data_5FKJ
# 
_entry.id   5FKJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5FKJ         
PDBE  EBI-65320    
WWPDB D_1290065320 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        5FKJ 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2015-10-16 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Nachon, F.'             1 ? 
'Villard-Wandhammer, M.' 2 ? 
'Petrov, K.'             3 ? 
'Masson, P.'             4 ? 
# 
_citation.id                        primary 
_citation.title                     
;Slow-Binding Inhibition of Acetylcholinesterase by a 6-Methyluracil Alkyl-Ammonium Derivative: Mechanism and Advantages for Myasthenia Gravis Treatment.
;
_citation.journal_abbrev            Biochem.J. 
_citation.journal_volume            473 
_citation.page_first                1225 
_citation.page_last                 ? 
_citation.year                      2016 
_citation.journal_id_ASTM           BIJOAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0264-6021 
_citation.journal_id_CSD            0043 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26929400 
_citation.pdbx_database_id_DOI      10.1042/BCJ20160084 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kharlamova, A.D.'       1  ? 
primary 'Lushchekina, S.V.'      2  ? 
primary 'Petrov, K.A.'           3  ? 
primary 'Kots, E.D.'             4  ? 
primary 'Nachon, F.V.'           5  ? 
primary 'Villard-Wandhammer, M.' 6  ? 
primary 'Zueva, I.V.'            7  ? 
primary 'Krejci, E.'             8  ? 
primary 'Reznik, V.S.'           9  ? 
primary 'Zobov, V.V.'            10 ? 
primary 'Nikolsky, E.E.'         11 ? 
primary 'Masson, P.'             12 ? 
# 
_cell.entry_id           5FKJ 
_cell.length_a           137.150 
_cell.length_b           175.450 
_cell.length_c           224.400 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5FKJ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE                                             59764.488 4   3.1.1.7 ? 'UNP RESIDUES 32-574' ? 
2 non-polymer syn '1,3-BIS[5(DIETHYL-O-NITROBENZYLAMMONIUM)PENTYL]-6-METHYLURACIL' 680.877   4   ?       ? ?                     ? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                         221.208   6   ?       ? ?                     ? 
4 non-polymer syn 'CHLORIDE ION'                                                   35.453    28  ?       ? ?                     ? 
5 non-polymer syn 'SULFATE ION'                                                    96.063    3   ?       ? ?                     ? 
6 water       nat water                                                            18.015    374 ?       ? ?                     ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SER n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'HOUSE MOUSE' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'MUS MUSCULUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'CHINESE HAMSTER' 
_entity_src_gen.pdbx_host_org_scientific_name      'CRICETULUS GRISEUS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     10029 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            CHO-K1 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PGS 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5FKJ A 1 ? 543 ? P21836 32 ? 574 ? 1 543 
2 1 5FKJ B 1 ? 543 ? P21836 32 ? 574 ? 1 543 
3 1 5FKJ C 1 ? 543 ? P21836 32 ? 574 ? 1 543 
4 1 5FKJ D 1 ? 543 ? P21836 32 ? 574 ? 1 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                                          ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking'          y ARGININE                                                         ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                       ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                  ? 'C4 H7 N O4'      133.103 
CL  non-polymer                  . 'CHLORIDE ION'                                                   ? 'Cl -1'           35.453  
CYS 'L-peptide linking'          y CYSTEINE                                                         ? 'C3 H7 N O2 S'    121.158 
G0W non-polymer                  . '1,3-BIS[5(DIETHYL-O-NITROBENZYLAMMONIUM)PENTYL]-6-METHYLURACIL' ? 'C37 H56 N6 O6 2' 680.877 
GLN 'L-peptide linking'          y GLUTAMINE                                                        ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                  ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'            y GLYCINE                                                          ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking'          y HISTIDINE                                                        ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer                  . WATER                                                            ? 'H2 O'            18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                       ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking'          y LEUCINE                                                          ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking'          y LYSINE                                                           ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking'          y METHIONINE                                                       ? 'C5 H11 N O2 S'   149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                         ? 'C8 H15 N O6'     221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                                                    ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking'          y PROLINE                                                          ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking'          y SERINE                                                           ? 'C3 H7 N O3'      105.093 
SO4 non-polymer                  . 'SULFATE ION'                                                    ? 'O4 S -2'         96.063  
THR 'L-peptide linking'          y THREONINE                                                        ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                       ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking'          y TYROSINE                                                         ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking'          y VALINE                                                           ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          5FKJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.9 
_exptl_crystal.density_percent_sol   75 
_exptl_crystal.description           NONE 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1 M BICINE BUFFER PH 9, 1.6 M AMMONIUM SULFATE' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9334 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-1 
_diffrn_source.pdbx_wavelength             0.9334 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5FKJ 
_reflns.observed_criterion_sigma_I   1.5 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             87.72 
_reflns.d_resolution_high            3.13 
_reflns.number_obs                   95147 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            0.14 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.69 
_reflns.B_iso_Wilson_estimate        65.96 
_reflns.pdbx_redundancy              3.7 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.13 
_reflns_shell.d_res_low              3.24 
_reflns_shell.percent_possible_all   97.0 
_reflns_shell.Rmerge_I_obs           0.84 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.57 
_reflns_shell.pdbx_redundancy        3.7 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5FKJ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     94994 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             94.524 
_refine.ls_d_res_high                            3.133 
_refine.ls_percent_reflns_obs                    99.35 
_refine.ls_R_factor_obs                          0.2078 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2073 
_refine.ls_R_factor_R_free                       0.2494 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 1.1 
_refine.ls_number_reflns_R_free                  1046 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               71.5 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4A16' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.40 
_refine.pdbx_overall_phase_error                 25.98 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        16744 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         287 
_refine_hist.number_atoms_solvent             374 
_refine_hist.number_atoms_total               17405 
_refine_hist.d_res_high                       3.133 
_refine_hist.d_res_low                        94.524 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.004  ? ? 17565 'X-RAY DIFFRACTION' ? 
f_angle_d          0.847  ? ? 24034 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 16.277 ? ? 10287 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.056  ? ? 2561  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 3155  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 3.1331 3.2983  13018 0.3357 98.00  0.3507 . . 145 . . 
'X-RAY DIFFRACTION' . 3.2983 3.5049  13343 0.2742 100.00 0.3317 . . 148 . . 
'X-RAY DIFFRACTION' . 3.5049 3.7756  13325 0.2417 100.00 0.2983 . . 149 . . 
'X-RAY DIFFRACTION' . 3.7756 4.1555  13394 0.1960 100.00 0.2354 . . 149 . . 
'X-RAY DIFFRACTION' . 4.1555 4.7568  13409 0.1695 100.00 0.2159 . . 149 . . 
'X-RAY DIFFRACTION' . 4.7568 5.9930  13543 0.1779 100.00 0.2039 . . 150 . . 
'X-RAY DIFFRACTION' . 5.9930 94.5674 13916 0.1849 100.00 0.2281 . . 156 . . 
# 
_struct.entry_id                  5FKJ 
_struct.title                     
'Crystal structure of mouse acetylcholinesterase in complex with C-547, an alkyl ammonium derivative of 6-methyl uracil' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        5FKJ 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, ACETYLCHOLINESTERASE, C-547' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 3 ? 
G  N N 4 ? 
H  N N 4 ? 
I  N N 4 ? 
J  N N 4 ? 
K  N N 4 ? 
L  N N 4 ? 
M  N N 4 ? 
N  N N 4 ? 
O  N N 4 ? 
P  N N 2 ? 
Q  N N 3 ? 
R  N N 3 ? 
S  N N 4 ? 
T  N N 4 ? 
U  N N 4 ? 
V  N N 4 ? 
W  N N 5 ? 
X  N N 2 ? 
Y  N N 3 ? 
Z  N N 4 ? 
AA N N 4 ? 
BA N N 4 ? 
CA N N 4 ? 
DA N N 4 ? 
EA N N 4 ? 
FA N N 4 ? 
GA N N 4 ? 
HA N N 4 ? 
IA N N 5 ? 
JA N N 2 ? 
KA N N 3 ? 
LA N N 3 ? 
MA N N 4 ? 
NA N N 4 ? 
OA N N 4 ? 
PA N N 4 ? 
QA N N 4 ? 
RA N N 4 ? 
SA N N 5 ? 
TA N N 6 ? 
UA N N 6 ? 
VA N N 6 ? 
WA N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P2   2   PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P3   3   LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P4   4   GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P5   5   VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P6   6   ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P7   7   ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P8   8   SER A 203 ? SER A 215 ? SER A 203 SER A 215 1 ? 13 
HELX_P HELX_P9   9   SER A 215 ? SER A 220 ? SER A 215 SER A 220 1 ? 6  
HELX_P HELX_P10  10  SER A 240 ? VAL A 255 ? SER A 240 VAL A 255 1 ? 16 
HELX_P HELX_P11  11  ASN A 265 ? ARG A 274 ? ASN A 265 ARG A 274 1 ? 10 
HELX_P HELX_P12  12  PRO A 277 ? HIS A 284 ? PRO A 277 HIS A 284 1 ? 8  
HELX_P HELX_P13  13  GLU A 285 ? LEU A 289 ? GLU A 285 LEU A 289 5 ? 5  
HELX_P HELX_P14  14  THR A 311 ? GLY A 319 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P15  15  GLY A 335 ? GLY A 342 ? GLY A 335 GLY A 342 5 ? 8  
HELX_P HELX_P16  16  SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P17  17  SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P18  18  ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P19  19  VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P20  20  PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P21  21  GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P22  22  GLY A 456 ? ASP A 460 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P23  23  ASP A 460 ? ASN A 464 ? ASP A 460 ASN A 464 5 ? 5  
HELX_P HELX_P24  24  THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25  25  ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26  26  PHE A 535 ? LEU A 540 ? PHE A 535 LEU A 540 5 ? 6  
HELX_P HELX_P27  27  VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P28  28  PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P29  29  LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P30  30  GLY B 135 ? GLY B 143 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P31  31  VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P32  32  ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P33  33  ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P34  34  SER B 203 ? SER B 215 ? SER B 203 SER B 215 1 ? 13 
HELX_P HELX_P35  35  LEU B 216 ? LEU B 221 ? LEU B 216 LEU B 221 5 ? 6  
HELX_P HELX_P36  36  SER B 240 ? VAL B 255 ? SER B 240 VAL B 255 1 ? 16 
HELX_P HELX_P37  37  ASN B 265 ? THR B 275 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P38  38  PRO B 277 ? HIS B 284 ? PRO B 277 HIS B 284 1 ? 8  
HELX_P HELX_P39  39  GLU B 285 ? LEU B 289 ? GLU B 285 LEU B 289 5 ? 5  
HELX_P HELX_P40  40  THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P41  41  SER B 336 ? GLY B 342 ? SER B 336 GLY B 342 5 ? 7  
HELX_P HELX_P42  42  SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P43  43  SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P44  44  ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P45  45  VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P46  46  PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P47  47  GLU B 450 ? PHE B 455 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P48  48  GLY B 456 ? ASP B 460 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P49  49  ASP B 460 ? ASN B 464 ? ASP B 460 ASN B 464 5 ? 5  
HELX_P HELX_P50  50  THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P51  51  ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P52  52  ARG B 534 ? SER B 541 ? ARG B 534 SER B 541 1 ? 8  
HELX_P HELX_P53  53  VAL C 42  ? ARG C 46  ? VAL C 42  ARG C 46  5 ? 5  
HELX_P HELX_P54  54  PHE C 80  ? MET C 85  ? PHE C 80  MET C 85  1 ? 6  
HELX_P HELX_P55  55  LEU C 130 ? ASP C 134 ? LEU C 130 ASP C 134 5 ? 5  
HELX_P HELX_P56  56  GLY C 135 ? GLY C 143 ? GLY C 135 GLY C 143 1 ? 9  
HELX_P HELX_P57  57  GLY C 154 ? LEU C 159 ? GLY C 154 LEU C 159 1 ? 6  
HELX_P HELX_P58  58  ASN C 170 ? ILE C 187 ? ASN C 170 ILE C 187 1 ? 18 
HELX_P HELX_P59  59  ALA C 188 ? PHE C 190 ? ALA C 188 PHE C 190 5 ? 3  
HELX_P HELX_P60  60  SER C 203 ? SER C 215 ? SER C 203 SER C 215 1 ? 13 
HELX_P HELX_P61  61  LEU C 216 ? PHE C 222 ? LEU C 216 PHE C 222 5 ? 7  
HELX_P HELX_P62  62  SER C 240 ? VAL C 255 ? SER C 240 VAL C 255 1 ? 16 
HELX_P HELX_P63  63  ASN C 265 ? ARG C 274 ? ASN C 265 ARG C 274 1 ? 10 
HELX_P HELX_P64  64  PRO C 277 ? GLU C 285 ? PRO C 277 GLU C 285 1 ? 9  
HELX_P HELX_P65  65  TRP C 286 ? LEU C 289 ? TRP C 286 LEU C 289 5 ? 4  
HELX_P HELX_P66  66  THR C 311 ? GLY C 319 ? THR C 311 GLY C 319 1 ? 9  
HELX_P HELX_P67  67  GLY C 335 ? GLY C 342 ? GLY C 335 GLY C 342 5 ? 8  
HELX_P HELX_P68  68  SER C 355 ? VAL C 367 ? SER C 355 VAL C 367 1 ? 13 
HELX_P HELX_P69  69  SER C 371 ? THR C 383 ? SER C 371 THR C 383 1 ? 13 
HELX_P HELX_P70  70  ASP C 390 ? VAL C 407 ? ASP C 390 VAL C 407 1 ? 18 
HELX_P HELX_P71  71  VAL C 407 ? GLN C 421 ? VAL C 407 GLN C 421 1 ? 15 
HELX_P HELX_P72  72  PRO C 440 ? GLY C 444 ? PRO C 440 GLY C 444 5 ? 5  
HELX_P HELX_P73  73  GLU C 450 ? PHE C 455 ? GLU C 450 PHE C 455 1 ? 6  
HELX_P HELX_P74  74  GLY C 456 ? ASP C 460 ? GLY C 456 ASP C 460 5 ? 5  
HELX_P HELX_P75  75  ASP C 460 ? ASN C 464 ? ASP C 460 ASN C 464 5 ? 5  
HELX_P HELX_P76  76  THR C 466 ? GLY C 487 ? THR C 466 GLY C 487 1 ? 22 
HELX_P HELX_P77  77  ARG C 525 ? ARG C 534 ? ARG C 525 ARG C 534 1 ? 10 
HELX_P HELX_P78  78  PHE C 535 ? LEU C 539 ? PHE C 535 LEU C 539 5 ? 5  
HELX_P HELX_P79  79  ASP D 5   ? GLN D 7   ? ASP D 5   GLN D 7   5 ? 3  
HELX_P HELX_P80  80  VAL D 42  ? ARG D 46  ? VAL D 42  ARG D 46  5 ? 5  
HELX_P HELX_P81  81  PHE D 80  ? MET D 85  ? PHE D 80  MET D 85  1 ? 6  
HELX_P HELX_P82  82  LEU D 130 ? ASP D 134 ? LEU D 130 ASP D 134 5 ? 5  
HELX_P HELX_P83  83  GLY D 135 ? GLY D 143 ? GLY D 135 GLY D 143 1 ? 9  
HELX_P HELX_P84  84  VAL D 153 ? LEU D 159 ? VAL D 153 LEU D 159 1 ? 7  
HELX_P HELX_P85  85  ASN D 170 ? ILE D 187 ? ASN D 170 ILE D 187 1 ? 18 
HELX_P HELX_P86  86  ALA D 188 ? PHE D 190 ? ALA D 188 PHE D 190 5 ? 3  
HELX_P HELX_P87  87  SER D 203 ? SER D 215 ? SER D 203 SER D 215 1 ? 13 
HELX_P HELX_P88  88  LEU D 216 ? PHE D 222 ? LEU D 216 PHE D 222 5 ? 7  
HELX_P HELX_P89  89  SER D 240 ? VAL D 255 ? SER D 240 VAL D 255 1 ? 16 
HELX_P HELX_P90  90  ASN D 265 ? ARG D 274 ? ASN D 265 ARG D 274 1 ? 10 
HELX_P HELX_P91  91  PRO D 277 ? GLU D 285 ? PRO D 277 GLU D 285 1 ? 9  
HELX_P HELX_P92  92  TRP D 286 ? LEU D 289 ? TRP D 286 LEU D 289 5 ? 4  
HELX_P HELX_P93  93  THR D 311 ? GLY D 319 ? THR D 311 GLY D 319 1 ? 9  
HELX_P HELX_P94  94  SER D 336 ? GLY D 342 ? SER D 336 GLY D 342 5 ? 7  
HELX_P HELX_P95  95  SER D 355 ? VAL D 367 ? SER D 355 VAL D 367 1 ? 13 
HELX_P HELX_P96  96  SER D 371 ? THR D 383 ? SER D 371 THR D 383 1 ? 13 
HELX_P HELX_P97  97  ASP D 390 ? VAL D 407 ? ASP D 390 VAL D 407 1 ? 18 
HELX_P HELX_P98  98  VAL D 407 ? GLN D 421 ? VAL D 407 GLN D 421 1 ? 15 
HELX_P HELX_P99  99  PRO D 440 ? GLY D 444 ? PRO D 440 GLY D 444 5 ? 5  
HELX_P HELX_P100 100 GLU D 450 ? PHE D 455 ? GLU D 450 PHE D 455 1 ? 6  
HELX_P HELX_P101 101 GLY D 456 ? ASP D 460 ? GLY D 456 ASP D 460 5 ? 5  
HELX_P HELX_P102 102 ASP D 460 ? ASN D 464 ? ASP D 460 ASN D 464 5 ? 5  
HELX_P HELX_P103 103 THR D 466 ? GLY D 487 ? THR D 466 GLY D 487 1 ? 22 
HELX_P HELX_P104 104 ARG D 525 ? LEU D 539 ? ARG D 525 LEU D 539 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?   ? A CYS 69  SG  ? ? ? 1_555 A  CYS 96  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.023 ? ?               
disulf2  disulf ?   ? A CYS 257 SG  ? ? ? 1_555 A  CYS 272 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf3  disulf ?   ? A CYS 409 SG  ? ? ? 1_555 A  CYS 529 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf4  disulf ?   ? B CYS 69  SG  ? ? ? 1_555 B  CYS 96  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf5  disulf ?   ? B CYS 257 SG  ? ? ? 1_555 B  CYS 272 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.021 ? ?               
disulf6  disulf ?   ? B CYS 409 SG  ? ? ? 1_555 B  CYS 529 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf7  disulf ?   ? C CYS 69  SG  ? ? ? 1_555 C  CYS 96  SG ? ? C CYS 69  C CYS 96  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf8  disulf ?   ? C CYS 257 SG  ? ? ? 1_555 C  CYS 272 SG ? ? C CYS 257 C CYS 272 1_555 ? ? ? ? ? ? ? 2.017 ? ?               
disulf9  disulf ?   ? C CYS 409 SG  ? ? ? 1_555 C  CYS 529 SG ? ? C CYS 409 C CYS 529 1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf10 disulf ?   ? D CYS 69  SG  ? ? ? 1_555 D  CYS 96  SG ? ? D CYS 69  D CYS 96  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf11 disulf ?   ? D CYS 257 SG  ? ? ? 1_555 D  CYS 272 SG ? ? D CYS 257 D CYS 272 1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf12 disulf ?   ? D CYS 409 SG  ? ? ? 1_555 D  CYS 529 SG ? ? D CYS 409 D CYS 529 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
covale1  covale one ? A ASN 265 ND2 ? ? ? 1_555 F  NAG .   C1 ? ? A ASN 265 A NAG 560 1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation 
covale2  covale one ? B ASN 265 ND2 ? ? ? 1_555 Q  NAG .   C1 ? ? B ASN 265 B NAG 560 1_555 ? ? ? ? ? ? ? 1.463 ? N-Glycosylation 
covale3  covale one ? B ASN 350 ND2 ? ? ? 1_555 R  NAG .   C1 ? ? B ASN 350 B NAG 561 1_555 ? ? ? ? ? ? ? 1.451 ? N-Glycosylation 
covale4  covale one ? C ASN 265 ND2 ? ? ? 1_555 Y  NAG .   C1 ? ? C ASN 265 C NAG 560 1_555 ? ? ? ? ? ? ? 1.449 ? N-Glycosylation 
covale5  covale one ? D ASN 265 ND2 ? ? ? 1_555 KA NAG .   C1 ? ? D ASN 265 D NAG 560 1_555 ? ? ? ? ? ? ? 1.456 ? N-Glycosylation 
covale6  covale one ? D ASN 350 ND2 ? ? ? 1_555 LA NAG .   C1 ? ? D ASN 350 D NAG 561 1_555 ? ? ? ? ? ? ? 1.452 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 2.77   
2 PRO 258 A . ? PRO 258 A PRO 259 A ? PRO 259 A 1 -6.34  
3 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 -1.02  
4 CYS 257 B . ? CYS 257 B PRO 258 B ? PRO 258 B 1 -12.13 
5 TYR 105 C . ? TYR 105 C PRO 106 C ? PRO 106 C 1 3.66   
6 PRO 258 C . ? PRO 258 C PRO 259 C ? PRO 259 C 1 -6.72  
7 SER 497 C . ? SER 497 C PRO 498 C ? PRO 498 C 1 5.53   
8 TYR 105 D . ? TYR 105 D PRO 106 D ? PRO 106 D 1 1.89   
9 CYS 257 D . ? CYS 257 D PRO 258 D ? PRO 258 D 1 -7.45  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
BA ? 3  ? 
BB ? 11 ? 
BC ? 2  ? 
CA ? 3  ? 
CB ? 11 ? 
CC ? 2  ? 
CD ? 2  ? 
DA ? 3  ? 
DB ? 11 ? 
DC ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
BA 1  2  ? anti-parallel 
BA 2  3  ? parallel      
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? parallel      
BB 5  6  ? parallel      
BB 6  7  ? parallel      
BB 7  8  ? parallel      
BB 8  9  ? parallel      
BB 9  10 ? parallel      
BB 10 11 ? anti-parallel 
BC 1  2  ? parallel      
CA 1  2  ? anti-parallel 
CA 2  3  ? parallel      
CB 1  2  ? anti-parallel 
CB 2  3  ? anti-parallel 
CB 3  4  ? anti-parallel 
CB 4  5  ? parallel      
CB 5  6  ? parallel      
CB 6  7  ? parallel      
CB 7  8  ? parallel      
CB 8  9  ? parallel      
CB 9  10 ? parallel      
CB 10 11 ? anti-parallel 
CC 1  2  ? anti-parallel 
CD 1  2  ? parallel      
DA 1  2  ? anti-parallel 
DA 2  3  ? parallel      
DB 1  2  ? anti-parallel 
DB 2  3  ? anti-parallel 
DB 3  4  ? anti-parallel 
DB 4  5  ? parallel      
DB 5  6  ? parallel      
DB 6  7  ? parallel      
DB 7  8  ? parallel      
DB 8  9  ? parallel      
DB 9  10 ? parallel      
DB 10 11 ? anti-parallel 
DC 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
AA 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
AA 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
AB 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
AB 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
AB 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
AB 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
AB 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
AB 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
AB 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
AB 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
AB 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
AB 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
AB 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
AC 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
AC 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
BA 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
BA 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
BA 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
BB 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
BB 2  GLY B 27  ? ILE B 35  ? GLY B 27  ILE B 35  
BB 3  LEU B 99  ? PRO B 104 ? LEU B 99  PRO B 104 
BB 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
BB 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
BB 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
BB 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
BB 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
BB 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
BB 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
BB 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
BC 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
BC 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
CA 1  LEU C 9   ? ARG C 11  ? LEU C 9   ARG C 11  
CA 2  GLN C 16  ? ARG C 18  ? GLN C 16  ARG C 18  
CA 3  VAL C 59  ? ASP C 61  ? VAL C 59  ASP C 61  
CB 1  ILE C 20  ? ALA C 24  ? ILE C 20  ALA C 24  
CB 2  GLY C 27  ? PRO C 36  ? GLY C 27  PRO C 36  
CB 3  TYR C 98  ? PRO C 104 ? TYR C 98  PRO C 104 
CB 4  VAL C 145 ? MET C 149 ? VAL C 145 MET C 149 
CB 5  THR C 112 ? ILE C 118 ? THR C 112 ILE C 118 
CB 6  GLY C 192 ? GLU C 202 ? GLY C 192 GLU C 202 
CB 7  ARG C 224 ? GLN C 228 ? ARG C 224 GLN C 228 
CB 8  GLN C 325 ? VAL C 331 ? GLN C 325 VAL C 331 
CB 9  ARG C 424 ? PHE C 430 ? ARG C 424 PHE C 430 
CB 10 GLN C 509 ? LEU C 513 ? GLN C 509 LEU C 513 
CB 11 GLU C 519 ? ARG C 522 ? GLU C 519 ARG C 522 
CC 1  ALA C 38  ? GLU C 39  ? ALA C 38  GLU C 39  
CC 2  GLU C 51  ? PRO C 52  ? GLU C 51  PRO C 52  
CD 1  VAL C 68  ? CYS C 69  ? VAL C 68  CYS C 69  
CD 2  LEU C 92  ? SER C 93  ? LEU C 92  SER C 93  
DA 1  LEU D 9   ? ARG D 11  ? LEU D 9   ARG D 11  
DA 2  GLN D 16  ? ARG D 18  ? GLN D 16  ARG D 18  
DA 3  VAL D 59  ? ASP D 61  ? VAL D 59  ASP D 61  
DB 1  ILE D 20  ? ALA D 24  ? ILE D 20  ALA D 24  
DB 2  GLY D 27  ? PRO D 36  ? GLY D 27  PRO D 36  
DB 3  TYR D 98  ? PRO D 104 ? TYR D 98  PRO D 104 
DB 4  VAL D 145 ? MET D 149 ? VAL D 145 MET D 149 
DB 5  THR D 112 ? ILE D 118 ? THR D 112 ILE D 118 
DB 6  GLY D 192 ? GLU D 202 ? GLY D 192 GLU D 202 
DB 7  ARG D 224 ? GLN D 228 ? ARG D 224 GLN D 228 
DB 8  GLN D 325 ? VAL D 331 ? GLN D 325 VAL D 331 
DB 9  ARG D 424 ? PHE D 430 ? ARG D 424 PHE D 430 
DB 10 GLN D 509 ? LEU D 513 ? GLN D 509 LEU D 513 
DB 11 GLU D 519 ? ARG D 522 ? GLU D 519 ARG D 522 
DC 1  VAL D 68  ? CYS D 69  ? VAL D 68  CYS D 69  
DC 2  LEU D 92  ? SER D 93  ? LEU D 92  SER D 93  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N VAL A 12  ? N VAL A 12  O GLY A 15  ? O GLY A 15  
AA 2  3  N ARG A 18  ? N ARG A 18  O LEU A 60  ? O LEU A 60  
AB 1  2  N ALA A 24  ? N ALA A 24  O GLY A 27  ? O GLY A 27  
AB 2  3  N ILE A 35  ? N ILE A 35  O LEU A 99  ? O LEU A 99  
AB 3  4  N TRP A 102 ? N TRP A 102 O LEU A 146 ? O LEU A 146 
AB 4  5  N VAL A 145 ? N VAL A 145 O PRO A 113 ? O PRO A 113 
AB 5  6  O THR A 112 ? O THR A 112 N ASP A 193 ? N ASP A 193 
AB 6  7  N LEU A 199 ? N LEU A 199 O ARG A 224 ? O ARG A 224 
AB 7  8  N ALA A 225 ? N ALA A 225 O GLN A 325 ? O GLN A 325 
AB 8  9  N VAL A 326 ? N VAL A 326 O ARG A 424 ? O ARG A 424 
AB 9  10 N ILE A 429 ? N ILE A 429 O VAL A 511 ? O VAL A 511 
AB 10 11 N SER A 512 ? N SER A 512 O GLU A 519 ? O GLU A 519 
AC 1  2  O VAL A 68  ? O VAL A 68  N SER A 93  ? N SER A 93  
BA 1  2  N VAL B 12  ? N VAL B 12  O GLY B 15  ? O GLY B 15  
BA 2  3  N ARG B 18  ? N ARG B 18  O LEU B 60  ? O LEU B 60  
BB 1  2  N ALA B 24  ? N ALA B 24  O GLY B 27  ? O GLY B 27  
BB 2  3  N ILE B 35  ? N ILE B 35  O LEU B 99  ? O LEU B 99  
BB 3  4  N TRP B 102 ? N TRP B 102 O LEU B 146 ? O LEU B 146 
BB 4  5  N VAL B 145 ? N VAL B 145 O PRO B 113 ? O PRO B 113 
BB 5  6  O THR B 112 ? O THR B 112 N ASP B 193 ? N ASP B 193 
BB 6  7  N LEU B 199 ? N LEU B 199 O ARG B 224 ? O ARG B 224 
BB 7  8  N ALA B 225 ? N ALA B 225 O GLN B 325 ? O GLN B 325 
BB 8  9  N VAL B 326 ? N VAL B 326 O ARG B 424 ? O ARG B 424 
BB 9  10 N ILE B 429 ? N ILE B 429 O VAL B 511 ? O VAL B 511 
BB 10 11 N SER B 512 ? N SER B 512 O GLU B 519 ? O GLU B 519 
BC 1  2  O VAL B 68  ? O VAL B 68  N SER B 93  ? N SER B 93  
CA 1  2  N VAL C 10  ? N VAL C 10  O LEU C 17  ? O LEU C 17  
CA 2  3  N ARG C 18  ? N ARG C 18  O LEU C 60  ? O LEU C 60  
CB 1  2  N ALA C 24  ? N ALA C 24  O GLY C 27  ? O GLY C 27  
CB 2  3  N ILE C 35  ? N ILE C 35  O LEU C 99  ? O LEU C 99  
CB 3  4  N TRP C 102 ? N TRP C 102 O LEU C 146 ? O LEU C 146 
CB 4  5  N VAL C 145 ? N VAL C 145 O PRO C 113 ? O PRO C 113 
CB 5  6  O THR C 112 ? O THR C 112 N ASP C 193 ? N ASP C 193 
CB 6  7  N LEU C 199 ? N LEU C 199 O ARG C 224 ? O ARG C 224 
CB 7  8  N ALA C 225 ? N ALA C 225 O GLN C 325 ? O GLN C 325 
CB 8  9  N VAL C 326 ? N VAL C 326 O ARG C 424 ? O ARG C 424 
CB 9  10 N ILE C 429 ? N ILE C 429 O VAL C 511 ? O VAL C 511 
CB 10 11 N SER C 512 ? N SER C 512 O GLU C 519 ? O GLU C 519 
CC 1  2  N GLU C 39  ? N GLU C 39  O GLU C 51  ? O GLU C 51  
CD 1  2  O VAL C 68  ? O VAL C 68  N SER C 93  ? N SER C 93  
DA 1  2  N VAL D 10  ? N VAL D 10  O LEU D 17  ? O LEU D 17  
DA 2  3  N ARG D 18  ? N ARG D 18  O LEU D 60  ? O LEU D 60  
DB 1  2  N ALA D 24  ? N ALA D 24  O GLY D 27  ? O GLY D 27  
DB 2  3  N ILE D 35  ? N ILE D 35  O LEU D 99  ? O LEU D 99  
DB 3  4  N TRP D 102 ? N TRP D 102 O LEU D 146 ? O LEU D 146 
DB 4  5  N VAL D 145 ? N VAL D 145 O PRO D 113 ? O PRO D 113 
DB 5  6  O THR D 112 ? O THR D 112 N ASP D 193 ? N ASP D 193 
DB 6  7  N LEU D 199 ? N LEU D 199 O ARG D 224 ? O ARG D 224 
DB 7  8  N ALA D 225 ? N ALA D 225 O GLN D 325 ? O GLN D 325 
DB 8  9  N VAL D 326 ? N VAL D 326 O ARG D 424 ? O ARG D 424 
DB 9  10 N ILE D 429 ? N ILE D 429 O VAL D 511 ? O VAL D 511 
DB 10 11 N SER D 512 ? N SER D 512 O GLU D 519 ? O GLU D 519 
DC 1  2  O VAL D 68  ? O VAL D 68  N SER D 93  ? N SER D 93  
# 
_database_PDB_matrix.entry_id          5FKJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5FKJ 
_atom_sites.fract_transf_matrix[1][1]   0.007291 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005700 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004456 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . ARG A  1 3   ? 0.352   -67.076 101.940 1.00 82.45  ?  3    ARG A N   1 
ATOM   2     C  CA  . ARG A  1 3   ? 1.000   -65.997 102.679 1.00 85.03  ?  3    ARG A CA  1 
ATOM   3     C  C   . ARG A  1 3   ? 0.979   -64.696 101.863 1.00 84.62  ?  3    ARG A C   1 
ATOM   4     O  O   . ARG A  1 3   ? 1.226   -63.604 102.390 1.00 86.57  ?  3    ARG A O   1 
ATOM   5     C  CB  . ARG A  1 3   ? 2.440   -66.394 103.034 1.00 87.98  ?  3    ARG A CB  1 
ATOM   6     C  CG  . ARG A  1 3   ? 3.174   -65.418 103.947 1.00 91.25  ?  3    ARG A CG  1 
ATOM   7     C  CD  . ARG A  1 3   ? 3.008   -65.771 105.427 1.00 97.18  ?  3    ARG A CD  1 
ATOM   8     N  NE  . ARG A  1 3   ? 1.610   -65.861 105.854 1.00 100.77 ?  3    ARG A NE  1 
ATOM   9     C  CZ  . ARG A  1 3   ? 0.840   -64.815 106.144 1.00 101.63 ?  3    ARG A CZ  1 
ATOM   10    N  NH1 . ARG A  1 3   ? 1.319   -63.579 106.044 1.00 100.01 ?  3    ARG A NH1 1 
ATOM   11    N  NH2 . ARG A  1 3   ? -0.417  -65.005 106.529 1.00 103.23 ?  3    ARG A NH2 1 
ATOM   12    N  N   . GLU A  1 4   ? 0.649   -64.822 100.578 1.00 80.64  ?  4    GLU A N   1 
ATOM   13    C  CA  . GLU A  1 4   ? 0.756   -63.741 99.606  1.00 74.32  ?  4    GLU A CA  1 
ATOM   14    C  C   . GLU A  1 4   ? -0.624  -63.194 99.252  1.00 72.76  ?  4    GLU A C   1 
ATOM   15    O  O   . GLU A  1 4   ? -1.569  -63.961 99.040  1.00 73.52  ?  4    GLU A O   1 
ATOM   16    C  CB  . GLU A  1 4   ? 1.467   -64.248 98.347  1.00 71.03  ?  4    GLU A CB  1 
ATOM   17    C  CG  . GLU A  1 4   ? 1.872   -63.194 97.338  1.00 68.24  ?  4    GLU A CG  1 
ATOM   18    C  CD  . GLU A  1 4   ? 3.088   -62.392 97.765  1.00 69.10  ?  4    GLU A CD  1 
ATOM   19    O  OE1 . GLU A  1 4   ? 4.224   -62.903 97.627  1.00 59.79  ?  4    GLU A OE1 1 
ATOM   20    O  OE2 . GLU A  1 4   ? 2.902   -61.253 98.251  1.00 67.52  ?  4    GLU A OE2 1 
ATOM   21    N  N   . ASP A  1 5   ? -0.734  -61.865 99.192  1.00 69.80  ?  5    ASP A N   1 
ATOM   22    C  CA  . ASP A  1 5   ? -1.978  -61.214 98.779  1.00 66.35  ?  5    ASP A CA  1 
ATOM   23    C  C   . ASP A  1 5   ? -2.036  -61.169 97.258  1.00 64.97  ?  5    ASP A C   1 
ATOM   24    O  O   . ASP A  1 5   ? -1.162  -60.553 96.638  1.00 63.50  ?  5    ASP A O   1 
ATOM   25    C  CB  . ASP A  1 5   ? -2.057  -59.796 99.337  1.00 63.20  ?  5    ASP A CB  1 
ATOM   26    C  CG  . ASP A  1 5   ? -3.427  -59.144 99.130  1.00 61.11  ?  5    ASP A CG  1 
ATOM   27    O  OD1 . ASP A  1 5   ? -4.152  -59.511 98.181  1.00 59.56  ?  5    ASP A OD1 1 
ATOM   28    O  OD2 . ASP A  1 5   ? -3.759  -58.216 99.901  1.00 61.71  ?  5    ASP A OD2 1 
ATOM   29    N  N   . PRO A  1 6   ? -3.039  -61.784 96.623  1.00 65.62  ?  6    PRO A N   1 
ATOM   30    C  CA  . PRO A  1 6   ? -3.080  -61.786 95.151  1.00 65.60  ?  6    PRO A CA  1 
ATOM   31    C  C   . PRO A  1 6   ? -3.274  -60.407 94.537  1.00 64.90  ?  6    PRO A C   1 
ATOM   32    O  O   . PRO A  1 6   ? -2.944  -60.224 93.358  1.00 64.28  ?  6    PRO A O   1 
ATOM   33    C  CB  . PRO A  1 6   ? -4.263  -62.714 94.834  1.00 65.91  ?  6    PRO A CB  1 
ATOM   34    C  CG  . PRO A  1 6   ? -5.136  -62.623 96.037  1.00 66.12  ?  6    PRO A CG  1 
ATOM   35    C  CD  . PRO A  1 6   ? -4.192  -62.496 97.205  1.00 66.76  ?  6    PRO A CD  1 
ATOM   36    N  N   . GLN A  1 7   ? -3.798  -59.434 95.284  1.00 64.74  ?  7    GLN A N   1 
ATOM   37    C  CA  . GLN A  1 7   ? -3.950  -58.088 94.747  1.00 62.57  ?  7    GLN A CA  1 
ATOM   38    C  C   . GLN A  1 7   ? -2.651  -57.297 94.782  1.00 62.95  ?  7    GLN A C   1 
ATOM   39    O  O   . GLN A  1 7   ? -2.495  -56.351 94.005  1.00 64.11  ?  7    GLN A O   1 
ATOM   40    C  CB  . GLN A  1 7   ? -5.030  -57.324 95.512  1.00 60.67  ?  7    GLN A CB  1 
ATOM   41    C  CG  . GLN A  1 7   ? -6.362  -58.032 95.534  1.00 61.41  ?  7    GLN A CG  1 
ATOM   42    C  CD  . GLN A  1 7   ? -6.932  -58.222 94.151  1.00 61.56  ?  7    GLN A CD  1 
ATOM   43    O  OE1 . GLN A  1 7   ? -6.888  -57.320 93.317  1.00 60.76  ?  7    GLN A OE1 1 
ATOM   44    N  NE2 . GLN A  1 7   ? -7.471  -59.408 93.896  1.00 63.34  ?  7    GLN A NE2 1 
ATOM   45    N  N   . LEU A  1 8   ? -1.729  -57.647 95.677  1.00 62.24  ?  8    LEU A N   1 
ATOM   46    C  CA  . LEU A  1 8   ? -0.451  -56.960 95.777  1.00 59.57  ?  8    LEU A CA  1 
ATOM   47    C  C   . LEU A  1 8   ? 0.653   -57.612 94.944  1.00 61.10  ?  8    LEU A C   1 
ATOM   48    O  O   . LEU A  1 8   ? 1.735   -57.027 94.822  1.00 61.19  ?  8    LEU A O   1 
ATOM   49    C  CB  . LEU A  1 8   ? -0.025  -56.874 97.247  1.00 57.81  ?  8    LEU A CB  1 
ATOM   50    C  CG  . LEU A  1 8   ? -1.050  -56.254 98.207  1.00 55.85  ?  8    LEU A CG  1 
ATOM   51    C  CD1 . LEU A  1 8   ? -0.464  -56.102 99.599  1.00 56.88  ?  8    LEU A CD1 1 
ATOM   52    C  CD2 . LEU A  1 8   ? -1.571  -54.921 97.702  1.00 53.99  ?  8    LEU A CD2 1 
ATOM   53    N  N   . LEU A  1 9   ? 0.421   -58.805 94.387  1.00 62.55  ?  9    LEU A N   1 
ATOM   54    C  CA  . LEU A  1 9   ? 1.371   -59.446 93.482  1.00 54.29  ?  9    LEU A CA  1 
ATOM   55    C  C   . LEU A  1 9   ? 1.047   -59.049 92.048  1.00 53.43  ?  9    LEU A C   1 
ATOM   56    O  O   . LEU A  1 9   ? -0.085  -59.236 91.588  1.00 54.02  ?  9    LEU A O   1 
ATOM   57    C  CB  . LEU A  1 9   ? 1.321   -60.968 93.609  1.00 55.87  ?  9    LEU A CB  1 
ATOM   58    C  CG  . LEU A  1 9   ? 2.539   -61.773 94.062  1.00 56.70  ?  9    LEU A CG  1 
ATOM   59    C  CD1 . LEU A  1 9   ? 2.283   -63.249 93.829  1.00 58.26  ?  9    LEU A CD1 1 
ATOM   60    C  CD2 . LEU A  1 9   ? 3.802   -61.342 93.357  1.00 55.84  ?  9    LEU A CD2 1 
ATOM   61    N  N   . VAL A  1 10  ? 2.037   -58.516 91.337  1.00 52.49  ?  10   VAL A N   1 
ATOM   62    C  CA  . VAL A  1 10  ? 1.881   -58.186 89.927  1.00 54.97  ?  10   VAL A CA  1 
ATOM   63    C  C   . VAL A  1 10  ? 3.066   -58.766 89.168  1.00 57.25  ?  10   VAL A C   1 
ATOM   64    O  O   . VAL A  1 10  ? 4.200   -58.724 89.655  1.00 58.99  ?  10   VAL A O   1 
ATOM   65    C  CB  . VAL A  1 10  ? 1.776   -56.659 89.704  1.00 52.13  ?  10   VAL A CB  1 
ATOM   66    C  CG1 . VAL A  1 10  ? 1.653   -56.340 88.221  1.00 51.57  ?  10   VAL A CG1 1 
ATOM   67    C  CG2 . VAL A  1 10  ? 0.594   -56.084 90.473  1.00 50.43  ?  10   VAL A CG2 1 
ATOM   68    N  N   . ARG A  1 11  ? 2.808   -59.328 87.985  1.00 56.92  ?  11   ARG A N   1 
ATOM   69    C  CA  . ARG A  1 11  ? 3.879   -59.732 87.077  1.00 55.51  ?  11   ARG A CA  1 
ATOM   70    C  C   . ARG A  1 11  ? 3.903   -58.773 85.894  1.00 53.60  ?  11   ARG A C   1 
ATOM   71    O  O   . ARG A  1 11  ? 2.972   -58.755 85.083  1.00 51.92  ?  11   ARG A O   1 
ATOM   72    C  CB  . ARG A  1 11  ? 3.715   -61.171 86.598  1.00 56.09  ?  11   ARG A CB  1 
ATOM   73    C  CG  . ARG A  1 11  ? 4.937   -61.683 85.825  1.00 56.22  ?  11   ARG A CG  1 
ATOM   74    C  CD  . ARG A  1 11  ? 4.696   -63.053 85.219  1.00 56.47  ?  11   ARG A CD  1 
ATOM   75    N  NE  . ARG A  1 11  ? 3.608   -63.023 84.249  1.00 56.58  ?  11   ARG A NE  1 
ATOM   76    C  CZ  . ARG A  1 11  ? 3.744   -62.620 82.992  1.00 56.34  ?  11   ARG A CZ  1 
ATOM   77    N  NH1 . ARG A  1 11  ? 4.929   -62.221 82.547  1.00 55.97  ?  11   ARG A NH1 1 
ATOM   78    N  NH2 . ARG A  1 11  ? 2.698   -62.622 82.178  1.00 56.65  ?  11   ARG A NH2 1 
ATOM   79    N  N   . VAL A  1 12  ? 4.963   -57.972 85.804  1.00 52.65  ?  12   VAL A N   1 
ATOM   80    C  CA  . VAL A  1 12  ? 5.220   -57.163 84.621  1.00 53.61  ?  12   VAL A CA  1 
ATOM   81    C  C   . VAL A  1 12  ? 6.224   -57.894 83.736  1.00 56.52  ?  12   VAL A C   1 
ATOM   82    O  O   . VAL A  1 12  ? 6.769   -58.938 84.122  1.00 58.80  ?  12   VAL A O   1 
ATOM   83    C  CB  . VAL A  1 12  ? 5.727   -55.757 84.997  1.00 49.01  ?  12   VAL A CB  1 
ATOM   84    C  CG1 . VAL A  1 12  ? 4.684   -55.017 85.813  1.00 48.33  ?  12   VAL A CG1 1 
ATOM   85    C  CG2 . VAL A  1 12  ? 7.040   -55.842 85.755  1.00 49.18  ?  12   VAL A CG2 1 
ATOM   86    N  N   . ARG A  1 13  ? 6.502   -57.328 82.558  1.00 55.34  ?  13   ARG A N   1 
ATOM   87    C  CA  . ARG A  1 13  ? 7.376   -57.991 81.595  1.00 54.05  ?  13   ARG A CA  1 
ATOM   88    C  C   . ARG A  1 13  ? 8.760   -58.249 82.171  1.00 53.71  ?  13   ARG A C   1 
ATOM   89    O  O   . ARG A  1 13  ? 9.418   -59.224 81.790  1.00 53.94  ?  13   ARG A O   1 
ATOM   90    C  CB  . ARG A  1 13  ? 7.486   -57.146 80.330  1.00 52.97  ?  13   ARG A CB  1 
ATOM   91    C  CG  . ARG A  1 13  ? 6.186   -56.994 79.577  1.00 54.46  ?  13   ARG A CG  1 
ATOM   92    C  CD  . ARG A  1 13  ? 6.283   -55.860 78.585  1.00 55.79  ?  13   ARG A CD  1 
ATOM   93    N  NE  . ARG A  1 13  ? 5.142   -55.835 77.679  1.00 59.46  ?  13   ARG A NE  1 
ATOM   94    C  CZ  . ARG A  1 13  ? 5.183   -56.264 76.423  1.00 63.51  ?  13   ARG A CZ  1 
ATOM   95    N  NH1 . ARG A  1 13  ? 6.312   -56.751 75.924  1.00 65.73  ?  13   ARG A NH1 1 
ATOM   96    N  NH2 . ARG A  1 13  ? 4.097   -56.198 75.665  1.00 64.27  ?  13   ARG A NH2 1 
ATOM   97    N  N   . GLY A  1 14  ? 9.214   -57.392 83.088  1.00 53.71  ?  14   GLY A N   1 
ATOM   98    C  CA  . GLY A  1 14  ? 10.520  -57.568 83.691  1.00 51.91  ?  14   GLY A CA  1 
ATOM   99    C  C   . GLY A  1 14  ? 10.571  -58.583 84.811  1.00 60.41  ?  14   GLY A C   1 
ATOM   100   O  O   . GLY A  1 14  ? 11.663  -59.045 85.157  1.00 63.20  ?  14   GLY A O   1 
ATOM   101   N  N   . GLY A  1 15  ? 9.433   -58.935 85.389  1.00 58.18  ?  15   GLY A N   1 
ATOM   102   C  CA  . GLY A  1 15  ? 9.412   -59.843 86.515  1.00 58.47  ?  15   GLY A CA  1 
ATOM   103   C  C   . GLY A  1 15  ? 8.282   -59.485 87.457  1.00 52.97  ?  15   GLY A C   1 
ATOM   104   O  O   . GLY A  1 15  ? 7.411   -58.687 87.135  1.00 51.95  ?  15   GLY A O   1 
ATOM   105   N  N   . GLN A  1 16  ? 8.324   -60.080 88.643  1.00 53.72  ?  16   GLN A N   1 
ATOM   106   C  CA  . GLN A  1 16  ? 7.241   -59.931 89.602  1.00 56.35  ?  16   GLN A CA  1 
ATOM   107   C  C   . GLN A  1 16  ? 7.611   -58.911 90.672  1.00 55.04  ?  16   GLN A C   1 
ATOM   108   O  O   . GLN A  1 16  ? 8.770   -58.816 91.088  1.00 54.91  ?  16   GLN A O   1 
ATOM   109   C  CB  . GLN A  1 16  ? 6.900   -61.273 90.246  1.00 54.98  ?  16   GLN A CB  1 
ATOM   110   C  CG  . GLN A  1 16  ? 6.541   -62.347 89.240  1.00 55.93  ?  16   GLN A CG  1 
ATOM   111   C  CD  . GLN A  1 16  ? 5.761   -63.491 89.854  1.00 63.09  ?  16   GLN A CD  1 
ATOM   112   O  OE1 . GLN A  1 16  ? 4.826   -63.276 90.623  1.00 63.53  ?  16   GLN A OE1 1 
ATOM   113   N  NE2 . GLN A  1 16  ? 6.153   -64.717 89.530  1.00 58.72  ?  16   GLN A NE2 1 
ATOM   114   N  N   . LEU A  1 17  ? 6.617   -58.138 91.099  1.00 52.69  ?  17   LEU A N   1 
ATOM   115   C  CA  . LEU A  1 17  ? 6.785   -57.139 92.137  1.00 52.93  ?  17   LEU A CA  1 
ATOM   116   C  C   . LEU A  1 17  ? 5.592   -57.209 93.077  1.00 56.99  ?  17   LEU A C   1 
ATOM   117   O  O   . LEU A  1 17  ? 4.487   -57.591 92.677  1.00 58.61  ?  17   LEU A O   1 
ATOM   118   C  CB  . LEU A  1 17  ? 6.927   -55.730 91.550  1.00 51.11  ?  17   LEU A CB  1 
ATOM   119   C  CG  . LEU A  1 17  ? 5.831   -55.241 90.601  1.00 52.52  ?  17   LEU A CG  1 
ATOM   120   C  CD1 . LEU A  1 17  ? 4.718   -54.511 91.349  1.00 53.23  ?  17   LEU A CD1 1 
ATOM   121   C  CD2 . LEU A  1 17  ? 6.417   -54.346 89.522  1.00 52.39  ?  17   LEU A CD2 1 
ATOM   122   N  N   . ARG A  1 18  ? 5.832   -56.835 94.334  1.00 58.82  ?  18   ARG A N   1 
ATOM   123   C  CA  . ARG A  1 18  ? 4.844   -56.920 95.405  1.00 58.47  ?  18   ARG A CA  1 
ATOM   124   C  C   . ARG A  1 18  ? 4.635   -55.539 96.006  1.00 57.21  ?  18   ARG A C   1 
ATOM   125   O  O   . ARG A  1 18  ? 5.586   -54.927 96.502  1.00 57.17  ?  18   ARG A O   1 
ATOM   126   C  CB  . ARG A  1 18  ? 5.296   -57.902 96.486  1.00 59.49  ?  18   ARG A CB  1 
ATOM   127   C  CG  . ARG A  1 18  ? 4.451   -57.880 97.745  1.00 60.14  ?  18   ARG A CG  1 
ATOM   128   C  CD  . ARG A  1 18  ? 4.931   -58.899 98.774  1.00 61.02  ?  18   ARG A CD  1 
ATOM   129   N  NE  . ARG A  1 18  ? 6.372   -59.139 98.703  1.00 60.04  ?  18   ARG A NE  1 
ATOM   130   C  CZ  . ARG A  1 18  ? 6.921   -60.265 98.251  1.00 59.64  ?  18   ARG A CZ  1 
ATOM   131   N  NH1 . ARG A  1 18  ? 6.147   -61.264 97.842  1.00 58.30  ?  18   ARG A NH1 1 
ATOM   132   N  NH2 . ARG A  1 18  ? 8.243   -60.396 98.217  1.00 58.45  ?  18   ARG A NH2 1 
ATOM   133   N  N   . GLY A  1 19  ? 3.390   -55.060 95.978  1.00 56.87  ?  19   GLY A N   1 
ATOM   134   C  CA  . GLY A  1 19  ? 3.051   -53.753 96.493  1.00 56.99  ?  19   GLY A CA  1 
ATOM   135   C  C   . GLY A  1 19  ? 2.516   -53.797 97.916  1.00 59.36  ?  19   GLY A C   1 
ATOM   136   O  O   . GLY A  1 19  ? 2.582   -54.809 98.618  1.00 60.99  ?  19   GLY A O   1 
ATOM   137   N  N   . ILE A  1 20  ? 1.964   -52.660 98.336  1.00 58.84  ?  20   ILE A N   1 
ATOM   138   C  CA  . ILE A  1 20  ? 1.503   -52.448 99.702  1.00 58.35  ?  20   ILE A CA  1 
ATOM   139   C  C   . ILE A  1 20  ? 0.073   -51.924 99.666  1.00 57.06  ?  20   ILE A C   1 
ATOM   140   O  O   . ILE A  1 20  ? -0.297  -51.157 98.769  1.00 54.22  ?  20   ILE A O   1 
ATOM   141   C  CB  . ILE A  1 20  ? 2.434   -51.475 100.463 1.00 57.24  ?  20   ILE A CB  1 
ATOM   142   C  CG1 . ILE A  1 20  ? 2.027   -51.365 101.933 1.00 59.69  ?  20   ILE A CG1 1 
ATOM   143   C  CG2 . ILE A  1 20  ? 2.464   -50.100 99.801  1.00 53.92  ?  20   ILE A CG2 1 
ATOM   144   C  CD1 . ILE A  1 20  ? 2.975   -50.533 102.767 1.00 59.96  ?  20   ILE A CD1 1 
ATOM   145   N  N   . ARG A  1 21  ? -0.735  -52.356 100.633 1.00 58.85  ?  21   ARG A N   1 
ATOM   146   C  CA  . ARG A  1 21  ? -2.097  -51.859 100.782 1.00 59.27  ?  21   ARG A CA  1 
ATOM   147   C  C   . ARG A  1 21  ? -2.087  -50.628 101.677 1.00 63.68  ?  21   ARG A C   1 
ATOM   148   O  O   . ARG A  1 21  ? -1.653  -50.697 102.832 1.00 69.01  ?  21   ARG A O   1 
ATOM   149   C  CB  . ARG A  1 21  ? -3.022  -52.926 101.359 1.00 56.96  ?  21   ARG A CB  1 
ATOM   150   C  CG  . ARG A  1 21  ? -4.393  -52.377 101.722 1.00 57.13  ?  21   ARG A CG  1 
ATOM   151   C  CD  . ARG A  1 21  ? -5.426  -53.478 101.813 1.00 61.51  ?  21   ARG A CD  1 
ATOM   152   N  NE  . ARG A  1 21  ? -5.435  -54.131 103.118 1.00 68.08  ?  21   ARG A NE  1 
ATOM   153   C  CZ  . ARG A  1 21  ? -6.296  -53.858 104.092 1.00 74.52  ?  21   ARG A CZ  1 
ATOM   154   N  NH1 . ARG A  1 21  ? -7.238  -52.940 103.914 1.00 75.34  ?  21   ARG A NH1 1 
ATOM   155   N  NH2 . ARG A  1 21  ? -6.217  -54.511 105.246 1.00 79.04  ?  21   ARG A NH2 1 
ATOM   156   N  N   . LEU A  1 22  ? -2.590  -49.515 101.156 1.00 60.53  ?  22   LEU A N   1 
ATOM   157   C  CA  . LEU A  1 22  ? -2.591  -48.256 101.880 1.00 58.28  ?  22   LEU A CA  1 
ATOM   158   C  C   . LEU A  1 22  ? -4.008  -47.916 102.315 1.00 58.97  ?  22   LEU A C   1 
ATOM   159   O  O   . LEU A  1 22  ? -4.985  -48.372 101.716 1.00 58.98  ?  22   LEU A O   1 
ATOM   160   C  CB  . LEU A  1 22  ? -2.027  -47.118 101.030 1.00 52.21  ?  22   LEU A CB  1 
ATOM   161   C  CG  . LEU A  1 22  ? -0.535  -47.220 100.741 1.00 51.30  ?  22   LEU A CG  1 
ATOM   162   C  CD1 . LEU A  1 22  ? -0.041  -45.944 100.078 1.00 50.01  ?  22   LEU A CD1 1 
ATOM   163   C  CD2 . LEU A  1 22  ? 0.243   -47.533 102.009 1.00 52.37  ?  22   LEU A CD2 1 
ATOM   164   N  N   . LYS A  1 23  ? -4.112  -47.149 103.396 1.00 59.86  ?  23   LYS A N   1 
ATOM   165   C  CA  . LYS A  1 23  ? -5.404  -46.712 103.908 1.00 62.12  ?  23   LYS A CA  1 
ATOM   166   C  C   . LYS A  1 23  ? -5.651  -45.286 103.428 1.00 61.93  ?  23   LYS A C   1 
ATOM   167   O  O   . LYS A  1 23  ? -4.940  -44.357 103.823 1.00 63.75  ?  23   LYS A O   1 
ATOM   168   C  CB  . LYS A  1 23  ? -5.456  -46.816 105.432 1.00 60.02  ?  23   LYS A CB  1 
ATOM   169   C  CG  . LYS A  1 23  ? -5.895  -48.194 105.917 1.00 62.71  ?  23   LYS A CG  1 
ATOM   170   C  CD  . LYS A  1 23  ? -5.379  -48.534 107.314 1.00 67.59  ?  23   LYS A CD  1 
ATOM   171   C  CE  . LYS A  1 23  ? -6.080  -47.715 108.403 1.00 71.44  ?  23   LYS A CE  1 
ATOM   172   N  NZ  . LYS A  1 23  ? -5.773  -48.202 109.786 1.00 73.28  ?  23   LYS A NZ  1 
ATOM   173   N  N   . ALA A  1 24  ? -6.632  -45.125 102.532 1.00 59.48  ?  24   ALA A N   1 
ATOM   174   C  CA  . ALA A  1 24  ? -7.228  -43.874 102.095 1.00 58.10  ?  24   ALA A CA  1 
ATOM   175   C  C   . ALA A  1 24  ? -8.451  -43.554 102.951 1.00 61.87  ?  24   ALA A C   1 
ATOM   176   O  O   . ALA A  1 24  ? -9.099  -44.467 103.474 1.00 65.28  ?  24   ALA A O   1 
ATOM   177   C  CB  . ALA A  1 24  ? -7.629  -43.957 100.626 1.00 56.09  ?  24   ALA A CB  1 
ATOM   178   N  N   . PRO A  1 25  ? -8.789  -42.268 103.097 1.00 61.84  ?  25   PRO A N   1 
ATOM   179   C  CA  . PRO A  1 25  ? -9.884  -41.883 104.006 1.00 64.05  ?  25   PRO A CA  1 
ATOM   180   C  C   . PRO A  1 25  ? -11.175 -42.668 103.820 1.00 67.84  ?  25   PRO A C   1 
ATOM   181   O  O   . PRO A  1 25  ? -11.881 -42.920 104.806 1.00 71.11  ?  25   PRO A O   1 
ATOM   182   C  CB  . PRO A  1 25  ? -10.081 -40.396 103.686 1.00 61.66  ?  25   PRO A CB  1 
ATOM   183   C  CG  . PRO A  1 25  ? -8.741  -39.939 103.253 1.00 58.79  ?  25   PRO A CG  1 
ATOM   184   C  CD  . PRO A  1 25  ? -8.138  -41.090 102.499 1.00 59.18  ?  25   PRO A CD  1 
ATOM   185   N  N   . GLY A  1 26  ? -11.507 -43.069 102.594 1.00 68.13  ?  26   GLY A N   1 
ATOM   186   C  CA  . GLY A  1 26  ? -12.714 -43.829 102.342 1.00 61.94  ?  26   GLY A CA  1 
ATOM   187   C  C   . GLY A  1 26  ? -12.540 -45.307 102.075 1.00 62.52  ?  26   GLY A C   1 
ATOM   188   O  O   . GLY A  1 26  ? -13.532 -45.978 101.758 1.00 63.58  ?  26   GLY A O   1 
ATOM   189   N  N   . GLY A  1 27  ? -11.328 -45.849 102.179 1.00 60.61  ?  27   GLY A N   1 
ATOM   190   C  CA  . GLY A  1 27  ? -11.108 -47.248 101.898 1.00 60.53  ?  27   GLY A CA  1 
ATOM   191   C  C   . GLY A  1 27  ? -9.673  -47.556 101.523 1.00 62.19  ?  27   GLY A C   1 
ATOM   192   O  O   . GLY A  1 27  ? -8.824  -46.664 101.444 1.00 63.13  ?  27   GLY A O   1 
ATOM   193   N  N   . PRO A  1 28  ? -9.369  -48.832 101.301 1.00 60.64  ?  28   PRO A N   1 
ATOM   194   C  CA  . PRO A  1 28  ? -7.998  -49.211 100.954 1.00 57.27  ?  28   PRO A CA  1 
ATOM   195   C  C   . PRO A  1 28  ? -7.682  -48.944 99.491  1.00 57.31  ?  28   PRO A C   1 
ATOM   196   O  O   . PRO A  1 28  ? -8.566  -48.896 98.632  1.00 56.41  ?  28   PRO A O   1 
ATOM   197   C  CB  . PRO A  1 28  ? -7.968  -50.711 101.258 1.00 58.25  ?  28   PRO A CB  1 
ATOM   198   C  CG  . PRO A  1 28  ? -9.361  -51.151 100.996 1.00 59.56  ?  28   PRO A CG  1 
ATOM   199   C  CD  . PRO A  1 28  ? -10.255 -50.004 101.399 1.00 60.27  ?  28   PRO A CD  1 
ATOM   200   N  N   . VAL A  1 29  ? -6.389  -48.757 99.220  1.00 56.28  ?  29   VAL A N   1 
ATOM   201   C  CA  . VAL A  1 29  ? -5.873  -48.647 97.864  1.00 55.04  ?  29   VAL A CA  1 
ATOM   202   C  C   . VAL A  1 29  ? -4.660  -49.557 97.737  1.00 54.94  ?  29   VAL A C   1 
ATOM   203   O  O   . VAL A  1 29  ? -4.097  -50.030 98.727  1.00 52.76  ?  29   VAL A O   1 
ATOM   204   C  CB  . VAL A  1 29  ? -5.485  -47.205 97.473  1.00 51.47  ?  29   VAL A CB  1 
ATOM   205   C  CG1 . VAL A  1 29  ? -6.606  -46.248 97.780  1.00 52.21  ?  29   VAL A CG1 1 
ATOM   206   C  CG2 . VAL A  1 29  ? -4.209  -46.790 98.175  1.00 50.92  ?  29   VAL A CG2 1 
ATOM   207   N  N   . SER A  1 30  ? -4.260  -49.787 96.491  1.00 54.33  ?  30   SER A N   1 
ATOM   208   C  CA  . SER A  1 30  ? -3.083  -50.571 96.144  1.00 53.14  ?  30   SER A CA  1 
ATOM   209   C  C   . SER A  1 30  ? -1.999  -49.619 95.662  1.00 50.87  ?  30   SER A C   1 
ATOM   210   O  O   . SER A  1 30  ? -2.221  -48.843 94.724  1.00 51.57  ?  30   SER A O   1 
ATOM   211   C  CB  . SER A  1 30  ? -3.414  -51.599 95.063  1.00 53.54  ?  30   SER A CB  1 
ATOM   212   O  OG  . SER A  1 30  ? -4.573  -52.342 95.404  1.00 56.20  ?  30   SER A OG  1 
ATOM   213   N  N   . ALA A  1 31  ? -0.833  -49.681 96.300  1.00 50.38  ?  31   ALA A N   1 
ATOM   214   C  CA  . ALA A  1 31  ? 0.293   -48.819 95.974  1.00 50.03  ?  31   ALA A CA  1 
ATOM   215   C  C   . ALA A  1 31  ? 1.495   -49.672 95.603  1.00 50.28  ?  31   ALA A C   1 
ATOM   216   O  O   . ALA A  1 31  ? 1.892   -50.561 96.363  1.00 49.37  ?  31   ALA A O   1 
ATOM   217   C  CB  . ALA A  1 31  ? 0.642   -47.902 97.146  1.00 48.25  ?  31   ALA A CB  1 
ATOM   218   N  N   . PHE A  1 32  ? 2.067   -49.403 94.435  1.00 46.96  ?  32   PHE A N   1 
ATOM   219   C  CA  . PHE A  1 32  ? 3.273   -50.076 93.969  1.00 46.88  ?  32   PHE A CA  1 
ATOM   220   C  C   . PHE A  1 32  ? 4.322   -48.999 93.738  1.00 51.72  ?  32   PHE A C   1 
ATOM   221   O  O   . PHE A  1 32  ? 4.216   -48.221 92.787  1.00 51.39  ?  32   PHE A O   1 
ATOM   222   C  CB  . PHE A  1 32  ? 2.976   -50.876 92.703  1.00 46.83  ?  32   PHE A CB  1 
ATOM   223   C  CG  . PHE A  1 32  ? 1.776   -51.782 92.833  1.00 56.32  ?  32   PHE A CG  1 
ATOM   224   C  CD1 . PHE A  1 32  ? 0.498   -51.314 92.564  1.00 47.63  ?  32   PHE A CD1 1 
ATOM   225   C  CD2 . PHE A  1 32  ? 1.927   -53.099 93.243  1.00 55.82  ?  32   PHE A CD2 1 
ATOM   226   C  CE1 . PHE A  1 32  ? -0.602  -52.146 92.692  1.00 50.02  ?  32   PHE A CE1 1 
ATOM   227   C  CE2 . PHE A  1 32  ? 0.830   -53.936 93.374  1.00 53.70  ?  32   PHE A CE2 1 
ATOM   228   C  CZ  . PHE A  1 32  ? -0.436  -53.459 93.097  1.00 51.72  ?  32   PHE A CZ  1 
ATOM   229   N  N   . LEU A  1 33  ? 5.339   -48.960 94.595  1.00 51.02  ?  33   LEU A N   1 
ATOM   230   C  CA  . LEU A  1 33  ? 6.223   -47.808 94.708  1.00 48.54  ?  33   LEU A CA  1 
ATOM   231   C  C   . LEU A  1 33  ? 7.668   -48.223 94.468  1.00 46.17  ?  33   LEU A C   1 
ATOM   232   O  O   . LEU A  1 33  ? 8.131   -49.241 94.993  1.00 47.11  ?  33   LEU A O   1 
ATOM   233   C  CB  . LEU A  1 33  ? 6.089   -47.165 96.092  1.00 48.51  ?  33   LEU A CB  1 
ATOM   234   C  CG  . LEU A  1 33  ? 4.679   -46.928 96.639  1.00 46.71  ?  33   LEU A CG  1 
ATOM   235   C  CD1 . LEU A  1 33  ? 4.750   -46.406 98.068  1.00 47.52  ?  33   LEU A CD1 1 
ATOM   236   C  CD2 . LEU A  1 33  ? 3.916   -45.963 95.758  1.00 45.77  ?  33   LEU A CD2 1 
ATOM   237   N  N   . GLY A  1 34  ? 8.383   -47.424 93.684  1.00 45.48  ?  34   GLY A N   1 
ATOM   238   C  CA  . GLY A  1 34  ? 9.772   -47.721 93.402  1.00 47.03  ?  34   GLY A CA  1 
ATOM   239   C  C   . GLY A  1 34  ? 9.998   -48.817 92.384  1.00 48.14  ?  34   GLY A C   1 
ATOM   240   O  O   . GLY A  1 34  ? 10.947  -49.597 92.529  1.00 49.59  ?  34   GLY A O   1 
ATOM   241   N  N   . ILE A  1 35  ? 9.149   -48.903 91.362  1.00 46.97  ?  35   ILE A N   1 
ATOM   242   C  CA  . ILE A  1 35  ? 9.312   -49.859 90.267  1.00 47.67  ?  35   ILE A CA  1 
ATOM   243   C  C   . ILE A  1 35  ? 10.398  -49.347 89.330  1.00 51.08  ?  35   ILE A C   1 
ATOM   244   O  O   . ILE A  1 35  ? 10.229  -48.268 88.742  1.00 54.11  ?  35   ILE A O   1 
ATOM   245   C  CB  . ILE A  1 35  ? 7.998   -50.055 89.495  1.00 45.34  ?  35   ILE A CB  1 
ATOM   246   C  CG1 . ILE A  1 35  ? 6.859   -50.447 90.434  1.00 45.67  ?  35   ILE A CG1 1 
ATOM   247   C  CG2 . ILE A  1 35  ? 8.173   -51.097 88.404  1.00 45.84  ?  35   ILE A CG2 1 
ATOM   248   C  CD1 . ILE A  1 35  ? 5.515   -50.537 89.741  1.00 45.46  ?  35   ILE A CD1 1 
ATOM   249   N  N   . PRO A  1 36  ? 11.518  -50.050 89.153  1.00 50.22  ?  36   PRO A N   1 
ATOM   250   C  CA  . PRO A  1 36  ? 12.519  -49.577 88.180  1.00 50.18  ?  36   PRO A CA  1 
ATOM   251   C  C   . PRO A  1 36  ? 11.987  -49.710 86.760  1.00 50.19  ?  36   PRO A C   1 
ATOM   252   O  O   . PRO A  1 36  ? 11.581  -50.796 86.337  1.00 51.36  ?  36   PRO A O   1 
ATOM   253   C  CB  . PRO A  1 36  ? 13.717  -50.502 88.426  1.00 49.63  ?  36   PRO A CB  1 
ATOM   254   C  CG  . PRO A  1 36  ? 13.104  -51.762 88.957  1.00 48.90  ?  36   PRO A CG  1 
ATOM   255   C  CD  . PRO A  1 36  ? 11.897  -51.336 89.762  1.00 48.86  ?  36   PRO A CD  1 
ATOM   256   N  N   . PHE A  1 37  ? 11.987  -48.602 86.020  1.00 48.48  ?  37   PHE A N   1 
ATOM   257   C  CA  . PHE A  1 37  ? 11.703  -48.652 84.592  1.00 49.53  ?  37   PHE A CA  1 
ATOM   258   C  C   . PHE A  1 37  ? 12.948  -48.513 83.722  1.00 51.37  ?  37   PHE A C   1 
ATOM   259   O  O   . PHE A  1 37  ? 12.837  -48.576 82.492  1.00 51.37  ?  37   PHE A O   1 
ATOM   260   C  CB  . PHE A  1 37  ? 10.651  -47.602 84.207  1.00 48.61  ?  37   PHE A CB  1 
ATOM   261   C  CG  . PHE A  1 37  ? 11.089  -46.179 84.403  1.00 48.89  ?  37   PHE A CG  1 
ATOM   262   C  CD1 . PHE A  1 37  ? 10.888  -45.541 85.617  1.00 48.95  ?  37   PHE A CD1 1 
ATOM   263   C  CD2 . PHE A  1 37  ? 11.665  -45.467 83.358  1.00 47.96  ?  37   PHE A CD2 1 
ATOM   264   C  CE1 . PHE A  1 37  ? 11.272  -44.228 85.795  1.00 48.06  ?  37   PHE A CE1 1 
ATOM   265   C  CE2 . PHE A  1 37  ? 12.055  -44.152 83.530  1.00 47.97  ?  37   PHE A CE2 1 
ATOM   266   C  CZ  . PHE A  1 37  ? 11.859  -43.531 84.752  1.00 48.65  ?  37   PHE A CZ  1 
ATOM   267   N  N   . ALA A  1 38  ? 14.122  -48.325 84.321  1.00 52.79  ?  38   ALA A N   1 
ATOM   268   C  CA  . ALA A  1 38  ? 15.342  -48.113 83.556  1.00 53.67  ?  38   ALA A CA  1 
ATOM   269   C  C   . ALA A  1 38  ? 16.544  -48.597 84.351  1.00 58.41  ?  38   ALA A C   1 
ATOM   270   O  O   . ALA A  1 38  ? 16.534  -48.597 85.585  1.00 60.91  ?  38   ALA A O   1 
ATOM   271   C  CB  . ALA A  1 38  ? 15.530  -46.636 83.191  1.00 50.42  ?  38   ALA A CB  1 
ATOM   272   N  N   . GLU A  1 39  ? 17.580  -49.010 83.633  1.00 60.77  ?  39   GLU A N   1 
ATOM   273   C  CA  . GLU A  1 39  ? 18.859  -49.245 84.280  1.00 62.35  ?  39   GLU A CA  1 
ATOM   274   C  C   . GLU A  1 39  ? 19.340  -47.940 84.907  1.00 60.39  ?  39   GLU A C   1 
ATOM   275   O  O   . GLU A  1 39  ? 19.152  -46.868 84.318  1.00 59.83  ?  39   GLU A O   1 
ATOM   276   C  CB  . GLU A  1 39  ? 19.890  -49.761 83.273  1.00 65.00  ?  39   GLU A CB  1 
ATOM   277   C  CG  . GLU A  1 39  ? 19.600  -51.160 82.784  1.00 66.65  ?  39   GLU A CG  1 
ATOM   278   C  CD  . GLU A  1 39  ? 19.856  -52.202 83.847  1.00 68.82  ?  39   GLU A CD  1 
ATOM   279   O  OE1 . GLU A  1 39  ? 21.018  -52.328 84.289  1.00 71.17  ?  39   GLU A OE1 1 
ATOM   280   O  OE2 . GLU A  1 39  ? 18.892  -52.881 84.256  1.00 68.65  ?  39   GLU A OE2 1 
ATOM   281   N  N   . PRO A  1 40  ? 19.931  -47.983 86.099  1.00 59.55  ?  40   PRO A N   1 
ATOM   282   C  CA  . PRO A  1 40  ? 20.377  -46.746 86.753  1.00 58.13  ?  40   PRO A CA  1 
ATOM   283   C  C   . PRO A  1 40  ? 21.331  -45.970 85.862  1.00 57.28  ?  40   PRO A C   1 
ATOM   284   O  O   . PRO A  1 40  ? 22.307  -46.530 85.339  1.00 57.54  ?  40   PRO A O   1 
ATOM   285   C  CB  . PRO A  1 40  ? 21.075  -47.248 88.030  1.00 58.26  ?  40   PRO A CB  1 
ATOM   286   C  CG  . PRO A  1 40  ? 21.312  -48.706 87.807  1.00 58.83  ?  40   PRO A CG  1 
ATOM   287   C  CD  . PRO A  1 40  ? 20.192  -49.167 86.931  1.00 59.33  ?  40   PRO A CD  1 
ATOM   288   N  N   . PRO A  1 41  ? 21.050  -44.603 85.636  1.00 55.50  ?  41   PRO A N   1 
ATOM   289   C  CA  . PRO A  1 41  ? 21.880  -43.772 84.745  1.00 50.32  ?  41   PRO A CA  1 
ATOM   290   C  C   . PRO A  1 41  ? 23.114  -43.222 85.452  1.00 60.36  ?  41   PRO A C   1 
ATOM   291   O  O   . PRO A  1 41  ? 23.333  -42.009 85.532  1.00 62.69  ?  41   PRO A O   1 
ATOM   292   C  CB  . PRO A  1 41  ? 20.901  -42.668 84.327  1.00 48.79  ?  41   PRO A CB  1 
ATOM   293   C  CG  . PRO A  1 41  ? 20.000  -42.519 85.493  1.00 47.84  ?  41   PRO A CG  1 
ATOM   294   C  CD  . PRO A  1 41  ? 19.850  -43.887 86.103  1.00 48.32  ?  41   PRO A CD  1 
ATOM   295   N  N   . VAL A  1 42  ? 23.948  -44.129 85.955  1.00 58.58  ?  42   VAL A N   1 
ATOM   296   C  CA  . VAL A  1 42  ? 25.058  -43.781 86.830  1.00 57.83  ?  42   VAL A CA  1 
ATOM   297   C  C   . VAL A  1 42  ? 26.362  -44.163 86.147  1.00 59.59  ?  42   VAL A C   1 
ATOM   298   O  O   . VAL A  1 42  ? 26.390  -44.964 85.210  1.00 61.46  ?  42   VAL A O   1 
ATOM   299   C  CB  . VAL A  1 42  ? 24.946  -44.471 88.201  1.00 54.77  ?  42   VAL A CB  1 
ATOM   300   C  CG1 . VAL A  1 42  ? 23.590  -44.196 88.827  1.00 54.65  ?  42   VAL A CG1 1 
ATOM   301   C  CG2 . VAL A  1 42  ? 25.168  -45.960 88.052  1.00 57.82  ?  42   VAL A CG2 1 
ATOM   302   N  N   . GLY A  1 43  ? 27.452  -43.567 86.620  1.00 60.71  ?  43   GLY A N   1 
ATOM   303   C  CA  . GLY A  1 43  ? 28.760  -43.862 86.068  1.00 62.40  ?  43   GLY A CA  1 
ATOM   304   C  C   . GLY A  1 43  ? 28.927  -43.394 84.637  1.00 62.15  ?  43   GLY A C   1 
ATOM   305   O  O   . GLY A  1 43  ? 28.756  -42.207 84.342  1.00 61.43  ?  43   GLY A O   1 
ATOM   306   N  N   . SER A  1 44  ? 29.268  -44.318 83.737  1.00 63.88  ?  44   SER A N   1 
ATOM   307   C  CA  . SER A  1 44  ? 29.467  -43.969 82.335  1.00 65.37  ?  44   SER A CA  1 
ATOM   308   C  C   . SER A  1 44  ? 28.165  -43.662 81.607  1.00 65.88  ?  44   SER A C   1 
ATOM   309   O  O   . SER A  1 44  ? 28.214  -43.210 80.458  1.00 67.64  ?  44   SER A O   1 
ATOM   310   C  CB  . SER A  1 44  ? 30.203  -45.097 81.611  1.00 67.37  ?  44   SER A CB  1 
ATOM   311   O  OG  . SER A  1 44  ? 29.417  -46.275 81.569  1.00 62.37  ?  44   SER A OG  1 
ATOM   312   N  N   . ARG A  1 45  ? 27.012  -43.893 82.229  1.00 66.48  ?  45   ARG A N   1 
ATOM   313   C  CA  . ARG A  1 45  ? 25.733  -43.577 81.611  1.00 68.47  ?  45   ARG A CA  1 
ATOM   314   C  C   . ARG A  1 45  ? 25.199  -42.201 81.998  1.00 71.17  ?  45   ARG A C   1 
ATOM   315   O  O   . ARG A  1 45  ? 24.070  -41.867 81.622  1.00 74.58  ?  45   ARG A O   1 
ATOM   316   C  CB  . ARG A  1 45  ? 24.694  -44.649 81.953  1.00 68.09  ?  45   ARG A CB  1 
ATOM   317   C  CG  . ARG A  1 45  ? 24.824  -45.904 81.112  1.00 73.19  ?  45   ARG A CG  1 
ATOM   318   C  CD  . ARG A  1 45  ? 23.626  -46.828 81.288  1.00 78.92  ?  45   ARG A CD  1 
ATOM   319   N  NE  . ARG A  1 45  ? 24.009  -48.240 81.222  1.00 86.93  ?  45   ARG A NE  1 
ATOM   320   C  CZ  . ARG A  1 45  ? 24.142  -49.035 82.283  1.00 92.15  ?  45   ARG A CZ  1 
ATOM   321   N  NH1 . ARG A  1 45  ? 23.912  -48.568 83.508  1.00 92.09  ?  45   ARG A NH1 1 
ATOM   322   N  NH2 . ARG A  1 45  ? 24.501  -50.303 82.120  1.00 95.35  ?  45   ARG A NH2 1 
ATOM   323   N  N   . ARG A  1 46  ? 25.962  -41.400 82.741  1.00 68.85  ?  46   ARG A N   1 
ATOM   324   C  CA  . ARG A  1 46  ? 25.509  -40.057 83.077  1.00 65.06  ?  46   ARG A CA  1 
ATOM   325   C  C   . ARG A  1 46  ? 25.394  -39.208 81.816  1.00 64.44  ?  46   ARG A C   1 
ATOM   326   O  O   . ARG A  1 46  ? 26.198  -39.338 80.887  1.00 66.86  ?  46   ARG A O   1 
ATOM   327   C  CB  . ARG A  1 46  ? 26.466  -39.402 84.072  1.00 65.47  ?  46   ARG A CB  1 
ATOM   328   C  CG  . ARG A  1 46  ? 25.973  -38.065 84.620  1.00 64.32  ?  46   ARG A CG  1 
ATOM   329   C  CD  . ARG A  1 46  ? 27.060  -37.340 85.404  1.00 66.19  ?  46   ARG A CD  1 
ATOM   330   N  NE  . ARG A  1 46  ? 27.135  -37.756 86.802  1.00 66.55  ?  46   ARG A NE  1 
ATOM   331   C  CZ  . ARG A  1 46  ? 28.129  -37.425 87.621  1.00 67.20  ?  46   ARG A CZ  1 
ATOM   332   N  NH1 . ARG A  1 46  ? 29.129  -36.673 87.180  1.00 66.78  ?  46   ARG A NH1 1 
ATOM   333   N  NH2 . ARG A  1 46  ? 28.124  -37.845 88.878  1.00 68.33  ?  46   ARG A NH2 1 
ATOM   334   N  N   . PHE A  1 47  ? 24.366  -38.350 81.787  1.00 61.49  ?  47   PHE A N   1 
ATOM   335   C  CA  . PHE A  1 47  ? 24.030  -37.460 80.673  1.00 59.61  ?  47   PHE A CA  1 
ATOM   336   C  C   . PHE A  1 47  ? 23.483  -38.215 79.469  1.00 62.10  ?  47   PHE A C   1 
ATOM   337   O  O   . PHE A  1 47  ? 23.000  -37.596 78.516  1.00 63.42  ?  47   PHE A O   1 
ATOM   338   C  CB  . PHE A  1 47  ? 25.234  -36.621 80.234  1.00 57.10  ?  47   PHE A CB  1 
ATOM   339   C  CG  . PHE A  1 47  ? 25.910  -35.889 81.354  1.00 55.53  ?  47   PHE A CG  1 
ATOM   340   C  CD1 . PHE A  1 47  ? 25.208  -34.985 82.134  1.00 53.83  ?  47   PHE A CD1 1 
ATOM   341   C  CD2 . PHE A  1 47  ? 27.256  -36.088 81.613  1.00 56.86  ?  47   PHE A CD2 1 
ATOM   342   C  CE1 . PHE A  1 47  ? 25.836  -34.301 83.163  1.00 55.29  ?  47   PHE A CE1 1 
ATOM   343   C  CE2 . PHE A  1 47  ? 27.890  -35.408 82.634  1.00 55.55  ?  47   PHE A CE2 1 
ATOM   344   C  CZ  . PHE A  1 47  ? 27.180  -34.511 83.411  1.00 58.06  ?  47   PHE A CZ  1 
ATOM   345   N  N   . MET A  1 48  ? 23.557  -39.541 79.499  1.00 63.43  ?  48   MET A N   1 
ATOM   346   C  CA  . MET A  1 48  ? 23.167  -40.406 78.397  1.00 62.87  ?  48   MET A CA  1 
ATOM   347   C  C   . MET A  1 48  ? 21.703  -40.819 78.507  1.00 59.46  ?  48   MET A C   1 
ATOM   348   O  O   . MET A  1 48  ? 21.124  -40.827 79.602  1.00 61.26  ?  48   MET A O   1 
ATOM   349   C  CB  . MET A  1 48  ? 24.061  -41.638 78.371  1.00 65.11  ?  48   MET A CB  1 
ATOM   350   C  CG  . MET A  1 48  ? 25.507  -41.318 78.117  1.00 69.88  ?  48   MET A CG  1 
ATOM   351   S  SD  . MET A  1 48  ? 26.138  -42.327 76.777  1.00 76.30  ?  48   MET A SD  1 
ATOM   352   C  CE  . MET A  1 48  ? 25.213  -41.666 75.404  1.00 75.30  ?  48   MET A CE  1 
ATOM   353   N  N   . PRO A  1 49  ? 21.072  -41.162 77.385  1.00 53.27  ?  49   PRO A N   1 
ATOM   354   C  CA  . PRO A  1 49  ? 19.666  -41.587 77.412  1.00 50.14  ?  49   PRO A CA  1 
ATOM   355   C  C   . PRO A  1 49  ? 19.475  -42.814 78.284  1.00 50.46  ?  49   PRO A C   1 
ATOM   356   O  O   . PRO A  1 49  ? 20.432  -43.562 78.538  1.00 51.97  ?  49   PRO A O   1 
ATOM   357   C  CB  . PRO A  1 49  ? 19.371  -41.903 75.938  1.00 49.92  ?  49   PRO A CB  1 
ATOM   358   C  CG  . PRO A  1 49  ? 20.326  -41.066 75.182  1.00 50.26  ?  49   PRO A CG  1 
ATOM   359   C  CD  . PRO A  1 49  ? 21.580  -41.042 76.009  1.00 52.00  ?  49   PRO A CD  1 
ATOM   360   N  N   . PRO A  1 50  ? 18.259  -43.056 78.767  1.00 50.32  ?  50   PRO A N   1 
ATOM   361   C  CA  . PRO A  1 50  ? 18.023  -44.221 79.622  1.00 50.66  ?  50   PRO A CA  1 
ATOM   362   C  C   . PRO A  1 50  ? 17.942  -45.511 78.828  1.00 53.27  ?  50   PRO A C   1 
ATOM   363   O  O   . PRO A  1 50  ? 17.566  -45.534 77.653  1.00 54.40  ?  50   PRO A O   1 
ATOM   364   C  CB  . PRO A  1 50  ? 16.676  -43.904 80.279  1.00 48.12  ?  50   PRO A CB  1 
ATOM   365   C  CG  . PRO A  1 50  ? 15.966  -43.110 79.245  1.00 47.90  ?  50   PRO A CG  1 
ATOM   366   C  CD  . PRO A  1 50  ? 17.035  -42.248 78.604  1.00 49.25  ?  50   PRO A CD  1 
ATOM   367   N  N   . GLU A  1 51  ? 18.293  -46.590 79.495  1.00 54.60  ?  51   GLU A N   1 
ATOM   368   C  CA  . GLU A  1 51  ? 18.142  -47.899 78.895  1.00 55.83  ?  51   GLU A CA  1 
ATOM   369   C  C   . GLU A  1 51  ? 17.126  -48.706 79.691  1.00 55.85  ?  51   GLU A C   1 
ATOM   370   O  O   . GLU A  1 51  ? 17.057  -48.570 80.918  1.00 55.95  ?  51   GLU A O   1 
ATOM   371   C  CB  . GLU A  1 51  ? 19.472  -48.659 78.857  1.00 57.85  ?  51   GLU A CB  1 
ATOM   372   C  CG  . GLU A  1 51  ? 20.498  -48.115 77.876  1.00 59.44  ?  51   GLU A CG  1 
ATOM   373   C  CD  . GLU A  1 51  ? 21.860  -48.757 78.060  0.08 61.33  ?  51   GLU A CD  1 
ATOM   374   O  OE1 . GLU A  1 51  ? 22.270  -48.947 79.227  1.00 60.41  ?  51   GLU A OE1 1 
ATOM   375   O  OE2 . GLU A  1 51  ? 22.508  -49.086 77.041  1.00 63.97  ?  51   GLU A OE2 1 
ATOM   376   N  N   . PRO A  1 52  ? 16.331  -49.546 79.028  1.00 54.48  ?  52   PRO A N   1 
ATOM   377   C  CA  . PRO A  1 52  ? 15.259  -50.253 79.737  1.00 52.79  ?  52   PRO A CA  1 
ATOM   378   C  C   . PRO A  1 52  ? 15.808  -51.141 80.844  1.00 53.08  ?  52   PRO A C   1 
ATOM   379   O  O   . PRO A  1 52  ? 16.904  -51.696 80.740  1.00 54.99  ?  52   PRO A O   1 
ATOM   380   C  CB  . PRO A  1 52  ? 14.590  -51.078 78.631  1.00 51.34  ?  52   PRO A CB  1 
ATOM   381   C  CG  . PRO A  1 52  ? 14.924  -50.353 77.370  1.00 50.16  ?  52   PRO A CG  1 
ATOM   382   C  CD  . PRO A  1 52  ? 16.303  -49.811 77.580  1.00 52.04  ?  52   PRO A CD  1 
ATOM   383   N  N   . LYS A  1 53  ? 15.034  -51.253 81.923  1.00 51.58  ?  53   LYS A N   1 
ATOM   384   C  CA  . LYS A  1 53  ? 15.443  -52.076 83.053  1.00 52.10  ?  53   LYS A CA  1 
ATOM   385   C  C   . LYS A  1 53  ? 15.545  -53.529 82.621  1.00 54.23  ?  53   LYS A C   1 
ATOM   386   O  O   . LYS A  1 53  ? 14.584  -54.101 82.097  1.00 51.11  ?  53   LYS A O   1 
ATOM   387   C  CB  . LYS A  1 53  ? 14.451  -51.928 84.205  1.00 50.83  ?  53   LYS A CB  1 
ATOM   388   C  CG  . LYS A  1 53  ? 14.725  -52.845 85.401  1.00 52.03  ?  53   LYS A CG  1 
ATOM   389   C  CD  . LYS A  1 53  ? 16.102  -52.599 85.998  1.00 53.79  ?  53   LYS A CD  1 
ATOM   390   C  CE  . LYS A  1 53  ? 16.426  -53.594 87.103  1.00 54.97  ?  53   LYS A CE  1 
ATOM   391   N  NZ  . LYS A  1 53  ? 17.885  -53.586 87.422  1.00 56.09  ?  53   LYS A NZ  1 
ATOM   392   N  N   . ARG A  1 54  ? 16.711  -54.122 82.850  1.00 52.53  ?  54   ARG A N   1 
ATOM   393   C  CA  . ARG A  1 54  ? 16.913  -55.511 82.495  1.00 54.90  ?  54   ARG A CA  1 
ATOM   394   C  C   . ARG A  1 54  ? 16.083  -56.402 83.422  1.00 54.89  ?  54   ARG A C   1 
ATOM   395   O  O   . ARG A  1 54  ? 15.860  -56.060 84.588  1.00 53.41  ?  54   ARG A O   1 
ATOM   396   C  CB  . ARG A  1 54  ? 18.395  -55.874 82.587  1.00 58.84  ?  54   ARG A CB  1 
ATOM   397   C  CG  . ARG A  1 54  ? 19.286  -55.134 81.588  1.00 63.53  ?  54   ARG A CG  1 
ATOM   398   C  CD  . ARG A  1 54  ? 20.720  -55.667 81.578  1.00 71.16  ?  54   ARG A CD  1 
ATOM   399   N  NE  . ARG A  1 54  ? 21.363  -55.605 82.891  1.00 76.80  ?  54   ARG A NE  1 
ATOM   400   C  CZ  . ARG A  1 54  ? 21.709  -56.677 83.608  1.00 81.30  ?  54   ARG A CZ  1 
ATOM   401   N  NH1 . ARG A  1 54  ? 21.480  -57.902 83.140  1.00 82.12  ?  54   ARG A NH1 1 
ATOM   402   N  NH2 . ARG A  1 54  ? 22.288  -56.526 84.795  1.00 82.56  ?  54   ARG A NH2 1 
ATOM   403   N  N   . PRO A  1 55  ? 15.596  -57.538 82.922  1.00 56.07  ?  55   PRO A N   1 
ATOM   404   C  CA  . PRO A  1 55  ? 14.702  -58.372 83.731  1.00 55.95  ?  55   PRO A CA  1 
ATOM   405   C  C   . PRO A  1 55  ? 15.402  -58.894 84.975  1.00 56.49  ?  55   PRO A C   1 
ATOM   406   O  O   . PRO A  1 55  ? 16.620  -59.079 85.000  1.00 57.03  ?  55   PRO A O   1 
ATOM   407   C  CB  . PRO A  1 55  ? 14.324  -59.513 82.781  1.00 56.11  ?  55   PRO A CB  1 
ATOM   408   C  CG  . PRO A  1 55  ? 14.532  -58.946 81.426  1.00 55.97  ?  55   PRO A CG  1 
ATOM   409   C  CD  . PRO A  1 55  ? 15.735  -58.067 81.556  1.00 55.91  ?  55   PRO A CD  1 
ATOM   410   N  N   . TRP A  1 56  ? 14.606  -59.133 86.013  1.00 55.98  ?  56   TRP A N   1 
ATOM   411   C  CA  . TRP A  1 56  ? 15.095  -59.561 87.314  1.00 56.67  ?  56   TRP A CA  1 
ATOM   412   C  C   . TRP A  1 56  ? 14.359  -60.819 87.753  1.00 57.53  ?  56   TRP A C   1 
ATOM   413   O  O   . TRP A  1 56  ? 13.330  -61.200 87.187  1.00 57.08  ?  56   TRP A O   1 
ATOM   414   C  CB  . TRP A  1 56  ? 14.919  -58.456 88.359  1.00 55.38  ?  56   TRP A CB  1 
ATOM   415   C  CG  . TRP A  1 56  ? 13.483  -58.094 88.598  1.00 53.90  ?  56   TRP A CG  1 
ATOM   416   C  CD1 . TRP A  1 56  ? 12.629  -58.669 89.494  1.00 59.41  ?  56   TRP A CD1 1 
ATOM   417   C  CD2 . TRP A  1 56  ? 12.736  -57.068 87.935  1.00 52.38  ?  56   TRP A CD2 1 
ATOM   418   N  NE1 . TRP A  1 56  ? 11.395  -58.066 89.427  1.00 57.27  ?  56   TRP A NE1 1 
ATOM   419   C  CE2 . TRP A  1 56  ? 11.437  -57.079 88.478  1.00 55.39  ?  56   TRP A CE2 1 
ATOM   420   C  CE3 . TRP A  1 56  ? 13.038  -56.141 86.935  1.00 56.23  ?  56   TRP A CE3 1 
ATOM   421   C  CZ2 . TRP A  1 56  ? 10.443  -56.199 88.054  1.00 53.03  ?  56   TRP A CZ2 1 
ATOM   422   C  CZ3 . TRP A  1 56  ? 12.049  -55.269 86.516  1.00 53.62  ?  56   TRP A CZ3 1 
ATOM   423   C  CH2 . TRP A  1 56  ? 10.769  -55.305 87.074  1.00 51.57  ?  56   TRP A CH2 1 
ATOM   424   N  N   . SER A  1 57  ? 14.895  -61.464 88.782  1.00 59.40  ?  57   SER A N   1 
ATOM   425   C  CA  . SER A  1 57  ? 14.302  -62.670 89.334  1.00 62.19  ?  57   SER A CA  1 
ATOM   426   C  C   . SER A  1 57  ? 13.846  -62.410 90.764  1.00 62.67  ?  57   SER A C   1 
ATOM   427   O  O   . SER A  1 57  ? 14.295  -61.470 91.428  1.00 58.66  ?  57   SER A O   1 
ATOM   428   C  CB  . SER A  1 57  ? 15.280  -63.852 89.286  1.00 61.69  ?  57   SER A CB  1 
ATOM   429   O  OG  . SER A  1 57  ? 16.548  -63.488 89.800  1.00 63.10  ?  57   SER A OG  1 
ATOM   430   N  N   . GLY A  1 58  ? 12.924  -63.240 91.223  1.00 59.77  ?  58   GLY A N   1 
ATOM   431   C  CA  . GLY A  1 58  ? 12.345  -63.038 92.526  1.00 69.26  ?  58   GLY A CA  1 
ATOM   432   C  C   . GLY A  1 58  ? 11.289  -61.954 92.483  1.00 65.00  ?  58   GLY A C   1 
ATOM   433   O  O   . GLY A  1 58  ? 10.969  -61.392 91.430  1.00 63.17  ?  58   GLY A O   1 
ATOM   434   N  N   . VAL A  1 59  ? 10.742  -61.657 93.655  1.00 57.69  ?  59   VAL A N   1 
ATOM   435   C  CA  . VAL A  1 59  ? 9.715   -60.631 93.796  1.00 61.00  ?  59   VAL A CA  1 
ATOM   436   C  C   . VAL A  1 59  ? 10.362  -59.354 94.312  1.00 57.54  ?  59   VAL A C   1 
ATOM   437   O  O   . VAL A  1 59  ? 10.937  -59.333 95.407  1.00 57.65  ?  59   VAL A O   1 
ATOM   438   C  CB  . VAL A  1 59  ? 8.582   -61.093 94.720  1.00 56.78  ?  59   VAL A CB  1 
ATOM   439   C  CG1 . VAL A  1 59  ? 7.514   -60.030 94.790  1.00 55.44  ?  59   VAL A CG1 1 
ATOM   440   C  CG2 . VAL A  1 59  ? 7.995   -62.391 94.200  1.00 57.79  ?  59   VAL A CG2 1 
ATOM   441   N  N   . LEU A  1 60  ? 10.264  -58.292 93.520  1.00 55.42  ?  60   LEU A N   1 
ATOM   442   C  CA  . LEU A  1 60  ? 10.835  -56.999 93.862  1.00 55.07  ?  60   LEU A CA  1 
ATOM   443   C  C   . LEU A  1 60  ? 9.903   -56.238 94.797  1.00 55.27  ?  60   LEU A C   1 
ATOM   444   O  O   . LEU A  1 60  ? 8.677   -56.336 94.701  1.00 53.82  ?  60   LEU A O   1 
ATOM   445   C  CB  . LEU A  1 60  ? 11.094  -56.193 92.587  1.00 53.06  ?  60   LEU A CB  1 
ATOM   446   C  CG  . LEU A  1 60  ? 11.614  -54.760 92.695  1.00 51.00  ?  60   LEU A CG  1 
ATOM   447   C  CD1 . LEU A  1 60  ? 12.616  -54.487 91.594  1.00 50.86  ?  60   LEU A CD1 1 
ATOM   448   C  CD2 . LEU A  1 60  ? 10.464  -53.767 92.611  1.00 49.68  ?  60   LEU A CD2 1 
ATOM   449   N  N   . ASP A  1 61  ? 10.499  -55.458 95.698  1.00 57.43  ?  61   ASP A N   1 
ATOM   450   C  CA  . ASP A  1 61  ? 9.736   -54.763 96.729  1.00 60.29  ?  61   ASP A CA  1 
ATOM   451   C  C   . ASP A  1 61  ? 9.199   -53.454 96.161  1.00 60.10  ?  61   ASP A C   1 
ATOM   452   O  O   . ASP A  1 61  ? 9.964   -52.537 95.845  1.00 60.21  ?  61   ASP A O   1 
ATOM   453   C  CB  . ASP A  1 61  ? 10.617  -54.517 97.951  1.00 64.33  ?  61   ASP A CB  1 
ATOM   454   C  CG  . ASP A  1 61  ? 9.848   -53.957 99.132  1.00 68.07  ?  61   ASP A CG  1 
ATOM   455   O  OD1 . ASP A  1 61  ? 8.868   -53.212 98.927  1.00 67.69  ?  61   ASP A OD1 1 
ATOM   456   O  OD2 . ASP A  1 61  ? 10.232  -54.260 100.279 1.00 71.51  ?  61   ASP A OD2 1 
ATOM   457   N  N   . ALA A  1 62  ? 7.875   -53.368 96.047  1.00 59.70  ?  62   ALA A N   1 
ATOM   458   C  CA  . ALA A  1 62  ? 7.185   -52.188 95.551  1.00 59.06  ?  62   ALA A CA  1 
ATOM   459   C  C   . ALA A  1 62  ? 6.613   -51.313 96.657  1.00 58.62  ?  62   ALA A C   1 
ATOM   460   O  O   . ALA A  1 62  ? 5.838   -50.403 96.360  1.00 59.73  ?  62   ALA A O   1 
ATOM   461   C  CB  . ALA A  1 62  ? 6.075   -52.586 94.581  1.00 61.00  ?  62   ALA A CB  1 
ATOM   462   N  N   . THR A  1 63  ? 6.916   -51.601 97.920  1.00 58.49  ?  63   THR A N   1 
ATOM   463   C  CA  . THR A  1 63  ? 6.189   -51.008 99.040  1.00 57.43  ?  63   THR A CA  1 
ATOM   464   C  C   . THR A  1 63  ? 6.719   -49.650 99.502  1.00 57.06  ?  63   THR A C   1 
ATOM   465   O  O   . THR A  1 63  ? 6.110   -49.050 100.393 1.00 57.91  ?  63   THR A O   1 
ATOM   466   C  CB  . THR A  1 63  ? 6.186   -51.965 100.235 1.00 57.48  ?  63   THR A CB  1 
ATOM   467   O  OG1 . THR A  1 63  ? 7.520   -52.101 100.740 1.00 58.12  ?  63   THR A OG1 1 
ATOM   468   C  CG2 . THR A  1 63  ? 5.658   -53.337 99.832  1.00 57.98  ?  63   THR A CG2 1 
ATOM   469   N  N   . THR A  1 64  ? 7.825   -49.147 98.951  1.00 56.21  ?  64   THR A N   1 
ATOM   470   C  CA  . THR A  1 64  ? 8.384   -47.883 99.422  1.00 55.21  ?  64   THR A CA  1 
ATOM   471   C  C   . THR A  1 64  ? 8.834   -47.027 98.250  1.00 55.97  ?  64   THR A C   1 
ATOM   472   O  O   . THR A  1 64  ? 9.250   -47.542 97.208  1.00 57.78  ?  64   THR A O   1 
ATOM   473   C  CB  . THR A  1 64  ? 9.583   -48.085 100.352 1.00 54.72  ?  64   THR A CB  1 
ATOM   474   O  OG1 . THR A  1 64  ? 10.636  -48.750 99.641  1.00 54.38  ?  64   THR A OG1 1 
ATOM   475   C  CG2 . THR A  1 64  ? 9.186   -48.910 101.555 1.00 55.99  ?  64   THR A CG2 1 
ATOM   476   N  N   . PHE A  1 65  ? 8.770   -45.708 98.447  1.00 54.78  ?  65   PHE A N   1 
ATOM   477   C  CA  . PHE A  1 65  ? 9.284   -44.772 97.453  1.00 52.70  ?  65   PHE A CA  1 
ATOM   478   C  C   . PHE A  1 65  ? 10.788  -44.951 97.284  1.00 53.90  ?  65   PHE A C   1 
ATOM   479   O  O   . PHE A  1 65  ? 11.519  -45.163 98.256  1.00 57.56  ?  65   PHE A O   1 
ATOM   480   C  CB  . PHE A  1 65  ? 8.981   -43.326 97.860  1.00 50.72  ?  65   PHE A CB  1 
ATOM   481   C  CG  . PHE A  1 65  ? 7.536   -42.932 97.719  1.00 48.47  ?  65   PHE A CG  1 
ATOM   482   C  CD1 . PHE A  1 65  ? 6.955   -42.812 96.467  1.00 47.43  ?  65   PHE A CD1 1 
ATOM   483   C  CD2 . PHE A  1 65  ? 6.768   -42.652 98.834  1.00 48.37  ?  65   PHE A CD2 1 
ATOM   484   C  CE1 . PHE A  1 65  ? 5.628   -42.441 96.333  1.00 46.00  ?  65   PHE A CE1 1 
ATOM   485   C  CE2 . PHE A  1 65  ? 5.440   -42.278 98.706  1.00 47.21  ?  65   PHE A CE2 1 
ATOM   486   C  CZ  . PHE A  1 65  ? 4.872   -42.171 97.455  1.00 46.14  ?  65   PHE A CZ  1 
ATOM   487   N  N   . GLN A  1 66  ? 11.254  -44.860 96.039  1.00 51.22  ?  66   GLN A N   1 
ATOM   488   C  CA  . GLN A  1 66  ? 12.677  -44.954 95.763  1.00 50.61  ?  66   GLN A CA  1 
ATOM   489   C  C   . GLN A  1 66  ? 13.327  -43.578 95.886  1.00 50.72  ?  66   GLN A C   1 
ATOM   490   O  O   . GLN A  1 66  ? 12.683  -42.585 96.232  1.00 51.28  ?  66   GLN A O   1 
ATOM   491   C  CB  . GLN A  1 66  ? 12.922  -45.551 94.376  1.00 49.94  ?  66   GLN A CB  1 
ATOM   492   C  CG  . GLN A  1 66  ? 13.229  -47.049 94.361  1.00 51.50  ?  66   GLN A CG  1 
ATOM   493   C  CD  . GLN A  1 66  ? 14.591  -47.394 94.950  1.00 53.23  ?  66   GLN A CD  1 
ATOM   494   O  OE1 . GLN A  1 66  ? 15.395  -46.515 95.267  1.00 49.05  ?  66   GLN A OE1 1 
ATOM   495   N  NE2 . GLN A  1 66  ? 14.860  -48.686 95.083  1.00 49.75  ?  66   GLN A NE2 1 
ATOM   496   N  N   . ASN A  1 67  ? 14.619  -43.518 95.570  1.00 51.05  ?  67   ASN A N   1 
ATOM   497   C  CA  . ASN A  1 67  ? 15.402  -42.307 95.767  1.00 52.07  ?  67   ASN A CA  1 
ATOM   498   C  C   . ASN A  1 67  ? 14.919  -41.169 94.868  1.00 51.85  ?  67   ASN A C   1 
ATOM   499   O  O   . ASN A  1 67  ? 14.271  -41.376 93.837  1.00 53.00  ?  67   ASN A O   1 
ATOM   500   C  CB  . ASN A  1 67  ? 16.881  -42.579 95.495  1.00 54.07  ?  67   ASN A CB  1 
ATOM   501   C  CG  . ASN A  1 67  ? 17.463  -43.613 96.429  1.00 56.24  ?  67   ASN A CG  1 
ATOM   502   O  OD1 . ASN A  1 67  ? 17.343  -43.492 97.648  1.00 58.34  ?  67   ASN A OD1 1 
ATOM   503   N  ND2 . ASN A  1 67  ? 18.088  -44.647 95.866  1.00 56.16  ?  67   ASN A ND2 1 
ATOM   504   N  N   . VAL A  1 68  ? 15.251  -39.958 95.279  1.00 50.74  ?  68   VAL A N   1 
ATOM   505   C  CA  . VAL A  1 68  ? 14.951  -38.749 94.525  1.00 49.85  ?  68   VAL A CA  1 
ATOM   506   C  C   . VAL A  1 68  ? 16.161  -38.391 93.673  1.00 51.97  ?  68   VAL A C   1 
ATOM   507   O  O   . VAL A  1 68  ? 17.305  -38.509 94.127  1.00 53.89  ?  68   VAL A O   1 
ATOM   508   C  CB  . VAL A  1 68  ? 14.570  -37.606 95.483  1.00 47.28  ?  68   VAL A CB  1 
ATOM   509   C  CG1 . VAL A  1 68  ? 14.455  -36.297 94.742  1.00 45.47  ?  68   VAL A CG1 1 
ATOM   510   C  CG2 . VAL A  1 68  ? 13.258  -37.926 96.173  1.00 46.60  ?  68   VAL A CG2 1 
ATOM   511   N  N   . CYS A  1 69  ? 15.919  -37.962 92.431  1.00 50.91  ?  69   CYS A N   1 
ATOM   512   C  CA  . CYS A  1 69  ? 17.016  -37.571 91.553  1.00 52.70  ?  69   CYS A CA  1 
ATOM   513   C  C   . CYS A  1 69  ? 17.778  -36.383 92.125  1.00 51.90  ?  69   CYS A C   1 
ATOM   514   O  O   . CYS A  1 69  ? 17.195  -35.498 92.760  1.00 52.23  ?  69   CYS A O   1 
ATOM   515   C  CB  . CYS A  1 69  ? 16.490  -37.228 90.161  1.00 56.19  ?  69   CYS A CB  1 
ATOM   516   S  SG  . CYS A  1 69  ? 15.778  -38.612 89.247  1.00 59.55  ?  69   CYS A SG  1 
ATOM   517   N  N   . TYR A  1 70  ? 19.090  -36.368 91.888  1.00 50.09  ?  70   TYR A N   1 
ATOM   518   C  CA  . TYR A  1 70  ? 19.939  -35.304 92.407  1.00 49.69  ?  70   TYR A CA  1 
ATOM   519   C  C   . TYR A  1 70  ? 19.447  -33.945 91.935  1.00 51.73  ?  70   TYR A C   1 
ATOM   520   O  O   . TYR A  1 70  ? 19.209  -33.736 90.739  1.00 52.32  ?  70   TYR A O   1 
ATOM   521   C  CB  . TYR A  1 70  ? 21.384  -35.517 91.970  1.00 50.00  ?  70   TYR A CB  1 
ATOM   522   C  CG  . TYR A  1 70  ? 22.289  -35.945 93.092  1.00 54.18  ?  70   TYR A CG  1 
ATOM   523   C  CD1 . TYR A  1 70  ? 22.794  -35.020 93.993  1.00 55.29  ?  70   TYR A CD1 1 
ATOM   524   C  CD2 . TYR A  1 70  ? 22.632  -37.278 93.258  1.00 58.47  ?  70   TYR A CD2 1 
ATOM   525   C  CE1 . TYR A  1 70  ? 23.619  -35.411 95.031  1.00 59.76  ?  70   TYR A CE1 1 
ATOM   526   C  CE2 . TYR A  1 70  ? 23.457  -37.682 94.287  1.00 63.02  ?  70   TYR A CE2 1 
ATOM   527   C  CZ  . TYR A  1 70  ? 23.950  -36.746 95.174  1.00 65.26  ?  70   TYR A CZ  1 
ATOM   528   O  OH  . TYR A  1 70  ? 24.775  -37.150 96.206  1.00 71.53  ?  70   TYR A OH  1 
ATOM   529   N  N   . GLN A  1 71  ? 19.296  -33.021 92.881  1.00 53.17  ?  71   GLN A N   1 
ATOM   530   C  CA  . GLN A  1 71  ? 18.740  -31.711 92.581  1.00 53.11  ?  71   GLN A CA  1 
ATOM   531   C  C   . GLN A  1 71  ? 19.168  -30.723 93.653  1.00 55.93  ?  71   GLN A C   1 
ATOM   532   O  O   . GLN A  1 71  ? 19.584  -31.105 94.749  1.00 59.25  ?  71   GLN A O   1 
ATOM   533   C  CB  . GLN A  1 71  ? 17.215  -31.776 92.487  1.00 50.42  ?  71   GLN A CB  1 
ATOM   534   C  CG  . GLN A  1 71  ? 16.564  -32.390 93.705  1.00 48.20  ?  71   GLN A CG  1 
ATOM   535   C  CD  . GLN A  1 71  ? 15.075  -32.567 93.530  1.00 47.66  ?  71   GLN A CD  1 
ATOM   536   O  OE1 . GLN A  1 71  ? 14.275  -31.769 94.025  1.00 49.31  ?  71   GLN A OE1 1 
ATOM   537   N  NE2 . GLN A  1 71  ? 14.690  -33.625 92.826  1.00 44.21  ?  71   GLN A NE2 1 
ATOM   538   N  N   . TYR A  1 72  ? 19.065  -29.442 93.310  1.00 55.27  ?  72   TYR A N   1 
ATOM   539   C  CA  . TYR A  1 72  ? 19.220  -28.383 94.296  1.00 56.07  ?  72   TYR A CA  1 
ATOM   540   C  C   . TYR A  1 72  ? 18.117  -28.484 95.346  1.00 54.46  ?  72   TYR A C   1 
ATOM   541   O  O   . TYR A  1 72  ? 16.989  -28.899 95.061  1.00 53.10  ?  72   TYR A O   1 
ATOM   542   C  CB  . TYR A  1 72  ? 19.195  -27.018 93.599  1.00 58.46  ?  72   TYR A CB  1 
ATOM   543   C  CG  . TYR A  1 72  ? 19.204  -25.814 94.517  1.00 61.99  ?  72   TYR A CG  1 
ATOM   544   C  CD1 . TYR A  1 72  ? 20.394  -25.315 95.035  1.00 64.21  ?  72   TYR A CD1 1 
ATOM   545   C  CD2 . TYR A  1 72  ? 18.022  -25.155 94.842  1.00 62.78  ?  72   TYR A CD2 1 
ATOM   546   C  CE1 . TYR A  1 72  ? 20.404  -24.205 95.871  1.00 65.69  ?  72   TYR A CE1 1 
ATOM   547   C  CE2 . TYR A  1 72  ? 18.024  -24.045 95.674  1.00 64.39  ?  72   TYR A CE2 1 
ATOM   548   C  CZ  . TYR A  1 72  ? 19.215  -23.575 96.187  1.00 65.15  ?  72   TYR A CZ  1 
ATOM   549   O  OH  . TYR A  1 72  ? 19.212  -22.476 97.020  1.00 65.34  ?  72   TYR A OH  1 
ATOM   550   N  N   . VAL A  1 73  ? 18.458  -28.121 96.580  1.00 55.55  ?  73   VAL A N   1 
ATOM   551   C  CA  . VAL A  1 73  ? 17.517  -28.121 97.694  1.00 56.59  ?  73   VAL A CA  1 
ATOM   552   C  C   . VAL A  1 73  ? 17.365  -26.687 98.187  1.00 60.15  ?  73   VAL A C   1 
ATOM   553   O  O   . VAL A  1 73  ? 18.363  -25.980 98.370  1.00 61.22  ?  73   VAL A O   1 
ATOM   554   C  CB  . VAL A  1 73  ? 17.982  -29.054 98.825  1.00 56.06  ?  73   VAL A CB  1 
ATOM   555   C  CG1 . VAL A  1 73  ? 17.029  -28.977 100.005 1.00 55.75  ?  73   VAL A CG1 1 
ATOM   556   C  CG2 . VAL A  1 73  ? 18.095  -30.478 98.314  1.00 55.50  ?  73   VAL A CG2 1 
ATOM   557   N  N   . ASP A  1 74  ? 16.119  -26.262 98.405  1.00 61.98  ?  74   ASP A N   1 
ATOM   558   C  CA  . ASP A  1 74  ? 15.824  -24.856 98.655  1.00 65.64  ?  74   ASP A CA  1 
ATOM   559   C  C   . ASP A  1 74  ? 16.122  -24.505 100.110 1.00 69.76  ?  74   ASP A C   1 
ATOM   560   O  O   . ASP A  1 74  ? 15.469  -25.011 101.030 1.00 69.81  ?  74   ASP A O   1 
ATOM   561   C  CB  . ASP A  1 74  ? 14.362  -24.576 98.312  1.00 66.43  ?  74   ASP A CB  1 
ATOM   562   C  CG  . ASP A  1 74  ? 14.029  -23.101 98.310  1.00 68.48  ?  74   ASP A CG  1 
ATOM   563   O  OD1 . ASP A  1 74  ? 13.914  -22.518 99.410  1.00 70.95  ?  74   ASP A OD1 1 
ATOM   564   O  OD2 . ASP A  1 74  ? 13.861  -22.529 97.210  1.00 68.09  ?  74   ASP A OD2 1 
ATOM   565   N  N   . THR A  1 75  ? 17.109  -23.636 100.312 1.00 72.97  ?  75   THR A N   1 
ATOM   566   C  CA  . THR A  1 75  ? 17.501  -23.170 101.634 1.00 75.11  ?  75   THR A CA  1 
ATOM   567   C  C   . THR A  1 75  ? 16.997  -21.772 101.973 1.00 75.68  ?  75   THR A C   1 
ATOM   568   O  O   . THR A  1 75  ? 17.304  -21.276 103.062 1.00 80.72  ?  75   THR A O   1 
ATOM   569   C  CB  . THR A  1 75  ? 19.023  -23.200 101.765 1.00 76.90  ?  75   THR A CB  1 
ATOM   570   O  OG1 . THR A  1 75  ? 19.608  -22.426 100.705 1.00 75.83  ?  75   THR A OG1 1 
ATOM   571   C  CG2 . THR A  1 75  ? 19.523  -24.643 101.701 1.00 76.61  ?  75   THR A CG2 1 
ATOM   572   N  N   . LEU A  1 76  ? 16.257  -21.117 101.075 1.00 70.87  ?  76   LEU A N   1 
ATOM   573   C  CA  . LEU A  1 76  ? 15.947  -19.701 101.265 1.00 69.44  ?  76   LEU A CA  1 
ATOM   574   C  C   . LEU A  1 76  ? 15.218  -19.460 102.583 1.00 72.89  ?  76   LEU A C   1 
ATOM   575   O  O   . LEU A  1 76  ? 15.569  -18.549 103.343 1.00 75.53  ?  76   LEU A O   1 
ATOM   576   C  CB  . LEU A  1 76  ? 15.117  -19.179 100.093 1.00 65.59  ?  76   LEU A CB  1 
ATOM   577   C  CG  . LEU A  1 76  ? 14.552  -17.768 100.279 1.00 65.51  ?  76   LEU A CG  1 
ATOM   578   C  CD1 . LEU A  1 76  ? 15.672  -16.757 100.468 1.00 66.64  ?  76   LEU A CD1 1 
ATOM   579   C  CD2 . LEU A  1 76  ? 13.666  -17.383 99.109  1.00 64.01  ?  76   LEU A CD2 1 
ATOM   580   N  N   . TYR A  1 77  ? 14.203  -20.270 102.875 1.00 72.74  ?  77   TYR A N   1 
ATOM   581   C  CA  . TYR A  1 77  ? 13.382  -20.118 104.076 1.00 74.08  ?  77   TYR A CA  1 
ATOM   582   C  C   . TYR A  1 77  ? 13.375  -21.444 104.824 1.00 73.31  ?  77   TYR A C   1 
ATOM   583   O  O   . TYR A  1 77  ? 12.423  -22.229 104.711 1.00 74.34  ?  77   TYR A O   1 
ATOM   584   C  CB  . TYR A  1 77  ? 11.963  -19.669 103.717 1.00 73.83  ?  77   TYR A CB  1 
ATOM   585   C  CG  . TYR A  1 77  ? 11.880  -18.281 103.120 1.00 73.93  ?  77   TYR A CG  1 
ATOM   586   C  CD1 . TYR A  1 77  ? 12.555  -17.217 103.696 1.00 77.04  ?  77   TYR A CD1 1 
ATOM   587   C  CD2 . TYR A  1 77  ? 11.127  -18.037 101.976 1.00 72.96  ?  77   TYR A CD2 1 
ATOM   588   C  CE1 . TYR A  1 77  ? 12.483  -15.943 103.156 1.00 79.64  ?  77   TYR A CE1 1 
ATOM   589   C  CE2 . TYR A  1 77  ? 11.047  -16.767 101.426 1.00 74.96  ?  77   TYR A CE2 1 
ATOM   590   C  CZ  . TYR A  1 77  ? 11.728  -15.722 102.020 1.00 78.77  ?  77   TYR A CZ  1 
ATOM   591   O  OH  . TYR A  1 77  ? 11.660  -14.451 101.486 1.00 80.66  ?  77   TYR A OH  1 
ATOM   592   N  N   . PRO A  1 78  ? 14.422  -21.730 105.599 1.00 70.68  ?  78   PRO A N   1 
ATOM   593   C  CA  . PRO A  1 78  ? 14.504  -23.031 106.275 1.00 68.32  ?  78   PRO A CA  1 
ATOM   594   C  C   . PRO A  1 78  ? 13.436  -23.179 107.349 1.00 69.00  ?  78   PRO A C   1 
ATOM   595   O  O   . PRO A  1 78  ? 13.171  -22.255 108.121 1.00 71.02  ?  78   PRO A O   1 
ATOM   596   C  CB  . PRO A  1 78  ? 15.911  -23.025 106.882 1.00 69.34  ?  78   PRO A CB  1 
ATOM   597   C  CG  . PRO A  1 78  ? 16.226  -21.577 107.065 1.00 72.31  ?  78   PRO A CG  1 
ATOM   598   C  CD  . PRO A  1 78  ? 15.588  -20.879 105.894 1.00 71.56  ?  78   PRO A CD  1 
ATOM   599   N  N   . GLY A  1 79  ? 12.826  -24.364 107.395 1.00 67.66  ?  79   GLY A N   1 
ATOM   600   C  CA  . GLY A  1 79  ? 11.737  -24.634 108.313 1.00 67.74  ?  79   GLY A CA  1 
ATOM   601   C  C   . GLY A  1 79  ? 10.378  -24.183 107.833 1.00 65.94  ?  79   GLY A C   1 
ATOM   602   O  O   . GLY A  1 79  ? 9.376   -24.449 108.512 1.00 67.15  ?  79   GLY A O   1 
ATOM   603   N  N   . PHE A  1 80  ? 10.311  -23.520 106.685 1.00 64.36  ?  80   PHE A N   1 
ATOM   604   C  CA  . PHE A  1 80  ? 9.074   -22.961 106.161 1.00 64.74  ?  80   PHE A CA  1 
ATOM   605   C  C   . PHE A  1 80  ? 8.388   -23.995 105.276 1.00 66.27  ?  80   PHE A C   1 
ATOM   606   O  O   . PHE A  1 80  ? 8.994   -24.507 104.327 1.00 67.01  ?  80   PHE A O   1 
ATOM   607   C  CB  . PHE A  1 80  ? 9.389   -21.678 105.387 1.00 63.01  ?  80   PHE A CB  1 
ATOM   608   C  CG  . PHE A  1 80  ? 8.200   -21.035 104.738 1.00 63.01  ?  80   PHE A CG  1 
ATOM   609   C  CD1 . PHE A  1 80  ? 7.090   -20.675 105.484 1.00 64.58  ?  80   PHE A CD1 1 
ATOM   610   C  CD2 . PHE A  1 80  ? 8.212   -20.746 103.382 1.00 61.80  ?  80   PHE A CD2 1 
ATOM   611   C  CE1 . PHE A  1 80  ? 6.000   -20.066 104.883 1.00 64.90  ?  80   PHE A CE1 1 
ATOM   612   C  CE2 . PHE A  1 80  ? 7.129   -20.136 102.776 1.00 61.80  ?  80   PHE A CE2 1 
ATOM   613   C  CZ  . PHE A  1 80  ? 6.021   -19.797 103.529 1.00 63.80  ?  80   PHE A CZ  1 
ATOM   614   N  N   . GLU A  1 81  ? 7.129   -24.314 105.594 1.00 67.03  ?  81   GLU A N   1 
ATOM   615   C  CA  . GLU A  1 81  ? 6.415   -25.325 104.819 1.00 67.83  ?  81   GLU A CA  1 
ATOM   616   C  C   . GLU A  1 81  ? 6.254   -24.917 103.360 1.00 66.14  ?  81   GLU A C   1 
ATOM   617   O  O   . GLU A  1 81  ? 6.248   -25.781 102.475 1.00 66.48  ?  81   GLU A O   1 
ATOM   618   C  CB  . GLU A  1 81  ? 5.037   -25.600 105.422 1.00 72.64  ?  81   GLU A CB  1 
ATOM   619   C  CG  . GLU A  1 81  ? 4.250   -26.634 104.620 1.00 76.49  ?  81   GLU A CG  1 
ATOM   620   C  CD  . GLU A  1 81  ? 2.758   -26.593 104.868 1.00 82.66  ?  81   GLU A CD  1 
ATOM   621   O  OE1 . GLU A  1 81  ? 2.343   -26.170 105.966 1.00 85.85  ?  81   GLU A OE1 1 
ATOM   622   O  OE2 . GLU A  1 81  ? 1.997   -26.980 103.953 1.00 84.30  ?  81   GLU A OE2 1 
ATOM   623   N  N   . GLY A  1 82  ? 6.116   -23.617 103.091 1.00 64.93  ?  82   GLY A N   1 
ATOM   624   C  CA  . GLY A  1 82  ? 5.912   -23.171 101.722 1.00 61.73  ?  82   GLY A CA  1 
ATOM   625   C  C   . GLY A  1 82  ? 7.010   -23.624 100.780 1.00 59.29  ?  82   GLY A C   1 
ATOM   626   O  O   . GLY A  1 82  ? 6.739   -24.118 99.683  1.00 58.37  ?  82   GLY A O   1 
ATOM   627   N  N   . THR A  1 83  ? 8.272   -23.441 101.185 1.00 58.54  ?  83   THR A N   1 
ATOM   628   C  CA  . THR A  1 83  ? 9.379   -23.921 100.361 1.00 57.59  ?  83   THR A CA  1 
ATOM   629   C  C   . THR A  1 83  ? 9.667   -25.405 100.579 1.00 58.83  ?  83   THR A C   1 
ATOM   630   O  O   . THR A  1 83  ? 9.886   -26.143 99.610  1.00 58.14  ?  83   THR A O   1 
ATOM   631   C  CB  . THR A  1 83  ? 10.646  -23.101 100.626 1.00 57.05  ?  83   THR A CB  1 
ATOM   632   O  OG1 . THR A  1 83  ? 10.905  -23.042 102.034 1.00 58.04  ?  83   THR A OG1 1 
ATOM   633   C  CG2 . THR A  1 83  ? 10.498  -21.694 100.071 1.00 57.23  ?  83   THR A CG2 1 
ATOM   634   N  N   . GLU A  1 84  ? 9.666   -25.867 101.834 1.00 59.88  ?  84   GLU A N   1 
ATOM   635   C  CA  . GLU A  1 84  ? 10.166  -27.207 102.126 1.00 58.32  ?  84   GLU A CA  1 
ATOM   636   C  C   . GLU A  1 84  ? 9.179   -28.309 101.766 1.00 56.40  ?  84   GLU A C   1 
ATOM   637   O  O   . GLU A  1 84  ? 9.587   -29.470 101.653 1.00 55.91  ?  84   GLU A O   1 
ATOM   638   C  CB  . GLU A  1 84  ? 10.562  -27.306 103.601 1.00 60.19  ?  84   GLU A CB  1 
ATOM   639   C  CG  . GLU A  1 84  ? 12.069  -27.383 103.803 1.00 65.30  ?  84   GLU A CG  1 
ATOM   640   C  CD  . GLU A  1 84  ? 12.520  -26.841 105.151 1.00 73.55  ?  84   GLU A CD  1 
ATOM   641   O  OE1 . GLU A  1 84  ? 11.792  -27.018 106.155 1.00 76.76  ?  84   GLU A OE1 1 
ATOM   642   O  OE2 . GLU A  1 84  ? 13.603  -26.215 105.198 1.00 76.13  ?  84   GLU A OE2 1 
ATOM   643   N  N   . MET A  1 85  ? 7.901   -27.977 101.567 1.00 56.47  ?  85   MET A N   1 
ATOM   644   C  CA  . MET A  1 85  ? 6.946   -28.981 101.116 1.00 57.84  ?  85   MET A CA  1 
ATOM   645   C  C   . MET A  1 85  ? 7.363   -29.580 99.778  1.00 58.00  ?  85   MET A C   1 
ATOM   646   O  O   . MET A  1 85  ? 7.049   -30.742 99.494  1.00 58.68  ?  85   MET A O   1 
ATOM   647   C  CB  . MET A  1 85  ? 5.547   -28.365 101.021 1.00 59.52  ?  85   MET A CB  1 
ATOM   648   C  CG  . MET A  1 85  ? 5.155   -27.889 99.628  1.00 58.68  ?  85   MET A CG  1 
ATOM   649   S  SD  . MET A  1 85  ? 3.612   -26.951 99.568  1.00 58.94  ?  85   MET A SD  1 
ATOM   650   C  CE  . MET A  1 85  ? 2.422   -28.158 100.146 1.00 60.20  ?  85   MET A CE  1 
ATOM   651   N  N   . TRP A  1 86  ? 8.082   -28.810 98.955  1.00 56.79  ?  86   TRP A N   1 
ATOM   652   C  CA  . TRP A  1 86  ? 8.544   -29.251 97.645  1.00 53.34  ?  86   TRP A CA  1 
ATOM   653   C  C   . TRP A  1 86  ? 9.919   -29.904 97.678  1.00 52.49  ?  86   TRP A C   1 
ATOM   654   O  O   . TRP A  1 86  ? 10.343  -30.459 96.658  1.00 51.94  ?  86   TRP A O   1 
ATOM   655   C  CB  . TRP A  1 86  ? 8.594   -28.070 96.671  1.00 53.01  ?  86   TRP A CB  1 
ATOM   656   C  CG  . TRP A  1 86  ? 7.367   -27.229 96.661  1.00 54.49  ?  86   TRP A CG  1 
ATOM   657   C  CD1 . TRP A  1 86  ? 7.155   -26.085 97.368  1.00 57.15  ?  86   TRP A CD1 1 
ATOM   658   C  CD2 . TRP A  1 86  ? 6.180   -27.453 95.892  1.00 54.06  ?  86   TRP A CD2 1 
ATOM   659   N  NE1 . TRP A  1 86  ? 5.905   -25.583 97.096  1.00 58.06  ?  86   TRP A NE1 1 
ATOM   660   C  CE2 . TRP A  1 86  ? 5.285   -26.406 96.192  1.00 56.39  ?  86   TRP A CE2 1 
ATOM   661   C  CE3 . TRP A  1 86  ? 5.786   -28.436 94.980  1.00 52.66  ?  86   TRP A CE3 1 
ATOM   662   C  CZ2 . TRP A  1 86  ? 4.019   -26.317 95.615  1.00 56.16  ?  86   TRP A CZ2 1 
ATOM   663   C  CZ3 . TRP A  1 86  ? 4.530   -28.346 94.408  1.00 52.86  ?  86   TRP A CZ3 1 
ATOM   664   C  CH2 . TRP A  1 86  ? 3.661   -27.294 94.728  1.00 54.58  ?  86   TRP A CH2 1 
ATOM   665   N  N   . ASN A  1 87  ? 10.626  -29.843 98.805  1.00 52.50  ?  87   ASN A N   1 
ATOM   666   C  CA  . ASN A  1 87  ? 11.983  -30.359 98.872  1.00 53.22  ?  87   ASN A CA  1 
ATOM   667   C  C   . ASN A  1 87  ? 11.982  -31.884 98.929  1.00 53.84  ?  87   ASN A C   1 
ATOM   668   O  O   . ASN A  1 87  ? 10.995  -32.499 99.346  1.00 54.23  ?  87   ASN A O   1 
ATOM   669   C  CB  . ASN A  1 87  ? 12.706  -29.779 100.082 1.00 55.44  ?  87   ASN A CB  1 
ATOM   670   C  CG  . ASN A  1 87  ? 13.423  -28.480 99.762  1.00 56.12  ?  87   ASN A CG  1 
ATOM   671   O  OD1 . ASN A  1 87  ? 13.665  -28.159 98.597  1.00 55.28  ?  87   ASN A OD1 1 
ATOM   672   N  ND2 . ASN A  1 87  ? 13.786  -27.736 100.800 1.00 57.27  ?  87   ASN A ND2 1 
ATOM   673   N  N   . PRO A  1 88  ? 13.077  -32.520 98.501  1.00 52.86  ?  88   PRO A N   1 
ATOM   674   C  CA  . PRO A  1 88  ? 13.092  -33.987 98.416  1.00 50.40  ?  88   PRO A CA  1 
ATOM   675   C  C   . PRO A  1 88  ? 12.814  -34.633 99.766  1.00 51.13  ?  88   PRO A C   1 
ATOM   676   O  O   . PRO A  1 88  ? 13.443  -34.306 100.774 1.00 55.18  ?  88   PRO A O   1 
ATOM   677   C  CB  . PRO A  1 88  ? 14.513  -34.295 97.927  1.00 50.36  ?  88   PRO A CB  1 
ATOM   678   C  CG  . PRO A  1 88  ? 14.928  -33.070 97.195  1.00 51.00  ?  88   PRO A CG  1 
ATOM   679   C  CD  . PRO A  1 88  ? 14.309  -31.929 97.943  1.00 53.12  ?  88   PRO A CD  1 
ATOM   680   N  N   . ASN A  1 89  ? 11.851  -35.552 99.775  1.00 49.21  ?  89   ASN A N   1 
ATOM   681   C  CA  . ASN A  1 89  ? 11.505  -36.329 100.955 1.00 49.51  ?  89   ASN A CA  1 
ATOM   682   C  C   . ASN A  1 89  ? 12.186  -37.693 100.983 1.00 52.95  ?  89   ASN A C   1 
ATOM   683   O  O   . ASN A  1 89  ? 11.829  -38.529 101.816 1.00 56.29  ?  89   ASN A O   1 
ATOM   684   C  CB  . ASN A  1 89  ? 9.989   -36.492 101.067 1.00 48.59  ?  89   ASN A CB  1 
ATOM   685   C  CG  . ASN A  1 89  ? 9.389   -37.217 99.888  1.00 52.89  ?  89   ASN A CG  1 
ATOM   686   O  OD1 . ASN A  1 89  ? 10.063  -37.476 98.890  1.00 51.33  ?  89   ASN A OD1 1 
ATOM   687   N  ND2 . ASN A  1 89  ? 8.103   -37.528 99.983  1.00 52.77  ?  89   ASN A ND2 1 
ATOM   688   N  N   . ARG A  1 90  ? 13.104  -37.966 100.057 1.00 53.31  ?  90   ARG A N   1 
ATOM   689   C  CA  . ARG A  1 90  ? 13.911  -39.180 100.106 1.00 54.51  ?  90   ARG A CA  1 
ATOM   690   C  C   . ARG A  1 90  ? 15.373  -38.824 99.861  1.00 56.88  ?  90   ARG A C   1 
ATOM   691   O  O   . ARG A  1 90  ? 15.728  -37.659 99.663  1.00 57.68  ?  90   ARG A O   1 
ATOM   692   C  CB  . ARG A  1 90  ? 13.430  -40.226 99.093  1.00 52.54  ?  90   ARG A CB  1 
ATOM   693   C  CG  . ARG A  1 90  ? 12.083  -40.833 99.422  1.00 53.29  ?  90   ARG A CG  1 
ATOM   694   C  CD  . ARG A  1 90  ? 12.110  -41.581 100.748 1.00 57.47  ?  90   ARG A CD  1 
ATOM   695   N  NE  . ARG A  1 90  ? 10.928  -42.423 100.915 1.00 59.67  ?  90   ARG A NE  1 
ATOM   696   C  CZ  . ARG A  1 90  ? 9.801   -42.030 101.509 1.00 60.22  ?  90   ARG A CZ  1 
ATOM   697   N  NH1 . ARG A  1 90  ? 9.679   -40.794 101.982 1.00 56.96  ?  90   ARG A NH1 1 
ATOM   698   N  NH2 . ARG A  1 90  ? 8.781   -42.874 101.611 1.00 62.80  ?  90   ARG A NH2 1 
ATOM   699   N  N   . GLU A  1 91  ? 16.227  -39.845 99.881  1.00 58.44  ?  91   GLU A N   1 
ATOM   700   C  CA  . GLU A  1 91  ? 17.648  -39.644 99.639  1.00 61.42  ?  91   GLU A CA  1 
ATOM   701   C  C   . GLU A  1 91  ? 17.903  -39.241 98.191  1.00 58.71  ?  91   GLU A C   1 
ATOM   702   O  O   . GLU A  1 91  ? 17.174  -39.630 97.275  1.00 58.36  ?  91   GLU A O   1 
ATOM   703   C  CB  . GLU A  1 91  ? 18.431  -40.919 99.946  1.00 69.17  ?  91   GLU A CB  1 
ATOM   704   C  CG  . GLU A  1 91  ? 18.220  -41.492 101.328 1.00 75.80  ?  91   GLU A CG  1 
ATOM   705   C  CD  . GLU A  1 91  ? 19.529  -41.684 102.068 1.00 81.66  ?  91   GLU A CD  1 
ATOM   706   O  OE1 . GLU A  1 91  ? 20.301  -40.704 102.167 1.00 83.56  ?  91   GLU A OE1 1 
ATOM   707   O  OE2 . GLU A  1 91  ? 19.790  -42.813 102.537 1.00 83.54  ?  91   GLU A OE2 1 
ATOM   708   N  N   . LEU A  1 92  ? 18.963  -38.461 97.988  1.00 58.78  ?  92   LEU A N   1 
ATOM   709   C  CA  . LEU A  1 92  ? 19.402  -38.091 96.649  1.00 55.52  ?  92   LEU A CA  1 
ATOM   710   C  C   . LEU A  1 92  ? 20.359  -39.151 96.121  1.00 55.00  ?  92   LEU A C   1 
ATOM   711   O  O   . LEU A  1 92  ? 21.290  -39.560 96.823  1.00 55.17  ?  92   LEU A O   1 
ATOM   712   C  CB  . LEU A  1 92  ? 20.085  -36.721 96.652  1.00 55.45  ?  92   LEU A CB  1 
ATOM   713   C  CG  . LEU A  1 92  ? 19.227  -35.505 97.007  1.00 50.33  ?  92   LEU A CG  1 
ATOM   714   C  CD1 . LEU A  1 92  ? 19.966  -34.218 96.689  1.00 50.74  ?  92   LEU A CD1 1 
ATOM   715   C  CD2 . LEU A  1 92  ? 17.889  -35.550 96.286  1.00 50.52  ?  92   LEU A CD2 1 
ATOM   716   N  N   . SER A  1 93  ? 20.114  -39.608 94.895  1.00 54.68  ?  93   SER A N   1 
ATOM   717   C  CA  . SER A  1 93  ? 21.005  -40.549 94.231  1.00 57.24  ?  93   SER A CA  1 
ATOM   718   C  C   . SER A  1 93  ? 20.866  -40.385 92.727  1.00 58.38  ?  93   SER A C   1 
ATOM   719   O  O   . SER A  1 93  ? 19.801  -40.008 92.231  1.00 59.22  ?  93   SER A O   1 
ATOM   720   C  CB  . SER A  1 93  ? 20.698  -41.996 94.635  1.00 58.00  ?  93   SER A CB  1 
ATOM   721   O  OG  . SER A  1 93  ? 21.470  -42.912 93.882  1.00 58.92  ?  93   SER A OG  1 
ATOM   722   N  N   . GLU A  1 94  ? 21.949  -40.683 92.000  1.00 58.87  ?  94   GLU A N   1 
ATOM   723   C  CA  . GLU A  1 94  ? 21.842  -40.739 90.548  1.00 56.00  ?  94   GLU A CA  1 
ATOM   724   C  C   . GLU A  1 94  ? 21.047  -41.949 90.084  1.00 54.00  ?  94   GLU A C   1 
ATOM   725   O  O   . GLU A  1 94  ? 20.521  -41.931 88.967  1.00 50.39  ?  94   GLU A O   1 
ATOM   726   C  CB  . GLU A  1 94  ? 23.217  -40.757 89.881  1.00 56.91  ?  94   GLU A CB  1 
ATOM   727   C  CG  . GLU A  1 94  ? 24.053  -39.517 90.101  1.00 58.66  ?  94   GLU A CG  1 
ATOM   728   C  CD  . GLU A  1 94  ? 25.146  -39.369 89.058  1.00 61.07  ?  94   GLU A CD  1 
ATOM   729   O  OE1 . GLU A  1 94  ? 24.807  -39.185 87.868  1.00 60.49  ?  94   GLU A OE1 1 
ATOM   730   O  OE2 . GLU A  1 94  ? 26.338  -39.455 89.421  1.00 63.45  ?  94   GLU A OE2 1 
ATOM   731   N  N   . ASP A  1 95  ? 20.914  -42.983 90.924  1.00 56.55  ?  95   ASP A N   1 
ATOM   732   C  CA  . ASP A  1 95  ? 20.033  -44.100 90.595  1.00 57.39  ?  95   ASP A CA  1 
ATOM   733   C  C   . ASP A  1 95  ? 18.674  -43.696 91.153  1.00 56.24  ?  95   ASP A C   1 
ATOM   734   O  O   . ASP A  1 95  ? 18.261  -44.076 92.251  1.00 57.05  ?  95   ASP A O   1 
ATOM   735   C  CB  . ASP A  1 95  ? 20.579  -45.371 91.243  1.00 60.19  ?  95   ASP A CB  1 
ATOM   736   C  CG  . ASP A  1 95  ? 19.669  -46.579 91.096  1.00 62.55  ?  95   ASP A CG  1 
ATOM   737   O  OD1 . ASP A  1 95  ? 18.507  -46.439 90.668  1.00 63.27  ?  95   ASP A OD1 1 
ATOM   738   O  OD2 . ASP A  1 95  ? 20.118  -47.686 91.465  1.00 64.01  ?  95   ASP A OD2 1 
ATOM   739   N  N   . CYS A  1 96  ? 17.959  -42.920 90.347  1.00 54.67  ?  96   CYS A N   1 
ATOM   740   C  CA  . CYS A  1 96  ? 16.653  -42.414 90.719  1.00 54.64  ?  96   CYS A CA  1 
ATOM   741   C  C   . CYS A  1 96  ? 15.506  -42.837 89.818  1.00 56.16  ?  96   CYS A C   1 
ATOM   742   O  O   . CYS A  1 96  ? 14.368  -42.434 90.083  1.00 59.37  ?  96   CYS A O   1 
ATOM   743   C  CB  . CYS A  1 96  ? 16.697  -40.893 90.824  1.00 53.24  ?  96   CYS A CB  1 
ATOM   744   S  SG  . CYS A  1 96  ? 17.190  -40.058 89.343  1.00 54.10  ?  96   CYS A SG  1 
ATOM   745   N  N   . LEU A  1 97  ? 15.744  -43.599 88.756  1.00 53.03  ?  97   LEU A N   1 
ATOM   746   C  CA  . LEU A  1 97  ? 14.716  -43.746 87.733  1.00 49.01  ?  97   LEU A CA  1 
ATOM   747   C  C   . LEU A  1 97  ? 13.803  -44.889 88.150  1.00 49.19  ?  97   LEU A C   1 
ATOM   748   O  O   . LEU A  1 97  ? 14.146  -46.068 88.002  1.00 51.61  ?  97   LEU A O   1 
ATOM   749   C  CB  . LEU A  1 97  ? 15.339  -43.984 86.361  1.00 47.02  ?  97   LEU A CB  1 
ATOM   750   C  CG  . LEU A  1 97  ? 16.072  -42.797 85.731  1.00 45.81  ?  97   LEU A CG  1 
ATOM   751   C  CD1 . LEU A  1 97  ? 16.549  -43.145 84.336  1.00 45.13  ?  97   LEU A CD1 1 
ATOM   752   C  CD2 . LEU A  1 97  ? 15.158  -41.582 85.680  1.00 43.60  ?  97   LEU A CD2 1 
ATOM   753   N  N   . TYR A  1 98  ? 12.613  -44.521 88.619  1.00 46.17  ?  98   TYR A N   1 
ATOM   754   C  CA  . TYR A  1 98  ? 11.636  -45.430 89.191  1.00 44.70  ?  98   TYR A CA  1 
ATOM   755   C  C   . TYR A  1 98  ? 10.278  -44.772 89.045  1.00 44.14  ?  98   TYR A C   1 
ATOM   756   O  O   . TYR A  1 98  ? 10.181  -43.560 88.848  1.00 43.57  ?  98   TYR A O   1 
ATOM   757   C  CB  . TYR A  1 98  ? 11.919  -45.737 90.667  1.00 44.53  ?  98   TYR A CB  1 
ATOM   758   C  CG  . TYR A  1 98  ? 13.259  -46.381 90.941  1.00 45.58  ?  98   TYR A CG  1 
ATOM   759   C  CD1 . TYR A  1 98  ? 13.409  -47.757 90.900  1.00 46.38  ?  98   TYR A CD1 1 
ATOM   760   C  CD2 . TYR A  1 98  ? 14.365  -45.614 91.276  1.00 45.96  ?  98   TYR A CD2 1 
ATOM   761   C  CE1 . TYR A  1 98  ? 14.627  -48.350 91.153  1.00 47.53  ?  98   TYR A CE1 1 
ATOM   762   C  CE2 . TYR A  1 98  ? 15.584  -46.198 91.538  1.00 47.14  ?  98   TYR A CE2 1 
ATOM   763   C  CZ  . TYR A  1 98  ? 15.711  -47.568 91.475  1.00 47.94  ?  98   TYR A CZ  1 
ATOM   764   O  OH  . TYR A  1 98  ? 16.930  -48.158 91.733  1.00 49.29  ?  98   TYR A OH  1 
ATOM   765   N  N   . LEU A  1 99  ? 9.228   -45.578 89.144  1.00 45.25  ?  99   LEU A N   1 
ATOM   766   C  CA  . LEU A  1 99  ? 7.880   -45.050 89.021  1.00 44.84  ?  99   LEU A CA  1 
ATOM   767   C  C   . LEU A  1 99  ? 6.982   -45.708 90.057  1.00 44.68  ?  99   LEU A C   1 
ATOM   768   O  O   . LEU A  1 99  ? 7.341   -46.703 90.692  1.00 48.52  ?  99   LEU A O   1 
ATOM   769   C  CB  . LEU A  1 99  ? 7.324   -45.230 87.598  1.00 45.12  ?  99   LEU A CB  1 
ATOM   770   C  CG  . LEU A  1 99  ? 7.302   -46.623 86.970  1.00 44.82  ?  99   LEU A CG  1 
ATOM   771   C  CD1 . LEU A  1 99  ? 6.041   -47.381 87.352  1.00 43.20  ?  99   LEU A CD1 1 
ATOM   772   C  CD2 . LEU A  1 99  ? 7.420   -46.513 85.466  1.00 42.74  ?  99   LEU A CD2 1 
ATOM   773   N  N   . ASN A  1 100 ? 5.797   -45.126 90.209  1.00 42.73  ?  100  ASN A N   1 
ATOM   774   C  CA  . ASN A  1 100 ? 4.832   -45.452 91.243  1.00 50.72  ?  100  ASN A CA  1 
ATOM   775   C  C   . ASN A  1 100 ? 3.457   -45.580 90.606  1.00 50.47  ?  100  ASN A C   1 
ATOM   776   O  O   . ASN A  1 100 ? 3.085   -44.768 89.749  1.00 52.02  ?  100  ASN A O   1 
ATOM   777   C  CB  . ASN A  1 100 ? 4.802   -44.357 92.326  1.00 51.49  ?  100  ASN A CB  1 
ATOM   778   C  CG  . ASN A  1 100 ? 6.195   -43.950 92.803  1.00 50.80  ?  100  ASN A CG  1 
ATOM   779   O  OD1 . ASN A  1 100 ? 7.000   -44.789 93.216  1.00 52.79  ?  100  ASN A OD1 1 
ATOM   780   N  ND2 . ASN A  1 100 ? 6.490   -42.656 92.723  1.00 47.27  ?  100  ASN A ND2 1 
ATOM   781   N  N   . VAL A  1 101 ? 2.700   -46.590 91.033  1.00 49.21  ?  101  VAL A N   1 
ATOM   782   C  CA  . VAL A  1 101 ? 1.369   -46.872 90.507  1.00 49.36  ?  101  VAL A CA  1 
ATOM   783   C  C   . VAL A  1 101 ? 0.390   -46.943 91.672  1.00 53.15  ?  101  VAL A C   1 
ATOM   784   O  O   . VAL A  1 101 ? 0.683   -47.565 92.699  1.00 56.32  ?  101  VAL A O   1 
ATOM   785   C  CB  . VAL A  1 101 ? 1.336   -48.188 89.703  1.00 46.43  ?  101  VAL A CB  1 
ATOM   786   C  CG1 . VAL A  1 101 ? -0.033  -48.391 89.089  1.00 45.61  ?  101  VAL A CG1 1 
ATOM   787   C  CG2 . VAL A  1 101 ? 2.415   -48.199 88.631  1.00 44.14  ?  101  VAL A CG2 1 
ATOM   788   N  N   . TRP A  1 102 ? -0.768  -46.311 91.510  1.00 51.96  ?  102  TRP A N   1 
ATOM   789   C  CA  . TRP A  1 102 ? -1.858  -46.360 92.472  1.00 51.62  ?  102  TRP A CA  1 
ATOM   790   C  C   . TRP A  1 102 ? -3.098  -46.896 91.772  1.00 52.71  ?  102  TRP A C   1 
ATOM   791   O  O   . TRP A  1 102 ? -3.514  -46.352 90.744  1.00 54.67  ?  102  TRP A O   1 
ATOM   792   C  CB  . TRP A  1 102 ? -2.151  -44.974 93.053  1.00 50.92  ?  102  TRP A CB  1 
ATOM   793   C  CG  . TRP A  1 102 ? -1.238  -44.530 94.156  1.00 52.19  ?  102  TRP A CG  1 
ATOM   794   C  CD1 . TRP A  1 102 ? -1.360  -44.812 95.490  1.00 53.90  ?  102  TRP A CD1 1 
ATOM   795   C  CD2 . TRP A  1 102 ? -0.077  -43.703 94.028  1.00 52.06  ?  102  TRP A CD2 1 
ATOM   796   N  NE1 . TRP A  1 102 ? -0.341  -44.216 96.197  1.00 53.12  ?  102  TRP A NE1 1 
ATOM   797   C  CE2 . TRP A  1 102 ? 0.460   -43.532 95.322  1.00 52.54  ?  102  TRP A CE2 1 
ATOM   798   C  CE3 . TRP A  1 102 ? 0.564   -43.094 92.945  1.00 52.24  ?  102  TRP A CE3 1 
ATOM   799   C  CZ2 . TRP A  1 102 ? 1.607   -42.782 95.559  1.00 53.65  ?  102  TRP A CZ2 1 
ATOM   800   C  CZ3 . TRP A  1 102 ? 1.702   -42.347 93.183  1.00 52.82  ?  102  TRP A CZ3 1 
ATOM   801   C  CH2 . TRP A  1 102 ? 2.212   -42.198 94.479  1.00 53.86  ?  102  TRP A CH2 1 
ATOM   802   N  N   . THR A  1 103 ? -3.677  -47.958 92.316  1.00 51.77  ?  103  THR A N   1 
ATOM   803   C  CA  . THR A  1 103 ? -4.905  -48.542 91.802  1.00 52.34  ?  103  THR A CA  1 
ATOM   804   C  C   . THR A  1 103 ? -5.860  -48.759 92.962  1.00 53.70  ?  103  THR A C   1 
ATOM   805   O  O   . THR A  1 103 ? -5.440  -48.764 94.121  1.00 55.77  ?  103  THR A O   1 
ATOM   806   C  CB  . THR A  1 103 ? -4.653  -49.884 91.100  1.00 53.74  ?  103  THR A CB  1 
ATOM   807   O  OG1 . THR A  1 103 ? -4.669  -50.932 92.076  1.00 56.14  ?  103  THR A OG1 1 
ATOM   808   C  CG2 . THR A  1 103 ? -3.310  -49.882 90.395  1.00 52.55  ?  103  THR A CG2 1 
ATOM   809   N  N   . PRO A  1 104 ? -7.150  -48.935 92.689  1.00 53.93  ?  104  PRO A N   1 
ATOM   810   C  CA  . PRO A  1 104 ? -8.087  -49.270 93.768  1.00 56.30  ?  104  PRO A CA  1 
ATOM   811   C  C   . PRO A  1 104 ? -7.776  -50.627 94.387  1.00 58.52  ?  104  PRO A C   1 
ATOM   812   O  O   . PRO A  1 104 ? -7.050  -51.450 93.822  1.00 58.39  ?  104  PRO A O   1 
ATOM   813   C  CB  . PRO A  1 104 ? -9.449  -49.281 93.067  1.00 56.18  ?  104  PRO A CB  1 
ATOM   814   C  CG  . PRO A  1 104 ? -9.270  -48.382 91.895  1.00 53.78  ?  104  PRO A CG  1 
ATOM   815   C  CD  . PRO A  1 104 ? -7.849  -48.558 91.450  1.00 53.02  ?  104  PRO A CD  1 
ATOM   816   N  N   . TYR A  1 105 ? -8.321  -50.836 95.590  1.00 59.25  ?  105  TYR A N   1 
ATOM   817   C  CA  . TYR A  1 105 ? -8.232  -52.127 96.287  1.00 57.77  ?  105  TYR A CA  1 
ATOM   818   C  C   . TYR A  1 105 ? -9.611  -52.766 96.505  1.00 57.30  ?  105  TYR A C   1 
ATOM   819   O  O   . TYR A  1 105 ? -10.456 -52.204 97.198  1.00 59.50  ?  105  TYR A O   1 
ATOM   820   C  CB  . TYR A  1 105 ? -7.525  -51.979 97.631  1.00 57.64  ?  105  TYR A CB  1 
ATOM   821   C  CG  . TYR A  1 105 ? -7.125  -53.305 98.248  1.00 58.10  ?  105  TYR A CG  1 
ATOM   822   C  CD1 . TYR A  1 105 ? -8.005  -54.013 99.059  1.00 58.37  ?  105  TYR A CD1 1 
ATOM   823   C  CD2 . TYR A  1 105 ? -5.863  -53.840 98.032  1.00 56.80  ?  105  TYR A CD2 1 
ATOM   824   C  CE1 . TYR A  1 105 ? -7.644  -55.223 99.621  1.00 59.34  ?  105  TYR A CE1 1 
ATOM   825   C  CE2 . TYR A  1 105 ? -5.493  -55.044 98.597  1.00 56.73  ?  105  TYR A CE2 1 
ATOM   826   C  CZ  . TYR A  1 105 ? -6.388  -55.731 99.388  1.00 58.51  ?  105  TYR A CZ  1 
ATOM   827   O  OH  . TYR A  1 105 ? -6.015  -56.930 99.946  1.00 59.60  ?  105  TYR A OH  1 
ATOM   828   N  N   . PRO A  1 106 ? -9.841  -53.955 95.920  1.00 57.95  ?  106  PRO A N   1 
ATOM   829   C  CA  . PRO A  1 106 ? -8.842  -54.689 95.147  1.00 61.79  ?  106  PRO A CA  1 
ATOM   830   C  C   . PRO A  1 106 ? -8.589  -54.078 93.777  1.00 60.91  ?  106  PRO A C   1 
ATOM   831   O  O   . PRO A  1 106 ? -9.242  -53.103 93.393  1.00 62.50  ?  106  PRO A O   1 
ATOM   832   C  CB  . PRO A  1 106 ? -9.470  -56.072 95.011  1.00 58.60  ?  106  PRO A CB  1 
ATOM   833   C  CG  . PRO A  1 106 ? -10.924 -55.793 94.962  1.00 59.87  ?  106  PRO A CG  1 
ATOM   834   C  CD  . PRO A  1 106 ? -11.135 -54.660 95.937  1.00 59.82  ?  106  PRO A CD  1 
ATOM   835   N  N   . ARG A  1 107 ? -7.632  -54.662 93.069  1.00 58.75  ?  107  ARG A N   1 
ATOM   836   C  CA  . ARG A  1 107 ? -7.248  -54.179 91.756  1.00 56.63  ?  107  ARG A CA  1 
ATOM   837   C  C   . ARG A  1 107 ? -8.484  -54.131 90.855  1.00 56.49  ?  107  ARG A C   1 
ATOM   838   O  O   . ARG A  1 107 ? -9.338  -55.022 90.934  1.00 56.07  ?  107  ARG A O   1 
ATOM   839   C  CB  . ARG A  1 107 ? -6.175  -55.106 91.189  1.00 59.03  ?  107  ARG A CB  1 
ATOM   840   C  CG  . ARG A  1 107 ? -5.277  -54.502 90.142  1.00 60.24  ?  107  ARG A CG  1 
ATOM   841   C  CD  . ARG A  1 107 ? -3.804  -54.771 90.417  1.00 58.93  ?  107  ARG A CD  1 
ATOM   842   N  NE  . ARG A  1 107 ? -3.571  -56.081 91.006  1.00 57.91  ?  107  ARG A NE  1 
ATOM   843   C  CZ  . ARG A  1 107 ? -3.095  -57.113 90.327  1.00 55.95  ?  107  ARG A CZ  1 
ATOM   844   N  NH1 . ARG A  1 107 ? -2.855  -56.992 89.034  1.00 54.86  ?  107  ARG A NH1 1 
ATOM   845   N  NH2 . ARG A  1 107 ? -2.907  -58.272 90.920  1.00 56.06  ?  107  ARG A NH2 1 
ATOM   846   N  N   . PRO A  1 108 ? -8.636  -53.096 90.019  1.00 55.24  ?  108  PRO A N   1 
ATOM   847   C  CA  . PRO A  1 108 ? -9.892  -52.933 89.271  1.00 57.12  ?  108  PRO A CA  1 
ATOM   848   C  C   . PRO A  1 108 ? -10.143 -54.084 88.308  1.00 60.72  ?  108  PRO A C   1 
ATOM   849   O  O   . PRO A  1 108 ? -9.221  -54.622 87.689  1.00 61.38  ?  108  PRO A O   1 
ATOM   850   C  CB  . PRO A  1 108 ? -9.695  -51.603 88.531  1.00 55.50  ?  108  PRO A CB  1 
ATOM   851   C  CG  . PRO A  1 108 ? -8.221  -51.401 88.490  1.00 52.02  ?  108  PRO A CG  1 
ATOM   852   C  CD  . PRO A  1 108 ? -7.715  -51.971 89.779  1.00 52.84  ?  108  PRO A CD  1 
ATOM   853   N  N   . ALA A  1 109 ? -11.419 -54.461 88.184  1.00 63.05  ?  109  ALA A N   1 
ATOM   854   C  CA  . ALA A  1 109 ? -11.751 -55.647 87.399  1.00 64.12  ?  109  ALA A CA  1 
ATOM   855   C  C   . ALA A  1 109 ? -11.653 -55.369 85.907  1.00 63.42  ?  109  ALA A C   1 
ATOM   856   O  O   . ALA A  1 109 ? -11.182 -56.218 85.143  1.00 64.17  ?  109  ALA A O   1 
ATOM   857   C  CB  . ALA A  1 109 ? -13.146 -56.151 87.763  1.00 67.04  ?  109  ALA A CB  1 
ATOM   858   N  N   . SER A  1 110 ? -12.067 -54.168 85.475  1.00 62.50  ?  110  SER A N   1 
ATOM   859   C  CA  . SER A  1 110 ? -12.074 -53.768 84.075  1.00 61.23  ?  110  SER A CA  1 
ATOM   860   C  C   . SER A  1 110 ? -11.032 -52.687 83.834  1.00 60.20  ?  110  SER A C   1 
ATOM   861   O  O   . SER A  1 110 ? -10.698 -51.927 84.750  1.00 59.04  ?  110  SER A O   1 
ATOM   862   C  CB  . SER A  1 110 ? -13.447 -53.239 83.641  1.00 61.48  ?  110  SER A CB  1 
ATOM   863   O  OG  . SER A  1 110 ? -13.955 -52.288 84.555  1.00 63.79  ?  110  SER A OG  1 
ATOM   864   N  N   . PRO A  1 111 ? -10.492 -52.595 82.618  1.00 59.94  ?  111  PRO A N   1 
ATOM   865   C  CA  . PRO A  1 111 ? -9.422  -51.620 82.365  1.00 59.77  ?  111  PRO A CA  1 
ATOM   866   C  C   . PRO A  1 111 ? -9.895  -50.194 82.619  1.00 62.36  ?  111  PRO A C   1 
ATOM   867   O  O   . PRO A  1 111 ? -10.904 -49.744 82.071  1.00 66.65  ?  111  PRO A O   1 
ATOM   868   C  CB  . PRO A  1 111 ? -9.066  -51.858 80.891  1.00 58.09  ?  111  PRO A CB  1 
ATOM   869   C  CG  . PRO A  1 111 ? -10.205 -52.651 80.328  1.00 59.09  ?  111  PRO A CG  1 
ATOM   870   C  CD  . PRO A  1 111 ? -10.729 -53.465 81.455  1.00 59.53  ?  111  PRO A CD  1 
ATOM   871   N  N   . THR A  1 112 ? -9.136  -49.480 83.469  1.00 60.06  ?  112  THR A N   1 
ATOM   872   C  CA  . THR A  1 112 ? -9.384  -48.158 84.034  1.00 58.69  ?  112  THR A CA  1 
ATOM   873   C  C   . THR A  1 112 ? -8.536  -47.106 83.338  1.00 55.62  ?  112  THR A C   1 
ATOM   874   O  O   . THR A  1 112 ? -7.328  -47.318 83.164  1.00 54.21  ?  112  THR A O   1 
ATOM   875   C  CB  . THR A  1 112 ? -9.076  -48.163 85.530  1.00 60.43  ?  112  THR A CB  1 
ATOM   876   O  OG1 . THR A  1 112 ? -10.030 -48.985 86.217  1.00 63.19  ?  112  THR A OG1 1 
ATOM   877   C  CG2 . THR A  1 112 ? -9.122  -46.753 86.095  1.00 61.07  ?  112  THR A CG2 1 
ATOM   878   N  N   . PRO A  1 113 ? -9.119  -45.984 82.913  1.00 54.35  ?  113  PRO A N   1 
ATOM   879   C  CA  . PRO A  1 113 ? -8.310  -44.917 82.311  1.00 50.26  ?  113  PRO A CA  1 
ATOM   880   C  C   . PRO A  1 113 ? -7.184  -44.476 83.237  1.00 49.49  ?  113  PRO A C   1 
ATOM   881   O  O   . PRO A  1 113 ? -7.389  -44.248 84.432  1.00 48.17  ?  113  PRO A O   1 
ATOM   882   C  CB  . PRO A  1 113 ? -9.325  -43.792 82.079  1.00 49.73  ?  113  PRO A CB  1 
ATOM   883   C  CG  . PRO A  1 113 ? -10.636 -44.486 81.977  1.00 57.36  ?  113  PRO A CG  1 
ATOM   884   C  CD  . PRO A  1 113 ? -10.553 -45.649 82.922  1.00 56.95  ?  113  PRO A CD  1 
ATOM   885   N  N   . VAL A  1 114 ? -5.985  -44.355 82.660  1.00 51.62  ?  114  VAL A N   1 
ATOM   886   C  CA  . VAL A  1 114 ? -4.747  -44.108 83.396  1.00 51.81  ?  114  VAL A CA  1 
ATOM   887   C  C   . VAL A  1 114 ? -4.394  -42.627 83.336  1.00 52.23  ?  114  VAL A C   1 
ATOM   888   O  O   . VAL A  1 114 ? -4.479  -42.000 82.271  1.00 52.92  ?  114  VAL A O   1 
ATOM   889   C  CB  . VAL A  1 114 ? -3.603  -44.969 82.828  1.00 45.14  ?  114  VAL A CB  1 
ATOM   890   C  CG1 . VAL A  1 114 ? -2.272  -44.578 83.447  1.00 44.10  ?  114  VAL A CG1 1 
ATOM   891   C  CG2 . VAL A  1 114 ? -3.888  -46.444 83.043  1.00 45.93  ?  114  VAL A CG2 1 
ATOM   892   N  N   . LEU A  1 115 ? -3.998  -42.064 84.481  1.00 52.38  ?  115  LEU A N   1 
ATOM   893   C  CA  . LEU A  1 115 ? -3.461  -40.709 84.559  1.00 54.33  ?  115  LEU A CA  1 
ATOM   894   C  C   . LEU A  1 115 ? -1.977  -40.791 84.884  1.00 49.67  ?  115  LEU A C   1 
ATOM   895   O  O   . LEU A  1 115 ? -1.597  -41.391 85.894  1.00 50.20  ?  115  LEU A O   1 
ATOM   896   C  CB  . LEU A  1 115 ? -4.184  -39.876 85.615  1.00 60.62  ?  115  LEU A CB  1 
ATOM   897   C  CG  . LEU A  1 115 ? -5.568  -39.359 85.239  1.00 63.80  ?  115  LEU A CG  1 
ATOM   898   C  CD1 . LEU A  1 115 ? -6.648  -40.360 85.619  1.00 68.59  ?  115  LEU A CD1 1 
ATOM   899   C  CD2 . LEU A  1 115 ? -5.814  -38.022 85.884  1.00 44.95  ?  115  LEU A CD2 1 
ATOM   900   N  N   . ILE A  1 116 ? -1.144  -40.191 84.038  1.00 44.77  ?  116  ILE A N   1 
ATOM   901   C  CA  . ILE A  1 116 ? 0.299   -40.143 84.250  1.00 43.22  ?  116  ILE A CA  1 
ATOM   902   C  C   . ILE A  1 116 ? 0.664   -38.728 84.670  1.00 43.28  ?  116  ILE A C   1 
ATOM   903   O  O   . ILE A  1 116 ? 0.472   -37.778 83.902  1.00 45.68  ?  116  ILE A O   1 
ATOM   904   C  CB  . ILE A  1 116 ? 1.082   -40.561 82.995  1.00 43.90  ?  116  ILE A CB  1 
ATOM   905   C  CG1 . ILE A  1 116 ? 0.691   -41.967 82.546  1.00 46.77  ?  116  ILE A CG1 1 
ATOM   906   C  CG2 . ILE A  1 116 ? 2.575   -40.514 83.256  1.00 40.89  ?  116  ILE A CG2 1 
ATOM   907   C  CD1 . ILE A  1 116 ? 1.536   -42.477 81.409  1.00 44.17  ?  116  ILE A CD1 1 
ATOM   908   N  N   . TRP A  1 117 ? 1.200   -38.590 85.878  1.00 43.04  ?  117  TRP A N   1 
ATOM   909   C  CA  . TRP A  1 117 ? 1.582   -37.301 86.440  1.00 43.85  ?  117  TRP A CA  1 
ATOM   910   C  C   . TRP A  1 117 ? 3.062   -37.041 86.204  1.00 44.96  ?  117  TRP A C   1 
ATOM   911   O  O   . TRP A  1 117 ? 3.903   -37.871 86.559  1.00 45.85  ?  117  TRP A O   1 
ATOM   912   C  CB  . TRP A  1 117 ? 1.288   -37.255 87.939  1.00 45.30  ?  117  TRP A CB  1 
ATOM   913   C  CG  . TRP A  1 117 ? 1.927   -36.091 88.616  1.00 47.06  ?  117  TRP A CG  1 
ATOM   914   C  CD1 . TRP A  1 117 ? 3.049   -36.105 89.397  1.00 47.35  ?  117  TRP A CD1 1 
ATOM   915   C  CD2 . TRP A  1 117 ? 1.494   -34.727 88.559  1.00 48.62  ?  117  TRP A CD2 1 
ATOM   916   N  NE1 . TRP A  1 117 ? 3.336   -34.832 89.835  1.00 48.61  ?  117  TRP A NE1 1 
ATOM   917   C  CE2 . TRP A  1 117 ? 2.395   -33.968 89.333  1.00 49.45  ?  117  TRP A CE2 1 
ATOM   918   C  CE3 . TRP A  1 117 ? 0.433   -34.074 87.927  1.00 48.05  ?  117  TRP A CE3 1 
ATOM   919   C  CZ2 . TRP A  1 117 ? 2.262   -32.589 89.491  1.00 49.28  ?  117  TRP A CZ2 1 
ATOM   920   C  CZ3 . TRP A  1 117 ? 0.302   -32.709 88.090  1.00 48.05  ?  117  TRP A CZ3 1 
ATOM   921   C  CH2 . TRP A  1 117 ? 1.210   -31.982 88.865  1.00 48.43  ?  117  TRP A CH2 1 
ATOM   922   N  N   . ILE A  1 118 ? 3.379   -35.883 85.627  1.00 45.99  ?  118  ILE A N   1 
ATOM   923   C  CA  . ILE A  1 118 ? 4.762   -35.448 85.442  1.00 45.99  ?  118  ILE A CA  1 
ATOM   924   C  C   . ILE A  1 118 ? 4.971   -34.212 86.307  1.00 47.18  ?  118  ILE A C   1 
ATOM   925   O  O   . ILE A  1 118 ? 4.353   -33.166 86.070  1.00 48.38  ?  118  ILE A O   1 
ATOM   926   C  CB  . ILE A  1 118 ? 5.086   -35.161 83.970  1.00 44.34  ?  118  ILE A CB  1 
ATOM   927   C  CG1 . ILE A  1 118 ? 4.832   -36.401 83.110  1.00 43.57  ?  118  ILE A CG1 1 
ATOM   928   C  CG2 . ILE A  1 118 ? 6.528   -34.715 83.827  1.00 43.64  ?  118  ILE A CG2 1 
ATOM   929   C  CD1 . ILE A  1 118 ? 5.079   -36.173 81.629  1.00 42.66  ?  118  ILE A CD1 1 
ATOM   930   N  N   . TYR A  1 119 ? 5.844   -34.324 87.306  1.00 47.02  ?  119  TYR A N   1 
ATOM   931   C  CA  . TYR A  1 119 ? 6.007   -33.244 88.267  1.00 47.94  ?  119  TYR A CA  1 
ATOM   932   C  C   . TYR A  1 119 ? 6.780   -32.069 87.665  1.00 48.10  ?  119  TYR A C   1 
ATOM   933   O  O   . TYR A  1 119 ? 7.494   -32.198 86.667  1.00 49.70  ?  119  TYR A O   1 
ATOM   934   C  CB  . TYR A  1 119 ? 6.699   -33.745 89.540  1.00 49.17  ?  119  TYR A CB  1 
ATOM   935   C  CG  . TYR A  1 119 ? 8.049   -34.415 89.344  1.00 49.01  ?  119  TYR A CG  1 
ATOM   936   C  CD1 . TYR A  1 119 ? 9.198   -33.668 89.119  1.00 47.75  ?  119  TYR A CD1 1 
ATOM   937   C  CD2 . TYR A  1 119 ? 8.178   -35.797 89.420  1.00 49.37  ?  119  TYR A CD2 1 
ATOM   938   C  CE1 . TYR A  1 119 ? 10.430  -34.278 88.950  1.00 47.23  ?  119  TYR A CE1 1 
ATOM   939   C  CE2 . TYR A  1 119 ? 9.406   -36.417 89.256  1.00 48.37  ?  119  TYR A CE2 1 
ATOM   940   C  CZ  . TYR A  1 119 ? 10.529  -35.652 89.021  1.00 47.06  ?  119  TYR A CZ  1 
ATOM   941   O  OH  . TYR A  1 119 ? 11.754  -36.263 88.854  1.00 45.61  ?  119  TYR A OH  1 
ATOM   942   N  N   . GLY A  1 120 ? 6.621   -30.910 88.292  1.00 48.15  ?  120  GLY A N   1 
ATOM   943   C  CA  . GLY A  1 120 ? 7.271   -29.675 87.909  1.00 49.49  ?  120  GLY A CA  1 
ATOM   944   C  C   . GLY A  1 120 ? 8.504   -29.368 88.734  1.00 51.63  ?  120  GLY A C   1 
ATOM   945   O  O   . GLY A  1 120 ? 9.208   -30.268 89.204  1.00 52.96  ?  120  GLY A O   1 
ATOM   946   N  N   . GLY A  1 121 ? 8.764   -28.085 88.929  1.00 52.64  ?  121  GLY A N   1 
ATOM   947   C  CA  . GLY A  1 121 ? 10.008  -27.635 89.495  1.00 53.34  ?  121  GLY A CA  1 
ATOM   948   C  C   . GLY A  1 121 ? 11.037  -27.024 88.536  1.00 53.52  ?  121  GLY A C   1 
ATOM   949   O  O   . GLY A  1 121 ? 12.222  -26.984 88.888  1.00 53.65  ?  121  GLY A O   1 
ATOM   950   N  N   . GLY A  1 122 ? 10.636  -26.609 87.335  1.00 53.48  ?  122  GLY A N   1 
ATOM   951   C  CA  . GLY A  1 122 ? 11.540  -25.870 86.467  1.00 54.04  ?  122  GLY A CA  1 
ATOM   952   C  C   . GLY A  1 122 ? 12.672  -26.690 85.889  1.00 54.17  ?  122  GLY A C   1 
ATOM   953   O  O   . GLY A  1 122 ? 13.730  -26.139 85.552  1.00 56.47  ?  122  GLY A O   1 
ATOM   954   N  N   . PHE A  1 123 ? 12.480  -28.001 85.784  1.00 50.65  ?  123  PHE A N   1 
ATOM   955   C  CA  . PHE A  1 123 ? 13.458  -28.975 85.315  1.00 49.85  ?  123  PHE A CA  1 
ATOM   956   C  C   . PHE A  1 123 ? 14.735  -28.983 86.144  1.00 52.77  ?  123  PHE A C   1 
ATOM   957   O  O   . PHE A  1 123 ? 15.727  -29.581 85.720  1.00 55.15  ?  123  PHE A O   1 
ATOM   958   C  CB  . PHE A  1 123 ? 13.846  -28.734 83.843  1.00 48.32  ?  123  PHE A CB  1 
ATOM   959   C  CG  . PHE A  1 123 ? 12.695  -28.790 82.870  1.00 46.02  ?  123  PHE A CG  1 
ATOM   960   C  CD1 . PHE A  1 123 ? 12.188  -30.008 82.442  1.00 44.94  ?  123  PHE A CD1 1 
ATOM   961   C  CD2 . PHE A  1 123 ? 12.149  -27.625 82.351  1.00 45.27  ?  123  PHE A CD2 1 
ATOM   962   C  CE1 . PHE A  1 123 ? 11.142  -30.063 81.531  1.00 44.50  ?  123  PHE A CE1 1 
ATOM   963   C  CE2 . PHE A  1 123 ? 11.099  -27.674 81.441  1.00 45.15  ?  123  PHE A CE2 1 
ATOM   964   C  CZ  . PHE A  1 123 ? 10.596  -28.895 81.032  1.00 44.52  ?  123  PHE A CZ  1 
ATOM   965   N  N   . TYR A  1 124 ? 14.758  -28.333 87.307  1.00 54.24  ?  124  TYR A N   1 
ATOM   966   C  CA  . TYR A  1 124 ? 15.875  -28.474 88.232  1.00 54.89  ?  124  TYR A CA  1 
ATOM   967   C  C   . TYR A  1 124 ? 15.544  -29.256 89.498  1.00 58.51  ?  124  TYR A C   1 
ATOM   968   O  O   . TYR A  1 124 ? 16.441  -29.457 90.324  1.00 62.74  ?  124  TYR A O   1 
ATOM   969   C  CB  . TYR A  1 124 ? 16.463  -27.101 88.596  1.00 51.19  ?  124  TYR A CB  1 
ATOM   970   C  CG  . TYR A  1 124 ? 15.668  -26.288 89.584  1.00 49.62  ?  124  TYR A CG  1 
ATOM   971   C  CD1 . TYR A  1 124 ? 15.886  -26.414 90.945  1.00 50.73  ?  124  TYR A CD1 1 
ATOM   972   C  CD2 . TYR A  1 124 ? 14.711  -25.380 89.153  1.00 49.48  ?  124  TYR A CD2 1 
ATOM   973   C  CE1 . TYR A  1 124 ? 15.163  -25.671 91.853  1.00 52.67  ?  124  TYR A CE1 1 
ATOM   974   C  CE2 . TYR A  1 124 ? 13.983  -24.627 90.055  1.00 50.60  ?  124  TYR A CE2 1 
ATOM   975   C  CZ  . TYR A  1 124 ? 14.216  -24.781 91.404  1.00 53.75  ?  124  TYR A CZ  1 
ATOM   976   O  OH  . TYR A  1 124 ? 13.506  -24.051 92.325  1.00 58.48  ?  124  TYR A OH  1 
ATOM   977   N  N   . SER A  1 125 ? 14.299  -29.689 89.691  1.00 56.40  ?  125  SER A N   1 
ATOM   978   C  CA  . SER A  1 125 ? 13.895  -30.219 90.989  1.00 54.94  ?  125  SER A CA  1 
ATOM   979   C  C   . SER A  1 125 ? 12.599  -31.010 90.847  1.00 53.78  ?  125  SER A C   1 
ATOM   980   O  O   . SER A  1 125 ? 12.013  -31.095 89.766  1.00 56.20  ?  125  SER A O   1 
ATOM   981   C  CB  . SER A  1 125 ? 13.736  -29.085 92.000  1.00 56.04  ?  125  SER A CB  1 
ATOM   982   O  OG  . SER A  1 125 ? 12.695  -28.213 91.597  1.00 55.96  ?  125  SER A OG  1 
ATOM   983   N  N   . GLY A  1 126 ? 12.142  -31.565 91.962  1.00 51.13  ?  126  GLY A N   1 
ATOM   984   C  CA  . GLY A  1 126 ? 10.904  -32.310 92.035  1.00 48.42  ?  126  GLY A CA  1 
ATOM   985   C  C   . GLY A  1 126 ? 11.135  -33.805 92.235  1.00 47.66  ?  126  GLY A C   1 
ATOM   986   O  O   . GLY A  1 126 ? 12.227  -34.341 92.016  1.00 46.78  ?  126  GLY A O   1 
ATOM   987   N  N   . ALA A  1 127 ? 10.082  -34.475 92.700  1.00 47.27  ?  127  ALA A N   1 
ATOM   988   C  CA  . ALA A  1 127 ? 10.058  -35.927 92.797  1.00 46.43  ?  127  ALA A CA  1 
ATOM   989   C  C   . ALA A  1 127 ? 8.607   -36.381 92.843  1.00 46.28  ?  127  ALA A C   1 
ATOM   990   O  O   . ALA A  1 127 ? 7.714   -35.619 93.223  1.00 45.07  ?  127  ALA A O   1 
ATOM   991   C  CB  . ALA A  1 127 ? 10.819  -36.421 94.030  1.00 47.05  ?  127  ALA A CB  1 
ATOM   992   N  N   . ALA A  1 128 ? 8.378   -37.642 92.468  1.00 47.44  ?  128  ALA A N   1 
ATOM   993   C  CA  . ALA A  1 128 ? 7.032   -38.200 92.550  1.00 48.57  ?  128  ALA A CA  1 
ATOM   994   C  C   . ALA A  1 128 ? 6.657   -38.627 93.964  1.00 53.01  ?  128  ALA A C   1 
ATOM   995   O  O   . ALA A  1 128 ? 5.482   -38.927 94.216  1.00 55.55  ?  128  ALA A O   1 
ATOM   996   C  CB  . ALA A  1 128 ? 6.883   -39.389 91.599  1.00 45.17  ?  128  ALA A CB  1 
ATOM   997   N  N   . SER A  1 129 ? 7.613   -38.653 94.889  1.00 52.58  ?  129  SER A N   1 
ATOM   998   C  CA  . SER A  1 129 ? 7.347   -39.065 96.259  1.00 52.46  ?  129  SER A CA  1 
ATOM   999   C  C   . SER A  1 129 ? 6.815   -37.934 97.133  1.00 52.81  ?  129  SER A C   1 
ATOM   1000  O  O   . SER A  1 129 ? 6.513   -38.176 98.308  1.00 54.87  ?  129  SER A O   1 
ATOM   1001  C  CB  . SER A  1 129 ? 8.622   -39.649 96.872  1.00 52.20  ?  129  SER A CB  1 
ATOM   1002  O  OG  . SER A  1 129 ? 9.764   -38.929 96.438  1.00 51.25  ?  129  SER A OG  1 
ATOM   1003  N  N   . LEU A  1 130 ? 6.687   -36.719 96.597  1.00 49.82  ?  130  LEU A N   1 
ATOM   1004  C  CA  . LEU A  1 130 ? 6.190   -35.598 97.385  1.00 47.78  ?  130  LEU A CA  1 
ATOM   1005  C  C   . LEU A  1 130 ? 4.740   -35.829 97.802  1.00 49.35  ?  130  LEU A C   1 
ATOM   1006  O  O   . LEU A  1 130 ? 3.963   -36.484 97.101  1.00 48.86  ?  130  LEU A O   1 
ATOM   1007  C  CB  . LEU A  1 130 ? 6.298   -34.293 96.595  1.00 44.55  ?  130  LEU A CB  1 
ATOM   1008  C  CG  . LEU A  1 130 ? 7.702   -33.840 96.203  1.00 44.00  ?  130  LEU A CG  1 
ATOM   1009  C  CD1 . LEU A  1 130 ? 7.660   -32.426 95.652  1.00 43.75  ?  130  LEU A CD1 1 
ATOM   1010  C  CD2 . LEU A  1 130 ? 8.652   -33.938 97.379  1.00 45.02  ?  130  LEU A CD2 1 
ATOM   1011  N  N   . ASP A  1 131 ? 4.375   -35.263 98.957  1.00 51.56  ?  131  ASP A N   1 
ATOM   1012  C  CA  . ASP A  1 131 ? 3.059   -35.530 99.529  1.00 53.06  ?  131  ASP A CA  1 
ATOM   1013  C  C   . ASP A  1 131 ? 1.936   -34.935 98.689  1.00 53.98  ?  131  ASP A C   1 
ATOM   1014  O  O   . ASP A  1 131 ? 0.824   -35.472 98.682  1.00 55.00  ?  131  ASP A O   1 
ATOM   1015  C  CB  . ASP A  1 131 ? 2.990   -34.993 100.954 1.00 54.93  ?  131  ASP A CB  1 
ATOM   1016  C  CG  . ASP A  1 131 ? 3.841   -35.791 101.914 1.00 55.76  ?  131  ASP A CG  1 
ATOM   1017  O  OD1 . ASP A  1 131 ? 4.637   -36.623 101.432 1.00 54.61  ?  131  ASP A OD1 1 
ATOM   1018  O  OD2 . ASP A  1 131 ? 3.720   -35.578 103.144 1.00 57.26  ?  131  ASP A OD2 1 
ATOM   1019  N  N   . VAL A  1 132 ? 2.199   -33.832 97.983  1.00 54.01  ?  132  VAL A N   1 
ATOM   1020  C  CA  . VAL A  1 132 ? 1.173   -33.212 97.153  1.00 52.58  ?  132  VAL A CA  1 
ATOM   1021  C  C   . VAL A  1 132 ? 0.791   -34.082 95.960  1.00 54.19  ?  132  VAL A C   1 
ATOM   1022  O  O   . VAL A  1 132 ? -0.302  -33.918 95.405  1.00 53.72  ?  132  VAL A O   1 
ATOM   1023  C  CB  . VAL A  1 132 ? 1.644   -31.822 96.695  1.00 49.53  ?  132  VAL A CB  1 
ATOM   1024  C  CG1 . VAL A  1 132 ? 1.612   -30.854 97.848  1.00 53.25  ?  132  VAL A CG1 1 
ATOM   1025  C  CG2 . VAL A  1 132 ? 3.057   -31.914 96.168  1.00 44.79  ?  132  VAL A CG2 1 
ATOM   1026  N  N   . TYR A  1 133 ? 1.667   -34.996 95.544  1.00 55.10  ?  133  TYR A N   1 
ATOM   1027  C  CA  . TYR A  1 133 ? 1.446   -35.847 94.380  1.00 52.91  ?  133  TYR A CA  1 
ATOM   1028  C  C   . TYR A  1 133 ? 0.889   -37.220 94.743  1.00 52.91  ?  133  TYR A C   1 
ATOM   1029  O  O   . TYR A  1 133 ? 0.828   -38.097 93.877  1.00 53.96  ?  133  TYR A O   1 
ATOM   1030  C  CB  . TYR A  1 133 ? 2.747   -35.999 93.588  1.00 50.45  ?  133  TYR A CB  1 
ATOM   1031  C  CG  . TYR A  1 133 ? 3.408   -34.684 93.230  1.00 47.05  ?  133  TYR A CG  1 
ATOM   1032  C  CD1 . TYR A  1 133 ? 2.655   -33.544 92.975  1.00 44.85  ?  133  TYR A CD1 1 
ATOM   1033  C  CD2 . TYR A  1 133 ? 4.790   -34.587 93.139  1.00 45.75  ?  133  TYR A CD2 1 
ATOM   1034  C  CE1 . TYR A  1 133 ? 3.264   -32.344 92.652  1.00 43.24  ?  133  TYR A CE1 1 
ATOM   1035  C  CE2 . TYR A  1 133 ? 5.405   -33.394 92.811  1.00 44.30  ?  133  TYR A CE2 1 
ATOM   1036  C  CZ  . TYR A  1 133 ? 4.640   -32.276 92.568  1.00 43.23  ?  133  TYR A CZ  1 
ATOM   1037  O  OH  . TYR A  1 133 ? 5.263   -31.090 92.244  1.00 44.01  ?  133  TYR A OH  1 
ATOM   1038  N  N   . ASP A  1 134 ? 0.532   -37.438 96.009  1.00 53.83  ?  134  ASP A N   1 
ATOM   1039  C  CA  . ASP A  1 134 ? 0.026   -38.734 96.451  1.00 55.58  ?  134  ASP A CA  1 
ATOM   1040  C  C   . ASP A  1 134 ? -1.271  -39.082 95.730  1.00 53.05  ?  134  ASP A C   1 
ATOM   1041  O  O   . ASP A  1 134 ? -2.251  -38.335 95.802  1.00 52.39  ?  134  ASP A O   1 
ATOM   1042  C  CB  . ASP A  1 134 ? -0.192  -38.701 97.966  1.00 61.78  ?  134  ASP A CB  1 
ATOM   1043  C  CG  . ASP A  1 134 ? -0.412  -40.076 98.559  1.00 68.20  ?  134  ASP A CG  1 
ATOM   1044  O  OD1 . ASP A  1 134 ? -0.560  -41.048 97.791  1.00 71.70  ?  134  ASP A OD1 1 
ATOM   1045  O  OD2 . ASP A  1 134 ? -0.427  -40.189 99.803  1.00 70.18  ?  134  ASP A OD2 1 
ATOM   1046  N  N   . GLY A  1 135 ? -1.281  -40.230 95.057  1.00 52.25  ?  135  GLY A N   1 
ATOM   1047  C  CA  . GLY A  1 135 ? -2.401  -40.606 94.222  1.00 53.26  ?  135  GLY A CA  1 
ATOM   1048  C  C   . GLY A  1 135 ? -3.430  -41.496 94.877  1.00 55.19  ?  135  GLY A C   1 
ATOM   1049  O  O   . GLY A  1 135 ? -4.359  -41.964 94.204  1.00 56.51  ?  135  GLY A O   1 
ATOM   1050  N  N   . ARG A  1 136 ? -3.289  -41.739 96.184  1.00 54.25  ?  136  ARG A N   1 
ATOM   1051  C  CA  . ARG A  1 136 ? -4.202  -42.634 96.890  1.00 53.99  ?  136  ARG A CA  1 
ATOM   1052  C  C   . ARG A  1 136 ? -5.629  -42.102 96.892  1.00 52.60  ?  136  ARG A C   1 
ATOM   1053  O  O   . ARG A  1 136 ? -6.583  -42.889 96.892  1.00 50.57  ?  136  ARG A O   1 
ATOM   1054  C  CB  . ARG A  1 136 ? -3.697  -42.861 98.319  1.00 55.35  ?  136  ARG A CB  1 
ATOM   1055  C  CG  . ARG A  1 136 ? -4.178  -41.831 99.335  1.00 55.34  ?  136  ARG A CG  1 
ATOM   1056  C  CD  . ARG A  1 136 ? -3.131  -41.578 100.395 1.00 56.04  ?  136  ARG A CD  1 
ATOM   1057  N  NE  . ARG A  1 136 ? -2.944  -42.713 101.290 1.00 58.52  ?  136  ARG A NE  1 
ATOM   1058  C  CZ  . ARG A  1 136 ? -1.821  -42.950 101.961 1.00 61.39  ?  136  ARG A CZ  1 
ATOM   1059  N  NH1 . ARG A  1 136 ? -0.772  -42.156 101.796 1.00 61.11  ?  136  ARG A NH1 1 
ATOM   1060  N  NH2 . ARG A  1 136 ? -1.735  -43.998 102.771 1.00 65.09  ?  136  ARG A NH2 1 
ATOM   1061  N  N   . PHE A  1 137 ? -5.804  -40.776 96.880  1.00 51.12  ?  137  PHE A N   1 
ATOM   1062  C  CA  . PHE A  1 137 ? -7.152  -40.222 96.956  1.00 51.81  ?  137  PHE A CA  1 
ATOM   1063  C  C   . PHE A  1 137 ? -7.860  -40.307 95.615  1.00 52.57  ?  137  PHE A C   1 
ATOM   1064  O  O   . PHE A  1 137 ? -9.052  -40.626 95.564  1.00 51.60  ?  137  PHE A O   1 
ATOM   1065  C  CB  . PHE A  1 137 ? -7.111  -38.773 97.443  1.00 51.28  ?  137  PHE A CB  1 
ATOM   1066  C  CG  . PHE A  1 137 ? -6.346  -38.579 98.721  1.00 51.95  ?  137  PHE A CG  1 
ATOM   1067  C  CD1 . PHE A  1 137 ? -6.934  -38.835 99.946  1.00 53.34  ?  137  PHE A CD1 1 
ATOM   1068  C  CD2 . PHE A  1 137 ? -5.037  -38.132 98.694  1.00 52.80  ?  137  PHE A CD2 1 
ATOM   1069  C  CE1 . PHE A  1 137 ? -6.225  -38.650 101.116 1.00 55.30  ?  137  PHE A CE1 1 
ATOM   1070  C  CE2 . PHE A  1 137 ? -4.325  -37.948 99.859  1.00 53.69  ?  137  PHE A CE2 1 
ATOM   1071  C  CZ  . PHE A  1 137 ? -4.921  -38.207 101.073 1.00 55.14  ?  137  PHE A CZ  1 
ATOM   1072  N  N   . LEU A  1 138 ? -7.150  -40.011 94.523  1.00 53.35  ?  138  LEU A N   1 
ATOM   1073  C  CA  . LEU A  1 138 ? -7.720  -40.236 93.201  1.00 52.26  ?  138  LEU A CA  1 
ATOM   1074  C  C   . LEU A  1 138 ? -8.031  -41.709 92.988  1.00 55.19  ?  138  LEU A C   1 
ATOM   1075  O  O   . LEU A  1 138 ? -9.101  -42.058 92.468  1.00 58.94  ?  138  LEU A O   1 
ATOM   1076  C  CB  . LEU A  1 138 ? -6.773  -39.716 92.120  1.00 47.48  ?  138  LEU A CB  1 
ATOM   1077  C  CG  . LEU A  1 138 ? -6.761  -38.200 91.947  1.00 47.26  ?  138  LEU A CG  1 
ATOM   1078  C  CD1 . LEU A  1 138 ? -5.482  -37.754 91.294  1.00 45.89  ?  138  LEU A CD1 1 
ATOM   1079  C  CD2 . LEU A  1 138 ? -7.950  -37.777 91.106  1.00 48.01  ?  138  LEU A CD2 1 
ATOM   1080  N  N   . ALA A  1 139 ? -7.122  -42.590 93.421  1.00 53.55  ?  139  ALA A N   1 
ATOM   1081  C  CA  . ALA A  1 139 ? -7.324  -44.023 93.236  1.00 52.83  ?  139  ALA A CA  1 
ATOM   1082  C  C   . ALA A  1 139 ? -8.540  -44.521 94.012  1.00 56.19  ?  139  ALA A C   1 
ATOM   1083  O  O   . ALA A  1 139 ? -9.362  -45.269 93.477  1.00 59.46  ?  139  ALA A O   1 
ATOM   1084  C  CB  . ALA A  1 139 ? -6.067  -44.786 93.649  1.00 48.71  ?  139  ALA A CB  1 
ATOM   1085  N  N   . GLN A  1 140 ? -8.676  -44.119 95.278  1.00 51.75  ?  140  GLN A N   1 
ATOM   1086  C  CA  . GLN A  1 140 ? -9.788  -44.621 96.082  1.00 53.53  ?  140  GLN A CA  1 
ATOM   1087  C  C   . GLN A  1 140 ? -11.107 -43.967 95.691  1.00 54.57  ?  140  GLN A C   1 
ATOM   1088  O  O   . GLN A  1 140 ? -12.114 -44.654 95.491  1.00 55.83  ?  140  GLN A O   1 
ATOM   1089  C  CB  . GLN A  1 140 ? -9.507  -44.394 97.567  1.00 54.19  ?  140  GLN A CB  1 
ATOM   1090  C  CG  . GLN A  1 140 ? -10.440 -45.134 98.518  1.00 56.12  ?  140  GLN A CG  1 
ATOM   1091  C  CD  . GLN A  1 140 ? -11.770 -44.431 98.725  1.00 63.42  ?  140  GLN A CD  1 
ATOM   1092  O  OE1 . GLN A  1 140 ? -12.832 -45.013 98.492  1.00 64.19  ?  140  GLN A OE1 1 
ATOM   1093  N  NE2 . GLN A  1 140 ? -11.720 -43.175 99.173  1.00 57.64  ?  140  GLN A NE2 1 
ATOM   1094  N  N   . VAL A  1 141 ? -11.118 -42.637 95.593  1.00 54.22  ?  141  VAL A N   1 
ATOM   1095  C  CA  . VAL A  1 141 ? -12.366 -41.907 95.389  1.00 57.95  ?  141  VAL A CA  1 
ATOM   1096  C  C   . VAL A  1 141 ? -12.859 -42.064 93.958  1.00 59.57  ?  141  VAL A C   1 
ATOM   1097  O  O   . VAL A  1 141 ? -14.017 -42.431 93.723  1.00 62.07  ?  141  VAL A O   1 
ATOM   1098  C  CB  . VAL A  1 141 ? -12.181 -40.425 95.753  1.00 57.04  ?  141  VAL A CB  1 
ATOM   1099  C  CG1 . VAL A  1 141 ? -13.441 -39.630 95.420  1.00 56.63  ?  141  VAL A CG1 1 
ATOM   1100  C  CG2 . VAL A  1 141 ? -11.818 -40.292 97.215  1.00 58.68  ?  141  VAL A CG2 1 
ATOM   1101  N  N   . GLU A  1 142 ? -12.001 -41.766 92.980  1.00 57.59  ?  142  GLU A N   1 
ATOM   1102  C  CA  . GLU A  1 142 ? -12.409 -41.781 91.582  1.00 56.47  ?  142  GLU A CA  1 
ATOM   1103  C  C   . GLU A  1 142 ? -12.036 -43.065 90.854  1.00 57.59  ?  142  GLU A C   1 
ATOM   1104  O  O   . GLU A  1 142 ? -12.289 -43.172 89.649  1.00 58.93  ?  142  GLU A O   1 
ATOM   1105  C  CB  . GLU A  1 142 ? -11.827 -40.572 90.852  1.00 54.88  ?  142  GLU A CB  1 
ATOM   1106  C  CG  . GLU A  1 142 ? -12.529 -39.275 91.205  1.00 58.48  ?  142  GLU A CG  1 
ATOM   1107  C  CD  . GLU A  1 142 ? -14.014 -39.304 90.873  1.00 64.49  ?  142  GLU A CD  1 
ATOM   1108  O  OE1 . GLU A  1 142 ? -14.401 -39.970 89.886  1.00 65.60  ?  142  GLU A OE1 1 
ATOM   1109  O  OE2 . GLU A  1 142 ? -14.797 -38.657 91.601  1.00 67.91  ?  142  GLU A OE2 1 
ATOM   1110  N  N   . GLY A  1 143 ? -11.441 -44.034 91.547  1.00 57.65  ?  143  GLY A N   1 
ATOM   1111  C  CA  . GLY A  1 143 ? -11.121 -45.312 90.945  1.00 59.05  ?  143  GLY A CA  1 
ATOM   1112  C  C   . GLY A  1 143 ? -10.028 -45.285 89.903  1.00 59.31  ?  143  GLY A C   1 
ATOM   1113  O  O   . GLY A  1 143 ? -9.866  -46.268 89.174  1.00 60.65  ?  143  GLY A O   1 
ATOM   1114  N  N   . ALA A  1 144 ? -9.266  -44.199 89.813  1.00 57.45  ?  144  ALA A N   1 
ATOM   1115  C  CA  . ALA A  1 144 ? -8.290  -44.052 88.747  1.00 55.92  ?  144  ALA A CA  1 
ATOM   1116  C  C   . ALA A  1 144 ? -7.073  -44.941 88.985  1.00 52.80  ?  144  ALA A C   1 
ATOM   1117  O  O   . ALA A  1 144 ? -6.805  -45.398 90.099  1.00 52.91  ?  144  ALA A O   1 
ATOM   1118  C  CB  . ALA A  1 144 ? -7.850  -42.593 88.616  1.00 55.69  ?  144  ALA A CB  1 
ATOM   1119  N  N   . VAL A  1 145 ? -6.351  -45.206 87.903  1.00 49.83  ?  145  VAL A N   1 
ATOM   1120  C  CA  . VAL A  1 145 ? -5.018  -45.788 87.959  1.00 46.81  ?  145  VAL A CA  1 
ATOM   1121  C  C   . VAL A  1 145 ? -4.047  -44.651 87.688  1.00 47.66  ?  145  VAL A C   1 
ATOM   1122  O  O   . VAL A  1 145 ? -4.007  -44.110 86.578  1.00 49.61  ?  145  VAL A O   1 
ATOM   1123  C  CB  . VAL A  1 145 ? -4.847  -46.929 86.950  1.00 46.67  ?  145  VAL A CB  1 
ATOM   1124  C  CG1 . VAL A  1 145 ? -3.403  -47.411 86.929  1.00 45.93  ?  145  VAL A CG1 1 
ATOM   1125  C  CG2 . VAL A  1 145 ? -5.784  -48.068 87.286  1.00 47.95  ?  145  VAL A CG2 1 
ATOM   1126  N  N   . LEU A  1 146 ? -3.281  -44.265 88.702  1.00 47.64  ?  146  LEU A N   1 
ATOM   1127  C  CA  . LEU A  1 146 ? -2.392  -43.116 88.607  1.00 48.14  ?  146  LEU A CA  1 
ATOM   1128  C  C   . LEU A  1 146 ? -0.945  -43.583 88.631  1.00 49.28  ?  146  LEU A C   1 
ATOM   1129  O  O   . LEU A  1 146 ? -0.512  -44.240 89.582  1.00 50.09  ?  146  LEU A O   1 
ATOM   1130  C  CB  . LEU A  1 146 ? -2.654  -42.116 89.733  1.00 46.85  ?  146  LEU A CB  1 
ATOM   1131  C  CG  . LEU A  1 146 ? -1.898  -40.797 89.576  1.00 45.17  ?  146  LEU A CG  1 
ATOM   1132  C  CD1 . LEU A  1 146 ? -2.792  -39.636 89.927  1.00 46.49  ?  146  LEU A CD1 1 
ATOM   1133  C  CD2 . LEU A  1 146 ? -0.639  -40.774 90.435  1.00 42.90  ?  146  LEU A CD2 1 
ATOM   1134  N  N   . VAL A  1 147 ? -0.201  -43.228 87.591  1.00 48.84  ?  147  VAL A N   1 
ATOM   1135  C  CA  . VAL A  1 147 ? 1.220   -43.520 87.483  1.00 47.76  ?  147  VAL A CA  1 
ATOM   1136  C  C   . VAL A  1 147 ? 1.989   -42.211 87.582  1.00 46.83  ?  147  VAL A C   1 
ATOM   1137  O  O   . VAL A  1 147 ? 1.573   -41.196 87.012  1.00 46.62  ?  147  VAL A O   1 
ATOM   1138  C  CB  . VAL A  1 147 ? 1.524   -44.241 86.158  1.00 45.85  ?  147  VAL A CB  1 
ATOM   1139  C  CG1 . VAL A  1 147 ? 2.976   -44.675 86.111  1.00 44.87  ?  147  VAL A CG1 1 
ATOM   1140  C  CG2 . VAL A  1 147 ? 0.587   -45.423 85.987  1.00 45.96  ?  147  VAL A CG2 1 
ATOM   1141  N  N   . SER A  1 148 ? 3.102   -42.229 88.312  1.00 46.26  ?  148  SER A N   1 
ATOM   1142  C  CA  . SER A  1 148 ? 3.988   -41.074 88.386  1.00 46.57  ?  148  SER A CA  1 
ATOM   1143  C  C   . SER A  1 148 ? 5.424   -41.568 88.376  1.00 45.68  ?  148  SER A C   1 
ATOM   1144  O  O   . SER A  1 148 ? 5.756   -42.509 89.098  1.00 47.81  ?  148  SER A O   1 
ATOM   1145  C  CB  . SER A  1 148 ? 3.727   -40.232 89.642  1.00 48.78  ?  148  SER A CB  1 
ATOM   1146  O  OG  . SER A  1 148 ? 4.051   -40.947 90.826  1.00 49.79  ?  148  SER A OG  1 
ATOM   1147  N  N   . MET A  1 149 ? 6.272   -40.936 87.575  1.00 44.06  ?  149  MET A N   1 
ATOM   1148  C  CA  . MET A  1 149 ? 7.641   -41.392 87.405  1.00 44.30  ?  149  MET A CA  1 
ATOM   1149  C  C   . MET A  1 149 ? 8.622   -40.325 87.861  1.00 43.50  ?  149  MET A C   1 
ATOM   1150  O  O   . MET A  1 149 ? 8.315   -39.129 87.857  1.00 44.26  ?  149  MET A O   1 
ATOM   1151  C  CB  . MET A  1 149 ? 7.939   -41.767 85.943  1.00 45.29  ?  149  MET A CB  1 
ATOM   1152  C  CG  . MET A  1 149 ? 8.428   -40.618 85.047  1.00 42.85  ?  149  MET A CG  1 
ATOM   1153  S  SD  . MET A  1 149 ? 7.144   -39.433 84.601  1.00 45.09  ?  149  MET A SD  1 
ATOM   1154  C  CE  . MET A  1 149 ? 6.063   -40.486 83.650  1.00 41.19  ?  149  MET A CE  1 
ATOM   1155  N  N   . ASN A  1 150 ? 9.802   -40.777 88.270  1.00 41.30  ?  150  ASN A N   1 
ATOM   1156  C  CA  . ASN A  1 150 ? 10.934  -39.892 88.481  1.00 46.87  ?  150  ASN A CA  1 
ATOM   1157  C  C   . ASN A  1 150 ? 11.703  -39.763 87.175  1.00 50.95  ?  150  ASN A C   1 
ATOM   1158  O  O   . ASN A  1 150 ? 11.936  -40.759 86.483  1.00 50.26  ?  150  ASN A O   1 
ATOM   1159  C  CB  . ASN A  1 150 ? 11.846  -40.415 89.592  1.00 47.73  ?  150  ASN A CB  1 
ATOM   1160  C  CG  . ASN A  1 150 ? 11.308  -40.114 90.985  1.00 48.44  ?  150  ASN A CG  1 
ATOM   1161  O  OD1 . ASN A  1 150 ? 10.221  -39.553 91.141  1.00 48.40  ?  150  ASN A OD1 1 
ATOM   1162  N  ND2 . ASN A  1 150 ? 12.075  -40.485 92.005  1.00 48.17  ?  150  ASN A ND2 1 
ATOM   1163  N  N   . TYR A  1 151 ? 12.062  -38.533 86.824  1.00 49.65  ?  151  TYR A N   1 
ATOM   1164  C  CA  . TYR A  1 151 ? 12.889  -38.264 85.661  1.00 46.39  ?  151  TYR A CA  1 
ATOM   1165  C  C   . TYR A  1 151 ? 14.041  -37.375 86.097  1.00 43.55  ?  151  TYR A C   1 
ATOM   1166  O  O   . TYR A  1 151 ? 13.921  -36.620 87.064  1.00 43.24  ?  151  TYR A O   1 
ATOM   1167  C  CB  . TYR A  1 151 ? 12.086  -37.603 84.522  1.00 46.51  ?  151  TYR A CB  1 
ATOM   1168  C  CG  . TYR A  1 151 ? 11.519  -36.234 84.840  1.00 46.75  ?  151  TYR A CG  1 
ATOM   1169  C  CD1 . TYR A  1 151 ? 10.260  -36.091 85.408  1.00 40.20  ?  151  TYR A CD1 1 
ATOM   1170  C  CD2 . TYR A  1 151 ? 12.232  -35.081 84.533  1.00 47.39  ?  151  TYR A CD2 1 
ATOM   1171  C  CE1 . TYR A  1 151 ? 9.740   -34.841 85.683  1.00 40.02  ?  151  TYR A CE1 1 
ATOM   1172  C  CE2 . TYR A  1 151 ? 11.718  -33.827 84.805  1.00 40.52  ?  151  TYR A CE2 1 
ATOM   1173  C  CZ  . TYR A  1 151 ? 10.475  -33.713 85.381  1.00 40.16  ?  151  TYR A CZ  1 
ATOM   1174  O  OH  . TYR A  1 151 ? 9.966   -32.463 85.654  1.00 40.10  ?  151  TYR A OH  1 
ATOM   1175  N  N   . ARG A  1 152 ? 15.164  -37.484 85.393  1.00 42.54  ?  152  ARG A N   1 
ATOM   1176  C  CA  . ARG A  1 152 ? 16.356  -36.748 85.790  1.00 44.93  ?  152  ARG A CA  1 
ATOM   1177  C  C   . ARG A  1 152 ? 16.162  -35.250 85.592  1.00 44.24  ?  152  ARG A C   1 
ATOM   1178  O  O   . ARG A  1 152 ? 15.504  -34.807 84.647  1.00 43.73  ?  152  ARG A O   1 
ATOM   1179  C  CB  . ARG A  1 152 ? 17.572  -37.239 85.007  1.00 45.63  ?  152  ARG A CB  1 
ATOM   1180  C  CG  . ARG A  1 152 ? 18.153  -38.540 85.528  1.00 44.92  ?  152  ARG A CG  1 
ATOM   1181  C  CD  . ARG A  1 152 ? 19.185  -39.092 84.568  1.00 49.61  ?  152  ARG A CD  1 
ATOM   1182  N  NE  . ARG A  1 152 ? 18.547  -39.630 83.369  1.00 49.90  ?  152  ARG A NE  1 
ATOM   1183  C  CZ  . ARG A  1 152 ? 19.203  -40.046 82.292  1.00 49.65  ?  152  ARG A CZ  1 
ATOM   1184  N  NH1 . ARG A  1 152 ? 20.528  -39.991 82.254  1.00 49.38  ?  152  ARG A NH1 1 
ATOM   1185  N  NH2 . ARG A  1 152 ? 18.530  -40.516 81.251  1.00 48.95  ?  152  ARG A NH2 1 
ATOM   1186  N  N   . VAL A  1 153 ? 16.734  -34.470 86.506  1.00 44.94  ?  153  VAL A N   1 
ATOM   1187  C  CA  . VAL A  1 153 ? 16.589  -33.023 86.527  1.00 47.84  ?  153  VAL A CA  1 
ATOM   1188  C  C   . VAL A  1 153 ? 17.979  -32.405 86.602  1.00 52.50  ?  153  VAL A C   1 
ATOM   1189  O  O   . VAL A  1 153 ? 18.971  -33.084 86.877  1.00 57.17  ?  153  VAL A O   1 
ATOM   1190  C  CB  . VAL A  1 153 ? 15.721  -32.538 87.707  1.00 47.16  ?  153  VAL A CB  1 
ATOM   1191  C  CG1 . VAL A  1 153 ? 14.303  -33.075 87.588  1.00 42.04  ?  153  VAL A CG1 1 
ATOM   1192  C  CG2 . VAL A  1 153 ? 16.348  -32.974 89.022  1.00 45.89  ?  153  VAL A CG2 1 
ATOM   1193  N  N   . GLY A  1 154 ? 18.040  -31.095 86.353  1.00 50.77  ?  154  GLY A N   1 
ATOM   1194  C  CA  . GLY A  1 154 ? 19.303  -30.389 86.455  1.00 50.55  ?  154  GLY A CA  1 
ATOM   1195  C  C   . GLY A  1 154 ? 20.259  -30.789 85.343  1.00 50.65  ?  154  GLY A C   1 
ATOM   1196  O  O   . GLY A  1 154 ? 19.852  -31.148 84.235  1.00 50.78  ?  154  GLY A O   1 
ATOM   1197  N  N   . THR A  1 155 ? 21.559  -30.716 85.647  1.00 51.01  ?  155  THR A N   1 
ATOM   1198  C  CA  . THR A  1 155 ? 22.566  -31.146 84.681  1.00 52.04  ?  155  THR A CA  1 
ATOM   1199  C  C   . THR A  1 155 ? 22.357  -32.599 84.283  1.00 54.78  ?  155  THR A C   1 
ATOM   1200  O  O   . THR A  1 155 ? 22.503  -32.960 83.110  1.00 56.51  ?  155  THR A O   1 
ATOM   1201  C  CB  . THR A  1 155 ? 23.970  -30.980 85.260  1.00 51.97  ?  155  THR A CB  1 
ATOM   1202  O  OG1 . THR A  1 155 ? 23.966  -31.379 86.633  1.00 50.27  ?  155  THR A OG1 1 
ATOM   1203  C  CG2 . THR A  1 155 ? 24.431  -29.548 85.157  1.00 53.04  ?  155  THR A CG2 1 
ATOM   1204  N  N   . PHE A  1 156 ? 22.004  -33.444 85.252  1.00 55.35  ?  156  PHE A N   1 
ATOM   1205  C  CA  . PHE A  1 156 ? 21.989  -34.882 85.019  1.00 55.76  ?  156  PHE A CA  1 
ATOM   1206  C  C   . PHE A  1 156 ? 21.003  -35.261 83.924  1.00 56.87  ?  156  PHE A C   1 
ATOM   1207  O  O   . PHE A  1 156 ? 21.278  -36.158 83.119  1.00 58.83  ?  156  PHE A O   1 
ATOM   1208  C  CB  . PHE A  1 156 ? 21.678  -35.606 86.326  1.00 54.27  ?  156  PHE A CB  1 
ATOM   1209  C  CG  . PHE A  1 156 ? 22.545  -35.165 87.460  1.00 55.85  ?  156  PHE A CG  1 
ATOM   1210  C  CD1 . PHE A  1 156 ? 23.790  -35.741 87.659  1.00 58.34  ?  156  PHE A CD1 1 
ATOM   1211  C  CD2 . PHE A  1 156 ? 22.137  -34.145 88.307  1.00 55.04  ?  156  PHE A CD2 1 
ATOM   1212  C  CE1 . PHE A  1 156 ? 24.603  -35.319 88.697  1.00 59.53  ?  156  PHE A CE1 1 
ATOM   1213  C  CE2 . PHE A  1 156 ? 22.945  -33.720 89.343  1.00 55.93  ?  156  PHE A CE2 1 
ATOM   1214  C  CZ  . PHE A  1 156 ? 24.178  -34.307 89.539  1.00 58.09  ?  156  PHE A CZ  1 
ATOM   1215  N  N   . GLY A  1 157 ? 19.846  -34.608 83.880  1.00 55.28  ?  157  GLY A N   1 
ATOM   1216  C  CA  . GLY A  1 157 ? 18.957  -34.866 82.769  1.00 54.42  ?  157  GLY A CA  1 
ATOM   1217  C  C   . GLY A  1 157 ? 19.036  -33.923 81.583  1.00 54.86  ?  157  GLY A C   1 
ATOM   1218  O  O   . GLY A  1 157 ? 18.682  -34.316 80.469  1.00 58.05  ?  157  GLY A O   1 
ATOM   1219  N  N   . PHE A  1 158 ? 19.401  -32.661 81.792  1.00 51.74  ?  158  PHE A N   1 
ATOM   1220  C  CA  . PHE A  1 158 ? 19.373  -31.718 80.683  1.00 48.98  ?  158  PHE A CA  1 
ATOM   1221  C  C   . PHE A  1 158 ? 20.703  -31.129 80.216  1.00 50.54  ?  158  PHE A C   1 
ATOM   1222  O  O   . PHE A  1 158 ? 20.695  -30.367 79.241  1.00 52.76  ?  158  PHE A O   1 
ATOM   1223  C  CB  . PHE A  1 158 ? 18.349  -30.633 81.001  1.00 47.72  ?  158  PHE A CB  1 
ATOM   1224  C  CG  . PHE A  1 158 ? 16.964  -31.191 81.104  1.00 47.95  ?  158  PHE A CG  1 
ATOM   1225  C  CD1 . PHE A  1 158 ? 16.258  -31.521 79.959  1.00 47.51  ?  158  PHE A CD1 1 
ATOM   1226  C  CD2 . PHE A  1 158 ? 16.405  -31.485 82.340  1.00 48.69  ?  158  PHE A CD2 1 
ATOM   1227  C  CE1 . PHE A  1 158 ? 14.993  -32.074 80.043  1.00 47.61  ?  158  PHE A CE1 1 
ATOM   1228  C  CE2 . PHE A  1 158 ? 15.138  -32.040 82.433  1.00 47.80  ?  158  PHE A CE2 1 
ATOM   1229  C  CZ  . PHE A  1 158 ? 14.432  -32.334 81.282  1.00 47.61  ?  158  PHE A CZ  1 
ATOM   1230  N  N   . LEU A  1 159 ? 21.836  -31.436 80.849  1.00 50.48  ?  159  LEU A N   1 
ATOM   1231  C  CA  . LEU A  1 159 ? 23.095  -30.905 80.331  1.00 52.92  ?  159  LEU A CA  1 
ATOM   1232  C  C   . LEU A  1 159 ? 23.333  -31.444 78.930  1.00 56.25  ?  159  LEU A C   1 
ATOM   1233  O  O   . LEU A  1 159 ? 23.315  -32.658 78.708  1.00 61.51  ?  159  LEU A O   1 
ATOM   1234  C  CB  . LEU A  1 159 ? 24.273  -31.260 81.239  1.00 50.55  ?  159  LEU A CB  1 
ATOM   1235  C  CG  . LEU A  1 159 ? 25.627  -30.674 80.816  1.00 52.33  ?  159  LEU A CG  1 
ATOM   1236  C  CD1 . LEU A  1 159 ? 26.405  -30.193 82.019  1.00 53.23  ?  159  LEU A CD1 1 
ATOM   1237  C  CD2 . LEU A  1 159 ? 26.459  -31.681 80.036  1.00 53.57  ?  159  LEU A CD2 1 
ATOM   1238  N  N   . ALA A  1 160 ? 23.557  -30.540 77.982  1.00 54.17  ?  160  ALA A N   1 
ATOM   1239  C  CA  . ALA A  1 160 ? 23.583  -30.903 76.576  1.00 52.65  ?  160  ALA A CA  1 
ATOM   1240  C  C   . ALA A  1 160 ? 24.797  -30.309 75.885  1.00 53.76  ?  160  ALA A C   1 
ATOM   1241  O  O   . ALA A  1 160 ? 25.127  -29.136 76.076  1.00 54.47  ?  160  ALA A O   1 
ATOM   1242  C  CB  . ALA A  1 160 ? 22.310  -30.434 75.863  1.00 51.77  ?  160  ALA A CB  1 
ATOM   1243  N  N   . LEU A  1 161 ? 25.454  -31.137 75.076  1.00 55.30  ?  161  LEU A N   1 
ATOM   1244  C  CA  . LEU A  1 161 ? 26.403  -30.689 74.061  1.00 58.47  ?  161  LEU A CA  1 
ATOM   1245  C  C   . LEU A  1 161 ? 25.813  -31.175 72.744  1.00 62.34  ?  161  LEU A C   1 
ATOM   1246  O  O   . LEU A  1 161 ? 26.114  -32.292 72.293  1.00 64.90  ?  161  LEU A O   1 
ATOM   1247  C  CB  . LEU A  1 161 ? 27.807  -31.240 74.304  1.00 58.27  ?  161  LEU A CB  1 
ATOM   1248  C  CG  . LEU A  1 161 ? 28.567  -30.635 75.484  1.00 58.17  ?  161  LEU A CG  1 
ATOM   1249  C  CD1 . LEU A  1 161 ? 29.965  -31.196 75.548  1.00 60.31  ?  161  LEU A CD1 1 
ATOM   1250  C  CD2 . LEU A  1 161 ? 28.614  -29.131 75.376  1.00 58.33  ?  161  LEU A CD2 1 
ATOM   1251  N  N   . PRO A  1 162 ? 24.946  -30.380 72.116  1.00 62.44  ?  162  PRO A N   1 
ATOM   1252  C  CA  . PRO A  1 162 ? 24.153  -30.871 70.980  1.00 61.86  ?  162  PRO A CA  1 
ATOM   1253  C  C   . PRO A  1 162 ? 25.010  -31.460 69.874  1.00 63.02  ?  162  PRO A C   1 
ATOM   1254  O  O   . PRO A  1 162 ? 25.997  -30.864 69.438  1.00 64.11  ?  162  PRO A O   1 
ATOM   1255  C  CB  . PRO A  1 162 ? 23.413  -29.619 70.505  1.00 61.66  ?  162  PRO A CB  1 
ATOM   1256  C  CG  . PRO A  1 162 ? 23.323  -28.755 71.722  1.00 60.61  ?  162  PRO A CG  1 
ATOM   1257  C  CD  . PRO A  1 162 ? 24.588  -29.001 72.490  1.00 61.71  ?  162  PRO A CD  1 
ATOM   1258  N  N   . GLY A  1 163 ? 24.623  -32.647 69.420  1.00 63.91  ?  163  GLY A N   1 
ATOM   1259  C  CA  . GLY A  1 163 ? 25.340  -33.346 68.379  1.00 67.86  ?  163  GLY A CA  1 
ATOM   1260  C  C   . GLY A  1 163 ? 26.334  -34.373 68.869  1.00 70.06  ?  163  GLY A C   1 
ATOM   1261  O  O   . GLY A  1 163 ? 26.782  -35.204 68.069  1.00 72.89  ?  163  GLY A O   1 
ATOM   1262  N  N   . SER A  1 164 ? 26.696  -34.342 70.145  1.00 69.34  ?  164  SER A N   1 
ATOM   1263  C  CA  . SER A  1 164 ? 27.624  -35.325 70.680  1.00 70.97  ?  164  SER A CA  1 
ATOM   1264  C  C   . SER A  1 164 ? 26.881  -36.586 71.098  1.00 70.58  ?  164  SER A C   1 
ATOM   1265  O  O   . SER A  1 164 ? 25.740  -36.527 71.568  1.00 67.88  ?  164  SER A O   1 
ATOM   1266  C  CB  . SER A  1 164 ? 28.374  -34.748 71.873  1.00 71.36  ?  164  SER A CB  1 
ATOM   1267  O  OG  . SER A  1 164 ? 27.494  -34.657 72.975  1.00 70.15  ?  164  SER A OG  1 
ATOM   1268  N  N   . ARG A  1 165 ? 27.533  -37.735 70.906  1.00 73.14  ?  165  ARG A N   1 
ATOM   1269  C  CA  . ARG A  1 165 ? 26.954  -38.992 71.363  1.00 72.61  ?  165  ARG A CA  1 
ATOM   1270  C  C   . ARG A  1 165 ? 26.783  -38.993 72.876  1.00 70.58  ?  165  ARG A C   1 
ATOM   1271  O  O   . ARG A  1 165 ? 25.744  -39.422 73.389  1.00 69.02  ?  165  ARG A O   1 
ATOM   1272  C  CB  . ARG A  1 165 ? 27.831  -40.169 70.921  1.00 77.83  ?  165  ARG A CB  1 
ATOM   1273  C  CG  . ARG A  1 165 ? 27.170  -41.539 71.061  1.00 82.37  ?  165  ARG A CG  1 
ATOM   1274  C  CD  . ARG A  1 165 ? 28.075  -42.543 71.781  1.00 89.24  ?  165  ARG A CD  1 
ATOM   1275  N  NE  . ARG A  1 165 ? 27.367  -43.785 72.097  1.00 93.85  ?  165  ARG A NE  1 
ATOM   1276  C  CZ  . ARG A  1 165 ? 27.657  -44.579 73.128  1.00 96.84  ?  165  ARG A CZ  1 
ATOM   1277  N  NH1 . ARG A  1 165 ? 28.641  -44.259 73.959  1.00 99.10  ?  165  ARG A NH1 1 
ATOM   1278  N  NH2 . ARG A  1 165 ? 26.955  -45.688 73.337  1.00 96.10  ?  165  ARG A NH2 1 
ATOM   1279  N  N   . GLU A  1 166 ? 27.770  -38.461 73.604  1.00 72.17  ?  166  GLU A N   1 
ATOM   1280  C  CA  . GLU A  1 166 ? 27.864  -38.685 75.044  1.00 73.43  ?  166  GLU A CA  1 
ATOM   1281  C  C   . GLU A  1 166 ? 26.846  -37.882 75.853  1.00 70.70  ?  166  GLU A C   1 
ATOM   1282  O  O   . GLU A  1 166 ? 26.474  -38.307 76.953  1.00 71.50  ?  166  GLU A O   1 
ATOM   1283  C  CB  . GLU A  1 166 ? 29.279  -38.361 75.528  1.00 78.20  ?  166  GLU A CB  1 
ATOM   1284  C  CG  . GLU A  1 166 ? 30.401  -38.914 74.650  1.00 83.72  ?  166  GLU A CG  1 
ATOM   1285  C  CD  . GLU A  1 166 ? 30.466  -40.434 74.661  1.00 88.32  ?  166  GLU A CD  1 
ATOM   1286  O  OE1 . GLU A  1 166 ? 29.965  -41.050 75.628  1.00 87.64  ?  166  GLU A OE1 1 
ATOM   1287  O  OE2 . GLU A  1 166 ? 31.011  -41.016 73.695  1.00 92.53  ?  166  GLU A OE2 1 
ATOM   1288  N  N   . ALA A  1 167 ? 26.417  -36.718 75.361  1.00 67.13  ?  167  ALA A N   1 
ATOM   1289  C  CA  . ALA A  1 167 ? 25.401  -35.901 76.033  1.00 62.69  ?  167  ALA A CA  1 
ATOM   1290  C  C   . ALA A  1 167 ? 24.513  -35.241 74.989  1.00 62.62  ?  167  ALA A C   1 
ATOM   1291  O  O   . ALA A  1 167 ? 24.670  -34.056 74.667  1.00 64.76  ?  167  ALA A O   1 
ATOM   1292  C  CB  . ALA A  1 167 ? 26.044  -34.859 76.950  1.00 60.42  ?  167  ALA A CB  1 
ATOM   1293  N  N   . PRO A  1 168 ? 23.560  -35.988 74.429  1.00 59.80  ?  168  PRO A N   1 
ATOM   1294  C  CA  . PRO A  1 168 ? 22.698  -35.420 73.382  1.00 57.84  ?  168  PRO A CA  1 
ATOM   1295  C  C   . PRO A  1 168 ? 21.716  -34.386 73.892  1.00 54.96  ?  168  PRO A C   1 
ATOM   1296  O  O   . PRO A  1 168 ? 21.159  -33.640 73.078  1.00 53.83  ?  168  PRO A O   1 
ATOM   1297  C  CB  . PRO A  1 168 ? 21.966  -36.648 72.836  1.00 58.83  ?  168  PRO A CB  1 
ATOM   1298  C  CG  . PRO A  1 168 ? 21.872  -37.555 74.026  1.00 58.18  ?  168  PRO A CG  1 
ATOM   1299  C  CD  . PRO A  1 168 ? 23.152  -37.354 74.800  1.00 59.06  ?  168  PRO A CD  1 
ATOM   1300  N  N   . GLY A  1 169 ? 21.467  -34.334 75.197  1.00 54.83  ?  169  GLY A N   1 
ATOM   1301  C  CA  . GLY A  1 169 ? 20.463  -33.457 75.762  1.00 54.16  ?  169  GLY A CA  1 
ATOM   1302  C  C   . GLY A  1 169 ? 19.085  -34.097 75.799  1.00 55.12  ?  169  GLY A C   1 
ATOM   1303  O  O   . GLY A  1 169 ? 18.816  -35.116 75.165  1.00 59.94  ?  169  GLY A O   1 
ATOM   1304  N  N   . ASN A  1 170 ? 18.196  -33.475 76.570  1.00 52.14  ?  170  ASN A N   1 
ATOM   1305  C  CA  . ASN A  1 170 ? 16.809  -33.916 76.729  1.00 50.97  ?  170  ASN A CA  1 
ATOM   1306  C  C   . ASN A  1 170 ? 16.685  -35.320 77.311  1.00 51.22  ?  170  ASN A C   1 
ATOM   1307  O  O   . ASN A  1 170 ? 15.643  -35.962 77.146  1.00 50.66  ?  170  ASN A O   1 
ATOM   1308  C  CB  . ASN A  1 170 ? 16.034  -33.858 75.403  1.00 49.43  ?  170  ASN A CB  1 
ATOM   1309  C  CG  . ASN A  1 170 ? 15.962  -32.467 74.822  1.00 49.70  ?  170  ASN A CG  1 
ATOM   1310  O  OD1 . ASN A  1 170 ? 15.924  -31.479 75.548  1.00 44.74  ?  170  ASN A OD1 1 
ATOM   1311  N  ND2 . ASN A  1 170 ? 15.941  -32.383 73.501  1.00 52.35  ?  170  ASN A ND2 1 
ATOM   1312  N  N   . VAL A  1 171 ? 17.693  -35.826 78.028  1.00 51.91  ?  171  VAL A N   1 
ATOM   1313  C  CA  . VAL A  1 171 ? 17.585  -37.216 78.462  1.00 53.03  ?  171  VAL A CA  1 
ATOM   1314  C  C   . VAL A  1 171 ? 16.600  -37.376 79.617  1.00 53.56  ?  171  VAL A C   1 
ATOM   1315  O  O   . VAL A  1 171 ? 16.142  -38.494 79.876  1.00 55.97  ?  171  VAL A O   1 
ATOM   1316  C  CB  . VAL A  1 171 ? 18.962  -37.821 78.818  1.00 52.99  ?  171  VAL A CB  1 
ATOM   1317  C  CG1 . VAL A  1 171 ? 19.857  -37.863 77.587  1.00 54.08  ?  171  VAL A CG1 1 
ATOM   1318  C  CG2 . VAL A  1 171 ? 19.634  -37.067 79.938  1.00 51.51  ?  171  VAL A CG2 1 
ATOM   1319  N  N   . GLY A  1 172 ? 16.237  -36.291 80.306  1.00 51.78  ?  172  GLY A N   1 
ATOM   1320  C  CA  . GLY A  1 172 ? 15.141  -36.378 81.260  1.00 49.35  ?  172  GLY A CA  1 
ATOM   1321  C  C   . GLY A  1 172 ? 13.803  -36.576 80.572  1.00 48.14  ?  172  GLY A C   1 
ATOM   1322  O  O   . GLY A  1 172 ? 12.936  -37.311 81.066  1.00 47.21  ?  172  GLY A O   1 
ATOM   1323  N  N   . LEU A  1 173 ? 13.618  -35.925 79.418  1.00 47.39  ?  173  LEU A N   1 
ATOM   1324  C  CA  . LEU A  1 173 ? 12.415  -36.150 78.627  1.00 45.38  ?  173  LEU A CA  1 
ATOM   1325  C  C   . LEU A  1 173 ? 12.383  -37.575 78.093  1.00 46.07  ?  173  LEU A C   1 
ATOM   1326  O  O   . LEU A  1 173 ? 11.312  -38.189 77.990  1.00 46.95  ?  173  LEU A O   1 
ATOM   1327  C  CB  . LEU A  1 173 ? 12.334  -35.137 77.490  1.00 43.56  ?  173  LEU A CB  1 
ATOM   1328  C  CG  . LEU A  1 173 ? 11.965  -33.713 77.906  1.00 44.26  ?  173  LEU A CG  1 
ATOM   1329  C  CD1 . LEU A  1 173 ? 12.055  -32.773 76.723  1.00 45.46  ?  173  LEU A CD1 1 
ATOM   1330  C  CD2 . LEU A  1 173 ? 10.559  -33.701 78.469  1.00 42.80  ?  173  LEU A CD2 1 
ATOM   1331  N  N   . LEU A  1 174 ? 13.555  -38.127 77.765  1.00 45.62  ?  174  LEU A N   1 
ATOM   1332  C  CA  . LEU A  1 174 ? 13.616  -39.534 77.379  1.00 47.70  ?  174  LEU A CA  1 
ATOM   1333  C  C   . LEU A  1 174 ? 13.296  -40.448 78.556  1.00 52.54  ?  174  LEU A C   1 
ATOM   1334  O  O   . LEU A  1 174 ? 12.708  -41.518 78.362  1.00 56.66  ?  174  LEU A O   1 
ATOM   1335  C  CB  . LEU A  1 174 ? 14.983  -39.869 76.793  1.00 46.68  ?  174  LEU A CB  1 
ATOM   1336  C  CG  . LEU A  1 174 ? 15.299  -39.155 75.482  1.00 45.46  ?  174  LEU A CG  1 
ATOM   1337  C  CD1 . LEU A  1 174 ? 16.631  -39.621 74.920  1.00 46.77  ?  174  LEU A CD1 1 
ATOM   1338  C  CD2 . LEU A  1 174 ? 14.174  -39.382 74.492  1.00 45.41  ?  174  LEU A CD2 1 
ATOM   1339  N  N   . ASP A  1 175 ? 13.667  -40.050 79.777  1.00 51.20  ?  175  ASP A N   1 
ATOM   1340  C  CA  . ASP A  1 175 ? 13.210  -40.777 80.957  1.00 48.17  ?  175  ASP A CA  1 
ATOM   1341  C  C   . ASP A  1 175 ? 11.689  -40.812 81.005  1.00 47.19  ?  175  ASP A C   1 
ATOM   1342  O  O   . ASP A  1 175 ? 11.080  -41.885 81.125  1.00 48.93  ?  175  ASP A O   1 
ATOM   1343  C  CB  . ASP A  1 175 ? 13.779  -40.136 82.223  1.00 46.64  ?  175  ASP A CB  1 
ATOM   1344  C  CG  . ASP A  1 175 ? 15.291  -40.265 82.316  1.00 46.78  ?  175  ASP A CG  1 
ATOM   1345  O  OD1 . ASP A  1 175 ? 15.866  -41.089 81.578  1.00 46.04  ?  175  ASP A OD1 1 
ATOM   1346  O  OD2 . ASP A  1 175 ? 15.911  -39.534 83.117  1.00 47.58  ?  175  ASP A OD2 1 
ATOM   1347  N  N   . GLN A  1 176 ? 11.054  -39.643 80.887  1.00 45.97  ?  176  GLN A N   1 
ATOM   1348  C  CA  . GLN A  1 176 ? 9.593   -39.593 80.912  1.00 44.97  ?  176  GLN A CA  1 
ATOM   1349  C  C   . GLN A  1 176 ? 8.990   -40.486 79.831  1.00 45.15  ?  176  GLN A C   1 
ATOM   1350  O  O   . GLN A  1 176 ? 8.054   -41.253 80.092  1.00 46.85  ?  176  GLN A O   1 
ATOM   1351  C  CB  . GLN A  1 176 ? 9.121   -38.152 80.737  1.00 45.20  ?  176  GLN A CB  1 
ATOM   1352  C  CG  . GLN A  1 176 ? 9.673   -37.186 81.757  1.00 48.04  ?  176  GLN A CG  1 
ATOM   1353  C  CD  . GLN A  1 176 ? 9.182   -35.781 81.510  1.00 52.83  ?  176  GLN A CD  1 
ATOM   1354  O  OE1 . GLN A  1 176 ? 8.470   -35.533 80.538  1.00 55.24  ?  176  GLN A OE1 1 
ATOM   1355  N  NE2 . GLN A  1 176 ? 9.557   -34.851 82.382  1.00 53.71  ?  176  GLN A NE2 1 
ATOM   1356  N  N   . ARG A  1 177 ? 9.517   -40.399 78.605  1.00 44.74  ?  177  ARG A N   1 
ATOM   1357  C  CA  . ARG A  1 177 ? 8.990   -41.217 77.517  1.00 46.65  ?  177  ARG A CA  1 
ATOM   1358  C  C   . ARG A  1 177 ? 9.151   -42.701 77.821  1.00 48.14  ?  177  ARG A C   1 
ATOM   1359  O  O   . ARG A  1 177 ? 8.254   -43.506 77.535  1.00 47.59  ?  177  ARG A O   1 
ATOM   1360  C  CB  . ARG A  1 177 ? 9.684   -40.864 76.198  1.00 46.46  ?  177  ARG A CB  1 
ATOM   1361  C  CG  . ARG A  1 177 ? 9.307   -41.768 75.024  1.00 46.16  ?  177  ARG A CG  1 
ATOM   1362  C  CD  . ARG A  1 177 ? 10.173  -41.478 73.816  1.00 50.25  ?  177  ARG A CD  1 
ATOM   1363  N  NE  . ARG A  1 177 ? 9.803   -40.228 73.155  1.00 49.39  ?  177  ARG A NE  1 
ATOM   1364  C  CZ  . ARG A  1 177 ? 10.537  -39.633 72.219  1.00 49.57  ?  177  ARG A CZ  1 
ATOM   1365  N  NH1 . ARG A  1 177 ? 11.690  -40.168 71.838  1.00 49.71  ?  177  ARG A NH1 1 
ATOM   1366  N  NH2 . ARG A  1 177 ? 10.124  -38.499 71.668  1.00 47.05  ?  177  ARG A NH2 1 
ATOM   1367  N  N   . LEU A  1 178 ? 10.288  -43.083 78.407  1.00 49.67  ?  178  LEU A N   1 
ATOM   1368  C  CA  . LEU A  1 178 ? 10.504  -44.484 78.751  1.00 52.32  ?  178  LEU A CA  1 
ATOM   1369  C  C   . LEU A  1 178 ? 9.476   -44.959 79.769  1.00 52.46  ?  178  LEU A C   1 
ATOM   1370  O  O   . LEU A  1 178 ? 8.962   -46.082 79.672  1.00 53.00  ?  178  LEU A O   1 
ATOM   1371  C  CB  . LEU A  1 178 ? 11.924  -44.678 79.282  1.00 53.37  ?  178  LEU A CB  1 
ATOM   1372  C  CG  . LEU A  1 178 ? 12.355  -46.119 79.522  1.00 44.95  ?  178  LEU A CG  1 
ATOM   1373  C  CD1 . LEU A  1 178 ? 12.141  -46.912 78.256  1.00 45.79  ?  178  LEU A CD1 1 
ATOM   1374  C  CD2 . LEU A  1 178 ? 13.816  -46.149 79.923  1.00 46.88  ?  178  LEU A CD2 1 
ATOM   1375  N  N   . ALA A  1 179 ? 9.157   -44.113 80.752  1.00 50.20  ?  179  ALA A N   1 
ATOM   1376  C  CA  . ALA A  1 179 ? 8.073   -44.449 81.667  1.00 46.67  ?  179  ALA A CA  1 
ATOM   1377  C  C   . ALA A  1 179 ? 6.739   -44.560 80.935  1.00 47.14  ?  179  ALA A C   1 
ATOM   1378  O  O   . ALA A  1 179 ? 5.887   -45.370 81.320  1.00 46.95  ?  179  ALA A O   1 
ATOM   1379  C  CB  . ALA A  1 179 ? 7.993   -43.413 82.782  1.00 43.97  ?  179  ALA A CB  1 
ATOM   1380  N  N   . LEU A  1 180 ? 6.545   -43.768 79.872  1.00 47.49  ?  180  LEU A N   1 
ATOM   1381  C  CA  . LEU A  1 180 ? 5.314   -43.877 79.090  1.00 48.03  ?  180  LEU A CA  1 
ATOM   1382  C  C   . LEU A  1 180 ? 5.232   -45.219 78.368  1.00 49.32  ?  180  LEU A C   1 
ATOM   1383  O  O   . LEU A  1 180 ? 4.164   -45.846 78.333  1.00 50.33  ?  180  LEU A O   1 
ATOM   1384  C  CB  . LEU A  1 180 ? 5.213   -42.726 78.089  1.00 48.33  ?  180  LEU A CB  1 
ATOM   1385  C  CG  . LEU A  1 180 ? 4.442   -41.467 78.501  1.00 48.88  ?  180  LEU A CG  1 
ATOM   1386  C  CD1 . LEU A  1 180 ? 4.882   -40.968 79.864  1.00 51.81  ?  180  LEU A CD1 1 
ATOM   1387  C  CD2 . LEU A  1 180 ? 4.590   -40.371 77.456  1.00 49.62  ?  180  LEU A CD2 1 
ATOM   1388  N  N   . GLN A  1 181 ? 6.347   -45.671 77.780  1.00 50.19  ?  181  GLN A N   1 
ATOM   1389  C  CA  . GLN A  1 181 ? 6.364   -46.988 77.146  1.00 51.22  ?  181  GLN A CA  1 
ATOM   1390  C  C   . GLN A  1 181 ? 6.132   -48.082 78.175  1.00 50.87  ?  181  GLN A C   1 
ATOM   1391  O  O   . GLN A  1 181 ? 5.404   -49.050 77.912  1.00 50.22  ?  181  GLN A O   1 
ATOM   1392  C  CB  . GLN A  1 181 ? 7.691   -47.216 76.419  1.00 52.38  ?  181  GLN A CB  1 
ATOM   1393  C  CG  . GLN A  1 181 ? 7.817   -46.479 75.097  1.00 54.26  ?  181  GLN A CG  1 
ATOM   1394  C  CD  . GLN A  1 181 ? 9.263   -46.229 74.710  0.19 55.15  ?  181  GLN A CD  1 
ATOM   1395  O  OE1 . GLN A  1 181 ? 10.184  -46.694 75.383  0.96 55.52  ?  181  GLN A OE1 1 
ATOM   1396  N  NE2 . GLN A  1 181 ? 9.471   -45.461 73.644  1.00 55.37  ?  181  GLN A NE2 1 
ATOM   1397  N  N   . TRP A  1 182 ? 6.743   -47.940 79.357  1.00 50.68  ?  182  TRP A N   1 
ATOM   1398  C  CA  . TRP A  1 182 ? 6.520   -48.904 80.428  1.00 50.94  ?  182  TRP A CA  1 
ATOM   1399  C  C   . TRP A  1 182 ? 5.043   -48.983 80.784  1.00 49.55  ?  182  TRP A C   1 
ATOM   1400  O  O   . TRP A  1 182 ? 4.511   -50.073 81.022  1.00 50.49  ?  182  TRP A O   1 
ATOM   1401  C  CB  . TRP A  1 182 ? 7.344   -48.528 81.663  1.00 50.18  ?  182  TRP A CB  1 
ATOM   1402  C  CG  . TRP A  1 182 ? 7.369   -49.589 82.733  1.00 47.35  ?  182  TRP A CG  1 
ATOM   1403  C  CD1 . TRP A  1 182 ? 8.369   -50.489 82.968  1.00 46.61  ?  182  TRP A CD1 1 
ATOM   1404  C  CD2 . TRP A  1 182 ? 6.351   -49.861 83.705  1.00 46.19  ?  182  TRP A CD2 1 
ATOM   1405  N  NE1 . TRP A  1 182 ? 8.039   -51.303 84.024  1.00 47.09  ?  182  TRP A NE1 1 
ATOM   1406  C  CE2 . TRP A  1 182 ? 6.804   -50.938 84.494  1.00 47.80  ?  182  TRP A CE2 1 
ATOM   1407  C  CE3 . TRP A  1 182 ? 5.103   -49.297 83.987  1.00 44.25  ?  182  TRP A CE3 1 
ATOM   1408  C  CZ2 . TRP A  1 182 ? 6.050   -51.461 85.546  1.00 48.01  ?  182  TRP A CZ2 1 
ATOM   1409  C  CZ3 . TRP A  1 182 ? 4.357   -49.818 85.028  1.00 44.64  ?  182  TRP A CZ3 1 
ATOM   1410  C  CH2 . TRP A  1 182 ? 4.833   -50.888 85.795  1.00 46.80  ?  182  TRP A CH2 1 
ATOM   1411  N  N   . VAL A  1 183 ? 4.365   -47.836 80.832  1.00 48.76  ?  183  VAL A N   1 
ATOM   1412  C  CA  . VAL A  1 183 ? 2.939   -47.850 81.130  1.00 49.34  ?  183  VAL A CA  1 
ATOM   1413  C  C   . VAL A  1 183 ? 2.172   -48.534 80.010  1.00 51.17  ?  183  VAL A C   1 
ATOM   1414  O  O   . VAL A  1 183 ? 1.250   -49.318 80.265  1.00 50.79  ?  183  VAL A O   1 
ATOM   1415  C  CB  . VAL A  1 183 ? 2.427   -46.420 81.382  1.00 48.85  ?  183  VAL A CB  1 
ATOM   1416  C  CG1 . VAL A  1 183 ? 0.903   -46.400 81.439  1.00 49.35  ?  183  VAL A CG1 1 
ATOM   1417  C  CG2 . VAL A  1 183 ? 3.014   -45.878 82.672  1.00 47.04  ?  183  VAL A CG2 1 
ATOM   1418  N  N   . GLN A  1 184 ? 2.550   -48.272 78.754  1.00 54.75  ?  184  GLN A N   1 
ATOM   1419  C  CA  . GLN A  1 184 ? 1.822   -48.867 77.637  1.00 56.09  ?  184  GLN A CA  1 
ATOM   1420  C  C   . GLN A  1 184 ? 1.955   -50.383 77.636  1.00 56.28  ?  184  GLN A C   1 
ATOM   1421  O  O   . GLN A  1 184 ? 0.998   -51.096 77.315  1.00 58.78  ?  184  GLN A O   1 
ATOM   1422  C  CB  . GLN A  1 184 ? 2.310   -48.299 76.305  1.00 58.28  ?  184  GLN A CB  1 
ATOM   1423  C  CG  . GLN A  1 184 ? 1.227   -48.283 75.233  1.00 65.33  ?  184  GLN A CG  1 
ATOM   1424  C  CD  . GLN A  1 184 ? 1.785   -48.203 73.816  1.00 73.18  ?  184  GLN A CD  1 
ATOM   1425  O  OE1 . GLN A  1 184 ? 2.816   -48.807 73.500  1.00 74.53  ?  184  GLN A OE1 1 
ATOM   1426  N  NE2 . GLN A  1 184 ? 1.097   -47.455 72.952  1.00 76.76  ?  184  GLN A NE2 1 
ATOM   1427  N  N   . GLU A  1 185 ? 3.137   -50.896 77.979  1.00 56.08  ?  185  GLU A N   1 
ATOM   1428  C  CA  . GLU A  1 185 ? 3.345   -52.340 77.962  1.00 57.50  ?  185  GLU A CA  1 
ATOM   1429  C  C   . GLU A  1 185 ? 2.771   -53.018 79.204  1.00 57.08  ?  185  GLU A C   1 
ATOM   1430  O  O   . GLU A  1 185 ? 2.043   -54.012 79.097  1.00 60.47  ?  185  GLU A O   1 
ATOM   1431  C  CB  . GLU A  1 185 ? 4.838   -52.639 77.816  1.00 60.86  ?  185  GLU A CB  1 
ATOM   1432  C  CG  . GLU A  1 185 ? 5.421   -52.125 76.502  1.00 66.99  ?  185  GLU A CG  1 
ATOM   1433  C  CD  . GLU A  1 185 ? 6.927   -52.295 76.394  1.00 72.27  ?  185  GLU A CD  1 
ATOM   1434  O  OE1 . GLU A  1 185 ? 7.489   -53.150 77.111  1.00 75.97  ?  185  GLU A OE1 1 
ATOM   1435  O  OE2 . GLU A  1 185 ? 7.546   -51.584 75.570  1.00 72.47  ?  185  GLU A OE2 1 
ATOM   1436  N  N   . ASN A  1 186 ? 3.091   -52.500 80.388  1.00 53.61  ?  186  ASN A N   1 
ATOM   1437  C  CA  . ASN A  1 186 ? 2.827   -53.195 81.641  1.00 52.45  ?  186  ASN A CA  1 
ATOM   1438  C  C   . ASN A  1 186 ? 1.598   -52.719 82.414  1.00 51.40  ?  186  ASN A C   1 
ATOM   1439  O  O   . ASN A  1 186 ? 1.275   -53.328 83.440  1.00 51.44  ?  186  ASN A O   1 
ATOM   1440  C  CB  . ASN A  1 186 ? 4.056   -53.095 82.549  1.00 51.85  ?  186  ASN A CB  1 
ATOM   1441  C  CG  . ASN A  1 186 ? 5.291   -53.698 81.919  1.00 53.50  ?  186  ASN A CG  1 
ATOM   1442  O  OD1 . ASN A  1 186 ? 5.443   -54.918 81.877  1.00 54.58  ?  186  ASN A OD1 1 
ATOM   1443  N  ND2 . ASN A  1 186 ? 6.185   -52.847 81.429  1.00 54.00  ?  186  ASN A ND2 1 
ATOM   1444  N  N   . ILE A  1 187 ? 0.892   -51.671 81.981  1.00 50.31  ?  187  ILE A N   1 
ATOM   1445  C  CA  . ILE A  1 187 ? -0.129  -51.134 82.885  1.00 51.19  ?  187  ILE A CA  1 
ATOM   1446  C  C   . ILE A  1 187 ? -1.383  -51.999 82.925  1.00 51.48  ?  187  ILE A C   1 
ATOM   1447  O  O   . ILE A  1 187 ? -2.150  -51.905 83.891  1.00 50.60  ?  187  ILE A O   1 
ATOM   1448  C  CB  . ILE A  1 187 ? -0.533  -49.685 82.552  1.00 53.56  ?  187  ILE A CB  1 
ATOM   1449  C  CG1 . ILE A  1 187 ? -1.068  -48.974 83.803  1.00 53.07  ?  187  ILE A CG1 1 
ATOM   1450  C  CG2 . ILE A  1 187 ? -1.623  -49.656 81.498  1.00 57.24  ?  187  ILE A CG2 1 
ATOM   1451  C  CD1 . ILE A  1 187 ? -0.079  -48.880 84.954  1.00 45.00  ?  187  ILE A CD1 1 
ATOM   1452  N  N   . ALA A  1 188 ? -1.612  -52.844 81.916  1.00 52.95  ?  188  ALA A N   1 
ATOM   1453  C  CA  . ALA A  1 188 ? -2.793  -53.702 81.939  1.00 53.22  ?  188  ALA A CA  1 
ATOM   1454  C  C   . ALA A  1 188 ? -2.735  -54.703 83.087  1.00 54.15  ?  188  ALA A C   1 
ATOM   1455  O  O   . ALA A  1 188 ? -3.781  -55.123 83.599  1.00 56.17  ?  188  ALA A O   1 
ATOM   1456  C  CB  . ALA A  1 188 ? -2.947  -54.427 80.600  1.00 51.01  ?  188  ALA A CB  1 
ATOM   1457  N  N   . ALA A  1 189 ? -1.526  -55.084 83.514  1.00 50.08  ?  189  ALA A N   1 
ATOM   1458  C  CA  . ALA A  1 189 ? -1.384  -56.022 84.623  1.00 56.34  ?  189  ALA A CA  1 
ATOM   1459  C  C   . ALA A  1 189 ? -1.946  -55.453 85.918  1.00 55.21  ?  189  ALA A C   1 
ATOM   1460  O  O   . ALA A  1 189 ? -2.386  -56.214 86.788  1.00 53.97  ?  189  ALA A O   1 
ATOM   1461  C  CB  . ALA A  1 189 ? 0.086   -56.393 84.809  1.00 50.39  ?  189  ALA A CB  1 
ATOM   1462  N  N   . PHE A  1 190 ? -1.933  -54.128 86.064  1.00 52.78  ?  190  PHE A N   1 
ATOM   1463  C  CA  . PHE A  1 190 ? -2.457  -53.450 87.242  1.00 49.78  ?  190  PHE A CA  1 
ATOM   1464  C  C   . PHE A  1 190 ? -3.921  -53.066 87.101  1.00 50.36  ?  190  PHE A C   1 
ATOM   1465  O  O   . PHE A  1 190 ? -4.468  -52.432 88.007  1.00 51.31  ?  190  PHE A O   1 
ATOM   1466  C  CB  . PHE A  1 190 ? -1.639  -52.187 87.540  1.00 47.80  ?  190  PHE A CB  1 
ATOM   1467  C  CG  . PHE A  1 190 ? -0.186  -52.447 87.802  1.00 47.39  ?  190  PHE A CG  1 
ATOM   1468  C  CD1 . PHE A  1 190 ? 0.724   -52.478 86.762  1.00 47.02  ?  190  PHE A CD1 1 
ATOM   1469  C  CD2 . PHE A  1 190 ? 0.273   -52.651 89.089  1.00 47.57  ?  190  PHE A CD2 1 
ATOM   1470  C  CE1 . PHE A  1 190 ? 2.063   -52.715 86.997  1.00 46.86  ?  190  PHE A CE1 1 
ATOM   1471  C  CE2 . PHE A  1 190 ? 1.611   -52.888 89.332  1.00 47.76  ?  190  PHE A CE2 1 
ATOM   1472  C  CZ  . PHE A  1 190 ? 2.507   -52.919 88.281  1.00 47.79  ?  190  PHE A CZ  1 
ATOM   1473  N  N   . GLY A  1 191 ? -4.563  -53.414 85.992  1.00 52.41  ?  191  GLY A N   1 
ATOM   1474  C  CA  . GLY A  1 191 ? -5.932  -53.010 85.749  1.00 53.74  ?  191  GLY A CA  1 
ATOM   1475  C  C   . GLY A  1 191 ? -6.094  -51.705 85.008  1.00 50.24  ?  191  GLY A C   1 
ATOM   1476  O  O   . GLY A  1 191 ? -7.226  -51.230 84.871  1.00 50.88  ?  191  GLY A O   1 
ATOM   1477  N  N   . GLY A  1 192 ? -5.002  -51.102 84.538  1.00 49.07  ?  192  GLY A N   1 
ATOM   1478  C  CA  . GLY A  1 192 ? -5.106  -49.901 83.741  1.00 53.30  ?  192  GLY A CA  1 
ATOM   1479  C  C   . GLY A  1 192 ? -5.386  -50.195 82.276  1.00 55.45  ?  192  GLY A C   1 
ATOM   1480  O  O   . GLY A  1 192 ? -5.156  -51.294 81.768  1.00 58.45  ?  192  GLY A O   1 
ATOM   1481  N  N   . ASP A  1 193 ? -5.903  -49.182 81.585  1.00 54.68  ?  193  ASP A N   1 
ATOM   1482  C  CA  . ASP A  1 193 ? -6.253  -49.319 80.180  1.00 54.82  ?  193  ASP A CA  1 
ATOM   1483  C  C   . ASP A  1 193 ? -5.196  -48.627 79.334  1.00 53.32  ?  193  ASP A C   1 
ATOM   1484  O  O   . ASP A  1 193 ? -5.182  -47.388 79.277  1.00 55.29  ?  193  ASP A O   1 
ATOM   1485  C  CB  . ASP A  1 193 ? -7.629  -48.706 79.919  1.00 56.73  ?  193  ASP A CB  1 
ATOM   1486  C  CG  . ASP A  1 193 ? -8.143  -48.992 78.526  1.00 57.91  ?  193  ASP A CG  1 
ATOM   1487  O  OD1 . ASP A  1 193 ? -7.532  -49.826 77.832  1.00 59.87  ?  193  ASP A OD1 1 
ATOM   1488  O  OD2 . ASP A  1 193 ? -9.152  -48.374 78.122  1.00 57.05  ?  193  ASP A OD2 1 
ATOM   1489  N  N   . PRO A  1 194 ? -4.313  -49.358 78.649  1.00 50.63  ?  194  PRO A N   1 
ATOM   1490  C  CA  . PRO A  1 194 ? -3.294  -48.689 77.824  1.00 50.41  ?  194  PRO A CA  1 
ATOM   1491  C  C   . PRO A  1 194 ? -3.876  -47.904 76.657  1.00 51.50  ?  194  PRO A C   1 
ATOM   1492  O  O   . PRO A  1 194 ? -3.162  -47.075 76.077  1.00 50.86  ?  194  PRO A O   1 
ATOM   1493  C  CB  . PRO A  1 194 ? -2.408  -49.848 77.345  1.00 50.48  ?  194  PRO A CB  1 
ATOM   1494  C  CG  . PRO A  1 194 ? -3.269  -51.062 77.466  1.00 52.05  ?  194  PRO A CG  1 
ATOM   1495  C  CD  . PRO A  1 194 ? -4.159  -50.820 78.647  1.00 52.42  ?  194  PRO A CD  1 
ATOM   1496  N  N   . MET A  1 195 ? -5.143  -48.138 76.305  1.00 53.97  ?  195  MET A N   1 
ATOM   1497  C  CA  . MET A  1 195 ? -5.830  -47.403 75.250  1.00 57.15  ?  195  MET A CA  1 
ATOM   1498  C  C   . MET A  1 195 ? -6.363  -46.042 75.686  1.00 60.16  ?  195  MET A C   1 
ATOM   1499  O  O   . MET A  1 195 ? -6.729  -45.242 74.818  1.00 64.18  ?  195  MET A O   1 
ATOM   1500  C  CB  . MET A  1 195 ? -6.986  -48.235 74.707  1.00 58.99  ?  195  MET A CB  1 
ATOM   1501  C  CG  . MET A  1 195 ? -6.616  -49.188 73.601  1.00 60.67  ?  195  MET A CG  1 
ATOM   1502  S  SD  . MET A  1 195 ? -7.730  -50.599 73.597  1.00 62.70  ?  195  MET A SD  1 
ATOM   1503  C  CE  . MET A  1 195 ? -7.241  -51.318 75.153  1.00 62.07  ?  195  MET A CE  1 
ATOM   1504  N  N   . SER A  1 196 ? -6.467  -45.764 76.984  1.00 57.86  ?  196  SER A N   1 
ATOM   1505  C  CA  . SER A  1 196 ? -6.848  -44.438 77.460  1.00 54.51  ?  196  SER A CA  1 
ATOM   1506  C  C   . SER A  1 196 ? -5.796  -44.001 78.467  1.00 53.18  ?  196  SER A C   1 
ATOM   1507  O  O   . SER A  1 196 ? -5.764  -44.499 79.597  1.00 53.25  ?  196  SER A O   1 
ATOM   1508  C  CB  . SER A  1 196 ? -8.242  -44.454 78.086  1.00 53.28  ?  196  SER A CB  1 
ATOM   1509  O  OG  . SER A  1 196 ? -8.756  -43.146 78.252  1.00 53.01  ?  196  SER A OG  1 
ATOM   1510  N  N   . VAL A  1 197 ? -4.966  -43.041 78.073  1.00 52.51  ?  197  VAL A N   1 
ATOM   1511  C  CA  . VAL A  1 197 ? -3.862  -42.566 78.898  1.00 50.78  ?  197  VAL A CA  1 
ATOM   1512  C  C   . VAL A  1 197 ? -3.838  -41.053 78.790  1.00 50.54  ?  197  VAL A C   1 
ATOM   1513  O  O   . VAL A  1 197 ? -3.706  -40.507 77.688  1.00 45.34  ?  197  VAL A O   1 
ATOM   1514  C  CB  . VAL A  1 197 ? -2.505  -43.155 78.471  1.00 50.19  ?  197  VAL A CB  1 
ATOM   1515  C  CG1 . VAL A  1 197 ? -1.387  -42.569 79.313  1.00 43.88  ?  197  VAL A CG1 1 
ATOM   1516  C  CG2 . VAL A  1 197 ? -2.513  -44.672 78.589  1.00 45.56  ?  197  VAL A CG2 1 
ATOM   1517  N  N   . THR A  1 198 ? -3.962  -40.376 79.922  1.00 49.38  ?  198  THR A N   1 
ATOM   1518  C  CA  . THR A  1 198 ? -3.941  -38.924 79.968  1.00 48.06  ?  198  THR A CA  1 
ATOM   1519  C  C   . THR A  1 198 ? -2.710  -38.487 80.737  1.00 46.79  ?  198  THR A C   1 
ATOM   1520  O  O   . THR A  1 198 ? -2.549  -38.845 81.908  1.00 46.51  ?  198  THR A O   1 
ATOM   1521  C  CB  . THR A  1 198 ? -5.204  -38.370 80.619  1.00 45.02  ?  198  THR A CB  1 
ATOM   1522  O  OG1 . THR A  1 198 ? -6.351  -38.847 79.907  1.00 55.11  ?  198  THR A OG1 1 
ATOM   1523  C  CG2 . THR A  1 198 ? -5.184  -36.858 80.587  1.00 44.86  ?  198  THR A CG2 1 
ATOM   1524  N  N   . LEU A  1 199 ? -1.835  -37.740 80.070  1.00 45.83  ?  199  LEU A N   1 
ATOM   1525  C  CA  . LEU A  1 199 ? -0.748  -37.064 80.753  1.00 44.17  ?  199  LEU A CA  1 
ATOM   1526  C  C   . LEU A  1 199 ? -1.282  -35.808 81.421  1.00 46.76  ?  199  LEU A C   1 
ATOM   1527  O  O   . LEU A  1 199 ? -2.145  -35.117 80.872  1.00 49.45  ?  199  LEU A O   1 
ATOM   1528  C  CB  . LEU A  1 199 ? 0.358   -36.687 79.772  1.00 42.02  ?  199  LEU A CB  1 
ATOM   1529  C  CG  . LEU A  1 199 ? 0.871   -37.776 78.836  1.00 43.11  ?  199  LEU A CG  1 
ATOM   1530  C  CD1 . LEU A  1 199 ? 1.952   -37.213 77.933  1.00 43.00  ?  199  LEU A CD1 1 
ATOM   1531  C  CD2 . LEU A  1 199 ? 1.387   -38.966 79.615  1.00 44.73  ?  199  LEU A CD2 1 
ATOM   1532  N  N   . PHE A  1 200 ? -0.782  -35.526 82.620  1.00 46.27  ?  200  PHE A N   1 
ATOM   1533  C  CA  . PHE A  1 200 ? -1.017  -34.234 83.242  1.00 46.36  ?  200  PHE A CA  1 
ATOM   1534  C  C   . PHE A  1 200 ? 0.193   -33.863 84.083  1.00 44.11  ?  200  PHE A C   1 
ATOM   1535  O  O   . PHE A  1 200 ? 0.820   -34.722 84.712  1.00 43.20  ?  200  PHE A O   1 
ATOM   1536  C  CB  . PHE A  1 200 ? -2.318  -34.216 84.061  1.00 49.09  ?  200  PHE A CB  1 
ATOM   1537  C  CG  . PHE A  1 200 ? -2.277  -35.010 85.333  1.00 51.75  ?  200  PHE A CG  1 
ATOM   1538  C  CD1 . PHE A  1 200 ? -1.933  -36.351 85.331  1.00 54.63  ?  200  PHE A CD1 1 
ATOM   1539  C  CD2 . PHE A  1 200 ? -2.668  -34.428 86.525  1.00 52.35  ?  200  PHE A CD2 1 
ATOM   1540  C  CE1 . PHE A  1 200 ? -1.929  -37.084 86.504  1.00 56.01  ?  200  PHE A CE1 1 
ATOM   1541  C  CE2 . PHE A  1 200 ? -2.674  -35.155 87.700  1.00 54.33  ?  200  PHE A CE2 1 
ATOM   1542  C  CZ  . PHE A  1 200 ? -2.299  -36.484 87.691  1.00 55.50  ?  200  PHE A CZ  1 
ATOM   1543  N  N   . GLY A  1 201 ? 0.533   -32.576 84.051  1.00 44.09  ?  201  GLY A N   1 
ATOM   1544  C  CA  . GLY A  1 201 ? 1.703   -32.077 84.742  1.00 44.17  ?  201  GLY A CA  1 
ATOM   1545  C  C   . GLY A  1 201 ? 1.538   -30.609 85.063  1.00 45.65  ?  201  GLY A C   1 
ATOM   1546  O  O   . GLY A  1 201 ? 0.625   -29.937 84.576  1.00 46.59  ?  201  GLY A O   1 
ATOM   1547  N  N   . GLU A  1 202 ? 2.443   -30.120 85.901  1.00 46.77  ?  202  GLU A N   1 
ATOM   1548  C  CA  . GLU A  1 202 ? 2.422   -28.745 86.370  1.00 48.48  ?  202  GLU A CA  1 
ATOM   1549  C  C   . GLU A  1 202 ? 3.824   -28.172 86.243  1.00 48.99  ?  202  GLU A C   1 
ATOM   1550  O  O   . GLU A  1 202 ? 4.813   -28.901 86.347  1.00 49.11  ?  202  GLU A O   1 
ATOM   1551  C  CB  . GLU A  1 202 ? 1.936   -28.659 87.828  1.00 49.25  ?  202  GLU A CB  1 
ATOM   1552  C  CG  . GLU A  1 202 ? 1.519   -27.273 88.286  1.00 50.93  ?  202  GLU A CG  1 
ATOM   1553  C  CD  . GLU A  1 202 ? 2.654   -26.495 88.926  1.00 51.13  ?  202  GLU A CD  1 
ATOM   1554  O  OE1 . GLU A  1 202 ? 3.694   -27.112 89.233  1.00 51.38  ?  202  GLU A OE1 1 
ATOM   1555  O  OE2 . GLU A  1 202 ? 2.505   -25.273 89.133  1.00 50.24  ?  202  GLU A OE2 1 
ATOM   1556  N  N   . SER A  1 203 ? 3.900   -26.864 86.005  1.00 48.88  ?  203  SER A N   1 
ATOM   1557  C  CA  . SER A  1 203 ? 5.177   -26.145 85.858  1.00 47.00  ?  203  SER A CA  1 
ATOM   1558  C  C   . SER A  1 203 ? 5.975   -26.836 84.752  1.00 44.87  ?  203  SER A C   1 
ATOM   1559  O  O   . SER A  1 203 ? 5.431   -27.060 83.658  1.00 41.19  ?  203  SER A O   1 
ATOM   1560  C  CB  . SER A  1 203 ? 5.877   -26.055 87.215  1.00 45.74  ?  203  SER A CB  1 
ATOM   1561  O  OG  . SER A  1 203 ? 7.127   -25.387 87.113  1.00 46.87  ?  203  SER A OG  1 
ATOM   1562  N  N   . ALA A  1 204 ? 7.239   -27.194 84.985  1.00 46.69  ?  204  ALA A N   1 
ATOM   1563  C  CA  . ALA A  1 204 ? 8.025   -27.872 83.961  1.00 47.06  ?  204  ALA A CA  1 
ATOM   1564  C  C   . ALA A  1 204 ? 7.395   -29.191 83.547  1.00 48.74  ?  204  ALA A C   1 
ATOM   1565  O  O   . ALA A  1 204 ? 7.632   -29.661 82.431  1.00 50.37  ?  204  ALA A O   1 
ATOM   1566  C  CB  . ALA A  1 204 ? 9.447   -28.113 84.461  1.00 46.35  ?  204  ALA A CB  1 
ATOM   1567  N  N   . GLY A  1 205 ? 6.620   -29.819 84.433  1.00 48.12  ?  205  GLY A N   1 
ATOM   1568  C  CA  . GLY A  1 205 ? 5.918   -31.028 84.040  1.00 47.08  ?  205  GLY A CA  1 
ATOM   1569  C  C   . GLY A  1 205 ? 4.932   -30.765 82.922  1.00 49.30  ?  205  GLY A C   1 
ATOM   1570  O  O   . GLY A  1 205 ? 4.804   -31.562 81.988  1.00 52.85  ?  205  GLY A O   1 
ATOM   1571  N  N   . ALA A  1 206 ? 4.239   -29.629 82.992  1.00 49.36  ?  206  ALA A N   1 
ATOM   1572  C  CA  . ALA A  1 206 ? 3.296   -29.278 81.940  1.00 51.09  ?  206  ALA A CA  1 
ATOM   1573  C  C   . ALA A  1 206 ? 4.028   -28.968 80.643  1.00 50.48  ?  206  ALA A C   1 
ATOM   1574  O  O   . ALA A  1 206 ? 3.579   -29.356 79.557  1.00 51.42  ?  206  ALA A O   1 
ATOM   1575  C  CB  . ALA A  1 206 ? 2.437   -28.095 82.384  1.00 53.88  ?  206  ALA A CB  1 
ATOM   1576  N  N   . ALA A  1 207 ? 5.163   -28.272 80.737  1.00 48.39  ?  207  ALA A N   1 
ATOM   1577  C  CA  . ALA A  1 207 ? 6.001   -28.068 79.563  1.00 47.21  ?  207  ALA A CA  1 
ATOM   1578  C  C   . ALA A  1 207 ? 6.417   -29.402 78.957  1.00 48.10  ?  207  ALA A C   1 
ATOM   1579  O  O   . ALA A  1 207 ? 6.395   -29.572 77.732  1.00 50.91  ?  207  ALA A O   1 
ATOM   1580  C  CB  . ALA A  1 207 ? 7.227   -27.236 79.935  1.00 46.69  ?  207  ALA A CB  1 
ATOM   1581  N  N   . SER A  1 208 ? 6.779   -30.364 79.808  1.00 46.31  ?  208  SER A N   1 
ATOM   1582  C  CA  . SER A  1 208 ? 7.098   -31.710 79.345  1.00 45.59  ?  208  SER A CA  1 
ATOM   1583  C  C   . SER A  1 208 ? 5.932   -32.315 78.577  1.00 44.07  ?  208  SER A C   1 
ATOM   1584  O  O   . SER A  1 208 ? 6.110   -32.841 77.473  1.00 44.66  ?  208  SER A O   1 
ATOM   1585  C  CB  . SER A  1 208 ? 7.475   -32.597 80.532  1.00 45.20  ?  208  SER A CB  1 
ATOM   1586  O  OG  . SER A  1 208 ? 8.611   -32.099 81.215  1.00 44.55  ?  208  SER A OG  1 
ATOM   1587  N  N   . VAL A  1 209 ? 4.729   -32.256 79.154  1.00 42.96  ?  209  VAL A N   1 
ATOM   1588  C  CA  . VAL A  1 209 ? 3.542   -32.761 78.467  1.00 45.46  ?  209  VAL A CA  1 
ATOM   1589  C  C   . VAL A  1 209 ? 3.429   -32.133 77.087  1.00 48.43  ?  209  VAL A C   1 
ATOM   1590  O  O   . VAL A  1 209 ? 3.250   -32.823 76.075  1.00 50.42  ?  209  VAL A O   1 
ATOM   1591  C  CB  . VAL A  1 209 ? 2.281   -32.489 79.305  1.00 47.80  ?  209  VAL A CB  1 
ATOM   1592  C  CG1 . VAL A  1 209 ? 1.051   -32.921 78.538  1.00 49.66  ?  209  VAL A CG1 1 
ATOM   1593  C  CG2 . VAL A  1 209 ? 2.363   -33.200 80.646  1.00 48.09  ?  209  VAL A CG2 1 
ATOM   1594  N  N   . GLY A  1 210 ? 3.548   -30.806 77.031  1.00 51.56  ?  210  GLY A N   1 
ATOM   1595  C  CA  . GLY A  1 210 ? 3.489   -30.120 75.752  1.00 55.19  ?  210  GLY A CA  1 
ATOM   1596  C  C   . GLY A  1 210 ? 4.544   -30.603 74.777  1.00 56.88  ?  210  GLY A C   1 
ATOM   1597  O  O   . GLY A  1 210 ? 4.302   -30.672 73.568  1.00 62.39  ?  210  GLY A O   1 
ATOM   1598  N  N   . MET A  1 211 ? 5.724   -30.961 75.283  1.00 51.52  ?  211  MET A N   1 
ATOM   1599  C  CA  . MET A  1 211 ? 6.774   -31.419 74.384  1.00 48.60  ?  211  MET A CA  1 
ATOM   1600  C  C   . MET A  1 211 ? 6.535   -32.849 73.918  1.00 47.40  ?  211  MET A C   1 
ATOM   1601  O  O   . MET A  1 211 ? 6.976   -33.222 72.828  1.00 49.98  ?  211  MET A O   1 
ATOM   1602  C  CB  . MET A  1 211 ? 8.133   -31.282 75.059  1.00 46.53  ?  211  MET A CB  1 
ATOM   1603  C  CG  . MET A  1 211 ? 8.507   -29.842 75.288  1.00 47.43  ?  211  MET A CG  1 
ATOM   1604  S  SD  . MET A  1 211 ? 10.064  -29.657 76.141  1.00 47.26  ?  211  MET A SD  1 
ATOM   1605  C  CE  . MET A  1 211 ? 10.020  -27.907 76.478  1.00 50.00  ?  211  MET A CE  1 
ATOM   1606  N  N   . HIS A  1 212 ? 5.840   -33.661 74.715  1.00 45.39  ?  212  HIS A N   1 
ATOM   1607  C  CA  . HIS A  1 212 ? 5.432   -34.969 74.221  1.00 46.73  ?  212  HIS A CA  1 
ATOM   1608  C  C   . HIS A  1 212 ? 4.335   -34.838 73.174  1.00 49.07  ?  212  HIS A C   1 
ATOM   1609  O  O   . HIS A  1 212 ? 4.265   -35.655 72.250  1.00 49.33  ?  212  HIS A O   1 
ATOM   1610  C  CB  . HIS A  1 212 ? 4.967   -35.864 75.371  1.00 45.68  ?  212  HIS A CB  1 
ATOM   1611  C  CG  . HIS A  1 212 ? 6.060   -36.243 76.320  1.00 43.25  ?  212  HIS A CG  1 
ATOM   1612  N  ND1 . HIS A  1 212 ? 7.153   -36.987 75.935  1.00 44.53  ?  212  HIS A ND1 1 
ATOM   1613  C  CD2 . HIS A  1 212 ? 6.231   -35.976 77.636  1.00 43.68  ?  212  HIS A CD2 1 
ATOM   1614  C  CE1 . HIS A  1 212 ? 7.952   -37.161 76.973  1.00 47.27  ?  212  HIS A CE1 1 
ATOM   1615  N  NE2 . HIS A  1 212 ? 7.414   -36.558 78.018  1.00 45.73  ?  212  HIS A NE2 1 
ATOM   1616  N  N   . ILE A  1 213 ? 3.480   -33.818 73.298  1.00 47.27  ?  213  ILE A N   1 
ATOM   1617  C  CA  . ILE A  1 213 ? 2.510   -33.541 72.243  1.00 49.14  ?  213  ILE A CA  1 
ATOM   1618  C  C   . ILE A  1 213 ? 3.219   -33.241 70.927  1.00 50.42  ?  213  ILE A C   1 
ATOM   1619  O  O   . ILE A  1 213 ? 2.799   -33.704 69.860  1.00 52.33  ?  213  ILE A O   1 
ATOM   1620  C  CB  . ILE A  1 213 ? 1.585   -32.383 72.659  1.00 51.33  ?  213  ILE A CB  1 
ATOM   1621  C  CG1 . ILE A  1 213 ? 0.662   -32.818 73.794  1.00 53.03  ?  213  ILE A CG1 1 
ATOM   1622  C  CG2 . ILE A  1 213 ? 0.780   -31.881 71.471  1.00 52.24  ?  213  ILE A CG2 1 
ATOM   1623  C  CD1 . ILE A  1 213 ? -0.296  -31.735 74.243  1.00 53.96  ?  213  ILE A CD1 1 
ATOM   1624  N  N   . LEU A  1 214 ? 4.310   -32.475 70.981  1.00 48.53  ?  214  LEU A N   1 
ATOM   1625  C  CA  . LEU A  1 214 ? 4.991   -32.002 69.783  1.00 47.77  ?  214  LEU A CA  1 
ATOM   1626  C  C   . LEU A  1 214 ? 6.072   -32.948 69.273  1.00 48.47  ?  214  LEU A C   1 
ATOM   1627  O  O   . LEU A  1 214 ? 6.639   -32.689 68.204  1.00 50.44  ?  214  LEU A O   1 
ATOM   1628  C  CB  . LEU A  1 214 ? 5.609   -30.625 70.045  1.00 47.38  ?  214  LEU A CB  1 
ATOM   1629  C  CG  . LEU A  1 214 ? 4.647   -29.525 70.496  1.00 47.69  ?  214  LEU A CG  1 
ATOM   1630  C  CD1 . LEU A  1 214 ? 5.415   -28.292 70.934  1.00 47.47  ?  214  LEU A CD1 1 
ATOM   1631  C  CD2 . LEU A  1 214 ? 3.671   -29.177 69.381  1.00 48.22  ?  214  LEU A CD2 1 
ATOM   1632  N  N   . SER A  1 215 ? 6.374   -34.025 69.993  1.00 48.28  ?  215  SER A N   1 
ATOM   1633  C  CA  . SER A  1 215 ? 7.394   -34.987 69.587  1.00 49.66  ?  215  SER A CA  1 
ATOM   1634  C  C   . SER A  1 215 ? 6.709   -36.263 69.111  1.00 54.00  ?  215  SER A C   1 
ATOM   1635  O  O   . SER A  1 215 ? 6.019   -36.927 69.893  1.00 56.95  ?  215  SER A O   1 
ATOM   1636  C  CB  . SER A  1 215 ? 8.353   -35.278 70.740  1.00 46.87  ?  215  SER A CB  1 
ATOM   1637  O  OG  . SER A  1 215 ? 9.301   -36.261 70.372  1.00 47.35  ?  215  SER A OG  1 
ATOM   1638  N  N   . LEU A  1 216 ? 6.905   -36.606 67.834  1.00 54.71  ?  216  LEU A N   1 
ATOM   1639  C  CA  . LEU A  1 216 ? 6.158   -37.712 67.232  1.00 54.24  ?  216  LEU A CA  1 
ATOM   1640  C  C   . LEU A  1 216 ? 6.361   -39.040 67.952  1.00 52.37  ?  216  LEU A C   1 
ATOM   1641  O  O   . LEU A  1 216 ? 5.360   -39.741 68.184  1.00 51.85  ?  216  LEU A O   1 
ATOM   1642  C  CB  . LEU A  1 216 ? 6.506   -37.814 65.739  1.00 56.82  ?  216  LEU A CB  1 
ATOM   1643  C  CG  . LEU A  1 216 ? 5.801   -38.808 64.796  1.00 57.43  ?  216  LEU A CG  1 
ATOM   1644  C  CD1 . LEU A  1 216 ? 6.519   -40.149 64.737  1.00 60.04  ?  216  LEU A CD1 1 
ATOM   1645  C  CD2 . LEU A  1 216 ? 4.330   -38.998 65.151  1.00 51.82  ?  216  LEU A CD2 1 
ATOM   1646  N  N   . PRO A  1 217 ? 7.582   -39.457 68.321  1.00 53.43  ?  217  PRO A N   1 
ATOM   1647  C  CA  . PRO A  1 217 ? 7.719   -40.743 69.031  1.00 53.60  ?  217  PRO A CA  1 
ATOM   1648  C  C   . PRO A  1 217 ? 6.905   -40.836 70.308  1.00 52.75  ?  217  PRO A C   1 
ATOM   1649  O  O   . PRO A  1 217 ? 6.451   -41.933 70.659  1.00 51.38  ?  217  PRO A O   1 
ATOM   1650  C  CB  . PRO A  1 217 ? 9.225   -40.826 69.314  1.00 53.00  ?  217  PRO A CB  1 
ATOM   1651  C  CG  . PRO A  1 217 ? 9.838   -40.060 68.200  1.00 54.09  ?  217  PRO A CG  1 
ATOM   1652  C  CD  . PRO A  1 217 ? 8.902   -38.910 67.949  1.00 54.35  ?  217  PRO A CD  1 
ATOM   1653  N  N   . SER A  1 218 ? 6.689   -39.718 71.005  1.00 54.06  ?  218  SER A N   1 
ATOM   1654  C  CA  . SER A  1 218 ? 5.900   -39.737 72.234  1.00 53.09  ?  218  SER A CA  1 
ATOM   1655  C  C   . SER A  1 218 ? 4.399   -39.784 71.972  1.00 56.25  ?  218  SER A C   1 
ATOM   1656  O  O   . SER A  1 218 ? 3.647   -40.257 72.830  1.00 58.36  ?  218  SER A O   1 
ATOM   1657  C  CB  . SER A  1 218 ? 6.232   -38.514 73.090  1.00 48.07  ?  218  SER A CB  1 
ATOM   1658  O  OG  . SER A  1 218 ? 7.598   -38.512 73.459  1.00 45.91  ?  218  SER A OG  1 
ATOM   1659  N  N   . ARG A  1 219 ? 3.949   -39.307 70.805  1.00 56.59  ?  219  ARG A N   1 
ATOM   1660  C  CA  . ARG A  1 219 ? 2.515   -39.152 70.567  1.00 57.15  ?  219  ARG A CA  1 
ATOM   1661  C  C   . ARG A  1 219 ? 1.787   -40.490 70.594  1.00 59.42  ?  219  ARG A C   1 
ATOM   1662  O  O   . ARG A  1 219 ? 0.599   -40.548 70.931  1.00 58.30  ?  219  ARG A O   1 
ATOM   1663  C  CB  . ARG A  1 219 ? 2.263   -38.448 69.232  1.00 59.51  ?  219  ARG A CB  1 
ATOM   1664  C  CG  . ARG A  1 219 ? 2.147   -36.934 69.310  1.00 62.38  ?  219  ARG A CG  1 
ATOM   1665  C  CD  . ARG A  1 219 ? 1.144   -36.499 70.374  1.00 67.10  ?  219  ARG A CD  1 
ATOM   1666  N  NE  . ARG A  1 219 ? -0.193  -36.190 69.864  1.00 71.36  ?  219  ARG A NE  1 
ATOM   1667  C  CZ  . ARG A  1 219 ? -1.275  -36.941 70.078  1.00 72.81  ?  219  ARG A CZ  1 
ATOM   1668  N  NH1 . ARG A  1 219 ? -1.198  -38.062 70.793  1.00 70.03  ?  219  ARG A NH1 1 
ATOM   1669  N  NH2 . ARG A  1 219 ? -2.444  -36.565 69.583  1.00 75.86  ?  219  ARG A NH2 1 
ATOM   1670  N  N   . SER A  1 220 ? 2.472   -41.574 70.235  1.00 63.41  ?  220  SER A N   1 
ATOM   1671  C  CA  . SER A  1 220 ? 1.842   -42.886 70.159  1.00 66.21  ?  220  SER A CA  1 
ATOM   1672  C  C   . SER A  1 220 ? 1.631   -43.523 71.525  1.00 66.64  ?  220  SER A C   1 
ATOM   1673  O  O   . SER A  1 220 ? 1.037   -44.604 71.598  1.00 71.57  ?  220  SER A O   1 
ATOM   1674  C  CB  . SER A  1 220 ? 2.684   -43.815 69.283  1.00 67.73  ?  220  SER A CB  1 
ATOM   1675  O  OG  . SER A  1 220 ? 2.988   -43.180 68.053  1.00 70.27  ?  220  SER A OG  1 
ATOM   1676  N  N   . LEU A  1 221 ? 2.140   -42.905 72.588  1.00 60.66  ?  221  LEU A N   1 
ATOM   1677  C  CA  . LEU A  1 221 ? 2.069   -43.439 73.940  1.00 56.04  ?  221  LEU A CA  1 
ATOM   1678  C  C   . LEU A  1 221 ? 0.951   -42.835 74.785  1.00 56.24  ?  221  LEU A C   1 
ATOM   1679  O  O   . LEU A  1 221 ? 0.791   -43.237 75.942  1.00 58.37  ?  221  LEU A O   1 
ATOM   1680  C  CB  . LEU A  1 221 ? 3.417   -43.240 74.643  1.00 52.32  ?  221  LEU A CB  1 
ATOM   1681  C  CG  . LEU A  1 221 ? 4.616   -43.756 73.844  1.00 50.11  ?  221  LEU A CG  1 
ATOM   1682  C  CD1 . LEU A  1 221 ? 5.935   -43.349 74.476  1.00 49.45  ?  221  LEU A CD1 1 
ATOM   1683  C  CD2 . LEU A  1 221 ? 4.536   -45.263 73.718  1.00 49.25  ?  221  LEU A CD2 1 
ATOM   1684  N  N   . PHE A  1 222 ? 0.179   -41.887 74.261  1.00 54.68  ?  222  PHE A N   1 
ATOM   1685  C  CA  . PHE A  1 222 ? -0.886  -41.285 75.057  1.00 53.24  ?  222  PHE A CA  1 
ATOM   1686  C  C   . PHE A  1 222 ? -1.952  -40.715 74.127  1.00 55.52  ?  222  PHE A C   1 
ATOM   1687  O  O   . PHE A  1 222 ? -1.825  -40.751 72.898  1.00 61.04  ?  222  PHE A O   1 
ATOM   1688  C  CB  . PHE A  1 222 ? -0.337  -40.215 76.009  1.00 50.52  ?  222  PHE A CB  1 
ATOM   1689  C  CG  . PHE A  1 222 ? 0.154   -38.969 75.322  1.00 47.81  ?  222  PHE A CG  1 
ATOM   1690  C  CD1 . PHE A  1 222 ? 1.398   -38.939 74.713  1.00 46.50  ?  222  PHE A CD1 1 
ATOM   1691  C  CD2 . PHE A  1 222 ? -0.624  -37.820 75.300  1.00 46.00  ?  222  PHE A CD2 1 
ATOM   1692  C  CE1 . PHE A  1 222 ? 1.855   -37.792 74.087  1.00 45.10  ?  222  PHE A CE1 1 
ATOM   1693  C  CE2 . PHE A  1 222 ? -0.173  -36.674 74.674  1.00 45.33  ?  222  PHE A CE2 1 
ATOM   1694  C  CZ  . PHE A  1 222 ? 1.068   -36.659 74.068  1.00 44.05  ?  222  PHE A CZ  1 
ATOM   1695  N  N   . HIS A  1 223 ? -3.005  -40.167 74.739  1.00 52.01  ?  223  HIS A N   1 
ATOM   1696  C  CA  . HIS A  1 223 ? -4.242  -39.788 74.060  1.00 52.27  ?  223  HIS A CA  1 
ATOM   1697  C  C   . HIS A  1 223 ? -4.658  -38.354 74.370  1.00 53.93  ?  223  HIS A C   1 
ATOM   1698  O  O   . HIS A  1 223 ? -4.893  -37.561 73.455  1.00 56.03  ?  223  HIS A O   1 
ATOM   1699  C  CB  . HIS A  1 223 ? -5.343  -40.785 74.413  1.00 52.66  ?  223  HIS A CB  1 
ATOM   1700  C  CG  . HIS A  1 223 ? -4.967  -42.202 74.115  1.00 54.30  ?  223  HIS A CG  1 
ATOM   1701  N  ND1 . HIS A  1 223 ? -4.241  -42.980 74.990  1.00 54.89  ?  223  HIS A ND1 1 
ATOM   1702  C  CD2 . HIS A  1 223 ? -5.177  -42.966 73.016  1.00 56.40  ?  223  HIS A CD2 1 
ATOM   1703  C  CE1 . HIS A  1 223 ? -4.037  -44.169 74.452  1.00 56.26  ?  223  HIS A CE1 1 
ATOM   1704  N  NE2 . HIS A  1 223 ? -4.597  -44.188 73.255  1.00 57.16  ?  223  HIS A NE2 1 
ATOM   1705  N  N   . ARG A  1 224 ? -4.820  -38.032 75.651  1.00 54.98  ?  224  ARG A N   1 
ATOM   1706  C  CA  . ARG A  1 224 ? -5.193  -36.700 76.108  1.00 57.08  ?  224  ARG A CA  1 
ATOM   1707  C  C   . ARG A  1 224 ? -4.057  -36.091 76.923  1.00 55.39  ?  224  ARG A C   1 
ATOM   1708  O  O   . ARG A  1 224 ? -3.150  -36.793 77.379  1.00 56.25  ?  224  ARG A O   1 
ATOM   1709  C  CB  . ARG A  1 224 ? -6.471  -36.750 76.952  1.00 60.19  ?  224  ARG A CB  1 
ATOM   1710  C  CG  . ARG A  1 224 ? -7.726  -37.046 76.158  1.00 63.41  ?  224  ARG A CG  1 
ATOM   1711  C  CD  . ARG A  1 224 ? -8.752  -37.795 76.996  1.00 65.24  ?  224  ARG A CD  1 
ATOM   1712  N  NE  . ARG A  1 224 ? -8.553  -39.240 76.939  1.00 66.91  ?  224  ARG A NE  1 
ATOM   1713  C  CZ  . ARG A  1 224 ? -8.998  -40.010 75.948  1.00 70.92  ?  224  ARG A CZ  1 
ATOM   1714  N  NH1 . ARG A  1 224 ? -9.674  -39.472 74.940  1.00 73.67  ?  224  ARG A NH1 1 
ATOM   1715  N  NH2 . ARG A  1 224 ? -8.775  -41.318 75.965  1.00 71.79  ?  224  ARG A NH2 1 
ATOM   1716  N  N   . ALA A  1 225 ? -4.093  -34.766 77.078  1.00 52.70  ?  225  ALA A N   1 
ATOM   1717  C  CA  . ALA A  1 225 ? -3.056  -34.057 77.816  1.00 50.69  ?  225  ALA A CA  1 
ATOM   1718  C  C   . ALA A  1 225 ? -3.663  -32.930 78.644  1.00 50.45  ?  225  ALA A C   1 
ATOM   1719  O  O   . ALA A  1 225 ? -4.645  -32.299 78.243  1.00 51.97  ?  225  ALA A O   1 
ATOM   1720  C  CB  . ALA A  1 225 ? -1.992  -33.489 76.874  1.00 43.88  ?  225  ALA A CB  1 
ATOM   1721  N  N   . VAL A  1 226 ? -3.057  -32.679 79.807  1.00 47.90  ?  226  VAL A N   1 
ATOM   1722  C  CA  . VAL A  1 226 ? -3.453  -31.598 80.704  1.00 46.41  ?  226  VAL A CA  1 
ATOM   1723  C  C   . VAL A  1 226 ? -2.199  -30.823 81.070  1.00 48.20  ?  226  VAL A C   1 
ATOM   1724  O  O   . VAL A  1 226 ? -1.254  -31.400 81.620  1.00 47.91  ?  226  VAL A O   1 
ATOM   1725  C  CB  . VAL A  1 226 ? -4.141  -32.110 81.981  1.00 45.10  ?  226  VAL A CB  1 
ATOM   1726  C  CG1 . VAL A  1 226 ? -4.657  -30.944 82.809  1.00 44.40  ?  226  VAL A CG1 1 
ATOM   1727  C  CG2 . VAL A  1 226 ? -5.259  -33.071 81.657  1.00 45.04  ?  226  VAL A CG2 1 
ATOM   1728  N  N   . LEU A  1 227 ? -2.192  -29.523 80.785  1.00 50.66  ?  227  LEU A N   1 
ATOM   1729  C  CA  . LEU A  1 227 ? -1.049  -28.661 81.075  1.00 50.44  ?  227  LEU A CA  1 
ATOM   1730  C  C   . LEU A  1 227 ? -1.464  -27.627 82.117  1.00 52.79  ?  227  LEU A C   1 
ATOM   1731  O  O   . LEU A  1 227 ? -2.282  -26.743 81.833  1.00 53.50  ?  227  LEU A O   1 
ATOM   1732  C  CB  . LEU A  1 227 ? -0.535  -27.989 79.803  1.00 48.70  ?  227  LEU A CB  1 
ATOM   1733  C  CG  . LEU A  1 227 ? 0.127   -28.864 78.739  1.00 47.61  ?  227  LEU A CG  1 
ATOM   1734  C  CD1 . LEU A  1 227 ? -0.907  -29.471 77.812  1.00 48.53  ?  227  LEU A CD1 1 
ATOM   1735  C  CD2 . LEU A  1 227 ? 1.116   -28.043 77.944  1.00 48.01  ?  227  LEU A CD2 1 
ATOM   1736  N  N   . GLN A  1 228 ? -0.893  -27.731 83.316  1.00 53.97  ?  228  GLN A N   1 
ATOM   1737  C  CA  . GLN A  1 228 ? -1.224  -26.852 84.436  1.00 53.98  ?  228  GLN A CA  1 
ATOM   1738  C  C   . GLN A  1 228 ? -0.067  -25.886 84.668  1.00 54.85  ?  228  GLN A C   1 
ATOM   1739  O  O   . GLN A  1 228 ? 0.993   -26.286 85.164  1.00 55.31  ?  228  GLN A O   1 
ATOM   1740  C  CB  . GLN A  1 228 ? -1.511  -27.665 85.698  1.00 51.58  ?  228  GLN A CB  1 
ATOM   1741  C  CG  . GLN A  1 228 ? -2.443  -28.848 85.484  1.00 50.49  ?  228  GLN A CG  1 
ATOM   1742  C  CD  . GLN A  1 228 ? -2.686  -29.639 86.759  1.00 49.57  ?  228  GLN A CD  1 
ATOM   1743  O  OE1 . GLN A  1 228 ? -3.424  -30.626 86.763  1.00 48.29  ?  228  GLN A OE1 1 
ATOM   1744  N  NE2 . GLN A  1 228 ? -2.051  -29.217 87.845  1.00 50.21  ?  228  GLN A NE2 1 
ATOM   1745  N  N   . SER A  1 229 ? -0.280  -24.614 84.330  1.00 53.85  ?  229  SER A N   1 
ATOM   1746  C  CA  . SER A  1 229 ? 0.695   -23.554 84.588  1.00 51.05  ?  229  SER A CA  1 
ATOM   1747  C  C   . SER A  1 229 ? 2.062   -23.890 83.995  1.00 48.78  ?  229  SER A C   1 
ATOM   1748  O  O   . SER A  1 229 ? 3.097   -23.796 84.660  1.00 47.75  ?  229  SER A O   1 
ATOM   1749  C  CB  . SER A  1 229 ? 0.810   -23.275 86.088  1.00 50.14  ?  229  SER A CB  1 
ATOM   1750  O  OG  . SER A  1 229 ? -0.456  -22.977 86.644  1.00 51.02  ?  229  SER A OG  1 
ATOM   1751  N  N   . GLY A  1 230 ? 2.060   -24.298 82.734  1.00 47.21  ?  230  GLY A N   1 
ATOM   1752  C  CA  . GLY A  1 230 ? 3.313   -24.504 82.024  1.00 46.04  ?  230  GLY A CA  1 
ATOM   1753  C  C   . GLY A  1 230 ? 3.037   -24.837 80.573  1.00 46.60  ?  230  GLY A C   1 
ATOM   1754  O  O   . GLY A  1 230 ? 1.959   -25.329 80.216  1.00 46.37  ?  230  GLY A O   1 
ATOM   1755  N  N   . THR A  1 231 ? 4.038   -24.564 79.739  1.00 47.81  ?  231  THR A N   1 
ATOM   1756  C  CA  . THR A  1 231 ? 3.898   -24.690 78.296  1.00 49.95  ?  231  THR A CA  1 
ATOM   1757  C  C   . THR A  1 231 ? 5.232   -25.088 77.688  1.00 48.23  ?  231  THR A C   1 
ATOM   1758  O  O   . THR A  1 231 ? 6.284   -24.711 78.216  1.00 47.89  ?  231  THR A O   1 
ATOM   1759  C  CB  . THR A  1 231 ? 3.412   -23.374 77.666  1.00 55.11  ?  231  THR A CB  1 
ATOM   1760  O  OG1 . THR A  1 231 ? 4.126   -22.274 78.251  1.00 57.77  ?  231  THR A OG1 1 
ATOM   1761  C  CG2 . THR A  1 231 ? 1.919   -23.183 77.876  1.00 56.07  ?  231  THR A CG2 1 
ATOM   1762  N  N   . PRO A  1 232 ? 5.227   -25.840 76.579  1.00 47.31  ?  232  PRO A N   1 
ATOM   1763  C  CA  . PRO A  1 232 ? 6.500   -26.096 75.886  1.00 46.73  ?  232  PRO A CA  1 
ATOM   1764  C  C   . PRO A  1 232 ? 7.065   -24.844 75.245  1.00 48.59  ?  232  PRO A C   1 
ATOM   1765  O  O   . PRO A  1 232 ? 8.287   -24.646 75.237  1.00 49.78  ?  232  PRO A O   1 
ATOM   1766  C  CB  . PRO A  1 232 ? 6.121   -27.160 74.849  1.00 46.91  ?  232  PRO A CB  1 
ATOM   1767  C  CG  . PRO A  1 232 ? 4.685   -26.891 74.559  1.00 46.53  ?  232  PRO A CG  1 
ATOM   1768  C  CD  . PRO A  1 232 ? 4.076   -26.404 75.851  1.00 46.96  ?  232  PRO A CD  1 
ATOM   1769  N  N   . ASN A  1 233 ? 6.198   -23.996 74.702  1.00 49.78  ?  233  ASN A N   1 
ATOM   1770  C  CA  . ASN A  1 233 ? 6.569   -22.678 74.213  1.00 51.45  ?  233  ASN A CA  1 
ATOM   1771  C  C   . ASN A  1 233 ? 6.825   -21.722 75.379  1.00 51.59  ?  233  ASN A C   1 
ATOM   1772  O  O   . ASN A  1 233 ? 6.453   -21.979 76.528  1.00 50.71  ?  233  ASN A O   1 
ATOM   1773  C  CB  . ASN A  1 233 ? 5.468   -22.115 73.317  1.00 52.25  ?  233  ASN A CB  1 
ATOM   1774  C  CG  . ASN A  1 233 ? 4.125   -22.075 74.014  1.00 51.10  ?  233  ASN A CG  1 
ATOM   1775  O  OD1 . ASN A  1 233 ? 3.674   -23.078 74.559  1.00 49.27  ?  233  ASN A OD1 1 
ATOM   1776  N  ND2 . ASN A  1 233 ? 3.493   -20.906 74.028  1.00 52.33  ?  233  ASN A ND2 1 
ATOM   1777  N  N   . GLY A  1 234 ? 7.461   -20.598 75.067  1.00 51.95  ?  234  GLY A N   1 
ATOM   1778  C  CA  . GLY A  1 234 ? 7.679   -19.558 76.044  1.00 52.20  ?  234  GLY A CA  1 
ATOM   1779  C  C   . GLY A  1 234 ? 9.125   -19.371 76.452  1.00 52.23  ?  234  GLY A C   1 
ATOM   1780  O  O   . GLY A  1 234 ? 10.034  -20.048 75.957  1.00 53.71  ?  234  GLY A O   1 
ATOM   1781  N  N   . PRO A  1 235 ? 9.362   -18.398 77.343  1.00 50.71  ?  235  PRO A N   1 
ATOM   1782  C  CA  . PRO A  1 235 ? 10.746  -17.959 77.597  1.00 46.10  ?  235  PRO A CA  1 
ATOM   1783  C  C   . PRO A  1 235 ? 11.605  -18.942 78.380  1.00 45.48  ?  235  PRO A C   1 
ATOM   1784  O  O   . PRO A  1 235 ? 12.814  -19.022 78.124  1.00 51.68  ?  235  PRO A O   1 
ATOM   1785  C  CB  . PRO A  1 235 ? 10.553  -16.643 78.361  1.00 46.70  ?  235  PRO A CB  1 
ATOM   1786  C  CG  . PRO A  1 235 ? 9.224   -16.779 79.014  1.00 46.27  ?  235  PRO A CG  1 
ATOM   1787  C  CD  . PRO A  1 235 ? 8.374   -17.602 78.094  1.00 49.48  ?  235  PRO A CD  1 
ATOM   1788  N  N   . TRP A  1 236 ? 11.050  -19.645 79.369  1.00 48.21  ?  236  TRP A N   1 
ATOM   1789  C  CA  . TRP A  1 236 ? 11.882  -20.439 80.268  1.00 48.73  ?  236  TRP A CA  1 
ATOM   1790  C  C   . TRP A  1 236 ? 11.995  -21.921 79.914  1.00 47.28  ?  236  TRP A C   1 
ATOM   1791  O  O   . TRP A  1 236 ? 12.893  -22.590 80.438  1.00 47.68  ?  236  TRP A O   1 
ATOM   1792  C  CB  . TRP A  1 236 ? 11.361  -20.312 81.708  1.00 49.03  ?  236  TRP A CB  1 
ATOM   1793  C  CG  . TRP A  1 236 ? 9.929   -20.733 81.864  1.00 47.81  ?  236  TRP A CG  1 
ATOM   1794  C  CD1 . TRP A  1 236 ? 8.823   -19.945 81.725  1.00 46.97  ?  236  TRP A CD1 1 
ATOM   1795  C  CD2 . TRP A  1 236 ? 9.449   -22.048 82.173  1.00 45.72  ?  236  TRP A CD2 1 
ATOM   1796  N  NE1 . TRP A  1 236 ? 7.685   -20.686 81.936  1.00 45.39  ?  236  TRP A NE1 1 
ATOM   1797  C  CE2 . TRP A  1 236 ? 8.043   -21.980 82.213  1.00 44.76  ?  236  TRP A CE2 1 
ATOM   1798  C  CE3 . TRP A  1 236 ? 10.073  -23.275 82.420  1.00 43.77  ?  236  TRP A CE3 1 
ATOM   1799  C  CZ2 . TRP A  1 236 ? 7.250   -23.094 82.491  1.00 43.55  ?  236  TRP A CZ2 1 
ATOM   1800  C  CZ3 . TRP A  1 236 ? 9.286   -24.376 82.694  1.00 41.72  ?  236  TRP A CZ3 1 
ATOM   1801  C  CH2 . TRP A  1 236 ? 7.889   -24.279 82.728  1.00 41.63  ?  236  TRP A CH2 1 
ATOM   1802  N  N   . ALA A  1 237 ? 11.153  -22.451 79.031  1.00 45.75  ?  237  ALA A N   1 
ATOM   1803  C  CA  . ALA A  1 237 ? 11.021  -23.902 78.948  1.00 45.59  ?  237  ALA A CA  1 
ATOM   1804  C  C   . ALA A  1 237 ? 11.985  -24.555 77.966  1.00 47.61  ?  237  ALA A C   1 
ATOM   1805  O  O   . ALA A  1 237 ? 12.107  -25.786 77.974  1.00 47.14  ?  237  ALA A O   1 
ATOM   1806  C  CB  . ALA A  1 237 ? 9.585   -24.285 78.582  1.00 42.48  ?  237  ALA A CB  1 
ATOM   1807  N  N   . THR A  1 238 ? 12.668  -23.777 77.128  1.00 49.26  ?  238  THR A N   1 
ATOM   1808  C  CA  . THR A  1 238 ? 13.603  -24.321 76.154  1.00 49.21  ?  238  THR A CA  1 
ATOM   1809  C  C   . THR A  1 238 ? 14.812  -23.407 76.058  1.00 47.27  ?  238  THR A C   1 
ATOM   1810  O  O   . THR A  1 238 ? 14.784  -22.252 76.492  1.00 46.87  ?  238  THR A O   1 
ATOM   1811  C  CB  . THR A  1 238 ? 12.976  -24.468 74.759  1.00 51.83  ?  238  THR A CB  1 
ATOM   1812  O  OG1 . THR A  1 238 ? 12.249  -23.278 74.435  1.00 54.39  ?  238  THR A OG1 1 
ATOM   1813  C  CG2 . THR A  1 238 ? 12.034  -25.651 74.711  1.00 51.10  ?  238  THR A CG2 1 
ATOM   1814  N  N   . VAL A  1 239 ? 15.884  -23.945 75.483  1.00 46.09  ?  239  VAL A N   1 
ATOM   1815  C  CA  . VAL A  1 239 ? 17.052  -23.155 75.119  1.00 49.55  ?  239  VAL A CA  1 
ATOM   1816  C  C   . VAL A  1 239 ? 17.494  -23.572 73.723  1.00 49.97  ?  239  VAL A C   1 
ATOM   1817  O  O   . VAL A  1 239 ? 17.227  -24.690 73.274  1.00 47.89  ?  239  VAL A O   1 
ATOM   1818  C  CB  . VAL A  1 239 ? 18.213  -23.310 76.129  1.00 47.56  ?  239  VAL A CB  1 
ATOM   1819  C  CG1 . VAL A  1 239 ? 17.855  -22.676 77.457  1.00 47.03  ?  239  VAL A CG1 1 
ATOM   1820  C  CG2 . VAL A  1 239 ? 18.564  -24.771 76.308  1.00 47.28  ?  239  VAL A CG2 1 
ATOM   1821  N  N   . SER A  1 240 ? 18.168  -22.655 73.032  1.00 49.36  ?  240  SER A N   1 
ATOM   1822  C  CA  . SER A  1 240 ? 18.764  -22.982 71.750  1.00 51.05  ?  240  SER A CA  1 
ATOM   1823  C  C   . SER A  1 240 ? 19.917  -23.961 71.950  1.00 54.51  ?  240  SER A C   1 
ATOM   1824  O  O   . SER A  1 240 ? 20.427  -24.141 73.059  1.00 55.43  ?  240  SER A O   1 
ATOM   1825  C  CB  . SER A  1 240 ? 19.263  -21.726 71.040  1.00 51.87  ?  240  SER A CB  1 
ATOM   1826  O  OG  . SER A  1 240 ? 20.357  -21.147 71.724  1.00 52.54  ?  240  SER A OG  1 
ATOM   1827  N  N   . ALA A  1 241 ? 20.304  -24.627 70.859  1.00 56.59  ?  241  ALA A N   1 
ATOM   1828  C  CA  . ALA A  1 241 ? 21.428  -25.555 70.928  1.00 56.79  ?  241  ALA A CA  1 
ATOM   1829  C  C   . ALA A  1 241 ? 22.708  -24.840 71.348  1.00 58.84  ?  241  ALA A C   1 
ATOM   1830  O  O   . ALA A  1 241 ? 23.471  -25.346 72.184  1.00 59.65  ?  241  ALA A O   1 
ATOM   1831  C  CB  . ALA A  1 241 ? 21.606  -26.253 69.582  1.00 53.81  ?  241  ALA A CB  1 
ATOM   1832  N  N   . GLY A  1 242 ? 22.947  -23.647 70.798  1.00 54.84  ?  242  GLY A N   1 
ATOM   1833  C  CA  . GLY A  1 242 ? 24.158  -22.920 71.139  1.00 60.25  ?  242  GLY A CA  1 
ATOM   1834  C  C   . GLY A  1 242 ? 24.189  -22.473 72.587  1.00 55.35  ?  242  GLY A C   1 
ATOM   1835  O  O   . GLY A  1 242 ? 25.245  -22.481 73.225  1.00 56.21  ?  242  GLY A O   1 
ATOM   1836  N  N   . GLU A  1 243 ? 23.034  -22.077 73.126  1.00 56.77  ?  243  GLU A N   1 
ATOM   1837  C  CA  . GLU A  1 243 ? 22.970  -21.643 74.519  1.00 55.35  ?  243  GLU A CA  1 
ATOM   1838  C  C   . GLU A  1 243 ? 23.229  -22.806 75.468  1.00 52.61  ?  243  GLU A C   1 
ATOM   1839  O  O   . GLU A  1 243 ? 24.011  -22.682 76.418  1.00 53.13  ?  243  GLU A O   1 
ATOM   1840  C  CB  . GLU A  1 243 ? 21.613  -20.995 74.799  1.00 51.97  ?  243  GLU A CB  1 
ATOM   1841  C  CG  . GLU A  1 243 ? 21.380  -20.611 76.244  1.00 58.29  ?  243  GLU A CG  1 
ATOM   1842  C  CD  . GLU A  1 243 ? 22.297  -19.490 76.722  1.00 59.11  ?  243  GLU A CD  1 
ATOM   1843  O  OE1 . GLU A  1 243 ? 23.001  -18.869 75.889  1.00 60.07  ?  243  GLU A OE1 1 
ATOM   1844  O  OE2 . GLU A  1 243 ? 22.321  -19.240 77.948  1.00 57.95  ?  243  GLU A OE2 1 
ATOM   1845  N  N   . ALA A  1 244 ? 22.582  -23.949 75.224  1.00 52.51  ?  244  ALA A N   1 
ATOM   1846  C  CA  . ALA A  1 244 ? 22.846  -25.140 76.025  1.00 53.41  ?  244  ALA A CA  1 
ATOM   1847  C  C   . ALA A  1 244 ? 24.312  -25.548 75.943  1.00 56.80  ?  244  ALA A C   1 
ATOM   1848  O  O   . ALA A  1 244 ? 24.896  -25.999 76.937  1.00 58.47  ?  244  ALA A O   1 
ATOM   1849  C  CB  . ALA A  1 244 ? 21.945  -26.286 75.569  1.00 50.26  ?  244  ALA A CB  1 
ATOM   1850  N  N   . ARG A  1 245 ? 24.927  -25.397 74.766  1.00 54.17  ?  245  ARG A N   1 
ATOM   1851  C  CA  . ARG A  1 245 ? 26.354  -25.681 74.650  1.00 55.97  ?  245  ARG A CA  1 
ATOM   1852  C  C   . ARG A  1 245 ? 27.186  -24.692 75.461  1.00 56.92  ?  245  ARG A C   1 
ATOM   1853  O  O   . ARG A  1 245 ? 28.194  -25.073 76.070  1.00 57.98  ?  245  ARG A O   1 
ATOM   1854  C  CB  . ARG A  1 245 ? 26.774  -25.667 73.180  1.00 58.13  ?  245  ARG A CB  1 
ATOM   1855  C  CG  . ARG A  1 245 ? 28.279  -25.737 72.948  1.00 59.58  ?  245  ARG A CG  1 
ATOM   1856  C  CD  . ARG A  1 245 ? 28.586  -26.039 71.494  1.00 60.93  ?  245  ARG A CD  1 
ATOM   1857  N  NE  . ARG A  1 245 ? 28.141  -27.379 71.130  1.00 60.36  ?  245  ARG A NE  1 
ATOM   1858  C  CZ  . ARG A  1 245 ? 28.889  -28.471 71.255  1.00 61.28  ?  245  ARG A CZ  1 
ATOM   1859  N  NH1 . ARG A  1 245 ? 30.130  -28.380 71.716  1.00 62.87  ?  245  ARG A NH1 1 
ATOM   1860  N  NH2 . ARG A  1 245 ? 28.400  -29.655 70.909  1.00 60.77  ?  245  ARG A NH2 1 
ATOM   1861  N  N   . ARG A  1 246 ? 26.779  -23.419 75.489  1.00 56.70  ?  246  ARG A N   1 
ATOM   1862  C  CA  . ARG A  1 246 ? 27.525  -22.427 76.256  1.00 57.71  ?  246  ARG A CA  1 
ATOM   1863  C  C   . ARG A  1 246 ? 27.443  -22.723 77.748  1.00 62.91  ?  246  ARG A C   1 
ATOM   1864  O  O   . ARG A  1 246 ? 28.452  -22.655 78.461  1.00 66.12  ?  246  ARG A O   1 
ATOM   1865  C  CB  . ARG A  1 246 ? 27.004  -21.017 75.964  1.00 65.25  ?  246  ARG A CB  1 
ATOM   1866  C  CG  . ARG A  1 246 ? 28.038  -19.925 76.242  1.00 68.91  ?  246  ARG A CG  1 
ATOM   1867  C  CD  . ARG A  1 246 ? 27.434  -18.639 76.810  1.00 70.66  ?  246  ARG A CD  1 
ATOM   1868  N  NE  . ARG A  1 246 ? 27.053  -18.761 78.220  1.00 70.47  ?  246  ARG A NE  1 
ATOM   1869  C  CZ  . ARG A  1 246 ? 25.827  -18.539 78.687  1.00 68.03  ?  246  ARG A CZ  1 
ATOM   1870  N  NH1 . ARG A  1 246 ? 24.856  -18.175 77.858  1.00 69.93  ?  246  ARG A NH1 1 
ATOM   1871  N  NH2 . ARG A  1 246 ? 25.573  -18.674 79.980  1.00 63.64  ?  246  ARG A NH2 1 
ATOM   1872  N  N   . ARG A  1 247 ? 26.246  -23.058 78.238  1.00 59.07  ?  247  ARG A N   1 
ATOM   1873  C  CA  . ARG A  1 247 ? 26.086  -23.339 79.661  1.00 57.80  ?  247  ARG A CA  1 
ATOM   1874  C  C   . ARG A  1 247 ? 26.793  -24.632 80.050  1.00 58.50  ?  247  ARG A C   1 
ATOM   1875  O  O   . ARG A  1 247 ? 27.404  -24.711 81.123  1.00 59.15  ?  247  ARG A O   1 
ATOM   1876  C  CB  . ARG A  1 247 ? 24.600  -23.391 80.021  1.00 52.54  ?  247  ARG A CB  1 
ATOM   1877  C  CG  . ARG A  1 247 ? 23.852  -22.093 79.718  1.00 52.20  ?  247  ARG A CG  1 
ATOM   1878  C  CD  . ARG A  1 247 ? 22.367  -22.182 80.054  1.00 50.50  ?  247  ARG A CD  1 
ATOM   1879  N  NE  . ARG A  1 247 ? 21.646  -20.960 79.699  1.00 51.39  ?  247  ARG A NE  1 
ATOM   1880  C  CZ  . ARG A  1 247 ? 20.345  -20.765 79.903  1.00 50.28  ?  247  ARG A CZ  1 
ATOM   1881  N  NH1 . ARG A  1 247 ? 19.603  -21.720 80.449  1.00 48.05  ?  247  ARG A NH1 1 
ATOM   1882  N  NH2 . ARG A  1 247 ? 19.780  -19.617 79.547  1.00 50.64  ?  247  ARG A NH2 1 
ATOM   1883  N  N   . ALA A  1 248 ? 26.739  -25.649 79.187  1.00 58.62  ?  248  ALA A N   1 
ATOM   1884  C  CA  . ALA A  1 248 ? 27.427  -26.902 79.483  1.00 55.41  ?  248  ALA A CA  1 
ATOM   1885  C  C   . ALA A  1 248 ? 28.938  -26.704 79.518  1.00 57.64  ?  248  ALA A C   1 
ATOM   1886  O  O   . ALA A  1 248 ? 29.620  -27.189 80.429  1.00 58.42  ?  248  ALA A O   1 
ATOM   1887  C  CB  . ALA A  1 248 ? 27.043  -27.968 78.459  1.00 54.98  ?  248  ALA A CB  1 
ATOM   1888  N  N   . THR A  1 249 ? 29.484  -25.989 78.532  1.00 59.44  ?  249  THR A N   1 
ATOM   1889  C  CA  . THR A  1 249 ? 30.920  -25.734 78.530  1.00 63.30  ?  249  THR A CA  1 
ATOM   1890  C  C   . THR A  1 249 ? 31.330  -24.894 79.732  1.00 67.02  ?  249  THR A C   1 
ATOM   1891  O  O   . THR A  1 249 ? 32.384  -25.135 80.338  1.00 70.77  ?  249  THR A O   1 
ATOM   1892  C  CB  . THR A  1 249 ? 31.338  -25.045 77.233  1.00 62.41  ?  249  THR A CB  1 
ATOM   1893  O  OG1 . THR A  1 249 ? 30.954  -25.855 76.116  1.00 62.04  ?  249  THR A OG1 1 
ATOM   1894  C  CG2 . THR A  1 249 ? 32.840  -24.843 77.211  1.00 65.04  ?  249  THR A CG2 1 
ATOM   1895  N  N   . LEU A  1 250 ? 30.502  -23.910 80.104  1.00 66.15  ?  250  LEU A N   1 
ATOM   1896  C  CA  . LEU A  1 250 ? 30.838  -23.054 81.240  1.00 66.45  ?  250  LEU A CA  1 
ATOM   1897  C  C   . LEU A  1 250 ? 30.823  -23.836 82.548  1.00 64.76  ?  250  LEU A C   1 
ATOM   1898  O  O   . LEU A  1 250 ? 31.727  -23.676 83.375  1.00 65.08  ?  250  LEU A O   1 
ATOM   1899  C  CB  . LEU A  1 250 ? 29.880  -21.867 81.322  1.00 65.63  ?  250  LEU A CB  1 
ATOM   1900  C  CG  . LEU A  1 250 ? 30.153  -20.934 82.504  1.00 60.90  ?  250  LEU A CG  1 
ATOM   1901  C  CD1 . LEU A  1 250 ? 31.538  -20.321 82.380  1.00 63.40  ?  250  LEU A CD1 1 
ATOM   1902  C  CD2 . LEU A  1 250 ? 29.091  -19.853 82.617  1.00 61.67  ?  250  LEU A CD2 1 
ATOM   1903  N  N   . LEU A  1 251 ? 29.804  -24.679 82.755  1.00 59.05  ?  251  LEU A N   1 
ATOM   1904  C  CA  . LEU A  1 251 ? 29.777  -25.533 83.939  1.00 58.81  ?  251  LEU A CA  1 
ATOM   1905  C  C   . LEU A  1 251 ? 30.982  -26.462 83.979  1.00 60.55  ?  251  LEU A C   1 
ATOM   1906  O  O   . LEU A  1 251 ? 31.618  -26.624 85.030  1.00 61.67  ?  251  LEU A O   1 
ATOM   1907  C  CB  . LEU A  1 251 ? 28.487  -26.348 83.978  1.00 56.66  ?  251  LEU A CB  1 
ATOM   1908  C  CG  . LEU A  1 251 ? 28.371  -27.215 85.230  1.00 56.43  ?  251  LEU A CG  1 
ATOM   1909  C  CD1 . LEU A  1 251 ? 27.488  -26.555 86.274  1.00 55.45  ?  251  LEU A CD1 1 
ATOM   1910  C  CD2 . LEU A  1 251 ? 27.867  -28.592 84.878  1.00 55.43  ?  251  LEU A CD2 1 
ATOM   1911  N  N   . ALA A  1 252 ? 31.310  -27.084 82.840  1.00 62.77  ?  252  ALA A N   1 
ATOM   1912  C  CA  . ALA A  1 252 ? 32.510  -27.913 82.766  1.00 64.98  ?  252  ALA A CA  1 
ATOM   1913  C  C   . ALA A  1 252 ? 33.761  -27.128 83.132  1.00 67.67  ?  252  ALA A C   1 
ATOM   1914  O  O   . ALA A  1 252 ? 34.693  -27.687 83.720  1.00 69.18  ?  252  ALA A O   1 
ATOM   1915  C  CB  . ALA A  1 252 ? 32.648  -28.509 81.365  1.00 63.18  ?  252  ALA A CB  1 
ATOM   1916  N  N   . ARG A  1 253 ? 33.803  -25.837 82.800  1.00 68.55  ?  253  ARG A N   1 
ATOM   1917  C  CA  . ARG A  1 253 ? 34.943  -25.021 83.197  1.00 71.89  ?  253  ARG A CA  1 
ATOM   1918  C  C   . ARG A  1 253 ? 34.919  -24.728 84.694  1.00 71.63  ?  253  ARG A C   1 
ATOM   1919  O  O   . ARG A  1 253 ? 35.972  -24.686 85.341  1.00 72.80  ?  253  ARG A O   1 
ATOM   1920  C  CB  . ARG A  1 253 ? 34.956  -23.721 82.393  1.00 73.99  ?  253  ARG A CB  1 
ATOM   1921  C  CG  . ARG A  1 253 ? 36.275  -22.965 82.450  1.00 79.93  ?  253  ARG A CG  1 
ATOM   1922  C  CD  . ARG A  1 253 ? 36.057  -21.460 82.380  1.00 82.61  ?  253  ARG A CD  1 
ATOM   1923  N  NE  . ARG A  1 253 ? 37.087  -20.811 81.576  1.00 88.31  ?  253  ARG A NE  1 
ATOM   1924  C  CZ  . ARG A  1 253 ? 38.299  -20.499 82.024  1.00 93.61  ?  253  ARG A CZ  1 
ATOM   1925  N  NH1 . ARG A  1 253 ? 38.638  -20.779 83.278  1.00 94.46  ?  253  ARG A NH1 1 
ATOM   1926  N  NH2 . ARG A  1 253 ? 39.173  -19.908 81.216  1.00 96.56  ?  253  ARG A NH2 1 
ATOM   1927  N  N   . LEU A  1 254 ? 33.726  -24.526 85.261  1.00 69.75  ?  254  LEU A N   1 
ATOM   1928  C  CA  . LEU A  1 254 ? 33.613  -24.146 86.665  1.00 68.79  ?  254  LEU A CA  1 
ATOM   1929  C  C   . LEU A  1 254 ? 33.915  -25.310 87.596  1.00 70.72  ?  254  LEU A C   1 
ATOM   1930  O  O   . LEU A  1 254 ? 34.373  -25.095 88.725  1.00 73.22  ?  254  LEU A O   1 
ATOM   1931  C  CB  . LEU A  1 254 ? 32.217  -23.596 86.944  1.00 63.84  ?  254  LEU A CB  1 
ATOM   1932  C  CG  . LEU A  1 254 ? 31.914  -22.269 86.258  1.00 63.63  ?  254  LEU A CG  1 
ATOM   1933  C  CD1 . LEU A  1 254 ? 30.461  -21.912 86.427  1.00 61.42  ?  254  LEU A CD1 1 
ATOM   1934  C  CD2 . LEU A  1 254 ? 32.803  -21.182 86.813  1.00 65.74  ?  254  LEU A CD2 1 
ATOM   1935  N  N   . VAL A  1 255 ? 33.693  -26.542 87.141  1.00 69.91  ?  255  VAL A N   1 
ATOM   1936  C  CA  . VAL A  1 255 ? 34.064  -27.711 87.930  1.00 68.48  ?  255  VAL A CA  1 
ATOM   1937  C  C   . VAL A  1 255 ? 35.523  -28.012 87.613  1.00 71.83  ?  255  VAL A C   1 
ATOM   1938  O  O   . VAL A  1 255 ? 36.048  -29.066 87.987  1.00 70.61  ?  255  VAL A O   1 
ATOM   1939  C  CB  . VAL A  1 255 ? 33.152  -28.922 87.650  1.00 64.74  ?  255  VAL A CB  1 
ATOM   1940  C  CG1 . VAL A  1 255 ? 31.750  -28.637 88.147  1.00 62.23  ?  255  VAL A CG1 1 
ATOM   1941  C  CG2 . VAL A  1 255 ? 33.144  -29.261 86.175  1.00 67.75  ?  255  VAL A CG2 1 
ATOM   1942  N  N   . GLY A  1 256 ? 36.166  -27.107 86.879  1.00 76.44  ?  256  GLY A N   1 
ATOM   1943  C  CA  . GLY A  1 256 ? 37.593  -27.198 86.616  1.00 82.06  ?  256  GLY A CA  1 
ATOM   1944  C  C   . GLY A  1 256 ? 37.945  -28.374 85.737  1.00 84.69  ?  256  GLY A C   1 
ATOM   1945  O  O   . GLY A  1 256 ? 38.919  -29.084 86.009  1.00 87.55  ?  256  GLY A O   1 
ATOM   1946  N  N   . CYS A  1 257 ? 37.168  -28.610 84.693  1.00 84.21  ?  257  CYS A N   1 
ATOM   1947  C  CA  . CYS A  1 257 ? 37.200  -29.883 83.978  1.00 84.61  ?  257  CYS A CA  1 
ATOM   1948  C  C   . CYS A  1 257 ? 37.251  -29.643 82.474  1.00 87.57  ?  257  CYS A C   1 
ATOM   1949  O  O   . CYS A  1 257 ? 36.398  -30.139 81.731  1.00 85.84  ?  257  CYS A O   1 
ATOM   1950  C  CB  . CYS A  1 257 ? 35.930  -30.640 84.345  1.00 79.59  ?  257  CYS A CB  1 
ATOM   1951  S  SG  . CYS A  1 257 ? 35.787  -32.406 84.276  1.00 77.92  ?  257  CYS A SG  1 
ATOM   1952  N  N   . PRO A  1 258 ? 38.234  -28.845 81.983  1.00 92.45  ?  258  PRO A N   1 
ATOM   1953  C  CA  . PRO A  1 258 ? 38.474  -28.864 80.535  1.00 95.69  ?  258  PRO A CA  1 
ATOM   1954  C  C   . PRO A  1 258 ? 39.087  -30.181 80.039  1.00 101.07 ?  258  PRO A C   1 
ATOM   1955  O  O   . PRO A  1 258 ? 38.600  -30.680 79.016  1.00 101.52 ?  258  PRO A O   1 
ATOM   1956  C  CB  . PRO A  1 258 ? 39.439  -27.694 80.318  1.00 96.48  ?  258  PRO A CB  1 
ATOM   1957  C  CG  . PRO A  1 258 ? 39.194  -26.798 81.494  1.00 94.85  ?  258  PRO A CG  1 
ATOM   1958  C  CD  . PRO A  1 258 ? 38.970  -27.729 82.620  1.00 94.03  ?  258  PRO A CD  1 
ATOM   1959  N  N   . PRO A  1 259 ? 40.116  -30.750 80.730  1.00 104.92 ?  259  PRO A N   1 
ATOM   1960  C  CA  . PRO A  1 259 ? 41.021  -30.472 81.872  1.00 106.44 ?  259  PRO A CA  1 
ATOM   1961  C  C   . PRO A  1 259 ? 42.319  -29.652 81.613  1.00 108.97 ?  259  PRO A C   1 
ATOM   1962  O  O   . PRO A  1 259 ? 43.343  -30.239 81.250  1.00 110.32 ?  259  PRO A O   1 
ATOM   1963  C  CB  . PRO A  1 259 ? 41.390  -31.879 82.378  1.00 107.60 ?  259  PRO A CB  1 
ATOM   1964  C  CG  . PRO A  1 259 ? 41.046  -32.833 81.273  1.00 107.44 ?  259  PRO A CG  1 
ATOM   1965  C  CD  . PRO A  1 259 ? 40.455  -32.049 80.126  1.00 106.49 ?  259  PRO A CD  1 
ATOM   1966  N  N   . GLY A  1 260 ? 42.274  -28.332 81.797  1.00 110.19 ?  260  GLY A N   1 
ATOM   1967  C  CA  . GLY A  1 260 ? 43.437  -27.453 81.661  1.00 114.64 ?  260  GLY A CA  1 
ATOM   1968  C  C   . GLY A  1 260 ? 43.433  -26.378 80.577  1.00 116.34 ?  260  GLY A C   1 
ATOM   1969  O  O   . GLY A  1 260 ? 44.233  -25.441 80.633  1.00 118.40 ?  260  GLY A O   1 
ATOM   1970  N  N   . GLY A  1 261 ? 42.556  -26.517 79.589  1.00 115.68 ?  261  GLY A N   1 
ATOM   1971  C  CA  . GLY A  1 261 ? 41.744  -25.401 79.131  1.00 114.68 ?  261  GLY A CA  1 
ATOM   1972  C  C   . GLY A  1 261 ? 40.899  -25.720 77.913  1.00 113.76 ?  261  GLY A C   1 
ATOM   1973  O  O   . GLY A  1 261 ? 41.355  -26.324 76.940  1.00 115.73 ?  261  GLY A O   1 
ATOM   1974  N  N   . ALA A  1 262 ? 39.656  -25.247 77.965  1.00 111.46 ?  262  ALA A N   1 
ATOM   1975  C  CA  . ALA A  1 262 ? 38.682  -25.290 76.877  1.00 110.97 ?  262  ALA A CA  1 
ATOM   1976  C  C   . ALA A  1 262 ? 38.389  -26.689 76.322  1.00 116.08 ?  262  ALA A C   1 
ATOM   1977  O  O   . ALA A  1 262 ? 37.293  -26.924 75.805  1.00 116.67 ?  262  ALA A O   1 
ATOM   1978  C  CB  . ALA A  1 262 ? 39.139  -24.366 75.743  1.00 108.50 ?  262  ALA A CB  1 
ATOM   1979  N  N   . GLY A  1 263 ? 39.319  -27.638 76.460  1.00 118.82 ?  263  GLY A N   1 
ATOM   1980  C  CA  . GLY A  1 263 ? 39.178  -28.937 75.813  1.00 117.22 ?  263  GLY A CA  1 
ATOM   1981  C  C   . GLY A  1 263 ? 39.266  -28.848 74.295  1.00 116.00 ?  263  GLY A C   1 
ATOM   1982  O  O   . GLY A  1 263 ? 39.166  -27.756 73.724  1.00 116.08 ?  263  GLY A O   1 
ATOM   1983  N  N   . GLY A  1 264 ? 39.473  -29.978 73.620  1.00 114.56 ?  264  GLY A N   1 
ATOM   1984  C  CA  . GLY A  1 264 ? 39.104  -30.047 72.214  1.00 112.43 ?  264  GLY A CA  1 
ATOM   1985  C  C   . GLY A  1 264 ? 37.882  -30.886 71.894  1.00 107.39 ?  264  GLY A C   1 
ATOM   1986  O  O   . GLY A  1 264 ? 37.160  -30.594 70.931  1.00 107.38 ?  264  GLY A O   1 
ATOM   1987  N  N   . ASN A  1 265 ? 37.582  -31.880 72.726  1.00 102.16 ?  265  ASN A N   1 
ATOM   1988  C  CA  . ASN A  1 265 ? 36.537  -32.835 72.373  1.00 96.56  ?  265  ASN A CA  1 
ATOM   1989  C  C   . ASN A  1 265 ? 35.278  -32.536 73.170  1.00 91.99  ?  265  ASN A C   1 
ATOM   1990  O  O   . ASN A  1 265 ? 35.344  -32.066 74.310  1.00 91.56  ?  265  ASN A O   1 
ATOM   1991  C  CB  . ASN A  1 265 ? 36.921  -34.284 72.686  1.00 96.01  ?  265  ASN A CB  1 
ATOM   1992  C  CG  . ASN A  1 265 ? 38.293  -34.715 72.200  1.00 98.82  ?  265  ASN A CG  1 
ATOM   1993  O  OD1 . ASN A  1 265 ? 39.275  -33.987 72.255  1.00 99.73  ?  265  ASN A OD1 1 
ATOM   1994  N  ND2 . ASN A  1 265 ? 38.361  -35.986 71.813  1.00 100.81 ?  265  ASN A ND2 1 
ATOM   1995  N  N   . ASP A  1 266 ? 34.127  -32.815 72.564  1.00 88.93  ?  266  ASP A N   1 
ATOM   1996  C  CA  . ASP A  1 266 ? 32.935  -33.025 73.373  1.00 84.51  ?  266  ASP A CA  1 
ATOM   1997  C  C   . ASP A  1 266 ? 33.080  -34.294 74.203  1.00 83.59  ?  266  ASP A C   1 
ATOM   1998  O  O   . ASP A  1 266 ? 32.635  -34.348 75.358  1.00 81.35  ?  266  ASP A O   1 
ATOM   1999  C  CB  . ASP A  1 266 ? 31.684  -33.105 72.490  1.00 82.18  ?  266  ASP A CB  1 
ATOM   2000  C  CG  . ASP A  1 266 ? 31.228  -31.744 71.974  1.00 80.64  ?  266  ASP A CG  1 
ATOM   2001  O  OD1 . ASP A  1 266 ? 31.990  -30.761 72.105  1.00 82.49  ?  266  ASP A OD1 1 
ATOM   2002  O  OD2 . ASP A  1 266 ? 30.087  -31.654 71.467  1.00 77.45  ?  266  ASP A OD2 1 
ATOM   2003  N  N   . THR A  1 267 ? 33.719  -35.320 73.631  1.00 85.73  ?  267  THR A N   1 
ATOM   2004  C  CA  . THR A  1 267 ? 33.907  -36.581 74.338  1.00 85.05  ?  267  THR A CA  1 
ATOM   2005  C  C   . THR A  1 267 ? 34.830  -36.405 75.537  1.00 85.49  ?  267  THR A C   1 
ATOM   2006  O  O   . THR A  1 267 ? 34.612  -37.014 76.590  1.00 86.29  ?  267  THR A O   1 
ATOM   2007  C  CB  . THR A  1 267 ? 34.471  -37.642 73.388  1.00 85.65  ?  267  THR A CB  1 
ATOM   2008  O  OG1 . THR A  1 267 ? 33.844  -37.522 72.105  1.00 84.89  ?  267  THR A OG1 1 
ATOM   2009  C  CG2 . THR A  1 267 ? 34.201  -39.032 73.931  1.00 84.42  ?  267  THR A CG2 1 
ATOM   2010  N  N   . GLU A  1 268 ? 35.869  -35.578 75.396  1.00 84.98  ?  268  GLU A N   1 
ATOM   2011  C  CA  . GLU A  1 268 ? 36.766  -35.325 76.517  1.00 84.75  ?  268  GLU A CA  1 
ATOM   2012  C  C   . GLU A  1 268 ? 36.090  -34.475 77.583  1.00 80.28  ?  268  GLU A C   1 
ATOM   2013  O  O   . GLU A  1 268 ? 36.357  -34.641 78.777  1.00 79.77  ?  268  GLU A O   1 
ATOM   2014  C  CB  . GLU A  1 268 ? 38.039  -34.633 76.031  1.00 89.31  ?  268  GLU A CB  1 
ATOM   2015  C  CG  . GLU A  1 268 ? 39.317  -35.248 76.558  1.00 95.48  ?  268  GLU A CG  1 
ATOM   2016  C  CD  . GLU A  1 268 ? 39.533  -36.662 76.048  1.00 101.15 ?  268  GLU A CD  1 
ATOM   2017  O  OE1 . GLU A  1 268 ? 39.912  -36.816 74.866  1.00 104.62 ?  268  GLU A OE1 1 
ATOM   2018  O  OE2 . GLU A  1 268 ? 39.337  -37.618 76.832  1.00 101.98 ?  268  GLU A OE2 1 
ATOM   2019  N  N   . LEU A  1 269 ? 35.224  -33.551 77.170  1.00 76.89  ?  269  LEU A N   1 
ATOM   2020  C  CA  . LEU A  1 269 ? 34.573  -32.670 78.129  1.00 73.51  ?  269  LEU A CA  1 
ATOM   2021  C  C   . LEU A  1 269 ? 33.548  -33.433 78.957  1.00 72.99  ?  269  LEU A C   1 
ATOM   2022  O  O   . LEU A  1 269 ? 33.521  -33.315 80.187  1.00 74.18  ?  269  LEU A O   1 
ATOM   2023  C  CB  . LEU A  1 269 ? 33.918  -31.495 77.402  1.00 70.18  ?  269  LEU A CB  1 
ATOM   2024  C  CG  . LEU A  1 269 ? 33.612  -30.259 78.246  1.00 67.68  ?  269  LEU A CG  1 
ATOM   2025  C  CD1 . LEU A  1 269 ? 34.869  -29.418 78.421  1.00 70.64  ?  269  LEU A CD1 1 
ATOM   2026  C  CD2 . LEU A  1 269 ? 32.493  -29.437 77.637  1.00 63.69  ?  269  LEU A CD2 1 
ATOM   2027  N  N   . ILE A  1 270 ? 32.697  -34.227 78.301  1.00 71.61  ?  270  ILE A N   1 
ATOM   2028  C  CA  . ILE A  1 270 ? 31.702  -35.007 79.034  1.00 69.18  ?  270  ILE A CA  1 
ATOM   2029  C  C   . ILE A  1 270 ? 32.365  -36.156 79.782  1.00 70.27  ?  270  ILE A C   1 
ATOM   2030  O  O   . ILE A  1 270 ? 31.960  -36.504 80.898  1.00 70.75  ?  270  ILE A O   1 
ATOM   2031  C  CB  . ILE A  1 270 ? 30.602  -35.508 78.081  1.00 68.24  ?  270  ILE A CB  1 
ATOM   2032  C  CG1 . ILE A  1 270 ? 29.919  -34.325 77.397  1.00 70.10  ?  270  ILE A CG1 1 
ATOM   2033  C  CG2 . ILE A  1 270 ? 29.587  -36.371 78.824  1.00 64.27  ?  270  ILE A CG2 1 
ATOM   2034  C  CD1 . ILE A  1 270 ? 29.398  -34.662 76.028  1.00 72.54  ?  270  ILE A CD1 1 
ATOM   2035  N  N   . ALA A  1 271 ? 33.394  -36.760 79.189  1.00 65.68  ?  271  ALA A N   1 
ATOM   2036  C  CA  . ALA A  1 271 ? 34.137  -37.805 79.886  1.00 71.84  ?  271  ALA A CA  1 
ATOM   2037  C  C   . ALA A  1 271 ? 34.807  -37.260 81.144  1.00 71.69  ?  271  ALA A C   1 
ATOM   2038  O  O   . ALA A  1 271 ? 34.859  -37.950 82.170  1.00 72.82  ?  271  ALA A O   1 
ATOM   2039  C  CB  . ALA A  1 271 ? 35.167  -38.429 78.946  1.00 75.45  ?  271  ALA A CB  1 
ATOM   2040  N  N   . CYS A  1 272 ? 35.308  -36.016 81.083  1.00 71.48  ?  272  CYS A N   1 
ATOM   2041  C  CA  . CYS A  1 272 ? 35.801  -35.332 82.276  1.00 72.38  ?  272  CYS A CA  1 
ATOM   2042  C  C   . CYS A  1 272 ? 34.659  -35.108 83.261  1.00 69.43  ?  272  CYS A C   1 
ATOM   2043  O  O   . CYS A  1 272 ? 34.802  -35.356 84.461  1.00 69.33  ?  272  CYS A O   1 
ATOM   2044  C  CB  . CYS A  1 272 ? 36.459  -33.987 81.892  1.00 75.85  ?  272  CYS A CB  1 
ATOM   2045  S  SG  . CYS A  1 272 ? 37.355  -33.140 83.201  1.00 78.31  ?  272  CYS A SG  1 
ATOM   2046  N  N   . LEU A  1 273 ? 33.540  -34.551 82.786  1.00 67.91  ?  273  LEU A N   1 
ATOM   2047  C  CA  . LEU A  1 273 ? 32.431  -34.207 83.684  1.00 65.28  ?  273  LEU A CA  1 
ATOM   2048  C  C   . LEU A  1 273 ? 31.898  -35.429 84.427  1.00 64.68  ?  273  LEU A C   1 
ATOM   2049  O  O   . LEU A  1 273 ? 31.401  -35.312 85.556  1.00 63.95  ?  273  LEU A O   1 
ATOM   2050  C  CB  . LEU A  1 273 ? 31.289  -33.551 82.896  1.00 60.71  ?  273  LEU A CB  1 
ATOM   2051  C  CG  . LEU A  1 273 ? 31.287  -32.039 82.696  1.00 60.61  ?  273  LEU A CG  1 
ATOM   2052  C  CD1 . LEU A  1 273 ? 30.210  -31.678 81.696  1.00 58.89  ?  273  LEU A CD1 1 
ATOM   2053  C  CD2 . LEU A  1 273 ? 31.060  -31.329 84.005  1.00 60.20  ?  273  LEU A CD2 1 
ATOM   2054  N  N   . ARG A  1 274 ? 31.977  -36.606 83.804  1.00 65.20  ?  274  ARG A N   1 
ATOM   2055  C  CA  . ARG A  1 274 ? 31.440  -37.804 84.429  1.00 65.01  ?  274  ARG A CA  1 
ATOM   2056  C  C   . ARG A  1 274 ? 32.250  -38.243 85.642  1.00 65.68  ?  274  ARG A C   1 
ATOM   2057  O  O   . ARG A  1 274 ? 31.754  -39.044 86.440  1.00 63.45  ?  274  ARG A O   1 
ATOM   2058  C  CB  . ARG A  1 274 ? 31.356  -38.935 83.404  1.00 67.79  ?  274  ARG A CB  1 
ATOM   2059  C  CG  . ARG A  1 274 ? 30.063  -38.916 82.595  1.00 68.22  ?  274  ARG A CG  1 
ATOM   2060  C  CD  . ARG A  1 274 ? 29.776  -40.274 81.981  1.00 69.52  ?  274  ARG A CD  1 
ATOM   2061  N  NE  . ARG A  1 274 ? 30.558  -40.532 80.779  1.00 71.37  ?  274  ARG A NE  1 
ATOM   2062  C  CZ  . ARG A  1 274 ? 30.107  -40.364 79.541  1.00 71.01  ?  274  ARG A CZ  1 
ATOM   2063  N  NH1 . ARG A  1 274 ? 28.865  -39.942 79.329  1.00 67.27  ?  274  ARG A NH1 1 
ATOM   2064  N  NH2 . ARG A  1 274 ? 30.900  -40.631 78.512  1.00 74.08  ?  274  ARG A NH2 1 
ATOM   2065  N  N   . THR A  1 275 ? 33.467  -37.726 85.812  1.00 65.50  ?  275  THR A N   1 
ATOM   2066  C  CA  . THR A  1 275 ? 34.284  -38.043 86.975  1.00 70.18  ?  275  THR A CA  1 
ATOM   2067  C  C   . THR A  1 275 ? 34.001  -37.138 88.168  1.00 71.12  ?  275  THR A C   1 
ATOM   2068  O  O   . THR A  1 275 ? 34.521  -37.395 89.260  1.00 72.87  ?  275  THR A O   1 
ATOM   2069  C  CB  . THR A  1 275 ? 35.775  -37.954 86.625  1.00 72.04  ?  275  THR A CB  1 
ATOM   2070  O  OG1 . THR A  1 275 ? 36.150  -36.580 86.454  1.00 70.59  ?  275  THR A OG1 1 
ATOM   2071  C  CG2 . THR A  1 275 ? 36.065  -38.712 85.340  1.00 72.56  ?  275  THR A CG2 1 
ATOM   2072  N  N   . ARG A  1 276 ? 33.203  -36.102 87.996  1.00 70.24  ?  276  ARG A N   1 
ATOM   2073  C  CA  . ARG A  1 276 ? 32.950  -35.186 89.098  1.00 69.25  ?  276  ARG A CA  1 
ATOM   2074  C  C   . ARG A  1 276 ? 31.818  -35.712 89.982  1.00 66.36  ?  276  ARG A C   1 
ATOM   2075  O  O   . ARG A  1 276 ? 30.844  -36.273 89.473  1.00 65.30  ?  276  ARG A O   1 
ATOM   2076  C  CB  . ARG A  1 276 ? 32.594  -33.799 88.566  1.00 67.85  ?  276  ARG A CB  1 
ATOM   2077  C  CG  . ARG A  1 276 ? 33.770  -33.056 87.960  1.00 69.93  ?  276  ARG A CG  1 
ATOM   2078  C  CD  . ARG A  1 276 ? 34.768  -32.671 89.034  1.00 74.63  ?  276  ARG A CD  1 
ATOM   2079  N  NE  . ARG A  1 276 ? 36.010  -32.146 88.475  1.00 80.33  ?  276  ARG A NE  1 
ATOM   2080  C  CZ  . ARG A  1 276 ? 37.068  -32.896 88.184  1.00 85.03  ?  276  ARG A CZ  1 
ATOM   2081  N  NH1 . ARG A  1 276 ? 37.029  -34.206 88.398  1.00 86.12  ?  276  ARG A NH1 1 
ATOM   2082  N  NH2 . ARG A  1 276 ? 38.163  -32.340 87.677  1.00 87.11  ?  276  ARG A NH2 1 
ATOM   2083  N  N   . PRO A  1 277 ? 31.928  -35.557 91.302  1.00 66.40  ?  277  PRO A N   1 
ATOM   2084  C  CA  . PRO A  1 277 ? 30.807  -35.917 92.179  1.00 65.34  ?  277  PRO A CA  1 
ATOM   2085  C  C   . PRO A  1 277 ? 29.573  -35.082 91.870  1.00 63.10  ?  277  PRO A C   1 
ATOM   2086  O  O   . PRO A  1 277 ? 29.667  -33.919 91.470  1.00 62.31  ?  277  PRO A O   1 
ATOM   2087  C  CB  . PRO A  1 277 ? 31.347  -35.630 93.586  1.00 63.98  ?  277  PRO A CB  1 
ATOM   2088  C  CG  . PRO A  1 277 ? 32.512  -34.713 93.377  1.00 65.82  ?  277  PRO A CG  1 
ATOM   2089  C  CD  . PRO A  1 277 ? 33.103  -35.108 92.065  1.00 66.23  ?  277  PRO A CD  1 
ATOM   2090  N  N   . ALA A  1 278 ? 28.402  -35.698 92.067  1.00 62.00  ?  278  ALA A N   1 
ATOM   2091  C  CA  . ALA A  1 278 ? 27.148  -35.084 91.635  1.00 59.94  ?  278  ALA A CA  1 
ATOM   2092  C  C   . ALA A  1 278 ? 26.897  -33.756 92.340  1.00 59.08  ?  278  ALA A C   1 
ATOM   2093  O  O   . ALA A  1 278 ? 26.367  -32.808 91.740  1.00 58.71  ?  278  ALA A O   1 
ATOM   2094  C  CB  . ALA A  1 278 ? 25.988  -36.050 91.878  1.00 54.80  ?  278  ALA A CB  1 
ATOM   2095  N  N   . GLN A  1 279 ? 27.276  -33.662 93.612  1.00 59.59  ?  279  GLN A N   1 
ATOM   2096  C  CA  . GLN A  1 279 ? 27.020  -32.422 94.328  1.00 59.74  ?  279  GLN A CA  1 
ATOM   2097  C  C   . GLN A  1 279 ? 27.824  -31.268 93.742  1.00 61.80  ?  279  GLN A C   1 
ATOM   2098  O  O   . GLN A  1 279 ? 27.362  -30.125 93.780  1.00 62.55  ?  279  GLN A O   1 
ATOM   2099  C  CB  . GLN A  1 279 ? 27.316  -32.586 95.816  1.00 59.35  ?  279  GLN A CB  1 
ATOM   2100  C  CG  . GLN A  1 279 ? 26.639  -31.528 96.670  1.00 58.63  ?  279  GLN A CG  1 
ATOM   2101  C  CD  . GLN A  1 279 ? 25.120  -31.540 96.517  1.00 58.22  ?  279  GLN A CD  1 
ATOM   2102  O  OE1 . GLN A  1 279 ? 24.502  -32.602 96.403  1.00 55.53  ?  279  GLN A OE1 1 
ATOM   2103  N  NE2 . GLN A  1 279 ? 24.516  -30.355 96.504  1.00 57.56  ?  279  GLN A NE2 1 
ATOM   2104  N  N   . ASP A  1 280 ? 29.015  -31.540 93.190  1.00 63.38  ?  280  ASP A N   1 
ATOM   2105  C  CA  . ASP A  1 280 ? 29.765  -30.491 92.502  1.00 65.35  ?  280  ASP A CA  1 
ATOM   2106  C  C   . ASP A  1 280 ? 28.950  -29.888 91.368  1.00 62.02  ?  280  ASP A C   1 
ATOM   2107  O  O   . ASP A  1 280 ? 28.954  -28.668 91.165  1.00 59.61  ?  280  ASP A O   1 
ATOM   2108  C  CB  . ASP A  1 280 ? 31.081  -31.040 91.952  1.00 69.66  ?  280  ASP A CB  1 
ATOM   2109  C  CG  . ASP A  1 280 ? 32.163  -31.119 92.997  1.00 74.57  ?  280  ASP A CG  1 
ATOM   2110  O  OD1 . ASP A  1 280 ? 31.839  -31.378 94.176  1.00 75.18  ?  280  ASP A OD1 1 
ATOM   2111  O  OD2 . ASP A  1 280 ? 33.341  -30.910 92.633  1.00 77.75  ?  280  ASP A OD2 1 
ATOM   2112  N  N   . LEU A  1 281 ? 28.250  -30.736 90.615  1.00 61.28  ?  281  LEU A N   1 
ATOM   2113  C  CA  . LEU A  1 281 ? 27.425  -30.256 89.516  1.00 58.78  ?  281  LEU A CA  1 
ATOM   2114  C  C   . LEU A  1 281 ? 26.209  -29.502 90.034  1.00 58.11  ?  281  LEU A C   1 
ATOM   2115  O  O   . LEU A  1 281 ? 25.787  -28.510 89.431  1.00 58.87  ?  281  LEU A O   1 
ATOM   2116  C  CB  . LEU A  1 281 ? 26.997  -31.428 88.633  1.00 56.69  ?  281  LEU A CB  1 
ATOM   2117  C  CG  . LEU A  1 281 ? 27.908  -31.905 87.499  1.00 56.93  ?  281  LEU A CG  1 
ATOM   2118  C  CD1 . LEU A  1 281 ? 29.374  -31.924 87.907  1.00 58.03  ?  281  LEU A CD1 1 
ATOM   2119  C  CD2 . LEU A  1 281 ? 27.467  -33.285 87.042  1.00 56.07  ?  281  LEU A CD2 1 
ATOM   2120  N  N   . VAL A  1 282 ? 25.631  -29.949 91.152  1.00 58.48  ?  282  VAL A N   1 
ATOM   2121  C  CA  . VAL A  1 282 ? 24.474  -29.222 91.676  1.00 58.05  ?  282  VAL A CA  1 
ATOM   2122  C  C   . VAL A  1 282 ? 24.898  -27.874 92.261  1.00 58.82  ?  282  VAL A C   1 
ATOM   2123  O  O   . VAL A  1 282 ? 24.122  -26.908 92.249  1.00 56.82  ?  282  VAL A O   1 
ATOM   2124  C  CB  . VAL A  1 282 ? 23.718  -30.079 92.710  1.00 55.80  ?  282  VAL A CB  1 
ATOM   2125  C  CG1 . VAL A  1 282 ? 22.468  -29.356 93.190  1.00 51.31  ?  282  VAL A CG1 1 
ATOM   2126  C  CG2 . VAL A  1 282 ? 23.348  -31.421 92.114  1.00 53.10  ?  282  VAL A CG2 1 
ATOM   2127  N  N   . ASP A  1 283 ? 26.132  -27.777 92.759  1.00 60.49  ?  283  ASP A N   1 
ATOM   2128  C  CA  . ASP A  1 283 ? 26.579  -26.551 93.406  1.00 62.00  ?  283  ASP A CA  1 
ATOM   2129  C  C   . ASP A  1 283 ? 26.779  -25.432 92.391  1.00 63.29  ?  283  ASP A C   1 
ATOM   2130  O  O   . ASP A  1 283 ? 26.480  -24.265 92.674  1.00 64.20  ?  283  ASP A O   1 
ATOM   2131  C  CB  . ASP A  1 283 ? 27.877  -26.809 94.177  1.00 64.49  ?  283  ASP A CB  1 
ATOM   2132  C  CG  . ASP A  1 283 ? 27.669  -27.674 95.415  1.00 65.80  ?  283  ASP A CG  1 
ATOM   2133  O  OD1 . ASP A  1 283 ? 26.502  -27.861 95.827  1.00 64.81  ?  283  ASP A OD1 1 
ATOM   2134  O  OD2 . ASP A  1 283 ? 28.678  -28.155 95.984  1.00 67.37  ?  283  ASP A OD2 1 
ATOM   2135  N  N   . HIS A  1 284 ? 27.292  -25.770 91.210  1.00 63.09  ?  284  HIS A N   1 
ATOM   2136  C  CA  . HIS A  1 284 ? 27.592  -24.805 90.160  1.00 62.12  ?  284  HIS A CA  1 
ATOM   2137  C  C   . HIS A  1 284 ? 26.482  -24.691 89.120  1.00 58.41  ?  284  HIS A C   1 
ATOM   2138  O  O   . HIS A  1 284 ? 26.667  -24.013 88.105  1.00 57.57  ?  284  HIS A O   1 
ATOM   2139  C  CB  . HIS A  1 284 ? 28.920  -25.165 89.496  1.00 63.75  ?  284  HIS A CB  1 
ATOM   2140  C  CG  . HIS A  1 284 ? 30.077  -25.166 90.447  1.00 65.59  ?  284  HIS A CG  1 
ATOM   2141  N  ND1 . HIS A  1 284 ? 30.308  -26.195 91.333  1.00 65.20  ?  284  HIS A ND1 1 
ATOM   2142  C  CD2 . HIS A  1 284 ? 31.056  -24.256 90.665  1.00 68.30  ?  284  HIS A CD2 1 
ATOM   2143  C  CE1 . HIS A  1 284 ? 31.387  -25.926 92.047  1.00 67.67  ?  284  HIS A CE1 1 
ATOM   2144  N  NE2 . HIS A  1 284 ? 31.859  -24.755 91.663  1.00 68.89  ?  284  HIS A NE2 1 
ATOM   2145  N  N   . GLU A  1 285 ? 25.348  -25.355 89.343  1.00 57.56  ?  285  GLU A N   1 
ATOM   2146  C  CA  . GLU A  1 285 ? 24.256  -25.348 88.374  1.00 57.34  ?  285  GLU A CA  1 
ATOM   2147  C  C   . GLU A  1 285 ? 23.787  -23.930 88.059  1.00 58.75  ?  285  GLU A C   1 
ATOM   2148  O  O   . GLU A  1 285 ? 23.606  -23.570 86.890  1.00 59.77  ?  285  GLU A O   1 
ATOM   2149  C  CB  . GLU A  1 285 ? 23.101  -26.189 88.909  1.00 57.51  ?  285  GLU A CB  1 
ATOM   2150  C  CG  . GLU A  1 285 ? 21.839  -26.088 88.104  1.00 59.69  ?  285  GLU A CG  1 
ATOM   2151  C  CD  . GLU A  1 285 ? 20.768  -26.998 88.640  1.00 62.83  ?  285  GLU A CD  1 
ATOM   2152  O  OE1 . GLU A  1 285 ? 21.114  -27.923 89.401  1.00 63.22  ?  285  GLU A OE1 1 
ATOM   2153  O  OE2 . GLU A  1 285 ? 19.586  -26.795 88.300  1.00 65.22  ?  285  GLU A OE2 1 
ATOM   2154  N  N   . TRP A  1 286 ? 23.581  -23.106 89.088  1.00 58.97  ?  286  TRP A N   1 
ATOM   2155  C  CA  . TRP A  1 286 ? 23.036  -21.770 88.871  1.00 58.15  ?  286  TRP A CA  1 
ATOM   2156  C  C   . TRP A  1 286 ? 24.074  -20.765 88.384  1.00 60.82  ?  286  TRP A C   1 
ATOM   2157  O  O   . TRP A  1 286 ? 23.693  -19.673 87.949  1.00 60.89  ?  286  TRP A O   1 
ATOM   2158  C  CB  . TRP A  1 286 ? 22.380  -21.250 90.154  1.00 56.16  ?  286  TRP A CB  1 
ATOM   2159  C  CG  . TRP A  1 286 ? 21.217  -22.080 90.614  1.00 53.36  ?  286  TRP A CG  1 
ATOM   2160  C  CD1 . TRP A  1 286 ? 21.250  -23.124 91.496  1.00 53.47  ?  286  TRP A CD1 1 
ATOM   2161  C  CD2 . TRP A  1 286 ? 19.850  -21.938 90.213  1.00 50.80  ?  286  TRP A CD2 1 
ATOM   2162  N  NE1 . TRP A  1 286 ? 19.986  -23.639 91.667  1.00 51.91  ?  286  TRP A NE1 1 
ATOM   2163  C  CE2 . TRP A  1 286 ? 19.109  -22.928 90.891  1.00 48.83  ?  286  TRP A CE2 1 
ATOM   2164  C  CE3 . TRP A  1 286 ? 19.181  -21.073 89.345  1.00 49.10  ?  286  TRP A CE3 1 
ATOM   2165  C  CZ2 . TRP A  1 286 ? 17.734  -23.073 90.726  1.00 47.92  ?  286  TRP A CZ2 1 
ATOM   2166  C  CZ3 . TRP A  1 286 ? 17.816  -21.220 89.183  1.00 47.91  ?  286  TRP A CZ3 1 
ATOM   2167  C  CH2 . TRP A  1 286 ? 17.107  -22.211 89.869  1.00 47.20  ?  286  TRP A CH2 1 
ATOM   2168  N  N   . HIS A  1 287 ? 25.365  -21.106 88.430  1.00 62.71  ?  287  HIS A N   1 
ATOM   2169  C  CA  . HIS A  1 287 ? 26.410  -20.172 88.022  1.00 63.18  ?  287  HIS A CA  1 
ATOM   2170  C  C   . HIS A  1 287 ? 26.323  -19.794 86.550  1.00 64.33  ?  287  HIS A C   1 
ATOM   2171  O  O   . HIS A  1 287 ? 26.839  -18.740 86.162  1.00 67.97  ?  287  HIS A O   1 
ATOM   2172  C  CB  . HIS A  1 287 ? 27.795  -20.766 88.288  1.00 62.80  ?  287  HIS A CB  1 
ATOM   2173  C  CG  . HIS A  1 287 ? 28.110  -20.978 89.736  1.00 62.51  ?  287  HIS A CG  1 
ATOM   2174  N  ND1 . HIS A  1 287 ? 27.209  -21.522 90.626  1.00 61.39  ?  287  HIS A ND1 1 
ATOM   2175  C  CD2 . HIS A  1 287 ? 29.237  -20.729 90.446  1.00 63.64  ?  287  HIS A CD2 1 
ATOM   2176  C  CE1 . HIS A  1 287 ? 27.765  -21.594 91.822  1.00 62.73  ?  287  HIS A CE1 1 
ATOM   2177  N  NE2 . HIS A  1 287 ? 28.994  -21.116 91.741  1.00 64.25  ?  287  HIS A NE2 1 
ATOM   2178  N  N   . VAL A  1 288 ? 25.694  -20.628 85.716  1.00 61.81  ?  288  VAL A N   1 
ATOM   2179  C  CA  . VAL A  1 288 ? 25.823  -20.474 84.271  1.00 60.36  ?  288  VAL A CA  1 
ATOM   2180  C  C   . VAL A  1 288 ? 24.709  -19.646 83.647  1.00 61.23  ?  288  VAL A C   1 
ATOM   2181  O  O   . VAL A  1 288 ? 24.702  -19.478 82.421  1.00 65.42  ?  288  VAL A O   1 
ATOM   2182  C  CB  . VAL A  1 288 ? 25.896  -21.860 83.604  1.00 57.02  ?  288  VAL A CB  1 
ATOM   2183  C  CG1 . VAL A  1 288 ? 27.110  -22.615 84.112  1.00 57.02  ?  288  VAL A CG1 1 
ATOM   2184  C  CG2 . VAL A  1 288 ? 24.632  -22.641 83.892  1.00 53.89  ?  288  VAL A CG2 1 
ATOM   2185  N  N   . LEU A  1 289 ? 23.779  -19.118 84.437  1.00 58.14  ?  289  LEU A N   1 
ATOM   2186  C  CA  . LEU A  1 289 ? 22.696  -18.320 83.865  1.00 56.04  ?  289  LEU A CA  1 
ATOM   2187  C  C   . LEU A  1 289 ? 23.265  -17.043 83.253  1.00 56.32  ?  289  LEU A C   1 
ATOM   2188  O  O   . LEU A  1 289 ? 24.129  -16.401 83.862  1.00 56.67  ?  289  LEU A O   1 
ATOM   2189  C  CB  . LEU A  1 289 ? 21.645  -17.992 84.920  1.00 55.61  ?  289  LEU A CB  1 
ATOM   2190  C  CG  . LEU A  1 289 ? 20.660  -19.125 85.222  1.00 50.27  ?  289  LEU A CG  1 
ATOM   2191  C  CD1 . LEU A  1 289 ? 19.562  -18.663 86.171  1.00 49.77  ?  289  LEU A CD1 1 
ATOM   2192  C  CD2 . LEU A  1 289 ? 20.068  -19.668 83.935  1.00 49.31  ?  289  LEU A CD2 1 
ATOM   2193  N  N   . PRO A  1 290 ? 22.834  -16.661 82.047  1.00 55.53  ?  290  PRO A N   1 
ATOM   2194  C  CA  . PRO A  1 290 ? 23.512  -15.562 81.341  1.00 56.14  ?  290  PRO A CA  1 
ATOM   2195  C  C   . PRO A  1 290 ? 23.242  -14.183 81.917  1.00 59.05  ?  290  PRO A C   1 
ATOM   2196  O  O   . PRO A  1 290 ? 24.100  -13.301 81.783  1.00 61.67  ?  290  PRO A O   1 
ATOM   2197  C  CB  . PRO A  1 290 ? 22.971  -15.687 79.913  1.00 54.60  ?  290  PRO A CB  1 
ATOM   2198  C  CG  . PRO A  1 290 ? 21.625  -16.296 80.089  1.00 55.33  ?  290  PRO A CG  1 
ATOM   2199  C  CD  . PRO A  1 290 ? 21.723  -17.226 81.262  1.00 54.28  ?  290  PRO A CD  1 
ATOM   2200  N  N   . GLN A  1 291 ? 22.083  -13.954 82.536  1.00 59.23  ?  291  GLN A N   1 
ATOM   2201  C  CA  . GLN A  1 291 ? 21.758  -12.641 83.082  1.00 59.79  ?  291  GLN A CA  1 
ATOM   2202  C  C   . GLN A  1 291 ? 21.122  -12.791 84.455  1.00 59.47  ?  291  GLN A C   1 
ATOM   2203  O  O   . GLN A  1 291 ? 20.689  -13.878 84.848  1.00 58.93  ?  291  GLN A O   1 
ATOM   2204  C  CB  . GLN A  1 291 ? 20.820  -11.845 82.161  1.00 60.12  ?  291  GLN A CB  1 
ATOM   2205  C  CG  . GLN A  1 291 ? 21.445  -11.458 80.831  1.00 63.78  ?  291  GLN A CG  1 
ATOM   2206  C  CD  . GLN A  1 291 ? 20.954  -12.314 79.682  1.00 65.51  ?  291  GLN A CD  1 
ATOM   2207  O  OE1 . GLN A  1 291 ? 20.251  -13.303 79.885  1.00 65.83  ?  291  GLN A OE1 1 
ATOM   2208  N  NE2 . GLN A  1 291 ? 21.352  -11.958 78.468  1.00 67.33  ?  291  GLN A NE2 1 
ATOM   2209  N  N   . GLU A  1 292 ? 21.074  -11.675 85.184  1.00 60.64  ?  292  GLU A N   1 
ATOM   2210  C  CA  . GLU A  1 292 ? 20.420  -11.651 86.485  1.00 61.37  ?  292  GLU A CA  1 
ATOM   2211  C  C   . GLU A  1 292 ? 18.915  -11.770 86.290  1.00 59.09  ?  292  GLU A C   1 
ATOM   2212  O  O   . GLU A  1 292 ? 18.299  -10.922 85.636  1.00 59.04  ?  292  GLU A O   1 
ATOM   2213  C  CB  . GLU A  1 292 ? 20.769  -10.366 87.232  1.00 65.36  ?  292  GLU A CB  1 
ATOM   2214  C  CG  . GLU A  1 292 ? 20.172  -10.289 88.629  1.00 68.45  ?  292  GLU A CG  1 
ATOM   2215  C  CD  . GLU A  1 292 ? 20.452  -8.967  89.317  1.00 72.88  ?  292  GLU A CD  1 
ATOM   2216  O  OE1 . GLU A  1 292 ? 21.188  -8.136  88.738  1.00 73.56  ?  292  GLU A OE1 1 
ATOM   2217  O  OE2 . GLU A  1 292 ? 19.934  -8.762  90.438  1.00 75.01  ?  292  GLU A OE2 1 
ATOM   2218  N  N   . SER A  1 293 ? 18.316  -12.801 86.882  1.00 57.77  ?  293  SER A N   1 
ATOM   2219  C  CA  . SER A  1 293 ? 16.984  -13.209 86.463  1.00 57.02  ?  293  SER A CA  1 
ATOM   2220  C  C   . SER A  1 293 ? 16.265  -13.953 87.576  1.00 56.64  ?  293  SER A C   1 
ATOM   2221  O  O   . SER A  1 293 ? 16.879  -14.469 88.514  1.00 56.77  ?  293  SER A O   1 
ATOM   2222  C  CB  . SER A  1 293 ? 17.056  -14.099 85.217  1.00 59.04  ?  293  SER A CB  1 
ATOM   2223  O  OG  . SER A  1 293 ? 17.765  -15.298 85.491  1.00 50.50  ?  293  SER A OG  1 
ATOM   2224  N  N   . ILE A  1 294 ? 14.942  -13.992 87.447  1.00 55.81  ?  294  ILE A N   1 
ATOM   2225  C  CA  . ILE A  1 294 ? 14.099  -14.950 88.143  1.00 54.73  ?  294  ILE A CA  1 
ATOM   2226  C  C   . ILE A  1 294 ? 13.279  -15.681 87.088  1.00 51.86  ?  294  ILE A C   1 
ATOM   2227  O  O   . ILE A  1 294 ? 13.077  -15.189 85.974  1.00 50.18  ?  294  ILE A O   1 
ATOM   2228  C  CB  . ILE A  1 294 ? 13.180  -14.292 89.190  1.00 49.99  ?  294  ILE A CB  1 
ATOM   2229  C  CG1 . ILE A  1 294 ? 12.212  -13.319 88.523  1.00 50.22  ?  294  ILE A CG1 1 
ATOM   2230  C  CG2 . ILE A  1 294 ? 14.002  -13.572 90.226  1.00 51.37  ?  294  ILE A CG2 1 
ATOM   2231  C  CD1 . ILE A  1 294 ? 11.050  -12.937 89.406  1.00 50.62  ?  294  ILE A CD1 1 
ATOM   2232  N  N   . PHE A  1 295 ? 12.811  -16.878 87.451  1.00 49.50  ?  295  PHE A N   1 
ATOM   2233  C  CA  . PHE A  1 295 ? 12.052  -17.735 86.538  1.00 47.82  ?  295  PHE A CA  1 
ATOM   2234  C  C   . PHE A  1 295 ? 12.879  -18.067 85.297  1.00 50.50  ?  295  PHE A C   1 
ATOM   2235  O  O   . PHE A  1 295 ? 12.380  -18.069 84.170  1.00 52.31  ?  295  PHE A O   1 
ATOM   2236  C  CB  . PHE A  1 295 ? 10.717  -17.096 86.156  1.00 46.21  ?  295  PHE A CB  1 
ATOM   2237  C  CG  . PHE A  1 295 ? 9.597   -18.080 85.967  1.00 45.31  ?  295  PHE A CG  1 
ATOM   2238  C  CD1 . PHE A  1 295 ? 9.807   -19.274 85.298  1.00 44.47  ?  295  PHE A CD1 1 
ATOM   2239  C  CD2 . PHE A  1 295 ? 8.329   -17.808 86.464  1.00 45.49  ?  295  PHE A CD2 1 
ATOM   2240  C  CE1 . PHE A  1 295 ? 8.776   -20.178 85.124  1.00 43.79  ?  295  PHE A CE1 1 
ATOM   2241  C  CE2 . PHE A  1 295 ? 7.290   -18.709 86.292  1.00 44.84  ?  295  PHE A CE2 1 
ATOM   2242  C  CZ  . PHE A  1 295 ? 7.513   -19.894 85.623  1.00 44.67  ?  295  PHE A CZ  1 
ATOM   2243  N  N   . ARG A  1 296 ? 14.167  -18.320 85.513  1.00 51.40  ?  296  ARG A N   1 
ATOM   2244  C  CA  . ARG A  1 296 ? 15.072  -18.847 84.500  1.00 49.76  ?  296  ARG A CA  1 
ATOM   2245  C  C   . ARG A  1 296 ? 15.852  -19.979 85.140  1.00 51.23  ?  296  ARG A C   1 
ATOM   2246  O  O   . ARG A  1 296 ? 16.327  -19.841 86.271  1.00 53.47  ?  296  ARG A O   1 
ATOM   2247  C  CB  . ARG A  1 296 ? 16.030  -17.774 83.980  1.00 49.71  ?  296  ARG A CB  1 
ATOM   2248  C  CG  . ARG A  1 296 ? 15.368  -16.678 83.188  1.00 53.17  ?  296  ARG A CG  1 
ATOM   2249  C  CD  . ARG A  1 296 ? 14.852  -17.194 81.863  1.00 51.36  ?  296  ARG A CD  1 
ATOM   2250  N  NE  . ARG A  1 296 ? 14.263  -16.113 81.082  1.00 52.14  ?  296  ARG A NE  1 
ATOM   2251  C  CZ  . ARG A  1 296 ? 12.980  -15.782 81.130  1.00 54.81  ?  296  ARG A CZ  1 
ATOM   2252  N  NH1 . ARG A  1 296 ? 12.151  -16.464 81.910  1.00 54.33  ?  296  ARG A NH1 1 
ATOM   2253  N  NH2 . ARG A  1 296 ? 12.522  -14.779 80.393  1.00 58.17  ?  296  ARG A NH2 1 
ATOM   2254  N  N   . PHE A  1 297 ? 15.979  -21.090 84.431  1.00 51.29  ?  297  PHE A N   1 
ATOM   2255  C  CA  . PHE A  1 297 ? 16.626  -22.278 84.963  1.00 53.14  ?  297  PHE A CA  1 
ATOM   2256  C  C   . PHE A  1 297 ? 17.746  -22.700 84.024  1.00 56.94  ?  297  PHE A C   1 
ATOM   2257  O  O   . PHE A  1 297 ? 17.583  -22.671 82.799  1.00 61.40  ?  297  PHE A O   1 
ATOM   2258  C  CB  . PHE A  1 297 ? 15.597  -23.394 85.159  1.00 51.05  ?  297  PHE A CB  1 
ATOM   2259  C  CG  . PHE A  1 297 ? 14.279  -22.896 85.688  1.00 49.53  ?  297  PHE A CG  1 
ATOM   2260  C  CD1 . PHE A  1 297 ? 14.168  -22.449 86.992  1.00 48.99  ?  297  PHE A CD1 1 
ATOM   2261  C  CD2 . PHE A  1 297 ? 13.156  -22.859 84.880  1.00 49.14  ?  297  PHE A CD2 1 
ATOM   2262  C  CE1 . PHE A  1 297 ? 12.962  -21.977 87.481  1.00 48.29  ?  297  PHE A CE1 1 
ATOM   2263  C  CE2 . PHE A  1 297 ? 11.943  -22.389 85.369  1.00 48.02  ?  297  PHE A CE2 1 
ATOM   2264  C  CZ  . PHE A  1 297 ? 11.849  -21.948 86.669  1.00 47.20  ?  297  PHE A CZ  1 
ATOM   2265  N  N   . SER A  1 298 ? 18.886  -23.083 84.605  1.00 55.53  ?  298  SER A N   1 
ATOM   2266  C  CA  . SER A  1 298 ? 20.101  -23.265 83.815  1.00 54.10  ?  298  SER A CA  1 
ATOM   2267  C  C   . SER A  1 298 ? 19.932  -24.341 82.750  1.00 52.19  ?  298  SER A C   1 
ATOM   2268  O  O   . SER A  1 298 ? 20.200  -24.103 81.567  1.00 52.42  ?  298  SER A O   1 
ATOM   2269  C  CB  . SER A  1 298 ? 21.277  -23.595 84.731  1.00 55.29  ?  298  SER A CB  1 
ATOM   2270  O  OG  . SER A  1 298 ? 21.626  -22.482 85.530  1.00 56.88  ?  298  SER A OG  1 
ATOM   2271  N  N   . PHE A  1 299 ? 19.492  -25.532 83.144  1.00 50.62  ?  299  PHE A N   1 
ATOM   2272  C  CA  . PHE A  1 299 ? 19.469  -26.677 82.239  1.00 50.13  ?  299  PHE A CA  1 
ATOM   2273  C  C   . PHE A  1 299 ? 18.033  -27.150 82.067  1.00 50.38  ?  299  PHE A C   1 
ATOM   2274  O  O   . PHE A  1 299 ? 17.444  -27.729 82.987  1.00 50.05  ?  299  PHE A O   1 
ATOM   2275  C  CB  . PHE A  1 299 ? 20.381  -27.782 82.763  1.00 49.02  ?  299  PHE A CB  1 
ATOM   2276  C  CG  . PHE A  1 299 ? 21.804  -27.340 82.925  1.00 48.09  ?  299  PHE A CG  1 
ATOM   2277  C  CD1 . PHE A  1 299 ? 22.699  -27.450 81.880  1.00 49.07  ?  299  PHE A CD1 1 
ATOM   2278  C  CD2 . PHE A  1 299 ? 22.236  -26.776 84.111  1.00 48.67  ?  299  PHE A CD2 1 
ATOM   2279  C  CE1 . PHE A  1 299 ? 24.004  -27.031 82.021  1.00 50.60  ?  299  PHE A CE1 1 
ATOM   2280  C  CE2 . PHE A  1 299 ? 23.540  -26.349 84.255  1.00 50.21  ?  299  PHE A CE2 1 
ATOM   2281  C  CZ  . PHE A  1 299 ? 24.426  -26.480 83.210  1.00 51.18  ?  299  PHE A CZ  1 
ATOM   2282  N  N   . VAL A  1 300 ? 17.492  -26.914 80.877  1.00 50.91  ?  300  VAL A N   1 
ATOM   2283  C  CA  . VAL A  1 300 ? 16.105  -27.209 80.532  1.00 50.98  ?  300  VAL A CA  1 
ATOM   2284  C  C   . VAL A  1 300 ? 16.150  -27.935 79.192  1.00 50.58  ?  300  VAL A C   1 
ATOM   2285  O  O   . VAL A  1 300 ? 17.248  -28.101 78.639  1.00 53.30  ?  300  VAL A O   1 
ATOM   2286  C  CB  . VAL A  1 300 ? 15.260  -25.922 80.477  1.00 52.24  ?  300  VAL A CB  1 
ATOM   2287  C  CG1 . VAL A  1 300 ? 15.169  -25.274 81.856  1.00 52.84  ?  300  VAL A CG1 1 
ATOM   2288  C  CG2 . VAL A  1 300 ? 15.839  -24.948 79.473  1.00 44.34  ?  300  VAL A CG2 1 
ATOM   2289  N  N   . PRO A  1 301 ? 15.026  -28.400 78.638  1.00 46.02  ?  301  PRO A N   1 
ATOM   2290  C  CA  . PRO A  1 301 ? 15.066  -28.996 77.299  1.00 44.95  ?  301  PRO A CA  1 
ATOM   2291  C  C   . PRO A  1 301 ? 15.716  -28.072 76.276  1.00 45.07  ?  301  PRO A C   1 
ATOM   2292  O  O   . PRO A  1 301 ? 15.522  -26.856 76.288  1.00 45.94  ?  301  PRO A O   1 
ATOM   2293  C  CB  . PRO A  1 301 ? 13.589  -29.239 76.984  1.00 44.74  ?  301  PRO A CB  1 
ATOM   2294  C  CG  . PRO A  1 301 ? 12.998  -29.534 78.303  1.00 42.22  ?  301  PRO A CG  1 
ATOM   2295  C  CD  . PRO A  1 301 ? 13.740  -28.681 79.303  1.00 44.08  ?  301  PRO A CD  1 
ATOM   2296  N  N   . VAL A  1 302 ? 16.491  -28.668 75.380  1.00 46.63  ?  302  VAL A N   1 
ATOM   2297  C  CA  . VAL A  1 302 ? 17.190  -27.943 74.329  1.00 49.68  ?  302  VAL A CA  1 
ATOM   2298  C  C   . VAL A  1 302 ? 16.481  -28.255 73.023  1.00 49.78  ?  302  VAL A C   1 
ATOM   2299  O  O   . VAL A  1 302 ? 15.866  -29.317 72.876  1.00 49.43  ?  302  VAL A O   1 
ATOM   2300  C  CB  . VAL A  1 302 ? 18.684  -28.334 74.258  1.00 50.57  ?  302  VAL A CB  1 
ATOM   2301  C  CG1 . VAL A  1 302 ? 18.834  -29.804 73.901  1.00 47.81  ?  302  VAL A CG1 1 
ATOM   2302  C  CG2 . VAL A  1 302 ? 19.433  -27.454 73.278  1.00 48.95  ?  302  VAL A CG2 1 
ATOM   2303  N  N   . VAL A  1 303 ? 16.539  -27.322 72.075  1.00 49.90  ?  303  VAL A N   1 
ATOM   2304  C  CA  . VAL A  1 303 ? 15.996  -27.573 70.746  1.00 51.43  ?  303  VAL A CA  1 
ATOM   2305  C  C   . VAL A  1 303 ? 17.148  -28.156 69.934  1.00 55.02  ?  303  VAL A C   1 
ATOM   2306  O  O   . VAL A  1 303 ? 18.042  -27.440 69.477  1.00 56.18  ?  303  VAL A O   1 
ATOM   2307  C  CB  . VAL A  1 303 ? 15.427  -26.300 70.116  1.00 51.01  ?  303  VAL A CB  1 
ATOM   2308  C  CG1 . VAL A  1 303 ? 14.841  -26.596 68.746  1.00 51.40  ?  303  VAL A CG1 1 
ATOM   2309  C  CG2 . VAL A  1 303 ? 14.373  -25.691 71.028  1.00 49.72  ?  303  VAL A CG2 1 
ATOM   2310  N  N   . ASP A  1 304 ? 17.114  -29.475 69.756  1.00 57.15  ?  304  ASP A N   1 
ATOM   2311  C  CA  . ASP A  1 304 ? 18.181  -30.227 69.117  1.00 61.28  ?  304  ASP A CA  1 
ATOM   2312  C  C   . ASP A  1 304 ? 17.871  -30.619 67.683  1.00 64.25  ?  304  ASP A C   1 
ATOM   2313  O  O   . ASP A  1 304 ? 18.717  -31.238 67.030  1.00 68.35  ?  304  ASP A O   1 
ATOM   2314  C  CB  . ASP A  1 304 ? 18.508  -31.478 69.949  1.00 62.50  ?  304  ASP A CB  1 
ATOM   2315  C  CG  . ASP A  1 304 ? 17.264  -32.285 70.323  1.00 60.72  ?  304  ASP A CG  1 
ATOM   2316  O  OD1 . ASP A  1 304 ? 16.131  -31.801 70.091  1.00 60.76  ?  304  ASP A OD1 1 
ATOM   2317  O  OD2 . ASP A  1 304 ? 17.423  -33.398 70.876  1.00 57.49  ?  304  ASP A OD2 1 
ATOM   2318  N  N   . GLY A  1 305 ? 16.689  -30.287 67.174  1.00 61.94  ?  305  GLY A N   1 
ATOM   2319  C  CA  . GLY A  1 305 ? 16.287  -30.842 65.897  1.00 60.45  ?  305  GLY A CA  1 
ATOM   2320  C  C   . GLY A  1 305 ? 16.094  -32.340 65.924  1.00 59.95  ?  305  GLY A C   1 
ATOM   2321  O  O   . GLY A  1 305 ? 16.080  -32.975 64.865  1.00 63.44  ?  305  GLY A O   1 
ATOM   2322  N  N   . ASP A  1 306 ? 15.963  -32.928 67.114  1.00 57.36  ?  306  ASP A N   1 
ATOM   2323  C  CA  . ASP A  1 306 ? 15.729  -34.360 67.254  1.00 58.55  ?  306  ASP A CA  1 
ATOM   2324  C  C   . ASP A  1 306 ? 14.455  -34.634 68.044  1.00 58.79  ?  306  ASP A C   1 
ATOM   2325  O  O   . ASP A  1 306 ? 13.433  -35.013 67.462  1.00 61.69  ?  306  ASP A O   1 
ATOM   2326  C  CB  . ASP A  1 306 ? 16.926  -35.033 67.929  1.00 58.85  ?  306  ASP A CB  1 
ATOM   2327  C  CG  . ASP A  1 306 ? 16.762  -36.539 68.050  1.00 57.84  ?  306  ASP A CG  1 
ATOM   2328  O  OD1 . ASP A  1 306 ? 15.978  -37.118 67.269  1.00 60.31  ?  306  ASP A OD1 1 
ATOM   2329  O  OD2 . ASP A  1 306 ? 17.418  -37.145 68.925  1.00 54.02  ?  306  ASP A OD2 1 
ATOM   2330  N  N   . PHE A  1 307 ? 14.504  -34.455 69.370  1.00 54.73  ?  307  PHE A N   1 
ATOM   2331  C  CA  . PHE A  1 307 ? 13.296  -34.622 70.173  1.00 50.35  ?  307  PHE A CA  1 
ATOM   2332  C  C   . PHE A  1 307 ? 12.271  -33.558 69.819  1.00 49.94  ?  307  PHE A C   1 
ATOM   2333  O  O   . PHE A  1 307 ? 11.074  -33.845 69.705  1.00 50.45  ?  307  PHE A O   1 
ATOM   2334  C  CB  . PHE A  1 307 ? 13.630  -34.568 71.666  1.00 47.06  ?  307  PHE A CB  1 
ATOM   2335  C  CG  . PHE A  1 307 ? 12.494  -34.998 72.559  1.00 44.97  ?  307  PHE A CG  1 
ATOM   2336  C  CD1 . PHE A  1 307 ? 11.432  -34.147 72.819  1.00 44.55  ?  307  PHE A CD1 1 
ATOM   2337  C  CD2 . PHE A  1 307 ? 12.490  -36.254 73.140  1.00 46.89  ?  307  PHE A CD2 1 
ATOM   2338  C  CE1 . PHE A  1 307 ? 10.385  -34.544 73.635  1.00 45.55  ?  307  PHE A CE1 1 
ATOM   2339  C  CE2 . PHE A  1 307 ? 11.448  -36.656 73.962  1.00 47.27  ?  307  PHE A CE2 1 
ATOM   2340  C  CZ  . PHE A  1 307 ? 10.394  -35.800 74.208  1.00 46.53  ?  307  PHE A CZ  1 
ATOM   2341  N  N   . LEU A  1 308 ? 12.722  -32.326 69.661  1.00 51.24  ?  308  LEU A N   1 
ATOM   2342  C  CA  . LEU A  1 308 ? 11.917  -31.249 69.111  1.00 54.10  ?  308  LEU A CA  1 
ATOM   2343  C  C   . LEU A  1 308 ? 12.487  -30.964 67.728  1.00 60.87  ?  308  LEU A C   1 
ATOM   2344  O  O   . LEU A  1 308 ? 13.605  -30.451 67.608  1.00 64.15  ?  308  LEU A O   1 
ATOM   2345  C  CB  . LEU A  1 308 ? 11.966  -30.013 70.008  1.00 50.80  ?  308  LEU A CB  1 
ATOM   2346  C  CG  . LEU A  1 308 ? 11.557  -30.186 71.474  1.00 46.18  ?  308  LEU A CG  1 
ATOM   2347  C  CD1 . LEU A  1 308 ? 11.795  -28.901 72.246  1.00 44.97  ?  308  LEU A CD1 1 
ATOM   2348  C  CD2 . LEU A  1 308 ? 10.110  -30.613 71.587  1.00 44.83  ?  308  LEU A CD2 1 
ATOM   2349  N  N   . SER A  1 309 ? 11.728  -31.319 66.686  1.00 62.29  ?  309  SER A N   1 
ATOM   2350  C  CA  . SER A  1 309 ? 12.201  -31.103 65.321  1.00 61.96  ?  309  SER A CA  1 
ATOM   2351  C  C   . SER A  1 309 ? 12.437  -29.625 65.038  1.00 64.52  ?  309  SER A C   1 
ATOM   2352  O  O   . SER A  1 309 ? 13.269  -29.275 64.192  1.00 67.18  ?  309  SER A O   1 
ATOM   2353  C  CB  . SER A  1 309 ? 11.203  -31.693 64.325  1.00 58.32  ?  309  SER A CB  1 
ATOM   2354  O  OG  . SER A  1 309 ? 9.910   -31.149 64.510  1.00 54.93  ?  309  SER A OG  1 
ATOM   2355  N  N   . ASP A  1 310 ? 11.725  -28.749 65.739  1.00 63.88  ?  310  ASP A N   1 
ATOM   2356  C  CA  . ASP A  1 310 ? 11.893  -27.312 65.611  1.00 62.83  ?  310  ASP A CA  1 
ATOM   2357  C  C   . ASP A  1 310 ? 11.590  -26.694 66.972  1.00 59.23  ?  310  ASP A C   1 
ATOM   2358  O  O   . ASP A  1 310 ? 11.330  -27.403 67.947  1.00 56.72  ?  310  ASP A O   1 
ATOM   2359  C  CB  . ASP A  1 310 ? 10.990  -26.763 64.503  1.00 63.16  ?  310  ASP A CB  1 
ATOM   2360  C  CG  . ASP A  1 310 ? 11.509  -25.478 63.911  1.00 63.36  ?  310  ASP A CG  1 
ATOM   2361  O  OD1 . ASP A  1 310 ? 12.340  -24.815 64.567  1.00 61.00  ?  310  ASP A OD1 1 
ATOM   2362  O  OD2 . ASP A  1 310 ? 11.086  -25.136 62.785  1.00 66.00  ?  310  ASP A OD2 1 
ATOM   2363  N  N   . THR A  1 311 ? 11.631  -25.365 67.042  1.00 59.10  ?  311  THR A N   1 
ATOM   2364  C  CA  . THR A  1 311 ? 11.243  -24.689 68.271  1.00 56.97  ?  311  THR A CA  1 
ATOM   2365  C  C   . THR A  1 311 ? 9.765   -24.951 68.567  1.00 56.33  ?  311  THR A C   1 
ATOM   2366  O  O   . THR A  1 311 ? 8.964   -25.143 67.645  1.00 57.55  ?  311  THR A O   1 
ATOM   2367  C  CB  . THR A  1 311 ? 11.497  -23.187 68.165  1.00 57.01  ?  311  THR A CB  1 
ATOM   2368  O  OG1 . THR A  1 311 ? 10.720  -22.647 67.088  1.00 50.58  ?  311  THR A OG1 1 
ATOM   2369  C  CG2 . THR A  1 311 ? 12.974  -22.909 67.928  1.00 50.33  ?  311  THR A CG2 1 
ATOM   2370  N  N   . PRO A  1 312 ? 9.379   -24.988 69.847  1.00 54.71  ?  312  PRO A N   1 
ATOM   2371  C  CA  . PRO A  1 312 ? 7.961   -25.222 70.167  1.00 54.20  ?  312  PRO A CA  1 
ATOM   2372  C  C   . PRO A  1 312 ? 7.030   -24.216 69.516  1.00 55.40  ?  312  PRO A C   1 
ATOM   2373  O  O   . PRO A  1 312 ? 5.909   -24.578 69.135  1.00 55.11  ?  312  PRO A O   1 
ATOM   2374  C  CB  . PRO A  1 312 ? 7.929   -25.123 71.699  1.00 52.56  ?  312  PRO A CB  1 
ATOM   2375  C  CG  . PRO A  1 312 ? 9.313   -25.486 72.126  1.00 51.97  ?  312  PRO A CG  1 
ATOM   2376  C  CD  . PRO A  1 312 ? 10.220  -24.939 71.056  1.00 53.60  ?  312  PRO A CD  1 
ATOM   2377  N  N   . GLU A  1 313 ? 7.473   -22.965 69.367  1.00 57.92  ?  313  GLU A N   1 
ATOM   2378  C  CA  . GLU A  1 313 ? 6.676   -21.957 68.675  1.00 60.32  ?  313  GLU A CA  1 
ATOM   2379  C  C   . GLU A  1 313 ? 6.325   -22.418 67.265  1.00 60.53  ?  313  GLU A C   1 
ATOM   2380  O  O   . GLU A  1 313 ? 5.152   -22.407 66.863  1.00 63.37  ?  313  GLU A O   1 
ATOM   2381  C  CB  . GLU A  1 313 ? 7.448   -20.637 68.643  1.00 67.29  ?  313  GLU A CB  1 
ATOM   2382  C  CG  . GLU A  1 313 ? 6.631   -19.408 68.269  1.00 75.43  ?  313  GLU A CG  1 
ATOM   2383  C  CD  . GLU A  1 313 ? 5.560   -19.084 69.297  1.00 83.16  ?  313  GLU A CD  1 
ATOM   2384  O  OE1 . GLU A  1 313 ? 5.889   -19.004 70.505  1.00 83.67  ?  313  GLU A OE1 1 
ATOM   2385  O  OE2 . GLU A  1 313 ? 4.386   -18.913 68.896  1.00 87.93  ?  313  GLU A OE2 1 
ATOM   2386  N  N   . ALA A  1 314 ? 7.335   -22.851 66.506  1.00 65.49  ?  314  ALA A N   1 
ATOM   2387  C  CA  . ALA A  1 314 ? 7.102   -23.289 65.136  1.00 52.09  ?  314  ALA A CA  1 
ATOM   2388  C  C   . ALA A  1 314 ? 6.234   -24.537 65.093  1.00 55.17  ?  314  ALA A C   1 
ATOM   2389  O  O   . ALA A  1 314 ? 5.329   -24.642 64.258  1.00 56.00  ?  314  ALA A O   1 
ATOM   2390  C  CB  . ALA A  1 314 ? 8.434   -23.542 64.434  1.00 52.80  ?  314  ALA A CB  1 
ATOM   2391  N  N   . LEU A  1 315 ? 6.487   -25.491 65.992  1.00 53.97  ?  315  LEU A N   1 
ATOM   2392  C  CA  . LEU A  1 315 ? 5.739   -26.743 65.966  1.00 53.14  ?  315  LEU A CA  1 
ATOM   2393  C  C   . LEU A  1 315 ? 4.271   -26.542 66.325  1.00 55.16  ?  315  LEU A C   1 
ATOM   2394  O  O   . LEU A  1 315 ? 3.405   -27.227 65.767  1.00 56.41  ?  315  LEU A O   1 
ATOM   2395  C  CB  . LEU A  1 315 ? 6.385   -27.757 66.903  1.00 50.98  ?  315  LEU A CB  1 
ATOM   2396  C  CG  . LEU A  1 315 ? 7.782   -28.210 66.485  1.00 50.97  ?  315  LEU A CG  1 
ATOM   2397  C  CD1 . LEU A  1 315 ? 8.313   -29.237 67.471  1.00 50.89  ?  315  LEU A CD1 1 
ATOM   2398  C  CD2 . LEU A  1 315 ? 7.758   -28.781 65.086  1.00 50.85  ?  315  LEU A CD2 1 
ATOM   2399  N  N   . ILE A  1 316 ? 3.965   -25.626 67.248  1.00 56.47  ?  316  ILE A N   1 
ATOM   2400  C  CA  . ILE A  1 316 ? 2.565   -25.342 67.546  1.00 57.96  ?  316  ILE A CA  1 
ATOM   2401  C  C   . ILE A  1 316 ? 1.932   -24.445 66.491  1.00 62.25  ?  316  ILE A C   1 
ATOM   2402  O  O   . ILE A  1 316 ? 0.699   -24.412 66.381  1.00 63.62  ?  316  ILE A O   1 
ATOM   2403  C  CB  . ILE A  1 316 ? 2.384   -24.701 68.933  1.00 55.92  ?  316  ILE A CB  1 
ATOM   2404  C  CG1 . ILE A  1 316 ? 2.978   -23.291 68.963  1.00 57.65  ?  316  ILE A CG1 1 
ATOM   2405  C  CG2 . ILE A  1 316 ? 3.003   -25.577 70.010  1.00 52.46  ?  316  ILE A CG2 1 
ATOM   2406  C  CD1 . ILE A  1 316 ? 2.863   -22.608 70.305  1.00 57.12  ?  316  ILE A CD1 1 
ATOM   2407  N  N   . ASN A  1 317 ? 2.733   -23.706 65.716  1.00 65.27  ?  317  ASN A N   1 
ATOM   2408  C  CA  . ASN A  1 317 ? 2.167   -22.937 64.611  1.00 69.47  ?  317  ASN A CA  1 
ATOM   2409  C  C   . ASN A  1 317 ? 1.796   -23.824 63.425  1.00 69.04  ?  317  ASN A C   1 
ATOM   2410  O  O   . ASN A  1 317 ? 0.766   -23.599 62.781  1.00 70.71  ?  317  ASN A O   1 
ATOM   2411  C  CB  . ASN A  1 317 ? 3.149   -21.852 64.162  1.00 74.28  ?  317  ASN A CB  1 
ATOM   2412  C  CG  . ASN A  1 317 ? 3.106   -20.622 65.043  1.00 79.15  ?  317  ASN A CG  1 
ATOM   2413  O  OD1 . ASN A  1 317 ? 2.885   -20.712 66.256  1.00 81.15  ?  317  ASN A OD1 1 
ATOM   2414  N  ND2 . ASN A  1 317 ? 3.323   -19.461 64.438  1.00 80.91  ?  317  ASN A ND2 1 
ATOM   2415  N  N   . THR A  1 318 ? 2.638   -24.802 63.098  1.00 66.65  ?  318  THR A N   1 
ATOM   2416  C  CA  . THR A  1 318 ? 2.464   -25.630 61.913  1.00 67.54  ?  318  THR A CA  1 
ATOM   2417  C  C   . THR A  1 318 ? 1.867   -27.011 62.184  1.00 72.80  ?  318  THR A C   1 
ATOM   2418  O  O   . THR A  1 318 ? 1.653   -27.767 61.230  1.00 78.50  ?  318  THR A O   1 
ATOM   2419  C  CB  . THR A  1 318 ? 3.808   -25.787 61.197  1.00 64.39  ?  318  THR A CB  1 
ATOM   2420  O  OG1 . THR A  1 318 ? 4.649   -26.683 61.938  1.00 61.64  ?  318  THR A OG1 1 
ATOM   2421  C  CG2 . THR A  1 318 ? 4.495   -24.433 61.075  1.00 63.04  ?  318  THR A CG2 1 
ATOM   2422  N  N   . GLY A  1 319 ? 1.600   -27.370 63.437  1.00 71.13  ?  319  GLY A N   1 
ATOM   2423  C  CA  . GLY A  1 319 ? 1.188   -28.729 63.747  1.00 68.36  ?  319  GLY A CA  1 
ATOM   2424  C  C   . GLY A  1 319 ? -0.230  -29.052 63.293  1.00 67.48  ?  319  GLY A C   1 
ATOM   2425  O  O   . GLY A  1 319 ? -1.025  -28.182 62.931  1.00 66.26  ?  319  GLY A O   1 
ATOM   2426  N  N   . ASP A  1 320 ? -0.548  -30.351 63.302  1.00 68.38  ?  320  ASP A N   1 
ATOM   2427  C  CA  . ASP A  1 320 ? -1.916  -30.824 63.092  1.00 71.28  ?  320  ASP A CA  1 
ATOM   2428  C  C   . ASP A  1 320 ? -2.367  -31.570 64.340  1.00 70.57  ?  320  ASP A C   1 
ATOM   2429  O  O   . ASP A  1 320 ? -1.918  -32.691 64.604  1.00 70.80  ?  320  ASP A O   1 
ATOM   2430  C  CB  . ASP A  1 320 ? -2.028  -31.722 61.864  1.00 75.79  ?  320  ASP A CB  1 
ATOM   2431  C  CG  . ASP A  1 320 ? -3.450  -32.218 61.642  1.00 79.48  ?  320  ASP A CG  1 
ATOM   2432  O  OD1 . ASP A  1 320 ? -4.395  -31.463 61.959  1.00 79.82  ?  320  ASP A OD1 1 
ATOM   2433  O  OD2 . ASP A  1 320 ? -3.624  -33.361 61.161  1.00 81.45  ?  320  ASP A OD2 1 
ATOM   2434  N  N   . PHE A  1 321 ? -3.258  -30.939 65.095  1.00 69.60  ?  321  PHE A N   1 
ATOM   2435  C  CA  . PHE A  1 321 ? -3.749  -31.430 66.372  1.00 67.14  ?  321  PHE A CA  1 
ATOM   2436  C  C   . PHE A  1 321 ? -5.144  -32.047 66.292  1.00 71.89  ?  321  PHE A C   1 
ATOM   2437  O  O   . PHE A  1 321 ? -5.781  -32.235 67.333  1.00 71.70  ?  321  PHE A O   1 
ATOM   2438  C  CB  . PHE A  1 321 ? -3.651  -30.310 67.397  1.00 62.04  ?  321  PHE A CB  1 
ATOM   2439  C  CG  . PHE A  1 321 ? -2.251  -29.781 67.529  1.00 58.64  ?  321  PHE A CG  1 
ATOM   2440  C  CD1 . PHE A  1 321 ? -1.296  -30.491 68.238  1.00 56.67  ?  321  PHE A CD1 1 
ATOM   2441  C  CD2 . PHE A  1 321 ? -1.873  -28.611 66.896  1.00 59.39  ?  321  PHE A CD2 1 
ATOM   2442  C  CE1 . PHE A  1 321 ? 0.003   -30.028 68.348  1.00 55.71  ?  321  PHE A CE1 1 
ATOM   2443  C  CE2 . PHE A  1 321 ? -0.575  -28.139 67.000  1.00 58.76  ?  321  PHE A CE2 1 
ATOM   2444  C  CZ  . PHE A  1 321 ? 0.364   -28.850 67.728  1.00 57.21  ?  321  PHE A CZ  1 
ATOM   2445  N  N   . GLN A  1 322 ? -5.638  -32.325 65.079  1.00 77.26  ?  322  GLN A N   1 
ATOM   2446  C  CA  . GLN A  1 322 ? -7.027  -32.727 64.851  1.00 82.07  ?  322  GLN A CA  1 
ATOM   2447  C  C   . GLN A  1 322 ? -7.555  -33.744 65.858  1.00 81.44  ?  322  GLN A C   1 
ATOM   2448  O  O   . GLN A  1 322 ? -8.635  -33.554 66.426  1.00 80.70  ?  322  GLN A O   1 
ATOM   2449  C  CB  . GLN A  1 322 ? -7.168  -33.298 63.435  1.00 86.98  ?  322  GLN A CB  1 
ATOM   2450  C  CG  . GLN A  1 322 ? -7.350  -32.264 62.345  1.00 90.88  ?  322  GLN A CG  1 
ATOM   2451  C  CD  . GLN A  1 322 ? -8.807  -31.911 62.130  1.00 94.78  ?  322  GLN A CD  1 
ATOM   2452  O  OE1 . GLN A  1 322 ? -9.198  -30.742 62.207  1.00 95.98  ?  322  GLN A OE1 1 
ATOM   2453  N  NE2 . GLN A  1 322 ? -9.623  -32.926 61.858  1.00 96.14  ?  322  GLN A NE2 1 
ATOM   2454  N  N   . ASP A  1 323 ? -6.823  -34.832 66.102  1.00 82.86  ?  323  ASP A N   1 
ATOM   2455  C  CA  . ASP A  1 323 ? -7.232  -35.757 67.154  1.00 86.56  ?  323  ASP A CA  1 
ATOM   2456  C  C   . ASP A  1 323 ? -6.340  -35.426 68.341  1.00 85.19  ?  323  ASP A C   1 
ATOM   2457  O  O   . ASP A  1 323 ? -5.222  -35.925 68.465  1.00 87.28  ?  323  ASP A O   1 
ATOM   2458  C  CB  . ASP A  1 323 ? -7.082  -37.214 66.714  1.00 91.46  ?  323  ASP A CB  1 
ATOM   2459  C  CG  . ASP A  1 323 ? -7.818  -37.527 65.405  1.00 97.22  ?  323  ASP A CG  1 
ATOM   2460  O  OD1 . ASP A  1 323 ? -8.855  -36.886 65.114  1.00 99.51  ?  323  ASP A OD1 1 
ATOM   2461  O  OD2 . ASP A  1 323 ? -7.355  -38.425 64.663  1.00 98.53  ?  323  ASP A OD2 1 
ATOM   2462  N  N   . LEU A  1 324 ? -6.855  -34.574 69.223  1.00 81.51  ?  324  LEU A N   1 
ATOM   2463  C  CA  . LEU A  1 324 ? -6.208  -34.236 70.481  1.00 74.34  ?  324  LEU A CA  1 
ATOM   2464  C  C   . LEU A  1 324 ? -7.256  -33.604 71.381  1.00 69.31  ?  324  LEU A C   1 
ATOM   2465  O  O   . LEU A  1 324 ? -8.129  -32.874 70.906  1.00 71.06  ?  324  LEU A O   1 
ATOM   2466  C  CB  . LEU A  1 324 ? -5.024  -33.288 70.267  1.00 72.12  ?  324  LEU A CB  1 
ATOM   2467  C  CG  . LEU A  1 324 ? -4.190  -32.926 71.491  1.00 69.02  ?  324  LEU A CG  1 
ATOM   2468  C  CD1 . LEU A  1 324 ? -3.671  -34.195 72.149  1.00 67.59  ?  324  LEU A CD1 1 
ATOM   2469  C  CD2 . LEU A  1 324 ? -3.037  -32.004 71.111  1.00 67.91  ?  324  LEU A CD2 1 
ATOM   2470  N  N   . GLN A  1 325 ? -7.137  -33.842 72.682  1.00 62.76  ?  325  GLN A N   1 
ATOM   2471  C  CA  . GLN A  1 325 ? -7.980  -33.179 73.668  1.00 61.21  ?  325  GLN A CA  1 
ATOM   2472  C  C   . GLN A  1 325 ? -7.085  -32.662 74.780  1.00 59.52  ?  325  GLN A C   1 
ATOM   2473  O  O   . GLN A  1 325 ? -6.429  -33.452 75.466  1.00 59.11  ?  325  GLN A O   1 
ATOM   2474  C  CB  . GLN A  1 325 ? -9.053  -34.125 74.217  1.00 62.78  ?  325  GLN A CB  1 
ATOM   2475  C  CG  . GLN A  1 325 ? -10.050 -34.609 73.173  1.00 67.11  ?  325  GLN A CG  1 
ATOM   2476  C  CD  . GLN A  1 325 ? -9.901  -36.083 72.850  1.00 69.37  ?  325  GLN A CD  1 
ATOM   2477  O  OE1 . GLN A  1 325 ? -9.701  -36.907 73.740  1.00 67.99  ?  325  GLN A OE1 1 
ATOM   2478  N  NE2 . GLN A  1 325 ? -10.015 -36.422 71.572  1.00 72.86  ?  325  GLN A NE2 1 
ATOM   2479  N  N   . VAL A  1 326 ? -7.051  -31.342 74.951  1.00 59.61  ?  326  VAL A N   1 
ATOM   2480  C  CA  . VAL A  1 326 ? -6.127  -30.690 75.868  1.00 57.70  ?  326  VAL A CA  1 
ATOM   2481  C  C   . VAL A  1 326 ? -6.909  -29.885 76.893  1.00 56.58  ?  326  VAL A C   1 
ATOM   2482  O  O   . VAL A  1 326 ? -7.854  -29.169 76.545  1.00 56.89  ?  326  VAL A O   1 
ATOM   2483  C  CB  . VAL A  1 326 ? -5.138  -29.776 75.122  1.00 59.22  ?  326  VAL A CB  1 
ATOM   2484  C  CG1 . VAL A  1 326 ? -4.166  -29.163 76.095  1.00 46.31  ?  326  VAL A CG1 1 
ATOM   2485  C  CG2 . VAL A  1 326 ? -4.397  -30.556 74.072  1.00 60.25  ?  326  VAL A CG2 1 
ATOM   2486  N  N   . LEU A  1 327 ? -6.498  -29.999 78.154  1.00 54.20  ?  327  LEU A N   1 
ATOM   2487  C  CA  . LEU A  1 327 ? -6.962  -29.150 79.244  1.00 51.74  ?  327  LEU A CA  1 
ATOM   2488  C  C   . LEU A  1 327 ? -5.786  -28.304 79.719  1.00 51.71  ?  327  LEU A C   1 
ATOM   2489  O  O   . LEU A  1 327 ? -4.735  -28.846 80.075  1.00 51.77  ?  327  LEU A O   1 
ATOM   2490  C  CB  . LEU A  1 327 ? -7.522  -30.003 80.381  1.00 49.47  ?  327  LEU A CB  1 
ATOM   2491  C  CG  . LEU A  1 327 ? -7.970  -29.366 81.694  1.00 49.05  ?  327  LEU A CG  1 
ATOM   2492  C  CD1 . LEU A  1 327 ? -8.970  -28.262 81.460  1.00 50.65  ?  327  LEU A CD1 1 
ATOM   2493  C  CD2 . LEU A  1 327 ? -8.581  -30.438 82.559  1.00 49.77  ?  327  LEU A CD2 1 
ATOM   2494  N  N   . VAL A  1 328 ? -5.948  -26.980 79.701  1.00 47.08  ?  328  VAL A N   1 
ATOM   2495  C  CA  . VAL A  1 328 ? -4.893  -26.068 80.123  1.00 51.62  ?  328  VAL A CA  1 
ATOM   2496  C  C   . VAL A  1 328 ? -5.479  -25.035 81.071  1.00 51.11  ?  328  VAL A C   1 
ATOM   2497  O  O   . VAL A  1 328 ? -6.682  -24.773 81.079  1.00 49.76  ?  328  VAL A O   1 
ATOM   2498  C  CB  . VAL A  1 328 ? -4.201  -25.363 78.937  1.00 52.49  ?  328  VAL A CB  1 
ATOM   2499  C  CG1 . VAL A  1 328 ? -3.397  -26.352 78.130  1.00 54.23  ?  328  VAL A CG1 1 
ATOM   2500  C  CG2 . VAL A  1 328 ? -5.230  -24.672 78.059  1.00 47.82  ?  328  VAL A CG2 1 
ATOM   2501  N  N   . GLY A  1 329 ? -4.606  -24.439 81.872  1.00 51.47  ?  329  GLY A N   1 
ATOM   2502  C  CA  . GLY A  1 329 ? -5.059  -23.431 82.813  1.00 53.49  ?  329  GLY A CA  1 
ATOM   2503  C  C   . GLY A  1 329 ? -3.902  -22.815 83.566  1.00 55.08  ?  329  GLY A C   1 
ATOM   2504  O  O   . GLY A  1 329 ? -2.747  -23.238 83.445  1.00 55.64  ?  329  GLY A O   1 
ATOM   2505  N  N   . VAL A  1 330 ? -4.241  -21.792 84.349  1.00 56.44  ?  330  VAL A N   1 
ATOM   2506  C  CA  . VAL A  1 330 ? -3.302  -21.044 85.169  1.00 55.17  ?  330  VAL A CA  1 
ATOM   2507  C  C   . VAL A  1 330 ? -3.899  -20.891 86.565  1.00 54.61  ?  330  VAL A C   1 
ATOM   2508  O  O   . VAL A  1 330 ? -5.028  -21.305 86.822  1.00 57.41  ?  330  VAL A O   1 
ATOM   2509  C  CB  . VAL A  1 330 ? -2.973  -19.664 84.560  1.00 54.04  ?  330  VAL A CB  1 
ATOM   2510  C  CG1 . VAL A  1 330 ? -2.392  -19.815 83.161  1.00 52.14  ?  330  VAL A CG1 1 
ATOM   2511  C  CG2 . VAL A  1 330 ? -4.227  -18.804 84.520  1.00 54.56  ?  330  VAL A CG2 1 
ATOM   2512  N  N   . VAL A  1 331 ? -3.135  -20.273 87.466  1.00 51.40  ?  331  VAL A N   1 
ATOM   2513  C  CA  . VAL A  1 331 ? -3.682  -19.893 88.766  1.00 51.77  ?  331  VAL A CA  1 
ATOM   2514  C  C   . VAL A  1 331 ? -3.702  -18.372 88.856  1.00 52.42  ?  331  VAL A C   1 
ATOM   2515  O  O   . VAL A  1 331 ? -3.204  -17.678 87.962  1.00 52.11  ?  331  VAL A O   1 
ATOM   2516  C  CB  . VAL A  1 331 ? -2.889  -20.517 89.932  1.00 51.93  ?  331  VAL A CB  1 
ATOM   2517  C  CG1 . VAL A  1 331 ? -2.818  -22.031 89.785  1.00 51.51  ?  331  VAL A CG1 1 
ATOM   2518  C  CG2 . VAL A  1 331 ? -1.495  -19.917 90.024  1.00 51.81  ?  331  VAL A CG2 1 
ATOM   2519  N  N   . LYS A  1 332 ? -4.252  -17.845 89.952  1.00 54.52  ?  332  LYS A N   1 
ATOM   2520  C  CA  . LYS A  1 332 ? -4.556  -16.418 90.023  1.00 58.71  ?  332  LYS A CA  1 
ATOM   2521  C  C   . LYS A  1 332 ? -3.290  -15.571 90.014  1.00 58.78  ?  332  LYS A C   1 
ATOM   2522  O  O   . LYS A  1 332 ? -3.188  -14.605 89.249  1.00 62.04  ?  332  LYS A O   1 
ATOM   2523  C  CB  . LYS A  1 332 ? -5.400  -16.122 91.262  1.00 64.13  ?  332  LYS A CB  1 
ATOM   2524  C  CG  . LYS A  1 332 ? -5.926  -14.697 91.345  1.00 67.68  ?  332  LYS A CG  1 
ATOM   2525  C  CD  . LYS A  1 332 ? -6.782  -14.512 92.592  1.00 71.42  ?  332  LYS A CD  1 
ATOM   2526  C  CE  . LYS A  1 332 ? -6.850  -13.053 93.029  1.00 75.35  ?  332  LYS A CE  1 
ATOM   2527  N  NZ  . LYS A  1 332 ? -5.553  -12.566 93.586  1.00 76.20  ?  332  LYS A NZ  1 
ATOM   2528  N  N   . ASP A  1 333 ? -2.330  -15.882 90.881  1.00 57.38  ?  333  ASP A N   1 
ATOM   2529  C  CA  . ASP A  1 333 ? -1.039  -15.196 90.869  1.00 57.77  ?  333  ASP A CA  1 
ATOM   2530  C  C   . ASP A  1 333 ? 0.048   -16.212 90.533  1.00 55.55  ?  333  ASP A C   1 
ATOM   2531  O  O   . ASP A  1 333 ? 0.516   -16.945 91.408  1.00 53.45  ?  333  ASP A O   1 
ATOM   2532  C  CB  . ASP A  1 333 ? -0.789  -14.530 92.214  1.00 59.42  ?  333  ASP A CB  1 
ATOM   2533  C  CG  . ASP A  1 333 ? -2.050  -13.935 92.799  1.00 61.84  ?  333  ASP A CG  1 
ATOM   2534  O  OD1 . ASP A  1 333 ? -2.845  -14.698 93.390  1.00 60.72  ?  333  ASP A OD1 1 
ATOM   2535  O  OD2 . ASP A  1 333 ? -2.262  -12.712 92.637  1.00 64.56  ?  333  ASP A OD2 1 
ATOM   2536  N  N   . GLU A  1 334 ? 0.517   -16.200 89.289  1.00 55.96  ?  334  GLU A N   1 
ATOM   2537  C  CA  . GLU A  1 334 ? 1.504   -17.191 88.885  1.00 55.73  ?  334  GLU A CA  1 
ATOM   2538  C  C   . GLU A  1 334 ? 2.905   -16.788 89.313  1.00 59.45  ?  334  GLU A C   1 
ATOM   2539  O  O   . GLU A  1 334 ? 3.694   -17.635 89.743  1.00 60.51  ?  334  GLU A O   1 
ATOM   2540  C  CB  . GLU A  1 334 ? 1.447   -17.411 87.373  1.00 53.03  ?  334  GLU A CB  1 
ATOM   2541  C  CG  . GLU A  1 334 ? 0.202   -18.141 86.897  1.00 52.09  ?  334  GLU A CG  1 
ATOM   2542  C  CD  . GLU A  1 334 ? 0.329   -19.652 87.012  1.00 50.10  ?  334  GLU A CD  1 
ATOM   2543  O  OE1 . GLU A  1 334 ? 1.446   -20.142 87.296  1.00 49.26  ?  334  GLU A OE1 1 
ATOM   2544  O  OE2 . GLU A  1 334 ? -0.688  -20.352 86.812  1.00 48.82  ?  334  GLU A OE2 1 
ATOM   2545  N  N   . GLY A  1 335 ? 3.233   -15.509 89.194  1.00 60.95  ?  335  GLY A N   1 
ATOM   2546  C  CA  . GLY A  1 335 ? 4.589   -15.087 89.445  1.00 61.02  ?  335  GLY A CA  1 
ATOM   2547  C  C   . GLY A  1 335 ? 4.855   -14.588 90.835  1.00 62.74  ?  335  GLY A C   1 
ATOM   2548  O  O   . GLY A  1 335 ? 5.970   -14.129 91.097  1.00 63.76  ?  335  GLY A O   1 
ATOM   2549  N  N   . SER A  1 336 ? 3.873   -14.687 91.738  1.00 63.10  ?  336  SER A N   1 
ATOM   2550  C  CA  . SER A  1 336 ? 3.953   -14.004 93.028  1.00 62.80  ?  336  SER A CA  1 
ATOM   2551  C  C   . SER A  1 336 ? 5.222   -14.375 93.785  1.00 62.40  ?  336  SER A C   1 
ATOM   2552  O  O   . SER A  1 336 ? 6.046   -13.507 94.088  1.00 65.03  ?  336  SER A O   1 
ATOM   2553  C  CB  . SER A  1 336 ? 2.708   -14.296 93.867  1.00 63.37  ?  336  SER A CB  1 
ATOM   2554  O  OG  . SER A  1 336 ? 2.538   -15.682 94.073  1.00 64.67  ?  336  SER A OG  1 
ATOM   2555  N  N   . TYR A  1 337 ? 5.401   -15.659 94.113  1.00 59.88  ?  337  TYR A N   1 
ATOM   2556  C  CA  . TYR A  1 337 ? 6.516   -15.990 94.994  1.00 57.02  ?  337  TYR A CA  1 
ATOM   2557  C  C   . TYR A  1 337 ? 7.866   -16.019 94.290  1.00 53.35  ?  337  TYR A C   1 
ATOM   2558  O  O   . TYR A  1 337 ? 8.891   -16.086 94.975  1.00 52.56  ?  337  TYR A O   1 
ATOM   2559  C  CB  . TYR A  1 337 ? 6.290   -17.321 95.734  1.00 56.22  ?  337  TYR A CB  1 
ATOM   2560  C  CG  . TYR A  1 337 ? 6.183   -18.617 94.940  1.00 55.02  ?  337  TYR A CG  1 
ATOM   2561  C  CD1 . TYR A  1 337 ? 7.147   -18.988 94.010  1.00 53.21  ?  337  TYR A CD1 1 
ATOM   2562  C  CD2 . TYR A  1 337 ? 5.171   -19.527 95.220  1.00 55.94  ?  337  TYR A CD2 1 
ATOM   2563  C  CE1 . TYR A  1 337 ? 7.056   -20.187 93.328  1.00 52.44  ?  337  TYR A CE1 1 
ATOM   2564  C  CE2 . TYR A  1 337 ? 5.078   -20.728 94.553  1.00 54.44  ?  337  TYR A CE2 1 
ATOM   2565  C  CZ  . TYR A  1 337 ? 6.022   -21.056 93.610  1.00 53.76  ?  337  TYR A CZ  1 
ATOM   2566  O  OH  . TYR A  1 337 ? 5.920   -22.259 92.950  1.00 54.07  ?  337  TYR A OH  1 
ATOM   2567  N  N   . PHE A  1 338 ? 7.907   -15.972 92.956  1.00 51.70  ?  338  PHE A N   1 
ATOM   2568  C  CA  . PHE A  1 338 ? 9.199   -15.840 92.292  1.00 50.58  ?  338  PHE A CA  1 
ATOM   2569  C  C   . PHE A  1 338 ? 9.893   -14.548 92.700  1.00 53.09  ?  338  PHE A C   1 
ATOM   2570  O  O   . PHE A  1 338 ? 11.128  -14.491 92.752  1.00 54.83  ?  338  PHE A O   1 
ATOM   2571  C  CB  . PHE A  1 338 ? 9.026   -15.905 90.773  1.00 48.85  ?  338  PHE A CB  1 
ATOM   2572  C  CG  . PHE A  1 338 ? 8.722   -17.283 90.258  1.00 49.52  ?  338  PHE A CG  1 
ATOM   2573  C  CD1 . PHE A  1 338 ? 9.747   -18.151 89.913  1.00 49.04  ?  338  PHE A CD1 1 
ATOM   2574  C  CD2 . PHE A  1 338 ? 7.412   -17.719 90.126  1.00 50.64  ?  338  PHE A CD2 1 
ATOM   2575  C  CE1 . PHE A  1 338 ? 9.470   -19.429 89.439  1.00 47.37  ?  338  PHE A CE1 1 
ATOM   2576  C  CE2 . PHE A  1 338 ? 7.130   -18.996 89.655  1.00 49.18  ?  338  PHE A CE2 1 
ATOM   2577  C  CZ  . PHE A  1 338 ? 8.163   -19.850 89.314  1.00 47.30  ?  338  PHE A CZ  1 
ATOM   2578  N  N   . LEU A  1 339 ? 9.110   -13.522 93.046  1.00 53.93  ?  339  LEU A N   1 
ATOM   2579  C  CA  . LEU A  1 339 ? 9.660   -12.194 93.298  1.00 55.62  ?  339  LEU A CA  1 
ATOM   2580  C  C   . LEU A  1 339 ? 10.596  -12.176 94.500  1.00 56.90  ?  339  LEU A C   1 
ATOM   2581  O  O   . LEU A  1 339 ? 11.558  -11.399 94.517  1.00 57.72  ?  339  LEU A O   1 
ATOM   2582  C  CB  . LEU A  1 339 ? 8.515   -11.199 93.485  1.00 56.01  ?  339  LEU A CB  1 
ATOM   2583  C  CG  . LEU A  1 339 ? 7.542   -11.150 92.305  1.00 53.49  ?  339  LEU A CG  1 
ATOM   2584  C  CD1 . LEU A  1 339 ? 6.429   -10.155 92.556  1.00 55.55  ?  339  LEU A CD1 1 
ATOM   2585  C  CD2 . LEU A  1 339 ? 8.289   -10.807 91.033  1.00 53.10  ?  339  LEU A CD2 1 
ATOM   2586  N  N   . VAL A  1 340 ? 10.361  -13.038 95.498  1.00 56.89  ?  340  VAL A N   1 
ATOM   2587  C  CA  . VAL A  1 340 ? 11.224  -13.065 96.681  1.00 58.29  ?  340  VAL A CA  1 
ATOM   2588  C  C   . VAL A  1 340 ? 12.519  -13.813 96.426  1.00 58.92  ?  340  VAL A C   1 
ATOM   2589  O  O   . VAL A  1 340 ? 13.369  -13.892 97.324  1.00 61.06  ?  340  VAL A O   1 
ATOM   2590  C  CB  . VAL A  1 340 ? 10.526  -13.703 97.900  1.00 58.26  ?  340  VAL A CB  1 
ATOM   2591  C  CG1 . VAL A  1 340 ? 9.194   -13.031 98.160  1.00 60.06  ?  340  VAL A CG1 1 
ATOM   2592  C  CG2 . VAL A  1 340 ? 10.345  -15.196 97.693  1.00 55.67  ?  340  VAL A CG2 1 
ATOM   2593  N  N   . TYR A  1 341 ? 12.693  -14.355 95.222  1.00 56.41  ?  341  TYR A N   1 
ATOM   2594  C  CA  . TYR A  1 341 ? 13.874  -15.094 94.805  1.00 54.99  ?  341  TYR A CA  1 
ATOM   2595  C  C   . TYR A  1 341 ? 14.929  -14.210 94.137  1.00 56.03  ?  341  TYR A C   1 
ATOM   2596  O  O   . TYR A  1 341 ? 15.761  -14.717 93.374  1.00 53.09  ?  341  TYR A O   1 
ATOM   2597  C  CB  . TYR A  1 341 ? 13.474  -16.284 93.941  1.00 53.63  ?  341  TYR A CB  1 
ATOM   2598  C  CG  . TYR A  1 341 ? 13.008  -17.436 94.809  1.00 54.33  ?  341  TYR A CG  1 
ATOM   2599  C  CD1 . TYR A  1 341 ? 13.921  -18.296 95.409  1.00 54.10  ?  341  TYR A CD1 1 
ATOM   2600  C  CD2 . TYR A  1 341 ? 11.658  -17.645 95.054  1.00 54.98  ?  341  TYR A CD2 1 
ATOM   2601  C  CE1 . TYR A  1 341 ? 13.498  -19.345 96.209  1.00 52.90  ?  341  TYR A CE1 1 
ATOM   2602  C  CE2 . TYR A  1 341 ? 11.227  -18.691 95.853  1.00 53.63  ?  341  TYR A CE2 1 
ATOM   2603  C  CZ  . TYR A  1 341 ? 12.151  -19.536 96.426  1.00 52.40  ?  341  TYR A CZ  1 
ATOM   2604  O  OH  . TYR A  1 341 ? 11.724  -20.578 97.216  1.00 52.43  ?  341  TYR A OH  1 
ATOM   2605  N  N   . GLY A  1 342 ? 14.910  -12.905 94.413  1.00 58.39  ?  342  GLY A N   1 
ATOM   2606  C  CA  . GLY A  1 342 ? 15.874  -11.978 93.848  1.00 59.37  ?  342  GLY A CA  1 
ATOM   2607  C  C   . GLY A  1 342 ? 15.440  -10.722 93.121  1.00 59.85  ?  342  GLY A C   1 
ATOM   2608  O  O   . GLY A  1 342 ? 16.295  -10.035 92.553  1.00 60.93  ?  342  GLY A O   1 
ATOM   2609  N  N   . VAL A  1 343 ? 14.157  -10.378 93.145  1.00 56.07  ?  343  VAL A N   1 
ATOM   2610  C  CA  . VAL A  1 343 ? 13.708  -9.026  92.818  1.00 59.46  ?  343  VAL A CA  1 
ATOM   2611  C  C   . VAL A  1 343 ? 13.791  -8.187  94.091  1.00 58.88  ?  343  VAL A C   1 
ATOM   2612  O  O   . VAL A  1 343 ? 13.064  -8.476  95.055  1.00 62.46  ?  343  VAL A O   1 
ATOM   2613  C  CB  . VAL A  1 343 ? 12.289  -9.009  92.241  1.00 58.42  ?  343  VAL A CB  1 
ATOM   2614  C  CG1 . VAL A  1 343 ? 11.808  -7.574  92.087  1.00 57.57  ?  343  VAL A CG1 1 
ATOM   2615  C  CG2 . VAL A  1 343 ? 12.262  -9.708  90.896  1.00 57.16  ?  343  VAL A CG2 1 
ATOM   2616  N  N   . PRO A  1 344 ? 14.646  -7.165  94.141  1.00 60.41  ?  344  PRO A N   1 
ATOM   2617  C  CA  . PRO A  1 344 ? 14.828  -6.409  95.390  1.00 65.98  ?  344  PRO A CA  1 
ATOM   2618  C  C   . PRO A  1 344 ? 13.562  -5.686  95.825  1.00 66.59  ?  344  PRO A C   1 
ATOM   2619  O  O   . PRO A  1 344 ? 12.839  -5.102  95.014  1.00 66.83  ?  344  PRO A O   1 
ATOM   2620  C  CB  . PRO A  1 344 ? 15.947  -5.419  95.049  1.00 67.13  ?  344  PRO A CB  1 
ATOM   2621  C  CG  . PRO A  1 344 ? 16.633  -6.001  93.866  1.00 65.49  ?  344  PRO A CG  1 
ATOM   2622  C  CD  . PRO A  1 344 ? 15.592  -6.748  93.097  1.00 61.88  ?  344  PRO A CD  1 
ATOM   2623  N  N   . GLY A  1 345 ? 13.311  -5.720  97.132  1.00 67.91  ?  345  GLY A N   1 
ATOM   2624  C  CA  . GLY A  1 345 ? 12.135  -5.121  97.721  1.00 69.57  ?  345  GLY A CA  1 
ATOM   2625  C  C   . GLY A  1 345 ? 11.047  -6.104  98.092  1.00 69.39  ?  345  GLY A C   1 
ATOM   2626  O  O   . GLY A  1 345 ? 10.086  -5.713  98.768  1.00 70.28  ?  345  GLY A O   1 
ATOM   2627  N  N   . PHE A  1 346 ? 11.170  -7.362  97.682  1.00 68.92  ?  346  PHE A N   1 
ATOM   2628  C  CA  . PHE A  1 346 ? 10.134  -8.363  97.884  1.00 68.33  ?  346  PHE A CA  1 
ATOM   2629  C  C   . PHE A  1 346 ? 10.604  -9.413  98.880  1.00 69.18  ?  346  PHE A C   1 
ATOM   2630  O  O   . PHE A  1 346 ? 11.678  -10.003 98.713  1.00 69.65  ?  346  PHE A O   1 
ATOM   2631  C  CB  . PHE A  1 346 ? 9.748   -9.016  96.556  1.00 64.66  ?  346  PHE A CB  1 
ATOM   2632  C  CG  . PHE A  1 346 ? 8.973   -8.110  95.645  1.00 63.48  ?  346  PHE A CG  1 
ATOM   2633  C  CD1 . PHE A  1 346 ? 9.626   -7.187  94.846  1.00 64.19  ?  346  PHE A CD1 1 
ATOM   2634  C  CD2 . PHE A  1 346 ? 7.591   -8.174  95.597  1.00 62.62  ?  346  PHE A CD2 1 
ATOM   2635  C  CE1 . PHE A  1 346 ? 8.913   -6.349  94.007  1.00 65.02  ?  346  PHE A CE1 1 
ATOM   2636  C  CE2 . PHE A  1 346 ? 6.874   -7.339  94.764  1.00 63.45  ?  346  PHE A CE2 1 
ATOM   2637  C  CZ  . PHE A  1 346 ? 7.534   -6.426  93.968  1.00 64.58  ?  346  PHE A CZ  1 
ATOM   2638  N  N   . SER A  1 347 ? 9.797   -9.636  99.914  1.00 69.76  ?  347  SER A N   1 
ATOM   2639  C  CA  . SER A  1 347 ? 10.059  -10.641 100.930 1.00 71.17  ?  347  SER A CA  1 
ATOM   2640  C  C   . SER A  1 347 ? 8.732   -11.233 101.382 1.00 69.01  ?  347  SER A C   1 
ATOM   2641  O  O   . SER A  1 347 ? 7.693   -10.570 101.336 1.00 68.84  ?  347  SER A O   1 
ATOM   2642  C  CB  . SER A  1 347 ? 10.814  -10.051 102.129 1.00 76.55  ?  347  SER A CB  1 
ATOM   2643  O  OG  . SER A  1 347 ? 10.930  -10.996 103.179 1.00 79.42  ?  347  SER A OG  1 
ATOM   2644  N  N   . LYS A  1 348 ? 8.773   -12.491 101.814 1.00 67.44  ?  348  LYS A N   1 
ATOM   2645  C  CA  . LYS A  1 348 ? 7.549   -13.156 102.236 1.00 67.18  ?  348  LYS A CA  1 
ATOM   2646  C  C   . LYS A  1 348 ? 7.064   -12.694 103.602 1.00 70.64  ?  348  LYS A C   1 
ATOM   2647  O  O   . LYS A  1 348 ? 5.940   -13.034 103.985 1.00 71.92  ?  348  LYS A O   1 
ATOM   2648  C  CB  . LYS A  1 348 ? 7.745   -14.675 102.262 1.00 64.80  ?  348  LYS A CB  1 
ATOM   2649  C  CG  . LYS A  1 348 ? 8.479   -15.198 103.492 1.00 64.54  ?  348  LYS A CG  1 
ATOM   2650  C  CD  . LYS A  1 348 ? 8.272   -16.700 103.644 1.00 62.69  ?  348  LYS A CD  1 
ATOM   2651  C  CE  . LYS A  1 348 ? 8.866   -17.225 104.937 1.00 63.59  ?  348  LYS A CE  1 
ATOM   2652  N  NZ  . LYS A  1 348 ? 8.177   -16.668 106.133 1.00 65.98  ?  348  LYS A NZ  1 
ATOM   2653  N  N   . ASP A  1 349 ? 7.877   -11.951 104.347 1.00 73.11  ?  349  ASP A N   1 
ATOM   2654  C  CA  . ASP A  1 349 ? 7.562   -11.610 105.728 1.00 76.46  ?  349  ASP A CA  1 
ATOM   2655  C  C   . ASP A  1 349 ? 6.959   -10.216 105.905 1.00 79.29  ?  349  ASP A C   1 
ATOM   2656  O  O   . ASP A  1 349 ? 6.584   -9.861  107.027 1.00 82.18  ?  349  ASP A O   1 
ATOM   2657  C  CB  . ASP A  1 349 ? 8.820   -11.770 106.588 1.00 76.94  ?  349  ASP A CB  1 
ATOM   2658  C  CG  . ASP A  1 349 ? 9.322   -13.213 106.616 1.00 73.53  ?  349  ASP A CG  1 
ATOM   2659  O  OD1 . ASP A  1 349 ? 8.513   -14.119 106.911 1.00 72.49  ?  349  ASP A OD1 1 
ATOM   2660  O  OD2 . ASP A  1 349 ? 10.512  -13.448 106.314 1.00 71.52  ?  349  ASP A OD2 1 
ATOM   2661  N  N   . ASN A  1 350 ? 6.840   -9.426  104.838 1.00 79.33  ?  350  ASN A N   1 
ATOM   2662  C  CA  . ASN A  1 350 ? 6.118   -8.158  104.883 1.00 81.56  ?  350  ASN A CA  1 
ATOM   2663  C  C   . ASN A  1 350 ? 5.327   -8.009  103.591 1.00 81.01  ?  350  ASN A C   1 
ATOM   2664  O  O   . ASN A  1 350 ? 5.411   -8.849  102.691 1.00 82.30  ?  350  ASN A O   1 
ATOM   2665  C  CB  . ASN A  1 350 ? 7.068   -6.973  105.099 1.00 82.75  ?  350  ASN A CB  1 
ATOM   2666  C  CG  . ASN A  1 350 ? 8.219   -6.967  104.120 1.00 81.64  ?  350  ASN A CG  1 
ATOM   2667  O  OD1 . ASN A  1 350 ? 8.125   -6.391  103.037 1.00 80.57  ?  350  ASN A OD1 1 
ATOM   2668  N  ND2 . ASN A  1 350 ? 9.314   -7.616  104.495 1.00 82.67  ?  350  ASN A ND2 1 
ATOM   2669  N  N   . GLU A  1 351 ? 4.558   -6.924  103.487 1.00 79.90  ?  351  GLU A N   1 
ATOM   2670  C  CA  . GLU A  1 351 ? 3.667   -6.759  102.343 1.00 78.70  ?  351  GLU A CA  1 
ATOM   2671  C  C   . GLU A  1 351 ? 4.392   -6.365  101.061 1.00 75.55  ?  351  GLU A C   1 
ATOM   2672  O  O   . GLU A  1 351 ? 3.747   -6.291  100.008 1.00 75.86  ?  351  GLU A O   1 
ATOM   2673  C  CB  . GLU A  1 351 ? 2.581   -5.729  102.653 1.00 84.09  ?  351  GLU A CB  1 
ATOM   2674  C  CG  . GLU A  1 351 ? 1.372   -6.307  103.372 1.00 88.89  ?  351  GLU A CG  1 
ATOM   2675  C  CD  . GLU A  1 351 ? 0.197   -5.347  103.383 1.00 95.66  ?  351  GLU A CD  1 
ATOM   2676  O  OE1 . GLU A  1 351 ? -0.237  -4.928  102.288 1.00 95.38  ?  351  GLU A OE1 1 
ATOM   2677  O  OE2 . GLU A  1 351 ? -0.282  -4.998  104.486 1.00 100.93 ?  351  GLU A OE2 1 
ATOM   2678  N  N   . SER A  1 352 ? 5.696   -6.096  101.127 1.00 75.44  ?  352  SER A N   1 
ATOM   2679  C  CA  . SER A  1 352 ? 6.522   -5.860  99.941  1.00 76.04  ?  352  SER A CA  1 
ATOM   2680  C  C   . SER A  1 352 ? 5.997   -4.699  99.102  1.00 77.19  ?  352  SER A C   1 
ATOM   2681  O  O   . SER A  1 352 ? 5.937   -4.776  97.874  1.00 78.09  ?  352  SER A O   1 
ATOM   2682  C  CB  . SER A  1 352 ? 6.639   -7.123  99.086  1.00 75.36  ?  352  SER A CB  1 
ATOM   2683  O  OG  . SER A  1 352 ? 7.201   -8.193  99.823  1.00 76.54  ?  352  SER A OG  1 
ATOM   2684  N  N   . LEU A  1 353 ? 5.602   -3.617  99.763  1.00 77.33  ?  353  LEU A N   1 
ATOM   2685  C  CA  . LEU A  1 353 ? 5.251   -2.397  99.050  1.00 74.77  ?  353  LEU A CA  1 
ATOM   2686  C  C   . LEU A  1 353 ? 6.529   -1.752  98.526  1.00 73.62  ?  353  LEU A C   1 
ATOM   2687  O  O   . LEU A  1 353 ? 7.454   -1.484  99.297  1.00 75.54  ?  353  LEU A O   1 
ATOM   2688  C  CB  . LEU A  1 353 ? 4.495   -1.448  99.974  1.00 75.13  ?  353  LEU A CB  1 
ATOM   2689  C  CG  . LEU A  1 353 ? 3.272   -2.034  100.685 1.00 74.41  ?  353  LEU A CG  1 
ATOM   2690  C  CD1 . LEU A  1 353 ? 2.687   -1.029  101.659 1.00 76.98  ?  353  LEU A CD1 1 
ATOM   2691  C  CD2 . LEU A  1 353 ? 2.220   -2.475  99.680  1.00 71.50  ?  353  LEU A CD2 1 
ATOM   2692  N  N   . ILE A  1 354 ? 6.592   -1.511  97.219  1.00 71.58  ?  354  ILE A N   1 
ATOM   2693  C  CA  . ILE A  1 354 ? 7.833   -1.095  96.581  1.00 70.19  ?  354  ILE A CA  1 
ATOM   2694  C  C   . ILE A  1 354 ? 7.652   0.273   95.940  1.00 70.37  ?  354  ILE A C   1 
ATOM   2695  O  O   . ILE A  1 354 ? 6.540   0.712   95.638  1.00 70.89  ?  354  ILE A O   1 
ATOM   2696  C  CB  . ILE A  1 354 ? 8.314   -2.119  95.534  1.00 66.55  ?  354  ILE A CB  1 
ATOM   2697  C  CG1 . ILE A  1 354 ? 7.231   -2.348  94.477  1.00 65.43  ?  354  ILE A CG1 1 
ATOM   2698  C  CG2 . ILE A  1 354 ? 8.702   -3.422  96.210  1.00 65.37  ?  354  ILE A CG2 1 
ATOM   2699  C  CD1 . ILE A  1 354 ? 7.759   -2.915  93.180  1.00 63.65  ?  354  ILE A CD1 1 
ATOM   2700  N  N   . SER A  1 355 ? 8.780   0.950   95.740  1.00 71.15  ?  355  SER A N   1 
ATOM   2701  C  CA  . SER A  1 355 ? 8.803   2.229   95.053  1.00 75.30  ?  355  SER A CA  1 
ATOM   2702  C  C   . SER A  1 355 ? 8.719   2.012   93.545  1.00 73.89  ?  355  SER A C   1 
ATOM   2703  O  O   . SER A  1 355 ? 8.678   0.882   93.051  1.00 71.70  ?  355  SER A O   1 
ATOM   2704  C  CB  . SER A  1 355 ? 10.066  3.001   95.422  1.00 74.08  ?  355  SER A CB  1 
ATOM   2705  O  OG  . SER A  1 355 ? 11.225  2.263   95.074  1.00 72.76  ?  355  SER A OG  1 
ATOM   2706  N  N   . ARG A  1 356 ? 8.704   3.112   92.794  1.00 75.26  ?  356  ARG A N   1 
ATOM   2707  C  CA  . ARG A  1 356 ? 8.648   2.982   91.344  1.00 74.12  ?  356  ARG A CA  1 
ATOM   2708  C  C   . ARG A  1 356 ? 9.985   2.507   90.786  1.00 74.48  ?  356  ARG A C   1 
ATOM   2709  O  O   . ARG A  1 356 ? 10.020  1.671   89.873  1.00 75.09  ?  356  ARG A O   1 
ATOM   2710  C  CB  . ARG A  1 356 ? 8.221   4.304   90.708  1.00 75.41  ?  356  ARG A CB  1 
ATOM   2711  C  CG  . ARG A  1 356 ? 8.131   4.234   89.197  1.00 75.69  ?  356  ARG A CG  1 
ATOM   2712  C  CD  . ARG A  1 356 ? 7.059   5.154   88.641  1.00 78.25  ?  356  ARG A CD  1 
ATOM   2713  N  NE  . ARG A  1 356 ? 6.871   4.939   87.207  1.00 78.24  ?  356  ARG A NE  1 
ATOM   2714  C  CZ  . ARG A  1 356 ? 6.038   4.043   86.686  1.00 75.64  ?  356  ARG A CZ  1 
ATOM   2715  N  NH1 . ARG A  1 356 ? 5.303   3.281   87.482  1.00 74.24  ?  356  ARG A NH1 1 
ATOM   2716  N  NH2 . ARG A  1 356 ? 5.933   3.914   85.369  1.00 74.30  ?  356  ARG A NH2 1 
ATOM   2717  N  N   . ALA A  1 357 ? 11.096  3.010   91.333  1.00 74.25  ?  357  ALA A N   1 
ATOM   2718  C  CA  . ALA A  1 357 ? 12.409  2.569   90.873  1.00 72.37  ?  357  ALA A CA  1 
ATOM   2719  C  C   . ALA A  1 357 ? 12.597  1.076   91.097  1.00 71.62  ?  357  ALA A C   1 
ATOM   2720  O  O   . ALA A  1 357 ? 13.115  0.370   90.221  1.00 71.46  ?  357  ALA A O   1 
ATOM   2721  C  CB  . ALA A  1 357 ? 13.508  3.364   91.576  1.00 73.75  ?  357  ALA A CB  1 
ATOM   2722  N  N   . GLN A  1 358 ? 12.173  0.574   92.263  1.00 72.50  ?  358  GLN A N   1 
ATOM   2723  C  CA  . GLN A  1 358 ? 12.216  -0.864  92.519  1.00 71.64  ?  358  GLN A CA  1 
ATOM   2724  C  C   . GLN A  1 358 ? 11.352  -1.637  91.534  1.00 71.66  ?  358  GLN A C   1 
ATOM   2725  O  O   . GLN A  1 358 ? 11.659  -2.791  91.217  1.00 70.39  ?  358  GLN A O   1 
ATOM   2726  C  CB  . GLN A  1 358 ? 11.762  -1.166  93.945  1.00 71.77  ?  358  GLN A CB  1 
ATOM   2727  C  CG  . GLN A  1 358 ? 12.816  -0.926  95.008  1.00 73.36  ?  358  GLN A CG  1 
ATOM   2728  C  CD  . GLN A  1 358 ? 12.247  -1.019  96.408  1.00 73.69  ?  358  GLN A CD  1 
ATOM   2729  O  OE1 . GLN A  1 358 ? 11.072  -0.726  96.633  1.00 69.68  ?  358  GLN A OE1 1 
ATOM   2730  N  NE2 . GLN A  1 358 ? 13.076  -1.433  97.357  1.00 73.41  ?  358  GLN A NE2 1 
ATOM   2731  N  N   . PHE A  1 359 ? 10.265  -1.027  91.051  1.00 73.22  ?  359  PHE A N   1 
ATOM   2732  C  CA  . PHE A  1 359 ? 9.458   -1.679  90.024  1.00 71.16  ?  359  PHE A CA  1 
ATOM   2733  C  C   . PHE A  1 359 ? 10.186  -1.707  88.686  1.00 70.48  ?  359  PHE A C   1 
ATOM   2734  O  O   . PHE A  1 359 ? 10.076  -2.682  87.935  1.00 68.78  ?  359  PHE A O   1 
ATOM   2735  C  CB  . PHE A  1 359 ? 8.101   -0.983  89.888  1.00 70.36  ?  359  PHE A CB  1 
ATOM   2736  C  CG  . PHE A  1 359 ? 7.284   -1.473  88.720  1.00 67.33  ?  359  PHE A CG  1 
ATOM   2737  C  CD1 . PHE A  1 359 ? 6.715   -2.738  88.736  1.00 64.95  ?  359  PHE A CD1 1 
ATOM   2738  C  CD2 . PHE A  1 359 ? 7.075   -0.669  87.613  1.00 67.12  ?  359  PHE A CD2 1 
ATOM   2739  C  CE1 . PHE A  1 359 ? 5.964   -3.197  87.666  1.00 62.33  ?  359  PHE A CE1 1 
ATOM   2740  C  CE2 . PHE A  1 359 ? 6.323   -1.121  86.541  1.00 65.26  ?  359  PHE A CE2 1 
ATOM   2741  C  CZ  . PHE A  1 359 ? 5.766   -2.386  86.570  1.00 62.81  ?  359  PHE A CZ  1 
ATOM   2742  N  N   . LEU A  1 360 ? 10.936  -0.649  88.369  1.00 71.62  ?  360  LEU A N   1 
ATOM   2743  C  CA  . LEU A  1 360 ? 11.684  -0.628  87.117  1.00 69.43  ?  360  LEU A CA  1 
ATOM   2744  C  C   . LEU A  1 360 ? 12.787  -1.680  87.131  1.00 65.65  ?  360  LEU A C   1 
ATOM   2745  O  O   . LEU A  1 360 ? 12.886  -2.508  86.212  1.00 64.01  ?  360  LEU A O   1 
ATOM   2746  C  CB  . LEU A  1 360 ? 12.257  0.771   86.875  1.00 72.57  ?  360  LEU A CB  1 
ATOM   2747  C  CG  . LEU A  1 360 ? 11.224  1.905   86.810  1.00 75.82  ?  360  LEU A CG  1 
ATOM   2748  C  CD1 . LEU A  1 360 ? 11.854  3.276   87.051  1.00 78.51  ?  360  LEU A CD1 1 
ATOM   2749  C  CD2 . LEU A  1 360 ? 10.489  1.894   85.490  1.00 76.93  ?  360  LEU A CD2 1 
ATOM   2750  N  N   . ALA A  1 361 ? 13.613  -1.683  88.183  1.00 64.69  ?  361  ALA A N   1 
ATOM   2751  C  CA  . ALA A  1 361 ? 14.638  -2.715  88.306  1.00 63.62  ?  361  ALA A CA  1 
ATOM   2752  C  C   . ALA A  1 361 ? 14.012  -4.102  88.355  1.00 62.58  ?  361  ALA A C   1 
ATOM   2753  O  O   . ALA A  1 361 ? 14.574  -5.069  87.822  1.00 62.10  ?  361  ALA A O   1 
ATOM   2754  C  CB  . ALA A  1 361 ? 15.492  -2.473  89.547  1.00 63.62  ?  361  ALA A CB  1 
ATOM   2755  N  N   . GLY A  1 362 ? 12.841  -4.217  88.986  1.00 62.54  ?  362  GLY A N   1 
ATOM   2756  C  CA  . GLY A  1 362 ? 12.151  -5.495  89.012  1.00 60.45  ?  362  GLY A CA  1 
ATOM   2757  C  C   . GLY A  1 362 ? 11.727  -5.952  87.629  1.00 58.90  ?  362  GLY A C   1 
ATOM   2758  O  O   . GLY A  1 362 ? 11.720  -7.148  87.334  1.00 55.76  ?  362  GLY A O   1 
ATOM   2759  N  N   . VAL A  1 363 ? 11.358  -5.006  86.763  1.00 57.97  ?  363  VAL A N   1 
ATOM   2760  C  CA  . VAL A  1 363 ? 11.024  -5.366  85.389  1.00 57.12  ?  363  VAL A CA  1 
ATOM   2761  C  C   . VAL A  1 363 ? 12.277  -5.789  84.631  1.00 63.72  ?  363  VAL A C   1 
ATOM   2762  O  O   . VAL A  1 363 ? 12.238  -6.719  83.813  1.00 61.25  ?  363  VAL A O   1 
ATOM   2763  C  CB  . VAL A  1 363 ? 10.293  -4.206  84.691  1.00 58.27  ?  363  VAL A CB  1 
ATOM   2764  C  CG1 . VAL A  1 363 ? 10.157  -4.487  83.214  1.00 57.70  ?  363  VAL A CG1 1 
ATOM   2765  C  CG2 . VAL A  1 363 ? 8.922   -4.011  85.310  1.00 58.55  ?  363  VAL A CG2 1 
ATOM   2766  N  N   . ARG A  1 364 ? 13.415  -5.137  84.904  1.00 64.94  ?  364  ARG A N   1 
ATOM   2767  C  CA  . ARG A  1 364 ? 14.661  -5.584  84.282  1.00 63.30  ?  364  ARG A CA  1 
ATOM   2768  C  C   . ARG A  1 364 ? 15.037  -7.000  84.720  1.00 60.27  ?  364  ARG A C   1 
ATOM   2769  O  O   . ARG A  1 364 ? 15.623  -7.754  83.935  1.00 58.90  ?  364  ARG A O   1 
ATOM   2770  C  CB  . ARG A  1 364 ? 15.800  -4.613  84.599  1.00 66.07  ?  364  ARG A CB  1 
ATOM   2771  C  CG  . ARG A  1 364 ? 15.595  -3.199  84.076  1.00 71.88  ?  364  ARG A CG  1 
ATOM   2772  C  CD  . ARG A  1 364 ? 15.048  -3.182  82.655  1.00 76.43  ?  364  ARG A CD  1 
ATOM   2773  N  NE  . ARG A  1 364 ? 15.884  -3.910  81.699  1.00 79.61  ?  364  ARG A NE  1 
ATOM   2774  C  CZ  . ARG A  1 364 ? 16.636  -3.333  80.764  1.00 82.05  ?  364  ARG A CZ  1 
ATOM   2775  N  NH1 . ARG A  1 364 ? 16.666  -2.009  80.647  1.00 83.68  ?  364  ARG A NH1 1 
ATOM   2776  N  NH2 . ARG A  1 364 ? 17.358  -4.084  79.940  1.00 81.60  ?  364  ARG A NH2 1 
ATOM   2777  N  N   . ILE A  1 365 ? 14.722  -7.377  85.963  1.00 59.20  ?  365  ILE A N   1 
ATOM   2778  C  CA  . ILE A  1 365 ? 15.072  -8.716  86.437  1.00 57.13  ?  365  ILE A CA  1 
ATOM   2779  C  C   . ILE A  1 365 ? 14.063  -9.761  85.966  1.00 55.80  ?  365  ILE A C   1 
ATOM   2780  O  O   . ILE A  1 365 ? 14.441  -10.870 85.568  1.00 54.85  ?  365  ILE A O   1 
ATOM   2781  C  CB  . ILE A  1 365 ? 15.220  -8.717  87.971  1.00 56.78  ?  365  ILE A CB  1 
ATOM   2782  C  CG1 . ILE A  1 365 ? 16.467  -7.932  88.372  1.00 59.26  ?  365  ILE A CG1 1 
ATOM   2783  C  CG2 . ILE A  1 365 ? 15.268  -10.131 88.519  1.00 54.34  ?  365  ILE A CG2 1 
ATOM   2784  C  CD1 . ILE A  1 365 ? 16.593  -7.697  89.839  1.00 58.13  ?  365  ILE A CD1 1 
ATOM   2785  N  N   . GLY A  1 366 ? 12.771  -9.437  86.012  1.00 55.24  ?  366  GLY A N   1 
ATOM   2786  C  CA  . GLY A  1 366 ? 11.740  -10.397 85.656  1.00 53.25  ?  366  GLY A CA  1 
ATOM   2787  C  C   . GLY A  1 366 ? 11.617  -10.647 84.169  1.00 53.92  ?  366  GLY A C   1 
ATOM   2788  O  O   . GLY A  1 366 ? 11.093  -11.690 83.770  1.00 55.41  ?  366  GLY A O   1 
ATOM   2789  N  N   . VAL A  1 367 ? 12.078  -9.716  83.342  1.00 54.27  ?  367  VAL A N   1 
ATOM   2790  C  CA  . VAL A  1 367 ? 12.113  -9.920  81.897  1.00 55.68  ?  367  VAL A CA  1 
ATOM   2791  C  C   . VAL A  1 367 ? 13.569  -9.783  81.468  1.00 57.95  ?  367  VAL A C   1 
ATOM   2792  O  O   . VAL A  1 367 ? 13.931  -8.801  80.803  1.00 58.80  ?  367  VAL A O   1 
ATOM   2793  C  CB  . VAL A  1 367 ? 11.203  -8.924  81.160  1.00 56.35  ?  367  VAL A CB  1 
ATOM   2794  C  CG1 . VAL A  1 367 ? 10.835  -9.457  79.783  1.00 55.31  ?  367  VAL A CG1 1 
ATOM   2795  C  CG2 . VAL A  1 367 ? 9.955   -8.637  81.976  1.00 56.44  ?  367  VAL A CG2 1 
ATOM   2796  N  N   . PRO A  1 368 ? 14.432  -10.744 81.818  1.00 56.23  ?  368  PRO A N   1 
ATOM   2797  C  CA  . PRO A  1 368 ? 15.876  -10.519 81.653  1.00 58.12  ?  368  PRO A CA  1 
ATOM   2798  C  C   . PRO A  1 368 ? 16.304  -10.403 80.206  1.00 60.66  ?  368  PRO A C   1 
ATOM   2799  O  O   . PRO A  1 368 ? 17.336  -9.781  79.927  1.00 61.67  ?  368  PRO A O   1 
ATOM   2800  C  CB  . PRO A  1 368 ? 16.499  -11.752 82.321  1.00 54.28  ?  368  PRO A CB  1 
ATOM   2801  C  CG  . PRO A  1 368 ? 15.467  -12.808 82.167  1.00 50.78  ?  368  PRO A CG  1 
ATOM   2802  C  CD  . PRO A  1 368 ? 14.133  -12.117 82.256  1.00 52.88  ?  368  PRO A CD  1 
ATOM   2803  N  N   . GLN A  1 369 ? 15.546  -10.984 79.276  1.00 61.39  ?  369  GLN A N   1 
ATOM   2804  C  CA  . GLN A  1 369 ? 15.949  -10.969 77.877  1.00 64.03  ?  369  GLN A CA  1 
ATOM   2805  C  C   . GLN A  1 369 ? 15.519  -9.698  77.158  1.00 67.04  ?  369  GLN A C   1 
ATOM   2806  O  O   . GLN A  1 369 ? 16.065  -9.388  76.094  1.00 68.07  ?  369  GLN A O   1 
ATOM   2807  C  CB  . GLN A  1 369 ? 15.377  -12.190 77.157  1.00 63.93  ?  369  GLN A CB  1 
ATOM   2808  C  CG  . GLN A  1 369 ? 15.145  -13.409 78.055  1.00 63.73  ?  369  GLN A CG  1 
ATOM   2809  C  CD  . GLN A  1 369 ? 16.421  -14.063 78.558  1.00 64.06  ?  369  GLN A CD  1 
ATOM   2810  O  OE1 . GLN A  1 369 ? 16.403  -14.798 79.546  1.00 61.00  ?  369  GLN A OE1 1 
ATOM   2811  N  NE2 . GLN A  1 369 ? 17.530  -13.802 77.883  1.00 66.43  ?  369  GLN A NE2 1 
ATOM   2812  N  N   . ALA A  1 370 ? 14.584  -8.943  77.728  1.00 68.69  ?  370  ALA A N   1 
ATOM   2813  C  CA  . ALA A  1 370 ? 14.052  -7.763  77.060  1.00 70.67  ?  370  ALA A CA  1 
ATOM   2814  C  C   . ALA A  1 370 ? 15.117  -6.686  76.895  1.00 71.34  ?  370  ALA A C   1 
ATOM   2815  O  O   . ALA A  1 370 ? 15.937  -6.452  77.789  1.00 70.31  ?  370  ALA A O   1 
ATOM   2816  C  CB  . ALA A  1 370 ? 12.873  -7.199  77.850  1.00 71.75  ?  370  ALA A CB  1 
ATOM   2817  N  N   . SER A  1 371 ? 15.083  -6.012  75.747  1.00 72.92  ?  371  SER A N   1 
ATOM   2818  C  CA  . SER A  1 371 ? 15.952  -4.870  75.508  1.00 73.13  ?  371  SER A CA  1 
ATOM   2819  C  C   . SER A  1 371 ? 15.477  -3.676  76.337  1.00 74.44  ?  371  SER A C   1 
ATOM   2820  O  O   . SER A  1 371 ? 14.486  -3.746  77.070  1.00 73.25  ?  371  SER A O   1 
ATOM   2821  C  CB  . SER A  1 371 ? 15.982  -4.530  74.020  1.00 70.68  ?  371  SER A CB  1 
ATOM   2822  O  OG  . SER A  1 371 ? 14.682  -4.220  73.547  1.00 68.86  ?  371  SER A OG  1 
ATOM   2823  N  N   . ASP A  1 372 ? 16.201  -2.560  76.222  1.00 76.97  ?  372  ASP A N   1 
ATOM   2824  C  CA  . ASP A  1 372 ? 15.795  -1.350  76.932  1.00 79.36  ?  372  ASP A CA  1 
ATOM   2825  C  C   . ASP A  1 372 ? 14.413  -0.895  76.482  1.00 77.18  ?  372  ASP A C   1 
ATOM   2826  O  O   . ASP A  1 372 ? 13.535  -0.614  77.308  1.00 77.83  ?  372  ASP A O   1 
ATOM   2827  C  CB  . ASP A  1 372 ? 16.829  -0.241  76.721  1.00 84.31  ?  372  ASP A CB  1 
ATOM   2828  C  CG  . ASP A  1 372 ? 18.038  -0.380  77.632  1.00 86.30  ?  372  ASP A CG  1 
ATOM   2829  O  OD1 . ASP A  1 372 ? 18.364  -1.520  78.028  1.00 86.08  ?  372  ASP A OD1 1 
ATOM   2830  O  OD2 . ASP A  1 372 ? 18.666  0.655   77.946  1.00 87.73  ?  372  ASP A OD2 1 
ATOM   2831  N  N   . LEU A  1 373 ? 14.196  -0.838  75.165  1.00 73.98  ?  373  LEU A N   1 
ATOM   2832  C  CA  . LEU A  1 373 ? 12.901  -0.412  74.651  1.00 71.35  ?  373  LEU A CA  1 
ATOM   2833  C  C   . LEU A  1 373 ? 11.791  -1.350  75.107  1.00 70.76  ?  373  LEU A C   1 
ATOM   2834  O  O   . LEU A  1 373 ? 10.720  -0.897  75.528  1.00 71.55  ?  373  LEU A O   1 
ATOM   2835  C  CB  . LEU A  1 373 ? 12.942  -0.332  73.128  1.00 68.87  ?  373  LEU A CB  1 
ATOM   2836  C  CG  . LEU A  1 373 ? 11.665  0.217   72.495  1.00 67.75  ?  373  LEU A CG  1 
ATOM   2837  C  CD1 . LEU A  1 373 ? 11.395  1.626   72.996  1.00 70.08  ?  373  LEU A CD1 1 
ATOM   2838  C  CD2 . LEU A  1 373 ? 11.756  0.190   70.985  1.00 67.07  ?  373  LEU A CD2 1 
ATOM   2839  N  N   . ALA A  1 374 ? 12.030  -2.664  75.038  1.00 69.70  ?  374  ALA A N   1 
ATOM   2840  C  CA  . ALA A  1 374 ? 11.011  -3.624  75.452  1.00 68.55  ?  374  ALA A CA  1 
ATOM   2841  C  C   . ALA A  1 374 ? 10.690  -3.482  76.935  1.00 70.82  ?  374  ALA A C   1 
ATOM   2842  O  O   . ALA A  1 374 ? 9.528   -3.604  77.344  1.00 71.72  ?  374  ALA A O   1 
ATOM   2843  C  CB  . ALA A  1 374 ? 11.468  -5.047  75.132  1.00 64.58  ?  374  ALA A CB  1 
ATOM   2844  N  N   . ALA A  1 375 ? 11.708  -3.220  77.756  1.00 71.32  ?  375  ALA A N   1 
ATOM   2845  C  CA  . ALA A  1 375 ? 11.466  -3.000  79.177  1.00 70.77  ?  375  ALA A CA  1 
ATOM   2846  C  C   . ALA A  1 375 ? 10.623  -1.752  79.402  1.00 70.67  ?  375  ALA A C   1 
ATOM   2847  O  O   . ALA A  1 375 ? 9.689   -1.762  80.213  1.00 69.91  ?  375  ALA A O   1 
ATOM   2848  C  CB  . ALA A  1 375 ? 12.793  -2.898  79.924  1.00 71.84  ?  375  ALA A CB  1 
ATOM   2849  N  N   . GLU A  1 376 ? 10.933  -0.667  78.689  1.00 72.25  ?  376  GLU A N   1 
ATOM   2850  C  CA  . GLU A  1 376 ? 10.114  0.537   78.800  1.00 74.69  ?  376  GLU A CA  1 
ATOM   2851  C  C   . GLU A  1 376 ? 8.677   0.263   78.368  1.00 71.06  ?  376  GLU A C   1 
ATOM   2852  O  O   . GLU A  1 376 ? 7.730   0.804   78.951  1.00 71.42  ?  376  GLU A O   1 
ATOM   2853  C  CB  . GLU A  1 376 ? 10.731  1.665   77.971  1.00 80.99  ?  376  GLU A CB  1 
ATOM   2854  C  CG  . GLU A  1 376 ? 12.125  2.074   78.437  1.00 86.48  ?  376  GLU A CG  1 
ATOM   2855  C  CD  . GLU A  1 376 ? 12.536  3.441   77.924  1.00 94.49  ?  376  GLU A CD  1 
ATOM   2856  O  OE1 . GLU A  1 376 ? 12.561  3.639   76.688  1.00 97.15  ?  376  GLU A OE1 1 
ATOM   2857  O  OE2 . GLU A  1 376 ? 12.834  4.323   78.758  1.00 97.89  ?  376  GLU A OE2 1 
ATOM   2858  N  N   . ALA A  1 377 ? 8.494   -0.591  77.359  1.00 68.46  ?  377  ALA A N   1 
ATOM   2859  C  CA  . ALA A  1 377 ? 7.146   -0.959  76.937  1.00 67.72  ?  377  ALA A CA  1 
ATOM   2860  C  C   . ALA A  1 377 ? 6.409   -1.717  78.035  1.00 66.83  ?  377  ALA A C   1 
ATOM   2861  O  O   . ALA A  1 377 ? 5.231   -1.447  78.302  1.00 68.20  ?  377  ALA A O   1 
ATOM   2862  C  CB  . ALA A  1 377 ? 7.207   -1.795  75.659  1.00 66.40  ?  377  ALA A CB  1 
ATOM   2863  N  N   . VAL A  1 378 ? 7.084   -2.676  78.676  1.00 64.07  ?  378  VAL A N   1 
ATOM   2864  C  CA  . VAL A  1 378 ? 6.463   -3.427  79.766  1.00 61.60  ?  378  VAL A CA  1 
ATOM   2865  C  C   . VAL A  1 378 ? 6.074   -2.492  80.905  1.00 62.53  ?  378  VAL A C   1 
ATOM   2866  O  O   . VAL A  1 378 ? 4.965   -2.574  81.452  1.00 62.73  ?  378  VAL A O   1 
ATOM   2867  C  CB  . VAL A  1 378 ? 7.406   -4.540  80.252  1.00 59.66  ?  378  VAL A CB  1 
ATOM   2868  C  CG1 . VAL A  1 378 ? 6.863   -5.171  81.520  1.00 59.78  ?  378  VAL A CG1 1 
ATOM   2869  C  CG2 . VAL A  1 378 ? 7.579   -5.583  79.169  1.00 58.18  ?  378  VAL A CG2 1 
ATOM   2870  N  N   . VAL A  1 379 ? 6.983   -1.584  81.274  1.00 63.66  ?  379  VAL A N   1 
ATOM   2871  C  CA  . VAL A  1 379 ? 6.694   -0.609  82.324  1.00 62.76  ?  379  VAL A CA  1 
ATOM   2872  C  C   . VAL A  1 379 ? 5.459   0.207   81.972  1.00 64.14  ?  379  VAL A C   1 
ATOM   2873  O  O   . VAL A  1 379 ? 4.503   0.287   82.752  1.00 64.58  ?  379  VAL A O   1 
ATOM   2874  C  CB  . VAL A  1 379 ? 7.913   0.298   82.566  1.00 63.90  ?  379  VAL A CB  1 
ATOM   2875  C  CG1 . VAL A  1 379 ? 7.542   1.424   83.504  1.00 65.66  ?  379  VAL A CG1 1 
ATOM   2876  C  CG2 . VAL A  1 379 ? 9.057   -0.507  83.145  1.00 62.79  ?  379  VAL A CG2 1 
ATOM   2877  N  N   . LEU A  1 380 ? 5.452   0.818   80.786  1.00 65.84  ?  380  LEU A N   1 
ATOM   2878  C  CA  . LEU A  1 380 ? 4.329   1.674   80.420  1.00 67.54  ?  380  LEU A CA  1 
ATOM   2879  C  C   . LEU A  1 380 ? 3.030   0.886   80.282  1.00 65.96  ?  380  LEU A C   1 
ATOM   2880  O  O   . LEU A  1 380 ? 1.950   1.459   80.463  1.00 67.29  ?  380  LEU A O   1 
ATOM   2881  C  CB  . LEU A  1 380 ? 4.642   2.446   79.128  1.00 68.31  ?  380  LEU A CB  1 
ATOM   2882  C  CG  . LEU A  1 380 ? 5.895   3.347   79.055  1.00 70.17  ?  380  LEU A CG  1 
ATOM   2883  C  CD1 . LEU A  1 380 ? 5.695   4.498   78.086  1.00 73.26  ?  380  LEU A CD1 1 
ATOM   2884  C  CD2 . LEU A  1 380 ? 6.338   3.892   80.410  1.00 69.43  ?  380  LEU A CD2 1 
ATOM   2885  N  N   . HIS A  1 381 ? 3.105   -0.417  79.996  1.00 64.67  ?  381  HIS A N   1 
ATOM   2886  C  CA  . HIS A  1 381 ? 1.885   -1.211  79.878  1.00 65.72  ?  381  HIS A CA  1 
ATOM   2887  C  C   . HIS A  1 381 ? 1.321   -1.591  81.239  1.00 66.59  ?  381  HIS A C   1 
ATOM   2888  O  O   . HIS A  1 381 ? 0.098   -1.598  81.420  1.00 67.91  ?  381  HIS A O   1 
ATOM   2889  C  CB  . HIS A  1 381 ? 2.134   -2.476  79.058  1.00 66.00  ?  381  HIS A CB  1 
ATOM   2890  C  CG  . HIS A  1 381 ? 0.909   -3.323  78.873  1.00 68.08  ?  381  HIS A CG  1 
ATOM   2891  N  ND1 . HIS A  1 381 ? 0.064   -3.185  77.790  1.00 70.03  ?  381  HIS A ND1 1 
ATOM   2892  C  CD2 . HIS A  1 381 ? 0.380   -4.309  79.638  1.00 66.68  ?  381  HIS A CD2 1 
ATOM   2893  C  CE1 . HIS A  1 381 ? -0.927  -4.053  77.893  1.00 68.68  ?  381  HIS A CE1 1 
ATOM   2894  N  NE2 . HIS A  1 381 ? -0.758  -4.748  79.005  1.00 66.66  ?  381  HIS A NE2 1 
ATOM   2895  N  N   . TYR A  1 382 ? 2.183   -1.922  82.201  1.00 66.91  ?  382  TYR A N   1 
ATOM   2896  C  CA  . TYR A  1 382 ? 1.716   -2.370  83.510  1.00 66.27  ?  382  TYR A CA  1 
ATOM   2897  C  C   . TYR A  1 382 ? 1.569   -1.243  84.525  1.00 68.04  ?  382  TYR A C   1 
ATOM   2898  O  O   . TYR A  1 382 ? 1.110   -1.497  85.643  1.00 69.46  ?  382  TYR A O   1 
ATOM   2899  C  CB  . TYR A  1 382 ? 2.648   -3.448  84.067  1.00 63.72  ?  382  TYR A CB  1 
ATOM   2900  C  CG  . TYR A  1 382 ? 2.376   -4.815  83.488  1.00 61.41  ?  382  TYR A CG  1 
ATOM   2901  C  CD1 . TYR A  1 382 ? 2.917   -5.192  82.263  1.00 60.90  ?  382  TYR A CD1 1 
ATOM   2902  C  CD2 . TYR A  1 382 ? 1.568   -5.724  84.158  1.00 60.10  ?  382  TYR A CD2 1 
ATOM   2903  C  CE1 . TYR A  1 382 ? 2.669   -6.439  81.722  1.00 59.26  ?  382  TYR A CE1 1 
ATOM   2904  C  CE2 . TYR A  1 382 ? 1.313   -6.975  83.626  1.00 59.83  ?  382  TYR A CE2 1 
ATOM   2905  C  CZ  . TYR A  1 382 ? 1.867   -7.326  82.406  1.00 59.77  ?  382  TYR A CZ  1 
ATOM   2906  O  OH  . TYR A  1 382 ? 1.619   -8.569  81.868  1.00 59.33  ?  382  TYR A OH  1 
ATOM   2907  N  N   . THR A  1 383 ? 1.934   -0.017  84.169  1.00 68.62  ?  383  THR A N   1 
ATOM   2908  C  CA  . THR A  1 383 ? 1.746   1.116   85.062  1.00 70.85  ?  383  THR A CA  1 
ATOM   2909  C  C   . THR A  1 383 ? 0.305   1.608   85.002  1.00 75.87  ?  383  THR A C   1 
ATOM   2910  O  O   . THR A  1 383 ? -0.298  1.682   83.926  1.00 77.95  ?  383  THR A O   1 
ATOM   2911  C  CB  . THR A  1 383 ? 2.705   2.256   84.697  1.00 70.23  ?  383  THR A CB  1 
ATOM   2912  O  OG1 . THR A  1 383 ? 4.058   1.835   84.907  1.00 67.33  ?  383  THR A OG1 1 
ATOM   2913  C  CG2 . THR A  1 383 ? 2.444   3.487   85.546  1.00 70.71  ?  383  THR A CG2 1 
ATOM   2914  N  N   . ASP A  1 384 ? -0.254  1.917   86.171  1.00 78.18  ?  384  ASP A N   1 
ATOM   2915  C  CA  . ASP A  1 384 ? -1.480  2.702   86.268  1.00 80.70  ?  384  ASP A CA  1 
ATOM   2916  C  C   . ASP A  1 384 ? -1.055  4.161   86.368  1.00 81.96  ?  384  ASP A C   1 
ATOM   2917  O  O   . ASP A  1 384 ? -0.413  4.560   87.345  1.00 84.79  ?  384  ASP A O   1 
ATOM   2918  C  CB  . ASP A  1 384 ? -2.315  2.278   87.475  1.00 82.48  ?  384  ASP A CB  1 
ATOM   2919  C  CG  . ASP A  1 384 ? -3.644  3.020   87.569  1.00 86.79  ?  384  ASP A CG  1 
ATOM   2920  O  OD1 . ASP A  1 384 ? -3.866  3.982   86.799  1.00 89.29  ?  384  ASP A OD1 1 
ATOM   2921  O  OD2 . ASP A  1 384 ? -4.469  2.639   88.427  1.00 87.62  ?  384  ASP A OD2 1 
ATOM   2922  N  N   . TRP A  1 385 ? -1.407  4.953   85.360  1.00 80.08  ?  385  TRP A N   1 
ATOM   2923  C  CA  . TRP A  1 385 ? -0.956  6.335   85.263  1.00 79.91  ?  385  TRP A CA  1 
ATOM   2924  C  C   . TRP A  1 385 ? -1.848  7.302   86.026  1.00 82.08  ?  385  TRP A C   1 
ATOM   2925  O  O   . TRP A  1 385 ? -1.576  8.508   86.027  1.00 83.37  ?  385  TRP A O   1 
ATOM   2926  C  CB  . TRP A  1 385 ? -0.841  6.738   83.790  1.00 79.08  ?  385  TRP A CB  1 
ATOM   2927  C  CG  . TRP A  1 385 ? 0.219   5.938   83.113  1.00 75.48  ?  385  TRP A CG  1 
ATOM   2928  C  CD1 . TRP A  1 385 ? 0.048   4.789   82.399  1.00 73.61  ?  385  TRP A CD1 1 
ATOM   2929  C  CD2 . TRP A  1 385 ? 1.627   6.193   83.134  1.00 75.08  ?  385  TRP A CD2 1 
ATOM   2930  N  NE1 . TRP A  1 385 ? 1.261   4.321   81.958  1.00 72.08  ?  385  TRP A NE1 1 
ATOM   2931  C  CE2 . TRP A  1 385 ? 2.247   5.167   82.395  1.00 72.97  ?  385  TRP A CE2 1 
ATOM   2932  C  CE3 . TRP A  1 385 ? 2.424   7.194   83.699  1.00 76.47  ?  385  TRP A CE3 1 
ATOM   2933  C  CZ2 . TRP A  1 385 ? 3.625   5.114   82.203  1.00 79.37  ?  385  TRP A CZ2 1 
ATOM   2934  C  CZ3 . TRP A  1 385 ? 3.793   7.141   83.508  1.00 82.03  ?  385  TRP A CZ3 1 
ATOM   2935  C  CH2 . TRP A  1 385 ? 4.380   6.108   82.765  1.00 80.89  ?  385  TRP A CH2 1 
ATOM   2936  N  N   . LEU A  1 386 ? -2.910  6.802   86.660  1.00 82.77  ?  386  LEU A N   1 
ATOM   2937  C  CA  . LEU A  1 386 ? -3.599  7.574   87.686  1.00 86.71  ?  386  LEU A CA  1 
ATOM   2938  C  C   . LEU A  1 386 ? -2.888  7.480   89.033  1.00 90.51  ?  386  LEU A C   1 
ATOM   2939  O  O   . LEU A  1 386 ? -2.977  8.413   89.840  1.00 94.26  ?  386  LEU A O   1 
ATOM   2940  C  CB  . LEU A  1 386 ? -5.051  7.111   87.808  1.00 85.66  ?  386  LEU A CB  1 
ATOM   2941  C  CG  . LEU A  1 386 ? -6.079  8.163   87.381  1.00 87.81  ?  386  LEU A CG  1 
ATOM   2942  C  CD1 . LEU A  1 386 ? -7.500  7.663   87.579  1.00 88.10  ?  386  LEU A CD1 1 
ATOM   2943  C  CD2 . LEU A  1 386 ? -5.856  9.472   88.132  1.00 90.54  ?  386  LEU A CD2 1 
ATOM   2944  N  N   . HIS A  1 387 ? -2.187  6.375   89.295  1.00 89.47  ?  387  HIS A N   1 
ATOM   2945  C  CA  . HIS A  1 387 ? -1.432  6.187   90.537  1.00 89.86  ?  387  HIS A CA  1 
ATOM   2946  C  C   . HIS A  1 387 ? -0.083  5.557   90.217  1.00 85.76  ?  387  HIS A C   1 
ATOM   2947  O  O   . HIS A  1 387 ? 0.183   4.403   90.572  1.00 82.99  ?  387  HIS A O   1 
ATOM   2948  C  CB  . HIS A  1 387 ? -2.210  5.316   91.525  1.00 92.77  ?  387  HIS A CB  1 
ATOM   2949  C  CG  . HIS A  1 387 ? -3.672  5.625   91.586  1.00 97.93  ?  387  HIS A CG  1 
ATOM   2950  N  ND1 . HIS A  1 387 ? -4.166  6.777   92.161  1.00 102.63 ?  387  HIS A ND1 1 
ATOM   2951  C  CD2 . HIS A  1 387 ? -4.748  4.923   91.159  1.00 98.32  ?  387  HIS A CD2 1 
ATOM   2952  C  CE1 . HIS A  1 387 ? -5.485  6.776   92.076  1.00 104.61 ?  387  HIS A CE1 1 
ATOM   2953  N  NE2 . HIS A  1 387 ? -5.863  5.662   91.475  1.00 102.36 ?  387  HIS A NE2 1 
ATOM   2954  N  N   . PRO A  1 388 ? 0.805   6.298   89.548  1.00 86.01  ?  388  PRO A N   1 
ATOM   2955  C  CA  . PRO A  1 388 ? 2.086   5.703   89.133  1.00 84.96  ?  388  PRO A CA  1 
ATOM   2956  C  C   . PRO A  1 388 ? 3.034   5.409   90.284  1.00 85.99  ?  388  PRO A C   1 
ATOM   2957  O  O   . PRO A  1 388 ? 3.946   4.591   90.114  1.00 85.38  ?  388  PRO A O   1 
ATOM   2958  C  CB  . PRO A  1 388 ? 2.671   6.759   88.186  1.00 85.42  ?  388  PRO A CB  1 
ATOM   2959  C  CG  . PRO A  1 388 ? 2.080   8.041   88.661  1.00 88.07  ?  388  PRO A CG  1 
ATOM   2960  C  CD  . PRO A  1 388 ? 0.699   7.716   89.162  1.00 88.14  ?  388  PRO A CD  1 
ATOM   2961  N  N   . GLU A  1 389 ? 2.861   6.056   91.436  1.00 87.12  ?  389  GLU A N   1 
ATOM   2962  C  CA  . GLU A  1 389 ? 3.709   5.841   92.601  1.00 85.92  ?  389  GLU A CA  1 
ATOM   2963  C  C   . GLU A  1 389 ? 3.117   4.866   93.610  1.00 82.67  ?  389  GLU A C   1 
ATOM   2964  O  O   . GLU A  1 389 ? 3.771   4.569   94.614  1.00 81.64  ?  389  GLU A O   1 
ATOM   2965  C  CB  . GLU A  1 389 ? 3.993   7.178   93.296  1.00 91.06  ?  389  GLU A CB  1 
ATOM   2966  C  CG  . GLU A  1 389 ? 4.568   8.251   92.385  1.00 94.92  ?  389  GLU A CG  1 
ATOM   2967  C  CD  . GLU A  1 389 ? 6.035   8.019   92.067  1.00 96.19  ?  389  GLU A CD  1 
ATOM   2968  O  OE1 . GLU A  1 389 ? 6.724   7.373   92.891  1.00 96.16  ?  389  GLU A OE1 1 
ATOM   2969  O  OE2 . GLU A  1 389 ? 6.500   8.487   91.002  1.00 96.65  ?  389  GLU A OE2 1 
ATOM   2970  N  N   . ASP A  1 390 ? 1.914   4.360   93.371  1.00 82.05  ?  390  ASP A N   1 
ATOM   2971  C  CA  . ASP A  1 390 ? 1.203   3.579   94.382  1.00 83.84  ?  390  ASP A CA  1 
ATOM   2972  C  C   . ASP A  1 390 ? 1.923   2.262   94.649  1.00 81.33  ?  390  ASP A C   1 
ATOM   2973  O  O   . ASP A  1 390 ? 2.044   1.434   93.733  1.00 81.63  ?  390  ASP A O   1 
ATOM   2974  C  CB  . ASP A  1 390 ? -0.233  3.326   93.932  1.00 86.46  ?  390  ASP A CB  1 
ATOM   2975  C  CG  . ASP A  1 390 ? -0.990  2.407   94.874  1.00 88.55  ?  390  ASP A CG  1 
ATOM   2976  O  OD1 . ASP A  1 390 ? -0.770  2.486   96.103  1.00 89.02  ?  390  ASP A OD1 1 
ATOM   2977  O  OD2 . ASP A  1 390 ? -1.806  1.600   94.379  1.00 89.54  ?  390  ASP A OD2 1 
ATOM   2978  N  N   . PRO A  1 391 ? 2.406   2.021   95.873  1.00 77.41  ?  391  PRO A N   1 
ATOM   2979  C  CA  . PRO A  1 391 ? 3.206   0.811   96.119  1.00 74.88  ?  391  PRO A CA  1 
ATOM   2980  C  C   . PRO A  1 391 ? 2.420   -0.484  96.005  1.00 75.35  ?  391  PRO A C   1 
ATOM   2981  O  O   . PRO A  1 391 ? 2.986   -1.495  95.567  1.00 76.35  ?  391  PRO A O   1 
ATOM   2982  C  CB  . PRO A  1 391 ? 3.733   1.025   97.545  1.00 74.00  ?  391  PRO A CB  1 
ATOM   2983  C  CG  . PRO A  1 391 ? 3.629   2.494   97.772  1.00 76.44  ?  391  PRO A CG  1 
ATOM   2984  C  CD  . PRO A  1 391 ? 2.403   2.919   97.037  1.00 77.05  ?  391  PRO A CD  1 
ATOM   2985  N  N   . THR A  1 392 ? 1.142   -0.496  96.393  1.00 75.12  ?  392  THR A N   1 
ATOM   2986  C  CA  . THR A  1 392 ? 0.347   -1.714  96.263  1.00 74.11  ?  392  THR A CA  1 
ATOM   2987  C  C   . THR A  1 392 ? 0.197   -2.114  94.799  1.00 74.65  ?  392  THR A C   1 
ATOM   2988  O  O   . THR A  1 392 ? 0.461   -3.266  94.423  1.00 73.44  ?  392  THR A O   1 
ATOM   2989  C  CB  . THR A  1 392 ? -1.023  -1.519  96.910  1.00 74.10  ?  392  THR A CB  1 
ATOM   2990  O  OG1 . THR A  1 392 ? -0.854  -1.063  98.257  1.00 73.73  ?  392  THR A OG1 1 
ATOM   2991  C  CG2 . THR A  1 392 ? -1.796  -2.827  96.919  1.00 70.54  ?  392  THR A CG2 1 
ATOM   2992  N  N   . HIS A  1 393 ? -0.215  -1.166  93.951  1.00 76.57  ?  393  HIS A N   1 
ATOM   2993  C  CA  . HIS A  1 393 ? -0.337  -1.460  92.529  1.00 76.96  ?  393  HIS A CA  1 
ATOM   2994  C  C   . HIS A  1 393 ? 1.005   -1.825  91.911  1.00 73.22  ?  393  HIS A C   1 
ATOM   2995  O  O   . HIS A  1 393 ? 1.056   -2.638  90.983  1.00 70.70  ?  393  HIS A O   1 
ATOM   2996  C  CB  . HIS A  1 393 ? -0.939  -0.279  91.772  1.00 82.94  ?  393  HIS A CB  1 
ATOM   2997  C  CG  . HIS A  1 393 ? -0.842  -0.427  90.284  1.00 88.00  ?  393  HIS A CG  1 
ATOM   2998  N  ND1 . HIS A  1 393 ? -1.408  -1.487  89.606  1.00 88.42  ?  393  HIS A ND1 1 
ATOM   2999  C  CD2 . HIS A  1 393 ? -0.214  0.325   89.349  1.00 90.83  ?  393  HIS A CD2 1 
ATOM   3000  C  CE1 . HIS A  1 393 ? -1.150  -1.371  88.316  1.00 88.76  ?  393  HIS A CE1 1 
ATOM   3001  N  NE2 . HIS A  1 393 ? -0.426  -0.281  88.133  1.00 90.45  ?  393  HIS A NE2 1 
ATOM   3002  N  N   . LEU A  1 394 ? 2.096   -1.227  92.393  1.00 71.63  ?  394  LEU A N   1 
ATOM   3003  C  CA  . LEU A  1 394 ? 3.407   -1.556  91.845  1.00 67.84  ?  394  LEU A CA  1 
ATOM   3004  C  C   . LEU A  1 394 ? 3.800   -2.988  92.183  1.00 65.24  ?  394  LEU A C   1 
ATOM   3005  O  O   . LEU A  1 394 ? 4.272   -3.730  91.315  1.00 65.65  ?  394  LEU A O   1 
ATOM   3006  C  CB  . LEU A  1 394 ? 4.451   -0.561  92.348  1.00 68.75  ?  394  LEU A CB  1 
ATOM   3007  C  CG  . LEU A  1 394 ? 4.364   0.807   91.669  1.00 70.00  ?  394  LEU A CG  1 
ATOM   3008  C  CD1 . LEU A  1 394 ? 5.402   1.761   92.228  1.00 70.14  ?  394  LEU A CD1 1 
ATOM   3009  C  CD2 . LEU A  1 394 ? 4.519   0.656   90.161  1.00 69.07  ?  394  LEU A CD2 1 
ATOM   3010  N  N   . ARG A  1 395 ? 3.603   -3.400  93.436  1.00 64.03  ?  395  ARG A N   1 
ATOM   3011  C  CA  . ARG A  1 395 ? 3.897   -4.781  93.819  1.00 63.13  ?  395  ARG A CA  1 
ATOM   3012  C  C   . ARG A  1 395 ? 3.047   -5.766  93.020  1.00 60.89  ?  395  ARG A C   1 
ATOM   3013  O  O   . ARG A  1 395 ? 3.570   -6.711  92.408  1.00 59.15  ?  395  ARG A O   1 
ATOM   3014  C  CB  . ARG A  1 395 ? 3.676   -4.950  95.326  1.00 64.27  ?  395  ARG A CB  1 
ATOM   3015  C  CG  . ARG A  1 395 ? 3.709   -6.382  95.836  1.00 62.04  ?  395  ARG A CG  1 
ATOM   3016  C  CD  . ARG A  1 395 ? 2.336   -6.819  96.324  1.00 62.42  ?  395  ARG A CD  1 
ATOM   3017  N  NE  . ARG A  1 395 ? 2.014   -6.295  97.648  1.00 64.41  ?  395  ARG A NE  1 
ATOM   3018  C  CZ  . ARG A  1 395 ? 0.791   -6.289  98.171  1.00 65.51  ?  395  ARG A CZ  1 
ATOM   3019  N  NH1 . ARG A  1 395 ? -0.231  -6.769  97.478  1.00 64.81  ?  395  ARG A NH1 1 
ATOM   3020  N  NH2 . ARG A  1 395 ? 0.585   -5.798  99.384  1.00 67.48  ?  395  ARG A NH2 1 
ATOM   3021  N  N   . ASP A  1 396 ? 1.727   -5.544  92.998  1.00 61.70  ?  396  ASP A N   1 
ATOM   3022  C  CA  . ASP A  1 396 ? 0.841   -6.434  92.254  1.00 63.07  ?  396  ASP A CA  1 
ATOM   3023  C  C   . ASP A  1 396 ? 1.214   -6.464  90.777  1.00 64.12  ?  396  ASP A C   1 
ATOM   3024  O  O   . ASP A  1 396 ? 1.116   -7.508  90.117  1.00 63.36  ?  396  ASP A O   1 
ATOM   3025  C  CB  . ASP A  1 396 ? -0.613  -6.001  92.433  1.00 62.04  ?  396  ASP A CB  1 
ATOM   3026  C  CG  . ASP A  1 396 ? -1.125  -6.245  93.838  1.00 63.01  ?  396  ASP A CG  1 
ATOM   3027  O  OD1 . ASP A  1 396 ? -0.496  -7.033  94.573  1.00 62.19  ?  396  ASP A OD1 1 
ATOM   3028  O  OD2 . ASP A  1 396 ? -2.152  -5.640  94.208  1.00 64.76  ?  396  ASP A OD2 1 
ATOM   3029  N  N   . ALA A  1 397 ? 1.650   -5.323  90.238  1.00 66.19  ?  397  ALA A N   1 
ATOM   3030  C  CA  . ALA A  1 397 ? 2.011   -5.255  88.826  1.00 65.60  ?  397  ALA A CA  1 
ATOM   3031  C  C   . ALA A  1 397 ? 3.303   -6.005  88.544  1.00 58.09  ?  397  ALA A C   1 
ATOM   3032  O  O   . ALA A  1 397 ? 3.454   -6.582  87.469  1.00 56.95  ?  397  ALA A O   1 
ATOM   3033  C  CB  . ALA A  1 397 ? 2.130   -3.798  88.378  1.00 67.07  ?  397  ALA A CB  1 
ATOM   3034  N  N   . MET A  1 398 ? 4.243   -5.999  89.487  1.00 58.20  ?  398  MET A N   1 
ATOM   3035  C  CA  . MET A  1 398 ? 5.426   -6.841  89.358  1.00 58.42  ?  398  MET A CA  1 
ATOM   3036  C  C   . MET A  1 398 ? 5.031   -8.311  89.280  1.00 57.88  ?  398  MET A C   1 
ATOM   3037  O  O   . MET A  1 398 ? 5.444   -9.038  88.360  1.00 58.09  ?  398  MET A O   1 
ATOM   3038  C  CB  . MET A  1 398 ? 6.358   -6.596  90.543  1.00 59.45  ?  398  MET A CB  1 
ATOM   3039  C  CG  . MET A  1 398 ? 7.734   -7.203  90.402  1.00 60.41  ?  398  MET A CG  1 
ATOM   3040  S  SD  . MET A  1 398 ? 8.644   -6.438  89.050  1.00 62.62  ?  398  MET A SD  1 
ATOM   3041  C  CE  . MET A  1 398 ? 8.536   -7.721  87.798  1.00 61.61  ?  398  MET A CE  1 
ATOM   3042  N  N   . SER A  1 399 ? 4.218   -8.761  90.243  1.00 58.49  ?  399  SER A N   1 
ATOM   3043  C  CA  . SER A  1 399 ? 3.735   -10.139 90.221  1.00 57.69  ?  399  SER A CA  1 
ATOM   3044  C  C   . SER A  1 399 ? 3.045   -10.468 88.899  1.00 58.97  ?  399  SER A C   1 
ATOM   3045  O  O   . SER A  1 399 ? 3.228   -11.560 88.343  1.00 51.97  ?  399  SER A O   1 
ATOM   3046  C  CB  . SER A  1 399 ? 2.786   -10.370 91.400  1.00 56.66  ?  399  SER A CB  1 
ATOM   3047  O  OG  . SER A  1 399 ? 2.087   -11.598 91.290  1.00 54.73  ?  399  SER A OG  1 
ATOM   3048  N  N   . ALA A  1 400 ? 2.264   -9.522  88.370  1.00 59.45  ?  400  ALA A N   1 
ATOM   3049  C  CA  . ALA A  1 400 ? 1.547   -9.767  87.124  1.00 57.52  ?  400  ALA A CA  1 
ATOM   3050  C  C   . ALA A  1 400 ? 2.486   -9.788  85.925  1.00 55.39  ?  400  ALA A C   1 
ATOM   3051  O  O   . ALA A  1 400 ? 2.248   -10.534 84.973  1.00 52.53  ?  400  ALA A O   1 
ATOM   3052  C  CB  . ALA A  1 400 ? 0.454   -8.718  86.932  1.00 55.69  ?  400  ALA A CB  1 
ATOM   3053  N  N   . VAL A  1 401 ? 3.548   -8.982  85.943  1.00 57.51  ?  401  VAL A N   1 
ATOM   3054  C  CA  . VAL A  1 401 ? 4.524   -9.020  84.858  1.00 53.25  ?  401  VAL A CA  1 
ATOM   3055  C  C   . VAL A  1 401 ? 5.173   -10.391 84.791  1.00 67.38  ?  401  VAL A C   1 
ATOM   3056  O  O   . VAL A  1 401 ? 5.234   -11.015 83.726  1.00 62.12  ?  401  VAL A O   1 
ATOM   3057  C  CB  . VAL A  1 401 ? 5.581   -7.915  85.026  1.00 54.22  ?  401  VAL A CB  1 
ATOM   3058  C  CG1 . VAL A  1 401 ? 6.782   -8.203  84.146  1.00 53.59  ?  401  VAL A CG1 1 
ATOM   3059  C  CG2 . VAL A  1 401 ? 5.003   -6.567  84.672  1.00 55.81  ?  401  VAL A CG2 1 
ATOM   3060  N  N   . VAL A  1 402 ? 5.661   -10.886 85.932  1.00 51.30  ?  402  VAL A N   1 
ATOM   3061  C  CA  . VAL A  1 402 ? 6.357   -12.171 85.904  1.00 49.97  ?  402  VAL A CA  1 
ATOM   3062  C  C   . VAL A  1 402 ? 5.388   -13.303 85.571  1.00 51.48  ?  402  VAL A C   1 
ATOM   3063  O  O   . VAL A  1 402 ? 5.694   -14.183 84.752  1.00 52.29  ?  402  VAL A O   1 
ATOM   3064  C  CB  . VAL A  1 402 ? 7.090   -12.411 87.234  1.00 50.02  ?  402  VAL A CB  1 
ATOM   3065  C  CG1 . VAL A  1 402 ? 7.630   -13.819 87.284  1.00 50.69  ?  402  VAL A CG1 1 
ATOM   3066  C  CG2 . VAL A  1 402 ? 8.222   -11.421 87.385  1.00 50.95  ?  402  VAL A CG2 1 
ATOM   3067  N  N   . GLY A  1 403 ? 4.198   -13.289 86.177  1.00 52.67  ?  403  GLY A N   1 
ATOM   3068  C  CA  . GLY A  1 403 ? 3.233   -14.346 85.909  1.00 52.06  ?  403  GLY A CA  1 
ATOM   3069  C  C   . GLY A  1 403 ? 2.770   -14.366 84.465  1.00 53.94  ?  403  GLY A C   1 
ATOM   3070  O  O   . GLY A  1 403 ? 2.813   -15.404 83.800  1.00 54.84  ?  403  GLY A O   1 
ATOM   3071  N  N   . ASP A  1 404 ? 2.319   -13.213 83.958  1.00 55.05  ?  404  ASP A N   1 
ATOM   3072  C  CA  . ASP A  1 404 ? 1.861   -13.133 82.573  1.00 53.23  ?  404  ASP A CA  1 
ATOM   3073  C  C   . ASP A  1 404 ? 2.975   -13.484 81.600  1.00 52.20  ?  404  ASP A C   1 
ATOM   3074  O  O   . ASP A  1 404 ? 2.751   -14.214 80.629  1.00 53.91  ?  404  ASP A O   1 
ATOM   3075  C  CB  . ASP A  1 404 ? 1.325   -11.735 82.261  1.00 54.15  ?  404  ASP A CB  1 
ATOM   3076  C  CG  . ASP A  1 404 ? 0.120   -11.366 83.100  1.00 56.36  ?  404  ASP A CG  1 
ATOM   3077  O  OD1 . ASP A  1 404 ? -0.458  -12.276 83.730  1.00 56.63  ?  404  ASP A OD1 1 
ATOM   3078  O  OD2 . ASP A  1 404 ? -0.262  -10.171 83.113  1.00 57.72  ?  404  ASP A OD2 1 
ATOM   3079  N  N   . HIS A  1 405 ? 4.180   -12.966 81.840  1.00 51.24  ?  405  HIS A N   1 
ATOM   3080  C  CA  . HIS A  1 405 ? 5.289   -13.203 80.922  1.00 51.85  ?  405  HIS A CA  1 
ATOM   3081  C  C   . HIS A  1 405 ? 5.645   -14.683 80.850  1.00 51.81  ?  405  HIS A C   1 
ATOM   3082  O  O   . HIS A  1 405 ? 5.776   -15.247 79.755  1.00 52.65  ?  405  HIS A O   1 
ATOM   3083  C  CB  . HIS A  1 405 ? 6.504   -12.378 81.349  1.00 51.89  ?  405  HIS A CB  1 
ATOM   3084  C  CG  . HIS A  1 405 ? 7.745   -12.676 80.565  1.00 52.68  ?  405  HIS A CG  1 
ATOM   3085  N  ND1 . HIS A  1 405 ? 7.745   -12.812 79.194  1.00 54.48  ?  405  HIS A ND1 1 
ATOM   3086  C  CD2 . HIS A  1 405 ? 9.027   -12.857 80.961  1.00 52.91  ?  405  HIS A CD2 1 
ATOM   3087  C  CE1 . HIS A  1 405 ? 8.973   -13.067 78.779  1.00 54.89  ?  405  HIS A CE1 1 
ATOM   3088  N  NE2 . HIS A  1 405 ? 9.771   -13.099 79.832  1.00 53.70  ?  405  HIS A NE2 1 
ATOM   3089  N  N   . ASN A  1 406 ? 5.833   -15.320 82.012  1.00 49.75  ?  406  ASN A N   1 
ATOM   3090  C  CA  . ASN A  1 406 ? 6.323   -16.696 82.042  1.00 47.87  ?  406  ASN A CA  1 
ATOM   3091  C  C   . ASN A  1 406 ? 5.232   -17.749 81.859  1.00 48.39  ?  406  ASN A C   1 
ATOM   3092  O  O   . ASN A  1 406 ? 5.515   -18.827 81.325  1.00 48.70  ?  406  ASN A O   1 
ATOM   3093  C  CB  . ASN A  1 406 ? 7.084   -16.943 83.341  1.00 46.85  ?  406  ASN A CB  1 
ATOM   3094  C  CG  . ASN A  1 406 ? 8.406   -16.208 83.380  1.00 48.91  ?  406  ASN A CG  1 
ATOM   3095  O  OD1 . ASN A  1 406 ? 9.335   -16.557 82.652  1.00 50.82  ?  406  ASN A OD1 1 
ATOM   3096  N  ND2 . ASN A  1 406 ? 8.499   -15.180 84.220  1.00 49.20  ?  406  ASN A ND2 1 
ATOM   3097  N  N   . VAL A  1 407 ? 4.002   -17.489 82.300  1.00 48.19  ?  407  VAL A N   1 
ATOM   3098  C  CA  . VAL A  1 407 ? 3.007   -18.558 82.370  1.00 46.87  ?  407  VAL A CA  1 
ATOM   3099  C  C   . VAL A  1 407 ? 1.723   -18.191 81.641  1.00 48.34  ?  407  VAL A C   1 
ATOM   3100  O  O   . VAL A  1 407 ? 1.317   -18.886 80.704  1.00 49.65  ?  407  VAL A O   1 
ATOM   3101  C  CB  . VAL A  1 407 ? 2.697   -18.934 83.827  1.00 47.32  ?  407  VAL A CB  1 
ATOM   3102  C  CG1 . VAL A  1 407 ? 1.588   -19.973 83.863  1.00 44.99  ?  407  VAL A CG1 1 
ATOM   3103  C  CG2 . VAL A  1 407 ? 3.953   -19.440 84.525  1.00 44.57  ?  407  VAL A CG2 1 
ATOM   3104  N  N   . VAL A  1 408 ? 1.059   -17.123 82.090  1.00 49.40  ?  408  VAL A N   1 
ATOM   3105  C  CA  . VAL A  1 408 ? -0.304  -16.840 81.640  1.00 51.13  ?  408  VAL A CA  1 
ATOM   3106  C  C   . VAL A  1 408 ? -0.352  -16.659 80.126  1.00 53.19  ?  408  VAL A C   1 
ATOM   3107  O  O   . VAL A  1 408 ? -1.125  -17.325 79.429  1.00 53.58  ?  408  VAL A O   1 
ATOM   3108  C  CB  . VAL A  1 408 ? -0.872  -15.612 82.371  1.00 51.30  ?  408  VAL A CB  1 
ATOM   3109  C  CG1 . VAL A  1 408 ? -2.216  -15.233 81.783  1.00 50.54  ?  408  VAL A CG1 1 
ATOM   3110  C  CG2 . VAL A  1 408 ? -1.008  -15.908 83.852  1.00 53.15  ?  408  VAL A CG2 1 
ATOM   3111  N  N   . CYS A  1 409 ? 0.460   -15.750 79.597  1.00 55.29  ?  409  CYS A N   1 
ATOM   3112  C  CA  . CYS A  1 409 ? 0.437   -15.479 78.163  1.00 58.47  ?  409  CYS A CA  1 
ATOM   3113  C  C   . CYS A  1 409 ? 0.974   -16.635 77.322  1.00 59.36  ?  409  CYS A C   1 
ATOM   3114  O  O   . CYS A  1 409 ? 0.413   -16.906 76.251  1.00 62.53  ?  409  CYS A O   1 
ATOM   3115  C  CB  . CYS A  1 409 ? 1.187   -14.187 77.855  1.00 61.16  ?  409  CYS A CB  1 
ATOM   3116  S  SG  . CYS A  1 409 ? 0.296   -12.776 78.509  1.00 64.07  ?  409  CYS A SG  1 
ATOM   3117  N  N   . PRO A  1 410 ? 2.064   -17.313 77.716  1.00 56.36  ?  410  PRO A N   1 
ATOM   3118  C  CA  . PRO A  1 410 ? 2.414   -18.559 77.011  1.00 54.54  ?  410  PRO A CA  1 
ATOM   3119  C  C   . PRO A  1 410 ? 1.261   -19.550 76.942  1.00 55.24  ?  410  PRO A C   1 
ATOM   3120  O  O   . PRO A  1 410 ? 1.016   -20.144 75.882  1.00 55.53  ?  410  PRO A O   1 
ATOM   3121  C  CB  . PRO A  1 410 ? 3.592   -19.098 77.830  1.00 51.62  ?  410  PRO A CB  1 
ATOM   3122  C  CG  . PRO A  1 410 ? 4.249   -17.885 78.341  1.00 52.37  ?  410  PRO A CG  1 
ATOM   3123  C  CD  . PRO A  1 410 ? 3.140   -16.906 78.641  1.00 54.85  ?  410  PRO A CD  1 
ATOM   3124  N  N   . VAL A  1 411 ? 0.528   -19.723 78.046  1.00 55.10  ?  411  VAL A N   1 
ATOM   3125  C  CA  . VAL A  1 411 ? -0.622  -20.624 78.043  1.00 54.62  ?  411  VAL A CA  1 
ATOM   3126  C  C   . VAL A  1 411 ? -1.698  -20.113 77.092  1.00 55.38  ?  411  VAL A C   1 
ATOM   3127  O  O   . VAL A  1 411 ? -2.308  -20.890 76.347  1.00 54.80  ?  411  VAL A O   1 
ATOM   3128  C  CB  . VAL A  1 411 ? -1.163  -20.801 79.474  1.00 54.48  ?  411  VAL A CB  1 
ATOM   3129  C  CG1 . VAL A  1 411 ? -2.549  -21.430 79.452  1.00 46.88  ?  411  VAL A CG1 1 
ATOM   3130  C  CG2 . VAL A  1 411 ? -0.206  -21.638 80.295  1.00 45.14  ?  411  VAL A CG2 1 
ATOM   3131  N  N   . ALA A  1 412 ? -1.940  -18.799 77.093  1.00 56.59  ?  412  ALA A N   1 
ATOM   3132  C  CA  . ALA A  1 412 ? -2.962  -18.232 76.219  1.00 57.57  ?  412  ALA A CA  1 
ATOM   3133  C  C   . ALA A  1 412 ? -2.615  -18.451 74.752  1.00 57.75  ?  412  ALA A C   1 
ATOM   3134  O  O   . ALA A  1 412 ? -3.489  -18.772 73.935  1.00 57.56  ?  412  ALA A O   1 
ATOM   3135  C  CB  . ALA A  1 412 ? -3.137  -16.743 76.520  1.00 57.47  ?  412  ALA A CB  1 
ATOM   3136  N  N   . GLN A  1 413 ? -1.336  -18.297 74.404  1.00 58.56  ?  413  GLN A N   1 
ATOM   3137  C  CA  . GLN A  1 413 ? -0.915  -18.521 73.027  1.00 60.41  ?  413  GLN A CA  1 
ATOM   3138  C  C   . GLN A  1 413 ? -1.027  -19.989 72.651  1.00 58.65  ?  413  GLN A C   1 
ATOM   3139  O  O   . GLN A  1 413 ? -1.518  -20.319 71.566  1.00 59.50  ?  413  GLN A O   1 
ATOM   3140  C  CB  . GLN A  1 413 ? 0.516   -18.036 72.824  1.00 62.63  ?  413  GLN A CB  1 
ATOM   3141  C  CG  . GLN A  1 413 ? 1.052   -18.357 71.445  1.00 66.49  ?  413  GLN A CG  1 
ATOM   3142  C  CD  . GLN A  1 413 ? 2.382   -17.705 71.177  1.00 70.27  ?  413  GLN A CD  1 
ATOM   3143  O  OE1 . GLN A  1 413 ? 3.326   -17.859 71.954  1.00 71.72  ?  413  GLN A OE1 1 
ATOM   3144  N  NE2 . GLN A  1 413 ? 2.465   -16.952 70.080  1.00 71.55  ?  413  GLN A NE2 1 
ATOM   3145  N  N   . LEU A  1 414 ? -0.577  -20.882 73.535  1.00 57.21  ?  414  LEU A N   1 
ATOM   3146  C  CA  . LEU A  1 414 ? -0.682  -22.307 73.250  1.00 56.74  ?  414  LEU A CA  1 
ATOM   3147  C  C   . LEU A  1 414 ? -2.134  -22.719 73.050  1.00 58.42  ?  414  LEU A C   1 
ATOM   3148  O  O   . LEU A  1 414 ? -2.455  -23.442 72.101  1.00 61.24  ?  414  LEU A O   1 
ATOM   3149  C  CB  . LEU A  1 414 ? -0.039  -23.125 74.370  1.00 54.71  ?  414  LEU A CB  1 
ATOM   3150  C  CG  . LEU A  1 414 ? -0.049  -24.638 74.152  1.00 53.55  ?  414  LEU A CG  1 
ATOM   3151  C  CD1 . LEU A  1 414 ? 0.834   -25.009 72.967  1.00 56.48  ?  414  LEU A CD1 1 
ATOM   3152  C  CD2 . LEU A  1 414 ? 0.387   -25.374 75.410  1.00 44.86  ?  414  LEU A CD2 1 
ATOM   3153  N  N   . ALA A  1 415 ? -3.032  -22.256 73.923  1.00 56.82  ?  415  ALA A N   1 
ATOM   3154  C  CA  . ALA A  1 415 ? -4.445  -22.589 73.770  1.00 57.25  ?  415  ALA A CA  1 
ATOM   3155  C  C   . ALA A  1 415 ? -5.008  -22.022 72.471  1.00 58.82  ?  415  ALA A C   1 
ATOM   3156  O  O   . ALA A  1 415 ? -5.839  -22.662 71.812  1.00 58.86  ?  415  ALA A O   1 
ATOM   3157  C  CB  . ALA A  1 415 ? -5.237  -22.081 74.975  1.00 56.50  ?  415  ALA A CB  1 
ATOM   3158  N  N   . GLY A  1 416 ? -4.558  -20.827 72.080  1.00 59.83  ?  416  GLY A N   1 
ATOM   3159  C  CA  . GLY A  1 416 ? -5.005  -20.267 70.815  1.00 61.33  ?  416  GLY A CA  1 
ATOM   3160  C  C   . GLY A  1 416 ? -4.557  -21.085 69.618  1.00 61.33  ?  416  GLY A C   1 
ATOM   3161  O  O   . GLY A  1 416 ? -5.340  -21.335 68.698  1.00 62.43  ?  416  GLY A O   1 
ATOM   3162  N  N   . ARG A  1 417 ? -3.294  -21.521 69.616  1.00 59.06  ?  417  ARG A N   1 
ATOM   3163  C  CA  . ARG A  1 417 ? -2.766  -22.234 68.456  1.00 57.13  ?  417  ARG A CA  1 
ATOM   3164  C  C   . ARG A  1 417 ? -3.315  -23.653 68.383  1.00 59.24  ?  417  ARG A C   1 
ATOM   3165  O  O   . ARG A  1 417 ? -3.684  -24.126 67.302  1.00 63.69  ?  417  ARG A O   1 
ATOM   3166  C  CB  . ARG A  1 417 ? -1.239  -22.248 68.491  1.00 57.76  ?  417  ARG A CB  1 
ATOM   3167  C  CG  . ARG A  1 417 ? -0.606  -20.860 68.495  1.00 62.51  ?  417  ARG A CG  1 
ATOM   3168  C  CD  . ARG A  1 417 ? -1.333  -19.878 67.575  1.00 68.94  ?  417  ARG A CD  1 
ATOM   3169  N  NE  . ARG A  1 417 ? -1.290  -20.287 66.174  1.00 76.68  ?  417  ARG A NE  1 
ATOM   3170  C  CZ  . ARG A  1 417 ? -0.665  -19.609 65.215  1.00 82.54  ?  417  ARG A CZ  1 
ATOM   3171  N  NH1 . ARG A  1 417 ? -0.033  -18.476 65.507  1.00 83.66  ?  417  ARG A NH1 1 
ATOM   3172  N  NH2 . ARG A  1 417 ? -0.675  -20.063 63.964  1.00 84.52  ?  417  ARG A NH2 1 
ATOM   3173  N  N   . LEU A  1 418 ? -3.369  -24.353 69.518  1.00 57.82  ?  418  LEU A N   1 
ATOM   3174  C  CA  . LEU A  1 418 ? -3.981  -25.678 69.536  1.00 55.96  ?  418  LEU A CA  1 
ATOM   3175  C  C   . LEU A  1 418 ? -5.444  -25.609 69.127  1.00 56.42  ?  418  LEU A C   1 
ATOM   3176  O  O   . LEU A  1 418 ? -5.924  -26.455 68.365  1.00 54.72  ?  418  LEU A O   1 
ATOM   3177  C  CB  . LEU A  1 418 ? -3.852  -26.306 70.923  1.00 52.90  ?  418  LEU A CB  1 
ATOM   3178  C  CG  . LEU A  1 418 ? -2.450  -26.718 71.375  1.00 51.97  ?  418  LEU A CG  1 
ATOM   3179  C  CD1 . LEU A  1 418 ? -2.517  -27.521 72.658  1.00 51.64  ?  418  LEU A CD1 1 
ATOM   3180  C  CD2 . LEU A  1 418 ? -1.753  -27.511 70.289  1.00 51.21  ?  418  LEU A CD2 1 
ATOM   3181  N  N   . ALA A  1 419 ? -6.170  -24.605 69.625  1.00 59.59  ?  419  ALA A N   1 
ATOM   3182  C  CA  . ALA A  1 419 ? -7.581  -24.480 69.277  1.00 63.27  ?  419  ALA A CA  1 
ATOM   3183  C  C   . ALA A  1 419 ? -7.759  -24.174 67.798  1.00 66.79  ?  419  ALA A C   1 
ATOM   3184  O  O   . ALA A  1 419 ? -8.648  -24.730 67.145  1.00 69.18  ?  419  ALA A O   1 
ATOM   3185  C  CB  . ALA A  1 419 ? -8.236  -23.393 70.124  1.00 55.97  ?  419  ALA A CB  1 
ATOM   3186  N  N   . ALA A  1 420 ? -6.917  -23.290 67.253  1.00 67.62  ?  420  ALA A N   1 
ATOM   3187  C  CA  . ALA A  1 420 ? -7.063  -22.890 65.857  1.00 67.44  ?  420  ALA A CA  1 
ATOM   3188  C  C   . ALA A  1 420 ? -6.780  -24.054 64.921  1.00 66.21  ?  420  ALA A C   1 
ATOM   3189  O  O   . ALA A  1 420 ? -7.426  -24.199 63.878  1.00 68.37  ?  420  ALA A O   1 
ATOM   3190  C  CB  . ALA A  1 420 ? -6.136  -21.716 65.542  1.00 66.30  ?  420  ALA A CB  1 
ATOM   3191  N  N   . GLN A  1 421 ? -5.831  -24.905 65.288  1.00 65.88  ?  421  GLN A N   1 
ATOM   3192  C  CA  . GLN A  1 421 ? -5.380  -26.002 64.446  1.00 70.57  ?  421  GLN A CA  1 
ATOM   3193  C  C   . GLN A  1 421 ? -6.126  -27.305 64.706  1.00 72.97  ?  421  GLN A C   1 
ATOM   3194  O  O   . GLN A  1 421 ? -5.669  -28.366 64.270  1.00 74.45  ?  421  GLN A O   1 
ATOM   3195  C  CB  . GLN A  1 421 ? -3.873  -26.188 64.585  1.00 72.96  ?  421  GLN A CB  1 
ATOM   3196  C  CG  . GLN A  1 421 ? -3.142  -25.324 63.573  1.00 79.27  ?  421  GLN A CG  1 
ATOM   3197  C  CD  . GLN A  1 421 ? -1.784  -24.892 64.035  1.00 84.51  ?  421  GLN A CD  1 
ATOM   3198  O  OE1 . GLN A  1 421 ? -1.515  -23.699 64.176  1.00 86.79  ?  421  GLN A OE1 1 
ATOM   3199  N  NE2 . GLN A  1 421 ? -0.905  -25.854 64.255  1.00 86.53  ?  421  GLN A NE2 1 
ATOM   3200  N  N   . GLY A  1 422 ? -7.216  -27.261 65.460  1.00 73.86  ?  422  GLY A N   1 
ATOM   3201  C  CA  . GLY A  1 422 ? -8.176  -28.340 65.441  1.00 74.76  ?  422  GLY A CA  1 
ATOM   3202  C  C   . GLY A  1 422 ? -8.182  -29.248 66.640  1.00 73.15  ?  422  GLY A C   1 
ATOM   3203  O  O   . GLY A  1 422 ? -8.839  -30.293 66.590  1.00 75.43  ?  422  GLY A O   1 
ATOM   3204  N  N   . ALA A  1 423 ? -7.458  -28.903 67.698  1.00 68.84  ?  423  ALA A N   1 
ATOM   3205  C  CA  . ALA A  1 423 ? -7.568  -29.618 68.957  1.00 64.03  ?  423  ALA A CA  1 
ATOM   3206  C  C   . ALA A  1 423 ? -8.789  -29.138 69.734  1.00 63.40  ?  423  ALA A C   1 
ATOM   3207  O  O   . ALA A  1 423 ? -9.284  -28.022 69.544  1.00 63.37  ?  423  ALA A O   1 
ATOM   3208  C  CB  . ALA A  1 423 ? -6.305  -29.431 69.794  1.00 61.04  ?  423  ALA A CB  1 
ATOM   3209  N  N   . ARG A  1 424 ? -9.284  -30.008 70.611  1.00 63.54  ?  424  ARG A N   1 
ATOM   3210  C  CA  . ARG A  1 424 ? -10.356 -29.654 71.535  1.00 66.11  ?  424  ARG A CA  1 
ATOM   3211  C  C   . ARG A  1 424 ? -9.713  -29.189 72.832  1.00 65.49  ?  424  ARG A C   1 
ATOM   3212  O  O   . ARG A  1 424 ? -9.071  -29.981 73.529  1.00 65.99  ?  424  ARG A O   1 
ATOM   3213  C  CB  . ARG A  1 424 ? -11.284 -30.836 71.780  1.00 69.39  ?  424  ARG A CB  1 
ATOM   3214  C  CG  . ARG A  1 424 ? -12.665 -30.432 72.251  1.00 74.83  ?  424  ARG A CG  1 
ATOM   3215  C  CD  . ARG A  1 424 ? -13.588 -31.635 72.272  1.00 82.05  ?  424  ARG A CD  1 
ATOM   3216  N  NE  . ARG A  1 424 ? -14.972 -31.272 71.983  1.00 90.97  ?  424  ARG A NE  1 
ATOM   3217  C  CZ  . ARG A  1 424 ? -15.469 -31.149 70.753  1.00 98.46  ?  424  ARG A CZ  1 
ATOM   3218  N  NH1 . ARG A  1 424 ? -14.693 -31.349 69.691  1.00 98.91  ?  424  ARG A NH1 1 
ATOM   3219  N  NH2 . ARG A  1 424 ? -16.743 -30.820 70.581  1.00 103.55 ?  424  ARG A NH2 1 
ATOM   3220  N  N   . VAL A  1 425 ? -9.884  -27.910 73.158  1.00 64.43  ?  425  VAL A N   1 
ATOM   3221  C  CA  . VAL A  1 425 ? -9.173  -27.275 74.261  1.00 60.08  ?  425  VAL A CA  1 
ATOM   3222  C  C   . VAL A  1 425 ? -10.182 -26.841 75.316  1.00 60.43  ?  425  VAL A C   1 
ATOM   3223  O  O   . VAL A  1 425 ? -11.217 -26.251 74.983  1.00 64.53  ?  425  VAL A O   1 
ATOM   3224  C  CB  . VAL A  1 425 ? -8.343  -26.075 73.773  1.00 57.60  ?  425  VAL A CB  1 
ATOM   3225  C  CG1 . VAL A  1 425 ? -7.533  -25.487 74.918  1.00 56.61  ?  425  VAL A CG1 1 
ATOM   3226  C  CG2 . VAL A  1 425 ? -7.440  -26.489 72.620  1.00 55.38  ?  425  VAL A CG2 1 
ATOM   3227  N  N   . TYR A  1 426 ? -9.883  -27.143 76.582  1.00 55.79  ?  426  TYR A N   1 
ATOM   3228  C  CA  . TYR A  1 426 ? -10.619 -26.628 77.730  1.00 53.06  ?  426  TYR A CA  1 
ATOM   3229  C  C   . TYR A  1 426 ? -9.664  -25.825 78.601  1.00 51.69  ?  426  TYR A C   1 
ATOM   3230  O  O   . TYR A  1 426 ? -8.546  -26.269 78.880  1.00 50.17  ?  426  TYR A O   1 
ATOM   3231  C  CB  . TYR A  1 426 ? -11.248 -27.752 78.556  1.00 52.94  ?  426  TYR A CB  1 
ATOM   3232  C  CG  . TYR A  1 426 ? -12.283 -28.558 77.812  1.00 54.31  ?  426  TYR A CG  1 
ATOM   3233  C  CD1 . TYR A  1 426 ? -13.611 -28.151 77.772  1.00 56.30  ?  426  TYR A CD1 1 
ATOM   3234  C  CD2 . TYR A  1 426 ? -11.935 -29.734 77.161  1.00 53.80  ?  426  TYR A CD2 1 
ATOM   3235  C  CE1 . TYR A  1 426 ? -14.563 -28.889 77.091  1.00 57.75  ?  426  TYR A CE1 1 
ATOM   3236  C  CE2 . TYR A  1 426 ? -12.878 -30.479 76.479  1.00 55.21  ?  426  TYR A CE2 1 
ATOM   3237  C  CZ  . TYR A  1 426 ? -14.190 -30.053 76.448  1.00 59.93  ?  426  TYR A CZ  1 
ATOM   3238  O  OH  . TYR A  1 426 ? -15.134 -30.790 75.769  1.00 61.51  ?  426  TYR A OH  1 
ATOM   3239  N  N   . ALA A  1 427 ? -10.103 -24.645 79.033  1.00 53.92  ?  427  ALA A N   1 
ATOM   3240  C  CA  . ALA A  1 427 ? -9.238  -23.708 79.739  1.00 54.08  ?  427  ALA A CA  1 
ATOM   3241  C  C   . ALA A  1 427 ? -9.870  -23.286 81.058  1.00 55.66  ?  427  ALA A C   1 
ATOM   3242  O  O   . ALA A  1 427 ? -11.077 -23.033 81.127  1.00 58.44  ?  427  ALA A O   1 
ATOM   3243  C  CB  . ALA A  1 427 ? -8.945  -22.473 78.879  1.00 55.19  ?  427  ALA A CB  1 
ATOM   3244  N  N   . TYR A  1 428 ? -9.044  -23.201 82.099  1.00 54.39  ?  428  TYR A N   1 
ATOM   3245  C  CA  . TYR A  1 428 ? -9.491  -22.857 83.441  1.00 55.19  ?  428  TYR A CA  1 
ATOM   3246  C  C   . TYR A  1 428 ? -8.556  -21.815 84.040  1.00 55.00  ?  428  TYR A C   1 
ATOM   3247  O  O   . TYR A  1 428 ? -7.453  -21.572 83.545  1.00 53.48  ?  428  TYR A O   1 
ATOM   3248  C  CB  . TYR A  1 428 ? -9.541  -24.091 84.359  1.00 54.47  ?  428  TYR A CB  1 
ATOM   3249  C  CG  . TYR A  1 428 ? -8.173  -24.662 84.683  1.00 52.83  ?  428  TYR A CG  1 
ATOM   3250  C  CD1 . TYR A  1 428 ? -7.403  -24.139 85.718  1.00 49.26  ?  428  TYR A CD1 1 
ATOM   3251  C  CD2 . TYR A  1 428 ? -7.656  -25.728 83.961  1.00 52.18  ?  428  TYR A CD2 1 
ATOM   3252  C  CE1 . TYR A  1 428 ? -6.157  -24.646 86.010  1.00 47.84  ?  428  TYR A CE1 1 
ATOM   3253  C  CE2 . TYR A  1 428 ? -6.407  -26.248 84.252  1.00 51.05  ?  428  TYR A CE2 1 
ATOM   3254  C  CZ  . TYR A  1 428 ? -5.663  -25.701 85.279  1.00 50.67  ?  428  TYR A CZ  1 
ATOM   3255  O  OH  . TYR A  1 428 ? -4.419  -26.207 85.578  1.00 49.27  ?  428  TYR A OH  1 
ATOM   3256  N  N   . ILE A  1 429 ? -9.006  -21.206 85.134  1.00 57.01  ?  429  ILE A N   1 
ATOM   3257  C  CA  . ILE A  1 429 ? -8.156  -20.371 85.974  1.00 56.80  ?  429  ILE A CA  1 
ATOM   3258  C  C   . ILE A  1 429 ? -8.489  -20.700 87.425  1.00 59.26  ?  429  ILE A C   1 
ATOM   3259  O  O   . ILE A  1 429 ? -9.654  -20.618 87.833  1.00 61.87  ?  429  ILE A O   1 
ATOM   3260  C  CB  . ILE A  1 429 ? -8.332  -18.867 85.683  1.00 55.29  ?  429  ILE A CB  1 
ATOM   3261  C  CG1 . ILE A  1 429 ? -7.569  -18.027 86.708  1.00 53.42  ?  429  ILE A CG1 1 
ATOM   3262  C  CG2 . ILE A  1 429 ? -9.808  -18.484 85.624  1.00 56.52  ?  429  ILE A CG2 1 
ATOM   3263  C  CD1 . ILE A  1 429 ? -7.625  -16.537 86.442  1.00 54.59  ?  429  ILE A CD1 1 
ATOM   3264  N  N   . PHE A  1 430 ? -7.477  -21.094 88.197  1.00 57.72  ?  430  PHE A N   1 
ATOM   3265  C  CA  . PHE A  1 430 ? -7.677  -21.585 89.557  1.00 57.09  ?  430  PHE A CA  1 
ATOM   3266  C  C   . PHE A  1 430 ? -7.520  -20.412 90.517  1.00 57.68  ?  430  PHE A C   1 
ATOM   3267  O  O   . PHE A  1 430 ? -6.406  -19.924 90.733  1.00 56.78  ?  430  PHE A O   1 
ATOM   3268  C  CB  . PHE A  1 430 ? -6.669  -22.689 89.858  1.00 55.96  ?  430  PHE A CB  1 
ATOM   3269  C  CG  . PHE A  1 430 ? -6.922  -23.413 91.141  1.00 58.77  ?  430  PHE A CG  1 
ATOM   3270  C  CD1 . PHE A  1 430 ? -6.394  -22.943 92.335  1.00 60.47  ?  430  PHE A CD1 1 
ATOM   3271  C  CD2 . PHE A  1 430 ? -7.666  -24.578 91.156  1.00 59.64  ?  430  PHE A CD2 1 
ATOM   3272  C  CE1 . PHE A  1 430 ? -6.618  -23.615 93.518  1.00 61.75  ?  430  PHE A CE1 1 
ATOM   3273  C  CE2 . PHE A  1 430 ? -7.892  -25.251 92.331  1.00 60.77  ?  430  PHE A CE2 1 
ATOM   3274  C  CZ  . PHE A  1 430 ? -7.370  -24.771 93.515  1.00 62.02  ?  430  PHE A CZ  1 
ATOM   3275  N  N   . GLU A  1 431 ? -8.638  -19.954 91.082  1.00 59.36  ?  431  GLU A N   1 
ATOM   3276  C  CA  . GLU A  1 431 ? -8.670  -18.727 91.869  1.00 60.15  ?  431  GLU A CA  1 
ATOM   3277  C  C   . GLU A  1 431 ? -8.706  -18.930 93.381  1.00 61.28  ?  431  GLU A C   1 
ATOM   3278  O  O   . GLU A  1 431 ? -8.693  -17.937 94.112  1.00 62.94  ?  431  GLU A O   1 
ATOM   3279  C  CB  . GLU A  1 431 ? -9.862  -17.866 91.439  1.00 60.74  ?  431  GLU A CB  1 
ATOM   3280  C  CG  . GLU A  1 431 ? -9.650  -17.166 90.107  1.00 58.48  ?  431  GLU A CG  1 
ATOM   3281  C  CD  . GLU A  1 431 ? -10.784 -16.229 89.749  1.00 60.90  ?  431  GLU A CD  1 
ATOM   3282  O  OE1 . GLU A  1 431 ? -11.911 -16.429 90.255  1.00 61.81  ?  431  GLU A OE1 1 
ATOM   3283  O  OE2 . GLU A  1 431 ? -10.544 -15.293 88.958  1.00 59.78  ?  431  GLU A OE2 1 
ATOM   3284  N  N   . HIS A  1 432 ? -8.754  -20.164 93.878  1.00 60.97  ?  432  HIS A N   1 
ATOM   3285  C  CA  . HIS A  1 432 ? -8.941  -20.392 95.308  1.00 61.28  ?  432  HIS A CA  1 
ATOM   3286  C  C   . HIS A  1 432 ? -7.602  -20.490 96.028  1.00 58.87  ?  432  HIS A C   1 
ATOM   3287  O  O   . HIS A  1 432 ? -6.709  -21.228 95.598  1.00 55.63  ?  432  HIS A O   1 
ATOM   3288  C  CB  . HIS A  1 432 ? -9.747  -21.663 95.573  1.00 62.13  ?  432  HIS A CB  1 
ATOM   3289  C  CG  . HIS A  1 432 ? -9.845  -22.009 97.027  1.00 64.52  ?  432  HIS A CG  1 
ATOM   3290  N  ND1 . HIS A  1 432 ? -10.573 -21.255 97.924  1.00 66.43  ?  432  HIS A ND1 1 
ATOM   3291  C  CD2 . HIS A  1 432 ? -9.269  -22.999 97.749  1.00 63.74  ?  432  HIS A CD2 1 
ATOM   3292  C  CE1 . HIS A  1 432 ? -10.463 -21.784 99.130  1.00 66.38  ?  432  HIS A CE1 1 
ATOM   3293  N  NE2 . HIS A  1 432 ? -9.675  -22.842 99.052  1.00 64.50  ?  432  HIS A NE2 1 
ATOM   3294  N  N   . ARG A  1 433 ? -7.477  -19.756 97.133  1.00 60.41  ?  433  ARG A N   1 
ATOM   3295  C  CA  . ARG A  1 433 ? -6.300  -19.820 97.990  1.00 59.60  ?  433  ARG A CA  1 
ATOM   3296  C  C   . ARG A  1 433 ? -6.544  -20.820 99.114  1.00 61.29  ?  433  ARG A C   1 
ATOM   3297  O  O   . ARG A  1 433 ? -7.567  -20.750 99.801  1.00 63.70  ?  433  ARG A O   1 
ATOM   3298  C  CB  . ARG A  1 433 ? -5.981  -18.438 98.562  1.00 58.71  ?  433  ARG A CB  1 
ATOM   3299  C  CG  . ARG A  1 433 ? -4.925  -18.419 99.652  1.00 58.46  ?  433  ARG A CG  1 
ATOM   3300  C  CD  . ARG A  1 433 ? -4.523  -16.987 99.963  1.00 59.61  ?  433  ARG A CD  1 
ATOM   3301  N  NE  . ARG A  1 433 ? -3.786  -16.853 101.216 1.00 62.08  ?  433  ARG A NE  1 
ATOM   3302  C  CZ  . ARG A  1 433 ? -2.468  -16.699 101.294 1.00 63.55  ?  433  ARG A CZ  1 
ATOM   3303  N  NH1 . ARG A  1 433 ? -1.735  -16.673 100.194 1.00 62.84  ?  433  ARG A NH1 1 
ATOM   3304  N  NH2 . ARG A  1 433 ? -1.881  -16.574 102.475 1.00 66.76  ?  433  ARG A NH2 1 
ATOM   3305  N  N   . ALA A  1 434 ? -5.608  -21.754 99.289  1.00 59.52  ?  434  ALA A N   1 
ATOM   3306  C  CA  . ALA A  1 434 ? -5.758  -22.778 100.316 1.00 59.04  ?  434  ALA A CA  1 
ATOM   3307  C  C   . ALA A  1 434 ? -5.842  -22.148 101.701 1.00 60.30  ?  434  ALA A C   1 
ATOM   3308  O  O   . ALA A  1 434 ? -5.087  -21.231 102.032 1.00 60.92  ?  434  ALA A O   1 
ATOM   3309  C  CB  . ALA A  1 434 ? -4.587  -23.759 100.259 1.00 57.81  ?  434  ALA A CB  1 
ATOM   3310  N  N   . SER A  1 435 ? -6.773  -22.644 102.517 1.00 60.18  ?  435  SER A N   1 
ATOM   3311  C  CA  . SER A  1 435 ? -6.904  -22.118 103.872 1.00 62.27  ?  435  SER A CA  1 
ATOM   3312  C  C   . SER A  1 435 ? -5.650  -22.379 104.696 1.00 65.50  ?  435  SER A C   1 
ATOM   3313  O  O   . SER A  1 435 ? -5.337  -21.612 105.614 1.00 67.43  ?  435  SER A O   1 
ATOM   3314  C  CB  . SER A  1 435 ? -8.130  -22.721 104.562 1.00 63.97  ?  435  SER A CB  1 
ATOM   3315  O  OG  . SER A  1 435 ? -8.002  -24.121 104.740 1.00 63.18  ?  435  SER A OG  1 
ATOM   3316  N  N   . THR A  1 436 ? -4.919  -23.442 104.377 1.00 60.28  ?  436  THR A N   1 
ATOM   3317  C  CA  . THR A  1 436 ? -3.713  -23.827 105.096 1.00 65.23  ?  436  THR A CA  1 
ATOM   3318  C  C   . THR A  1 436 ? -2.445  -23.246 104.483 1.00 63.12  ?  436  THR A C   1 
ATOM   3319  O  O   . THR A  1 436 ? -1.344  -23.601 104.917 1.00 63.77  ?  436  THR A O   1 
ATOM   3320  C  CB  . THR A  1 436 ? -3.605  -25.353 105.163 1.00 65.01  ?  436  THR A CB  1 
ATOM   3321  O  OG1 . THR A  1 436 ? -3.506  -25.888 103.834 1.00 65.39  ?  436  THR A OG1 1 
ATOM   3322  C  CG2 . THR A  1 436 ? -4.820  -25.948 105.868 1.00 65.88  ?  436  THR A CG2 1 
ATOM   3323  N  N   . LEU A  1 437 ? -2.572  -22.381 103.479 1.00 62.17  ?  437  LEU A N   1 
ATOM   3324  C  CA  . LEU A  1 437 ? -1.413  -21.889 102.745 1.00 61.23  ?  437  LEU A CA  1 
ATOM   3325  C  C   . LEU A  1 437 ? -0.566  -20.999 103.651 1.00 61.17  ?  437  LEU A C   1 
ATOM   3326  O  O   . LEU A  1 437 ? -1.089  -20.099 104.314 1.00 59.77  ?  437  LEU A O   1 
ATOM   3327  C  CB  . LEU A  1 437 ? -1.880  -21.123 101.509 1.00 61.49  ?  437  LEU A CB  1 
ATOM   3328  C  CG  . LEU A  1 437 ? -0.999  -21.040 100.259 1.00 59.22  ?  437  LEU A CG  1 
ATOM   3329  C  CD1 . LEU A  1 437 ? -1.725  -20.259 99.193  1.00 58.24  ?  437  LEU A CD1 1 
ATOM   3330  C  CD2 . LEU A  1 437 ? 0.369   -20.452 100.513 1.00 60.42  ?  437  LEU A CD2 1 
ATOM   3331  N  N   . THR A  1 438 ? 0.744   -21.266 103.693 1.00 60.45  ?  438  THR A N   1 
ATOM   3332  C  CA  . THR A  1 438 ? 1.668   -20.577 104.591 1.00 61.96  ?  438  THR A CA  1 
ATOM   3333  C  C   . THR A  1 438 ? 2.350   -19.357 103.977 1.00 60.55  ?  438  THR A C   1 
ATOM   3334  O  O   . THR A  1 438 ? 2.975   -18.584 104.715 1.00 61.66  ?  438  THR A O   1 
ATOM   3335  C  CB  . THR A  1 438 ? 2.746   -21.553 105.076 1.00 63.62  ?  438  THR A CB  1 
ATOM   3336  O  OG1 . THR A  1 438 ? 3.148   -22.402 103.991 1.00 63.89  ?  438  THR A OG1 1 
ATOM   3337  C  CG2 . THR A  1 438 ? 2.227   -22.398 106.220 1.00 65.59  ?  438  THR A CG2 1 
ATOM   3338  N  N   . TRP A  1 439 ? 2.251   -19.158 102.663 1.00 57.56  ?  439  TRP A N   1 
ATOM   3339  C  CA  . TRP A  1 439 ? 2.850   -17.987 102.050 1.00 57.72  ?  439  TRP A CA  1 
ATOM   3340  C  C   . TRP A  1 439 ? 2.058   -16.739 102.437 1.00 60.75  ?  439  TRP A C   1 
ATOM   3341  O  O   . TRP A  1 439 ? 0.879   -16.829 102.787 1.00 61.05  ?  439  TRP A O   1 
ATOM   3342  C  CB  . TRP A  1 439 ? 2.898   -18.135 100.531 1.00 56.04  ?  439  TRP A CB  1 
ATOM   3343  C  CG  . TRP A  1 439 ? 3.923   -19.112 100.021 1.00 56.43  ?  439  TRP A CG  1 
ATOM   3344  C  CD1 . TRP A  1 439 ? 3.707   -20.408 99.653  1.00 56.01  ?  439  TRP A CD1 1 
ATOM   3345  C  CD2 . TRP A  1 439 ? 5.321   -18.866 99.812  1.00 57.91  ?  439  TRP A CD2 1 
ATOM   3346  N  NE1 . TRP A  1 439 ? 4.880   -20.985 99.232  1.00 55.60  ?  439  TRP A NE1 1 
ATOM   3347  C  CE2 . TRP A  1 439 ? 5.887   -20.060 99.319  1.00 56.94  ?  439  TRP A CE2 1 
ATOM   3348  C  CE3 . TRP A  1 439 ? 6.149   -17.753 99.995  1.00 60.20  ?  439  TRP A CE3 1 
ATOM   3349  C  CZ2 . TRP A  1 439 ? 7.241   -20.173 99.004  1.00 57.81  ?  439  TRP A CZ2 1 
ATOM   3350  C  CZ3 . TRP A  1 439 ? 7.497   -17.868 99.681  1.00 60.81  ?  439  TRP A CZ3 1 
ATOM   3351  C  CH2 . TRP A  1 439 ? 8.027   -19.070 99.191  1.00 59.31  ?  439  TRP A CH2 1 
ATOM   3352  N  N   . PRO A  1 440 ? 2.683   -15.560 102.380 1.00 62.56  ?  440  PRO A N   1 
ATOM   3353  C  CA  . PRO A  1 440 ? 1.987   -14.344 102.811 1.00 62.77  ?  440  PRO A CA  1 
ATOM   3354  C  C   . PRO A  1 440 ? 0.725   -14.093 102.001 1.00 62.70  ?  440  PRO A C   1 
ATOM   3355  O  O   . PRO A  1 440 ? 0.533   -14.621 100.903 1.00 59.38  ?  440  PRO A O   1 
ATOM   3356  C  CB  . PRO A  1 440 ? 3.027   -13.239 102.590 1.00 62.37  ?  440  PRO A CB  1 
ATOM   3357  C  CG  . PRO A  1 440 ? 3.989   -13.808 101.607 1.00 59.65  ?  440  PRO A CG  1 
ATOM   3358  C  CD  . PRO A  1 440 ? 4.058   -15.264 101.940 1.00 63.53  ?  440  PRO A CD  1 
ATOM   3359  N  N   . LEU A  1 441 ? -0.155  -13.275 102.580 1.00 66.77  ?  441  LEU A N   1 
ATOM   3360  C  CA  . LEU A  1 441 ? -1.463  -13.042 101.981 1.00 68.83  ?  441  LEU A CA  1 
ATOM   3361  C  C   . LEU A  1 441 ? -1.361  -12.286 100.661 1.00 69.85  ?  441  LEU A C   1 
ATOM   3362  O  O   . LEU A  1 441 ? -2.222  -12.454 99.787  1.00 70.21  ?  441  LEU A O   1 
ATOM   3363  C  CB  . LEU A  1 441 ? -2.355  -12.280 102.964 1.00 70.81  ?  441  LEU A CB  1 
ATOM   3364  C  CG  . LEU A  1 441 ? -3.812  -12.097 102.538 1.00 69.97  ?  441  LEU A CG  1 
ATOM   3365  C  CD1 . LEU A  1 441 ? -4.427  -13.439 102.172 1.00 67.49  ?  441  LEU A CD1 1 
ATOM   3366  C  CD2 . LEU A  1 441 ? -4.615  -11.407 103.627 1.00 71.81  ?  441  LEU A CD2 1 
ATOM   3367  N  N   . TRP A  1 442 ? -0.323  -11.460 100.488 1.00 69.32  ?  442  TRP A N   1 
ATOM   3368  C  CA  . TRP A  1 442 ? -0.217  -10.673 99.264  1.00 67.01  ?  442  TRP A CA  1 
ATOM   3369  C  C   . TRP A  1 442 ? 0.127   -11.510 98.039  1.00 62.68  ?  442  TRP A C   1 
ATOM   3370  O  O   . TRP A  1 442 ? 0.001   -11.006 96.918  1.00 61.27  ?  442  TRP A O   1 
ATOM   3371  C  CB  . TRP A  1 442 ? 0.811   -9.547  99.427  1.00 67.69  ?  442  TRP A CB  1 
ATOM   3372  C  CG  . TRP A  1 442 ? 2.244   -9.969  99.615  1.00 61.96  ?  442  TRP A CG  1 
ATOM   3373  C  CD1 . TRP A  1 442 ? 2.911   -10.091 100.796 1.00 62.87  ?  442  TRP A CD1 1 
ATOM   3374  C  CD2 . TRP A  1 442 ? 3.190   -10.296 98.586  1.00 61.33  ?  442  TRP A CD2 1 
ATOM   3375  N  NE1 . TRP A  1 442 ? 4.210   -10.477 100.572 1.00 61.80  ?  442  TRP A NE1 1 
ATOM   3376  C  CE2 . TRP A  1 442 ? 4.407   -10.612 99.223  1.00 60.16  ?  442  TRP A CE2 1 
ATOM   3377  C  CE3 . TRP A  1 442 ? 3.125   -10.357 97.189  1.00 59.86  ?  442  TRP A CE3 1 
ATOM   3378  C  CZ2 . TRP A  1 442 ? 5.549   -10.982 98.513  1.00 58.82  ?  442  TRP A CZ2 1 
ATOM   3379  C  CZ3 . TRP A  1 442 ? 4.262   -10.724 96.486  1.00 58.33  ?  442  TRP A CZ3 1 
ATOM   3380  C  CH2 . TRP A  1 442 ? 5.456   -11.034 97.150  1.00 57.49  ?  442  TRP A CH2 1 
ATOM   3381  N  N   . MET A  1 443 ? 0.551   -12.761 98.217  1.00 60.58  ?  443  MET A N   1 
ATOM   3382  C  CA  . MET A  1 443 ? 0.877   -13.614 97.083  1.00 57.76  ?  443  MET A CA  1 
ATOM   3383  C  C   . MET A  1 443 ? -0.338  -14.314 96.493  1.00 57.80  ?  443  MET A C   1 
ATOM   3384  O  O   . MET A  1 443 ? -0.203  -14.970 95.454  1.00 58.04  ?  443  MET A O   1 
ATOM   3385  C  CB  . MET A  1 443 ? 1.928   -14.649 97.486  1.00 56.12  ?  443  MET A CB  1 
ATOM   3386  C  CG  . MET A  1 443 ? 3.292   -14.055 97.791  1.00 56.96  ?  443  MET A CG  1 
ATOM   3387  S  SD  . MET A  1 443 ? 4.481   -15.346 98.173  1.00 55.61  ?  443  MET A SD  1 
ATOM   3388  C  CE  . MET A  1 443 ? 5.951   -14.398 98.522  1.00 55.45  ?  443  MET A CE  1 
ATOM   3389  N  N   . GLY A  1 444 ? -1.505  -14.195 97.122  1.00 59.05  ?  444  GLY A N   1 
ATOM   3390  C  CA  . GLY A  1 444 ? -2.734  -14.686 96.505  1.00 61.99  ?  444  GLY A CA  1 
ATOM   3391  C  C   . GLY A  1 444 ? -2.742  -16.198 96.389  1.00 63.36  ?  444  GLY A C   1 
ATOM   3392  O  O   . GLY A  1 444 ? -2.510  -16.915 97.366  1.00 64.18  ?  444  GLY A O   1 
ATOM   3393  N  N   . VAL A  1 445 ? -3.024  -16.700 95.190  1.00 62.78  ?  445  VAL A N   1 
ATOM   3394  C  CA  . VAL A  1 445 ? -2.893  -18.130 94.913  1.00 58.92  ?  445  VAL A CA  1 
ATOM   3395  C  C   . VAL A  1 445 ? -1.604  -18.331 94.131  1.00 57.50  ?  445  VAL A C   1 
ATOM   3396  O  O   . VAL A  1 445 ? -1.588  -18.083 92.919  1.00 58.80  ?  445  VAL A O   1 
ATOM   3397  C  CB  . VAL A  1 445 ? -4.096  -18.657 94.116  1.00 52.97  ?  445  VAL A CB  1 
ATOM   3398  C  CG1 . VAL A  1 445 ? -4.016  -20.159 93.962  1.00 51.73  ?  445  VAL A CG1 1 
ATOM   3399  C  CG2 . VAL A  1 445 ? -5.394  -18.247 94.777  1.00 54.84  ?  445  VAL A CG2 1 
ATOM   3400  N  N   . PRO A  1 446 ? -0.527  -18.817 94.748  1.00 54.98  ?  446  PRO A N   1 
ATOM   3401  C  CA  . PRO A  1 446 ? 0.763   -18.825 94.041  1.00 54.53  ?  446  PRO A CA  1 
ATOM   3402  C  C   . PRO A  1 446 ? 0.958   -20.001 93.089  1.00 55.19  ?  446  PRO A C   1 
ATOM   3403  O  O   . PRO A  1 446 ? 0.038   -20.775 92.808  1.00 57.25  ?  446  PRO A O   1 
ATOM   3404  C  CB  . PRO A  1 446 ? 1.794   -18.824 95.179  1.00 52.85  ?  446  PRO A CB  1 
ATOM   3405  C  CG  . PRO A  1 446 ? 1.074   -19.298 96.365  1.00 53.95  ?  446  PRO A CG  1 
ATOM   3406  C  CD  . PRO A  1 446 ? -0.372  -18.975 96.201  1.00 54.72  ?  446  PRO A CD  1 
ATOM   3407  N  N   . HIS A  1 447 ? 2.174   -20.106 92.561  1.00 53.78  ?  447  HIS A N   1 
ATOM   3408  C  CA  . HIS A  1 447 ? 2.476   -21.076 91.520  1.00 51.00  ?  447  HIS A CA  1 
ATOM   3409  C  C   . HIS A  1 447 ? 2.464   -22.479 92.117  1.00 51.05  ?  447  HIS A C   1 
ATOM   3410  O  O   . HIS A  1 447 ? 3.201   -22.760 93.068  1.00 52.08  ?  447  HIS A O   1 
ATOM   3411  C  CB  . HIS A  1 447 ? 3.840   -20.735 90.908  1.00 49.46  ?  447  HIS A CB  1 
ATOM   3412  C  CG  . HIS A  1 447 ? 4.234   -21.577 89.730  1.00 49.50  ?  447  HIS A CG  1 
ATOM   3413  N  ND1 . HIS A  1 447 ? 3.412   -21.773 88.641  1.00 51.09  ?  447  HIS A ND1 1 
ATOM   3414  C  CD2 . HIS A  1 447 ? 5.395   -22.215 89.442  1.00 48.98  ?  447  HIS A CD2 1 
ATOM   3415  C  CE1 . HIS A  1 447 ? 4.037   -22.523 87.749  1.00 50.88  ?  447  HIS A CE1 1 
ATOM   3416  N  NE2 . HIS A  1 447 ? 5.243   -22.803 88.210  1.00 49.48  ?  447  HIS A NE2 1 
ATOM   3417  N  N   . GLY A  1 448 ? 1.620   -23.354 91.573  1.00 50.57  ?  448  GLY A N   1 
ATOM   3418  C  CA  . GLY A  1 448 ? 1.584   -24.746 91.981  1.00 49.81  ?  448  GLY A CA  1 
ATOM   3419  C  C   . GLY A  1 448 ? 0.720   -25.078 93.179  1.00 50.27  ?  448  GLY A C   1 
ATOM   3420  O  O   . GLY A  1 448 ? 0.852   -26.178 93.729  1.00 48.43  ?  448  GLY A O   1 
ATOM   3421  N  N   . TYR A  1 449 ? -0.136  -24.163 93.623  1.00 52.20  ?  449  TYR A N   1 
ATOM   3422  C  CA  . TYR A  1 449 ? -0.990  -24.411 94.774  1.00 53.66  ?  449  TYR A CA  1 
ATOM   3423  C  C   . TYR A  1 449 ? -2.395  -24.858 94.399  1.00 54.27  ?  449  TYR A C   1 
ATOM   3424  O  O   . TYR A  1 449 ? -3.282  -24.862 95.257  1.00 57.61  ?  449  TYR A O   1 
ATOM   3425  C  CB  . TYR A  1 449 ? -0.985  -23.200 95.704  1.00 53.72  ?  449  TYR A CB  1 
ATOM   3426  C  CG  . TYR A  1 449 ? 0.281   -23.260 96.519  1.00 51.90  ?  449  TYR A CG  1 
ATOM   3427  C  CD1 . TYR A  1 449 ? 0.353   -24.047 97.660  1.00 51.03  ?  449  TYR A CD1 1 
ATOM   3428  C  CD2 . TYR A  1 449 ? 1.434   -22.621 96.092  1.00 50.76  ?  449  TYR A CD2 1 
ATOM   3429  C  CE1 . TYR A  1 449 ? 1.521   -24.146 98.381  1.00 49.53  ?  449  TYR A CE1 1 
ATOM   3430  C  CE2 . TYR A  1 449 ? 2.604   -22.709 96.814  1.00 50.84  ?  449  TYR A CE2 1 
ATOM   3431  C  CZ  . TYR A  1 449 ? 2.644   -23.475 97.955  1.00 50.89  ?  449  TYR A CZ  1 
ATOM   3432  O  OH  . TYR A  1 449 ? 3.818   -23.565 98.665  1.00 49.40  ?  449  TYR A OH  1 
ATOM   3433  N  N   . GLU A  1 450 ? -2.633  -25.170 93.130  1.00 51.24  ?  450  GLU A N   1 
ATOM   3434  C  CA  . GLU A  1 450 ? -3.812  -25.934 92.750  1.00 50.39  ?  450  GLU A CA  1 
ATOM   3435  C  C   . GLU A  1 450 ? -3.605  -27.441 92.858  1.00 49.79  ?  450  GLU A C   1 
ATOM   3436  O  O   . GLU A  1 450 ? -4.591  -28.183 92.848  1.00 51.52  ?  450  GLU A O   1 
ATOM   3437  C  CB  . GLU A  1 450 ? -4.232  -25.598 91.315  1.00 50.62  ?  450  GLU A CB  1 
ATOM   3438  C  CG  . GLU A  1 450 ? -3.550  -26.447 90.232  1.00 51.74  ?  450  GLU A CG  1 
ATOM   3439  C  CD  . GLU A  1 450 ? -2.129  -26.007 89.898  1.00 53.26  ?  450  GLU A CD  1 
ATOM   3440  O  OE1 . GLU A  1 450 ? -1.401  -25.544 90.801  1.00 55.65  ?  450  GLU A OE1 1 
ATOM   3441  O  OE2 . GLU A  1 450 ? -1.734  -26.133 88.720  1.00 52.51  ?  450  GLU A OE2 1 
ATOM   3442  N  N   . ILE A  1 451 ? -2.357  -27.907 92.973  1.00 49.20  ?  451  ILE A N   1 
ATOM   3443  C  CA  . ILE A  1 451 ? -2.078  -29.339 92.863  1.00 50.44  ?  451  ILE A CA  1 
ATOM   3444  C  C   . ILE A  1 451 ? -2.703  -30.104 94.025  1.00 54.98  ?  451  ILE A C   1 
ATOM   3445  O  O   . ILE A  1 451 ? -3.307  -31.169 93.836  1.00 56.51  ?  451  ILE A O   1 
ATOM   3446  C  CB  . ILE A  1 451 ? -0.560  -29.595 92.785  1.00 48.00  ?  451  ILE A CB  1 
ATOM   3447  C  CG1 . ILE A  1 451 ? 0.097   -28.687 91.750  1.00 47.13  ?  451  ILE A CG1 1 
ATOM   3448  C  CG2 . ILE A  1 451 ? -0.283  -31.040 92.427  1.00 46.69  ?  451  ILE A CG2 1 
ATOM   3449  C  CD1 . ILE A  1 451 ? 1.587   -28.939 91.589  1.00 42.93  ?  451  ILE A CD1 1 
ATOM   3450  N  N   . GLU A  1 452 ? -2.559  -29.579 95.249  1.00 55.82  ?  452  GLU A N   1 
ATOM   3451  C  CA  . GLU A  1 452 ? -3.072  -30.292 96.417  1.00 54.11  ?  452  GLU A CA  1 
ATOM   3452  C  C   . GLU A  1 452 ? -4.582  -30.464 96.352  1.00 52.16  ?  452  GLU A C   1 
ATOM   3453  O  O   . GLU A  1 452 ? -5.128  -31.381 96.972  1.00 51.93  ?  452  GLU A O   1 
ATOM   3454  C  CB  . GLU A  1 452 ? -2.673  -29.574 97.705  1.00 55.26  ?  452  GLU A CB  1 
ATOM   3455  C  CG  . GLU A  1 452 ? -2.950  -28.087 97.715  1.00 57.62  ?  452  GLU A CG  1 
ATOM   3456  C  CD  . GLU A  1 452 ? -2.429  -27.415 98.970  1.00 62.55  ?  452  GLU A CD  1 
ATOM   3457  O  OE1 . GLU A  1 452 ? -1.198  -27.238 99.084  1.00 62.95  ?  452  GLU A OE1 1 
ATOM   3458  O  OE2 . GLU A  1 452 ? -3.248  -27.079 99.855  1.00 66.51  ?  452  GLU A OE2 1 
ATOM   3459  N  N   . PHE A  1 453 ? -5.277  -29.594 95.621  1.00 51.00  ?  453  PHE A N   1 
ATOM   3460  C  CA  . PHE A  1 453 ? -6.712  -29.772 95.446  1.00 51.50  ?  453  PHE A CA  1 
ATOM   3461  C  C   . PHE A  1 453 ? -7.028  -30.777 94.347  1.00 51.50  ?  453  PHE A C   1 
ATOM   3462  O  O   . PHE A  1 453 ? -7.969  -31.567 94.483  1.00 51.80  ?  453  PHE A O   1 
ATOM   3463  C  CB  . PHE A  1 453 ? -7.366  -28.425 95.170  1.00 51.13  ?  453  PHE A CB  1 
ATOM   3464  C  CG  . PHE A  1 453 ? -7.261  -27.469 96.318  1.00 52.21  ?  453  PHE A CG  1 
ATOM   3465  C  CD1 . PHE A  1 453 ? -6.131  -26.686 96.490  1.00 51.62  ?  453  PHE A CD1 1 
ATOM   3466  C  CD2 . PHE A  1 453 ? -8.287  -27.371 97.241  1.00 54.01  ?  453  PHE A CD2 1 
ATOM   3467  C  CE1 . PHE A  1 453 ? -6.038  -25.810 97.556  1.00 53.43  ?  453  PHE A CE1 1 
ATOM   3468  C  CE2 . PHE A  1 453 ? -8.200  -26.500 98.306  1.00 55.59  ?  453  PHE A CE2 1 
ATOM   3469  C  CZ  . PHE A  1 453 ? -7.077  -25.718 98.466  1.00 55.43  ?  453  PHE A CZ  1 
ATOM   3470  N  N   . ILE A  1 454 ? -6.257  -30.767 93.255  1.00 51.72  ?  454  ILE A N   1 
ATOM   3471  C  CA  . ILE A  1 454 ? -6.478  -31.733 92.179  1.00 53.38  ?  454  ILE A CA  1 
ATOM   3472  C  C   . ILE A  1 454 ? -6.248  -33.153 92.683  1.00 54.35  ?  454  ILE A C   1 
ATOM   3473  O  O   . ILE A  1 454 ? -6.981  -34.085 92.325  1.00 56.61  ?  454  ILE A O   1 
ATOM   3474  C  CB  . ILE A  1 454 ? -5.578  -31.413 90.970  1.00 53.38  ?  454  ILE A CB  1 
ATOM   3475  C  CG1 . ILE A  1 454 ? -5.876  -30.015 90.426  1.00 46.74  ?  454  ILE A CG1 1 
ATOM   3476  C  CG2 . ILE A  1 454 ? -5.743  -32.464 89.876  1.00 45.90  ?  454  ILE A CG2 1 
ATOM   3477  C  CD1 . ILE A  1 454 ? -7.310  -29.824 90.006  1.00 47.97  ?  454  ILE A CD1 1 
ATOM   3478  N  N   . PHE A  1 455 ? -5.232  -33.344 93.525  1.00 51.72  ?  455  PHE A N   1 
ATOM   3479  C  CA  . PHE A  1 455 ? -4.947  -34.675 94.039  1.00 49.36  ?  455  PHE A CA  1 
ATOM   3480  C  C   . PHE A  1 455 ? -5.853  -35.076 95.195  1.00 49.27  ?  455  PHE A C   1 
ATOM   3481  O  O   . PHE A  1 455 ? -5.815  -36.237 95.616  1.00 49.47  ?  455  PHE A O   1 
ATOM   3482  C  CB  . PHE A  1 455 ? -3.482  -34.770 94.463  1.00 48.08  ?  455  PHE A CB  1 
ATOM   3483  C  CG  . PHE A  1 455 ? -2.559  -35.143 93.341  1.00 47.26  ?  455  PHE A CG  1 
ATOM   3484  C  CD1 . PHE A  1 455 ? -2.281  -36.475 93.072  1.00 47.15  ?  455  PHE A CD1 1 
ATOM   3485  C  CD2 . PHE A  1 455 ? -1.975  -34.165 92.553  1.00 47.18  ?  455  PHE A CD2 1 
ATOM   3486  C  CE1 . PHE A  1 455 ? -1.433  -36.825 92.038  1.00 46.74  ?  455  PHE A CE1 1 
ATOM   3487  C  CE2 . PHE A  1 455 ? -1.125  -34.505 91.514  1.00 46.77  ?  455  PHE A CE2 1 
ATOM   3488  C  CZ  . PHE A  1 455 ? -0.853  -35.838 91.257  1.00 47.11  ?  455  PHE A CZ  1 
ATOM   3489  N  N   . GLY A  1 456 ? -6.663  -34.160 95.714  1.00 49.41  ?  456  GLY A N   1 
ATOM   3490  C  CA  . GLY A  1 456 ? -7.615  -34.518 96.744  1.00 52.77  ?  456  GLY A CA  1 
ATOM   3491  C  C   . GLY A  1 456 ? -7.066  -34.608 98.149  1.00 52.99  ?  456  GLY A C   1 
ATOM   3492  O  O   . GLY A  1 456 ? -7.657  -35.298 98.986  1.00 54.11  ?  456  GLY A O   1 
ATOM   3493  N  N   . LEU A  1 457 ? -5.953  -33.933 98.435  1.00 51.33  ?  457  LEU A N   1 
ATOM   3494  C  CA  . LEU A  1 457 ? -5.456  -33.880 99.806  1.00 52.20  ?  457  LEU A CA  1 
ATOM   3495  C  C   . LEU A  1 457 ? -6.484  -33.356 100.809 1.00 55.78  ?  457  LEU A C   1 
ATOM   3496  O  O   . LEU A  1 457 ? -6.501  -33.866 101.943 1.00 59.46  ?  457  LEU A O   1 
ATOM   3497  C  CB  . LEU A  1 457 ? -4.169  -33.047 99.863  1.00 50.91  ?  457  LEU A CB  1 
ATOM   3498  C  CG  . LEU A  1 457 ? -2.858  -33.824 99.725  1.00 49.76  ?  457  LEU A CG  1 
ATOM   3499  C  CD1 . LEU A  1 457 ? -2.713  -34.394 98.326  1.00 48.36  ?  457  LEU A CD1 1 
ATOM   3500  C  CD2 . LEU A  1 457 ? -1.663  -32.953 100.080 1.00 51.20  ?  457  LEU A CD2 1 
ATOM   3501  N  N   . PRO A  1 458 ? -7.343  -32.376 100.491 1.00 55.85  ?  458  PRO A N   1 
ATOM   3502  C  CA  . PRO A  1 458 ? -8.378  -31.966 101.460 1.00 57.82  ?  458  PRO A CA  1 
ATOM   3503  C  C   . PRO A  1 458 ? -9.320  -33.082 101.895 1.00 58.95  ?  458  PRO A C   1 
ATOM   3504  O  O   . PRO A  1 458 ? -10.048 -32.892 102.880 1.00 59.50  ?  458  PRO A O   1 
ATOM   3505  C  CB  . PRO A  1 458 ? -9.138  -30.866 100.713 1.00 58.13  ?  458  PRO A CB  1 
ATOM   3506  C  CG  . PRO A  1 458 ? -8.125  -30.272 99.839  1.00 55.03  ?  458  PRO A CG  1 
ATOM   3507  C  CD  . PRO A  1 458 ? -7.261  -31.413 99.378  1.00 54.83  ?  458  PRO A CD  1 
ATOM   3508  N  N   . LEU A  1 459 ? -9.354  -34.217 101.190 1.00 59.63  ?  459  LEU A N   1 
ATOM   3509  C  CA  . LEU A  1 459 ? -10.164 -35.344 101.641 1.00 64.79  ?  459  LEU A CA  1 
ATOM   3510  C  C   . LEU A  1 459 ? -9.535  -36.066 102.830 1.00 65.78  ?  459  LEU A C   1 
ATOM   3511  O  O   . LEU A  1 459 ? -10.215 -36.861 103.489 1.00 66.17  ?  459  LEU A O   1 
ATOM   3512  C  CB  . LEU A  1 459 ? -10.401 -36.324 100.490 1.00 66.12  ?  459  LEU A CB  1 
ATOM   3513  C  CG  . LEU A  1 459 ? -11.582 -35.989 99.575  1.00 70.23  ?  459  LEU A CG  1 
ATOM   3514  C  CD1 . LEU A  1 459 ? -11.301 -34.752 98.739  1.00 69.48  ?  459  LEU A CD1 1 
ATOM   3515  C  CD2 . LEU A  1 459 ? -11.915 -37.159 98.690  1.00 74.52  ?  459  LEU A CD2 1 
ATOM   3516  N  N   . ASP A  1 460 ? -8.255  -35.815 103.110 1.00 66.08  ?  460  ASP A N   1 
ATOM   3517  C  CA  . ASP A  1 460 ? -7.606  -36.247 104.342 1.00 67.07  ?  460  ASP A CA  1 
ATOM   3518  C  C   . ASP A  1 460 ? -8.062  -35.311 105.453 1.00 70.77  ?  460  ASP A C   1 
ATOM   3519  O  O   . ASP A  1 460 ? -7.739  -34.114 105.422 1.00 73.39  ?  460  ASP A O   1 
ATOM   3520  C  CB  . ASP A  1 460 ? -6.080  -36.217 104.192 1.00 64.31  ?  460  ASP A CB  1 
ATOM   3521  C  CG  . ASP A  1 460 ? -5.357  -36.981 105.295 1.00 63.81  ?  460  ASP A CG  1 
ATOM   3522  O  OD1 . ASP A  1 460 ? -5.845  -36.987 106.447 1.00 64.12  ?  460  ASP A OD1 1 
ATOM   3523  O  OD2 . ASP A  1 460 ? -4.284  -37.561 105.008 1.00 62.17  ?  460  ASP A OD2 1 
ATOM   3524  N  N   . PRO A  1 461 ? -8.815  -35.806 106.443 1.00 70.68  ?  461  PRO A N   1 
ATOM   3525  C  CA  . PRO A  1 461 ? -9.312  -34.911 107.503 1.00 71.57  ?  461  PRO A CA  1 
ATOM   3526  C  C   . PRO A  1 461 ? -8.222  -34.398 108.426 1.00 74.36  ?  461  PRO A C   1 
ATOM   3527  O  O   . PRO A  1 461 ? -8.395  -33.329 109.025 1.00 77.54  ?  461  PRO A O   1 
ATOM   3528  C  CB  . PRO A  1 461 ? -10.316 -35.786 108.258 1.00 70.86  ?  461  PRO A CB  1 
ATOM   3529  C  CG  . PRO A  1 461 ? -9.778  -37.165 108.083 1.00 71.03  ?  461  PRO A CG  1 
ATOM   3530  C  CD  . PRO A  1 461 ? -9.175  -37.211 106.696 1.00 69.65  ?  461  PRO A CD  1 
ATOM   3531  N  N   . SER A  1 462 ? -7.105  -35.117 108.550 1.00 73.51  ?  462  SER A N   1 
ATOM   3532  C  CA  . SER A  1 462 ? -6.001  -34.691 109.401 1.00 73.69  ?  462  SER A CA  1 
ATOM   3533  C  C   . SER A  1 462 ? -5.207  -33.529 108.817 1.00 69.71  ?  462  SER A C   1 
ATOM   3534  O  O   . SER A  1 462 ? -4.345  -32.981 109.511 1.00 70.84  ?  462  SER A O   1 
ATOM   3535  C  CB  . SER A  1 462 ? -5.061  -35.870 109.659 1.00 76.46  ?  462  SER A CB  1 
ATOM   3536  O  OG  . SER A  1 462 ? -4.477  -36.321 108.447 1.00 76.45  ?  462  SER A OG  1 
ATOM   3537  N  N   . LEU A  1 463 ? -5.463  -33.143 107.574 1.00 67.90  ?  463  LEU A N   1 
ATOM   3538  C  CA  . LEU A  1 463 ? -4.742  -32.035 106.968 1.00 68.76  ?  463  LEU A CA  1 
ATOM   3539  C  C   . LEU A  1 463 ? -5.392  -30.684 107.243 1.00 73.88  ?  463  LEU A C   1 
ATOM   3540  O  O   . LEU A  1 463 ? -4.897  -29.663 106.750 1.00 74.84  ?  463  LEU A O   1 
ATOM   3541  C  CB  . LEU A  1 463 ? -4.602  -32.260 105.463 1.00 64.99  ?  463  LEU A CB  1 
ATOM   3542  C  CG  . LEU A  1 463 ? -3.514  -33.277 105.116 1.00 62.18  ?  463  LEU A CG  1 
ATOM   3543  C  CD1 . LEU A  1 463 ? -3.431  -33.514 103.614 1.00 60.75  ?  463  LEU A CD1 1 
ATOM   3544  C  CD2 . LEU A  1 463 ? -2.171  -32.832 105.677 1.00 61.18  ?  463  LEU A CD2 1 
ATOM   3545  N  N   . ASN A  1 464 ? -6.493  -30.661 107.999 1.00 76.48  ?  464  ASN A N   1 
ATOM   3546  C  CA  . ASN A  1 464 ? -7.074  -29.426 108.534 1.00 77.92  ?  464  ASN A CA  1 
ATOM   3547  C  C   . ASN A  1 464 ? -7.576  -28.495 107.429 1.00 73.72  ?  464  ASN A C   1 
ATOM   3548  O  O   . ASN A  1 464 ? -7.498  -27.271 107.548 1.00 73.70  ?  464  ASN A O   1 
ATOM   3549  C  CB  . ASN A  1 464 ? -6.077  -28.695 109.444 1.00 81.14  ?  464  ASN A CB  1 
ATOM   3550  C  CG  . ASN A  1 464 ? -5.889  -29.385 110.792 1.00 84.68  ?  464  ASN A CG  1 
ATOM   3551  O  OD1 . ASN A  1 464 ? -6.832  -29.942 111.362 1.00 86.86  ?  464  ASN A OD1 1 
ATOM   3552  N  ND2 . ASN A  1 464 ? -4.663  -29.344 111.310 1.00 84.80  ?  464  ASN A ND2 1 
ATOM   3553  N  N   . TYR A  1 465 ? -8.106  -29.066 106.348 1.00 70.43  ?  465  TYR A N   1 
ATOM   3554  C  CA  . TYR A  1 465 ? -8.776  -28.221 105.373 1.00 67.91  ?  465  TYR A CA  1 
ATOM   3555  C  C   . TYR A  1 465 ? -10.216 -27.958 105.818 1.00 68.43  ?  465  TYR A C   1 
ATOM   3556  O  O   . TYR A  1 465 ? -10.705 -28.522 106.799 1.00 69.78  ?  465  TYR A O   1 
ATOM   3557  C  CB  . TYR A  1 465 ? -8.759  -28.871 103.987 1.00 66.01  ?  465  TYR A CB  1 
ATOM   3558  C  CG  . TYR A  1 465 ? -7.409  -28.882 103.290 1.00 64.22  ?  465  TYR A CG  1 
ATOM   3559  C  CD1 . TYR A  1 465 ? -6.504  -29.914 103.510 1.00 62.82  ?  465  TYR A CD1 1 
ATOM   3560  C  CD2 . TYR A  1 465 ? -7.049  -27.873 102.396 1.00 62.82  ?  465  TYR A CD2 1 
ATOM   3561  C  CE1 . TYR A  1 465 ? -5.276  -29.940 102.871 1.00 60.25  ?  465  TYR A CE1 1 
ATOM   3562  C  CE2 . TYR A  1 465 ? -5.819  -27.889 101.755 1.00 59.80  ?  465  TYR A CE2 1 
ATOM   3563  C  CZ  . TYR A  1 465 ? -4.938  -28.927 101.998 1.00 59.01  ?  465  TYR A CZ  1 
ATOM   3564  O  OH  . TYR A  1 465 ? -3.713  -28.958 101.369 1.00 57.28  ?  465  TYR A OH  1 
ATOM   3565  N  N   . THR A  1 466 ? -10.896 -27.082 105.086 1.00 67.93  ?  466  THR A N   1 
ATOM   3566  C  CA  . THR A  1 466 ? -12.303 -26.777 105.312 1.00 69.88  ?  466  THR A CA  1 
ATOM   3567  C  C   . THR A  1 466 ? -13.202 -27.787 104.599 1.00 69.64  ?  466  THR A C   1 
ATOM   3568  O  O   . THR A  1 466 ? -12.788 -28.465 103.656 1.00 68.29  ?  466  THR A O   1 
ATOM   3569  C  CB  . THR A  1 466 ? -12.626 -25.351 104.860 1.00 70.87  ?  466  THR A CB  1 
ATOM   3570  O  OG1 . THR A  1 466 ? -12.790 -25.315 103.437 1.00 70.05  ?  466  THR A OG1 1 
ATOM   3571  C  CG2 . THR A  1 466 ? -11.493 -24.413 105.247 1.00 70.48  ?  466  THR A CG2 1 
ATOM   3572  N  N   . THR A  1 467 ? -14.443 -27.902 105.084 1.00 71.10  ?  467  THR A N   1 
ATOM   3573  C  CA  . THR A  1 467 ? -15.430 -28.712 104.373 1.00 71.81  ?  467  THR A CA  1 
ATOM   3574  C  C   . THR A  1 467 ? -15.674 -28.171 102.970 1.00 71.47  ?  467  THR A C   1 
ATOM   3575  O  O   . THR A  1 467 ? -15.787 -28.945 102.007 1.00 71.10  ?  467  THR A O   1 
ATOM   3576  C  CB  . THR A  1 467 ? -16.744 -28.769 105.152 1.00 75.16  ?  467  THR A CB  1 
ATOM   3577  O  OG1 . THR A  1 467 ? -16.478 -28.948 106.550 1.00 76.16  ?  467  THR A OG1 1 
ATOM   3578  C  CG2 . THR A  1 467 ? -17.609 -29.916 104.648 1.00 75.36  ?  467  THR A CG2 1 
ATOM   3579  N  N   . GLU A  1 468 ? -15.764 -26.841 102.839 1.00 73.17  ?  468  GLU A N   1 
ATOM   3580  C  CA  . GLU A  1 468 ? -15.828 -26.207 101.524 1.00 72.55  ?  468  GLU A CA  1 
ATOM   3581  C  C   . GLU A  1 468 ? -14.711 -26.711 100.618 1.00 69.31  ?  468  GLU A C   1 
ATOM   3582  O  O   . GLU A  1 468 ? -14.944 -27.073 99.460  1.00 64.54  ?  468  GLU A O   1 
ATOM   3583  C  CB  . GLU A  1 468 ? -15.731 -24.687 101.666 1.00 75.57  ?  468  GLU A CB  1 
ATOM   3584  C  CG  . GLU A  1 468 ? -16.985 -23.988 102.146 1.00 83.32  ?  468  GLU A CG  1 
ATOM   3585  C  CD  . GLU A  1 468 ? -16.843 -22.472 102.103 1.00 88.86  ?  468  GLU A CD  1 
ATOM   3586  O  OE1 . GLU A  1 468 ? -15.809 -21.959 102.585 1.00 89.59  ?  468  GLU A OE1 1 
ATOM   3587  O  OE2 . GLU A  1 468 ? -17.760 -21.793 101.586 1.00 91.80  ?  468  GLU A OE2 1 
ATOM   3588  N  N   . GLU A  1 469 ? -13.485 -26.738 101.143 1.00 66.96  ?  469  GLU A N   1 
ATOM   3589  C  CA  . GLU A  1 469 ? -12.338 -27.180 100.363 1.00 64.02  ?  469  GLU A CA  1 
ATOM   3590  C  C   . GLU A  1 469 ? -12.373 -28.678 100.086 1.00 65.98  ?  469  GLU A C   1 
ATOM   3591  O  O   . GLU A  1 469 ? -11.825 -29.132 99.074  1.00 66.59  ?  469  GLU A O   1 
ATOM   3592  C  CB  . GLU A  1 469 ? -11.053 -26.791 101.086 1.00 61.33  ?  469  GLU A CB  1 
ATOM   3593  C  CG  . GLU A  1 469 ? -10.773 -25.303 101.035 1.00 62.53  ?  469  GLU A CG  1 
ATOM   3594  C  CD  . GLU A  1 469 ? -9.614  -24.903 101.912 1.00 65.29  ?  469  GLU A CD  1 
ATOM   3595  O  OE1 . GLU A  1 469 ? -9.389  -25.584 102.934 1.00 68.14  ?  469  GLU A OE1 1 
ATOM   3596  O  OE2 . GLU A  1 469 ? -8.909  -23.931 101.563 1.00 65.31  ?  469  GLU A OE2 1 
ATOM   3597  N  N   . ARG A  1 470 ? -12.999 -29.465 100.962 1.00 67.62  ?  470  ARG A N   1 
ATOM   3598  C  CA  . ARG A  1 470 ? -13.150 -30.887 100.676 1.00 67.39  ?  470  ARG A CA  1 
ATOM   3599  C  C   . ARG A  1 470 ? -14.078 -31.099 99.484  1.00 65.50  ?  470  ARG A C   1 
ATOM   3600  O  O   . ARG A  1 470 ? -13.741 -31.827 98.540  1.00 62.68  ?  470  ARG A O   1 
ATOM   3601  C  CB  . ARG A  1 470 ? -13.669 -31.614 101.915 1.00 72.35  ?  470  ARG A CB  1 
ATOM   3602  C  CG  . ARG A  1 470 ? -13.676 -33.129 101.794 1.00 75.89  ?  470  ARG A CG  1 
ATOM   3603  C  CD  . ARG A  1 470 ? -15.093 -33.667 101.654 1.00 81.14  ?  470  ARG A CD  1 
ATOM   3604  N  NE  . ARG A  1 470 ? -15.918 -33.352 102.818 1.00 86.22  ?  470  ARG A NE  1 
ATOM   3605  C  CZ  . ARG A  1 470 ? -17.205 -33.665 102.932 1.00 89.44  ?  470  ARG A CZ  1 
ATOM   3606  N  NH1 . ARG A  1 470 ? -17.826 -34.308 101.947 1.00 89.03  ?  470  ARG A NH1 1 
ATOM   3607  N  NH2 . ARG A  1 470 ? -17.873 -33.331 104.032 1.00 92.07  ?  470  ARG A NH2 1 
ATOM   3608  N  N   . ILE A  1 471 ? -15.245 -30.442 99.498  1.00 67.73  ?  471  ILE A N   1 
ATOM   3609  C  CA  . ILE A  1 471 ? -16.176 -30.557 98.375  1.00 68.92  ?  471  ILE A CA  1 
ATOM   3610  C  C   . ILE A  1 471 ? -15.547 -30.012 97.097  1.00 67.15  ?  471  ILE A C   1 
ATOM   3611  O  O   . ILE A  1 471 ? -15.701 -30.592 96.012  1.00 66.41  ?  471  ILE A O   1 
ATOM   3612  C  CB  . ILE A  1 471 ? -17.503 -29.843 98.701  1.00 72.16  ?  471  ILE A CB  1 
ATOM   3613  C  CG1 . ILE A  1 471 ? -18.161 -30.473 99.935  1.00 68.71  ?  471  ILE A CG1 1 
ATOM   3614  C  CG2 . ILE A  1 471 ? -18.433 -29.864 97.488  1.00 73.25  ?  471  ILE A CG2 1 
ATOM   3615  C  CD1 . ILE A  1 471 ? -19.438 -29.786 100.378 1.00 71.64  ?  471  ILE A CD1 1 
ATOM   3616  N  N   . PHE A  1 472 ? -14.831 -28.889 97.207  1.00 66.06  ?  472  PHE A N   1 
ATOM   3617  C  CA  . PHE A  1 472 ? -14.129 -28.320 96.060  1.00 63.54  ?  472  PHE A CA  1 
ATOM   3618  C  C   . PHE A  1 472 ? -13.146 -29.325 95.472  1.00 62.75  ?  472  PHE A C   1 
ATOM   3619  O  O   . PHE A  1 472 ? -13.139 -29.573 94.259  1.00 65.03  ?  472  PHE A O   1 
ATOM   3620  C  CB  . PHE A  1 472 ? -13.414 -27.038 96.494  1.00 62.32  ?  472  PHE A CB  1 
ATOM   3621  C  CG  . PHE A  1 472 ? -12.710 -26.315 95.380  1.00 60.11  ?  472  PHE A CG  1 
ATOM   3622  C  CD1 . PHE A  1 472 ? -13.345 -26.087 94.170  1.00 60.29  ?  472  PHE A CD1 1 
ATOM   3623  C  CD2 . PHE A  1 472 ? -11.418 -25.843 95.555  1.00 58.35  ?  472  PHE A CD2 1 
ATOM   3624  C  CE1 . PHE A  1 472 ? -12.697 -25.413 93.149  1.00 59.40  ?  472  PHE A CE1 1 
ATOM   3625  C  CE2 . PHE A  1 472 ? -10.765 -25.167 94.539  1.00 57.40  ?  472  PHE A CE2 1 
ATOM   3626  C  CZ  . PHE A  1 472 ? -11.405 -24.953 93.334  1.00 58.10  ?  472  PHE A CZ  1 
ATOM   3627  N  N   . ALA A  1 473 ? -12.319 -29.932 96.328  1.00 60.33  ?  473  ALA A N   1 
ATOM   3628  C  CA  . ALA A  1 473 ? -11.366 -30.935 95.863  1.00 57.27  ?  473  ALA A CA  1 
ATOM   3629  C  C   . ALA A  1 473 ? -12.071 -32.087 95.159  1.00 57.49  ?  473  ALA A C   1 
ATOM   3630  O  O   . ALA A  1 473 ? -11.611 -32.554 94.111  1.00 56.43  ?  473  ALA A O   1 
ATOM   3631  C  CB  . ALA A  1 473 ? -10.536 -31.455 97.036  1.00 56.55  ?  473  ALA A CB  1 
ATOM   3632  N  N   . GLN A  1 474 ? -13.188 -32.561 95.717  1.00 59.69  ?  474  GLN A N   1 
ATOM   3633  C  CA  . GLN A  1 474 ? -13.928 -33.636 95.058  1.00 61.49  ?  474  GLN A CA  1 
ATOM   3634  C  C   . GLN A  1 474 ? -14.413 -33.210 93.680  1.00 62.18  ?  474  GLN A C   1 
ATOM   3635  O  O   . GLN A  1 474 ? -14.354 -33.995 92.723  1.00 62.24  ?  474  GLN A O   1 
ATOM   3636  C  CB  . GLN A  1 474 ? -15.103 -34.078 95.926  1.00 65.51  ?  474  GLN A CB  1 
ATOM   3637  C  CG  . GLN A  1 474 ? -14.675 -34.722 97.226  1.00 67.94  ?  474  GLN A CG  1 
ATOM   3638  C  CD  . GLN A  1 474 ? -15.840 -35.282 98.001  1.00 72.63  ?  474  GLN A CD  1 
ATOM   3639  O  OE1 . GLN A  1 474 ? -16.980 -34.836 97.845  1.00 75.09  ?  474  GLN A OE1 1 
ATOM   3640  N  NE2 . GLN A  1 474 ? -15.567 -36.281 98.832  1.00 73.98  ?  474  GLN A NE2 1 
ATOM   3641  N  N   . ARG A  1 475 ? -14.890 -31.967 93.557  1.00 63.59  ?  475  ARG A N   1 
ATOM   3642  C  CA  . ARG A  1 475 ? -15.363 -31.482 92.264  1.00 63.39  ?  475  ARG A CA  1 
ATOM   3643  C  C   . ARG A  1 475 ? -14.225 -31.433 91.249  1.00 61.53  ?  475  ARG A C   1 
ATOM   3644  O  O   . ARG A  1 475 ? -14.407 -31.802 90.081  1.00 56.09  ?  475  ARG A O   1 
ATOM   3645  C  CB  . ARG A  1 475 ? -16.012 -30.106 92.429  1.00 64.58  ?  475  ARG A CB  1 
ATOM   3646  C  CG  . ARG A  1 475 ? -16.701 -29.588 91.175  1.00 66.75  ?  475  ARG A CG  1 
ATOM   3647  C  CD  . ARG A  1 475 ? -17.638 -28.409 91.473  1.00 70.56  ?  475  ARG A CD  1 
ATOM   3648  N  NE  . ARG A  1 475 ? -17.126 -27.133 90.964  1.00 71.68  ?  475  ARG A NE  1 
ATOM   3649  C  CZ  . ARG A  1 475 ? -16.666 -26.141 91.722  1.00 71.83  ?  475  ARG A CZ  1 
ATOM   3650  N  NH1 . ARG A  1 475 ? -16.652 -26.254 93.047  1.00 72.51  ?  475  ARG A NH1 1 
ATOM   3651  N  NH2 . ARG A  1 475 ? -16.223 -25.025 91.150  1.00 70.76  ?  475  ARG A NH2 1 
ATOM   3652  N  N   . LEU A  1 476 ? -13.034 -31.006 91.684  1.00 59.21  ?  476  LEU A N   1 
ATOM   3653  C  CA  . LEU A  1 476 ? -11.896 -30.941 90.771  1.00 55.55  ?  476  LEU A CA  1 
ATOM   3654  C  C   . LEU A  1 476 ? -11.430 -32.329 90.359  1.00 55.33  ?  476  LEU A C   1 
ATOM   3655  O  O   . LEU A  1 476 ? -11.109 -32.556 89.188  1.00 55.48  ?  476  LEU A O   1 
ATOM   3656  C  CB  . LEU A  1 476 ? -10.748 -30.167 91.410  1.00 52.54  ?  476  LEU A CB  1 
ATOM   3657  C  CG  . LEU A  1 476 ? -11.002 -28.682 91.630  1.00 53.06  ?  476  LEU A CG  1 
ATOM   3658  C  CD1 . LEU A  1 476 ? -9.746  -28.041 92.156  1.00 52.05  ?  476  LEU A CD1 1 
ATOM   3659  C  CD2 . LEU A  1 476 ? -11.444 -28.028 90.339  1.00 53.32  ?  476  LEU A CD2 1 
ATOM   3660  N  N   . MET A  1 477 ? -11.366 -33.267 91.306  1.00 55.57  ?  477  MET A N   1 
ATOM   3661  C  CA  . MET A  1 477 ? -11.062 -34.648 90.947  1.00 57.15  ?  477  MET A CA  1 
ATOM   3662  C  C   . MET A  1 477 ? -12.062 -35.184 89.932  1.00 58.55  ?  477  MET A C   1 
ATOM   3663  O  O   . MET A  1 477 ? -11.687 -35.920 89.011  1.00 59.65  ?  477  MET A O   1 
ATOM   3664  C  CB  . MET A  1 477 ? -11.046 -35.529 92.194  1.00 58.25  ?  477  MET A CB  1 
ATOM   3665  C  CG  . MET A  1 477 ? -9.930  -35.204 93.167  1.00 57.76  ?  477  MET A CG  1 
ATOM   3666  S  SD  . MET A  1 477 ? -10.129 -36.050 94.741  1.00 59.55  ?  477  MET A SD  1 
ATOM   3667  C  CE  . MET A  1 477 ? -10.046 -37.755 94.226  1.00 59.41  ?  477  MET A CE  1 
ATOM   3668  N  N   . LYS A  1 478 ? -13.340 -34.822 90.076  1.00 58.80  ?  478  LYS A N   1 
ATOM   3669  C  CA  . LYS A  1 478 ? -14.325 -35.256 89.092  1.00 59.92  ?  478  LYS A CA  1 
ATOM   3670  C  C   . LYS A  1 478 ? -14.069 -34.616 87.731  1.00 59.56  ?  478  LYS A C   1 
ATOM   3671  O  O   . LYS A  1 478 ? -14.216 -35.275 86.696  1.00 57.22  ?  478  LYS A O   1 
ATOM   3672  C  CB  . LYS A  1 478 ? -15.739 -34.944 89.580  1.00 62.51  ?  478  LYS A CB  1 
ATOM   3673  C  CG  . LYS A  1 478 ? -16.386 -36.065 90.386  1.00 63.19  ?  478  LYS A CG  1 
ATOM   3674  C  CD  . LYS A  1 478 ? -17.743 -36.446 89.812  1.00 66.85  ?  478  LYS A CD  1 
ATOM   3675  C  CE  . LYS A  1 478 ? -18.432 -37.500 90.670  1.00 69.22  ?  478  LYS A CE  1 
ATOM   3676  N  NZ  . LYS A  1 478 ? -17.616 -38.743 90.786  1.00 67.39  ?  478  LYS A NZ  1 
ATOM   3677  N  N   . TYR A  1 479 ? -13.687 -33.335 87.706  1.00 61.65  ?  479  TYR A N   1 
ATOM   3678  C  CA  . TYR A  1 479 ? -13.367 -32.695 86.430  1.00 62.12  ?  479  TYR A CA  1 
ATOM   3679  C  C   . TYR A  1 479 ? -12.197 -33.393 85.747  1.00 60.41  ?  479  TYR A C   1 
ATOM   3680  O  O   . TYR A  1 479 ? -12.258 -33.710 84.552  1.00 62.08  ?  479  TYR A O   1 
ATOM   3681  C  CB  . TYR A  1 479 ? -13.058 -31.207 86.628  1.00 61.95  ?  479  TYR A CB  1 
ATOM   3682  C  CG  . TYR A  1 479 ? -14.260 -30.343 86.941  1.00 64.10  ?  479  TYR A CG  1 
ATOM   3683  C  CD1 . TYR A  1 479 ? -15.515 -30.647 86.427  1.00 66.00  ?  479  TYR A CD1 1 
ATOM   3684  C  CD2 . TYR A  1 479 ? -14.136 -29.207 87.737  1.00 64.46  ?  479  TYR A CD2 1 
ATOM   3685  C  CE1 . TYR A  1 479 ? -16.620 -29.853 86.713  1.00 68.02  ?  479  TYR A CE1 1 
ATOM   3686  C  CE2 . TYR A  1 479 ? -15.230 -28.406 88.026  1.00 65.47  ?  479  TYR A CE2 1 
ATOM   3687  C  CZ  . TYR A  1 479 ? -16.471 -28.732 87.513  1.00 66.95  ?  479  TYR A CZ  1 
ATOM   3688  O  OH  . TYR A  1 479 ? -17.562 -27.937 87.800  1.00 67.05  ?  479  TYR A OH  1 
ATOM   3689  N  N   . TRP A  1 480 ? -11.122 -33.653 86.498  1.00 56.47  ?  480  TRP A N   1 
ATOM   3690  C  CA  . TRP A  1 480 ? -9.920  -34.225 85.899  1.00 52.46  ?  480  TRP A CA  1 
ATOM   3691  C  C   . TRP A  1 480 ? -10.142 -35.667 85.465  1.00 53.64  ?  480  TRP A C   1 
ATOM   3692  O  O   . TRP A  1 480 ? -9.711  -36.061 84.377  1.00 52.99  ?  480  TRP A O   1 
ATOM   3693  C  CB  . TRP A  1 480 ? -8.753  -34.142 86.879  1.00 49.46  ?  480  TRP A CB  1 
ATOM   3694  C  CG  . TRP A  1 480 ? -7.817  -33.003 86.639  1.00 46.99  ?  480  TRP A CG  1 
ATOM   3695  C  CD1 . TRP A  1 480 ? -6.475  -33.083 86.401  1.00 45.67  ?  480  TRP A CD1 1 
ATOM   3696  C  CD2 . TRP A  1 480 ? -8.145  -31.607 86.624  1.00 47.55  ?  480  TRP A CD2 1 
ATOM   3697  N  NE1 . TRP A  1 480 ? -5.946  -31.824 86.240  1.00 45.37  ?  480  TRP A NE1 1 
ATOM   3698  C  CE2 . TRP A  1 480 ? -6.950  -30.900 86.374  1.00 46.48  ?  480  TRP A CE2 1 
ATOM   3699  C  CE3 . TRP A  1 480 ? -9.331  -30.887 86.800  1.00 49.00  ?  480  TRP A CE3 1 
ATOM   3700  C  CZ2 . TRP A  1 480 ? -6.909  -29.509 86.295  1.00 46.77  ?  480  TRP A CZ2 1 
ATOM   3701  C  CZ3 . TRP A  1 480 ? -9.287  -29.508 86.723  1.00 49.29  ?  480  TRP A CZ3 1 
ATOM   3702  C  CH2 . TRP A  1 480 ? -8.084  -28.833 86.472  1.00 48.16  ?  480  TRP A CH2 1 
ATOM   3703  N  N   . THR A  1 481 ? -10.799 -36.478 86.298  1.00 55.22  ?  481  THR A N   1 
ATOM   3704  C  CA  . THR A  1 481 ? -11.032 -37.862 85.897  1.00 56.08  ?  481  THR A CA  1 
ATOM   3705  C  C   . THR A  1 481 ? -12.047 -37.945 84.764  1.00 56.83  ?  481  THR A C   1 
ATOM   3706  O  O   . THR A  1 481 ? -11.937 -38.820 83.895  1.00 55.24  ?  481  THR A O   1 
ATOM   3707  C  CB  . THR A  1 481 ? -11.493 -38.697 87.091  1.00 56.99  ?  481  THR A CB  1 
ATOM   3708  O  OG1 . THR A  1 481 ? -12.407 -37.933 87.885  1.00 60.43  ?  481  THR A OG1 1 
ATOM   3709  C  CG2 . THR A  1 481 ? -10.298 -39.082 87.942  1.00 49.71  ?  481  THR A CG2 1 
ATOM   3710  N  N   . ASN A  1 482 ? -13.036 -37.047 84.761  1.00 58.68  ?  482  ASN A N   1 
ATOM   3711  C  CA  . ASN A  1 482 ? -13.936 -36.938 83.621  1.00 59.95  ?  482  ASN A CA  1 
ATOM   3712  C  C   . ASN A  1 482 ? -13.164 -36.633 82.345  1.00 60.91  ?  482  ASN A C   1 
ATOM   3713  O  O   . ASN A  1 482 ? -13.416 -37.239 81.297  1.00 64.10  ?  482  ASN A O   1 
ATOM   3714  C  CB  . ASN A  1 482 ? -14.992 -35.859 83.872  1.00 60.03  ?  482  ASN A CB  1 
ATOM   3715  C  CG  . ASN A  1 482 ? -16.180 -36.372 84.660  1.00 60.67  ?  482  ASN A CG  1 
ATOM   3716  O  OD1 . ASN A  1 482 ? -16.450 -37.573 84.687  1.00 60.67  ?  482  ASN A OD1 1 
ATOM   3717  N  ND2 . ASN A  1 482 ? -16.917 -35.458 85.280  1.00 61.72  ?  482  ASN A ND2 1 
ATOM   3718  N  N   . PHE A  1 483 ? -12.220 -35.693 82.409  1.00 57.69  ?  483  PHE A N   1 
ATOM   3719  C  CA  . PHE A  1 483 ? -11.436 -35.380 81.222  1.00 55.88  ?  483  PHE A CA  1 
ATOM   3720  C  C   . PHE A  1 483 ? -10.586 -36.571 80.791  1.00 58.05  ?  483  PHE A C   1 
ATOM   3721  O  O   . PHE A  1 483 ? -10.574 -36.942 79.613  1.00 61.12  ?  483  PHE A O   1 
ATOM   3722  C  CB  . PHE A  1 483 ? -10.561 -34.156 81.469  1.00 52.08  ?  483  PHE A CB  1 
ATOM   3723  C  CG  . PHE A  1 483 ? -9.685  -33.819 80.310  1.00 50.69  ?  483  PHE A CG  1 
ATOM   3724  C  CD1 . PHE A  1 483 ? -10.220 -33.220 79.183  1.00 51.73  ?  483  PHE A CD1 1 
ATOM   3725  C  CD2 . PHE A  1 483 ? -8.333  -34.114 80.333  1.00 47.81  ?  483  PHE A CD2 1 
ATOM   3726  C  CE1 . PHE A  1 483 ? -9.426  -32.913 78.105  1.00 52.04  ?  483  PHE A CE1 1 
ATOM   3727  C  CE2 . PHE A  1 483 ? -7.533  -33.809 79.253  1.00 49.41  ?  483  PHE A CE2 1 
ATOM   3728  C  CZ  . PHE A  1 483 ? -8.080  -33.204 78.140  1.00 50.61  ?  483  PHE A CZ  1 
ATOM   3729  N  N   . ALA A  1 484 ? -9.869  -37.185 81.736  1.00 57.58  ?  484  ALA A N   1 
ATOM   3730  C  CA  . ALA A  1 484 ? -9.018  -38.324 81.407  1.00 56.70  ?  484  ALA A CA  1 
ATOM   3731  C  C   . ALA A  1 484 ? -9.823  -39.457 80.788  1.00 61.99  ?  484  ALA A C   1 
ATOM   3732  O  O   . ALA A  1 484 ? -9.335  -40.160 79.895  1.00 64.52  ?  484  ALA A O   1 
ATOM   3733  C  CB  . ALA A  1 484 ? -8.287  -38.813 82.657  1.00 51.99  ?  484  ALA A CB  1 
ATOM   3734  N  N   . ARG A  1 485 ? -11.064 -39.635 81.240  1.00 63.84  ?  485  ARG A N   1 
ATOM   3735  C  CA  . ARG A  1 485 ? -11.927 -40.699 80.738  1.00 65.39  ?  485  ARG A CA  1 
ATOM   3736  C  C   . ARG A  1 485 ? -12.502 -40.357 79.364  1.00 62.49  ?  485  ARG A C   1 
ATOM   3737  O  O   . ARG A  1 485 ? -12.215 -41.037 78.374  1.00 60.42  ?  485  ARG A O   1 
ATOM   3738  C  CB  . ARG A  1 485 ? -13.047 -40.961 81.751  1.00 70.98  ?  485  ARG A CB  1 
ATOM   3739  C  CG  . ARG A  1 485 ? -13.734 -42.308 81.627  1.00 77.90  ?  485  ARG A CG  1 
ATOM   3740  C  CD  . ARG A  1 485 ? -14.732 -42.503 82.764  1.00 84.97  ?  485  ARG A CD  1 
ATOM   3741  N  NE  . ARG A  1 485 ? -14.200 -42.015 84.040  1.00 88.99  ?  485  ARG A NE  1 
ATOM   3742  C  CZ  . ARG A  1 485 ? -13.588 -42.775 84.950  1.00 91.59  ?  485  ARG A CZ  1 
ATOM   3743  N  NH1 . ARG A  1 485 ? -13.422 -44.078 84.741  1.00 92.69  ?  485  ARG A NH1 1 
ATOM   3744  N  NH2 . ARG A  1 485 ? -13.140 -42.228 86.074  1.00 91.54  ?  485  ARG A NH2 1 
ATOM   3745  N  N   . THR A  1 486 ? -13.327 -39.312 79.290  1.00 62.12  ?  486  THR A N   1 
ATOM   3746  C  CA  . THR A  1 486 ? -14.088 -38.988 78.090  1.00 60.35  ?  486  THR A CA  1 
ATOM   3747  C  C   . THR A  1 486 ? -13.464 -37.898 77.226  1.00 61.29  ?  486  THR A C   1 
ATOM   3748  O  O   . THR A  1 486 ? -14.012 -37.592 76.164  1.00 63.72  ?  486  THR A O   1 
ATOM   3749  C  CB  . THR A  1 486 ? -15.506 -38.552 78.469  1.00 62.43  ?  486  THR A CB  1 
ATOM   3750  O  OG1 . THR A  1 486 ? -15.456 -37.276 79.117  1.00 64.00  ?  486  THR A OG1 1 
ATOM   3751  C  CG2 . THR A  1 486 ? -16.136 -39.555 79.416  1.00 62.39  ?  486  THR A CG2 1 
ATOM   3752  N  N   . GLY A  1 487 ? -12.349 -37.299 77.640  1.00 60.13  ?  487  GLY A N   1 
ATOM   3753  C  CA  . GLY A  1 487 ? -11.872 -36.121 76.936  1.00 58.40  ?  487  GLY A CA  1 
ATOM   3754  C  C   . GLY A  1 487 ? -12.716 -34.882 77.140  1.00 59.01  ?  487  GLY A C   1 
ATOM   3755  O  O   . GLY A  1 487 ? -12.545 -33.903 76.408  1.00 59.16  ?  487  GLY A O   1 
ATOM   3756  N  N   . ASP A  1 488 ? -13.639 -34.901 78.106  1.00 60.33  ?  488  ASP A N   1 
ATOM   3757  C  CA  . ASP A  1 488 ? -14.491 -33.773 78.429  1.00 61.30  ?  488  ASP A CA  1 
ATOM   3758  C  C   . ASP A  1 488 ? -14.475 -33.642 79.949  1.00 61.33  ?  488  ASP A C   1 
ATOM   3759  O  O   . ASP A  1 488 ? -14.621 -34.658 80.654  1.00 62.20  ?  488  ASP A O   1 
ATOM   3760  C  CB  . ASP A  1 488 ? -15.907 -34.053 77.905  1.00 63.75  ?  488  ASP A CB  1 
ATOM   3761  C  CG  . ASP A  1 488 ? -16.875 -32.894 78.099  1.00 66.32  ?  488  ASP A CG  1 
ATOM   3762  O  OD1 . ASP A  1 488 ? -16.727 -32.102 79.051  1.00 66.72  ?  488  ASP A OD1 1 
ATOM   3763  O  OD2 . ASP A  1 488 ? -17.826 -32.801 77.291  1.00 62.03  ?  488  ASP A OD2 1 
ATOM   3764  N  N   . PRO A  1 489 ? -14.332 -32.427 80.491  1.00 60.53  ?  489  PRO A N   1 
ATOM   3765  C  CA  . PRO A  1 489 ? -14.412 -32.275 81.952  1.00 59.67  ?  489  PRO A CA  1 
ATOM   3766  C  C   . PRO A  1 489 ? -15.821 -32.412 82.494  1.00 62.54  ?  489  PRO A C   1 
ATOM   3767  O  O   . PRO A  1 489 ? -15.991 -32.821 83.650  1.00 62.25  ?  489  PRO A O   1 
ATOM   3768  C  CB  . PRO A  1 489 ? -13.862 -30.862 82.191  1.00 57.76  ?  489  PRO A CB  1 
ATOM   3769  C  CG  . PRO A  1 489 ? -13.115 -30.513 80.950  1.00 57.05  ?  489  PRO A CG  1 
ATOM   3770  C  CD  . PRO A  1 489 ? -13.857 -31.194 79.844  1.00 59.34  ?  489  PRO A CD  1 
ATOM   3771  N  N   . ASN A  1 490 ? -16.832 -32.085 81.694  1.00 65.61  ?  490  ASN A N   1 
ATOM   3772  C  CA  . ASN A  1 490 ? -18.193 -31.981 82.197  1.00 71.47  ?  490  ASN A CA  1 
ATOM   3773  C  C   . ASN A  1 490 ? -18.740 -33.332 82.629  1.00 79.81  ?  490  ASN A C   1 
ATOM   3774  O  O   . ASN A  1 490 ? -18.380 -34.382 82.089  1.00 80.30  ?  490  ASN A O   1 
ATOM   3775  C  CB  . ASN A  1 490 ? -19.106 -31.373 81.138  1.00 71.34  ?  490  ASN A CB  1 
ATOM   3776  C  CG  . ASN A  1 490 ? -19.071 -29.869 81.148  1.00 70.93  ?  490  ASN A CG  1 
ATOM   3777  O  OD1 . ASN A  1 490 ? -18.693 -29.236 80.161  1.00 72.13  ?  490  ASN A OD1 1 
ATOM   3778  N  ND2 . ASN A  1 490 ? -19.473 -29.279 82.270  1.00 69.84  ?  490  ASN A ND2 1 
ATOM   3779  N  N   . ASP A  1 491 ? -19.624 -33.288 83.612  1.00 88.02  ?  491  ASP A N   1 
ATOM   3780  C  CA  . ASP A  1 491 ? -20.276 -34.491 84.107  1.00 94.86  ?  491  ASP A CA  1 
ATOM   3781  C  C   . ASP A  1 491 ? -21.208 -35.033 83.030  1.00 98.33  ?  491  ASP A C   1 
ATOM   3782  O  O   . ASP A  1 491 ? -22.122 -34.316 82.602  1.00 99.06  ?  491  ASP A O   1 
ATOM   3783  C  CB  . ASP A  1 491 ? -21.040 -34.171 85.386  1.00 99.84  ?  491  ASP A CB  1 
ATOM   3784  C  CG  . ASP A  1 491 ? -21.175 -35.369 86.293  1.00 102.99 ?  491  ASP A CG  1 
ATOM   3785  O  OD1 . ASP A  1 491 ? -21.183 -36.507 85.774  1.00 103.55 ?  491  ASP A OD1 1 
ATOM   3786  O  OD2 . ASP A  1 491 ? -21.258 -35.170 87.524  1.00 104.34 ?  491  ASP A OD2 1 
ATOM   3787  N  N   . PRO A  1 492 ? -21.008 -36.265 82.546  1.00 100.41 ?  492  PRO A N   1 
ATOM   3788  C  CA  . PRO A  1 492 ? -21.807 -36.726 81.392  1.00 101.12 ?  492  PRO A CA  1 
ATOM   3789  C  C   . PRO A  1 492 ? -23.301 -36.799 81.668  1.00 101.54 ?  492  PRO A C   1 
ATOM   3790  O  O   . PRO A  1 492 ? -24.100 -36.329 80.848  1.00 99.61  ?  492  PRO A O   1 
ATOM   3791  C  CB  . PRO A  1 492 ? -21.207 -38.109 81.081  1.00 101.82 ?  492  PRO A CB  1 
ATOM   3792  C  CG  . PRO A  1 492 ? -19.854 -38.115 81.724  1.00 100.30 ?  492  PRO A CG  1 
ATOM   3793  C  CD  . PRO A  1 492 ? -19.988 -37.252 82.946  1.00 100.26 ?  492  PRO A CD  1 
ATOM   3794  N  N   . ARG A  1 493 ? -23.705 -37.355 82.813  1.00 105.27 ?  493  ARG A N   1 
ATOM   3795  C  CA  . ARG A  1 493 ? -25.113 -37.555 83.140  1.00 111.90 ?  493  ARG A CA  1 
ATOM   3796  C  C   . ARG A  1 493 ? -25.758 -36.316 83.747  1.00 114.89 ?  493  ARG A C   1 
ATOM   3797  O  O   . ARG A  1 493 ? -26.940 -36.362 84.113  1.00 118.80 ?  493  ARG A O   1 
ATOM   3798  C  CB  . ARG A  1 493 ? -25.289 -38.753 84.092  1.00 113.78 ?  493  ARG A CB  1 
ATOM   3799  C  CG  . ARG A  1 493 ? -24.817 -38.570 85.547  1.00 113.82 ?  493  ARG A CG  1 
ATOM   3800  C  CD  . ARG A  1 493 ? -23.316 -38.733 85.685  1.00 110.82 ?  493  ARG A CD  1 
ATOM   3801  N  NE  . ARG A  1 493 ? -22.942 -39.361 86.948  1.00 109.31 ?  493  ARG A NE  1 
ATOM   3802  C  CZ  . ARG A  1 493 ? -22.798 -38.713 88.099  1.00 107.02 ?  493  ARG A CZ  1 
ATOM   3803  N  NH1 . ARG A  1 493 ? -23.027 -37.408 88.160  1.00 106.52 ?  493  ARG A NH1 1 
ATOM   3804  N  NH2 . ARG A  1 493 ? -22.446 -39.374 89.186  1.00 105.38 ?  493  ARG A NH2 1 
ATOM   3805  N  N   . ASP A  1 494 ? -25.018 -35.215 83.859  1.00 112.74 ?  494  ASP A N   1 
ATOM   3806  C  CA  . ASP A  1 494 ? -25.484 -34.034 84.569  1.00 112.98 ?  494  ASP A CA  1 
ATOM   3807  C  C   . ASP A  1 494 ? -25.662 -32.856 83.619  1.00 112.00 ?  494  ASP A C   1 
ATOM   3808  O  O   . ASP A  1 494 ? -24.794 -32.579 82.780  1.00 108.74 ?  494  ASP A O   1 
ATOM   3809  C  CB  . ASP A  1 494 ? -24.510 -33.654 85.690  1.00 111.00 ?  494  ASP A CB  1 
ATOM   3810  C  CG  . ASP A  1 494 ? -25.117 -32.691 86.693  1.00 112.60 ?  494  ASP A CG  1 
ATOM   3811  O  OD1 . ASP A  1 494 ? -26.206 -32.138 86.424  1.00 114.90 ?  494  ASP A OD1 1 
ATOM   3812  O  OD2 . ASP A  1 494 ? -24.498 -32.485 87.757  1.00 111.67 ?  494  ASP A OD2 1 
ATOM   3813  N  N   . SER A  1 495 ? -26.800 -32.178 83.755  1.00 114.47 ?  495  SER A N   1 
ATOM   3814  C  CA  . SER A  1 495 ? -26.995 -30.817 83.281  1.00 115.45 ?  495  SER A CA  1 
ATOM   3815  C  C   . SER A  1 495 ? -27.635 -30.025 84.417  1.00 117.59 ?  495  SER A C   1 
ATOM   3816  O  O   . SER A  1 495 ? -28.367 -30.588 85.239  1.00 119.21 ?  495  SER A O   1 
ATOM   3817  C  CB  . SER A  1 495 ? -27.861 -30.768 82.004  1.00 117.10 ?  495  SER A CB  1 
ATOM   3818  O  OG  . SER A  1 495 ? -27.916 -29.454 81.473  1.00 117.57 ?  495  SER A OG  1 
ATOM   3819  N  N   . LYS A  1 496 ? -27.353 -28.715 84.448  1.00 116.61 ?  496  LYS A N   1 
ATOM   3820  C  CA  . LYS A  1 496 ? -27.593 -27.737 85.517  1.00 115.55 ?  496  LYS A CA  1 
ATOM   3821  C  C   . LYS A  1 496 ? -26.443 -27.724 86.529  1.00 111.42 ?  496  LYS A C   1 
ATOM   3822  O  O   . LYS A  1 496 ? -26.399 -26.840 87.381  1.00 110.02 ?  496  LYS A O   1 
ATOM   3823  C  CB  . LYS A  1 496 ? -28.934 -27.935 86.254  1.00 117.72 ?  496  LYS A CB  1 
ATOM   3824  C  CG  . LYS A  1 496 ? -29.364 -26.793 87.192  1.00 118.00 ?  496  LYS A CG  1 
ATOM   3825  C  CD  . LYS A  1 496 ? -29.000 -25.410 86.632  1.00 115.10 ?  496  LYS A CD  1 
ATOM   3826  C  CE  . LYS A  1 496 ? -28.743 -24.395 87.748  1.00 111.82 ?  496  LYS A CE  1 
ATOM   3827  N  NZ  . LYS A  1 496 ? -29.996 -24.036 88.467  1.00 113.10 ?  496  LYS A NZ  1 
ATOM   3828  N  N   . SER A  1 497 ? -25.511 -28.666 86.449  1.00 109.54 ?  497  SER A N   1 
ATOM   3829  C  CA  . SER A  1 497 ? -24.144 -28.382 86.857  1.00 107.25 ?  497  SER A CA  1 
ATOM   3830  C  C   . SER A  1 497 ? -23.512 -27.571 85.734  1.00 107.48 ?  497  SER A C   1 
ATOM   3831  O  O   . SER A  1 497 ? -23.409 -28.077 84.609  1.00 111.19 ?  497  SER A O   1 
ATOM   3832  C  CB  . SER A  1 497 ? -23.350 -29.661 87.109  1.00 103.50 ?  497  SER A CB  1 
ATOM   3833  O  OG  . SER A  1 497 ? -23.726 -30.277 88.332  1.00 102.82 ?  497  SER A OG  1 
ATOM   3834  N  N   . PRO A  1 498 ? -23.113 -26.321 85.975  1.00 102.08 ?  498  PRO A N   1 
ATOM   3835  C  CA  . PRO A  1 498 ? -22.832 -25.401 84.860  1.00 98.90  ?  498  PRO A CA  1 
ATOM   3836  C  C   . PRO A  1 498 ? -21.820 -25.977 83.877  1.00 94.16  ?  498  PRO A C   1 
ATOM   3837  O  O   . PRO A  1 498 ? -20.744 -26.446 84.259  1.00 92.66  ?  498  PRO A O   1 
ATOM   3838  C  CB  . PRO A  1 498 ? -22.298 -24.147 85.566  1.00 97.38  ?  498  PRO A CB  1 
ATOM   3839  C  CG  . PRO A  1 498 ? -22.829 -24.233 86.973  1.00 97.97  ?  498  PRO A CG  1 
ATOM   3840  C  CD  . PRO A  1 498 ? -22.882 -25.699 87.293  1.00 98.75  ?  498  PRO A CD  1 
ATOM   3841  N  N   . GLN A  1 499 ? -22.178 -25.948 82.595  1.00 91.10  ?  499  GLN A N   1 
ATOM   3842  C  CA  . GLN A  1 499 ? -21.349 -26.574 81.574  1.00 85.21  ?  499  GLN A CA  1 
ATOM   3843  C  C   . GLN A  1 499 ? -20.052 -25.800 81.361  1.00 77.91  ?  499  GLN A C   1 
ATOM   3844  O  O   . GLN A  1 499 ? -19.985 -24.581 81.531  1.00 77.90  ?  499  GLN A O   1 
ATOM   3845  C  CB  . GLN A  1 499 ? -22.112 -26.688 80.253  1.00 87.94  ?  499  GLN A CB  1 
ATOM   3846  C  CG  . GLN A  1 499 ? -23.279 -27.689 80.248  1.00 91.36  ?  499  GLN A CG  1 
ATOM   3847  C  CD  . GLN A  1 499 ? -22.891 -29.073 80.767  1.00 91.38  ?  499  GLN A CD  1 
ATOM   3848  O  OE1 . GLN A  1 499 ? -22.921 -29.338 81.971  1.00 92.15  ?  499  GLN A OE1 1 
ATOM   3849  N  NE2 . GLN A  1 499 ? -22.507 -29.955 79.853  1.00 90.45  ?  499  GLN A NE2 1 
ATOM   3850  N  N   . TRP A  1 500 ? -19.010 -26.534 80.981  1.00 72.75  ?  500  TRP A N   1 
ATOM   3851  C  CA  . TRP A  1 500 ? -17.685 -25.976 80.742  1.00 69.60  ?  500  TRP A CA  1 
ATOM   3852  C  C   . TRP A  1 500 ? -17.434 -26.005 79.239  1.00 70.20  ?  500  TRP A C   1 
ATOM   3853  O  O   . TRP A  1 500 ? -17.133 -27.072 78.679  1.00 70.16  ?  500  TRP A O   1 
ATOM   3854  C  CB  . TRP A  1 500 ? -16.641 -26.804 81.500  1.00 65.53  ?  500  TRP A CB  1 
ATOM   3855  C  CG  . TRP A  1 500 ? -15.211 -26.356 81.430  1.00 60.78  ?  500  TRP A CG  1 
ATOM   3856  C  CD1 . TRP A  1 500 ? -14.655 -25.482 80.544  1.00 61.14  ?  500  TRP A CD1 1 
ATOM   3857  C  CD2 . TRP A  1 500 ? -14.146 -26.792 82.283  1.00 56.43  ?  500  TRP A CD2 1 
ATOM   3858  N  NE1 . TRP A  1 500 ? -13.312 -25.338 80.799  1.00 59.87  ?  500  TRP A NE1 1 
ATOM   3859  C  CE2 . TRP A  1 500 ? -12.974 -26.136 81.860  1.00 58.50  ?  500  TRP A CE2 1 
ATOM   3860  C  CE3 . TRP A  1 500 ? -14.072 -27.671 83.367  1.00 55.90  ?  500  TRP A CE3 1 
ATOM   3861  C  CZ2 . TRP A  1 500 ? -11.741 -26.328 82.486  1.00 53.26  ?  500  TRP A CZ2 1 
ATOM   3862  C  CZ3 . TRP A  1 500 ? -12.848 -27.864 83.984  1.00 54.07  ?  500  TRP A CZ3 1 
ATOM   3863  C  CH2 . TRP A  1 500 ? -11.699 -27.195 83.542  1.00 52.79  ?  500  TRP A CH2 1 
ATOM   3864  N  N   . PRO A  1 501 ? -17.531 -24.873 78.546  1.00 69.85  ?  501  PRO A N   1 
ATOM   3865  C  CA  . PRO A  1 501 ? -17.416 -24.880 77.082  1.00 69.41  ?  501  PRO A CA  1 
ATOM   3866  C  C   . PRO A  1 501 ? -15.966 -24.972 76.645  1.00 66.09  ?  501  PRO A C   1 
ATOM   3867  O  O   . PRO A  1 501 ? -15.061 -24.549 77.379  1.00 64.74  ?  501  PRO A O   1 
ATOM   3868  C  CB  . PRO A  1 501 ? -18.040 -23.537 76.676  1.00 71.57  ?  501  PRO A CB  1 
ATOM   3869  C  CG  . PRO A  1 501 ? -17.800 -22.654 77.855  1.00 70.66  ?  501  PRO A CG  1 
ATOM   3870  C  CD  . PRO A  1 501 ? -17.894 -23.544 79.069  1.00 70.05  ?  501  PRO A CD  1 
ATOM   3871  N  N   . PRO A  1 502 ? -15.702 -25.521 75.462  1.00 64.71  ?  502  PRO A N   1 
ATOM   3872  C  CA  . PRO A  1 502 ? -14.317 -25.577 74.980  1.00 62.41  ?  502  PRO A CA  1 
ATOM   3873  C  C   . PRO A  1 502 ? -13.806 -24.192 74.620  1.00 61.79  ?  502  PRO A C   1 
ATOM   3874  O  O   . PRO A  1 502 ? -14.550 -23.347 74.118  1.00 61.46  ?  502  PRO A O   1 
ATOM   3875  C  CB  . PRO A  1 502 ? -14.403 -26.483 73.743  1.00 62.92  ?  502  PRO A CB  1 
ATOM   3876  C  CG  . PRO A  1 502 ? -15.698 -27.232 73.897  1.00 64.26  ?  502  PRO A CG  1 
ATOM   3877  C  CD  . PRO A  1 502 ? -16.619 -26.281 74.598  1.00 65.87  ?  502  PRO A CD  1 
ATOM   3878  N  N   . TYR A  1 503 ? -12.525 -23.959 74.905  1.00 60.46  ?  503  TYR A N   1 
ATOM   3879  C  CA  . TYR A  1 503 ? -11.874 -22.735 74.460  1.00 60.62  ?  503  TYR A CA  1 
ATOM   3880  C  C   . TYR A  1 503 ? -11.758 -22.739 72.944  1.00 62.25  ?  503  TYR A C   1 
ATOM   3881  O  O   . TYR A  1 503 ? -11.227 -23.684 72.355  1.00 61.74  ?  503  TYR A O   1 
ATOM   3882  C  CB  . TYR A  1 503 ? -10.489 -22.603 75.087  1.00 57.69  ?  503  TYR A CB  1 
ATOM   3883  C  CG  . TYR A  1 503 ? -9.786  -21.306 74.755  1.00 55.68  ?  503  TYR A CG  1 
ATOM   3884  C  CD1 . TYR A  1 503 ? -9.983  -20.171 75.529  1.00 57.08  ?  503  TYR A CD1 1 
ATOM   3885  C  CD2 . TYR A  1 503 ? -8.920  -21.218 73.671  1.00 55.32  ?  503  TYR A CD2 1 
ATOM   3886  C  CE1 . TYR A  1 503 ? -9.341  -18.986 75.234  1.00 57.64  ?  503  TYR A CE1 1 
ATOM   3887  C  CE2 . TYR A  1 503 ? -8.272  -20.034 73.367  1.00 55.85  ?  503  TYR A CE2 1 
ATOM   3888  C  CZ  . TYR A  1 503 ? -8.488  -18.921 74.152  1.00 56.69  ?  503  TYR A CZ  1 
ATOM   3889  O  OH  . TYR A  1 503 ? -7.850  -17.736 73.861  1.00 56.49  ?  503  TYR A OH  1 
ATOM   3890  N  N   . THR A  1 504 ? -12.254 -21.678 72.316  1.00 64.30  ?  504  THR A N   1 
ATOM   3891  C  CA  . THR A  1 504 ? -12.222 -21.542 70.870  1.00 67.11  ?  504  THR A CA  1 
ATOM   3892  C  C   . THR A  1 504 ? -11.588 -20.209 70.509  1.00 69.58  ?  504  THR A C   1 
ATOM   3893  O  O   . THR A  1 504 ? -11.482 -19.303 71.340  1.00 71.20  ?  504  THR A O   1 
ATOM   3894  C  CB  . THR A  1 504 ? -13.624 -21.632 70.263  1.00 69.81  ?  504  THR A CB  1 
ATOM   3895  O  OG1 . THR A  1 504 ? -14.492 -20.711 70.935  1.00 71.62  ?  504  THR A OG1 1 
ATOM   3896  C  CG2 . THR A  1 504 ? -14.177 -23.042 70.410  1.00 69.80  ?  504  THR A CG2 1 
ATOM   3897  N  N   . THR A  1 505 ? -11.160 -20.097 69.252  1.00 69.85  ?  505  THR A N   1 
ATOM   3898  C  CA  . THR A  1 505 ? -10.594 -18.835 68.791  1.00 69.81  ?  505  THR A CA  1 
ATOM   3899  C  C   . THR A  1 505 ? -11.649 -17.736 68.776  1.00 71.70  ?  505  THR A C   1 
ATOM   3900  O  O   . THR A  1 505 ? -11.382 -16.606 69.202  1.00 72.41  ?  505  THR A O   1 
ATOM   3901  C  CB  . THR A  1 505 ? -9.972  -19.015 67.409  1.00 70.36  ?  505  THR A CB  1 
ATOM   3902  O  OG1 . THR A  1 505 ? -8.881  -19.938 67.501  1.00 68.39  ?  505  THR A OG1 1 
ATOM   3903  C  CG2 . THR A  1 505 ? -9.469  -17.685 66.867  1.00 71.40  ?  505  THR A CG2 1 
ATOM   3904  N  N   . ALA A  1 506 ? -12.859 -18.055 68.312  1.00 72.61  ?  506  ALA A N   1 
ATOM   3905  C  CA  . ALA A  1 506 ? -13.923 -17.058 68.250  1.00 74.53  ?  506  ALA A CA  1 
ATOM   3906  C  C   . ALA A  1 506 ? -14.353 -16.611 69.645  1.00 77.09  ?  506  ALA A C   1 
ATOM   3907  O  O   . ALA A  1 506 ? -14.321 -15.416 69.968  1.00 81.00  ?  506  ALA A O   1 
ATOM   3908  C  CB  . ALA A  1 506 ? -15.116 -17.621 67.472  1.00 73.79  ?  506  ALA A CB  1 
ATOM   3909  N  N   . ALA A  1 507 ? -14.773 -17.560 70.487  1.00 73.81  ?  507  ALA A N   1 
ATOM   3910  C  CA  . ALA A  1 507 ? -15.381 -17.213 71.767  1.00 70.79  ?  507  ALA A CA  1 
ATOM   3911  C  C   . ALA A  1 507 ? -14.344 -16.932 72.851  1.00 67.11  ?  507  ALA A C   1 
ATOM   3912  O  O   . ALA A  1 507 ? -14.544 -16.039 73.681  1.00 66.49  ?  507  ALA A O   1 
ATOM   3913  C  CB  . ALA A  1 507 ? -16.331 -18.324 72.208  1.00 70.97  ?  507  ALA A CB  1 
ATOM   3914  N  N   . GLN A  1 508 ? -13.250 -17.696 72.873  1.00 64.84  ?  508  GLN A N   1 
ATOM   3915  C  CA  . GLN A  1 508 ? -12.223 -17.594 73.916  1.00 65.28  ?  508  GLN A CA  1 
ATOM   3916  C  C   . GLN A  1 508 ? -12.806 -17.831 75.309  1.00 68.61  ?  508  GLN A C   1 
ATOM   3917  O  O   . GLN A  1 508 ? -12.589 -17.047 76.234  1.00 70.40  ?  508  GLN A O   1 
ATOM   3918  C  CB  . GLN A  1 508 ? -11.507 -16.243 73.870  1.00 66.71  ?  508  GLN A CB  1 
ATOM   3919  C  CG  . GLN A  1 508 ? -10.857 -15.887 72.559  1.00 68.58  ?  508  GLN A CG  1 
ATOM   3920  C  CD  . GLN A  1 508 ? -9.944  -14.688 72.705  1.00 69.02  ?  508  GLN A CD  1 
ATOM   3921  O  OE1 . GLN A  1 508 ? -9.017  -14.698 73.517  1.00 68.47  ?  508  GLN A OE1 1 
ATOM   3922  N  NE2 . GLN A  1 508 ? -10.209 -13.643 71.932  1.00 70.11  ?  508  GLN A NE2 1 
ATOM   3923  N  N   . GLN A  1 509 ? -13.540 -18.930 75.466  1.00 69.56  ?  509  GLN A N   1 
ATOM   3924  C  CA  . GLN A  1 509 ? -14.231 -19.203 76.721  1.00 69.18  ?  509  GLN A CA  1 
ATOM   3925  C  C   . GLN A  1 509 ? -13.375 -20.059 77.648  1.00 65.55  ?  509  GLN A C   1 
ATOM   3926  O  O   . GLN A  1 509 ? -12.825 -21.084 77.233  1.00 65.01  ?  509  GLN A O   1 
ATOM   3927  C  CB  . GLN A  1 509 ? -15.572 -19.889 76.463  1.00 63.89  ?  509  GLN A CB  1 
ATOM   3928  C  CG  . GLN A  1 509 ? -16.608 -18.983 75.839  1.00 66.50  ?  509  GLN A CG  1 
ATOM   3929  C  CD  . GLN A  1 509 ? -17.933 -19.678 75.635  1.00 68.42  ?  509  GLN A CD  1 
ATOM   3930  O  OE1 . GLN A  1 509 ? -18.015 -20.682 74.929  1.00 68.26  ?  509  GLN A OE1 1 
ATOM   3931  N  NE2 . GLN A  1 509 ? -18.983 -19.146 76.253  1.00 70.41  ?  509  GLN A NE2 1 
ATOM   3932  N  N   . TYR A  1 510 ? -13.272 -19.628 78.905  1.00 63.85  ?  510  TYR A N   1 
ATOM   3933  C  CA  . TYR A  1 510 ? -12.609 -20.373 79.967  1.00 61.66  ?  510  TYR A CA  1 
ATOM   3934  C  C   . TYR A  1 510 ? -13.500 -20.313 81.201  1.00 63.56  ?  510  TYR A C   1 
ATOM   3935  O  O   . TYR A  1 510 ? -14.500 -19.593 81.227  1.00 65.87  ?  510  TYR A O   1 
ATOM   3936  C  CB  . TYR A  1 510 ? -11.199 -19.831 80.257  1.00 56.36  ?  510  TYR A CB  1 
ATOM   3937  C  CG  . TYR A  1 510 ? -11.145 -18.379 80.683  1.00 64.51  ?  510  TYR A CG  1 
ATOM   3938  C  CD1 . TYR A  1 510 ? -11.438 -17.361 79.788  1.00 66.00  ?  510  TYR A CD1 1 
ATOM   3939  C  CD2 . TYR A  1 510 ? -10.763 -18.026 81.969  1.00 64.69  ?  510  TYR A CD2 1 
ATOM   3940  C  CE1 . TYR A  1 510 ? -11.383 -16.036 80.168  1.00 66.31  ?  510  TYR A CE1 1 
ATOM   3941  C  CE2 . TYR A  1 510 ? -10.701 -16.700 82.359  1.00 64.89  ?  510  TYR A CE2 1 
ATOM   3942  C  CZ  . TYR A  1 510 ? -11.011 -15.710 81.451  1.00 65.43  ?  510  TYR A CZ  1 
ATOM   3943  O  OH  . TYR A  1 510 ? -10.953 -14.385 81.818  1.00 66.38  ?  510  TYR A OH  1 
ATOM   3944  N  N   . VAL A  1 511 ? -13.165 -21.106 82.218  1.00 63.90  ?  511  VAL A N   1 
ATOM   3945  C  CA  . VAL A  1 511 ? -13.952 -21.131 83.445  1.00 64.74  ?  511  VAL A CA  1 
ATOM   3946  C  C   . VAL A  1 511 ? -13.050 -20.804 84.624  1.00 64.02  ?  511  VAL A C   1 
ATOM   3947  O  O   . VAL A  1 511 ? -11.821 -20.896 84.551  1.00 56.20  ?  511  VAL A O   1 
ATOM   3948  C  CB  . VAL A  1 511 ? -14.653 -22.484 83.678  1.00 59.25  ?  511  VAL A CB  1 
ATOM   3949  C  CG1 . VAL A  1 511 ? -15.531 -22.844 82.497  1.00 60.46  ?  511  VAL A CG1 1 
ATOM   3950  C  CG2 . VAL A  1 511 ? -13.624 -23.565 83.944  1.00 57.11  ?  511  VAL A CG2 1 
ATOM   3951  N  N   . SER A  1 512 ? -13.686 -20.425 85.728  1.00 64.86  ?  512  SER A N   1 
ATOM   3952  C  CA  . SER A  1 512 ? -12.991 -20.134 86.975  1.00 63.31  ?  512  SER A CA  1 
ATOM   3953  C  C   . SER A  1 512 ? -13.205 -21.279 87.957  1.00 60.93  ?  512  SER A C   1 
ATOM   3954  O  O   . SER A  1 512 ? -14.346 -21.675 88.221  1.00 62.53  ?  512  SER A O   1 
ATOM   3955  C  CB  . SER A  1 512 ? -13.487 -18.825 87.584  1.00 60.46  ?  512  SER A CB  1 
ATOM   3956  O  OG  . SER A  1 512 ? -14.842 -18.946 87.977  1.00 62.51  ?  512  SER A OG  1 
ATOM   3957  N  N   . LEU A  1 513 ? -12.112 -21.801 88.498  1.00 57.16  ?  513  LEU A N   1 
ATOM   3958  C  CA  . LEU A  1 513 ? -12.169 -22.873 89.483  1.00 56.46  ?  513  LEU A CA  1 
ATOM   3959  C  C   . LEU A  1 513 ? -11.978 -22.257 90.865  1.00 57.12  ?  513  LEU A C   1 
ATOM   3960  O  O   . LEU A  1 513 ? -10.880 -21.813 91.212  1.00 56.13  ?  513  LEU A O   1 
ATOM   3961  C  CB  . LEU A  1 513 ? -11.115 -23.939 89.190  1.00 55.34  ?  513  LEU A CB  1 
ATOM   3962  C  CG  . LEU A  1 513 ? -11.240 -24.632 87.831  1.00 53.78  ?  513  LEU A CG  1 
ATOM   3963  C  CD1 . LEU A  1 513 ? -10.151 -25.675 87.654  1.00 51.90  ?  513  LEU A CD1 1 
ATOM   3964  C  CD2 . LEU A  1 513 ? -12.613 -25.259 87.679  1.00 55.25  ?  513  LEU A CD2 1 
ATOM   3965  N  N   . ASN A  1 514 ? -13.050 -22.235 91.648  1.00 59.30  ?  514  ASN A N   1 
ATOM   3966  C  CA  . ASN A  1 514 ? -13.038 -21.644 92.980  1.00 64.41  ?  514  ASN A CA  1 
ATOM   3967  C  C   . ASN A  1 514 ? -14.179 -22.268 93.770  1.00 68.99  ?  514  ASN A C   1 
ATOM   3968  O  O   . ASN A  1 514 ? -14.854 -23.185 93.294  1.00 72.21  ?  514  ASN A O   1 
ATOM   3969  C  CB  . ASN A  1 514 ? -13.155 -20.117 92.916  1.00 67.05  ?  514  ASN A CB  1 
ATOM   3970  C  CG  . ASN A  1 514 ? -14.356 -19.652 92.111  1.00 70.00  ?  514  ASN A CG  1 
ATOM   3971  O  OD1 . ASN A  1 514 ? -15.048 -20.452 91.477  1.00 71.41  ?  514  ASN A OD1 1 
ATOM   3972  N  ND2 . ASN A  1 514 ? -14.579 -18.347 92.089  1.00 71.43  ?  514  ASN A ND2 1 
ATOM   3973  N  N   . LEU A  1 515 ? -14.402 -21.755 94.981  1.00 68.67  ?  515  LEU A N   1 
ATOM   3974  C  CA  . LEU A  1 515 ? -15.420 -22.351 95.840  1.00 68.06  ?  515  LEU A CA  1 
ATOM   3975  C  C   . LEU A  1 515 ? -16.822 -22.088 95.306  1.00 69.60  ?  515  LEU A C   1 
ATOM   3976  O  O   . LEU A  1 515 ? -17.745 -22.869 95.568  1.00 68.25  ?  515  LEU A O   1 
ATOM   3977  C  CB  . LEU A  1 515 ? -15.274 -21.825 97.266  1.00 68.64  ?  515  LEU A CB  1 
ATOM   3978  C  CG  . LEU A  1 515 ? -14.115 -22.456 98.035  1.00 64.68  ?  515  LEU A CG  1 
ATOM   3979  C  CD1 . LEU A  1 515 ? -13.877 -21.733 99.340  1.00 66.01  ?  515  LEU A CD1 1 
ATOM   3980  C  CD2 . LEU A  1 515 ? -14.390 -23.916 98.275  1.00 64.90  ?  515  LEU A CD2 1 
ATOM   3981  N  N   . LYS A  1 516 ? -16.998 -21.009 94.553  1.00 72.22  ?  516  LYS A N   1 
ATOM   3982  C  CA  . LYS A  1 516 ? -18.261 -20.754 93.894  1.00 75.06  ?  516  LYS A CA  1 
ATOM   3983  C  C   . LYS A  1 516 ? -18.439 -21.737 92.738  1.00 75.01  ?  516  LYS A C   1 
ATOM   3984  O  O   . LYS A  1 516 ? -17.466 -22.323 92.255  1.00 74.52  ?  516  LYS A O   1 
ATOM   3985  C  CB  . LYS A  1 516 ? -18.311 -19.313 93.385  1.00 76.47  ?  516  LYS A CB  1 
ATOM   3986  C  CG  . LYS A  1 516 ? -18.824 -18.299 94.397  1.00 81.44  ?  516  LYS A CG  1 
ATOM   3987  C  CD  . LYS A  1 516 ? -17.848 -18.124 95.550  1.00 85.14  ?  516  LYS A CD  1 
ATOM   3988  C  CE  . LYS A  1 516 ? -18.508 -17.445 96.735  1.00 91.35  ?  516  LYS A CE  1 
ATOM   3989  N  NZ  . LYS A  1 516 ? -17.789 -17.757 98.001  1.00 92.51  ?  516  LYS A NZ  1 
ATOM   3990  N  N   . PRO A  1 517 ? -19.675 -21.945 92.284  1.00 75.92  ?  517  PRO A N   1 
ATOM   3991  C  CA  . PRO A  1 517 ? -19.890 -22.789 91.103  1.00 75.69  ?  517  PRO A CA  1 
ATOM   3992  C  C   . PRO A  1 517 ? -19.204 -22.220 89.867  1.00 75.68  ?  517  PRO A C   1 
ATOM   3993  O  O   . PRO A  1 517 ? -18.805 -21.052 89.824  1.00 76.00  ?  517  PRO A O   1 
ATOM   3994  C  CB  . PRO A  1 517 ? -21.417 -22.802 90.945  1.00 77.41  ?  517  PRO A CB  1 
ATOM   3995  C  CG  . PRO A  1 517 ? -21.903 -21.639 91.746  1.00 79.12  ?  517  PRO A CG  1 
ATOM   3996  C  CD  . PRO A  1 517 ? -20.947 -21.520 92.888  1.00 78.19  ?  517  PRO A CD  1 
ATOM   3997  N  N   . LEU A  1 518 ? -19.055 -23.082 88.857  1.00 74.26  ?  518  LEU A N   1 
ATOM   3998  C  CA  . LEU A  1 518 ? -18.334 -22.726 87.638  1.00 71.15  ?  518  LEU A CA  1 
ATOM   3999  C  C   . LEU A  1 518 ? -18.852 -21.425 87.048  1.00 72.86  ?  518  LEU A C   1 
ATOM   4000  O  O   . LEU A  1 518 ? -20.061 -21.245 86.873  1.00 76.39  ?  518  LEU A O   1 
ATOM   4001  C  CB  . LEU A  1 518 ? -18.466 -23.837 86.596  1.00 68.83  ?  518  LEU A CB  1 
ATOM   4002  C  CG  . LEU A  1 518 ? -17.423 -24.948 86.547  1.00 67.09  ?  518  LEU A CG  1 
ATOM   4003  C  CD1 . LEU A  1 518 ? -17.484 -25.628 85.190  1.00 68.37  ?  518  LEU A CD1 1 
ATOM   4004  C  CD2 . LEU A  1 518 ? -16.037 -24.399 86.813  1.00 64.19  ?  518  LEU A CD2 1 
ATOM   4005  N  N   . GLU A  1 519 ? -17.926 -20.521 86.742  1.00 70.87  ?  519  GLU A N   1 
ATOM   4006  C  CA  . GLU A  1 519 ? -18.230 -19.266 86.067  1.00 71.50  ?  519  GLU A CA  1 
ATOM   4007  C  C   . GLU A  1 519 ? -17.455 -19.212 84.757  1.00 69.28  ?  519  GLU A C   1 
ATOM   4008  O  O   . GLU A  1 519 ? -16.246 -19.475 84.733  1.00 65.79  ?  519  GLU A O   1 
ATOM   4009  C  CB  . GLU A  1 519 ? -17.881 -18.064 86.949  1.00 73.09  ?  519  GLU A CB  1 
ATOM   4010  C  CG  . GLU A  1 519 ? -18.127 -16.720 86.287  1.00 76.52  ?  519  GLU A CG  1 
ATOM   4011  C  CD  . GLU A  1 519 ? -17.740 -15.553 87.173  1.00 78.95  ?  519  GLU A CD  1 
ATOM   4012  O  OE1 . GLU A  1 519 ? -16.528 -15.269 87.287  1.00 77.82  ?  519  GLU A OE1 1 
ATOM   4013  O  OE2 . GLU A  1 519 ? -18.649 -14.923 87.758  1.00 81.99  ?  519  GLU A OE2 1 
ATOM   4014  N  N   . VAL A  1 520 ? -18.152 -18.885 83.672  1.00 71.11  ?  520  VAL A N   1 
ATOM   4015  C  CA  . VAL A  1 520 ? -17.555 -18.832 82.344  1.00 70.17  ?  520  VAL A CA  1 
ATOM   4016  C  C   . VAL A  1 520 ? -17.201 -17.385 82.029  1.00 73.72  ?  520  VAL A C   1 
ATOM   4017  O  O   . VAL A  1 520 ? -18.055 -16.492 82.095  1.00 76.65  ?  520  VAL A O   1 
ATOM   4018  C  CB  . VAL A  1 520 ? -18.492 -19.420 81.278  1.00 69.03  ?  520  VAL A CB  1 
ATOM   4019  C  CG1 . VAL A  1 520 ? -17.976 -19.088 79.888  1.00 67.41  ?  520  VAL A CG1 1 
ATOM   4020  C  CG2 . VAL A  1 520 ? -18.594 -20.917 81.451  1.00 66.97  ?  520  VAL A CG2 1 
ATOM   4021  N  N   . ARG A  1 521 ? -15.938 -17.159 81.692  1.00 72.65  ?  521  ARG A N   1 
ATOM   4022  C  CA  . ARG A  1 521 ? -15.426 -15.866 81.281  1.00 72.28  ?  521  ARG A CA  1 
ATOM   4023  C  C   . ARG A  1 521 ? -14.861 -15.987 79.874  1.00 70.30  ?  521  ARG A C   1 
ATOM   4024  O  O   . ARG A  1 521 ? -14.528 -17.079 79.408  1.00 66.54  ?  521  ARG A O   1 
ATOM   4025  C  CB  . ARG A  1 521 ? -14.344 -15.374 82.250  1.00 71.06  ?  521  ARG A CB  1 
ATOM   4026  C  CG  . ARG A  1 521 ? -14.769 -15.400 83.713  1.00 70.61  ?  521  ARG A CG  1 
ATOM   4027  C  CD  . ARG A  1 521 ? -13.591 -15.152 84.641  1.00 67.78  ?  521  ARG A CD  1 
ATOM   4028  N  NE  . ARG A  1 521 ? -13.981 -15.260 86.043  1.00 67.64  ?  521  ARG A NE  1 
ATOM   4029  C  CZ  . ARG A  1 521 ? -13.124 -15.411 87.047  1.00 66.30  ?  521  ARG A CZ  1 
ATOM   4030  N  NH1 . ARG A  1 521 ? -11.822 -15.490 86.802  1.00 64.97  ?  521  ARG A NH1 1 
ATOM   4031  N  NH2 . ARG A  1 521 ? -13.568 -15.497 88.295  1.00 66.50  ?  521  ARG A NH2 1 
ATOM   4032  N  N   . ARG A  1 522 ? -14.764 -14.852 79.198  1.00 73.42  ?  522  ARG A N   1 
ATOM   4033  C  CA  . ARG A  1 522 ? -14.191 -14.789 77.865  1.00 75.32  ?  522  ARG A CA  1 
ATOM   4034  C  C   . ARG A  1 522 ? -12.928 -13.940 77.906  1.00 76.66  ?  522  ARG A C   1 
ATOM   4035  O  O   . ARG A  1 522 ? -12.786 -13.057 78.759  1.00 79.46  ?  522  ARG A O   1 
ATOM   4036  C  CB  . ARG A  1 522 ? -15.203 -14.218 76.867  1.00 77.98  ?  522  ARG A CB  1 
ATOM   4037  C  CG  . ARG A  1 522 ? -16.472 -15.056 76.740  1.00 81.72  ?  522  ARG A CG  1 
ATOM   4038  C  CD  . ARG A  1 522 ? -17.613 -14.255 76.131  1.00 89.42  ?  522  ARG A CD  1 
ATOM   4039  N  NE  . ARG A  1 522 ? -17.175 -13.457 74.987  1.00 96.37  ?  522  ARG A NE  1 
ATOM   4040  C  CZ  . ARG A  1 522 ? -17.257 -13.850 73.717  1.00 102.47 ?  522  ARG A CZ  1 
ATOM   4041  N  NH1 . ARG A  1 522 ? -17.765 -15.042 73.417  1.00 104.85 ?  522  ARG A NH1 1 
ATOM   4042  N  NH2 . ARG A  1 522 ? -16.832 -13.051 72.743  1.00 104.11 ?  522  ARG A NH2 1 
ATOM   4043  N  N   . GLY A  1 523 ? -12.016 -14.194 76.969  1.00 75.09  ?  523  GLY A N   1 
ATOM   4044  C  CA  . GLY A  1 523 ? -10.817 -13.382 76.912  1.00 75.68  ?  523  GLY A CA  1 
ATOM   4045  C  C   . GLY A  1 523 ? -9.762  -13.580 77.987  1.00 74.65  ?  523  GLY A C   1 
ATOM   4046  O  O   . GLY A  1 523 ? -9.602  -12.704 78.845  1.00 77.22  ?  523  GLY A O   1 
ATOM   4047  N  N   . LEU A  1 524 ? -9.085  -14.730 78.015  1.00 70.76  ?  524  LEU A N   1 
ATOM   4048  C  CA  . LEU A  1 524 ? -8.083  -14.959 79.054  1.00 68.32  ?  524  LEU A CA  1 
ATOM   4049  C  C   . LEU A  1 524 ? -6.976  -13.932 78.861  1.00 64.85  ?  524  LEU A C   1 
ATOM   4050  O  O   . LEU A  1 524 ? -6.136  -14.070 77.969  1.00 60.86  ?  524  LEU A O   1 
ATOM   4051  C  CB  . LEU A  1 524 ? -7.536  -16.379 78.915  1.00 69.00  ?  524  LEU A CB  1 
ATOM   4052  C  CG  . LEU A  1 524 ? -6.896  -17.223 80.021  1.00 68.53  ?  524  LEU A CG  1 
ATOM   4053  C  CD1 . LEU A  1 524 ? -6.411  -18.548 79.431  1.00 66.02  ?  524  LEU A CD1 1 
ATOM   4054  C  CD2 . LEU A  1 524 ? -5.746  -16.502 80.712  1.00 68.86  ?  524  LEU A CD2 1 
ATOM   4055  N  N   . ARG A  1 525 ? -6.934  -12.945 79.765  1.00 67.08  ?  525  ARG A N   1 
ATOM   4056  C  CA  . ARG A  1 525 ? -6.052  -11.777 79.698  1.00 69.86  ?  525  ARG A CA  1 
ATOM   4057  C  C   . ARG A  1 525 ? -5.803  -11.346 78.255  1.00 72.57  ?  525  ARG A C   1 
ATOM   4058  O  O   . ARG A  1 525 ? -4.660  -11.376 77.787  1.00 75.25  ?  525  ARG A O   1 
ATOM   4059  C  CB  . ARG A  1 525 ? -4.741  -12.034 80.449  1.00 68.09  ?  525  ARG A CB  1 
ATOM   4060  C  CG  . ARG A  1 525 ? -4.837  -11.621 81.924  1.00 69.71  ?  525  ARG A CG  1 
ATOM   4061  C  CD  . ARG A  1 525 ? -3.581  -11.932 82.726  1.00 71.39  ?  525  ARG A CD  1 
ATOM   4062  N  NE  . ARG A  1 525 ? -3.660  -11.438 84.105  1.00 76.11  ?  525  ARG A NE  1 
ATOM   4063  C  CZ  . ARG A  1 525 ? -3.883  -12.201 85.178  1.00 79.07  ?  525  ARG A CZ  1 
ATOM   4064  N  NH1 . ARG A  1 525 ? -4.051  -13.511 85.051  1.00 78.89  ?  525  ARG A NH1 1 
ATOM   4065  N  NH2 . ARG A  1 525 ? -3.932  -11.652 86.388  1.00 80.52  ?  525  ARG A NH2 1 
ATOM   4066  N  N   . ALA A  1 526 ? -6.857  -10.919 77.550  1.00 70.75  ?  526  ALA A N   1 
ATOM   4067  C  CA  . ALA A  1 526 ? -6.787  -10.839 76.092  1.00 68.44  ?  526  ALA A CA  1 
ATOM   4068  C  C   . ALA A  1 526 ? -5.857  -9.724  75.632  1.00 67.82  ?  526  ALA A C   1 
ATOM   4069  O  O   . ALA A  1 526 ? -4.949  -9.953  74.823  1.00 65.62  ?  526  ALA A O   1 
ATOM   4070  C  CB  . ALA A  1 526 ? -8.186  -10.647 75.506  1.00 69.25  ?  526  ALA A CB  1 
ATOM   4071  N  N   . GLN A  1 527 ? -6.070  -8.506  76.135  1.00 69.47  ?  527  GLN A N   1 
ATOM   4072  C  CA  . GLN A  1 527 ? -5.290  -7.363  75.672  1.00 68.56  ?  527  GLN A CA  1 
ATOM   4073  C  C   . GLN A  1 527 ? -3.832  -7.478  76.101  1.00 64.86  ?  527  GLN A C   1 
ATOM   4074  O  O   . GLN A  1 527 ? -2.918  -7.222  75.304  1.00 64.85  ?  527  GLN A O   1 
ATOM   4075  C  CB  . GLN A  1 527 ? -5.906  -6.074  76.212  1.00 71.09  ?  527  GLN A CB  1 
ATOM   4076  C  CG  . GLN A  1 527 ? -7.412  -5.982  76.019  1.00 75.06  ?  527  GLN A CG  1 
ATOM   4077  C  CD  . GLN A  1 527 ? -7.810  -5.872  74.560  1.00 79.65  ?  527  GLN A CD  1 
ATOM   4078  O  OE1 . GLN A  1 527 ? -8.723  -6.561  74.102  1.00 80.26  ?  527  GLN A OE1 1 
ATOM   4079  N  NE2 . GLN A  1 527 ? -7.125  -4.997  73.819  1.00 81.65  ?  527  GLN A NE2 1 
ATOM   4080  N  N   . THR A  1 528 ? -3.600  -7.887  77.350  1.00 62.35  ?  528  THR A N   1 
ATOM   4081  C  CA  . THR A  1 528 ? -2.243  -7.947  77.879  1.00 61.92  ?  528  THR A CA  1 
ATOM   4082  C  C   . THR A  1 528 ? -1.429  -9.047  77.207  1.00 61.70  ?  528  THR A C   1 
ATOM   4083  O  O   . THR A  1 528 ? -0.244  -8.856  76.893  1.00 56.14  ?  528  THR A O   1 
ATOM   4084  C  CB  . THR A  1 528 ? -2.299  -8.151  79.393  1.00 61.72  ?  528  THR A CB  1 
ATOM   4085  O  OG1 . THR A  1 528 ? -2.842  -6.974  80.007  1.00 59.32  ?  528  THR A OG1 1 
ATOM   4086  C  CG2 . THR A  1 528 ? -0.916  -8.439  79.961  1.00 60.44  ?  528  THR A CG2 1 
ATOM   4087  N  N   . CYS A  1 529 ? -2.043  -10.207 76.974  1.00 61.01  ?  529  CYS A N   1 
ATOM   4088  C  CA  . CYS A  1 529 ? -1.339  -11.271 76.274  1.00 59.36  ?  529  CYS A CA  1 
ATOM   4089  C  C   . CYS A  1 529 ? -1.235  -11.012 74.779  1.00 60.84  ?  529  CYS A C   1 
ATOM   4090  O  O   . CYS A  1 529 ? -0.355  -11.581 74.130  1.00 60.21  ?  529  CYS A O   1 
ATOM   4091  C  CB  . CYS A  1 529 ? -2.013  -12.615 76.540  1.00 57.91  ?  529  CYS A CB  1 
ATOM   4092  S  SG  . CYS A  1 529 ? -1.653  -13.256 78.188  1.00 56.33  ?  529  CYS A SG  1 
ATOM   4093  N  N   . ALA A  1 530 ? -2.107  -10.171 74.219  1.00 63.61  ?  530  ALA A N   1 
ATOM   4094  C  CA  . ALA A  1 530 ? -1.856  -9.672  72.872  1.00 64.25  ?  530  ALA A CA  1 
ATOM   4095  C  C   . ALA A  1 530 ? -0.633  -8.769  72.855  1.00 58.29  ?  530  ALA A C   1 
ATOM   4096  O  O   . ALA A  1 530 ? 0.109   -8.737  71.869  1.00 58.46  ?  530  ALA A O   1 
ATOM   4097  C  CB  . ALA A  1 530 ? -3.079  -8.928  72.338  1.00 60.20  ?  530  ALA A CB  1 
ATOM   4098  N  N   . PHE A  1 531 ? -0.407  -8.025  73.940  1.00 58.35  ?  531  PHE A N   1 
ATOM   4099  C  CA  . PHE A  1 531 ? 0.818   -7.239  74.047  1.00 61.13  ?  531  PHE A CA  1 
ATOM   4100  C  C   . PHE A  1 531 ? 2.042   -8.147  74.124  1.00 61.07  ?  531  PHE A C   1 
ATOM   4101  O  O   . PHE A  1 531 ? 3.045   -7.914  73.440  1.00 56.97  ?  531  PHE A O   1 
ATOM   4102  C  CB  . PHE A  1 531 ? 0.741   -6.316  75.267  1.00 60.62  ?  531  PHE A CB  1 
ATOM   4103  C  CG  . PHE A  1 531 ? 2.066   -5.746  75.696  1.00 58.76  ?  531  PHE A CG  1 
ATOM   4104  C  CD1 . PHE A  1 531 ? 2.581   -4.615  75.085  1.00 60.10  ?  531  PHE A CD1 1 
ATOM   4105  C  CD2 . PHE A  1 531 ? 2.787   -6.333  76.723  1.00 57.41  ?  531  PHE A CD2 1 
ATOM   4106  C  CE1 . PHE A  1 531 ? 3.791   -4.087  75.484  1.00 60.10  ?  531  PHE A CE1 1 
ATOM   4107  C  CE2 . PHE A  1 531 ? 4.001   -5.812  77.123  1.00 57.44  ?  531  PHE A CE2 1 
ATOM   4108  C  CZ  . PHE A  1 531 ? 4.502   -4.686  76.505  1.00 61.86  ?  531  PHE A CZ  1 
ATOM   4109  N  N   . TRP A  1 532 ? 1.975   -9.197  74.949  1.00 60.98  ?  532  TRP A N   1 
ATOM   4110  C  CA  . TRP A  1 532 ? 3.150   -10.047 75.146  1.00 59.27  ?  532  TRP A CA  1 
ATOM   4111  C  C   . TRP A  1 532 ? 3.440   -10.905 73.918  1.00 57.37  ?  532  TRP A C   1 
ATOM   4112  O  O   . TRP A  1 532 ? 4.594   -11.023 73.491  1.00 55.41  ?  532  TRP A O   1 
ATOM   4113  C  CB  . TRP A  1 532 ? 2.962   -10.935 76.379  1.00 57.06  ?  532  TRP A CB  1 
ATOM   4114  C  CG  . TRP A  1 532 ? 3.198   -10.241 77.683  1.00 54.85  ?  532  TRP A CG  1 
ATOM   4115  C  CD1 . TRP A  1 532 ? 2.251   -9.776  78.546  1.00 56.33  ?  532  TRP A CD1 1 
ATOM   4116  C  CD2 . TRP A  1 532 ? 4.466   -9.948  78.283  1.00 54.54  ?  532  TRP A CD2 1 
ATOM   4117  N  NE1 . TRP A  1 532 ? 2.849   -9.204  79.642  1.00 57.62  ?  532  TRP A NE1 1 
ATOM   4118  C  CE2 . TRP A  1 532 ? 4.209   -9.296  79.504  1.00 58.01  ?  532  TRP A CE2 1 
ATOM   4119  C  CE3 . TRP A  1 532 ? 5.792   -10.165 77.901  1.00 55.39  ?  532  TRP A CE3 1 
ATOM   4120  C  CZ2 . TRP A  1 532 ? 5.231   -8.860  80.348  1.00 57.35  ?  532  TRP A CZ2 1 
ATOM   4121  C  CZ3 . TRP A  1 532 ? 6.807   -9.732  78.742  1.00 55.93  ?  532  TRP A CZ3 1 
ATOM   4122  C  CH2 . TRP A  1 532 ? 6.520   -9.088  79.949  1.00 56.41  ?  532  TRP A CH2 1 
ATOM   4123  N  N   . ASN A  1 533 ? 2.406   -11.539 73.360  1.00 57.09  ?  533  ASN A N   1 
ATOM   4124  C  CA  . ASN A  1 533 ? 2.601   -12.549 72.324  1.00 57.07  ?  533  ASN A CA  1 
ATOM   4125  C  C   . ASN A  1 533 ? 2.759   -11.947 70.929  1.00 59.15  ?  533  ASN A C   1 
ATOM   4126  O  O   . ASN A  1 533 ? 3.511   -12.482 70.109  1.00 59.17  ?  533  ASN A O   1 
ATOM   4127  C  CB  . ASN A  1 533 ? 1.435   -13.539 72.341  1.00 57.39  ?  533  ASN A CB  1 
ATOM   4128  C  CG  . ASN A  1 533 ? 1.347   -14.316 73.643  1.00 57.19  ?  533  ASN A CG  1 
ATOM   4129  O  OD1 . ASN A  1 533 ? 2.349   -14.529 74.328  1.00 57.32  ?  533  ASN A OD1 1 
ATOM   4130  N  ND2 . ASN A  1 533 ? 0.143   -14.753 73.985  1.00 57.25  ?  533  ASN A ND2 1 
ATOM   4131  N  N   . ARG A  1 534 ? 2.053   -10.854 70.635  1.00 63.44  ?  534  ARG A N   1 
ATOM   4132  C  CA  . ARG A  1 534 ? 1.967   -10.300 69.283  1.00 68.44  ?  534  ARG A CA  1 
ATOM   4133  C  C   . ARG A  1 534 ? 2.912   -9.117  69.076  1.00 67.71  ?  534  ARG A C   1 
ATOM   4134  O  O   . ARG A  1 534 ? 3.765   -9.144  68.182  1.00 68.41  ?  534  ARG A O   1 
ATOM   4135  C  CB  . ARG A  1 534 ? 0.518   -9.895  68.971  1.00 74.69  ?  534  ARG A CB  1 
ATOM   4136  C  CG  . ARG A  1 534 ? -0.437  -11.077 68.875  1.00 78.81  ?  534  ARG A CG  1 
ATOM   4137  C  CD  . ARG A  1 534 ? -1.895  -10.637 68.804  1.00 83.15  ?  534  ARG A CD  1 
ATOM   4138  N  NE  . ARG A  1 534 ? -2.790  -11.774 68.587  1.00 83.85  ?  534  ARG A NE  1 
ATOM   4139  C  CZ  . ARG A  1 534 ? -3.185  -12.204 67.393  1.00 84.57  ?  534  ARG A CZ  1 
ATOM   4140  N  NH1 . ARG A  1 534 ? -2.770  -11.590 66.289  1.00 85.87  ?  534  ARG A NH1 1 
ATOM   4141  N  NH2 . ARG A  1 534 ? -3.996  -13.253 67.306  1.00 83.00  ?  534  ARG A NH2 1 
ATOM   4142  N  N   . PHE A  1 535 ? 2.745   -8.055  69.868  1.00 65.82  ?  535  PHE A N   1 
ATOM   4143  C  CA  . PHE A  1 535 ? 3.527   -6.832  69.702  1.00 65.35  ?  535  PHE A CA  1 
ATOM   4144  C  C   . PHE A  1 535 ? 4.958   -6.984  70.217  1.00 64.71  ?  535  PHE A C   1 
ATOM   4145  O  O   . PHE A  1 535 ? 5.917   -6.821  69.456  1.00 66.58  ?  535  PHE A O   1 
ATOM   4146  C  CB  . PHE A  1 535 ? 2.829   -5.669  70.412  1.00 65.02  ?  535  PHE A CB  1 
ATOM   4147  C  CG  . PHE A  1 535 ? 3.568   -4.371  70.321  1.00 63.89  ?  535  PHE A CG  1 
ATOM   4148  C  CD1 . PHE A  1 535 ? 3.630   -3.682  69.126  1.00 64.44  ?  535  PHE A CD1 1 
ATOM   4149  C  CD2 . PHE A  1 535 ? 4.190   -3.835  71.435  1.00 63.24  ?  535  PHE A CD2 1 
ATOM   4150  C  CE1 . PHE A  1 535 ? 4.313   -2.482  69.039  1.00 66.71  ?  535  PHE A CE1 1 
ATOM   4151  C  CE2 . PHE A  1 535 ? 4.869   -2.637  71.359  1.00 63.62  ?  535  PHE A CE2 1 
ATOM   4152  C  CZ  . PHE A  1 535 ? 4.929   -1.957  70.162  1.00 65.96  ?  535  PHE A CZ  1 
ATOM   4153  N  N   . LEU A  1 536 ? 5.113   -7.265  71.514  1.00 62.88  ?  536  LEU A N   1 
ATOM   4154  C  CA  . LEU A  1 536 ? 6.419   -7.211  72.173  1.00 62.57  ?  536  LEU A CA  1 
ATOM   4155  C  C   . LEU A  1 536 ? 7.538   -7.935  71.423  1.00 60.97  ?  536  LEU A C   1 
ATOM   4156  O  O   . LEU A  1 536 ? 8.671   -7.423  71.429  1.00 60.65  ?  536  LEU A O   1 
ATOM   4157  C  CB  . LEU A  1 536 ? 6.264   -7.746  73.609  1.00 63.30  ?  536  LEU A CB  1 
ATOM   4158  C  CG  . LEU A  1 536 ? 7.239   -7.381  74.742  1.00 62.74  ?  536  LEU A CG  1 
ATOM   4159  C  CD1 . LEU A  1 536 ? 8.598   -8.035  74.587  1.00 63.53  ?  536  LEU A CD1 1 
ATOM   4160  C  CD2 . LEU A  1 536 ? 7.383   -5.869  74.855  1.00 57.46  ?  536  LEU A CD2 1 
ATOM   4161  N  N   . PRO A  1 537 ? 7.321   -9.094  70.784  1.00 61.32  ?  537  PRO A N   1 
ATOM   4162  C  CA  . PRO A  1 537 ? 8.397   -9.667  69.952  1.00 62.72  ?  537  PRO A CA  1 
ATOM   4163  C  C   . PRO A  1 537 ? 8.904   -8.728  68.870  1.00 67.37  ?  537  PRO A C   1 
ATOM   4164  O  O   . PRO A  1 537 ? 10.120  -8.641  68.655  1.00 68.48  ?  537  PRO A O   1 
ATOM   4165  C  CB  . PRO A  1 537 ? 7.737   -10.915 69.358  1.00 61.09  ?  537  PRO A CB  1 
ATOM   4166  C  CG  . PRO A  1 537 ? 6.773   -11.333 70.403  1.00 60.01  ?  537  PRO A CG  1 
ATOM   4167  C  CD  . PRO A  1 537 ? 6.215   -10.054 70.960  1.00 60.83  ?  537  PRO A CD  1 
ATOM   4168  N  N   . LYS A  1 538 ? 8.006   -8.002  68.195  1.00 69.77  ?  538  LYS A N   1 
ATOM   4169  C  CA  . LYS A  1 538 ? 8.395   -7.120  67.098  1.00 70.69  ?  538  LYS A CA  1 
ATOM   4170  C  C   . LYS A  1 538 ? 9.319   -5.993  67.535  1.00 72.28  ?  538  LYS A C   1 
ATOM   4171  O  O   . LYS A  1 538 ? 9.882   -5.313  66.670  1.00 71.23  ?  538  LYS A O   1 
ATOM   4172  C  CB  . LYS A  1 538 ? 7.147   -6.543  66.427  1.00 71.60  ?  538  LYS A CB  1 
ATOM   4173  C  CG  . LYS A  1 538 ? 6.406   -7.564  65.577  1.00 73.00  ?  538  LYS A CG  1 
ATOM   4174  C  CD  . LYS A  1 538 ? 5.042   -7.077  65.125  1.00 74.46  ?  538  LYS A CD  1 
ATOM   4175  C  CE  . LYS A  1 538 ? 4.448   -8.046  64.107  1.00 75.17  ?  538  LYS A CE  1 
ATOM   4176  N  NZ  . LYS A  1 538 ? 3.006   -7.794  63.836  1.00 76.36  ?  538  LYS A NZ  1 
ATOM   4177  N  N   . LEU A  1 539 ? 9.489   -5.780  68.844  1.00 77.23  ?  539  LEU A N   1 
ATOM   4178  C  CA  . LEU A  1 539 ? 10.441  -4.778  69.314  1.00 84.15  ?  539  LEU A CA  1 
ATOM   4179  C  C   . LEU A  1 539 ? 11.878  -5.246  69.138  1.00 93.75  ?  539  LEU A C   1 
ATOM   4180  O  O   . LEU A  1 539 ? 12.788  -4.413  69.033  1.00 97.09  ?  539  LEU A O   1 
ATOM   4181  C  CB  . LEU A  1 539 ? 10.175  -4.427  70.775  1.00 79.71  ?  539  LEU A CB  1 
ATOM   4182  C  CG  . LEU A  1 539 ? 9.430   -3.111  71.002  1.00 78.58  ?  539  LEU A CG  1 
ATOM   4183  C  CD1 . LEU A  1 539 ? 8.147   -3.085  70.204  1.00 78.12  ?  539  LEU A CD1 1 
ATOM   4184  C  CD2 . LEU A  1 539 ? 9.124   -2.916  72.476  1.00 77.49  ?  539  LEU A CD2 1 
ATOM   4185  N  N   . LEU A  1 540 ? 12.103  -6.568  69.126  1.00 98.39  ?  540  LEU A N   1 
ATOM   4186  C  CA  . LEU A  1 540 ? 13.411  -7.168  68.869  1.00 101.64 ?  540  LEU A CA  1 
ATOM   4187  C  C   . LEU A  1 540 ? 14.473  -6.529  69.755  1.00 106.23 ?  540  LEU A C   1 
ATOM   4188  O  O   . LEU A  1 540 ? 14.218  -6.211  70.924  1.00 108.05 ?  540  LEU A O   1 
ATOM   4189  C  CB  . LEU A  1 540 ? 13.802  -6.988  67.394  1.00 100.47 ?  540  LEU A CB  1 
ATOM   4190  C  CG  . LEU A  1 540 ? 13.470  -7.999  66.291  1.00 97.85  ?  540  LEU A CG  1 
ATOM   4191  C  CD1 . LEU A  1 540 ? 13.494  -7.302  64.931  1.00 98.53  ?  540  LEU A CD1 1 
ATOM   4192  C  CD2 . LEU A  1 540 ? 14.460  -9.155  66.306  1.00 96.07  ?  540  LEU A CD2 1 
ATOM   4193  N  N   . SER A  1 541 ? 15.674  -6.380  69.200  1.00 106.31 ?  541  SER A N   1 
ATOM   4194  C  CA  . SER A  1 541 ? 16.542  -5.229  69.398  1.00 105.22 ?  541  SER A CA  1 
ATOM   4195  C  C   . SER A  1 541 ? 17.453  -5.180  68.181  1.00 105.07 ?  541  SER A C   1 
ATOM   4196  O  O   . SER A  1 541 ? 17.926  -6.223  67.720  1.00 103.84 ?  541  SER A O   1 
ATOM   4197  C  CB  . SER A  1 541 ? 17.351  -5.313  70.698  1.00 104.61 ?  541  SER A CB  1 
ATOM   4198  O  OG  . SER A  1 541 ? 17.682  -4.016  71.173  1.00 105.90 ?  541  SER A OG  1 
ATOM   4199  N  N   . ALA A  1 542 ? 17.722  -3.977  67.687  1.00 107.15 ?  542  ALA A N   1 
ATOM   4200  C  CA  . ALA A  1 542 ? 18.434  -3.830  66.425  1.00 109.38 ?  542  ALA A CA  1 
ATOM   4201  C  C   . ALA A  1 542 ? 19.932  -4.038  66.618  1.00 113.54 ?  542  ALA A C   1 
ATOM   4202  O  O   . ALA A  1 542 ? 20.514  -3.599  67.615  1.00 117.29 ?  542  ALA A O   1 
ATOM   4203  C  CB  . ALA A  1 542 ? 18.167  -2.453  65.814  1.00 108.24 ?  542  ALA A CB  1 
ATOM   4204  N  N   . THR A  1 543 ? 20.549  -4.723  65.657  1.00 111.64 ?  543  THR A N   1 
ATOM   4205  C  CA  . THR A  1 543 ? 22.003  -4.862  65.613  1.00 108.52 ?  543  THR A CA  1 
ATOM   4206  C  C   . THR A  1 543 ? 22.534  -4.216  64.331  1.00 105.30 ?  543  THR A C   1 
ATOM   4207  O  O   . THR A  1 543 ? 21.874  -3.361  63.741  1.00 105.36 ?  543  THR A O   1 
ATOM   4208  C  CB  . THR A  1 543 ? 22.447  -6.342  65.679  1.00 108.19 ?  543  THR A CB  1 
ATOM   4209  O  OG1 . THR A  1 543 ? 23.880  -6.421  65.639  1.00 110.63 ?  543  THR A OG1 1 
ATOM   4210  C  CG2 . THR A  1 543 ? 21.864  -7.131  64.510  1.00 106.91 ?  543  THR A CG2 1 
ATOM   4211  O  OXT . THR A  1 543 ? 23.627  -4.521  63.852  1.00 103.40 ?  543  THR A OXT 1 
ATOM   4212  N  N   . GLU B  1 4   ? -29.290 60.908  65.328  1.00 187.04 ?  4    GLU B N   1 
ATOM   4213  C  CA  . GLU B  1 4   ? -28.198 59.952  65.486  1.00 182.04 ?  4    GLU B CA  1 
ATOM   4214  C  C   . GLU B  1 4   ? -28.182 59.347  66.888  1.00 183.85 ?  4    GLU B C   1 
ATOM   4215  O  O   . GLU B  1 4   ? -28.212 60.070  67.886  1.00 189.90 ?  4    GLU B O   1 
ATOM   4216  C  CB  . GLU B  1 4   ? -26.853 60.621  65.191  1.00 181.01 ?  4    GLU B CB  1 
ATOM   4217  C  CG  . GLU B  1 4   ? -25.653 59.675  65.199  1.00 176.27 ?  4    GLU B CG  1 
ATOM   4218  C  CD  . GLU B  1 4   ? -25.612 58.747  63.992  1.00 171.73 ?  4    GLU B CD  1 
ATOM   4219  O  OE1 . GLU B  1 4   ? -25.666 59.258  62.853  1.00 170.94 ?  4    GLU B OE1 1 
ATOM   4220  O  OE2 . GLU B  1 4   ? -25.527 57.510  64.182  1.00 168.34 ?  4    GLU B OE2 1 
ATOM   4221  N  N   . ASP B  1 5   ? -28.138 58.021  66.954  1.00 178.78 ?  5    ASP B N   1 
ATOM   4222  C  CA  . ASP B  1 5   ? -28.052 57.323  68.233  1.00 178.43 ?  5    ASP B CA  1 
ATOM   4223  C  C   . ASP B  1 5   ? -26.715 57.644  68.888  1.00 178.01 ?  5    ASP B C   1 
ATOM   4224  O  O   . ASP B  1 5   ? -25.665 57.397  68.280  1.00 173.87 ?  5    ASP B O   1 
ATOM   4225  C  CB  . ASP B  1 5   ? -28.210 55.814  68.022  1.00 172.11 ?  5    ASP B CB  1 
ATOM   4226  C  CG  . ASP B  1 5   ? -28.464 55.053  69.320  1.00 172.53 ?  5    ASP B CG  1 
ATOM   4227  O  OD1 . ASP B  1 5   ? -27.926 55.448  70.375  1.00 174.44 ?  5    ASP B OD1 1 
ATOM   4228  O  OD2 . ASP B  1 5   ? -29.208 54.049  69.283  1.00 171.17 ?  5    ASP B OD2 1 
ATOM   4229  N  N   . PRO B  1 6   ? -26.697 58.204  70.103  1.00 182.38 ?  6    PRO B N   1 
ATOM   4230  C  CA  . PRO B  1 6   ? -25.405 58.520  70.733  1.00 180.91 ?  6    PRO B CA  1 
ATOM   4231  C  C   . PRO B  1 6   ? -24.568 57.291  71.043  1.00 174.25 ?  6    PRO B C   1 
ATOM   4232  O  O   . PRO B  1 6   ? -23.334 57.381  71.042  1.00 170.48 ?  6    PRO B O   1 
ATOM   4233  C  CB  . PRO B  1 6   ? -25.808 59.267  72.016  1.00 188.34 ?  6    PRO B CB  1 
ATOM   4234  C  CG  . PRO B  1 6   ? -27.229 59.702  71.794  1.00 193.30 ?  6    PRO B CG  1 
ATOM   4235  C  CD  . PRO B  1 6   ? -27.837 58.649  70.921  1.00 189.22 ?  6    PRO B CD  1 
ATOM   4236  N  N   . GLN B  1 7   ? -25.198 56.145  71.302  1.00 173.02 ?  7    GLN B N   1 
ATOM   4237  C  CA  . GLN B  1 7   ? -24.463 54.951  71.704  1.00 169.33 ?  7    GLN B CA  1 
ATOM   4238  C  C   . GLN B  1 7   ? -23.842 54.199  70.531  1.00 163.23 ?  7    GLN B C   1 
ATOM   4239  O  O   . GLN B  1 7   ? -22.940 53.384  70.750  1.00 160.58 ?  7    GLN B O   1 
ATOM   4240  C  CB  . GLN B  1 7   ? -25.381 54.012  72.491  1.00 170.64 ?  7    GLN B CB  1 
ATOM   4241  C  CG  . GLN B  1 7   ? -25.950 54.624  73.763  1.00 177.39 ?  7    GLN B CG  1 
ATOM   4242  C  CD  . GLN B  1 7   ? -24.900 54.843  74.831  1.00 177.85 ?  7    GLN B CD  1 
ATOM   4243  O  OE1 . GLN B  1 7   ? -24.041 53.992  75.056  1.00 172.87 ?  7    GLN B OE1 1 
ATOM   4244  N  NE2 . GLN B  1 7   ? -24.960 55.994  75.493  1.00 183.83 ?  7    GLN B NE2 1 
ATOM   4245  N  N   . LEU B  1 8   ? -24.306 54.434  69.300  1.00 160.84 ?  8    LEU B N   1 
ATOM   4246  C  CA  . LEU B  1 8   ? -23.759 53.752  68.133  1.00 153.73 ?  8    LEU B CA  1 
ATOM   4247  C  C   . LEU B  1 8   ? -22.598 54.494  67.481  1.00 151.42 ?  8    LEU B C   1 
ATOM   4248  O  O   . LEU B  1 8   ? -21.943 53.927  66.601  1.00 147.38 ?  8    LEU B O   1 
ATOM   4249  C  CB  . LEU B  1 8   ? -24.855 53.514  67.087  1.00 152.05 ?  8    LEU B CB  1 
ATOM   4250  C  CG  . LEU B  1 8   ? -26.054 52.674  67.528  1.00 153.62 ?  8    LEU B CG  1 
ATOM   4251  C  CD1 . LEU B  1 8   ? -26.939 52.335  66.340  1.00 152.43 ?  8    LEU B CD1 1 
ATOM   4252  C  CD2 . LEU B  1 8   ? -25.603 51.414  68.247  1.00 150.36 ?  8    LEU B CD2 1 
ATOM   4253  N  N   . LEU B  1 9   ? -22.316 55.730  67.887  1.00 155.28 ?  9    LEU B N   1 
ATOM   4254  C  CA  . LEU B  1 9   ? -21.187 56.491  67.363  1.00 154.00 ?  9    LEU B CA  1 
ATOM   4255  C  C   . LEU B  1 9   ? -20.022 56.386  68.342  1.00 153.18 ?  9    LEU B C   1 
ATOM   4256  O  O   . LEU B  1 9   ? -20.148 56.782  69.506  1.00 157.58 ?  9    LEU B O   1 
ATOM   4257  C  CB  . LEU B  1 9   ? -21.572 57.953  67.131  1.00 159.16 ?  9    LEU B CB  1 
ATOM   4258  C  CG  . LEU B  1 9   ? -21.699 58.419  65.677  1.00 157.66 ?  9    LEU B CG  1 
ATOM   4259  C  CD1 . LEU B  1 9   ? -22.060 59.893  65.613  1.00 163.56 ?  9    LEU B CD1 1 
ATOM   4260  C  CD2 . LEU B  1 9   ? -20.411 58.162  64.915  1.00 152.29 ?  9    LEU B CD2 1 
ATOM   4261  N  N   . VAL B  1 10  ? -18.894 55.854  67.869  1.00 148.14 ?  10   VAL B N   1 
ATOM   4262  C  CA  . VAL B  1 10  ? -17.712 55.623  68.694  1.00 147.15 ?  10   VAL B CA  1 
ATOM   4263  C  C   . VAL B  1 10  ? -16.487 56.148  67.952  1.00 145.12 ?  10   VAL B C   1 
ATOM   4264  O  O   . VAL B  1 10  ? -16.296 55.846  66.770  1.00 145.66 ?  10   VAL B O   1 
ATOM   4265  C  CB  . VAL B  1 10  ? -17.531 54.128  69.038  1.00 142.75 ?  10   VAL B CB  1 
ATOM   4266  C  CG1 . VAL B  1 10  ? -16.222 53.900  69.774  1.00 141.54 ?  10   VAL B CG1 1 
ATOM   4267  C  CG2 . VAL B  1 10  ? -18.704 53.609  69.859  1.00 145.17 ?  10   VAL B CG2 1 
ATOM   4268  N  N   . ARG B  1 11  ? -15.668 56.938  68.644  1.00 148.13 ?  11   ARG B N   1 
ATOM   4269  C  CA  . ARG B  1 11  ? -14.359 57.342  68.149  1.00 146.47 ?  11   ARG B CA  1 
ATOM   4270  C  C   . ARG B  1 11  ? -13.337 56.281  68.533  1.00 142.78 ?  11   ARG B C   1 
ATOM   4271  O  O   . ARG B  1 11  ? -13.281 55.868  69.696  1.00 143.60 ?  11   ARG B O   1 
ATOM   4272  C  CB  . ARG B  1 11  ? -13.928 58.691  68.737  1.00 152.06 ?  11   ARG B CB  1 
ATOM   4273  C  CG  . ARG B  1 11  ? -14.840 59.879  68.474  1.00 157.00 ?  11   ARG B CG  1 
ATOM   4274  C  CD  . ARG B  1 11  ? -14.730 60.873  69.600  1.00 165.48 ?  11   ARG B CD  1 
ATOM   4275  N  NE  . ARG B  1 11  ? -14.353 62.194  69.128  1.00 168.41 ?  11   ARG B NE  1 
ATOM   4276  C  CZ  . ARG B  1 11  ? -14.076 63.207  69.925  1.00 173.12 ?  11   ARG B CZ  1 
ATOM   4277  N  NH1 . ARG B  1 11  ? -14.117 63.011  71.219  1.00 175.41 ?  11   ARG B NH1 1 
ATOM   4278  N  NH2 . ARG B  1 11  ? -13.744 64.387  69.436  1.00 175.48 ?  11   ARG B NH2 1 
ATOM   4279  N  N   . VAL B  1 12  ? -12.534 55.844  67.562  1.00 138.23 ?  12   VAL B N   1 
ATOM   4280  C  CA  . VAL B  1 12  ? -11.352 55.038  67.850  1.00 134.25 ?  12   VAL B CA  1 
ATOM   4281  C  C   . VAL B  1 12  ? -10.139 55.833  67.387  1.00 134.67 ?  12   VAL B C   1 
ATOM   4282  O  O   . VAL B  1 12  ? -10.284 56.930  66.834  1.00 137.36 ?  12   VAL B O   1 
ATOM   4283  C  CB  . VAL B  1 12  ? -11.421 53.653  67.180  1.00 128.35 ?  12   VAL B CB  1 
ATOM   4284  C  CG1 . VAL B  1 12  ? -12.627 52.883  67.686  1.00 128.41 ?  12   VAL B CG1 1 
ATOM   4285  C  CG2 . VAL B  1 12  ? -11.475 53.786  65.665  1.00 127.00 ?  12   VAL B CG2 1 
ATOM   4286  N  N   . ARG B  1 13  ? -8.937  55.293  67.595  1.00 132.23 ?  13   ARG B N   1 
ATOM   4287  C  CA  . ARG B  1 13  ? -7.731  56.025  67.221  1.00 133.86 ?  13   ARG B CA  1 
ATOM   4288  C  C   . ARG B  1 13  ? -7.669  56.305  65.723  1.00 132.39 ?  13   ARG B C   1 
ATOM   4289  O  O   . ARG B  1 13  ? -6.974  57.237  65.305  1.00 133.77 ?  13   ARG B O   1 
ATOM   4290  C  CB  . ARG B  1 13  ? -6.488  55.252  67.677  1.00 132.63 ?  13   ARG B CB  1 
ATOM   4291  C  CG  . ARG B  1 13  ? -5.189  56.038  67.580  1.00 136.34 ?  13   ARG B CG  1 
ATOM   4292  C  CD  . ARG B  1 13  ? -4.029  55.318  68.256  1.00 137.57 ?  13   ARG B CD  1 
ATOM   4293  N  NE  . ARG B  1 13  ? -4.253  55.092  69.685  1.00 143.64 ?  13   ARG B NE  1 
ATOM   4294  C  CZ  . ARG B  1 13  ? -4.049  56.000  70.641  1.00 151.18 ?  13   ARG B CZ  1 
ATOM   4295  N  NH1 . ARG B  1 13  ? -3.630  57.224  70.335  1.00 154.82 ?  13   ARG B NH1 1 
ATOM   4296  N  NH2 . ARG B  1 13  ? -4.277  55.688  71.911  1.00 153.67 ?  13   ARG B NH2 1 
ATOM   4297  N  N   . GLY B  1 14  ? -8.398  55.540  64.911  1.00 129.92 ?  14   GLY B N   1 
ATOM   4298  C  CA  . GLY B  1 14  ? -8.369  55.716  63.472  1.00 127.87 ?  14   GLY B CA  1 
ATOM   4299  C  C   . GLY B  1 14  ? -9.488  56.560  62.896  1.00 131.37 ?  14   GLY B C   1 
ATOM   4300  O  O   . GLY B  1 14  ? -9.389  57.003  61.748  1.00 126.96 ?  14   GLY B O   1 
ATOM   4301  N  N   . GLY B  1 15  ? -10.553 56.786  63.654  1.00 130.69 ?  15   GLY B N   1 
ATOM   4302  C  CA  . GLY B  1 15  ? -11.630 57.636  63.187  1.00 133.76 ?  15   GLY B CA  1 
ATOM   4303  C  C   . GLY B  1 15  ? -12.960 57.245  63.804  1.00 135.10 ?  15   GLY B C   1 
ATOM   4304  O  O   . GLY B  1 15  ? -13.014 56.551  64.815  1.00 134.82 ?  15   GLY B O   1 
ATOM   4305  N  N   . GLN B  1 16  ? -14.026 57.721  63.161  1.00 136.81 ?  16   GLN B N   1 
ATOM   4306  C  CA  . GLN B  1 16  ? -15.394 57.542  63.635  1.00 139.95 ?  16   GLN B CA  1 
ATOM   4307  C  C   . GLN B  1 16  ? -15.981 56.231  63.130  1.00 134.58 ?  16   GLN B C   1 
ATOM   4308  O  O   . GLN B  1 16  ? -15.702 55.803  62.006  1.00 137.83 ?  16   GLN B O   1 
ATOM   4309  C  CB  . GLN B  1 16  ? -16.276 58.710  63.181  1.00 144.60 ?  16   GLN B CB  1 
ATOM   4310  C  CG  . GLN B  1 16  ? -15.794 60.094  63.614  1.00 149.28 ?  16   GLN B CG  1 
ATOM   4311  C  CD  . GLN B  1 16  ? -16.041 60.391  65.087  1.00 153.18 ?  16   GLN B CD  1 
ATOM   4312  O  OE1 . GLN B  1 16  ? -16.698 59.623  65.794  1.00 152.72 ?  16   GLN B OE1 1 
ATOM   4313  N  NE2 . GLN B  1 16  ? -15.502 61.509  65.558  1.00 157.22 ?  16   GLN B NE2 1 
ATOM   4314  N  N   . LEU B  1 17  ? -16.795 55.594  63.969  1.00 135.40 ?  17   LEU B N   1 
ATOM   4315  C  CA  . LEU B  1 17  ? -17.456 54.345  63.625  1.00 131.91 ?  17   LEU B CA  1 
ATOM   4316  C  C   . LEU B  1 17  ? -18.951 54.449  63.899  1.00 135.42 ?  17   LEU B C   1 
ATOM   4317  O  O   . LEU B  1 17  ? -19.383 55.114  64.844  1.00 140.16 ?  17   LEU B O   1 
ATOM   4318  C  CB  . LEU B  1 17  ? -16.863 53.159  64.406  1.00 130.94 ?  17   LEU B CB  1 
ATOM   4319  C  CG  . LEU B  1 17  ? -15.438 52.736  64.039  1.00 126.69 ?  17   LEU B CG  1 
ATOM   4320  C  CD1 . LEU B  1 17  ? -14.884 51.769  65.070  1.00 125.41 ?  17   LEU B CD1 1 
ATOM   4321  C  CD2 . LEU B  1 17  ? -15.405 52.116  62.645  1.00 120.18 ?  17   LEU B CD2 1 
ATOM   4322  N  N   . ARG B  1 18  ? -19.738 53.780  63.058  1.00 133.31 ?  18   ARG B N   1 
ATOM   4323  C  CA  . ARG B  1 18  ? -21.193 53.754  63.167  1.00 138.76 ?  18   ARG B CA  1 
ATOM   4324  C  C   . ARG B  1 18  ? -21.649 52.306  63.286  1.00 133.33 ?  18   ARG B C   1 
ATOM   4325  O  O   . ARG B  1 18  ? -21.438 51.513  62.362  1.00 129.00 ?  18   ARG B O   1 
ATOM   4326  C  CB  . ARG B  1 18  ? -21.848 54.412  61.951  1.00 141.02 ?  18   ARG B CB  1 
ATOM   4327  C  CG  . ARG B  1 18  ? -23.366 54.364  61.961  1.00 145.74 ?  18   ARG B CG  1 
ATOM   4328  C  CD  . ARG B  1 18  ? -23.951 54.622  60.573  1.00 147.19 ?  18   ARG B CD  1 
ATOM   4329  N  NE  . ARG B  1 18  ? -23.184 55.595  59.797  1.00 148.68 ?  18   ARG B NE  1 
ATOM   4330  C  CZ  . ARG B  1 18  ? -23.214 56.912  59.987  1.00 154.11 ?  18   ARG B CZ  1 
ATOM   4331  N  NH1 . ARG B  1 18  ? -23.979 57.439  60.937  1.00 159.52 ?  18   ARG B NH1 1 
ATOM   4332  N  NH2 . ARG B  1 18  ? -22.473 57.705  59.222  1.00 153.35 ?  18   ARG B NH2 1 
ATOM   4333  N  N   . GLY B  1 19  ? -22.277 51.964  64.414  1.00 135.84 ?  19   GLY B N   1 
ATOM   4334  C  CA  . GLY B  1 19  ? -22.769 50.624  64.650  1.00 133.64 ?  19   GLY B CA  1 
ATOM   4335  C  C   . GLY B  1 19  ? -24.260 50.486  64.363  1.00 137.81 ?  19   GLY B C   1 
ATOM   4336  O  O   . GLY B  1 19  ? -24.931 51.417  63.922  1.00 141.28 ?  19   GLY B O   1 
ATOM   4337  N  N   . ILE B  1 20  ? -24.779 49.279  64.621  1.00 134.84 ?  20   ILE B N   1 
ATOM   4338  C  CA  . ILE B  1 20  ? -26.203 49.004  64.460  1.00 139.41 ?  20   ILE B CA  1 
ATOM   4339  C  C   . ILE B  1 20  ? -26.768 48.388  65.730  1.00 142.27 ?  20   ILE B C   1 
ATOM   4340  O  O   . ILE B  1 20  ? -26.055 47.766  66.524  1.00 140.15 ?  20   ILE B O   1 
ATOM   4341  C  CB  . ILE B  1 20  ? -26.511 48.081  63.260  1.00 133.88 ?  20   ILE B CB  1 
ATOM   4342  C  CG1 . ILE B  1 20  ? -26.057 46.646  63.538  1.00 129.65 ?  20   ILE B CG1 1 
ATOM   4343  C  CG2 . ILE B  1 20  ? -25.885 48.617  62.016  1.00 131.43 ?  20   ILE B CG2 1 
ATOM   4344  C  CD1 . ILE B  1 20  ? -26.613 45.616  62.562  1.00 127.96 ?  20   ILE B CD1 1 
ATOM   4345  N  N   . ARG B  1 21  ? -28.072 48.574  65.913  1.00 147.53 ?  21   ARG B N   1 
ATOM   4346  C  CA  . ARG B  1 21  ? -28.840 47.884  66.939  1.00 150.34 ?  21   ARG B CA  1 
ATOM   4347  C  C   . ARG B  1 21  ? -29.560 46.702  66.301  1.00 148.96 ?  21   ARG B C   1 
ATOM   4348  O  O   . ARG B  1 21  ? -30.421 46.891  65.435  1.00 150.43 ?  21   ARG B O   1 
ATOM   4349  C  CB  . ARG B  1 21  ? -29.848 48.831  67.591  1.00 156.90 ?  21   ARG B CB  1 
ATOM   4350  C  CG  . ARG B  1 21  ? -31.105 48.150  68.139  1.00 159.89 ?  21   ARG B CG  1 
ATOM   4351  C  CD  . ARG B  1 21  ? -32.303 49.087  68.105  1.00 165.48 ?  21   ARG B CD  1 
ATOM   4352  N  NE  . ARG B  1 21  ? -33.390 48.600  68.938  1.00 169.10 ?  21   ARG B NE  1 
ATOM   4353  C  CZ  . ARG B  1 21  ? -34.066 49.349  69.789  1.00 175.01 ?  21   ARG B CZ  1 
ATOM   4354  N  NH1 . ARG B  1 21  ? -33.765 50.628  69.921  1.00 177.57 ?  21   ARG B NH1 1 
ATOM   4355  N  NH2 . ARG B  1 21  ? -35.032 48.821  70.510  1.00 178.64 ?  21   ARG B NH2 1 
ATOM   4356  N  N   . LEU B  1 22  ? -29.181 45.492  66.691  1.00 145.98 ?  22   LEU B N   1 
ATOM   4357  C  CA  . LEU B  1 22  ? -29.944 44.304  66.344  1.00 144.03 ?  22   LEU B CA  1 
ATOM   4358  C  C   . LEU B  1 22  ? -30.553 43.733  67.615  1.00 146.43 ?  22   LEU B C   1 
ATOM   4359  O  O   . LEU B  1 22  ? -29.966 43.813  68.700  1.00 144.52 ?  22   LEU B O   1 
ATOM   4360  C  CB  . LEU B  1 22  ? -29.079 43.246  65.640  1.00 137.40 ?  22   LEU B CB  1 
ATOM   4361  C  CG  . LEU B  1 22  ? -29.725 42.352  64.563  1.00 134.96 ?  22   LEU B CG  1 
ATOM   4362  C  CD1 . LEU B  1 22  ? -28.665 41.554  63.809  1.00 128.80 ?  22   LEU B CD1 1 
ATOM   4363  C  CD2 . LEU B  1 22  ? -30.788 41.399  65.117  1.00 136.77 ?  22   LEU B CD2 1 
ATOM   4364  N  N   . LYS B  1 23  ? -31.760 43.202  67.464  1.00 150.22 ?  23   LYS B N   1 
ATOM   4365  C  CA  . LYS B  1 23  ? -32.423 42.497  68.547  1.00 156.24 ?  23   LYS B CA  1 
ATOM   4366  C  C   . LYS B  1 23  ? -31.517 41.404  69.097  1.00 155.20 ?  23   LYS B C   1 
ATOM   4367  O  O   . LYS B  1 23  ? -30.871 40.671  68.342  1.00 152.23 ?  23   LYS B O   1 
ATOM   4368  C  CB  . LYS B  1 23  ? -33.734 41.882  68.036  1.00 158.95 ?  23   LYS B CB  1 
ATOM   4369  C  CG  . LYS B  1 23  ? -34.314 40.740  68.878  1.00 161.54 ?  23   LYS B CG  1 
ATOM   4370  C  CD  . LYS B  1 23  ? -33.855 39.351  68.416  1.00 156.72 ?  23   LYS B CD  1 
ATOM   4371  C  CE  . LYS B  1 23  ? -34.338 39.024  67.020  1.00 154.64 ?  23   LYS B CE  1 
ATOM   4372  N  NZ  . LYS B  1 23  ? -33.888 37.660  66.628  1.00 149.17 ?  23   LYS B NZ  1 
ATOM   4373  N  N   . ALA B  1 24  ? -31.458 41.314  70.414  1.00 157.55 ?  24   ALA B N   1 
ATOM   4374  C  CA  . ALA B  1 24  ? -31.143 40.034  71.018  1.00 154.19 ?  24   ALA B CA  1 
ATOM   4375  C  C   . ALA B  1 24  ? -32.365 39.568  71.802  1.00 159.42 ?  24   ALA B C   1 
ATOM   4376  O  O   . ALA B  1 24  ? -33.136 40.400  72.293  1.00 166.79 ?  24   ALA B O   1 
ATOM   4377  C  CB  . ALA B  1 24  ? -29.925 40.112  71.948  1.00 151.14 ?  24   ALA B CB  1 
ATOM   4378  N  N   . PRO B  1 25  ? -32.587 38.257  71.920  1.00 155.27 ?  25   PRO B N   1 
ATOM   4379  C  CA  . PRO B  1 25  ? -33.841 37.779  72.531  1.00 159.58 ?  25   PRO B CA  1 
ATOM   4380  C  C   . PRO B  1 25  ? -34.147 38.384  73.897  1.00 166.23 ?  25   PRO B C   1 
ATOM   4381  O  O   . PRO B  1 25  ? -35.326 38.490  74.263  1.00 172.93 ?  25   PRO B O   1 
ATOM   4382  C  CB  . PRO B  1 25  ? -33.623 36.263  72.605  1.00 154.73 ?  25   PRO B CB  1 
ATOM   4383  C  CG  . PRO B  1 25  ? -32.743 35.973  71.426  1.00 147.94 ?  25   PRO B CG  1 
ATOM   4384  C  CD  . PRO B  1 25  ? -31.812 37.157  71.316  1.00 147.38 ?  25   PRO B CD  1 
ATOM   4385  N  N   . GLY B  1 26  ? -33.129 38.796  74.654  1.00 164.62 ?  26   GLY B N   1 
ATOM   4386  C  CA  . GLY B  1 26  ? -33.321 39.428  75.946  1.00 168.57 ?  26   GLY B CA  1 
ATOM   4387  C  C   . GLY B  1 26  ? -33.064 40.917  76.026  1.00 169.49 ?  26   GLY B C   1 
ATOM   4388  O  O   . GLY B  1 26  ? -33.105 41.474  77.131  1.00 173.70 ?  26   GLY B O   1 
ATOM   4389  N  N   . GLY B  1 27  ? -32.810 41.592  74.909  1.00 166.49 ?  27   GLY B N   1 
ATOM   4390  C  CA  . GLY B  1 27  ? -32.642 43.027  74.906  1.00 169.43 ?  27   GLY B CA  1 
ATOM   4391  C  C   . GLY B  1 27  ? -31.849 43.500  73.706  1.00 165.56 ?  27   GLY B C   1 
ATOM   4392  O  O   . GLY B  1 27  ? -31.334 42.696  72.926  1.00 162.17 ?  27   GLY B O   1 
ATOM   4393  N  N   . PRO B  1 28  ? -31.744 44.813  73.522  1.00 166.31 ?  28   PRO B N   1 
ATOM   4394  C  CA  . PRO B  1 28  ? -30.908 45.335  72.437  1.00 161.91 ?  28   PRO B CA  1 
ATOM   4395  C  C   . PRO B  1 28  ? -29.425 45.248  72.763  1.00 159.86 ?  28   PRO B C   1 
ATOM   4396  O  O   . PRO B  1 28  ? -29.009 45.310  73.924  1.00 162.86 ?  28   PRO B O   1 
ATOM   4397  C  CB  . PRO B  1 28  ? -31.359 46.798  72.314  1.00 164.75 ?  28   PRO B CB  1 
ATOM   4398  C  CG  . PRO B  1 28  ? -32.674 46.864  73.021  1.00 171.10 ?  28   PRO B CG  1 
ATOM   4399  C  CD  . PRO B  1 28  ? -32.574 45.865  74.124  1.00 171.12 ?  28   PRO B CD  1 
ATOM   4400  N  N   . VAL B  1 29  ? -28.623 45.104  71.704  1.00 154.26 ?  29   VAL B N   1 
ATOM   4401  C  CA  . VAL B  1 29  ? -27.170 45.084  71.807  1.00 149.62 ?  29   VAL B CA  1 
ATOM   4402  C  C   . VAL B  1 29  ? -26.582 46.022  70.763  1.00 147.56 ?  29   VAL B C   1 
ATOM   4403  O  O   . VAL B  1 29  ? -27.201 46.330  69.740  1.00 146.69 ?  29   VAL B O   1 
ATOM   4404  C  CB  . VAL B  1 29  ? -26.571 43.668  71.636  1.00 143.74 ?  29   VAL B CB  1 
ATOM   4405  C  CG1 . VAL B  1 29  ? -27.237 42.679  72.578  1.00 144.80 ?  29   VAL B CG1 1 
ATOM   4406  C  CG2 . VAL B  1 29  ? -26.675 43.207  70.184  1.00 140.31 ?  29   VAL B CG2 1 
ATOM   4407  N  N   . SER B  1 30  ? -25.358 46.465  71.037  1.00 147.04 ?  30   SER B N   1 
ATOM   4408  C  CA  . SER B  1 30  ? -24.610 47.359  70.162  1.00 146.08 ?  30   SER B CA  1 
ATOM   4409  C  C   . SER B  1 30  ? -23.548 46.561  69.415  1.00 138.83 ?  30   SER B C   1 
ATOM   4410  O  O   . SER B  1 30  ? -22.736 45.869  70.037  1.00 137.39 ?  30   SER B O   1 
ATOM   4411  C  CB  . SER B  1 30  ? -23.962 48.481  70.978  1.00 150.46 ?  30   SER B CB  1 
ATOM   4412  O  OG  . SER B  1 30  ? -23.589 49.569  70.153  1.00 151.74 ?  30   SER B OG  1 
ATOM   4413  N  N   . ALA B  1 31  ? -23.553 46.657  68.087  1.00 134.39 ?  31   ALA B N   1 
ATOM   4414  C  CA  . ALA B  1 31  ? -22.685 45.844  67.248  1.00 127.09 ?  31   ALA B CA  1 
ATOM   4415  C  C   . ALA B  1 31  ? -21.928 46.722  66.263  1.00 126.07 ?  31   ALA B C   1 
ATOM   4416  O  O   . ALA B  1 31  ? -22.532 47.552  65.576  1.00 128.43 ?  31   ALA B O   1 
ATOM   4417  C  CB  . ALA B  1 31  ? -23.499 44.787  66.492  1.00 124.01 ?  31   ALA B CB  1 
ATOM   4418  N  N   . PHE B  1 32  ? -20.608 46.538  66.200  1.00 122.90 ?  32   PHE B N   1 
ATOM   4419  C  CA  . PHE B  1 32  ? -19.746 47.186  65.211  1.00 120.94 ?  32   PHE B CA  1 
ATOM   4420  C  C   . PHE B  1 32  ? -19.066 46.081  64.407  1.00 116.81 ?  32   PHE B C   1 
ATOM   4421  O  O   . PHE B  1 32  ? -18.232 45.343  64.943  1.00 116.04 ?  32   PHE B O   1 
ATOM   4422  C  CB  . PHE B  1 32  ? -18.720 48.096  65.891  1.00 121.20 ?  32   PHE B CB  1 
ATOM   4423  C  CG  . PHE B  1 32  ? -19.323 49.058  66.879  1.00 126.67 ?  32   PHE B CG  1 
ATOM   4424  C  CD1 . PHE B  1 32  ? -19.543 48.672  68.193  1.00 128.59 ?  32   PHE B CD1 1 
ATOM   4425  C  CD2 . PHE B  1 32  ? -19.664 50.348  66.499  1.00 130.39 ?  32   PHE B CD2 1 
ATOM   4426  C  CE1 . PHE B  1 32  ? -20.098 49.547  69.106  1.00 134.27 ?  32   PHE B CE1 1 
ATOM   4427  C  CE2 . PHE B  1 32  ? -20.223 51.230  67.410  1.00 136.06 ?  32   PHE B CE2 1 
ATOM   4428  C  CZ  . PHE B  1 32  ? -20.439 50.827  68.715  1.00 138.23 ?  32   PHE B CZ  1 
ATOM   4429  N  N   . LEU B  1 33  ? -19.412 45.968  63.125  1.00 114.15 ?  33   LEU B N   1 
ATOM   4430  C  CA  . LEU B  1 33  ? -19.001 44.841  62.295  1.00 108.01 ?  33   LEU B CA  1 
ATOM   4431  C  C   . LEU B  1 33  ? -18.126 45.309  61.139  1.00 105.67 ?  33   LEU B C   1 
ATOM   4432  O  O   . LEU B  1 33  ? -18.563 46.112  60.310  1.00 106.20 ?  33   LEU B O   1 
ATOM   4433  C  CB  . LEU B  1 33  ? -20.225 44.093  61.746  1.00 107.20 ?  33   LEU B CB  1 
ATOM   4434  C  CG  . LEU B  1 33  ? -21.323 43.703  62.738  1.00 109.97 ?  33   LEU B CG  1 
ATOM   4435  C  CD1 . LEU B  1 33  ? -22.429 42.922  62.039  1.00 109.79 ?  33   LEU B CD1 1 
ATOM   4436  C  CD2 . LEU B  1 33  ? -20.747 42.913  63.898  1.00 108.82 ?  33   LEU B CD2 1 
ATOM   4437  N  N   . GLY B  1 34  ? -16.925 44.747  61.038  1.00 104.41 ?  34   GLY B N   1 
ATOM   4438  C  CA  . GLY B  1 34  ? -16.017 45.115  59.969  1.00 104.59 ?  34   GLY B CA  1 
ATOM   4439  C  C   . GLY B  1 34  ? -15.136 46.320  60.210  1.00 106.60 ?  34   GLY B C   1 
ATOM   4440  O  O   . GLY B  1 34  ? -14.833 47.051  59.259  1.00 100.76 ?  34   GLY B O   1 
ATOM   4441  N  N   . ILE B  1 35  ? -14.725 46.563  61.450  1.00 102.40 ?  35   ILE B N   1 
ATOM   4442  C  CA  . ILE B  1 35  ? -13.758 47.614  61.764  1.00 104.10 ?  35   ILE B CA  1 
ATOM   4443  C  C   . ILE B  1 35  ? -12.392 47.197  61.227  1.00 106.89 ?  35   ILE B C   1 
ATOM   4444  O  O   . ILE B  1 35  ? -11.845 46.187  61.691  1.00 106.24 ?  35   ILE B O   1 
ATOM   4445  C  CB  . ILE B  1 35  ? -13.682 47.848  63.282  1.00 106.99 ?  35   ILE B CB  1 
ATOM   4446  C  CG1 . ILE B  1 35  ? -15.077 48.078  63.866  1.00 110.59 ?  35   ILE B CG1 1 
ATOM   4447  C  CG2 . ILE B  1 35  ? -12.753 49.006  63.603  1.00 109.38 ?  35   ILE B CG2 1 
ATOM   4448  C  CD1 . ILE B  1 35  ? -15.098 48.142  65.380  1.00 113.48 ?  35   ILE B CD1 1 
ATOM   4449  N  N   . PRO B  1 36  ? -11.800 47.905  60.261  1.00 104.00 ?  36   PRO B N   1 
ATOM   4450  C  CA  . PRO B  1 36  ? -10.449 47.527  59.813  1.00 100.44 ?  36   PRO B CA  1 
ATOM   4451  C  C   . PRO B  1 36  ? -9.416  47.792  60.900  1.00 101.91 ?  36   PRO B C   1 
ATOM   4452  O  O   . PRO B  1 36  ? -9.321  48.907  61.421  1.00 106.07 ?  36   PRO B O   1 
ATOM   4453  C  CB  . PRO B  1 36  ? -10.218 48.426  58.593  1.00 99.68  ?  36   PRO B CB  1 
ATOM   4454  C  CG  . PRO B  1 36  ? -11.091 49.613  58.840  1.00 103.03 ?  36   PRO B CG  1 
ATOM   4455  C  CD  . PRO B  1 36  ? -12.311 49.082  59.542  1.00 104.90 ?  36   PRO B CD  1 
ATOM   4456  N  N   . PHE B  1 37  ? -8.627  46.766  61.231  1.00 97.91  ?  37   PHE B N   1 
ATOM   4457  C  CA  . PHE B  1 37  ? -7.451  46.942  62.073  1.00 97.65  ?  37   PHE B CA  1 
ATOM   4458  C  C   . PHE B  1 37  ? -6.140  46.977  61.298  1.00 94.73  ?  37   PHE B C   1 
ATOM   4459  O  O   . PHE B  1 37  ? -5.085  47.177  61.908  1.00 95.30  ?  37   PHE B O   1 
ATOM   4460  C  CB  . PHE B  1 37  ? -7.392  45.857  63.157  1.00 97.23  ?  37   PHE B CB  1 
ATOM   4461  C  CG  . PHE B  1 37  ? -7.234  44.460  62.631  1.00 93.27  ?  37   PHE B CG  1 
ATOM   4462  C  CD1 . PHE B  1 37  ? -8.334  43.735  62.199  1.00 92.25  ?  37   PHE B CD1 1 
ATOM   4463  C  CD2 . PHE B  1 37  ? -5.987  43.856  62.606  1.00 91.10  ?  37   PHE B CD2 1 
ATOM   4464  C  CE1 . PHE B  1 37  ? -8.188  42.438  61.730  1.00 88.77  ?  37   PHE B CE1 1 
ATOM   4465  C  CE2 . PHE B  1 37  ? -5.834  42.560  62.138  1.00 87.58  ?  37   PHE B CE2 1 
ATOM   4466  C  CZ  . PHE B  1 37  ? -6.936  41.851  61.699  1.00 86.23  ?  37   PHE B CZ  1 
ATOM   4467  N  N   . ALA B  1 38  ? -6.169  46.780  59.981  1.00 92.88  ?  38   ALA B N   1 
ATOM   4468  C  CA  . ALA B  1 38  ? -4.936  46.702  59.212  1.00 92.74  ?  38   ALA B CA  1 
ATOM   4469  C  C   . ALA B  1 38  ? -5.178  47.152  57.779  1.00 94.58  ?  38   ALA B C   1 
ATOM   4470  O  O   . ALA B  1 38  ? -6.273  46.984  57.235  1.00 95.21  ?  38   ALA B O   1 
ATOM   4471  C  CB  . ALA B  1 38  ? -4.357  45.282  59.224  1.00 86.63  ?  38   ALA B CB  1 
ATOM   4472  N  N   . GLU B  1 39  ? -4.140  47.728  57.175  1.00 95.38  ?  39   GLU B N   1 
ATOM   4473  C  CA  . GLU B  1 39  ? -4.175  47.998  55.746  1.00 94.62  ?  39   GLU B CA  1 
ATOM   4474  C  C   . GLU B  1 39  ? -4.288  46.677  54.988  1.00 89.45  ?  39   GLU B C   1 
ATOM   4475  O  O   . GLU B  1 39  ? -3.722  45.664  55.421  1.00 86.23  ?  39   GLU B O   1 
ATOM   4476  C  CB  . GLU B  1 39  ? -2.919  48.756  55.307  1.00 97.19  ?  39   GLU B CB  1 
ATOM   4477  C  CG  . GLU B  1 39  ? -2.853  50.216  55.752  1.00 103.06 ?  39   GLU B CG  1 
ATOM   4478  C  CD  . GLU B  1 39  ? -3.718  51.135  54.903  1.00 106.14 ?  39   GLU B CD  1 
ATOM   4479  O  OE1 . GLU B  1 39  ? -4.902  51.339  55.245  1.00 107.73 ?  39   GLU B OE1 1 
ATOM   4480  O  OE2 . GLU B  1 39  ? -3.205  51.669  53.897  1.00 107.16 ?  39   GLU B OE2 1 
ATOM   4481  N  N   . PRO B  1 40  ? -5.011  46.643  53.871  1.00 88.09  ?  40   PRO B N   1 
ATOM   4482  C  CA  . PRO B  1 40  ? -5.235  45.373  53.167  1.00 85.62  ?  40   PRO B CA  1 
ATOM   4483  C  C   . PRO B  1 40  ? -3.923  44.757  52.718  1.00 85.30  ?  40   PRO B C   1 
ATOM   4484  O  O   . PRO B  1 40  ? -3.095  45.425  52.080  1.00 89.18  ?  40   PRO B O   1 
ATOM   4485  C  CB  . PRO B  1 40  ? -6.098  45.785  51.964  1.00 84.79  ?  40   PRO B CB  1 
ATOM   4486  C  CG  . PRO B  1 40  ? -6.739  47.069  52.380  1.00 87.43  ?  40   PRO B CG  1 
ATOM   4487  C  CD  . PRO B  1 40  ? -5.726  47.762  53.234  1.00 89.27  ?  40   PRO B CD  1 
ATOM   4488  N  N   . PRO B  1 41  ? -3.685  43.424  53.042  1.00 79.78  ?  41   PRO B N   1 
ATOM   4489  C  CA  . PRO B  1 41  ? -2.435  42.753  52.646  1.00 77.03  ?  41   PRO B CA  1 
ATOM   4490  C  C   . PRO B  1 41  ? -2.518  42.182  51.230  1.00 76.65  ?  41   PRO B C   1 
ATOM   4491  O  O   . PRO B  1 41  ? -2.430  40.965  51.008  1.00 75.35  ?  41   PRO B O   1 
ATOM   4492  C  CB  . PRO B  1 41  ? -2.300  41.665  53.716  1.00 73.53  ?  41   PRO B CB  1 
ATOM   4493  C  CG  . PRO B  1 41  ? -3.710  41.303  54.033  1.00 73.22  ?  41   PRO B CG  1 
ATOM   4494  C  CD  . PRO B  1 41  ? -4.531  42.562  53.886  1.00 75.96  ?  41   PRO B CD  1 
ATOM   4495  N  N   . VAL B  1 42  ? -2.670  43.075  50.254  1.00 77.63  ?  42   VAL B N   1 
ATOM   4496  C  CA  . VAL B  1 42  ? -2.951  42.704  48.876  1.00 77.15  ?  42   VAL B CA  1 
ATOM   4497  C  C   . VAL B  1 42  ? -1.809  43.196  47.995  1.00 79.92  ?  42   VAL B C   1 
ATOM   4498  O  O   . VAL B  1 42  ? -1.054  44.099  48.363  1.00 84.13  ?  42   VAL B O   1 
ATOM   4499  C  CB  . VAL B  1 42  ? -4.302  43.272  48.392  1.00 75.21  ?  42   VAL B CB  1 
ATOM   4500  C  CG1 . VAL B  1 42  ? -5.416  42.918  49.370  1.00 75.15  ?  42   VAL B CG1 1 
ATOM   4501  C  CG2 . VAL B  1 42  ? -4.210  44.776  48.207  1.00 78.19  ?  42   VAL B CG2 1 
ATOM   4502  N  N   . GLY B  1 43  ? -1.686  42.584  46.818  1.00 77.55  ?  43   GLY B N   1 
ATOM   4503  C  CA  . GLY B  1 43  ? -0.633  42.959  45.892  1.00 78.10  ?  43   GLY B CA  1 
ATOM   4504  C  C   . GLY B  1 43  ? 0.754   42.618  46.392  1.00 73.57  ?  43   GLY B C   1 
ATOM   4505  O  O   . GLY B  1 43  ? 1.051   41.450  46.660  1.00 71.73  ?  43   GLY B O   1 
ATOM   4506  N  N   . SER B  1 44  ? 1.621   43.628  46.489  1.00 75.77  ?  44   SER B N   1 
ATOM   4507  C  CA  . SER B  1 44  ? 2.966   43.432  47.018  1.00 79.45  ?  44   SER B CA  1 
ATOM   4508  C  C   . SER B  1 44  ? 2.980   43.171  48.517  1.00 81.12  ?  44   SER B C   1 
ATOM   4509  O  O   . SER B  1 44  ? 4.042   42.847  49.061  1.00 82.02  ?  44   SER B O   1 
ATOM   4510  C  CB  . SER B  1 44  ? 3.845   44.646  46.709  1.00 80.83  ?  44   SER B CB  1 
ATOM   4511  O  OG  . SER B  1 44  ? 3.423   45.781  47.442  1.00 82.11  ?  44   SER B OG  1 
ATOM   4512  N  N   . ARG B  1 45  ? 1.846   43.307  49.197  1.00 82.22  ?  45   ARG B N   1 
ATOM   4513  C  CA  . ARG B  1 45  ? 1.769   43.055  50.629  1.00 82.96  ?  45   ARG B CA  1 
ATOM   4514  C  C   . ARG B  1 45  ? 1.354   41.622  50.958  1.00 79.52  ?  45   ARG B C   1 
ATOM   4515  O  O   . ARG B  1 45  ? 1.240   41.281  52.142  1.00 78.76  ?  45   ARG B O   1 
ATOM   4516  C  CB  . ARG B  1 45  ? 0.806   44.058  51.282  1.00 86.98  ?  45   ARG B CB  1 
ATOM   4517  C  CG  . ARG B  1 45  ? 1.494   45.059  52.206  1.00 94.10  ?  45   ARG B CG  1 
ATOM   4518  C  CD  . ARG B  1 45  ? 2.059   44.331  53.419  1.00 99.15  ?  45   ARG B CD  1 
ATOM   4519  N  NE  . ARG B  1 45  ? 2.930   45.146  54.266  1.00 105.82 ?  45   ARG B NE  1 
ATOM   4520  C  CZ  . ARG B  1 45  ? 4.229   45.328  54.051  1.00 109.33 ?  45   ARG B CZ  1 
ATOM   4521  N  NH1 . ARG B  1 45  ? 4.819   44.772  52.999  1.00 109.43 ?  45   ARG B NH1 1 
ATOM   4522  N  NH2 . ARG B  1 45  ? 4.941   46.073  54.884  1.00 112.30 ?  45   ARG B NH2 1 
ATOM   4523  N  N   . ARG B  1 46  ? 1.143   40.779  49.945  1.00 76.88  ?  46   ARG B N   1 
ATOM   4524  C  CA  . ARG B  1 46  ? 0.794   39.385  50.181  1.00 73.56  ?  46   ARG B CA  1 
ATOM   4525  C  C   . ARG B  1 46  ? 1.989   38.629  50.748  1.00 74.49  ?  46   ARG B C   1 
ATOM   4526  O  O   . ARG B  1 46  ? 3.120   38.783  50.272  1.00 76.91  ?  46   ARG B O   1 
ATOM   4527  C  CB  . ARG B  1 46  ? 0.327   38.720  48.886  1.00 70.28  ?  46   ARG B CB  1 
ATOM   4528  C  CG  . ARG B  1 46  ? -0.150  37.281  49.068  1.00 66.35  ?  46   ARG B CG  1 
ATOM   4529  C  CD  . ARG B  1 46  ? -0.288  36.568  47.733  1.00 65.16  ?  46   ARG B CD  1 
ATOM   4530  N  NE  . ARG B  1 46  ? -1.603  36.739  47.120  1.00 66.75  ?  46   ARG B NE  1 
ATOM   4531  C  CZ  . ARG B  1 46  ? -1.897  36.381  45.872  1.00 66.78  ?  46   ARG B CZ  1 
ATOM   4532  N  NH1 . ARG B  1 46  ? -0.965  35.846  45.092  1.00 62.77  ?  46   ARG B NH1 1 
ATOM   4533  N  NH2 . ARG B  1 46  ? -3.120  36.564  45.398  1.00 63.95  ?  46   ARG B NH2 1 
ATOM   4534  N  N   . PHE B  1 47  ? 1.724   37.809  51.770  1.00 72.15  ?  47   PHE B N   1 
ATOM   4535  C  CA  . PHE B  1 47  ? 2.681   37.035  52.562  1.00 70.27  ?  47   PHE B CA  1 
ATOM   4536  C  C   . PHE B  1 47  ? 3.443   37.896  53.560  1.00 73.56  ?  47   PHE B C   1 
ATOM   4537  O  O   . PHE B  1 47  ? 4.238   37.356  54.338  1.00 73.19  ?  47   PHE B O   1 
ATOM   4538  C  CB  . PHE B  1 47  ? 3.694   36.259  51.707  1.00 68.01  ?  47   PHE B CB  1 
ATOM   4539  C  CG  . PHE B  1 47  ? 3.069   35.448  50.608  1.00 67.36  ?  47   PHE B CG  1 
ATOM   4540  C  CD1 . PHE B  1 47  ? 2.134   34.467  50.895  1.00 66.10  ?  47   PHE B CD1 1 
ATOM   4541  C  CD2 . PHE B  1 47  ? 3.421   35.664  49.287  1.00 67.92  ?  47   PHE B CD2 1 
ATOM   4542  C  CE1 . PHE B  1 47  ? 1.559   33.722  49.883  1.00 64.87  ?  47   PHE B CE1 1 
ATOM   4543  C  CE2 . PHE B  1 47  ? 2.851   34.922  48.274  1.00 66.39  ?  47   PHE B CE2 1 
ATOM   4544  C  CZ  . PHE B  1 47  ? 1.919   33.950  48.572  1.00 64.98  ?  47   PHE B CZ  1 
ATOM   4545  N  N   . MET B  1 48  ? 3.238   39.205  53.562  1.00 77.61  ?  48   MET B N   1 
ATOM   4546  C  CA  . MET B  1 48  ? 3.906   40.127  54.465  1.00 83.16  ?  48   MET B CA  1 
ATOM   4547  C  C   . MET B  1 48  ? 3.124   40.284  55.765  1.00 82.69  ?  48   MET B C   1 
ATOM   4548  O  O   . MET B  1 48  ? 1.909   40.068  55.804  1.00 83.84  ?  48   MET B O   1 
ATOM   4549  C  CB  . MET B  1 48  ? 4.071   41.486  53.788  1.00 87.39  ?  48   MET B CB  1 
ATOM   4550  C  CG  . MET B  1 48  ? 4.932   41.460  52.540  1.00 89.59  ?  48   MET B CG  1 
ATOM   4551  S  SD  . MET B  1 48  ? 6.664   41.131  52.907  1.00 91.07  ?  48   MET B SD  1 
ATOM   4552  C  CE  . MET B  1 48  ? 6.956   42.321  54.210  1.00 93.96  ?  48   MET B CE  1 
ATOM   4553  N  N   . PRO B  1 49  ? 3.798   40.657  56.851  1.00 81.61  ?  49   PRO B N   1 
ATOM   4554  C  CA  . PRO B  1 49  ? 3.098   40.972  58.107  1.00 82.27  ?  49   PRO B CA  1 
ATOM   4555  C  C   . PRO B  1 49  ? 2.133   42.130  57.926  1.00 85.79  ?  49   PRO B C   1 
ATOM   4556  O  O   . PRO B  1 49  ? 2.336   42.985  57.050  1.00 87.27  ?  49   PRO B O   1 
ATOM   4557  C  CB  . PRO B  1 49  ? 4.243   41.358  59.056  1.00 77.75  ?  49   PRO B CB  1 
ATOM   4558  C  CG  . PRO B  1 49  ? 5.446   40.682  58.495  1.00 76.41  ?  49   PRO B CG  1 
ATOM   4559  C  CD  . PRO B  1 49  ? 5.263   40.705  57.011  1.00 84.28  ?  49   PRO B CD  1 
ATOM   4560  N  N   . PRO B  1 50  ? 1.075   42.204  58.735  1.00 84.39  ?  50   PRO B N   1 
ATOM   4561  C  CA  . PRO B  1 50  ? 0.103   43.292  58.570  1.00 86.42  ?  50   PRO B CA  1 
ATOM   4562  C  C   . PRO B  1 50  ? 0.650   44.627  59.048  1.00 90.45  ?  50   PRO B C   1 
ATOM   4563  O  O   . PRO B  1 50  ? 1.320   44.715  60.078  1.00 92.37  ?  50   PRO B O   1 
ATOM   4564  C  CB  . PRO B  1 50  ? -1.071  42.841  59.441  1.00 86.42  ?  50   PRO B CB  1 
ATOM   4565  C  CG  . PRO B  1 50  ? -0.407  42.086  60.540  1.00 87.47  ?  50   PRO B CG  1 
ATOM   4566  C  CD  . PRO B  1 50  ? 0.725   41.334  59.870  1.00 85.01  ?  50   PRO B CD  1 
ATOM   4567  N  N   . GLU B  1 51  ? 0.344   45.682  58.282  1.00 93.29  ?  51   GLU B N   1 
ATOM   4568  C  CA  . GLU B  1 51  ? 0.542   47.076  58.658  1.00 98.00  ?  51   GLU B CA  1 
ATOM   4569  C  C   . GLU B  1 51  ? -0.736  47.630  59.289  1.00 98.55  ?  51   GLU B C   1 
ATOM   4570  O  O   . GLU B  1 51  ? -1.836  47.323  58.821  1.00 98.24  ?  51   GLU B O   1 
ATOM   4571  C  CB  . GLU B  1 51  ? 0.930   47.913  57.441  1.00 102.53 ?  51   GLU B CB  1 
ATOM   4572  C  CG  . GLU B  1 51  ? 2.331   47.615  56.917  1.00 104.00 ?  51   GLU B CG  1 
ATOM   4573  C  CD  . GLU B  1 51  ? 2.629   48.298  55.589  1.00 106.01 ?  51   GLU B CD  1 
ATOM   4574  O  OE1 . GLU B  1 51  ? 1.750   48.294  54.699  1.00 105.29 ?  51   GLU B OE1 1 
ATOM   4575  O  OE2 . GLU B  1 51  ? 3.744   48.844  55.437  1.00 107.92 ?  51   GLU B OE2 1 
ATOM   4576  N  N   . PRO B  1 52  ? -0.632  48.432  60.354  1.00 99.16  ?  52   PRO B N   1 
ATOM   4577  C  CA  . PRO B  1 52  ? -1.844  48.951  61.005  1.00 100.53 ?  52   PRO B CA  1 
ATOM   4578  C  C   . PRO B  1 52  ? -2.636  49.872  60.084  1.00 105.03 ?  52   PRO B C   1 
ATOM   4579  O  O   . PRO B  1 52  ? -2.075  50.578  59.242  1.00 100.02 ?  52   PRO B O   1 
ATOM   4580  C  CB  . PRO B  1 52  ? -1.298  49.712  62.220  1.00 101.95 ?  52   PRO B CB  1 
ATOM   4581  C  CG  . PRO B  1 52  ? 0.069   49.156  62.443  1.00 100.39 ?  52   PRO B CG  1 
ATOM   4582  C  CD  . PRO B  1 52  ? 0.589   48.808  61.085  1.00 97.53  ?  52   PRO B CD  1 
ATOM   4583  N  N   . LYS B  1 53  ? -3.958  49.864  60.267  1.00 107.04 ?  53   LYS B N   1 
ATOM   4584  C  CA  . LYS B  1 53  ? -4.850  50.621  59.396  1.00 107.40 ?  53   LYS B CA  1 
ATOM   4585  C  C   . LYS B  1 53  ? -4.544  52.110  59.484  1.00 113.12 ?  53   LYS B C   1 
ATOM   4586  O  O   . LYS B  1 53  ? -4.479  52.679  60.579  1.00 116.74 ?  53   LYS B O   1 
ATOM   4587  C  CB  . LYS B  1 53  ? -6.311  50.356  59.772  1.00 104.98 ?  53   LYS B CB  1 
ATOM   4588  C  CG  . LYS B  1 53  ? -7.342  51.136  58.948  1.00 106.15 ?  53   LYS B CG  1 
ATOM   4589  C  CD  . LYS B  1 53  ? -7.107  50.974  57.449  1.00 104.75 ?  53   LYS B CD  1 
ATOM   4590  C  CE  . LYS B  1 53  ? -7.883  52.004  56.629  1.00 107.20 ?  53   LYS B CE  1 
ATOM   4591  N  NZ  . LYS B  1 53  ? -9.068  51.420  55.940  1.00 101.64 ?  53   LYS B NZ  1 
ATOM   4592  N  N   . ARG B  1 54  ? -4.347  52.736  58.323  1.00 113.07 ?  54   ARG B N   1 
ATOM   4593  C  CA  . ARG B  1 54  ? -4.075  54.165  58.281  1.00 115.05 ?  54   ARG B CA  1 
ATOM   4594  C  C   . ARG B  1 54  ? -5.291  54.942  58.776  1.00 115.68 ?  54   ARG B C   1 
ATOM   4595  O  O   . ARG B  1 54  ? -6.429  54.551  58.499  1.00 112.79 ?  54   ARG B O   1 
ATOM   4596  C  CB  . ARG B  1 54  ? -3.727  54.609  56.862  1.00 117.22 ?  54   ARG B CB  1 
ATOM   4597  C  CG  . ARG B  1 54  ? -2.343  54.194  56.392  1.00 118.50 ?  54   ARG B CG  1 
ATOM   4598  C  CD  . ARG B  1 54  ? -1.343  55.327  56.541  1.00 125.53 ?  54   ARG B CD  1 
ATOM   4599  N  NE  . ARG B  1 54  ? -0.438  55.415  55.396  1.00 126.97 ?  54   ARG B NE  1 
ATOM   4600  C  CZ  . ARG B  1 54  ? -0.578  56.285  54.398  1.00 129.50 ?  54   ARG B CZ  1 
ATOM   4601  N  NH1 . ARG B  1 54  ? -1.585  57.150  54.408  1.00 131.39 ?  54   ARG B NH1 1 
ATOM   4602  N  NH2 . ARG B  1 54  ? 0.291   56.295  53.396  1.00 129.51 ?  54   ARG B NH2 1 
ATOM   4603  N  N   . PRO B  1 55  ? -5.084  56.037  59.507  1.00 119.87 ?  55   PRO B N   1 
ATOM   4604  C  CA  . PRO B  1 55  ? -6.223  56.828  59.988  1.00 125.33 ?  55   PRO B CA  1 
ATOM   4605  C  C   . PRO B  1 55  ? -7.061  57.360  58.834  1.00 125.70 ?  55   PRO B C   1 
ATOM   4606  O  O   . PRO B  1 55  ? -6.543  57.706  57.770  1.00 121.34 ?  55   PRO B O   1 
ATOM   4607  C  CB  . PRO B  1 55  ? -5.560  57.963  60.778  1.00 129.24 ?  55   PRO B CB  1 
ATOM   4608  C  CG  . PRO B  1 55  ? -4.199  57.442  61.127  1.00 126.47 ?  55   PRO B CG  1 
ATOM   4609  C  CD  . PRO B  1 55  ? -3.797  56.577  59.975  1.00 122.46 ?  55   PRO B CD  1 
ATOM   4610  N  N   . TRP B  1 56  ? -8.370  57.416  59.059  1.00 123.27 ?  56   TRP B N   1 
ATOM   4611  C  CA  . TRP B  1 56  ? -9.340  57.794  58.045  1.00 123.75 ?  56   TRP B CA  1 
ATOM   4612  C  C   . TRP B  1 56  ? -10.194 58.958  58.537  1.00 132.66 ?  56   TRP B C   1 
ATOM   4613  O  O   . TRP B  1 56  ? -10.213 59.292  59.727  1.00 136.22 ?  56   TRP B O   1 
ATOM   4614  C  CB  . TRP B  1 56  ? -10.233 56.603  57.656  1.00 120.07 ?  56   TRP B CB  1 
ATOM   4615  C  CG  . TRP B  1 56  ? -11.220 56.190  58.714  1.00 121.16 ?  56   TRP B CG  1 
ATOM   4616  C  CD1 . TRP B  1 56  ? -12.480 56.685  58.897  1.00 124.33 ?  56   TRP B CD1 1 
ATOM   4617  C  CD2 . TRP B  1 56  ? -11.032 55.193  59.728  1.00 119.38 ?  56   TRP B CD2 1 
ATOM   4618  N  NE1 . TRP B  1 56  ? -13.085 56.062  59.962  1.00 124.66 ?  56   TRP B NE1 1 
ATOM   4619  C  CE2 . TRP B  1 56  ? -12.218 55.142  60.490  1.00 121.59 ?  56   TRP B CE2 1 
ATOM   4620  C  CE3 . TRP B  1 56  ? -9.976  54.340  60.066  1.00 116.48 ?  56   TRP B CE3 1 
ATOM   4621  C  CZ2 . TRP B  1 56  ? -12.376 54.272  61.568  1.00 120.81 ?  56   TRP B CZ2 1 
ATOM   4622  C  CZ3 . TRP B  1 56  ? -10.137 53.477  61.137  1.00 115.35 ?  56   TRP B CZ3 1 
ATOM   4623  C  CH2 . TRP B  1 56  ? -11.328 53.450  61.875  1.00 117.64 ?  56   TRP B CH2 1 
ATOM   4624  N  N   . SER B  1 57  ? -10.889 59.585  57.595  1.00 132.82 ?  57   SER B N   1 
ATOM   4625  C  CA  . SER B  1 57  ? -11.770 60.705  57.875  1.00 137.19 ?  57   SER B CA  1 
ATOM   4626  C  C   . SER B  1 57  ? -13.214 60.320  57.577  1.00 135.31 ?  57   SER B C   1 
ATOM   4627  O  O   . SER B  1 57  ? -13.495 59.437  56.762  1.00 131.47 ?  57   SER B O   1 
ATOM   4628  C  CB  . SER B  1 57  ? -11.364 61.940  57.055  1.00 141.01 ?  57   SER B CB  1 
ATOM   4629  O  OG  . SER B  1 57  ? -11.199 61.632  55.678  1.00 139.29 ?  57   SER B OG  1 
ATOM   4630  N  N   . GLY B  1 58  ? -14.130 60.986  58.259  1.00 139.74 ?  58   GLY B N   1 
ATOM   4631  C  CA  . GLY B  1 58  ? -15.534 60.677  58.108  1.00 140.28 ?  58   GLY B CA  1 
ATOM   4632  C  C   . GLY B  1 58  ? -15.993 59.638  59.108  1.00 140.04 ?  58   GLY B C   1 
ATOM   4633  O  O   . GLY B  1 58  ? -15.256 59.196  59.996  1.00 138.85 ?  58   GLY B O   1 
ATOM   4634  N  N   . VAL B  1 59  ? -17.248 59.238  58.947  1.00 140.81 ?  59   VAL B N   1 
ATOM   4635  C  CA  . VAL B  1 59  ? -17.875 58.251  59.815  1.00 139.89 ?  59   VAL B CA  1 
ATOM   4636  C  C   . VAL B  1 59  ? -17.871 56.925  59.070  1.00 134.44 ?  59   VAL B C   1 
ATOM   4637  O  O   . VAL B  1 59  ? -18.617 56.740  58.103  1.00 132.16 ?  59   VAL B O   1 
ATOM   4638  C  CB  . VAL B  1 59  ? -19.299 58.665  60.210  1.00 144.31 ?  59   VAL B CB  1 
ATOM   4639  C  CG1 . VAL B  1 59  ? -19.805 57.798  61.349  1.00 145.13 ?  59   VAL B CG1 1 
ATOM   4640  C  CG2 . VAL B  1 59  ? -19.337 60.136  60.603  1.00 149.41 ?  59   VAL B CG2 1 
ATOM   4641  N  N   . LEU B  1 60  ? -17.045 55.992  59.538  1.00 131.61 ?  60   LEU B N   1 
ATOM   4642  C  CA  . LEU B  1 60  ? -16.928 54.690  58.900  1.00 126.97 ?  60   LEU B CA  1 
ATOM   4643  C  C   . LEU B  1 60  ? -18.102 53.805  59.285  1.00 128.01 ?  60   LEU B C   1 
ATOM   4644  O  O   . LEU B  1 60  ? -18.443 53.677  60.466  1.00 131.06 ?  60   LEU B O   1 
ATOM   4645  C  CB  . LEU B  1 60  ? -15.615 54.011  59.283  1.00 123.12 ?  60   LEU B CB  1 
ATOM   4646  C  CG  . LEU B  1 60  ? -15.426 52.597  58.722  1.00 118.34 ?  60   LEU B CG  1 
ATOM   4647  C  CD1 . LEU B  1 60  ? -15.633 52.550  57.209  1.00 117.68 ?  60   LEU B CD1 1 
ATOM   4648  C  CD2 . LEU B  1 60  ? -14.055 52.075  59.087  1.00 114.80 ?  60   LEU B CD2 1 
ATOM   4649  N  N   . ASP B  1 61  ? -18.712 53.190  58.281  1.00 125.77 ?  61   ASP B N   1 
ATOM   4650  C  CA  . ASP B  1 61  ? -19.844 52.308  58.496  1.00 125.80 ?  61   ASP B CA  1 
ATOM   4651  C  C   . ASP B  1 61  ? -19.337 50.946  58.942  1.00 121.90 ?  61   ASP B C   1 
ATOM   4652  O  O   . ASP B  1 61  ? -18.620 50.276  58.189  1.00 117.96 ?  61   ASP B O   1 
ATOM   4653  C  CB  . ASP B  1 61  ? -20.635 52.182  57.194  1.00 125.14 ?  61   ASP B CB  1 
ATOM   4654  C  CG  . ASP B  1 61  ? -21.893 51.357  57.340  1.00 126.16 ?  61   ASP B CG  1 
ATOM   4655  O  OD1 . ASP B  1 61  ? -21.805 50.111  57.315  1.00 118.60 ?  61   ASP B OD1 1 
ATOM   4656  O  OD2 . ASP B  1 61  ? -22.979 51.966  57.437  1.00 130.99 ?  61   ASP B OD2 1 
ATOM   4657  N  N   . ALA B  1 62  ? -19.701 50.522  60.153  1.00 123.41 ?  62   ALA B N   1 
ATOM   4658  C  CA  . ALA B  1 62  ? -19.766 49.089  60.412  1.00 119.56 ?  62   ALA B CA  1 
ATOM   4659  C  C   . ALA B  1 62  ? -21.231 48.775  60.684  1.00 123.50 ?  62   ALA B C   1 
ATOM   4660  O  O   . ALA B  1 62  ? -21.685 48.850  61.828  1.00 126.26 ?  62   ALA B O   1 
ATOM   4661  C  CB  . ALA B  1 62  ? -18.882 48.748  61.614  1.00 116.67 ?  62   ALA B CB  1 
ATOM   4662  N  N   . THR B  1 63  ? -21.955 48.356  59.642  1.00 123.97 ?  63   THR B N   1 
ATOM   4663  C  CA  . THR B  1 63  ? -23.251 47.710  59.780  1.00 125.49 ?  63   THR B CA  1 
ATOM   4664  C  C   . THR B  1 63  ? -23.257 46.217  59.476  1.00 120.44 ?  63   THR B C   1 
ATOM   4665  O  O   . THR B  1 63  ? -24.278 45.561  59.714  1.00 120.71 ?  63   THR B O   1 
ATOM   4666  C  CB  . THR B  1 63  ? -24.285 48.423  58.890  1.00 128.98 ?  63   THR B CB  1 
ATOM   4667  O  OG1 . THR B  1 63  ? -23.923 48.294  57.510  1.00 125.96 ?  63   THR B OG1 1 
ATOM   4668  C  CG2 . THR B  1 63  ? -24.357 49.901  59.249  1.00 133.34 ?  63   THR B CG2 1 
ATOM   4669  N  N   . THR B  1 64  ? -22.155 45.662  58.973  1.00 116.02 ?  64   THR B N   1 
ATOM   4670  C  CA  . THR B  1 64  ? -22.207 44.377  58.286  1.00 111.28 ?  64   THR B CA  1 
ATOM   4671  C  C   . THR B  1 64  ? -20.856 43.691  58.386  1.00 107.21 ?  64   THR B C   1 
ATOM   4672  O  O   . THR B  1 64  ? -19.816 44.346  58.491  1.00 107.17 ?  64   THR B O   1 
ATOM   4673  C  CB  . THR B  1 64  ? -22.577 44.517  56.796  1.00 108.29 ?  64   THR B CB  1 
ATOM   4674  O  OG1 . THR B  1 64  ? -21.894 45.644  56.231  1.00 107.10 ?  64   THR B OG1 1 
ATOM   4675  C  CG2 . THR B  1 64  ? -24.086 44.673  56.594  1.00 110.80 ?  64   THR B CG2 1 
ATOM   4676  N  N   . PHE B  1 65  ? -20.881 42.366  58.315  1.00 104.17 ?  65   PHE B N   1 
ATOM   4677  C  CA  . PHE B  1 65  ? -19.642 41.607  58.290  1.00 100.18 ?  65   PHE B CA  1 
ATOM   4678  C  C   . PHE B  1 65  ? -18.880 41.904  57.004  1.00 98.33  ?  65   PHE B C   1 
ATOM   4679  O  O   . PHE B  1 65  ? -19.471 42.056  55.929  1.00 98.81  ?  65   PHE B O   1 
ATOM   4680  C  CB  . PHE B  1 65  ? -19.932 40.110  58.415  1.00 97.08  ?  65   PHE B CB  1 
ATOM   4681  C  CG  . PHE B  1 65  ? -20.427 39.699  59.778  1.00 98.10  ?  65   PHE B CG  1 
ATOM   4682  C  CD1 . PHE B  1 65  ? -19.599 39.783  60.887  1.00 97.68  ?  65   PHE B CD1 1 
ATOM   4683  C  CD2 . PHE B  1 65  ? -21.721 39.230  59.950  1.00 99.63  ?  65   PHE B CD2 1 
ATOM   4684  C  CE1 . PHE B  1 65  ? -20.051 39.409  62.140  1.00 97.71  ?  65   PHE B CE1 1 
ATOM   4685  C  CE2 . PHE B  1 65  ? -22.178 38.853  61.203  1.00 101.08 ?  65   PHE B CE2 1 
ATOM   4686  C  CZ  . PHE B  1 65  ? -21.341 38.943  62.298  1.00 99.93  ?  65   PHE B CZ  1 
ATOM   4687  N  N   . GLN B  1 66  ? -17.560 42.009  57.124  1.00 95.70  ?  66   GLN B N   1 
ATOM   4688  C  CA  . GLN B  1 66  ? -16.700 42.276  55.979  1.00 92.76  ?  66   GLN B CA  1 
ATOM   4689  C  C   . GLN B  1 66  ? -16.416 40.968  55.245  1.00 87.97  ?  66   GLN B C   1 
ATOM   4690  O  O   . GLN B  1 66  ? -17.036 39.933  55.503  1.00 87.08  ?  66   GLN B O   1 
ATOM   4691  C  CB  . GLN B  1 66  ? -15.424 42.979  56.427  1.00 93.20  ?  66   GLN B CB  1 
ATOM   4692  C  CG  . GLN B  1 66  ? -15.460 44.494  56.276  1.00 97.92  ?  66   GLN B CG  1 
ATOM   4693  C  CD  . GLN B  1 66  ? -15.481 44.947  54.825  1.00 98.48  ?  66   GLN B CD  1 
ATOM   4694  O  OE1 . GLN B  1 66  ? -15.242 44.158  53.911  1.00 95.82  ?  66   GLN B OE1 1 
ATOM   4695  N  NE2 . GLN B  1 66  ? -15.761 46.228  54.609  1.00 101.66 ?  66   GLN B NE2 1 
ATOM   4696  N  N   . ASN B  1 67  ? -15.477 41.005  54.307  1.00 86.63  ?  67   ASN B N   1 
ATOM   4697  C  CA  . ASN B  1 67  ? -15.205 39.844  53.476  1.00 85.07  ?  67   ASN B CA  1 
ATOM   4698  C  C   . ASN B  1 67  ? -14.511 38.745  54.277  1.00 85.42  ?  67   ASN B C   1 
ATOM   4699  O  O   . ASN B  1 67  ? -13.895 38.984  55.321  1.00 87.04  ?  67   ASN B O   1 
ATOM   4700  C  CB  . ASN B  1 67  ? -14.349 40.238  52.273  1.00 82.00  ?  67   ASN B CB  1 
ATOM   4701  C  CG  . ASN B  1 67  ? -15.028 41.266  51.393  1.00 83.36  ?  67   ASN B CG  1 
ATOM   4702  O  OD1 . ASN B  1 67  ? -16.181 41.097  50.989  1.00 84.05  ?  67   ASN B OD1 1 
ATOM   4703  N  ND2 . ASN B  1 67  ? -14.315 42.345  51.092  1.00 84.43  ?  67   ASN B ND2 1 
ATOM   4704  N  N   . VAL B  1 68  ? -14.630 37.523  53.775  1.00 84.16  ?  68   VAL B N   1 
ATOM   4705  C  CA  . VAL B  1 68  ? -13.984 36.358  54.363  1.00 83.00  ?  68   VAL B CA  1 
ATOM   4706  C  C   . VAL B  1 68  ? -12.599 36.224  53.750  1.00 82.08  ?  68   VAL B C   1 
ATOM   4707  O  O   . VAL B  1 68  ? -12.425 36.419  52.541  1.00 83.60  ?  68   VAL B O   1 
ATOM   4708  C  CB  . VAL B  1 68  ? -14.834 35.093  54.126  1.00 82.16  ?  68   VAL B CB  1 
ATOM   4709  C  CG1 . VAL B  1 68  ? -14.110 33.845  54.618  1.00 80.01  ?  68   VAL B CG1 1 
ATOM   4710  C  CG2 . VAL B  1 68  ? -16.201 35.235  54.789  1.00 84.76  ?  68   VAL B CG2 1 
ATOM   4711  N  N   . CYS B  1 69  ? -11.602 35.916  54.579  1.00 80.71  ?  69   CYS B N   1 
ATOM   4712  C  CA  . CYS B  1 69  ? -10.258 35.691  54.063  1.00 79.48  ?  69   CYS B CA  1 
ATOM   4713  C  C   . CYS B  1 69  ? -10.275 34.594  53.008  1.00 74.10  ?  69   CYS B C   1 
ATOM   4714  O  O   . CYS B  1 69  ? -11.011 33.610  53.123  1.00 74.44  ?  69   CYS B O   1 
ATOM   4715  C  CB  . CYS B  1 69  ? -9.298  35.325  55.197  1.00 82.71  ?  69   CYS B CB  1 
ATOM   4716  S  SG  . CYS B  1 69  ? -8.757  36.729  56.215  1.00 87.10  ?  69   CYS B SG  1 
ATOM   4717  N  N   . TYR B  1 70  ? -9.474  34.779  51.962  1.00 69.86  ?  70   TYR B N   1 
ATOM   4718  C  CA  . TYR B  1 70  ? -9.497  33.847  50.844  1.00 68.48  ?  70   TYR B CA  1 
ATOM   4719  C  C   . TYR B  1 70  ? -9.045  32.464  51.291  1.00 67.89  ?  70   TYR B C   1 
ATOM   4720  O  O   . TYR B  1 70  ? -8.014  32.315  51.956  1.00 67.21  ?  70   TYR B O   1 
ATOM   4721  C  CB  . TYR B  1 70  ? -8.618  34.353  49.705  1.00 67.61  ?  70   TYR B CB  1 
ATOM   4722  C  CG  . TYR B  1 70  ? -9.127  33.898  48.366  1.00 67.92  ?  70   TYR B CG  1 
ATOM   4723  C  CD1 . TYR B  1 70  ? -8.728  32.682  47.834  1.00 68.19  ?  70   TYR B CD1 1 
ATOM   4724  C  CD2 . TYR B  1 70  ? -10.034 34.664  47.652  1.00 70.21  ?  70   TYR B CD2 1 
ATOM   4725  C  CE1 . TYR B  1 70  ? -9.202  32.249  46.615  1.00 70.89  ?  70   TYR B CE1 1 
ATOM   4726  C  CE2 . TYR B  1 70  ? -10.515 34.242  46.433  1.00 73.26  ?  70   TYR B CE2 1 
ATOM   4727  C  CZ  . TYR B  1 70  ? -10.094 33.032  45.917  1.00 74.27  ?  70   TYR B CZ  1 
ATOM   4728  O  OH  . TYR B  1 70  ? -10.566 32.602  44.698  1.00 77.45  ?  70   TYR B OH  1 
ATOM   4729  N  N   . GLN B  1 71  ? -9.835  31.452  50.941  1.00 68.73  ?  71   GLN B N   1 
ATOM   4730  C  CA  . GLN B  1 71  ? -9.631  30.122  51.494  1.00 70.00  ?  71   GLN B CA  1 
ATOM   4731  C  C   . GLN B  1 71  ? -10.271 29.080  50.590  1.00 69.32  ?  71   GLN B C   1 
ATOM   4732  O  O   . GLN B  1 71  ? -11.100 29.396  49.731  1.00 68.48  ?  71   GLN B O   1 
ATOM   4733  C  CB  . GLN B  1 71  ? -10.214 30.021  52.903  1.00 73.85  ?  71   GLN B CB  1 
ATOM   4734  C  CG  . GLN B  1 71  ? -11.719 30.209  52.924  1.00 77.86  ?  71   GLN B CG  1 
ATOM   4735  C  CD  . GLN B  1 71  ? -12.294 30.131  54.313  1.00 79.74  ?  71   GLN B CD  1 
ATOM   4736  O  OE1 . GLN B  1 71  ? -13.126 29.270  54.604  1.00 79.96  ?  71   GLN B OE1 1 
ATOM   4737  N  NE2 . GLN B  1 71  ? -11.853 31.029  55.185  1.00 81.24  ?  71   GLN B NE2 1 
ATOM   4738  N  N   . TYR B  1 72  ? -9.863  27.828  50.803  1.00 68.58  ?  72   TYR B N   1 
ATOM   4739  C  CA  . TYR B  1 72  ? -10.566 26.686  50.235  1.00 68.15  ?  72   TYR B CA  1 
ATOM   4740  C  C   . TYR B  1 72  ? -11.971 26.583  50.824  1.00 72.25  ?  72   TYR B C   1 
ATOM   4741  O  O   . TYR B  1 72  ? -12.203 26.888  51.999  1.00 75.19  ?  72   TYR B O   1 
ATOM   4742  C  CB  . TYR B  1 72  ? -9.780  25.405  50.513  1.00 64.99  ?  72   TYR B CB  1 
ATOM   4743  C  CG  . TYR B  1 72  ? -10.454 24.112  50.098  1.00 65.96  ?  72   TYR B CG  1 
ATOM   4744  C  CD1 . TYR B  1 72  ? -10.251 23.573  48.834  1.00 66.31  ?  72   TYR B CD1 1 
ATOM   4745  C  CD2 . TYR B  1 72  ? -11.268 23.413  50.982  1.00 66.98  ?  72   TYR B CD2 1 
ATOM   4746  C  CE1 . TYR B  1 72  ? -10.855 22.383  48.458  1.00 67.02  ?  72   TYR B CE1 1 
ATOM   4747  C  CE2 . TYR B  1 72  ? -11.875 22.226  50.613  1.00 67.88  ?  72   TYR B CE2 1 
ATOM   4748  C  CZ  . TYR B  1 72  ? -11.667 21.718  49.351  1.00 68.17  ?  72   TYR B CZ  1 
ATOM   4749  O  OH  . TYR B  1 72  ? -12.271 20.538  48.983  1.00 70.50  ?  72   TYR B OH  1 
ATOM   4750  N  N   . VAL B  1 73  ? -12.915 26.143  49.994  1.00 72.48  ?  73   VAL B N   1 
ATOM   4751  C  CA  . VAL B  1 73  ? -14.312 25.993  50.386  1.00 72.78  ?  73   VAL B CA  1 
ATOM   4752  C  C   . VAL B  1 73  ? -14.674 24.516  50.309  1.00 76.51  ?  73   VAL B C   1 
ATOM   4753  O  O   . VAL B  1 73  ? -14.258 23.818  49.376  1.00 77.68  ?  73   VAL B O   1 
ATOM   4754  C  CB  . VAL B  1 73  ? -15.236 26.841  49.488  1.00 68.56  ?  73   VAL B CB  1 
ATOM   4755  C  CG1 . VAL B  1 73  ? -16.698 26.605  49.843  1.00 69.93  ?  73   VAL B CG1 1 
ATOM   4756  C  CG2 . VAL B  1 73  ? -14.866 28.306  49.604  1.00 66.47  ?  73   VAL B CG2 1 
ATOM   4757  N  N   . ASP B  1 74  ? -15.455 24.037  51.279  1.00 77.87  ?  74   ASP B N   1 
ATOM   4758  C  CA  . ASP B  1 74  ? -15.685 22.603  51.387  1.00 78.15  ?  74   ASP B CA  1 
ATOM   4759  C  C   . ASP B  1 74  ? -16.736 22.186  50.365  1.00 78.81  ?  74   ASP B C   1 
ATOM   4760  O  O   . ASP B  1 74  ? -17.903 22.586  50.456  1.00 79.04  ?  74   ASP B O   1 
ATOM   4761  C  CB  . ASP B  1 74  ? -16.123 22.255  52.811  1.00 80.43  ?  74   ASP B CB  1 
ATOM   4762  C  CG  . ASP B  1 74  ? -16.238 20.757  53.046  1.00 81.58  ?  74   ASP B CG  1 
ATOM   4763  O  OD1 . ASP B  1 74  ? -17.219 20.149  52.564  1.00 83.75  ?  74   ASP B OD1 1 
ATOM   4764  O  OD2 . ASP B  1 74  ? -15.340 20.191  53.713  1.00 79.91  ?  74   ASP B OD2 1 
ATOM   4765  N  N   . THR B  1 75  ? -16.315 21.369  49.401  1.00 79.10  ?  75   THR B N   1 
ATOM   4766  C  CA  . THR B  1 75  ? -17.182 20.857  48.351  1.00 82.09  ?  75   THR B CA  1 
ATOM   4767  C  C   . THR B  1 75  ? -17.662 19.432  48.591  1.00 83.65  ?  75   THR B C   1 
ATOM   4768  O  O   . THR B  1 75  ? -18.418 18.911  47.764  1.00 87.95  ?  75   THR B O   1 
ATOM   4769  C  CB  . THR B  1 75  ? -16.467 20.929  46.997  1.00 81.66  ?  75   THR B CB  1 
ATOM   4770  O  OG1 . THR B  1 75  ? -15.248 20.181  47.060  1.00 79.90  ?  75   THR B OG1 1 
ATOM   4771  C  CG2 . THR B  1 75  ? -16.161 22.372  46.631  1.00 81.71  ?  75   THR B CG2 1 
ATOM   4772  N  N   . LEU B  1 76  ? -17.239 18.788  49.683  1.00 79.31  ?  76   LEU B N   1 
ATOM   4773  C  CA  . LEU B  1 76  ? -17.455 17.350  49.828  1.00 76.81  ?  76   LEU B CA  1 
ATOM   4774  C  C   . LEU B  1 76  ? -18.938 17.001  49.837  1.00 77.76  ?  76   LEU B C   1 
ATOM   4775  O  O   . LEU B  1 76  ? -19.376 16.078  49.139  1.00 76.60  ?  76   LEU B O   1 
ATOM   4776  C  CB  . LEU B  1 76  ? -16.779 16.837  51.101  1.00 75.32  ?  76   LEU B CB  1 
ATOM   4777  C  CG  . LEU B  1 76  ? -17.091 15.384  51.484  1.00 76.01  ?  76   LEU B CG  1 
ATOM   4778  C  CD1 . LEU B  1 76  ? -16.668 14.420  50.384  1.00 76.76  ?  76   LEU B CD1 1 
ATOM   4779  C  CD2 . LEU B  1 76  ? -16.441 15.010  52.816  1.00 73.11  ?  76   LEU B CD2 1 
ATOM   4780  N  N   . TYR B  1 77  ? -19.728 17.722  50.631  1.00 80.83  ?  77   TYR B N   1 
ATOM   4781  C  CA  . TYR B  1 77  ? -21.160 17.472  50.778  1.00 86.47  ?  77   TYR B CA  1 
ATOM   4782  C  C   . TYR B  1 77  ? -21.892 18.768  50.454  1.00 90.16  ?  77   TYR B C   1 
ATOM   4783  O  O   . TYR B  1 77  ? -22.274 19.519  51.365  1.00 93.49  ?  77   TYR B O   1 
ATOM   4784  C  CB  . TYR B  1 77  ? -21.495 16.971  52.185  1.00 86.94  ?  77   TYR B CB  1 
ATOM   4785  C  CG  . TYR B  1 77  ? -20.934 15.599  52.516  1.00 84.57  ?  77   TYR B CG  1 
ATOM   4786  C  CD1 . TYR B  1 77  ? -21.108 14.525  51.649  1.00 84.29  ?  77   TYR B CD1 1 
ATOM   4787  C  CD2 . TYR B  1 77  ? -20.214 15.383  53.687  1.00 82.25  ?  77   TYR B CD2 1 
ATOM   4788  C  CE1 . TYR B  1 77  ? -20.595 13.270  51.947  1.00 82.62  ?  77   TYR B CE1 1 
ATOM   4789  C  CE2 . TYR B  1 77  ? -19.693 14.132  53.991  1.00 80.27  ?  77   TYR B CE2 1 
ATOM   4790  C  CZ  . TYR B  1 77  ? -19.887 13.081  53.118  1.00 80.00  ?  77   TYR B CZ  1 
ATOM   4791  O  OH  . TYR B  1 77  ? -19.373 11.838  53.418  1.00 77.49  ?  77   TYR B OH  1 
ATOM   4792  N  N   . PRO B  1 78  ? -22.100 19.067  49.169  1.00 89.25  ?  78   PRO B N   1 
ATOM   4793  C  CA  . PRO B  1 78  ? -22.721 20.347  48.798  1.00 89.56  ?  78   PRO B CA  1 
ATOM   4794  C  C   . PRO B  1 78  ? -24.136 20.470  49.347  1.00 93.46  ?  78   PRO B C   1 
ATOM   4795  O  O   . PRO B  1 78  ? -24.934 19.532  49.280  1.00 96.28  ?  78   PRO B O   1 
ATOM   4796  C  CB  . PRO B  1 78  ? -22.712 20.316  47.265  1.00 87.97  ?  78   PRO B CB  1 
ATOM   4797  C  CG  . PRO B  1 78  ? -21.643 19.331  46.903  1.00 85.34  ?  78   PRO B CG  1 
ATOM   4798  C  CD  . PRO B  1 78  ? -21.684 18.292  47.987  1.00 86.77  ?  78   PRO B CD  1 
ATOM   4799  N  N   . GLY B  1 79  ? -24.435 21.644  49.906  1.00 93.58  ?  79   GLY B N   1 
ATOM   4800  C  CA  . GLY B  1 79  ? -25.732 21.928  50.486  1.00 97.10  ?  79   GLY B CA  1 
ATOM   4801  C  C   . GLY B  1 79  ? -25.972 21.343  51.860  1.00 98.61  ?  79   GLY B C   1 
ATOM   4802  O  O   . GLY B  1 79  ? -27.048 21.572  52.430  1.00 101.91 ?  79   GLY B O   1 
ATOM   4803  N  N   . PHE B  1 80  ? -25.012 20.604  52.414  1.00 96.75  ?  80   PHE B N   1 
ATOM   4804  C  CA  . PHE B  1 80  ? -25.180 19.917  53.689  1.00 97.45  ?  80   PHE B CA  1 
ATOM   4805  C  C   . PHE B  1 80  ? -24.826 20.847  54.846  1.00 96.76  ?  80   PHE B C   1 
ATOM   4806  O  O   . PHE B  1 80  ? -23.725 21.405  54.889  1.00 93.66  ?  80   PHE B O   1 
ATOM   4807  C  CB  . PHE B  1 80  ? -24.317 18.653  53.725  1.00 94.59  ?  80   PHE B CB  1 
ATOM   4808  C  CG  . PHE B  1 80  ? -24.291 17.965  55.059  1.00 94.33  ?  80   PHE B CG  1 
ATOM   4809  C  CD1 . PHE B  1 80  ? -25.462 17.529  55.655  1.00 97.91  ?  80   PHE B CD1 1 
ATOM   4810  C  CD2 . PHE B  1 80  ? -23.090 17.741  55.711  1.00 91.05  ?  80   PHE B CD2 1 
ATOM   4811  C  CE1 . PHE B  1 80  ? -25.435 16.893  56.884  1.00 98.47  ?  80   PHE B CE1 1 
ATOM   4812  C  CE2 . PHE B  1 80  ? -23.057 17.103  56.937  1.00 91.56  ?  80   PHE B CE2 1 
ATOM   4813  C  CZ  . PHE B  1 80  ? -24.231 16.681  57.525  1.00 95.22  ?  80   PHE B CZ  1 
ATOM   4814  N  N   . GLU B  1 81  ? -25.770 21.004  55.782  1.00 99.78  ?  81   GLU B N   1 
ATOM   4815  C  CA  . GLU B  1 81  ? -25.601 21.944  56.888  1.00 101.37 ?  81   GLU B CA  1 
ATOM   4816  C  C   . GLU B  1 81  ? -24.347 21.654  57.707  1.00 100.27 ?  81   GLU B C   1 
ATOM   4817  O  O   . GLU B  1 81  ? -23.712 22.586  58.216  1.00 98.72  ?  81   GLU B O   1 
ATOM   4818  C  CB  . GLU B  1 81  ? -26.844 21.916  57.780  1.00 106.38 ?  81   GLU B CB  1 
ATOM   4819  C  CG  . GLU B  1 81  ? -26.678 22.566  59.154  1.00 108.44 ?  81   GLU B CG  1 
ATOM   4820  C  CD  . GLU B  1 81  ? -27.004 24.051  59.159  1.00 110.68 ?  81   GLU B CD  1 
ATOM   4821  O  OE1 . GLU B  1 81  ? -27.172 24.631  58.063  1.00 111.19 ?  81   GLU B OE1 1 
ATOM   4822  O  OE2 . GLU B  1 81  ? -27.096 24.634  60.263  1.00 111.68 ?  81   GLU B OE2 1 
ATOM   4823  N  N   . GLY B  1 82  ? -23.971 20.379  57.840  1.00 101.48 ?  82   GLY B N   1 
ATOM   4824  C  CA  . GLY B  1 82  ? -22.806 20.038  58.646  1.00 99.74  ?  82   GLY B CA  1 
ATOM   4825  C  C   . GLY B  1 82  ? -21.521 20.646  58.114  1.00 96.46  ?  82   GLY B C   1 
ATOM   4826  O  O   . GLY B  1 82  ? -20.737 21.227  58.868  1.00 95.42  ?  82   GLY B O   1 
ATOM   4827  N  N   . THR B  1 83  ? -21.270 20.492  56.809  1.00 93.90  ?  83   THR B N   1 
ATOM   4828  C  CA  . THR B  1 83  ? -20.097 21.116  56.202  1.00 88.93  ?  83   THR B CA  1 
ATOM   4829  C  C   . THR B  1 83  ? -20.327 22.591  55.880  1.00 90.03  ?  83   THR B C   1 
ATOM   4830  O  O   . THR B  1 83  ? -19.466 23.431  56.170  1.00 90.04  ?  83   THR B O   1 
ATOM   4831  C  CB  . THR B  1 83  ? -19.695 20.357  54.936  1.00 85.34  ?  83   THR B CB  1 
ATOM   4832  O  OG1 . THR B  1 83  ? -20.851 20.141  54.118  1.00 87.07  ?  83   THR B OG1 1 
ATOM   4833  C  CG2 . THR B  1 83  ? -19.073 19.019  55.290  1.00 83.34  ?  83   THR B CG2 1 
ATOM   4834  N  N   . GLU B  1 84  ? -21.484 22.930  55.304  1.00 91.02  ?  84   GLU B N   1 
ATOM   4835  C  CA  . GLU B  1 84  ? -21.705 24.287  54.806  1.00 90.63  ?  84   GLU B CA  1 
ATOM   4836  C  C   . GLU B  1 84  ? -21.874 25.294  55.933  1.00 89.79  ?  84   GLU B C   1 
ATOM   4837  O  O   . GLU B  1 84  ? -21.711 26.497  55.708  1.00 88.66  ?  84   GLU B O   1 
ATOM   4838  C  CB  . GLU B  1 84  ? -22.933 24.318  53.894  1.00 94.86  ?  84   GLU B CB  1 
ATOM   4839  C  CG  . GLU B  1 84  ? -22.816 25.251  52.696  1.00 96.32  ?  84   GLU B CG  1 
ATOM   4840  C  CD  . GLU B  1 84  ? -22.313 24.540  51.449  1.00 96.04  ?  84   GLU B CD  1 
ATOM   4841  O  OE1 . GLU B  1 84  ? -22.870 23.473  51.109  1.00 96.62  ?  84   GLU B OE1 1 
ATOM   4842  O  OE2 . GLU B  1 84  ? -21.366 25.049  50.806  1.00 94.98  ?  84   GLU B OE2 1 
ATOM   4843  N  N   . MET B  1 85  ? -22.210 24.822  57.133  1.00 91.40  ?  85   MET B N   1 
ATOM   4844  C  CA  . MET B  1 85  ? -22.273 25.688  58.303  1.00 94.26  ?  85   MET B CA  1 
ATOM   4845  C  C   . MET B  1 85  ? -20.955 26.425  58.507  1.00 90.65  ?  85   MET B C   1 
ATOM   4846  O  O   . MET B  1 85  ? -20.935 27.587  58.932  1.00 90.81  ?  85   MET B O   1 
ATOM   4847  C  CB  . MET B  1 85  ? -22.634 24.838  59.523  1.00 98.90  ?  85   MET B CB  1 
ATOM   4848  C  CG  . MET B  1 85  ? -22.380 25.450  60.885  1.00 103.21 ?  85   MET B CG  1 
ATOM   4849  S  SD  . MET B  1 85  ? -22.316 24.165  62.164  1.00 105.96 ?  85   MET B SD  1 
ATOM   4850  C  CE  . MET B  1 85  ? -23.798 23.224  61.794  1.00 109.66 ?  85   MET B CE  1 
ATOM   4851  N  N   . TRP B  1 86  ? -19.839 25.765  58.198  1.00 87.76  ?  86   TRP B N   1 
ATOM   4852  C  CA  . TRP B  1 86  ? -18.508 26.325  58.395  1.00 86.13  ?  86   TRP B CA  1 
ATOM   4853  C  C   . TRP B  1 86  ? -17.959 27.052  57.173  1.00 83.84  ?  86   TRP B C   1 
ATOM   4854  O  O   . TRP B  1 86  ? -16.926 27.720  57.288  1.00 81.94  ?  86   TRP B O   1 
ATOM   4855  C  CB  . TRP B  1 86  ? -17.544 25.211  58.794  1.00 85.21  ?  86   TRP B CB  1 
ATOM   4856  C  CG  . TRP B  1 86  ? -18.069 24.375  59.908  1.00 87.32  ?  86   TRP B CG  1 
ATOM   4857  C  CD1 . TRP B  1 86  ? -18.754 23.201  59.799  1.00 88.24  ?  86   TRP B CD1 1 
ATOM   4858  C  CD2 . TRP B  1 86  ? -17.956 24.646  61.308  1.00 88.32  ?  86   TRP B CD2 1 
ATOM   4859  N  NE1 . TRP B  1 86  ? -19.079 22.724  61.046  1.00 89.49  ?  86   TRP B NE1 1 
ATOM   4860  C  CE2 . TRP B  1 86  ? -18.598 23.593  61.990  1.00 89.85  ?  86   TRP B CE2 1 
ATOM   4861  C  CE3 . TRP B  1 86  ? -17.374 25.676  62.052  1.00 88.57  ?  86   TRP B CE3 1 
ATOM   4862  C  CZ2 . TRP B  1 86  ? -18.672 23.540  63.380  1.00 91.85  ?  86   TRP B CZ2 1 
ATOM   4863  C  CZ3 . TRP B  1 86  ? -17.447 25.623  63.430  1.00 90.46  ?  86   TRP B CZ3 1 
ATOM   4864  C  CH2 . TRP B  1 86  ? -18.092 24.562  64.081  1.00 92.12  ?  86   TRP B CH2 1 
ATOM   4865  N  N   . ASN B  1 87  ? -18.617 26.949  56.020  1.00 84.22  ?  87   ASN B N   1 
ATOM   4866  C  CA  . ASN B  1 87  ? -18.097 27.554  54.803  1.00 82.85  ?  87   ASN B CA  1 
ATOM   4867  C  C   . ASN B  1 87  ? -18.262 29.074  54.852  1.00 82.72  ?  87   ASN B C   1 
ATOM   4868  O  O   . ASN B  1 87  ? -19.044 29.594  55.650  1.00 85.45  ?  87   ASN B O   1 
ATOM   4869  C  CB  . ASN B  1 87  ? -18.808 26.975  53.581  1.00 84.11  ?  87   ASN B CB  1 
ATOM   4870  C  CG  . ASN B  1 87  ? -18.122 25.731  53.043  1.00 82.42  ?  87   ASN B CG  1 
ATOM   4871  O  OD1 . ASN B  1 87  ? -16.942 25.488  53.312  1.00 80.11  ?  87   ASN B OD1 1 
ATOM   4872  N  ND2 . ASN B  1 87  ? -18.857 24.943  52.267  1.00 83.61  ?  87   ASN B ND2 1 
ATOM   4873  N  N   . PRO B  1 88  ? -17.519 29.811  54.022  1.00 79.66  ?  88   PRO B N   1 
ATOM   4874  C  CA  . PRO B  1 88  ? -17.633 31.277  54.052  1.00 80.57  ?  88   PRO B CA  1 
ATOM   4875  C  C   . PRO B  1 88  ? -19.043 31.729  53.701  1.00 83.90  ?  88   PRO B C   1 
ATOM   4876  O  O   . PRO B  1 88  ? -19.624 31.291  52.707  1.00 87.31  ?  88   PRO B O   1 
ATOM   4877  C  CB  . PRO B  1 88  ? -16.616 31.734  52.999  1.00 78.81  ?  88   PRO B CB  1 
ATOM   4878  C  CG  . PRO B  1 88  ? -15.646 30.610  52.890  1.00 75.84  ?  88   PRO B CG  1 
ATOM   4879  C  CD  . PRO B  1 88  ? -16.455 29.365  53.103  1.00 76.44  ?  88   PRO B CD  1 
ATOM   4880  N  N   . ASN B  1 89  ? -19.597 32.599  54.544  1.00 83.74  ?  89   ASN B N   1 
ATOM   4881  C  CA  . ASN B  1 89  ? -20.918 33.180  54.338  1.00 85.96  ?  89   ASN B CA  1 
ATOM   4882  C  C   . ASN B  1 89  ? -20.878 34.564  53.691  1.00 88.25  ?  89   ASN B C   1 
ATOM   4883  O  O   . ASN B  1 89  ? -21.928 35.202  53.569  1.00 90.74  ?  89   ASN B O   1 
ATOM   4884  C  CB  . ASN B  1 89  ? -21.682 33.232  55.667  1.00 87.42  ?  89   ASN B CB  1 
ATOM   4885  C  CG  . ASN B  1 89  ? -20.982 34.072  56.713  1.00 86.82  ?  89   ASN B CG  1 
ATOM   4886  O  OD1 . ASN B  1 89  ? -19.870 34.550  56.499  1.00 84.55  ?  89   ASN B OD1 1 
ATOM   4887  N  ND2 . ASN B  1 89  ? -21.620 34.231  57.866  1.00 89.35  ?  89   ASN B ND2 1 
ATOM   4888  N  N   . ARG B  1 90  ? -19.697 35.061  53.317  1.00 88.04  ?  90   ARG B N   1 
ATOM   4889  C  CA  . ARG B  1 90  ? -19.553 36.338  52.625  1.00 89.93  ?  90   ARG B CA  1 
ATOM   4890  C  C   . ARG B  1 90  ? -18.657 36.163  51.401  1.00 88.09  ?  90   ARG B C   1 
ATOM   4891  O  O   . ARG B  1 90  ? -18.248 35.051  51.051  1.00 86.13  ?  90   ARG B O   1 
ATOM   4892  C  CB  . ARG B  1 90  ? -18.986 37.422  53.552  1.00 90.14  ?  90   ARG B CB  1 
ATOM   4893  C  CG  . ARG B  1 90  ? -19.927 37.848  54.660  1.00 93.12  ?  90   ARG B CG  1 
ATOM   4894  C  CD  . ARG B  1 90  ? -21.150 38.572  54.121  1.00 96.43  ?  90   ARG B CD  1 
ATOM   4895  N  NE  . ARG B  1 90  ? -21.865 39.282  55.180  1.00 101.15 ?  90   ARG B NE  1 
ATOM   4896  C  CZ  . ARG B  1 90  ? -22.889 38.777  55.865  1.00 104.11 ?  90   ARG B CZ  1 
ATOM   4897  N  NH1 . ARG B  1 90  ? -23.327 37.552  55.608  1.00 102.76 ?  90   ARG B NH1 1 
ATOM   4898  N  NH2 . ARG B  1 90  ? -23.476 39.499  56.812  1.00 108.06 ?  90   ARG B NH2 1 
ATOM   4899  N  N   . GLU B  1 91  ? -18.365 37.282  50.742  1.00 88.87  ?  91   GLU B N   1 
ATOM   4900  C  CA  . GLU B  1 91  ? -17.458 37.281  49.604  1.00 87.74  ?  91   GLU B CA  1 
ATOM   4901  C  C   . GLU B  1 91  ? -16.033 36.966  50.045  1.00 81.18  ?  91   GLU B C   1 
ATOM   4902  O  O   . GLU B  1 91  ? -15.589 37.369  51.124  1.00 81.25  ?  91   GLU B O   1 
ATOM   4903  C  CB  . GLU B  1 91  ? -17.490 38.638  48.899  1.00 94.31  ?  91   GLU B CB  1 
ATOM   4904  C  CG  . GLU B  1 91  ? -18.873 39.096  48.465  1.00 102.11 ?  91   GLU B CG  1 
ATOM   4905  C  CD  . GLU B  1 91  ? -19.308 38.468  47.156  1.00 106.00 ?  91   GLU B CD  1 
ATOM   4906  O  OE1 . GLU B  1 91  ? -19.488 37.231  47.117  1.00 106.19 ?  91   GLU B OE1 1 
ATOM   4907  O  OE2 . GLU B  1 91  ? -19.462 39.210  46.162  1.00 108.69 ?  91   GLU B OE2 1 
ATOM   4908  N  N   . LEU B  1 92  ? -15.311 36.249  49.189  1.00 77.45  ?  92   LEU B N   1 
ATOM   4909  C  CA  . LEU B  1 92  ? -13.911 35.924  49.432  1.00 75.85  ?  92   LEU B CA  1 
ATOM   4910  C  C   . LEU B  1 92  ? -13.018 37.017  48.858  1.00 75.95  ?  92   LEU B C   1 
ATOM   4911  O  O   . LEU B  1 92  ? -13.111 37.340  47.670  1.00 76.74  ?  92   LEU B O   1 
ATOM   4912  C  CB  . LEU B  1 92  ? -13.552 34.574  48.808  1.00 74.82  ?  92   LEU B CB  1 
ATOM   4913  C  CG  . LEU B  1 92  ? -14.179 33.320  49.422  1.00 73.21  ?  92   LEU B CG  1 
ATOM   4914  C  CD1 . LEU B  1 92  ? -13.500 32.069  48.900  1.00 66.88  ?  92   LEU B CD1 1 
ATOM   4915  C  CD2 . LEU B  1 92  ? -14.113 33.369  50.940  1.00 72.83  ?  92   LEU B CD2 1 
ATOM   4916  N  N   . SER B  1 93  ? -12.152 37.578  49.701  1.00 73.73  ?  93   SER B N   1 
ATOM   4917  C  CA  . SER B  1 93  ? -11.228 38.615  49.265  1.00 74.14  ?  93   SER B CA  1 
ATOM   4918  C  C   . SER B  1 93  ? -9.949  38.542  50.085  1.00 73.16  ?  93   SER B C   1 
ATOM   4919  O  O   . SER B  1 93  ? -9.958  38.110  51.241  1.00 70.55  ?  93   SER B O   1 
ATOM   4920  C  CB  . SER B  1 93  ? -11.844 40.013  49.391  1.00 75.18  ?  93   SER B CB  1 
ATOM   4921  O  OG  . SER B  1 93  ? -10.878 41.015  49.124  1.00 75.74  ?  93   SER B OG  1 
ATOM   4922  N  N   . GLU B  1 94  ? -8.841  38.960  49.467  1.00 74.40  ?  94   GLU B N   1 
ATOM   4923  C  CA  . GLU B  1 94  ? -7.607  39.133  50.222  1.00 74.50  ?  94   GLU B CA  1 
ATOM   4924  C  C   . GLU B  1 94  ? -7.633  40.378  51.093  1.00 79.07  ?  94   GLU B C   1 
ATOM   4925  O  O   . GLU B  1 94  ? -6.806  40.483  52.006  1.00 81.19  ?  94   GLU B O   1 
ATOM   4926  C  CB  . GLU B  1 94  ? -6.387  39.215  49.312  1.00 72.62  ?  94   GLU B CB  1 
ATOM   4927  C  CG  . GLU B  1 94  ? -5.999  37.944  48.610  1.00 70.08  ?  94   GLU B CG  1 
ATOM   4928  C  CD  . GLU B  1 94  ? -4.545  37.980  48.177  1.00 69.60  ?  94   GLU B CD  1 
ATOM   4929  O  OE1 . GLU B  1 94  ? -3.670  37.930  49.071  1.00 68.97  ?  94   GLU B OE1 1 
ATOM   4930  O  OE2 . GLU B  1 94  ? -4.276  38.096  46.960  1.00 69.35  ?  94   GLU B OE2 1 
ATOM   4931  N  N   . ASP B  1 95  ? -8.549  41.326  50.859  1.00 80.60  ?  95   ASP B N   1 
ATOM   4932  C  CA  . ASP B  1 95  ? -8.706  42.356  51.878  1.00 82.91  ?  95   ASP B CA  1 
ATOM   4933  C  C   . ASP B  1 95  ? -9.808  41.786  52.755  1.00 83.50  ?  95   ASP B C   1 
ATOM   4934  O  O   . ASP B  1 95  ? -11.000 42.050  52.567  1.00 84.28  ?  95   ASP B O   1 
ATOM   4935  C  CB  . ASP B  1 95  ? -9.097  43.667  51.197  1.00 84.32  ?  95   ASP B CB  1 
ATOM   4936  C  CG  . ASP B  1 95  ? -9.432  44.790  52.160  1.00 87.33  ?  95   ASP B CG  1 
ATOM   4937  O  OD1 . ASP B  1 95  ? -9.571  44.547  53.374  1.00 88.35  ?  95   ASP B OD1 1 
ATOM   4938  O  OD2 . ASP B  1 95  ? -9.604  45.930  51.673  1.00 89.53  ?  95   ASP B OD2 1 
ATOM   4939  N  N   . CYS B  1 96  ? -9.381  41.031  53.767  1.00 81.65  ?  96   CYS B N   1 
ATOM   4940  C  CA  . CYS B  1 96  ? -10.240 40.494  54.803  1.00 82.41  ?  96   CYS B CA  1 
ATOM   4941  C  C   . CYS B  1 96  ? -10.029 41.068  56.192  1.00 87.37  ?  96   CYS B C   1 
ATOM   4942  O  O   . CYS B  1 96  ? -10.731 40.645  57.118  1.00 90.25  ?  96   CYS B O   1 
ATOM   4943  C  CB  . CYS B  1 96  ? -10.136 38.969  54.838  1.00 79.06  ?  96   CYS B CB  1 
ATOM   4944  S  SG  . CYS B  1 96  ? -8.499  38.253  54.895  1.00 77.87  ?  96   CYS B SG  1 
ATOM   4945  N  N   . LEU B  1 97  ? -9.077  41.973  56.403  1.00 88.39  ?  97   LEU B N   1 
ATOM   4946  C  CA  . LEU B  1 97  ? -8.587  42.168  57.763  1.00 88.51  ?  97   LEU B CA  1 
ATOM   4947  C  C   . LEU B  1 97  ? -9.460  43.221  58.426  1.00 92.83  ?  97   LEU B C   1 
ATOM   4948  O  O   . LEU B  1 97  ? -9.364  44.420  58.135  1.00 95.91  ?  97   LEU B O   1 
ATOM   4949  C  CB  . LEU B  1 97  ? -7.113  42.568  57.778  1.00 86.29  ?  97   LEU B CB  1 
ATOM   4950  C  CG  . LEU B  1 97  ? -6.103  41.500  57.361  1.00 81.63  ?  97   LEU B CG  1 
ATOM   4951  C  CD1 . LEU B  1 97  ? -4.677  41.987  57.595  1.00 81.86  ?  97   LEU B CD1 1 
ATOM   4952  C  CD2 . LEU B  1 97  ? -6.368  40.215  58.121  1.00 79.99  ?  97   LEU B CD2 1 
ATOM   4953  N  N   . TYR B  1 98  ? -10.290 42.746  59.346  1.00 92.50  ?  98   TYR B N   1 
ATOM   4954  C  CA  . TYR B  1 98  ? -11.327 43.504  60.018  1.00 95.00  ?  98   TYR B CA  1 
ATOM   4955  C  C   . TYR B  1 98  ? -11.653 42.723  61.278  1.00 95.40  ?  98   TYR B C   1 
ATOM   4956  O  O   . TYR B  1 98  ? -11.348 41.531  61.377  1.00 93.42  ?  98   TYR B O   1 
ATOM   4957  C  CB  . TYR B  1 98  ? -12.579 43.677  59.141  1.00 95.27  ?  98   TYR B CB  1 
ATOM   4958  C  CG  . TYR B  1 98  ? -12.340 44.347  57.796  1.00 94.26  ?  98   TYR B CG  1 
ATOM   4959  C  CD1 . TYR B  1 98  ? -12.386 45.725  57.660  1.00 97.34  ?  98   TYR B CD1 1 
ATOM   4960  C  CD2 . TYR B  1 98  ? -12.094 43.590  56.659  1.00 91.49  ?  98   TYR B CD2 1 
ATOM   4961  C  CE1 . TYR B  1 98  ? -12.168 46.330  56.433  1.00 98.62  ?  98   TYR B CE1 1 
ATOM   4962  C  CE2 . TYR B  1 98  ? -11.880 44.184  55.431  1.00 92.05  ?  98   TYR B CE2 1 
ATOM   4963  C  CZ  . TYR B  1 98  ? -11.917 45.551  55.320  1.00 95.87  ?  98   TYR B CZ  1 
ATOM   4964  O  OH  . TYR B  1 98  ? -11.704 46.135  54.089  1.00 97.10  ?  98   TYR B OH  1 
ATOM   4965  N  N   . LEU B  1 99  ? -12.284 43.394  62.234  1.00 98.04  ?  99   LEU B N   1 
ATOM   4966  C  CA  . LEU B  1 99  ? -12.727 42.734  63.450  1.00 97.28  ?  99   LEU B CA  1 
ATOM   4967  C  C   . LEU B  1 99  ? -14.099 43.271  63.827  1.00 101.23 ?  99   LEU B C   1 
ATOM   4968  O  O   . LEU B  1 99  ? -14.552 44.305  63.322  1.00 104.90 ?  99   LEU B O   1 
ATOM   4969  C  CB  . LEU B  1 99  ? -11.713 42.904  64.587  1.00 94.46  ?  99   LEU B CB  1 
ATOM   4970  C  CG  . LEU B  1 99  ? -11.229 44.314  64.913  1.00 97.70  ?  99   LEU B CG  1 
ATOM   4971  C  CD1 . LEU B  1 99  ? -12.144 44.975  65.924  1.00 102.17 ?  99   LEU B CD1 1 
ATOM   4972  C  CD2 . LEU B  1 99  ? -9.798  44.263  65.427  1.00 96.87  ?  99   LEU B CD2 1 
ATOM   4973  N  N   . ASN B  1 100 ? -14.760 42.543  64.721  1.00 101.26 ?  100  ASN B N   1 
ATOM   4974  C  CA  . ASN B  1 100 ? -16.121 42.838  65.136  1.00 105.66 ?  100  ASN B CA  1 
ATOM   4975  C  C   . ASN B  1 100 ? -16.155 42.967  66.650  1.00 110.27 ?  100  ASN B C   1 
ATOM   4976  O  O   . ASN B  1 100 ? -15.509 42.186  67.359  1.00 111.57 ?  100  ASN B O   1 
ATOM   4977  C  CB  . ASN B  1 100 ? -17.089 41.739  64.684  1.00 103.64 ?  100  ASN B CB  1 
ATOM   4978  C  CG  . ASN B  1 100 ? -16.939 41.397  63.215  1.00 100.24 ?  100  ASN B CG  1 
ATOM   4979  O  OD1 . ASN B  1 100 ? -16.847 42.279  62.360  1.00 100.34 ?  100  ASN B OD1 1 
ATOM   4980  N  ND2 . ASN B  1 100 ? -16.924 40.107  62.913  1.00 97.66  ?  100  ASN B ND2 1 
ATOM   4981  N  N   . VAL B  1 101 ? -16.909 43.954  67.138  1.00 112.83 ?  101  VAL B N   1 
ATOM   4982  C  CA  . VAL B  1 101 ? -17.056 44.212  68.567  1.00 114.41 ?  101  VAL B CA  1 
ATOM   4983  C  C   . VAL B  1 101 ? -18.539 44.189  68.920  1.00 116.58 ?  101  VAL B C   1 
ATOM   4984  O  O   . VAL B  1 101 ? -19.349 44.850  68.261  1.00 118.28 ?  101  VAL B O   1 
ATOM   4985  C  CB  . VAL B  1 101 ? -16.425 45.558  68.976  1.00 116.77 ?  101  VAL B CB  1 
ATOM   4986  C  CG1 . VAL B  1 101 ? -16.478 45.736  70.487  1.00 120.26 ?  101  VAL B CG1 1 
ATOM   4987  C  CG2 . VAL B  1 101 ? -14.991 45.663  68.463  1.00 113.15 ?  101  VAL B CG2 1 
ATOM   4988  N  N   . TRP B  1 102 ? -18.887 43.434  69.962  1.00 117.48 ?  102  TRP B N   1 
ATOM   4989  C  CA  . TRP B  1 102 ? -20.244 43.341  70.483  1.00 121.50 ?  102  TRP B CA  1 
ATOM   4990  C  C   . TRP B  1 102 ? -20.265 43.878  71.909  1.00 126.26 ?  102  TRP B C   1 
ATOM   4991  O  O   . TRP B  1 102 ? -19.451 43.465  72.745  1.00 125.03 ?  102  TRP B O   1 
ATOM   4992  C  CB  . TRP B  1 102 ? -20.764 41.895  70.458  1.00 119.37 ?  102  TRP B CB  1 
ATOM   4993  C  CG  . TRP B  1 102 ? -21.342 41.436  69.138  1.00 116.64 ?  102  TRP B CG  1 
ATOM   4994  C  CD1 . TRP B  1 102 ? -22.608 41.659  68.676  1.00 119.08 ?  102  TRP B CD1 1 
ATOM   4995  C  CD2 . TRP B  1 102 ? -20.691 40.630  68.143  1.00 111.37 ?  102  TRP B CD2 1 
ATOM   4996  N  NE1 . TRP B  1 102 ? -22.776 41.068  67.446  1.00 115.83 ?  102  TRP B NE1 1 
ATOM   4997  C  CE2 . TRP B  1 102 ? -21.616 40.429  67.098  1.00 111.10 ?  102  TRP B CE2 1 
ATOM   4998  C  CE3 . TRP B  1 102 ? -19.414 40.071  68.030  1.00 107.26 ?  102  TRP B CE3 1 
ATOM   4999  C  CZ2 . TRP B  1 102 ? -21.305 39.694  65.955  1.00 107.07 ?  102  TRP B CZ2 1 
ATOM   5000  C  CZ3 . TRP B  1 102 ? -19.107 39.342  66.893  1.00 103.74 ?  102  TRP B CZ3 1 
ATOM   5001  C  CH2 . TRP B  1 102 ? -20.048 39.161  65.870  1.00 103.52 ?  102  TRP B CH2 1 
ATOM   5002  N  N   . THR B  1 103 ? -21.195 44.793  72.176  1.00 131.81 ?  103  THR B N   1 
ATOM   5003  C  CA  . THR B  1 103 ? -21.402 45.433  73.467  1.00 136.91 ?  103  THR B CA  1 
ATOM   5004  C  C   . THR B  1 103 ? -22.898 45.489  73.739  1.00 141.23 ?  103  THR B C   1 
ATOM   5005  O  O   . THR B  1 103 ? -23.694 45.637  72.804  1.00 140.47 ?  103  THR B O   1 
ATOM   5006  C  CB  . THR B  1 103 ? -20.815 46.859  73.497  1.00 139.80 ?  103  THR B CB  1 
ATOM   5007  O  OG1 . THR B  1 103 ? -19.556 46.878  72.814  1.00 135.67 ?  103  THR B OG1 1 
ATOM   5008  C  CG2 . THR B  1 103 ? -20.596 47.345  74.924  1.00 143.22 ?  103  THR B CG2 1 
ATOM   5009  N  N   . PRO B  1 104 ? -23.312 45.357  74.997  1.00 147.05 ?  104  PRO B N   1 
ATOM   5010  C  CA  . PRO B  1 104 ? -24.726 45.567  75.327  1.00 153.36 ?  104  PRO B CA  1 
ATOM   5011  C  C   . PRO B  1 104 ? -25.139 47.013  75.105  1.00 158.43 ?  104  PRO B C   1 
ATOM   5012  O  O   . PRO B  1 104 ? -24.315 47.919  74.960  1.00 159.47 ?  104  PRO B O   1 
ATOM   5013  C  CB  . PRO B  1 104 ? -24.816 45.186  76.811  1.00 156.41 ?  104  PRO B CB  1 
ATOM   5014  C  CG  . PRO B  1 104 ? -23.409 45.198  77.303  1.00 153.96 ?  104  PRO B CG  1 
ATOM   5015  C  CD  . PRO B  1 104 ? -22.568 44.799  76.137  1.00 147.30 ?  104  PRO B CD  1 
ATOM   5016  N  N   . TYR B  1 105 ? -26.452 47.209  75.050  1.00 161.15 ?  105  TYR B N   1 
ATOM   5017  C  CA  . TYR B  1 105 ? -27.057 48.523  74.887  1.00 164.78 ?  105  TYR B CA  1 
ATOM   5018  C  C   . TYR B  1 105 ? -27.712 48.928  76.195  1.00 171.65 ?  105  TYR B C   1 
ATOM   5019  O  O   . TYR B  1 105 ? -28.662 48.275  76.629  1.00 173.43 ?  105  TYR B O   1 
ATOM   5020  C  CB  . TYR B  1 105 ? -28.088 48.496  73.757  1.00 164.24 ?  105  TYR B CB  1 
ATOM   5021  C  CG  . TYR B  1 105 ? -28.565 49.853  73.295  1.00 168.23 ?  105  TYR B CG  1 
ATOM   5022  C  CD1 . TYR B  1 105 ? -27.842 51.000  73.581  1.00 168.64 ?  105  TYR B CD1 1 
ATOM   5023  C  CD2 . TYR B  1 105 ? -29.739 49.984  72.561  1.00 168.68 ?  105  TYR B CD2 1 
ATOM   5024  C  CE1 . TYR B  1 105 ? -28.277 52.240  73.159  1.00 172.50 ?  105  TYR B CE1 1 
ATOM   5025  C  CE2 . TYR B  1 105 ? -30.179 51.224  72.131  1.00 172.50 ?  105  TYR B CE2 1 
ATOM   5026  C  CZ  . TYR B  1 105 ? -29.442 52.348  72.434  1.00 174.36 ?  105  TYR B CZ  1 
ATOM   5027  O  OH  . TYR B  1 105 ? -29.871 53.586  72.013  1.00 178.59 ?  105  TYR B OH  1 
ATOM   5028  N  N   . PRO B  1 106 ? -27.207 49.989  76.849  1.00 176.52 ?  106  PRO B N   1 
ATOM   5029  C  CA  . PRO B  1 106 ? -26.075 50.882  76.556  1.00 175.45 ?  106  PRO B CA  1 
ATOM   5030  C  C   . PRO B  1 106 ? -24.721 50.340  77.018  1.00 171.03 ?  106  PRO B C   1 
ATOM   5031  O  O   . PRO B  1 106 ? -24.636 49.171  77.399  1.00 168.66 ?  106  PRO B O   1 
ATOM   5032  C  CB  . PRO B  1 106 ? -26.431 52.144  77.336  1.00 183.52 ?  106  PRO B CB  1 
ATOM   5033  C  CG  . PRO B  1 106 ? -27.136 51.618  78.542  1.00 187.66 ?  106  PRO B CG  1 
ATOM   5034  C  CD  . PRO B  1 106 ? -27.912 50.405  78.076  1.00 184.30 ?  106  PRO B CD  1 
ATOM   5035  N  N   . ARG B  1 107 ? -23.690 51.184  76.966  1.00 170.42 ?  107  ARG B N   1 
ATOM   5036  C  CA  . ARG B  1 107 ? -22.371 50.803  77.452  1.00 167.76 ?  107  ARG B CA  1 
ATOM   5037  C  C   . ARG B  1 107 ? -22.483 50.250  78.871  1.00 171.37 ?  107  ARG B C   1 
ATOM   5038  O  O   . ARG B  1 107 ? -23.259 50.775  79.681  1.00 176.17 ?  107  ARG B O   1 
ATOM   5039  C  CB  . ARG B  1 107 ? -21.426 52.009  77.448  1.00 169.25 ?  107  ARG B CB  1 
ATOM   5040  C  CG  . ARG B  1 107 ? -21.350 52.749  76.135  1.00 167.76 ?  107  ARG B CG  1 
ATOM   5041  C  CD  . ARG B  1 107 ? -20.931 51.851  74.982  1.00 160.72 ?  107  ARG B CD  1 
ATOM   5042  N  NE  . ARG B  1 107 ? -21.299 52.464  73.711  1.00 159.89 ?  107  ARG B NE  1 
ATOM   5043  C  CZ  . ARG B  1 107 ? -20.630 53.460  73.141  1.00 159.57 ?  107  ARG B CZ  1 
ATOM   5044  N  NH1 . ARG B  1 107 ? -19.543 53.951  73.721  1.00 160.36 ?  107  ARG B NH1 1 
ATOM   5045  N  NH2 . ARG B  1 107 ? -21.047 53.966  71.991  1.00 158.77 ?  107  ARG B NH2 1 
ATOM   5046  N  N   . PRO B  1 108 ? -21.736 49.199  79.212  1.00 170.09 ?  108  PRO B N   1 
ATOM   5047  C  CA  . PRO B  1 108 ? -21.907 48.534  80.511  1.00 175.07 ?  108  PRO B CA  1 
ATOM   5048  C  C   . PRO B  1 108 ? -21.315 49.312  81.685  1.00 182.11 ?  108  PRO B C   1 
ATOM   5049  O  O   . PRO B  1 108 ? -20.598 48.756  82.518  1.00 184.51 ?  108  PRO B O   1 
ATOM   5050  C  CB  . PRO B  1 108 ? -21.181 47.198  80.311  1.00 167.73 ?  108  PRO B CB  1 
ATOM   5051  C  CG  . PRO B  1 108 ? -20.841 47.115  78.842  1.00 161.31 ?  108  PRO B CG  1 
ATOM   5052  C  CD  . PRO B  1 108 ? -20.739 48.518  78.373  1.00 163.15 ?  108  PRO B CD  1 
ATOM   5053  N  N   . ALA B  1 109 ? -21.654 50.605  81.774  1.00 184.56 ?  109  ALA B N   1 
ATOM   5054  C  CA  . ALA B  1 109 ? -21.191 51.459  82.864  1.00 187.04 ?  109  ALA B CA  1 
ATOM   5055  C  C   . ALA B  1 109 ? -19.675 51.378  83.028  1.00 183.49 ?  109  ALA B C   1 
ATOM   5056  O  O   . ALA B  1 109 ? -18.923 51.764  82.126  1.00 179.16 ?  109  ALA B O   1 
ATOM   5057  C  CB  . ALA B  1 109 ? -21.897 51.089  84.171  1.00 190.61 ?  109  ALA B CB  1 
ATOM   5058  N  N   . SER B  1 110 ? -19.228 50.889  84.185  1.00 185.78 ?  110  SER B N   1 
ATOM   5059  C  CA  . SER B  1 110 ? -17.810 50.683  84.451  1.00 183.69 ?  110  SER B CA  1 
ATOM   5060  C  C   . SER B  1 110 ? -17.196 49.706  83.443  1.00 176.44 ?  110  SER B C   1 
ATOM   5061  O  O   . SER B  1 110 ? -17.898 48.865  82.876  1.00 175.41 ?  110  SER B O   1 
ATOM   5062  C  CB  . SER B  1 110 ? -17.621 50.151  85.869  1.00 185.86 ?  110  SER B CB  1 
ATOM   5063  O  OG  . SER B  1 110 ? -18.125 51.076  86.815  1.00 193.06 ?  110  SER B OG  1 
ATOM   5064  N  N   . PRO B  1 111 ? -15.884 49.794  83.206  1.00 171.04 ?  111  PRO B N   1 
ATOM   5065  C  CA  . PRO B  1 111 ? -15.246 48.893  82.235  1.00 163.14 ?  111  PRO B CA  1 
ATOM   5066  C  C   . PRO B  1 111 ? -15.432 47.428  82.610  1.00 160.90 ?  111  PRO B C   1 
ATOM   5067  O  O   . PRO B  1 111 ? -15.308 47.043  83.775  1.00 163.94 ?  111  PRO B O   1 
ATOM   5068  C  CB  . PRO B  1 111 ? -13.771 49.311  82.286  1.00 161.23 ?  111  PRO B CB  1 
ATOM   5069  C  CG  . PRO B  1 111 ? -13.803 50.737  82.745  1.00 167.08 ?  111  PRO B CG  1 
ATOM   5070  C  CD  . PRO B  1 111 ? -14.945 50.811  83.715  1.00 173.12 ?  111  PRO B CD  1 
ATOM   5071  N  N   . THR B  1 112 ? -15.734 46.607  81.599  1.00 155.83 ?  112  THR B N   1 
ATOM   5072  C  CA  . THR B  1 112 ? -16.057 45.196  81.764  1.00 152.82 ?  112  THR B CA  1 
ATOM   5073  C  C   . THR B  1 112 ? -15.046 44.325  81.019  1.00 145.82 ?  112  THR B C   1 
ATOM   5074  O  O   . THR B  1 112 ? -14.496 44.746  79.996  1.00 142.56 ?  112  THR B O   1 
ATOM   5075  C  CB  . THR B  1 112 ? -17.483 44.910  81.259  1.00 153.21 ?  112  THR B CB  1 
ATOM   5076  O  OG1 . THR B  1 112 ? -17.739 43.500  81.259  1.00 150.70 ?  112  THR B OG1 1 
ATOM   5077  C  CG2 . THR B  1 112 ? -17.677 45.460  79.857  1.00 150.12 ?  112  THR B CG2 1 
ATOM   5078  N  N   . PRO B  1 113 ? -14.753 43.123  81.527  1.00 143.35 ?  113  PRO B N   1 
ATOM   5079  C  CA  . PRO B  1 113 ? -13.760 42.263  80.866  1.00 136.96 ?  113  PRO B CA  1 
ATOM   5080  C  C   . PRO B  1 113 ? -14.208 41.843  79.472  1.00 132.98 ?  113  PRO B C   1 
ATOM   5081  O  O   . PRO B  1 113 ? -15.395 41.631  79.211  1.00 133.72 ?  113  PRO B O   1 
ATOM   5082  C  CB  . PRO B  1 113 ? -13.647 41.053  81.806  1.00 135.84 ?  113  PRO B CB  1 
ATOM   5083  C  CG  . PRO B  1 113 ? -14.854 41.123  82.697  1.00 140.60 ?  113  PRO B CG  1 
ATOM   5084  C  CD  . PRO B  1 113 ? -15.184 42.573  82.825  1.00 145.90 ?  113  PRO B CD  1 
ATOM   5085  N  N   . VAL B  1 114 ? -13.232 41.719  78.573  1.00 129.18 ?  114  VAL B N   1 
ATOM   5086  C  CA  . VAL B  1 114 ? -13.481 41.459  77.159  1.00 124.34 ?  114  VAL B CA  1 
ATOM   5087  C  C   . VAL B  1 114 ? -13.115 40.019  76.824  1.00 119.20 ?  114  VAL B C   1 
ATOM   5088  O  O   . VAL B  1 114 ? -12.198 39.428  77.407  1.00 116.10 ?  114  VAL B O   1 
ATOM   5089  C  CB  . VAL B  1 114 ? -12.706 42.431  76.246  1.00 122.38 ?  114  VAL B CB  1 
ATOM   5090  C  CG1 . VAL B  1 114 ? -13.154 43.862  76.495  1.00 127.49 ?  114  VAL B CG1 1 
ATOM   5091  C  CG2 . VAL B  1 114 ? -11.210 42.278  76.449  1.00 120.10 ?  114  VAL B CG2 1 
ATOM   5092  N  N   . LEU B  1 115 ? -13.855 39.456  75.872  1.00 118.47 ?  115  LEU B N   1 
ATOM   5093  C  CA  . LEU B  1 115 ? -13.612 38.119  75.343  1.00 115.62 ?  115  LEU B CA  1 
ATOM   5094  C  C   . LEU B  1 115 ? -13.284 38.238  73.861  1.00 113.83 ?  115  LEU B C   1 
ATOM   5095  O  O   . LEU B  1 115 ? -14.091 38.767  73.088  1.00 116.27 ?  115  LEU B O   1 
ATOM   5096  C  CB  . LEU B  1 115 ? -14.836 37.224  75.548  1.00 115.52 ?  115  LEU B CB  1 
ATOM   5097  C  CG  . LEU B  1 115 ? -15.062 36.661  76.951  1.00 117.94 ?  115  LEU B CG  1 
ATOM   5098  C  CD1 . LEU B  1 115 ? -16.403 35.942  77.029  1.00 118.08 ?  115  LEU B CD1 1 
ATOM   5099  C  CD2 . LEU B  1 115 ? -13.928 35.730  77.334  1.00 116.66 ?  115  LEU B CD2 1 
ATOM   5100  N  N   . ILE B  1 116 ? -12.112 37.742  73.465  1.00 109.83 ?  116  ILE B N   1 
ATOM   5101  C  CA  . ILE B  1 116 ? -11.666 37.764  72.074  1.00 104.41 ?  116  ILE B CA  1 
ATOM   5102  C  C   . ILE B  1 116 ? -11.725 36.340  71.538  1.00 99.50  ?  116  ILE B C   1 
ATOM   5103  O  O   . ILE B  1 116 ? -11.084 35.436  72.089  1.00 99.14  ?  116  ILE B O   1 
ATOM   5104  C  CB  . ILE B  1 116 ? -10.250 38.344  71.931  1.00 101.52 ?  116  ILE B CB  1 
ATOM   5105  C  CG1 . ILE B  1 116 ? -10.166 39.733  72.564  1.00 108.00 ?  116  ILE B CG1 1 
ATOM   5106  C  CG2 . ILE B  1 116 ? -9.857  38.423  70.465  1.00 95.24  ?  116  ILE B CG2 1 
ATOM   5107  C  CD1 . ILE B  1 116 ? -8.834  40.426  72.338  1.00 109.19 ?  116  ILE B CD1 1 
ATOM   5108  N  N   . TRP B  1 117 ? -12.489 36.138  70.467  1.00 95.57  ?  117  TRP B N   1 
ATOM   5109  C  CA  . TRP B  1 117 ? -12.668 34.820  69.869  1.00 92.15  ?  117  TRP B CA  1 
ATOM   5110  C  C   . TRP B  1 117 ? -11.770 34.666  68.648  1.00 89.73  ?  117  TRP B C   1 
ATOM   5111  O  O   . TRP B  1 117 ? -11.760 35.530  67.765  1.00 90.45  ?  117  TRP B O   1 
ATOM   5112  C  CB  . TRP B  1 117 ? -14.127 34.591  69.472  1.00 92.76  ?  117  TRP B CB  1 
ATOM   5113  C  CG  . TRP B  1 117 ? -14.317 33.369  68.625  1.00 90.27  ?  117  TRP B CG  1 
ATOM   5114  C  CD1 . TRP B  1 117 ? -14.547 33.331  67.281  1.00 89.51  ?  117  TRP B CD1 1 
ATOM   5115  C  CD2 . TRP B  1 117 ? -14.284 32.006  69.064  1.00 89.18  ?  117  TRP B CD2 1 
ATOM   5116  N  NE1 . TRP B  1 117 ? -14.663 32.029  66.856  1.00 87.71  ?  117  TRP B NE1 1 
ATOM   5117  C  CE2 . TRP B  1 117 ? -14.506 31.197  67.933  1.00 87.91  ?  117  TRP B CE2 1 
ATOM   5118  C  CE3 . TRP B  1 117 ? -14.087 31.391  70.303  1.00 89.45  ?  117  TRP B CE3 1 
ATOM   5119  C  CZ2 . TRP B  1 117 ? -14.538 29.804  68.007  1.00 86.31  ?  117  TRP B CZ2 1 
ATOM   5120  C  CZ3 . TRP B  1 117 ? -14.123 30.009  70.374  1.00 87.65  ?  117  TRP B CZ3 1 
ATOM   5121  C  CH2 . TRP B  1 117 ? -14.347 29.232  69.234  1.00 85.81  ?  117  TRP B CH2 1 
ATOM   5122  N  N   . ILE B  1 118 ? -11.032 33.561  68.596  1.00 87.56  ?  118  ILE B N   1 
ATOM   5123  C  CA  . ILE B  1 118 ? -10.173 33.227  67.465  1.00 84.77  ?  118  ILE B CA  1 
ATOM   5124  C  C   . ILE B  1 118 ? -10.730 31.954  66.839  1.00 87.22  ?  118  ILE B C   1 
ATOM   5125  O  O   . ILE B  1 118 ? -10.682 30.878  67.451  1.00 88.97  ?  118  ILE B O   1 
ATOM   5126  C  CB  . ILE B  1 118 ? -8.708  33.049  67.885  1.00 79.35  ?  118  ILE B CB  1 
ATOM   5127  C  CG1 . ILE B  1 118 ? -8.213  34.288  68.638  1.00 79.94  ?  118  ILE B CG1 1 
ATOM   5128  C  CG2 . ILE B  1 118 ? -7.834  32.780  66.665  1.00 74.16  ?  118  ILE B CG2 1 
ATOM   5129  C  CD1 . ILE B  1 118 ? -6.786  34.180  69.128  1.00 79.27  ?  118  ILE B CD1 1 
ATOM   5130  N  N   . TYR B  1 119 ? -11.246 32.071  65.618  1.00 87.23  ?  119  TYR B N   1 
ATOM   5131  C  CA  . TYR B  1 119 ? -11.950 30.967  64.980  1.00 86.16  ?  119  TYR B CA  1 
ATOM   5132  C  C   . TYR B  1 119 ? -10.985 29.873  64.523  1.00 80.25  ?  119  TYR B C   1 
ATOM   5133  O  O   . TYR B  1 119 ? -9.784  30.093  64.347  1.00 79.66  ?  119  TYR B O   1 
ATOM   5134  C  CB  . TYR B  1 119 ? -12.780 31.471  63.796  1.00 89.82  ?  119  TYR B CB  1 
ATOM   5135  C  CG  . TYR B  1 119 ? -12.005 32.225  62.728  1.00 90.40  ?  119  TYR B CG  1 
ATOM   5136  C  CD1 . TYR B  1 119 ? -11.298 31.545  61.741  1.00 87.89  ?  119  TYR B CD1 1 
ATOM   5137  C  CD2 . TYR B  1 119 ? -12.002 33.616  62.693  1.00 93.07  ?  119  TYR B CD2 1 
ATOM   5138  C  CE1 . TYR B  1 119 ? -10.597 32.230  60.758  1.00 87.38  ?  119  TYR B CE1 1 
ATOM   5139  C  CE2 . TYR B  1 119 ? -11.302 34.311  61.713  1.00 92.46  ?  119  TYR B CE2 1 
ATOM   5140  C  CZ  . TYR B  1 119 ? -10.602 33.612  60.747  1.00 89.41  ?  119  TYR B CZ  1 
ATOM   5141  O  OH  . TYR B  1 119 ? -9.907  34.295  59.767  1.00 87.74  ?  119  TYR B OH  1 
ATOM   5142  N  N   . GLY B  1 120 ? -11.544 28.685  64.311  1.00 79.07  ?  120  GLY B N   1 
ATOM   5143  C  CA  . GLY B  1 120 ? -10.798 27.506  63.905  1.00 79.10  ?  120  GLY B CA  1 
ATOM   5144  C  C   . GLY B  1 120 ? -10.743 27.339  62.400  1.00 80.96  ?  120  GLY B C   1 
ATOM   5145  O  O   . GLY B  1 120 ? -10.717 28.315  61.646  1.00 85.49  ?  120  GLY B O   1 
ATOM   5146  N  N   . GLY B  1 121 ? -10.735 26.091  61.953  1.00 77.84  ?  121  GLY B N   1 
ATOM   5147  C  CA  . GLY B  1 121 ? -10.528 25.766  60.562  1.00 74.65  ?  121  GLY B CA  1 
ATOM   5148  C  C   . GLY B  1 121 ? -9.162  25.197  60.145  1.00 71.73  ?  121  GLY B C   1 
ATOM   5149  O  O   . GLY B  1 121 ? -8.864  25.201  58.947  1.00 70.06  ?  121  GLY B O   1 
ATOM   5150  N  N   . GLY B  1 122 ? -8.329  24.748  61.085  1.00 71.98  ?  122  GLY B N   1 
ATOM   5151  C  CA  . GLY B  1 122 ? -7.088  24.075  60.730  1.00 68.65  ?  122  GLY B CA  1 
ATOM   5152  C  C   . GLY B  1 122 ? -6.067  24.946  60.033  1.00 65.42  ?  122  GLY B C   1 
ATOM   5153  O  O   . GLY B  1 122 ? -5.191  24.434  59.333  1.00 64.02  ?  122  GLY B O   1 
ATOM   5154  N  N   . PHE B  1 123 ? -6.190  26.257  60.192  1.00 64.43  ?  123  PHE B N   1 
ATOM   5155  C  CA  . PHE B  1 123 ? -5.443  27.319  59.528  1.00 63.85  ?  123  PHE B CA  1 
ATOM   5156  C  C   . PHE B  1 123 ? -5.566  27.274  58.011  1.00 62.60  ?  123  PHE B C   1 
ATOM   5157  O  O   . PHE B  1 123 ? -4.788  27.946  57.320  1.00 61.08  ?  123  PHE B O   1 
ATOM   5158  C  CB  . PHE B  1 123 ? -3.941  27.268  59.878  1.00 62.38  ?  123  PHE B CB  1 
ATOM   5159  C  CG  . PHE B  1 123 ? -3.632  27.325  61.346  1.00 61.78  ?  123  PHE B CG  1 
ATOM   5160  C  CD1 . PHE B  1 123 ? -3.613  28.529  62.024  1.00 64.63  ?  123  PHE B CD1 1 
ATOM   5161  C  CD2 . PHE B  1 123 ? -3.324  26.170  62.040  1.00 61.52  ?  123  PHE B CD2 1 
ATOM   5162  C  CE1 . PHE B  1 123 ? -3.306  28.579  63.378  1.00 67.23  ?  123  PHE B CE1 1 
ATOM   5163  C  CE2 . PHE B  1 123 ? -3.022  26.209  63.397  1.00 63.60  ?  123  PHE B CE2 1 
ATOM   5164  C  CZ  . PHE B  1 123 ? -3.014  27.415  64.067  1.00 65.63  ?  123  PHE B CZ  1 
ATOM   5165  N  N   . TYR B  1 124 ? -6.528  26.529  57.463  1.00 63.87  ?  124  TYR B N   1 
ATOM   5166  C  CA  . TYR B  1 124 ? -6.860  26.642  56.052  1.00 64.14  ?  124  TYR B CA  1 
ATOM   5167  C  C   . TYR B  1 124 ? -8.156  27.391  55.764  1.00 66.16  ?  124  TYR B C   1 
ATOM   5168  O  O   . TYR B  1 124 ? -8.460  27.614  54.587  1.00 70.69  ?  124  TYR B O   1 
ATOM   5169  C  CB  . TYR B  1 124 ? -6.894  25.253  55.381  1.00 62.47  ?  124  TYR B CB  1 
ATOM   5170  C  CG  . TYR B  1 124 ? -8.143  24.423  55.604  1.00 61.91  ?  124  TYR B CG  1 
ATOM   5171  C  CD1 . TYR B  1 124 ? -9.220  24.522  54.734  1.00 61.89  ?  124  TYR B CD1 1 
ATOM   5172  C  CD2 . TYR B  1 124 ? -8.213  23.480  56.627  1.00 61.42  ?  124  TYR B CD2 1 
ATOM   5173  C  CE1 . TYR B  1 124 ? -10.356 23.766  54.912  1.00 57.07  ?  124  TYR B CE1 1 
ATOM   5174  C  CE2 . TYR B  1 124 ? -9.350  22.710  56.809  1.00 55.91  ?  124  TYR B CE2 1 
ATOM   5175  C  CZ  . TYR B  1 124 ? -10.418 22.860  55.943  1.00 56.98  ?  124  TYR B CZ  1 
ATOM   5176  O  OH  . TYR B  1 124 ? -11.558 22.108  56.096  1.00 58.22  ?  124  TYR B OH  1 
ATOM   5177  N  N   . SER B  1 125 ? -8.924  27.790  56.776  1.00 65.24  ?  125  SER B N   1 
ATOM   5178  C  CA  . SER B  1 125 ? -10.288 28.250  56.512  1.00 67.66  ?  125  SER B CA  1 
ATOM   5179  C  C   . SER B  1 125 ? -10.866 28.930  57.751  1.00 67.69  ?  125  SER B C   1 
ATOM   5180  O  O   . SER B  1 125 ? -10.199 29.083  58.779  1.00 65.95  ?  125  SER B O   1 
ATOM   5181  C  CB  . SER B  1 125 ? -11.194 27.095  56.067  1.00 68.90  ?  125  SER B CB  1 
ATOM   5182  O  OG  . SER B  1 125 ? -11.523 26.241  57.147  1.00 61.02  ?  125  SER B OG  1 
ATOM   5183  N  N   . GLY B  1 126 ? -12.125 29.340  57.630  1.00 69.88  ?  126  GLY B N   1 
ATOM   5184  C  CA  . GLY B  1 126 ? -12.866 29.983  58.694  1.00 74.26  ?  126  GLY B CA  1 
ATOM   5185  C  C   . GLY B  1 126 ? -12.926 31.493  58.527  1.00 79.22  ?  126  GLY B C   1 
ATOM   5186  O  O   . GLY B  1 126 ? -12.253 32.095  57.685  1.00 80.50  ?  126  GLY B O   1 
ATOM   5187  N  N   . ALA B  1 127 ? -13.746 32.108  59.377  1.00 82.14  ?  127  ALA B N   1 
ATOM   5188  C  CA  . ALA B  1 127 ? -13.877 33.557  59.488  1.00 84.03  ?  127  ALA B CA  1 
ATOM   5189  C  C   . ALA B  1 127 ? -14.873 33.851  60.597  1.00 85.93  ?  127  ALA B C   1 
ATOM   5190  O  O   . ALA B  1 127 ? -15.700 33.004  60.946  1.00 88.12  ?  127  ALA B O   1 
ATOM   5191  C  CB  . ALA B  1 127 ? -14.345 34.205  58.182  1.00 85.54  ?  127  ALA B CB  1 
ATOM   5192  N  N   . ALA B  1 128 ? -14.814 35.080  61.115  1.00 86.23  ?  128  ALA B N   1 
ATOM   5193  C  CA  . ALA B  1 128 ? -15.651 35.476  62.242  1.00 87.76  ?  128  ALA B CA  1 
ATOM   5194  C  C   . ALA B  1 128 ? -17.079 35.796  61.829  1.00 90.64  ?  128  ALA B C   1 
ATOM   5195  O  O   . ALA B  1 128 ? -17.931 36.012  62.698  1.00 93.71  ?  128  ALA B O   1 
ATOM   5196  C  CB  . ALA B  1 128 ? -15.036 36.682  62.959  1.00 87.63  ?  128  ALA B CB  1 
ATOM   5197  N  N   . SER B  1 129 ? -17.356 35.824  60.527  1.00 90.35  ?  129  SER B N   1 
ATOM   5198  C  CA  . SER B  1 129 ? -18.687 36.112  60.018  1.00 92.76  ?  129  SER B CA  1 
ATOM   5199  C  C   . SER B  1 129 ? -19.675 34.976  60.265  1.00 94.70  ?  129  SER B C   1 
ATOM   5200  O  O   . SER B  1 129 ? -20.884 35.193  60.130  1.00 98.74  ?  129  SER B O   1 
ATOM   5201  C  CB  . SER B  1 129 ? -18.605 36.400  58.517  1.00 90.09  ?  129  SER B CB  1 
ATOM   5202  O  OG  . SER B  1 129 ? -17.419 37.101  58.179  1.00 87.07  ?  129  SER B OG  1 
ATOM   5203  N  N   . LEU B  1 130 ? -19.198 33.786  60.629  1.00 92.20  ?  130  LEU B N   1 
ATOM   5204  C  CA  . LEU B  1 130 ? -20.070 32.623  60.728  1.00 92.23  ?  130  LEU B CA  1 
ATOM   5205  C  C   . LEU B  1 130 ? -21.131 32.822  61.805  1.00 96.73  ?  130  LEU B C   1 
ATOM   5206  O  O   . LEU B  1 130 ? -20.942 33.572  62.768  1.00 98.93  ?  130  LEU B O   1 
ATOM   5207  C  CB  . LEU B  1 130 ? -19.256 31.364  61.030  1.00 88.47  ?  130  LEU B CB  1 
ATOM   5208  C  CG  . LEU B  1 130 ? -18.252 30.911  59.971  1.00 84.41  ?  130  LEU B CG  1 
ATOM   5209  C  CD1 . LEU B  1 130 ? -17.679 29.554  60.349  1.00 83.60  ?  130  LEU B CD1 1 
ATOM   5210  C  CD2 . LEU B  1 130 ? -18.902 30.860  58.604  1.00 83.41  ?  130  LEU B CD2 1 
ATOM   5211  N  N   . ASP B  1 131 ? -22.265 32.137  61.624  1.00 98.19  ?  131  ASP B N   1 
ATOM   5212  C  CA  . ASP B  1 131 ? -23.394 32.297  62.537  1.00 101.26 ?  131  ASP B CA  1 
ATOM   5213  C  C   . ASP B  1 131 ? -23.084 31.752  63.929  1.00 100.87 ?  131  ASP B C   1 
ATOM   5214  O  O   . ASP B  1 131 ? -23.478 32.353  64.936  1.00 105.17 ?  131  ASP B O   1 
ATOM   5215  C  CB  . ASP B  1 131 ? -24.637 31.618  61.956  1.00 101.44 ?  131  ASP B CB  1 
ATOM   5216  C  CG  . ASP B  1 131 ? -25.223 32.380  60.785  1.00 100.50 ?  131  ASP B CG  1 
ATOM   5217  O  OD1 . ASP B  1 131 ? -24.550 33.300  60.276  1.00 98.59  ?  131  ASP B OD1 1 
ATOM   5218  O  OD2 . ASP B  1 131 ? -26.363 32.067  60.382  1.00 102.18 ?  131  ASP B OD2 1 
ATOM   5219  N  N   . VAL B  1 132 ? -22.381 30.619  64.010  1.00 95.99  ?  132  VAL B N   1 
ATOM   5220  C  CA  . VAL B  1 132 ? -22.059 30.026  65.303  1.00 96.62  ?  132  VAL B CA  1 
ATOM   5221  C  C   . VAL B  1 132 ? -21.108 30.888  66.123  1.00 96.33  ?  132  VAL B C   1 
ATOM   5222  O  O   . VAL B  1 132 ? -20.915 30.620  67.316  1.00 96.38  ?  132  VAL B O   1 
ATOM   5223  C  CB  . VAL B  1 132 ? -21.471 28.615  65.102  1.00 93.60  ?  132  VAL B CB  1 
ATOM   5224  C  CG1 . VAL B  1 132 ? -22.514 27.690  64.476  1.00 90.25  ?  132  VAL B CG1 1 
ATOM   5225  C  CG2 . VAL B  1 132 ? -20.210 28.675  64.255  1.00 85.37  ?  132  VAL B CG2 1 
ATOM   5226  N  N   . TYR B  1 133 ? -20.493 31.900  65.508  1.00 96.32  ?  133  TYR B N   1 
ATOM   5227  C  CA  . TYR B  1 133 ? -19.604 32.837  66.184  1.00 98.86  ?  133  TYR B CA  1 
ATOM   5228  C  C   . TYR B  1 133 ? -20.301 34.129  66.599  1.00 103.81 ?  133  TYR B C   1 
ATOM   5229  O  O   . TYR B  1 133 ? -19.630 35.059  67.058  1.00 104.81 ?  133  TYR B O   1 
ATOM   5230  C  CB  . TYR B  1 133 ? -18.390 33.145  65.306  1.00 97.03  ?  133  TYR B CB  1 
ATOM   5231  C  CG  . TYR B  1 133 ? -17.588 31.907  64.959  1.00 92.95  ?  133  TYR B CG  1 
ATOM   5232  C  CD1 . TYR B  1 133 ? -17.508 30.842  65.847  1.00 91.65  ?  133  TYR B CD1 1 
ATOM   5233  C  CD2 . TYR B  1 133 ? -16.914 31.803  63.748  1.00 89.07  ?  133  TYR B CD2 1 
ATOM   5234  C  CE1 . TYR B  1 133 ? -16.788 29.706  65.536  1.00 87.92  ?  133  TYR B CE1 1 
ATOM   5235  C  CE2 . TYR B  1 133 ? -16.188 30.670  63.429  1.00 84.81  ?  133  TYR B CE2 1 
ATOM   5236  C  CZ  . TYR B  1 133 ? -16.125 29.624  64.327  1.00 84.50  ?  133  TYR B CZ  1 
ATOM   5237  O  OH  . TYR B  1 133 ? -15.399 28.492  64.014  1.00 80.80  ?  133  TYR B OH  1 
ATOM   5238  N  N   . ASP B  1 134 ? -21.620 34.221  66.407  1.00 107.40 ?  134  ASP B N   1 
ATOM   5239  C  CA  . ASP B  1 134 ? -22.377 35.416  66.776  1.00 112.07 ?  134  ASP B CA  1 
ATOM   5240  C  C   . ASP B  1 134 ? -22.229 35.712  68.264  1.00 116.31 ?  134  ASP B C   1 
ATOM   5241  O  O   . ASP B  1 134 ? -22.536 34.866  69.109  1.00 119.18 ?  134  ASP B O   1 
ATOM   5242  C  CB  . ASP B  1 134 ? -23.849 35.215  66.417  1.00 113.40 ?  134  ASP B CB  1 
ATOM   5243  C  CG  . ASP B  1 134 ? -24.673 36.476  66.580  1.00 116.99 ?  134  ASP B CG  1 
ATOM   5244  O  OD1 . ASP B  1 134 ? -24.137 37.504  67.047  1.00 117.31 ?  134  ASP B OD1 1 
ATOM   5245  O  OD2 . ASP B  1 134 ? -25.872 36.431  66.240  1.00 120.08 ?  134  ASP B OD2 1 
ATOM   5246  N  N   . GLY B  1 135 ? -21.801 36.927  68.589  1.00 117.08 ?  135  GLY B N   1 
ATOM   5247  C  CA  . GLY B  1 135 ? -21.496 37.286  69.956  1.00 119.18 ?  135  GLY B CA  1 
ATOM   5248  C  C   . GLY B  1 135 ? -22.527 38.149  70.643  1.00 124.85 ?  135  GLY B C   1 
ATOM   5249  O  O   . GLY B  1 135 ? -22.232 38.714  71.703  1.00 126.61 ?  135  GLY B O   1 
ATOM   5250  N  N   . ARG B  1 136 ? -23.726 38.274  70.068  1.00 128.11 ?  136  ARG B N   1 
ATOM   5251  C  CA  . ARG B  1 136 ? -24.766 39.113  70.656  1.00 133.67 ?  136  ARG B CA  1 
ATOM   5252  C  C   . ARG B  1 136 ? -25.252 38.563  71.989  1.00 134.01 ?  136  ARG B C   1 
ATOM   5253  O  O   . ARG B  1 136 ? -25.714 39.331  72.839  1.00 138.10 ?  136  ARG B O   1 
ATOM   5254  C  CB  . ARG B  1 136 ? -25.938 39.247  69.678  1.00 137.40 ?  136  ARG B CB  1 
ATOM   5255  C  CG  . ARG B  1 136 ? -26.930 38.084  69.713  1.00 139.31 ?  136  ARG B CG  1 
ATOM   5256  C  CD  . ARG B  1 136 ? -27.984 38.198  68.617  1.00 140.28 ?  136  ARG B CD  1 
ATOM   5257  N  NE  . ARG B  1 136 ? -27.391 38.108  67.286  1.00 134.83 ?  136  ARG B NE  1 
ATOM   5258  C  CZ  . ARG B  1 136 ? -27.295 39.129  66.439  1.00 133.56 ?  136  ARG B CZ  1 
ATOM   5259  N  NH1 . ARG B  1 136 ? -27.762 40.322  66.778  1.00 137.37 ?  136  ARG B NH1 1 
ATOM   5260  N  NH2 . ARG B  1 136 ? -26.734 38.953  65.248  1.00 128.76 ?  136  ARG B NH2 1 
ATOM   5261  N  N   . PHE B  1 137 ? -25.153 37.247  72.191  1.00 130.33 ?  137  PHE B N   1 
ATOM   5262  C  CA  . PHE B  1 137 ? -25.715 36.620  73.383  1.00 131.99 ?  137  PHE B CA  1 
ATOM   5263  C  C   . PHE B  1 137 ? -24.807 36.789  74.595  1.00 132.83 ?  137  PHE B C   1 
ATOM   5264  O  O   . PHE B  1 137 ? -25.295 37.012  75.709  1.00 136.60 ?  137  PHE B O   1 
ATOM   5265  C  CB  . PHE B  1 137 ? -25.991 35.144  73.101  1.00 128.28 ?  137  PHE B CB  1 
ATOM   5266  C  CG  . PHE B  1 137 ? -26.804 34.917  71.860  1.00 127.49 ?  137  PHE B CG  1 
ATOM   5267  C  CD1 . PHE B  1 137 ? -28.183 35.049  71.883  1.00 131.87 ?  137  PHE B CD1 1 
ATOM   5268  C  CD2 . PHE B  1 137 ? -26.186 34.601  70.660  1.00 123.22 ?  137  PHE B CD2 1 
ATOM   5269  C  CE1 . PHE B  1 137 ? -28.931 34.852  70.734  1.00 131.97 ?  137  PHE B CE1 1 
ATOM   5270  C  CE2 . PHE B  1 137 ? -26.927 34.404  69.509  1.00 122.98 ?  137  PHE B CE2 1 
ATOM   5271  C  CZ  . PHE B  1 137 ? -28.301 34.529  69.545  1.00 127.27 ?  137  PHE B CZ  1 
ATOM   5272  N  N   . LEU B  1 138 ? -23.489 36.679  74.402  1.00 129.74 ?  138  LEU B N   1 
ATOM   5273  C  CA  . LEU B  1 138 ? -22.556 36.937  75.494  1.00 130.76 ?  138  LEU B CA  1 
ATOM   5274  C  C   . LEU B  1 138 ? -22.658 38.379  75.970  1.00 135.18 ?  138  LEU B C   1 
ATOM   5275  O  O   . LEU B  1 138 ? -22.581 38.654  77.174  1.00 138.87 ?  138  LEU B O   1 
ATOM   5276  C  CB  . LEU B  1 138 ? -21.119 36.631  75.059  1.00 125.39 ?  138  LEU B CB  1 
ATOM   5277  C  CG  . LEU B  1 138 ? -20.605 35.191  74.968  1.00 120.78 ?  138  LEU B CG  1 
ATOM   5278  C  CD1 . LEU B  1 138 ? -20.709 34.480  76.309  1.00 122.20 ?  138  LEU B CD1 1 
ATOM   5279  C  CD2 . LEU B  1 138 ? -21.319 34.417  73.876  1.00 118.83 ?  138  LEU B CD2 1 
ATOM   5280  N  N   . ALA B  1 139 ? -22.830 39.316  75.036  1.00 134.57 ?  139  ALA B N   1 
ATOM   5281  C  CA  . ALA B  1 139 ? -22.881 40.725  75.400  1.00 137.97 ?  139  ALA B CA  1 
ATOM   5282  C  C   . ALA B  1 139 ? -24.153 41.058  76.170  1.00 145.58 ?  139  ALA B C   1 
ATOM   5283  O  O   . ALA B  1 139 ? -24.104 41.774  77.177  1.00 150.97 ?  139  ALA B O   1 
ATOM   5284  C  CB  . ALA B  1 139 ? -22.759 41.590  74.144  1.00 134.96 ?  139  ALA B CB  1 
ATOM   5285  N  N   . GLN B  1 140 ? -25.301 40.552  75.713  1.00 146.12 ?  140  GLN B N   1 
ATOM   5286  C  CA  . GLN B  1 140 ? -26.566 40.882  76.362  1.00 149.87 ?  140  GLN B CA  1 
ATOM   5287  C  C   . GLN B  1 140 ? -26.719 40.152  77.693  1.00 151.15 ?  140  GLN B C   1 
ATOM   5288  O  O   . GLN B  1 140 ? -27.013 40.774  78.722  1.00 155.75 ?  140  GLN B O   1 
ATOM   5289  C  CB  . GLN B  1 140 ? -27.732 40.559  75.424  1.00 148.04 ?  140  GLN B CB  1 
ATOM   5290  C  CG  . GLN B  1 140 ? -29.079 41.122  75.863  1.00 153.40 ?  140  GLN B CG  1 
ATOM   5291  C  CD  . GLN B  1 140 ? -29.795 40.224  76.850  1.00 156.10 ?  140  GLN B CD  1 
ATOM   5292  O  OE1 . GLN B  1 140 ? -30.184 40.658  77.931  1.00 161.12 ?  140  GLN B OE1 1 
ATOM   5293  N  NE2 . GLN B  1 140 ? -29.971 38.961  76.480  1.00 152.75 ?  140  GLN B NE2 1 
ATOM   5294  N  N   . VAL B  1 141 ? -26.528 38.830  77.693  1.00 146.51 ?  141  VAL B N   1 
ATOM   5295  C  CA  . VAL B  1 141 ? -26.832 38.034  78.880  1.00 149.00 ?  141  VAL B CA  1 
ATOM   5296  C  C   . VAL B  1 141 ? -25.785 38.251  79.968  1.00 151.25 ?  141  VAL B C   1 
ATOM   5297  O  O   . VAL B  1 141 ? -26.119 38.564  81.116  1.00 158.42 ?  141  VAL B O   1 
ATOM   5298  C  CB  . VAL B  1 141 ? -26.960 36.545  78.508  1.00 143.88 ?  141  VAL B CB  1 
ATOM   5299  C  CG1 . VAL B  1 141 ? -27.076 35.684  79.762  1.00 146.08 ?  141  VAL B CG1 1 
ATOM   5300  C  CG2 . VAL B  1 141 ? -28.154 36.329  77.593  1.00 144.65 ?  141  VAL B CG2 1 
ATOM   5301  N  N   . GLU B  1 142 ? -24.507 38.080  79.635  1.00 143.14 ?  142  GLU B N   1 
ATOM   5302  C  CA  . GLU B  1 142 ? -23.446 38.155  80.634  1.00 143.36 ?  142  GLU B CA  1 
ATOM   5303  C  C   . GLU B  1 142 ? -22.756 39.513  80.694  1.00 144.79 ?  142  GLU B C   1 
ATOM   5304  O  O   . GLU B  1 142 ? -21.821 39.678  81.484  1.00 145.23 ?  142  GLU B O   1 
ATOM   5305  C  CB  . GLU B  1 142 ? -22.414 37.052  80.390  1.00 139.14 ?  142  GLU B CB  1 
ATOM   5306  C  CG  . GLU B  1 142 ? -22.938 35.654  80.698  1.00 138.45 ?  142  GLU B CG  1 
ATOM   5307  C  CD  . GLU B  1 142 ? -23.332 35.479  82.154  1.00 141.97 ?  142  GLU B CD  1 
ATOM   5308  O  OE1 . GLU B  1 142 ? -22.700 36.112  83.027  1.00 144.29 ?  142  GLU B OE1 1 
ATOM   5309  O  OE2 . GLU B  1 142 ? -24.280 34.712  82.424  1.00 143.86 ?  142  GLU B OE2 1 
ATOM   5310  N  N   . GLY B  1 143 ? -23.180 40.479  79.881  1.00 145.72 ?  143  GLY B N   1 
ATOM   5311  C  CA  . GLY B  1 143 ? -22.614 41.814  79.924  1.00 147.62 ?  143  GLY B CA  1 
ATOM   5312  C  C   . GLY B  1 143 ? -21.195 41.948  79.418  1.00 146.54 ?  143  GLY B C   1 
ATOM   5313  O  O   . GLY B  1 143 ? -20.555 42.966  79.696  1.00 144.91 ?  143  GLY B O   1 
ATOM   5314  N  N   . ALA B  1 144 ? -20.682 40.950  78.696  1.00 140.88 ?  144  ALA B N   1 
ATOM   5315  C  CA  . ALA B  1 144 ? -19.323 40.956  78.170  1.00 132.76 ?  144  ALA B CA  1 
ATOM   5316  C  C   . ALA B  1 144 ? -19.207 41.801  76.899  1.00 131.05 ?  144  ALA B C   1 
ATOM   5317  O  O   . ALA B  1 144 ? -20.179 42.027  76.175  1.00 131.77 ?  144  ALA B O   1 
ATOM   5318  C  CB  . ALA B  1 144 ? -18.857 39.529  77.879  1.00 127.61 ?  144  ALA B CB  1 
ATOM   5319  N  N   . VAL B  1 145 ? -17.990 42.273  76.639  1.00 128.99 ?  145  VAL B N   1 
ATOM   5320  C  CA  . VAL B  1 145 ? -17.633 42.910  75.374  1.00 130.12 ?  145  VAL B CA  1 
ATOM   5321  C  C   . VAL B  1 145 ? -16.857 41.883  74.555  1.00 123.50 ?  145  VAL B C   1 
ATOM   5322  O  O   . VAL B  1 145 ? -15.734 41.508  74.910  1.00 120.24 ?  145  VAL B O   1 
ATOM   5323  C  CB  . VAL B  1 145 ? -16.817 44.192  75.592  1.00 128.83 ?  145  VAL B CB  1 
ATOM   5324  C  CG1 . VAL B  1 145 ? -16.274 44.711  74.269  1.00 125.78 ?  145  VAL B CG1 1 
ATOM   5325  C  CG2 . VAL B  1 145 ? -17.672 45.256  76.262  1.00 135.06 ?  145  VAL B CG2 1 
ATOM   5326  N  N   . LEU B  1 146 ? -17.447 41.422  73.454  1.00 121.22 ?  146  LEU B N   1 
ATOM   5327  C  CA  . LEU B  1 146 ? -16.923 40.288  72.700  1.00 116.27 ?  146  LEU B CA  1 
ATOM   5328  C  C   . LEU B  1 146 ? -16.337 40.770  71.377  1.00 114.27 ?  146  LEU B C   1 
ATOM   5329  O  O   . LEU B  1 146 ? -17.057 41.318  70.538  1.00 115.11 ?  146  LEU B O   1 
ATOM   5330  C  CB  . LEU B  1 146 ? -18.021 39.249  72.462  1.00 116.30 ?  146  LEU B CB  1 
ATOM   5331  C  CG  . LEU B  1 146 ? -17.579 37.896  71.902  1.00 113.15 ?  146  LEU B CG  1 
ATOM   5332  C  CD1 . LEU B  1 146 ? -18.357 36.770  72.563  1.00 114.81 ?  146  LEU B CD1 1 
ATOM   5333  C  CD2 . LEU B  1 146 ? -17.754 37.842  70.390  1.00 110.22 ?  146  LEU B CD2 1 
ATOM   5334  N  N   . VAL B  1 147 ? -15.038 40.548  71.184  1.00 111.38 ?  147  VAL B N   1 
ATOM   5335  C  CA  . VAL B  1 147 ? -14.338 40.916  69.957  1.00 107.69 ?  147  VAL B CA  1 
ATOM   5336  C  C   . VAL B  1 147 ? -13.952 39.641  69.220  1.00 102.20 ?  147  VAL B C   1 
ATOM   5337  O  O   . VAL B  1 147 ? -13.513 38.665  69.839  1.00 100.58 ?  147  VAL B O   1 
ATOM   5338  C  CB  . VAL B  1 147 ? -13.097 41.783  70.255  1.00 104.18 ?  147  VAL B CB  1 
ATOM   5339  C  CG1 . VAL B  1 147 ? -12.453 42.261  68.968  1.00 101.78 ?  147  VAL B CG1 1 
ATOM   5340  C  CG2 . VAL B  1 147 ? -13.470 42.969  71.129  1.00 109.41 ?  147  VAL B CG2 1 
ATOM   5341  N  N   . SER B  1 148 ? -14.137 39.635  67.900  1.00 99.90  ?  148  SER B N   1 
ATOM   5342  C  CA  . SER B  1 148 ? -13.692 38.516  67.074  1.00 95.89  ?  148  SER B CA  1 
ATOM   5343  C  C   . SER B  1 148 ? -13.119 39.057  65.772  1.00 96.54  ?  148  SER B C   1 
ATOM   5344  O  O   . SER B  1 148 ? -13.759 39.878  65.109  1.00 99.54  ?  148  SER B O   1 
ATOM   5345  C  CB  . SER B  1 148 ? -14.840 37.534  66.797  1.00 93.61  ?  148  SER B CB  1 
ATOM   5346  O  OG  . SER B  1 148 ? -15.868 38.135  66.028  1.00 94.83  ?  148  SER B OG  1 
ATOM   5347  N  N   . MET B  1 149 ? -11.925 38.593  65.400  1.00 92.61  ?  149  MET B N   1 
ATOM   5348  C  CA  . MET B  1 149 ? -11.200 39.159  64.272  1.00 89.64  ?  149  MET B CA  1 
ATOM   5349  C  C   . MET B  1 149 ? -11.003 38.119  63.176  1.00 87.93  ?  149  MET B C   1 
ATOM   5350  O  O   . MET B  1 149 ? -10.979 36.912  63.435  1.00 86.38  ?  149  MET B O   1 
ATOM   5351  C  CB  . MET B  1 149 ? -9.831  39.717  64.703  1.00 87.28  ?  149  MET B CB  1 
ATOM   5352  C  CG  . MET B  1 149 ? -8.657  38.764  64.507  1.00 84.50  ?  149  MET B CG  1 
ATOM   5353  S  SD  . MET B  1 149 ? -8.635  37.390  65.672  1.00 86.55  ?  149  MET B SD  1 
ATOM   5354  C  CE  . MET B  1 149 ? -8.202  38.228  67.193  1.00 90.83  ?  149  MET B CE  1 
ATOM   5355  N  N   . ASN B  1 150 ? -10.877 38.613  61.943  1.00 87.89  ?  150  ASN B N   1 
ATOM   5356  C  CA  . ASN B  1 150 ? -10.490 37.802  60.796  1.00 83.62  ?  150  ASN B CA  1 
ATOM   5357  C  C   . ASN B  1 150 ? -8.973  37.829  60.647  1.00 83.47  ?  150  ASN B C   1 
ATOM   5358  O  O   . ASN B  1 150 ? -8.348  38.889  60.744  1.00 86.49  ?  150  ASN B O   1 
ATOM   5359  C  CB  . ASN B  1 150 ? -11.147 38.324  59.511  1.00 81.90  ?  150  ASN B CB  1 
ATOM   5360  C  CG  . ASN B  1 150 ? -12.611 37.917  59.379  1.00 81.65  ?  150  ASN B CG  1 
ATOM   5361  O  OD1 . ASN B  1 150 ? -13.167 37.251  60.251  1.00 82.68  ?  150  ASN B OD1 1 
ATOM   5362  N  ND2 . ASN B  1 150 ? -13.244 38.336  58.284  1.00 80.52  ?  150  ASN B ND2 1 
ATOM   5363  N  N   . TYR B  1 151 ? -8.383  36.657  60.425  1.00 80.15  ?  151  TYR B N   1 
ATOM   5364  C  CA  . TYR B  1 151 ? -6.956  36.553  60.161  1.00 77.78  ?  151  TYR B CA  1 
ATOM   5365  C  C   . TYR B  1 151 ? -6.736  35.731  58.896  1.00 75.04  ?  151  TYR B C   1 
ATOM   5366  O  O   . TYR B  1 151 ? -7.583  34.925  58.498  1.00 75.66  ?  151  TYR B O   1 
ATOM   5367  C  CB  . TYR B  1 151 ? -6.200  35.941  61.355  1.00 76.79  ?  151  TYR B CB  1 
ATOM   5368  C  CG  . TYR B  1 151 ? -6.628  34.537  61.714  1.00 74.89  ?  151  TYR B CG  1 
ATOM   5369  C  CD1 . TYR B  1 151 ? -7.696  34.312  62.574  1.00 76.40  ?  151  TYR B CD1 1 
ATOM   5370  C  CD2 . TYR B  1 151 ? -5.952  33.435  61.209  1.00 72.21  ?  151  TYR B CD2 1 
ATOM   5371  C  CE1 . TYR B  1 151 ? -8.088  33.027  62.907  1.00 74.82  ?  151  TYR B CE1 1 
ATOM   5372  C  CE2 . TYR B  1 151 ? -6.335  32.149  61.535  1.00 70.72  ?  151  TYR B CE2 1 
ATOM   5373  C  CZ  . TYR B  1 151 ? -7.403  31.952  62.381  1.00 72.60  ?  151  TYR B CZ  1 
ATOM   5374  O  OH  . TYR B  1 151 ? -7.777  30.670  62.699  1.00 73.01  ?  151  TYR B OH  1 
ATOM   5375  N  N   . ARG B  1 152 ? -5.583  35.953  58.266  1.00 72.07  ?  152  ARG B N   1 
ATOM   5376  C  CA  . ARG B  1 152 ? -5.261  35.288  57.011  1.00 68.48  ?  152  ARG B CA  1 
ATOM   5377  C  C   . ARG B  1 152 ? -5.016  33.798  57.219  1.00 65.70  ?  152  ARG B C   1 
ATOM   5378  O  O   . ARG B  1 152 ? -4.305  33.387  58.140  1.00 63.46  ?  152  ARG B O   1 
ATOM   5379  C  CB  . ARG B  1 152 ? -4.035  35.934  56.372  1.00 68.74  ?  152  ARG B CB  1 
ATOM   5380  C  CG  . ARG B  1 152 ? -4.305  37.290  55.750  1.00 72.35  ?  152  ARG B CG  1 
ATOM   5381  C  CD  . ARG B  1 152 ? -3.020  37.926  55.251  1.00 72.81  ?  152  ARG B CD  1 
ATOM   5382  N  NE  . ARG B  1 152 ? -2.278  38.572  56.329  1.00 74.05  ?  152  ARG B NE  1 
ATOM   5383  C  CZ  . ARG B  1 152 ? -1.080  39.127  56.183  1.00 75.37  ?  152  ARG B CZ  1 
ATOM   5384  N  NH1 . ARG B  1 152 ? -0.479  39.102  55.003  1.00 75.86  ?  152  ARG B NH1 1 
ATOM   5385  N  NH2 . ARG B  1 152 ? -0.479  39.698  57.217  1.00 77.11  ?  152  ARG B NH2 1 
ATOM   5386  N  N   . VAL B  1 153 ? -5.596  32.990  56.334  1.00 63.77  ?  153  VAL B N   1 
ATOM   5387  C  CA  . VAL B  1 153 ? -5.548  31.540  56.431  1.00 62.93  ?  153  VAL B CA  1 
ATOM   5388  C  C   . VAL B  1 153 ? -4.963  30.979  55.142  1.00 61.47  ?  153  VAL B C   1 
ATOM   5389  O  O   . VAL B  1 153 ? -4.852  31.667  54.123  1.00 58.61  ?  153  VAL B O   1 
ATOM   5390  C  CB  . VAL B  1 153 ? -6.935  30.928  56.714  1.00 63.65  ?  153  VAL B CB  1 
ATOM   5391  C  CG1 . VAL B  1 153 ? -7.478  31.444  58.033  1.00 62.27  ?  153  VAL B CG1 1 
ATOM   5392  C  CG2 . VAL B  1 153 ? -7.902  31.246  55.586  1.00 60.96  ?  153  VAL B CG2 1 
ATOM   5393  N  N   . GLY B  1 154 ? -4.559  29.712  55.209  1.00 60.32  ?  154  GLY B N   1 
ATOM   5394  C  CA  . GLY B  1 154 ? -4.006  29.035  54.054  1.00 60.70  ?  154  GLY B CA  1 
ATOM   5395  C  C   . GLY B  1 154 ? -2.647  29.589  53.658  1.00 61.27  ?  154  GLY B C   1 
ATOM   5396  O  O   . GLY B  1 154 ? -1.888  30.115  54.479  1.00 63.70  ?  154  GLY B O   1 
ATOM   5397  N  N   . THR B  1 155 ? -2.340  29.455  52.365  1.00 59.35  ?  155  THR B N   1 
ATOM   5398  C  CA  . THR B  1 155 ? -1.106  30.010  51.815  1.00 58.98  ?  155  THR B CA  1 
ATOM   5399  C  C   . THR B  1 155 ? -0.917  31.468  52.212  1.00 61.25  ?  155  THR B C   1 
ATOM   5400  O  O   . THR B  1 155 ? 0.190   31.891  52.564  1.00 59.85  ?  155  THR B O   1 
ATOM   5401  C  CB  . THR B  1 155 ? -1.127  29.889  50.291  1.00 58.03  ?  155  THR B CB  1 
ATOM   5402  O  OG1 . THR B  1 155 ? -2.464  30.100  49.824  1.00 55.34  ?  155  THR B OG1 1 
ATOM   5403  C  CG2 . THR B  1 155 ? -0.647  28.527  49.845  1.00 56.23  ?  155  THR B CG2 1 
ATOM   5404  N  N   . PHE B  1 156 ? -1.998  32.244  52.185  1.00 64.21  ?  156  PHE B N   1 
ATOM   5405  C  CA  . PHE B  1 156 ? -1.881  33.692  52.290  1.00 67.91  ?  156  PHE B CA  1 
ATOM   5406  C  C   . PHE B  1 156 ? -1.300  34.109  53.634  1.00 72.16  ?  156  PHE B C   1 
ATOM   5407  O  O   . PHE B  1 156 ? -0.411  34.968  53.690  1.00 74.77  ?  156  PHE B O   1 
ATOM   5408  C  CB  . PHE B  1 156 ? -3.246  34.323  52.031  1.00 67.47  ?  156  PHE B CB  1 
ATOM   5409  C  CG  . PHE B  1 156 ? -3.870  33.852  50.750  1.00 66.27  ?  156  PHE B CG  1 
ATOM   5410  C  CD1 . PHE B  1 156 ? -4.657  32.710  50.726  1.00 65.35  ?  156  PHE B CD1 1 
ATOM   5411  C  CD2 . PHE B  1 156 ? -3.650  34.534  49.564  1.00 65.28  ?  156  PHE B CD2 1 
ATOM   5412  C  CE1 . PHE B  1 156 ? -5.219  32.261  49.544  1.00 63.97  ?  156  PHE B CE1 1 
ATOM   5413  C  CE2 . PHE B  1 156 ? -4.215  34.092  48.384  1.00 63.69  ?  156  PHE B CE2 1 
ATOM   5414  C  CZ  . PHE B  1 156 ? -4.999  32.954  48.375  1.00 62.95  ?  156  PHE B CZ  1 
ATOM   5415  N  N   . GLY B  1 157 ? -1.799  33.540  54.732  1.00 72.53  ?  157  GLY B N   1 
ATOM   5416  C  CA  . GLY B  1 157 ? -1.145  33.794  55.999  1.00 72.77  ?  157  GLY B CA  1 
ATOM   5417  C  C   . GLY B  1 157 ? 0.030   32.920  56.408  1.00 71.12  ?  157  GLY B C   1 
ATOM   5418  O  O   . GLY B  1 157 ? 0.938   33.396  57.093  1.00 72.48  ?  157  GLY B O   1 
ATOM   5419  N  N   . PHE B  1 158 ? 0.006   31.630  56.085  1.00 68.43  ?  158  PHE B N   1 
ATOM   5420  C  CA  . PHE B  1 158 ? 1.036   30.725  56.589  1.00 66.37  ?  158  PHE B CA  1 
ATOM   5421  C  C   . PHE B  1 158 ? 2.112   30.257  55.605  1.00 65.55  ?  158  PHE B C   1 
ATOM   5422  O  O   . PHE B  1 158 ? 3.001   29.507  56.024  1.00 66.35  ?  158  PHE B O   1 
ATOM   5423  C  CB  . PHE B  1 158 ? 0.345   29.566  57.296  1.00 63.83  ?  158  PHE B CB  1 
ATOM   5424  C  CG  . PHE B  1 158 ? -0.437  30.035  58.480  1.00 63.22  ?  158  PHE B CG  1 
ATOM   5425  C  CD1 . PHE B  1 158 ? 0.220   30.410  59.641  1.00 63.05  ?  158  PHE B CD1 1 
ATOM   5426  C  CD2 . PHE B  1 158 ? -1.803  30.229  58.399  1.00 63.48  ?  158  PHE B CD2 1 
ATOM   5427  C  CE1 . PHE B  1 158 ? -0.481  30.891  60.728  1.00 64.24  ?  158  PHE B CE1 1 
ATOM   5428  C  CE2 . PHE B  1 158 ? -2.512  30.715  59.484  1.00 64.39  ?  158  PHE B CE2 1 
ATOM   5429  C  CZ  . PHE B  1 158 ? -1.848  31.047  60.649  1.00 64.57  ?  158  PHE B CZ  1 
ATOM   5430  N  N   . LEU B  1 159 ? 2.077   30.647  54.329  1.00 63.10  ?  159  LEU B N   1 
ATOM   5431  C  CA  . LEU B  1 159 ? 3.156   30.237  53.433  1.00 58.85  ?  159  LEU B CA  1 
ATOM   5432  C  C   . LEU B  1 159 ? 4.450   30.906  53.877  1.00 59.69  ?  159  LEU B C   1 
ATOM   5433  O  O   . LEU B  1 159 ? 4.487   32.119  54.102  1.00 62.43  ?  159  LEU B O   1 
ATOM   5434  C  CB  . LEU B  1 159 ? 2.848   30.598  51.978  1.00 57.25  ?  159  LEU B CB  1 
ATOM   5435  C  CG  . LEU B  1 159 ? 3.801   30.069  50.892  1.00 55.99  ?  159  LEU B CG  1 
ATOM   5436  C  CD1 . LEU B  1 159 ? 3.025   29.674  49.640  1.00 54.88  ?  159  LEU B CD1 1 
ATOM   5437  C  CD2 . LEU B  1 159 ? 4.913   31.055  50.536  1.00 56.99  ?  159  LEU B CD2 1 
ATOM   5438  N  N   . ALA B  1 160 ? 5.509   30.116  54.018  1.00 58.61  ?  160  ALA B N   1 
ATOM   5439  C  CA  . ALA B  1 160 ? 6.757   30.611  54.576  1.00 61.49  ?  160  ALA B CA  1 
ATOM   5440  C  C   . ALA B  1 160 ? 7.945   30.134  53.757  1.00 64.00  ?  160  ALA B C   1 
ATOM   5441  O  O   . ALA B  1 160 ? 7.981   28.987  53.299  1.00 63.48  ?  160  ALA B O   1 
ATOM   5442  C  CB  . ALA B  1 160 ? 6.931   30.163  56.028  1.00 57.94  ?  160  ALA B CB  1 
ATOM   5443  N  N   . LEU B  1 161 ? 8.915   31.031  53.580  1.00 66.75  ?  161  LEU B N   1 
ATOM   5444  C  CA  . LEU B  1 161 ? 10.268  30.691  53.142  1.00 67.13  ?  161  LEU B CA  1 
ATOM   5445  C  C   . LEU B  1 161 ? 11.176  31.190  54.257  1.00 69.57  ?  161  LEU B C   1 
ATOM   5446  O  O   . LEU B  1 161 ? 11.629  32.345  54.227  1.00 71.29  ?  161  LEU B O   1 
ATOM   5447  C  CB  . LEU B  1 161 ? 10.617  31.326  51.799  1.00 67.29  ?  161  LEU B CB  1 
ATOM   5448  C  CG  . LEU B  1 161 ? 9.972   30.737  50.546  1.00 65.56  ?  161  LEU B CG  1 
ATOM   5449  C  CD1 . LEU B  1 161 ? 10.519  31.429  49.306  1.00 66.43  ?  161  LEU B CD1 1 
ATOM   5450  C  CD2 . LEU B  1 161 ? 10.197  29.236  50.475  1.00 64.50  ?  161  LEU B CD2 1 
ATOM   5451  N  N   . PRO B  1 162 ? 11.445  30.362  55.269  1.00 69.97  ?  162  PRO B N   1 
ATOM   5452  C  CA  . PRO B  1 162 ? 12.071  30.863  56.501  1.00 71.28  ?  162  PRO B CA  1 
ATOM   5453  C  C   . PRO B  1 162 ? 13.396  31.565  56.240  1.00 73.07  ?  162  PRO B C   1 
ATOM   5454  O  O   . PRO B  1 162 ? 14.219  31.109  55.443  1.00 72.84  ?  162  PRO B O   1 
ATOM   5455  C  CB  . PRO B  1 162 ? 12.262  29.592  57.336  1.00 70.71  ?  162  PRO B CB  1 
ATOM   5456  C  CG  . PRO B  1 162 ? 11.212  28.648  56.823  1.00 67.88  ?  162  PRO B CG  1 
ATOM   5457  C  CD  . PRO B  1 162 ? 11.120  28.928  55.354  1.00 67.97  ?  162  PRO B CD  1 
ATOM   5458  N  N   . GLY B  1 163 ? 13.585  32.696  56.922  1.00 75.28  ?  163  GLY B N   1 
ATOM   5459  C  CA  . GLY B  1 163 ? 14.747  33.533  56.739  1.00 79.20  ?  163  GLY B CA  1 
ATOM   5460  C  C   . GLY B  1 163 ? 14.596  34.612  55.686  1.00 82.06  ?  163  GLY B C   1 
ATOM   5461  O  O   . GLY B  1 163 ? 15.334  35.604  55.725  1.00 86.19  ?  163  GLY B O   1 
ATOM   5462  N  N   . SER B  1 164 ? 13.656  34.455  54.757  1.00 79.99  ?  164  SER B N   1 
ATOM   5463  C  CA  . SER B  1 164 ? 13.406  35.455  53.733  1.00 80.66  ?  164  SER B CA  1 
ATOM   5464  C  C   . SER B  1 164 ? 12.611  36.620  54.306  1.00 80.33  ?  164  SER B C   1 
ATOM   5465  O  O   . SER B  1 164 ? 11.867  36.483  55.281  1.00 79.57  ?  164  SER B O   1 
ATOM   5466  C  CB  . SER B  1 164 ? 12.635  34.859  52.559  1.00 80.29  ?  164  SER B CB  1 
ATOM   5467  O  OG  . SER B  1 164 ? 11.273  34.678  52.913  1.00 79.67  ?  164  SER B OG  1 
ATOM   5468  N  N   . ARG B  1 165 ? 12.774  37.783  53.673  1.00 83.03  ?  165  ARG B N   1 
ATOM   5469  C  CA  . ARG B  1 165 ? 12.077  38.978  54.130  1.00 86.72  ?  165  ARG B CA  1 
ATOM   5470  C  C   . ARG B  1 165 ? 10.615  38.984  53.693  1.00 83.43  ?  165  ARG B C   1 
ATOM   5471  O  O   . ARG B  1 165 ? 9.745   39.450  54.438  1.00 82.51  ?  165  ARG B O   1 
ATOM   5472  C  CB  . ARG B  1 165 ? 12.785  40.231  53.606  1.00 95.02  ?  165  ARG B CB  1 
ATOM   5473  C  CG  . ARG B  1 165 ? 14.307  40.216  53.725  1.00 102.13 ?  165  ARG B CG  1 
ATOM   5474  C  CD  . ARG B  1 165 ? 14.773  40.164  55.176  1.00 107.11 ?  165  ARG B CD  1 
ATOM   5475  N  NE  . ARG B  1 165 ? 15.420  38.890  55.490  1.00 107.72 ?  165  ARG B NE  1 
ATOM   5476  C  CZ  . ARG B  1 165 ? 16.689  38.606  55.209  1.00 108.98 ?  165  ARG B CZ  1 
ATOM   5477  N  NH1 . ARG B  1 165 ? 17.458  39.512  54.614  1.00 111.82 ?  165  ARG B NH1 1 
ATOM   5478  N  NH2 . ARG B  1 165 ? 17.192  37.418  55.529  1.00 106.68 ?  165  ARG B NH2 1 
ATOM   5479  N  N   . GLU B  1 166 ? 10.327  38.490  52.487  1.00 82.27  ?  166  GLU B N   1 
ATOM   5480  C  CA  . GLU B  1 166 ? 9.008   38.666  51.890  1.00 81.36  ?  166  GLU B CA  1 
ATOM   5481  C  C   . GLU B  1 166 ? 7.997   37.598  52.290  1.00 78.02  ?  166  GLU B C   1 
ATOM   5482  O  O   . GLU B  1 166 ? 6.796   37.804  52.084  1.00 78.20  ?  166  GLU B O   1 
ATOM   5483  C  CB  . GLU B  1 166 ? 9.115   38.699  50.361  1.00 82.84  ?  166  GLU B CB  1 
ATOM   5484  C  CG  . GLU B  1 166 ? 10.061  39.763  49.811  1.00 88.01  ?  166  GLU B CG  1 
ATOM   5485  C  CD  . GLU B  1 166 ? 11.517  39.311  49.782  1.00 91.19  ?  166  GLU B CD  1 
ATOM   5486  O  OE1 . GLU B  1 166 ? 11.886  38.401  50.559  1.00 91.69  ?  166  GLU B OE1 1 
ATOM   5487  O  OE2 . GLU B  1 166 ? 12.297  39.872  48.984  1.00 93.08  ?  166  GLU B OE2 1 
ATOM   5488  N  N   . ALA B  1 167 ? 8.437   36.471  52.845  1.00 75.02  ?  167  ALA B N   1 
ATOM   5489  C  CA  . ALA B  1 167 ? 7.532   35.425  53.327  1.00 71.10  ?  167  ALA B CA  1 
ATOM   5490  C  C   . ALA B  1 167 ? 8.095   34.838  54.613  1.00 68.32  ?  167  ALA B C   1 
ATOM   5491  O  O   . ALA B  1 167 ? 8.512   33.673  54.660  1.00 65.81  ?  167  ALA B O   1 
ATOM   5492  C  CB  . ALA B  1 167 ? 7.322   34.346  52.262  1.00 70.12  ?  167  ALA B CB  1 
ATOM   5493  N  N   . PRO B  1 168 ? 8.128   35.632  55.689  1.00 68.17  ?  168  PRO B N   1 
ATOM   5494  C  CA  . PRO B  1 168 ? 8.742   35.156  56.937  1.00 68.26  ?  168  PRO B CA  1 
ATOM   5495  C  C   . PRO B  1 168 ? 7.938   34.081  57.647  1.00 65.73  ?  168  PRO B C   1 
ATOM   5496  O  O   . PRO B  1 168 ? 8.498   33.375  58.496  1.00 64.96  ?  168  PRO B O   1 
ATOM   5497  C  CB  . PRO B  1 168 ? 8.833   36.433  57.777  1.00 70.98  ?  168  PRO B CB  1 
ATOM   5498  C  CG  . PRO B  1 168 ? 7.637   37.208  57.348  1.00 70.10  ?  168  PRO B CG  1 
ATOM   5499  C  CD  . PRO B  1 168 ? 7.460   36.932  55.874  1.00 68.55  ?  168  PRO B CD  1 
ATOM   5500  N  N   . GLY B  1 169 ? 6.653   33.942  57.341  1.00 64.56  ?  169  GLY B N   1 
ATOM   5501  C  CA  . GLY B  1 169 ? 5.803   32.989  58.019  1.00 63.34  ?  169  GLY B CA  1 
ATOM   5502  C  C   . GLY B  1 169 ? 5.035   33.611  59.174  1.00 67.46  ?  169  GLY B C   1 
ATOM   5503  O  O   . GLY B  1 169 ? 5.365   34.683  59.683  1.00 71.49  ?  169  GLY B O   1 
ATOM   5504  N  N   . ASN B  1 170 ? 3.971   32.916  59.576  1.00 66.51  ?  170  ASN B N   1 
ATOM   5505  C  CA  . ASN B  1 170 ? 3.159   33.271  60.740  1.00 66.22  ?  170  ASN B CA  1 
ATOM   5506  C  C   . ASN B  1 170 ? 2.479   34.624  60.596  1.00 67.70  ?  170  ASN B C   1 
ATOM   5507  O  O   . ASN B  1 170 ? 2.167   35.263  61.604  1.00 71.11  ?  170  ASN B O   1 
ATOM   5508  C  CB  . ASN B  1 170 ? 3.989   33.269  62.035  1.00 66.69  ?  170  ASN B CB  1 
ATOM   5509  C  CG  . ASN B  1 170 ? 4.640   31.931  62.324  1.00 65.40  ?  170  ASN B CG  1 
ATOM   5510  O  OD1 . ASN B  1 170 ? 4.083   30.872  62.034  1.00 63.43  ?  170  ASN B OD1 1 
ATOM   5511  N  ND2 . ASN B  1 170 ? 5.834   31.975  62.903  1.00 64.74  ?  170  ASN B ND2 1 
ATOM   5512  N  N   . VAL B  1 171 ? 2.229   35.102  59.374  1.00 67.49  ?  171  VAL B N   1 
ATOM   5513  C  CA  . VAL B  1 171 ? 1.669   36.445  59.270  1.00 70.66  ?  171  VAL B CA  1 
ATOM   5514  C  C   . VAL B  1 171 ? 0.191   36.452  59.650  1.00 72.24  ?  171  VAL B C   1 
ATOM   5515  O  O   . VAL B  1 171 ? -0.363  37.518  59.941  1.00 75.04  ?  171  VAL B O   1 
ATOM   5516  C  CB  . VAL B  1 171 ? 1.891   37.061  57.870  1.00 69.81  ?  171  VAL B CB  1 
ATOM   5517  C  CG1 . VAL B  1 171 ? 3.381   37.116  57.536  1.00 70.03  ?  171  VAL B CG1 1 
ATOM   5518  C  CG2 . VAL B  1 171 ? 1.096   36.353  56.797  1.00 67.21  ?  171  VAL B CG2 1 
ATOM   5519  N  N   . GLY B  1 172 ? -0.461  35.286  59.678  1.00 70.70  ?  172  GLY B N   1 
ATOM   5520  C  CA  . GLY B  1 172 ? -1.808  35.224  60.225  1.00 72.10  ?  172  GLY B CA  1 
ATOM   5521  C  C   . GLY B  1 172 ? -1.816  35.365  61.736  1.00 75.12  ?  172  GLY B C   1 
ATOM   5522  O  O   . GLY B  1 172 ? -2.707  36.004  62.311  1.00 78.68  ?  172  GLY B O   1 
ATOM   5523  N  N   . LEU B  1 173 ? -0.819  34.776  62.401  1.00 73.59  ?  173  LEU B N   1 
ATOM   5524  C  CA  . LEU B  1 173 ? -0.659  34.997  63.832  1.00 73.83  ?  173  LEU B CA  1 
ATOM   5525  C  C   . LEU B  1 173 ? -0.343  36.459  64.119  1.00 77.06  ?  173  LEU B C   1 
ATOM   5526  O  O   . LEU B  1 173 ? -0.803  37.020  65.120  1.00 81.49  ?  173  LEU B O   1 
ATOM   5527  C  CB  . LEU B  1 173 ? 0.439   34.087  64.381  1.00 71.75  ?  173  LEU B CB  1 
ATOM   5528  C  CG  . LEU B  1 173 ? 0.124   32.589  64.416  1.00 68.21  ?  173  LEU B CG  1 
ATOM   5529  C  CD1 . LEU B  1 173 ? 1.334   31.802  64.886  1.00 65.59  ?  173  LEU B CD1 1 
ATOM   5530  C  CD2 . LEU B  1 173 ? -1.085  32.305  65.295  1.00 67.19  ?  173  LEU B CD2 1 
ATOM   5531  N  N   . LEU B  1 174 ? 0.434   37.098  63.242  1.00 75.07  ?  174  LEU B N   1 
ATOM   5532  C  CA  . LEU B  1 174 ? 0.683   38.525  63.388  1.00 77.20  ?  174  LEU B CA  1 
ATOM   5533  C  C   . LEU B  1 174 ? -0.573  39.343  63.110  1.00 77.34  ?  174  LEU B C   1 
ATOM   5534  O  O   . LEU B  1 174 ? -0.716  40.449  63.642  1.00 81.14  ?  174  LEU B O   1 
ATOM   5535  C  CB  . LEU B  1 174 ? 1.823   38.949  62.466  1.00 76.18  ?  174  LEU B CB  1 
ATOM   5536  C  CG  . LEU B  1 174 ? 3.160   38.269  62.763  1.00 75.70  ?  174  LEU B CG  1 
ATOM   5537  C  CD1 . LEU B  1 174 ? 4.246   38.792  61.835  1.00 77.19  ?  174  LEU B CD1 1 
ATOM   5538  C  CD2 . LEU B  1 174 ? 3.548   38.460  64.220  1.00 77.23  ?  174  LEU B CD2 1 
ATOM   5539  N  N   . ASP B  1 175 ? -1.486  38.827  62.280  1.00 75.16  ?  175  ASP B N   1 
ATOM   5540  C  CA  . ASP B  1 175 ? -2.803  39.448  62.162  1.00 76.79  ?  175  ASP B CA  1 
ATOM   5541  C  C   . ASP B  1 175 ? -3.540  39.397  63.492  1.00 78.98  ?  175  ASP B C   1 
ATOM   5542  O  O   . ASP B  1 175 ? -4.086  40.407  63.954  1.00 82.39  ?  175  ASP B O   1 
ATOM   5543  C  CB  . ASP B  1 175 ? -3.637  38.760  61.078  1.00 76.39  ?  175  ASP B CB  1 
ATOM   5544  C  CG  . ASP B  1 175 ? -3.057  38.926  59.686  1.00 78.37  ?  175  ASP B CG  1 
ATOM   5545  O  OD1 . ASP B  1 175 ? -2.203  39.813  59.488  1.00 81.70  ?  175  ASP B OD1 1 
ATOM   5546  O  OD2 . ASP B  1 175 ? -3.462  38.161  58.784  1.00 77.15  ?  175  ASP B OD2 1 
ATOM   5547  N  N   . GLN B  1 176 ? -3.565  38.219  64.122  1.00 76.98  ?  176  GLN B N   1 
ATOM   5548  C  CA  . GLN B  1 176 ? -4.211  38.088  65.425  1.00 81.00  ?  176  GLN B CA  1 
ATOM   5549  C  C   . GLN B  1 176 ? -3.590  39.034  66.450  1.00 85.07  ?  176  GLN B C   1 
ATOM   5550  O  O   . GLN B  1 176 ? -4.301  39.740  67.177  1.00 85.19  ?  176  GLN B O   1 
ATOM   5551  C  CB  . GLN B  1 176 ? -4.114  36.643  65.907  1.00 80.66  ?  176  GLN B CB  1 
ATOM   5552  C  CG  . GLN B  1 176 ? -4.634  35.609  64.932  1.00 80.20  ?  176  GLN B CG  1 
ATOM   5553  C  CD  . GLN B  1 176 ? -4.470  34.196  65.463  1.00 80.76  ?  176  GLN B CD  1 
ATOM   5554  O  OE1 . GLN B  1 176 ? -3.800  33.975  66.473  1.00 81.21  ?  176  GLN B OE1 1 
ATOM   5555  N  NE2 . GLN B  1 176 ? -5.093  33.234  64.793  1.00 80.20  ?  176  GLN B NE2 1 
ATOM   5556  N  N   . ARG B  1 177 ? -2.257  39.057  66.521  1.00 81.81  ?  177  ARG B N   1 
ATOM   5557  C  CA  . ARG B  1 177 ? -1.570  39.902  67.493  1.00 85.08  ?  177  ARG B CA  1 
ATOM   5558  C  C   . ARG B  1 177 ? -1.836  41.379  67.233  1.00 90.58  ?  177  ARG B C   1 
ATOM   5559  O  O   . ARG B  1 177 ? -2.023  42.159  68.174  1.00 94.86  ?  177  ARG B O   1 
ATOM   5560  C  CB  . ARG B  1 177 ? -0.070  39.610  67.461  1.00 84.15  ?  177  ARG B CB  1 
ATOM   5561  C  CG  . ARG B  1 177 ? 0.785   40.634  68.182  1.00 87.71  ?  177  ARG B CG  1 
ATOM   5562  C  CD  . ARG B  1 177 ? 2.258   40.384  67.929  1.00 86.84  ?  177  ARG B CD  1 
ATOM   5563  N  NE  . ARG B  1 177 ? 2.722   39.182  68.614  1.00 86.64  ?  177  ARG B NE  1 
ATOM   5564  C  CZ  . ARG B  1 177 ? 3.917   38.631  68.431  1.00 86.36  ?  177  ARG B CZ  1 
ATOM   5565  N  NH1 . ARG B  1 177 ? 4.778   39.175  67.579  1.00 87.54  ?  177  ARG B NH1 1 
ATOM   5566  N  NH2 . ARG B  1 177 ? 4.253   37.537  69.101  1.00 85.12  ?  177  ARG B NH2 1 
ATOM   5567  N  N   . LEU B  1 178 ? -1.856  41.786  65.960  1.00 88.88  ?  178  LEU B N   1 
ATOM   5568  C  CA  . LEU B  1 178 ? -2.191  43.169  65.636  1.00 91.97  ?  178  LEU B CA  1 
ATOM   5569  C  C   . LEU B  1 178 ? -3.610  43.509  66.074  1.00 94.65  ?  178  LEU B C   1 
ATOM   5570  O  O   . LEU B  1 178 ? -3.862  44.601  66.600  1.00 98.02  ?  178  LEU B O   1 
ATOM   5571  C  CB  . LEU B  1 178 ? -2.018  43.417  64.138  1.00 90.03  ?  178  LEU B CB  1 
ATOM   5572  C  CG  . LEU B  1 178 ? -2.227  44.867  63.692  1.00 92.26  ?  178  LEU B CG  1 
ATOM   5573  C  CD1 . LEU B  1 178 ? -1.261  45.814  64.398  1.00 94.79  ?  178  LEU B CD1 1 
ATOM   5574  C  CD2 . LEU B  1 178 ? -2.099  44.981  62.183  1.00 90.63  ?  178  LEU B CD2 1 
ATOM   5575  N  N   . ALA B  1 179 ? -4.553  42.585  65.866  1.00 93.10  ?  179  ALA B N   1 
ATOM   5576  C  CA  . ALA B  1 179 ? -5.906  42.796  66.371  1.00 95.02  ?  179  ALA B CA  1 
ATOM   5577  C  C   . ALA B  1 179 ? -5.905  42.960  67.887  1.00 99.60  ?  179  ALA B C   1 
ATOM   5578  O  O   . ALA B  1 179 ? -6.631  43.802  68.429  1.00 104.97 ?  179  ALA B O   1 
ATOM   5579  C  CB  . ALA B  1 179 ? -6.810  41.638  65.952  1.00 90.64  ?  179  ALA B CB  1 
ATOM   5580  N  N   . LEU B  1 180 ? -5.083  42.172  68.587  1.00 96.84  ?  180  LEU B N   1 
ATOM   5581  C  CA  . LEU B  1 180 ? -5.004  42.284  70.042  1.00 97.42  ?  180  LEU B CA  1 
ATOM   5582  C  C   . LEU B  1 180 ? -4.463  43.646  70.465  1.00 100.91 ?  180  LEU B C   1 
ATOM   5583  O  O   . LEU B  1 180 ? -4.950  44.240  71.434  1.00 104.65 ?  180  LEU B O   1 
ATOM   5584  C  CB  . LEU B  1 180 ? -4.134  41.158  70.602  1.00 94.84  ?  180  LEU B CB  1 
ATOM   5585  C  CG  . LEU B  1 180 ? -4.818  39.874  71.082  1.00 93.07  ?  180  LEU B CG  1 
ATOM   5586  C  CD1 . LEU B  1 180 ? -5.847  39.371  70.086  1.00 90.62  ?  180  LEU B CD1 1 
ATOM   5587  C  CD2 . LEU B  1 180 ? -3.774  38.806  71.350  1.00 90.63  ?  180  LEU B CD2 1 
ATOM   5588  N  N   . GLN B  1 181 ? -3.452  44.155  69.754  1.00 101.19 ?  181  GLN B N   1 
ATOM   5589  C  CA  . GLN B  1 181 ? -2.958  45.503  70.028  1.00 106.20 ?  181  GLN B CA  1 
ATOM   5590  C  C   . GLN B  1 181 ? -4.041  46.546  69.781  1.00 110.17 ?  181  GLN B C   1 
ATOM   5591  O  O   . GLN B  1 181 ? -4.163  47.521  70.537  1.00 114.23 ?  181  GLN B O   1 
ATOM   5592  C  CB  . GLN B  1 181 ? -1.723  45.790  69.172  1.00 104.58 ?  181  GLN B CB  1 
ATOM   5593  C  CG  . GLN B  1 181 ? -0.449  45.124  69.674  1.00 103.17 ?  181  GLN B CG  1 
ATOM   5594  C  CD  . GLN B  1 181 ? 0.550   44.838  68.562  0.33 98.93  ?  181  GLN B CD  1 
ATOM   5595  O  OE1 . GLN B  1 181 ? 0.306   45.141  67.393  1.00 97.55  ?  181  GLN B OE1 1 
ATOM   5596  N  NE2 . GLN B  1 181 ? 1.682   44.245  68.925  1.00 98.16  ?  181  GLN B NE2 1 
ATOM   5597  N  N   . TRP B  1 182 ? -4.844  46.353  68.728  1.00 109.09 ?  182  TRP B N   1 
ATOM   5598  C  CA  . TRP B  1 182 ? -5.974  47.245  68.483  1.00 112.60 ?  182  TRP B CA  1 
ATOM   5599  C  C   . TRP B  1 182 ? -6.973  47.201  69.634  1.00 116.25 ?  182  TRP B C   1 
ATOM   5600  O  O   . TRP B  1 182 ? -7.561  48.227  69.992  1.00 120.03 ?  182  TRP B O   1 
ATOM   5601  C  CB  . TRP B  1 182 ? -6.663  46.880  67.169  1.00 108.57 ?  182  TRP B CB  1 
ATOM   5602  C  CG  . TRP B  1 182 ? -7.783  47.810  66.787  1.00 109.58 ?  182  TRP B CG  1 
ATOM   5603  C  CD1 . TRP B  1 182 ? -7.713  48.855  65.914  1.00 111.14 ?  182  TRP B CD1 1 
ATOM   5604  C  CD2 . TRP B  1 182 ? -9.140  47.773  67.259  1.00 109.90 ?  182  TRP B CD2 1 
ATOM   5605  N  NE1 . TRP B  1 182 ? -8.937  49.472  65.814  1.00 113.01 ?  182  TRP B NE1 1 
ATOM   5606  C  CE2 . TRP B  1 182 ? -9.829  48.827  66.630  1.00 112.14 ?  182  TRP B CE2 1 
ATOM   5607  C  CE3 . TRP B  1 182 ? -9.837  46.952  68.151  1.00 110.02 ?  182  TRP B CE3 1 
ATOM   5608  C  CZ2 . TRP B  1 182 ? -11.180 49.082  66.865  1.00 114.13 ?  182  TRP B CZ2 1 
ATOM   5609  C  CZ3 . TRP B  1 182 ? -11.176 47.211  68.386  1.00 112.35 ?  182  TRP B CZ3 1 
ATOM   5610  C  CH2 . TRP B  1 182 ? -11.833 48.264  67.743  1.00 113.89 ?  182  TRP B CH2 1 
ATOM   5611  N  N   . VAL B  1 183 ? -7.201  46.014  70.205  1.00 114.96 ?  183  VAL B N   1 
ATOM   5612  C  CA  . VAL B  1 183 ? -8.067  45.909  71.378  1.00 117.46 ?  183  VAL B CA  1 
ATOM   5613  C  C   . VAL B  1 183 ? -7.461  46.675  72.548  1.00 122.86 ?  183  VAL B C   1 
ATOM   5614  O  O   . VAL B  1 183 ? -8.166  47.382  73.280  1.00 127.21 ?  183  VAL B O   1 
ATOM   5615  C  CB  . VAL B  1 183 ? -8.318  44.428  71.727  1.00 112.16 ?  183  VAL B CB  1 
ATOM   5616  C  CG1 . VAL B  1 183 ? -8.985  44.299  73.089  1.00 114.34 ?  183  VAL B CG1 1 
ATOM   5617  C  CG2 . VAL B  1 183 ? -9.169  43.763  70.651  1.00 108.25 ?  183  VAL B CG2 1 
ATOM   5618  N  N   . GLN B  1 184 ? -6.139  46.568  72.722  1.00 122.23 ?  184  GLN B N   1 
ATOM   5619  C  CA  . GLN B  1 184 ? -5.452  47.308  73.777  1.00 125.19 ?  184  GLN B CA  1 
ATOM   5620  C  C   . GLN B  1 184 ? -5.694  48.807  73.654  1.00 129.65 ?  184  GLN B C   1 
ATOM   5621  O  O   . GLN B  1 184 ? -6.086  49.464  74.625  1.00 134.30 ?  184  GLN B O   1 
ATOM   5622  C  CB  . GLN B  1 184 ? -3.953  47.007  73.737  1.00 121.56 ?  184  GLN B CB  1 
ATOM   5623  C  CG  . GLN B  1 184 ? -3.553  45.747  74.466  1.00 118.18 ?  184  GLN B CG  1 
ATOM   5624  C  CD  . GLN B  1 184 ? -3.644  45.900  75.963  1.00 121.53 ?  184  GLN B CD  1 
ATOM   5625  O  OE1 . GLN B  1 184 ? -2.809  46.561  76.580  1.00 122.73 ?  184  GLN B OE1 1 
ATOM   5626  N  NE2 . GLN B  1 184 ? -4.666  45.296  76.560  1.00 121.89 ?  184  GLN B NE2 1 
ATOM   5627  N  N   . GLU B  1 185 ? -5.463  49.369  72.464  1.00 128.01 ?  185  GLU B N   1 
ATOM   5628  C  CA  . GLU B  1 185 ? -5.588  50.816  72.307  1.00 131.49 ?  185  GLU B CA  1 
ATOM   5629  C  C   . GLU B  1 185 ? -7.048  51.266  72.333  1.00 130.24 ?  185  GLU B C   1 
ATOM   5630  O  O   . GLU B  1 185 ? -7.414  52.168  73.095  1.00 134.33 ?  185  GLU B O   1 
ATOM   5631  C  CB  . GLU B  1 185 ? -4.910  51.264  71.010  1.00 132.83 ?  185  GLU B CB  1 
ATOM   5632  C  CG  . GLU B  1 185 ? -3.415  50.968  70.939  1.00 134.35 ?  185  GLU B CG  1 
ATOM   5633  C  CD  . GLU B  1 185 ? -2.824  51.253  69.564  1.00 135.31 ?  185  GLU B CD  1 
ATOM   5634  O  OE1 . GLU B  1 185 ? -3.388  52.089  68.823  1.00 137.03 ?  185  GLU B OE1 1 
ATOM   5635  O  OE2 . GLU B  1 185 ? -1.796  50.633  69.218  1.00 134.33 ?  185  GLU B OE2 1 
ATOM   5636  N  N   . ASN B  1 186 ? -7.896  50.658  71.505  1.00 125.54 ?  186  ASN B N   1 
ATOM   5637  C  CA  . ASN B  1 186 ? -9.228  51.187  71.229  1.00 127.43 ?  186  ASN B CA  1 
ATOM   5638  C  C   . ASN B  1 186 ? -10.361 50.551  72.032  1.00 128.52 ?  186  ASN B C   1 
ATOM   5639  O  O   . ASN B  1 186 ? -11.508 50.980  71.878  1.00 130.76 ?  186  ASN B O   1 
ATOM   5640  C  CB  . ASN B  1 186 ? -9.541  51.050  69.734  1.00 124.14 ?  186  ASN B CB  1 
ATOM   5641  C  CG  . ASN B  1 186 ? -8.534  51.773  68.854  1.00 124.66 ?  186  ASN B CG  1 
ATOM   5642  O  OD1 . ASN B  1 186 ? -8.563  52.999  68.732  1.00 128.73 ?  186  ASN B OD1 1 
ATOM   5643  N  ND2 . ASN B  1 186 ? -7.636  51.012  68.235  1.00 120.88 ?  186  ASN B ND2 1 
ATOM   5644  N  N   . ILE B  1 187 ? -10.104 49.546  72.873  1.00 127.25 ?  187  ILE B N   1 
ATOM   5645  C  CA  . ILE B  1 187 ? -11.252 48.828  73.430  1.00 127.77 ?  187  ILE B CA  1 
ATOM   5646  C  C   . ILE B  1 187 ? -11.940 49.614  74.540  1.00 133.87 ?  187  ILE B C   1 
ATOM   5647  O  O   . ILE B  1 187 ? -13.102 49.328  74.856  1.00 139.50 ?  187  ILE B O   1 
ATOM   5648  C  CB  . ILE B  1 187 ? -10.877 47.427  73.946  1.00 127.04 ?  187  ILE B CB  1 
ATOM   5649  C  CG1 . ILE B  1 187 ? -12.097 46.497  73.878  1.00 123.21 ?  187  ILE B CG1 1 
ATOM   5650  C  CG2 . ILE B  1 187 ? -10.382 47.490  75.391  1.00 131.05 ?  187  ILE B CG2 1 
ATOM   5651  C  CD1 . ILE B  1 187 ? -12.733 46.383  72.494  1.00 120.34 ?  187  ILE B CD1 1 
ATOM   5652  N  N   . ALA B  1 188 ? -11.268 50.608  75.128  1.00 142.08 ?  188  ALA B N   1 
ATOM   5653  C  CA  . ALA B  1 188 ? -11.867 51.362  76.226  1.00 143.94 ?  188  ALA B CA  1 
ATOM   5654  C  C   . ALA B  1 188 ? -13.049 52.201  75.759  1.00 146.90 ?  188  ALA B C   1 
ATOM   5655  O  O   . ALA B  1 188 ? -13.963 52.476  76.545  1.00 151.35 ?  188  ALA B O   1 
ATOM   5656  C  CB  . ALA B  1 188 ? -10.813 52.248  76.890  1.00 147.53 ?  188  ALA B CB  1 
ATOM   5657  N  N   . ALA B  1 189 ? -13.055 52.605  74.487  1.00 144.69 ?  189  ALA B N   1 
ATOM   5658  C  CA  . ALA B  1 189 ? -14.150 53.409  73.961  1.00 147.44 ?  189  ALA B CA  1 
ATOM   5659  C  C   . ALA B  1 189 ? -15.463 52.639  73.894  1.00 146.72 ?  189  ALA B C   1 
ATOM   5660  O  O   . ALA B  1 189 ? -16.531 53.259  73.915  1.00 153.23 ?  189  ALA B O   1 
ATOM   5661  C  CB  . ALA B  1 189 ? -13.782 53.944  72.576  1.00 145.00 ?  189  ALA B CB  1 
ATOM   5662  N  N   . PHE B  1 190 ? -15.414 51.311  73.824  1.00 142.71 ?  190  PHE B N   1 
ATOM   5663  C  CA  . PHE B  1 190 ? -16.611 50.482  73.760  1.00 141.46 ?  190  PHE B CA  1 
ATOM   5664  C  C   . PHE B  1 190 ? -17.083 50.016  75.129  1.00 144.57 ?  190  PHE B C   1 
ATOM   5665  O  O   . PHE B  1 190 ? -18.052 49.253  75.208  1.00 144.28 ?  190  PHE B O   1 
ATOM   5666  C  CB  . PHE B  1 190 ? -16.366 49.265  72.861  1.00 136.28 ?  190  PHE B CB  1 
ATOM   5667  C  CG  . PHE B  1 190 ? -15.965 49.619  71.458  1.00 131.95 ?  190  PHE B CG  1 
ATOM   5668  C  CD1 . PHE B  1 190 ? -14.639 49.862  71.144  1.00 129.81 ?  190  PHE B CD1 1 
ATOM   5669  C  CD2 . PHE B  1 190 ? -16.915 49.715  70.455  1.00 131.46 ?  190  PHE B CD2 1 
ATOM   5670  C  CE1 . PHE B  1 190 ? -14.267 50.194  69.857  1.00 127.52 ?  190  PHE B CE1 1 
ATOM   5671  C  CE2 . PHE B  1 190 ? -16.549 50.046  69.165  1.00 128.85 ?  190  PHE B CE2 1 
ATOM   5672  C  CZ  . PHE B  1 190 ? -15.224 50.285  68.865  1.00 126.73 ?  190  PHE B CZ  1 
ATOM   5673  N  N   . GLY B  1 191 ? -16.424 50.447  76.202  1.00 147.74 ?  191  GLY B N   1 
ATOM   5674  C  CA  . GLY B  1 191 ? -16.759 50.012  77.539  1.00 150.86 ?  191  GLY B CA  1 
ATOM   5675  C  C   . GLY B  1 191 ? -15.975 48.819  78.034  1.00 147.50 ?  191  GLY B C   1 
ATOM   5676  O  O   . GLY B  1 191 ? -16.219 48.363  79.159  1.00 149.70 ?  191  GLY B O   1 
ATOM   5677  N  N   . GLY B  1 192 ? -15.042 48.293  77.229  1.00 142.35 ?  192  GLY B N   1 
ATOM   5678  C  CA  . GLY B  1 192 ? -14.253 47.150  77.629  1.00 138.28 ?  192  GLY B CA  1 
ATOM   5679  C  C   . GLY B  1 192 ? -13.043 47.522  78.467  1.00 140.02 ?  192  GLY B C   1 
ATOM   5680  O  O   . GLY B  1 192 ? -12.554 48.650  78.430  1.00 142.65 ?  192  GLY B O   1 
ATOM   5681  N  N   . ASP B  1 193 ? -12.568 46.546  79.240  1.00 138.74 ?  193  ASP B N   1 
ATOM   5682  C  CA  . ASP B  1 193 ? -11.441 46.758  80.135  1.00 142.49 ?  193  ASP B CA  1 
ATOM   5683  C  C   . ASP B  1 193 ? -10.189 46.178  79.497  1.00 137.51 ?  193  ASP B C   1 
ATOM   5684  O  O   . ASP B  1 193 ? -10.061 44.947  79.422  1.00 134.47 ?  193  ASP B O   1 
ATOM   5685  C  CB  . ASP B  1 193 ? -11.707 46.102  81.492  1.00 144.35 ?  193  ASP B CB  1 
ATOM   5686  C  CG  . ASP B  1 193 ? -10.620 46.394  82.517  1.00 146.09 ?  193  ASP B CG  1 
ATOM   5687  O  OD1 . ASP B  1 193 ? -9.715  47.203  82.226  1.00 146.46 ?  193  ASP B OD1 1 
ATOM   5688  O  OD2 . ASP B  1 193 ? -10.679 45.821  83.626  1.00 147.96 ?  193  ASP B OD2 1 
ATOM   5689  N  N   . PRO B  1 194 ? -9.243  47.003  79.035  1.00 136.84 ?  194  PRO B N   1 
ATOM   5690  C  CA  . PRO B  1 194 ? -8.047  46.450  78.378  1.00 132.82 ?  194  PRO B CA  1 
ATOM   5691  C  C   . PRO B  1 194 ? -7.138  45.660  79.307  1.00 133.65 ?  194  PRO B C   1 
ATOM   5692  O  O   . PRO B  1 194 ? -6.296  44.899  78.812  1.00 130.63 ?  194  PRO B O   1 
ATOM   5693  C  CB  . PRO B  1 194 ? -7.335  47.696  77.831  1.00 132.27 ?  194  PRO B CB  1 
ATOM   5694  C  CG  . PRO B  1 194 ? -7.842  48.822  78.666  1.00 138.63 ?  194  PRO B CG  1 
ATOM   5695  C  CD  . PRO B  1 194 ? -9.262  48.475  79.000  1.00 139.88 ?  194  PRO B CD  1 
ATOM   5696  N  N   . MET B  1 195 ? -7.264  45.816  80.624  1.00 137.40 ?  195  MET B N   1 
ATOM   5697  C  CA  . MET B  1 195 ? -6.416  45.100  81.567  1.00 137.22 ?  195  MET B CA  1 
ATOM   5698  C  C   . MET B  1 195 ? -7.047  43.818  82.105  1.00 136.00 ?  195  MET B C   1 
ATOM   5699  O  O   . MET B  1 195 ? -6.435  43.153  82.949  1.00 136.19 ?  195  MET B O   1 
ATOM   5700  C  CB  . MET B  1 195 ? -6.009  46.024  82.719  1.00 143.24 ?  195  MET B CB  1 
ATOM   5701  C  CG  . MET B  1 195 ? -4.735  46.805  82.415  1.00 144.87 ?  195  MET B CG  1 
ATOM   5702  S  SD  . MET B  1 195 ? -4.378  48.119  83.592  1.00 155.16 ?  195  MET B SD  1 
ATOM   5703  C  CE  . MET B  1 195 ? -5.644  49.316  83.164  1.00 159.49 ?  195  MET B CE  1 
ATOM   5704  N  N   . SER B  1 196 ? -8.249  43.459  81.653  1.00 134.54 ?  196  SER B N   1 
ATOM   5705  C  CA  . SER B  1 196 ? -8.767  42.102  81.807  1.00 130.96 ?  196  SER B CA  1 
ATOM   5706  C  C   . SER B  1 196 ? -9.154  41.623  80.413  1.00 126.24 ?  196  SER B C   1 
ATOM   5707  O  O   . SER B  1 196 ? -10.145 42.091  79.845  1.00 127.02 ?  196  SER B O   1 
ATOM   5708  C  CB  . SER B  1 196 ? -9.963  42.065  82.765  1.00 133.70 ?  196  SER B CB  1 
ATOM   5709  O  OG  . SER B  1 196 ? -10.187 40.758  83.265  1.00 131.89 ?  196  SER B OG  1 
ATOM   5710  N  N   . VAL B  1 197 ? -8.400  40.664  79.883  1.00 122.39 ?  197  VAL B N   1 
ATOM   5711  C  CA  . VAL B  1 197 ? -8.566  40.202  78.509  1.00 120.21 ?  197  VAL B CA  1 
ATOM   5712  C  C   . VAL B  1 197 ? -8.463  38.686  78.503  1.00 118.29 ?  197  VAL B C   1 
ATOM   5713  O  O   . VAL B  1 197 ? -7.516  38.115  79.057  1.00 118.04 ?  197  VAL B O   1 
ATOM   5714  C  CB  . VAL B  1 197 ? -7.524  40.810  77.544  1.00 118.75 ?  197  VAL B CB  1 
ATOM   5715  C  CG1 . VAL B  1 197 ? -7.699  40.249  76.137  1.00 112.86 ?  197  VAL B CG1 1 
ATOM   5716  C  CG2 . VAL B  1 197 ? -7.632  42.322  77.513  1.00 123.82 ?  197  VAL B CG2 1 
ATOM   5717  N  N   . THR B  1 198 ? -9.436  38.035  77.877  1.00 117.05 ?  198  THR B N   1 
ATOM   5718  C  CA  . THR B  1 198 ? -9.474  36.583  77.809  1.00 115.01 ?  198  THR B CA  1 
ATOM   5719  C  C   . THR B  1 198 ? -9.611  36.178  76.349  1.00 113.26 ?  198  THR B C   1 
ATOM   5720  O  O   . THR B  1 198 ? -10.641 36.443  75.719  1.00 116.38 ?  198  THR B O   1 
ATOM   5721  C  CB  . THR B  1 198 ? -10.627 36.029  78.644  1.00 116.17 ?  198  THR B CB  1 
ATOM   5722  O  OG1 . THR B  1 198 ? -10.532 36.538  79.980  1.00 121.73 ?  198  THR B OG1 1 
ATOM   5723  C  CG2 . THR B  1 198 ? -10.579 34.511  78.681  1.00 111.90 ?  198  THR B CG2 1 
ATOM   5724  N  N   . LEU B  1 199 ? -8.573  35.542  75.816  1.00 107.24 ?  199  LEU B N   1 
ATOM   5725  C  CA  . LEU B  1 199 ? -8.657  34.916  74.510  1.00 101.20 ?  199  LEU B CA  1 
ATOM   5726  C  C   . LEU B  1 199 ? -9.326  33.561  74.659  1.00 100.76 ?  199  LEU B C   1 
ATOM   5727  O  O   . LEU B  1 199 ? -9.100  32.852  75.642  1.00 102.52 ?  199  LEU B O   1 
ATOM   5728  C  CB  . LEU B  1 199 ? -7.262  34.740  73.912  1.00 96.52  ?  199  LEU B CB  1 
ATOM   5729  C  CG  . LEU B  1 199 ? -6.332  35.951  73.942  1.00 96.69  ?  199  LEU B CG  1 
ATOM   5730  C  CD1 . LEU B  1 199 ? -4.964  35.569  73.391  1.00 92.83  ?  199  LEU B CD1 1 
ATOM   5731  C  CD2 . LEU B  1 199 ? -6.928  37.121  73.171  1.00 97.40  ?  199  LEU B CD2 1 
ATOM   5732  N  N   . PHE B  1 200 ? -10.168 33.205  73.693  1.00 98.91  ?  200  PHE B N   1 
ATOM   5733  C  CA  . PHE B  1 200 ? -10.697 31.850  73.656  1.00 95.95  ?  200  PHE B CA  1 
ATOM   5734  C  C   . PHE B  1 200 ? -10.895 31.431  72.206  1.00 90.59  ?  200  PHE B C   1 
ATOM   5735  O  O   . PHE B  1 200 ? -11.298 32.239  71.366  1.00 87.58  ?  200  PHE B O   1 
ATOM   5736  C  CB  . PHE B  1 200 ? -11.986 31.720  74.497  1.00 97.74  ?  200  PHE B CB  1 
ATOM   5737  C  CG  . PHE B  1 200 ? -13.211 32.354  73.898  1.00 97.02  ?  200  PHE B CG  1 
ATOM   5738  C  CD1 . PHE B  1 200 ? -13.241 33.700  73.580  1.00 96.53  ?  200  PHE B CD1 1 
ATOM   5739  C  CD2 . PHE B  1 200 ? -14.362 31.603  73.713  1.00 93.52  ?  200  PHE B CD2 1 
ATOM   5740  C  CE1 . PHE B  1 200 ? -14.383 34.275  73.050  1.00 97.45  ?  200  PHE B CE1 1 
ATOM   5741  C  CE2 . PHE B  1 200 ? -15.506 32.170  73.187  1.00 95.34  ?  200  PHE B CE2 1 
ATOM   5742  C  CZ  . PHE B  1 200 ? -15.517 33.507  72.853  1.00 96.88  ?  200  PHE B CZ  1 
ATOM   5743  N  N   . GLY B  1 201 ? -10.576 30.169  71.918  1.00 89.50  ?  201  GLY B N   1 
ATOM   5744  C  CA  . GLY B  1 201 ? -10.619 29.698  70.544  1.00 88.49  ?  201  GLY B CA  1 
ATOM   5745  C  C   . GLY B  1 201 ? -10.811 28.201  70.472  1.00 88.62  ?  201  GLY B C   1 
ATOM   5746  O  O   . GLY B  1 201 ? -10.668 27.479  71.461  1.00 90.18  ?  201  GLY B O   1 
ATOM   5747  N  N   . GLU B  1 202 ? -11.142 27.740  69.268  1.00 87.30  ?  202  GLU B N   1 
ATOM   5748  C  CA  . GLU B  1 202 ? -11.388 26.330  69.010  1.00 87.03  ?  202  GLU B CA  1 
ATOM   5749  C  C   . GLU B  1 202 ? -10.638 25.906  67.756  1.00 84.66  ?  202  GLU B C   1 
ATOM   5750  O  O   . GLU B  1 202 ? -10.432 26.707  66.842  1.00 85.75  ?  202  GLU B O   1 
ATOM   5751  C  CB  . GLU B  1 202 ? -12.895 26.049  68.863  1.00 89.29  ?  202  GLU B CB  1 
ATOM   5752  C  CG  . GLU B  1 202 ? -13.265 24.574  68.804  1.00 89.17  ?  202  GLU B CG  1 
ATOM   5753  C  CD  . GLU B  1 202 ? -13.247 24.029  67.388  1.00 87.68  ?  202  GLU B CD  1 
ATOM   5754  O  OE1 . GLU B  1 202 ? -13.263 24.843  66.436  1.00 87.68  ?  202  GLU B OE1 1 
ATOM   5755  O  OE2 . GLU B  1 202 ? -13.195 22.792  67.228  1.00 86.51  ?  202  GLU B OE2 1 
ATOM   5756  N  N   . SER B  1 203 ? -10.233 24.637  67.727  1.00 81.06  ?  203  SER B N   1 
ATOM   5757  C  CA  . SER B  1 203 ? -9.488  24.039  66.606  1.00 76.77  ?  203  SER B CA  1 
ATOM   5758  C  C   . SER B  1 203 ? -8.210  24.855  66.425  1.00 76.44  ?  203  SER B C   1 
ATOM   5759  O  O   . SER B  1 203 ? -7.546  25.154  67.432  1.00 76.51  ?  203  SER B O   1 
ATOM   5760  C  CB  . SER B  1 203 ? -10.388 23.939  65.377  1.00 74.59  ?  203  SER B CB  1 
ATOM   5761  O  OG  . SER B  1 203 ? -9.732  23.258  64.317  1.00 71.75  ?  203  SER B OG  1 
ATOM   5762  N  N   . ALA B  1 204 ? -7.841  25.237  65.196  1.00 75.64  ?  204  ALA B N   1 
ATOM   5763  C  CA  . ALA B  1 204 ? -6.636  26.033  64.978  1.00 74.30  ?  204  ALA B CA  1 
ATOM   5764  C  C   . ALA B  1 204 ? -6.625  27.283  65.845  1.00 77.80  ?  204  ALA B C   1 
ATOM   5765  O  O   . ALA B  1 204 ? -5.588  27.639  66.419  1.00 79.01  ?  204  ALA B O   1 
ATOM   5766  C  CB  . ALA B  1 204 ? -6.523  26.415  63.505  1.00 71.73  ?  204  ALA B CB  1 
ATOM   5767  N  N   . GLY B  1 205 ? -7.771  27.963  65.950  1.00 79.38  ?  205  GLY B N   1 
ATOM   5768  C  CA  . GLY B  1 205 ? -7.865  29.119  66.829  1.00 80.82  ?  205  GLY B CA  1 
ATOM   5769  C  C   . GLY B  1 205 ? -7.413  28.812  68.242  1.00 80.44  ?  205  GLY B C   1 
ATOM   5770  O  O   . GLY B  1 205 ? -6.622  29.556  68.831  1.00 81.04  ?  205  GLY B O   1 
ATOM   5771  N  N   . ALA B  1 206 ? -7.898  27.698  68.800  1.00 79.10  ?  206  ALA B N   1 
ATOM   5772  C  CA  . ALA B  1 206 ? -7.401  27.239  70.093  1.00 78.11  ?  206  ALA B CA  1 
ATOM   5773  C  C   . ALA B  1 206 ? -5.882  27.146  70.082  1.00 73.85  ?  206  ALA B C   1 
ATOM   5774  O  O   . ALA B  1 206 ? -5.204  27.720  70.944  1.00 75.04  ?  206  ALA B O   1 
ATOM   5775  C  CB  . ALA B  1 206 ? -8.026  25.889  70.451  1.00 77.60  ?  206  ALA B CB  1 
ATOM   5776  N  N   . ALA B  1 207 ? -5.328  26.456  69.081  1.00 69.37  ?  207  ALA B N   1 
ATOM   5777  C  CA  . ALA B  1 207 ? -3.877  26.405  68.933  1.00 68.08  ?  207  ALA B CA  1 
ATOM   5778  C  C   . ALA B  1 207 ? -3.284  27.805  68.859  1.00 70.96  ?  207  ALA B C   1 
ATOM   5779  O  O   . ALA B  1 207 ? -2.289  28.102  69.534  1.00 73.29  ?  207  ALA B O   1 
ATOM   5780  C  CB  . ALA B  1 207 ? -3.504  25.594  67.693  1.00 64.09  ?  207  ALA B CB  1 
ATOM   5781  N  N   . SER B  1 208 ? -3.905  28.689  68.073  1.00 71.21  ?  208  SER B N   1 
ATOM   5782  C  CA  . SER B  1 208 ? -3.443  30.071  68.010  1.00 71.86  ?  208  SER B CA  1 
ATOM   5783  C  C   . SER B  1 208 ? -3.346  30.670  69.404  1.00 75.05  ?  208  SER B C   1 
ATOM   5784  O  O   . SER B  1 208 ? -2.329  31.276  69.762  1.00 77.96  ?  208  SER B O   1 
ATOM   5785  C  CB  . SER B  1 208 ? -4.379  30.900  67.131  1.00 71.05  ?  208  SER B CB  1 
ATOM   5786  O  OG  . SER B  1 208 ? -4.459  30.363  65.826  1.00 66.46  ?  208  SER B OG  1 
ATOM   5787  N  N   . VAL B  1 209 ? -4.387  30.473  70.220  1.00 74.15  ?  209  VAL B N   1 
ATOM   5788  C  CA  . VAL B  1 209 ? -4.371  30.999  71.582  1.00 77.70  ?  209  VAL B CA  1 
ATOM   5789  C  C   . VAL B  1 209 ? -3.136  30.501  72.320  1.00 77.40  ?  209  VAL B C   1 
ATOM   5790  O  O   . VAL B  1 209 ? -2.396  31.284  72.930  1.00 78.43  ?  209  VAL B O   1 
ATOM   5791  C  CB  . VAL B  1 209 ? -5.666  30.615  72.319  1.00 82.26  ?  209  VAL B CB  1 
ATOM   5792  C  CG1 . VAL B  1 209 ? -5.570  30.987  73.786  1.00 86.52  ?  209  VAL B CG1 1 
ATOM   5793  C  CG2 . VAL B  1 209 ? -6.860  31.295  71.667  1.00 84.17  ?  209  VAL B CG2 1 
ATOM   5794  N  N   . GLY B  1 210 ? -2.869  29.194  72.231  1.00 76.30  ?  210  GLY B N   1 
ATOM   5795  C  CA  . GLY B  1 210 ? -1.692  28.646  72.884  1.00 77.35  ?  210  GLY B CA  1 
ATOM   5796  C  C   . GLY B  1 210 ? -0.410  29.291  72.398  1.00 79.90  ?  210  GLY B C   1 
ATOM   5797  O  O   . GLY B  1 210 ? 0.502   29.561  73.185  1.00 84.24  ?  210  GLY B O   1 
ATOM   5798  N  N   . MET B  1 211 ? -0.336  29.582  71.099  1.00 78.77  ?  211  MET B N   1 
ATOM   5799  C  CA  . MET B  1 211 ? 0.863   30.205  70.561  1.00 78.22  ?  211  MET B CA  1 
ATOM   5800  C  C   . MET B  1 211 ? 0.988   31.661  70.978  1.00 84.81  ?  211  MET B C   1 
ATOM   5801  O  O   . MET B  1 211 ? 2.100   32.200  70.963  1.00 88.78  ?  211  MET B O   1 
ATOM   5802  C  CB  . MET B  1 211 ? 0.880   30.067  69.044  1.00 72.67  ?  211  MET B CB  1 
ATOM   5803  C  CG  . MET B  1 211 ? 1.291   28.682  68.633  1.00 71.77  ?  211  MET B CG  1 
ATOM   5804  S  SD  . MET B  1 211 ? 1.108   28.366  66.889  1.00 73.61  ?  211  MET B SD  1 
ATOM   5805  C  CE  . MET B  1 211 ? -0.083  27.029  66.931  1.00 75.18  ?  211  MET B CE  1 
ATOM   5806  N  N   . HIS B  1 212 ? -0.114  32.309  71.363  1.00 85.15  ?  212  HIS B N   1 
ATOM   5807  C  CA  . HIS B  1 212 ? 0.026   33.624  71.970  1.00 85.85  ?  212  HIS B CA  1 
ATOM   5808  C  C   . HIS B  1 212 ? 0.565   33.522  73.387  1.00 85.50  ?  212  HIS B C   1 
ATOM   5809  O  O   . HIS B  1 212 ? 1.162   34.483  73.880  1.00 87.20  ?  212  HIS B O   1 
ATOM   5810  C  CB  . HIS B  1 212 ? -1.316  34.361  71.949  1.00 87.95  ?  212  HIS B CB  1 
ATOM   5811  C  CG  . HIS B  1 212 ? -1.747  34.777  70.574  1.00 86.23  ?  212  HIS B CG  1 
ATOM   5812  N  ND1 . HIS B  1 212 ? -1.020  35.657  69.801  1.00 84.94  ?  212  HIS B ND1 1 
ATOM   5813  C  CD2 . HIS B  1 212 ? -2.823  34.424  69.830  1.00 85.08  ?  212  HIS B CD2 1 
ATOM   5814  C  CE1 . HIS B  1 212 ? -1.630  35.831  68.642  1.00 82.04  ?  212  HIS B CE1 1 
ATOM   5815  N  NE2 . HIS B  1 212 ? -2.727  35.094  68.635  1.00 77.52  ?  212  HIS B NE2 1 
ATOM   5816  N  N   . ILE B  1 213 ? 0.380   32.368  74.034  1.00 85.10  ?  213  ILE B N   1 
ATOM   5817  C  CA  . ILE B  1 213 ? 0.932   32.144  75.367  1.00 88.48  ?  213  ILE B CA  1 
ATOM   5818  C  C   . ILE B  1 213 ? 2.443   31.967  75.289  1.00 86.98  ?  213  ILE B C   1 
ATOM   5819  O  O   . ILE B  1 213 ? 3.187   32.429  76.162  1.00 86.58  ?  213  ILE B O   1 
ATOM   5820  C  CB  . ILE B  1 213 ? 0.247   30.922  76.010  1.00 88.75  ?  213  ILE B CB  1 
ATOM   5821  C  CG1 . ILE B  1 213 ? -1.224  31.226  76.307  1.00 84.93  ?  213  ILE B CG1 1 
ATOM   5822  C  CG2 . ILE B  1 213 ? 0.977   30.483  77.271  1.00 85.25  ?  213  ILE B CG2 1 
ATOM   5823  C  CD1 . ILE B  1 213 ? -1.978  30.067  76.924  1.00 84.61  ?  213  ILE B CD1 1 
ATOM   5824  N  N   . LEU B  1 214 ? 2.918   31.307  74.235  1.00 86.44  ?  214  LEU B N   1 
ATOM   5825  C  CA  . LEU B  1 214 ? 4.321   30.952  74.087  1.00 88.16  ?  214  LEU B CA  1 
ATOM   5826  C  C   . LEU B  1 214 ? 5.144   32.011  73.362  1.00 90.64  ?  214  LEU B C   1 
ATOM   5827  O  O   . LEU B  1 214 ? 6.373   31.884  73.312  1.00 92.07  ?  214  LEU B O   1 
ATOM   5828  C  CB  . LEU B  1 214 ? 4.438   29.619  73.338  1.00 83.63  ?  214  LEU B CB  1 
ATOM   5829  C  CG  . LEU B  1 214 ? 3.683   28.446  73.964  1.00 80.54  ?  214  LEU B CG  1 
ATOM   5830  C  CD1 . LEU B  1 214 ? 3.601   27.284  72.990  1.00 75.68  ?  214  LEU B CD1 1 
ATOM   5831  C  CD2 . LEU B  1 214 ? 4.338   28.021  75.272  1.00 82.05  ?  214  LEU B CD2 1 
ATOM   5832  N  N   . SER B  1 215 ? 4.513   33.038  72.796  1.00 90.43  ?  215  SER B N   1 
ATOM   5833  C  CA  . SER B  1 215 ? 5.218   34.092  72.075  1.00 89.45  ?  215  SER B CA  1 
ATOM   5834  C  C   . SER B  1 215 ? 5.341   35.310  72.980  1.00 91.00  ?  215  SER B C   1 
ATOM   5835  O  O   . SER B  1 215 ? 4.332   35.930  73.336  1.00 89.55  ?  215  SER B O   1 
ATOM   5836  C  CB  . SER B  1 215 ? 4.495   34.456  70.778  1.00 88.22  ?  215  SER B CB  1 
ATOM   5837  O  OG  . SER B  1 215 ? 5.210   35.443  70.054  1.00 89.11  ?  215  SER B OG  1 
ATOM   5838  N  N   . LEU B  1 216 ? 6.577   35.652  73.337  1.00 94.57  ?  216  LEU B N   1 
ATOM   5839  C  CA  . LEU B  1 216 ? 6.800   36.706  74.324  1.00 101.17 ?  216  LEU B CA  1 
ATOM   5840  C  C   . LEU B  1 216 ? 6.224   38.063  73.923  1.00 103.00 ?  216  LEU B C   1 
ATOM   5841  O  O   . LEU B  1 216 ? 5.700   38.759  74.811  1.00 109.72 ?  216  LEU B O   1 
ATOM   5842  C  CB  . LEU B  1 216 ? 8.302   36.812  74.624  1.00 103.53 ?  216  LEU B CB  1 
ATOM   5843  C  CG  . LEU B  1 216 ? 8.707   37.572  75.888  1.00 107.46 ?  216  LEU B CG  1 
ATOM   5844  C  CD1 . LEU B  1 216 ? 9.862   36.849  76.572  1.00 108.31 ?  216  LEU B CD1 1 
ATOM   5845  C  CD2 . LEU B  1 216 ? 9.063   39.026  75.581  1.00 109.64 ?  216  LEU B CD2 1 
ATOM   5846  N  N   . PRO B  1 217 ? 6.296   38.514  72.662  1.00 97.16  ?  217  PRO B N   1 
ATOM   5847  C  CA  . PRO B  1 217 ? 5.631   39.784  72.321  1.00 98.15  ?  217  PRO B CA  1 
ATOM   5848  C  C   . PRO B  1 217 ? 4.129   39.778  72.565  1.00 99.25  ?  217  PRO B C   1 
ATOM   5849  O  O   . PRO B  1 217 ? 3.554   40.835  72.856  1.00 102.57 ?  217  PRO B O   1 
ATOM   5850  C  CB  . PRO B  1 217 ? 5.961   39.959  70.833  1.00 93.88  ?  217  PRO B CB  1 
ATOM   5851  C  CG  . PRO B  1 217 ? 7.246   39.243  70.658  1.00 91.54  ?  217  PRO B CG  1 
ATOM   5852  C  CD  . PRO B  1 217 ? 7.163   38.049  71.562  1.00 92.10  ?  217  PRO B CD  1 
ATOM   5853  N  N   . SER B  1 218 ? 3.475   38.620  72.470  1.00 97.12  ?  218  SER B N   1 
ATOM   5854  C  CA  . SER B  1 218 ? 2.029   38.556  72.643  1.00 96.96  ?  218  SER B CA  1 
ATOM   5855  C  C   . SER B  1 218 ? 1.603   38.597  74.103  1.00 100.90 ?  218  SER B C   1 
ATOM   5856  O  O   . SER B  1 218 ? 0.443   38.916  74.386  1.00 100.82 ?  218  SER B O   1 
ATOM   5857  C  CB  . SER B  1 218 ? 1.477   37.282  71.996  1.00 91.46  ?  218  SER B CB  1 
ATOM   5858  O  OG  . SER B  1 218 ? 1.765   37.240  70.607  1.00 87.30  ?  218  SER B OG  1 
ATOM   5859  N  N   . ARG B  1 219 ? 2.516   38.295  75.031  1.00 104.53 ?  219  ARG B N   1 
ATOM   5860  C  CA  . ARG B  1 219 ? 2.159   38.078  76.429  1.00 107.19 ?  219  ARG B CA  1 
ATOM   5861  C  C   . ARG B  1 219 ? 1.667   39.334  77.135  1.00 110.67 ?  219  ARG B C   1 
ATOM   5862  O  O   . ARG B  1 219 ? 1.159   39.226  78.256  1.00 114.31 ?  219  ARG B O   1 
ATOM   5863  C  CB  . ARG B  1 219 ? 3.356   37.498  77.194  1.00 107.60 ?  219  ARG B CB  1 
ATOM   5864  C  CG  . ARG B  1 219 ? 3.499   35.983  77.081  1.00 103.89 ?  219  ARG B CG  1 
ATOM   5865  C  CD  . ARG B  1 219 ? 2.193   35.271  77.417  1.00 104.07 ?  219  ARG B CD  1 
ATOM   5866  N  NE  . ARG B  1 219 ? 1.717   35.597  78.759  1.00 109.63 ?  219  ARG B NE  1 
ATOM   5867  C  CZ  . ARG B  1 219 ? 1.813   34.779  79.804  1.00 111.30 ?  219  ARG B CZ  1 
ATOM   5868  N  NH1 . ARG B  1 219 ? 2.355   33.574  79.658  1.00 108.55 ?  219  ARG B NH1 1 
ATOM   5869  N  NH2 . ARG B  1 219 ? 1.358   35.162  80.993  1.00 114.82 ?  219  ARG B NH2 1 
ATOM   5870  N  N   . SER B  1 220 ? 1.815   40.512  76.540  1.00 109.95 ?  220  SER B N   1 
ATOM   5871  C  CA  . SER B  1 220 ? 1.320   41.724  77.178  1.00 113.95 ?  220  SER B CA  1 
ATOM   5872  C  C   . SER B  1 220 ? -0.073  42.119  76.706  1.00 112.83 ?  220  SER B C   1 
ATOM   5873  O  O   . SER B  1 220 ? -0.636  43.086  77.230  1.00 114.93 ?  220  SER B O   1 
ATOM   5874  C  CB  . SER B  1 220 ? 2.292   42.885  76.938  1.00 117.38 ?  220  SER B CB  1 
ATOM   5875  O  OG  . SER B  1 220 ? 2.373   43.220  75.563  1.00 115.70 ?  220  SER B OG  1 
ATOM   5876  N  N   . LEU B  1 221 ? -0.637  41.405  75.734  1.00 109.74 ?  221  LEU B N   1 
ATOM   5877  C  CA  . LEU B  1 221 ? -1.918  41.764  75.142  1.00 109.46 ?  221  LEU B CA  1 
ATOM   5878  C  C   . LEU B  1 221 ? -3.103  41.000  75.722  1.00 109.36 ?  221  LEU B C   1 
ATOM   5879  O  O   . LEU B  1 221 ? -4.242  41.266  75.322  1.00 108.37 ?  221  LEU B O   1 
ATOM   5880  C  CB  . LEU B  1 221 ? -1.861  41.555  73.628  1.00 105.25 ?  221  LEU B CB  1 
ATOM   5881  C  CG  . LEU B  1 221 ? -0.687  42.251  72.938  1.00 105.65 ?  221  LEU B CG  1 
ATOM   5882  C  CD1 . LEU B  1 221 ? -0.651  41.898  71.463  1.00 101.91 ?  221  LEU B CD1 1 
ATOM   5883  C  CD2 . LEU B  1 221 ? -0.773  43.754  73.132  1.00 105.69 ?  221  LEU B CD2 1 
ATOM   5884  N  N   . PHE B  1 222 ? -2.878  40.063  76.642  1.00 110.90 ?  222  PHE B N   1 
ATOM   5885  C  CA  . PHE B  1 222 ? -3.974  39.257  77.169  1.00 112.39 ?  222  PHE B CA  1 
ATOM   5886  C  C   . PHE B  1 222 ? -3.591  38.703  78.536  1.00 115.25 ?  222  PHE B C   1 
ATOM   5887  O  O   . PHE B  1 222 ? -2.428  38.737  78.947  1.00 116.30 ?  222  PHE B O   1 
ATOM   5888  C  CB  . PHE B  1 222 ? -4.364  38.126  76.210  1.00 108.19 ?  222  PHE B CB  1 
ATOM   5889  C  CG  . PHE B  1 222 ? -3.386  36.991  76.180  1.00 106.07 ?  222  PHE B CG  1 
ATOM   5890  C  CD1 . PHE B  1 222 ? -2.230  37.081  75.426  1.00 105.18 ?  222  PHE B CD1 1 
ATOM   5891  C  CD2 . PHE B  1 222 ? -3.625  35.833  76.903  1.00 106.31 ?  222  PHE B CD2 1 
ATOM   5892  C  CE1 . PHE B  1 222 ? -1.327  36.040  75.394  1.00 103.90 ?  222  PHE B CE1 1 
ATOM   5893  C  CE2 . PHE B  1 222 ? -2.725  34.789  76.878  1.00 105.38 ?  222  PHE B CE2 1 
ATOM   5894  C  CZ  . PHE B  1 222 ? -1.574  34.892  76.120  1.00 104.00 ?  222  PHE B CZ  1 
ATOM   5895  N  N   . HIS B  1 223 ? -4.605  38.201  79.240  1.00 116.45 ?  223  HIS B N   1 
ATOM   5896  C  CA  . HIS B  1 223 ? -4.475  37.695  80.603  1.00 118.11 ?  223  HIS B CA  1 
ATOM   5897  C  C   . HIS B  1 223 ? -4.886  36.232  80.718  1.00 115.36 ?  223  HIS B C   1 
ATOM   5898  O  O   . HIS B  1 223 ? -4.076  35.411  81.162  1.00 115.04 ?  223  HIS B O   1 
ATOM   5899  C  CB  . HIS B  1 223 ? -5.259  38.605  81.552  1.00 122.55 ?  223  HIS B CB  1 
ATOM   5900  C  CG  . HIS B  1 223 ? -4.811  40.033  81.490  1.00 125.19 ?  223  HIS B CG  1 
ATOM   5901  N  ND1 . HIS B  1 223 ? -5.291  40.924  80.554  1.00 124.73 ?  223  HIS B ND1 1 
ATOM   5902  C  CD2 . HIS B  1 223 ? -3.906  40.716  82.230  1.00 128.46 ?  223  HIS B CD2 1 
ATOM   5903  C  CE1 . HIS B  1 223 ? -4.707  42.096  80.726  1.00 127.79 ?  223  HIS B CE1 1 
ATOM   5904  N  NE2 . HIS B  1 223 ? -3.867  41.999  81.740  1.00 130.07 ?  223  HIS B NE2 1 
ATOM   5905  N  N   . ARG B  1 224 ? -6.124  35.881  80.382  1.00 113.21 ?  224  ARG B N   1 
ATOM   5906  C  CA  . ARG B  1 224 ? -6.610  34.510  80.495  1.00 109.16 ?  224  ARG B CA  1 
ATOM   5907  C  C   . ARG B  1 224 ? -6.889  33.911  79.117  1.00 103.29 ?  224  ARG B C   1 
ATOM   5908  O  O   . ARG B  1 224 ? -7.106  34.628  78.136  1.00 101.98 ?  224  ARG B O   1 
ATOM   5909  C  CB  . ARG B  1 224 ? -7.869  34.460  81.366  1.00 112.09 ?  224  ARG B CB  1 
ATOM   5910  C  CG  . ARG B  1 224 ? -7.592  34.657  82.849  1.00 115.47 ?  224  ARG B CG  1 
ATOM   5911  C  CD  . ARG B  1 224 ? -8.774  35.290  83.564  1.00 119.33 ?  224  ARG B CD  1 
ATOM   5912  N  NE  . ARG B  1 224 ? -8.749  36.749  83.512  1.00 121.72 ?  224  ARG B NE  1 
ATOM   5913  C  CZ  . ARG B  1 224 ? -8.075  37.509  84.369  1.00 124.95 ?  224  ARG B CZ  1 
ATOM   5914  N  NH1 . ARG B  1 224 ? -7.366  36.941  85.335  1.00 125.74 ?  224  ARG B NH1 1 
ATOM   5915  N  NH2 . ARG B  1 224 ? -8.105  38.831  84.262  1.00 127.72 ?  224  ARG B NH2 1 
ATOM   5916  N  N   . ALA B  1 225 ? -6.852  32.574  79.046  1.00 100.62 ?  225  ALA B N   1 
ATOM   5917  C  CA  . ALA B  1 225 ? -6.952  31.847  77.783  1.00 95.96  ?  225  ALA B CA  1 
ATOM   5918  C  C   . ALA B  1 225 ? -7.850  30.621  77.919  1.00 93.51  ?  225  ALA B C   1 
ATOM   5919  O  O   . ALA B  1 225 ? -7.917  29.988  78.980  1.00 94.26  ?  225  ALA B O   1 
ATOM   5920  C  CB  . ALA B  1 225 ? -5.570  31.403  77.283  1.00 93.08  ?  225  ALA B CB  1 
ATOM   5921  N  N   . VAL B  1 226 ? -8.528  30.286  76.817  1.00 90.49  ?  226  VAL B N   1 
ATOM   5922  C  CA  . VAL B  1 226 ? -9.400  29.117  76.721  1.00 89.86  ?  226  VAL B CA  1 
ATOM   5923  C  C   . VAL B  1 226 ? -9.119  28.396  75.406  1.00 84.58  ?  226  VAL B C   1 
ATOM   5924  O  O   . VAL B  1 226 ? -9.289  28.979  74.325  1.00 85.70  ?  226  VAL B O   1 
ATOM   5925  C  CB  . VAL B  1 226 ? -10.888 29.490  76.820  1.00 92.22  ?  226  VAL B CB  1 
ATOM   5926  C  CG1 . VAL B  1 226 ? -11.757 28.241  76.748  1.00 90.90  ?  226  VAL B CG1 1 
ATOM   5927  C  CG2 . VAL B  1 226 ? -11.167 30.256  78.099  1.00 96.33  ?  226  VAL B CG2 1 
ATOM   5928  N  N   . LEU B  1 227 ? -8.721  27.121  75.504  1.00 82.53  ?  227  LEU B N   1 
ATOM   5929  C  CA  . LEU B  1 227 ? -8.392  26.269  74.365  1.00 78.69  ?  227  LEU B CA  1 
ATOM   5930  C  C   . LEU B  1 227 ? -9.427  25.152  74.267  1.00 78.40  ?  227  LEU B C   1 
ATOM   5931  O  O   . LEU B  1 227 ? -9.479  24.251  75.122  1.00 79.15  ?  227  LEU B O   1 
ATOM   5932  C  CB  . LEU B  1 227 ? -6.982  25.696  74.490  1.00 76.70  ?  227  LEU B CB  1 
ATOM   5933  C  CG  . LEU B  1 227 ? -5.834  26.710  74.445  1.00 76.82  ?  227  LEU B CG  1 
ATOM   5934  C  CD1 . LEU B  1 227 ? -5.548  27.313  75.821  1.00 80.23  ?  227  LEU B CD1 1 
ATOM   5935  C  CD2 . LEU B  1 227 ? -4.579  26.102  73.845  1.00 73.84  ?  227  LEU B CD2 1 
ATOM   5936  N  N   . GLN B  1 228 ? -10.238 25.211  73.213  1.00 79.03  ?  228  GLN B N   1 
ATOM   5937  C  CA  . GLN B  1 228 ? -11.310 24.252  72.976  1.00 80.47  ?  228  GLN B CA  1 
ATOM   5938  C  C   . GLN B  1 228 ? -10.882 23.299  71.861  1.00 79.97  ?  228  GLN B C   1 
ATOM   5939  O  O   . GLN B  1 228 ? -10.766 23.705  70.698  1.00 79.44  ?  228  GLN B O   1 
ATOM   5940  C  CB  . GLN B  1 228 ? -12.605 24.978  72.617  1.00 80.76  ?  228  GLN B CB  1 
ATOM   5941  C  CG  . GLN B  1 228 ? -12.974 26.108  73.574  1.00 84.22  ?  228  GLN B CG  1 
ATOM   5942  C  CD  . GLN B  1 228 ? -14.332 26.722  73.269  1.00 87.14  ?  228  GLN B CD  1 
ATOM   5943  O  OE1 . GLN B  1 228 ? -14.752 27.685  73.914  1.00 90.47  ?  228  GLN B OE1 1 
ATOM   5944  N  NE2 . GLN B  1 228 ? -15.026 26.165  72.281  1.00 85.83  ?  228  GLN B NE2 1 
ATOM   5945  N  N   . SER B  1 229 ? -10.638 22.038  72.225  1.00 78.33  ?  229  SER B N   1 
ATOM   5946  C  CA  . SER B  1 229 ? -10.258 20.979  71.287  1.00 73.37  ?  229  SER B CA  1 
ATOM   5947  C  C   . SER B  1 229 ? -9.172  21.433  70.304  1.00 67.64  ?  229  SER B C   1 
ATOM   5948  O  O   . SER B  1 229 ? -9.263  21.197  69.099  1.00 65.82  ?  229  SER B O   1 
ATOM   5949  C  CB  . SER B  1 229 ? -11.487 20.445  70.539  1.00 72.42  ?  229  SER B CB  1 
ATOM   5950  O  OG  . SER B  1 229 ? -12.369 21.480  70.139  1.00 73.44  ?  229  SER B OG  1 
ATOM   5951  N  N   . GLY B  1 230 ? -8.151  22.124  70.825  1.00 67.76  ?  230  GLY B N   1 
ATOM   5952  C  CA  . GLY B  1 230 ? -6.948  22.419  70.062  1.00 65.54  ?  230  GLY B CA  1 
ATOM   5953  C  C   . GLY B  1 230 ? -5.756  22.842  70.911  1.00 66.09  ?  230  GLY B C   1 
ATOM   5954  O  O   . GLY B  1 230 ? -5.932  23.375  72.006  1.00 68.55  ?  230  GLY B O   1 
ATOM   5955  N  N   . THR B  1 231 ? -4.535  22.631  70.419  1.00 64.13  ?  231  THR B N   1 
ATOM   5956  C  CA  . THR B  1 231 ? -3.348  22.922  71.214  1.00 67.13  ?  231  THR B CA  1 
ATOM   5957  C  C   . THR B  1 231 ? -2.237  23.420  70.304  1.00 65.82  ?  231  THR B C   1 
ATOM   5958  O  O   . THR B  1 231 ? -2.211  23.074  69.117  1.00 61.17  ?  231  THR B O   1 
ATOM   5959  C  CB  . THR B  1 231 ? -2.861  21.681  71.980  1.00 65.89  ?  231  THR B CB  1 
ATOM   5960  O  OG1 . THR B  1 231 ? -2.860  20.544  71.107  1.00 62.30  ?  231  THR B OG1 1 
ATOM   5961  C  CG2 . THR B  1 231 ? -3.750  21.390  73.194  1.00 67.56  ?  231  THR B CG2 1 
ATOM   5962  N  N   . PRO B  1 232 ? -1.303  24.229  70.824  1.00 67.06  ?  232  PRO B N   1 
ATOM   5963  C  CA  . PRO B  1 232 ? -0.124  24.574  70.007  1.00 65.10  ?  232  PRO B CA  1 
ATOM   5964  C  C   . PRO B  1 232 ? 0.803   23.394  69.785  1.00 64.36  ?  232  PRO B C   1 
ATOM   5965  O  O   . PRO B  1 232 ? 1.400   23.260  68.709  1.00 63.72  ?  232  PRO B O   1 
ATOM   5966  C  CB  . PRO B  1 232 ? 0.550   25.688  70.822  1.00 68.05  ?  232  PRO B CB  1 
ATOM   5967  C  CG  . PRO B  1 232 ? 0.121   25.436  72.233  1.00 69.47  ?  232  PRO B CG  1 
ATOM   5968  C  CD  . PRO B  1 232 ? -1.290  24.907  72.135  1.00 69.74  ?  232  PRO B CD  1 
ATOM   5969  N  N   . ASN B  1 233 ? 0.953   22.542  70.790  1.00 65.72  ?  233  ASN B N   1 
ATOM   5970  C  CA  . ASN B  1 233 ? 1.701   21.305  70.654  1.00 66.49  ?  233  ASN B CA  1 
ATOM   5971  C  C   . ASN B  1 233 ? 0.898   20.269  69.865  1.00 67.56  ?  233  ASN B C   1 
ATOM   5972  O  O   . ASN B  1 233 ? -0.316  20.394  69.664  1.00 69.17  ?  233  ASN B O   1 
ATOM   5973  C  CB  . ASN B  1 233 ? 2.086   20.750  72.024  1.00 66.69  ?  233  ASN B CB  1 
ATOM   5974  C  CG  . ASN B  1 233 ? 0.886   20.462  72.890  1.00 66.97  ?  233  ASN B CG  1 
ATOM   5975  O  OD1 . ASN B  1 233 ? 0.014   21.311  73.066  1.00 64.72  ?  233  ASN B OD1 1 
ATOM   5976  N  ND2 . ASN B  1 233 ? 0.823   19.247  73.421  1.00 67.41  ?  233  ASN B ND2 1 
ATOM   5977  N  N   . GLY B  1 234 ? 1.606   19.245  69.392  1.00 65.58  ?  234  GLY B N   1 
ATOM   5978  C  CA  . GLY B  1 234 ? 0.987   18.129  68.720  1.00 63.09  ?  234  GLY B CA  1 
ATOM   5979  C  C   . GLY B  1 234 ? 1.246   18.089  67.229  1.00 62.61  ?  234  GLY B C   1 
ATOM   5980  O  O   . GLY B  1 234 ? 1.940   18.938  66.661  1.00 64.31  ?  234  GLY B O   1 
ATOM   5981  N  N   . PRO B  1 235 ? 0.683   17.076  66.567  1.00 60.57  ?  235  PRO B N   1 
ATOM   5982  C  CA  . PRO B  1 235 ? 1.143   16.754  65.203  1.00 60.92  ?  235  PRO B CA  1 
ATOM   5983  C  C   . PRO B  1 235 ? 0.833   17.807  64.148  1.00 63.66  ?  235  PRO B C   1 
ATOM   5984  O  O   . PRO B  1 235 ? 1.680   18.061  63.282  1.00 62.89  ?  235  PRO B O   1 
ATOM   5985  C  CB  . PRO B  1 235 ? 0.421   15.431  64.910  1.00 59.20  ?  235  PRO B CB  1 
ATOM   5986  C  CG  . PRO B  1 235 ? -0.814  15.482  65.767  1.00 58.97  ?  235  PRO B CG  1 
ATOM   5987  C  CD  . PRO B  1 235 ? -0.421  16.210  67.015  1.00 59.56  ?  235  PRO B CD  1 
ATOM   5988  N  N   . TRP B  1 236 ? -0.373  18.388  64.159  1.00 66.43  ?  236  TRP B N   1 
ATOM   5989  C  CA  . TRP B  1 236 ? -0.852  19.202  63.044  1.00 65.91  ?  236  TRP B CA  1 
ATOM   5990  C  C   . TRP B  1 236 ? -0.620  20.705  63.183  1.00 66.16  ?  236  TRP B C   1 
ATOM   5991  O  O   . TRP B  1 236 ? -0.765  21.424  62.188  1.00 66.05  ?  236  TRP B O   1 
ATOM   5992  C  CB  . TRP B  1 236 ? -2.353  18.957  62.843  1.00 65.15  ?  236  TRP B CB  1 
ATOM   5993  C  CG  . TRP B  1 236 ? -3.158  19.256  64.067  1.00 65.22  ?  236  TRP B CG  1 
ATOM   5994  C  CD1 . TRP B  1 236 ? -3.455  18.399  65.091  1.00 66.50  ?  236  TRP B CD1 1 
ATOM   5995  C  CD2 . TRP B  1 236 ? -3.763  20.507  64.404  1.00 64.17  ?  236  TRP B CD2 1 
ATOM   5996  N  NE1 . TRP B  1 236 ? -4.213  19.042  66.043  1.00 67.29  ?  236  TRP B NE1 1 
ATOM   5997  C  CE2 . TRP B  1 236 ? -4.415  20.338  65.643  1.00 66.69  ?  236  TRP B CE2 1 
ATOM   5998  C  CE3 . TRP B  1 236 ? -3.817  21.754  63.779  1.00 61.38  ?  236  TRP B CE3 1 
ATOM   5999  C  CZ2 . TRP B  1 236 ? -5.111  21.370  66.264  1.00 67.57  ?  236  TRP B CZ2 1 
ATOM   6000  C  CZ3 . TRP B  1 236 ? -4.507  22.775  64.396  1.00 62.53  ?  236  TRP B CZ3 1 
ATOM   6001  C  CH2 . TRP B  1 236 ? -5.146  22.579  65.624  1.00 65.69  ?  236  TRP B CH2 1 
ATOM   6002  N  N   . ALA B  1 237 ? -0.242  21.201  64.362  1.00 65.21  ?  237  ALA B N   1 
ATOM   6003  C  CA  . ALA B  1 237 ? -0.343  22.632  64.629  1.00 62.36  ?  237  ALA B CA  1 
ATOM   6004  C  C   . ALA B  1 237 ? 0.888   23.425  64.215  1.00 59.40  ?  237  ALA B C   1 
ATOM   6005  O  O   . ALA B  1 237 ? 0.821   24.658  64.178  1.00 58.33  ?  237  ALA B O   1 
ATOM   6006  C  CB  . ALA B  1 237 ? -0.632  22.867  66.114  1.00 63.95  ?  237  ALA B CB  1 
ATOM   6007  N  N   . THR B  1 238 ? 1.997   22.759  63.906  1.00 58.87  ?  238  THR B N   1 
ATOM   6008  C  CA  . THR B  1 238 ? 3.214   23.435  63.483  1.00 59.71  ?  238  THR B CA  1 
ATOM   6009  C  C   . THR B  1 238 ? 3.943   22.552  62.486  1.00 58.93  ?  238  THR B C   1 
ATOM   6010  O  O   . THR B  1 238 ? 3.729   21.338  62.429  1.00 60.49  ?  238  THR B O   1 
ATOM   6011  C  CB  . THR B  1 238 ? 4.139   23.762  64.665  1.00 61.38  ?  238  THR B CB  1 
ATOM   6012  O  OG1 . THR B  1 238 ? 4.175   22.651  65.571  1.00 62.98  ?  238  THR B OG1 1 
ATOM   6013  C  CG2 . THR B  1 238 ? 3.679   25.017  65.392  1.00 57.52  ?  238  THR B CG2 1 
ATOM   6014  N  N   . VAL B  1 239 ? 4.804   23.185  61.690  1.00 56.93  ?  239  VAL B N   1 
ATOM   6015  C  CA  . VAL B  1 239 ? 5.715   22.493  60.788  1.00 54.52  ?  239  VAL B CA  1 
ATOM   6016  C  C   . VAL B  1 239 ? 7.109   23.067  60.990  1.00 53.76  ?  239  VAL B C   1 
ATOM   6017  O  O   . VAL B  1 239 ? 7.272   24.235  61.354  1.00 54.51  ?  239  VAL B O   1 
ATOM   6018  C  CB  . VAL B  1 239 ? 5.290   22.618  59.309  1.00 51.05  ?  239  VAL B CB  1 
ATOM   6019  C  CG1 . VAL B  1 239 ? 3.998   21.868  59.059  1.00 50.05  ?  239  VAL B CG1 1 
ATOM   6020  C  CG2 . VAL B  1 239 ? 5.136   24.077  58.932  1.00 51.95  ?  239  VAL B CG2 1 
ATOM   6021  N  N   . SER B  1 240 ? 8.120   22.236  60.756  1.00 53.93  ?  240  SER B N   1 
ATOM   6022  C  CA  . SER B  1 240 ? 9.487   22.714  60.878  1.00 58.19  ?  240  SER B CA  1 
ATOM   6023  C  C   . SER B  1 240 ? 9.792   23.717  59.771  1.00 59.95  ?  240  SER B C   1 
ATOM   6024  O  O   . SER B  1 240 ? 9.107   23.779  58.745  1.00 59.09  ?  240  SER B O   1 
ATOM   6025  C  CB  . SER B  1 240 ? 10.479  21.552  60.829  1.00 62.04  ?  240  SER B CB  1 
ATOM   6026  O  OG  . SER B  1 240 ? 10.501  20.936  59.556  1.00 64.64  ?  240  SER B OG  1 
ATOM   6027  N  N   . ALA B  1 241 ? 10.822  24.534  60.004  1.00 63.17  ?  241  ALA B N   1 
ATOM   6028  C  CA  . ALA B  1 241 ? 11.227  25.514  59.000  1.00 64.58  ?  241  ALA B CA  1 
ATOM   6029  C  C   . ALA B  1 241 ? 11.520  24.834  57.670  1.00 64.79  ?  241  ALA B C   1 
ATOM   6030  O  O   . ALA B  1 241 ? 11.045  25.274  56.616  1.00 66.47  ?  241  ALA B O   1 
ATOM   6031  C  CB  . ALA B  1 241 ? 12.444  26.300  59.485  1.00 66.63  ?  241  ALA B CB  1 
ATOM   6032  N  N   . GLY B  1 242 ? 12.279  23.738  57.707  1.00 64.58  ?  242  GLY B N   1 
ATOM   6033  C  CA  . GLY B  1 242 ? 12.576  23.014  56.481  1.00 65.16  ?  242  GLY B CA  1 
ATOM   6034  C  C   . GLY B  1 242 ? 11.335  22.457  55.807  1.00 63.56  ?  242  GLY B C   1 
ATOM   6035  O  O   . GLY B  1 242 ? 11.241  22.442  54.576  1.00 64.01  ?  242  GLY B O   1 
ATOM   6036  N  N   . GLU B  1 243 ? 10.362  22.000  56.602  1.00 61.65  ?  243  GLU B N   1 
ATOM   6037  C  CA  . GLU B  1 243 ? 9.138   21.452  56.025  1.00 60.19  ?  243  GLU B CA  1 
ATOM   6038  C  C   . GLU B  1 243 ? 8.273   22.547  55.404  1.00 62.35  ?  243  GLU B C   1 
ATOM   6039  O  O   . GLU B  1 243 ? 7.698   22.355  54.323  1.00 63.67  ?  243  GLU B O   1 
ATOM   6040  C  CB  . GLU B  1 243 ? 8.364   20.676  57.089  1.00 57.22  ?  243  GLU B CB  1 
ATOM   6041  C  CG  . GLU B  1 243 ? 7.038   20.111  56.615  1.00 55.59  ?  243  GLU B CG  1 
ATOM   6042  C  CD  . GLU B  1 243 ? 7.196   19.021  55.566  1.00 55.06  ?  243  GLU B CD  1 
ATOM   6043  O  OE1 . GLU B  1 243 ? 8.335   18.536  55.361  1.00 55.59  ?  243  GLU B OE1 1 
ATOM   6044  O  OE2 . GLU B  1 243 ? 6.176   18.664  54.936  1.00 53.29  ?  243  GLU B OE2 1 
ATOM   6045  N  N   . ALA B  1 244 ? 8.175   23.705  56.060  1.00 61.39  ?  244  ALA B N   1 
ATOM   6046  C  CA  . ALA B  1 244 ? 7.447   24.819  55.460  1.00 58.08  ?  244  ALA B CA  1 
ATOM   6047  C  C   . ALA B  1 244 ? 8.132   25.292  54.183  1.00 57.59  ?  244  ALA B C   1 
ATOM   6048  O  O   . ALA B  1 244 ? 7.461   25.674  53.216  1.00 58.33  ?  244  ALA B O   1 
ATOM   6049  C  CB  . ALA B  1 244 ? 7.311   25.966  56.461  1.00 57.53  ?  244  ALA B CB  1 
ATOM   6050  N  N   . ARG B  1 245 ? 9.469   25.270  54.156  1.00 56.86  ?  245  ARG B N   1 
ATOM   6051  C  CA  . ARG B  1 245 ? 10.175  25.607  52.923  1.00 57.83  ?  245  ARG B CA  1 
ATOM   6052  C  C   . ARG B  1 245 ? 9.884   24.587  51.830  1.00 58.33  ?  245  ARG B C   1 
ATOM   6053  O  O   . ARG B  1 245 ? 9.706   24.951  50.661  1.00 58.25  ?  245  ARG B O   1 
ATOM   6054  C  CB  . ARG B  1 245 ? 11.679  25.705  53.177  1.00 59.09  ?  245  ARG B CB  1 
ATOM   6055  C  CG  . ARG B  1 245 ? 12.514  25.712  51.901  1.00 62.38  ?  245  ARG B CG  1 
ATOM   6056  C  CD  . ARG B  1 245 ? 13.940  26.160  52.157  1.00 67.55  ?  245  ARG B CD  1 
ATOM   6057  N  NE  . ARG B  1 245 ? 13.996  27.562  52.554  1.00 71.82  ?  245  ARG B NE  1 
ATOM   6058  C  CZ  . ARG B  1 245 ? 14.036  28.577  51.696  1.00 75.18  ?  245  ARG B CZ  1 
ATOM   6059  N  NH1 . ARG B  1 245 ? 14.025  28.344  50.389  1.00 76.19  ?  245  ARG B NH1 1 
ATOM   6060  N  NH2 . ARG B  1 245 ? 14.081  29.823  52.147  1.00 76.94  ?  245  ARG B NH2 1 
ATOM   6061  N  N   . ARG B  1 246 ? 9.824   23.306  52.198  1.00 58.84  ?  246  ARG B N   1 
ATOM   6062  C  CA  . ARG B  1 246 ? 9.530   22.258  51.226  1.00 58.70  ?  246  ARG B CA  1 
ATOM   6063  C  C   . ARG B  1 246 ? 8.142   22.455  50.623  1.00 55.74  ?  246  ARG B C   1 
ATOM   6064  O  O   . ARG B  1 246 ? 7.964   22.379  49.399  1.00 55.51  ?  246  ARG B O   1 
ATOM   6065  C  CB  . ARG B  1 246 ? 9.653   20.891  51.907  1.00 61.06  ?  246  ARG B CB  1 
ATOM   6066  C  CG  . ARG B  1 246 ? 9.972   19.727  50.983  1.00 64.52  ?  246  ARG B CG  1 
ATOM   6067  C  CD  . ARG B  1 246 ? 8.705   19.066  50.490  1.00 64.77  ?  246  ARG B CD  1 
ATOM   6068  N  NE  . ARG B  1 246 ? 7.816   18.732  51.597  1.00 63.68  ?  246  ARG B NE  1 
ATOM   6069  C  CZ  . ARG B  1 246 ? 6.590   18.245  51.444  1.00 63.78  ?  246  ARG B CZ  1 
ATOM   6070  N  NH1 . ARG B  1 246 ? 6.096   18.041  50.225  1.00 63.61  ?  246  ARG B NH1 1 
ATOM   6071  N  NH2 . ARG B  1 246 ? 5.854   17.971  52.512  1.00 63.74  ?  246  ARG B NH2 1 
ATOM   6072  N  N   . ARG B  1 247 ? 7.151   22.746  51.471  1.00 53.79  ?  247  ARG B N   1 
ATOM   6073  C  CA  . ARG B  1 247 ? 5.783   22.919  50.991  1.00 52.91  ?  247  ARG B CA  1 
ATOM   6074  C  C   . ARG B  1 247 ? 5.636   24.189  50.158  1.00 57.50  ?  247  ARG B C   1 
ATOM   6075  O  O   . ARG B  1 247 ? 4.957   24.183  49.123  1.00 61.66  ?  247  ARG B O   1 
ATOM   6076  C  CB  . ARG B  1 247 ? 4.816   22.934  52.176  1.00 50.97  ?  247  ARG B CB  1 
ATOM   6077  C  CG  . ARG B  1 247 ? 4.866   21.670  53.009  1.00 50.99  ?  247  ARG B CG  1 
ATOM   6078  C  CD  . ARG B  1 247 ? 3.890   21.675  54.178  1.00 50.06  ?  247  ARG B CD  1 
ATOM   6079  N  NE  . ARG B  1 247 ? 3.967   20.406  54.902  1.00 51.56  ?  247  ARG B NE  1 
ATOM   6080  C  CZ  . ARG B  1 247 ? 3.168   20.053  55.904  1.00 53.12  ?  247  ARG B CZ  1 
ATOM   6081  N  NH1 . ARG B  1 247 ? 2.217   20.877  56.326  1.00 53.95  ?  247  ARG B NH1 1 
ATOM   6082  N  NH2 . ARG B  1 247 ? 3.323   18.870  56.487  1.00 53.22  ?  247  ARG B NH2 1 
ATOM   6083  N  N   . ALA B  1 248 ? 6.256   25.290  50.590  1.00 57.26  ?  248  ALA B N   1 
ATOM   6084  C  CA  . ALA B  1 248 ? 6.156   26.532  49.828  1.00 57.15  ?  248  ALA B CA  1 
ATOM   6085  C  C   . ALA B  1 248 ? 6.839   26.397  48.473  1.00 57.85  ?  248  ALA B C   1 
ATOM   6086  O  O   . ALA B  1 248 ? 6.282   26.794  47.444  1.00 57.11  ?  248  ALA B O   1 
ATOM   6087  C  CB  . ALA B  1 248 ? 6.758   27.690  50.622  1.00 58.10  ?  248  ALA B CB  1 
ATOM   6088  N  N   . THR B  1 249 ? 8.045   25.825  48.453  1.00 59.82  ?  249  THR B N   1 
ATOM   6089  C  CA  . THR B  1 249 ? 8.753   25.639  47.191  1.00 61.59  ?  249  THR B CA  1 
ATOM   6090  C  C   . THR B  1 249 ? 7.979   24.716  46.259  1.00 62.97  ?  249  THR B C   1 
ATOM   6091  O  O   . THR B  1 249 ? 7.928   24.951  45.047  1.00 67.44  ?  249  THR B O   1 
ATOM   6092  C  CB  . THR B  1 249 ? 10.159  25.088  47.446  1.00 60.87  ?  249  THR B CB  1 
ATOM   6093  O  OG1 . THR B  1 249 ? 10.882  25.982  48.303  1.00 60.87  ?  249  THR B OG1 1 
ATOM   6094  C  CG2 . THR B  1 249 ? 10.924  24.941  46.138  1.00 61.52  ?  249  THR B CG2 1 
ATOM   6095  N  N   . LEU B  1 250 ? 7.359   23.666  46.806  1.00 53.53  ?  250  LEU B N   1 
ATOM   6096  C  CA  . LEU B  1 250 ? 6.589   22.759  45.959  1.00 54.33  ?  250  LEU B CA  1 
ATOM   6097  C  C   . LEU B  1 250 ? 5.352   23.445  45.387  1.00 53.19  ?  250  LEU B C   1 
ATOM   6098  O  O   . LEU B  1 250 ? 5.054   23.301  44.195  1.00 57.00  ?  250  LEU B O   1 
ATOM   6099  C  CB  . LEU B  1 250 ? 6.186   21.507  46.735  1.00 53.44  ?  250  LEU B CB  1 
ATOM   6100  C  CG  . LEU B  1 250 ? 5.288   20.556  45.940  1.00 51.85  ?  250  LEU B CG  1 
ATOM   6101  C  CD1 . LEU B  1 250 ? 6.021   20.030  44.724  1.00 53.09  ?  250  LEU B CD1 1 
ATOM   6102  C  CD2 . LEU B  1 250 ? 4.783   19.420  46.800  1.00 50.84  ?  250  LEU B CD2 1 
ATOM   6103  N  N   . LEU B  1 251 ? 4.611   24.187  46.215  1.00 52.65  ?  251  LEU B N   1 
ATOM   6104  C  CA  . LEU B  1 251 ? 3.466   24.919  45.683  1.00 55.01  ?  251  LEU B CA  1 
ATOM   6105  C  C   . LEU B  1 251 ? 3.902   25.905  44.606  1.00 56.12  ?  251  LEU B C   1 
ATOM   6106  O  O   . LEU B  1 251 ? 3.251   26.025  43.561  1.00 54.99  ?  251  LEU B O   1 
ATOM   6107  C  CB  . LEU B  1 251 ? 2.726   25.651  46.799  1.00 52.54  ?  251  LEU B CB  1 
ATOM   6108  C  CG  . LEU B  1 251 ? 1.497   26.402  46.288  1.00 53.07  ?  251  LEU B CG  1 
ATOM   6109  C  CD1 . LEU B  1 251 ? 0.222   25.656  46.637  1.00 52.40  ?  251  LEU B CD1 1 
ATOM   6110  C  CD2 . LEU B  1 251 ? 1.473   27.818  46.820  1.00 53.80  ?  251  LEU B CD2 1 
ATOM   6111  N  N   . ALA B  1 252 ? 5.010   26.613  44.842  1.00 57.54  ?  252  ALA B N   1 
ATOM   6112  C  CA  . ALA B  1 252 ? 5.541   27.517  43.828  1.00 59.77  ?  252  ALA B CA  1 
ATOM   6113  C  C   . ALA B  1 252 ? 5.897   26.774  42.549  1.00 59.59  ?  252  ALA B C   1 
ATOM   6114  O  O   . ALA B  1 252 ? 5.741   27.319  41.452  1.00 61.28  ?  252  ALA B O   1 
ATOM   6115  C  CB  . ALA B  1 252 ? 6.764   28.256  44.368  1.00 61.80  ?  252  ALA B CB  1 
ATOM   6116  N  N   . ARG B  1 253 ? 6.370   25.532  42.665  1.00 58.09  ?  253  ARG B N   1 
ATOM   6117  C  CA  . ARG B  1 253 ? 6.660   24.749  41.471  1.00 57.91  ?  253  ARG B CA  1 
ATOM   6118  C  C   . ARG B  1 253 ? 5.385   24.334  40.745  1.00 57.76  ?  253  ARG B C   1 
ATOM   6119  O  O   . ARG B  1 253 ? 5.391   24.220  39.516  1.00 59.13  ?  253  ARG B O   1 
ATOM   6120  C  CB  . ARG B  1 253 ? 7.493   23.518  41.832  1.00 57.64  ?  253  ARG B CB  1 
ATOM   6121  C  CG  . ARG B  1 253 ? 7.850   22.641  40.644  1.00 58.94  ?  253  ARG B CG  1 
ATOM   6122  C  CD  . ARG B  1 253 ? 8.752   21.484  41.027  1.00 58.97  ?  253  ARG B CD  1 
ATOM   6123  N  NE  . ARG B  1 253 ? 9.844   21.926  41.880  1.00 61.00  ?  253  ARG B NE  1 
ATOM   6124  C  CZ  . ARG B  1 253 ? 9.970   21.588  43.158  1.00 63.09  ?  253  ARG B CZ  1 
ATOM   6125  N  NH1 . ARG B  1 253 ? 9.078   20.789  43.734  1.00 61.80  ?  253  ARG B NH1 1 
ATOM   6126  N  NH2 . ARG B  1 253 ? 10.988  22.052  43.862  1.00 66.11  ?  253  ARG B NH2 1 
ATOM   6127  N  N   . LEU B  1 254 ? 4.286   24.102  41.468  1.00 56.39  ?  254  LEU B N   1 
ATOM   6128  C  CA  . LEU B  1 254 ? 3.057   23.703  40.785  1.00 70.18  ?  254  LEU B CA  1 
ATOM   6129  C  C   . LEU B  1 254 ? 2.447   24.860  40.007  1.00 71.42  ?  254  LEU B C   1 
ATOM   6130  O  O   . LEU B  1 254 ? 1.750   24.637  39.011  1.00 58.60  ?  254  LEU B O   1 
ATOM   6131  C  CB  . LEU B  1 254 ? 2.042   23.134  41.777  1.00 64.74  ?  254  LEU B CB  1 
ATOM   6132  C  CG  . LEU B  1 254 ? 2.364   21.748  42.337  1.00 57.61  ?  254  LEU B CG  1 
ATOM   6133  C  CD1 . LEU B  1 254 ? 1.297   21.295  43.321  1.00 54.18  ?  254  LEU B CD1 1 
ATOM   6134  C  CD2 . LEU B  1 254 ? 2.523   20.746  41.211  1.00 55.44  ?  254  LEU B CD2 1 
ATOM   6135  N  N   . VAL B  1 255 ? 2.680   26.090  40.450  1.00 71.14  ?  255  VAL B N   1 
ATOM   6136  C  CA  . VAL B  1 255 ? 2.417   27.268  39.635  1.00 70.94  ?  255  VAL B CA  1 
ATOM   6137  C  C   . VAL B  1 255 ? 3.697   27.578  38.872  1.00 75.24  ?  255  VAL B C   1 
ATOM   6138  O  O   . VAL B  1 255 ? 4.612   26.751  38.809  1.00 76.35  ?  255  VAL B O   1 
ATOM   6139  C  CB  . VAL B  1 255 ? 1.938   28.460  40.479  1.00 66.77  ?  255  VAL B CB  1 
ATOM   6140  C  CG1 . VAL B  1 255 ? 0.611   28.125  41.130  1.00 63.83  ?  255  VAL B CG1 1 
ATOM   6141  C  CG2 . VAL B  1 255 ? 2.964   28.818  41.530  1.00 70.53  ?  255  VAL B CG2 1 
ATOM   6142  N  N   . GLY B  1 256 ? 3.776   28.752  38.271  1.00 75.09  ?  256  GLY B N   1 
ATOM   6143  C  CA  . GLY B  1 256 ? 4.875   28.998  37.364  1.00 78.48  ?  256  GLY B CA  1 
ATOM   6144  C  C   . GLY B  1 256 ? 6.155   29.509  37.998  1.00 78.56  ?  256  GLY B C   1 
ATOM   6145  O  O   . GLY B  1 256 ? 6.970   30.117  37.302  1.00 81.26  ?  256  GLY B O   1 
ATOM   6146  N  N   . CYS B  1 257 ? 6.366   29.260  39.291  1.00 74.97  ?  257  CYS B N   1 
ATOM   6147  C  CA  . CYS B  1 257 ? 7.432   29.938  40.031  1.00 73.45  ?  257  CYS B CA  1 
ATOM   6148  C  C   . CYS B  1 257 ? 8.564   29.048  40.547  1.00 75.57  ?  257  CYS B C   1 
ATOM   6149  O  O   . CYS B  1 257 ? 8.336   27.899  40.927  1.00 76.16  ?  257  CYS B O   1 
ATOM   6150  C  CB  . CYS B  1 257 ? 6.825   30.663  41.226  1.00 69.19  ?  257  CYS B CB  1 
ATOM   6151  S  SG  . CYS B  1 257 ? 5.331   31.547  40.836  1.00 68.39  ?  257  CYS B SG  1 
ATOM   6152  N  N   . PRO B  1 258 ? 9.794   29.594  40.576  1.00 77.20  ?  258  PRO B N   1 
ATOM   6153  C  CA  . PRO B  1 258 ? 10.163  30.860  39.924  1.00 79.84  ?  258  PRO B CA  1 
ATOM   6154  C  C   . PRO B  1 258 ? 10.273  30.649  38.422  1.00 82.52  ?  258  PRO B C   1 
ATOM   6155  O  O   . PRO B  1 258 ? 10.798  29.614  38.031  1.00 84.73  ?  258  PRO B O   1 
ATOM   6156  C  CB  . PRO B  1 258 ? 11.535  31.192  40.534  1.00 80.48  ?  258  PRO B CB  1 
ATOM   6157  C  CG  . PRO B  1 258 ? 11.711  30.231  41.691  1.00 78.21  ?  258  PRO B CG  1 
ATOM   6158  C  CD  . PRO B  1 258 ? 10.928  29.017  41.314  1.00 76.63  ?  258  PRO B CD  1 
ATOM   6159  N  N   . PRO B  1 259 ? 9.793   31.585  37.587  1.00 83.27  ?  259  PRO B N   1 
ATOM   6160  C  CA  . PRO B  1 259 ? 9.874   31.403  36.133  1.00 85.67  ?  259  PRO B CA  1 
ATOM   6161  C  C   . PRO B  1 259 ? 11.166  31.941  35.529  1.00 88.66  ?  259  PRO B C   1 
ATOM   6162  O  O   . PRO B  1 259 ? 11.158  32.601  34.486  1.00 91.30  ?  259  PRO B O   1 
ATOM   6163  C  CB  . PRO B  1 259 ? 8.664   32.194  35.633  1.00 85.15  ?  259  PRO B CB  1 
ATOM   6164  C  CG  . PRO B  1 259 ? 8.549   33.330  36.660  1.00 84.15  ?  259  PRO B CG  1 
ATOM   6165  C  CD  . PRO B  1 259 ? 9.309   32.933  37.920  1.00 82.39  ?  259  PRO B CD  1 
ATOM   6166  N  N   . GLY B  1 260 ? 12.295  31.617  36.152  1.00 88.51  ?  260  GLY B N   1 
ATOM   6167  C  CA  . GLY B  1 260 ? 13.564  32.155  35.709  1.00 90.50  ?  260  GLY B CA  1 
ATOM   6168  C  C   . GLY B  1 260 ? 14.222  31.449  34.545  1.00 92.04  ?  260  GLY B C   1 
ATOM   6169  O  O   . GLY B  1 260 ? 14.692  32.076  33.589  1.00 93.89  ?  260  GLY B O   1 
ATOM   6170  N  N   . GLY B  1 261 ? 14.212  30.126  34.607  1.00 91.82  ?  261  GLY B N   1 
ATOM   6171  C  CA  . GLY B  1 261 ? 15.265  29.335  34.020  1.00 95.26  ?  261  GLY B CA  1 
ATOM   6172  C  C   . GLY B  1 261 ? 16.290  28.865  35.028  1.00 96.52  ?  261  GLY B C   1 
ATOM   6173  O  O   . GLY B  1 261 ? 17.321  28.314  34.623  1.00 100.20 ?  261  GLY B O   1 
ATOM   6174  N  N   . ALA B  1 262 ? 16.035  29.076  36.323  1.00 93.08  ?  262  ALA B N   1 
ATOM   6175  C  CA  . ALA B  1 262 ? 16.815  28.598  37.463  1.00 89.97  ?  262  ALA B CA  1 
ATOM   6176  C  C   . ALA B  1 262 ? 16.133  29.072  38.740  1.00 86.00  ?  262  ALA B C   1 
ATOM   6177  O  O   . ALA B  1 262 ? 15.358  30.033  38.731  1.00 85.91  ?  262  ALA B O   1 
ATOM   6178  C  CB  . ALA B  1 262 ? 18.262  29.101  37.433  1.00 92.52  ?  262  ALA B CB  1 
ATOM   6179  N  N   . GLY B  1 263 ? 16.456  28.401  39.846  1.00 83.76  ?  263  GLY B N   1 
ATOM   6180  C  CA  . GLY B  1 263 ? 15.897  28.712  41.139  1.00 82.05  ?  263  GLY B CA  1 
ATOM   6181  C  C   . GLY B  1 263 ? 16.901  29.344  42.088  1.00 84.52  ?  263  GLY B C   1 
ATOM   6182  O  O   . GLY B  1 263 ? 17.980  29.796  41.699  1.00 88.67  ?  263  GLY B O   1 
ATOM   6183  N  N   . GLY B  1 264 ? 16.518  29.367  43.365  1.00 81.93  ?  264  GLY B N   1 
ATOM   6184  C  CA  . GLY B  1 264 ? 17.391  29.756  44.446  1.00 83.00  ?  264  GLY B CA  1 
ATOM   6185  C  C   . GLY B  1 264 ? 17.191  31.165  44.966  1.00 84.62  ?  264  GLY B C   1 
ATOM   6186  O  O   . GLY B  1 264 ? 17.542  31.437  46.123  1.00 86.24  ?  264  GLY B O   1 
ATOM   6187  N  N   . ASN B  1 265 ? 16.619  32.062  44.165  1.00 84.30  ?  265  ASN B N   1 
ATOM   6188  C  CA  . ASN B  1 265 ? 16.301  33.395  44.657  1.00 84.44  ?  265  ASN B CA  1 
ATOM   6189  C  C   . ASN B  1 265 ? 14.928  33.342  45.315  1.00 80.50  ?  265  ASN B C   1 
ATOM   6190  O  O   . ASN B  1 265 ? 13.921  33.068  44.652  1.00 78.80  ?  265  ASN B O   1 
ATOM   6191  C  CB  . ASN B  1 265 ? 16.345  34.423  43.522  1.00 87.48  ?  265  ASN B CB  1 
ATOM   6192  C  CG  . ASN B  1 265 ? 16.582  35.848  44.024  1.00 91.52  ?  265  ASN B CG  1 
ATOM   6193  O  OD1 . ASN B  1 265 ? 16.694  36.067  45.230  1.00 92.29  ?  265  ASN B OD1 1 
ATOM   6194  N  ND2 . ASN B  1 265 ? 16.669  36.820  43.094  1.00 95.26  ?  265  ASN B ND2 1 
ATOM   6195  N  N   . ASP B  1 266 ? 14.895  33.596  46.627  1.00 79.23  ?  266  ASP B N   1 
ATOM   6196  C  CA  . ASP B  1 266 ? 13.631  33.590  47.356  1.00 76.25  ?  266  ASP B CA  1 
ATOM   6197  C  C   . ASP B  1 266 ? 12.780  34.790  46.977  1.00 75.28  ?  266  ASP B C   1 
ATOM   6198  O  O   . ASP B  1 266 ? 11.551  34.686  46.884  1.00 73.46  ?  266  ASP B O   1 
ATOM   6199  C  CB  . ASP B  1 266 ? 13.895  33.583  48.861  1.00 76.79  ?  266  ASP B CB  1 
ATOM   6200  C  CG  . ASP B  1 266 ? 14.241  32.213  49.383  1.00 75.63  ?  266  ASP B CG  1 
ATOM   6201  O  OD1 . ASP B  1 266 ? 14.466  31.294  48.566  1.00 74.48  ?  266  ASP B OD1 1 
ATOM   6202  O  OD2 . ASP B  1 266 ? 14.291  32.061  50.620  1.00 76.16  ?  266  ASP B OD2 1 
ATOM   6203  N  N   . THR B  1 267 ? 13.424  35.940  46.766  1.00 76.61  ?  267  THR B N   1 
ATOM   6204  C  CA  . THR B  1 267 ? 12.697  37.134  46.358  1.00 76.90  ?  267  THR B CA  1 
ATOM   6205  C  C   . THR B  1 267 ? 11.982  36.911  45.034  1.00 75.04  ?  267  THR B C   1 
ATOM   6206  O  O   . THR B  1 267 ? 10.823  37.307  44.874  1.00 74.13  ?  267  THR B O   1 
ATOM   6207  C  CB  . THR B  1 267 ? 13.655  38.323  46.261  1.00 80.47  ?  267  THR B CB  1 
ATOM   6208  O  OG1 . THR B  1 267 ? 14.334  38.498  47.512  1.00 78.02  ?  267  THR B OG1 1 
ATOM   6209  C  CG2 . THR B  1 267 ? 12.895  39.595  45.913  1.00 81.36  ?  267  THR B CG2 1 
ATOM   6210  N  N   . GLU B  1 268 ? 12.653  36.268  44.075  1.00 73.14  ?  268  GLU B N   1 
ATOM   6211  C  CA  . GLU B  1 268 ? 12.004  35.988  42.799  1.00 77.00  ?  268  GLU B CA  1 
ATOM   6212  C  C   . GLU B  1 268 ? 10.858  35.000  42.971  1.00 74.47  ?  268  GLU B C   1 
ATOM   6213  O  O   . GLU B  1 268 ? 9.818   35.127  42.314  1.00 74.57  ?  268  GLU B O   1 
ATOM   6214  C  CB  . GLU B  1 268 ? 13.020  35.457  41.789  1.00 80.37  ?  268  GLU B CB  1 
ATOM   6215  C  CG  . GLU B  1 268 ? 12.381  34.943  40.510  1.00 82.74  ?  268  GLU B CG  1 
ATOM   6216  C  CD  . GLU B  1 268 ? 13.389  34.660  39.418  1.00 89.75  ?  268  GLU B CD  1 
ATOM   6217  O  OE1 . GLU B  1 268 ? 14.182  35.571  39.094  1.00 94.54  ?  268  GLU B OE1 1 
ATOM   6218  O  OE2 . GLU B  1 268 ? 13.387  33.527  38.884  1.00 91.17  ?  268  GLU B OE2 1 
ATOM   6219  N  N   . LEU B  1 269 ? 11.025  34.018  43.859  1.00 73.11  ?  269  LEU B N   1 
ATOM   6220  C  CA  . LEU B  1 269 ? 9.986   33.013  44.057  1.00 69.91  ?  269  LEU B CA  1 
ATOM   6221  C  C   . LEU B  1 269 ? 8.730   33.637  44.658  1.00 68.78  ?  269  LEU B C   1 
ATOM   6222  O  O   . LEU B  1 269 ? 7.619   33.439  44.149  1.00 68.43  ?  269  LEU B O   1 
ATOM   6223  C  CB  . LEU B  1 269 ? 10.518  31.883  44.943  1.00 64.21  ?  269  LEU B CB  1 
ATOM   6224  C  CG  . LEU B  1 269 ? 9.734   30.570  45.003  1.00 61.91  ?  269  LEU B CG  1 
ATOM   6225  C  CD1 . LEU B  1 269 ? 10.687  29.391  45.107  1.00 61.70  ?  269  LEU B CD1 1 
ATOM   6226  C  CD2 . LEU B  1 269 ? 8.765   30.569  46.173  1.00 60.34  ?  269  LEU B CD2 1 
ATOM   6227  N  N   . ILE B  1 270 ? 8.888   34.411  45.732  1.00 68.62  ?  270  ILE B N   1 
ATOM   6228  C  CA  . ILE B  1 270 ? 7.731   35.038  46.361  1.00 67.84  ?  270  ILE B CA  1 
ATOM   6229  C  C   . ILE B  1 270 ? 7.134   36.103  45.447  1.00 68.54  ?  270  ILE B C   1 
ATOM   6230  O  O   . ILE B  1 270 ? 5.912   36.287  45.403  1.00 67.48  ?  270  ILE B O   1 
ATOM   6231  C  CB  . ILE B  1 270 ? 8.127   35.616  47.730  1.00 68.82  ?  270  ILE B CB  1 
ATOM   6232  C  CG1 . ILE B  1 270 ? 8.725   34.514  48.605  1.00 66.17  ?  270  ILE B CG1 1 
ATOM   6233  C  CG2 . ILE B  1 270 ? 6.924   36.255  48.410  1.00 69.58  ?  270  ILE B CG2 1 
ATOM   6234  C  CD1 . ILE B  1 270 ? 9.663   35.028  49.666  1.00 67.29  ?  270  ILE B CD1 1 
ATOM   6235  N  N   . ALA B  1 271 ? 7.982   36.814  44.699  1.00 71.14  ?  271  ALA B N   1 
ATOM   6236  C  CA  . ALA B  1 271 ? 7.483   37.839  43.784  1.00 73.24  ?  271  ALA B CA  1 
ATOM   6237  C  C   . ALA B  1 271 ? 6.662   37.220  42.663  1.00 73.34  ?  271  ALA B C   1 
ATOM   6238  O  O   . ALA B  1 271 ? 5.680   37.812  42.197  1.00 69.14  ?  271  ALA B O   1 
ATOM   6239  C  CB  . ALA B  1 271 ? 8.645   38.647  43.210  1.00 75.13  ?  271  ALA B CB  1 
ATOM   6240  N  N   . CYS B  1 272 ? 7.058   36.027  42.211  1.00 72.55  ?  272  CYS B N   1 
ATOM   6241  C  CA  . CYS B  1 272 ? 6.235   35.290  41.262  1.00 70.17  ?  272  CYS B CA  1 
ATOM   6242  C  C   . CYS B  1 272 ? 4.940   34.825  41.918  1.00 69.00  ?  272  CYS B C   1 
ATOM   6243  O  O   . CYS B  1 272 ? 3.868   34.887  41.303  1.00 70.12  ?  272  CYS B O   1 
ATOM   6244  C  CB  . CYS B  1 272 ? 7.015   34.099  40.702  1.00 67.73  ?  272  CYS B CB  1 
ATOM   6245  S  SG  . CYS B  1 272 ? 6.047   32.997  39.624  1.00 66.64  ?  272  CYS B SG  1 
ATOM   6246  N  N   . LEU B  1 273 ? 5.021   34.365  43.173  1.00 66.40  ?  273  LEU B N   1 
ATOM   6247  C  CA  . LEU B  1 273 ? 3.820   33.926  43.878  1.00 63.28  ?  273  LEU B CA  1 
ATOM   6248  C  C   . LEU B  1 273 ? 2.822   35.061  44.048  1.00 62.80  ?  273  LEU B C   1 
ATOM   6249  O  O   . LEU B  1 273 ? 1.609   34.823  44.074  1.00 62.13  ?  273  LEU B O   1 
ATOM   6250  C  CB  . LEU B  1 273 ? 4.196   33.341  45.240  1.00 60.69  ?  273  LEU B CB  1 
ATOM   6251  C  CG  . LEU B  1 273 ? 4.503   31.844  45.284  1.00 59.12  ?  273  LEU B CG  1 
ATOM   6252  C  CD1 . LEU B  1 273 ? 5.132   31.464  46.609  1.00 58.45  ?  273  LEU B CD1 1 
ATOM   6253  C  CD2 . LEU B  1 273 ? 3.231   31.050  45.056  1.00 58.98  ?  273  LEU B CD2 1 
ATOM   6254  N  N   . ARG B  1 274 ? 3.305   36.301  44.145  1.00 64.59  ?  274  ARG B N   1 
ATOM   6255  C  CA  . ARG B  1 274 ? 2.412   37.424  44.386  1.00 71.37  ?  274  ARG B CA  1 
ATOM   6256  C  C   . ARG B  1 274 ? 1.589   37.789  43.158  1.00 72.83  ?  274  ARG B C   1 
ATOM   6257  O  O   . ARG B  1 274 ? 0.544   38.431  43.302  1.00 74.72  ?  274  ARG B O   1 
ATOM   6258  C  CB  . ARG B  1 274 ? 3.212   38.635  44.857  1.00 73.60  ?  274  ARG B CB  1 
ATOM   6259  C  CG  . ARG B  1 274 ? 3.436   38.664  46.354  1.00 76.52  ?  274  ARG B CG  1 
ATOM   6260  C  CD  . ARG B  1 274 ? 3.946   40.017  46.809  1.00 81.75  ?  274  ARG B CD  1 
ATOM   6261  N  NE  . ARG B  1 274 ? 5.356   40.218  46.487  1.00 84.27  ?  274  ARG B NE  1 
ATOM   6262  C  CZ  . ARG B  1 274 ? 6.347   40.094  47.364  1.00 85.83  ?  274  ARG B CZ  1 
ATOM   6263  N  NH1 . ARG B  1 274 ? 6.088   39.766  48.629  1.00 84.55  ?  274  ARG B NH1 1 
ATOM   6264  N  NH2 . ARG B  1 274 ? 7.600   40.299  46.976  1.00 87.70  ?  274  ARG B NH2 1 
ATOM   6265  N  N   . THR B  1 275 ? 2.025   37.396  41.962  1.00 73.69  ?  275  THR B N   1 
ATOM   6266  C  CA  . THR B  1 275 ? 1.299   37.728  40.743  1.00 75.76  ?  275  THR B CA  1 
ATOM   6267  C  C   . THR B  1 275 ? 0.310   36.650  40.314  1.00 75.02  ?  275  THR B C   1 
ATOM   6268  O  O   . THR B  1 275 ? -0.396  36.843  39.318  1.00 78.47  ?  275  THR B O   1 
ATOM   6269  C  CB  . THR B  1 275 ? 2.278   38.003  39.595  1.00 77.39  ?  275  THR B CB  1 
ATOM   6270  O  OG1 . THR B  1 275 ? 2.898   36.779  39.187  1.00 75.97  ?  275  THR B OG1 1 
ATOM   6271  C  CG2 . THR B  1 275 ? 3.345   39.008  40.022  1.00 78.72  ?  275  THR B CG2 1 
ATOM   6272  N  N   . ARG B  1 276 ? 0.237   35.532  41.028  1.00 70.53  ?  276  ARG B N   1 
ATOM   6273  C  CA  . ARG B  1 276 ? -0.754  34.517  40.700  1.00 67.84  ?  276  ARG B CA  1 
ATOM   6274  C  C   . ARG B  1 276 ? -2.100  34.879  41.324  1.00 67.91  ?  276  ARG B C   1 
ATOM   6275  O  O   . ARG B  1 276 ? -2.145  35.378  42.451  1.00 70.43  ?  276  ARG B O   1 
ATOM   6276  C  CB  . ARG B  1 276 ? -0.304  33.153  41.205  1.00 61.83  ?  276  ARG B CB  1 
ATOM   6277  C  CG  . ARG B  1 276 ? 0.958   32.650  40.539  1.00 62.79  ?  276  ARG B CG  1 
ATOM   6278  C  CD  . ARG B  1 276 ? 0.686   32.165  39.125  1.00 64.43  ?  276  ARG B CD  1 
ATOM   6279  N  NE  . ARG B  1 276 ? 1.922   31.878  38.402  1.00 65.30  ?  276  ARG B NE  1 
ATOM   6280  C  CZ  . ARG B  1 276 ? 2.559   32.761  37.637  1.00 68.21  ?  276  ARG B CZ  1 
ATOM   6281  N  NH1 . ARG B  1 276 ? 2.067   33.987  37.482  1.00 69.79  ?  276  ARG B NH1 1 
ATOM   6282  N  NH2 . ARG B  1 276 ? 3.679   32.417  37.016  1.00 69.94  ?  276  ARG B NH2 1 
ATOM   6283  N  N   . PRO B  1 277 ? -3.207  34.658  40.616  1.00 67.51  ?  277  PRO B N   1 
ATOM   6284  C  CA  . PRO B  1 277 ? -4.519  34.849  41.241  1.00 68.65  ?  277  PRO B CA  1 
ATOM   6285  C  C   . PRO B  1 277 ? -4.689  33.915  42.430  1.00 68.24  ?  277  PRO B C   1 
ATOM   6286  O  O   . PRO B  1 277 ? -4.154  32.806  42.453  1.00 67.97  ?  277  PRO B O   1 
ATOM   6287  C  CB  . PRO B  1 277 ? -5.506  34.523  40.112  1.00 69.23  ?  277  PRO B CB  1 
ATOM   6288  C  CG  . PRO B  1 277 ? -4.715  33.753  39.109  1.00 68.40  ?  277  PRO B CG  1 
ATOM   6289  C  CD  . PRO B  1 277 ? -3.321  34.284  39.199  1.00 68.27  ?  277  PRO B CD  1 
ATOM   6290  N  N   . ALA B  1 278 ? -5.432  34.393  43.432  1.00 68.63  ?  278  ALA B N   1 
ATOM   6291  C  CA  . ALA B  1 278 ? -5.532  33.683  44.704  1.00 66.69  ?  278  ALA B CA  1 
ATOM   6292  C  C   . ALA B  1 278 ? -6.000  32.245  44.510  1.00 67.44  ?  278  ALA B C   1 
ATOM   6293  O  O   . ALA B  1 278 ? -5.503  31.318  45.171  1.00 68.49  ?  278  ALA B O   1 
ATOM   6294  C  CB  . ALA B  1 278 ? -6.478  34.438  45.634  1.00 62.71  ?  278  ALA B CB  1 
ATOM   6295  N  N   . GLN B  1 279 ? -6.948  32.038  43.595  1.00 68.64  ?  279  GLN B N   1 
ATOM   6296  C  CA  . GLN B  1 279 ? -7.470  30.697  43.371  1.00 69.41  ?  279  GLN B CA  1 
ATOM   6297  C  C   . GLN B  1 279 ? -6.391  29.750  42.858  1.00 68.84  ?  279  GLN B C   1 
ATOM   6298  O  O   . GLN B  1 279 ? -6.441  28.551  43.148  1.00 69.27  ?  279  GLN B O   1 
ATOM   6299  C  CB  . GLN B  1 279 ? -8.652  30.751  42.405  1.00 72.66  ?  279  GLN B CB  1 
ATOM   6300  C  CG  . GLN B  1 279 ? -9.464  29.467  42.357  1.00 75.94  ?  279  GLN B CG  1 
ATOM   6301  C  CD  . GLN B  1 279 ? -9.958  29.030  43.725  1.00 78.09  ?  279  GLN B CD  1 
ATOM   6302  O  OE1 . GLN B  1 279 ? -10.298 29.858  44.573  1.00 79.71  ?  279  GLN B OE1 1 
ATOM   6303  N  NE2 . GLN B  1 279 ? -9.993  27.719  43.949  1.00 77.95  ?  279  GLN B NE2 1 
ATOM   6304  N  N   . ASP B  1 280 ? -5.411  30.261  42.101  1.00 69.46  ?  280  ASP B N   1 
ATOM   6305  C  CA  . ASP B  1 280 ? -4.291  29.422  41.673  1.00 68.51  ?  280  ASP B CA  1 
ATOM   6306  C  C   . ASP B  1 280 ? -3.554  28.837  42.869  1.00 68.37  ?  280  ASP B C   1 
ATOM   6307  O  O   . ASP B  1 280 ? -3.171  27.660  42.860  1.00 71.27  ?  280  ASP B O   1 
ATOM   6308  C  CB  . ASP B  1 280 ? -3.317  30.226  40.813  1.00 68.80  ?  280  ASP B CB  1 
ATOM   6309  C  CG  . ASP B  1 280 ? -3.800  30.408  39.396  1.00 70.17  ?  280  ASP B CG  1 
ATOM   6310  O  OD1 . ASP B  1 280 ? -5.031  30.426  39.181  1.00 71.21  ?  280  ASP B OD1 1 
ATOM   6311  O  OD2 . ASP B  1 280 ? -2.940  30.529  38.496  1.00 69.70  ?  280  ASP B OD2 1 
ATOM   6312  N  N   . LEU B  1 281 ? -3.331  29.652  43.902  1.00 64.03  ?  281  LEU B N   1 
ATOM   6313  C  CA  . LEU B  1 281 ? -2.695  29.152  45.113  1.00 58.31  ?  281  LEU B CA  1 
ATOM   6314  C  C   . LEU B  1 281 ? -3.599  28.163  45.833  1.00 57.30  ?  281  LEU B C   1 
ATOM   6315  O  O   . LEU B  1 281 ? -3.145  27.092  46.252  1.00 56.34  ?  281  LEU B O   1 
ATOM   6316  C  CB  . LEU B  1 281 ? -2.330  30.320  46.029  1.00 57.99  ?  281  LEU B CB  1 
ATOM   6317  C  CG  . LEU B  1 281 ? -0.959  30.987  45.871  1.00 58.30  ?  281  LEU B CG  1 
ATOM   6318  C  CD1 . LEU B  1 281 ? -0.577  31.180  44.417  1.00 57.78  ?  281  LEU B CD1 1 
ATOM   6319  C  CD2 . LEU B  1 281 ? -0.936  32.317  46.608  1.00 58.00  ?  281  LEU B CD2 1 
ATOM   6320  N  N   . VAL B  1 282 ? -4.889  28.490  45.962  1.00 59.81  ?  282  VAL B N   1 
ATOM   6321  C  CA  . VAL B  1 282 ? -5.794  27.625  46.723  1.00 60.51  ?  282  VAL B CA  1 
ATOM   6322  C  C   . VAL B  1 282 ? -5.972  26.260  46.057  1.00 61.12  ?  282  VAL B C   1 
ATOM   6323  O  O   . VAL B  1 282 ? -6.133  25.245  46.748  1.00 58.13  ?  282  VAL B O   1 
ATOM   6324  C  CB  . VAL B  1 282 ? -7.144  28.337  46.929  1.00 62.37  ?  282  VAL B CB  1 
ATOM   6325  C  CG1 . VAL B  1 282 ? -8.123  27.434  47.652  1.00 62.14  ?  282  VAL B CG1 1 
ATOM   6326  C  CG2 . VAL B  1 282 ? -6.938  29.621  47.710  1.00 63.96  ?  282  VAL B CG2 1 
ATOM   6327  N  N   . ASP B  1 283 ? -5.936  26.205  44.720  1.00 64.74  ?  283  ASP B N   1 
ATOM   6328  C  CA  . ASP B  1 283 ? -6.177  24.945  44.018  1.00 66.91  ?  283  ASP B CA  1 
ATOM   6329  C  C   . ASP B  1 283 ? -5.141  23.893  44.388  1.00 67.65  ?  283  ASP B C   1 
ATOM   6330  O  O   . ASP B  1 283 ? -5.476  22.717  44.577  1.00 70.29  ?  283  ASP B O   1 
ATOM   6331  C  CB  . ASP B  1 283 ? -6.180  25.170  42.506  1.00 68.06  ?  283  ASP B CB  1 
ATOM   6332  C  CG  . ASP B  1 283 ? -7.450  25.837  42.016  1.00 70.06  ?  283  ASP B CG  1 
ATOM   6333  O  OD1 . ASP B  1 283 ? -8.434  25.886  42.786  1.00 70.53  ?  283  ASP B OD1 1 
ATOM   6334  O  OD2 . ASP B  1 283 ? -7.466  26.308  40.855  1.00 71.07  ?  283  ASP B OD2 1 
ATOM   6335  N  N   . HIS B  1 284 ? -3.882  24.297  44.504  1.00 64.59  ?  284  HIS B N   1 
ATOM   6336  C  CA  . HIS B  1 284 ? -2.788  23.374  44.768  1.00 60.74  ?  284  HIS B CA  1 
ATOM   6337  C  C   . HIS B  1 284 ? -2.479  23.224  46.249  1.00 59.20  ?  284  HIS B C   1 
ATOM   6338  O  O   . HIS B  1 284 ? -1.505  22.547  46.593  1.00 58.73  ?  284  HIS B O   1 
ATOM   6339  C  CB  . HIS B  1 284 ? -1.541  23.834  44.013  1.00 59.04  ?  284  HIS B CB  1 
ATOM   6340  C  CG  . HIS B  1 284 ? -1.721  23.852  42.529  1.00 59.35  ?  284  HIS B CG  1 
ATOM   6341  N  ND1 . HIS B  1 284 ? -1.798  22.702  41.775  1.00 59.44  ?  284  HIS B ND1 1 
ATOM   6342  C  CD2 . HIS B  1 284 ? -1.864  24.881  41.661  1.00 60.35  ?  284  HIS B CD2 1 
ATOM   6343  C  CE1 . HIS B  1 284 ? -1.966  23.021  40.504  1.00 61.85  ?  284  HIS B CE1 1 
ATOM   6344  N  NE2 . HIS B  1 284 ? -2.009  24.338  40.408  1.00 61.85  ?  284  HIS B NE2 1 
ATOM   6345  N  N   . GLU B  1 285 ? -3.279  23.841  47.122  1.00 59.20  ?  285  GLU B N   1 
ATOM   6346  C  CA  . GLU B  1 285 ? -2.956  23.896  48.546  1.00 58.29  ?  285  GLU B CA  1 
ATOM   6347  C  C   . GLU B  1 285 ? -2.770  22.504  49.144  1.00 56.22  ?  285  GLU B C   1 
ATOM   6348  O  O   . GLU B  1 285 ? -1.772  22.242  49.825  1.00 55.67  ?  285  GLU B O   1 
ATOM   6349  C  CB  . GLU B  1 285 ? -4.046  24.663  49.292  1.00 61.04  ?  285  GLU B CB  1 
ATOM   6350  C  CG  . GLU B  1 285 ? -3.858  24.704  50.793  1.00 65.32  ?  285  GLU B CG  1 
ATOM   6351  C  CD  . GLU B  1 285 ? -4.879  25.591  51.480  1.00 72.29  ?  285  GLU B CD  1 
ATOM   6352  O  OE1 . GLU B  1 285 ? -5.425  26.500  50.811  1.00 75.19  ?  285  GLU B OE1 1 
ATOM   6353  O  OE2 . GLU B  1 285 ? -5.133  25.382  52.688  1.00 74.38  ?  285  GLU B OE2 1 
ATOM   6354  N  N   . TRP B  1 286 ? -3.716  21.593  48.897  1.00 55.69  ?  286  TRP B N   1 
ATOM   6355  C  CA  . TRP B  1 286 ? -3.688  20.270  49.513  1.00 55.12  ?  286  TRP B CA  1 
ATOM   6356  C  C   . TRP B  1 286 ? -2.669  19.326  48.888  1.00 57.10  ?  286  TRP B C   1 
ATOM   6357  O  O   . TRP B  1 286 ? -2.462  18.230  49.419  1.00 58.95  ?  286  TRP B O   1 
ATOM   6358  C  CB  . TRP B  1 286 ? -5.075  19.618  49.450  1.00 56.28  ?  286  TRP B CB  1 
ATOM   6359  C  CG  . TRP B  1 286 ? -6.111  20.355  50.242  1.00 58.88  ?  286  TRP B CG  1 
ATOM   6360  C  CD1 . TRP B  1 286 ? -7.036  21.240  49.765  1.00 61.53  ?  286  TRP B CD1 1 
ATOM   6361  C  CD2 . TRP B  1 286 ? -6.302  20.303  51.663  1.00 58.65  ?  286  TRP B CD2 1 
ATOM   6362  N  NE1 . TRP B  1 286 ? -7.803  21.729  50.799  1.00 62.01  ?  286  TRP B NE1 1 
ATOM   6363  C  CE2 . TRP B  1 286 ? -7.370  21.172  51.974  1.00 60.34  ?  286  TRP B CE2 1 
ATOM   6364  C  CE3 . TRP B  1 286 ? -5.678  19.603  52.702  1.00 56.05  ?  286  TRP B CE3 1 
ATOM   6365  C  CZ2 . TRP B  1 286 ? -7.825  21.358  53.276  1.00 59.80  ?  286  TRP B CZ2 1 
ATOM   6366  C  CZ3 . TRP B  1 286 ? -6.131  19.790  53.995  1.00 56.08  ?  286  TRP B CZ3 1 
ATOM   6367  C  CH2 . TRP B  1 286 ? -7.195  20.658  54.270  1.00 58.27  ?  286  TRP B CH2 1 
ATOM   6368  N  N   . HIS B  1 287 ? -2.030  19.710  47.787  1.00 60.37  ?  287  HIS B N   1 
ATOM   6369  C  CA  . HIS B  1 287 ? -1.158  18.789  47.070  1.00 62.63  ?  287  HIS B CA  1 
ATOM   6370  C  C   . HIS B  1 287 ? 0.260   18.754  47.619  1.00 60.15  ?  287  HIS B C   1 
ATOM   6371  O  O   . HIS B  1 287 ? 1.054   17.920  47.177  1.00 60.21  ?  287  HIS B O   1 
ATOM   6372  C  CB  . HIS B  1 287 ? -1.123  19.164  45.592  1.00 68.78  ?  287  HIS B CB  1 
ATOM   6373  C  CG  . HIS B  1 287 ? -2.466  19.132  44.929  1.00 75.05  ?  287  HIS B CG  1 
ATOM   6374  N  ND1 . HIS B  1 287 ? -3.608  18.692  45.565  1.00 77.55  ?  287  HIS B ND1 1 
ATOM   6375  C  CD2 . HIS B  1 287 ? -2.857  19.543  43.702  1.00 77.32  ?  287  HIS B CD2 1 
ATOM   6376  C  CE1 . HIS B  1 287 ? -4.638  18.798  44.744  1.00 78.89  ?  287  HIS B CE1 1 
ATOM   6377  N  NE2 . HIS B  1 287 ? -4.208  19.314  43.607  1.00 78.89  ?  287  HIS B NE2 1 
ATOM   6378  N  N   . VAL B  1 288 ? 0.596   19.636  48.561  1.00 58.82  ?  288  VAL B N   1 
ATOM   6379  C  CA  . VAL B  1 288 ? 1.930   19.679  49.134  1.00 58.78  ?  288  VAL B CA  1 
ATOM   6380  C  C   . VAL B  1 288 ? 2.040   18.877  50.431  1.00 59.11  ?  288  VAL B C   1 
ATOM   6381  O  O   . VAL B  1 288 ? 3.117   18.856  51.045  1.00 60.54  ?  288  VAL B O   1 
ATOM   6382  C  CB  . VAL B  1 288 ? 2.381   21.137  49.350  1.00 58.70  ?  288  VAL B CB  1 
ATOM   6383  C  CG1 . VAL B  1 288 ? 2.380   21.875  48.025  1.00 60.43  ?  288  VAL B CG1 1 
ATOM   6384  C  CG2 . VAL B  1 288 ? 1.470   21.841  50.340  1.00 57.57  ?  288  VAL B CG2 1 
ATOM   6385  N  N   . LEU B  1 289 ? 0.967   18.215  50.863  1.00 57.17  ?  289  LEU B N   1 
ATOM   6386  C  CA  . LEU B  1 289 ? 1.045   17.385  52.062  1.00 54.82  ?  289  LEU B CA  1 
ATOM   6387  C  C   . LEU B  1 289 ? 1.967   16.190  51.813  1.00 54.92  ?  289  LEU B C   1 
ATOM   6388  O  O   . LEU B  1 289 ? 1.896   15.560  50.753  1.00 56.63  ?  289  LEU B O   1 
ATOM   6389  C  CB  . LEU B  1 289 ? -0.347  16.907  52.478  1.00 52.69  ?  289  LEU B CB  1 
ATOM   6390  C  CG  . LEU B  1 289 ? -1.227  17.948  53.179  1.00 50.83  ?  289  LEU B CG  1 
ATOM   6391  C  CD1 . LEU B  1 289 ? -2.584  17.367  53.534  1.00 48.39  ?  289  LEU B CD1 1 
ATOM   6392  C  CD2 . LEU B  1 289 ? -0.535  18.484  54.415  1.00 47.72  ?  289  LEU B CD2 1 
ATOM   6393  N  N   . PRO B  1 290 ? 2.854   15.868  52.762  1.00 53.11  ?  290  PRO B N   1 
ATOM   6394  C  CA  . PRO B  1 290 ? 3.901   14.866  52.485  1.00 51.01  ?  290  PRO B CA  1 
ATOM   6395  C  C   . PRO B  1 290 ? 3.395   13.438  52.380  1.00 49.91  ?  290  PRO B C   1 
ATOM   6396  O  O   . PRO B  1 290 ? 4.053   12.612  51.736  1.00 48.35  ?  290  PRO B O   1 
ATOM   6397  C  CB  . PRO B  1 290 ? 4.865   15.033  53.667  1.00 53.06  ?  290  PRO B CB  1 
ATOM   6398  C  CG  . PRO B  1 290 ? 4.012   15.560  54.773  1.00 54.91  ?  290  PRO B CG  1 
ATOM   6399  C  CD  . PRO B  1 290 ? 2.947   16.413  54.128  1.00 54.71  ?  290  PRO B CD  1 
ATOM   6400  N  N   . GLN B  1 291 ? 2.284   13.103  53.025  1.00 52.19  ?  291  GLN B N   1 
ATOM   6401  C  CA  . GLN B  1 291 ? 1.714   11.770  52.920  1.00 54.28  ?  291  GLN B CA  1 
ATOM   6402  C  C   . GLN B  1 291 ? 0.202   11.888  52.845  1.00 54.45  ?  291  GLN B C   1 
ATOM   6403  O  O   . GLN B  1 291 ? -0.377  12.921  53.186  1.00 55.89  ?  291  GLN B O   1 
ATOM   6404  C  CB  . GLN B  1 291 ? 2.115   10.868  54.098  1.00 58.18  ?  291  GLN B CB  1 
ATOM   6405  C  CG  . GLN B  1 291 ? 3.602   10.545  54.165  1.00 64.72  ?  291  GLN B CG  1 
ATOM   6406  C  CD  . GLN B  1 291 ? 4.326   11.306  55.264  1.00 71.45  ?  291  GLN B CD  1 
ATOM   6407  O  OE1 . GLN B  1 291 ? 3.783   12.241  55.861  1.00 73.42  ?  291  GLN B OE1 1 
ATOM   6408  N  NE2 . GLN B  1 291 ? 5.568   10.913  55.529  1.00 74.46  ?  291  GLN B NE2 1 
ATOM   6409  N  N   . GLU B  1 292 ? -0.436  10.814  52.394  1.00 55.81  ?  292  GLU B N   1 
ATOM   6410  C  CA  . GLU B  1 292 ? -1.889  10.792  52.357  1.00 59.42  ?  292  GLU B CA  1 
ATOM   6411  C  C   . GLU B  1 292 ? -2.402  10.773  53.789  1.00 60.02  ?  292  GLU B C   1 
ATOM   6412  O  O   . GLU B  1 292 ? -2.030  9.897   54.577  1.00 60.44  ?  292  GLU B O   1 
ATOM   6413  C  CB  . GLU B  1 292 ? -2.387  9.578   51.581  1.00 63.77  ?  292  GLU B CB  1 
ATOM   6414  C  CG  . GLU B  1 292 ? -3.893  9.540   51.425  1.00 69.18  ?  292  GLU B CG  1 
ATOM   6415  C  CD  . GLU B  1 292 ? -4.390  8.236   50.834  1.00 74.68  ?  292  GLU B CD  1 
ATOM   6416  O  OE1 . GLU B  1 292 ? -3.550  7.399   50.431  1.00 75.66  ?  292  GLU B OE1 1 
ATOM   6417  O  OE2 . GLU B  1 292 ? -5.625  8.046   50.779  1.00 77.31  ?  292  GLU B OE2 1 
ATOM   6418  N  N   . SER B  1 293 ? -3.247  11.742  54.132  1.00 59.74  ?  293  SER B N   1 
ATOM   6419  C  CA  . SER B  1 293 ? -3.554  11.961  55.534  1.00 58.98  ?  293  SER B CA  1 
ATOM   6420  C  C   . SER B  1 293 ? -4.893  12.661  55.685  1.00 60.01  ?  293  SER B C   1 
ATOM   6421  O  O   . SER B  1 293 ? -5.389  13.314  54.764  1.00 62.22  ?  293  SER B O   1 
ATOM   6422  C  CB  . SER B  1 293 ? -2.458  12.791  56.208  1.00 57.66  ?  293  SER B CB  1 
ATOM   6423  O  OG  . SER B  1 293 ? -2.349  14.069  55.607  1.00 57.42  ?  293  SER B OG  1 
ATOM   6424  N  N   . ILE B  1 294 ? -5.458  12.521  56.882  1.00 58.88  ?  294  ILE B N   1 
ATOM   6425  C  CA  . ILE B  1 294 ? -6.543  13.359  57.363  1.00 57.24  ?  294  ILE B CA  1 
ATOM   6426  C  C   . ILE B  1 294 ? -6.069  14.026  58.647  1.00 54.96  ?  294  ILE B C   1 
ATOM   6427  O  O   . ILE B  1 294 ? -5.127  13.570  59.303  1.00 52.67  ?  294  ILE B O   1 
ATOM   6428  C  CB  . ILE B  1 294 ? -7.843  12.569  57.601  1.00 58.77  ?  294  ILE B CB  1 
ATOM   6429  C  CG1 . ILE B  1 294 ? -7.611  11.454  58.625  1.00 58.85  ?  294  ILE B CG1 1 
ATOM   6430  C  CG2 . ILE B  1 294 ? -8.365  12.007  56.287  1.00 59.97  ?  294  ILE B CG2 1 
ATOM   6431  C  CD1 . ILE B  1 294 ? -8.891  10.857  59.170  1.00 55.35  ?  294  ILE B CD1 1 
ATOM   6432  N  N   . PHE B  1 295 ? -6.734  15.126  58.998  1.00 56.12  ?  295  PHE B N   1 
ATOM   6433  C  CA  . PHE B  1 295 ? -6.333  15.957  60.134  1.00 57.87  ?  295  PHE B CA  1 
ATOM   6434  C  C   . PHE B  1 295 ? -4.880  16.410  59.985  1.00 59.23  ?  295  PHE B C   1 
ATOM   6435  O  O   . PHE B  1 295 ? -4.089  16.364  60.929  1.00 60.25  ?  295  PHE B O   1 
ATOM   6436  C  CB  . PHE B  1 295 ? -6.560  15.228  61.462  1.00 58.36  ?  295  PHE B CB  1 
ATOM   6437  C  CG  . PHE B  1 295 ? -6.990  16.128  62.590  1.00 59.77  ?  295  PHE B CG  1 
ATOM   6438  C  CD1 . PHE B  1 295 ? -6.323  17.317  62.848  1.00 59.54  ?  295  PHE B CD1 1 
ATOM   6439  C  CD2 . PHE B  1 295 ? -8.069  15.786  63.391  1.00 61.61  ?  295  PHE B CD2 1 
ATOM   6440  C  CE1 . PHE B  1 295 ? -6.721  18.146  63.889  1.00 60.57  ?  295  PHE B CE1 1 
ATOM   6441  C  CE2 . PHE B  1 295 ? -8.468  16.609  64.436  1.00 62.53  ?  295  PHE B CE2 1 
ATOM   6442  C  CZ  . PHE B  1 295 ? -7.795  17.791  64.682  1.00 61.83  ?  295  PHE B CZ  1 
ATOM   6443  N  N   . ARG B  1 296 ? -4.525  16.818  58.767  1.00 59.95  ?  296  ARG B N   1 
ATOM   6444  C  CA  . ARG B  1 296 ? -3.264  17.477  58.455  1.00 59.08  ?  296  ARG B CA  1 
ATOM   6445  C  C   . ARG B  1 296 ? -3.565  18.624  57.506  1.00 62.49  ?  296  ARG B C   1 
ATOM   6446  O  O   . ARG B  1 296 ? -4.361  18.472  56.575  1.00 65.16  ?  296  ARG B O   1 
ATOM   6447  C  CB  . ARG B  1 296 ? -2.252  16.527  57.806  1.00 55.58  ?  296  ARG B CB  1 
ATOM   6448  C  CG  . ARG B  1 296 ? -1.724  15.455  58.719  1.00 55.16  ?  296  ARG B CG  1 
ATOM   6449  C  CD  . ARG B  1 296 ? -0.854  16.042  59.808  1.00 56.42  ?  296  ARG B CD  1 
ATOM   6450  N  NE  . ARG B  1 296 ? -0.268  14.987  60.624  1.00 58.49  ?  296  ARG B NE  1 
ATOM   6451  C  CZ  . ARG B  1 296 ? -0.846  14.478  61.704  1.00 61.83  ?  296  ARG B CZ  1 
ATOM   6452  N  NH1 . ARG B  1 296 ? -2.023  14.941  62.105  1.00 63.06  ?  296  ARG B NH1 1 
ATOM   6453  N  NH2 . ARG B  1 296 ? -0.248  13.509  62.382  1.00 63.90  ?  296  ARG B NH2 1 
ATOM   6454  N  N   . PHE B  1 297 ? -2.933  19.768  57.740  1.00 61.63  ?  297  PHE B N   1 
ATOM   6455  C  CA  . PHE B  1 297 ? -3.206  20.963  56.957  1.00 60.35  ?  297  PHE B CA  1 
ATOM   6456  C  C   . PHE B  1 297 ? -1.899  21.518  56.419  1.00 57.62  ?  297  PHE B C   1 
ATOM   6457  O  O   . PHE B  1 297 ? -0.876  21.500  57.113  1.00 59.01  ?  297  PHE B O   1 
ATOM   6458  C  CB  . PHE B  1 297 ? -3.940  21.984  57.807  1.00 63.43  ?  297  PHE B CB  1 
ATOM   6459  C  CG  . PHE B  1 297 ? -4.980  21.368  58.698  1.00 63.23  ?  297  PHE B CG  1 
ATOM   6460  C  CD1 . PHE B  1 297 ? -6.176  20.904  58.171  1.00 63.47  ?  297  PHE B CD1 1 
ATOM   6461  C  CD2 . PHE B  1 297 ? -4.748  21.213  60.049  1.00 60.82  ?  297  PHE B CD2 1 
ATOM   6462  C  CE1 . PHE B  1 297 ? -7.128  20.323  58.983  1.00 62.04  ?  297  PHE B CE1 1 
ATOM   6463  C  CE2 . PHE B  1 297 ? -5.696  20.632  60.859  1.00 60.52  ?  297  PHE B CE2 1 
ATOM   6464  C  CZ  . PHE B  1 297 ? -6.887  20.186  60.325  1.00 60.57  ?  297  PHE B CZ  1 
ATOM   6465  N  N   . SER B  1 298 ? -1.943  22.008  55.177  1.00 54.10  ?  298  SER B N   1 
ATOM   6466  C  CA  . SER B  1 298 ? -0.714  22.234  54.419  1.00 51.81  ?  298  SER B CA  1 
ATOM   6467  C  C   . SER B  1 298 ? 0.073   23.425  54.950  1.00 51.79  ?  298  SER B C   1 
ATOM   6468  O  O   . SER B  1 298 ? 1.286   23.329  55.178  1.00 50.94  ?  298  SER B O   1 
ATOM   6469  C  CB  . SER B  1 298 ? -1.045  22.425  52.942  1.00 51.60  ?  298  SER B CB  1 
ATOM   6470  O  OG  . SER B  1 298 ? -1.595  21.240  52.401  1.00 52.24  ?  298  SER B OG  1 
ATOM   6471  N  N   . PHE B  1 299 ? -0.582  24.563  55.125  1.00 52.88  ?  299  PHE B N   1 
ATOM   6472  C  CA  . PHE B  1 299 ? 0.094   25.774  55.564  1.00 56.78  ?  299  PHE B CA  1 
ATOM   6473  C  C   . PHE B  1 299 ? -0.439  26.162  56.937  1.00 60.76  ?  299  PHE B C   1 
ATOM   6474  O  O   . PHE B  1 299 ? -1.590  26.595  57.072  1.00 64.02  ?  299  PHE B O   1 
ATOM   6475  C  CB  . PHE B  1 299 ? -0.077  26.878  54.527  1.00 59.05  ?  299  PHE B CB  1 
ATOM   6476  C  CG  . PHE B  1 299 ? 0.537   26.530  53.202  1.00 59.88  ?  299  PHE B CG  1 
ATOM   6477  C  CD1 . PHE B  1 299 ? 1.867   26.822  52.945  1.00 60.14  ?  299  PHE B CD1 1 
ATOM   6478  C  CD2 . PHE B  1 299 ? -0.196  25.859  52.236  1.00 59.72  ?  299  PHE B CD2 1 
ATOM   6479  C  CE1 . PHE B  1 299 ? 2.445   26.481  51.738  1.00 60.22  ?  299  PHE B CE1 1 
ATOM   6480  C  CE2 . PHE B  1 299 ? 0.379   25.512  51.028  1.00 59.70  ?  299  PHE B CE2 1 
ATOM   6481  C  CZ  . PHE B  1 299 ? 1.700   25.827  50.777  1.00 60.06  ?  299  PHE B CZ  1 
ATOM   6482  N  N   . VAL B  1 300 ? 0.412   26.004  57.945  1.00 59.37  ?  300  VAL B N   1 
ATOM   6483  C  CA  . VAL B  1 300 ? 0.069   26.213  59.346  1.00 57.29  ?  300  VAL B CA  1 
ATOM   6484  C  C   . VAL B  1 300 ? 1.209   27.028  59.946  1.00 58.74  ?  300  VAL B C   1 
ATOM   6485  O  O   . VAL B  1 300 ? 2.172   27.335  59.223  1.00 58.68  ?  300  VAL B O   1 
ATOM   6486  C  CB  . VAL B  1 300 ? -0.139  24.869  60.063  1.00 54.18  ?  300  VAL B CB  1 
ATOM   6487  C  CG1 . VAL B  1 300 ? -1.344  24.140  59.488  1.00 52.16  ?  300  VAL B CG1 1 
ATOM   6488  C  CG2 . VAL B  1 300 ? 1.110   24.016  59.946  1.00 51.91  ?  300  VAL B CG2 1 
ATOM   6489  N  N   . PRO B  1 301 ? 1.152   27.422  61.224  1.00 59.93  ?  301  PRO B N   1 
ATOM   6490  C  CA  . PRO B  1 301 ? 2.292   28.127  61.819  1.00 59.93  ?  301  PRO B CA  1 
ATOM   6491  C  C   . PRO B  1 301 ? 3.572   27.319  61.692  1.00 56.50  ?  301  PRO B C   1 
ATOM   6492  O  O   . PRO B  1 301 ? 3.565   26.091  61.771  1.00 57.85  ?  301  PRO B O   1 
ATOM   6493  C  CB  . PRO B  1 301 ? 1.875   28.295  63.280  1.00 58.90  ?  301  PRO B CB  1 
ATOM   6494  C  CG  . PRO B  1 301 ? 0.400   28.418  63.211  1.00 60.71  ?  301  PRO B CG  1 
ATOM   6495  C  CD  . PRO B  1 301 ? -0.040  27.512  62.090  1.00 60.17  ?  301  PRO B CD  1 
ATOM   6496  N  N   . VAL B  1 302 ? 4.673   28.026  61.483  1.00 57.46  ?  302  VAL B N   1 
ATOM   6497  C  CA  . VAL B  1 302 ? 5.990   27.427  61.312  1.00 61.29  ?  302  VAL B CA  1 
ATOM   6498  C  C   . VAL B  1 302 ? 6.818   27.790  62.534  1.00 64.67  ?  302  VAL B C   1 
ATOM   6499  O  O   . VAL B  1 302 ? 6.588   28.831  63.163  1.00 68.30  ?  302  VAL B O   1 
ATOM   6500  C  CB  . VAL B  1 302 ? 6.654   27.924  60.008  1.00 57.14  ?  302  VAL B CB  1 
ATOM   6501  C  CG1 . VAL B  1 302 ? 6.768   29.442  60.023  1.00 59.10  ?  302  VAL B CG1 1 
ATOM   6502  C  CG2 . VAL B  1 302 ? 8.015   27.274  59.790  1.00 57.10  ?  302  VAL B CG2 1 
ATOM   6503  N  N   . VAL B  1 303 ? 7.783   26.941  62.886  1.00 64.26  ?  303  VAL B N   1 
ATOM   6504  C  CA  . VAL B  1 303 ? 8.676   27.271  63.990  1.00 66.83  ?  303  VAL B CA  1 
ATOM   6505  C  C   . VAL B  1 303 ? 9.864   27.977  63.349  1.00 69.08  ?  303  VAL B C   1 
ATOM   6506  O  O   . VAL B  1 303 ? 10.754  27.345  62.777  1.00 68.09  ?  303  VAL B O   1 
ATOM   6507  C  CB  . VAL B  1 303 ? 9.106   26.026  64.770  1.00 65.39  ?  303  VAL B CB  1 
ATOM   6508  C  CG1 . VAL B  1 303 ? 9.986   26.413  65.950  1.00 67.48  ?  303  VAL B CG1 1 
ATOM   6509  C  CG2 . VAL B  1 303 ? 7.888   25.231  65.230  1.00 63.89  ?  303  VAL B CG2 1 
ATOM   6510  N  N   . ASP B  1 304 ? 9.895   29.296  63.509  1.00 72.63  ?  304  ASP B N   1 
ATOM   6511  C  CA  . ASP B  1 304 ? 10.854  30.168  62.852  1.00 76.86  ?  304  ASP B CA  1 
ATOM   6512  C  C   . ASP B  1 304 ? 12.004  30.589  63.750  1.00 80.97  ?  304  ASP B C   1 
ATOM   6513  O  O   . ASP B  1 304 ? 12.919  31.273  63.280  1.00 84.34  ?  304  ASP B O   1 
ATOM   6514  C  CB  . ASP B  1 304 ? 10.129  31.405  62.311  1.00 79.66  ?  304  ASP B CB  1 
ATOM   6515  C  CG  . ASP B  1 304 ? 9.300   32.108  63.375  1.00 83.52  ?  304  ASP B CG  1 
ATOM   6516  O  OD1 . ASP B  1 304 ? 9.101   31.527  64.465  1.00 83.83  ?  304  ASP B OD1 1 
ATOM   6517  O  OD2 . ASP B  1 304 ? 8.846   33.245  63.123  1.00 86.40  ?  304  ASP B OD2 1 
ATOM   6518  N  N   . GLY B  1 305 ? 11.985  30.197  65.021  1.00 80.85  ?  305  GLY B N   1 
ATOM   6519  C  CA  . GLY B  1 305 ? 12.856  30.830  65.990  1.00 82.55  ?  305  GLY B CA  1 
ATOM   6520  C  C   . GLY B  1 305 ? 12.640  32.321  66.134  1.00 83.51  ?  305  GLY B C   1 
ATOM   6521  O  O   . GLY B  1 305 ? 13.575  33.038  66.498  1.00 87.80  ?  305  GLY B O   1 
ATOM   6522  N  N   . ASP B  1 306 ? 11.441  32.820  65.822  1.00 79.84  ?  306  ASP B N   1 
ATOM   6523  C  CA  . ASP B  1 306 ? 11.125  34.223  66.064  1.00 80.21  ?  306  ASP B CA  1 
ATOM   6524  C  C   . ASP B  1 306 ? 9.807   34.368  66.818  1.00 78.59  ?  306  ASP B C   1 
ATOM   6525  O  O   . ASP B  1 306 ? 9.799   34.714  68.004  1.00 80.00  ?  306  ASP B O   1 
ATOM   6526  C  CB  . ASP B  1 306 ? 11.071  34.996  64.743  1.00 79.16  ?  306  ASP B CB  1 
ATOM   6527  C  CG  . ASP B  1 306 ? 10.848  36.486  64.947  1.00 81.73  ?  306  ASP B CG  1 
ATOM   6528  O  OD1 . ASP B  1 306 ? 11.538  37.081  65.804  1.00 84.78  ?  306  ASP B OD1 1 
ATOM   6529  O  OD2 . ASP B  1 306 ? 9.985   37.061  64.247  1.00 80.64  ?  306  ASP B OD2 1 
ATOM   6530  N  N   . PHE B  1 307 ? 8.686   34.086  66.146  1.00 75.18  ?  307  PHE B N   1 
ATOM   6531  C  CA  . PHE B  1 307 ? 7.399   34.116  66.834  1.00 75.72  ?  307  PHE B CA  1 
ATOM   6532  C  C   . PHE B  1 307 ? 7.308   32.977  67.839  1.00 75.96  ?  307  PHE B C   1 
ATOM   6533  O  O   . PHE B  1 307 ? 6.816   33.163  68.957  1.00 78.97  ?  307  PHE B O   1 
ATOM   6534  C  CB  . PHE B  1 307 ? 6.258   34.045  65.817  1.00 74.41  ?  307  PHE B CB  1 
ATOM   6535  C  CG  . PHE B  1 307 ? 4.884   34.298  66.401  1.00 76.00  ?  307  PHE B CG  1 
ATOM   6536  C  CD1 . PHE B  1 307 ? 4.228   33.322  67.137  1.00 71.61  ?  307  PHE B CD1 1 
ATOM   6537  C  CD2 . PHE B  1 307 ? 4.238   35.503  66.182  1.00 74.26  ?  307  PHE B CD2 1 
ATOM   6538  C  CE1 . PHE B  1 307 ? 2.967   33.550  67.657  1.00 72.48  ?  307  PHE B CE1 1 
ATOM   6539  C  CE2 . PHE B  1 307 ? 2.976   35.735  66.699  1.00 75.10  ?  307  PHE B CE2 1 
ATOM   6540  C  CZ  . PHE B  1 307 ? 2.340   34.757  67.436  1.00 74.25  ?  307  PHE B CZ  1 
ATOM   6541  N  N   . LEU B  1 308 ? 7.774   31.793  67.449  1.00 73.25  ?  308  LEU B N   1 
ATOM   6542  C  CA  . LEU B  1 308 ? 7.972   30.663  68.349  1.00 72.68  ?  308  LEU B CA  1 
ATOM   6543  C  C   . LEU B  1 308 ? 9.477   30.499  68.524  1.00 74.73  ?  308  LEU B C   1 
ATOM   6544  O  O   . LEU B  1 308 ? 10.181  30.140  67.573  1.00 70.48  ?  308  LEU B O   1 
ATOM   6545  C  CB  . LEU B  1 308 ? 7.334   29.394  67.789  1.00 68.38  ?  308  LEU B CB  1 
ATOM   6546  C  CG  . LEU B  1 308 ? 5.829   29.462  67.533  1.00 67.51  ?  308  LEU B CG  1 
ATOM   6547  C  CD1 . LEU B  1 308 ? 5.342   28.170  66.905  1.00 63.60  ?  308  LEU B CD1 1 
ATOM   6548  C  CD2 . LEU B  1 308 ? 5.073   29.758  68.819  1.00 68.47  ?  308  LEU B CD2 1 
ATOM   6549  N  N   . SER B  1 309 ? 9.969   30.782  69.734  1.00 77.03  ?  309  SER B N   1 
ATOM   6550  C  CA  . SER B  1 309 ? 11.407  30.720  69.981  1.00 78.81  ?  309  SER B CA  1 
ATOM   6551  C  C   . SER B  1 309 ? 11.939  29.300  69.850  1.00 79.64  ?  309  SER B C   1 
ATOM   6552  O  O   . SER B  1 309 ? 13.110  29.102  69.506  1.00 81.59  ?  309  SER B O   1 
ATOM   6553  C  CB  . SER B  1 309 ? 11.721  31.283  71.362  1.00 81.41  ?  309  SER B CB  1 
ATOM   6554  O  OG  . SER B  1 309 ? 11.007  30.584  72.365  1.00 81.77  ?  309  SER B OG  1 
ATOM   6555  N  N   . ASP B  1 310 ? 11.097  28.306  70.122  1.00 78.25  ?  310  ASP B N   1 
ATOM   6556  C  CA  . ASP B  1 310 ? 11.436  26.900  69.959  1.00 76.18  ?  310  ASP B CA  1 
ATOM   6557  C  C   . ASP B  1 310 ? 10.166  26.167  69.547  1.00 73.89  ?  310  ASP B C   1 
ATOM   6558  O  O   . ASP B  1 310 ? 9.110   26.778  69.353  1.00 73.94  ?  310  ASP B O   1 
ATOM   6559  C  CB  . ASP B  1 310 ? 12.039  26.332  71.249  1.00 78.57  ?  310  ASP B CB  1 
ATOM   6560  C  CG  . ASP B  1 310 ? 12.898  25.103  71.008  1.00 78.13  ?  310  ASP B CG  1 
ATOM   6561  O  OD1 . ASP B  1 310 ? 12.686  24.405  69.995  1.00 76.22  ?  310  ASP B OD1 1 
ATOM   6562  O  OD2 . ASP B  1 310 ? 13.790  24.834  71.839  1.00 80.14  ?  310  ASP B OD2 1 
ATOM   6563  N  N   . THR B  1 311 ? 10.273  24.852  69.402  1.00 72.37  ?  311  THR B N   1 
ATOM   6564  C  CA  . THR B  1 311 ? 9.087   24.052  69.154  1.00 70.00  ?  311  THR B CA  1 
ATOM   6565  C  C   . THR B  1 311 ? 8.140   24.168  70.348  1.00 71.10  ?  311  THR B C   1 
ATOM   6566  O  O   . THR B  1 311 ? 8.596   24.214  71.496  1.00 73.17  ?  311  THR B O   1 
ATOM   6567  C  CB  . THR B  1 311 ? 9.459   22.588  68.901  1.00 68.23  ?  311  THR B CB  1 
ATOM   6568  O  OG1 . THR B  1 311 ? 8.275   21.781  68.901  1.00 69.31  ?  311  THR B OG1 1 
ATOM   6569  C  CG2 . THR B  1 311 ? 10.423  22.073  69.951  1.00 67.52  ?  311  THR B CG2 1 
ATOM   6570  N  N   . PRO B  1 312 ? 6.827   24.254  70.116  1.00 70.33  ?  312  PRO B N   1 
ATOM   6571  C  CA  . PRO B  1 312 ? 5.896   24.343  71.251  1.00 72.92  ?  312  PRO B CA  1 
ATOM   6572  C  C   . PRO B  1 312 ? 6.003   23.165  72.203  1.00 76.04  ?  312  PRO B C   1 
ATOM   6573  O  O   . PRO B  1 312 ? 5.681   23.310  73.389  1.00 78.59  ?  312  PRO B O   1 
ATOM   6574  C  CB  . PRO B  1 312 ? 4.520   24.415  70.571  1.00 69.73  ?  312  PRO B CB  1 
ATOM   6575  C  CG  . PRO B  1 312 ? 4.729   23.850  69.211  1.00 67.05  ?  312  PRO B CG  1 
ATOM   6576  C  CD  . PRO B  1 312 ? 6.119   24.256  68.825  1.00 67.84  ?  312  PRO B CD  1 
ATOM   6577  N  N   . GLU B  1 313 ? 6.452   21.999  71.723  1.00 77.05  ?  313  GLU B N   1 
ATOM   6578  C  CA  A GLU B  1 313 ? 6.685   20.880  72.628  0.51 72.05  ?  313  GLU B CA  1 
ATOM   6579  C  CA  B GLU B  1 313 ? 6.688   20.880  72.628  0.49 72.05  ?  313  GLU B CA  1 
ATOM   6580  C  C   . GLU B  1 313 ? 7.829   21.172  73.592  1.00 79.23  ?  313  GLU B C   1 
ATOM   6581  O  O   . GLU B  1 313 ? 7.826   20.671  74.721  1.00 80.71  ?  313  GLU B O   1 
ATOM   6582  C  CB  A GLU B  1 313 ? 6.961   19.602  71.832  0.51 71.97  ?  313  GLU B CB  1 
ATOM   6583  C  CB  B GLU B  1 313 ? 6.973   19.603  71.835  0.49 71.91  ?  313  GLU B CB  1 
ATOM   6584  C  CG  A GLU B  1 313 ? 6.686   18.319  72.607  0.51 69.82  ?  313  GLU B CG  1 
ATOM   6585  C  CG  B GLU B  1 313 ? 5.739   18.761  71.525  0.49 69.09  ?  313  GLU B CG  1 
ATOM   6586  C  CD  A GLU B  1 313 ? 7.943   17.520  72.885  0.51 73.68  ?  313  GLU B CD  1 
ATOM   6587  C  CD  B GLU B  1 313 ? 5.066   19.139  70.216  0.49 66.18  ?  313  GLU B CD  1 
ATOM   6588  O  OE1 A GLU B  1 313 ? 8.860   17.544  72.038  0.51 71.87  ?  313  GLU B OE1 1 
ATOM   6589  O  OE1 B GLU B  1 313 ? 5.537   20.081  69.541  0.49 64.20  ?  313  GLU B OE1 1 
ATOM   6590  O  OE2 A GLU B  1 313 ? 8.017   16.875  73.953  0.51 74.73  ?  313  GLU B OE2 1 
ATOM   6591  O  OE2 B GLU B  1 313 ? 4.065   18.481  69.859  0.49 64.51  ?  313  GLU B OE2 1 
ATOM   6592  N  N   . ALA B  1 314 ? 8.816   21.971  73.169  1.00 75.15  ?  314  ALA B N   1 
ATOM   6593  C  CA  . ALA B  1 314 ? 9.887   22.390  74.072  1.00 75.35  ?  314  ALA B CA  1 
ATOM   6594  C  C   . ALA B  1 314 ? 9.482   23.564  74.960  1.00 76.60  ?  314  ALA B C   1 
ATOM   6595  O  O   . ALA B  1 314 ? 9.925   23.641  76.110  1.00 77.48  ?  314  ALA B O   1 
ATOM   6596  C  CB  . ALA B  1 314 ? 11.144  22.758  73.283  1.00 74.58  ?  314  ALA B CB  1 
ATOM   6597  N  N   . LEU B  1 315 ? 8.663   24.488  74.445  1.00 77.23  ?  315  LEU B N   1 
ATOM   6598  C  CA  . LEU B  1 315 ? 8.333   25.698  75.190  1.00 80.75  ?  315  LEU B CA  1 
ATOM   6599  C  C   . LEU B  1 315 ? 7.344   25.446  76.319  1.00 85.75  ?  315  LEU B C   1 
ATOM   6600  O  O   . LEU B  1 315 ? 7.394   26.143  77.339  1.00 91.03  ?  315  LEU B O   1 
ATOM   6601  C  CB  . LEU B  1 315 ? 7.770   26.768  74.251  1.00 77.75  ?  315  LEU B CB  1 
ATOM   6602  C  CG  . LEU B  1 315 ? 8.743   27.385  73.246  1.00 75.38  ?  315  LEU B CG  1 
ATOM   6603  C  CD1 . LEU B  1 315 ? 8.043   28.449  72.415  1.00 74.04  ?  315  LEU B CD1 1 
ATOM   6604  C  CD2 . LEU B  1 315 ? 9.977   27.952  73.942  1.00 78.01  ?  315  LEU B CD2 1 
ATOM   6605  N  N   . ILE B  1 316 ? 6.428   24.489  76.156  1.00 84.70  ?  316  ILE B N   1 
ATOM   6606  C  CA  . ILE B  1 316 ? 5.532   24.163  77.260  1.00 86.85  ?  316  ILE B CA  1 
ATOM   6607  C  C   . ILE B  1 316 ? 6.216   23.282  78.295  1.00 91.48  ?  316  ILE B C   1 
ATOM   6608  O  O   . ILE B  1 316 ? 5.787   23.259  79.457  1.00 94.08  ?  316  ILE B O   1 
ATOM   6609  C  CB  . ILE B  1 316 ? 4.241   23.487  76.769  1.00 81.96  ?  316  ILE B CB  1 
ATOM   6610  C  CG1 . ILE B  1 316 ? 4.532   22.089  76.226  1.00 80.42  ?  316  ILE B CG1 1 
ATOM   6611  C  CG2 . ILE B  1 316 ? 3.561   24.343  75.716  1.00 78.10  ?  316  ILE B CG2 1 
ATOM   6612  C  CD1 . ILE B  1 316 ? 3.300   21.365  75.736  1.00 79.94  ?  316  ILE B CD1 1 
ATOM   6613  N  N   . ASN B  1 317 ? 7.272   22.559  77.907  1.00 93.10  ?  317  ASN B N   1 
ATOM   6614  C  CA  . ASN B  1 317 ? 8.025   21.755  78.863  1.00 98.06  ?  317  ASN B CA  1 
ATOM   6615  C  C   . ASN B  1 317 ? 8.931   22.617  79.740  1.00 104.13 ?  317  ASN B C   1 
ATOM   6616  O  O   . ASN B  1 317 ? 8.982   22.421  80.960  1.00 109.41 ?  317  ASN B O   1 
ATOM   6617  C  CB  . ASN B  1 317 ? 8.848   20.692  78.124  1.00 96.90  ?  317  ASN B CB  1 
ATOM   6618  C  CG  . ASN B  1 317 ? 7.993   19.535  77.622  1.00 97.03  ?  317  ASN B CG  1 
ATOM   6619  O  OD1 . ASN B  1 317 ? 6.948   19.231  78.195  1.00 98.63  ?  317  ASN B OD1 1 
ATOM   6620  N  ND2 . ASN B  1 317 ? 8.443   18.876  76.555  1.00 95.48  ?  317  ASN B ND2 1 
ATOM   6621  N  N   . THR B  1 318 ? 9.650   23.566  79.141  1.00 103.09 ?  318  THR B N   1 
ATOM   6622  C  CA  . THR B  1 318 ? 10.625  24.394  79.840  1.00 104.46 ?  318  THR B CA  1 
ATOM   6623  C  C   . THR B  1 318 ? 10.103  25.767  80.260  1.00 105.90 ?  318  THR B C   1 
ATOM   6624  O  O   . THR B  1 318 ? 10.858  26.532  80.867  1.00 109.75 ?  318  THR B O   1 
ATOM   6625  C  CB  . THR B  1 318 ? 11.873  24.573  78.966  1.00 103.59 ?  318  THR B CB  1 
ATOM   6626  O  OG1 . THR B  1 318 ? 11.595  25.512  77.918  1.00 102.27 ?  318  THR B OG1 1 
ATOM   6627  C  CG2 . THR B  1 318 ? 12.289  23.243  78.347  1.00 100.47 ?  318  THR B CG2 1 
ATOM   6628  N  N   . GLY B  1 319 ? 8.857   26.113  79.947  1.00 103.50 ?  319  GLY B N   1 
ATOM   6629  C  CA  . GLY B  1 319 ? 8.372   27.457  80.218  1.00 105.33 ?  319  GLY B CA  1 
ATOM   6630  C  C   . GLY B  1 319 ? 8.215   27.746  81.704  1.00 109.40 ?  319  GLY B C   1 
ATOM   6631  O  O   . GLY B  1 319 ? 8.358   26.874  82.560  1.00 111.16 ?  319  GLY B O   1 
ATOM   6632  N  N   . ASP B  1 320 ? 7.942   29.014  82.022  1.00 111.88 ?  320  ASP B N   1 
ATOM   6633  C  CA  . ASP B  1 320 ? 7.535   29.401  83.373  1.00 116.01 ?  320  ASP B CA  1 
ATOM   6634  C  C   . ASP B  1 320 ? 6.152   30.036  83.291  1.00 118.52 ?  320  ASP B C   1 
ATOM   6635  O  O   . ASP B  1 320 ? 5.995   31.148  82.774  1.00 121.77 ?  320  ASP B O   1 
ATOM   6636  C  CB  . ASP B  1 320 ? 8.534   30.363  84.014  1.00 118.77 ?  320  ASP B CB  1 
ATOM   6637  C  CG  . ASP B  1 320 ? 8.164   30.707  85.445  1.00 122.57 ?  320  ASP B CG  1 
ATOM   6638  O  OD1 . ASP B  1 320 ? 7.883   29.765  86.213  1.00 122.88 ?  320  ASP B OD1 1 
ATOM   6639  O  OD2 . ASP B  1 320 ? 8.148   31.907  85.798  1.00 125.55 ?  320  ASP B OD2 1 
ATOM   6640  N  N   . PHE B  1 321 ? 5.157   29.311  83.786  1.00 116.43 ?  321  PHE B N   1 
ATOM   6641  C  CA  . PHE B  1 321 ? 3.749   29.680  83.731  1.00 114.21 ?  321  PHE B CA  1 
ATOM   6642  C  C   . PHE B  1 321 ? 3.202   30.283  85.025  1.00 118.47 ?  321  PHE B C   1 
ATOM   6643  O  O   . PHE B  1 321 ? 1.987   30.484  85.125  1.00 118.94 ?  321  PHE B O   1 
ATOM   6644  C  CB  . PHE B  1 321 ? 2.956   28.480  83.234  1.00 108.41 ?  321  PHE B CB  1 
ATOM   6645  C  CG  . PHE B  1 321 ? 3.383   28.054  81.852  1.00 102.15 ?  321  PHE B CG  1 
ATOM   6646  C  CD1 . PHE B  1 321 ? 3.817   29.012  80.942  1.00 100.49 ?  321  PHE B CD1 1 
ATOM   6647  C  CD2 . PHE B  1 321 ? 3.451   26.723  81.489  1.00 97.74  ?  321  PHE B CD2 1 
ATOM   6648  C  CE1 . PHE B  1 321 ? 4.238   28.658  79.677  1.00 95.40  ?  321  PHE B CE1 1 
ATOM   6649  C  CE2 . PHE B  1 321 ? 3.883   26.362  80.220  1.00 92.81  ?  321  PHE B CE2 1 
ATOM   6650  C  CZ  . PHE B  1 321 ? 4.274   27.332  79.316  1.00 91.71  ?  321  PHE B CZ  1 
ATOM   6651  N  N   . GLN B  1 322 ? 4.064   30.570  86.010  1.00 121.65 ?  322  GLN B N   1 
ATOM   6652  C  CA  . GLN B  1 322 ? 3.690   30.733  87.416  1.00 127.11 ?  322  GLN B CA  1 
ATOM   6653  C  C   . GLN B  1 322 ? 2.431   31.558  87.660  1.00 129.58 ?  322  GLN B C   1 
ATOM   6654  O  O   . GLN B  1 322 ? 1.611   31.178  88.503  1.00 131.45 ?  322  GLN B O   1 
ATOM   6655  C  CB  . GLN B  1 322 ? 4.843   31.369  88.194  1.00 133.16 ?  322  GLN B CB  1 
ATOM   6656  C  CG  . GLN B  1 322 ? 5.991   30.432  88.498  1.00 135.49 ?  322  GLN B CG  1 
ATOM   6657  C  CD  . GLN B  1 322 ? 7.036   31.062  89.403  1.00 143.34 ?  322  GLN B CD  1 
ATOM   6658  O  OE1 . GLN B  1 322 ? 6.735   31.968  90.184  1.00 148.66 ?  322  GLN B OE1 1 
ATOM   6659  N  NE2 . GLN B  1 322 ? 8.271   30.583  89.303  1.00 143.90 ?  322  GLN B NE2 1 
ATOM   6660  N  N   . ASP B  1 323 ? 2.243   32.677  86.961  1.00 130.32 ?  323  ASP B N   1 
ATOM   6661  C  CA  . ASP B  1 323 ? 0.926   33.308  86.934  1.00 132.29 ?  323  ASP B CA  1 
ATOM   6662  C  C   . ASP B  1 323 ? 0.378   33.129  85.523  1.00 128.56 ?  323  ASP B C   1 
ATOM   6663  O  O   . ASP B  1 323 ? 0.780   33.835  84.592  1.00 128.65 ?  323  ASP B O   1 
ATOM   6664  C  CB  . ASP B  1 323 ? 1.005   34.786  87.321  1.00 136.52 ?  323  ASP B CB  1 
ATOM   6665  C  CG  . ASP B  1 323 ? 1.622   35.009  88.700  1.00 141.39 ?  323  ASP B CG  1 
ATOM   6666  O  OD1 . ASP B  1 323 ? 1.472   34.138  89.586  1.00 142.31 ?  323  ASP B OD1 1 
ATOM   6667  O  OD2 . ASP B  1 323 ? 2.258   36.068  88.897  1.00 143.99 ?  323  ASP B OD2 1 
ATOM   6668  N  N   . LEU B  1 324 ? -0.556  32.190  85.383  1.00 124.80 ?  324  LEU B N   1 
ATOM   6669  C  CA  . LEU B  1 324 ? -1.388  32.034  84.201  1.00 118.55 ?  324  LEU B CA  1 
ATOM   6670  C  C   . LEU B  1 324 ? -2.652  31.303  84.637  1.00 117.33 ?  324  LEU B C   1 
ATOM   6671  O  O   . LEU B  1 324 ? -2.602  30.447  85.524  1.00 118.63 ?  324  LEU B O   1 
ATOM   6672  C  CB  . LEU B  1 324 ? -0.644  31.273  83.094  1.00 112.01 ?  324  LEU B CB  1 
ATOM   6673  C  CG  . LEU B  1 324 ? -1.286  31.108  81.714  1.00 105.83 ?  324  LEU B CG  1 
ATOM   6674  C  CD1 . LEU B  1 324 ? -1.644  32.463  81.114  1.00 106.52 ?  324  LEU B CD1 1 
ATOM   6675  C  CD2 . LEU B  1 324 ? -0.362  30.322  80.783  1.00 100.02 ?  324  LEU B CD2 1 
ATOM   6676  N  N   . GLN B  1 325 ? -3.776  31.622  83.999  1.00 115.78 ?  325  GLN B N   1 
ATOM   6677  C  CA  . GLN B  1 325 ? -5.037  30.937  84.262  1.00 116.89 ?  325  GLN B CA  1 
ATOM   6678  C  C   . GLN B  1 325 ? -5.617  30.463  82.938  1.00 115.98 ?  325  GLN B C   1 
ATOM   6679  O  O   . GLN B  1 325 ? -5.974  31.282  82.085  1.00 118.34 ?  325  GLN B O   1 
ATOM   6680  C  CB  . GLN B  1 325 ? -6.026  31.841  85.009  1.00 120.99 ?  325  GLN B CB  1 
ATOM   6681  C  CG  . GLN B  1 325 ? -5.526  32.324  86.379  1.00 126.19 ?  325  GLN B CG  1 
ATOM   6682  C  CD  . GLN B  1 325 ? -5.223  33.815  86.419  1.00 129.66 ?  325  GLN B CD  1 
ATOM   6683  O  OE1 . GLN B  1 325 ? -5.992  34.634  85.909  1.00 130.42 ?  325  GLN B OE1 1 
ATOM   6684  N  NE2 . GLN B  1 325 ? -4.091  34.173  87.020  1.00 131.56 ?  325  GLN B NE2 1 
ATOM   6685  N  N   . VAL B  1 326 ? -5.712  29.143  82.772  1.00 112.04 ?  326  VAL B N   1 
ATOM   6686  C  CA  . VAL B  1 326 ? -6.031  28.518  81.493  1.00 104.43 ?  326  VAL B CA  1 
ATOM   6687  C  C   . VAL B  1 326 ? -7.196  27.555  81.669  1.00 103.16 ?  326  VAL B C   1 
ATOM   6688  O  O   . VAL B  1 326 ? -7.231  26.763  82.620  1.00 106.13 ?  326  VAL B O   1 
ATOM   6689  C  CB  . VAL B  1 326 ? -4.811  27.776  80.905  1.00 98.86  ?  326  VAL B CB  1 
ATOM   6690  C  CG1 . VAL B  1 326 ? -5.168  27.123  79.582  1.00 95.37  ?  326  VAL B CG1 1 
ATOM   6691  C  CG2 . VAL B  1 326 ? -3.655  28.728  80.715  1.00 97.67  ?  326  VAL B CG2 1 
ATOM   6692  N  N   . LEU B  1 327 ? -8.148  27.622  80.742  1.00 98.61  ?  327  LEU B N   1 
ATOM   6693  C  CA  . LEU B  1 327 ? -9.217  26.641  80.631  1.00 95.87  ?  327  LEU B CA  1 
ATOM   6694  C  C   . LEU B  1 327 ? -9.025  25.867  79.333  1.00 90.39  ?  327  LEU B C   1 
ATOM   6695  O  O   . LEU B  1 327 ? -8.860  26.472  78.273  1.00 87.98  ?  327  LEU B O   1 
ATOM   6696  C  CB  . LEU B  1 327 ? -10.586 27.326  80.661  1.00 97.63  ?  327  LEU B CB  1 
ATOM   6697  C  CG  . LEU B  1 327 ? -11.810 26.486  80.296  1.00 97.56  ?  327  LEU B CG  1 
ATOM   6698  C  CD1 . LEU B  1 327 ? -11.903 25.255  81.184  1.00 98.87  ?  327  LEU B CD1 1 
ATOM   6699  C  CD2 . LEU B  1 327 ? -13.077 27.323  80.390  1.00 100.59 ?  327  LEU B CD2 1 
ATOM   6700  N  N   . VAL B  1 328 ? -9.017  24.535  79.416  1.00 89.43  ?  328  VAL B N   1 
ATOM   6701  C  CA  . VAL B  1 328 ? -8.859  23.681  78.245  1.00 86.72  ?  328  VAL B CA  1 
ATOM   6702  C  C   . VAL B  1 328 ? -9.907  22.580  78.281  1.00 88.19  ?  328  VAL B C   1 
ATOM   6703  O  O   . VAL B  1 328 ? -10.423 22.209  79.340  1.00 91.86  ?  328  VAL B O   1 
ATOM   6704  C  CB  . VAL B  1 328 ? -7.450  23.050  78.142  1.00 82.39  ?  328  VAL B CB  1 
ATOM   6705  C  CG1 . VAL B  1 328 ? -6.392  24.118  77.936  1.00 81.43  ?  328  VAL B CG1 1 
ATOM   6706  C  CG2 . VAL B  1 328 ? -7.149  22.214  79.377  1.00 83.89  ?  328  VAL B CG2 1 
ATOM   6707  N  N   . GLY B  1 329 ? -10.209 22.040  77.107  1.00 85.22  ?  329  GLY B N   1 
ATOM   6708  C  CA  . GLY B  1 329 ? -11.060 20.863  77.096  1.00 86.24  ?  329  GLY B CA  1 
ATOM   6709  C  C   . GLY B  1 329 ? -11.211 20.295  75.706  1.00 83.95  ?  329  GLY B C   1 
ATOM   6710  O  O   . GLY B  1 329 ? -10.680 20.828  74.726  1.00 82.46  ?  329  GLY B O   1 
ATOM   6711  N  N   . VAL B  1 330 ? -11.953 19.190  75.634  1.00 83.72  ?  330  VAL B N   1 
ATOM   6712  C  CA  . VAL B  1 330 ? -12.195 18.489  74.381  1.00 82.10  ?  330  VAL B CA  1 
ATOM   6713  C  C   . VAL B  1 330 ? -13.684 18.174  74.272  1.00 85.17  ?  330  VAL B C   1 
ATOM   6714  O  O   . VAL B  1 330 ? -14.467 18.477  75.171  1.00 88.80  ?  330  VAL B O   1 
ATOM   6715  C  CB  . VAL B  1 330 ? -11.358 17.199  74.264  1.00 80.08  ?  330  VAL B CB  1 
ATOM   6716  C  CG1 . VAL B  1 330 ? -9.876  17.509  74.412  1.00 78.62  ?  330  VAL B CG1 1 
ATOM   6717  C  CG2 . VAL B  1 330 ? -11.810 16.186  75.300  1.00 82.30  ?  330  VAL B CG2 1 
ATOM   6718  N  N   . VAL B  1 331 ? -14.066 17.552  73.155  1.00 83.49  ?  331  VAL B N   1 
ATOM   6719  C  CA  . VAL B  1 331 ? -15.425 17.046  72.993  1.00 86.24  ?  331  VAL B CA  1 
ATOM   6720  C  C   . VAL B  1 331 ? -15.349 15.527  72.934  1.00 90.12  ?  331  VAL B C   1 
ATOM   6721  O  O   . VAL B  1 331 ? -14.253 14.953  72.954  1.00 90.23  ?  331  VAL B O   1 
ATOM   6722  C  CB  . VAL B  1 331 ? -16.111 17.623  71.742  1.00 83.00  ?  331  VAL B CB  1 
ATOM   6723  C  CG1 . VAL B  1 331 ? -16.024 19.139  71.743  1.00 82.02  ?  331  VAL B CG1 1 
ATOM   6724  C  CG2 . VAL B  1 331 ? -15.498 17.042  70.485  1.00 80.42  ?  331  VAL B CG2 1 
ATOM   6725  N  N   . LYS B  1 332 ? -16.506 14.864  72.846  1.00 94.03  ?  332  LYS B N   1 
ATOM   6726  C  CA  . LYS B  1 332 ? -16.546 13.423  73.077  1.00 95.31  ?  332  LYS B CA  1 
ATOM   6727  C  C   . LYS B  1 332 ? -15.811 12.655  71.984  1.00 90.61  ?  332  LYS B C   1 
ATOM   6728  O  O   . LYS B  1 332 ? -14.850 11.926  72.261  1.00 88.93  ?  332  LYS B O   1 
ATOM   6729  C  CB  . LYS B  1 332 ? -17.997 12.949  73.192  1.00 101.23 ?  332  LYS B CB  1 
ATOM   6730  C  CG  . LYS B  1 332 ? -18.130 11.500  73.645  1.00 104.46 ?  332  LYS B CG  1 
ATOM   6731  C  CD  . LYS B  1 332 ? -19.584 11.051  73.728  1.00 109.27 ?  332  LYS B CD  1 
ATOM   6732  C  CE  . LYS B  1 332 ? -19.706 9.530   73.667  1.00 110.37 ?  332  LYS B CE  1 
ATOM   6733  N  NZ  . LYS B  1 332 ? -19.337 8.989   72.323  1.00 107.98 ?  332  LYS B NZ  1 
ATOM   6734  N  N   . ASP B  1 333 ? -16.229 12.814  70.732  1.00 88.89  ?  333  ASP B N   1 
ATOM   6735  C  CA  . ASP B  1 333 ? -15.556 12.155  69.616  1.00 86.59  ?  333  ASP B CA  1 
ATOM   6736  C  C   . ASP B  1 333 ? -14.955 13.235  68.722  1.00 81.68  ?  333  ASP B C   1 
ATOM   6737  O  O   . ASP B  1 333 ? -15.663 13.867  67.933  1.00 80.56  ?  333  ASP B O   1 
ATOM   6738  C  CB  . ASP B  1 333 ? -16.544 11.265  68.862  1.00 90.19  ?  333  ASP B CB  1 
ATOM   6739  C  CG  . ASP B  1 333 ? -17.495 10.525  69.803  1.00 94.64  ?  333  ASP B CG  1 
ATOM   6740  O  OD1 . ASP B  1 333 ? -18.441 11.160  70.323  1.00 97.06  ?  333  ASP B OD1 1 
ATOM   6741  O  OD2 . ASP B  1 333 ? -17.301 9.307   70.017  1.00 95.01  ?  333  ASP B OD2 1 
ATOM   6742  N  N   . GLU B  1 334 ? -13.637 13.396  68.789  1.00 78.89  ?  334  GLU B N   1 
ATOM   6743  C  CA  . GLU B  1 334 ? -13.010 14.490  68.060  1.00 77.41  ?  334  GLU B CA  1 
ATOM   6744  C  C   . GLU B  1 334 ? -12.830 14.152  66.587  1.00 77.44  ?  334  GLU B C   1 
ATOM   6745  O  O   . GLU B  1 334 ? -13.185 14.948  65.711  1.00 80.64  ?  334  GLU B O   1 
ATOM   6746  C  CB  . GLU B  1 334 ? -11.671 14.853  68.704  1.00 75.63  ?  334  GLU B CB  1 
ATOM   6747  C  CG  . GLU B  1 334 ? -11.806 15.452  70.101  1.00 77.92  ?  334  GLU B CG  1 
ATOM   6748  C  CD  . GLU B  1 334 ? -12.079 16.951  70.078  1.00 78.83  ?  334  GLU B CD  1 
ATOM   6749  O  OE1 . GLU B  1 334 ? -11.972 17.568  68.995  1.00 77.11  ?  334  GLU B OE1 1 
ATOM   6750  O  OE2 . GLU B  1 334 ? -12.404 17.511  71.148  1.00 81.14  ?  334  GLU B OE2 1 
ATOM   6751  N  N   . GLY B  1 335 ? -12.305 12.970  66.294  1.00 75.17  ?  335  GLY B N   1 
ATOM   6752  C  CA  . GLY B  1 335 ? -11.910 12.643  64.943  1.00 72.19  ?  335  GLY B CA  1 
ATOM   6753  C  C   . GLY B  1 335 ? -12.965 11.982  64.089  1.00 72.39  ?  335  GLY B C   1 
ATOM   6754  O  O   . GLY B  1 335 ? -12.622 11.411  63.049  1.00 72.01  ?  335  GLY B O   1 
ATOM   6755  N  N   . SER B  1 336 ? -14.236 12.048  64.485  1.00 73.76  ?  336  SER B N   1 
ATOM   6756  C  CA  . SER B  1 336 ? -15.311 11.368  63.772  1.00 75.55  ?  336  SER B CA  1 
ATOM   6757  C  C   . SER B  1 336 ? -15.375 11.752  62.296  1.00 74.52  ?  336  SER B C   1 
ATOM   6758  O  O   . SER B  1 336 ? -15.013 10.943  61.432  1.00 75.30  ?  336  SER B O   1 
ATOM   6759  C  CB  . SER B  1 336 ? -16.647 11.657  64.460  1.00 80.84  ?  336  SER B CB  1 
ATOM   6760  O  OG  . SER B  1 336 ? -16.851 13.052  64.629  1.00 83.23  ?  336  SER B OG  1 
ATOM   6761  N  N   . TYR B  1 337 ? -15.790 12.987  61.985  1.00 73.10  ?  337  TYR B N   1 
ATOM   6762  C  CA  . TYR B  1 337 ? -16.067 13.314  60.588  1.00 71.52  ?  337  TYR B CA  1 
ATOM   6763  C  C   . TYR B  1 337 ? -14.807 13.396  59.734  1.00 67.51  ?  337  TYR B C   1 
ATOM   6764  O  O   . TYR B  1 337 ? -14.894 13.220  58.511  1.00 66.20  ?  337  TYR B O   1 
ATOM   6765  C  CB  . TYR B  1 337 ? -16.887 14.606  60.470  1.00 72.83  ?  337  TYR B CB  1 
ATOM   6766  C  CG  . TYR B  1 337 ? -16.323 15.872  61.093  1.00 73.18  ?  337  TYR B CG  1 
ATOM   6767  C  CD1 . TYR B  1 337 ? -15.124 16.429  60.661  1.00 70.00  ?  337  TYR B CD1 1 
ATOM   6768  C  CD2 . TYR B  1 337 ? -17.051 16.567  62.053  1.00 76.67  ?  337  TYR B CD2 1 
ATOM   6769  C  CE1 . TYR B  1 337 ? -14.636 17.606  61.219  1.00 68.54  ?  337  TYR B CE1 1 
ATOM   6770  C  CE2 . TYR B  1 337 ? -16.575 17.748  62.609  1.00 74.94  ?  337  TYR B CE2 1 
ATOM   6771  C  CZ  . TYR B  1 337 ? -15.369 18.261  62.188  1.00 70.37  ?  337  TYR B CZ  1 
ATOM   6772  O  OH  . TYR B  1 337 ? -14.893 19.430  62.740  1.00 66.45  ?  337  TYR B OH  1 
ATOM   6773  N  N   . PHE B  1 338 ? -13.638 13.608  60.343  1.00 65.31  ?  338  PHE B N   1 
ATOM   6774  C  CA  . PHE B  1 338 ? -12.399 13.530  59.579  1.00 62.61  ?  338  PHE B CA  1 
ATOM   6775  C  C   . PHE B  1 338 ? -12.315 12.217  58.810  1.00 62.84  ?  338  PHE B C   1 
ATOM   6776  O  O   . PHE B  1 338 ? -11.759 12.174  57.705  1.00 61.24  ?  338  PHE B O   1 
ATOM   6777  C  CB  . PHE B  1 338 ? -11.194 13.672  60.512  1.00 62.25  ?  338  PHE B CB  1 
ATOM   6778  C  CG  . PHE B  1 338 ? -11.097 15.015  61.171  1.00 65.23  ?  338  PHE B CG  1 
ATOM   6779  C  CD1 . PHE B  1 338 ? -10.470 16.074  60.532  1.00 67.42  ?  338  PHE B CD1 1 
ATOM   6780  C  CD2 . PHE B  1 338 ? -11.618 15.216  62.439  1.00 67.89  ?  338  PHE B CD2 1 
ATOM   6781  C  CE1 . PHE B  1 338 ? -10.385 17.318  61.140  1.00 70.26  ?  338  PHE B CE1 1 
ATOM   6782  C  CE2 . PHE B  1 338 ? -11.532 16.452  63.054  1.00 71.07  ?  338  PHE B CE2 1 
ATOM   6783  C  CZ  . PHE B  1 338 ? -10.917 17.506  62.404  1.00 71.97  ?  338  PHE B CZ  1 
ATOM   6784  N  N   . LEU B  1 339 ? -12.910 11.148  59.354  1.00 64.78  ?  339  LEU B N   1 
ATOM   6785  C  CA  . LEU B  1 339 ? -12.809 9.841   58.714  1.00 65.29  ?  339  LEU B CA  1 
ATOM   6786  C  C   . LEU B  1 339 ? -13.465 9.816   57.339  1.00 68.43  ?  339  LEU B C   1 
ATOM   6787  O  O   . LEU B  1 339 ? -13.017 9.068   56.462  1.00 70.16  ?  339  LEU B O   1 
ATOM   6788  C  CB  . LEU B  1 339 ? -13.420 8.767   59.612  1.00 66.05  ?  339  LEU B CB  1 
ATOM   6789  C  CG  . LEU B  1 339 ? -12.757 8.656   60.985  1.00 65.19  ?  339  LEU B CG  1 
ATOM   6790  C  CD1 . LEU B  1 339 ? -13.374 7.536   61.806  1.00 67.63  ?  339  LEU B CD1 1 
ATOM   6791  C  CD2 . LEU B  1 339 ? -11.257 8.468   60.840  1.00 62.15  ?  339  LEU B CD2 1 
ATOM   6792  N  N   . VAL B  1 340 ? -14.504 10.633  57.111  1.00 69.78  ?  340  VAL B N   1 
ATOM   6793  C  CA  . VAL B  1 340 ? -15.176 10.618  55.809  1.00 70.94  ?  340  VAL B CA  1 
ATOM   6794  C  C   . VAL B  1 340 ? -14.431 11.454  54.786  1.00 68.77  ?  340  VAL B C   1 
ATOM   6795  O  O   . VAL B  1 340 ? -14.851 11.536  53.625  1.00 67.19  ?  340  VAL B O   1 
ATOM   6796  C  CB  . VAL B  1 340 ? -16.635 11.107  55.897  1.00 74.34  ?  340  VAL B CB  1 
ATOM   6797  C  CG1 . VAL B  1 340 ? -17.380 10.362  56.997  1.00 75.79  ?  340  VAL B CG1 1 
ATOM   6798  C  CG2 . VAL B  1 340 ? -16.697 12.615  56.094  1.00 74.83  ?  340  VAL B CG2 1 
ATOM   6799  N  N   . TYR B  1 341 ? -13.315 12.049  55.188  1.00 69.54  ?  341  TYR B N   1 
ATOM   6800  C  CA  . TYR B  1 341 ? -12.484 12.925  54.382  1.00 69.32  ?  341  TYR B CA  1 
ATOM   6801  C  C   . TYR B  1 341 ? -11.416 12.159  53.601  1.00 67.81  ?  341  TYR B C   1 
ATOM   6802  O  O   . TYR B  1 341 ? -10.423 12.759  53.175  1.00 66.28  ?  341  TYR B O   1 
ATOM   6803  C  CB  . TYR B  1 341 ? -11.926 14.066  55.231  1.00 70.22  ?  341  TYR B CB  1 
ATOM   6804  C  CG  . TYR B  1 341 ? -12.959 15.180  55.294  1.00 73.28  ?  341  TYR B CG  1 
ATOM   6805  C  CD1 . TYR B  1 341 ? -13.029 16.145  54.294  1.00 73.09  ?  341  TYR B CD1 1 
ATOM   6806  C  CD2 . TYR B  1 341 ? -13.911 15.223  56.310  1.00 75.45  ?  341  TYR B CD2 1 
ATOM   6807  C  CE1 . TYR B  1 341 ? -13.989 17.145  54.326  1.00 74.56  ?  341  TYR B CE1 1 
ATOM   6808  C  CE2 . TYR B  1 341 ? -14.874 16.219  56.349  1.00 76.86  ?  341  TYR B CE2 1 
ATOM   6809  C  CZ  . TYR B  1 341 ? -14.908 17.177  55.355  1.00 76.64  ?  341  TYR B CZ  1 
ATOM   6810  O  OH  . TYR B  1 341 ? -15.866 18.167  55.396  1.00 78.37  ?  341  TYR B OH  1 
ATOM   6811  N  N   . GLY B  1 342 ? -11.585 10.850  53.440  1.00 68.84  ?  342  GLY B N   1 
ATOM   6812  C  CA  . GLY B  1 342 ? -10.608 10.001  52.798  1.00 68.39  ?  342  GLY B CA  1 
ATOM   6813  C  C   . GLY B  1 342 ? -9.884  8.921   53.588  1.00 67.91  ?  342  GLY B C   1 
ATOM   6814  O  O   . GLY B  1 342 ? -8.827  8.461   53.132  1.00 67.46  ?  342  GLY B O   1 
ATOM   6815  N  N   . VAL B  1 343 ? -10.393 8.519   54.748  1.00 68.47  ?  343  VAL B N   1 
ATOM   6816  C  CA  . VAL B  1 343 ? -10.176 7.136   55.185  1.00 67.76  ?  343  VAL B CA  1 
ATOM   6817  C  C   . VAL B  1 343 ? -11.209 6.254   54.488  1.00 70.82  ?  343  VAL B C   1 
ATOM   6818  O  O   . VAL B  1 343 ? -12.407 6.345   54.800  1.00 75.59  ?  343  VAL B O   1 
ATOM   6819  C  CB  . VAL B  1 343 ? -10.271 6.984   56.709  1.00 64.69  ?  343  VAL B CB  1 
ATOM   6820  C  CG1 . VAL B  1 343 ? -10.213 5.513   57.083  1.00 63.98  ?  343  VAL B CG1 1 
ATOM   6821  C  CG2 . VAL B  1 343 ? -9.139  7.731   57.380  1.00 61.76  ?  343  VAL B CG2 1 
ATOM   6822  N  N   . PRO B  1 344 ? -10.798 5.377   53.567  1.00 67.12  ?  344  PRO B N   1 
ATOM   6823  C  CA  . PRO B  1 344 ? -11.776 4.663   52.732  1.00 68.14  ?  344  PRO B CA  1 
ATOM   6824  C  C   . PRO B  1 344 ? -12.647 3.715   53.542  1.00 70.96  ?  344  PRO B C   1 
ATOM   6825  O  O   . PRO B  1 344 ? -12.180 3.047   54.467  1.00 70.78  ?  344  PRO B O   1 
ATOM   6826  C  CB  . PRO B  1 344 ? -10.897 3.900   51.735  1.00 66.58  ?  344  PRO B CB  1 
ATOM   6827  C  CG  . PRO B  1 344 ? -9.584  3.752   52.431  1.00 64.83  ?  344  PRO B CG  1 
ATOM   6828  C  CD  . PRO B  1 344 ? -9.413  5.008   53.233  1.00 63.35  ?  344  PRO B CD  1 
ATOM   6829  N  N   . GLY B  1 345 ? -13.927 3.660   53.174  1.00 73.85  ?  345  GLY B N   1 
ATOM   6830  C  CA  . GLY B  1 345 ? -14.927 2.918   53.910  1.00 76.70  ?  345  GLY B CA  1 
ATOM   6831  C  C   . GLY B  1 345 ? -15.825 3.768   54.785  1.00 78.78  ?  345  GLY B C   1 
ATOM   6832  O  O   . GLY B  1 345 ? -16.843 3.260   55.275  1.00 82.14  ?  345  GLY B O   1 
ATOM   6833  N  N   . PHE B  1 346 ? -15.487 5.042   54.987  1.00 77.31  ?  346  PHE B N   1 
ATOM   6834  C  CA  . PHE B  1 346 ? -16.213 5.933   55.886  1.00 78.41  ?  346  PHE B CA  1 
ATOM   6835  C  C   . PHE B  1 346 ? -16.997 6.959   55.079  1.00 81.29  ?  346  PHE B C   1 
ATOM   6836  O  O   . PHE B  1 346 ? -16.423 7.682   54.256  1.00 80.96  ?  346  PHE B O   1 
ATOM   6837  C  CB  . PHE B  1 346 ? -15.256 6.637   56.845  1.00 75.35  ?  346  PHE B CB  1 
ATOM   6838  C  CG  . PHE B  1 346 ? -14.684 5.736   57.890  1.00 76.13  ?  346  PHE B CG  1 
ATOM   6839  C  CD1 . PHE B  1 346 ? -13.588 4.941   57.611  1.00 76.16  ?  346  PHE B CD1 1 
ATOM   6840  C  CD2 . PHE B  1 346 ? -15.251 5.674   59.151  1.00 78.06  ?  346  PHE B CD2 1 
ATOM   6841  C  CE1 . PHE B  1 346 ? -13.057 4.104   58.574  1.00 77.60  ?  346  PHE B CE1 1 
ATOM   6842  C  CE2 . PHE B  1 346 ? -14.728 4.837   60.115  1.00 79.76  ?  346  PHE B CE2 1 
ATOM   6843  C  CZ  . PHE B  1 346 ? -13.628 4.052   59.828  1.00 79.20  ?  346  PHE B CZ  1 
ATOM   6844  N  N   . SER B  1 347 ? -18.302 7.026   55.325  1.00 84.47  ?  347  SER B N   1 
ATOM   6845  C  CA  . SER B  1 347 ? -19.157 8.026   54.707  1.00 86.34  ?  347  SER B CA  1 
ATOM   6846  C  C   . SER B  1 347 ? -20.229 8.409   55.714  1.00 89.21  ?  347  SER B C   1 
ATOM   6847  O  O   . SER B  1 347 ? -20.583 7.616   56.589  1.00 92.56  ?  347  SER B O   1 
ATOM   6848  C  CB  . SER B  1 347 ? -19.786 7.509   53.408  1.00 88.57  ?  347  SER B CB  1 
ATOM   6849  O  OG  . SER B  1 347 ? -20.671 8.464   52.848  1.00 90.38  ?  347  SER B OG  1 
ATOM   6850  N  N   . LYS B  1 348 ? -20.735 9.637   55.596  1.00 88.08  ?  348  LYS B N   1 
ATOM   6851  C  CA  . LYS B  1 348 ? -21.774 10.081  56.516  1.00 89.08  ?  348  LYS B CA  1 
ATOM   6852  C  C   . LYS B  1 348 ? -23.122 9.441   56.220  1.00 93.47  ?  348  LYS B C   1 
ATOM   6853  O  O   . LYS B  1 348 ? -24.010 9.476   57.078  1.00 96.89  ?  348  LYS B O   1 
ATOM   6854  C  CB  . LYS B  1 348 ? -21.912 11.604  56.476  1.00 88.31  ?  348  LYS B CB  1 
ATOM   6855  C  CG  . LYS B  1 348 ? -22.584 12.141  55.216  1.00 90.98  ?  348  LYS B CG  1 
ATOM   6856  C  CD  . LYS B  1 348 ? -23.021 13.589  55.403  1.00 92.76  ?  348  LYS B CD  1 
ATOM   6857  C  CE  . LYS B  1 348 ? -23.810 14.100  54.207  1.00 95.30  ?  348  LYS B CE  1 
ATOM   6858  N  NZ  . LYS B  1 348 ? -25.019 13.273  53.956  1.00 99.65  ?  348  LYS B NZ  1 
ATOM   6859  N  N   . ASP B  1 349 ? -23.302 8.868   55.030  1.00 94.52  ?  349  ASP B N   1 
ATOM   6860  C  CA  . ASP B  1 349 ? -24.601 8.366   54.602  1.00 99.20  ?  349  ASP B CA  1 
ATOM   6861  C  C   . ASP B  1 349 ? -24.799 6.875   54.854  1.00 101.31 ?  349  ASP B C   1 
ATOM   6862  O  O   . ASP B  1 349 ? -25.903 6.368   54.627  1.00 105.86 ?  349  ASP B O   1 
ATOM   6863  C  CB  . ASP B  1 349 ? -24.808 8.678   53.116  1.00 99.92  ?  349  ASP B CB  1 
ATOM   6864  C  CG  . ASP B  1 349 ? -24.725 10.166  52.819  1.00 98.25  ?  349  ASP B CG  1 
ATOM   6865  O  OD1 . ASP B  1 349 ? -25.401 10.951  53.517  1.00 99.85  ?  349  ASP B OD1 1 
ATOM   6866  O  OD2 . ASP B  1 349 ? -23.968 10.550  51.900  1.00 95.32  ?  349  ASP B OD2 1 
ATOM   6867  N  N   . ASN B  1 350 ? -23.781 6.165   55.332  1.00 98.46  ?  350  ASN B N   1 
ATOM   6868  C  CA  . ASN B  1 350 ? -23.943 4.796   55.805  1.00 100.50 ?  350  ASN B CA  1 
ATOM   6869  C  C   . ASN B  1 350 ? -23.258 4.667   57.159  1.00 97.93  ?  350  ASN B C   1 
ATOM   6870  O  O   . ASN B  1 350 ? -22.525 5.558   57.596  1.00 94.79  ?  350  ASN B O   1 
ATOM   6871  C  CB  . ASN B  1 350 ? -23.425 3.749   54.791  1.00 102.19 ?  350  ASN B CB  1 
ATOM   6872  C  CG  . ASN B  1 350 ? -21.993 4.003   54.319  1.00 101.42 ?  350  ASN B CG  1 
ATOM   6873  O  OD1 . ASN B  1 350 ? -21.215 4.696   54.973  1.00 98.43  ?  350  ASN B OD1 1 
ATOM   6874  N  ND2 . ASN B  1 350 ? -21.645 3.420   53.160  1.00 105.13 ?  350  ASN B ND2 1 
ATOM   6875  N  N   . GLU B  1 351 ? -23.521 3.553   57.841  1.00 99.94  ?  351  GLU B N   1 
ATOM   6876  C  CA  . GLU B  1 351 ? -23.063 3.401   59.218  1.00 99.30  ?  351  GLU B CA  1 
ATOM   6877  C  C   . GLU B  1 351 ? -21.554 3.236   59.331  1.00 95.70  ?  351  GLU B C   1 
ATOM   6878  O  O   . GLU B  1 351 ? -21.044 3.164   60.457  1.00 95.91  ?  351  GLU B O   1 
ATOM   6879  C  CB  . GLU B  1 351 ? -23.773 2.224   59.887  1.00 102.99 ?  351  GLU B CB  1 
ATOM   6880  C  CG  . GLU B  1 351 ? -25.243 2.485   60.172  1.00 108.13 ?  351  GLU B CG  1 
ATOM   6881  C  CD  . GLU B  1 351 ? -25.799 1.547   61.225  1.00 112.73 ?  351  GLU B CD  1 
ATOM   6882  O  OE1 . GLU B  1 351 ? -24.991 0.966   61.983  1.00 111.79 ?  351  GLU B OE1 1 
ATOM   6883  O  OE2 . GLU B  1 351 ? -27.038 1.395   61.300  1.00 117.16 ?  351  GLU B OE2 1 
ATOM   6884  N  N   . SER B  1 352 ? -20.845 3.146   58.204  1.00 92.67  ?  352  SER B N   1 
ATOM   6885  C  CA  . SER B  1 352 ? -19.381 3.138   58.181  1.00 87.89  ?  352  SER B CA  1 
ATOM   6886  C  C   . SER B  1 352 ? -18.820 1.925   58.919  1.00 89.47  ?  352  SER B C   1 
ATOM   6887  O  O   . SER B  1 352 ? -17.838 2.020   59.658  1.00 88.34  ?  352  SER B O   1 
ATOM   6888  C  CB  . SER B  1 352 ? -18.809 4.438   58.754  1.00 82.16  ?  352  SER B CB  1 
ATOM   6889  O  OG  . SER B  1 352 ? -19.250 5.565   58.017  1.00 79.92  ?  352  SER B OG  1 
ATOM   6890  N  N   . LEU B  1 353 ? -19.452 0.772   58.723  1.00 91.55  ?  353  LEU B N   1 
ATOM   6891  C  CA  . LEU B  1 353 ? -18.921 -0.471  59.262  1.00 89.72  ?  353  LEU B CA  1 
ATOM   6892  C  C   . LEU B  1 353 ? -17.749 -0.900  58.393  1.00 86.91  ?  353  LEU B C   1 
ATOM   6893  O  O   . LEU B  1 353 ? -17.897 -1.070  57.177  1.00 87.33  ?  353  LEU B O   1 
ATOM   6894  C  CB  . LEU B  1 353 ? -20.005 -1.545  59.301  1.00 92.24  ?  353  LEU B CB  1 
ATOM   6895  C  CG  . LEU B  1 353 ? -21.320 -1.091  59.936  1.00 93.38  ?  353  LEU B CG  1 
ATOM   6896  C  CD1 . LEU B  1 353 ? -22.370 -2.184  59.836  1.00 97.27  ?  353  LEU B CD1 1 
ATOM   6897  C  CD2 . LEU B  1 353 ? -21.110 -0.662  61.381  1.00 91.68  ?  353  LEU B CD2 1 
ATOM   6898  N  N   . ILE B  1 354 ? -16.582 -1.060  59.005  1.00 84.29  ?  354  ILE B N   1 
ATOM   6899  C  CA  . ILE B  1 354 ? -15.353 -1.278  58.257  1.00 81.70  ?  354  ILE B CA  1 
ATOM   6900  C  C   . ILE B  1 354 ? -14.775 -2.640  58.611  1.00 81.49  ?  354  ILE B C   1 
ATOM   6901  O  O   . ILE B  1 354 ? -14.995 -3.172  59.704  1.00 81.75  ?  354  ILE B O   1 
ATOM   6902  C  CB  . ILE B  1 354 ? -14.317 -0.160  58.515  1.00 78.01  ?  354  ILE B CB  1 
ATOM   6903  C  CG1 . ILE B  1 354 ? -14.020 -0.030  60.011  1.00 77.16  ?  354  ILE B CG1 1 
ATOM   6904  C  CG2 . ILE B  1 354 ? -14.822 1.160   57.965  1.00 76.96  ?  354  ILE B CG2 1 
ATOM   6905  C  CD1 . ILE B  1 354 ? -12.702 0.654   60.320  1.00 73.37  ?  354  ILE B CD1 1 
ATOM   6906  N  N   . SER B  1 355 ? -14.027 -3.202  57.666  1.00 81.60  ?  355  SER B N   1 
ATOM   6907  C  CA  . SER B  1 355 ? -13.313 -4.446  57.896  1.00 83.88  ?  355  SER B CA  1 
ATOM   6908  C  C   . SER B  1 355 ? -12.047 -4.170  58.702  1.00 84.17  ?  355  SER B C   1 
ATOM   6909  O  O   . SER B  1 355 ? -11.732 -3.029  59.049  1.00 84.10  ?  355  SER B O   1 
ATOM   6910  C  CB  . SER B  1 355 ? -12.982 -5.121  56.567  1.00 83.83  ?  355  SER B CB  1 
ATOM   6911  O  OG  . SER B  1 355 ? -12.143 -4.299  55.773  1.00 80.40  ?  355  SER B OG  1 
ATOM   6912  N  N   . ARG B  1 356 ? -11.301 -5.231  59.004  1.00 84.99  ?  356  ARG B N   1 
ATOM   6913  C  CA  . ARG B  1 356 ? -10.044 -5.046  59.718  1.00 82.65  ?  356  ARG B CA  1 
ATOM   6914  C  C   . ARG B  1 356 ? -8.977  -4.452  58.806  1.00 79.68  ?  356  ARG B C   1 
ATOM   6915  O  O   . ARG B  1 356 ? -8.158  -3.638  59.250  1.00 76.64  ?  356  ARG B O   1 
ATOM   6916  C  CB  . ARG B  1 356 ? -9.575  -6.374  60.313  1.00 85.24  ?  356  ARG B CB  1 
ATOM   6917  C  CG  . ARG B  1 356 ? -8.253  -6.276  61.051  1.00 83.45  ?  356  ARG B CG  1 
ATOM   6918  C  CD  . ARG B  1 356 ? -8.154  -7.297  62.171  1.00 84.75  ?  356  ARG B CD  1 
ATOM   6919  N  NE  . ARG B  1 356 ? -6.998  -7.022  63.015  1.00 82.85  ?  356  ARG B NE  1 
ATOM   6920  C  CZ  . ARG B  1 356 ? -7.012  -6.165  64.033  1.00 81.04  ?  356  ARG B CZ  1 
ATOM   6921  N  NH1 . ARG B  1 356 ? -8.122  -5.501  64.326  1.00 80.57  ?  356  ARG B NH1 1 
ATOM   6922  N  NH2 . ARG B  1 356 ? -5.915  -5.966  64.754  1.00 79.72  ?  356  ARG B NH2 1 
ATOM   6923  N  N   . ALA B  1 357 ? -8.972  -4.840  57.526  1.00 80.86  ?  357  ALA B N   1 
ATOM   6924  C  CA  . ALA B  1 357 ? -8.022  -4.257  56.582  1.00 79.03  ?  357  ALA B CA  1 
ATOM   6925  C  C   . ALA B  1 357 ? -8.295  -2.774  56.378  1.00 78.33  ?  357  ALA B C   1 
ATOM   6926  O  O   . ALA B  1 357 ? -7.362  -1.956  56.353  1.00 79.16  ?  357  ALA B O   1 
ATOM   6927  C  CB  . ALA B  1 357 ? -8.077  -5.004  55.251  1.00 80.03  ?  357  ALA B CB  1 
ATOM   6928  N  N   . GLN B  1 358 ? -9.572  -2.407  56.230  1.00 77.03  ?  358  GLN B N   1 
ATOM   6929  C  CA  . GLN B  1 358 ? -9.940  -0.996  56.206  1.00 74.16  ?  358  GLN B CA  1 
ATOM   6930  C  C   . GLN B  1 358 ? -9.469  -0.277  57.461  1.00 72.44  ?  358  GLN B C   1 
ATOM   6931  O  O   . GLN B  1 358 ? -9.083  0.894   57.396  1.00 71.76  ?  358  GLN B O   1 
ATOM   6932  C  CB  . GLN B  1 358 ? -11.451 -0.845  56.037  1.00 75.67  ?  358  GLN B CB  1 
ATOM   6933  C  CG  . GLN B  1 358 ? -11.918 -0.964  54.596  1.00 79.04  ?  358  GLN B CG  1 
ATOM   6934  C  CD  . GLN B  1 358 ? -13.428 -1.010  54.469  1.00 84.37  ?  358  GLN B CD  1 
ATOM   6935  O  OE1 . GLN B  1 358 ? -14.122 -1.487  55.366  1.00 86.95  ?  358  GLN B OE1 1 
ATOM   6936  N  NE2 . GLN B  1 358 ? -13.947 -0.487  53.361  1.00 85.58  ?  358  GLN B NE2 1 
ATOM   6937  N  N   . PHE B  1 359 ? -9.476  -0.960  58.608  1.00 72.09  ?  359  PHE B N   1 
ATOM   6938  C  CA  . PHE B  1 359 ? -9.010  -0.323  59.835  1.00 68.88  ?  359  PHE B CA  1 
ATOM   6939  C  C   . PHE B  1 359 ? -7.500  -0.128  59.820  1.00 66.05  ?  359  PHE B C   1 
ATOM   6940  O  O   . PHE B  1 359 ? -7.003  0.897   60.293  1.00 66.13  ?  359  PHE B O   1 
ATOM   6941  C  CB  . PHE B  1 359 ? -9.427  -1.140  61.056  1.00 70.02  ?  359  PHE B CB  1 
ATOM   6942  C  CG  . PHE B  1 359 ? -8.843  -0.635  62.348  1.00 68.59  ?  359  PHE B CG  1 
ATOM   6943  C  CD1 . PHE B  1 359 ? -9.307  0.541   62.921  1.00 67.81  ?  359  PHE B CD1 1 
ATOM   6944  C  CD2 . PHE B  1 359 ? -7.830  -1.331  62.991  1.00 68.08  ?  359  PHE B CD2 1 
ATOM   6945  C  CE1 . PHE B  1 359 ? -8.772  1.013   64.111  1.00 66.25  ?  359  PHE B CE1 1 
ATOM   6946  C  CE2 . PHE B  1 359 ? -7.292  -0.864  64.181  1.00 66.78  ?  359  PHE B CE2 1 
ATOM   6947  C  CZ  . PHE B  1 359 ? -7.764  0.309   64.741  1.00 65.76  ?  359  PHE B CZ  1 
ATOM   6948  N  N   . LEU B  1 360 ? -6.754  -1.097  59.286  1.00 64.72  ?  360  LEU B N   1 
ATOM   6949  C  CA  . LEU B  1 360 ? -5.300  -0.970  59.227  1.00 62.90  ?  360  LEU B CA  1 
ATOM   6950  C  C   . LEU B  1 360 ? -4.882  0.161   58.291  1.00 62.35  ?  360  LEU B C   1 
ATOM   6951  O  O   . LEU B  1 360 ? -4.079  1.031   58.666  1.00 62.50  ?  360  LEU B O   1 
ATOM   6952  C  CB  . LEU B  1 360 ? -4.684  -2.298  58.788  1.00 64.89  ?  360  LEU B CB  1 
ATOM   6953  C  CG  . LEU B  1 360 ? -4.886  -3.473  59.748  1.00 67.91  ?  360  LEU B CG  1 
ATOM   6954  C  CD1 . LEU B  1 360 ? -4.743  -4.802  59.026  1.00 70.95  ?  360  LEU B CD1 1 
ATOM   6955  C  CD2 . LEU B  1 360 ? -3.889  -3.390  60.886  1.00 66.83  ?  360  LEU B CD2 1 
ATOM   6956  N  N   . ALA B  1 361 ? -5.423  0.169   57.065  1.00 62.57  ?  361  ALA B N   1 
ATOM   6957  C  CA  . ALA B  1 361 ? -5.153  1.279   56.155  1.00 61.15  ?  361  ALA B CA  1 
ATOM   6958  C  C   . ALA B  1 361 ? -5.596  2.603   56.763  1.00 61.06  ?  361  ALA B C   1 
ATOM   6959  O  O   . ALA B  1 361 ? -4.891  3.617   56.656  1.00 60.02  ?  361  ALA B O   1 
ATOM   6960  C  CB  . ALA B  1 361 ? -5.849  1.048   54.816  1.00 61.46  ?  361  ALA B CB  1 
ATOM   6961  N  N   . GLY B  1 362 ? -6.756  2.604   57.423  1.00 62.09  ?  362  GLY B N   1 
ATOM   6962  C  CA  . GLY B  1 362 ? -7.245  3.821   58.046  1.00 60.88  ?  362  GLY B CA  1 
ATOM   6963  C  C   . GLY B  1 362 ? -6.312  4.343   59.119  1.00 59.00  ?  362  GLY B C   1 
ATOM   6964  O  O   . GLY B  1 362 ? -6.115  5.550   59.245  1.00 57.94  ?  362  GLY B O   1 
ATOM   6965  N  N   . VAL B  1 363 ? -5.728  3.442   59.910  1.00 59.78  ?  363  VAL B N   1 
ATOM   6966  C  CA  . VAL B  1 363 ? -4.692  3.854   60.853  1.00 60.13  ?  363  VAL B CA  1 
ATOM   6967  C  C   . VAL B  1 363 ? -3.521  4.485   60.113  1.00 60.87  ?  363  VAL B C   1 
ATOM   6968  O  O   . VAL B  1 363 ? -2.978  5.511   60.545  1.00 61.42  ?  363  VAL B O   1 
ATOM   6969  C  CB  . VAL B  1 363 ? -4.236  2.664   61.719  1.00 59.38  ?  363  VAL B CB  1 
ATOM   6970  C  CG1 . VAL B  1 363 ? -2.991  3.037   62.509  1.00 55.00  ?  363  VAL B CG1 1 
ATOM   6971  C  CG2 . VAL B  1 363 ? -5.353  2.235   62.666  1.00 57.86  ?  363  VAL B CG2 1 
ATOM   6972  N  N   . ARG B  1 364 ? -3.122  3.895   58.978  1.00 60.13  ?  364  ARG B N   1 
ATOM   6973  C  CA  . ARG B  1 364 ? -1.986  4.448   58.240  1.00 56.36  ?  364  ARG B CA  1 
ATOM   6974  C  C   . ARG B  1 364 ? -2.286  5.845   57.697  1.00 55.48  ?  364  ARG B C   1 
ATOM   6975  O  O   . ARG B  1 364 ? -1.370  6.667   57.572  1.00 54.43  ?  364  ARG B O   1 
ATOM   6976  C  CB  . ARG B  1 364 ? -1.580  3.485   57.121  1.00 56.16  ?  364  ARG B CB  1 
ATOM   6977  C  CG  . ARG B  1 364 ? -1.199  2.104   57.666  1.00 62.15  ?  364  ARG B CG  1 
ATOM   6978  C  CD  . ARG B  1 364 ? 0.255   1.812   57.535  1.00 61.92  ?  364  ARG B CD  1 
ATOM   6979  N  NE  . ARG B  1 364 ? 1.061   2.849   58.147  1.00 60.51  ?  364  ARG B NE  1 
ATOM   6980  C  CZ  . ARG B  1 364 ? 2.376   2.796   58.222  1.00 61.06  ?  364  ARG B CZ  1 
ATOM   6981  N  NH1 . ARG B  1 364 ? 2.986   1.718   57.769  1.00 60.97  ?  364  ARG B NH1 1 
ATOM   6982  N  NH2 . ARG B  1 364 ? 3.060   3.776   58.769  1.00 61.20  ?  364  ARG B NH2 1 
ATOM   6983  N  N   . ILE B  1 365 ? -3.550  6.135   57.378  1.00 56.06  ?  365  ILE B N   1 
ATOM   6984  C  CA  . ILE B  1 365 ? -3.910  7.474   56.917  1.00 55.65  ?  365  ILE B CA  1 
ATOM   6985  C  C   . ILE B  1 365 ? -4.059  8.438   58.086  1.00 61.13  ?  365  ILE B C   1 
ATOM   6986  O  O   . ILE B  1 365 ? -3.595  9.582   58.023  1.00 63.26  ?  365  ILE B O   1 
ATOM   6987  C  CB  . ILE B  1 365 ? -5.191  7.414   56.069  1.00 54.34  ?  365  ILE B CB  1 
ATOM   6988  C  CG1 . ILE B  1 365 ? -4.896  6.700   54.752  1.00 54.82  ?  365  ILE B CG1 1 
ATOM   6989  C  CG2 . ILE B  1 365 ? -5.762  8.813   55.834  1.00 52.62  ?  365  ILE B CG2 1 
ATOM   6990  C  CD1 . ILE B  1 365 ? -6.116  6.359   53.957  1.00 57.64  ?  365  ILE B CD1 1 
ATOM   6991  N  N   . GLY B  1 366 ? -4.704  7.997   59.169  1.00 62.91  ?  366  GLY B N   1 
ATOM   6992  C  CA  . GLY B  1 366 ? -4.983  8.865   60.299  1.00 60.52  ?  366  GLY B CA  1 
ATOM   6993  C  C   . GLY B  1 366 ? -3.776  9.146   61.163  1.00 55.36  ?  366  GLY B C   1 
ATOM   6994  O  O   . GLY B  1 366 ? -3.770  10.138  61.897  1.00 55.47  ?  366  GLY B O   1 
ATOM   6995  N  N   . VAL B  1 367 ? -2.759  8.294   61.097  1.00 52.27  ?  367  VAL B N   1 
ATOM   6996  C  CA  . VAL B  1 367 ? -1.479  8.564   61.743  1.00 52.04  ?  367  VAL B CA  1 
ATOM   6997  C  C   . VAL B  1 367 ? -0.431  8.599   60.636  1.00 51.04  ?  367  VAL B C   1 
ATOM   6998  O  O   . VAL B  1 367 ? 0.387   7.675   60.516  1.00 49.58  ?  367  VAL B O   1 
ATOM   6999  C  CB  . VAL B  1 367 ? -1.154  7.513   62.815  1.00 51.07  ?  367  VAL B CB  1 
ATOM   7000  C  CG1 . VAL B  1 367 ? -0.138  8.059   63.782  1.00 50.83  ?  367  VAL B CG1 1 
ATOM   7001  C  CG2 . VAL B  1 367 ? -2.415  7.090   63.543  1.00 52.35  ?  367  VAL B CG2 1 
ATOM   7002  N  N   . PRO B  1 368 ? -0.415  9.653   59.813  1.00 49.69  ?  368  PRO B N   1 
ATOM   7003  C  CA  . PRO B  1 368 ? 0.424   9.633   58.604  1.00 50.53  ?  368  PRO B CA  1 
ATOM   7004  C  C   . PRO B  1 368 ? 1.913   9.673   58.879  1.00 50.96  ?  368  PRO B C   1 
ATOM   7005  O  O   . PRO B  1 368 ? 2.699   9.220   58.037  1.00 50.52  ?  368  PRO B O   1 
ATOM   7006  C  CB  . PRO B  1 368 ? -0.034  10.888  57.853  1.00 50.56  ?  368  PRO B CB  1 
ATOM   7007  C  CG  . PRO B  1 368 ? -0.465  11.808  58.937  1.00 50.26  ?  368  PRO B CG  1 
ATOM   7008  C  CD  . PRO B  1 368 ? -1.119  10.935  59.970  1.00 49.83  ?  368  PRO B CD  1 
ATOM   7009  N  N   . GLN B  1 369 ? 2.331   10.209  60.019  1.00 53.94  ?  369  GLN B N   1 
ATOM   7010  C  CA  A GLN B  1 369 ? 3.742   10.283  60.371  0.26 53.01  ?  369  GLN B CA  1 
ATOM   7011  C  CA  B GLN B  1 369 ? 3.744   10.281  60.363  0.74 53.98  ?  369  GLN B CA  1 
ATOM   7012  C  C   . GLN B  1 369 ? 4.235   9.046   61.109  1.00 56.58  ?  369  GLN B C   1 
ATOM   7013  O  O   . GLN B  1 369 ? 5.409   8.997   61.491  1.00 57.96  ?  369  GLN B O   1 
ATOM   7014  C  CB  A GLN B  1 369 ? 4.011   11.534  61.217  0.26 55.69  ?  369  GLN B CB  1 
ATOM   7015  C  CB  B GLN B  1 369 ? 4.020   11.543  61.191  0.74 55.75  ?  369  GLN B CB  1 
ATOM   7016  C  CG  A GLN B  1 369 ? 2.781   12.106  61.914  0.26 54.28  ?  369  GLN B CG  1 
ATOM   7017  C  CG  B GLN B  1 369 ? 4.218   12.809  60.357  0.74 54.08  ?  369  GLN B CG  1 
ATOM   7018  C  CD  A GLN B  1 369 ? 2.215   11.185  62.977  0.26 55.42  ?  369  GLN B CD  1 
ATOM   7019  C  CD  B GLN B  1 369 ? 2.990   13.199  59.561  0.74 47.49  ?  369  GLN B CD  1 
ATOM   7020  O  OE1 A GLN B  1 369 ? 1.001   11.006  63.074  0.26 49.33  ?  369  GLN B OE1 1 
ATOM   7021  O  OE1 B GLN B  1 369 ? 1.956   13.557  60.122  0.74 47.70  ?  369  GLN B OE1 1 
ATOM   7022  N  NE2 A GLN B  1 369 ? 3.092   10.598  63.782  0.26 49.47  ?  369  GLN B NE2 1 
ATOM   7023  N  NE2 B GLN B  1 369 ? 3.098   13.128  58.242  0.74 47.22  ?  369  GLN B NE2 1 
ATOM   7024  N  N   . ALA B  1 370 ? 3.373   8.050   61.310  1.00 54.42  ?  370  ALA B N   1 
ATOM   7025  C  CA  . ALA B  1 370 ? 3.747   6.835   62.017  1.00 54.30  ?  370  ALA B CA  1 
ATOM   7026  C  C   . ALA B  1 370 ? 4.593   5.929   61.137  1.00 55.47  ?  370  ALA B C   1 
ATOM   7027  O  O   . ALA B  1 370 ? 4.320   5.768   59.943  1.00 56.26  ?  370  ALA B O   1 
ATOM   7028  C  CB  . ALA B  1 370 ? 2.498   6.083   62.470  1.00 53.89  ?  370  ALA B CB  1 
ATOM   7029  N  N   . SER B  1 371 ? 5.622   5.330   61.734  1.00 57.41  ?  371  SER B N   1 
ATOM   7030  C  CA  . SER B  1 371 ? 6.379   4.294   61.051  1.00 60.49  ?  371  SER B CA  1 
ATOM   7031  C  C   . SER B  1 371 ? 5.565   3.003   61.032  1.00 64.84  ?  371  SER B C   1 
ATOM   7032  O  O   . SER B  1 371 ? 4.470   2.923   61.596  1.00 66.91  ?  371  SER B O   1 
ATOM   7033  C  CB  . SER B  1 371 ? 7.732   4.086   61.730  1.00 60.74  ?  371  SER B CB  1 
ATOM   7034  O  OG  . SER B  1 371 ? 7.577   3.699   63.083  1.00 60.61  ?  371  SER B OG  1 
ATOM   7035  N  N   . ASP B  1 372 ? 6.106   1.968   60.384  1.00 67.19  ?  372  ASP B N   1 
ATOM   7036  C  CA  . ASP B  1 372 ? 5.414   0.682   60.363  1.00 68.26  ?  372  ASP B CA  1 
ATOM   7037  C  C   . ASP B  1 372 ? 5.210   0.156   61.777  1.00 68.84  ?  372  ASP B C   1 
ATOM   7038  O  O   . ASP B  1 372 ? 4.097   -0.234  62.156  1.00 72.37  ?  372  ASP B O   1 
ATOM   7039  C  CB  . ASP B  1 372 ? 6.191   -0.328  59.518  1.00 68.33  ?  372  ASP B CB  1 
ATOM   7040  C  CG  . ASP B  1 372 ? 5.947   -0.154  58.034  1.00 68.01  ?  372  ASP B CG  1 
ATOM   7041  O  OD1 . ASP B  1 372 ? 5.620   0.974   57.606  1.00 66.76  ?  372  ASP B OD1 1 
ATOM   7042  O  OD2 . ASP B  1 372 ? 6.076   -1.153  57.295  1.00 69.27  ?  372  ASP B OD2 1 
ATOM   7043  N  N   . LEU B  1 373 ? 6.277   0.169   62.579  1.00 65.11  ?  373  LEU B N   1 
ATOM   7044  C  CA  . LEU B  1 373 ? 6.212   -0.366  63.934  1.00 62.22  ?  373  LEU B CA  1 
ATOM   7045  C  C   . LEU B  1 373 ? 5.261   0.450   64.800  1.00 61.31  ?  373  LEU B C   1 
ATOM   7046  O  O   . LEU B  1 373 ? 4.446   -0.107  65.546  1.00 63.32  ?  373  LEU B O   1 
ATOM   7047  C  CB  . LEU B  1 373 ? 7.616   -0.397  64.540  1.00 60.50  ?  373  LEU B CB  1 
ATOM   7048  C  CG  . LEU B  1 373 ? 7.820   -1.068  65.895  1.00 60.58  ?  373  LEU B CG  1 
ATOM   7049  C  CD1 . LEU B  1 373 ? 7.370   -2.513  65.847  1.00 58.69  ?  373  LEU B CD1 1 
ATOM   7050  C  CD2 . LEU B  1 373 ? 9.280   -0.982  66.281  1.00 58.02  ?  373  LEU B CD2 1 
ATOM   7051  N  N   . ALA B  1 374 ? 5.349   1.780   64.711  1.00 58.75  ?  374  ALA B N   1 
ATOM   7052  C  CA  . ALA B  1 374 ? 4.455   2.631   65.488  1.00 58.42  ?  374  ALA B CA  1 
ATOM   7053  C  C   . ALA B  1 374 ? 3.007   2.442   65.053  1.00 58.76  ?  374  ALA B C   1 
ATOM   7054  O  O   . ALA B  1 374 ? 2.091   2.475   65.885  1.00 59.36  ?  374  ALA B O   1 
ATOM   7055  C  CB  . ALA B  1 374 ? 4.877   4.093   65.357  1.00 52.65  ?  374  ALA B CB  1 
ATOM   7056  N  N   . ALA B  1 375 ? 2.781   2.232   63.753  1.00 58.62  ?  375  ALA B N   1 
ATOM   7057  C  CA  . ALA B  1 375 ? 1.429   1.953   63.279  1.00 59.97  ?  375  ALA B CA  1 
ATOM   7058  C  C   . ALA B  1 375 ? 0.907   0.648   63.860  1.00 63.08  ?  375  ALA B C   1 
ATOM   7059  O  O   . ALA B  1 375 ? -0.263  0.557   64.252  1.00 62.58  ?  375  ALA B O   1 
ATOM   7060  C  CB  . ALA B  1 375 ? 1.397   1.908   61.754  1.00 59.54  ?  375  ALA B CB  1 
ATOM   7061  N  N   . GLU B  1 376 ? 1.766   -0.374  63.937  1.00 66.85  ?  376  GLU B N   1 
ATOM   7062  C  CA  . GLU B  1 376 ? 1.355   -1.624  64.566  1.00 71.05  ?  376  GLU B CA  1 
ATOM   7063  C  C   . GLU B  1 376 ? 1.091   -1.436  66.051  1.00 69.95  ?  376  GLU B C   1 
ATOM   7064  O  O   . GLU B  1 376 ? 0.217   -2.104  66.615  1.00 72.77  ?  376  GLU B O   1 
ATOM   7065  C  CB  . GLU B  1 376 ? 2.411   -2.705  64.345  1.00 75.60  ?  376  GLU B CB  1 
ATOM   7066  C  CG  . GLU B  1 376 ? 2.619   -3.073  62.884  1.00 80.05  ?  376  GLU B CG  1 
ATOM   7067  C  CD  . GLU B  1 376 ? 3.175   -4.469  62.721  1.00 85.85  ?  376  GLU B CD  1 
ATOM   7068  O  OE1 . GLU B  1 376 ? 2.943   -5.295  63.629  1.00 87.92  ?  376  GLU B OE1 1 
ATOM   7069  O  OE2 . GLU B  1 376 ? 3.837   -4.741  61.694  1.00 88.02  ?  376  GLU B OE2 1 
ATOM   7070  N  N   . ALA B  1 377 ? 1.829   -0.532  66.700  1.00 66.19  ?  377  ALA B N   1 
ATOM   7071  C  CA  . ALA B  1 377 ? 1.554   -0.226  68.100  1.00 64.74  ?  377  ALA B CA  1 
ATOM   7072  C  C   . ALA B  1 377 ? 0.177   0.405   68.262  1.00 64.58  ?  377  ALA B C   1 
ATOM   7073  O  O   . ALA B  1 377 ? -0.567  0.065   69.193  1.00 68.09  ?  377  ALA B O   1 
ATOM   7074  C  CB  . ALA B  1 377 ? 2.636   0.695   68.662  1.00 63.25  ?  377  ALA B CB  1 
ATOM   7075  N  N   . VAL B  1 378 ? -0.181  1.327   67.366  1.00 60.88  ?  378  VAL B N   1 
ATOM   7076  C  CA  . VAL B  1 378 ? -1.515  1.919   67.419  1.00 60.30  ?  378  VAL B CA  1 
ATOM   7077  C  C   . VAL B  1 378 ? -2.572  0.843   67.196  1.00 60.02  ?  378  VAL B C   1 
ATOM   7078  O  O   . VAL B  1 378 ? -3.577  0.767   67.918  1.00 60.17  ?  378  VAL B O   1 
ATOM   7079  C  CB  . VAL B  1 378 ? -1.641  3.058   66.392  1.00 55.84  ?  378  VAL B CB  1 
ATOM   7080  C  CG1 . VAL B  1 378 ? -3.068  3.573   66.348  1.00 56.48  ?  378  VAL B CG1 1 
ATOM   7081  C  CG2 . VAL B  1 378 ? -0.675  4.177   66.722  1.00 54.74  ?  378  VAL B CG2 1 
ATOM   7082  N  N   . VAL B  1 379 ? -2.343  -0.022  66.205  1.00 59.72  ?  379  VAL B N   1 
ATOM   7083  C  CA  . VAL B  1 379 ? -3.309  -1.072  65.897  1.00 62.48  ?  379  VAL B CA  1 
ATOM   7084  C  C   . VAL B  1 379 ? -3.525  -1.966  67.109  1.00 65.25  ?  379  VAL B C   1 
ATOM   7085  O  O   . VAL B  1 379 ? -4.666  -2.268  67.478  1.00 67.47  ?  379  VAL B O   1 
ATOM   7086  C  CB  . VAL B  1 379 ? -2.857  -1.882  64.671  1.00 60.51  ?  379  VAL B CB  1 
ATOM   7087  C  CG1 . VAL B  1 379 ? -3.787  -3.055  64.462  1.00 62.69  ?  379  VAL B CG1 1 
ATOM   7088  C  CG2 . VAL B  1 379 ? -2.849  -0.998  63.443  1.00 59.11  ?  379  VAL B CG2 1 
ATOM   7089  N  N   . LEU B  1 380 ? -2.434  -2.388  67.756  1.00 66.37  ?  380  LEU B N   1 
ATOM   7090  C  CA  . LEU B  1 380 ? -2.558  -3.209  68.958  1.00 69.93  ?  380  LEU B CA  1 
ATOM   7091  C  C   . LEU B  1 380 ? -3.327  -2.490  70.055  1.00 71.62  ?  380  LEU B C   1 
ATOM   7092  O  O   . LEU B  1 380 ? -4.284  -3.041  70.611  1.00 75.94  ?  380  LEU B O   1 
ATOM   7093  C  CB  . LEU B  1 380 ? -1.181  -3.634  69.470  1.00 70.11  ?  380  LEU B CB  1 
ATOM   7094  C  CG  . LEU B  1 380 ? -1.269  -4.328  70.837  1.00 71.58  ?  380  LEU B CG  1 
ATOM   7095  C  CD1 . LEU B  1 380 ? -0.569  -5.649  70.856  1.00 74.43  ?  380  LEU B CD1 1 
ATOM   7096  C  CD2 . LEU B  1 380 ? -0.674  -3.417  71.906  1.00 68.68  ?  380  LEU B CD2 1 
ATOM   7097  N  N   . HIS B  1 381 ? -2.920  -1.261  70.386  1.00 68.17  ?  381  HIS B N   1 
ATOM   7098  C  CA  . HIS B  1 381 ? -3.528  -0.581  71.526  1.00 67.17  ?  381  HIS B CA  1 
ATOM   7099  C  C   . HIS B  1 381 ? -5.019  -0.349  71.317  1.00 65.48  ?  381  HIS B C   1 
ATOM   7100  O  O   . HIS B  1 381 ? -5.808  -0.474  72.260  1.00 67.45  ?  381  HIS B O   1 
ATOM   7101  C  CB  . HIS B  1 381 ? -2.817  0.740   71.807  1.00 67.01  ?  381  HIS B CB  1 
ATOM   7102  C  CG  . HIS B  1 381 ? -3.414  1.508   72.945  1.00 70.22  ?  381  HIS B CG  1 
ATOM   7103  N  ND1 . HIS B  1 381 ? -2.999  1.346   74.250  1.00 72.41  ?  381  HIS B ND1 1 
ATOM   7104  C  CD2 . HIS B  1 381 ? -4.387  2.449   72.973  1.00 71.38  ?  381  HIS B CD2 1 
ATOM   7105  C  CE1 . HIS B  1 381 ? -3.700  2.147   75.034  1.00 74.28  ?  381  HIS B CE1 1 
ATOM   7106  N  NE2 . HIS B  1 381 ? -4.547  2.829   74.284  1.00 73.30  ?  381  HIS B NE2 1 
ATOM   7107  N  N   . TYR B  1 382 ? -5.430  -0.017  70.093  1.00 64.95  ?  382  TYR B N   1 
ATOM   7108  C  CA  . TYR B  1 382 ? -6.829  0.305   69.831  1.00 67.03  ?  382  TYR B CA  1 
ATOM   7109  C  C   . TYR B  1 382 ? -7.671  -0.892  69.406  1.00 70.54  ?  382  TYR B C   1 
ATOM   7110  O  O   . TYR B  1 382 ? -8.882  -0.736  69.215  1.00 72.59  ?  382  TYR B O   1 
ATOM   7111  C  CB  . TYR B  1 382 ? -6.929  1.407   68.776  1.00 64.30  ?  382  TYR B CB  1 
ATOM   7112  C  CG  . TYR B  1 382 ? -6.720  2.780   69.355  1.00 63.04  ?  382  TYR B CG  1 
ATOM   7113  C  CD1 . TYR B  1 382 ? -5.449  3.319   69.482  1.00 61.34  ?  382  TYR B CD1 1 
ATOM   7114  C  CD2 . TYR B  1 382 ? -7.797  3.526   69.806  1.00 64.32  ?  382  TYR B CD2 1 
ATOM   7115  C  CE1 . TYR B  1 382 ? -5.261  4.573   70.023  1.00 64.67  ?  382  TYR B CE1 1 
ATOM   7116  C  CE2 . TYR B  1 382 ? -7.621  4.777   70.346  1.00 66.78  ?  382  TYR B CE2 1 
ATOM   7117  C  CZ  . TYR B  1 382 ? -6.354  5.296   70.455  1.00 65.15  ?  382  TYR B CZ  1 
ATOM   7118  O  OH  . TYR B  1 382 ? -6.185  6.545   70.997  1.00 64.12  ?  382  TYR B OH  1 
ATOM   7119  N  N   . THR B  1 383 ? -7.074  -2.072  69.265  1.00 70.96  ?  383  THR B N   1 
ATOM   7120  C  CA  . THR B  1 383 ? -7.811  -3.278  68.914  1.00 73.56  ?  383  THR B CA  1 
ATOM   7121  C  C   . THR B  1 383 ? -8.390  -3.924  70.166  1.00 77.20  ?  383  THR B C   1 
ATOM   7122  O  O   . THR B  1 383 ? -7.711  -4.036  71.192  1.00 79.91  ?  383  THR B O   1 
ATOM   7123  C  CB  . THR B  1 383 ? -6.903  -4.279  68.191  1.00 69.50  ?  383  THR B CB  1 
ATOM   7124  O  OG1 . THR B  1 383 ? -6.482  -3.732  66.935  1.00 67.52  ?  383  THR B OG1 1 
ATOM   7125  C  CG2 . THR B  1 383 ? -7.625  -5.596  67.942  1.00 72.12  ?  383  THR B CG2 1 
ATOM   7126  N  N   . ASP B  1 384 ? -9.647  -4.355  70.076  1.00 77.57  ?  384  ASP B N   1 
ATOM   7127  C  CA  . ASP B  1 384 ? -10.239 -5.214  71.095  1.00 79.44  ?  384  ASP B CA  1 
ATOM   7128  C  C   . ASP B  1 384 ? -10.000 -6.644  70.637  1.00 80.80  ?  384  ASP B C   1 
ATOM   7129  O  O   . ASP B  1 384 ? -10.577 -7.087  69.639  1.00 82.33  ?  384  ASP B O   1 
ATOM   7130  C  CB  . ASP B  1 384 ? -11.730 -4.927  71.263  1.00 81.05  ?  384  ASP B CB  1 
ATOM   7131  C  CG  . ASP B  1 384 ? -12.365 -5.721  72.396  1.00 84.67  ?  384  ASP B CG  1 
ATOM   7132  O  OD1 . ASP B  1 384 ? -11.707 -6.622  72.956  1.00 86.70  ?  384  ASP B OD1 1 
ATOM   7133  O  OD2 . ASP B  1 384 ? -13.541 -5.447  72.718  1.00 85.95  ?  384  ASP B OD2 1 
ATOM   7134  N  N   . TRP B  1 385 ? -9.156  -7.366  71.360  1.00 80.30  ?  385  TRP B N   1 
ATOM   7135  C  CA  . TRP B  1 385 ? -8.759  -8.683  70.894  1.00 80.44  ?  385  TRP B CA  1 
ATOM   7136  C  C   . TRP B  1 385 ? -9.771  -9.756  71.254  1.00 87.10  ?  385  TRP B C   1 
ATOM   7137  O  O   . TRP B  1 385 ? -9.567  -10.921 70.898  1.00 88.65  ?  385  TRP B O   1 
ATOM   7138  C  CB  . TRP B  1 385 ? -7.372  -9.028  71.436  1.00 79.34  ?  385  TRP B CB  1 
ATOM   7139  C  CG  . TRP B  1 385 ? -6.306  -8.128  70.884  1.00 79.86  ?  385  TRP B CG  1 
ATOM   7140  C  CD1 . TRP B  1 385 ? -5.757  -7.035  71.491  1.00 78.77  ?  385  TRP B CD1 1 
ATOM   7141  C  CD2 . TRP B  1 385 ? -5.677  -8.230  69.599  1.00 79.24  ?  385  TRP B CD2 1 
ATOM   7142  N  NE1 . TRP B  1 385 ? -4.815  -6.458  70.669  1.00 75.52  ?  385  TRP B NE1 1 
ATOM   7143  C  CE2 . TRP B  1 385 ? -4.749  -7.172  69.501  1.00 75.97  ?  385  TRP B CE2 1 
ATOM   7144  C  CE3 . TRP B  1 385 ? -5.804  -9.117  68.523  1.00 81.14  ?  385  TRP B CE3 1 
ATOM   7145  C  CZ2 . TRP B  1 385 ? -3.953  -6.977  68.369  1.00 74.53  ?  385  TRP B CZ2 1 
ATOM   7146  C  CZ3 . TRP B  1 385 ? -5.011  -8.923  67.402  1.00 78.48  ?  385  TRP B CZ3 1 
ATOM   7147  C  CH2 . TRP B  1 385 ? -4.098  -7.862  67.334  1.00 75.31  ?  385  TRP B CH2 1 
ATOM   7148  N  N   . LEU B  1 386 ? -10.846 -9.392  71.957  1.00 89.37  ?  386  LEU B N   1 
ATOM   7149  C  CA  . LEU B  1 386 ? -11.980 -10.294 72.117  1.00 94.09  ?  386  LEU B CA  1 
ATOM   7150  C  C   . LEU B  1 386 ? -12.893 -10.289 70.897  1.00 95.47  ?  386  LEU B C   1 
ATOM   7151  O  O   . LEU B  1 386 ? -13.485 -11.325 70.570  1.00 100.28 ?  386  LEU B O   1 
ATOM   7152  C  CB  . LEU B  1 386 ? -12.770 -9.933  73.373  1.00 96.00  ?  386  LEU B CB  1 
ATOM   7153  C  CG  . LEU B  1 386 ? -12.770 -11.046 74.418  1.00 98.86  ?  386  LEU B CG  1 
ATOM   7154  C  CD1 . LEU B  1 386 ? -13.657 -10.685 75.597  1.00 101.95 ?  386  LEU B CD1 1 
ATOM   7155  C  CD2 . LEU B  1 386 ? -13.215 -12.361 73.784  1.00 101.01 ?  386  LEU B CD2 1 
ATOM   7156  N  N   . HIS B  1 387 ? -13.028 -9.146  70.222  1.00 91.72  ?  387  HIS B N   1 
ATOM   7157  C  CA  . HIS B  1 387 ? -13.785 -9.035  68.973  1.00 90.87  ?  387  HIS B CA  1 
ATOM   7158  C  C   . HIS B  1 387 ? -12.954 -8.260  67.959  1.00 85.96  ?  387  HIS B C   1 
ATOM   7159  O  O   . HIS B  1 387 ? -13.291 -7.125  67.603  1.00 84.07  ?  387  HIS B O   1 
ATOM   7160  C  CB  . HIS B  1 387 ? -15.132 -8.344  69.192  1.00 93.04  ?  387  HIS B CB  1 
ATOM   7161  C  CG  . HIS B  1 387 ? -15.827 -8.750  70.452  1.00 97.84  ?  387  HIS B CG  1 
ATOM   7162  N  ND1 . HIS B  1 387 ? -15.659 -8.075  71.642  1.00 98.40  ?  387  HIS B ND1 1 
ATOM   7163  C  CD2 . HIS B  1 387 ? -16.705 -9.749  70.706  1.00 103.53 ?  387  HIS B CD2 1 
ATOM   7164  C  CE1 . HIS B  1 387 ? -16.395 -8.647  72.577  1.00 103.40 ?  387  HIS B CE1 1 
ATOM   7165  N  NE2 . HIS B  1 387 ? -17.040 -9.665  72.035  1.00 106.62 ?  387  HIS B NE2 1 
ATOM   7166  N  N   . PRO B  1 388 ? -11.861 -8.848  67.463  1.00 83.91  ?  388  PRO B N   1 
ATOM   7167  C  CA  . PRO B  1 388 ? -10.972 -8.089  66.570  1.00 84.30  ?  388  PRO B CA  1 
ATOM   7168  C  C   . PRO B  1 388 ? -11.592 -7.762  65.221  1.00 84.94  ?  388  PRO B C   1 
ATOM   7169  O  O   . PRO B  1 388 ? -11.113 -6.839  64.549  1.00 82.23  ?  388  PRO B O   1 
ATOM   7170  C  CB  . PRO B  1 388 ? -9.758  -9.013  66.419  1.00 80.07  ?  388  PRO B CB  1 
ATOM   7171  C  CG  . PRO B  1 388 ? -10.322 -10.369 66.586  1.00 83.53  ?  388  PRO B CG  1 
ATOM   7172  C  CD  . PRO B  1 388 ? -11.421 -10.245 67.610  1.00 85.67  ?  388  PRO B CD  1 
ATOM   7173  N  N   . GLU B  1 389 ? -12.623 -8.492  64.796  1.00 88.69  ?  389  GLU B N   1 
ATOM   7174  C  CA  . GLU B  1 389 ? -13.280 -8.257  63.518  1.00 89.62  ?  389  GLU B CA  1 
ATOM   7175  C  C   . GLU B  1 389 ? -14.531 -7.397  63.626  1.00 89.00  ?  389  GLU B C   1 
ATOM   7176  O  O   . GLU B  1 389 ? -15.133 -7.083  62.596  1.00 89.98  ?  389  GLU B O   1 
ATOM   7177  C  CB  . GLU B  1 389 ? -13.644 -9.592  62.860  1.00 96.54  ?  389  GLU B CB  1 
ATOM   7178  C  CG  . GLU B  1 389 ? -12.517 -10.609 62.838  1.00 99.15  ?  389  GLU B CG  1 
ATOM   7179  C  CD  . GLU B  1 389 ? -11.436 -10.259 61.832  1.00 98.06  ?  389  GLU B CD  1 
ATOM   7180  O  OE1 . GLU B  1 389 ? -11.706 -9.449  60.918  1.00 96.40  ?  389  GLU B OE1 1 
ATOM   7181  O  OE2 . GLU B  1 389 ? -10.317 -10.800 61.958  1.00 98.62  ?  389  GLU B OE2 1 
ATOM   7182  N  N   . ASP B  1 390 ? -14.934 -7.011  64.829  1.00 89.08  ?  390  ASP B N   1 
ATOM   7183  C  CA  . ASP B  1 390 ? -16.215 -6.331  65.013  1.00 92.28  ?  390  ASP B CA  1 
ATOM   7184  C  C   . ASP B  1 390 ? -16.187 -4.968  64.330  1.00 89.96  ?  390  ASP B C   1 
ATOM   7185  O  O   . ASP B  1 390 ? -15.410 -4.095  64.739  1.00 87.72  ?  390  ASP B O   1 
ATOM   7186  C  CB  . ASP B  1 390 ? -16.518 -6.190  66.503  1.00 95.55  ?  390  ASP B CB  1 
ATOM   7187  C  CG  . ASP B  1 390 ? -17.784 -5.397  66.776  1.00 99.91  ?  390  ASP B CG  1 
ATOM   7188  O  OD1 . ASP B  1 390 ? -18.724 -5.472  65.954  1.00 102.42 ?  390  ASP B OD1 1 
ATOM   7189  O  OD2 . ASP B  1 390 ? -17.846 -4.712  67.822  1.00 100.85 ?  390  ASP B OD2 1 
ATOM   7190  N  N   . PRO B  1 391 ? -17.015 -4.737  63.304  1.00 90.34  ?  391  PRO B N   1 
ATOM   7191  C  CA  . PRO B  1 391 ? -16.906 -3.477  62.548  1.00 87.77  ?  391  PRO B CA  1 
ATOM   7192  C  C   . PRO B  1 391 ? -17.292 -2.241  63.344  1.00 88.19  ?  391  PRO B C   1 
ATOM   7193  O  O   . PRO B  1 391 ? -16.745 -1.163  63.081  1.00 87.37  ?  391  PRO B O   1 
ATOM   7194  C  CB  . PRO B  1 391 ? -17.854 -3.698  61.358  1.00 88.63  ?  391  PRO B CB  1 
ATOM   7195  C  CG  . PRO B  1 391 ? -18.020 -5.184  61.267  1.00 90.76  ?  391  PRO B CG  1 
ATOM   7196  C  CD  . PRO B  1 391 ? -17.971 -5.668  62.682  1.00 92.69  ?  391  PRO B CD  1 
ATOM   7197  N  N   . THR B  1 392 ? -18.219 -2.352  64.298  1.00 89.86  ?  392  THR B N   1 
ATOM   7198  C  CA  . THR B  1 392 ? -18.626 -1.177  65.063  1.00 89.69  ?  392  THR B CA  1 
ATOM   7199  C  C   . THR B  1 392 ? -17.487 -0.678  65.944  1.00 88.82  ?  392  THR B C   1 
ATOM   7200  O  O   . THR B  1 392 ? -17.188 0.525   65.974  1.00 87.27  ?  392  THR B O   1 
ATOM   7201  C  CB  . THR B  1 392 ? -19.861 -1.496  65.905  1.00 93.24  ?  392  THR B CB  1 
ATOM   7202  O  OG1 . THR B  1 392 ? -20.903 -1.994  65.057  1.00 92.82  ?  392  THR B OG1 1 
ATOM   7203  C  CG2 . THR B  1 392 ? -20.353 -0.245  66.619  1.00 92.44  ?  392  THR B CG2 1 
ATOM   7204  N  N   . HIS B  1 393 ? -16.832 -1.593  66.665  1.00 90.96  ?  393  HIS B N   1 
ATOM   7205  C  CA  . HIS B  1 393 ? -15.671 -1.205  67.454  1.00 92.36  ?  393  HIS B CA  1 
ATOM   7206  C  C   . HIS B  1 393 ? -14.506 -0.770  66.575  1.00 87.58  ?  393  HIS B C   1 
ATOM   7207  O  O   . HIS B  1 393 ? -13.706 0.075   66.989  1.00 86.11  ?  393  HIS B O   1 
ATOM   7208  C  CB  . HIS B  1 393 ? -15.223 -2.346  68.364  1.00 98.63  ?  393  HIS B CB  1 
ATOM   7209  C  CG  . HIS B  1 393 ? -13.895 -2.096  69.009  1.00 100.94 ?  393  HIS B CG  1 
ATOM   7210  N  ND1 . HIS B  1 393 ? -13.670 -1.029  69.855  1.00 101.61 ?  393  HIS B ND1 1 
ATOM   7211  C  CD2 . HIS B  1 393 ? -12.711 -2.743  68.897  1.00 101.12 ?  393  HIS B CD2 1 
ATOM   7212  C  CE1 . HIS B  1 393 ? -12.411 -1.044  70.254  1.00 100.29 ?  393  HIS B CE1 1 
ATOM   7213  N  NE2 . HIS B  1 393 ? -11.807 -2.074  69.688  1.00 100.11 ?  393  HIS B NE2 1 
ATOM   7214  N  N   . LEU B  1 394 ? -14.377 -1.341  65.376  1.00 84.73  ?  394  LEU B N   1 
ATOM   7215  C  CA  . LEU B  1 394 ? -13.336 -0.883  64.462  1.00 78.89  ?  394  LEU B CA  1 
ATOM   7216  C  C   . LEU B  1 394 ? -13.570 0.563   64.044  1.00 76.64  ?  394  LEU B C   1 
ATOM   7217  O  O   . LEU B  1 394 ? -12.632 1.367   64.023  1.00 74.61  ?  394  LEU B O   1 
ATOM   7218  C  CB  . LEU B  1 394 ? -13.265 -1.795  63.236  1.00 77.87  ?  394  LEU B CB  1 
ATOM   7219  C  CG  . LEU B  1 394 ? -12.675 -3.185  63.465  1.00 78.13  ?  394  LEU B CG  1 
ATOM   7220  C  CD1 . LEU B  1 394 ? -12.672 -3.978  62.168  1.00 79.25  ?  394  LEU B CD1 1 
ATOM   7221  C  CD2 . LEU B  1 394 ? -11.276 -3.076  64.047  1.00 72.49  ?  394  LEU B CD2 1 
ATOM   7222  N  N   . ARG B  1 395 ? -14.815 0.916   63.721  1.00 77.44  ?  395  ARG B N   1 
ATOM   7223  C  CA  . ARG B  1 395 ? -15.109 2.279   63.290  1.00 76.25  ?  395  ARG B CA  1 
ATOM   7224  C  C   . ARG B  1 395 ? -14.955 3.267   64.443  1.00 78.86  ?  395  ARG B C   1 
ATOM   7225  O  O   . ARG B  1 395 ? -14.251 4.283   64.320  1.00 79.97  ?  395  ARG B O   1 
ATOM   7226  C  CB  . ARG B  1 395 ? -16.518 2.331   62.691  1.00 77.15  ?  395  ARG B CB  1 
ATOM   7227  C  CG  . ARG B  1 395 ? -17.081 3.720   62.463  1.00 75.51  ?  395  ARG B CG  1 
ATOM   7228  C  CD  . ARG B  1 395 ? -18.131 4.049   63.509  1.00 78.11  ?  395  ARG B CD  1 
ATOM   7229  N  NE  . ARG B  1 395 ? -19.401 3.383   63.235  1.00 81.67  ?  395  ARG B NE  1 
ATOM   7230  C  CZ  . ARG B  1 395 ? -20.378 3.242   64.126  1.00 87.34  ?  395  ARG B CZ  1 
ATOM   7231  N  NH1 . ARG B  1 395 ? -20.234 3.722   65.356  1.00 87.48  ?  395  ARG B NH1 1 
ATOM   7232  N  NH2 . ARG B  1 395 ? -21.502 2.623   63.787  1.00 91.55  ?  395  ARG B NH2 1 
ATOM   7233  N  N   . ASP B  1 396 ? -15.603 2.984   65.580  1.00 80.16  ?  396  ASP B N   1 
ATOM   7234  C  CA  . ASP B  1 396 ? -15.445 3.861   66.738  1.00 78.94  ?  396  ASP B CA  1 
ATOM   7235  C  C   . ASP B  1 396 ? -13.987 3.942   67.172  1.00 76.13  ?  396  ASP B C   1 
ATOM   7236  O  O   . ASP B  1 396 ? -13.549 4.972   67.700  1.00 75.57  ?  396  ASP B O   1 
ATOM   7237  C  CB  . ASP B  1 396 ? -16.321 3.369   67.887  1.00 82.17  ?  396  ASP B CB  1 
ATOM   7238  C  CG  . ASP B  1 396 ? -17.804 3.511   67.592  1.00 87.57  ?  396  ASP B CG  1 
ATOM   7239  O  OD1 . ASP B  1 396 ? -18.164 4.308   66.698  1.00 88.57  ?  396  ASP B OD1 1 
ATOM   7240  O  OD2 . ASP B  1 396 ? -18.610 2.821   68.249  1.00 91.70  ?  396  ASP B OD2 1 
ATOM   7241  N  N   . ALA B  1 397 ? -13.217 2.879   66.929  1.00 73.98  ?  397  ALA B N   1 
ATOM   7242  C  CA  . ALA B  1 397 ? -11.810 2.880   67.307  1.00 72.41  ?  397  ALA B CA  1 
ATOM   7243  C  C   . ALA B  1 397 ? -10.974 3.683   66.323  1.00 68.27  ?  397  ALA B C   1 
ATOM   7244  O  O   . ALA B  1 397 ? -9.933  4.229   66.698  1.00 65.97  ?  397  ALA B O   1 
ATOM   7245  C  CB  . ALA B  1 397 ? -11.292 1.447   67.412  1.00 75.15  ?  397  ALA B CB  1 
ATOM   7246  N  N   . MET B  1 398 ? -11.408 3.761   65.065  1.00 67.89  ?  398  MET B N   1 
ATOM   7247  C  CA  . MET B  1 398 ? -10.768 4.660   64.112  1.00 66.24  ?  398  MET B CA  1 
ATOM   7248  C  C   . MET B  1 398 ? -10.989 6.112   64.523  1.00 67.06  ?  398  MET B C   1 
ATOM   7249  O  O   . MET B  1 398 ? -10.039 6.913   64.583  1.00 65.56  ?  398  MET B O   1 
ATOM   7250  C  CB  . MET B  1 398 ? -11.322 4.391   62.711  1.00 67.80  ?  398  MET B CB  1 
ATOM   7251  C  CG  . MET B  1 398 ? -10.546 5.011   61.565  1.00 66.63  ?  398  MET B CG  1 
ATOM   7252  S  SD  . MET B  1 398 ? -8.887  4.325   61.348  1.00 65.32  ?  398  MET B SD  1 
ATOM   7253  C  CE  . MET B  1 398 ? -7.885  5.632   62.054  1.00 57.77  ?  398  MET B CE  1 
ATOM   7254  N  N   . SER B  1 399 ? -12.244 6.461   64.839  1.00 65.11  ?  399  SER B N   1 
ATOM   7255  C  CA  . SER B  1 399 ? -12.525 7.794   65.366  1.00 65.24  ?  399  SER B CA  1 
ATOM   7256  C  C   . SER B  1 399 ? -11.706 8.075   66.619  1.00 66.44  ?  399  SER B C   1 
ATOM   7257  O  O   . SER B  1 399 ? -11.241 9.204   66.828  1.00 64.72  ?  399  SER B O   1 
ATOM   7258  C  CB  . SER B  1 399 ? -14.015 7.945   65.664  1.00 68.09  ?  399  SER B CB  1 
ATOM   7259  O  OG  . SER B  1 399 ? -14.255 9.089   66.469  1.00 68.73  ?  399  SER B OG  1 
ATOM   7260  N  N   . ALA B  1 400 ? -11.512 7.056   67.461  1.00 66.86  ?  400  ALA B N   1 
ATOM   7261  C  CA  . ALA B  1 400 ? -10.724 7.243   68.673  1.00 67.18  ?  400  ALA B CA  1 
ATOM   7262  C  C   . ALA B  1 400 ? -9.251  7.465   68.349  1.00 66.03  ?  400  ALA B C   1 
ATOM   7263  O  O   . ALA B  1 400 ? -8.583  8.272   69.005  1.00 64.26  ?  400  ALA B O   1 
ATOM   7264  C  CB  . ALA B  1 400 ? -10.898 6.043   69.599  1.00 67.20  ?  400  ALA B CB  1 
ATOM   7265  N  N   . VAL B  1 401 ? -8.726  6.761   67.341  1.00 68.07  ?  401  VAL B N   1 
ATOM   7266  C  CA  . VAL B  1 401 ? -7.335  6.957   66.938  1.00 66.45  ?  401  VAL B CA  1 
ATOM   7267  C  C   . VAL B  1 401 ? -7.114  8.394   66.492  1.00 64.73  ?  401  VAL B C   1 
ATOM   7268  O  O   . VAL B  1 401 ? -6.228  9.093   67.004  1.00 64.35  ?  401  VAL B O   1 
ATOM   7269  C  CB  . VAL B  1 401 ? -6.943  5.961   65.831  1.00 58.44  ?  401  VAL B CB  1 
ATOM   7270  C  CG1 . VAL B  1 401 ? -5.672  6.416   65.146  1.00 56.34  ?  401  VAL B CG1 1 
ATOM   7271  C  CG2 . VAL B  1 401 ? -6.742  4.581   66.413  1.00 59.45  ?  401  VAL B CG2 1 
ATOM   7272  N  N   . VAL B  1 402 ? -7.934  8.865   65.550  1.00 62.52  ?  402  VAL B N   1 
ATOM   7273  C  CA  . VAL B  1 402 ? -7.737  10.214  65.025  1.00 60.77  ?  402  VAL B CA  1 
ATOM   7274  C  C   . VAL B  1 402 ? -7.942  11.251  66.127  1.00 62.35  ?  402  VAL B C   1 
ATOM   7275  O  O   . VAL B  1 402 ? -7.131  12.172  66.301  1.00 60.52  ?  402  VAL B O   1 
ATOM   7276  C  CB  . VAL B  1 402 ? -8.668  10.461  63.827  1.00 60.04  ?  402  VAL B CB  1 
ATOM   7277  C  CG1 . VAL B  1 402 ? -8.544  11.897  63.347  1.00 59.10  ?  402  VAL B CG1 1 
ATOM   7278  C  CG2 . VAL B  1 402 ? -8.339  9.489   62.716  1.00 59.16  ?  402  VAL B CG2 1 
ATOM   7279  N  N   . GLY B  1 403 ? -9.017  11.098  66.904  1.00 65.64  ?  403  GLY B N   1 
ATOM   7280  C  CA  . GLY B  1 403 ? -9.321  12.080  67.935  1.00 68.01  ?  403  GLY B CA  1 
ATOM   7281  C  C   . GLY B  1 403 ? -8.256  12.160  69.013  1.00 68.94  ?  403  GLY B C   1 
ATOM   7282  O  O   . GLY B  1 403 ? -7.793  13.248  69.365  1.00 70.15  ?  403  GLY B O   1 
ATOM   7283  N  N   . ASP B  1 404 ? -7.854  11.007  69.557  1.00 68.73  ?  404  ASP B N   1 
ATOM   7284  C  CA  . ASP B  1 404 ? -6.857  11.007  70.626  1.00 67.99  ?  404  ASP B CA  1 
ATOM   7285  C  C   . ASP B  1 404 ? -5.505  11.483  70.116  1.00 65.22  ?  404  ASP B C   1 
ATOM   7286  O  O   . ASP B  1 404 ? -4.787  12.198  70.824  1.00 64.25  ?  404  ASP B O   1 
ATOM   7287  C  CB  . ASP B  1 404 ? -6.717  9.614   71.235  1.00 69.04  ?  404  ASP B CB  1 
ATOM   7288  C  CG  . ASP B  1 404 ? -8.002  9.110   71.851  1.00 72.97  ?  404  ASP B CG  1 
ATOM   7289  O  OD1 . ASP B  1 404 ? -8.899  9.934   72.139  1.00 75.27  ?  404  ASP B OD1 1 
ATOM   7290  O  OD2 . ASP B  1 404 ? -8.110  7.881   72.051  1.00 73.91  ?  404  ASP B OD2 1 
ATOM   7291  N  N   . HIS B  1 405 ? -5.136  11.083  68.897  1.00 64.69  ?  405  HIS B N   1 
ATOM   7292  C  CA  . HIS B  1 405 ? -3.847  11.487  68.342  1.00 64.28  ?  405  HIS B CA  1 
ATOM   7293  C  C   . HIS B  1 405 ? -3.787  12.996  68.132  1.00 63.95  ?  405  HIS B C   1 
ATOM   7294  O  O   . HIS B  1 405 ? -2.849  13.660  68.589  1.00 63.97  ?  405  HIS B O   1 
ATOM   7295  C  CB  . HIS B  1 405 ? -3.595  10.746  67.025  1.00 64.15  ?  405  HIS B CB  1 
ATOM   7296  C  CG  . HIS B  1 405 ? -2.358  11.183  66.296  1.00 62.08  ?  405  HIS B CG  1 
ATOM   7297  N  ND1 . HIS B  1 405 ? -1.143  11.362  66.923  1.00 61.75  ?  405  HIS B ND1 1 
ATOM   7298  C  CD2 . HIS B  1 405 ? -2.150  11.465  64.988  1.00 59.84  ?  405  HIS B CD2 1 
ATOM   7299  C  CE1 . HIS B  1 405 ? -0.241  11.736  66.032  1.00 60.03  ?  405  HIS B CE1 1 
ATOM   7300  N  NE2 . HIS B  1 405 ? -0.827  11.807  64.850  1.00 58.85  ?  405  HIS B NE2 1 
ATOM   7301  N  N   . ASN B  1 406 ? -4.771  13.554  67.418  1.00 63.35  ?  406  ASN B N   1 
ATOM   7302  C  CA  . ASN B  1 406 ? -4.699  14.956  67.023  1.00 61.05  ?  406  ASN B CA  1 
ATOM   7303  C  C   . ASN B  1 406 ? -5.171  15.941  68.088  1.00 62.00  ?  406  ASN B C   1 
ATOM   7304  O  O   . ASN B  1 406 ? -4.774  17.109  68.038  1.00 61.98  ?  406  ASN B O   1 
ATOM   7305  C  CB  . ASN B  1 406 ? -5.510  15.170  65.745  1.00 60.25  ?  406  ASN B CB  1 
ATOM   7306  C  CG  . ASN B  1 406 ? -4.921  14.438  64.554  1.00 58.70  ?  406  ASN B CG  1 
ATOM   7307  O  OD1 . ASN B  1 406 ? -3.884  14.834  64.019  1.00 57.48  ?  406  ASN B OD1 1 
ATOM   7308  N  ND2 . ASN B  1 406 ? -5.575  13.356  64.140  1.00 58.53  ?  406  ASN B ND2 1 
ATOM   7309  N  N   . VAL B  1 407 ? -6.003  15.525  69.042  1.00 64.22  ?  407  VAL B N   1 
ATOM   7310  C  CA  . VAL B  1 407 ? -6.609  16.497  69.952  1.00 67.28  ?  407  VAL B CA  1 
ATOM   7311  C  C   . VAL B  1 407 ? -6.463  16.093  71.415  1.00 70.01  ?  407  VAL B C   1 
ATOM   7312  O  O   . VAL B  1 407 ? -5.800  16.787  72.194  1.00 72.50  ?  407  VAL B O   1 
ATOM   7313  C  CB  . VAL B  1 407 ? -8.092  16.739  69.605  1.00 67.41  ?  407  VAL B CB  1 
ATOM   7314  C  CG1 . VAL B  1 407 ? -8.739  17.644  70.644  1.00 69.07  ?  407  VAL B CG1 1 
ATOM   7315  C  CG2 . VAL B  1 407 ? -8.219  17.369  68.227  1.00 65.64  ?  407  VAL B CG2 1 
ATOM   7316  N  N   . VAL B  1 408 ? -7.101  14.986  71.803  1.00 69.03  ?  408  VAL B N   1 
ATOM   7317  C  CA  . VAL B  1 408 ? -7.310  14.703  73.223  1.00 69.83  ?  408  VAL B CA  1 
ATOM   7318  C  C   . VAL B  1 408 ? -5.977  14.564  73.951  1.00 68.72  ?  408  VAL B C   1 
ATOM   7319  O  O   . VAL B  1 408 ? -5.749  15.192  74.992  1.00 69.17  ?  408  VAL B O   1 
ATOM   7320  C  CB  . VAL B  1 408 ? -8.185  13.449  73.397  1.00 70.58  ?  408  VAL B CB  1 
ATOM   7321  C  CG1 . VAL B  1 408 ? -8.266  13.063  74.862  1.00 69.64  ?  408  VAL B CG1 1 
ATOM   7322  C  CG2 . VAL B  1 408 ? -9.579  13.690  72.830  1.00 70.11  ?  408  VAL B CG2 1 
ATOM   7323  N  N   . CYS B  1 409 ? -5.087  13.735  73.429  1.00 68.13  ?  409  CYS B N   1 
ATOM   7324  C  CA  . CYS B  1 409 ? -3.793  13.557  74.077  1.00 70.20  ?  409  CYS B CA  1 
ATOM   7325  C  C   . CYS B  1 409 ? -2.920  14.809  74.020  1.00 72.49  ?  409  CYS B C   1 
ATOM   7326  O  O   . CYS B  1 409 ? -2.236  15.106  75.008  1.00 76.02  ?  409  CYS B O   1 
ATOM   7327  C  CB  . CYS B  1 409 ? -3.068  12.351  73.488  1.00 66.85  ?  409  CYS B CB  1 
ATOM   7328  S  SG  . CYS B  1 409 ? -3.928  10.846  73.923  1.00 67.10  ?  409  CYS B SG  1 
ATOM   7329  N  N   . PRO B  1 410 ? -2.871  15.554  72.904  1.00 68.65  ?  410  PRO B N   1 
ATOM   7330  C  CA  . PRO B  1 410 ? -2.199  16.863  72.964  1.00 68.24  ?  410  PRO B CA  1 
ATOM   7331  C  C   . PRO B  1 410 ? -2.784  17.784  74.024  1.00 72.40  ?  410  PRO B C   1 
ATOM   7332  O  O   . PRO B  1 410 ? -2.041  18.544  74.659  1.00 74.92  ?  410  PRO B O   1 
ATOM   7333  C  CB  . PRO B  1 410 ? -2.395  17.416  71.549  1.00 64.21  ?  410  PRO B CB  1 
ATOM   7334  C  CG  . PRO B  1 410 ? -2.455  16.217  70.702  1.00 61.86  ?  410  PRO B CG  1 
ATOM   7335  C  CD  . PRO B  1 410 ? -3.160  15.165  71.511  1.00 64.23  ?  410  PRO B CD  1 
ATOM   7336  N  N   . VAL B  1 411 ? -4.100  17.724  74.247  1.00 72.64  ?  411  VAL B N   1 
ATOM   7337  C  CA  . VAL B  1 411 ? -4.723  18.552  75.276  1.00 73.29  ?  411  VAL B CA  1 
ATOM   7338  C  C   . VAL B  1 411 ? -4.276  18.111  76.667  1.00 75.57  ?  411  VAL B C   1 
ATOM   7339  O  O   . VAL B  1 411 ? -3.931  18.946  77.511  1.00 76.19  ?  411  VAL B O   1 
ATOM   7340  C  CB  . VAL B  1 411 ? -6.255  18.523  75.131  1.00 71.70  ?  411  VAL B CB  1 
ATOM   7341  C  CG1 . VAL B  1 411 ? -6.924  19.034  76.399  1.00 73.78  ?  411  VAL B CG1 1 
ATOM   7342  C  CG2 . VAL B  1 411 ? -6.687  19.350  73.926  1.00 69.15  ?  411  VAL B CG2 1 
ATOM   7343  N  N   . ALA B  1 412 ? -4.265  16.798  76.924  1.00 75.62  ?  412  ALA B N   1 
ATOM   7344  C  CA  . ALA B  1 412 ? -3.820  16.297  78.222  1.00 75.11  ?  412  ALA B CA  1 
ATOM   7345  C  C   . ALA B  1 412 ? -2.341  16.586  78.449  1.00 72.89  ?  412  ALA B C   1 
ATOM   7346  O  O   . ALA B  1 412 ? -1.920  16.858  79.578  1.00 74.41  ?  412  ALA B O   1 
ATOM   7347  C  CB  . ALA B  1 412 ? -4.098  14.798  78.327  1.00 75.47  ?  412  ALA B CB  1 
ATOM   7348  N  N   . GLN B  1 413 ? -1.537  16.519  77.387  1.00 72.19  ?  413  GLN B N   1 
ATOM   7349  C  CA  . GLN B  1 413 ? -0.130  16.895  77.479  1.00 73.28  ?  413  GLN B CA  1 
ATOM   7350  C  C   . GLN B  1 413 ? 0.018   18.359  77.863  1.00 73.88  ?  413  GLN B C   1 
ATOM   7351  O  O   . GLN B  1 413 ? 0.766   18.701  78.790  1.00 75.14  ?  413  GLN B O   1 
ATOM   7352  C  CB  . GLN B  1 413 ? 0.564   16.611  76.145  1.00 73.40  ?  413  GLN B CB  1 
ATOM   7353  C  CG  . GLN B  1 413 ? 1.992   17.115  76.031  1.00 78.90  ?  413  GLN B CG  1 
ATOM   7354  C  CD  . GLN B  1 413 ? 3.015   16.226  76.708  1.00 85.72  ?  413  GLN B CD  1 
ATOM   7355  O  OE1 . GLN B  1 413 ? 4.207   16.520  76.680  1.00 87.70  ?  413  GLN B OE1 1 
ATOM   7356  N  NE2 . GLN B  1 413 ? 2.562   15.142  77.322  1.00 88.79  ?  413  GLN B NE2 1 
ATOM   7357  N  N   . LEU B  1 414 ? -0.701  19.240  77.163  1.00 73.46  ?  414  LEU B N   1 
ATOM   7358  C  CA  . LEU B  1 414 ? -0.642  20.661  77.481  1.00 72.59  ?  414  LEU B CA  1 
ATOM   7359  C  C   . LEU B  1 414 ? -1.063  20.917  78.922  1.00 83.79  ?  414  LEU B C   1 
ATOM   7360  O  O   . LEU B  1 414 ? -0.370  21.619  79.662  1.00 87.85  ?  414  LEU B O   1 
ATOM   7361  C  CB  . LEU B  1 414 ? -1.513  21.459  76.515  1.00 71.84  ?  414  LEU B CB  1 
ATOM   7362  C  CG  . LEU B  1 414 ? -1.403  22.975  76.711  1.00 74.94  ?  414  LEU B CG  1 
ATOM   7363  C  CD1 . LEU B  1 414 ? 0.005   23.464  76.387  1.00 73.16  ?  414  LEU B CD1 1 
ATOM   7364  C  CD2 . LEU B  1 414 ? -2.448  23.723  75.901  1.00 73.57  ?  414  LEU B CD2 1 
ATOM   7365  N  N   . ALA B  1 415 ? -2.192  20.342  79.348  1.00 83.24  ?  415  ALA B N   1 
ATOM   7366  C  CA  . ALA B  1 415 ? -2.656  20.568  80.715  1.00 80.72  ?  415  ALA B CA  1 
ATOM   7367  C  C   . ALA B  1 415 ? -1.649  20.053  81.735  1.00 101.20 ?  415  ALA B C   1 
ATOM   7368  O  O   . ALA B  1 415 ? -1.420  20.693  82.767  1.00 85.11  ?  415  ALA B O   1 
ATOM   7369  C  CB  . ALA B  1 415 ? -4.018  19.910  80.927  1.00 81.56  ?  415  ALA B CB  1 
ATOM   7370  N  N   . GLY B  1 416 ? -1.030  18.903  81.459  1.00 91.26  ?  416  GLY B N   1 
ATOM   7371  C  CA  . GLY B  1 416 ? -0.047  18.361  82.382  1.00 90.60  ?  416  GLY B CA  1 
ATOM   7372  C  C   . GLY B  1 416 ? 1.183   19.238  82.518  1.00 90.77  ?  416  GLY B C   1 
ATOM   7373  O  O   . GLY B  1 416 ? 1.689   19.445  83.625  1.00 93.12  ?  416  GLY B O   1 
ATOM   7374  N  N   . ARG B  1 417 ? 1.684   19.769  81.398  1.00 88.09  ?  417  ARG B N   1 
ATOM   7375  C  CA  . ARG B  1 417 ? 2.862   20.632  81.479  1.00 88.22  ?  417  ARG B CA  1 
ATOM   7376  C  C   . ARG B  1 417 ? 2.515   21.987  82.094  1.00 89.72  ?  417  ARG B C   1 
ATOM   7377  O  O   . ARG B  1 417 ? 3.262   22.503  82.935  1.00 93.50  ?  417  ARG B O   1 
ATOM   7378  C  CB  . ARG B  1 417 ? 3.490   20.816  80.096  1.00 86.72  ?  417  ARG B CB  1 
ATOM   7379  C  CG  . ARG B  1 417 ? 3.738   19.534  79.304  1.00 87.26  ?  417  ARG B CG  1 
ATOM   7380  C  CD  . ARG B  1 417 ? 4.483   18.464  80.086  1.00 92.99  ?  417  ARG B CD  1 
ATOM   7381  N  NE  . ARG B  1 417 ? 5.781   18.930  80.569  1.00 99.38  ?  417  ARG B NE  1 
ATOM   7382  C  CZ  . ARG B  1 417 ? 6.752   18.128  81.001  1.00 103.09 ?  417  ARG B CZ  1 
ATOM   7383  N  NH1 . ARG B  1 417 ? 6.584   16.809  80.992  1.00 101.84 ?  417  ARG B NH1 1 
ATOM   7384  N  NH2 . ARG B  1 417 ? 7.901   18.643  81.427  1.00 106.08 ?  417  ARG B NH2 1 
ATOM   7385  N  N   . LEU B  1 418 ? 1.391   22.582  81.684  1.00 86.68  ?  418  LEU B N   1 
ATOM   7386  C  CA  . LEU B  1 418 ? 0.954   23.846  82.272  1.00 88.57  ?  418  LEU B CA  1 
ATOM   7387  C  C   . LEU B  1 418 ? 0.795   23.722  83.782  1.00 91.69  ?  418  LEU B C   1 
ATOM   7388  O  O   . LEU B  1 418 ? 1.262   24.579  84.539  1.00 93.85  ?  418  LEU B O   1 
ATOM   7389  C  CB  . LEU B  1 418 ? -0.363  24.303  81.641  1.00 87.85  ?  418  LEU B CB  1 
ATOM   7390  C  CG  . LEU B  1 418 ? -0.454  24.740  80.176  1.00 83.37  ?  418  LEU B CG  1 
ATOM   7391  C  CD1 . LEU B  1 418 ? -1.843  25.284  79.890  1.00 84.04  ?  418  LEU B CD1 1 
ATOM   7392  C  CD2 . LEU B  1 418 ? 0.583   25.784  79.850  1.00 83.73  ?  418  LEU B CD2 1 
ATOM   7393  N  N   . ALA B  1 419 ? 0.128   22.658  84.235  1.00 90.64  ?  419  ALA B N   1 
ATOM   7394  C  CA  . ALA B  1 419 ? -0.039  22.443  85.669  1.00 94.36  ?  419  ALA B CA  1 
ATOM   7395  C  C   . ALA B  1 419 ? 1.301   22.216  86.356  1.00 98.25  ?  419  ALA B C   1 
ATOM   7396  O  O   . ALA B  1 419 ? 1.542   22.739  87.452  1.00 103.23 ?  419  ALA B O   1 
ATOM   7397  C  CB  . ALA B  1 419 ? -0.975  21.260  85.918  1.00 93.95  ?  419  ALA B CB  1 
ATOM   7398  N  N   . ALA B  1 420 ? 2.188   21.438  85.729  1.00 94.51  ?  420  ALA B N   1 
ATOM   7399  C  CA  . ALA B  1 420 ? 3.487   21.163  86.335  1.00 95.66  ?  420  ALA B CA  1 
ATOM   7400  C  C   . ALA B  1 420 ? 4.345   22.419  86.439  1.00 97.66  ?  420  ALA B C   1 
ATOM   7401  O  O   . ALA B  1 420 ? 5.221   22.501  87.308  1.00 98.45  ?  420  ALA B O   1 
ATOM   7402  C  CB  . ALA B  1 420 ? 4.219   20.081  85.538  1.00 92.34  ?  420  ALA B CB  1 
ATOM   7403  N  N   . GLN B  1 421 ? 4.117   23.399  85.571  1.00 99.23  ?  421  GLN B N   1 
ATOM   7404  C  CA  . GLN B  1 421 ? 4.904   24.626  85.559  1.00 105.42 ?  421  GLN B CA  1 
ATOM   7405  C  C   . GLN B  1 421 ? 4.291   25.761  86.374  1.00 112.40 ?  421  GLN B C   1 
ATOM   7406  O  O   . GLN B  1 421 ? 4.808   26.882  86.323  1.00 116.30 ?  421  GLN B O   1 
ATOM   7407  C  CB  . GLN B  1 421 ? 5.151   25.075  84.117  1.00 104.17 ?  421  GLN B CB  1 
ATOM   7408  C  CG  . GLN B  1 421 ? 6.533   24.695  83.610  1.00 104.87 ?  421  GLN B CG  1 
ATOM   7409  C  CD  . GLN B  1 421 ? 6.754   23.203  83.514  1.00 104.39 ?  421  GLN B CD  1 
ATOM   7410  O  OE1 . GLN B  1 421 ? 5.998   22.491  82.857  1.00 102.63 ?  421  GLN B OE1 1 
ATOM   7411  N  NE2 . GLN B  1 421 ? 7.800   22.718  84.177  1.00 106.32 ?  421  GLN B NE2 1 
ATOM   7412  N  N   . GLY B  1 422 ? 3.197   25.517  87.093  1.00 114.17 ?  422  GLY B N   1 
ATOM   7413  C  CA  . GLY B  1 422 ? 2.650   26.498  88.010  1.00 117.39 ?  422  GLY B CA  1 
ATOM   7414  C  C   . GLY B  1 422 ? 1.434   27.260  87.532  1.00 115.28 ?  422  GLY B C   1 
ATOM   7415  O  O   . GLY B  1 422 ? 1.017   28.210  88.207  1.00 117.39 ?  422  GLY B O   1 
ATOM   7416  N  N   . ALA B  1 423 ? 0.859   26.890  86.391  1.00 110.85 ?  423  ALA B N   1 
ATOM   7417  C  CA  . ALA B  1 423 ? -0.371  27.509  85.920  1.00 109.25 ?  423  ALA B CA  1 
ATOM   7418  C  C   . ALA B  1 423 ? -1.585  26.943  86.649  1.00 107.63 ?  423  ALA B C   1 
ATOM   7419  O  O   . ALA B  1 423 ? -1.568  25.818  87.160  1.00 104.98 ?  423  ALA B O   1 
ATOM   7420  C  CB  . ALA B  1 423 ? -0.532  27.309  84.410  1.00 104.90 ?  423  ALA B CB  1 
ATOM   7421  N  N   . ARG B  1 424 ? -2.644  27.745  86.696  1.00 109.32 ?  424  ARG B N   1 
ATOM   7422  C  CA  . ARG B  1 424 ? -3.935  27.311  87.216  1.00 112.49 ?  424  ARG B CA  1 
ATOM   7423  C  C   . ARG B  1 424 ? -4.759  26.813  86.035  1.00 108.86 ?  424  ARG B C   1 
ATOM   7424  O  O   . ARG B  1 424 ? -5.150  27.601  85.167  1.00 109.91 ?  424  ARG B O   1 
ATOM   7425  C  CB  . ARG B  1 424 ? -4.631  28.458  87.943  1.00 119.89 ?  424  ARG B CB  1 
ATOM   7426  C  CG  . ARG B  1 424 ? -5.149  28.104  89.326  1.00 128.15 ?  424  ARG B CG  1 
ATOM   7427  C  CD  . ARG B  1 424 ? -5.553  29.360  90.094  1.00 137.68 ?  424  ARG B CD  1 
ATOM   7428  N  NE  . ARG B  1 424 ? -6.249  29.049  91.340  1.00 145.28 ?  424  ARG B NE  1 
ATOM   7429  C  CZ  . ARG B  1 424 ? -7.540  28.738  91.412  1.00 149.02 ?  424  ARG B CZ  1 
ATOM   7430  N  NH1 . ARG B  1 424 ? -8.271  28.701  90.304  1.00 148.52 ?  424  ARG B NH1 1 
ATOM   7431  N  NH2 . ARG B  1 424 ? -8.099  28.464  92.584  1.00 152.38 ?  424  ARG B NH2 1 
ATOM   7432  N  N   . VAL B  1 425 ? -5.025  25.510  86.001  1.00 102.99 ?  425  VAL B N   1 
ATOM   7433  C  CA  . VAL B  1 425 ? -5.598  24.858  84.829  1.00 99.14  ?  425  VAL B CA  1 
ATOM   7434  C  C   . VAL B  1 425 ? -6.944  24.252  85.200  1.00 100.72 ?  425  VAL B C   1 
ATOM   7435  O  O   . VAL B  1 425 ? -7.075  23.609  86.248  1.00 103.02 ?  425  VAL B O   1 
ATOM   7436  C  CB  . VAL B  1 425 ? -4.654  23.778  84.261  1.00 95.17  ?  425  VAL B CB  1 
ATOM   7437  C  CG1 . VAL B  1 425 ? -5.268  23.127  83.040  1.00 91.56  ?  425  VAL B CG1 1 
ATOM   7438  C  CG2 . VAL B  1 425 ? -3.299  24.377  83.911  1.00 93.98  ?  425  VAL B CG2 1 
ATOM   7439  N  N   . TYR B  1 426 ? -7.938  24.459  84.339  1.00 101.41 ?  426  TYR B N   1 
ATOM   7440  C  CA  . TYR B  1 426 ? -9.222  23.774  84.417  1.00 103.69 ?  426  TYR B CA  1 
ATOM   7441  C  C   . TYR B  1 426 ? -9.420  22.954  83.149  1.00 101.59 ?  426  TYR B C   1 
ATOM   7442  O  O   . TYR B  1 426 ? -9.004  23.369  82.063  1.00 101.71 ?  426  TYR B O   1 
ATOM   7443  C  CB  . TYR B  1 426 ? -10.371 24.771  84.594  1.00 104.09 ?  426  TYR B CB  1 
ATOM   7444  C  CG  . TYR B  1 426 ? -10.305 25.545  85.890  1.00 111.19 ?  426  TYR B CG  1 
ATOM   7445  C  CD1 . TYR B  1 426 ? -9.527  26.690  86.001  1.00 112.68 ?  426  TYR B CD1 1 
ATOM   7446  C  CD2 . TYR B  1 426 ? -11.028 25.135  87.003  1.00 114.71 ?  426  TYR B CD2 1 
ATOM   7447  C  CE1 . TYR B  1 426 ? -9.460  27.400  87.188  1.00 114.63 ?  426  TYR B CE1 1 
ATOM   7448  C  CE2 . TYR B  1 426 ? -10.967 25.840  88.195  1.00 117.48 ?  426  TYR B CE2 1 
ATOM   7449  C  CZ  . TYR B  1 426 ? -10.182 26.970  88.278  1.00 118.41 ?  426  TYR B CZ  1 
ATOM   7450  O  OH  . TYR B  1 426 ? -10.118 27.674  89.455  1.00 124.67 ?  426  TYR B OH  1 
ATOM   7451  N  N   . ALA B  1 427 ? -10.051 21.788  83.279  1.00 100.31 ?  427  ALA B N   1 
ATOM   7452  C  CA  . ALA B  1 427 ? -10.191 20.876  82.151  1.00 96.38  ?  427  ALA B CA  1 
ATOM   7453  C  C   . ALA B  1 427 ? -11.619 20.362  82.045  1.00 96.93  ?  427  ALA B C   1 
ATOM   7454  O  O   . ALA B  1 427 ? -12.245 20.017  83.054  1.00 100.29 ?  427  ALA B O   1 
ATOM   7455  C  CB  . ALA B  1 427 ? -9.220  19.697  82.268  1.00 94.93  ?  427  ALA B CB  1 
ATOM   7456  N  N   . TYR B  1 428 ? -12.120 20.288  80.812  1.00 95.26  ?  428  TYR B N   1 
ATOM   7457  C  CA  . TYR B  1 428 ? -13.491 19.864  80.563  1.00 99.30  ?  428  TYR B CA  1 
ATOM   7458  C  C   . TYR B  1 428 ? -13.540 18.895  79.387  1.00 97.24  ?  428  TYR B C   1 
ATOM   7459  O  O   . TYR B  1 428 ? -12.693 18.925  78.486  1.00 95.47  ?  428  TYR B O   1 
ATOM   7460  C  CB  . TYR B  1 428 ? -14.413 21.066  80.277  1.00 103.94 ?  428  TYR B CB  1 
ATOM   7461  C  CG  . TYR B  1 428 ? -14.179 21.709  78.919  1.00 104.25 ?  428  TYR B CG  1 
ATOM   7462  C  CD1 . TYR B  1 428 ? -14.750 21.176  77.764  1.00 103.25 ?  428  TYR B CD1 1 
ATOM   7463  C  CD2 . TYR B  1 428 ? -13.392 22.848  78.791  1.00 104.79 ?  428  TYR B CD2 1 
ATOM   7464  C  CE1 . TYR B  1 428 ? -14.534 21.742  76.530  1.00 100.93 ?  428  TYR B CE1 1 
ATOM   7465  C  CE2 . TYR B  1 428 ? -13.178 23.431  77.553  1.00 102.32 ?  428  TYR B CE2 1 
ATOM   7466  C  CZ  . TYR B  1 428 ? -13.752 22.869  76.427  1.00 100.73 ?  428  TYR B CZ  1 
ATOM   7467  O  OH  . TYR B  1 428 ? -13.548 23.427  75.189  1.00 98.91  ?  428  TYR B OH  1 
ATOM   7468  N  N   . ILE B  1 429 ? -14.582 18.060  79.388  1.00 97.23  ?  429  ILE B N   1 
ATOM   7469  C  CA  . ILE B  1 429 ? -14.929 17.203  78.256  1.00 93.28  ?  429  ILE B CA  1 
ATOM   7470  C  C   . ILE B  1 429 ? -16.417 17.382  77.972  1.00 95.01  ?  429  ILE B C   1 
ATOM   7471  O  O   . ILE B  1 429 ? -17.251 17.196  78.866  1.00 97.77  ?  429  ILE B O   1 
ATOM   7472  C  CB  . ILE B  1 429 ? -14.594 15.724  78.516  1.00 90.99  ?  429  ILE B CB  1 
ATOM   7473  C  CG1 . ILE B  1 429 ? -15.196 14.839  77.423  1.00 87.82  ?  429  ILE B CG1 1 
ATOM   7474  C  CG2 . ILE B  1 429 ? -15.083 15.290  79.891  1.00 95.02  ?  429  ILE B CG2 1 
ATOM   7475  C  CD1 . ILE B  1 429 ? -14.896 13.365  77.596  1.00 86.19  ?  429  ILE B CD1 1 
ATOM   7476  N  N   . PHE B  1 430 ? -16.750 17.745  76.734  1.00 93.26  ?  430  PHE B N   1 
ATOM   7477  C  CA  . PHE B  1 430 ? -18.115 18.089  76.352  1.00 96.52  ?  430  PHE B CA  1 
ATOM   7478  C  C   . PHE B  1 430 ? -18.765 16.838  75.768  1.00 97.10  ?  430  PHE B C   1 
ATOM   7479  O  O   . PHE B  1 430 ? -18.433 16.418  74.655  1.00 95.98  ?  430  PHE B O   1 
ATOM   7480  C  CB  . PHE B  1 430 ? -18.076 19.239  75.345  1.00 95.48  ?  430  PHE B CB  1 
ATOM   7481  C  CG  . PHE B  1 430 ? -19.415 19.852  75.035  1.00 98.82  ?  430  PHE B CG  1 
ATOM   7482  C  CD1 . PHE B  1 430 ? -19.911 20.892  75.806  1.00 102.52 ?  430  PHE B CD1 1 
ATOM   7483  C  CD2 . PHE B  1 430 ? -20.152 19.429  73.941  1.00 98.59  ?  430  PHE B CD2 1 
ATOM   7484  C  CE1 . PHE B  1 430 ? -21.132 21.477  75.512  1.00 105.52 ?  430  PHE B CE1 1 
ATOM   7485  C  CE2 . PHE B  1 430 ? -21.374 20.011  73.644  1.00 101.50 ?  430  PHE B CE2 1 
ATOM   7486  C  CZ  . PHE B  1 430 ? -21.865 21.034  74.432  1.00 104.78 ?  430  PHE B CZ  1 
ATOM   7487  N  N   . GLU B  1 431 ? -19.693 16.245  76.518  1.00 100.24 ?  431  GLU B N   1 
ATOM   7488  C  CA  . GLU B  1 431 ? -20.305 14.977  76.139  1.00 101.26 ?  431  GLU B CA  1 
ATOM   7489  C  C   . GLU B  1 431 ? -21.687 15.109  75.501  1.00 103.67 ?  431  GLU B C   1 
ATOM   7490  O  O   . GLU B  1 431 ? -22.276 14.089  75.129  1.00 104.77 ?  431  GLU B O   1 
ATOM   7491  C  CB  . GLU B  1 431 ? -20.361 14.047  77.356  1.00 104.53 ?  431  GLU B CB  1 
ATOM   7492  C  CG  . GLU B  1 431 ? -18.981 13.516  77.741  1.00 103.31 ?  431  GLU B CG  1 
ATOM   7493  C  CD  . GLU B  1 431 ? -19.017 12.485  78.853  1.00 106.90 ?  431  GLU B CD  1 
ATOM   7494  O  OE1 . GLU B  1 431 ? -19.943 12.535  79.693  1.00 112.05 ?  431  GLU B OE1 1 
ATOM   7495  O  OE2 . GLU B  1 431 ? -18.109 11.627  78.887  1.00 104.20 ?  431  GLU B OE2 1 
ATOM   7496  N  N   . HIS B  1 432 ? -22.218 16.320  75.362  1.00 104.75 ?  432  HIS B N   1 
ATOM   7497  C  CA  . HIS B  1 432 ? -23.594 16.514  74.915  1.00 109.80 ?  432  HIS B CA  1 
ATOM   7498  C  C   . HIS B  1 432 ? -23.654 16.729  73.404  1.00 108.75 ?  432  HIS B C   1 
ATOM   7499  O  O   . HIS B  1 432 ? -22.916 17.554  72.856  1.00 106.74 ?  432  HIS B O   1 
ATOM   7500  C  CB  . HIS B  1 432 ? -24.216 17.707  75.643  1.00 115.28 ?  432  HIS B CB  1 
ATOM   7501  C  CG  . HIS B  1 432 ? -25.541 18.134  75.089  1.00 120.10 ?  432  HIS B CG  1 
ATOM   7502  N  ND1 . HIS B  1 432 ? -26.660 17.329  75.128  1.00 124.18 ?  432  HIS B ND1 1 
ATOM   7503  C  CD2 . HIS B  1 432 ? -25.923 19.280  74.477  1.00 120.87 ?  432  HIS B CD2 1 
ATOM   7504  C  CE1 . HIS B  1 432 ? -27.675 17.964  74.570  1.00 126.56 ?  432  HIS B CE1 1 
ATOM   7505  N  NE2 . HIS B  1 432 ? -27.254 19.149  74.165  1.00 124.73 ?  432  HIS B NE2 1 
ATOM   7506  N  N   . ARG B  1 433 ? -24.538 15.990  72.734  1.00 109.98 ?  433  ARG B N   1 
ATOM   7507  C  CA  . ARG B  1 433 ? -24.761 16.156  71.302  1.00 107.37 ?  433  ARG B CA  1 
ATOM   7508  C  C   . ARG B  1 433 ? -25.936 17.095  71.056  1.00 111.21 ?  433  ARG B C   1 
ATOM   7509  O  O   . ARG B  1 433 ? -26.988 16.964  71.691  1.00 115.31 ?  433  ARG B O   1 
ATOM   7510  C  CB  . ARG B  1 433 ? -25.011 14.808  70.624  1.00 105.26 ?  433  ARG B CB  1 
ATOM   7511  C  CG  . ARG B  1 433 ? -25.671 14.921  69.255  1.00 103.74 ?  433  ARG B CG  1 
ATOM   7512  C  CD  . ARG B  1 433 ? -25.535 13.642  68.451  1.00 101.45 ?  433  ARG B CD  1 
ATOM   7513  N  NE  . ARG B  1 433 ? -26.424 13.631  67.293  1.00 102.45 ?  433  ARG B NE  1 
ATOM   7514  C  CZ  . ARG B  1 433 ? -26.168 12.991  66.157  1.00 100.38 ?  433  ARG B CZ  1 
ATOM   7515  N  NH1 . ARG B  1 433 ? -25.030 12.327  66.007  1.00 96.91  ?  433  ARG B NH1 1 
ATOM   7516  N  NH2 . ARG B  1 433 ? -27.044 13.030  65.162  1.00 102.15 ?  433  ARG B NH2 1 
ATOM   7517  N  N   . ALA B  1 434 ? -25.749 18.039  70.134  1.00 109.51 ?  434  ALA B N   1 
ATOM   7518  C  CA  . ALA B  1 434 ? -26.796 19.000  69.814  1.00 112.05 ?  434  ALA B CA  1 
ATOM   7519  C  C   . ALA B  1 434 ? -27.980 18.309  69.152  1.00 113.66 ?  434  ALA B C   1 
ATOM   7520  O  O   . ALA B  1 434 ? -27.814 17.414  68.316  1.00 113.00 ?  434  ALA B O   1 
ATOM   7521  C  CB  . ALA B  1 434 ? -26.254 20.097  68.897  1.00 109.66 ?  434  ALA B CB  1 
ATOM   7522  N  N   . SER B  1 435 ? -29.187 18.734  69.534  1.00 116.29 ?  435  SER B N   1 
ATOM   7523  C  CA  . SER B  1 435 ? -30.393 18.151  68.956  1.00 119.49 ?  435  SER B CA  1 
ATOM   7524  C  C   . SER B  1 435 ? -30.513 18.463  67.471  1.00 117.81 ?  435  SER B C   1 
ATOM   7525  O  O   . SER B  1 435 ? -31.122 17.691  66.720  1.00 117.46 ?  435  SER B O   1 
ATOM   7526  C  CB  . SER B  1 435 ? -31.627 18.651  69.710  1.00 125.71 ?  435  SER B CB  1 
ATOM   7527  O  OG  . SER B  1 435 ? -31.704 20.068  69.710  1.00 121.20 ?  435  SER B OG  1 
ATOM   7528  N  N   . THR B  1 436 ? -29.928 19.575  67.030  1.00 117.13 ?  436  THR B N   1 
ATOM   7529  C  CA  . THR B  1 436 ? -30.016 20.040  65.651  1.00 118.32 ?  436  THR B CA  1 
ATOM   7530  C  C   . THR B  1 436 ? -28.889 19.500  64.775  1.00 112.58 ?  436  THR B C   1 
ATOM   7531  O  O   . THR B  1 436 ? -28.778 19.900  63.611  1.00 110.13 ?  436  THR B O   1 
ATOM   7532  C  CB  . THR B  1 436 ? -30.020 21.573  65.609  1.00 122.48 ?  436  THR B CB  1 
ATOM   7533  O  OG1 . THR B  1 436 ? -28.762 22.077  66.080  1.00 121.22 ?  436  THR B OG1 1 
ATOM   7534  C  CG2 . THR B  1 436 ? -31.144 22.127  66.483  1.00 128.07 ?  436  THR B CG2 1 
ATOM   7535  N  N   . LEU B  1 437 ? -28.046 18.622  65.315  1.00 110.92 ?  437  LEU B N   1 
ATOM   7536  C  CA  . LEU B  1 437 ? -26.891 18.114  64.583  1.00 106.83 ?  437  LEU B CA  1 
ATOM   7537  C  C   . LEU B  1 437 ? -27.320 17.381  63.315  1.00 107.96 ?  437  LEU B C   1 
ATOM   7538  O  O   . LEU B  1 437 ? -28.176 16.491  63.354  1.00 112.32 ?  437  LEU B O   1 
ATOM   7539  C  CB  . LEU B  1 437 ? -26.085 17.184  65.486  1.00 103.81 ?  437  LEU B CB  1 
ATOM   7540  C  CG  . LEU B  1 437 ? -24.642 16.894  65.083  1.00 97.74  ?  437  LEU B CG  1 
ATOM   7541  C  CD1 . LEU B  1 437 ? -23.902 18.187  64.802  1.00 93.62  ?  437  LEU B CD1 1 
ATOM   7542  C  CD2 . LEU B  1 437 ? -23.952 16.105  66.175  1.00 97.81  ?  437  LEU B CD2 1 
ATOM   7543  N  N   . THR B  1 438 ? -26.724 17.767  62.184  1.00 103.83 ?  438  THR B N   1 
ATOM   7544  C  CA  . THR B  1 438 ? -27.030 17.174  60.887  1.00 102.06 ?  438  THR B CA  1 
ATOM   7545  C  C   . THR B  1 438 ? -26.124 16.001  60.521  1.00 99.57  ?  438  THR B C   1 
ATOM   7546  O  O   . THR B  1 438 ? -26.387 15.326  59.519  1.00 98.64  ?  438  THR B O   1 
ATOM   7547  C  CB  . THR B  1 438 ? -26.948 18.242  59.789  1.00 98.53  ?  438  THR B CB  1 
ATOM   7548  O  OG1 . THR B  1 438 ? -25.825 19.099  60.032  1.00 94.54  ?  438  THR B OG1 1 
ATOM   7549  C  CG2 . THR B  1 438 ? -28.218 19.078  59.768  1.00 101.35 ?  438  THR B CG2 1 
ATOM   7550  N  N   . TRP B  1 439 ? -25.073 15.740  61.297  1.00 98.43  ?  439  TRP B N   1 
ATOM   7551  C  CA  . TRP B  1 439 ? -24.176 14.630  61.013  1.00 97.02  ?  439  TRP B CA  1 
ATOM   7552  C  C   . TRP B  1 439 ? -24.815 13.311  61.449  1.00 99.37  ?  439  TRP B C   1 
ATOM   7553  O  O   . TRP B  1 439 ? -25.777 13.304  62.223  1.00 104.21 ?  439  TRP B O   1 
ATOM   7554  C  CB  . TRP B  1 439 ? -22.837 14.849  61.717  1.00 94.63  ?  439  TRP B CB  1 
ATOM   7555  C  CG  . TRP B  1 439 ? -22.017 15.962  61.117  1.00 93.23  ?  439  TRP B CG  1 
ATOM   7556  C  CD1 . TRP B  1 439 ? -21.893 17.234  61.594  1.00 94.76  ?  439  TRP B CD1 1 
ATOM   7557  C  CD2 . TRP B  1 439 ? -21.214 15.902  59.926  1.00 89.97  ?  439  TRP B CD2 1 
ATOM   7558  N  NE1 . TRP B  1 439 ? -21.065 17.970  60.778  1.00 92.52  ?  439  TRP B NE1 1 
ATOM   7559  C  CE2 . TRP B  1 439 ? -20.635 17.176  59.748  1.00 89.09  ?  439  TRP B CE2 1 
ATOM   7560  C  CE3 . TRP B  1 439 ? -20.930 14.897  58.995  1.00 87.34  ?  439  TRP B CE3 1 
ATOM   7561  C  CZ2 . TRP B  1 439 ? -19.788 17.470  58.679  1.00 84.80  ?  439  TRP B CZ2 1 
ATOM   7562  C  CZ3 . TRP B  1 439 ? -20.087 15.192  57.935  1.00 83.95  ?  439  TRP B CZ3 1 
ATOM   7563  C  CH2 . TRP B  1 439 ? -19.526 16.467  57.787  1.00 82.66  ?  439  TRP B CH2 1 
ATOM   7564  N  N   . PRO B  1 440 ? -24.319 12.177  60.949  1.00 95.27  ?  440  PRO B N   1 
ATOM   7565  C  CA  . PRO B  1 440 ? -24.908 10.890  61.335  1.00 95.45  ?  440  PRO B CA  1 
ATOM   7566  C  C   . PRO B  1 440 ? -24.685 10.580  62.807  1.00 94.29  ?  440  PRO B C   1 
ATOM   7567  O  O   . PRO B  1 440 ? -23.830 11.161  63.480  1.00 90.39  ?  440  PRO B O   1 
ATOM   7568  C  CB  . PRO B  1 440 ? -24.187 9.878   60.437  1.00 93.19  ?  440  PRO B CB  1 
ATOM   7569  C  CG  . PRO B  1 440 ? -22.931 10.554  60.038  1.00 89.95  ?  440  PRO B CG  1 
ATOM   7570  C  CD  . PRO B  1 440 ? -23.278 12.006  59.921  1.00 91.29  ?  440  PRO B CD  1 
ATOM   7571  N  N   . LEU B  1 441 ? -25.491 9.637   63.302  1.00 98.18  ?  441  LEU B N   1 
ATOM   7572  C  CA  . LEU B  1 441 ? -25.506 9.336   64.730  1.00 100.53 ?  441  LEU B CA  1 
ATOM   7573  C  C   . LEU B  1 441 ? -24.180 8.755   65.204  1.00 97.65  ?  441  LEU B C   1 
ATOM   7574  O  O   . LEU B  1 441 ? -23.764 9.006   66.342  1.00 96.54  ?  441  LEU B O   1 
ATOM   7575  C  CB  . LEU B  1 441 ? -26.659 8.375   65.039  1.00 105.37 ?  441  LEU B CB  1 
ATOM   7576  C  CG  . LEU B  1 441 ? -26.999 8.026   66.494  1.00 108.22 ?  441  LEU B CG  1 
ATOM   7577  C  CD1 . LEU B  1 441 ? -26.218 6.804   66.986  1.00 107.55 ?  441  LEU B CD1 1 
ATOM   7578  C  CD2 . LEU B  1 441 ? -26.791 9.222   67.419  1.00 107.34 ?  441  LEU B CD2 1 
ATOM   7579  N  N   . TRP B  1 442 ? -23.496 7.990   64.352  1.00 96.57  ?  442  TRP B N   1 
ATOM   7580  C  CA  . TRP B  1 442 ? -22.293 7.288   64.782  1.00 95.12  ?  442  TRP B CA  1 
ATOM   7581  C  C   . TRP B  1 442 ? -21.113 8.216   65.048  1.00 93.16  ?  442  TRP B C   1 
ATOM   7582  O  O   . TRP B  1 442 ? -20.096 7.753   65.582  1.00 91.23  ?  442  TRP B O   1 
ATOM   7583  C  CB  . TRP B  1 442 ? -21.903 6.238   63.741  1.00 92.95  ?  442  TRP B CB  1 
ATOM   7584  C  CG  . TRP B  1 442 ? -21.546 6.798   62.406  1.00 89.27  ?  442  TRP B CG  1 
ATOM   7585  C  CD1 . TRP B  1 442 ? -22.359 6.889   61.317  1.00 91.17  ?  442  TRP B CD1 1 
ATOM   7586  C  CD2 . TRP B  1 442 ? -20.271 7.317   62.002  1.00 83.87  ?  442  TRP B CD2 1 
ATOM   7587  N  NE1 . TRP B  1 442 ? -21.676 7.444   60.262  1.00 88.50  ?  442  TRP B NE1 1 
ATOM   7588  C  CE2 . TRP B  1 442 ? -20.392 7.715   60.658  1.00 83.92  ?  442  TRP B CE2 1 
ATOM   7589  C  CE3 . TRP B  1 442 ? -19.043 7.488   62.648  1.00 79.88  ?  442  TRP B CE3 1 
ATOM   7590  C  CZ2 . TRP B  1 442 ? -19.332 8.272   59.947  1.00 79.95  ?  442  TRP B CZ2 1 
ATOM   7591  C  CZ3 . TRP B  1 442 ? -17.993 8.045   61.941  1.00 76.41  ?  442  TRP B CZ3 1 
ATOM   7592  C  CH2 . TRP B  1 442 ? -18.144 8.430   60.605  1.00 76.37  ?  442  TRP B CH2 1 
ATOM   7593  N  N   . MET B  1 443 ? -21.215 9.500   64.688  1.00 92.66  ?  443  MET B N   1 
ATOM   7594  C  CA  . MET B  1 443 ? -20.145 10.457  64.942  1.00 88.30  ?  443  MET B CA  1 
ATOM   7595  C  C   . MET B  1 443 ? -20.196 11.054  66.343  1.00 87.95  ?  443  MET B C   1 
ATOM   7596  O  O   . MET B  1 443 ? -19.225 11.700  66.753  1.00 85.02  ?  443  MET B O   1 
ATOM   7597  C  CB  . MET B  1 443 ? -20.183 11.580  63.903  1.00 87.44  ?  443  MET B CB  1 
ATOM   7598  C  CG  . MET B  1 443 ? -19.851 11.128  62.486  1.00 86.79  ?  443  MET B CG  1 
ATOM   7599  S  SD  . MET B  1 443 ? -19.693 12.524  61.354  1.00 86.29  ?  443  MET B SD  1 
ATOM   7600  C  CE  . MET B  1 443 ? -19.370 11.701  59.795  1.00 84.38  ?  443  MET B CE  1 
ATOM   7601  N  N   . GLY B  1 444 ? -21.287 10.852  67.079  1.00 91.18  ?  444  GLY B N   1 
ATOM   7602  C  CA  . GLY B  1 444 ? -21.346 11.315  68.461  1.00 92.46  ?  444  GLY B CA  1 
ATOM   7603  C  C   . GLY B  1 444 ? -21.359 12.830  68.543  1.00 91.59  ?  444  GLY B C   1 
ATOM   7604  O  O   . GLY B  1 444 ? -22.158 13.503  67.883  1.00 93.52  ?  444  GLY B O   1 
ATOM   7605  N  N   . VAL B  1 445 ? -20.474 13.377  69.371  1.00 89.15  ?  445  VAL B N   1 
ATOM   7606  C  CA  . VAL B  1 445 ? -20.257 14.818  69.456  1.00 88.31  ?  445  VAL B CA  1 
ATOM   7607  C  C   . VAL B  1 445 ? -19.029 15.139  68.609  1.00 86.77  ?  445  VAL B C   1 
ATOM   7608  O  O   . VAL B  1 445 ? -17.902 14.860  69.048  1.00 86.75  ?  445  VAL B O   1 
ATOM   7609  C  CB  . VAL B  1 445 ? -20.056 15.270  70.908  1.00 88.65  ?  445  VAL B CB  1 
ATOM   7610  C  CG1 . VAL B  1 445 ? -19.856 16.777  70.980  1.00 88.99  ?  445  VAL B CG1 1 
ATOM   7611  C  CG2 . VAL B  1 445 ? -21.228 14.829  71.767  1.00 90.30  ?  445  VAL B CG2 1 
ATOM   7612  N  N   . PRO B  1 446 ? -19.185 15.738  67.433  1.00 85.88  ?  446  PRO B N   1 
ATOM   7613  C  CA  . PRO B  1 446 ? -18.058 15.888  66.509  1.00 82.15  ?  446  PRO B CA  1 
ATOM   7614  C  C   . PRO B  1 446 ? -17.205 17.101  66.866  1.00 82.02  ?  446  PRO B C   1 
ATOM   7615  O  O   . PRO B  1 446 ? -17.481 17.844  67.807  1.00 83.59  ?  446  PRO B O   1 
ATOM   7616  C  CB  . PRO B  1 446 ? -18.738 16.061  65.145  1.00 80.87  ?  446  PRO B CB  1 
ATOM   7617  C  CG  . PRO B  1 446 ? -20.168 15.645  65.353  1.00 84.31  ?  446  PRO B CG  1 
ATOM   7618  C  CD  . PRO B  1 446 ? -20.461 16.031  66.767  1.00 87.50  ?  446  PRO B CD  1 
ATOM   7619  N  N   . HIS B  1 447 ? -16.162 17.300  66.065  1.00 79.94  ?  447  HIS B N   1 
ATOM   7620  C  CA  . HIS B  1 447 ? -15.159 18.313  66.358  1.00 78.92  ?  447  HIS B CA  1 
ATOM   7621  C  C   . HIS B  1 447 ? -15.767 19.703  66.189  1.00 83.06  ?  447  HIS B C   1 
ATOM   7622  O  O   . HIS B  1 447 ? -16.282 20.040  65.116  1.00 84.72  ?  447  HIS B O   1 
ATOM   7623  C  CB  . HIS B  1 447 ? -13.965 18.103  65.425  1.00 72.38  ?  447  HIS B CB  1 
ATOM   7624  C  CG  . HIS B  1 447 ? -12.833 19.058  65.638  1.00 68.90  ?  447  HIS B CG  1 
ATOM   7625  N  ND1 . HIS B  1 447 ? -12.238 19.254  66.866  1.00 69.14  ?  447  HIS B ND1 1 
ATOM   7626  C  CD2 . HIS B  1 447 ? -12.166 19.852  64.766  1.00 66.76  ?  447  HIS B CD2 1 
ATOM   7627  C  CE1 . HIS B  1 447 ? -11.264 20.138  66.744  1.00 68.05  ?  447  HIS B CE1 1 
ATOM   7628  N  NE2 . HIS B  1 447 ? -11.199 20.516  65.480  1.00 66.58  ?  447  HIS B NE2 1 
ATOM   7629  N  N   . GLY B  1 448 ? -15.713 20.508  67.251  1.00 83.64  ?  448  GLY B N   1 
ATOM   7630  C  CA  . GLY B  1 448 ? -16.150 21.888  67.190  1.00 84.34  ?  448  GLY B CA  1 
ATOM   7631  C  C   . GLY B  1 448 ? -17.633 22.128  67.359  1.00 87.57  ?  448  GLY B C   1 
ATOM   7632  O  O   . GLY B  1 448 ? -18.099 23.235  67.060  1.00 89.00  ?  448  GLY B O   1 
ATOM   7633  N  N   . TYR B  1 449 ? -18.394 21.140  67.824  1.00 88.48  ?  449  TYR B N   1 
ATOM   7634  C  CA  . TYR B  1 449 ? -19.831 21.302  68.004  1.00 91.88  ?  449  TYR B CA  1 
ATOM   7635  C  C   . TYR B  1 449 ? -20.220 21.714  69.420  1.00 95.57  ?  449  TYR B C   1 
ATOM   7636  O  O   . TYR B  1 449 ? -21.415 21.747  69.737  1.00 100.78 ?  449  TYR B O   1 
ATOM   7637  C  CB  . TYR B  1 449 ? -20.568 20.038  67.561  1.00 92.27  ?  449  TYR B CB  1 
ATOM   7638  C  CG  . TYR B  1 449 ? -20.774 20.073  66.070  1.00 92.46  ?  449  TYR B CG  1 
ATOM   7639  C  CD1 . TYR B  1 449 ? -21.742 20.899  65.508  1.00 95.28  ?  449  TYR B CD1 1 
ATOM   7640  C  CD2 . TYR B  1 449 ? -19.966 19.336  65.216  1.00 90.33  ?  449  TYR B CD2 1 
ATOM   7641  C  CE1 . TYR B  1 449 ? -21.921 20.967  64.137  1.00 94.75  ?  449  TYR B CE1 1 
ATOM   7642  C  CE2 . TYR B  1 449 ? -20.140 19.393  63.841  1.00 90.13  ?  449  TYR B CE2 1 
ATOM   7643  C  CZ  . TYR B  1 449 ? -21.119 20.209  63.309  1.00 92.58  ?  449  TYR B CZ  1 
ATOM   7644  O  OH  . TYR B  1 449 ? -21.292 20.269  61.944  1.00 92.97  ?  449  TYR B OH  1 
ATOM   7645  N  N   . GLU B  1 450 ? -19.244 21.998  70.283  1.00 92.89  ?  450  GLU B N   1 
ATOM   7646  C  CA  . GLU B  1 450 ? -19.520 22.697  71.532  1.00 94.44  ?  450  GLU B CA  1 
ATOM   7647  C  C   . GLU B  1 450 ? -19.627 24.207  71.347  1.00 97.50  ?  450  GLU B C   1 
ATOM   7648  O  O   . GLU B  1 450 ? -20.086 24.894  72.268  1.00 100.81 ?  450  GLU B O   1 
ATOM   7649  C  CB  . GLU B  1 450 ? -18.429 22.401  72.564  1.00 91.52  ?  450  GLU B CB  1 
ATOM   7650  C  CG  . GLU B  1 450 ? -17.254 23.376  72.536  1.00 90.34  ?  450  GLU B CG  1 
ATOM   7651  C  CD  . GLU B  1 450 ? -16.234 23.069  71.455  1.00 88.77  ?  450  GLU B CD  1 
ATOM   7652  O  OE1 . GLU B  1 450 ? -16.619 22.594  70.366  1.00 89.11  ?  450  GLU B OE1 1 
ATOM   7653  O  OE2 . GLU B  1 450 ? -15.033 23.307  71.698  1.00 87.70  ?  450  GLU B OE2 1 
ATOM   7654  N  N   . ILE B  1 451 ? -19.219 24.736  70.186  1.00 96.04  ?  451  ILE B N   1 
ATOM   7655  C  CA  . ILE B  1 451 ? -19.184 26.185  69.986  1.00 95.00  ?  451  ILE B CA  1 
ATOM   7656  C  C   . ILE B  1 451 ? -20.593 26.764  69.961  1.00 100.01 ?  451  ILE B C   1 
ATOM   7657  O  O   . ILE B  1 451 ? -20.832 27.860  70.480  1.00 102.51 ?  451  ILE B O   1 
ATOM   7658  C  CB  . ILE B  1 451 ? -18.410 26.538  68.703  1.00 87.49  ?  451  ILE B CB  1 
ATOM   7659  C  CG1 . ILE B  1 451 ? -17.080 25.792  68.650  1.00 83.17  ?  451  ILE B CG1 1 
ATOM   7660  C  CG2 . ILE B  1 451 ? -18.162 28.036  68.626  1.00 86.90  ?  451  ILE B CG2 1 
ATOM   7661  C  CD1 . ILE B  1 451 ? -16.272 26.077  67.401  1.00 80.05  ?  451  ILE B CD1 1 
ATOM   7662  N  N   . GLU B  1 452 ? -21.541 26.048  69.346  1.00 101.44 ?  452  GLU B N   1 
ATOM   7663  C  CA  . GLU B  1 452 ? -22.923 26.516  69.307  1.00 105.08 ?  452  GLU B CA  1 
ATOM   7664  C  C   . GLU B  1 452 ? -23.434 26.842  70.706  1.00 109.81 ?  452  GLU B C   1 
ATOM   7665  O  O   . GLU B  1 452 ? -24.140 27.837  70.907  1.00 113.88 ?  452  GLU B O   1 
ATOM   7666  C  CB  . GLU B  1 452 ? -23.817 25.461  68.648  1.00 104.45 ?  452  GLU B CB  1 
ATOM   7667  C  CG  . GLU B  1 452 ? -23.360 24.999  67.268  1.00 100.61 ?  452  GLU B CG  1 
ATOM   7668  C  CD  . GLU B  1 452 ? -24.255 23.911  66.694  1.00 102.29 ?  452  GLU B CD  1 
ATOM   7669  O  OE1 . GLU B  1 452 ? -24.969 23.255  67.482  1.00 104.74 ?  452  GLU B OE1 1 
ATOM   7670  O  OE2 . GLU B  1 452 ? -24.247 23.708  65.460  1.00 101.65 ?  452  GLU B OE2 1 
ATOM   7671  N  N   . PHE B  1 453 ? -23.085 26.009  71.689  1.00 109.51 ?  453  PHE B N   1 
ATOM   7672  C  CA  . PHE B  1 453 ? -23.588 26.184  73.048  1.00 113.12 ?  453  PHE B CA  1 
ATOM   7673  C  C   . PHE B  1 453 ? -22.806 27.233  73.832  1.00 113.14 ?  453  PHE B C   1 
ATOM   7674  O  O   . PHE B  1 453 ? -23.389 27.956  74.646  1.00 117.65 ?  453  PHE B O   1 
ATOM   7675  C  CB  . PHE B  1 453 ? -23.575 24.841  73.769  1.00 113.62 ?  453  PHE B CB  1 
ATOM   7676  C  CG  . PHE B  1 453 ? -24.466 23.818  73.132  1.00 115.18 ?  453  PHE B CG  1 
ATOM   7677  C  CD1 . PHE B  1 453 ? -24.031 23.081  72.041  1.00 112.49 ?  453  PHE B CD1 1 
ATOM   7678  C  CD2 . PHE B  1 453 ? -25.745 23.604  73.612  1.00 119.97 ?  453  PHE B CD2 1 
ATOM   7679  C  CE1 . PHE B  1 453 ? -24.857 22.148  71.446  1.00 113.86 ?  453  PHE B CE1 1 
ATOM   7680  C  CE2 . PHE B  1 453 ? -26.574 22.670  73.024  1.00 121.23 ?  453  PHE B CE2 1 
ATOM   7681  C  CZ  . PHE B  1 453 ? -26.131 21.941  71.941  1.00 118.20 ?  453  PHE B CZ  1 
ATOM   7682  N  N   . ILE B  1 454 ? -21.492 27.336  73.606  1.00 108.73 ?  454  ILE B N   1 
ATOM   7683  C  CA  . ILE B  1 454 ? -20.694 28.322  74.333  1.00 109.02 ?  454  ILE B CA  1 
ATOM   7684  C  C   . ILE B  1 454 ? -21.162 29.734  74.006  1.00 111.36 ?  454  ILE B C   1 
ATOM   7685  O  O   . ILE B  1 454 ? -21.270 30.590  74.894  1.00 113.26 ?  454  ILE B O   1 
ATOM   7686  C  CB  . ILE B  1 454 ? -19.195 28.141  74.028  1.00 104.81 ?  454  ILE B CB  1 
ATOM   7687  C  CG1 . ILE B  1 454 ? -18.721 26.752  74.458  1.00 104.54 ?  454  ILE B CG1 1 
ATOM   7688  C  CG2 . ILE B  1 454 ? -18.373 29.221  74.720  1.00 104.76 ?  454  ILE B CG2 1 
ATOM   7689  C  CD1 . ILE B  1 454 ? -18.956 26.464  75.921  1.00 108.82 ?  454  ILE B CD1 1 
ATOM   7690  N  N   . PHE B  1 455 ? -21.461 29.997  72.731  1.00 111.19 ?  455  PHE B N   1 
ATOM   7691  C  CA  . PHE B  1 455 ? -21.883 31.324  72.297  1.00 114.00 ?  455  PHE B CA  1 
ATOM   7692  C  C   . PHE B  1 455 ? -23.336 31.639  72.642  1.00 120.81 ?  455  PHE B C   1 
ATOM   7693  O  O   . PHE B  1 455 ? -23.767 32.782  72.440  1.00 124.87 ?  455  PHE B O   1 
ATOM   7694  C  CB  . PHE B  1 455 ? -21.661 31.490  70.787  1.00 108.83 ?  455  PHE B CB  1 
ATOM   7695  C  CG  . PHE B  1 455 ? -20.289 32.005  70.427  1.00 103.89 ?  455  PHE B CG  1 
ATOM   7696  C  CD1 . PHE B  1 455 ? -19.207 31.141  70.337  1.00 99.41  ?  455  PHE B CD1 1 
ATOM   7697  C  CD2 . PHE B  1 455 ? -20.079 33.356  70.196  1.00 103.98 ?  455  PHE B CD2 1 
ATOM   7698  C  CE1 . PHE B  1 455 ? -17.945 31.616  70.013  1.00 96.35  ?  455  PHE B CE1 1 
ATOM   7699  C  CE2 . PHE B  1 455 ? -18.818 33.836  69.873  1.00 100.78 ?  455  PHE B CE2 1 
ATOM   7700  C  CZ  . PHE B  1 455 ? -17.752 32.965  69.781  1.00 97.26  ?  455  PHE B CZ  1 
ATOM   7701  N  N   . GLY B  1 456 ? -24.096 30.669  73.148  1.00 121.30 ?  456  GLY B N   1 
ATOM   7702  C  CA  . GLY B  1 456 ? -25.472 30.919  73.530  1.00 124.67 ?  456  GLY B CA  1 
ATOM   7703  C  C   . GLY B  1 456 ? -26.473 30.928  72.396  1.00 123.21 ?  456  GLY B C   1 
ATOM   7704  O  O   . GLY B  1 456 ? -27.502 31.605  72.495  1.00 126.90 ?  456  GLY B O   1 
ATOM   7705  N  N   . LEU B  1 457 ? -26.198 30.207  71.309  1.00 117.67 ?  457  LEU B N   1 
ATOM   7706  C  CA  . LEU B  1 457 ? -27.185 30.089  70.237  1.00 117.58 ?  457  LEU B CA  1 
ATOM   7707  C  C   . LEU B  1 457 ? -28.495 29.440  70.680  1.00 120.43 ?  457  LEU B C   1 
ATOM   7708  O  O   . LEU B  1 457 ? -29.553 29.861  70.179  1.00 122.70 ?  457  LEU B O   1 
ATOM   7709  C  CB  . LEU B  1 457 ? -26.576 29.337  69.045  1.00 113.23 ?  457  LEU B CB  1 
ATOM   7710  C  CG  . LEU B  1 457 ? -25.928 30.199  67.956  1.00 110.57 ?  457  LEU B CG  1 
ATOM   7711  C  CD1 . LEU B  1 457 ? -24.717 30.951  68.496  1.00 105.79 ?  457  LEU B CD1 1 
ATOM   7712  C  CD2 . LEU B  1 457 ? -25.553 29.352  66.747  1.00 103.38 ?  457  LEU B CD2 1 
ATOM   7713  N  N   . PRO B  1 458 ? -28.516 28.436  71.569  1.00 120.68 ?  458  PRO B N   1 
ATOM   7714  C  CA  . PRO B  1 458 ? -29.810 27.881  72.010  1.00 125.69 ?  458  PRO B CA  1 
ATOM   7715  C  C   . PRO B  1 458 ? -30.746 28.897  72.653  1.00 131.96 ?  458  PRO B C   1 
ATOM   7716  O  O   . PRO B  1 458 ? -31.949 28.623  72.760  1.00 135.15 ?  458  PRO B O   1 
ATOM   7717  C  CB  . PRO B  1 458 ? -29.395 26.787  73.003  1.00 124.67 ?  458  PRO B CB  1 
ATOM   7718  C  CG  . PRO B  1 458 ? -28.073 26.338  72.502  1.00 118.25 ?  458  PRO B CG  1 
ATOM   7719  C  CD  . PRO B  1 458 ? -27.394 27.583  72.011  1.00 116.39 ?  458  PRO B CD  1 
ATOM   7720  N  N   . LEU B  1 459 ? -30.239 30.055  73.080  1.00 133.79 ?  459  LEU B N   1 
ATOM   7721  C  CA  . LEU B  1 459 ? -31.104 31.096  73.623  1.00 139.76 ?  459  LEU B CA  1 
ATOM   7722  C  C   . LEU B  1 459 ? -31.990 31.731  72.556  1.00 142.89 ?  459  LEU B C   1 
ATOM   7723  O  O   . LEU B  1 459 ? -33.025 32.313  72.899  1.00 148.79 ?  459  LEU B O   1 
ATOM   7724  C  CB  . LEU B  1 459 ? -30.266 32.171  74.317  1.00 138.58 ?  459  LEU B CB  1 
ATOM   7725  C  CG  . LEU B  1 459 ? -29.744 31.868  75.727  1.00 138.40 ?  459  LEU B CG  1 
ATOM   7726  C  CD1 . LEU B  1 459 ? -28.743 30.715  75.759  1.00 132.85 ?  459  LEU B CD1 1 
ATOM   7727  C  CD2 . LEU B  1 459 ? -29.146 33.122  76.338  1.00 139.67 ?  459  LEU B CD2 1 
ATOM   7728  N  N   . ASP B  1 460 ? -31.612 31.644  71.282  1.00 139.26 ?  460  ASP B N   1 
ATOM   7729  C  CA  . ASP B  1 460 ? -32.484 32.111  70.209  1.00 141.34 ?  460  ASP B CA  1 
ATOM   7730  C  C   . ASP B  1 460 ? -33.554 31.056  69.961  1.00 143.58 ?  460  ASP B C   1 
ATOM   7731  O  O   . ASP B  1 460 ? -33.225 29.942  69.534  1.00 139.98 ?  460  ASP B O   1 
ATOM   7732  C  CB  . ASP B  1 460 ? -31.683 32.382  68.934  1.00 136.70 ?  460  ASP B CB  1 
ATOM   7733  C  CG  . ASP B  1 460 ? -32.461 33.205  67.901  1.00 138.33 ?  460  ASP B CG  1 
ATOM   7734  O  OD1 . ASP B  1 460 ? -33.684 32.999  67.746  1.00 142.46 ?  460  ASP B OD1 1 
ATOM   7735  O  OD2 . ASP B  1 460 ? -31.836 34.060  67.233  1.00 135.46 ?  460  ASP B OD2 1 
ATOM   7736  N  N   . PRO B  1 461 ? -34.830 31.355  70.215  1.00 149.85 ?  461  PRO B N   1 
ATOM   7737  C  CA  . PRO B  1 461 ? -35.860 30.303  70.157  1.00 154.07 ?  461  PRO B CA  1 
ATOM   7738  C  C   . PRO B  1 461 ? -36.132 29.764  68.758  1.00 154.34 ?  461  PRO B C   1 
ATOM   7739  O  O   . PRO B  1 461 ? -36.723 28.683  68.640  1.00 156.94 ?  461  PRO B O   1 
ATOM   7740  C  CB  . PRO B  1 461 ? -37.102 30.996  70.742  1.00 159.90 ?  461  PRO B CB  1 
ATOM   7741  C  CG  . PRO B  1 461 ? -36.568 32.220  71.468  1.00 159.86 ?  461  PRO B CG  1 
ATOM   7742  C  CD  . PRO B  1 461 ? -35.372 32.641  70.683  1.00 153.79 ?  461  PRO B CD  1 
ATOM   7743  N  N   . SER B  1 462 ? -35.722 30.464  67.698  1.00 151.40 ?  462  SER B N   1 
ATOM   7744  C  CA  . SER B  1 462 ? -36.142 30.096  66.350  1.00 149.78 ?  462  SER B CA  1 
ATOM   7745  C  C   . SER B  1 462 ? -35.338 28.950  65.743  1.00 143.57 ?  462  SER B C   1 
ATOM   7746  O  O   . SER B  1 462 ? -35.732 28.436  64.689  1.00 141.15 ?  462  SER B O   1 
ATOM   7747  C  CB  . SER B  1 462 ? -36.068 31.316  65.429  1.00 149.97 ?  462  SER B CB  1 
ATOM   7748  O  OG  . SER B  1 462 ? -34.746 31.820  65.352  1.00 145.89 ?  462  SER B OG  1 
ATOM   7749  N  N   . LEU B  1 463 ? -34.235 28.533  66.367  1.00 141.65 ?  463  LEU B N   1 
ATOM   7750  C  CA  . LEU B  1 463 ? -33.427 27.438  65.837  1.00 138.67 ?  463  LEU B CA  1 
ATOM   7751  C  C   . LEU B  1 463 ? -33.920 26.065  66.295  1.00 140.89 ?  463  LEU B C   1 
ATOM   7752  O  O   . LEU B  1 463 ? -33.328 25.051  65.915  1.00 138.38 ?  463  LEU B O   1 
ATOM   7753  C  CB  . LEU B  1 463 ? -31.958 27.641  66.238  1.00 135.15 ?  463  LEU B CB  1 
ATOM   7754  C  CG  . LEU B  1 463 ? -30.828 27.179  65.302  1.00 130.61 ?  463  LEU B CG  1 
ATOM   7755  C  CD1 . LEU B  1 463 ? -29.563 27.919  65.660  1.00 128.27 ?  463  LEU B CD1 1 
ATOM   7756  C  CD2 . LEU B  1 463 ? -30.555 25.679  65.320  1.00 128.32 ?  463  LEU B CD2 1 
ATOM   7757  N  N   . ASN B  1 464 ? -34.993 26.010  67.086  1.00 145.46 ?  464  ASN B N   1 
ATOM   7758  C  CA  . ASN B  1 464 ? -35.615 24.756  67.530  1.00 146.42 ?  464  ASN B CA  1 
ATOM   7759  C  C   . ASN B  1 464 ? -34.688 23.924  68.422  1.00 142.71 ?  464  ASN B C   1 
ATOM   7760  O  O   . ASN B  1 464 ? -34.635 22.698  68.304  1.00 141.57 ?  464  ASN B O   1 
ATOM   7761  C  CB  . ASN B  1 464 ? -36.104 23.918  66.337  1.00 145.68 ?  464  ASN B CB  1 
ATOM   7762  C  CG  . ASN B  1 464 ? -37.334 24.511  65.659  1.00 150.11 ?  464  ASN B CG  1 
ATOM   7763  O  OD1 . ASN B  1 464 ? -37.230 25.418  64.833  1.00 148.78 ?  464  ASN B OD1 1 
ATOM   7764  N  ND2 . ASN B  1 464 ? -38.508 23.984  65.999  1.00 155.50 ?  464  ASN B ND2 1 
ATOM   7765  N  N   . TYR B  1 465 ? -33.965 24.575  69.337  1.00 140.87 ?  465  TYR B N   1 
ATOM   7766  C  CA  . TYR B  1 465 ? -33.278 23.776  70.339  1.00 138.62 ?  465  TYR B CA  1 
ATOM   7767  C  C   . TYR B  1 465 ? -34.247 23.422  71.472  1.00 144.50 ?  465  TYR B C   1 
ATOM   7768  O  O   . TYR B  1 465 ? -35.376 23.916  71.539  1.00 150.37 ?  465  TYR B O   1 
ATOM   7769  C  CB  . TYR B  1 465 ? -32.067 24.530  70.904  1.00 135.51 ?  465  TYR B CB  1 
ATOM   7770  C  CG  . TYR B  1 465 ? -30.856 24.642  69.984  1.00 130.94 ?  465  TYR B CG  1 
ATOM   7771  C  CD1 . TYR B  1 465 ? -30.095 23.526  69.651  1.00 128.70 ?  465  TYR B CD1 1 
ATOM   7772  C  CD2 . TYR B  1 465 ? -30.464 25.871  69.466  1.00 129.79 ?  465  TYR B CD2 1 
ATOM   7773  C  CE1 . TYR B  1 465 ? -28.983 23.629  68.820  1.00 124.69 ?  465  TYR B CE1 1 
ATOM   7774  C  CE2 . TYR B  1 465 ? -29.351 25.986  68.636  1.00 126.06 ?  465  TYR B CE2 1 
ATOM   7775  C  CZ  . TYR B  1 465 ? -28.617 24.861  68.313  1.00 123.81 ?  465  TYR B CZ  1 
ATOM   7776  O  OH  . TYR B  1 465 ? -27.516 24.968  67.486  1.00 120.18 ?  465  TYR B OH  1 
ATOM   7777  N  N   . THR B  1 466 ? -33.780 22.572  72.385  1.00 142.85 ?  466  THR B N   1 
ATOM   7778  C  CA  . THR B  1 466 ? -34.512 22.220  73.596  1.00 145.78 ?  466  THR B CA  1 
ATOM   7779  C  C   . THR B  1 466 ? -34.292 23.258  74.698  1.00 148.26 ?  466  THR B C   1 
ATOM   7780  O  O   . THR B  1 466 ? -33.290 23.978  74.720  1.00 146.52 ?  466  THR B O   1 
ATOM   7781  C  CB  . THR B  1 466 ? -34.119 20.822  74.080  1.00 141.95 ?  466  THR B CB  1 
ATOM   7782  O  OG1 . THR B  1 466 ? -32.888 20.890  74.807  1.00 135.34 ?  466  THR B OG1 1 
ATOM   7783  C  CG2 . THR B  1 466 ? -33.965 19.875  72.897  1.00 138.15 ?  466  THR B CG2 1 
ATOM   7784  N  N   . THR B  1 467 ? -35.260 23.332  75.618  1.00 153.67 ?  467  THR B N   1 
ATOM   7785  C  CA  . THR B  1 467 ? -35.118 24.194  76.790  1.00 156.64 ?  467  THR B CA  1 
ATOM   7786  C  C   . THR B  1 467 ? -33.917 23.783  77.640  1.00 156.60 ?  467  THR B C   1 
ATOM   7787  O  O   . THR B  1 467 ? -33.188 24.642  78.163  1.00 157.37 ?  467  THR B O   1 
ATOM   7788  C  CB  . THR B  1 467 ? -36.401 24.157  77.622  1.00 162.49 ?  467  THR B CB  1 
ATOM   7789  O  OG1 . THR B  1 467 ? -37.538 24.177  76.751  1.00 165.80 ?  467  THR B OG1 1 
ATOM   7790  C  CG2 . THR B  1 467 ? -36.466 25.348  78.565  1.00 167.84 ?  467  THR B CG2 1 
ATOM   7791  N  N   . GLU B  1 468 ? -33.701 22.471  77.799  1.00 154.26 ?  468  GLU B N   1 
ATOM   7792  C  CA  . GLU B  1 468 ? -32.525 21.998  78.523  1.00 151.43 ?  468  GLU B CA  1 
ATOM   7793  C  C   . GLU B  1 468 ? -31.246 22.521  77.887  1.00 145.93 ?  468  GLU B C   1 
ATOM   7794  O  O   . GLU B  1 468 ? -30.283 22.851  78.587  1.00 144.88 ?  468  GLU B O   1 
ATOM   7795  C  CB  . GLU B  1 468 ? -32.493 20.471  78.562  1.00 150.98 ?  468  GLU B CB  1 
ATOM   7796  C  CG  . GLU B  1 468 ? -33.822 19.788  78.796  1.00 157.23 ?  468  GLU B CG  1 
ATOM   7797  C  CD  . GLU B  1 468 ? -33.702 18.278  78.689  1.00 156.86 ?  468  GLU B CD  1 
ATOM   7798  O  OE1 . GLU B  1 468 ? -33.391 17.634  79.715  1.00 157.94 ?  468  GLU B OE1 1 
ATOM   7799  O  OE2 . GLU B  1 468 ? -33.907 17.738  77.580  1.00 155.30 ?  468  GLU B OE2 1 
ATOM   7800  N  N   . GLU B  1 469 ? -31.215 22.593  76.557  1.00 142.63 ?  469  GLU B N   1 
ATOM   7801  C  CA  . GLU B  1 469 ? -30.063 23.165  75.877  1.00 137.58 ?  469  GLU B CA  1 
ATOM   7802  C  C   . GLU B  1 469 ? -29.969 24.670  76.101  1.00 139.09 ?  469  GLU B C   1 
ATOM   7803  O  O   . GLU B  1 469 ? -28.876 25.239  76.009  1.00 136.45 ?  469  GLU B O   1 
ATOM   7804  C  CB  . GLU B  1 469 ? -30.132 22.825  74.388  1.00 135.24 ?  469  GLU B CB  1 
ATOM   7805  C  CG  . GLU B  1 469 ? -29.908 21.343  74.103  1.00 134.32 ?  469  GLU B CG  1 
ATOM   7806  C  CD  . GLU B  1 469 ? -30.196 20.971  72.663  1.00 133.59 ?  469  GLU B CD  1 
ATOM   7807  O  OE1 . GLU B  1 469 ? -30.661 21.847  71.912  1.00 134.54 ?  469  GLU B OE1 1 
ATOM   7808  O  OE2 . GLU B  1 469 ? -29.941 19.811  72.275  1.00 131.92 ?  469  GLU B OE2 1 
ATOM   7809  N  N   . ARG B  1 470 ? -31.093 25.331  76.397  1.00 143.39 ?  470  ARG B N   1 
ATOM   7810  C  CA  . ARG B  1 470 ? -31.047 26.755  76.721  1.00 143.88 ?  470  ARG B CA  1 
ATOM   7811  C  C   . ARG B  1 470 ? -30.402 26.985  78.083  1.00 143.66 ?  470  ARG B C   1 
ATOM   7812  O  O   . ARG B  1 470 ? -29.455 27.776  78.209  1.00 141.35 ?  470  ARG B O   1 
ATOM   7813  C  CB  . ARG B  1 470 ? -32.457 27.353  76.670  1.00 149.48 ?  470  ARG B CB  1 
ATOM   7814  C  CG  . ARG B  1 470 ? -32.506 28.872  76.793  1.00 151.77 ?  470  ARG B CG  1 
ATOM   7815  C  CD  . ARG B  1 470 ? -33.895 29.365  77.191  1.00 158.25 ?  470  ARG B CD  1 
ATOM   7816  N  NE  . ARG B  1 470 ? -34.255 28.999  78.556  1.00 162.57 ?  470  ARG B NE  1 
ATOM   7817  C  CZ  . ARG B  1 470 ? -35.503 28.782  78.963  1.00 168.47 ?  470  ARG B CZ  1 
ATOM   7818  N  NH1 . ARG B  1 470 ? -36.508 28.899  78.105  1.00 170.65 ?  470  ARG B NH1 1 
ATOM   7819  N  NH2 . ARG B  1 470 ? -35.746 28.451  80.225  1.00 172.22 ?  470  ARG B NH2 1 
ATOM   7820  N  N   . ILE B  1 471 ? -30.887 26.286  79.116  1.00 146.29 ?  471  ILE B N   1 
ATOM   7821  C  CA  . ILE B  1 471 ? -30.293 26.459  80.443  1.00 147.26 ?  471  ILE B CA  1 
ATOM   7822  C  C   . ILE B  1 471 ? -28.850 25.964  80.440  1.00 142.38 ?  471  ILE B C   1 
ATOM   7823  O  O   . ILE B  1 471 ? -27.979 26.522  81.122  1.00 141.80 ?  471  ILE B O   1 
ATOM   7824  C  CB  . ILE B  1 471 ? -31.138 25.751  81.522  1.00 151.55 ?  471  ILE B CB  1 
ATOM   7825  C  CG1 . ILE B  1 471 ? -31.551 24.356  81.052  1.00 149.34 ?  471  ILE B CG1 1 
ATOM   7826  C  CG2 . ILE B  1 471 ? -32.356 26.597  81.873  1.00 155.73 ?  471  ILE B CG2 1 
ATOM   7827  C  CD1 . ILE B  1 471 ? -31.748 23.353  82.173  1.00 151.80 ?  471  ILE B CD1 1 
ATOM   7828  N  N   . PHE B  1 472 ? -28.577 24.915  79.660  1.00 139.35 ?  472  PHE B N   1 
ATOM   7829  C  CA  . PHE B  1 472 ? -27.213 24.423  79.493  1.00 134.96 ?  472  PHE B CA  1 
ATOM   7830  C  C   . PHE B  1 472 ? -26.321 25.497  78.879  1.00 132.09 ?  472  PHE B C   1 
ATOM   7831  O  O   . PHE B  1 472 ? -25.208 25.754  79.359  1.00 131.15 ?  472  PHE B O   1 
ATOM   7832  C  CB  . PHE B  1 472 ? -27.232 23.166  78.619  1.00 132.05 ?  472  PHE B CB  1 
ATOM   7833  C  CG  . PHE B  1 472 ? -25.889 22.525  78.440  1.00 127.81 ?  472  PHE B CG  1 
ATOM   7834  C  CD1 . PHE B  1 472 ? -25.030 22.371  79.516  1.00 128.50 ?  472  PHE B CD1 1 
ATOM   7835  C  CD2 . PHE B  1 472 ? -25.478 22.086  77.193  1.00 123.66 ?  472  PHE B CD2 1 
ATOM   7836  C  CE1 . PHE B  1 472 ? -23.788 21.778  79.355  1.00 123.94 ?  472  PHE B CE1 1 
ATOM   7837  C  CE2 . PHE B  1 472 ? -24.235 21.498  77.023  1.00 119.34 ?  472  PHE B CE2 1 
ATOM   7838  C  CZ  . PHE B  1 472 ? -23.390 21.343  78.107  1.00 119.23 ?  472  PHE B CZ  1 
ATOM   7839  N  N   . ALA B  1 473 ? -26.808 26.153  77.823  1.00 130.72 ?  473  ALA B N   1 
ATOM   7840  C  CA  . ALA B  1 473 ? -26.019 27.185  77.158  1.00 126.64 ?  473  ALA B CA  1 
ATOM   7841  C  C   . ALA B  1 473 ? -25.723 28.344  78.099  1.00 128.59 ?  473  ALA B C   1 
ATOM   7842  O  O   . ALA B  1 473 ? -24.583 28.815  78.176  1.00 123.10 ?  473  ALA B O   1 
ATOM   7843  C  CB  . ALA B  1 473 ? -26.738 27.679  75.900  1.00 126.34 ?  473  ALA B CB  1 
ATOM   7844  N  N   . GLN B  1 474 ? -26.736 28.823  78.831  1.00 134.49 ?  474  GLN B N   1 
ATOM   7845  C  CA  . GLN B  1 474 ? -26.474 29.963  79.709  1.00 138.40 ?  474  GLN B CA  1 
ATOM   7846  C  C   . GLN B  1 474 ? -25.595 29.573  80.895  1.00 138.79 ?  474  GLN B C   1 
ATOM   7847  O  O   . GLN B  1 474 ? -24.821 30.405  81.388  1.00 139.59 ?  474  GLN B O   1 
ATOM   7848  C  CB  . GLN B  1 474 ? -27.787 30.605  80.178  1.00 145.03 ?  474  GLN B CB  1 
ATOM   7849  C  CG  . GLN B  1 474 ? -28.852 29.639  80.650  1.00 148.46 ?  474  GLN B CG  1 
ATOM   7850  C  CD  . GLN B  1 474 ? -30.256 30.217  80.554  1.00 152.89 ?  474  GLN B CD  1 
ATOM   7851  O  OE1 . GLN B  1 474 ? -31.056 29.801  79.714  1.00 152.48 ?  474  GLN B OE1 1 
ATOM   7852  N  NE2 . GLN B  1 474 ? -30.566 31.168  81.427  1.00 157.33 ?  474  GLN B NE2 1 
ATOM   7853  N  N   . ARG B  1 475 ? -25.676 28.320  81.356  1.00 134.04 ?  475  ARG B N   1 
ATOM   7854  C  CA  . ARG B  1 475 ? -24.745 27.869  82.387  1.00 133.85 ?  475  ARG B CA  1 
ATOM   7855  C  C   . ARG B  1 475 ? -23.313 27.880  81.866  1.00 129.86 ?  475  ARG B C   1 
ATOM   7856  O  O   . ARG B  1 475 ? -22.389 28.316  82.567  1.00 128.14 ?  475  ARG B O   1 
ATOM   7857  C  CB  . ARG B  1 475 ? -25.124 26.471  82.881  1.00 134.62 ?  475  ARG B CB  1 
ATOM   7858  C  CG  . ARG B  1 475 ? -24.260 25.989  84.043  1.00 135.34 ?  475  ARG B CG  1 
ATOM   7859  C  CD  . ARG B  1 475 ? -24.860 24.790  84.764  1.00 138.40 ?  475  ARG B CD  1 
ATOM   7860  N  NE  . ARG B  1 475 ? -24.310 23.520  84.292  1.00 134.68 ?  475  ARG B NE  1 
ATOM   7861  C  CZ  . ARG B  1 475 ? -24.951 22.670  83.496  1.00 133.27 ?  475  ARG B CZ  1 
ATOM   7862  N  NH1 . ARG B  1 475 ? -26.175 22.951  83.066  1.00 136.09 ?  475  ARG B NH1 1 
ATOM   7863  N  NH2 . ARG B  1 475 ? -24.365 21.537  83.130  1.00 128.61 ?  475  ARG B NH2 1 
ATOM   7864  N  N   . LEU B  1 476 ? -23.112 27.418  80.627  1.00 126.87 ?  476  LEU B N   1 
ATOM   7865  C  CA  . LEU B  1 476 ? -21.779 27.458  80.030  1.00 122.57 ?  476  LEU B CA  1 
ATOM   7866  C  C   . LEU B  1 476 ? -21.291 28.892  79.843  1.00 123.21 ?  476  LEU B C   1 
ATOM   7867  O  O   . LEU B  1 476 ? -20.108 29.182  80.058  1.00 123.12 ?  476  LEU B O   1 
ATOM   7868  C  CB  . LEU B  1 476 ? -21.774 26.713  78.694  1.00 117.74 ?  476  LEU B CB  1 
ATOM   7869  C  CG  . LEU B  1 476 ? -22.047 25.212  78.754  1.00 116.79 ?  476  LEU B CG  1 
ATOM   7870  C  CD1 . LEU B  1 476 ? -21.867 24.583  77.383  1.00 111.42 ?  476  LEU B CD1 1 
ATOM   7871  C  CD2 . LEU B  1 476 ? -21.137 24.550  79.777  1.00 117.52 ?  476  LEU B CD2 1 
ATOM   7872  N  N   . MET B  1 477 ? -22.181 29.800  79.432  1.00 123.11 ?  477  MET B N   1 
ATOM   7873  C  CA  . MET B  1 477 ? -21.811 31.208  79.335  1.00 122.84 ?  477  MET B CA  1 
ATOM   7874  C  C   . MET B  1 477 ? -21.379 31.752  80.690  1.00 125.86 ?  477  MET B C   1 
ATOM   7875  O  O   . MET B  1 477 ? -20.436 32.550  80.776  1.00 125.84 ?  477  MET B O   1 
ATOM   7876  C  CB  . MET B  1 477 ? -22.979 32.018  78.772  1.00 127.51 ?  477  MET B CB  1 
ATOM   7877  C  CG  . MET B  1 477 ? -23.388 31.596  77.366  1.00 126.95 ?  477  MET B CG  1 
ATOM   7878  S  SD  . MET B  1 477 ? -24.858 32.428  76.727  1.00 132.30 ?  477  MET B SD  1 
ATOM   7879  C  CE  . MET B  1 477 ? -24.353 34.137  76.854  1.00 134.77 ?  477  MET B CE  1 
ATOM   7880  N  N   . LYS B  1 478 ? -22.052 31.317  81.764  1.00 131.05 ?  478  LYS B N   1 
ATOM   7881  C  CA  . LYS B  1 478 ? -21.649 31.718  83.109  1.00 135.75 ?  478  LYS B CA  1 
ATOM   7882  C  C   . LYS B  1 478 ? -20.269 31.173  83.459  1.00 132.55 ?  478  LYS B C   1 
ATOM   7883  O  O   . LYS B  1 478 ? -19.460 31.874  84.081  1.00 131.21 ?  478  LYS B O   1 
ATOM   7884  C  CB  . LYS B  1 478 ? -22.687 31.250  84.132  1.00 141.34 ?  478  LYS B CB  1 
ATOM   7885  C  CG  . LYS B  1 478 ? -23.658 32.331  84.591  1.00 146.41 ?  478  LYS B CG  1 
ATOM   7886  C  CD  . LYS B  1 478 ? -22.956 33.455  85.339  1.00 147.73 ?  478  LYS B CD  1 
ATOM   7887  C  CE  . LYS B  1 478 ? -23.934 34.206  86.233  1.00 154.06 ?  478  LYS B CE  1 
ATOM   7888  N  NZ  . LYS B  1 478 ? -25.212 34.519  85.528  1.00 155.99 ?  478  LYS B NZ  1 
ATOM   7889  N  N   . TYR B  1 479 ? -19.983 29.925  83.073  1.00 128.35 ?  479  TYR B N   1 
ATOM   7890  C  CA  . TYR B  1 479 ? -18.654 29.360  83.302  1.00 124.39 ?  479  TYR B CA  1 
ATOM   7891  C  C   . TYR B  1 479 ? -17.580 30.164  82.578  1.00 122.52 ?  479  TYR B C   1 
ATOM   7892  O  O   . TYR B  1 479 ? -16.579 30.576  83.179  1.00 122.77 ?  479  TYR B O   1 
ATOM   7893  C  CB  . TYR B  1 479 ? -18.613 27.899  82.848  1.00 119.03 ?  479  TYR B CB  1 
ATOM   7894  C  CG  . TYR B  1 479 ? -19.359 26.924  83.733  1.00 121.85 ?  479  TYR B CG  1 
ATOM   7895  C  CD1 . TYR B  1 479 ? -19.464 27.132  85.103  1.00 126.48 ?  479  TYR B CD1 1 
ATOM   7896  C  CD2 . TYR B  1 479 ? -19.956 25.790  83.196  1.00 120.18 ?  479  TYR B CD2 1 
ATOM   7897  C  CE1 . TYR B  1 479 ? -20.147 26.238  85.910  1.00 129.31 ?  479  TYR B CE1 1 
ATOM   7898  C  CE2 . TYR B  1 479 ? -20.640 24.891  83.995  1.00 123.26 ?  479  TYR B CE2 1 
ATOM   7899  C  CZ  . TYR B  1 479 ? -20.733 25.120  85.350  1.00 128.43 ?  479  TYR B CZ  1 
ATOM   7900  O  OH  . TYR B  1 479 ? -21.414 24.223  86.141  1.00 133.51 ?  479  TYR B OH  1 
ATOM   7901  N  N   . TRP B  1 480 ? -17.775 30.394  81.276  1.00 121.17 ?  480  TRP B N   1 
ATOM   7902  C  CA  . TRP B  1 480 ? -16.767 31.072  80.465  1.00 118.70 ?  480  TRP B CA  1 
ATOM   7903  C  C   . TRP B  1 480 ? -16.537 32.503  80.939  1.00 122.85 ?  480  TRP B C   1 
ATOM   7904  O  O   . TRP B  1 480 ? -15.390 32.943  81.085  1.00 122.29 ?  480  TRP B O   1 
ATOM   7905  C  CB  . TRP B  1 480 ? -17.184 31.052  78.991  1.00 115.46 ?  480  TRP B CB  1 
ATOM   7906  C  CG  . TRP B  1 480 ? -16.529 29.977  78.153  1.00 110.70 ?  480  TRP B CG  1 
ATOM   7907  C  CD1 . TRP B  1 480 ? -15.838 30.160  76.986  1.00 106.95 ?  480  TRP B CD1 1 
ATOM   7908  C  CD2 . TRP B  1 480 ? -16.507 28.564  78.410  1.00 109.34 ?  480  TRP B CD2 1 
ATOM   7909  N  NE1 . TRP B  1 480 ? -15.388 28.954  76.504  1.00 102.83 ?  480  TRP B NE1 1 
ATOM   7910  C  CE2 . TRP B  1 480 ? -15.785 27.959  77.359  1.00 104.59 ?  480  TRP B CE2 1 
ATOM   7911  C  CE3 . TRP B  1 480 ? -17.026 27.752  79.425  1.00 111.28 ?  480  TRP B CE3 1 
ATOM   7912  C  CZ2 . TRP B  1 480 ? -15.569 26.583  77.296  1.00 102.02 ?  480  TRP B CZ2 1 
ATOM   7913  C  CZ3 . TRP B  1 480 ? -16.809 26.386  79.359  1.00 108.42 ?  480  TRP B CZ3 1 
ATOM   7914  C  CH2 . TRP B  1 480 ? -16.087 25.816  78.303  1.00 103.91 ?  480  TRP B CH2 1 
ATOM   7915  N  N   . THR B  1 481 ? -17.617 33.253  81.177  1.00 127.53 ?  481  THR B N   1 
ATOM   7916  C  CA  . THR B  1 481 ? -17.457 34.647  81.582  1.00 131.90 ?  481  THR B CA  1 
ATOM   7917  C  C   . THR B  1 481 ? -16.893 34.754  82.996  1.00 135.55 ?  481  THR B C   1 
ATOM   7918  O  O   . THR B  1 481 ? -16.030 35.604  83.262  1.00 136.94 ?  481  THR B O   1 
ATOM   7919  C  CB  . THR B  1 481 ? -18.790 35.386  81.468  1.00 136.64 ?  481  THR B CB  1 
ATOM   7920  O  OG1 . THR B  1 481 ? -19.784 34.717  82.254  1.00 141.40 ?  481  THR B OG1 1 
ATOM   7921  C  CG2 . THR B  1 481 ? -19.242 35.430  80.014  1.00 133.12 ?  481  THR B CG2 1 
ATOM   7922  N  N   . ASN B  1 482 ? -17.367 33.903  83.916  1.00 136.96 ?  482  ASN B N   1 
ATOM   7923  C  CA  . ASN B  1 482 ? -16.767 33.843  85.246  1.00 138.92 ?  482  ASN B CA  1 
ATOM   7924  C  C   . ASN B  1 482 ? -15.268 33.589  85.159  1.00 133.75 ?  482  ASN B C   1 
ATOM   7925  O  O   . ASN B  1 482 ? -14.479 34.221  85.873  1.00 134.44 ?  482  ASN B O   1 
ATOM   7926  C  CB  . ASN B  1 482 ? -17.445 32.761  86.091  1.00 141.59 ?  482  ASN B CB  1 
ATOM   7927  C  CG  . ASN B  1 482 ? -18.674 33.273  86.829  1.00 148.45 ?  482  ASN B CG  1 
ATOM   7928  O  OD1 . ASN B  1 482 ? -19.730 32.639  86.817  1.00 150.21 ?  482  ASN B OD1 1 
ATOM   7929  N  ND2 . ASN B  1 482 ? -18.535 34.420  87.487  1.00 152.37 ?  482  ASN B ND2 1 
ATOM   7930  N  N   . PHE B  1 483 ? -14.856 32.663  84.287  1.00 129.20 ?  483  PHE B N   1 
ATOM   7931  C  CA  . PHE B  1 483 ? -13.429 32.437  84.070  1.00 126.04 ?  483  PHE B CA  1 
ATOM   7932  C  C   . PHE B  1 483 ? -12.752 33.688  83.527  1.00 125.93 ?  483  PHE B C   1 
ATOM   7933  O  O   . PHE B  1 483 ? -11.620 34.006  83.911  1.00 127.45 ?  483  PHE B O   1 
ATOM   7934  C  CB  . PHE B  1 483 ? -13.215 31.256  83.119  1.00 119.63 ?  483  PHE B CB  1 
ATOM   7935  C  CG  . PHE B  1 483 ? -11.765 30.965  82.831  1.00 114.49 ?  483  PHE B CG  1 
ATOM   7936  C  CD1 . PHE B  1 483 ? -10.954 30.388  83.793  1.00 113.81 ?  483  PHE B CD1 1 
ATOM   7937  C  CD2 . PHE B  1 483 ? -11.211 31.281  81.602  1.00 107.31 ?  483  PHE B CD2 1 
ATOM   7938  C  CE1 . PHE B  1 483 ? -9.620  30.127  83.531  1.00 109.84 ?  483  PHE B CE1 1 
ATOM   7939  C  CE2 . PHE B  1 483 ? -9.879  31.023  81.339  1.00 104.28 ?  483  PHE B CE2 1 
ATOM   7940  C  CZ  . PHE B  1 483 ? -9.084  30.445  82.304  1.00 104.90 ?  483  PHE B CZ  1 
ATOM   7941  N  N   . ALA B  1 484 ? -13.435 34.418  82.643  1.00 123.98 ?  484  ALA B N   1 
ATOM   7942  C  CA  . ALA B  1 484 ? -12.841 35.606  82.038  1.00 122.61 ?  484  ALA B CA  1 
ATOM   7943  C  C   . ALA B  1 484 ? -12.532 36.670  83.086  1.00 128.59 ?  484  ALA B C   1 
ATOM   7944  O  O   . ALA B  1 484 ? -11.422 37.213  83.121  1.00 127.37 ?  484  ALA B O   1 
ATOM   7945  C  CB  . ALA B  1 484 ? -13.769 36.163  80.958  1.00 122.67 ?  484  ALA B CB  1 
ATOM   7946  N  N   . ARG B  1 485 ? -13.509 36.999  83.941  1.00 136.02 ?  485  ARG B N   1 
ATOM   7947  C  CA  . ARG B  1 485 ? -13.274 38.064  84.917  1.00 142.76 ?  485  ARG B CA  1 
ATOM   7948  C  C   . ARG B  1 485 ? -12.456 37.592  86.123  1.00 142.90 ?  485  ARG B C   1 
ATOM   7949  O  O   . ARG B  1 485 ? -11.499 38.263  86.524  1.00 144.26 ?  485  ARG B O   1 
ATOM   7950  C  CB  . ARG B  1 485 ? -14.605 38.684  85.366  1.00 149.86 ?  485  ARG B CB  1 
ATOM   7951  C  CG  . ARG B  1 485 ? -15.733 37.703  85.640  1.00 151.67 ?  485  ARG B CG  1 
ATOM   7952  C  CD  . ARG B  1 485 ? -17.089 38.385  85.464  1.00 155.32 ?  485  ARG B CD  1 
ATOM   7953  N  NE  . ARG B  1 485 ? -18.208 37.449  85.555  1.00 155.27 ?  485  ARG B NE  1 
ATOM   7954  C  CZ  . ARG B  1 485 ? -19.437 37.708  85.115  1.00 156.27 ?  485  ARG B CZ  1 
ATOM   7955  N  NH1 . ARG B  1 485 ? -19.706 38.873  84.539  1.00 156.89 ?  485  ARG B NH1 1 
ATOM   7956  N  NH2 . ARG B  1 485 ? -20.395 36.798  85.240  1.00 156.81 ?  485  ARG B NH2 1 
ATOM   7957  N  N   . THR B  1 486 ? -12.818 36.459  86.729  1.00 141.37 ?  486  THR B N   1 
ATOM   7958  C  CA  . THR B  1 486 ? -12.184 36.043  87.979  1.00 142.22 ?  486  THR B CA  1 
ATOM   7959  C  C   . THR B  1 486 ? -11.064 35.021  87.806  1.00 136.06 ?  486  THR B C   1 
ATOM   7960  O  O   . THR B  1 486 ? -10.410 34.678  88.796  1.00 137.77 ?  486  THR B O   1 
ATOM   7961  C  CB  . THR B  1 486 ? -13.233 35.479  88.949  1.00 146.01 ?  486  THR B CB  1 
ATOM   7962  O  OG1 . THR B  1 486 ? -13.705 34.211  88.478  1.00 142.14 ?  486  THR B OG1 1 
ATOM   7963  C  CG2 . THR B  1 486 ? -14.412 36.434  89.070  1.00 150.66 ?  486  THR B CG2 1 
ATOM   7964  N  N   . GLY B  1 487 ? -10.809 34.540  86.591  1.00 129.17 ?  487  GLY B N   1 
ATOM   7965  C  CA  . GLY B  1 487 ? -9.864  33.449  86.437  1.00 124.42 ?  487  GLY B CA  1 
ATOM   7966  C  C   . GLY B  1 487 ? -10.317 32.131  87.027  1.00 124.76 ?  487  GLY B C   1 
ATOM   7967  O  O   . GLY B  1 487 ? -9.497  31.225  87.199  1.00 122.38 ?  487  GLY B O   1 
ATOM   7968  N  N   . ASP B  1 488 ? -11.607 32.000  87.348  1.00 128.22 ?  488  ASP B N   1 
ATOM   7969  C  CA  . ASP B  1 488 ? -12.188 30.778  87.876  1.00 129.46 ?  488  ASP B CA  1 
ATOM   7970  C  C   . ASP B  1 488 ? -13.512 30.581  87.149  1.00 129.99 ?  488  ASP B C   1 
ATOM   7971  O  O   . ASP B  1 488 ? -14.286 31.538  87.010  1.00 134.07 ?  488  ASP B O   1 
ATOM   7972  C  CB  . ASP B  1 488 ? -12.406 30.936  89.396  1.00 135.33 ?  488  ASP B CB  1 
ATOM   7973  C  CG  . ASP B  1 488 ? -12.827 29.649  90.105  1.00 135.80 ?  488  ASP B CG  1 
ATOM   7974  O  OD1 . ASP B  1 488 ? -13.508 28.792  89.508  1.00 133.20 ?  488  ASP B OD1 1 
ATOM   7975  O  OD2 . ASP B  1 488 ? -12.474 29.506  91.297  1.00 136.81 ?  488  ASP B OD2 1 
ATOM   7976  N  N   . PRO B  1 489 ? -13.828 29.357  86.715  1.00 123.35 ?  489  PRO B N   1 
ATOM   7977  C  CA  . PRO B  1 489 ? -15.162 29.106  86.147  1.00 123.58 ?  489  PRO B CA  1 
ATOM   7978  C  C   . PRO B  1 489 ? -16.270 29.109  87.179  1.00 129.13 ?  489  PRO B C   1 
ATOM   7979  O  O   . PRO B  1 489 ? -17.430 29.347  86.820  1.00 130.77 ?  489  PRO B O   1 
ATOM   7980  C  CB  . PRO B  1 489 ? -15.011 27.726  85.498  1.00 119.00 ?  489  PRO B CB  1 
ATOM   7981  C  CG  . PRO B  1 489 ? -13.920 27.075  86.279  1.00 118.33 ?  489  PRO B CG  1 
ATOM   7982  C  CD  . PRO B  1 489 ? -12.945 28.192  86.548  1.00 119.27 ?  489  PRO B CD  1 
ATOM   7983  N  N   . ASN B  1 490 ? -15.953 28.832  88.439  1.00 132.60 ?  490  ASN B N   1 
ATOM   7984  C  CA  . ASN B  1 490 ? -16.980 28.663  89.453  1.00 138.67 ?  490  ASN B CA  1 
ATOM   7985  C  C   . ASN B  1 490 ? -17.601 29.999  89.831  1.00 146.42 ?  490  ASN B C   1 
ATOM   7986  O  O   . ASN B  1 490 ? -16.980 31.059  89.710  1.00 147.39 ?  490  ASN B O   1 
ATOM   7987  C  CB  . ASN B  1 490 ? -16.391 27.996  90.693  1.00 139.48 ?  490  ASN B CB  1 
ATOM   7988  C  CG  . ASN B  1 490 ? -16.265 26.505  90.534  1.00 135.97 ?  490  ASN B CG  1 
ATOM   7989  O  OD1 . ASN B  1 490 ? -17.241 25.822  90.235  1.00 135.96 ?  490  ASN B OD1 1 
ATOM   7990  N  ND2 . ASN B  1 490 ? -15.054 25.991  90.710  1.00 133.28 ?  490  ASN B ND2 1 
ATOM   7991  N  N   . ASP B  1 491 ? -18.845 29.939  90.289  1.00 152.64 ?  491  ASP B N   1 
ATOM   7992  C  CA  . ASP B  1 491 ? -19.511 31.143  90.762  1.00 160.26 ?  491  ASP B CA  1 
ATOM   7993  C  C   . ASP B  1 491 ? -18.803 31.645  92.015  1.00 164.00 ?  491  ASP B C   1 
ATOM   7994  O  O   . ASP B  1 491 ? -18.573 30.864  92.947  1.00 164.03 ?  491  ASP B O   1 
ATOM   7995  C  CB  . ASP B  1 491 ? -20.987 30.873  91.046  1.00 166.23 ?  491  ASP B CB  1 
ATOM   7996  C  CG  . ASP B  1 491 ? -21.825 32.143  91.035  1.00 172.25 ?  491  ASP B CG  1 
ATOM   7997  O  OD1 . ASP B  1 491 ? -21.906 32.812  92.089  1.00 178.06 ?  491  ASP B OD1 1 
ATOM   7998  O  OD2 . ASP B  1 491 ? -22.403 32.468  89.972  1.00 170.90 ?  491  ASP B OD2 1 
ATOM   7999  N  N   . PRO B  1 492 ? -18.428 32.925  92.069  1.00 167.17 ?  492  PRO B N   1 
ATOM   8000  C  CA  . PRO B  1 492 ? -17.654 33.420  93.219  1.00 171.01 ?  492  PRO B CA  1 
ATOM   8001  C  C   . PRO B  1 492 ? -18.382 33.315  94.546  1.00 176.89 ?  492  PRO B C   1 
ATOM   8002  O  O   . PRO B  1 492 ? -17.734 33.405  95.595  1.00 179.91 ?  492  PRO B O   1 
ATOM   8003  C  CB  . PRO B  1 492 ? -17.376 34.886  92.852  1.00 172.56 ?  492  PRO B CB  1 
ATOM   8004  C  CG  . PRO B  1 492 ? -18.418 35.237  91.832  1.00 171.67 ?  492  PRO B CG  1 
ATOM   8005  C  CD  . PRO B  1 492 ? -18.666 33.975  91.064  1.00 166.56 ?  492  PRO B CD  1 
ATOM   8006  N  N   . ARG B  1 493 ? -19.697 33.123  94.541  1.00 178.61 ?  493  ARG B N   1 
ATOM   8007  C  CA  A ARG B  1 493 ? -20.484 33.128  95.763  0.46 183.70 ?  493  ARG B CA  1 
ATOM   8008  C  CA  B ARG B  1 493 ? -20.499 33.130  95.754  0.54 183.71 ?  493  ARG B CA  1 
ATOM   8009  C  C   . ARG B  1 493 ? -20.929 31.723  96.151  1.00 185.66 ?  493  ARG B C   1 
ATOM   8010  O  O   . ARG B  1 493 ? -21.187 30.866  95.300  1.00 181.47 ?  493  ARG B O   1 
ATOM   8011  C  CB  A ARG B  1 493 ? -21.709 34.043  95.633  0.46 187.70 ?  493  ARG B CB  1 
ATOM   8012  C  CB  B ARG B  1 493 ? -21.740 34.011  95.581  0.54 187.50 ?  493  ARG B CB  1 
ATOM   8013  C  CG  A ARG B  1 493 ? -21.379 35.533  95.625  0.46 188.20 ?  493  ARG B CG  1 
ATOM   8014  C  CG  B ARG B  1 493 ? -21.442 35.428  95.129  0.54 186.04 ?  493  ARG B CG  1 
ATOM   8015  C  CD  A ARG B  1 493 ? -21.055 36.049  94.236  0.46 182.91 ?  493  ARG B CD  1 
ATOM   8016  C  CD  B ARG B  1 493 ? -22.370 35.841  94.009  0.54 184.81 ?  493  ARG B CD  1 
ATOM   8017  N  NE  A ARG B  1 493 ? -20.916 37.503  94.216  0.46 186.37 ?  493  ARG B NE  1 
ATOM   8018  N  NE  B ARG B  1 493 ? -23.048 37.097  94.308  0.54 190.90 ?  493  ARG B NE  1 
ATOM   8019  C  CZ  A ARG B  1 493 ? -19.767 38.149  94.390  0.46 186.17 ?  493  ARG B CZ  1 
ATOM   8020  C  CZ  B ARG B  1 493 ? -24.299 37.179  94.748  0.54 196.32 ?  493  ARG B CZ  1 
ATOM   8021  N  NH1 A ARG B  1 493 ? -18.645 37.472  94.596  0.46 179.51 ?  493  ARG B NH1 1 
ATOM   8022  N  NH1 B ARG B  1 493 ? -25.014 36.078  94.937  0.54 194.04 ?  493  ARG B NH1 1 
ATOM   8023  N  NH2 A ARG B  1 493 ? -19.739 39.474  94.354  0.46 186.30 ?  493  ARG B NH2 1 
ATOM   8024  N  NH2 B ARG B  1 493 ? -24.840 38.364  94.996  0.54 199.46 ?  493  ARG B NH2 1 
ATOM   8025  N  N   . ASP B  1 494 ? -21.003 31.515  97.458  1.00 192.30 ?  494  ASP B N   1 
ATOM   8026  C  CA  . ASP B  1 494 ? -21.511 30.347  98.186  1.00 195.56 ?  494  ASP B CA  1 
ATOM   8027  C  C   . ASP B  1 494 ? -20.820 29.055  97.729  1.00 190.65 ?  494  ASP B C   1 
ATOM   8028  O  O   . ASP B  1 494 ? -19.628 29.042  97.405  1.00 186.88 ?  494  ASP B O   1 
ATOM   8029  C  CB  . ASP B  1 494 ? -23.039 30.365  97.999  1.00 197.85 ?  494  ASP B CB  1 
ATOM   8030  C  CG  . ASP B  1 494 ? -23.784 29.429  98.952  1.00 200.78 ?  494  ASP B CG  1 
ATOM   8031  O  OD1 . ASP B  1 494 ? -23.400 28.244  99.056  1.00 197.22 ?  494  ASP B OD1 1 
ATOM   8032  O  OD2 . ASP B  1 494 ? -24.788 29.867  99.555  1.00 206.68 ?  494  ASP B OD2 1 
ATOM   8033  N  N   . SER B  1 495 ? -21.586 27.965  97.709  1.00 190.24 ?  495  SER B N   1 
ATOM   8034  C  CA  . SER B  1 495 ? -21.385 26.806  96.854  1.00 182.73 ?  495  SER B CA  1 
ATOM   8035  C  C   . SER B  1 495 ? -22.780 26.480  96.350  1.00 184.39 ?  495  SER B C   1 
ATOM   8036  O  O   . SER B  1 495 ? -23.643 26.059  97.130  1.00 188.68 ?  495  SER B O   1 
ATOM   8037  C  CB  . SER B  1 495 ? -20.769 25.632  97.621  1.00 180.44 ?  495  SER B CB  1 
ATOM   8038  O  OG  . SER B  1 495 ? -20.706 24.464  96.820  1.00 174.10 ?  495  SER B OG  1 
ATOM   8039  N  N   . LYS B  1 496 ? -23.002 26.661  95.066  1.00 181.60 ?  496  LYS B N   1 
ATOM   8040  C  CA  . LYS B  1 496 ? -24.259 26.287  94.449  1.00 183.29 ?  496  LYS B CA  1 
ATOM   8041  C  C   . LYS B  1 496 ? -23.879 25.166  93.504  1.00 177.70 ?  496  LYS B C   1 
ATOM   8042  O  O   . LYS B  1 496 ? -23.223 25.425  92.487  1.00 172.17 ?  496  LYS B O   1 
ATOM   8043  C  CB  . LYS B  1 496 ? -24.873 27.452  93.677  1.00 183.62 ?  496  LYS B CB  1 
ATOM   8044  C  CG  . LYS B  1 496 ? -25.082 28.720  94.481  1.00 188.68 ?  496  LYS B CG  1 
ATOM   8045  C  CD  . LYS B  1 496 ? -25.278 29.907  93.535  1.00 186.97 ?  496  LYS B CD  1 
ATOM   8046  C  CE  . LYS B  1 496 ? -24.211 30.981  93.724  1.00 185.91 ?  496  LYS B CE  1 
ATOM   8047  N  NZ  . LYS B  1 496 ? -22.836 30.405  93.675  1.00 180.24 ?  496  LYS B NZ  1 
ATOM   8048  N  N   . SER B  1 497 ? -24.244 23.919  93.852  1.00 178.56 ?  497  SER B N   1 
ATOM   8049  C  CA  . SER B  1 497 ? -24.219 22.913  92.800  1.00 173.10 ?  497  SER B CA  1 
ATOM   8050  C  C   . SER B  1 497 ? -22.753 22.561  92.482  1.00 167.65 ?  497  SER B C   1 
ATOM   8051  O  O   . SER B  1 497 ? -21.838 23.145  93.076  1.00 168.71 ?  497  SER B O   1 
ATOM   8052  C  CB  . SER B  1 497 ? -25.076 23.403  91.620  1.00 171.14 ?  497  SER B CB  1 
ATOM   8053  O  OG  . SER B  1 497 ? -26.462 23.332  91.938  1.00 175.79 ?  497  SER B OG  1 
ATOM   8054  N  N   . PRO B  1 498 ? -22.486 21.600  91.591  1.00 161.86 ?  498  PRO B N   1 
ATOM   8055  C  CA  . PRO B  1 498 ? -21.369 20.643  91.786  1.00 157.48 ?  498  PRO B CA  1 
ATOM   8056  C  C   . PRO B  1 498 ? -19.952 21.222  91.966  1.00 153.44 ?  498  PRO B C   1 
ATOM   8057  O  O   . PRO B  1 498 ? -19.060 20.478  92.390  1.00 150.74 ?  498  PRO B O   1 
ATOM   8058  C  CB  . PRO B  1 498 ? -21.444 19.809  90.509  1.00 153.30 ?  498  PRO B CB  1 
ATOM   8059  C  CG  . PRO B  1 498 ? -21.905 20.807  89.492  1.00 152.81 ?  498  PRO B CG  1 
ATOM   8060  C  CD  . PRO B  1 498 ? -22.873 21.684  90.166  1.00 158.42 ?  498  PRO B CD  1 
ATOM   8061  N  N   . GLN B  1 499 ? -19.736 22.502  91.683  1.00 153.04 ?  499  GLN B N   1 
ATOM   8062  C  CA  . GLN B  1 499 ? -18.469 23.215  91.476  1.00 149.09 ?  499  GLN B CA  1 
ATOM   8063  C  C   . GLN B  1 499 ? -17.562 22.684  90.347  1.00 146.36 ?  499  GLN B C   1 
ATOM   8064  O  O   . GLN B  1 499 ? -18.046 22.003  89.436  1.00 146.07 ?  499  GLN B O   1 
ATOM   8065  C  CB  . GLN B  1 499 ? -17.701 23.147  92.814  1.00 146.65 ?  499  GLN B CB  1 
ATOM   8066  C  CG  . GLN B  1 499 ? -16.645 24.203  93.130  1.00 145.45 ?  499  GLN B CG  1 
ATOM   8067  C  CD  . GLN B  1 499 ? -17.216 25.433  93.802  1.00 152.91 ?  499  GLN B CD  1 
ATOM   8068  O  OE1 . GLN B  1 499 ? -18.432 25.605  93.887  1.00 156.45 ?  499  GLN B OE1 1 
ATOM   8069  N  NE2 . GLN B  1 499 ? -16.335 26.290  94.303  1.00 153.90 ?  499  GLN B NE2 1 
ATOM   8070  N  N   . TRP B  1 500 ? -16.228 22.975  90.410  1.00 142.65 ?  500  TRP B N   1 
ATOM   8071  C  CA  . TRP B  1 500 ? -15.235 22.659  89.369  1.00 132.97 ?  500  TRP B CA  1 
ATOM   8072  C  C   . TRP B  1 500 ? -13.783 22.582  89.863  1.00 128.42 ?  500  TRP B C   1 
ATOM   8073  O  O   . TRP B  1 500 ? -13.089 23.603  89.768  1.00 128.67 ?  500  TRP B O   1 
ATOM   8074  C  CB  . TRP B  1 500 ? -15.339 23.652  88.202  1.00 130.72 ?  500  TRP B CB  1 
ATOM   8075  C  CG  . TRP B  1 500 ? -14.532 23.257  86.965  1.00 124.71 ?  500  TRP B CG  1 
ATOM   8076  C  CD1 . TRP B  1 500 ? -13.423 22.457  86.923  1.00 121.87 ?  500  TRP B CD1 1 
ATOM   8077  C  CD2 . TRP B  1 500 ? -14.824 23.593  85.598  1.00 121.21 ?  500  TRP B CD2 1 
ATOM   8078  N  NE1 . TRP B  1 500 ? -12.989 22.305  85.630  1.00 117.13 ?  500  TRP B NE1 1 
ATOM   8079  C  CE2 . TRP B  1 500 ? -13.831 22.990  84.797  1.00 116.64 ?  500  TRP B CE2 1 
ATOM   8080  C  CE3 . TRP B  1 500 ? -15.818 24.354  84.976  1.00 122.18 ?  500  TRP B CE3 1 
ATOM   8081  C  CZ2 . TRP B  1 500 ? -13.805 23.122  83.411  1.00 113.10 ?  500  TRP B CZ2 1 
ATOM   8082  C  CZ3 . TRP B  1 500 ? -15.788 24.487  83.597  1.00 118.59 ?  500  TRP B CZ3 1 
ATOM   8083  C  CH2 . TRP B  1 500 ? -14.789 23.872  82.831  1.00 114.11 ?  500  TRP B CH2 1 
ATOM   8084  N  N   . PRO B  1 501 ? -13.279 21.481  90.417  1.00 125.16 ?  501  PRO B N   1 
ATOM   8085  C  CA  . PRO B  1 501 ? -11.890 21.481  90.887  1.00 122.35 ?  501  PRO B CA  1 
ATOM   8086  C  C   . PRO B  1 501 ? -10.927 21.798  89.763  1.00 116.72 ?  501  PRO B C   1 
ATOM   8087  O  O   . PRO B  1 501 ? -11.171 21.448  88.593  1.00 112.95 ?  501  PRO B O   1 
ATOM   8088  C  CB  . PRO B  1 501 ? -11.696 20.049  91.401  1.00 121.20 ?  501  PRO B CB  1 
ATOM   8089  C  CG  . PRO B  1 501 ? -12.569 19.251  90.501  1.00 118.87 ?  501  PRO B CG  1 
ATOM   8090  C  CD  . PRO B  1 501 ? -13.793 20.112  90.256  1.00 121.29 ?  501  PRO B CD  1 
ATOM   8091  N  N   . PRO B  1 502 ? -9.810  22.463  90.065  1.00 116.87 ?  502  PRO B N   1 
ATOM   8092  C  CA  . PRO B  1 502 ? -8.774  22.694  89.050  1.00 115.15 ?  502  PRO B CA  1 
ATOM   8093  C  C   . PRO B  1 502 ? -7.954  21.448  88.743  1.00 112.96 ?  502  PRO B C   1 
ATOM   8094  O  O   . PRO B  1 502 ? -7.740  20.582  89.595  1.00 114.56 ?  502  PRO B O   1 
ATOM   8095  C  CB  . PRO B  1 502 ? -7.887  23.773  89.689  1.00 115.30 ?  502  PRO B CB  1 
ATOM   8096  C  CG  . PRO B  1 502 ? -8.697  24.348  90.797  1.00 120.48 ?  502  PRO B CG  1 
ATOM   8097  C  CD  . PRO B  1 502 ? -9.536  23.218  91.295  1.00 121.64 ?  502  PRO B CD  1 
ATOM   8098  N  N   . TYR B  1 503 ? -7.481  21.380  87.500  1.00 110.74 ?  503  TYR B N   1 
ATOM   8099  C  CA  . TYR B  1 503 ? -6.610  20.290  87.075  1.00 110.46 ?  503  TYR B CA  1 
ATOM   8100  C  C   . TYR B  1 503 ? -5.245  20.423  87.744  1.00 113.16 ?  503  TYR B C   1 
ATOM   8101  O  O   . TYR B  1 503 ? -4.652  21.507  87.761  1.00 115.06 ?  503  TYR B O   1 
ATOM   8102  C  CB  . TYR B  1 503 ? -6.466  20.298  85.548  1.00 107.65 ?  503  TYR B CB  1 
ATOM   8103  C  CG  . TYR B  1 503 ? -5.760  19.092  84.960  1.00 104.47 ?  503  TYR B CG  1 
ATOM   8104  C  CD1 . TYR B  1 503 ? -4.376  19.055  84.848  1.00 103.10 ?  503  TYR B CD1 1 
ATOM   8105  C  CD2 . TYR B  1 503 ? -6.483  18.000  84.492  1.00 102.25 ?  503  TYR B CD2 1 
ATOM   8106  C  CE1 . TYR B  1 503 ? -3.728  17.952  84.307  1.00 98.83  ?  503  TYR B CE1 1 
ATOM   8107  C  CE2 . TYR B  1 503 ? -5.844  16.892  83.948  1.00 98.02  ?  503  TYR B CE2 1 
ATOM   8108  C  CZ  . TYR B  1 503 ? -4.466  16.874  83.859  1.00 95.23  ?  503  TYR B CZ  1 
ATOM   8109  O  OH  . TYR B  1 503 ? -3.820  15.781  83.323  1.00 90.74  ?  503  TYR B OH  1 
ATOM   8110  N  N   . THR B  1 504 ? -4.758  19.323  88.320  1.00 112.98 ?  504  THR B N   1 
ATOM   8111  C  CA  . THR B  1 504 ? -3.446  19.264  88.950  1.00 112.20 ?  504  THR B CA  1 
ATOM   8112  C  C   . THR B  1 504 ? -2.688  18.052  88.422  1.00 111.03 ?  504  THR B C   1 
ATOM   8113  O  O   . THR B  1 504 ? -3.254  17.163  87.779  1.00 109.20 ?  504  THR B O   1 
ATOM   8114  C  CB  . THR B  1 504 ? -3.547  19.201  90.482  1.00 113.24 ?  504  THR B CB  1 
ATOM   8115  O  OG1 . THR B  1 504 ? -4.358  18.085  90.866  1.00 112.58 ?  504  THR B OG1 1 
ATOM   8116  C  CG2 . THR B  1 504 ? -4.152  20.484  91.032  1.00 116.55 ?  504  THR B CG2 1 
ATOM   8117  N  N   . THR B  1 505 ? -1.379  18.036  88.681  1.00 111.74 ?  505  THR B N   1 
ATOM   8118  C  CA  . THR B  1 505 ? -0.569  16.885  88.296  1.00 107.94 ?  505  THR B CA  1 
ATOM   8119  C  C   . THR B  1 505 ? -0.930  15.654  89.120  1.00 108.16 ?  505  THR B C   1 
ATOM   8120  O  O   . THR B  1 505 ? -1.002  14.541  88.585  1.00 105.38 ?  505  THR B O   1 
ATOM   8121  C  CB  . THR B  1 505 ? 0.916   17.211  88.449  1.00 107.11 ?  505  THR B CB  1 
ATOM   8122  O  OG1 . THR B  1 505 ? 1.175   18.519  87.927  1.00 107.00 ?  505  THR B OG1 1 
ATOM   8123  C  CG2 . THR B  1 505 ? 1.759   16.200  87.698  1.00 103.17 ?  505  THR B CG2 1 
ATOM   8124  N  N   . ALA B  1 506 ? -1.156  15.835  90.425  1.00 110.44 ?  506  ALA B N   1 
ATOM   8125  C  CA  . ALA B  1 506 ? -1.457  14.702  91.297  1.00 109.42 ?  506  ALA B CA  1 
ATOM   8126  C  C   . ALA B  1 506 ? -2.856  14.149  91.039  1.00 109.11 ?  506  ALA B C   1 
ATOM   8127  O  O   . ALA B  1 506 ? -3.024  12.949  90.790  1.00 108.68 ?  506  ALA B O   1 
ATOM   8128  C  CB  . ALA B  1 506 ? -1.301  15.118  92.761  1.00 112.42 ?  506  ALA B CB  1 
ATOM   8129  N  N   . ALA B  1 507 ? -3.876  15.010  91.095  1.00 109.78 ?  507  ALA B N   1 
ATOM   8130  C  CA  . ALA B  1 507 ? -5.258  14.546  91.007  1.00 110.06 ?  507  ALA B CA  1 
ATOM   8131  C  C   . ALA B  1 507 ? -5.688  14.276  89.569  1.00 107.99 ?  507  ALA B C   1 
ATOM   8132  O  O   . ALA B  1 507 ? -6.381  13.286  89.305  1.00 107.02 ?  507  ALA B O   1 
ATOM   8133  C  CB  . ALA B  1 507 ? -6.194  15.563  91.657  1.00 113.08 ?  507  ALA B CB  1 
ATOM   8134  N  N   . GLN B  1 508 ? -5.293  15.148  88.637  1.00 108.01 ?  508  GLN B N   1 
ATOM   8135  C  CA  . GLN B  1 508 ? -5.704  15.071  87.230  1.00 105.78 ?  508  GLN B CA  1 
ATOM   8136  C  C   . GLN B  1 508 ? -7.227  15.136  87.089  1.00 104.45 ?  508  GLN B C   1 
ATOM   8137  O  O   . GLN B  1 508 ? -7.843  14.334  86.385  1.00 102.72 ?  508  GLN B O   1 
ATOM   8138  C  CB  . GLN B  1 508 ? -5.142  13.814  86.551  1.00 106.32 ?  508  GLN B CB  1 
ATOM   8139  C  CG  . GLN B  1 508 ? -3.619  13.718  86.526  1.00 107.30 ?  508  GLN B CG  1 
ATOM   8140  C  CD  . GLN B  1 508 ? -3.113  12.671  85.539  1.00 105.43 ?  508  GLN B CD  1 
ATOM   8141  O  OE1 . GLN B  1 508 ? -2.094  12.870  84.876  1.00 104.65 ?  508  GLN B OE1 1 
ATOM   8142  N  NE2 . GLN B  1 508 ? -3.827  11.554  85.437  1.00 104.51 ?  508  GLN B NE2 1 
ATOM   8143  N  N   . GLN B  1 509 ? -7.833  16.125  87.746  1.00 105.29 ?  509  GLN B N   1 
ATOM   8144  C  CA  . GLN B  1 509 ? -9.285  16.246  87.796  1.00 105.51 ?  509  GLN B CA  1 
ATOM   8145  C  C   . GLN B  1 509 ? -9.807  17.130  86.672  1.00 105.57 ?  509  GLN B C   1 
ATOM   8146  O  O   . GLN B  1 509 ? -9.348  18.264  86.493  1.00 105.24 ?  509  GLN B O   1 
ATOM   8147  C  CB  . GLN B  1 509 ? -9.735  16.810  89.142  1.00 108.32 ?  509  GLN B CB  1 
ATOM   8148  C  CG  . GLN B  1 509 ? -9.518  15.871  90.302  1.00 111.06 ?  509  GLN B CG  1 
ATOM   8149  C  CD  . GLN B  1 509 ? -9.892  16.503  91.620  1.00 117.90 ?  509  GLN B CD  1 
ATOM   8150  O  OE1 . GLN B  1 509 ? -9.362  17.551  91.986  1.00 120.07 ?  509  GLN B OE1 1 
ATOM   8151  N  NE2 . GLN B  1 509 ? -10.808 15.870  92.347  1.00 121.85 ?  509  GLN B NE2 1 
ATOM   8152  N  N   . TYR B  1 510 ? -10.778 16.604  85.931  1.00 106.25 ?  510  TYR B N   1 
ATOM   8153  C  CA  . TYR B  1 510 ? -11.509 17.327  84.904  1.00 105.05 ?  510  TYR B CA  1 
ATOM   8154  C  C   . TYR B  1 510 ? -13.002 17.134  85.135  1.00 107.25 ?  510  TYR B C   1 
ATOM   8155  O  O   . TYR B  1 510 ? -13.428 16.242  85.877  1.00 108.98 ?  510  TYR B O   1 
ATOM   8156  C  CB  . TYR B  1 510 ? -11.107 16.866  83.487  1.00 99.56  ?  510  TYR B CB  1 
ATOM   8157  C  CG  . TYR B  1 510 ? -11.424 15.416  83.151  1.00 96.06  ?  510  TYR B CG  1 
ATOM   8158  C  CD1 . TYR B  1 510 ? -10.700 14.374  83.722  1.00 95.27  ?  510  TYR B CD1 1 
ATOM   8159  C  CD2 . TYR B  1 510 ? -12.419 15.094  82.236  1.00 92.94  ?  510  TYR B CD2 1 
ATOM   8160  C  CE1 . TYR B  1 510 ? -10.976 13.052  83.409  1.00 93.53  ?  510  TYR B CE1 1 
ATOM   8161  C  CE2 . TYR B  1 510 ? -12.699 13.774  81.916  1.00 91.41  ?  510  TYR B CE2 1 
ATOM   8162  C  CZ  . TYR B  1 510 ? -11.976 12.761  82.504  1.00 92.34  ?  510  TYR B CZ  1 
ATOM   8163  O  OH  . TYR B  1 510 ? -12.258 11.453  82.183  1.00 92.18  ?  510  TYR B OH  1 
ATOM   8164  N  N   . VAL B  1 511 ? -13.800 17.990  84.501  1.00 106.98 ?  511  VAL B N   1 
ATOM   8165  C  CA  . VAL B  1 511 ? -15.247 17.902  84.623  1.00 109.18 ?  511  VAL B CA  1 
ATOM   8166  C  C   . VAL B  1 511 ? -15.841 17.602  83.256  1.00 106.75 ?  511  VAL B C   1 
ATOM   8167  O  O   . VAL B  1 511 ? -15.243 17.869  82.208  1.00 103.77 ?  511  VAL B O   1 
ATOM   8168  C  CB  . VAL B  1 511 ? -15.878 19.181  85.209  1.00 113.04 ?  511  VAL B CB  1 
ATOM   8169  C  CG1 . VAL B  1 511 ? -15.233 19.534  86.540  1.00 116.03 ?  511  VAL B CG1 1 
ATOM   8170  C  CG2 . VAL B  1 511 ? -15.790 20.327  84.212  1.00 110.68 ?  511  VAL B CG2 1 
ATOM   8171  N  N   . SER B  1 512 ? -17.033 17.020  83.283  1.00 108.32 ?  512  SER B N   1 
ATOM   8172  C  CA  . SER B  1 512 ? -17.791 16.729  82.077  1.00 106.90 ?  512  SER B CA  1 
ATOM   8173  C  C   . SER B  1 512 ? -18.933 17.724  81.962  1.00 112.09 ?  512  SER B C   1 
ATOM   8174  O  O   . SER B  1 512 ? -19.737 17.856  82.891  1.00 116.54 ?  512  SER B O   1 
ATOM   8175  C  CB  . SER B  1 512 ? -18.339 15.300  82.103  1.00 105.83 ?  512  SER B CB  1 
ATOM   8176  O  OG  . SER B  1 512 ? -19.255 15.117  83.170  1.00 108.74 ?  512  SER B OG  1 
ATOM   8177  N  N   . LEU B  1 513 ? -19.031 18.397  80.815  1.00 111.43 ?  513  LEU B N   1 
ATOM   8178  C  CA  . LEU B  1 513 ? -20.198 19.226  80.546  1.00 113.66 ?  513  LEU B CA  1 
ATOM   8179  C  C   . LEU B  1 513 ? -21.082 18.394  79.630  1.00 116.18 ?  513  LEU B C   1 
ATOM   8180  O  O   . LEU B  1 513 ? -20.840 18.301  78.424  1.00 112.38 ?  513  LEU B O   1 
ATOM   8181  C  CB  . LEU B  1 513 ? -19.790 20.529  79.868  1.00 107.99 ?  513  LEU B CB  1 
ATOM   8182  C  CG  . LEU B  1 513 ? -18.575 21.273  80.418  1.00 105.27 ?  513  LEU B CG  1 
ATOM   8183  C  CD1 . LEU B  1 513 ? -18.136 22.343  79.444  1.00 102.65 ?  513  LEU B CD1 1 
ATOM   8184  C  CD2 . LEU B  1 513 ? -18.900 21.895  81.742  1.00 110.07 ?  513  LEU B CD2 1 
ATOM   8185  N  N   . ASN B  1 514 ? -22.119 17.799  80.217  1.00 122.43 ?  514  ASN B N   1 
ATOM   8186  C  CA  . ASN B  1 514 ? -23.248 17.224  79.495  1.00 123.93 ?  514  ASN B CA  1 
ATOM   8187  C  C   . ASN B  1 514 ? -24.486 17.548  80.312  1.00 127.02 ?  514  ASN B C   1 
ATOM   8188  O  O   . ASN B  1 514 ? -24.601 17.009  81.416  1.00 129.56 ?  514  ASN B O   1 
ATOM   8189  C  CB  . ASN B  1 514 ? -23.087 15.705  79.365  1.00 124.92 ?  514  ASN B CB  1 
ATOM   8190  C  CG  . ASN B  1 514 ? -22.581 15.048  80.668  1.00 127.17 ?  514  ASN B CG  1 
ATOM   8191  O  OD1 . ASN B  1 514 ? -22.244 15.733  81.637  1.00 129.31 ?  514  ASN B OD1 1 
ATOM   8192  N  ND2 . ASN B  1 514 ? -22.525 13.717  80.681  1.00 126.45 ?  514  ASN B ND2 1 
ATOM   8193  N  N   . LEU B  1 515 ? -25.425 18.349  79.788  1.00 127.50 ?  515  LEU B N   1 
ATOM   8194  C  CA  . LEU B  1 515 ? -26.784 18.230  80.315  1.00 132.83 ?  515  LEU B CA  1 
ATOM   8195  C  C   . LEU B  1 515 ? -26.741 18.289  81.842  1.00 135.93 ?  515  LEU B C   1 
ATOM   8196  O  O   . LEU B  1 515 ? -26.534 19.354  82.435  1.00 138.00 ?  515  LEU B O   1 
ATOM   8197  C  CB  . LEU B  1 515 ? -27.475 16.976  79.775  1.00 133.24 ?  515  LEU B CB  1 
ATOM   8198  C  CG  . LEU B  1 515 ? -28.070 17.325  78.398  1.00 131.89 ?  515  LEU B CG  1 
ATOM   8199  C  CD1 . LEU B  1 515 ? -28.808 16.163  77.738  1.00 132.22 ?  515  LEU B CD1 1 
ATOM   8200  C  CD2 . LEU B  1 515 ? -28.957 18.574  78.478  1.00 135.45 ?  515  LEU B CD2 1 
ATOM   8201  N  N   . LYS B  1 516 ? -26.935 17.117  82.466  1.00 135.52 ?  516  LYS B N   1 
ATOM   8202  C  CA  . LYS B  1 516 ? -26.920 16.810  83.893  1.00 136.52 ?  516  LYS B CA  1 
ATOM   8203  C  C   . LYS B  1 516 ? -25.717 17.448  84.585  1.00 134.38 ?  516  LYS B C   1 
ATOM   8204  O  O   . LYS B  1 516 ? -24.648 17.584  83.977  1.00 127.16 ?  516  LYS B O   1 
ATOM   8205  C  CB  . LYS B  1 516 ? -26.822 15.293  84.089  1.00 134.37 ?  516  LYS B CB  1 
ATOM   8206  C  CG  . LYS B  1 516 ? -27.406 14.451  82.968  1.00 132.15 ?  516  LYS B CG  1 
ATOM   8207  C  CD  . LYS B  1 516 ? -26.691 13.102  82.843  1.00 129.09 ?  516  LYS B CD  1 
ATOM   8208  C  CE  . LYS B  1 516 ? -26.549 12.400  84.179  1.00 132.76 ?  516  LYS B CE  1 
ATOM   8209  N  NZ  . LYS B  1 516 ? -26.061 11.001  84.042  1.00 129.34 ?  516  LYS B NZ  1 
ATOM   8210  N  N   . PRO B  1 517 ? -25.861 17.861  85.848  1.00 137.88 ?  517  PRO B N   1 
ATOM   8211  C  CA  . PRO B  1 517 ? -24.859 18.731  86.481  1.00 137.19 ?  517  PRO B CA  1 
ATOM   8212  C  C   . PRO B  1 517 ? -23.465 18.119  86.494  1.00 133.01 ?  517  PRO B C   1 
ATOM   8213  O  O   . PRO B  1 517 ? -23.281 16.911  86.326  1.00 131.91 ?  517  PRO B O   1 
ATOM   8214  C  CB  . PRO B  1 517 ? -25.398 18.910  87.906  1.00 141.90 ?  517  PRO B CB  1 
ATOM   8215  C  CG  . PRO B  1 517 ? -26.268 17.707  88.129  1.00 144.42 ?  517  PRO B CG  1 
ATOM   8216  C  CD  . PRO B  1 517 ? -26.901 17.436  86.802  1.00 142.82 ?  517  PRO B CD  1 
ATOM   8217  N  N   . LEU B  1 518 ? -22.472 18.991  86.681  1.00 131.07 ?  518  LEU B N   1 
ATOM   8218  C  CA  . LEU B  1 518 ? -21.070 18.602  86.576  1.00 126.82 ?  518  LEU B CA  1 
ATOM   8219  C  C   . LEU B  1 518 ? -20.770 17.413  87.475  1.00 129.58 ?  518  LEU B C   1 
ATOM   8220  O  O   . LEU B  1 518 ? -21.076 17.426  88.670  1.00 133.81 ?  518  LEU B O   1 
ATOM   8221  C  CB  . LEU B  1 518 ? -20.172 19.774  86.977  1.00 125.90 ?  518  LEU B CB  1 
ATOM   8222  C  CG  . LEU B  1 518 ? -19.944 20.917  86.001  1.00 124.54 ?  518  LEU B CG  1 
ATOM   8223  C  CD1 . LEU B  1 518 ? -18.875 21.857  86.509  1.00 124.08 ?  518  LEU B CD1 1 
ATOM   8224  C  CD2 . LEU B  1 518 ? -19.526 20.331  84.695  1.00 120.52 ?  518  LEU B CD2 1 
ATOM   8225  N  N   . GLU B  1 519 ? -20.185 16.376  86.890  1.00 127.72 ?  519  GLU B N   1 
ATOM   8226  C  CA  . GLU B  1 519 ? -19.606 15.277  87.648  1.00 130.23 ?  519  GLU B CA  1 
ATOM   8227  C  C   . GLU B  1 519 ? -18.102 15.297  87.428  1.00 123.28 ?  519  GLU B C   1 
ATOM   8228  O  O   . GLU B  1 519 ? -17.639 15.475  86.296  1.00 119.14 ?  519  GLU B O   1 
ATOM   8229  C  CB  . GLU B  1 519 ? -20.218 13.930  87.243  1.00 133.64 ?  519  GLU B CB  1 
ATOM   8230  C  CG  . GLU B  1 519 ? -20.376 13.722  85.744  1.00 131.54 ?  519  GLU B CG  1 
ATOM   8231  C  CD  . GLU B  1 519 ? -20.801 12.304  85.388  1.00 131.14 ?  519  GLU B CD  1 
ATOM   8232  O  OE1 . GLU B  1 519 ? -20.221 11.346  85.947  1.00 129.29 ?  519  GLU B OE1 1 
ATOM   8233  O  OE2 . GLU B  1 519 ? -21.725 12.152  84.557  1.00 131.94 ?  519  GLU B OE2 1 
ATOM   8234  N  N   . VAL B  1 520 ? -17.348 15.155  88.513  1.00 122.35 ?  520  VAL B N   1 
ATOM   8235  C  CA  . VAL B  1 520 ? -15.898 15.288  88.472  1.00 118.55 ?  520  VAL B CA  1 
ATOM   8236  C  C   . VAL B  1 520 ? -15.284 13.920  88.223  1.00 117.61 ?  520  VAL B C   1 
ATOM   8237  O  O   . VAL B  1 520 ? -15.581 12.951  88.934  1.00 120.24 ?  520  VAL B O   1 
ATOM   8238  C  CB  . VAL B  1 520 ? -15.362 15.903  89.775  1.00 119.88 ?  520  VAL B CB  1 
ATOM   8239  C  CG1 . VAL B  1 520 ? -13.837 15.844  89.813  1.00 115.89 ?  520  VAL B CG1 1 
ATOM   8240  C  CG2 . VAL B  1 520 ? -15.854 17.322  89.916  1.00 121.60 ?  520  VAL B CG2 1 
ATOM   8241  N  N   . ARG B  1 521 ? -14.425 13.842  87.215  1.00 113.71 ?  521  ARG B N   1 
ATOM   8242  C  CA  . ARG B  1 521 ? -13.689 12.632  86.900  1.00 111.32 ?  521  ARG B CA  1 
ATOM   8243  C  C   . ARG B  1 521 ? -12.205 12.957  86.952  1.00 110.04 ?  521  ARG B C   1 
ATOM   8244  O  O   . ARG B  1 521 ? -11.807 14.124  86.952  1.00 109.12 ?  521  ARG B O   1 
ATOM   8245  C  CB  . ARG B  1 521 ? -14.066 12.083  85.517  1.00 107.25 ?  521  ARG B CB  1 
ATOM   8246  C  CG  . ARG B  1 521 ? -15.562 11.908  85.285  1.00 108.84 ?  521  ARG B CG  1 
ATOM   8247  C  CD  . ARG B  1 521 ? -15.835 11.532  83.833  1.00 105.49 ?  521  ARG B CD  1 
ATOM   8248  N  NE  . ARG B  1 521 ? -17.255 11.580  83.492  1.00 107.60 ?  521  ARG B NE  1 
ATOM   8249  C  CZ  . ARG B  1 521 ? -17.716 11.667  82.246  1.00 105.49 ?  521  ARG B CZ  1 
ATOM   8250  N  NH1 . ARG B  1 521 ? -16.866 11.714  81.228  1.00 97.23  ?  521  ARG B NH1 1 
ATOM   8251  N  NH2 . ARG B  1 521 ? -19.023 11.713  82.017  1.00 106.85 ?  521  ARG B NH2 1 
ATOM   8252  N  N   . ARG B  1 522 ? -11.386 11.917  87.025  1.00 110.05 ?  522  ARG B N   1 
ATOM   8253  C  CA  . ARG B  1 522 ? -9.942  12.086  86.998  1.00 108.94 ?  522  ARG B CA  1 
ATOM   8254  C  C   . ARG B  1 522 ? -9.353  11.108  85.990  1.00 104.45 ?  522  ARG B C   1 
ATOM   8255  O  O   . ARG B  1 522 ? -10.029 10.189  85.517  1.00 101.55 ?  522  ARG B O   1 
ATOM   8256  C  CB  . ARG B  1 522 ? -9.316  11.903  88.391  1.00 112.90 ?  522  ARG B CB  1 
ATOM   8257  C  CG  . ARG B  1 522 ? -9.655  10.605  89.106  1.00 116.59 ?  522  ARG B CG  1 
ATOM   8258  C  CD  . ARG B  1 522 ? -10.951 10.691  89.904  1.00 122.16 ?  522  ARG B CD  1 
ATOM   8259  N  NE  . ARG B  1 522 ? -11.225 9.440   90.607  1.00 125.66 ?  522  ARG B NE  1 
ATOM   8260  C  CZ  . ARG B  1 522 ? -11.778 8.370   90.043  1.00 125.55 ?  522  ARG B CZ  1 
ATOM   8261  N  NH1 . ARG B  1 522 ? -12.118 8.392   88.759  1.00 122.80 ?  522  ARG B NH1 1 
ATOM   8262  N  NH2 . ARG B  1 522 ? -11.986 7.273   90.762  1.00 127.88 ?  522  ARG B NH2 1 
ATOM   8263  N  N   . GLY B  1 523 ? -8.070  11.288  85.679  1.00 104.33 ?  523  GLY B N   1 
ATOM   8264  C  CA  . GLY B  1 523 ? -7.467  10.434  84.675  1.00 102.26 ?  523  GLY B CA  1 
ATOM   8265  C  C   . GLY B  1 523 ? -7.895  10.643  83.234  1.00 98.39  ?  523  GLY B C   1 
ATOM   8266  O  O   . GLY B  1 523 ? -8.497  9.741   82.638  1.00 100.55 ?  523  GLY B O   1 
ATOM   8267  N  N   . LEU B  1 524 ? -7.657  11.832  82.668  1.00 92.63  ?  524  LEU B N   1 
ATOM   8268  C  CA  . LEU B  1 524 ? -8.168  12.091  81.327  1.00 88.43  ?  524  LEU B CA  1 
ATOM   8269  C  C   . LEU B  1 524 ? -7.363  11.256  80.342  1.00 83.64  ?  524  LEU B C   1 
ATOM   8270  O  O   . LEU B  1 524 ? -6.190  11.546  80.080  1.00 78.88  ?  524  LEU B O   1 
ATOM   8271  C  CB  . LEU B  1 524 ? -8.020  13.582  81.027  1.00 88.28  ?  524  LEU B CB  1 
ATOM   8272  C  CG  . LEU B  1 524 ? -8.662  14.354  79.870  1.00 87.01  ?  524  LEU B CG  1 
ATOM   8273  C  CD1 . LEU B  1 524 ? -8.233  15.793  79.966  1.00 80.61  ?  524  LEU B CD1 1 
ATOM   8274  C  CD2 . LEU B  1 524 ? -8.290  13.829  78.505  1.00 86.14  ?  524  LEU B CD2 1 
ATOM   8275  N  N   . ARG B  1 525 ? -8.040  10.281  79.736  1.00 85.96  ?  525  ARG B N   1 
ATOM   8276  C  CA  . ARG B  1 525 ? -7.441  9.320   78.809  1.00 87.05  ?  525  ARG B CA  1 
ATOM   8277  C  C   . ARG B  1 525 ? -6.064  8.869   79.297  1.00 86.41  ?  525  ARG B C   1 
ATOM   8278  O  O   . ARG B  1 525 ? -5.096  8.825   78.538  1.00 88.27  ?  525  ARG B O   1 
ATOM   8279  C  CB  . ARG B  1 525 ? -7.387  9.876   77.392  1.00 87.59  ?  525  ARG B CB  1 
ATOM   8280  C  CG  . ARG B  1 525 ? -8.755  9.890   76.729  1.00 91.30  ?  525  ARG B CG  1 
ATOM   8281  C  CD  . ARG B  1 525 ? -9.369  8.493   76.605  1.00 94.45  ?  525  ARG B CD  1 
ATOM   8282  N  NE  . ARG B  1 525 ? -9.589  8.118   75.211  1.00 96.14  ?  525  ARG B NE  1 
ATOM   8283  C  CZ  . ARG B  1 525 ? -10.618 8.551   74.480  1.00 99.95  ?  525  ARG B CZ  1 
ATOM   8284  N  NH1 . ARG B  1 525 ? -11.511 9.380   75.009  1.00 102.70 ?  525  ARG B NH1 1 
ATOM   8285  N  NH2 . ARG B  1 525 ? -10.753 8.165   73.216  1.00 99.42  ?  525  ARG B NH2 1 
ATOM   8286  N  N   . ALA B  1 526 ? -5.983  8.533   80.587  1.00 83.23  ?  526  ALA B N   1 
ATOM   8287  C  CA  . ALA B  1 526 ? -4.682  8.424   81.246  1.00 78.93  ?  526  ALA B CA  1 
ATOM   8288  C  C   . ALA B  1 526 ? -3.806  7.361   80.594  1.00 75.25  ?  526  ALA B C   1 
ATOM   8289  O  O   . ALA B  1 526 ? -2.649  7.626   80.246  1.00 72.92  ?  526  ALA B O   1 
ATOM   8290  C  CB  . ALA B  1 526 ? -4.871  8.127   82.733  1.00 80.20  ?  526  ALA B CB  1 
ATOM   8291  N  N   . GLN B  1 527 ? -4.343  6.150   80.422  1.00 76.05  ?  527  GLN B N   1 
ATOM   8292  C  CA  . GLN B  1 527 ? -3.568  5.062   79.831  1.00 76.05  ?  527  GLN B CA  1 
ATOM   8293  C  C   . GLN B  1 527 ? -3.271  5.332   78.360  1.00 74.28  ?  527  GLN B C   1 
ATOM   8294  O  O   . GLN B  1 527 ? -2.112  5.272   77.924  1.00 73.07  ?  527  GLN B O   1 
ATOM   8295  C  CB  . GLN B  1 527 ? -4.322  3.742   79.983  1.00 77.84  ?  527  GLN B CB  1 
ATOM   8296  C  CG  . GLN B  1 527 ? -4.773  3.437   81.398  1.00 84.03  ?  527  GLN B CG  1 
ATOM   8297  C  CD  . GLN B  1 527 ? -3.610  3.239   82.350  1.00 88.86  ?  527  GLN B CD  1 
ATOM   8298  O  OE1 . GLN B  1 527 ? -3.579  3.814   83.440  1.00 92.24  ?  527  GLN B OE1 1 
ATOM   8299  N  NE2 . GLN B  1 527 ? -2.637  2.430   81.936  1.00 89.05  ?  527  GLN B NE2 1 
ATOM   8300  N  N   . THR B  1 528 ? -4.313  5.636   77.582  1.00 73.43  ?  528  THR B N   1 
ATOM   8301  C  CA  . THR B  1 528 ? -4.148  5.859   76.150  1.00 69.31  ?  528  THR B CA  1 
ATOM   8302  C  C   . THR B  1 528 ? -3.197  7.017   75.875  1.00 66.87  ?  528  THR B C   1 
ATOM   8303  O  O   . THR B  1 528 ? -2.256  6.888   75.084  1.00 64.55  ?  528  THR B O   1 
ATOM   8304  C  CB  . THR B  1 528 ? -5.511  6.118   75.510  1.00 71.08  ?  528  THR B CB  1 
ATOM   8305  O  OG1 . THR B  1 528 ? -6.293  4.917   75.552  1.00 72.19  ?  528  THR B OG1 1 
ATOM   8306  C  CG2 . THR B  1 528 ? -5.344  6.564   74.071  1.00 69.59  ?  528  THR B CG2 1 
ATOM   8307  N  N   . CYS B  1 529 ? -3.421  8.160   76.522  1.00 66.80  ?  529  CYS B N   1 
ATOM   8308  C  CA  . CYS B  1 529 ? -2.532  9.290   76.295  1.00 65.69  ?  529  CYS B CA  1 
ATOM   8309  C  C   . CYS B  1 529 ? -1.151  9.063   76.887  1.00 65.75  ?  529  CYS B C   1 
ATOM   8310  O  O   . CYS B  1 529 ? -0.192  9.697   76.437  1.00 65.66  ?  529  CYS B O   1 
ATOM   8311  C  CB  . CYS B  1 529 ? -3.147  10.573  76.845  1.00 67.22  ?  529  CYS B CB  1 
ATOM   8312  S  SG  . CYS B  1 529 ? -4.523  11.155  75.850  1.00 66.78  ?  529  CYS B SG  1 
ATOM   8313  N  N   . ALA B  1 530 ? -1.016  8.181   77.879  1.00 67.36  ?  530  ALA B N   1 
ATOM   8314  C  CA  . ALA B  1 530 ? 0.326   7.762   78.264  1.00 69.00  ?  530  ALA B CA  1 
ATOM   8315  C  C   . ALA B  1 530 ? 0.999   6.982   77.142  1.00 66.12  ?  530  ALA B C   1 
ATOM   8316  O  O   . ALA B  1 530 ? 2.218   7.089   76.958  1.00 66.34  ?  530  ALA B O   1 
ATOM   8317  C  CB  . ALA B  1 530 ? 0.275   6.934   79.547  1.00 69.68  ?  530  ALA B CB  1 
ATOM   8318  N  N   . PHE B  1 531 ? 0.221   6.214   76.375  1.00 64.75  ?  531  PHE B N   1 
ATOM   8319  C  CA  . PHE B  1 531 ? 0.765   5.521   75.209  1.00 63.07  ?  531  PHE B CA  1 
ATOM   8320  C  C   . PHE B  1 531 ? 1.179   6.505   74.121  1.00 63.12  ?  531  PHE B C   1 
ATOM   8321  O  O   . PHE B  1 531 ? 2.268   6.386   73.547  1.00 62.56  ?  531  PHE B O   1 
ATOM   8322  C  CB  . PHE B  1 531 ? -0.262  4.523   74.669  1.00 62.85  ?  531  PHE B CB  1 
ATOM   8323  C  CG  . PHE B  1 531 ? -0.009  4.087   73.247  1.00 62.57  ?  531  PHE B CG  1 
ATOM   8324  C  CD1 . PHE B  1 531 ? 0.890   3.070   72.965  1.00 62.99  ?  531  PHE B CD1 1 
ATOM   8325  C  CD2 . PHE B  1 531 ? -0.688  4.685   72.193  1.00 62.54  ?  531  PHE B CD2 1 
ATOM   8326  C  CE1 . PHE B  1 531 ? 1.116   2.666   71.659  1.00 62.23  ?  531  PHE B CE1 1 
ATOM   8327  C  CE2 . PHE B  1 531 ? -0.465  4.286   70.886  1.00 61.91  ?  531  PHE B CE2 1 
ATOM   8328  C  CZ  . PHE B  1 531 ? 0.439   3.273   70.620  1.00 61.60  ?  531  PHE B CZ  1 
ATOM   8329  N  N   . TRP B  1 532 ? 0.315   7.476   73.812  1.00 64.06  ?  532  TRP B N   1 
ATOM   8330  C  CA  . TRP B  1 532 ? 0.618   8.436   72.753  1.00 61.42  ?  532  TRP B CA  1 
ATOM   8331  C  C   . TRP B  1 532 ? 1.794   9.333   73.123  1.00 60.93  ?  532  TRP B C   1 
ATOM   8332  O  O   . TRP B  1 532 ? 2.727   9.507   72.329  1.00 59.77  ?  532  TRP B O   1 
ATOM   8333  C  CB  . TRP B  1 532 ? -0.615  9.286   72.439  1.00 61.18  ?  532  TRP B CB  1 
ATOM   8334  C  CG  . TRP B  1 532 ? -1.627  8.581   71.611  1.00 58.33  ?  532  TRP B CG  1 
ATOM   8335  C  CD1 . TRP B  1 532 ? -2.804  8.044   72.033  1.00 59.76  ?  532  TRP B CD1 1 
ATOM   8336  C  CD2 . TRP B  1 532 ? -1.551  8.330   70.204  1.00 59.06  ?  532  TRP B CD2 1 
ATOM   8337  N  NE1 . TRP B  1 532 ? -3.469  7.474   70.977  1.00 61.59  ?  532  TRP B NE1 1 
ATOM   8338  C  CE2 . TRP B  1 532 ? -2.719  7.634   69.842  1.00 59.24  ?  532  TRP B CE2 1 
ATOM   8339  C  CE3 . TRP B  1 532 ? -0.607  8.626   69.215  1.00 55.49  ?  532  TRP B CE3 1 
ATOM   8340  C  CZ2 . TRP B  1 532 ? -2.969  7.230   68.534  1.00 57.72  ?  532  TRP B CZ2 1 
ATOM   8341  C  CZ3 . TRP B  1 532 ? -0.855  8.222   67.921  1.00 54.05  ?  532  TRP B CZ3 1 
ATOM   8342  C  CH2 . TRP B  1 532 ? -2.026  7.534   67.590  1.00 56.95  ?  532  TRP B CH2 1 
ATOM   8343  N  N   . ASN B  1 533 ? 1.746   9.946   74.311  1.00 61.69  ?  533  ASN B N   1 
ATOM   8344  C  CA  . ASN B  1 533 ? 2.753   10.931  74.688  1.00 62.79  ?  533  ASN B CA  1 
ATOM   8345  C  C   . ASN B  1 533 ? 4.042   10.289  75.198  1.00 66.33  ?  533  ASN B C   1 
ATOM   8346  O  O   . ASN B  1 533 ? 5.136   10.729  74.833  1.00 67.62  ?  533  ASN B O   1 
ATOM   8347  C  CB  . ASN B  1 533 ? 2.180   11.882  75.738  1.00 62.92  ?  533  ASN B CB  1 
ATOM   8348  C  CG  . ASN B  1 533 ? 0.999   12.683  75.216  1.00 63.82  ?  533  ASN B CG  1 
ATOM   8349  O  OD1 . ASN B  1 533 ? 0.901   12.961  74.021  1.00 64.01  ?  533  ASN B OD1 1 
ATOM   8350  N  ND2 . ASN B  1 533 ? 0.095   13.058  76.114  1.00 65.33  ?  533  ASN B ND2 1 
ATOM   8351  N  N   . ARG B  1 534 ? 3.948   9.277   76.066  1.00 69.72  ?  534  ARG B N   1 
ATOM   8352  C  CA  . ARG B  1 534 ? 5.167   8.728   76.658  1.00 73.83  ?  534  ARG B CA  1 
ATOM   8353  C  C   . ARG B  1 534 ? 5.866   7.697   75.776  1.00 73.75  ?  534  ARG B C   1 
ATOM   8354  O  O   . ARG B  1 534 ? 7.096   7.730   75.647  1.00 75.18  ?  534  ARG B O   1 
ATOM   8355  C  CB  . ARG B  1 534 ? 4.866   8.140   78.034  1.00 77.73  ?  534  ARG B CB  1 
ATOM   8356  C  CG  . ARG B  1 534 ? 4.676   9.233   79.058  1.00 81.09  ?  534  ARG B CG  1 
ATOM   8357  C  CD  . ARG B  1 534 ? 4.145   8.735   80.366  1.00 85.99  ?  534  ARG B CD  1 
ATOM   8358  N  NE  . ARG B  1 534 ? 4.158   9.808   81.353  1.00 92.20  ?  534  ARG B NE  1 
ATOM   8359  C  CZ  . ARG B  1 534 ? 5.225   10.122  82.081  1.00 98.08  ?  534  ARG B CZ  1 
ATOM   8360  N  NH1 . ARG B  1 534 ? 6.356   9.445   81.922  1.00 98.29  ?  534  ARG B NH1 1 
ATOM   8361  N  NH2 . ARG B  1 534 ? 5.165   11.112  82.965  1.00 102.56 ?  534  ARG B NH2 1 
ATOM   8362  N  N   . PHE B  1 535 ? 5.115   6.780   75.163  1.00 71.59  ?  535  PHE B N   1 
ATOM   8363  C  CA  . PHE B  1 535 ? 5.724   5.595   74.561  1.00 68.59  ?  535  PHE B CA  1 
ATOM   8364  C  C   . PHE B  1 535 ? 6.094   5.799   73.094  1.00 66.23  ?  535  PHE B C   1 
ATOM   8365  O  O   . PHE B  1 535 ? 7.270   5.685   72.733  1.00 64.71  ?  535  PHE B O   1 
ATOM   8366  C  CB  . PHE B  1 535 ? 4.808   4.380   74.695  1.00 66.13  ?  535  PHE B CB  1 
ATOM   8367  C  CG  . PHE B  1 535 ? 5.373   3.137   74.072  1.00 63.99  ?  535  PHE B CG  1 
ATOM   8368  C  CD1 . PHE B  1 535 ? 6.484   2.518   74.632  1.00 64.13  ?  535  PHE B CD1 1 
ATOM   8369  C  CD2 . PHE B  1 535 ? 4.817   2.593   72.927  1.00 63.50  ?  535  PHE B CD2 1 
ATOM   8370  C  CE1 . PHE B  1 535 ? 7.019   1.372   74.070  1.00 64.28  ?  535  PHE B CE1 1 
ATOM   8371  C  CE2 . PHE B  1 535 ? 5.349   1.445   72.357  1.00 64.25  ?  535  PHE B CE2 1 
ATOM   8372  C  CZ  . PHE B  1 535 ? 6.451   0.835   72.931  1.00 64.54  ?  535  PHE B CZ  1 
ATOM   8373  N  N   . LEU B  1 536 ? 5.096   6.048   72.240  1.00 65.29  ?  536  LEU B N   1 
ATOM   8374  C  CA  . LEU B  1 536 ? 5.340   6.216   70.808  1.00 63.46  ?  536  LEU B CA  1 
ATOM   8375  C  C   . LEU B  1 536 ? 6.540   7.107   70.491  1.00 68.83  ?  536  LEU B C   1 
ATOM   8376  O  O   . LEU B  1 536 ? 7.295   6.752   69.571  1.00 69.38  ?  536  LEU B O   1 
ATOM   8377  C  CB  . LEU B  1 536 ? 4.068   6.733   70.122  1.00 57.51  ?  536  LEU B CB  1 
ATOM   8378  C  CG  . LEU B  1 536 ? 3.067   5.650   69.718  1.00 55.73  ?  536  LEU B CG  1 
ATOM   8379  C  CD1 . LEU B  1 536 ? 2.004   6.255   68.823  1.00 54.36  ?  536  LEU B CD1 1 
ATOM   8380  C  CD2 . LEU B  1 536 ? 3.757   4.456   69.059  1.00 55.02  ?  536  LEU B CD2 1 
ATOM   8381  N  N   . PRO B  1 537 ? 6.799   8.226   71.194  1.00 73.24  ?  537  PRO B N   1 
ATOM   8382  C  CA  . PRO B  1 537 ? 8.077   8.933   70.970  1.00 75.87  ?  537  PRO B CA  1 
ATOM   8383  C  C   . PRO B  1 537 ? 9.311   8.067   71.177  1.00 78.60  ?  537  PRO B C   1 
ATOM   8384  O  O   . PRO B  1 537 ? 10.244  8.129   70.364  1.00 79.77  ?  537  PRO B O   1 
ATOM   8385  C  CB  . PRO B  1 537 ? 8.018   10.089  71.976  1.00 77.66  ?  537  PRO B CB  1 
ATOM   8386  C  CG  . PRO B  1 537 ? 6.576   10.379  72.102  1.00 77.04  ?  537  PRO B CG  1 
ATOM   8387  C  CD  . PRO B  1 537 ? 5.876   9.037   72.008  1.00 75.06  ?  537  PRO B CD  1 
ATOM   8388  N  N   . LYS B  1 538 ? 9.347   7.240   72.228  1.00 78.59  ?  538  LYS B N   1 
ATOM   8389  C  CA  . LYS B  1 538 ? 10.477  6.333   72.406  1.00 76.73  ?  538  LYS B CA  1 
ATOM   8390  C  C   . LYS B  1 538 ? 10.665  5.421   71.202  1.00 77.15  ?  538  LYS B C   1 
ATOM   8391  O  O   . LYS B  1 538 ? 11.737  4.826   71.045  1.00 77.95  ?  538  LYS B O   1 
ATOM   8392  C  CB  . LYS B  1 538 ? 10.312  5.505   73.686  1.00 74.50  ?  538  LYS B CB  1 
ATOM   8393  C  CG  . LYS B  1 538 ? 10.424  6.327   74.964  1.00 74.81  ?  538  LYS B CG  1 
ATOM   8394  C  CD  . LYS B  1 538 ? 10.033  5.554   76.213  1.00 75.48  ?  538  LYS B CD  1 
ATOM   8395  C  CE  . LYS B  1 538 ? 10.408  6.349   77.460  1.00 77.03  ?  538  LYS B CE  1 
ATOM   8396  N  NZ  . LYS B  1 538 ? 9.760   5.810   78.685  1.00 78.57  ?  538  LYS B NZ  1 
ATOM   8397  N  N   . LEU B  1 539 ? 9.639   5.289   70.363  1.00 77.62  ?  539  LEU B N   1 
ATOM   8398  C  CA  . LEU B  1 539 ? 9.719   4.456   69.173  1.00 81.04  ?  539  LEU B CA  1 
ATOM   8399  C  C   . LEU B  1 539 ? 10.399  5.164   67.996  1.00 86.90  ?  539  LEU B C   1 
ATOM   8400  O  O   . LEU B  1 539 ? 10.974  4.491   67.128  1.00 87.40  ?  539  LEU B O   1 
ATOM   8401  C  CB  . LEU B  1 539 ? 8.313   3.972   68.817  1.00 79.04  ?  539  LEU B CB  1 
ATOM   8402  C  CG  . LEU B  1 539 ? 8.138   2.601   68.183  1.00 79.45  ?  539  LEU B CG  1 
ATOM   8403  C  CD1 . LEU B  1 539 ? 6.778   2.122   68.355  1.00 78.52  ?  539  LEU B CD1 1 
ATOM   8404  C  CD2 . LEU B  1 539 ? 8.454   2.615   66.748  1.00 80.25  ?  539  LEU B CD2 1 
ATOM   8405  N  N   . LEU B  1 540 ? 10.359  6.504   67.922  1.00 91.05  ?  540  LEU B N   1 
ATOM   8406  C  CA  . LEU B  1 540 ? 10.961  7.178   66.770  1.00 92.13  ?  540  LEU B CA  1 
ATOM   8407  C  C   . LEU B  1 540 ? 12.395  7.623   67.033  1.00 97.07  ?  540  LEU B C   1 
ATOM   8408  O  O   . LEU B  1 540 ? 13.027  8.189   66.134  1.00 98.06  ?  540  LEU B O   1 
ATOM   8409  C  CB  . LEU B  1 540 ? 10.137  8.396   66.309  1.00 87.05  ?  540  LEU B CB  1 
ATOM   8410  C  CG  . LEU B  1 540 ? 10.335  9.851   66.784  1.00 83.72  ?  540  LEU B CG  1 
ATOM   8411  C  CD1 . LEU B  1 540 ? 9.505   10.786  65.916  1.00 81.61  ?  540  LEU B CD1 1 
ATOM   8412  C  CD2 . LEU B  1 540 ? 10.036  10.104  68.238  1.00 83.05  ?  540  LEU B CD2 1 
ATOM   8413  N  N   . SER B  1 541 ? 12.924  7.386   68.232  1.00 99.18  ?  541  SER B N   1 
ATOM   8414  C  CA  . SER B  1 541 ? 14.299  7.766   68.545  1.00 99.86  ?  541  SER B CA  1 
ATOM   8415  C  C   . SER B  1 541 ? 14.995  6.704   69.400  1.00 102.23 ?  541  SER B C   1 
ATOM   8416  O  O   . SER B  1 541 ? 15.203  5.570   68.960  1.00 102.63 ?  541  SER B O   1 
ATOM   8417  C  CB  . SER B  1 541 ? 14.332  9.126   69.255  1.00 97.95  ?  541  SER B CB  1 
ATOM   8418  O  OG  . SER B  1 541 ? 13.783  9.046   70.560  1.00 96.83  ?  541  SER B OG  1 
ATOM   8419  N  N   . GLU C  1 4   ? 23.261  17.604  -11.009 1.00 65.73  ?  4    GLU C N   1 
ATOM   8420  C  CA  . GLU C  1 4   ? 24.250  17.270  -12.029 1.00 67.88  ?  4    GLU C CA  1 
ATOM   8421  C  C   . GLU C  1 4   ? 25.454  16.540  -11.430 1.00 69.99  ?  4    GLU C C   1 
ATOM   8422  O  O   . GLU C  1 4   ? 26.072  15.715  -12.102 1.00 73.35  ?  4    GLU C O   1 
ATOM   8423  C  CB  . GLU C  1 4   ? 24.712  18.532  -12.767 1.00 68.76  ?  4    GLU C CB  1 
ATOM   8424  C  CG  . GLU C  1 4   ? 23.766  19.007  -13.866 1.00 73.34  ?  4    GLU C CG  1 
ATOM   8425  C  CD  . GLU C  1 4   ? 23.829  18.144  -15.118 1.00 81.24  ?  4    GLU C CD  1 
ATOM   8426  O  OE1 . GLU C  1 4   ? 23.456  16.949  -15.049 1.00 84.60  ?  4    GLU C OE1 1 
ATOM   8427  O  OE2 . GLU C  1 4   ? 24.255  18.659  -16.177 1.00 83.54  ?  4    GLU C OE2 1 
ATOM   8428  N  N   . ASP C  1 5   ? 25.774  16.833  -10.171 1.00 68.22  ?  5    ASP C N   1 
ATOM   8429  C  CA  . ASP C  1 5   ? 26.899  16.196  -9.495  1.00 66.69  ?  5    ASP C CA  1 
ATOM   8430  C  C   . ASP C  1 5   ? 26.648  14.696  -9.375  1.00 66.06  ?  5    ASP C C   1 
ATOM   8431  O  O   . ASP C  1 5   ? 25.696  14.289  -8.689  1.00 64.02  ?  5    ASP C O   1 
ATOM   8432  C  CB  . ASP C  1 5   ? 27.097  16.807  -8.110  1.00 65.74  ?  5    ASP C CB  1 
ATOM   8433  C  CG  . ASP C  1 5   ? 28.411  16.387  -7.454  1.00 65.87  ?  5    ASP C CG  1 
ATOM   8434  O  OD1 . ASP C  1 5   ? 28.907  15.270  -7.721  1.00 64.89  ?  5    ASP C OD1 1 
ATOM   8435  O  OD2 . ASP C  1 5   ? 28.938  17.179  -6.642  1.00 66.01  ?  5    ASP C OD2 1 
ATOM   8436  N  N   . PRO C  1 6   ? 27.470  13.847  -9.998  1.00 68.15  ?  6    PRO C N   1 
ATOM   8437  C  CA  . PRO C  1 6   ? 27.198  12.401  -9.958  1.00 69.35  ?  6    PRO C CA  1 
ATOM   8438  C  C   . PRO C  1 6   ? 27.392  11.778  -8.590  1.00 70.55  ?  6    PRO C C   1 
ATOM   8439  O  O   . PRO C  1 6   ? 26.814  10.714  -8.328  1.00 72.08  ?  6    PRO C O   1 
ATOM   8440  C  CB  . PRO C  1 6   ? 28.192  11.829  -10.976 1.00 70.76  ?  6    PRO C CB  1 
ATOM   8441  C  CG  . PRO C  1 6   ? 29.305  12.824  -11.007 1.00 70.77  ?  6    PRO C CG  1 
ATOM   8442  C  CD  . PRO C  1 6   ? 28.665  14.167  -10.799 1.00 69.80  ?  6    PRO C CD  1 
ATOM   8443  N  N   . GLN C  1 7   ? 28.188  12.391  -7.714  1.00 70.48  ?  7    GLN C N   1 
ATOM   8444  C  CA  . GLN C  1 7   ? 28.450  11.810  -6.404  1.00 69.63  ?  7    GLN C CA  1 
ATOM   8445  C  C   . GLN C  1 7   ? 27.336  12.074  -5.400  1.00 68.53  ?  7    GLN C C   1 
ATOM   8446  O  O   . GLN C  1 7   ? 27.248  11.361  -4.395  1.00 71.89  ?  7    GLN C O   1 
ATOM   8447  C  CB  . GLN C  1 7   ? 29.768  12.352  -5.849  1.00 69.71  ?  7    GLN C CB  1 
ATOM   8448  C  CG  . GLN C  1 7   ? 31.008  12.010  -6.670  1.00 71.92  ?  7    GLN C CG  1 
ATOM   8449  C  CD  . GLN C  1 7   ? 31.392  10.543  -6.573  1.00 73.17  ?  7    GLN C CD  1 
ATOM   8450  O  OE1 . GLN C  1 7   ? 31.215  9.912   -5.531  1.00 71.04  ?  7    GLN C OE1 1 
ATOM   8451  N  NE2 . GLN C  1 7   ? 31.954  10.004  -7.651  1.00 76.71  ?  7    GLN C NE2 1 
ATOM   8452  N  N   . LEU C  1 8   ? 26.499  13.082  -5.633  1.00 63.74  ?  8    LEU C N   1 
ATOM   8453  C  CA  . LEU C  1 8   ? 25.510  13.508  -4.652  1.00 59.10  ?  8    LEU C CA  1 
ATOM   8454  C  C   . LEU C  1 8   ? 24.124  12.911  -4.878  1.00 56.67  ?  8    LEU C C   1 
ATOM   8455  O  O   . LEU C  1 8   ? 23.219  13.171  -4.079  1.00 55.19  ?  8    LEU C O   1 
ATOM   8456  C  CB  . LEU C  1 8   ? 25.424  15.037  -4.636  1.00 56.13  ?  8    LEU C CB  1 
ATOM   8457  C  CG  . LEU C  1 8   ? 26.740  15.767  -4.348  1.00 56.48  ?  8    LEU C CG  1 
ATOM   8458  C  CD1 . LEU C  1 8   ? 26.521  17.262  -4.211  1.00 56.28  ?  8    LEU C CD1 1 
ATOM   8459  C  CD2 . LEU C  1 8   ? 27.406  15.208  -3.103  1.00 55.57  ?  8    LEU C CD2 1 
ATOM   8460  N  N   . LEU C  1 9   ? 23.929  12.124  -5.934  1.00 57.20  ?  9    LEU C N   1 
ATOM   8461  C  CA  . LEU C  1 9   ? 22.650  11.473  -6.196  1.00 58.30  ?  9    LEU C CA  1 
ATOM   8462  C  C   . LEU C  1 9   ? 22.726  10.045  -5.670  1.00 57.26  ?  9    LEU C C   1 
ATOM   8463  O  O   . LEU C  1 9   ? 23.518  9.236   -6.169  1.00 58.03  ?  9    LEU C O   1 
ATOM   8464  C  CB  . LEU C  1 9   ? 22.318  11.501  -7.689  1.00 62.08  ?  9    LEU C CB  1 
ATOM   8465  C  CG  . LEU C  1 9   ? 20.911  11.130  -8.180  1.00 63.31  ?  9    LEU C CG  1 
ATOM   8466  C  CD1 . LEU C  1 9   ? 20.771  9.629   -8.464  1.00 65.55  ?  9    LEU C CD1 1 
ATOM   8467  C  CD2 . LEU C  1 9   ? 19.850  11.593  -7.194  1.00 60.68  ?  9    LEU C CD2 1 
ATOM   8468  N  N   . VAL C  1 10  ? 21.919  9.749   -4.648  1.00 55.69  ?  10   VAL C N   1 
ATOM   8469  C  CA  . VAL C  1 10  ? 21.946  8.474   -3.939  1.00 55.38  ?  10   VAL C CA  1 
ATOM   8470  C  C   . VAL C  1 10  ? 20.520  7.961   -3.800  1.00 55.07  ?  10   VAL C C   1 
ATOM   8471  O  O   . VAL C  1 10  ? 19.605  8.730   -3.489  1.00 54.31  ?  10   VAL C O   1 
ATOM   8472  C  CB  . VAL C  1 10  ? 22.606  8.606   -2.548  1.00 54.13  ?  10   VAL C CB  1 
ATOM   8473  C  CG1 . VAL C  1 10  ? 22.438  7.330   -1.757  1.00 53.80  ?  10   VAL C CG1 1 
ATOM   8474  C  CG2 . VAL C  1 10  ? 24.081  8.942   -2.681  1.00 54.67  ?  10   VAL C CG2 1 
ATOM   8475  N  N   . ARG C  1 11  ? 20.329  6.662   -4.026  1.00 56.25  ?  11   ARG C N   1 
ATOM   8476  C  CA  . ARG C  1 11  ? 19.023  6.026   -3.883  1.00 56.55  ?  11   ARG C CA  1 
ATOM   8477  C  C   . ARG C  1 11  ? 19.021  5.130   -2.652  1.00 55.73  ?  11   ARG C C   1 
ATOM   8478  O  O   . ARG C  1 11  ? 19.799  4.173   -2.584  1.00 57.67  ?  11   ARG C O   1 
ATOM   8479  C  CB  . ARG C  1 11  ? 18.660  5.207   -5.120  1.00 59.00  ?  11   ARG C CB  1 
ATOM   8480  C  CG  . ARG C  1 11  ? 17.641  4.118   -4.816  1.00 58.09  ?  11   ARG C CG  1 
ATOM   8481  C  CD  . ARG C  1 11  ? 17.054  3.512   -6.063  1.00 59.27  ?  11   ARG C CD  1 
ATOM   8482  N  NE  . ARG C  1 11  ? 15.704  3.997   -6.303  1.00 59.25  ?  11   ARG C NE  1 
ATOM   8483  C  CZ  . ARG C  1 11  ? 15.388  4.844   -7.273  1.00 62.65  ?  11   ARG C CZ  1 
ATOM   8484  N  NH1 . ARG C  1 11  ? 16.333  5.295   -8.087  1.00 62.70  ?  11   ARG C NH1 1 
ATOM   8485  N  NH2 . ARG C  1 11  ? 14.131  5.238   -7.429  1.00 63.33  ?  11   ARG C NH2 1 
ATOM   8486  N  N   . VAL C  1 12  ? 18.139  5.434   -1.692  1.00 53.79  ?  12   VAL C N   1 
ATOM   8487  C  CA  . VAL C  1 12  ? 17.896  4.573   -0.534  1.00 53.16  ?  12   VAL C CA  1 
ATOM   8488  C  C   . VAL C  1 12  ? 16.578  3.824   -0.721  1.00 64.48  ?  12   VAL C C   1 
ATOM   8489  O  O   . VAL C  1 12  ? 15.915  3.963   -1.753  1.00 62.81  ?  12   VAL C O   1 
ATOM   8490  C  CB  . VAL C  1 12  ? 17.890  5.372   0.787   1.00 51.58  ?  12   VAL C CB  1 
ATOM   8491  C  CG1 . VAL C  1 12  ? 19.245  6.004   1.039   1.00 51.18  ?  12   VAL C CG1 1 
ATOM   8492  C  CG2 . VAL C  1 12  ? 16.798  6.426   0.774   1.00 51.05  ?  12   VAL C CG2 1 
ATOM   8493  N  N   . ARG C  1 13  ? 16.189  3.028   0.281   1.00 53.31  ?  13   ARG C N   1 
ATOM   8494  C  CA  . ARG C  1 13  ? 14.992  2.193   0.175   1.00 54.02  ?  13   ARG C CA  1 
ATOM   8495  C  C   . ARG C  1 13  ? 13.730  3.031   -0.006  1.00 56.77  ?  13   ARG C C   1 
ATOM   8496  O  O   . ARG C  1 13  ? 12.795  2.608   -0.698  1.00 58.70  ?  13   ARG C O   1 
ATOM   8497  C  CB  . ARG C  1 13  ? 14.877  1.301   1.411   1.00 54.20  ?  13   ARG C CB  1 
ATOM   8498  C  CG  . ARG C  1 13  ? 13.525  0.693   1.668   1.00 54.90  ?  13   ARG C CG  1 
ATOM   8499  C  CD  . ARG C  1 13  ? 13.131  -0.338  0.679   1.00 55.69  ?  13   ARG C CD  1 
ATOM   8500  N  NE  . ARG C  1 13  ? 11.845  -0.008  0.104   1.00 56.22  ?  13   ARG C NE  1 
ATOM   8501  C  CZ  . ARG C  1 13  ? 10.997  -0.900  -0.351  1.00 57.57  ?  13   ARG C CZ  1 
ATOM   8502  N  NH1 . ARG C  1 13  ? 11.296  -2.173  -0.236  1.00 58.46  ?  13   ARG C NH1 1 
ATOM   8503  N  NH2 . ARG C  1 13  ? 9.853   -0.521  -0.870  1.00 58.11  ?  13   ARG C NH2 1 
ATOM   8504  N  N   . GLY C  1 14  ? 13.684  4.224   0.592   1.00 55.41  ?  14   GLY C N   1 
ATOM   8505  C  CA  . GLY C  1 14  ? 12.492  5.056   0.492   1.00 55.45  ?  14   GLY C CA  1 
ATOM   8506  C  C   . GLY C  1 14  ? 12.367  5.846   -0.796  1.00 58.13  ?  14   GLY C C   1 
ATOM   8507  O  O   . GLY C  1 14  ? 11.248  6.199   -1.184  1.00 53.71  ?  14   GLY C O   1 
ATOM   8508  N  N   . GLY C  1 15  ? 13.480  6.134   -1.459  1.00 58.46  ?  15   GLY C N   1 
ATOM   8509  C  CA  . GLY C  1 15  ? 13.452  6.900   -2.688  1.00 58.95  ?  15   GLY C CA  1 
ATOM   8510  C  C   . GLY C  1 15  ? 14.822  7.476   -2.998  1.00 58.34  ?  15   GLY C C   1 
ATOM   8511  O  O   . GLY C  1 15  ? 15.833  7.076   -2.420  1.00 53.68  ?  15   GLY C O   1 
ATOM   8512  N  N   . GLN C  1 16  ? 14.827  8.431   -3.923  1.00 54.71  ?  16   GLN C N   1 
ATOM   8513  C  CA  . GLN C  1 16  ? 16.052  9.100   -4.335  1.00 59.30  ?  16   GLN C CA  1 
ATOM   8514  C  C   . GLN C  1 16  ? 16.257  10.363  -3.513  1.00 53.62  ?  16   GLN C C   1 
ATOM   8515  O  O   . GLN C  1 16  ? 15.294  11.057  -3.176  1.00 53.17  ?  16   GLN C O   1 
ATOM   8516  C  CB  . GLN C  1 16  ? 16.008  9.467   -5.818  1.00 61.63  ?  16   GLN C CB  1 
ATOM   8517  C  CG  . GLN C  1 16  ? 15.854  8.310   -6.765  1.00 64.79  ?  16   GLN C CG  1 
ATOM   8518  C  CD  . GLN C  1 16  ? 16.281  8.680   -8.165  1.00 68.36  ?  16   GLN C CD  1 
ATOM   8519  O  OE1 . GLN C  1 16  ? 17.465  8.911   -8.423  1.00 68.74  ?  16   GLN C OE1 1 
ATOM   8520  N  NE2 . GLN C  1 16  ? 15.320  8.745   -9.081  1.00 70.75  ?  16   GLN C NE2 1 
ATOM   8521  N  N   . LEU C  1 17  ? 17.515  10.659  -3.187  1.00 55.26  ?  17   LEU C N   1 
ATOM   8522  C  CA  . LEU C  1 17  ? 17.841  11.894  -2.487  1.00 54.43  ?  17   LEU C CA  1 
ATOM   8523  C  C   . LEU C  1 17  ? 19.104  12.514  -3.073  1.00 56.89  ?  17   LEU C C   1 
ATOM   8524  O  O   . LEU C  1 17  ? 20.027  11.802  -3.476  1.00 57.97  ?  17   LEU C O   1 
ATOM   8525  C  CB  . LEU C  1 17  ? 17.989  11.656  -0.972  1.00 51.57  ?  17   LEU C CB  1 
ATOM   8526  C  CG  . LEU C  1 17  ? 18.914  10.557  -0.448  1.00 52.08  ?  17   LEU C CG  1 
ATOM   8527  C  CD1 . LEU C  1 17  ? 20.245  11.137  -0.011  1.00 53.63  ?  17   LEU C CD1 1 
ATOM   8528  C  CD2 . LEU C  1 17  ? 18.261  9.814   0.703   1.00 49.92  ?  17   LEU C CD2 1 
ATOM   8529  N  N   . ARG C  1 18  ? 19.121  13.847  -3.131  1.00 56.80  ?  18   ARG C N   1 
ATOM   8530  C  CA  . ARG C  1 18  ? 20.220  14.637  -3.676  1.00 55.69  ?  18   ARG C CA  1 
ATOM   8531  C  C   . ARG C  1 18  ? 20.889  15.394  -2.534  1.00 52.43  ?  18   ARG C C   1 
ATOM   8532  O  O   . ARG C  1 18  ? 20.234  16.194  -1.857  1.00 64.63  ?  18   ARG C O   1 
ATOM   8533  C  CB  . ARG C  1 18  ? 19.695  15.607  -4.736  1.00 56.80  ?  18   ARG C CB  1 
ATOM   8534  C  CG  . ARG C  1 18  ? 20.679  16.670  -5.213  1.00 58.08  ?  18   ARG C CG  1 
ATOM   8535  C  CD  . ARG C  1 18  ? 21.207  16.346  -6.603  1.00 62.08  ?  18   ARG C CD  1 
ATOM   8536  N  NE  . ARG C  1 18  ? 20.130  16.055  -7.549  1.00 66.43  ?  18   ARG C NE  1 
ATOM   8537  C  CZ  . ARG C  1 18  ? 20.321  15.624  -8.796  1.00 70.04  ?  18   ARG C CZ  1 
ATOM   8538  N  NH1 . ARG C  1 18  ? 21.554  15.432  -9.257  1.00 70.52  ?  18   ARG C NH1 1 
ATOM   8539  N  NH2 . ARG C  1 18  ? 19.279  15.389  -9.587  1.00 71.38  ?  18   ARG C NH2 1 
ATOM   8540  N  N   . GLY C  1 19  ? 22.187  15.156  -2.329  1.00 59.48  ?  19   GLY C N   1 
ATOM   8541  C  CA  . GLY C  1 19  ? 22.927  15.764  -1.243  1.00 51.76  ?  19   GLY C CA  1 
ATOM   8542  C  C   . GLY C  1 19  ? 23.650  17.037  -1.657  1.00 55.07  ?  19   GLY C C   1 
ATOM   8543  O  O   . GLY C  1 19  ? 23.403  17.621  -2.714  1.00 56.09  ?  19   GLY C O   1 
ATOM   8544  N  N   . ILE C  1 20  ? 24.568  17.470  -0.791  1.00 55.38  ?  20   ILE C N   1 
ATOM   8545  C  CA  . ILE C  1 20  ? 25.322  18.705  -0.990  1.00 57.35  ?  20   ILE C CA  1 
ATOM   8546  C  C   . ILE C  1 20  ? 26.797  18.450  -0.700  1.00 59.90  ?  20   ILE C C   1 
ATOM   8547  O  O   . ILE C  1 20  ? 27.140  17.700  0.222   1.00 59.80  ?  20   ILE C O   1 
ATOM   8548  C  CB  . ILE C  1 20  ? 24.784  19.860  -0.109  1.00 55.64  ?  20   ILE C CB  1 
ATOM   8549  C  CG1 . ILE C  1 20  ? 25.661  21.107  -0.251  1.00 56.10  ?  20   ILE C CG1 1 
ATOM   8550  C  CG2 . ILE C  1 20  ? 24.717  19.446  1.351   1.00 50.52  ?  20   ILE C CG2 1 
ATOM   8551  C  CD1 . ILE C  1 20  ? 25.157  22.301  0.511   1.00 56.03  ?  20   ILE C CD1 1 
ATOM   8552  N  N   . ARG C  1 21  ? 27.667  19.069  -1.501  1.00 61.72  ?  21   ARG C N   1 
ATOM   8553  C  CA  . ARG C  1 21  ? 29.105  19.042  -1.272  1.00 62.33  ?  21   ARG C CA  1 
ATOM   8554  C  C   . ARG C  1 21  ? 29.473  20.183  -0.333  1.00 61.25  ?  21   ARG C C   1 
ATOM   8555  O  O   . ARG C  1 21  ? 29.153  21.345  -0.606  1.00 63.54  ?  21   ARG C O   1 
ATOM   8556  C  CB  . ARG C  1 21  ? 29.872  19.164  -2.588  1.00 65.53  ?  21   ARG C CB  1 
ATOM   8557  C  CG  . ARG C  1 21  ? 31.373  19.327  -2.403  1.00 68.53  ?  21   ARG C CG  1 
ATOM   8558  C  CD  . ARG C  1 21  ? 32.154  18.995  -3.667  1.00 73.28  ?  21   ARG C CD  1 
ATOM   8559  N  NE  . ARG C  1 21  ? 32.464  20.184  -4.457  1.00 77.83  ?  21   ARG C NE  1 
ATOM   8560  C  CZ  . ARG C  1 21  ? 33.576  20.904  -4.328  1.00 81.46  ?  21   ARG C CZ  1 
ATOM   8561  N  NH1 . ARG C  1 21  ? 34.497  20.568  -3.434  1.00 80.39  ?  21   ARG C NH1 1 
ATOM   8562  N  NH2 . ARG C  1 21  ? 33.767  21.968  -5.096  1.00 85.65  ?  21   ARG C NH2 1 
ATOM   8563  N  N   . LEU C  1 22  ? 30.134  19.853  0.770   1.00 58.67  ?  22   LEU C N   1 
ATOM   8564  C  CA  . LEU C  1 22  ? 30.556  20.832  1.755   1.00 58.47  ?  22   LEU C CA  1 
ATOM   8565  C  C   . LEU C  1 22  ? 32.073  20.914  1.775   1.00 60.23  ?  22   LEU C C   1 
ATOM   8566  O  O   . LEU C  1 22  ? 32.765  19.942  1.463   1.00 60.32  ?  22   LEU C O   1 
ATOM   8567  C  CB  . LEU C  1 22  ? 30.044  20.470  3.148   1.00 55.44  ?  22   LEU C CB  1 
ATOM   8568  C  CG  . LEU C  1 22  ? 28.534  20.523  3.339   1.00 51.11  ?  22   LEU C CG  1 
ATOM   8569  C  CD1 . LEU C  1 22  ? 28.196  20.265  4.795   1.00 53.22  ?  22   LEU C CD1 1 
ATOM   8570  C  CD2 . LEU C  1 22  ? 27.996  21.860  2.877   1.00 51.53  ?  22   LEU C CD2 1 
ATOM   8571  N  N   . LYS C  1 23  ? 32.588  22.086  2.140   1.00 62.81  ?  23   LYS C N   1 
ATOM   8572  C  CA  . LYS C  1 23  ? 34.026  22.301  2.258   1.00 66.59  ?  23   LYS C CA  1 
ATOM   8573  C  C   . LYS C  1 23  ? 34.445  22.124  3.716   1.00 66.82  ?  23   LYS C C   1 
ATOM   8574  O  O   . LYS C  1 23  ? 34.052  22.913  4.583   1.00 67.78  ?  23   LYS C O   1 
ATOM   8575  C  CB  . LYS C  1 23  ? 34.422  23.683  1.743   1.00 70.03  ?  23   LYS C CB  1 
ATOM   8576  C  CG  . LYS C  1 23  ? 35.871  24.038  2.062   1.00 74.78  ?  23   LYS C CG  1 
ATOM   8577  C  CD  . LYS C  1 23  ? 36.479  24.997  1.048   1.00 80.19  ?  23   LYS C CD  1 
ATOM   8578  C  CE  . LYS C  1 23  ? 36.317  26.451  1.467   1.00 83.33  ?  23   LYS C CE  1 
ATOM   8579  N  NZ  . LYS C  1 23  ? 36.895  27.383  0.446   1.00 86.92  ?  23   LYS C NZ  1 
ATOM   8580  N  N   . ALA C  1 24  ? 35.232  21.066  3.984   1.00 65.29  ?  24   ALA C N   1 
ATOM   8581  C  CA  . ALA C  1 24  ? 35.991  20.835  5.205   1.00 62.02  ?  24   ALA C CA  1 
ATOM   8582  C  C   . ALA C  1 24  ? 37.377  21.452  5.071   1.00 59.91  ?  24   ALA C C   1 
ATOM   8583  O  O   . ALA C  1 24  ? 37.844  21.704  3.956   1.00 59.31  ?  24   ALA C O   1 
ATOM   8584  C  CB  . ALA C  1 24  ? 36.099  19.336  5.486   1.00 61.98  ?  24   ALA C CB  1 
ATOM   8585  N  N   . PRO C  1 25  ? 38.059  21.729  6.189   1.00 59.23  ?  25   PRO C N   1 
ATOM   8586  C  CA  . PRO C  1 25  ? 39.355  22.427  6.102   1.00 61.02  ?  25   PRO C CA  1 
ATOM   8587  C  C   . PRO C  1 25  ? 40.368  21.789  5.157   1.00 62.88  ?  25   PRO C C   1 
ATOM   8588  O  O   . PRO C  1 25  ? 41.136  22.514  4.511   1.00 64.37  ?  25   PRO C O   1 
ATOM   8589  C  CB  . PRO C  1 25  ? 39.847  22.406  7.555   1.00 59.99  ?  25   PRO C CB  1 
ATOM   8590  C  CG  . PRO C  1 25  ? 38.598  22.409  8.357   1.00 57.29  ?  25   PRO C CG  1 
ATOM   8591  C  CD  . PRO C  1 25  ? 37.631  21.551  7.588   1.00 57.11  ?  25   PRO C CD  1 
ATOM   8592  N  N   . GLY C  1 26  ? 40.399  20.462  5.051   1.00 62.98  ?  26   GLY C N   1 
ATOM   8593  C  CA  . GLY C  1 26  ? 41.364  19.787  4.205   1.00 64.23  ?  26   GLY C CA  1 
ATOM   8594  C  C   . GLY C  1 26  ? 40.841  19.180  2.923   1.00 63.80  ?  26   GLY C C   1 
ATOM   8595  O  O   . GLY C  1 26  ? 41.595  18.467  2.247   1.00 64.46  ?  26   GLY C O   1 
ATOM   8596  N  N   . GLY C  1 27  ? 39.585  19.425  2.555   1.00 63.50  ?  27   GLY C N   1 
ATOM   8597  C  CA  . GLY C  1 27  ? 39.017  18.867  1.348   1.00 65.41  ?  27   GLY C CA  1 
ATOM   8598  C  C   . GLY C  1 27  ? 37.507  18.789  1.425   1.00 65.76  ?  27   GLY C C   1 
ATOM   8599  O  O   . GLY C  1 27  ? 36.902  19.128  2.446   1.00 66.64  ?  27   GLY C O   1 
ATOM   8600  N  N   . PRO C  1 28  ? 36.863  18.357  0.346   1.00 60.20  ?  28   PRO C N   1 
ATOM   8601  C  CA  . PRO C  1 28  ? 35.401  18.260  0.342   1.00 58.68  ?  28   PRO C CA  1 
ATOM   8602  C  C   . PRO C  1 28  ? 34.893  17.029  1.082   1.00 57.41  ?  28   PRO C C   1 
ATOM   8603  O  O   . PRO C  1 28  ? 35.608  16.047  1.292   1.00 57.89  ?  28   PRO C O   1 
ATOM   8604  C  CB  . PRO C  1 28  ? 35.062  18.181  -1.150  1.00 59.72  ?  28   PRO C CB  1 
ATOM   8605  C  CG  . PRO C  1 28  ? 36.245  17.532  -1.746  1.00 61.43  ?  28   PRO C CG  1 
ATOM   8606  C  CD  . PRO C  1 28  ? 37.438  18.020  -0.966  1.00 62.00  ?  28   PRO C CD  1 
ATOM   8607  N  N   . VAL C  1 29  ? 33.628  17.112  1.498   1.00 55.88  ?  29   VAL C N   1 
ATOM   8608  C  CA  . VAL C  1 29  ? 32.893  15.969  2.021   1.00 54.75  ?  29   VAL C CA  1 
ATOM   8609  C  C   . VAL C  1 29  ? 31.513  15.970  1.383   1.00 57.30  ?  29   VAL C C   1 
ATOM   8610  O  O   . VAL C  1 29  ? 31.068  16.965  0.808   1.00 54.36  ?  29   VAL C O   1 
ATOM   8611  C  CB  . VAL C  1 29  ? 32.755  15.975  3.563   1.00 53.39  ?  29   VAL C CB  1 
ATOM   8612  C  CG1 . VAL C  1 29  ? 34.097  16.182  4.234   1.00 54.05  ?  29   VAL C CG1 1 
ATOM   8613  C  CG2 . VAL C  1 29  ? 31.759  17.027  4.007   1.00 52.29  ?  29   VAL C CG2 1 
ATOM   8614  N  N   . SER C  1 30  ? 30.832  14.836  1.499   1.00 57.12  ?  30   SER C N   1 
ATOM   8615  C  CA  . SER C  1 30  ? 29.455  14.697  1.047   1.00 58.14  ?  30   SER C CA  1 
ATOM   8616  C  C   . SER C  1 30  ? 28.531  14.756  2.255   1.00 55.97  ?  30   SER C C   1 
ATOM   8617  O  O   . SER C  1 30  ? 28.780  14.093  3.269   1.00 56.54  ?  30   SER C O   1 
ATOM   8618  C  CB  . SER C  1 30  ? 29.249  13.385  0.284   1.00 60.92  ?  30   SER C CB  1 
ATOM   8619  O  OG  . SER C  1 30  ? 30.180  13.251  -0.777  1.00 64.47  ?  30   SER C OG  1 
ATOM   8620  N  N   . ALA C  1 31  ? 27.472  15.550  2.148   1.00 52.19  ?  31   ALA C N   1 
ATOM   8621  C  CA  . ALA C  1 31  ? 26.516  15.702  3.231   1.00 50.26  ?  31   ALA C CA  1 
ATOM   8622  C  C   . ALA C  1 31  ? 25.115  15.446  2.707   1.00 51.63  ?  31   ALA C C   1 
ATOM   8623  O  O   . ALA C  1 31  ? 24.705  16.041  1.706   1.00 53.64  ?  31   ALA C O   1 
ATOM   8624  C  CB  . ALA C  1 31  ? 26.605  17.097  3.847   1.00 51.72  ?  31   ALA C CB  1 
ATOM   8625  N  N   . PHE C  1 32  ? 24.392  14.548  3.369   1.00 53.60  ?  32   PHE C N   1 
ATOM   8626  C  CA  . PHE C  1 32  ? 22.979  14.307  3.097   1.00 53.58  ?  32   PHE C CA  1 
ATOM   8627  C  C   . PHE C  1 32  ? 22.220  14.583  4.387   1.00 55.35  ?  32   PHE C C   1 
ATOM   8628  O  O   . PHE C  1 32  ? 22.321  13.808  5.345   1.00 57.82  ?  32   PHE C O   1 
ATOM   8629  C  CB  . PHE C  1 32  ? 22.763  12.879  2.602   1.00 49.61  ?  32   PHE C CB  1 
ATOM   8630  C  CG  . PHE C  1 32  ? 23.710  12.477  1.504   1.00 49.85  ?  32   PHE C CG  1 
ATOM   8631  C  CD1 . PHE C  1 32  ? 24.969  11.973  1.798   1.00 50.72  ?  32   PHE C CD1 1 
ATOM   8632  C  CD2 . PHE C  1 32  ? 23.354  12.628  0.179   1.00 50.84  ?  32   PHE C CD2 1 
ATOM   8633  C  CE1 . PHE C  1 32  ? 25.845  11.613  0.789   1.00 51.51  ?  32   PHE C CE1 1 
ATOM   8634  C  CE2 . PHE C  1 32  ? 24.224  12.270  -0.836  1.00 58.06  ?  32   PHE C CE2 1 
ATOM   8635  C  CZ  . PHE C  1 32  ? 25.472  11.763  -0.529  1.00 58.54  ?  32   PHE C CZ  1 
ATOM   8636  N  N   . LEU C  1 33  ? 21.439  15.663  4.404   1.00 53.60  ?  33   LEU C N   1 
ATOM   8637  C  CA  . LEU C  1 33  ? 20.885  16.220  5.633   1.00 45.75  ?  33   LEU C CA  1 
ATOM   8638  C  C   . LEU C  1 33  ? 19.365  16.241  5.557   1.00 45.57  ?  33   LEU C C   1 
ATOM   8639  O  O   . LEU C  1 33  ? 18.795  16.629  4.534   1.00 46.23  ?  33   LEU C O   1 
ATOM   8640  C  CB  . LEU C  1 33  ? 21.413  17.636  5.875   1.00 45.81  ?  33   LEU C CB  1 
ATOM   8641  C  CG  . LEU C  1 33  ? 22.913  17.866  5.685   1.00 46.36  ?  33   LEU C CG  1 
ATOM   8642  C  CD1 . LEU C  1 33  ? 23.280  19.312  5.991   1.00 46.50  ?  33   LEU C CD1 1 
ATOM   8643  C  CD2 . LEU C  1 33  ? 23.712  16.911  6.546   1.00 45.95  ?  33   LEU C CD2 1 
ATOM   8644  N  N   . GLY C  1 34  ? 18.710  15.837  6.640   1.00 46.81  ?  34   GLY C N   1 
ATOM   8645  C  CA  . GLY C  1 34  ? 17.262  15.877  6.671   1.00 47.94  ?  34   GLY C CA  1 
ATOM   8646  C  C   . GLY C  1 34  ? 16.566  14.769  5.912   1.00 51.09  ?  34   GLY C C   1 
ATOM   8647  O  O   . GLY C  1 34  ? 15.482  14.993  5.363   1.00 55.18  ?  34   GLY C O   1 
ATOM   8648  N  N   . ILE C  1 35  ? 17.162  13.580  5.858   1.00 49.66  ?  35   ILE C N   1 
ATOM   8649  C  CA  . ILE C  1 35  ? 16.535  12.390  5.285   1.00 48.67  ?  35   ILE C CA  1 
ATOM   8650  C  C   . ILE C  1 35  ? 15.447  11.923  6.244   1.00 49.58  ?  35   ILE C C   1 
ATOM   8651  O  O   . ILE C  1 35  ? 15.764  11.598  7.396   1.00 50.29  ?  35   ILE C O   1 
ATOM   8652  C  CB  . ILE C  1 35  ? 17.573  11.278  5.068   1.00 46.43  ?  35   ILE C CB  1 
ATOM   8653  C  CG1 . ILE C  1 35  ? 18.774  11.812  4.292   1.00 46.68  ?  35   ILE C CG1 1 
ATOM   8654  C  CG2 . ILE C  1 35  ? 16.950  10.089  4.359   1.00 46.94  ?  35   ILE C CG2 1 
ATOM   8655  C  CD1 . ILE C  1 35  ? 19.939  10.854  4.249   1.00 47.05  ?  35   ILE C CD1 1 
ATOM   8656  N  N   . PRO C  1 36  ? 14.168  11.896  5.861   1.00 50.42  ?  36   PRO C N   1 
ATOM   8657  C  CA  . PRO C  1 36  ? 13.158  11.376  6.795   1.00 51.41  ?  36   PRO C CA  1 
ATOM   8658  C  C   . PRO C  1 36  ? 13.340  9.879   6.998   1.00 51.76  ?  36   PRO C C   1 
ATOM   8659  O  O   . PRO C  1 36  ? 13.389  9.112   6.031   1.00 51.11  ?  36   PRO C O   1 
ATOM   8660  C  CB  . PRO C  1 36  ? 11.831  11.691  6.094   1.00 53.41  ?  36   PRO C CB  1 
ATOM   8661  C  CG  . PRO C  1 36  ? 12.180  11.737  4.642   1.00 52.73  ?  36   PRO C CG  1 
ATOM   8662  C  CD  . PRO C  1 36  ? 13.587  12.273  4.562   1.00 51.18  ?  36   PRO C CD  1 
ATOM   8663  N  N   . PHE C  1 37  ? 13.450  9.461   8.264   1.00 51.04  ?  37   PHE C N   1 
ATOM   8664  C  CA  . PHE C  1 37  ? 13.363  8.047   8.609   1.00 50.01  ?  37   PHE C CA  1 
ATOM   8665  C  C   . PHE C  1 37  ? 12.020  7.631   9.203   1.00 49.33  ?  37   PHE C C   1 
ATOM   8666  O  O   . PHE C  1 37  ? 11.824  6.441   9.467   1.00 49.31  ?  37   PHE C O   1 
ATOM   8667  C  CB  . PHE C  1 37  ? 14.523  7.636   9.533   1.00 48.63  ?  37   PHE C CB  1 
ATOM   8668  C  CG  . PHE C  1 37  ? 14.474  8.220   10.920  1.00 48.61  ?  37   PHE C CG  1 
ATOM   8669  C  CD1 . PHE C  1 37  ? 15.046  9.459   11.191  1.00 48.16  ?  37   PHE C CD1 1 
ATOM   8670  C  CD2 . PHE C  1 37  ? 13.923  7.497   11.971  1.00 46.67  ?  37   PHE C CD2 1 
ATOM   8671  C  CE1 . PHE C  1 37  ? 15.030  9.982   12.477  1.00 45.88  ?  37   PHE C CE1 1 
ATOM   8672  C  CE2 . PHE C  1 37  ? 13.904  8.014   13.254  1.00 44.86  ?  37   PHE C CE2 1 
ATOM   8673  C  CZ  . PHE C  1 37  ? 14.459  9.258   13.509  1.00 44.63  ?  37   PHE C CZ  1 
ATOM   8674  N  N   . ALA C  1 38  ? 11.090  8.559   9.416   1.00 49.60  ?  38   ALA C N   1 
ATOM   8675  C  CA  . ALA C  1 38  ? 9.835   8.197   10.059  1.00 51.13  ?  38   ALA C CA  1 
ATOM   8676  C  C   . ALA C  1 38  ? 8.722   9.134   9.612   1.00 53.01  ?  38   ALA C C   1 
ATOM   8677  O  O   . ALA C  1 38  ? 8.958   10.314  9.329   1.00 55.11  ?  38   ALA C O   1 
ATOM   8678  C  CB  . ALA C  1 38  ? 9.964   8.225   11.585  1.00 44.78  ?  38   ALA C CB  1 
ATOM   8679  N  N   . GLU C  1 39  ? 7.506   8.595   9.555   1.00 52.99  ?  39   GLU C N   1 
ATOM   8680  C  CA  . GLU C  1 39  ? 6.341   9.435   9.328   1.00 53.22  ?  39   GLU C CA  1 
ATOM   8681  C  C   . GLU C  1 39  ? 6.182   10.385  10.510  1.00 53.47  ?  39   GLU C C   1 
ATOM   8682  O  O   . GLU C  1 39  ? 6.377   9.971   11.662  1.00 55.38  ?  39   GLU C O   1 
ATOM   8683  C  CB  . GLU C  1 39  ? 5.081   8.586   9.153   1.00 55.08  ?  39   GLU C CB  1 
ATOM   8684  C  CG  . GLU C  1 39  ? 5.010   7.877   7.817   1.00 58.83  ?  39   GLU C CG  1 
ATOM   8685  C  CD  . GLU C  1 39  ? 4.860   8.842   6.655   1.00 62.62  ?  39   GLU C CD  1 
ATOM   8686  O  OE1 . GLU C  1 39  ? 4.289   9.935   6.860   1.00 64.63  ?  39   GLU C OE1 1 
ATOM   8687  O  OE2 . GLU C  1 39  ? 5.353   8.529   5.549   1.00 63.63  ?  39   GLU C OE2 1 
ATOM   8688  N  N   . PRO C  1 40  ? 5.847   11.651  10.270  1.00 51.62  ?  40   PRO C N   1 
ATOM   8689  C  CA  . PRO C  1 40  ? 5.901   12.654  11.342  1.00 51.11  ?  40   PRO C CA  1 
ATOM   8690  C  C   . PRO C  1 40  ? 5.003   12.280  12.507  1.00 51.85  ?  40   PRO C C   1 
ATOM   8691  O  O   . PRO C  1 40  ? 3.800   12.030  12.331  1.00 52.92  ?  40   PRO C O   1 
ATOM   8692  C  CB  . PRO C  1 40  ? 5.412   13.934  10.648  1.00 50.08  ?  40   PRO C CB  1 
ATOM   8693  C  CG  . PRO C  1 40  ? 5.752   13.719  9.218   1.00 51.61  ?  40   PRO C CG  1 
ATOM   8694  C  CD  . PRO C  1 40  ? 5.542   12.256  8.964   1.00 51.57  ?  40   PRO C CD  1 
ATOM   8695  N  N   . PRO C  1 41  ? 5.567   12.264  13.762  1.00 45.89  ?  41   PRO C N   1 
ATOM   8696  C  CA  . PRO C  1 41  ? 4.793   11.890  14.958  1.00 46.89  ?  41   PRO C CA  1 
ATOM   8697  C  C   . PRO C  1 41  ? 3.924   13.040  15.454  1.00 51.05  ?  41   PRO C C   1 
ATOM   8698  O  O   . PRO C  1 41  ? 4.062   13.530  16.579  1.00 53.65  ?  41   PRO C O   1 
ATOM   8699  C  CB  . PRO C  1 41  ? 5.898   11.511  15.952  1.00 46.07  ?  41   PRO C CB  1 
ATOM   8700  C  CG  . PRO C  1 41  ? 7.043   12.383  15.558  1.00 43.82  ?  41   PRO C CG  1 
ATOM   8701  C  CD  . PRO C  1 41  ? 6.994   12.471  14.068  1.00 44.29  ?  41   PRO C CD  1 
ATOM   8702  N  N   . VAL C  1 42  ? 2.997   13.468  14.604  1.00 52.03  ?  42   VAL C N   1 
ATOM   8703  C  CA  . VAL C  1 42  ? 2.216   14.676  14.828  1.00 52.36  ?  42   VAL C CA  1 
ATOM   8704  C  C   . VAL C  1 42  ? 0.740   14.305  14.869  1.00 56.53  ?  42   VAL C C   1 
ATOM   8705  O  O   . VAL C  1 42  ? 0.330   13.226  14.431  1.00 58.38  ?  42   VAL C O   1 
ATOM   8706  C  CB  . VAL C  1 42  ? 2.477   15.737  13.744  1.00 51.53  ?  42   VAL C CB  1 
ATOM   8707  C  CG1 . VAL C  1 42  ? 3.961   16.059  13.665  1.00 49.38  ?  42   VAL C CG1 1 
ATOM   8708  C  CG2 . VAL C  1 42  ? 1.966   15.248  12.401  1.00 48.29  ?  42   VAL C CG2 1 
ATOM   8709  N  N   . GLY C  1 43  ? -0.059  15.209  15.428  1.00 59.01  ?  43   GLY C N   1 
ATOM   8710  C  CA  . GLY C  1 43  ? -1.476  14.956  15.546  1.00 61.31  ?  43   GLY C CA  1 
ATOM   8711  C  C   . GLY C  1 43  ? -1.782  13.759  16.415  1.00 61.90  ?  43   GLY C C   1 
ATOM   8712  O  O   . GLY C  1 43  ? -1.349  13.694  17.569  1.00 63.04  ?  43   GLY C O   1 
ATOM   8713  N  N   . SER C  1 44  ? -2.512  12.790  15.860  1.00 61.73  ?  44   SER C N   1 
ATOM   8714  C  CA  . SER C  1 44  ? -2.854  11.589  16.606  1.00 61.44  ?  44   SER C CA  1 
ATOM   8715  C  C   . SER C  1 44  ? -1.652  10.702  16.908  1.00 62.83  ?  44   SER C C   1 
ATOM   8716  O  O   . SER C  1 44  ? -1.787  9.770   17.707  1.00 66.06  ?  44   SER C O   1 
ATOM   8717  C  CB  . SER C  1 44  ? -3.905  10.786  15.840  1.00 60.60  ?  44   SER C CB  1 
ATOM   8718  O  OG  . SER C  1 44  ? -3.412  10.354  14.584  1.00 59.04  ?  44   SER C OG  1 
ATOM   8719  N  N   . ARG C  1 45  ? -0.492  10.954  16.308  1.00 61.62  ?  45   ARG C N   1 
ATOM   8720  C  CA  . ARG C  1 45  ? 0.680   10.119  16.538  1.00 61.26  ?  45   ARG C CA  1 
ATOM   8721  C  C   . ARG C  1 45  ? 1.558   10.618  17.681  1.00 59.18  ?  45   ARG C C   1 
ATOM   8722  O  O   . ARG C  1 45  ? 2.588   9.997   17.964  1.00 60.36  ?  45   ARG C O   1 
ATOM   8723  C  CB  . ARG C  1 45  ? 1.517   10.009  15.255  1.00 62.94  ?  45   ARG C CB  1 
ATOM   8724  C  CG  . ARG C  1 45  ? 0.800   9.359   14.073  1.00 66.61  ?  45   ARG C CG  1 
ATOM   8725  C  CD  . ARG C  1 45  ? 0.063   8.080   14.476  1.00 70.01  ?  45   ARG C CD  1 
ATOM   8726  N  NE  . ARG C  1 45  ? 0.963   7.013   14.916  1.00 70.49  ?  45   ARG C NE  1 
ATOM   8727  C  CZ  . ARG C  1 45  ? 0.553   5.824   15.356  1.00 70.73  ?  45   ARG C CZ  1 
ATOM   8728  N  NH1 . ARG C  1 45  ? -0.746  5.553   15.422  1.00 72.15  ?  45   ARG C NH1 1 
ATOM   8729  N  NH2 . ARG C  1 45  ? 1.439   4.909   15.738  1.00 68.97  ?  45   ARG C NH2 1 
ATOM   8730  N  N   . ARG C  1 46  ? 1.182   11.710  18.342  1.00 55.96  ?  46   ARG C N   1 
ATOM   8731  C  CA  . ARG C  1 46  ? 1.975   12.212  19.456  1.00 53.57  ?  46   ARG C CA  1 
ATOM   8732  C  C   . ARG C  1 46  ? 1.993   11.198  20.596  1.00 53.68  ?  46   ARG C C   1 
ATOM   8733  O  O   . ARG C  1 46  ? 0.987   10.532  20.869  1.00 55.95  ?  46   ARG C O   1 
ATOM   8734  C  CB  . ARG C  1 46  ? 1.413   13.553  19.935  1.00 52.54  ?  46   ARG C CB  1 
ATOM   8735  C  CG  . ARG C  1 46  ? 2.249   14.250  20.995  1.00 49.89  ?  46   ARG C CG  1 
ATOM   8736  C  CD  . ARG C  1 46  ? 1.507   15.438  21.581  1.00 49.58  ?  46   ARG C CD  1 
ATOM   8737  N  NE  . ARG C  1 46  ? 1.712   16.672  20.828  1.00 50.86  ?  46   ARG C NE  1 
ATOM   8738  C  CZ  . ARG C  1 46  ? 1.014   17.785  21.027  1.00 51.77  ?  46   ARG C CZ  1 
ATOM   8739  N  NH1 . ARG C  1 46  ? 0.061   17.810  21.947  1.00 52.14  ?  46   ARG C NH1 1 
ATOM   8740  N  NH2 . ARG C  1 46  ? 1.261   18.871  20.307  1.00 51.37  ?  46   ARG C NH2 1 
ATOM   8741  N  N   . PHE C  1 47  ? 3.160   11.077  21.248  1.00 51.52  ?  47   PHE C N   1 
ATOM   8742  C  CA  . PHE C  1 47  ? 3.434   10.134  22.337  1.00 51.33  ?  47   PHE C CA  1 
ATOM   8743  C  C   . PHE C  1 47  ? 3.524   8.686   21.867  1.00 53.45  ?  47   PHE C C   1 
ATOM   8744  O  O   . PHE C  1 47  ? 3.882   7.800   22.651  1.00 52.31  ?  47   PHE C O   1 
ATOM   8745  C  CB  . PHE C  1 47  ? 2.374   10.210  23.442  1.00 50.42  ?  47   PHE C CB  1 
ATOM   8746  C  CG  . PHE C  1 47  ? 2.101   11.595  23.939  1.00 49.07  ?  47   PHE C CG  1 
ATOM   8747  C  CD1 . PHE C  1 47  ? 3.117   12.358  24.481  1.00 47.68  ?  47   PHE C CD1 1 
ATOM   8748  C  CD2 . PHE C  1 47  ? 0.818   12.121  23.896  1.00 50.05  ?  47   PHE C CD2 1 
ATOM   8749  C  CE1 . PHE C  1 47  ? 2.867   13.631  24.959  1.00 45.68  ?  47   PHE C CE1 1 
ATOM   8750  C  CE2 . PHE C  1 47  ? 0.561   13.393  24.370  1.00 50.63  ?  47   PHE C CE2 1 
ATOM   8751  C  CZ  . PHE C  1 47  ? 1.587   14.148  24.903  1.00 46.76  ?  47   PHE C CZ  1 
ATOM   8752  N  N   . MET C  1 48  ? 3.150   8.421   20.553  1.00 55.42  ?  48   MET C N   1 
ATOM   8753  C  CA  . MET C  1 48  ? 3.094   7.091   19.963  1.00 54.14  ?  48   MET C CA  1 
ATOM   8754  C  C   . MET C  1 48  ? 4.425   6.714   19.318  1.00 53.09  ?  48   MET C C   1 
ATOM   8755  O  O   . MET C  1 48  ? 5.203   7.596   18.927  1.00 51.93  ?  48   MET C O   1 
ATOM   8756  C  CB  . MET C  1 48  ? 1.980   7.022   18.925  1.00 55.04  ?  48   MET C CB  1 
ATOM   8757  C  CG  . MET C  1 48  ? 0.624   7.242   19.523  1.00 57.91  ?  48   MET C CG  1 
ATOM   8758  S  SD  . MET C  1 48  ? -0.542  5.954   19.077  1.00 61.17  ?  48   MET C SD  1 
ATOM   8759  C  CE  . MET C  1 48  ? 0.169   4.575   19.962  1.00 59.88  ?  48   MET C CE  1 
ATOM   8760  N  N   . PRO C  1 49  ? 4.693   5.411   19.214  1.00 53.10  ?  49   PRO C N   1 
ATOM   8761  C  CA  . PRO C  1 49  ? 5.948   4.973   18.612  1.00 51.28  ?  49   PRO C CA  1 
ATOM   8762  C  C   . PRO C  1 49  ? 6.034   5.414   17.166  1.00 52.99  ?  49   PRO C C   1 
ATOM   8763  O  O   . PRO C  1 49  ? 5.004   5.667   16.507  1.00 55.82  ?  49   PRO C O   1 
ATOM   8764  C  CB  . PRO C  1 49  ? 5.882   3.445   18.734  1.00 48.67  ?  49   PRO C CB  1 
ATOM   8765  C  CG  . PRO C  1 49  ? 4.981   3.212   19.868  1.00 47.48  ?  49   PRO C CG  1 
ATOM   8766  C  CD  . PRO C  1 49  ? 3.949   4.288   19.806  1.00 51.75  ?  49   PRO C CD  1 
ATOM   8767  N  N   . PRO C  1 50  ? 7.245   5.528   16.626  1.00 51.19  ?  50   PRO C N   1 
ATOM   8768  C  CA  . PRO C  1 50  ? 7.390   6.030   15.262  1.00 52.00  ?  50   PRO C CA  1 
ATOM   8769  C  C   . PRO C  1 50  ? 7.002   4.979   14.243  1.00 55.60  ?  50   PRO C C   1 
ATOM   8770  O  O   . PRO C  1 50  ? 7.047   3.775   14.506  1.00 58.57  ?  50   PRO C O   1 
ATOM   8771  C  CB  . PRO C  1 50  ? 8.880   6.365   15.173  1.00 49.80  ?  50   PRO C CB  1 
ATOM   8772  C  CG  . PRO C  1 50  ? 9.502   5.354   16.071  1.00 49.28  ?  50   PRO C CG  1 
ATOM   8773  C  CD  . PRO C  1 50  ? 8.547   5.204   17.229  1.00 49.99  ?  50   PRO C CD  1 
ATOM   8774  N  N   . GLU C  1 51  ? 6.616   5.450   13.058  1.00 55.87  ?  51   GLU C N   1 
ATOM   8775  C  CA  . GLU C  1 51  ? 6.305   4.544   11.976  1.00 58.92  ?  51   GLU C CA  1 
ATOM   8776  C  C   . GLU C  1 51  ? 7.268   4.775   10.821  1.00 58.27  ?  51   GLU C C   1 
ATOM   8777  O  O   . GLU C  1 51  ? 7.650   5.921   10.559  1.00 59.00  ?  51   GLU C O   1 
ATOM   8778  C  CB  . GLU C  1 51  ? 4.856   4.726   11.481  1.00 63.20  ?  51   GLU C CB  1 
ATOM   8779  C  CG  . GLU C  1 51  ? 3.792   4.234   12.451  1.00 67.49  ?  51   GLU C CG  1 
ATOM   8780  C  CD  . GLU C  1 51  ? 2.381   4.629   12.035  1.00 71.26  ?  51   GLU C CD  1 
ATOM   8781  O  OE1 . GLU C  1 51  ? 2.186   5.778   11.570  1.00 70.87  ?  51   GLU C OE1 1 
ATOM   8782  O  OE2 . GLU C  1 51  ? 1.466   3.786   12.170  1.00 73.86  ?  51   GLU C OE2 1 
ATOM   8783  N  N   . PRO C  1 52  ? 7.670   3.720   10.113  1.00 56.33  ?  52   PRO C N   1 
ATOM   8784  C  CA  . PRO C  1 52  ? 8.719   3.873   9.100   1.00 56.61  ?  52   PRO C CA  1 
ATOM   8785  C  C   . PRO C  1 52  ? 8.298   4.852   8.016   1.00 58.23  ?  52   PRO C C   1 
ATOM   8786  O  O   . PRO C  1 52  ? 7.130   4.905   7.624   1.00 59.45  ?  52   PRO C O   1 
ATOM   8787  C  CB  . PRO C  1 52  ? 8.885   2.454   8.546   1.00 56.83  ?  52   PRO C CB  1 
ATOM   8788  C  CG  . PRO C  1 52  ? 8.353   1.566   9.611   1.00 56.17  ?  52   PRO C CG  1 
ATOM   8789  C  CD  . PRO C  1 52  ? 7.223   2.323   10.226  1.00 55.88  ?  52   PRO C CD  1 
ATOM   8790  N  N   . LYS C  1 53  ? 9.261   5.641   7.541   1.00 57.66  ?  53   LYS C N   1 
ATOM   8791  C  CA  . LYS C  1 53  ? 8.948   6.638   6.527   1.00 57.10  ?  53   LYS C CA  1 
ATOM   8792  C  C   . LYS C  1 53  ? 8.457   5.940   5.274   1.00 61.07  ?  53   LYS C C   1 
ATOM   8793  O  O   . LYS C  1 53  ? 9.148   5.079   4.721   1.00 63.17  ?  53   LYS C O   1 
ATOM   8794  C  CB  . LYS C  1 53  ? 10.173  7.495   6.215   1.00 52.77  ?  53   LYS C CB  1 
ATOM   8795  C  CG  . LYS C  1 53  ? 9.943   8.540   5.133   1.00 50.11  ?  53   LYS C CG  1 
ATOM   8796  C  CD  . LYS C  1 53  ? 8.753   9.419   5.464   1.00 49.02  ?  53   LYS C CD  1 
ATOM   8797  C  CE  . LYS C  1 53  ? 8.448   10.379  4.335   1.00 48.90  ?  53   LYS C CE  1 
ATOM   8798  N  NZ  . LYS C  1 53  ? 7.103   10.991  4.491   1.00 49.33  ?  53   LYS C NZ  1 
ATOM   8799  N  N   . ARG C  1 54  ? 7.272   6.317   4.827   1.00 62.00  ?  54   ARG C N   1 
ATOM   8800  C  CA  . ARG C  1 54  ? 6.717   5.679   3.653   1.00 62.92  ?  54   ARG C CA  1 
ATOM   8801  C  C   . ARG C  1 54  ? 7.416   6.218   2.405   1.00 63.07  ?  54   ARG C C   1 
ATOM   8802  O  O   . ARG C  1 54  ? 7.892   7.357   2.400   1.00 62.97  ?  54   ARG C O   1 
ATOM   8803  C  CB  . ARG C  1 54  ? 5.210   5.924   3.579   1.00 64.09  ?  54   ARG C CB  1 
ATOM   8804  C  CG  . ARG C  1 54  ? 4.371   4.652   3.710   1.00 67.52  ?  54   ARG C CG  1 
ATOM   8805  C  CD  . ARG C  1 54  ? 2.877   4.948   3.705   1.00 71.80  ?  54   ARG C CD  1 
ATOM   8806  N  NE  . ARG C  1 54  ? 2.468   5.747   4.856   1.00 74.98  ?  54   ARG C NE  1 
ATOM   8807  C  CZ  . ARG C  1 54  ? 2.016   6.996   4.780   1.00 78.60  ?  54   ARG C CZ  1 
ATOM   8808  N  NH1 . ARG C  1 54  ? 1.910   7.596   3.599   1.00 80.24  ?  54   ARG C NH1 1 
ATOM   8809  N  NH2 . ARG C  1 54  ? 1.666   7.645   5.887   1.00 78.94  ?  54   ARG C NH2 1 
ATOM   8810  N  N   . PRO C  1 55  ? 7.528   5.404   1.352   1.00 63.66  ?  55   PRO C N   1 
ATOM   8811  C  CA  . PRO C  1 55  ? 8.276   5.833   0.164   1.00 63.00  ?  55   PRO C CA  1 
ATOM   8812  C  C   . PRO C  1 55  ? 7.723   7.122   -0.427  1.00 64.85  ?  55   PRO C C   1 
ATOM   8813  O  O   . PRO C  1 55  ? 6.540   7.439   -0.293  1.00 67.54  ?  55   PRO C O   1 
ATOM   8814  C  CB  . PRO C  1 55  ? 8.108   4.657   -0.802  1.00 62.66  ?  55   PRO C CB  1 
ATOM   8815  C  CG  . PRO C  1 55  ? 7.831   3.485   0.078   1.00 63.07  ?  55   PRO C CG  1 
ATOM   8816  C  CD  . PRO C  1 55  ? 7.044   4.018   1.229   1.00 63.96  ?  55   PRO C CD  1 
ATOM   8817  N  N   . TRP C  1 56  ? 8.606   7.874   -1.074  1.00 64.57  ?  56   TRP C N   1 
ATOM   8818  C  CA  . TRP C  1 56  ? 8.278   9.157   -1.680  1.00 65.67  ?  56   TRP C CA  1 
ATOM   8819  C  C   . TRP C  1 56  ? 8.666   9.149   -3.155  1.00 66.87  ?  56   TRP C C   1 
ATOM   8820  O  O   . TRP C  1 56  ? 9.413   8.287   -3.626  1.00 65.83  ?  56   TRP C O   1 
ATOM   8821  C  CB  . TRP C  1 56  ? 8.978   10.309  -0.946  1.00 63.83  ?  56   TRP C CB  1 
ATOM   8822  C  CG  . TRP C  1 56  ? 10.469  10.264  -1.051  1.00 62.75  ?  56   TRP C CG  1 
ATOM   8823  C  CD1 . TRP C  1 56  ? 11.237  10.781  -2.056  1.00 64.11  ?  56   TRP C CD1 1 
ATOM   8824  C  CD2 . TRP C  1 56  ? 11.379  9.670   -0.115  1.00 59.54  ?  56   TRP C CD2 1 
ATOM   8825  N  NE1 . TRP C  1 56  ? 12.567  10.542  -1.803  1.00 62.92  ?  56   TRP C NE1 1 
ATOM   8826  C  CE2 . TRP C  1 56  ? 12.681  9.863   -0.617  1.00 59.29  ?  56   TRP C CE2 1 
ATOM   8827  C  CE3 . TRP C  1 56  ? 11.218  8.994   1.098   1.00 56.54  ?  56   TRP C CE3 1 
ATOM   8828  C  CZ2 . TRP C  1 56  ? 13.815  9.404   0.052   1.00 55.26  ?  56   TRP C CZ2 1 
ATOM   8829  C  CZ3 . TRP C  1 56  ? 12.346  8.539   1.759   1.00 53.40  ?  56   TRP C CZ3 1 
ATOM   8830  C  CH2 . TRP C  1 56  ? 13.626  8.744   1.234   1.00 52.43  ?  56   TRP C CH2 1 
ATOM   8831  N  N   . SER C  1 57  ? 8.139   10.121  -3.892  1.00 68.73  ?  57   SER C N   1 
ATOM   8832  C  CA  . SER C  1 57  ? 8.397   10.235  -5.320  1.00 71.84  ?  57   SER C CA  1 
ATOM   8833  C  C   . SER C  1 57  ? 9.257   11.459  -5.600  1.00 65.83  ?  57   SER C C   1 
ATOM   8834  O  O   . SER C  1 57  ? 9.205   12.454  -4.875  1.00 64.95  ?  57   SER C O   1 
ATOM   8835  C  CB  . SER C  1 57  ? 7.091   10.326  -6.120  1.00 78.95  ?  57   SER C CB  1 
ATOM   8836  O  OG  . SER C  1 57  ? 6.262   11.367  -5.630  1.00 82.63  ?  57   SER C OG  1 
ATOM   8837  N  N   . GLY C  1 58  ? 10.049  11.374  -6.662  1.00 62.31  ?  58   GLY C N   1 
ATOM   8838  C  CA  . GLY C  1 58  ? 10.979  12.428  -6.994  1.00 60.25  ?  58   GLY C CA  1 
ATOM   8839  C  C   . GLY C  1 58  ? 12.296  12.269  -6.259  1.00 58.38  ?  58   GLY C C   1 
ATOM   8840  O  O   . GLY C  1 58  ? 12.561  11.263  -5.598  1.00 59.33  ?  58   GLY C O   1 
ATOM   8841  N  N   . VAL C  1 59  ? 13.139  13.290  -6.388  1.00 57.49  ?  59   VAL C N   1 
ATOM   8842  C  CA  . VAL C  1 59  ? 14.415  13.351  -5.686  1.00 59.49  ?  59   VAL C CA  1 
ATOM   8843  C  C   . VAL C  1 59  ? 14.256  14.257  -4.472  1.00 60.78  ?  59   VAL C C   1 
ATOM   8844  O  O   . VAL C  1 59  ? 13.947  15.447  -4.603  1.00 64.18  ?  59   VAL C O   1 
ATOM   8845  C  CB  . VAL C  1 59  ? 15.543  13.841  -6.606  1.00 61.92  ?  59   VAL C CB  1 
ATOM   8846  C  CG1 . VAL C  1 59  ? 16.049  12.697  -7.454  1.00 64.37  ?  59   VAL C CG1 1 
ATOM   8847  C  CG2 . VAL C  1 59  ? 15.053  14.979  -7.490  1.00 64.87  ?  59   VAL C CG2 1 
ATOM   8848  N  N   . LEU C  1 60  ? 14.465  13.697  -3.286  1.00 58.59  ?  60   LEU C N   1 
ATOM   8849  C  CA  . LEU C  1 60  ? 14.294  14.452  -2.054  1.00 56.08  ?  60   LEU C CA  1 
ATOM   8850  C  C   . LEU C  1 60  ? 15.503  15.345  -1.812  1.00 53.32  ?  60   LEU C C   1 
ATOM   8851  O  O   . LEU C  1 60  ? 16.643  14.960  -2.087  1.00 52.30  ?  60   LEU C O   1 
ATOM   8852  C  CB  . LEU C  1 60  ? 14.086  13.491  -0.882  1.00 55.66  ?  60   LEU C CB  1 
ATOM   8853  C  CG  . LEU C  1 60  ? 13.904  14.057  0.521   1.00 49.53  ?  60   LEU C CG  1 
ATOM   8854  C  CD1 . LEU C  1 60  ? 12.818  13.277  1.227   1.00 49.22  ?  60   LEU C CD1 1 
ATOM   8855  C  CD2 . LEU C  1 60  ? 15.200  13.980  1.303   1.00 48.77  ?  60   LEU C CD2 1 
ATOM   8856  N  N   . ASP C  1 61  ? 15.251  16.548  -1.298  1.00 52.54  ?  61   ASP C N   1 
ATOM   8857  C  CA  . ASP C  1 61  ? 16.328  17.498  -1.059  1.00 53.41  ?  61   ASP C CA  1 
ATOM   8858  C  C   . ASP C  1 61  ? 17.019  17.154  0.254   1.00 52.20  ?  61   ASP C C   1 
ATOM   8859  O  O   . ASP C  1 61  ? 16.416  17.254  1.329   1.00 50.23  ?  61   ASP C O   1 
ATOM   8860  C  CB  . ASP C  1 61  ? 15.755  18.912  -1.029  1.00 57.22  ?  61   ASP C CB  1 
ATOM   8861  C  CG  . ASP C  1 61  ? 16.822  19.983  -0.998  1.00 61.58  ?  61   ASP C CG  1 
ATOM   8862  O  OD1 . ASP C  1 61  ? 17.902  19.757  -0.416  1.00 62.27  ?  61   ASP C OD1 1 
ATOM   8863  O  OD2 . ASP C  1 61  ? 16.570  21.067  -1.562  1.00 65.00  ?  61   ASP C OD2 1 
ATOM   8864  N  N   . ALA C  1 62  ? 18.290  16.775  0.165   1.00 53.86  ?  62   ALA C N   1 
ATOM   8865  C  CA  . ALA C  1 62  ? 19.109  16.426  1.317   1.00 52.73  ?  62   ALA C CA  1 
ATOM   8866  C  C   . ALA C  1 62  ? 20.029  17.551  1.770   1.00 54.42  ?  62   ALA C C   1 
ATOM   8867  O  O   . ALA C  1 62  ? 20.899  17.311  2.608   1.00 55.15  ?  62   ALA C O   1 
ATOM   8868  C  CB  . ALA C  1 62  ? 19.925  15.166  1.029   1.00 55.16  ?  62   ALA C CB  1 
ATOM   8869  N  N   . THR C  1 63  ? 19.925  18.740  1.179   1.00 53.95  ?  63   THR C N   1 
ATOM   8870  C  CA  . THR C  1 63  ? 20.996  19.728  1.278   1.00 54.41  ?  63   THR C CA  1 
ATOM   8871  C  C   . THR C  1 63  ? 20.941  20.606  2.524   1.00 53.62  ?  63   THR C C   1 
ATOM   8872  O  O   . THR C  1 63  ? 21.835  21.441  2.695   1.00 48.98  ?  63   THR C O   1 
ATOM   8873  C  CB  . THR C  1 63  ? 20.998  20.628  0.036   1.00 55.30  ?  63   THR C CB  1 
ATOM   8874  O  OG1 . THR C  1 63  ? 19.781  21.383  -0.014  1.00 53.74  ?  63   THR C OG1 1 
ATOM   8875  C  CG2 . THR C  1 63  ? 21.142  19.796  -1.233  1.00 51.71  ?  63   THR C CG2 1 
ATOM   8876  N  N   . THR C  1 64  ? 19.942  20.459  3.393   1.00 53.79  ?  64   THR C N   1 
ATOM   8877  C  CA  . THR C  1 64  ? 19.845  21.301  4.579   1.00 54.15  ?  64   THR C CA  1 
ATOM   8878  C  C   . THR C  1 64  ? 19.348  20.493  5.767   1.00 51.37  ?  64   THR C C   1 
ATOM   8879  O  O   . THR C  1 64  ? 18.647  19.491  5.609   1.00 45.88  ?  64   THR C O   1 
ATOM   8880  C  CB  . THR C  1 64  ? 18.896  22.479  4.365   1.00 56.77  ?  64   THR C CB  1 
ATOM   8881  O  OG1 . THR C  1 64  ? 17.771  22.039  3.597   1.00 58.20  ?  64   THR C OG1 1 
ATOM   8882  C  CG2 . THR C  1 64  ? 19.599  23.624  3.646   1.00 57.99  ?  64   THR C CG2 1 
ATOM   8883  N  N   . PHE C  1 65  ? 19.697  20.962  6.962   1.00 50.83  ?  65   PHE C N   1 
ATOM   8884  C  CA  . PHE C  1 65  ? 19.181  20.346  8.175   1.00 48.83  ?  65   PHE C CA  1 
ATOM   8885  C  C   . PHE C  1 65  ? 17.676  20.565  8.275   1.00 48.45  ?  65   PHE C C   1 
ATOM   8886  O  O   . PHE C  1 65  ? 17.155  21.609  7.870   1.00 51.56  ?  65   PHE C O   1 
ATOM   8887  C  CB  . PHE C  1 65  ? 19.861  20.929  9.414   1.00 47.86  ?  65   PHE C CB  1 
ATOM   8888  C  CG  . PHE C  1 65  ? 21.265  20.441  9.637   1.00 47.82  ?  65   PHE C CG  1 
ATOM   8889  C  CD1 . PHE C  1 65  ? 21.521  19.102  9.878   1.00 47.95  ?  65   PHE C CD1 1 
ATOM   8890  C  CD2 . PHE C  1 65  ? 22.321  21.337  9.679   1.00 44.54  ?  65   PHE C CD2 1 
ATOM   8891  C  CE1 . PHE C  1 65  ? 22.816  18.659  10.101  1.00 48.40  ?  65   PHE C CE1 1 
ATOM   8892  C  CE2 . PHE C  1 65  ? 23.616  20.902  9.912   1.00 48.92  ?  65   PHE C CE2 1 
ATOM   8893  C  CZ  . PHE C  1 65  ? 23.864  19.562  10.123  1.00 48.75  ?  65   PHE C CZ  1 
ATOM   8894  N  N   . GLN C  1 66  ? 16.977  19.578  8.828   1.00 47.23  ?  66   GLN C N   1 
ATOM   8895  C  CA  . GLN C  1 66  ? 15.542  19.672  9.042   1.00 48.25  ?  66   GLN C CA  1 
ATOM   8896  C  C   . GLN C  1 66  ? 15.257  20.294  10.410  1.00 50.40  ?  66   GLN C C   1 
ATOM   8897  O  O   . GLN C  1 66  ? 16.155  20.791  11.097  1.00 51.00  ?  66   GLN C O   1 
ATOM   8898  C  CB  . GLN C  1 66  ? 14.889  18.299  8.906   1.00 46.42  ?  66   GLN C CB  1 
ATOM   8899  C  CG  . GLN C  1 66  ? 14.209  18.047  7.568   1.00 48.13  ?  66   GLN C CG  1 
ATOM   8900  C  CD  . GLN C  1 66  ? 12.942  18.862  7.378   1.00 46.83  ?  66   GLN C CD  1 
ATOM   8901  O  OE1 . GLN C  1 66  ? 12.483  19.542  8.289   1.00 44.87  ?  66   GLN C OE1 1 
ATOM   8902  N  NE2 . GLN C  1 66  ? 12.351  18.765  6.197   1.00 45.97  ?  66   GLN C NE2 1 
ATOM   8903  N  N   . ASN C  1 67  ? 13.992  20.253  10.823  1.00 50.68  ?  67   ASN C N   1 
ATOM   8904  C  CA  . ASN C  1 67  ? 13.551  20.888  12.054  1.00 49.47  ?  67   ASN C CA  1 
ATOM   8905  C  C   . ASN C  1 67  ? 14.152  20.208  13.283  1.00 48.93  ?  67   ASN C C   1 
ATOM   8906  O  O   . ASN C  1 67  ? 14.549  19.038  13.258  1.00 48.45  ?  67   ASN C O   1 
ATOM   8907  C  CB  . ASN C  1 67  ? 12.026  20.850  12.157  1.00 49.86  ?  67   ASN C CB  1 
ATOM   8908  C  CG  . ASN C  1 67  ? 11.342  21.562  11.011  1.00 51.36  ?  67   ASN C CG  1 
ATOM   8909  O  OD1 . ASN C  1 67  ? 11.705  22.684  10.654  1.00 52.16  ?  67   ASN C OD1 1 
ATOM   8910  N  ND2 . ASN C  1 67  ? 10.335  20.916  10.434  1.00 52.14  ?  67   ASN C ND2 1 
ATOM   8911  N  N   . VAL C  1 68  ? 14.205  20.970  14.379  1.00 48.88  ?  68   VAL C N   1 
ATOM   8912  C  CA  . VAL C  1 68  ? 14.585  20.463  15.694  1.00 47.22  ?  68   VAL C CA  1 
ATOM   8913  C  C   . VAL C  1 68  ? 13.324  20.016  16.421  1.00 47.26  ?  68   VAL C C   1 
ATOM   8914  O  O   . VAL C  1 68  ? 12.266  20.649  16.305  1.00 45.86  ?  68   VAL C O   1 
ATOM   8915  C  CB  . VAL C  1 68  ? 15.347  21.537  16.497  1.00 44.81  ?  68   VAL C CB  1 
ATOM   8916  C  CG1 . VAL C  1 68  ? 15.631  21.062  17.917  1.00 42.53  ?  68   VAL C CG1 1 
ATOM   8917  C  CG2 . VAL C  1 68  ? 16.637  21.914  15.789  1.00 44.64  ?  68   VAL C CG2 1 
ATOM   8918  N  N   . CYS C  1 69  ? 13.424  18.908  17.154  1.00 48.51  ?  69   CYS C N   1 
ATOM   8919  C  CA  . CYS C  1 69  ? 12.288  18.432  17.931  1.00 49.81  ?  69   CYS C CA  1 
ATOM   8920  C  C   . CYS C  1 69  ? 11.871  19.477  18.956  1.00 47.15  ?  69   CYS C C   1 
ATOM   8921  O  O   . CYS C  1 69  ? 12.713  20.154  19.559  1.00 46.06  ?  69   CYS C O   1 
ATOM   8922  C  CB  . CYS C  1 69  ? 12.628  17.109  18.616  1.00 52.03  ?  69   CYS C CB  1 
ATOM   8923  S  SG  . CYS C  1 69  ? 12.814  15.728  17.471  1.00 53.77  ?  69   CYS C SG  1 
ATOM   8924  N  N   . TYR C  1 70  ? 10.561  19.618  19.139  1.00 45.46  ?  70   TYR C N   1 
ATOM   8925  C  CA  . TYR C  1 70  ? 10.059  20.691  19.980  1.00 46.32  ?  70   TYR C CA  1 
ATOM   8926  C  C   . TYR C  1 70  ? 10.539  20.514  21.415  1.00 46.40  ?  70   TYR C C   1 
ATOM   8927  O  O   . TYR C  1 70  ? 10.322  19.469  22.037  1.00 46.06  ?  70   TYR C O   1 
ATOM   8928  C  CB  . TYR C  1 70  ? 8.540   20.741  19.923  1.00 46.42  ?  70   TYR C CB  1 
ATOM   8929  C  CG  . TYR C  1 70  ? 8.035   22.142  20.103  1.00 46.66  ?  70   TYR C CG  1 
ATOM   8930  C  CD1 . TYR C  1 70  ? 7.891   22.991  19.020  1.00 44.12  ?  70   TYR C CD1 1 
ATOM   8931  C  CD2 . TYR C  1 70  ? 7.733   22.625  21.363  1.00 46.35  ?  70   TYR C CD2 1 
ATOM   8932  C  CE1 . TYR C  1 70  ? 7.444   24.273  19.187  1.00 45.97  ?  70   TYR C CE1 1 
ATOM   8933  C  CE2 . TYR C  1 70  ? 7.286   23.905  21.541  1.00 46.02  ?  70   TYR C CE2 1 
ATOM   8934  C  CZ  . TYR C  1 70  ? 7.143   24.728  20.451  1.00 46.10  ?  70   TYR C CZ  1 
ATOM   8935  O  OH  . TYR C  1 70  ? 6.691   26.014  20.622  1.00 46.25  ?  70   TYR C OH  1 
ATOM   8936  N  N   . GLN C  1 71  ? 11.176  21.552  21.946  1.00 46.87  ?  71   GLN C N   1 
ATOM   8937  C  CA  . GLN C  1 71  ? 11.923  21.405  23.181  1.00 48.05  ?  71   GLN C CA  1 
ATOM   8938  C  C   . GLN C  1 71  ? 12.023  22.748  23.885  1.00 49.07  ?  71   GLN C C   1 
ATOM   8939  O  O   . GLN C  1 71  ? 11.802  23.806  23.291  1.00 51.45  ?  71   GLN C O   1 
ATOM   8940  C  CB  . GLN C  1 71  ? 13.325  20.850  22.909  1.00 47.19  ?  71   GLN C CB  1 
ATOM   8941  C  CG  . GLN C  1 71  ? 14.165  21.729  21.999  1.00 46.53  ?  71   GLN C CG  1 
ATOM   8942  C  CD  . GLN C  1 71  ? 15.530  21.137  21.729  1.00 46.59  ?  71   GLN C CD  1 
ATOM   8943  O  OE1 . GLN C  1 71  ? 16.560  21.705  22.107  1.00 46.32  ?  71   GLN C OE1 1 
ATOM   8944  N  NE2 . GLN C  1 71  ? 15.548  19.985  21.069  1.00 46.28  ?  71   GLN C NE2 1 
ATOM   8945  N  N   . TYR C  1 72  ? 12.364  22.681  25.168  1.00 47.00  ?  72   TYR C N   1 
ATOM   8946  C  CA  . TYR C  1 72  ? 12.647  23.873  25.950  1.00 46.59  ?  72   TYR C CA  1 
ATOM   8947  C  C   . TYR C  1 72  ? 13.882  24.585  25.400  1.00 46.61  ?  72   TYR C C   1 
ATOM   8948  O  O   . TYR C  1 72  ? 14.818  23.958  24.895  1.00 48.44  ?  72   TYR C O   1 
ATOM   8949  C  CB  . TYR C  1 72  ? 12.847  23.477  27.416  1.00 46.40  ?  72   TYR C CB  1 
ATOM   8950  C  CG  . TYR C  1 72  ? 13.194  24.604  28.351  1.00 47.10  ?  72   TYR C CG  1 
ATOM   8951  C  CD1 . TYR C  1 72  ? 12.192  25.358  28.948  1.00 48.90  ?  72   TYR C CD1 1 
ATOM   8952  C  CD2 . TYR C  1 72  ? 14.512  24.897  28.665  1.00 47.66  ?  72   TYR C CD2 1 
ATOM   8953  C  CE1 . TYR C  1 72  ? 12.487  26.387  29.809  1.00 50.64  ?  72   TYR C CE1 1 
ATOM   8954  C  CE2 . TYR C  1 72  ? 14.819  25.924  29.528  1.00 51.32  ?  72   TYR C CE2 1 
ATOM   8955  C  CZ  . TYR C  1 72  ? 13.802  26.669  30.097  1.00 53.53  ?  72   TYR C CZ  1 
ATOM   8956  O  OH  . TYR C  1 72  ? 14.107  27.700  30.957  1.00 57.76  ?  72   TYR C OH  1 
ATOM   8957  N  N   . VAL C  1 73  ? 13.873  25.912  25.490  1.00 45.55  ?  73   VAL C N   1 
ATOM   8958  C  CA  . VAL C  1 73  ? 14.971  26.757  25.031  1.00 47.15  ?  73   VAL C CA  1 
ATOM   8959  C  C   . VAL C  1 73  ? 15.622  27.404  26.244  1.00 51.70  ?  73   VAL C C   1 
ATOM   8960  O  O   . VAL C  1 73  ? 14.925  27.944  27.112  1.00 54.23  ?  73   VAL C O   1 
ATOM   8961  C  CB  . VAL C  1 73  ? 14.473  27.822  24.043  1.00 47.21  ?  73   VAL C CB  1 
ATOM   8962  C  CG1 . VAL C  1 73  ? 15.595  28.773  23.697  1.00 44.35  ?  73   VAL C CG1 1 
ATOM   8963  C  CG2 . VAL C  1 73  ? 13.923  27.153  22.799  1.00 43.60  ?  73   VAL C CG2 1 
ATOM   8964  N  N   . ASP C  1 74  ? 16.955  27.381  26.300  1.00 53.83  ?  74   ASP C N   1 
ATOM   8965  C  CA  . ASP C  1 74  ? 17.640  27.812  27.514  1.00 58.81  ?  74   ASP C CA  1 
ATOM   8966  C  C   . ASP C  1 74  ? 17.674  29.335  27.547  1.00 64.18  ?  74   ASP C C   1 
ATOM   8967  O  O   . ASP C  1 74  ? 18.293  29.979  26.692  1.00 64.71  ?  74   ASP C O   1 
ATOM   8968  C  CB  . ASP C  1 74  ? 19.049  27.228  27.559  1.00 58.27  ?  74   ASP C CB  1 
ATOM   8969  C  CG  . ASP C  1 74  ? 19.746  27.479  28.885  1.00 57.48  ?  74   ASP C CG  1 
ATOM   8970  O  OD1 . ASP C  1 74  ? 20.125  28.644  29.140  1.00 58.45  ?  74   ASP C OD1 1 
ATOM   8971  O  OD2 . ASP C  1 74  ? 19.938  26.512  29.657  1.00 55.24  ?  74   ASP C OD2 1 
ATOM   8972  N  N   . THR C  1 75  ? 16.991  29.907  28.533  1.00 67.65  ?  75   THR C N   1 
ATOM   8973  C  CA  . THR C  1 75  ? 16.882  31.347  28.704  1.00 69.48  ?  75   THR C CA  1 
ATOM   8974  C  C   . THR C  1 75  ? 17.785  31.932  29.786  1.00 66.91  ?  75   THR C C   1 
ATOM   8975  O  O   . THR C  1 75  ? 17.768  33.152  29.985  1.00 67.78  ?  75   THR C O   1 
ATOM   8976  C  CB  . THR C  1 75  ? 15.427  31.704  28.991  1.00 72.61  ?  75   THR C CB  1 
ATOM   8977  O  OG1 . THR C  1 75  ? 14.994  31.032  30.187  1.00 74.78  ?  75   THR C OG1 1 
ATOM   8978  C  CG2 . THR C  1 75  ? 14.564  31.276  27.812  1.00 70.95  ?  75   THR C CG2 1 
ATOM   8979  N  N   . LEU C  1 76  ? 18.552  31.106  30.501  1.00 63.15  ?  76   LEU C N   1 
ATOM   8980  C  CA  . LEU C  1 76  ? 19.181  31.576  31.734  1.00 61.84  ?  76   LEU C CA  1 
ATOM   8981  C  C   . LEU C  1 76  ? 20.142  32.729  31.469  1.00 61.71  ?  76   LEU C C   1 
ATOM   8982  O  O   . LEU C  1 76  ? 20.151  33.721  32.207  1.00 61.92  ?  76   LEU C O   1 
ATOM   8983  C  CB  . LEU C  1 76  ? 19.909  30.423  32.426  1.00 60.01  ?  76   LEU C CB  1 
ATOM   8984  C  CG  . LEU C  1 76  ? 20.747  30.772  33.658  1.00 58.76  ?  76   LEU C CG  1 
ATOM   8985  C  CD1 . LEU C  1 76  ? 19.865  31.373  34.738  1.00 59.26  ?  76   LEU C CD1 1 
ATOM   8986  C  CD2 . LEU C  1 76  ? 21.485  29.552  34.177  1.00 57.39  ?  76   LEU C CD2 1 
ATOM   8987  N  N   . TYR C  1 77  ? 20.944  32.620  30.415  1.00 61.35  ?  77   TYR C N   1 
ATOM   8988  C  CA  . TYR C  1 77  ? 21.973  33.604  30.079  1.00 62.35  ?  77   TYR C CA  1 
ATOM   8989  C  C   . TYR C  1 77  ? 21.803  34.002  28.619  1.00 64.07  ?  77   TYR C C   1 
ATOM   8990  O  O   . TYR C  1 77  ? 22.494  33.475  27.734  1.00 65.69  ?  77   TYR C O   1 
ATOM   8991  C  CB  . TYR C  1 77  ? 23.370  33.043  30.344  1.00 60.81  ?  77   TYR C CB  1 
ATOM   8992  C  CG  . TYR C  1 77  ? 23.673  32.788  31.801  1.00 61.66  ?  77   TYR C CG  1 
ATOM   8993  C  CD1 . TYR C  1 77  ? 23.426  33.764  32.755  1.00 65.47  ?  77   TYR C CD1 1 
ATOM   8994  C  CD2 . TYR C  1 77  ? 24.193  31.568  32.224  1.00 61.58  ?  77   TYR C CD2 1 
ATOM   8995  C  CE1 . TYR C  1 77  ? 23.706  33.544  34.088  1.00 69.16  ?  77   TYR C CE1 1 
ATOM   8996  C  CE2 . TYR C  1 77  ? 24.472  31.335  33.559  1.00 64.57  ?  77   TYR C CE2 1 
ATOM   8997  C  CZ  . TYR C  1 77  ? 24.225  32.330  34.487  1.00 70.16  ?  77   TYR C CZ  1 
ATOM   8998  O  OH  . TYR C  1 77  ? 24.492  32.132  35.824  1.00 75.10  ?  77   TYR C OH  1 
ATOM   8999  N  N   . PRO C  1 78  ? 20.881  34.920  28.327  1.00 61.89  ?  78   PRO C N   1 
ATOM   9000  C  CA  . PRO C  1 78  ? 20.637  35.294  26.929  1.00 61.88  ?  78   PRO C CA  1 
ATOM   9001  C  C   . PRO C  1 78  ? 21.862  35.943  26.300  1.00 64.11  ?  78   PRO C C   1 
ATOM   9002  O  O   . PRO C  1 78  ? 22.534  36.775  26.913  1.00 66.55  ?  78   PRO C O   1 
ATOM   9003  C  CB  . PRO C  1 78  ? 19.462  36.273  27.027  1.00 60.30  ?  78   PRO C CB  1 
ATOM   9004  C  CG  . PRO C  1 78  ? 18.775  35.898  28.289  1.00 58.82  ?  78   PRO C CG  1 
ATOM   9005  C  CD  . PRO C  1 78  ? 19.881  35.508  29.231  1.00 59.40  ?  78   PRO C CD  1 
ATOM   9006  N  N   . GLY C  1 79  ? 22.151  35.540  25.060  1.00 63.10  ?  79   GLY C N   1 
ATOM   9007  C  CA  . GLY C  1 79  ? 23.306  36.023  24.336  1.00 62.36  ?  79   GLY C CA  1 
ATOM   9008  C  C   . GLY C  1 79  ? 24.616  35.363  24.701  1.00 61.36  ?  79   GLY C C   1 
ATOM   9009  O  O   . GLY C  1 79  ? 25.619  35.592  24.013  1.00 60.77  ?  79   GLY C O   1 
ATOM   9010  N  N   . PHE C  1 80  ? 24.643  34.550  25.752  1.00 61.66  ?  80   PHE C N   1 
ATOM   9011  C  CA  . PHE C  1 80  ? 25.862  33.885  26.187  1.00 60.92  ?  80   PHE C CA  1 
ATOM   9012  C  C   . PHE C  1 80  ? 26.107  32.657  25.321  1.00 58.98  ?  80   PHE C C   1 
ATOM   9013  O  O   . PHE C  1 80  ? 25.208  31.832  25.139  1.00 57.55  ?  80   PHE C O   1 
ATOM   9014  C  CB  . PHE C  1 80  ? 25.734  33.501  27.664  1.00 60.75  ?  80   PHE C CB  1 
ATOM   9015  C  CG  . PHE C  1 80  ? 26.933  32.795  28.229  1.00 60.43  ?  80   PHE C CG  1 
ATOM   9016  C  CD1 . PHE C  1 80  ? 28.173  33.407  28.233  1.00 62.65  ?  80   PHE C CD1 1 
ATOM   9017  C  CD2 . PHE C  1 80  ? 26.811  31.540  28.799  1.00 58.19  ?  80   PHE C CD2 1 
ATOM   9018  C  CE1 . PHE C  1 80  ? 29.277  32.770  28.766  1.00 62.67  ?  80   PHE C CE1 1 
ATOM   9019  C  CE2 . PHE C  1 80  ? 27.913  30.899  29.337  1.00 58.56  ?  80   PHE C CE2 1 
ATOM   9020  C  CZ  . PHE C  1 80  ? 29.147  31.514  29.319  1.00 60.67  ?  80   PHE C CZ  1 
ATOM   9021  N  N   . GLU C  1 81  ? 27.320  32.541  24.775  1.00 60.43  ?  81   GLU C N   1 
ATOM   9022  C  CA  . GLU C  1 81  ? 27.613  31.406  23.904  1.00 62.65  ?  81   GLU C CA  1 
ATOM   9023  C  C   . GLU C  1 81  ? 27.537  30.087  24.662  1.00 62.23  ?  81   GLU C C   1 
ATOM   9024  O  O   . GLU C  1 81  ? 27.057  29.083  24.122  1.00 64.75  ?  81   GLU C O   1 
ATOM   9025  C  CB  . GLU C  1 81  ? 28.988  31.562  23.258  1.00 67.42  ?  81   GLU C CB  1 
ATOM   9026  C  CG  . GLU C  1 81  ? 29.374  30.353  22.420  1.00 73.33  ?  81   GLU C CG  1 
ATOM   9027  C  CD  . GLU C  1 81  ? 30.664  30.539  21.654  1.00 82.61  ?  81   GLU C CD  1 
ATOM   9028  O  OE1 . GLU C  1 81  ? 31.722  30.726  22.295  1.00 85.84  ?  81   GLU C OE1 1 
ATOM   9029  O  OE2 . GLU C  1 81  ? 30.619  30.493  20.404  1.00 86.56  ?  81   GLU C OE2 1 
ATOM   9030  N  N   . GLY C  1 82  ? 27.994  30.072  25.916  1.00 60.10  ?  82   GLY C N   1 
ATOM   9031  C  CA  . GLY C  1 82  ? 28.021  28.831  26.676  1.00 57.77  ?  82   GLY C CA  1 
ATOM   9032  C  C   . GLY C  1 82  ? 26.687  28.112  26.696  1.00 56.37  ?  82   GLY C C   1 
ATOM   9033  O  O   . GLY C  1 82  ? 26.619  26.899  26.482  1.00 58.17  ?  82   GLY C O   1 
ATOM   9034  N  N   . THR C  1 83  ? 25.604  28.844  26.978  1.00 53.11  ?  83   THR C N   1 
ATOM   9035  C  CA  . THR C  1 83  ? 24.280  28.228  26.939  1.00 50.19  ?  83   THR C CA  1 
ATOM   9036  C  C   . THR C  1 83  ? 23.727  28.150  25.520  1.00 50.19  ?  83   THR C C   1 
ATOM   9037  O  O   . THR C  1 83  ? 23.119  27.142  25.145  1.00 47.49  ?  83   THR C O   1 
ATOM   9038  C  CB  . THR C  1 83  ? 23.300  28.980  27.845  1.00 50.04  ?  83   THR C CB  1 
ATOM   9039  O  OG1 . THR C  1 83  ? 23.323  30.379  27.544  1.00 50.61  ?  83   THR C OG1 1 
ATOM   9040  C  CG2 . THR C  1 83  ? 23.667  28.773  29.307  1.00 50.73  ?  83   THR C CG2 1 
ATOM   9041  N  N   . GLU C  1 84  ? 23.922  29.204  24.722  1.00 54.67  ?  84   GLU C N   1 
ATOM   9042  C  CA  . GLU C  1 84  ? 23.252  29.304  23.428  1.00 56.59  ?  84   GLU C CA  1 
ATOM   9043  C  C   . GLU C  1 84  ? 23.813  28.340  22.390  1.00 55.42  ?  84   GLU C C   1 
ATOM   9044  O  O   . GLU C  1 84  ? 23.118  28.034  21.415  1.00 57.02  ?  84   GLU C O   1 
ATOM   9045  C  CB  . GLU C  1 84  ? 23.344  30.731  22.888  1.00 59.70  ?  84   GLU C CB  1 
ATOM   9046  C  CG  . GLU C  1 84  ? 22.071  31.273  22.262  1.00 61.91  ?  84   GLU C CG  1 
ATOM   9047  C  CD  . GLU C  1 84  ? 21.177  31.984  23.242  1.00 63.24  ?  84   GLU C CD  1 
ATOM   9048  O  OE1 . GLU C  1 84  ? 21.606  33.000  23.813  1.00 61.82  ?  84   GLU C OE1 1 
ATOM   9049  O  OE2 . GLU C  1 84  ? 20.025  31.563  23.426  1.00 65.38  ?  84   GLU C OE2 1 
ATOM   9050  N  N   . MET C  1 85  ? 25.046  27.858  22.567  1.00 51.78  ?  85   MET C N   1 
ATOM   9051  C  CA  . MET C  1 85  ? 25.601  26.900  21.621  1.00 48.30  ?  85   MET C CA  1 
ATOM   9052  C  C   . MET C  1 85  ? 24.802  25.607  21.596  1.00 47.72  ?  85   MET C C   1 
ATOM   9053  O  O   . MET C  1 85  ? 24.833  24.889  20.590  1.00 46.13  ?  85   MET C O   1 
ATOM   9054  C  CB  . MET C  1 85  ? 27.068  26.616  21.958  1.00 48.15  ?  85   MET C CB  1 
ATOM   9055  C  CG  . MET C  1 85  ? 27.289  25.410  22.848  1.00 49.83  ?  85   MET C CG  1 
ATOM   9056  S  SD  . MET C  1 85  ? 28.978  25.233  23.468  1.00 54.05  ?  85   MET C SD  1 
ATOM   9057  C  CE  . MET C  1 85  ? 29.935  25.144  21.954  1.00 56.98  ?  85   MET C CE  1 
ATOM   9058  N  N   . TRP C  1 86  ? 24.082  25.297  22.677  1.00 49.51  ?  86   TRP C N   1 
ATOM   9059  C  CA  . TRP C  1 86  ? 23.257  24.100  22.754  1.00 49.58  ?  86   TRP C CA  1 
ATOM   9060  C  C   . TRP C  1 86  ? 21.811  24.329  22.325  1.00 53.31  ?  86   TRP C C   1 
ATOM   9061  O  O   . TRP C  1 86  ? 21.073  23.350  22.157  1.00 54.61  ?  86   TRP C O   1 
ATOM   9062  C  CB  . TRP C  1 86  ? 23.286  23.545  24.179  1.00 46.91  ?  86   TRP C CB  1 
ATOM   9063  C  CG  . TRP C  1 86  ? 24.674  23.470  24.749  1.00 47.19  ?  86   TRP C CG  1 
ATOM   9064  C  CD1 . TRP C  1 86  ? 25.283  24.388  25.562  1.00 47.81  ?  86   TRP C CD1 1 
ATOM   9065  C  CD2 . TRP C  1 86  ? 25.637  22.436  24.525  1.00 47.31  ?  86   TRP C CD2 1 
ATOM   9066  N  NE1 . TRP C  1 86  ? 26.559  23.978  25.871  1.00 47.89  ?  86   TRP C NE1 1 
ATOM   9067  C  CE2 . TRP C  1 86  ? 26.801  22.783  25.244  1.00 48.89  ?  86   TRP C CE2 1 
ATOM   9068  C  CE3 . TRP C  1 86  ? 25.626  21.245  23.795  1.00 46.91  ?  86   TRP C CE3 1 
ATOM   9069  C  CZ2 . TRP C  1 86  ? 27.938  21.979  25.252  1.00 50.66  ?  86   TRP C CZ2 1 
ATOM   9070  C  CZ3 . TRP C  1 86  ? 26.756  20.454  23.803  1.00 48.80  ?  86   TRP C CZ3 1 
ATOM   9071  C  CH2 . TRP C  1 86  ? 27.895  20.822  24.527  1.00 50.21  ?  86   TRP C CH2 1 
ATOM   9072  N  N   . ASN C  1 87  ? 21.396  25.579  22.118  1.00 54.57  ?  87   ASN C N   1 
ATOM   9073  C  CA  . ASN C  1 87  ? 20.007  25.871  21.803  1.00 53.90  ?  87   ASN C CA  1 
ATOM   9074  C  C   . ASN C  1 87  ? 19.686  25.501  20.356  1.00 51.38  ?  87   ASN C C   1 
ATOM   9075  O  O   . ASN C  1 87  ? 20.586  25.402  19.518  1.00 50.42  ?  87   ASN C O   1 
ATOM   9076  C  CB  . ASN C  1 87  ? 19.713  27.347  22.049  1.00 56.80  ?  87   ASN C CB  1 
ATOM   9077  C  CG  . ASN C  1 87  ? 19.285  27.624  23.469  1.00 59.17  ?  87   ASN C CG  1 
ATOM   9078  O  OD1 . ASN C  1 87  ? 18.819  26.729  24.181  1.00 60.28  ?  87   ASN C OD1 1 
ATOM   9079  N  ND2 . ASN C  1 87  ? 19.449  28.867  23.896  1.00 60.57  ?  87   ASN C ND2 1 
ATOM   9080  N  N   . PRO C  1 88  ? 18.406  25.295  20.038  1.00 50.58  ?  88   PRO C N   1 
ATOM   9081  C  CA  . PRO C  1 88  ? 18.044  24.898  18.670  1.00 51.50  ?  88   PRO C CA  1 
ATOM   9082  C  C   . PRO C  1 88  ? 18.453  25.953  17.651  1.00 55.49  ?  88   PRO C C   1 
ATOM   9083  O  O   . PRO C  1 88  ? 18.135  27.137  17.792  1.00 57.35  ?  88   PRO C O   1 
ATOM   9084  C  CB  . PRO C  1 88  ? 16.520  24.745  18.740  1.00 48.85  ?  88   PRO C CB  1 
ATOM   9085  C  CG  . PRO C  1 88  ? 16.232  24.470  20.165  1.00 47.74  ?  88   PRO C CG  1 
ATOM   9086  C  CD  . PRO C  1 88  ? 17.245  25.255  20.944  1.00 49.27  ?  88   PRO C CD  1 
ATOM   9087  N  N   . ASN C  1 89  ? 19.172  25.509  16.621  1.00 56.18  ?  89   ASN C N   1 
ATOM   9088  C  CA  . ASN C  1 89  ? 19.587  26.370  15.523  1.00 57.02  ?  89   ASN C CA  1 
ATOM   9089  C  C   . ASN C  1 89  ? 18.691  26.259  14.295  1.00 58.94  ?  89   ASN C C   1 
ATOM   9090  O  O   . ASN C  1 89  ? 18.987  26.885  13.271  1.00 61.31  ?  89   ASN C O   1 
ATOM   9091  C  CB  . ASN C  1 89  ? 21.044  26.085  15.142  1.00 55.39  ?  89   ASN C CB  1 
ATOM   9092  C  CG  . ASN C  1 89  ? 21.255  24.685  14.639  1.00 52.12  ?  89   ASN C CG  1 
ATOM   9093  O  OD1 . ASN C  1 89  ? 20.374  23.832  14.741  1.00 50.41  ?  89   ASN C OD1 1 
ATOM   9094  N  ND2 . ASN C  1 89  ? 22.436  24.434  14.094  1.00 52.20  ?  89   ASN C ND2 1 
ATOM   9095  N  N   . ARG C  1 90  ? 17.630  25.459  14.351  1.00 58.00  ?  90   ARG C N   1 
ATOM   9096  C  CA  . ARG C  1 90  ? 16.656  25.405  13.270  1.00 56.96  ?  90   ARG C CA  1 
ATOM   9097  C  C   . ARG C  1 90  ? 15.256  25.594  13.843  1.00 56.52  ?  90   ARG C C   1 
ATOM   9098  O  O   . ARG C  1 90  ? 15.069  25.733  15.054  1.00 59.81  ?  90   ARG C O   1 
ATOM   9099  C  CB  . ARG C  1 90  ? 16.760  24.090  12.488  1.00 55.36  ?  90   ARG C CB  1 
ATOM   9100  C  CG  . ARG C  1 90  ? 18.038  23.932  11.677  1.00 55.65  ?  90   ARG C CG  1 
ATOM   9101  C  CD  . ARG C  1 90  ? 18.085  24.905  10.509  1.00 59.03  ?  90   ARG C CD  1 
ATOM   9102  N  NE  . ARG C  1 90  ? 19.022  24.466  9.476   1.00 62.64  ?  90   ARG C NE  1 
ATOM   9103  C  CZ  . ARG C  1 90  ? 20.293  24.852  9.399   1.00 65.78  ?  90   ARG C CZ  1 
ATOM   9104  N  NH1 . ARG C  1 90  ? 20.794  25.692  10.302  1.00 65.69  ?  90   ARG C NH1 1 
ATOM   9105  N  NH2 . ARG C  1 90  ? 21.067  24.393  8.420   1.00 67.68  ?  90   ARG C NH2 1 
ATOM   9106  N  N   . GLU C  1 91  ? 14.268  25.603  12.955  1.00 53.04  ?  91   GLU C N   1 
ATOM   9107  C  CA  . GLU C  1 91  ? 12.880  25.763  13.362  1.00 51.64  ?  91   GLU C CA  1 
ATOM   9108  C  C   . GLU C  1 91  ? 12.454  24.618  14.272  1.00 48.48  ?  91   GLU C C   1 
ATOM   9109  O  O   . GLU C  1 91  ? 12.868  23.472  14.088  1.00 49.18  ?  91   GLU C O   1 
ATOM   9110  C  CB  . GLU C  1 91  ? 11.992  25.819  12.119  1.00 56.82  ?  91   GLU C CB  1 
ATOM   9111  C  CG  . GLU C  1 91  ? 10.516  26.062  12.368  1.00 62.24  ?  91   GLU C CG  1 
ATOM   9112  C  CD  . GLU C  1 91  ? 9.757   26.319  11.077  1.00 66.51  ?  91   GLU C CD  1 
ATOM   9113  O  OE1 . GLU C  1 91  ? 10.047  27.338  10.412  1.00 67.87  ?  91   GLU C OE1 1 
ATOM   9114  O  OE2 . GLU C  1 91  ? 8.879   25.502  10.723  1.00 68.08  ?  91   GLU C OE2 1 
ATOM   9115  N  N   . LEU C  1 92  ? 11.637  24.934  15.274  1.00 47.58  ?  92   LEU C N   1 
ATOM   9116  C  CA  . LEU C  1 92  ? 11.080  23.922  16.160  1.00 45.67  ?  92   LEU C CA  1 
ATOM   9117  C  C   . LEU C  1 92  ? 9.765   23.423  15.583  1.00 45.99  ?  92   LEU C C   1 
ATOM   9118  O  O   . LEU C  1 92  ? 8.916   24.224  15.174  1.00 48.46  ?  92   LEU C O   1 
ATOM   9119  C  CB  . LEU C  1 92  ? 10.855  24.473  17.569  1.00 44.95  ?  92   LEU C CB  1 
ATOM   9120  C  CG  . LEU C  1 92  ? 12.071  24.809  18.430  1.00 43.33  ?  92   LEU C CG  1 
ATOM   9121  C  CD1 . LEU C  1 92  ? 11.638  25.000  19.866  1.00 43.25  ?  92   LEU C CD1 1 
ATOM   9122  C  CD2 . LEU C  1 92  ? 13.118  23.726  18.333  1.00 43.72  ?  92   LEU C CD2 1 
ATOM   9123  N  N   . SER C  1 93  ? 9.610   22.103  15.531  1.00 44.48  ?  93   SER C N   1 
ATOM   9124  C  CA  . SER C  1 93  ? 8.386   21.492  15.035  1.00 48.96  ?  93   SER C CA  1 
ATOM   9125  C  C   . SER C  1 93  ? 8.231   20.113  15.652  1.00 51.44  ?  93   SER C C   1 
ATOM   9126  O  O   . SER C  1 93  ? 9.212   19.468  16.032  1.00 52.58  ?  93   SER C O   1 
ATOM   9127  C  CB  . SER C  1 93  ? 8.387   21.388  13.505  1.00 49.83  ?  93   SER C CB  1 
ATOM   9128  O  OG  . SER C  1 93  ? 7.255   20.680  13.039  1.00 49.57  ?  93   SER C OG  1 
ATOM   9129  N  N   . GLU C  1 94  ? 6.978   19.658  15.733  1.00 52.39  ?  94   GLU C N   1 
ATOM   9130  C  CA  . GLU C  1 94  ? 6.742   18.267  16.098  1.00 51.73  ?  94   GLU C CA  1 
ATOM   9131  C  C   . GLU C  1 94  ? 7.079   17.309  14.971  1.00 52.35  ?  94   GLU C C   1 
ATOM   9132  O  O   . GLU C  1 94  ? 7.308   16.125  15.245  1.00 52.39  ?  94   GLU C O   1 
ATOM   9133  C  CB  . GLU C  1 94  ? 5.298   18.034  16.532  1.00 52.25  ?  94   GLU C CB  1 
ATOM   9134  C  CG  . GLU C  1 94  ? 4.922   18.687  17.834  1.00 52.09  ?  94   GLU C CG  1 
ATOM   9135  C  CD  . GLU C  1 94  ? 3.714   18.030  18.444  1.00 52.45  ?  94   GLU C CD  1 
ATOM   9136  O  OE1 . GLU C  1 94  ? 3.816   16.840  18.807  1.00 51.74  ?  94   GLU C OE1 1 
ATOM   9137  O  OE2 . GLU C  1 94  ? 2.664   18.691  18.547  1.00 54.35  ?  94   GLU C OE2 1 
ATOM   9138  N  N   . ASP C  1 95  ? 7.156   17.781  13.720  1.00 53.36  ?  95   ASP C N   1 
ATOM   9139  C  CA  . ASP C  1 95  ? 7.666   16.907  12.668  1.00 52.76  ?  95   ASP C CA  1 
ATOM   9140  C  C   . ASP C  1 95  ? 9.151   17.223  12.673  1.00 52.31  ?  95   ASP C C   1 
ATOM   9141  O  O   . ASP C  1 95  ? 9.628   18.127  11.980  1.00 52.44  ?  95   ASP C O   1 
ATOM   9142  C  CB  . ASP C  1 95  ? 6.968   17.290  11.362  1.00 54.11  ?  95   ASP C CB  1 
ATOM   9143  C  CG  . ASP C  1 95  ? 7.556   16.646  10.121  1.00 56.18  ?  95   ASP C CG  1 
ATOM   9144  O  OD1 . ASP C  1 95  ? 8.653   16.059  10.175  1.00 59.39  ?  95   ASP C OD1 1 
ATOM   9145  O  OD2 . ASP C  1 95  ? 6.918   16.788  9.053   1.00 54.48  ?  95   ASP C OD2 1 
ATOM   9146  N  N   . CYS C  1 96  ? 9.891   16.449  13.471  1.00 51.62  ?  96   CYS C N   1 
ATOM   9147  C  CA  . CYS C  1 96  ? 11.339  16.538  13.557  1.00 51.25  ?  96   CYS C CA  1 
ATOM   9148  C  C   . CYS C  1 96  ? 12.124  15.334  13.069  1.00 51.10  ?  96   CYS C C   1 
ATOM   9149  O  O   . CYS C  1 96  ? 13.357  15.364  13.167  1.00 52.48  ?  96   CYS C O   1 
ATOM   9150  C  CB  . CYS C  1 96  ? 11.770  16.881  14.980  1.00 50.55  ?  96   CYS C CB  1 
ATOM   9151  S  SG  . CYS C  1 96  ? 11.160  15.849  16.290  1.00 49.39  ?  96   CYS C SG  1 
ATOM   9152  N  N   . LEU C  1 97  ? 11.497  14.247  12.628  1.00 49.19  ?  97   LEU C N   1 
ATOM   9153  C  CA  . LEU C  1 97  ? 12.231  12.983  12.633  1.00 48.91  ?  97   LEU C CA  1 
ATOM   9154  C  C   . LEU C  1 97  ? 12.947  12.832  11.300  1.00 50.28  ?  97   LEU C C   1 
ATOM   9155  O  O   . LEU C  1 97  ? 12.345  12.474  10.280  1.00 51.51  ?  97   LEU C O   1 
ATOM   9156  C  CB  . LEU C  1 97  ? 11.303  11.803  12.906  1.00 48.37  ?  97   LEU C CB  1 
ATOM   9157  C  CG  . LEU C  1 97  ? 10.760  11.699  14.330  1.00 47.70  ?  97   LEU C CG  1 
ATOM   9158  C  CD1 . LEU C  1 97  ? 9.999   10.399  14.524  1.00 46.14  ?  97   LEU C CD1 1 
ATOM   9159  C  CD2 . LEU C  1 97  ? 11.905  11.801  15.327  1.00 47.40  ?  97   LEU C CD2 1 
ATOM   9160  N  N   . TYR C  1 98  ? 14.261  13.019  11.357  1.00 50.20  ?  98   TYR C N   1 
ATOM   9161  C  CA  . TYR C  1 98  ? 15.136  13.122  10.206  1.00 42.97  ?  98   TYR C CA  1 
ATOM   9162  C  C   . TYR C  1 98  ? 16.535  12.810  10.700  1.00 43.67  ?  98   TYR C C   1 
ATOM   9163  O  O   . TYR C  1 98  ? 16.840  12.971  11.884  1.00 42.73  ?  98   TYR C O   1 
ATOM   9164  C  CB  . TYR C  1 98  ? 15.086  14.521  9.571   1.00 43.20  ?  98   TYR C CB  1 
ATOM   9165  C  CG  . TYR C  1 98  ? 13.714  14.951  9.106   1.00 44.59  ?  98   TYR C CG  1 
ATOM   9166  C  CD1 . TYR C  1 98  ? 13.251  14.613  7.844   1.00 45.76  ?  98   TYR C CD1 1 
ATOM   9167  C  CD2 . TYR C  1 98  ? 12.886  15.694  9.925   1.00 43.43  ?  98   TYR C CD2 1 
ATOM   9168  C  CE1 . TYR C  1 98  ? 11.999  14.994  7.417   1.00 46.49  ?  98   TYR C CE1 1 
ATOM   9169  C  CE2 . TYR C  1 98  ? 11.636  16.079  9.509   1.00 48.58  ?  98   TYR C CE2 1 
ATOM   9170  C  CZ  . TYR C  1 98  ? 11.196  15.728  8.253   1.00 47.94  ?  98   TYR C CZ  1 
ATOM   9171  O  OH  . TYR C  1 98  ? 9.944   16.113  7.833   1.00 49.43  ?  98   TYR C OH  1 
ATOM   9172  N  N   . LEU C  1 99  ? 17.399  12.407  9.779   1.00 45.10  ?  99   LEU C N   1 
ATOM   9173  C  CA  . LEU C  1 99  ? 18.764  12.072  10.142  1.00 46.62  ?  99   LEU C CA  1 
ATOM   9174  C  C   . LEU C  1 99  ? 19.695  12.650  9.091   1.00 49.07  ?  99   LEU C C   1 
ATOM   9175  O  O   . LEU C  1 99  ? 19.267  13.064  8.012   1.00 52.34  ?  99   LEU C O   1 
ATOM   9176  C  CB  . LEU C  1 99  ? 18.953  10.554  10.299  1.00 46.08  ?  99   LEU C CB  1 
ATOM   9177  C  CG  . LEU C  1 99  ? 18.547  9.599   9.173   1.00 45.22  ?  99   LEU C CG  1 
ATOM   9178  C  CD1 . LEU C  1 99  ? 19.682  9.430   8.180   1.00 45.50  ?  99   LEU C CD1 1 
ATOM   9179  C  CD2 . LEU C  1 99  ? 18.146  8.254   9.742   1.00 44.19  ?  99   LEU C CD2 1 
ATOM   9180  N  N   . ASN C  1 100 ? 20.981  12.676  9.418   1.00 47.94  ?  100  ASN C N   1 
ATOM   9181  C  CA  . ASN C  1 100 ? 21.991  13.280  8.568   1.00 49.35  ?  100  ASN C CA  1 
ATOM   9182  C  C   . ASN C  1 100 ? 23.106  12.272  8.328   1.00 52.50  ?  100  ASN C C   1 
ATOM   9183  O  O   . ASN C  1 100 ? 23.454  11.502  9.229   1.00 55.47  ?  100  ASN C O   1 
ATOM   9184  C  CB  . ASN C  1 100 ? 22.540  14.546  9.221   1.00 49.40  ?  100  ASN C CB  1 
ATOM   9185  C  CG  . ASN C  1 100 ? 21.439  15.465  9.725   1.00 49.82  ?  100  ASN C CG  1 
ATOM   9186  O  OD1 . ASN C  1 100 ? 20.493  15.787  9.002   1.00 49.47  ?  100  ASN C OD1 1 
ATOM   9187  N  ND2 . ASN C  1 100 ? 21.552  15.882  10.981  1.00 50.17  ?  100  ASN C ND2 1 
ATOM   9188  N  N   . VAL C  1 101 ? 23.657  12.267  7.112   1.00 50.59  ?  101  VAL C N   1 
ATOM   9189  C  CA  . VAL C  1 101 ? 24.738  11.358  6.742   1.00 47.30  ?  101  VAL C CA  1 
ATOM   9190  C  C   . VAL C  1 101 ? 25.891  12.172  6.180   1.00 47.28  ?  101  VAL C C   1 
ATOM   9191  O  O   . VAL C  1 101 ? 25.686  13.026  5.313   1.00 50.58  ?  101  VAL C O   1 
ATOM   9192  C  CB  . VAL C  1 101 ? 24.286  10.303  5.716   1.00 47.31  ?  101  VAL C CB  1 
ATOM   9193  C  CG1 . VAL C  1 101 ? 25.409  9.319   5.452   1.00 48.68  ?  101  VAL C CG1 1 
ATOM   9194  C  CG2 . VAL C  1 101 ? 23.046  9.575   6.207   1.00 46.75  ?  101  VAL C CG2 1 
ATOM   9195  N  N   . TRP C  1 102 ? 27.099  11.904  6.671   1.00 47.61  ?  102  TRP C N   1 
ATOM   9196  C  CA  . TRP C  1 102 ? 28.327  12.508  6.170   1.00 51.01  ?  102  TRP C CA  1 
ATOM   9197  C  C   . TRP C  1 102 ? 29.223  11.410  5.620   1.00 52.96  ?  102  TRP C C   1 
ATOM   9198  O  O   . TRP C  1 102 ? 29.465  10.408  6.299   1.00 54.84  ?  102  TRP C O   1 
ATOM   9199  C  CB  . TRP C  1 102 ? 29.076  13.260  7.272   1.00 52.79  ?  102  TRP C CB  1 
ATOM   9200  C  CG  . TRP C  1 102 ? 28.566  14.633  7.572   1.00 53.25  ?  102  TRP C CG  1 
ATOM   9201  C  CD1 . TRP C  1 102 ? 28.875  15.789  6.912   1.00 53.70  ?  102  TRP C CD1 1 
ATOM   9202  C  CD2 . TRP C  1 102 ? 27.681  15.003  8.633   1.00 52.92  ?  102  TRP C CD2 1 
ATOM   9203  N  NE1 . TRP C  1 102 ? 28.226  16.854  7.488   1.00 52.78  ?  102  TRP C NE1 1 
ATOM   9204  C  CE2 . TRP C  1 102 ? 27.486  16.397  8.547   1.00 52.98  ?  102  TRP C CE2 1 
ATOM   9205  C  CE3 . TRP C  1 102 ? 27.027  14.290  9.642   1.00 54.08  ?  102  TRP C CE3 1 
ATOM   9206  C  CZ2 . TRP C  1 102 ? 26.665  17.090  9.430   1.00 54.54  ?  102  TRP C CZ2 1 
ATOM   9207  C  CZ3 . TRP C  1 102 ? 26.212  14.979  10.518  1.00 55.36  ?  102  TRP C CZ3 1 
ATOM   9208  C  CH2 . TRP C  1 102 ? 26.039  16.367  10.407  1.00 55.69  ?  102  TRP C CH2 1 
ATOM   9209  N  N   . THR C  1 103 ? 29.708  11.590  4.400   1.00 54.17  ?  103  THR C N   1 
ATOM   9210  C  CA  . THR C  1 103 ? 30.663  10.675  3.795   1.00 55.60  ?  103  THR C CA  1 
ATOM   9211  C  C   . THR C  1 103 ? 31.745  11.499  3.122   1.00 55.27  ?  103  THR C C   1 
ATOM   9212  O  O   . THR C  1 103 ? 31.537  12.680  2.825   1.00 56.83  ?  103  THR C O   1 
ATOM   9213  C  CB  . THR C  1 103 ? 30.013  9.743   2.760   1.00 57.72  ?  103  THR C CB  1 
ATOM   9214  O  OG1 . THR C  1 103 ? 29.653  10.499  1.597   1.00 60.40  ?  103  THR C OG1 1 
ATOM   9215  C  CG2 . THR C  1 103 ? 28.776  9.061   3.333   1.00 56.38  ?  103  THR C CG2 1 
ATOM   9216  N  N   . PRO C  1 104 ? 32.912  10.911  2.871   1.00 54.98  ?  104  PRO C N   1 
ATOM   9217  C  CA  . PRO C  1 104 ? 33.959  11.640  2.151   1.00 56.83  ?  104  PRO C CA  1 
ATOM   9218  C  C   . PRO C  1 104 ? 33.558  11.929  0.710   1.00 58.37  ?  104  PRO C C   1 
ATOM   9219  O  O   . PRO C  1 104 ? 32.609  11.360  0.165   1.00 58.31  ?  104  PRO C O   1 
ATOM   9220  C  CB  . PRO C  1 104 ? 35.158  10.689  2.212   1.00 57.29  ?  104  PRO C CB  1 
ATOM   9221  C  CG  . PRO C  1 104 ? 34.877  9.801   3.368   1.00 56.31  ?  104  PRO C CG  1 
ATOM   9222  C  CD  . PRO C  1 104 ? 33.400  9.620   3.379   1.00 54.99  ?  104  PRO C CD  1 
ATOM   9223  N  N   . TYR C  1 105 ? 34.287  12.862  0.105   1.00 58.28  ?  105  TYR C N   1 
ATOM   9224  C  CA  . TYR C  1 105 ? 34.089  13.211  -1.296  1.00 58.95  ?  105  TYR C CA  1 
ATOM   9225  C  C   . TYR C  1 105 ? 35.333  12.851  -2.112  1.00 61.00  ?  105  TYR C C   1 
ATOM   9226  O  O   . TYR C  1 105 ? 36.399  13.434  -1.910  1.00 61.82  ?  105  TYR C O   1 
ATOM   9227  C  CB  . TYR C  1 105 ? 33.765  14.700  -1.440  1.00 59.53  ?  105  TYR C CB  1 
ATOM   9228  C  CG  . TYR C  1 105 ? 33.215  15.089  -2.795  1.00 63.29  ?  105  TYR C CG  1 
ATOM   9229  C  CD1 . TYR C  1 105 ? 31.850  15.043  -3.057  1.00 63.65  ?  105  TYR C CD1 1 
ATOM   9230  C  CD2 . TYR C  1 105 ? 34.062  15.522  -3.809  1.00 66.68  ?  105  TYR C CD2 1 
ATOM   9231  C  CE1 . TYR C  1 105 ? 31.348  15.408  -4.298  1.00 66.56  ?  105  TYR C CE1 1 
ATOM   9232  C  CE2 . TYR C  1 105 ? 33.570  15.884  -5.050  1.00 69.40  ?  105  TYR C CE2 1 
ATOM   9233  C  CZ  . TYR C  1 105 ? 32.215  15.827  -5.292  1.00 69.61  ?  105  TYR C CZ  1 
ATOM   9234  O  OH  . TYR C  1 105 ? 31.732  16.187  -6.533  1.00 71.76  ?  105  TYR C OH  1 
ATOM   9235  N  N   . PRO C  1 106 ? 35.200  11.899  -3.052  1.00 62.45  ?  106  PRO C N   1 
ATOM   9236  C  CA  . PRO C  1 106 ? 33.947  11.227  -3.416  1.00 62.88  ?  106  PRO C CA  1 
ATOM   9237  C  C   . PRO C  1 106 ? 33.541  10.134  -2.437  1.00 62.92  ?  106  PRO C C   1 
ATOM   9238  O  O   . PRO C  1 106 ? 34.294  9.842   -1.507  1.00 61.30  ?  106  PRO C O   1 
ATOM   9239  C  CB  . PRO C  1 106 ? 34.274  10.620  -4.775  1.00 63.21  ?  106  PRO C CB  1 
ATOM   9240  C  CG  . PRO C  1 106 ? 35.725  10.311  -4.678  1.00 64.62  ?  106  PRO C CG  1 
ATOM   9241  C  CD  . PRO C  1 106 ? 36.325  11.438  -3.881  1.00 64.10  ?  106  PRO C CD  1 
ATOM   9242  N  N   . ARG C  1 107 ? 32.381  9.525   -2.667  1.00 64.55  ?  107  ARG C N   1 
ATOM   9243  C  CA  . ARG C  1 107 ? 31.873  8.516   -1.752  1.00 65.36  ?  107  ARG C CA  1 
ATOM   9244  C  C   . ARG C  1 107 ? 32.792  7.289   -1.771  1.00 67.83  ?  107  ARG C C   1 
ATOM   9245  O  O   . ARG C  1 107 ? 33.358  6.945   -2.815  1.00 72.00  ?  107  ARG C O   1 
ATOM   9246  C  CB  . ARG C  1 107 ? 30.436  8.129   -2.122  1.00 63.06  ?  107  ARG C CB  1 
ATOM   9247  C  CG  . ARG C  1 107 ? 29.410  9.249   -1.908  1.00 57.92  ?  107  ARG C CG  1 
ATOM   9248  C  CD  . ARG C  1 107 ? 27.970  8.779   -2.118  1.00 56.85  ?  107  ARG C CD  1 
ATOM   9249  N  NE  . ARG C  1 107 ? 27.762  8.065   -3.377  1.00 62.93  ?  107  ARG C NE  1 
ATOM   9250  C  CZ  . ARG C  1 107 ? 27.368  6.796   -3.459  1.00 69.86  ?  107  ARG C CZ  1 
ATOM   9251  N  NH1 . ARG C  1 107 ? 27.150  6.103   -2.350  1.00 73.16  ?  107  ARG C NH1 1 
ATOM   9252  N  NH2 . ARG C  1 107 ? 27.196  6.210   -4.638  1.00 71.91  ?  107  ARG C NH2 1 
ATOM   9253  N  N   . PRO C  1 108 ? 32.960  6.619   -0.626  1.00 64.06  ?  108  PRO C N   1 
ATOM   9254  C  CA  . PRO C  1 108 ? 34.051  5.641   -0.492  1.00 64.22  ?  108  PRO C CA  1 
ATOM   9255  C  C   . PRO C  1 108 ? 33.857  4.427   -1.388  1.00 65.78  ?  108  PRO C C   1 
ATOM   9256  O  O   . PRO C  1 108 ? 32.737  3.951   -1.590  1.00 66.74  ?  108  PRO C O   1 
ATOM   9257  C  CB  . PRO C  1 108 ? 34.004  5.255   0.992   1.00 63.08  ?  108  PRO C CB  1 
ATOM   9258  C  CG  . PRO C  1 108 ? 32.619  5.591   1.434   1.00 60.70  ?  108  PRO C CG  1 
ATOM   9259  C  CD  . PRO C  1 108 ? 32.193  6.774   0.622   1.00 61.01  ?  108  PRO C CD  1 
ATOM   9260  N  N   . ALA C  1 109 ? 34.973  3.916   -1.915  1.00 66.82  ?  109  ALA C N   1 
ATOM   9261  C  CA  . ALA C  1 109 ? 34.890  2.842   -2.901  1.00 68.46  ?  109  ALA C CA  1 
ATOM   9262  C  C   . ALA C  1 109 ? 34.510  1.517   -2.251  1.00 71.94  ?  109  ALA C C   1 
ATOM   9263  O  O   . ALA C  1 109 ? 33.730  0.743   -2.817  1.00 73.47  ?  109  ALA C O   1 
ATOM   9264  C  CB  . ALA C  1 109 ? 36.215  2.715   -3.653  1.00 67.88  ?  109  ALA C CB  1 
ATOM   9265  N  N   . SER C  1 110 ? 35.040  1.246   -1.060  1.00 72.59  ?  110  SER C N   1 
ATOM   9266  C  CA  . SER C  1 110 ? 34.805  0.034   -0.290  1.00 71.47  ?  110  SER C CA  1 
ATOM   9267  C  C   . SER C  1 110 ? 34.092  0.363   1.023   1.00 66.37  ?  110  SER C C   1 
ATOM   9268  O  O   . SER C  1 110 ? 34.176  1.498   1.507   1.00 64.50  ?  110  SER C O   1 
ATOM   9269  C  CB  . SER C  1 110 ? 36.130  -0.688  -0.010  1.00 75.88  ?  110  SER C CB  1 
ATOM   9270  O  OG  . SER C  1 110 ? 37.135  0.212   0.425   1.00 77.93  ?  110  SER C OG  1 
ATOM   9271  N  N   . PRO C  1 111 ? 33.356  -0.588  1.604   1.00 65.42  ?  111  PRO C N   1 
ATOM   9272  C  CA  . PRO C  1 111 ? 32.508  -0.260  2.759   1.00 65.08  ?  111  PRO C CA  1 
ATOM   9273  C  C   . PRO C  1 111 ? 33.319  0.232   3.952   1.00 65.59  ?  111  PRO C C   1 
ATOM   9274  O  O   . PRO C  1 111 ? 34.279  -0.409  4.388   1.00 67.64  ?  111  PRO C O   1 
ATOM   9275  C  CB  . PRO C  1 111 ? 31.793  -1.585  3.059   1.00 63.88  ?  111  PRO C CB  1 
ATOM   9276  C  CG  . PRO C  1 111 ? 32.653  -2.627  2.451   1.00 65.61  ?  111  PRO C CG  1 
ATOM   9277  C  CD  . PRO C  1 111 ? 33.217  -1.999  1.216   1.00 66.40  ?  111  PRO C CD  1 
ATOM   9278  N  N   . THR C  1 112 ? 32.904  1.391   4.484   1.00 62.95  ?  112  THR C N   1 
ATOM   9279  C  CA  . THR C  1 112 ? 33.515  2.191   5.539   1.00 61.68  ?  112  THR C CA  1 
ATOM   9280  C  C   . THR C  1 112 ? 32.783  1.992   6.861   1.00 61.48  ?  112  THR C C   1 
ATOM   9281  O  O   . THR C  1 112 ? 31.543  2.020   6.882   1.00 62.02  ?  112  THR C O   1 
ATOM   9282  C  CB  . THR C  1 112 ? 33.504  3.668   5.149   1.00 59.30  ?  112  THR C CB  1 
ATOM   9283  O  OG1 . THR C  1 112 ? 34.494  3.898   4.136   1.00 60.96  ?  112  THR C OG1 1 
ATOM   9284  C  CG2 . THR C  1 112 ? 33.819  4.542   6.345   1.00 55.32  ?  112  THR C CG2 1 
ATOM   9285  N  N   . PRO C  1 113 ? 33.496  1.739   7.963   1.00 58.42  ?  113  PRO C N   1 
ATOM   9286  C  CA  . PRO C  1 113 ? 32.832  1.660   9.271   1.00 55.18  ?  113  PRO C CA  1 
ATOM   9287  C  C   . PRO C  1 113 ? 32.023  2.912   9.587   1.00 52.70  ?  113  PRO C C   1 
ATOM   9288  O  O   . PRO C  1 113 ? 32.480  4.040   9.393   1.00 52.51  ?  113  PRO C O   1 
ATOM   9289  C  CB  . PRO C  1 113 ? 33.999  1.490   10.250  1.00 55.40  ?  113  PRO C CB  1 
ATOM   9290  C  CG  . PRO C  1 113 ? 35.103  0.933   9.435   1.00 57.36  ?  113  PRO C CG  1 
ATOM   9291  C  CD  . PRO C  1 113 ? 34.948  1.511   8.064   1.00 58.90  ?  113  PRO C CD  1 
ATOM   9292  N  N   . VAL C  1 114 ? 30.815  2.691   10.112  1.00 53.15  ?  114  VAL C N   1 
ATOM   9293  C  CA  . VAL C  1 114 ? 29.827  3.738   10.351  1.00 50.35  ?  114  VAL C CA  1 
ATOM   9294  C  C   . VAL C  1 114 ? 29.879  4.170   11.809  1.00 50.16  ?  114  VAL C C   1 
ATOM   9295  O  O   . VAL C  1 114 ? 30.029  3.338   12.712  1.00 52.11  ?  114  VAL C O   1 
ATOM   9296  C  CB  . VAL C  1 114 ? 28.416  3.248   9.971   1.00 49.76  ?  114  VAL C CB  1 
ATOM   9297  C  CG1 . VAL C  1 114 ? 27.402  4.375   10.085  1.00 48.47  ?  114  VAL C CG1 1 
ATOM   9298  C  CG2 . VAL C  1 114 ? 28.419  2.676   8.564   1.00 50.94  ?  114  VAL C CG2 1 
ATOM   9299  N  N   . LEU C  1 115 ? 29.770  5.480   12.034  1.00 49.09  ?  115  LEU C N   1 
ATOM   9300  C  CA  . LEU C  1 115 ? 29.651  6.082   13.355  1.00 48.22  ?  115  LEU C CA  1 
ATOM   9301  C  C   . LEU C  1 115 ? 28.298  6.767   13.464  1.00 47.49  ?  115  LEU C C   1 
ATOM   9302  O  O   . LEU C  1 115 ? 27.971  7.624   12.637  1.00 46.33  ?  115  LEU C O   1 
ATOM   9303  C  CB  . LEU C  1 115 ? 30.760  7.109   13.601  1.00 47.56  ?  115  LEU C CB  1 
ATOM   9304  C  CG  . LEU C  1 115 ? 32.107  6.610   14.105  1.00 48.58  ?  115  LEU C CG  1 
ATOM   9305  C  CD1 . LEU C  1 115 ? 33.112  7.742   14.101  1.00 48.93  ?  115  LEU C CD1 1 
ATOM   9306  C  CD2 . LEU C  1 115 ? 31.943  6.069   15.499  1.00 49.08  ?  115  LEU C CD2 1 
ATOM   9307  N  N   . ILE C  1 116 ? 27.521  6.400   14.480  1.00 45.49  ?  116  ILE C N   1 
ATOM   9308  C  CA  . ILE C  1 116 ? 26.206  6.986   14.722  1.00 44.49  ?  116  ILE C CA  1 
ATOM   9309  C  C   . ILE C  1 116 ? 26.267  7.774   16.022  1.00 45.22  ?  116  ILE C C   1 
ATOM   9310  O  O   . ILE C  1 116 ? 26.581  7.216   17.081  1.00 47.19  ?  116  ILE C O   1 
ATOM   9311  C  CB  . ILE C  1 116 ? 25.104  5.920   14.782  1.00 44.46  ?  116  ILE C CB  1 
ATOM   9312  C  CG1 . ILE C  1 116 ? 25.091  5.085   13.507  1.00 45.36  ?  116  ILE C CG1 1 
ATOM   9313  C  CG2 . ILE C  1 116 ? 23.752  6.573   14.965  1.00 43.60  ?  116  ILE C CG2 1 
ATOM   9314  C  CD1 . ILE C  1 116 ? 23.930  4.128   13.439  1.00 45.46  ?  116  ILE C CD1 1 
ATOM   9315  N  N   . TRP C  1 117 ? 25.956  9.066   15.942  1.00 46.88  ?  117  TRP C N   1 
ATOM   9316  C  CA  . TRP C  1 117 ? 25.989  9.968   17.086  1.00 42.93  ?  117  TRP C CA  1 
ATOM   9317  C  C   . TRP C  1 117 ? 24.578  10.168  17.623  1.00 43.13  ?  117  TRP C C   1 
ATOM   9318  O  O   . TRP C  1 117 ? 23.649  10.427  16.851  1.00 43.61  ?  117  TRP C O   1 
ATOM   9319  C  CB  . TRP C  1 117 ? 26.598  11.316  16.699  1.00 42.71  ?  117  TRP C CB  1 
ATOM   9320  C  CG  . TRP C  1 117 ? 26.429  12.372  17.750  1.00 47.77  ?  117  TRP C CG  1 
ATOM   9321  C  CD1 . TRP C  1 117 ? 25.516  13.390  17.760  1.00 46.72  ?  117  TRP C CD1 1 
ATOM   9322  C  CD2 . TRP C  1 117 ? 27.194  12.512  18.952  1.00 49.44  ?  117  TRP C CD2 1 
ATOM   9323  N  NE1 . TRP C  1 117 ? 25.668  14.153  18.894  1.00 44.24  ?  117  TRP C NE1 1 
ATOM   9324  C  CE2 . TRP C  1 117 ? 26.692  13.633  19.640  1.00 47.77  ?  117  TRP C CE2 1 
ATOM   9325  C  CE3 . TRP C  1 117 ? 28.254  11.795  19.515  1.00 51.60  ?  117  TRP C CE3 1 
ATOM   9326  C  CZ2 . TRP C  1 117 ? 27.217  14.052  20.858  1.00 51.14  ?  117  TRP C CZ2 1 
ATOM   9327  C  CZ3 . TRP C  1 117 ? 28.773  12.213  20.723  1.00 52.34  ?  117  TRP C CZ3 1 
ATOM   9328  C  CH2 . TRP C  1 117 ? 28.256  13.330  21.381  1.00 52.98  ?  117  TRP C CH2 1 
ATOM   9329  N  N   . ILE C  1 118 ? 24.421  10.039  18.941  1.00 43.87  ?  118  ILE C N   1 
ATOM   9330  C  CA  . ILE C  1 118 ? 23.153  10.281  19.627  1.00 44.55  ?  118  ILE C CA  1 
ATOM   9331  C  C   . ILE C  1 118 ? 23.373  11.448  20.579  1.00 47.01  ?  118  ILE C C   1 
ATOM   9332  O  O   . ILE C  1 118 ? 24.120  11.324  21.557  1.00 49.64  ?  118  ILE C O   1 
ATOM   9333  C  CB  . ILE C  1 118 ? 22.659  9.042   20.383  1.00 43.16  ?  118  ILE C CB  1 
ATOM   9334  C  CG1 . ILE C  1 118 ? 22.549  7.847   19.435  1.00 43.74  ?  118  ILE C CG1 1 
ATOM   9335  C  CG2 . ILE C  1 118 ? 21.319  9.323   21.026  1.00 40.55  ?  118  ILE C CG2 1 
ATOM   9336  C  CD1 . ILE C  1 118 ? 22.092  6.572   20.113  1.00 44.14  ?  118  ILE C CD1 1 
ATOM   9337  N  N   . TYR C  1 119 ? 22.727  12.577  20.303  1.00 47.99  ?  119  TYR C N   1 
ATOM   9338  C  CA  . TYR C  1 119 ? 23.019  13.800  21.037  1.00 48.62  ?  119  TYR C CA  1 
ATOM   9339  C  C   . TYR C  1 119 ? 22.438  13.753  22.451  1.00 48.73  ?  119  TYR C C   1 
ATOM   9340  O  O   . TYR C  1 119 ? 21.515  12.990  22.752  1.00 48.43  ?  119  TYR C O   1 
ATOM   9341  C  CB  . TYR C  1 119 ? 22.489  15.023  20.279  1.00 48.57  ?  119  TYR C CB  1 
ATOM   9342  C  CG  . TYR C  1 119 ? 21.000  15.011  20.003  1.00 48.08  ?  119  TYR C CG  1 
ATOM   9343  C  CD1 . TYR C  1 119 ? 20.086  15.378  20.983  1.00 47.26  ?  119  TYR C CD1 1 
ATOM   9344  C  CD2 . TYR C  1 119 ? 20.508  14.659  18.751  1.00 48.62  ?  119  TYR C CD2 1 
ATOM   9345  C  CE1 . TYR C  1 119 ? 18.727  15.375  20.733  1.00 47.18  ?  119  TYR C CE1 1 
ATOM   9346  C  CE2 . TYR C  1 119 ? 19.146  14.655  18.489  1.00 48.17  ?  119  TYR C CE2 1 
ATOM   9347  C  CZ  . TYR C  1 119 ? 18.261  15.014  19.484  1.00 46.16  ?  119  TYR C CZ  1 
ATOM   9348  O  OH  . TYR C  1 119 ? 16.907  15.013  19.234  1.00 42.93  ?  119  TYR C OH  1 
ATOM   9349  N  N   . GLY C  1 120 ? 22.996  14.588  23.319  1.00 50.49  ?  120  GLY C N   1 
ATOM   9350  C  CA  . GLY C  1 120 ? 22.594  14.709  24.705  1.00 53.58  ?  120  GLY C CA  1 
ATOM   9351  C  C   . GLY C  1 120 ? 21.622  15.845  24.945  1.00 57.23  ?  120  GLY C C   1 
ATOM   9352  O  O   . GLY C  1 120 ? 20.834  16.219  24.068  1.00 60.05  ?  120  GLY C O   1 
ATOM   9353  N  N   . GLY C  1 121 ? 21.701  16.434  26.133  1.00 57.23  ?  121  GLY C N   1 
ATOM   9354  C  CA  . GLY C  1 121 ? 20.697  17.373  26.575  1.00 55.79  ?  121  GLY C CA  1 
ATOM   9355  C  C   . GLY C  1 121 ? 19.696  16.872  27.596  1.00 54.73  ?  121  GLY C C   1 
ATOM   9356  O  O   . GLY C  1 121 ? 18.638  17.491  27.737  1.00 55.36  ?  121  GLY C O   1 
ATOM   9357  N  N   . GLY C  1 122 ? 19.959  15.750  28.267  1.00 53.44  ?  122  GLY C N   1 
ATOM   9358  C  CA  . GLY C  1 122 ? 19.126  15.359  29.394  1.00 52.21  ?  122  GLY C CA  1 
ATOM   9359  C  C   . GLY C  1 122 ? 17.738  14.896  29.021  1.00 51.72  ?  122  GLY C C   1 
ATOM   9360  O  O   . GLY C  1 122 ? 16.824  14.955  29.847  1.00 54.29  ?  122  GLY C O   1 
ATOM   9361  N  N   . PHE C  1 123 ? 17.562  14.470  27.778  1.00 48.25  ?  123  PHE C N   1 
ATOM   9362  C  CA  . PHE C  1 123 ? 16.316  14.051  27.147  1.00 46.09  ?  123  PHE C CA  1 
ATOM   9363  C  C   . PHE C  1 123 ? 15.246  15.135  27.164  1.00 49.36  ?  123  PHE C C   1 
ATOM   9364  O  O   . PHE C  1 123 ? 14.077  14.835  26.892  1.00 51.09  ?  123  PHE C O   1 
ATOM   9365  C  CB  . PHE C  1 123 ? 15.711  12.810  27.836  1.00 42.43  ?  123  PHE C CB  1 
ATOM   9366  C  CG  . PHE C  1 123 ? 16.618  11.603  27.910  1.00 41.31  ?  123  PHE C CG  1 
ATOM   9367  C  CD1 . PHE C  1 123 ? 16.774  10.758  26.825  1.00 41.05  ?  123  PHE C CD1 1 
ATOM   9368  C  CD2 . PHE C  1 123 ? 17.250  11.270  29.100  1.00 41.46  ?  123  PHE C CD2 1 
ATOM   9369  C  CE1 . PHE C  1 123 ? 17.584  9.629   26.912  1.00 41.11  ?  123  PHE C CE1 1 
ATOM   9370  C  CE2 . PHE C  1 123 ? 18.060  10.144  29.189  1.00 41.07  ?  123  PHE C CE2 1 
ATOM   9371  C  CZ  . PHE C  1 123 ? 18.227  9.325   28.095  1.00 40.34  ?  123  PHE C CZ  1 
ATOM   9372  N  N   . TYR C  1 124 ? 15.590  16.390  27.464  1.00 50.18  ?  124  TYR C N   1 
ATOM   9373  C  CA  . TYR C  1 124 ? 14.668  17.498  27.252  1.00 50.07  ?  124  TYR C CA  1 
ATOM   9374  C  C   . TYR C  1 124 ? 15.015  18.389  26.064  1.00 51.24  ?  124  TYR C C   1 
ATOM   9375  O  O   . TYR C  1 124 ? 14.254  19.320  25.776  1.00 51.84  ?  124  TYR C O   1 
ATOM   9376  C  CB  . TYR C  1 124 ? 14.511  18.331  28.535  1.00 48.98  ?  124  TYR C CB  1 
ATOM   9377  C  CG  . TYR C  1 124 ? 15.641  19.268  28.859  1.00 48.57  ?  124  TYR C CG  1 
ATOM   9378  C  CD1 . TYR C  1 124 ? 16.727  18.844  29.605  1.00 47.31  ?  124  TYR C CD1 1 
ATOM   9379  C  CD2 . TYR C  1 124 ? 15.615  20.586  28.427  1.00 49.59  ?  124  TYR C CD2 1 
ATOM   9380  C  CE1 . TYR C  1 124 ? 17.758  19.703  29.907  1.00 47.58  ?  124  TYR C CE1 1 
ATOM   9381  C  CE2 . TYR C  1 124 ? 16.639  21.448  28.720  1.00 50.12  ?  124  TYR C CE2 1 
ATOM   9382  C  CZ  . TYR C  1 124 ? 17.708  21.004  29.459  1.00 49.68  ?  124  TYR C CZ  1 
ATOM   9383  O  OH  . TYR C  1 124 ? 18.729  21.878  29.746  1.00 51.85  ?  124  TYR C OH  1 
ATOM   9384  N  N   . SER C  1 125 ? 16.128  18.149  25.372  1.00 51.93  ?  125  SER C N   1 
ATOM   9385  C  CA  . SER C  1 125 ? 16.654  19.141  24.439  1.00 52.09  ?  125  SER C CA  1 
ATOM   9386  C  C   . SER C  1 125 ? 17.609  18.470  23.460  1.00 55.44  ?  125  SER C C   1 
ATOM   9387  O  O   . SER C  1 125 ? 17.772  17.247  23.450  1.00 57.89  ?  125  SER C O   1 
ATOM   9388  C  CB  . SER C  1 125 ? 17.358  20.278  25.186  1.00 50.06  ?  125  SER C CB  1 
ATOM   9389  O  OG  . SER C  1 125 ? 18.552  19.822  25.800  1.00 50.50  ?  125  SER C OG  1 
ATOM   9390  N  N   . GLY C  1 126 ? 18.242  19.294  22.630  1.00 56.69  ?  126  GLY C N   1 
ATOM   9391  C  CA  . GLY C  1 126 ? 19.270  18.856  21.709  1.00 56.50  ?  126  GLY C CA  1 
ATOM   9392  C  C   . GLY C  1 126 ? 18.757  18.714  20.284  1.00 54.98  ?  126  GLY C C   1 
ATOM   9393  O  O   . GLY C  1 126 ? 17.567  18.849  19.991  1.00 55.67  ?  126  GLY C O   1 
ATOM   9394  N  N   . ALA C  1 127 ? 19.697  18.422  19.387  1.00 52.22  ?  127  ALA C N   1 
ATOM   9395  C  CA  . ALA C  1 127 ? 19.434  18.170  17.976  1.00 50.61  ?  127  ALA C CA  1 
ATOM   9396  C  C   . ALA C  1 127 ? 20.761  17.842  17.310  1.00 51.45  ?  127  ALA C C   1 
ATOM   9397  O  O   . ALA C  1 127 ? 21.830  18.162  17.835  1.00 52.02  ?  127  ALA C O   1 
ATOM   9398  C  CB  . ALA C  1 127 ? 18.781  19.369  17.283  1.00 49.00  ?  127  ALA C CB  1 
ATOM   9399  N  N   . ALA C  1 128 ? 20.678  17.222  16.133  1.00 50.62  ?  128  ALA C N   1 
ATOM   9400  C  CA  . ALA C  1 128 ? 21.875  16.840  15.397  1.00 49.22  ?  128  ALA C CA  1 
ATOM   9401  C  C   . ALA C  1 128 ? 22.434  17.973  14.548  1.00 48.80  ?  128  ALA C C   1 
ATOM   9402  O  O   . ALA C  1 128 ? 23.561  17.861  14.053  1.00 48.42  ?  128  ALA C O   1 
ATOM   9403  C  CB  . ALA C  1 128 ? 21.580  15.631  14.510  1.00 49.14  ?  128  ALA C CB  1 
ATOM   9404  N  N   . SER C  1 129 ? 21.683  19.058  14.378  1.00 48.49  ?  129  SER C N   1 
ATOM   9405  C  CA  . SER C  1 129 ? 22.115  20.182  13.559  1.00 48.18  ?  129  SER C CA  1 
ATOM   9406  C  C   . SER C  1 129 ? 23.061  21.120  14.294  1.00 47.25  ?  129  SER C C   1 
ATOM   9407  O  O   . SER C  1 129 ? 23.576  22.055  13.672  1.00 48.39  ?  129  SER C O   1 
ATOM   9408  C  CB  . SER C  1 129 ? 20.898  20.961  13.052  1.00 48.48  ?  129  SER C CB  1 
ATOM   9409  O  OG  . SER C  1 129 ? 19.888  21.044  14.044  1.00 48.29  ?  129  SER C OG  1 
ATOM   9410  N  N   . LEU C  1 130 ? 23.310  20.893  15.583  1.00 45.81  ?  130  LEU C N   1 
ATOM   9411  C  CA  . LEU C  1 130 ? 24.205  21.762  16.336  1.00 46.71  ?  130  LEU C CA  1 
ATOM   9412  C  C   . LEU C  1 130 ? 25.606  21.741  15.736  1.00 48.31  ?  130  LEU C C   1 
ATOM   9413  O  O   . LEU C  1 130 ? 26.044  20.746  15.151  1.00 49.30  ?  130  LEU C O   1 
ATOM   9414  C  CB  . LEU C  1 130 ? 24.267  21.341  17.807  1.00 45.81  ?  130  LEU C CB  1 
ATOM   9415  C  CG  . LEU C  1 130 ? 22.993  21.407  18.654  1.00 43.83  ?  130  LEU C CG  1 
ATOM   9416  C  CD1 . LEU C  1 130 ? 23.338  21.205  20.119  1.00 43.10  ?  130  LEU C CD1 1 
ATOM   9417  C  CD2 . LEU C  1 130 ? 22.248  22.716  18.454  1.00 44.12  ?  130  LEU C CD2 1 
ATOM   9418  N  N   . ASP C  1 131 ? 26.311  22.866  15.885  1.00 48.89  ?  131  ASP C N   1 
ATOM   9419  C  CA  . ASP C  1 131 ? 27.631  23.007  15.278  1.00 49.70  ?  131  ASP C CA  1 
ATOM   9420  C  C   . ASP C  1 131 ? 28.643  22.034  15.868  1.00 52.13  ?  131  ASP C C   1 
ATOM   9421  O  O   . ASP C  1 131 ? 29.546  21.580  15.155  1.00 53.76  ?  131  ASP C O   1 
ATOM   9422  C  CB  . ASP C  1 131 ? 28.129  24.442  15.435  1.00 48.96  ?  131  ASP C CB  1 
ATOM   9423  C  CG  . ASP C  1 131 ? 27.382  25.418  14.554  1.00 49.30  ?  131  ASP C CG  1 
ATOM   9424  O  OD1 . ASP C  1 131 ? 26.361  25.020  13.950  1.00 47.94  ?  131  ASP C OD1 1 
ATOM   9425  O  OD2 . ASP C  1 131 ? 27.807  26.590  14.483  1.00 49.52  ?  131  ASP C OD2 1 
ATOM   9426  N  N   . VAL C  1 132 ? 28.517  21.702  17.155  1.00 53.00  ?  132  VAL C N   1 
ATOM   9427  C  CA  . VAL C  1 132 ? 29.486  20.807  17.777  1.00 53.69  ?  132  VAL C CA  1 
ATOM   9428  C  C   . VAL C  1 132 ? 29.341  19.379  17.277  1.00 51.85  ?  132  VAL C C   1 
ATOM   9429  O  O   . VAL C  1 132 ? 30.263  18.574  17.445  1.00 53.53  ?  132  VAL C O   1 
ATOM   9430  C  CB  . VAL C  1 132 ? 29.365  20.860  19.308  1.00 56.51  ?  132  VAL C CB  1 
ATOM   9431  C  CG1 . VAL C  1 132 ? 29.839  22.204  19.825  1.00 58.76  ?  132  VAL C CG1 1 
ATOM   9432  C  CG2 . VAL C  1 132 ? 27.924  20.618  19.726  1.00 56.02  ?  132  VAL C CG2 1 
ATOM   9433  N  N   . TYR C  1 133 ? 28.203  19.036  16.677  1.00 49.96  ?  133  TYR C N   1 
ATOM   9434  C  CA  . TYR C  1 133 ? 27.959  17.696  16.158  1.00 49.70  ?  133  TYR C CA  1 
ATOM   9435  C  C   . TYR C  1 133 ? 28.265  17.582  14.666  1.00 49.89  ?  133  TYR C C   1 
ATOM   9436  O  O   . TYR C  1 133 ? 27.991  16.536  14.067  1.00 49.13  ?  133  TYR C O   1 
ATOM   9437  C  CB  . TYR C  1 133 ? 26.511  17.284  16.434  1.00 48.67  ?  133  TYR C CB  1 
ATOM   9438  C  CG  . TYR C  1 133 ? 26.118  17.397  17.887  1.00 47.12  ?  133  TYR C CG  1 
ATOM   9439  C  CD1 . TYR C  1 133 ? 27.047  17.230  18.908  1.00 46.64  ?  133  TYR C CD1 1 
ATOM   9440  C  CD2 . TYR C  1 133 ? 24.815  17.704  18.237  1.00 46.69  ?  133  TYR C CD2 1 
ATOM   9441  C  CE1 . TYR C  1 133 ? 26.675  17.359  20.240  1.00 45.15  ?  133  TYR C CE1 1 
ATOM   9442  C  CE2 . TYR C  1 133 ? 24.435  17.833  19.559  1.00 45.52  ?  133  TYR C CE2 1 
ATOM   9443  C  CZ  . TYR C  1 133 ? 25.364  17.661  20.556  1.00 43.60  ?  133  TYR C CZ  1 
ATOM   9444  O  OH  . TYR C  1 133 ? 24.964  17.794  21.863  1.00 41.61  ?  133  TYR C OH  1 
ATOM   9445  N  N   . ASP C  1 134 ? 28.790  18.643  14.052  1.00 51.59  ?  134  ASP C N   1 
ATOM   9446  C  CA  . ASP C  1 134 ? 29.080  18.645  12.622  1.00 55.17  ?  134  ASP C CA  1 
ATOM   9447  C  C   . ASP C  1 134 ? 30.077  17.546  12.273  1.00 54.25  ?  134  ASP C C   1 
ATOM   9448  O  O   . ASP C  1 134 ? 31.190  17.507  12.806  1.00 54.67  ?  134  ASP C O   1 
ATOM   9449  C  CB  . ASP C  1 134 ? 29.625  20.020  12.222  1.00 60.70  ?  134  ASP C CB  1 
ATOM   9450  C  CG  . ASP C  1 134 ? 29.739  20.205  10.721  1.00 66.83  ?  134  ASP C CG  1 
ATOM   9451  O  OD1 . ASP C  1 134 ? 29.526  19.238  9.959   1.00 69.36  ?  134  ASP C OD1 1 
ATOM   9452  O  OD2 . ASP C  1 134 ? 30.025  21.344  10.299  1.00 69.59  ?  134  ASP C OD2 1 
ATOM   9453  N  N   . GLY C  1 135 ? 29.692  16.681  11.345  1.00 53.33  ?  135  GLY C N   1 
ATOM   9454  C  CA  . GLY C  1 135 ? 30.467  15.500  11.049  1.00 51.94  ?  135  GLY C CA  1 
ATOM   9455  C  C   . GLY C  1 135 ? 31.444  15.630  9.906   1.00 53.18  ?  135  GLY C C   1 
ATOM   9456  O  O   . GLY C  1 135 ? 32.060  14.631  9.523   1.00 53.34  ?  135  GLY C O   1 
ATOM   9457  N  N   . ARG C  1 136 ? 31.614  16.834  9.353   1.00 55.34  ?  136  ARG C N   1 
ATOM   9458  C  CA  . ARG C  1 136 ? 32.453  17.003  8.169   1.00 57.42  ?  136  ARG C CA  1 
ATOM   9459  C  C   . ARG C  1 136 ? 33.919  16.702  8.459   1.00 60.40  ?  136  ARG C C   1 
ATOM   9460  O  O   . ARG C  1 136 ? 34.634  16.213  7.575   1.00 65.77  ?  136  ARG C O   1 
ATOM   9461  C  CB  . ARG C  1 136 ? 32.290  18.421  7.614   1.00 56.39  ?  136  ARG C CB  1 
ATOM   9462  C  CG  . ARG C  1 136 ? 33.183  19.472  8.267   1.00 56.89  ?  136  ARG C CG  1 
ATOM   9463  C  CD  . ARG C  1 136 ? 32.468  20.810  8.373   1.00 56.99  ?  136  ARG C CD  1 
ATOM   9464  N  NE  . ARG C  1 136 ? 32.191  21.430  7.084   1.00 57.78  ?  136  ARG C NE  1 
ATOM   9465  C  CZ  . ARG C  1 136 ? 31.201  22.290  6.875   1.00 58.80  ?  136  ARG C CZ  1 
ATOM   9466  N  NH1 . ARG C  1 136 ? 30.376  22.599  7.862   1.00 57.51  ?  136  ARG C NH1 1 
ATOM   9467  N  NH2 . ARG C  1 136 ? 31.022  22.824  5.676   1.00 61.91  ?  136  ARG C NH2 1 
ATOM   9468  N  N   . PHE C  1 137 ? 34.382  16.962  9.684   1.00 56.92  ?  137  PHE C N   1 
ATOM   9469  C  CA  . PHE C  1 137 ? 35.800  16.781  9.977   1.00 55.61  ?  137  PHE C CA  1 
ATOM   9470  C  C   . PHE C  1 137 ? 36.144  15.305  10.111  1.00 54.71  ?  137  PHE C C   1 
ATOM   9471  O  O   . PHE C  1 137 ? 37.174  14.852  9.600   1.00 55.73  ?  137  PHE C O   1 
ATOM   9472  C  CB  . PHE C  1 137 ? 36.182  17.547  11.242  1.00 56.24  ?  137  PHE C CB  1 
ATOM   9473  C  CG  . PHE C  1 137 ? 35.702  18.972  11.257  1.00 56.60  ?  137  PHE C CG  1 
ATOM   9474  C  CD1 . PHE C  1 137 ? 36.417  19.968  10.610  1.00 57.74  ?  137  PHE C CD1 1 
ATOM   9475  C  CD2 . PHE C  1 137 ? 34.536  19.316  11.922  1.00 55.22  ?  137  PHE C CD2 1 
ATOM   9476  C  CE1 . PHE C  1 137 ? 35.974  21.279  10.625  1.00 57.75  ?  137  PHE C CE1 1 
ATOM   9477  C  CE2 . PHE C  1 137 ? 34.088  20.623  11.941  1.00 54.82  ?  137  PHE C CE2 1 
ATOM   9478  C  CZ  . PHE C  1 137 ? 34.809  21.606  11.292  1.00 56.48  ?  137  PHE C CZ  1 
ATOM   9479  N  N   . LEU C  1 138 ? 35.294  14.539  10.799  1.00 53.44  ?  138  LEU C N   1 
ATOM   9480  C  CA  . LEU C  1 138 ? 35.519  13.101  10.895  1.00 53.57  ?  138  LEU C CA  1 
ATOM   9481  C  C   . LEU C  1 138 ? 35.372  12.424  9.538   1.00 55.29  ?  138  LEU C C   1 
ATOM   9482  O  O   . LEU C  1 138 ? 36.017  11.400  9.279   1.00 56.88  ?  138  LEU C O   1 
ATOM   9483  C  CB  . LEU C  1 138 ? 34.559  12.484  11.911  1.00 50.24  ?  138  LEU C CB  1 
ATOM   9484  C  CG  . LEU C  1 138 ? 34.900  12.750  13.374  1.00 49.83  ?  138  LEU C CG  1 
ATOM   9485  C  CD1 . LEU C  1 138 ? 33.670  12.598  14.234  1.00 48.08  ?  138  LEU C CD1 1 
ATOM   9486  C  CD2 . LEU C  1 138 ? 35.979  11.793  13.834  1.00 51.41  ?  138  LEU C CD2 1 
ATOM   9487  N  N   . ALA C  1 139 ? 34.539  12.984  8.657   1.00 53.98  ?  139  ALA C N   1 
ATOM   9488  C  CA  . ALA C  1 139 ? 34.375  12.406  7.328   1.00 54.11  ?  139  ALA C CA  1 
ATOM   9489  C  C   . ALA C  1 139 ? 35.594  12.687  6.458   1.00 55.68  ?  139  ALA C C   1 
ATOM   9490  O  O   . ALA C  1 139 ? 36.118  11.786  5.793   1.00 57.33  ?  139  ALA C O   1 
ATOM   9491  C  CB  . ALA C  1 139 ? 33.102  12.944  6.677   1.00 51.59  ?  139  ALA C CB  1 
ATOM   9492  N  N   . GLN C  1 140 ? 36.065  13.934  6.455   1.00 55.16  ?  140  GLN C N   1 
ATOM   9493  C  CA  . GLN C  1 140 ? 37.202  14.288  5.612   1.00 56.16  ?  140  GLN C CA  1 
ATOM   9494  C  C   . GLN C  1 140 ? 38.495  13.666  6.128   1.00 57.28  ?  140  GLN C C   1 
ATOM   9495  O  O   . GLN C  1 140 ? 39.203  12.973  5.385   1.00 58.72  ?  140  GLN C O   1 
ATOM   9496  C  CB  . GLN C  1 140 ? 37.333  15.808  5.538   1.00 56.31  ?  140  GLN C CB  1 
ATOM   9497  C  CG  . GLN C  1 140 ? 38.172  16.309  4.377   1.00 58.86  ?  140  GLN C CG  1 
ATOM   9498  C  CD  . GLN C  1 140 ? 39.652  16.364  4.698   1.00 60.21  ?  140  GLN C CD  1 
ATOM   9499  O  OE1 . GLN C  1 140 ? 40.480  15.856  3.941   1.00 61.19  ?  140  GLN C OE1 1 
ATOM   9500  N  NE2 . GLN C  1 140 ? 39.993  16.978  5.828   1.00 59.81  ?  140  GLN C NE2 1 
ATOM   9501  N  N   . VAL C  1 141 ? 38.821  13.908  7.401   1.00 56.76  ?  141  VAL C N   1 
ATOM   9502  C  CA  . VAL C  1 141 ? 40.144  13.563  7.918   1.00 58.34  ?  141  VAL C CA  1 
ATOM   9503  C  C   . VAL C  1 141 ? 40.291  12.054  8.087   1.00 60.05  ?  141  VAL C C   1 
ATOM   9504  O  O   . VAL C  1 141 ? 41.255  11.449  7.604   1.00 59.97  ?  141  VAL C O   1 
ATOM   9505  C  CB  . VAL C  1 141 ? 40.404  14.302  9.243   1.00 57.47  ?  141  VAL C CB  1 
ATOM   9506  C  CG1 . VAL C  1 141 ? 41.706  13.829  9.869   1.00 58.79  ?  141  VAL C CG1 1 
ATOM   9507  C  CG2 . VAL C  1 141 ? 40.422  15.801  9.019   1.00 57.58  ?  141  VAL C CG2 1 
ATOM   9508  N  N   . GLU C  1 142 ? 39.357  11.432  8.805   1.00 59.84  ?  142  GLU C N   1 
ATOM   9509  C  CA  . GLU C  1 142 ? 39.424  10.016  9.142   1.00 61.09  ?  142  GLU C CA  1 
ATOM   9510  C  C   . GLU C  1 142 ? 38.619  9.120   8.207   1.00 62.74  ?  142  GLU C C   1 
ATOM   9511  O  O   . GLU C  1 142 ? 38.524  7.913   8.463   1.00 57.15  ?  142  GLU C O   1 
ATOM   9512  C  CB  . GLU C  1 142 ? 38.977  9.807   10.589  1.00 58.85  ?  142  GLU C CB  1 
ATOM   9513  C  CG  . GLU C  1 142 ? 40.017  10.266  11.585  1.00 58.24  ?  142  GLU C CG  1 
ATOM   9514  C  CD  . GLU C  1 142 ? 41.337  9.541   11.406  1.00 61.01  ?  142  GLU C CD  1 
ATOM   9515  O  OE1 . GLU C  1 142 ? 41.319  8.338   11.060  1.00 60.94  ?  142  GLU C OE1 1 
ATOM   9516  O  OE2 . GLU C  1 142 ? 42.394  10.176  11.597  1.00 63.81  ?  142  GLU C OE2 1 
ATOM   9517  N  N   . GLY C  1 143 ? 38.010  9.680   7.161   1.00 62.81  ?  143  GLY C N   1 
ATOM   9518  C  CA  . GLY C  1 143 ? 37.302  8.893   6.167   1.00 61.99  ?  143  GLY C CA  1 
ATOM   9519  C  C   . GLY C  1 143 ? 36.045  8.201   6.642   1.00 59.48  ?  143  GLY C C   1 
ATOM   9520  O  O   . GLY C  1 143 ? 35.529  7.339   5.926   1.00 58.03  ?  143  GLY C O   1 
ATOM   9521  N  N   . ALA C  1 144 ? 35.531  8.552   7.821   1.00 58.91  ?  144  ALA C N   1 
ATOM   9522  C  CA  . ALA C  1 144 ? 34.391  7.865   8.407   1.00 56.76  ?  144  ALA C CA  1 
ATOM   9523  C  C   . ALA C  1 144 ? 33.086  8.272   7.727   1.00 56.07  ?  144  ALA C C   1 
ATOM   9524  O  O   . ALA C  1 144 ? 32.979  9.328   7.099   1.00 56.83  ?  144  ALA C O   1 
ATOM   9525  C  CB  . ALA C  1 144 ? 34.303  8.150   9.907   1.00 51.86  ?  144  ALA C CB  1 
ATOM   9526  N  N   . VAL C  1 145 ? 32.093  7.394   7.841   1.00 55.22  ?  145  VAL C N   1 
ATOM   9527  C  CA  . VAL C  1 145 ? 30.713  7.688   7.475   1.00 54.47  ?  145  VAL C CA  1 
ATOM   9528  C  C   . VAL C  1 145 ? 29.962  7.933   8.774   1.00 55.29  ?  145  VAL C C   1 
ATOM   9529  O  O   . VAL C  1 145 ? 29.738  6.999   9.550   1.00 57.57  ?  145  VAL C O   1 
ATOM   9530  C  CB  . VAL C  1 145 ? 30.077  6.541   6.681   1.00 51.11  ?  145  VAL C CB  1 
ATOM   9531  C  CG1 . VAL C  1 145 ? 28.600  6.815   6.452   1.00 50.17  ?  145  VAL C CG1 1 
ATOM   9532  C  CG2 . VAL C  1 145 ? 30.802  6.336   5.368   1.00 52.63  ?  145  VAL C CG2 1 
ATOM   9533  N  N   . LEU C  1 146 ? 29.563  9.175   9.023   1.00 54.17  ?  146  LEU C N   1 
ATOM   9534  C  CA  . LEU C  1 146 ? 28.971  9.554   10.299  1.00 52.67  ?  146  LEU C CA  1 
ATOM   9535  C  C   . LEU C  1 146 ? 27.492  9.872   10.124  1.00 56.58  ?  146  LEU C C   1 
ATOM   9536  O  O   . LEU C  1 146 ? 27.127  10.718  9.301   1.00 57.21  ?  146  LEU C O   1 
ATOM   9537  C  CB  . LEU C  1 146 ? 29.702  10.749  10.909  1.00 49.77  ?  146  LEU C CB  1 
ATOM   9538  C  CG  . LEU C  1 146 ? 29.334  11.014  12.369  1.00 48.62  ?  146  LEU C CG  1 
ATOM   9539  C  CD1 . LEU C  1 146 ? 30.565  11.399  13.161  1.00 48.14  ?  146  LEU C CD1 1 
ATOM   9540  C  CD2 . LEU C  1 146 ? 28.270  12.100  12.473  1.00 47.60  ?  146  LEU C CD2 1 
ATOM   9541  N  N   . VAL C  1 147 ? 26.649  9.204   10.914  1.00 59.09  ?  147  VAL C N   1 
ATOM   9542  C  CA  . VAL C  1 147 ? 25.206  9.412   10.906  1.00 59.74  ?  147  VAL C CA  1 
ATOM   9543  C  C   . VAL C  1 147 ? 24.798  10.013  12.243  1.00 60.37  ?  147  VAL C C   1 
ATOM   9544  O  O   . VAL C  1 147 ? 25.360  9.666   13.287  1.00 60.37  ?  147  VAL C O   1 
ATOM   9545  C  CB  . VAL C  1 147 ? 24.443  8.098   10.644  1.00 57.10  ?  147  VAL C CB  1 
ATOM   9546  C  CG1 . VAL C  1 147 ? 22.951  8.365   10.444  1.00 44.61  ?  147  VAL C CG1 1 
ATOM   9547  C  CG2 . VAL C  1 147 ? 25.043  7.362   9.456   1.00 55.21  ?  147  VAL C CG2 1 
ATOM   9548  N  N   . SER C  1 148 ? 23.832  10.927  12.208  1.00 43.32  ?  148  SER C N   1 
ATOM   9549  C  CA  . SER C  1 148 ? 23.239  11.494  13.412  1.00 45.91  ?  148  SER C CA  1 
ATOM   9550  C  C   . SER C  1 148 ? 21.756  11.710  13.165  1.00 46.41  ?  148  SER C C   1 
ATOM   9551  O  O   . SER C  1 148 ? 21.364  12.201  12.102  1.00 49.60  ?  148  SER C O   1 
ATOM   9552  C  CB  . SER C  1 148 ? 23.908  12.817  13.812  1.00 47.32  ?  148  SER C CB  1 
ATOM   9553  O  OG  . SER C  1 148 ? 23.738  13.808  12.813  1.00 46.64  ?  148  SER C OG  1 
ATOM   9554  N  N   . MET C  1 149 ? 20.934  11.346  14.145  1.00 45.94  ?  149  MET C N   1 
ATOM   9555  C  CA  . MET C  1 149 ? 19.491  11.407  13.989  1.00 46.30  ?  149  MET C CA  1 
ATOM   9556  C  C   . MET C  1 149 ? 18.869  12.283  15.063  1.00 45.16  ?  149  MET C C   1 
ATOM   9557  O  O   . MET C  1 149 ? 19.412  12.440  16.161  1.00 45.89  ?  149  MET C O   1 
ATOM   9558  C  CB  . MET C  1 149 ? 18.847  10.015  14.053  1.00 46.68  ?  149  MET C CB  1 
ATOM   9559  C  CG  . MET C  1 149 ? 18.436  9.577   15.453  1.00 44.23  ?  149  MET C CG  1 
ATOM   9560  S  SD  . MET C  1 149 ? 19.860  9.174   16.471  1.00 44.35  ?  149  MET C SD  1 
ATOM   9561  C  CE  . MET C  1 149 ? 20.453  7.706   15.639  1.00 46.61  ?  149  MET C CE  1 
ATOM   9562  N  N   . ASN C  1 150 ? 17.726  12.861  14.717  1.00 44.50  ?  150  ASN C N   1 
ATOM   9563  C  CA  . ASN C  1 150 ? 16.875  13.543  15.671  1.00 44.44  ?  150  ASN C CA  1 
ATOM   9564  C  C   . ASN C  1 150 ? 15.933  12.523  16.291  1.00 44.56  ?  150  ASN C C   1 
ATOM   9565  O  O   . ASN C  1 150 ? 15.414  11.640  15.603  1.00 44.46  ?  150  ASN C O   1 
ATOM   9566  C  CB  . ASN C  1 150 ? 16.071  14.653  14.989  1.00 46.16  ?  150  ASN C CB  1 
ATOM   9567  C  CG  . ASN C  1 150 ? 16.908  15.885  14.695  1.00 49.68  ?  150  ASN C CG  1 
ATOM   9568  O  OD1 . ASN C  1 150 ? 18.099  15.934  15.008  1.00 51.79  ?  150  ASN C OD1 1 
ATOM   9569  N  ND2 . ASN C  1 150 ? 16.288  16.885  14.076  1.00 41.20  ?  150  ASN C ND2 1 
ATOM   9570  N  N   . TYR C  1 151 ? 15.739  12.632  17.598  1.00 45.02  ?  151  TYR C N   1 
ATOM   9571  C  CA  . TYR C  1 151 ? 14.765  11.826  18.311  1.00 44.88  ?  151  TYR C CA  1 
ATOM   9572  C  C   . TYR C  1 151 ? 13.950  12.749  19.202  1.00 42.54  ?  151  TYR C C   1 
ATOM   9573  O  O   . TYR C  1 151 ? 14.426  13.807  19.621  1.00 43.59  ?  151  TYR C O   1 
ATOM   9574  C  CB  . TYR C  1 151 ? 15.440  10.723  19.143  1.00 43.77  ?  151  TYR C CB  1 
ATOM   9575  C  CG  . TYR C  1 151 ? 16.335  11.243  20.245  1.00 45.05  ?  151  TYR C CG  1 
ATOM   9576  C  CD1 . TYR C  1 151 ? 17.658  11.574  19.993  1.00 46.52  ?  151  TYR C CD1 1 
ATOM   9577  C  CD2 . TYR C  1 151 ? 15.862  11.380  21.545  1.00 46.28  ?  151  TYR C CD2 1 
ATOM   9578  C  CE1 . TYR C  1 151 ? 18.483  12.047  21.004  1.00 48.78  ?  151  TYR C CE1 1 
ATOM   9579  C  CE2 . TYR C  1 151 ? 16.678  11.848  22.562  1.00 47.69  ?  151  TYR C CE2 1 
ATOM   9580  C  CZ  . TYR C  1 151 ? 17.986  12.182  22.286  1.00 48.78  ?  151  TYR C CZ  1 
ATOM   9581  O  OH  . TYR C  1 151 ? 18.799  12.652  23.294  1.00 48.49  ?  151  TYR C OH  1 
ATOM   9582  N  N   . ARG C  1 152 ? 12.714  12.347  19.473  1.00 42.79  ?  152  ARG C N   1 
ATOM   9583  C  CA  . ARG C  1 152 ? 11.828  13.162  20.291  1.00 44.52  ?  152  ARG C CA  1 
ATOM   9584  C  C   . ARG C  1 152 ? 12.348  13.292  21.720  1.00 48.20  ?  152  ARG C C   1 
ATOM   9585  O  O   . ARG C  1 152 ? 12.804  12.318  22.327  1.00 49.98  ?  152  ARG C O   1 
ATOM   9586  C  CB  . ARG C  1 152 ? 10.425  12.566  20.284  1.00 43.03  ?  152  ARG C CB  1 
ATOM   9587  C  CG  . ARG C  1 152 ? 9.656   12.865  19.026  1.00 41.68  ?  152  ARG C CG  1 
ATOM   9588  C  CD  . ARG C  1 152 ? 8.335   12.145  19.019  1.00 42.39  ?  152  ARG C CD  1 
ATOM   9589  N  NE  . ARG C  1 152 ? 8.499   10.736  18.690  1.00 45.44  ?  152  ARG C NE  1 
ATOM   9590  C  CZ  . ARG C  1 152 ? 7.510   9.851   18.704  1.00 49.45  ?  152  ARG C CZ  1 
ATOM   9591  N  NH1 . ARG C  1 152 ? 6.286   10.232  19.046  1.00 51.74  ?  152  ARG C NH1 1 
ATOM   9592  N  NH2 . ARG C  1 152 ? 7.744   8.587   18.378  1.00 50.48  ?  152  ARG C NH2 1 
ATOM   9593  N  N   . VAL C  1 153 ? 12.276  14.512  22.255  1.00 48.22  ?  153  VAL C N   1 
ATOM   9594  C  CA  . VAL C  1 153 ? 12.722  14.810  23.609  1.00 48.12  ?  153  VAL C CA  1 
ATOM   9595  C  C   . VAL C  1 153 ? 11.566  15.431  24.379  1.00 50.94  ?  153  VAL C C   1 
ATOM   9596  O  O   . VAL C  1 153 ? 10.573  15.886  23.804  1.00 55.18  ?  153  VAL C O   1 
ATOM   9597  C  CB  . VAL C  1 153 ? 13.945  15.747  23.643  1.00 44.93  ?  153  VAL C CB  1 
ATOM   9598  C  CG1 . VAL C  1 153 ? 15.123  15.113  22.928  1.00 43.30  ?  153  VAL C CG1 1 
ATOM   9599  C  CG2 . VAL C  1 153 ? 13.594  17.098  23.038  1.00 44.73  ?  153  VAL C CG2 1 
ATOM   9600  N  N   . GLY C  1 154 ? 11.712  15.445  25.703  1.00 47.57  ?  154  GLY C N   1 
ATOM   9601  C  CA  . GLY C  1 154 ? 10.698  16.027  26.556  1.00 45.53  ?  154  GLY C CA  1 
ATOM   9602  C  C   . GLY C  1 154 ? 9.436   15.186  26.571  1.00 44.17  ?  154  GLY C C   1 
ATOM   9603  O  O   . GLY C  1 154 ? 9.459   13.973  26.339  1.00 43.98  ?  154  GLY C O   1 
ATOM   9604  N  N   . THR C  1 155 ? 8.311   15.852  26.844  1.00 44.64  ?  155  THR C N   1 
ATOM   9605  C  CA  . THR C  1 155 ? 7.020   15.172  26.840  1.00 45.65  ?  155  THR C CA  1 
ATOM   9606  C  C   . THR C  1 155 ? 6.804   14.393  25.551  1.00 47.23  ?  155  THR C C   1 
ATOM   9607  O  O   . THR C  1 155 ? 6.264   13.281  25.566  1.00 48.03  ?  155  THR C O   1 
ATOM   9608  C  CB  . THR C  1 155 ? 5.896   16.191  27.022  1.00 43.68  ?  155  THR C CB  1 
ATOM   9609  O  OG1 . THR C  1 155 ? 6.223   17.385  26.301  1.00 43.50  ?  155  THR C OG1 1 
ATOM   9610  C  CG2 . THR C  1 155 ? 5.708   16.530  28.486  1.00 44.09  ?  155  THR C CG2 1 
ATOM   9611  N  N   . PHE C  1 156 ? 7.247   14.952  24.425  1.00 47.86  ?  156  PHE C N   1 
ATOM   9612  C  CA  . PHE C  1 156 ? 6.864   14.409  23.129  1.00 48.04  ?  156  PHE C CA  1 
ATOM   9613  C  C   . PHE C  1 156 ? 7.454   13.029  22.891  1.00 52.61  ?  156  PHE C C   1 
ATOM   9614  O  O   . PHE C  1 156 ? 6.801   12.178  22.275  1.00 55.68  ?  156  PHE C O   1 
ATOM   9615  C  CB  . PHE C  1 156 ? 7.251   15.383  22.024  1.00 44.34  ?  156  PHE C CB  1 
ATOM   9616  C  CG  . PHE C  1 156 ? 6.695   16.753  22.234  1.00 42.94  ?  156  PHE C CG  1 
ATOM   9617  C  CD1 . PHE C  1 156 ? 5.414   17.057  21.806  1.00 43.82  ?  156  PHE C CD1 1 
ATOM   9618  C  CD2 . PHE C  1 156 ? 7.433   17.729  22.880  1.00 42.82  ?  156  PHE C CD2 1 
ATOM   9619  C  CE1 . PHE C  1 156 ? 4.887   18.306  22.005  1.00 44.37  ?  156  PHE C CE1 1 
ATOM   9620  C  CE2 . PHE C  1 156 ? 6.910   18.984  23.084  1.00 43.15  ?  156  PHE C CE2 1 
ATOM   9621  C  CZ  . PHE C  1 156 ? 5.635   19.273  22.647  1.00 44.68  ?  156  PHE C CZ  1 
ATOM   9622  N  N   . GLY C  1 157 ? 8.698   12.791  23.305  1.00 54.04  ?  157  GLY C N   1 
ATOM   9623  C  CA  . GLY C  1 157 ? 9.120   11.406  23.311  1.00 55.46  ?  157  GLY C CA  1 
ATOM   9624  C  C   . GLY C  1 157 ? 9.004   10.602  24.594  1.00 56.14  ?  157  GLY C C   1 
ATOM   9625  O  O   . GLY C  1 157 ? 8.899   9.374   24.536  1.00 58.37  ?  157  GLY C O   1 
ATOM   9626  N  N   . PHE C  1 158 ? 9.096   11.239  25.758  1.00 53.21  ?  158  PHE C N   1 
ATOM   9627  C  CA  . PHE C  1 158 ? 9.151   10.471  26.997  1.00 49.43  ?  158  PHE C CA  1 
ATOM   9628  C  C   . PHE C  1 158 ? 7.916   10.489  27.897  1.00 48.88  ?  158  PHE C C   1 
ATOM   9629  O  O   . PHE C  1 158 ? 7.941   9.831   28.941  1.00 48.83  ?  158  PHE C O   1 
ATOM   9630  C  CB  . PHE C  1 158 ? 10.430  10.846  27.734  1.00 46.14  ?  158  PHE C CB  1 
ATOM   9631  C  CG  . PHE C  1 158 ? 11.639  10.444  26.951  1.00 44.26  ?  158  PHE C CG  1 
ATOM   9632  C  CD1 . PHE C  1 158 ? 11.975  9.106   26.841  1.00 43.28  ?  158  PHE C CD1 1 
ATOM   9633  C  CD2 . PHE C  1 158 ? 12.384  11.374  26.251  1.00 43.43  ?  158  PHE C CD2 1 
ATOM   9634  C  CE1 . PHE C  1 158 ? 13.056  8.706   26.089  1.00 41.18  ?  158  PHE C CE1 1 
ATOM   9635  C  CE2 . PHE C  1 158 ? 13.476  10.977  25.499  1.00 43.23  ?  158  PHE C CE2 1 
ATOM   9636  C  CZ  . PHE C  1 158 ? 13.810  9.642   25.420  1.00 40.67  ?  158  PHE C CZ  1 
ATOM   9637  N  N   . LEU C  1 159 ? 6.850   11.211  27.562  1.00 48.70  ?  159  LEU C N   1 
ATOM   9638  C  CA  . LEU C  1 159 ? 5.683   11.171  28.437  1.00 47.56  ?  159  LEU C CA  1 
ATOM   9639  C  C   . LEU C  1 159 ? 5.055   9.790   28.358  1.00 48.72  ?  159  LEU C C   1 
ATOM   9640  O  O   . LEU C  1 159 ? 4.752   9.294   27.269  1.00 49.83  ?  159  LEU C O   1 
ATOM   9641  C  CB  . LEU C  1 159 ? 4.661   12.249  28.071  1.00 44.79  ?  159  LEU C CB  1 
ATOM   9642  C  CG  . LEU C  1 159 ? 3.444   12.348  29.003  1.00 57.29  ?  159  LEU C CG  1 
ATOM   9643  C  CD1 . LEU C  1 159 ? 3.038   13.792  29.243  1.00 55.77  ?  159  LEU C CD1 1 
ATOM   9644  C  CD2 . LEU C  1 159 ? 2.253   11.574  28.458  1.00 46.88  ?  159  LEU C CD2 1 
ATOM   9645  N  N   . ALA C  1 160 ? 4.866   9.165   29.514  1.00 48.54  ?  160  ALA C N   1 
ATOM   9646  C  CA  . ALA C  1 160 ? 4.473   7.768   29.579  1.00 48.23  ?  160  ALA C CA  1 
ATOM   9647  C  C   . ALA C  1 160 ? 3.329   7.569   30.559  1.00 49.19  ?  160  ALA C C   1 
ATOM   9648  O  O   . ALA C  1 160 ? 3.341   8.109   31.669  1.00 49.26  ?  160  ALA C O   1 
ATOM   9649  C  CB  . ALA C  1 160 ? 5.653   6.885   29.991  1.00 45.83  ?  160  ALA C CB  1 
ATOM   9650  N  N   . LEU C  1 161 ? 2.346   6.777   30.138  1.00 50.31  ?  161  LEU C N   1 
ATOM   9651  C  CA  . LEU C  1 161 ? 1.348   6.184   31.021  1.00 52.69  ?  161  LEU C CA  1 
ATOM   9652  C  C   . LEU C  1 161 ? 1.557   4.682   30.894  1.00 56.69  ?  161  LEU C C   1 
ATOM   9653  O  O   . LEU C  1 161 ? 0.847   4.012   30.127  1.00 61.40  ?  161  LEU C O   1 
ATOM   9654  C  CB  . LEU C  1 161 ? -0.076  6.585   30.645  1.00 53.02  ?  161  LEU C CB  1 
ATOM   9655  C  CG  . LEU C  1 161 ? -0.497  8.024   30.936  1.00 51.65  ?  161  LEU C CG  1 
ATOM   9656  C  CD1 . LEU C  1 161 ? -1.973  8.195   30.658  1.00 52.86  ?  161  LEU C CD1 1 
ATOM   9657  C  CD2 . LEU C  1 161 ? -0.181  8.411   32.365  1.00 50.94  ?  161  LEU C CD2 1 
ATOM   9658  N  N   . PRO C  1 162 ? 2.535   4.127   31.615  1.00 53.62  ?  162  PRO C N   1 
ATOM   9659  C  CA  . PRO C  1 162 ? 3.021   2.771   31.324  1.00 52.56  ?  162  PRO C CA  1 
ATOM   9660  C  C   . PRO C  1 162 ? 1.900   1.747   31.225  1.00 53.29  ?  162  PRO C C   1 
ATOM   9661  O  O   . PRO C  1 162 ? 0.930   1.780   31.984  1.00 52.82  ?  162  PRO C O   1 
ATOM   9662  C  CB  . PRO C  1 162 ? 3.948   2.476   32.506  1.00 51.90  ?  162  PRO C CB  1 
ATOM   9663  C  CG  . PRO C  1 162 ? 4.429   3.814   32.940  1.00 50.02  ?  162  PRO C CG  1 
ATOM   9664  C  CD  . PRO C  1 162 ? 3.292   4.768   32.704  1.00 50.99  ?  162  PRO C CD  1 
ATOM   9665  N  N   . GLY C  1 163 ? 2.035   0.840   30.257  1.00 54.67  ?  163  GLY C N   1 
ATOM   9666  C  CA  . GLY C  1 163 ? 1.035   -0.172  30.009  1.00 57.26  ?  163  GLY C CA  1 
ATOM   9667  C  C   . GLY C  1 163 ? -0.057  0.231   29.045  1.00 60.51  ?  163  GLY C C   1 
ATOM   9668  O  O   . GLY C  1 163 ? -0.789  -0.646  28.569  1.00 64.31  ?  163  GLY C O   1 
ATOM   9669  N  N   . SER C  1 164 ? -0.203  1.523   28.756  1.00 60.48  ?  164  SER C N   1 
ATOM   9670  C  CA  . SER C  1 164 ? -1.206  1.998   27.813  1.00 61.56  ?  164  SER C CA  1 
ATOM   9671  C  C   . SER C  1 164 ? -0.743  1.804   26.374  1.00 61.93  ?  164  SER C C   1 
ATOM   9672  O  O   . SER C  1 164 ? 0.453   1.725   26.078  1.00 59.44  ?  164  SER C O   1 
ATOM   9673  C  CB  . SER C  1 164 ? -1.517  3.475   28.034  1.00 61.18  ?  164  SER C CB  1 
ATOM   9674  O  OG  . SER C  1 164 ? -0.527  4.282   27.424  1.00 60.09  ?  164  SER C OG  1 
ATOM   9675  N  N   . ARG C  1 165 ? -1.723  1.729   25.474  1.00 65.38  ?  165  ARG C N   1 
ATOM   9676  C  CA  . ARG C  1 165 ? -1.424  1.681   24.049  1.00 67.22  ?  165  ARG C CA  1 
ATOM   9677  C  C   . ARG C  1 165 ? -1.076  3.060   23.499  1.00 66.92  ?  165  ARG C C   1 
ATOM   9678  O  O   . ARG C  1 165 ? -0.145  3.192   22.697  1.00 67.54  ?  165  ARG C O   1 
ATOM   9679  C  CB  . ARG C  1 165 ? -2.617  1.103   23.283  1.00 71.40  ?  165  ARG C CB  1 
ATOM   9680  C  CG  . ARG C  1 165 ? -2.515  1.238   21.763  1.00 74.33  ?  165  ARG C CG  1 
ATOM   9681  C  CD  . ARG C  1 165 ? -3.877  1.119   21.084  1.00 79.56  ?  165  ARG C CD  1 
ATOM   9682  N  NE  . ARG C  1 165 ? -3.760  1.142   19.626  1.00 84.42  ?  165  ARG C NE  1 
ATOM   9683  C  CZ  . ARG C  1 165 ? -3.684  2.253   18.896  1.00 88.22  ?  165  ARG C CZ  1 
ATOM   9684  N  NH1 . ARG C  1 165 ? -3.709  3.442   19.489  1.00 88.54  ?  165  ARG C NH1 1 
ATOM   9685  N  NH2 . ARG C  1 165 ? -3.579  2.179   17.572  1.00 89.81  ?  165  ARG C NH2 1 
ATOM   9686  N  N   . GLU C  1 166 ? -1.788  4.098   23.951  1.00 62.31  ?  166  GLU C N   1 
ATOM   9687  C  CA  A GLU C  1 166 ? -1.696  5.398   23.295  0.42 61.22  ?  166  GLU C CA  1 
ATOM   9688  C  CA  B GLU C  1 166 ? -1.710  5.410   23.317  0.58 60.99  ?  166  GLU C CA  1 
ATOM   9689  C  C   . GLU C  1 166 ? -0.434  6.166   23.676  1.00 56.30  ?  166  GLU C C   1 
ATOM   9690  O  O   . GLU C  1 166 ? 0.014   7.019   22.900  1.00 60.22  ?  166  GLU C O   1 
ATOM   9691  C  CB  A GLU C  1 166 ? -2.942  6.233   23.598  0.42 56.71  ?  166  GLU C CB  1 
ATOM   9692  C  CB  B GLU C  1 166 ? -2.939  6.243   23.695  0.58 56.96  ?  166  GLU C CB  1 
ATOM   9693  C  CG  A GLU C  1 166 ? -4.265  5.554   23.221  0.42 60.79  ?  166  GLU C CG  1 
ATOM   9694  C  CG  B GLU C  1 166 ? -4.287  5.565   23.421  0.58 60.82  ?  166  GLU C CG  1 
ATOM   9695  C  CD  A GLU C  1 166 ? -4.686  5.818   21.781  0.42 58.59  ?  166  GLU C CD  1 
ATOM   9696  C  CD  B GLU C  1 166 ? -4.770  4.687   24.575  0.58 59.14  ?  166  GLU C CD  1 
ATOM   9697  O  OE1 A GLU C  1 166 ? -3.833  6.253   20.977  0.42 58.84  ?  166  GLU C OE1 1 
ATOM   9698  O  OE1 B GLU C  1 166 ? -4.074  4.611   25.610  0.58 59.58  ?  166  GLU C OE1 1 
ATOM   9699  O  OE2 A GLU C  1 166 ? -5.874  5.595   21.453  0.42 60.57  ?  166  GLU C OE2 1 
ATOM   9700  O  OE2 B GLU C  1 166 ? -5.855  4.081   24.449  0.58 60.97  ?  166  GLU C OE2 1 
ATOM   9701  N  N   . ALA C  1 167 ? 0.148   5.907   24.848  1.00 55.22  ?  167  ALA C N   1 
ATOM   9702  C  CA  . ALA C  1 167 ? 1.414   6.532   25.247  1.00 53.19  ?  167  ALA C CA  1 
ATOM   9703  C  C   . ALA C  1 167 ? 2.259   5.552   26.054  1.00 55.97  ?  167  ALA C C   1 
ATOM   9704  O  O   . ALA C  1 167 ? 2.398   5.683   27.276  1.00 56.94  ?  167  ALA C O   1 
ATOM   9705  C  CB  . ALA C  1 167 ? 1.160   7.819   26.030  1.00 52.32  ?  167  ALA C CB  1 
ATOM   9706  N  N   . PRO C  1 168 ? 2.866   4.562   25.388  1.00 56.37  ?  168  PRO C N   1 
ATOM   9707  C  CA  . PRO C  1 168 ? 3.601   3.518   26.126  1.00 56.27  ?  168  PRO C CA  1 
ATOM   9708  C  C   . PRO C  1 168 ? 4.883   3.999   26.785  1.00 54.60  ?  168  PRO C C   1 
ATOM   9709  O  O   . PRO C  1 168 ? 5.408   3.298   27.659  1.00 52.39  ?  168  PRO C O   1 
ATOM   9710  C  CB  . PRO C  1 168 ? 3.898   2.476   25.043  1.00 56.00  ?  168  PRO C CB  1 
ATOM   9711  C  CG  . PRO C  1 168 ? 4.003   3.286   23.799  1.00 55.04  ?  168  PRO C CG  1 
ATOM   9712  C  CD  . PRO C  1 168 ? 2.976   4.383   23.932  1.00 55.70  ?  168  PRO C CD  1 
ATOM   9713  N  N   . GLY C  1 169 ? 5.419   5.144   26.385  1.00 56.18  ?  169  GLY C N   1 
ATOM   9714  C  CA  . GLY C  1 169 ? 6.684   5.608   26.909  1.00 56.56  ?  169  GLY C CA  1 
ATOM   9715  C  C   . GLY C  1 169 ? 7.858   5.163   26.056  1.00 58.24  ?  169  GLY C C   1 
ATOM   9716  O  O   . GLY C  1 169 ? 7.758   4.270   25.216  1.00 62.70  ?  169  GLY C O   1 
ATOM   9717  N  N   . ASN C  1 170 ? 8.990   5.826   26.275  1.00 54.91  ?  170  ASN C N   1 
ATOM   9718  C  CA  . ASN C  1 170 ? 10.250  5.537   25.588  1.00 50.75  ?  170  ASN C CA  1 
ATOM   9719  C  C   . ASN C  1 170 ? 10.159  5.690   24.078  1.00 49.44  ?  170  ASN C C   1 
ATOM   9720  O  O   . ASN C  1 170 ? 10.969  5.102   23.357  1.00 50.83  ?  170  ASN C O   1 
ATOM   9721  C  CB  . ASN C  1 170 ? 10.764  4.125   25.899  1.00 48.52  ?  170  ASN C CB  1 
ATOM   9722  C  CG  . ASN C  1 170 ? 10.910  3.867   27.370  1.00 48.48  ?  170  ASN C CG  1 
ATOM   9723  O  OD1 . ASN C  1 170 ? 11.229  4.767   28.140  1.00 48.00  ?  170  ASN C OD1 1 
ATOM   9724  N  ND2 . ASN C  1 170 ? 10.681  2.624   27.775  1.00 50.35  ?  170  ASN C ND2 1 
ATOM   9725  N  N   . VAL C  1 171 ? 9.219   6.476   23.550  1.00 46.76  ?  171  VAL C N   1 
ATOM   9726  C  CA  . VAL C  1 171 ? 9.120   6.508   22.096  1.00 46.19  ?  171  VAL C CA  1 
ATOM   9727  C  C   . VAL C  1 171 ? 10.271  7.289   21.480  1.00 45.45  ?  171  VAL C C   1 
ATOM   9728  O  O   . VAL C  1 171 ? 10.539  7.130   20.286  1.00 48.28  ?  171  VAL C O   1 
ATOM   9729  C  CB  . VAL C  1 171 ? 7.764   7.058   21.606  1.00 46.78  ?  171  VAL C CB  1 
ATOM   9730  C  CG1 . VAL C  1 171 ? 6.621   6.212   22.147  1.00 44.71  ?  171  VAL C CG1 1 
ATOM   9731  C  CG2 . VAL C  1 171 ? 7.592   8.513   21.959  1.00 43.30  ?  171  VAL C CG2 1 
ATOM   9732  N  N   . GLY C  1 172 ? 10.971  8.119   22.257  1.00 42.79  ?  172  GLY C N   1 
ATOM   9733  C  CA  . GLY C  1 172 ? 12.186  8.735   21.747  1.00 41.27  ?  172  GLY C CA  1 
ATOM   9734  C  C   . GLY C  1 172 ? 13.286  7.718   21.508  1.00 44.78  ?  172  GLY C C   1 
ATOM   9735  O  O   . GLY C  1 172 ? 14.021  7.797   20.513  1.00 47.67  ?  172  GLY C O   1 
ATOM   9736  N  N   . LEU C  1 173 ? 13.409  6.739   22.409  1.00 46.01  ?  173  LEU C N   1 
ATOM   9737  C  CA  . LEU C  1 173 ? 14.347  5.646   22.184  1.00 49.01  ?  173  LEU C CA  1 
ATOM   9738  C  C   . LEU C  1 173 ? 13.954  4.831   20.956  1.00 50.86  ?  173  LEU C C   1 
ATOM   9739  O  O   . LEU C  1 173 ? 14.819  4.406   20.182  1.00 53.28  ?  173  LEU C O   1 
ATOM   9740  C  CB  . LEU C  1 173 ? 14.433  4.758   23.426  1.00 50.10  ?  173  LEU C CB  1 
ATOM   9741  C  CG  . LEU C  1 173 ? 15.198  5.364   24.605  1.00 50.85  ?  173  LEU C CG  1 
ATOM   9742  C  CD1 . LEU C  1 173 ? 15.113  4.469   25.829  1.00 50.58  ?  173  LEU C CD1 1 
ATOM   9743  C  CD2 . LEU C  1 173 ? 16.651  5.599   24.222  1.00 51.66  ?  173  LEU C CD2 1 
ATOM   9744  N  N   . LEU C  1 174 ? 12.651  4.614   20.752  1.00 47.77  ?  174  LEU C N   1 
ATOM   9745  C  CA  . LEU C  1 174 ? 12.211  3.917   19.549  1.00 46.24  ?  174  LEU C CA  1 
ATOM   9746  C  C   . LEU C  1 174 ? 12.501  4.731   18.295  1.00 47.81  ?  174  LEU C C   1 
ATOM   9747  O  O   . LEU C  1 174 ? 12.755  4.156   17.232  1.00 50.77  ?  174  LEU C O   1 
ATOM   9748  C  CB  . LEU C  1 174 ? 10.722  3.588   19.642  1.00 46.04  ?  174  LEU C CB  1 
ATOM   9749  C  CG  . LEU C  1 174 ? 10.313  2.625   20.755  1.00 44.81  ?  174  LEU C CG  1 
ATOM   9750  C  CD1 . LEU C  1 174 ? 8.850   2.249   20.625  1.00 45.71  ?  174  LEU C CD1 1 
ATOM   9751  C  CD2 . LEU C  1 174 ? 11.198  1.397   20.760  1.00 45.26  ?  174  LEU C CD2 1 
ATOM   9752  N  N   . ASP C  1 175 ? 12.447  6.062   18.393  1.00 48.26  ?  175  ASP C N   1 
ATOM   9753  C  CA  . ASP C  1 175 ? 12.944  6.908   17.311  1.00 48.16  ?  175  ASP C CA  1 
ATOM   9754  C  C   . ASP C  1 175 ? 14.400  6.584   17.010  1.00 50.10  ?  175  ASP C C   1 
ATOM   9755  O  O   . ASP C  1 175 ? 14.777  6.359   15.850  1.00 53.08  ?  175  ASP C O   1 
ATOM   9756  C  CB  . ASP C  1 175 ? 12.797  8.388   17.679  1.00 44.61  ?  175  ASP C CB  1 
ATOM   9757  C  CG  . ASP C  1 175 ? 11.350  8.824   17.820  1.00 42.94  ?  175  ASP C CG  1 
ATOM   9758  O  OD1 . ASP C  1 175 ? 10.455  8.120   17.315  1.00 44.16  ?  175  ASP C OD1 1 
ATOM   9759  O  OD2 . ASP C  1 175 ? 11.106  9.877   18.443  1.00 41.72  ?  175  ASP C OD2 1 
ATOM   9760  N  N   . GLN C  1 176 ? 15.236  6.547   18.052  1.00 48.12  ?  176  GLN C N   1 
ATOM   9761  C  CA  . GLN C  1 176 ? 16.644  6.218   17.845  1.00 47.20  ?  176  GLN C CA  1 
ATOM   9762  C  C   . GLN C  1 176 ? 16.804  4.850   17.186  1.00 49.64  ?  176  GLN C C   1 
ATOM   9763  O  O   . GLN C  1 176 ? 17.574  4.690   16.228  1.00 49.31  ?  176  GLN C O   1 
ATOM   9764  C  CB  . GLN C  1 176 ? 17.390  6.265   19.174  1.00 45.13  ?  176  GLN C CB  1 
ATOM   9765  C  CG  . GLN C  1 176 ? 17.320  7.606   19.858  1.00 44.47  ?  176  GLN C CG  1 
ATOM   9766  C  CD  . GLN C  1 176 ? 18.127  7.630   21.131  1.00 44.11  ?  176  GLN C CD  1 
ATOM   9767  O  OE1 . GLN C  1 176 ? 18.723  6.625   21.513  1.00 43.73  ?  176  GLN C OE1 1 
ATOM   9768  N  NE2 . GLN C  1 176 ? 18.152  8.777   21.796  1.00 43.46  ?  176  GLN C NE2 1 
ATOM   9769  N  N   . ARG C  1 177 ? 16.077  3.849   17.688  1.00 51.19  ?  177  ARG C N   1 
ATOM   9770  C  CA  . ARG C  1 177 ? 16.183  2.507   17.128  1.00 51.91  ?  177  ARG C CA  1 
ATOM   9771  C  C   . ARG C  1 177 ? 15.762  2.484   15.665  1.00 54.99  ?  177  ARG C C   1 
ATOM   9772  O  O   . ARG C  1 177 ? 16.406  1.830   14.837  1.00 58.46  ?  177  ARG C O   1 
ATOM   9773  C  CB  . ARG C  1 177 ? 15.335  1.527   17.934  1.00 47.85  ?  177  ARG C CB  1 
ATOM   9774  C  CG  . ARG C  1 177 ? 15.267  0.147   17.311  1.00 46.27  ?  177  ARG C CG  1 
ATOM   9775  C  CD  . ARG C  1 177 ? 14.394  -0.773  18.121  1.00 49.20  ?  177  ARG C CD  1 
ATOM   9776  N  NE  . ARG C  1 177 ? 14.993  -1.071  19.412  1.00 52.34  ?  177  ARG C NE  1 
ATOM   9777  C  CZ  . ARG C  1 177 ? 14.333  -1.629  20.420  1.00 58.32  ?  177  ARG C CZ  1 
ATOM   9778  N  NH1 . ARG C  1 177 ? 13.050  -1.944  20.273  1.00 62.13  ?  177  ARG C NH1 1 
ATOM   9779  N  NH2 . ARG C  1 177 ? 14.950  -1.872  21.572  1.00 59.54  ?  177  ARG C NH2 1 
ATOM   9780  N  N   . LEU C  1 178 ? 14.675  3.182   15.329  1.00 51.83  ?  178  LEU C N   1 
ATOM   9781  C  CA  . LEU C  1 178 ? 14.231  3.226   13.942  1.00 48.27  ?  178  LEU C CA  1 
ATOM   9782  C  C   . LEU C  1 178 ? 15.298  3.839   13.055  1.00 47.29  ?  178  LEU C C   1 
ATOM   9783  O  O   . LEU C  1 178 ? 15.536  3.362   11.940  1.00 49.83  ?  178  LEU C O   1 
ATOM   9784  C  CB  . LEU C  1 178 ? 12.923  4.004   13.831  1.00 47.31  ?  178  LEU C CB  1 
ATOM   9785  C  CG  . LEU C  1 178 ? 12.281  4.030   12.449  1.00 45.51  ?  178  LEU C CG  1 
ATOM   9786  C  CD1 . LEU C  1 178 ? 12.021  2.623   11.962  1.00 46.62  ?  178  LEU C CD1 1 
ATOM   9787  C  CD2 . LEU C  1 178 ? 10.988  4.821   12.500  1.00 45.47  ?  178  LEU C CD2 1 
ATOM   9788  N  N   . ALA C  1 179 ? 15.964  4.890   13.535  1.00 46.12  ?  179  ALA C N   1 
ATOM   9789  C  CA  . ALA C  1 179 ? 17.104  5.412   12.791  1.00 45.86  ?  179  ALA C CA  1 
ATOM   9790  C  C   . ALA C  1 179 ? 18.175  4.343   12.614  1.00 47.55  ?  179  ALA C C   1 
ATOM   9791  O  O   . ALA C  1 179 ? 18.791  4.244   11.545  1.00 50.23  ?  179  ALA C O   1 
ATOM   9792  C  CB  . ALA C  1 179 ? 17.678  6.640   13.489  1.00 43.52  ?  179  ALA C CB  1 
ATOM   9793  N  N   . LEU C  1 180 ? 18.395  3.517   13.642  1.00 45.98  ?  180  LEU C N   1 
ATOM   9794  C  CA  . LEU C  1 180 ? 19.428  2.486   13.551  1.00 47.34  ?  180  LEU C CA  1 
ATOM   9795  C  C   . LEU C  1 180 ? 19.054  1.410   12.534  1.00 48.42  ?  180  LEU C C   1 
ATOM   9796  O  O   . LEU C  1 180 ? 19.924  0.884   11.825  1.00 47.26  ?  180  LEU C O   1 
ATOM   9797  C  CB  . LEU C  1 180 ? 19.673  1.871   14.932  1.00 48.36  ?  180  LEU C CB  1 
ATOM   9798  C  CG  . LEU C  1 180 ? 20.801  2.424   15.816  1.00 48.42  ?  180  LEU C CG  1 
ATOM   9799  C  CD1 . LEU C  1 180 ? 20.769  3.934   15.885  1.00 43.86  ?  180  LEU C CD1 1 
ATOM   9800  C  CD2 . LEU C  1 180 ? 20.699  1.843   17.209  1.00 50.09  ?  180  LEU C CD2 1 
ATOM   9801  N  N   . GLN C  1 181 ? 17.766  1.073   12.447  1.00 50.16  ?  181  GLN C N   1 
ATOM   9802  C  CA  . GLN C  1 181 ? 17.304  0.107   11.455  1.00 54.34  ?  181  GLN C CA  1 
ATOM   9803  C  C   . GLN C  1 181 ? 17.418  0.676   10.046  1.00 54.87  ?  181  GLN C C   1 
ATOM   9804  O  O   . GLN C  1 181 ? 17.857  -0.019  9.115   1.00 57.59  ?  181  GLN C O   1 
ATOM   9805  C  CB  . GLN C  1 181 ? 15.862  -0.303  11.762  1.00 56.86  ?  181  GLN C CB  1 
ATOM   9806  C  CG  . GLN C  1 181 ? 15.720  -1.285  12.926  1.00 58.28  ?  181  GLN C CG  1 
ATOM   9807  C  CD  . GLN C  1 181 ? 14.369  -1.190  13.621  1.00 58.69  ?  181  GLN C CD  1 
ATOM   9808  O  OE1 . GLN C  1 181 ? 13.508  -0.400  13.232  1.00 57.91  ?  181  GLN C OE1 1 
ATOM   9809  N  NE2 . GLN C  1 181 ? 14.172  -2.014  14.646  1.00 59.68  ?  181  GLN C NE2 1 
ATOM   9810  N  N   . TRP C  1 182 ? 17.026  1.942   9.876   1.00 52.62  ?  182  TRP C N   1 
ATOM   9811  C  CA  . TRP C  1 182 ? 17.250  2.626   8.609   1.00 52.83  ?  182  TRP C CA  1 
ATOM   9812  C  C   . TRP C  1 182 ? 18.714  2.551   8.204   1.00 53.55  ?  182  TRP C C   1 
ATOM   9813  O  O   . TRP C  1 182 ? 19.033  2.234   7.056   1.00 55.98  ?  182  TRP C O   1 
ATOM   9814  C  CB  . TRP C  1 182 ? 16.800  4.082   8.709   1.00 51.21  ?  182  TRP C CB  1 
ATOM   9815  C  CG  . TRP C  1 182 ? 16.869  4.832   7.408   1.00 51.10  ?  182  TRP C CG  1 
ATOM   9816  C  CD1 . TRP C  1 182 ? 15.846  5.048   6.536   1.00 49.62  ?  182  TRP C CD1 1 
ATOM   9817  C  CD2 . TRP C  1 182 ? 18.021  5.474   6.840   1.00 49.02  ?  182  TRP C CD2 1 
ATOM   9818  N  NE1 . TRP C  1 182 ? 16.285  5.784   5.462   1.00 52.63  ?  182  TRP C NE1 1 
ATOM   9819  C  CE2 . TRP C  1 182 ? 17.618  6.057   5.626   1.00 50.01  ?  182  TRP C CE2 1 
ATOM   9820  C  CE3 . TRP C  1 182 ? 19.352  5.616   7.244   1.00 46.82  ?  182  TRP C CE3 1 
ATOM   9821  C  CZ2 . TRP C  1 182 ? 18.496  6.767   4.813   1.00 50.87  ?  182  TRP C CZ2 1 
ATOM   9822  C  CZ3 . TRP C  1 182 ? 20.222  6.318   6.433   1.00 47.13  ?  182  TRP C CZ3 1 
ATOM   9823  C  CH2 . TRP C  1 182 ? 19.792  6.886   5.236   1.00 49.37  ?  182  TRP C CH2 1 
ATOM   9824  N  N   . VAL C  1 183 ? 19.623  2.846   9.138   1.00 51.71  ?  183  VAL C N   1 
ATOM   9825  C  CA  . VAL C  1 183 ? 21.047  2.746   8.829   1.00 50.95  ?  183  VAL C CA  1 
ATOM   9826  C  C   . VAL C  1 183 ? 21.402  1.331   8.399   1.00 53.09  ?  183  VAL C C   1 
ATOM   9827  O  O   . VAL C  1 183 ? 22.175  1.134   7.453   1.00 55.01  ?  183  VAL C O   1 
ATOM   9828  C  CB  . VAL C  1 183 ? 21.894  3.206   10.028  1.00 49.29  ?  183  VAL C CB  1 
ATOM   9829  C  CG1 . VAL C  1 183 ? 23.355  2.835   9.822   1.00 47.76  ?  183  VAL C CG1 1 
ATOM   9830  C  CG2 . VAL C  1 183 ? 21.761  4.708   10.202  1.00 47.95  ?  183  VAL C CG2 1 
ATOM   9831  N  N   . GLN C  1 184 ? 20.821  0.324   9.061   1.00 53.32  ?  184  GLN C N   1 
ATOM   9832  C  CA  . GLN C  1 184 ? 21.135  -1.061  8.714   1.00 54.15  ?  184  GLN C CA  1 
ATOM   9833  C  C   . GLN C  1 184 ? 20.771  -1.367  7.269   1.00 52.82  ?  184  GLN C C   1 
ATOM   9834  O  O   . GLN C  1 184 ? 21.557  -1.984  6.542   1.00 52.83  ?  184  GLN C O   1 
ATOM   9835  C  CB  . GLN C  1 184 ? 20.424  -2.029  9.660   1.00 53.64  ?  184  GLN C CB  1 
ATOM   9836  C  CG  . GLN C  1 184 ? 21.209  -2.309  10.926  1.00 50.47  ?  184  GLN C CG  1 
ATOM   9837  C  CD  . GLN C  1 184 ? 22.502  -3.060  10.660  1.00 52.33  ?  184  GLN C CD  1 
ATOM   9838  O  OE1 . GLN C  1 184 ? 22.501  -4.277  10.449  1.00 53.48  ?  184  GLN C OE1 1 
ATOM   9839  N  NE2 . GLN C  1 184 ? 23.615  -2.333  10.659  1.00 51.30  ?  184  GLN C NE2 1 
ATOM   9840  N  N   . GLU C  1 185 ? 19.581  -0.948  6.828   1.00 53.99  ?  185  GLU C N   1 
ATOM   9841  C  CA  . GLU C  1 185 ? 19.196  -1.253  5.451   1.00 56.26  ?  185  GLU C CA  1 
ATOM   9842  C  C   . GLU C  1 185 ? 19.913  -0.358  4.440   1.00 57.87  ?  185  GLU C C   1 
ATOM   9843  O  O   . GLU C  1 185 ? 20.468  -0.850  3.451   1.00 59.95  ?  185  GLU C O   1 
ATOM   9844  C  CB  . GLU C  1 185 ? 17.676  -1.132  5.283   1.00 57.51  ?  185  GLU C CB  1 
ATOM   9845  C  CG  . GLU C  1 185 ? 17.104  -2.060  4.218   1.00 62.42  ?  185  GLU C CG  1 
ATOM   9846  C  CD  . GLU C  1 185 ? 15.744  -1.616  3.706   1.00 65.32  ?  185  GLU C CD  1 
ATOM   9847  O  OE1 . GLU C  1 185 ? 15.050  -0.876  4.436   1.00 66.53  ?  185  GLU C OE1 1 
ATOM   9848  O  OE2 . GLU C  1 185 ? 15.367  -2.009  2.577   1.00 65.58  ?  185  GLU C OE2 1 
ATOM   9849  N  N   . ASN C  1 186 ? 19.906  0.955   4.670   1.00 56.96  ?  186  ASN C N   1 
ATOM   9850  C  CA  . ASN C  1 186 ? 20.254  1.943   3.658   1.00 56.09  ?  186  ASN C CA  1 
ATOM   9851  C  C   . ASN C  1 186 ? 21.681  2.476   3.720   1.00 53.33  ?  186  ASN C C   1 
ATOM   9852  O  O   . ASN C  1 186 ? 22.056  3.264   2.845   1.00 53.51  ?  186  ASN C O   1 
ATOM   9853  C  CB  . ASN C  1 186 ? 19.290  3.126   3.753   1.00 57.93  ?  186  ASN C CB  1 
ATOM   9854  C  CG  . ASN C  1 186 ? 17.859  2.717   3.533   1.00 62.18  ?  186  ASN C CG  1 
ATOM   9855  O  OD1 . ASN C  1 186 ? 17.459  2.436   2.411   1.00 65.50  ?  186  ASN C OD1 1 
ATOM   9856  N  ND2 . ASN C  1 186 ? 17.083  2.660   4.606   1.00 63.17  ?  186  ASN C ND2 1 
ATOM   9857  N  N   . ILE C  1 187 ? 22.494  2.099   4.706   1.00 52.63  ?  187  ILE C N   1 
ATOM   9858  C  CA  . ILE C  1 187 ? 23.782  2.784   4.803   1.00 54.00  ?  187  ILE C CA  1 
ATOM   9859  C  C   . ILE C  1 187 ? 24.790  2.267   3.784   1.00 58.32  ?  187  ILE C C   1 
ATOM   9860  O  O   . ILE C  1 187 ? 25.763  2.969   3.481   1.00 59.74  ?  187  ILE C O   1 
ATOM   9861  C  CB  . ILE C  1 187 ? 24.379  2.706   6.218   1.00 51.77  ?  187  ILE C CB  1 
ATOM   9862  C  CG1 . ILE C  1 187 ? 25.353  3.868   6.434   1.00 49.96  ?  187  ILE C CG1 1 
ATOM   9863  C  CG2 . ILE C  1 187 ? 25.123  1.402   6.412   1.00 52.31  ?  187  ILE C CG2 1 
ATOM   9864  C  CD1 . ILE C  1 187 ? 24.740  5.238   6.241   1.00 49.08  ?  187  ILE C CD1 1 
ATOM   9865  N  N   . ALA C  1 188 ? 24.582  1.069   3.230   1.00 60.98  ?  188  ALA C N   1 
ATOM   9866  C  CA  . ALA C  1 188 ? 25.487  0.586   2.191   1.00 63.85  ?  188  ALA C CA  1 
ATOM   9867  C  C   . ALA C  1 188 ? 25.411  1.446   0.934   1.00 63.33  ?  188  ALA C C   1 
ATOM   9868  O  O   . ALA C  1 188 ? 26.385  1.516   0.175   1.00 64.36  ?  188  ALA C O   1 
ATOM   9869  C  CB  . ALA C  1 188 ? 25.180  -0.875  1.862   1.00 65.86  ?  188  ALA C CB  1 
ATOM   9870  N  N   . ALA C  1 189 ? 24.275  2.111   0.700   1.00 60.50  ?  189  ALA C N   1 
ATOM   9871  C  CA  . ALA C  1 189 ? 24.151  2.992   -0.457  1.00 58.49  ?  189  ALA C CA  1 
ATOM   9872  C  C   . ALA C  1 189 ? 25.087  4.188   -0.359  1.00 58.79  ?  189  ALA C C   1 
ATOM   9873  O  O   . ALA C  1 189 ? 25.494  4.733   -1.388  1.00 62.32  ?  189  ALA C O   1 
ATOM   9874  C  CB  . ALA C  1 189 ? 22.710  3.472   -0.608  1.00 54.78  ?  189  ALA C CB  1 
ATOM   9875  N  N   . PHE C  1 190 ? 25.432  4.613   0.855   1.00 57.71  ?  190  PHE C N   1 
ATOM   9876  C  CA  . PHE C  1 190 ? 26.329  5.745   1.061   1.00 56.95  ?  190  PHE C CA  1 
ATOM   9877  C  C   . PHE C  1 190 ? 27.786  5.334   1.187   1.00 58.88  ?  190  PHE C C   1 
ATOM   9878  O  O   . PHE C  1 190 ? 28.647  6.202   1.363   1.00 60.50  ?  190  PHE C O   1 
ATOM   9879  C  CB  . PHE C  1 190 ? 25.926  6.525   2.312   1.00 55.01  ?  190  PHE C CB  1 
ATOM   9880  C  CG  . PHE C  1 190 ? 24.535  7.066   2.265   1.00 55.41  ?  190  PHE C CG  1 
ATOM   9881  C  CD1 . PHE C  1 190 ? 23.460  6.279   2.646   1.00 56.14  ?  190  PHE C CD1 1 
ATOM   9882  C  CD2 . PHE C  1 190 ? 24.302  8.371   1.854   1.00 55.90  ?  190  PHE C CD2 1 
ATOM   9883  C  CE1 . PHE C  1 190 ? 22.180  6.774   2.607   1.00 55.96  ?  190  PHE C CE1 1 
ATOM   9884  C  CE2 . PHE C  1 190 ? 23.022  8.877   1.815   1.00 55.96  ?  190  PHE C CE2 1 
ATOM   9885  C  CZ  . PHE C  1 190 ? 21.956  8.077   2.192   1.00 55.55  ?  190  PHE C CZ  1 
ATOM   9886  N  N   . GLY C  1 191 ? 28.085  4.045   1.101   1.00 60.78  ?  191  GLY C N   1 
ATOM   9887  C  CA  . GLY C  1 191 ? 29.431  3.568   1.303   1.00 62.55  ?  191  GLY C CA  1 
ATOM   9888  C  C   . GLY C  1 191 ? 29.725  3.100   2.706   1.00 61.50  ?  191  GLY C C   1 
ATOM   9889  O  O   . GLY C  1 191 ? 30.868  2.716   2.986   1.00 62.60  ?  191  GLY C O   1 
ATOM   9890  N  N   . GLY C  1 192 ? 28.738  3.120   3.595   1.00 60.29  ?  192  GLY C N   1 
ATOM   9891  C  CA  . GLY C  1 192 ? 28.947  2.635   4.938   1.00 53.72  ?  192  GLY C CA  1 
ATOM   9892  C  C   . GLY C  1 192 ? 28.896  1.124   5.023   1.00 54.66  ?  192  GLY C C   1 
ATOM   9893  O  O   . GLY C  1 192 ? 28.334  0.438   4.170   1.00 55.45  ?  192  GLY C O   1 
ATOM   9894  N  N   . ASP C  1 193 ? 29.500  0.602   6.088   1.00 55.76  ?  193  ASP C N   1 
ATOM   9895  C  CA  . ASP C  1 193 ? 29.526  -0.831  6.329   1.00 57.04  ?  193  ASP C CA  1 
ATOM   9896  C  C   . ASP C  1 193 ? 28.507  -1.176  7.403   1.00 55.49  ?  193  ASP C C   1 
ATOM   9897  O  O   . ASP C  1 193 ? 28.731  -0.850  8.576   1.00 53.69  ?  193  ASP C O   1 
ATOM   9898  C  CB  . ASP C  1 193 ? 30.928  -1.266  6.754   1.00 59.69  ?  193  ASP C CB  1 
ATOM   9899  C  CG  . ASP C  1 193 ? 31.068  -2.768  6.871   1.00 62.55  ?  193  ASP C CG  1 
ATOM   9900  O  OD1 . ASP C  1 193 ? 30.096  -3.492  6.562   1.00 63.76  ?  193  ASP C OD1 1 
ATOM   9901  O  OD2 . ASP C  1 193 ? 32.175  -3.229  7.224   1.00 59.12  ?  193  ASP C OD2 1 
ATOM   9902  N  N   . PRO C  1 194 ? 27.388  -1.825  7.067   1.00 57.00  ?  194  PRO C N   1 
ATOM   9903  C  CA  . PRO C  1 194 ? 26.380  -2.132  8.097   1.00 59.86  ?  194  PRO C CA  1 
ATOM   9904  C  C   . PRO C  1 194 ? 26.864  -3.112  9.157   1.00 64.08  ?  194  PRO C C   1 
ATOM   9905  O  O   . PRO C  1 194 ? 26.244  -3.195  10.228  1.00 64.29  ?  194  PRO C O   1 
ATOM   9906  C  CB  . PRO C  1 194 ? 25.215  -2.720  7.288   1.00 58.23  ?  194  PRO C CB  1 
ATOM   9907  C  CG  . PRO C  1 194 ? 25.413  -2.210  5.912   1.00 57.38  ?  194  PRO C CG  1 
ATOM   9908  C  CD  . PRO C  1 194 ? 26.902  -2.153  5.719   1.00 57.50  ?  194  PRO C CD  1 
ATOM   9909  N  N   . MET C  1 195 ? 27.936  -3.858  8.895   1.00 65.97  ?  195  MET C N   1 
ATOM   9910  C  CA  . MET C  1 195 ? 28.479  -4.806  9.855   1.00 64.95  ?  195  MET C CA  1 
ATOM   9911  C  C   . MET C  1 195 ? 29.559  -4.206  10.744  1.00 64.32  ?  195  MET C C   1 
ATOM   9912  O  O   . MET C  1 195 ? 30.104  -4.917  11.596  1.00 68.11  ?  195  MET C O   1 
ATOM   9913  C  CB  . MET C  1 195 ? 29.024  -6.035  9.129   1.00 69.29  ?  195  MET C CB  1 
ATOM   9914  C  CG  . MET C  1 195 ? 27.960  -7.050  8.772   1.00 73.42  ?  195  MET C CG  1 
ATOM   9915  S  SD  . MET C  1 195 ? 28.563  -8.206  7.535   1.00 81.67  ?  195  MET C SD  1 
ATOM   9916  C  CE  . MET C  1 195 ? 28.601  -7.144  6.083   1.00 83.17  ?  195  MET C CE  1 
ATOM   9917  N  N   . SER C  1 196 ? 29.905  -2.934  10.557  1.00 62.74  ?  196  SER C N   1 
ATOM   9918  C  CA  . SER C  1 196 ? 30.675  -2.195  11.549  1.00 62.60  ?  196  SER C CA  1 
ATOM   9919  C  C   . SER C  1 196 ? 29.883  -0.934  11.862  1.00 60.93  ?  196  SER C C   1 
ATOM   9920  O  O   . SER C  1 196 ? 29.865  0.007   11.064  1.00 64.24  ?  196  SER C O   1 
ATOM   9921  C  CB  . SER C  1 196 ? 32.073  -1.867  11.017  1.00 61.66  ?  196  SER C CB  1 
ATOM   9922  O  OG  . SER C  1 196 ? 32.958  -1.473  12.049  1.00 62.10  ?  196  SER C OG  1 
ATOM   9923  N  N   . VAL C  1 197 ? 29.290  -0.879  13.050  1.00 56.60  ?  197  VAL C N   1 
ATOM   9924  C  CA  . VAL C  1 197 ? 28.472  0.257   13.453  1.00 53.32  ?  197  VAL C CA  1 
ATOM   9925  C  C   . VAL C  1 197 ? 28.789  0.548   14.910  1.00 53.91  ?  197  VAL C C   1 
ATOM   9926  O  O   . VAL C  1 197 ? 28.647  -0.332  15.766  1.00 55.06  ?  197  VAL C O   1 
ATOM   9927  C  CB  . VAL C  1 197 ? 26.961  0.008   13.273  1.00 51.16  ?  197  VAL C CB  1 
ATOM   9928  C  CG1 . VAL C  1 197 ? 26.167  1.221   13.735  1.00 48.08  ?  197  VAL C CG1 1 
ATOM   9929  C  CG2 . VAL C  1 197 ? 26.624  -0.328  11.831  1.00 50.31  ?  197  VAL C CG2 1 
ATOM   9930  N  N   . THR C  1 198 ? 29.200  1.775   15.193  1.00 53.23  ?  198  THR C N   1 
ATOM   9931  C  CA  . THR C  1 198 ? 29.579  2.192   16.533  1.00 52.43  ?  198  THR C CA  1 
ATOM   9932  C  C   . THR C  1 198 ? 28.643  3.306   16.960  1.00 50.83  ?  198  THR C C   1 
ATOM   9933  O  O   . THR C  1 198 ? 28.574  4.346   16.297  1.00 50.55  ?  198  THR C O   1 
ATOM   9934  C  CB  . THR C  1 198 ? 31.037  2.654   16.570  1.00 48.99  ?  198  THR C CB  1 
ATOM   9935  O  OG1 . THR C  1 198 ? 31.880  1.614   16.060  1.00 50.48  ?  198  THR C OG1 1 
ATOM   9936  C  CG2 . THR C  1 198 ? 31.461  3.006   17.985  1.00 48.67  ?  198  THR C CG2 1 
ATOM   9937  N  N   . LEU C  1 199 ? 27.904  3.074   18.040  1.00 50.00  ?  199  LEU C N   1 
ATOM   9938  C  CA  . LEU C  1 199 ? 27.130  4.131   18.669  1.00 47.33  ?  199  LEU C CA  1 
ATOM   9939  C  C   . LEU C  1 199 ? 28.029  4.937   19.591  1.00 47.79  ?  199  LEU C C   1 
ATOM   9940  O  O   . LEU C  1 199 ? 28.818  4.376   20.356  1.00 50.84  ?  199  LEU C O   1 
ATOM   9941  C  CB  . LEU C  1 199 ? 25.963  3.545   19.464  1.00 44.75  ?  199  LEU C CB  1 
ATOM   9942  C  CG  . LEU C  1 199 ? 25.033  2.571   18.746  1.00 55.07  ?  199  LEU C CG  1 
ATOM   9943  C  CD1 . LEU C  1 199 ? 23.962  2.092   19.696  1.00 44.82  ?  199  LEU C CD1 1 
ATOM   9944  C  CD2 . LEU C  1 199 ? 24.403  3.220   17.513  1.00 52.44  ?  199  LEU C CD2 1 
ATOM   9945  N  N   . PHE C  1 200 ? 27.926  6.261   19.506  1.00 46.06  ?  200  PHE C N   1 
ATOM   9946  C  CA  . PHE C  1 200 ? 28.575  7.108   20.494  1.00 47.69  ?  200  PHE C CA  1 
ATOM   9947  C  C   . PHE C  1 200 ? 27.692  8.317   20.767  1.00 48.09  ?  200  PHE C C   1 
ATOM   9948  O  O   . PHE C  1 200 ? 27.084  8.873   19.850  1.00 45.48  ?  200  PHE C O   1 
ATOM   9949  C  CB  . PHE C  1 200 ? 29.999  7.507   20.060  1.00 48.18  ?  200  PHE C CB  1 
ATOM   9950  C  CG  . PHE C  1 200 ? 30.076  8.534   18.959  1.00 49.56  ?  200  PHE C CG  1 
ATOM   9951  C  CD1 . PHE C  1 200 ? 29.445  8.339   17.742  1.00 49.72  ?  200  PHE C CD1 1 
ATOM   9952  C  CD2 . PHE C  1 200 ? 30.864  9.667   19.123  1.00 50.06  ?  200  PHE C CD2 1 
ATOM   9953  C  CE1 . PHE C  1 200 ? 29.558  9.285   16.729  1.00 50.07  ?  200  PHE C CE1 1 
ATOM   9954  C  CE2 . PHE C  1 200 ? 30.984  10.610  18.120  1.00 48.56  ?  200  PHE C CE2 1 
ATOM   9955  C  CZ  . PHE C  1 200 ? 30.328  10.422  16.922  1.00 49.40  ?  200  PHE C CZ  1 
ATOM   9956  N  N   . GLY C  1 201 ? 27.603  8.690   22.042  1.00 49.98  ?  201  GLY C N   1 
ATOM   9957  C  CA  . GLY C  1 201 ? 26.770  9.800   22.464  1.00 50.12  ?  201  GLY C CA  1 
ATOM   9958  C  C   . GLY C  1 201 ? 27.278  10.368  23.769  1.00 52.21  ?  201  GLY C C   1 
ATOM   9959  O  O   . GLY C  1 201 ? 28.165  9.806   24.416  1.00 53.40  ?  201  GLY C O   1 
ATOM   9960  N  N   . GLU C  1 202 ? 26.694  11.501  24.151  1.00 53.55  ?  202  GLU C N   1 
ATOM   9961  C  CA  . GLU C  1 202 ? 27.099  12.236  25.340  1.00 54.82  ?  202  GLU C CA  1 
ATOM   9962  C  C   . GLU C  1 202 ? 25.864  12.625  26.141  1.00 54.67  ?  202  GLU C C   1 
ATOM   9963  O  O   . GLU C  1 202 ? 24.785  12.827  25.579  1.00 58.37  ?  202  GLU C O   1 
ATOM   9964  C  CB  . GLU C  1 202 ? 27.916  13.484  24.965  1.00 54.66  ?  202  GLU C CB  1 
ATOM   9965  C  CG  . GLU C  1 202 ? 28.622  14.174  26.123  1.00 54.79  ?  202  GLU C CG  1 
ATOM   9966  C  CD  . GLU C  1 202 ? 27.755  15.229  26.800  1.00 53.02  ?  202  GLU C CD  1 
ATOM   9967  O  OE1 . GLU C  1 202 ? 26.690  15.573  26.247  1.00 52.84  ?  202  GLU C OE1 1 
ATOM   9968  O  OE2 . GLU C  1 202 ? 28.142  15.723  27.879  1.00 50.97  ?  202  GLU C OE2 1 
ATOM   9969  N  N   . SER C  1 203 ? 26.031  12.724  27.461  1.00 49.72  ?  203  SER C N   1 
ATOM   9970  C  CA  . SER C  1 203 ? 24.938  13.019  28.401  1.00 46.48  ?  203  SER C CA  1 
ATOM   9971  C  C   . SER C  1 203 ? 23.804  12.033  28.115  1.00 45.20  ?  203  SER C C   1 
ATOM   9972  O  O   . SER C  1 203 ? 24.058  10.821  28.071  1.00 43.85  ?  203  SER C O   1 
ATOM   9973  C  CB  . SER C  1 203 ? 24.554  14.492  28.319  1.00 45.54  ?  203  SER C CB  1 
ATOM   9974  O  OG  . SER C  1 203 ? 23.471  14.789  29.194  1.00 44.26  ?  203  SER C OG  1 
ATOM   9975  N  N   . ALA C  1 204 ? 22.568  12.498  27.914  1.00 44.21  ?  204  ALA C N   1 
ATOM   9976  C  CA  . ALA C  1 204 ? 21.450  11.585  27.699  1.00 45.16  ?  204  ALA C CA  1 
ATOM   9977  C  C   . ALA C  1 204 ? 21.711  10.661  26.520  1.00 45.73  ?  204  ALA C C   1 
ATOM   9978  O  O   . ALA C  1 204 ? 21.398  9.465   26.581  1.00 48.40  ?  204  ALA C O   1 
ATOM   9979  C  CB  . ALA C  1 204 ? 20.161  12.375  27.485  1.00 46.09  ?  204  ALA C CB  1 
ATOM   9980  N  N   . GLY C  1 205 ? 22.291  11.195  25.442  1.00 44.04  ?  205  GLY C N   1 
ATOM   9981  C  CA  . GLY C  1 205 ? 22.675  10.351  24.322  1.00 45.11  ?  205  GLY C CA  1 
ATOM   9982  C  C   . GLY C  1 205 ? 23.496  9.154   24.755  1.00 47.92  ?  205  GLY C C   1 
ATOM   9983  O  O   . GLY C  1 205 ? 23.193  8.013   24.389  1.00 48.22  ?  205  GLY C O   1 
ATOM   9984  N  N   . ALA C  1 206 ? 24.526  9.396   25.575  1.00 49.49  ?  206  ALA C N   1 
ATOM   9985  C  CA  . ALA C  1 206 ? 25.295  8.301   26.166  1.00 48.60  ?  206  ALA C CA  1 
ATOM   9986  C  C   . ALA C  1 206 ? 24.381  7.309   26.872  1.00 45.34  ?  206  ALA C C   1 
ATOM   9987  O  O   . ALA C  1 206 ? 24.432  6.103   26.605  1.00 43.68  ?  206  ALA C O   1 
ATOM   9988  C  CB  . ALA C  1 206 ? 26.341  8.850   27.138  1.00 50.23  ?  206  ALA C CB  1 
ATOM   9989  N  N   . ALA C  1 207 ? 23.518  7.807   27.763  1.00 41.51  ?  207  ALA C N   1 
ATOM   9990  C  CA  . ALA C  1 207 ? 22.541  6.939   28.408  1.00 41.67  ?  207  ALA C CA  1 
ATOM   9991  C  C   . ALA C  1 207 ? 21.773  6.132   27.375  1.00 45.25  ?  207  ALA C C   1 
ATOM   9992  O  O   . ALA C  1 207 ? 21.642  4.907   27.492  1.00 49.23  ?  207  ALA C O   1 
ATOM   9993  C  CB  . ALA C  1 207 ? 21.580  7.767   29.258  1.00 44.90  ?  207  ALA C CB  1 
ATOM   9994  N  N   . SER C  1 208 ? 21.296  6.809   26.328  1.00 47.32  ?  208  SER C N   1 
ATOM   9995  C  CA  . SER C  1 208 ? 20.572  6.134   25.258  1.00 48.12  ?  208  SER C CA  1 
ATOM   9996  C  C   . SER C  1 208 ? 21.396  4.989   24.690  1.00 47.92  ?  208  SER C C   1 
ATOM   9997  O  O   . SER C  1 208 ? 20.910  3.857   24.560  1.00 48.41  ?  208  SER C O   1 
ATOM   9998  C  CB  . SER C  1 208 ? 20.221  7.144   24.167  1.00 48.35  ?  208  SER C CB  1 
ATOM   9999  O  OG  . SER C  1 208 ? 19.435  8.197   24.696  1.00 49.05  ?  208  SER C OG  1 
ATOM   10000 N  N   . VAL C  1 209 ? 22.666  5.264   24.378  1.00 46.39  ?  209  VAL C N   1 
ATOM   10001 C  CA  . VAL C  1 209 ? 23.555  4.214   23.894  1.00 45.31  ?  209  VAL C CA  1 
ATOM   10002 C  C   . VAL C  1 209 ? 23.513  3.029   24.845  1.00 46.40  ?  209  VAL C C   1 
ATOM   10003 O  O   . VAL C  1 209 ? 23.220  1.897   24.441  1.00 48.57  ?  209  VAL C O   1 
ATOM   10004 C  CB  . VAL C  1 209 ? 24.984  4.759   23.723  1.00 45.17  ?  209  VAL C CB  1 
ATOM   10005 C  CG1 . VAL C  1 209 ? 25.945  3.637   23.381  1.00 45.76  ?  209  VAL C CG1 1 
ATOM   10006 C  CG2 . VAL C  1 209 ? 25.008  5.837   22.650  1.00 44.06  ?  209  VAL C CG2 1 
ATOM   10007 N  N   . GLY C  1 210 ? 23.732  3.294   26.137  1.00 45.77  ?  210  GLY C N   1 
ATOM   10008 C  CA  . GLY C  1 210 ? 23.718  2.223   27.119  1.00 46.17  ?  210  GLY C CA  1 
ATOM   10009 C  C   . GLY C  1 210 ? 22.431  1.427   27.094  1.00 46.00  ?  210  GLY C C   1 
ATOM   10010 O  O   . GLY C  1 210 ? 22.446  0.198   27.207  1.00 47.26  ?  210  GLY C O   1 
ATOM   10011 N  N   . MET C  1 211 ? 21.298  2.109   26.903  1.00 44.17  ?  211  MET C N   1 
ATOM   10012 C  CA  . MET C  1 211 ? 20.033  1.391   26.900  1.00 44.43  ?  211  MET C CA  1 
ATOM   10013 C  C   . MET C  1 211 ? 19.875  0.544   25.650  1.00 44.55  ?  211  MET C C   1 
ATOM   10014 O  O   . MET C  1 211 ? 19.312  -0.556  25.721  1.00 45.32  ?  211  MET C O   1 
ATOM   10015 C  CB  . MET C  1 211 ? 18.881  2.374   27.063  1.00 45.31  ?  211  MET C CB  1 
ATOM   10016 C  CG  . MET C  1 211 ? 18.881  2.952   28.458  1.00 49.85  ?  211  MET C CG  1 
ATOM   10017 S  SD  . MET C  1 211 ? 17.659  4.214   28.765  1.00 55.13  ?  211  MET C SD  1 
ATOM   10018 C  CE  . MET C  1 211 ? 18.232  4.815   30.349  1.00 56.73  ?  211  MET C CE  1 
ATOM   10019 N  N   . HIS C  1 212 ? 20.406  1.003   24.515  1.00 44.27  ?  212  HIS C N   1 
ATOM   10020 C  CA  . HIS C  1 212 ? 20.451  0.134   23.347  1.00 45.63  ?  212  HIS C CA  1 
ATOM   10021 C  C   . HIS C  1 212 ? 21.296  -1.103  23.621  1.00 46.95  ?  212  HIS C C   1 
ATOM   10022 O  O   . HIS C  1 212 ? 21.068  -2.156  23.018  1.00 48.93  ?  212  HIS C O   1 
ATOM   10023 C  CB  . HIS C  1 212 ? 20.989  0.896   22.134  1.00 45.35  ?  212  HIS C CB  1 
ATOM   10024 C  CG  . HIS C  1 212 ? 20.060  1.953   21.618  1.00 44.69  ?  212  HIS C CG  1 
ATOM   10025 N  ND1 . HIS C  1 212 ? 18.793  1.673   21.153  1.00 44.53  ?  212  HIS C ND1 1 
ATOM   10026 C  CD2 . HIS C  1 212 ? 20.217  3.294   21.494  1.00 44.37  ?  212  HIS C CD2 1 
ATOM   10027 C  CE1 . HIS C  1 212 ? 18.208  2.795   20.769  1.00 44.52  ?  212  HIS C CE1 1 
ATOM   10028 N  NE2 . HIS C  1 212 ? 19.051  3.793   20.966  1.00 42.61  ?  212  HIS C NE2 1 
ATOM   10029 N  N   . ILE C  1 213 ? 22.266  -1.002  24.531  1.00 47.88  ?  213  ILE C N   1 
ATOM   10030 C  CA  . ILE C  1 213 ? 23.019  -2.185  24.927  1.00 51.01  ?  213  ILE C CA  1 
ATOM   10031 C  C   . ILE C  1 213 ? 22.143  -3.119  25.755  1.00 54.68  ?  213  ILE C C   1 
ATOM   10032 O  O   . ILE C  1 213 ? 22.216  -4.346  25.616  1.00 58.55  ?  213  ILE C O   1 
ATOM   10033 C  CB  . ILE C  1 213 ? 24.291  -1.776  25.692  1.00 50.67  ?  213  ILE C CB  1 
ATOM   10034 C  CG1 . ILE C  1 213 ? 25.271  -1.068  24.760  1.00 50.05  ?  213  ILE C CG1 1 
ATOM   10035 C  CG2 . ILE C  1 213 ? 24.949  -2.994  26.321  1.00 52.30  ?  213  ILE C CG2 1 
ATOM   10036 C  CD1 . ILE C  1 213 ? 26.572  -0.677  25.428  1.00 47.33  ?  213  ILE C CD1 1 
ATOM   10037 N  N   . LEU C  1 214 ? 21.295  -2.559  26.620  1.00 53.58  ?  214  LEU C N   1 
ATOM   10038 C  CA  . LEU C  1 214 ? 20.497  -3.358  27.540  1.00 52.87  ?  214  LEU C CA  1 
ATOM   10039 C  C   . LEU C  1 214 ? 19.156  -3.784  26.960  1.00 51.77  ?  214  LEU C C   1 
ATOM   10040 O  O   . LEU C  1 214 ? 18.479  -4.629  27.559  1.00 52.10  ?  214  LEU C O   1 
ATOM   10041 C  CB  . LEU C  1 214 ? 20.268  -2.579  28.837  1.00 51.93  ?  214  LEU C CB  1 
ATOM   10042 C  CG  . LEU C  1 214 ? 21.527  -2.127  29.574  1.00 50.86  ?  214  LEU C CG  1 
ATOM   10043 C  CD1 . LEU C  1 214 ? 21.153  -1.152  30.679  1.00 50.58  ?  214  LEU C CD1 1 
ATOM   10044 C  CD2 . LEU C  1 214 ? 22.278  -3.328  30.133  1.00 49.83  ?  214  LEU C CD2 1 
ATOM   10045 N  N   . SER C  1 215 ? 18.759  -3.223  25.822  1.00 52.60  ?  215  SER C N   1 
ATOM   10046 C  CA  . SER C  1 215 ? 17.516  -3.583  25.153  1.00 56.60  ?  215  SER C CA  1 
ATOM   10047 C  C   . SER C  1 215 ? 17.841  -4.576  24.046  1.00 58.64  ?  215  SER C C   1 
ATOM   10048 O  O   . SER C  1 215 ? 18.620  -4.266  23.137  1.00 59.88  ?  215  SER C O   1 
ATOM   10049 C  CB  . SER C  1 215 ? 16.816  -2.347  24.587  1.00 58.20  ?  215  SER C CB  1 
ATOM   10050 O  OG  . SER C  1 215 ? 15.614  -2.706  23.924  1.00 60.46  ?  215  SER C OG  1 
ATOM   10051 N  N   . LEU C  1 216 ? 17.254  -5.767  24.129  1.00 59.67  ?  216  LEU C N   1 
ATOM   10052 C  CA  . LEU C  1 216 ? 17.662  -6.841  23.228  1.00 61.78  ?  216  LEU C CA  1 
ATOM   10053 C  C   . LEU C  1 216 ? 17.343  -6.566  21.760  1.00 62.85  ?  216  LEU C C   1 
ATOM   10054 O  O   . LEU C  1 216 ? 18.183  -6.902  20.907  1.00 65.26  ?  216  LEU C O   1 
ATOM   10055 C  CB  . LEU C  1 216 ? 17.046  -8.166  23.694  1.00 63.35  ?  216  LEU C CB  1 
ATOM   10056 C  CG  . LEU C  1 216 ? 17.707  -9.426  23.138  1.00 66.19  ?  216  LEU C CG  1 
ATOM   10057 C  CD1 . LEU C  1 216 ? 17.762  -10.487 24.226  1.00 68.90  ?  216  LEU C CD1 1 
ATOM   10058 C  CD2 . LEU C  1 216 ? 16.991  -9.954  21.898  1.00 67.03  ?  216  LEU C CD2 1 
ATOM   10059 N  N   . PRO C  1 217 ? 16.189  -5.997  21.386  1.00 61.03  ?  217  PRO C N   1 
ATOM   10060 C  CA  . PRO C  1 217 ? 15.963  -5.710  19.959  1.00 60.03  ?  217  PRO C CA  1 
ATOM   10061 C  C   . PRO C  1 217 ? 16.997  -4.776  19.352  1.00 61.32  ?  217  PRO C C   1 
ATOM   10062 O  O   . PRO C  1 217 ? 17.316  -4.913  18.163  1.00 64.98  ?  217  PRO C O   1 
ATOM   10063 C  CB  . PRO C  1 217 ? 14.560  -5.091  19.949  1.00 57.44  ?  217  PRO C CB  1 
ATOM   10064 C  CG  . PRO C  1 217 ? 13.896  -5.691  21.130  1.00 58.91  ?  217  PRO C CG  1 
ATOM   10065 C  CD  . PRO C  1 217 ? 14.961  -5.782  22.176  1.00 60.29  ?  217  PRO C CD  1 
ATOM   10066 N  N   . SER C  1 218 ? 17.549  -3.840  20.130  1.00 58.51  ?  218  SER C N   1 
ATOM   10067 C  CA  . SER C  1 218 ? 18.544  -2.923  19.583  1.00 56.18  ?  218  SER C CA  1 
ATOM   10068 C  C   . SER C  1 218 ? 19.904  -3.574  19.381  1.00 57.74  ?  218  SER C C   1 
ATOM   10069 O  O   . SER C  1 218 ? 20.776  -2.967  18.753  1.00 57.01  ?  218  SER C O   1 
ATOM   10070 C  CB  . SER C  1 218 ? 18.694  -1.709  20.497  1.00 52.53  ?  218  SER C CB  1 
ATOM   10071 O  OG  . SER C  1 218 ? 17.473  -1.005  20.605  1.00 50.81  ?  218  SER C OG  1 
ATOM   10072 N  N   . ARG C  1 219 ? 20.106  -4.789  19.884  1.00 60.62  ?  219  ARG C N   1 
ATOM   10073 C  CA  . ARG C  1 219 ? 21.442  -5.370  19.928  1.00 63.87  ?  219  ARG C CA  1 
ATOM   10074 C  C   . ARG C  1 219 ? 21.951  -5.820  18.565  1.00 60.06  ?  219  ARG C C   1 
ATOM   10075 O  O   . ARG C  1 219 ? 23.167  -5.945  18.388  1.00 59.20  ?  219  ARG C O   1 
ATOM   10076 C  CB  . ARG C  1 219 ? 21.442  -6.531  20.914  1.00 71.71  ?  219  ARG C CB  1 
ATOM   10077 C  CG  . ARG C  1 219 ? 21.991  -6.166  22.286  1.00 77.13  ?  219  ARG C CG  1 
ATOM   10078 C  CD  . ARG C  1 219 ? 23.402  -5.681  22.152  1.00 81.40  ?  219  ARG C CD  1 
ATOM   10079 N  NE  . ARG C  1 219 ? 24.260  -6.289  23.160  1.00 84.17  ?  219  ARG C NE  1 
ATOM   10080 C  CZ  . ARG C  1 219 ? 25.582  -6.267  23.111  1.00 83.48  ?  219  ARG C CZ  1 
ATOM   10081 N  NH1 . ARG C  1 219 ? 26.184  -5.692  22.082  1.00 80.35  ?  219  ARG C NH1 1 
ATOM   10082 N  NH2 . ARG C  1 219 ? 26.284  -6.851  24.071  1.00 83.94  ?  219  ARG C NH2 1 
ATOM   10083 N  N   . SER C  1 220 ? 21.065  -6.064  17.605  1.00 58.22  ?  220  SER C N   1 
ATOM   10084 C  CA  . SER C  1 220 ? 21.469  -6.476  16.268  1.00 57.42  ?  220  SER C CA  1 
ATOM   10085 C  C   . SER C  1 220 ? 21.761  -5.302  15.340  1.00 56.20  ?  220  SER C C   1 
ATOM   10086 O  O   . SER C  1 220 ? 22.129  -5.525  14.183  1.00 55.36  ?  220  SER C O   1 
ATOM   10087 C  CB  . SER C  1 220 ? 20.381  -7.352  15.649  1.00 58.36  ?  220  SER C CB  1 
ATOM   10088 O  OG  . SER C  1 220 ? 19.215  -6.589  15.400  1.00 58.81  ?  220  SER C OG  1 
ATOM   10089 N  N   . LEU C  1 221 ? 21.571  -4.069  15.805  1.00 54.19  ?  221  LEU C N   1 
ATOM   10090 C  CA  . LEU C  1 221 ? 21.773  -2.875  14.998  1.00 51.67  ?  221  LEU C CA  1 
ATOM   10091 C  C   . LEU C  1 221 ? 23.135  -2.213  15.204  1.00 50.72  ?  221  LEU C C   1 
ATOM   10092 O  O   . LEU C  1 221 ? 23.423  -1.209  14.543  1.00 50.68  ?  221  LEU C O   1 
ATOM   10093 C  CB  . LEU C  1 221 ? 20.656  -1.871  15.298  1.00 50.68  ?  221  LEU C CB  1 
ATOM   10094 C  CG  . LEU C  1 221 ? 19.268  -2.517  15.340  1.00 51.01  ?  221  LEU C CG  1 
ATOM   10095 C  CD1 . LEU C  1 221 ? 18.208  -1.527  15.796  1.00 49.25  ?  221  LEU C CD1 1 
ATOM   10096 C  CD2 . LEU C  1 221 ? 18.907  -3.100  13.981  1.00 52.71  ?  221  LEU C CD2 1 
ATOM   10097 N  N   . PHE C  1 222 ? 23.969  -2.727  16.106  1.00 50.16  ?  222  PHE C N   1 
ATOM   10098 C  CA  . PHE C  1 222 ? 25.269  -2.116  16.353  1.00 49.49  ?  222  PHE C CA  1 
ATOM   10099 C  C   . PHE C  1 222 ? 26.214  -3.152  16.949  1.00 50.51  ?  222  PHE C C   1 
ATOM   10100 O  O   . PHE C  1 222 ? 25.811  -4.248  17.341  1.00 52.53  ?  222  PHE C O   1 
ATOM   10101 C  CB  . PHE C  1 222 ? 25.166  -0.872  17.243  1.00 49.56  ?  222  PHE C CB  1 
ATOM   10102 C  CG  . PHE C  1 222 ? 24.792  -1.161  18.659  1.00 48.46  ?  222  PHE C CG  1 
ATOM   10103 C  CD1 . PHE C  1 222 ? 23.478  -1.404  19.003  1.00 47.39  ?  222  PHE C CD1 1 
ATOM   10104 C  CD2 . PHE C  1 222 ? 25.755  -1.175  19.649  1.00 48.32  ?  222  PHE C CD2 1 
ATOM   10105 C  CE1 . PHE C  1 222 ? 23.135  -1.663  20.301  1.00 48.91  ?  222  PHE C CE1 1 
ATOM   10106 C  CE2 . PHE C  1 222 ? 25.416  -1.439  20.950  1.00 49.24  ?  222  PHE C CE2 1 
ATOM   10107 C  CZ  . PHE C  1 222 ? 24.103  -1.682  21.278  1.00 49.10  ?  222  PHE C CZ  1 
ATOM   10108 N  N   . HIS C  1 223 ? 27.494  -2.789  16.956  1.00 50.82  ?  223  HIS C N   1 
ATOM   10109 C  CA  . HIS C  1 223 ? 28.609  -3.646  17.346  1.00 55.56  ?  223  HIS C CA  1 
ATOM   10110 C  C   . HIS C  1 223 ? 29.373  -3.085  18.539  1.00 54.84  ?  223  HIS C C   1 
ATOM   10111 O  O   . HIS C  1 223 ? 29.514  -3.770  19.556  1.00 56.29  ?  223  HIS C O   1 
ATOM   10112 C  CB  . HIS C  1 223 ? 29.506  -3.861  16.126  1.00 57.10  ?  223  HIS C CB  1 
ATOM   10113 C  CG  . HIS C  1 223 ? 28.750  -4.363  14.938  1.00 61.98  ?  223  HIS C CG  1 
ATOM   10114 N  ND1 . HIS C  1 223 ? 28.065  -3.527  14.082  1.00 63.62  ?  223  HIS C ND1 1 
ATOM   10115 C  CD2 . HIS C  1 223 ? 28.527  -5.623  14.493  1.00 66.09  ?  223  HIS C CD2 1 
ATOM   10116 C  CE1 . HIS C  1 223 ? 27.471  -4.250  13.148  1.00 66.66  ?  223  HIS C CE1 1 
ATOM   10117 N  NE2 . HIS C  1 223 ? 27.738  -5.525  13.374  1.00 67.62  ?  223  HIS C NE2 1 
ATOM   10118 N  N   . ARG C  1 224 ? 29.911  -1.879  18.424  1.00 53.90  ?  224  ARG C N   1 
ATOM   10119 C  CA  . ARG C  1 224 ? 30.660  -1.216  19.476  1.00 54.44  ?  224  ARG C CA  1 
ATOM   10120 C  C   . ARG C  1 224 ? 29.868  -0.023  19.999  1.00 53.49  ?  224  ARG C C   1 
ATOM   10121 O  O   . ARG C  1 224 ? 28.977  0.498   19.323  1.00 53.26  ?  224  ARG C O   1 
ATOM   10122 C  CB  . ARG C  1 224 ? 32.021  -0.748  18.953  1.00 56.36  ?  224  ARG C CB  1 
ATOM   10123 C  CG  . ARG C  1 224 ? 33.004  -1.867  18.697  1.00 58.88  ?  224  ARG C CG  1 
ATOM   10124 C  CD  . ARG C  1 224 ? 33.942  -1.513  17.566  1.00 60.23  ?  224  ARG C CD  1 
ATOM   10125 N  NE  . ARG C  1 224 ? 33.375  -1.893  16.280  1.00 61.28  ?  224  ARG C NE  1 
ATOM   10126 C  CZ  . ARG C  1 224 ? 33.476  -3.112  15.765  1.00 64.01  ?  224  ARG C CZ  1 
ATOM   10127 N  NH1 . ARG C  1 224 ? 34.133  -4.056  16.426  1.00 66.27  ?  224  ARG C NH1 1 
ATOM   10128 N  NH2 . ARG C  1 224 ? 32.930  -3.389  14.589  1.00 64.79  ?  224  ARG C NH2 1 
ATOM   10129 N  N   . ALA C  1 225 ? 30.163  0.371   21.242  1.00 53.14  ?  225  ALA C N   1 
ATOM   10130 C  CA  . ALA C  1 225 ? 29.483  1.492   21.880  1.00 52.02  ?  225  ALA C CA  1 
ATOM   10131 C  C   . ALA C  1 225 ? 30.484  2.399   22.590  1.00 52.05  ?  225  ALA C C   1 
ATOM   10132 O  O   . ALA C  1 225 ? 31.521  1.946   23.081  1.00 52.93  ?  225  ALA C O   1 
ATOM   10133 C  CB  . ALA C  1 225 ? 28.426  1.008   22.878  1.00 47.13  ?  225  ALA C CB  1 
ATOM   10134 N  N   . VAL C  1 226 ? 30.152  3.690   22.642  1.00 51.29  ?  226  VAL C N   1 
ATOM   10135 C  CA  . VAL C  1 226 ? 30.932  4.696   23.358  1.00 51.74  ?  226  VAL C CA  1 
ATOM   10136 C  C   . VAL C  1 226 ? 29.969  5.503   24.220  1.00 52.71  ?  226  VAL C C   1 
ATOM   10137 O  O   . VAL C  1 226 ? 28.993  6.060   23.705  1.00 54.30  ?  226  VAL C O   1 
ATOM   10138 C  CB  . VAL C  1 226 ? 31.700  5.627   22.402  1.00 51.15  ?  226  VAL C CB  1 
ATOM   10139 C  CG1 . VAL C  1 226 ? 32.611  6.571   23.177  1.00 51.11  ?  226  VAL C CG1 1 
ATOM   10140 C  CG2 . VAL C  1 226 ? 32.492  4.828   21.386  1.00 52.36  ?  226  VAL C CG2 1 
ATOM   10141 N  N   . LEU C  1 227 ? 30.233  5.564   25.526  1.00 52.11  ?  227  LEU C N   1 
ATOM   10142 C  CA  . LEU C  1 227 ? 29.404  6.326   26.458  1.00 50.45  ?  227  LEU C CA  1 
ATOM   10143 C  C   . LEU C  1 227 ? 30.235  7.466   27.034  1.00 50.79  ?  227  LEU C C   1 
ATOM   10144 O  O   . LEU C  1 227 ? 31.168  7.232   27.809  1.00 54.34  ?  227  LEU C O   1 
ATOM   10145 C  CB  . LEU C  1 227 ? 28.849  5.432   27.566  1.00 49.67  ?  227  LEU C CB  1 
ATOM   10146 C  CG  . LEU C  1 227 ? 27.778  4.414   27.157  1.00 51.34  ?  227  LEU C CG  1 
ATOM   10147 C  CD1 . LEU C  1 227 ? 28.399  3.102   26.717  1.00 45.69  ?  227  LEU C CD1 1 
ATOM   10148 C  CD2 . LEU C  1 227 ? 26.791  4.192   28.286  1.00 44.40  ?  227  LEU C CD2 1 
ATOM   10149 N  N   . GLN C  1 228 ? 29.891  8.697   26.662  1.00 48.85  ?  228  GLN C N   1 
ATOM   10150 C  CA  . GLN C  1 228 ? 30.614  9.889   27.094  1.00 50.38  ?  228  GLN C CA  1 
ATOM   10151 C  C   . GLN C  1 228 ? 29.753  10.631  28.110  1.00 54.76  ?  228  GLN C C   1 
ATOM   10152 O  O   . GLN C  1 228 ? 28.697  11.167  27.757  1.00 58.68  ?  228  GLN C O   1 
ATOM   10153 C  CB  . GLN C  1 228 ? 30.949  10.787  25.904  1.00 48.40  ?  228  GLN C CB  1 
ATOM   10154 C  CG  . GLN C  1 228 ? 31.579  10.049  24.734  1.00 49.28  ?  228  GLN C CG  1 
ATOM   10155 C  CD  . GLN C  1 228 ? 31.908  10.961  23.558  1.00 49.49  ?  228  GLN C CD  1 
ATOM   10156 O  OE1 . GLN C  1 228 ? 32.401  10.505  22.528  1.00 45.37  ?  228  GLN C OE1 1 
ATOM   10157 N  NE2 . GLN C  1 228 ? 31.637  12.253  23.712  1.00 49.69  ?  228  GLN C NE2 1 
ATOM   10158 N  N   . SER C  1 229 ? 30.205  10.657  29.367  1.00 52.69  ?  229  SER C N   1 
ATOM   10159 C  CA  . SER C  1 229 ? 29.556  11.422  30.433  1.00 48.29  ?  229  SER C CA  1 
ATOM   10160 C  C   . SER C  1 229 ? 28.067  11.105  30.532  1.00 42.88  ?  229  SER C C   1 
ATOM   10161 O  O   . SER C  1 229 ? 27.219  11.997  30.595  1.00 44.49  ?  229  SER C O   1 
ATOM   10162 C  CB  . SER C  1 229 ? 29.774  12.923  30.242  1.00 44.78  ?  229  SER C CB  1 
ATOM   10163 O  OG  . SER C  1 229 ? 31.150  13.214  30.102  1.00 45.66  ?  229  SER C OG  1 
ATOM   10164 N  N   . GLY C  1 230 ? 27.750  9.818   30.534  1.00 44.64  ?  230  GLY C N   1 
ATOM   10165 C  CA  . GLY C  1 230 ? 26.383  9.392   30.758  1.00 44.25  ?  230  GLY C CA  1 
ATOM   10166 C  C   . GLY C  1 230 ? 26.307  7.888   30.850  1.00 44.63  ?  230  GLY C C   1 
ATOM   10167 O  O   . GLY C  1 230 ? 27.183  7.173   30.353  1.00 46.51  ?  230  GLY C O   1 
ATOM   10168 N  N   . THR C  1 231 ? 25.245  7.415   31.499  1.00 43.89  ?  231  THR C N   1 
ATOM   10169 C  CA  . THR C  1 231 ? 25.052  5.995   31.761  1.00 44.79  ?  231  THR C CA  1 
ATOM   10170 C  C   . THR C  1 231 ? 23.570  5.657   31.748  1.00 45.05  ?  231  THR C C   1 
ATOM   10171 O  O   . THR C  1 231 ? 22.736  6.522   32.040  1.00 44.06  ?  231  THR C O   1 
ATOM   10172 C  CB  . THR C  1 231 ? 25.657  5.596   33.114  1.00 47.31  ?  231  THR C CB  1 
ATOM   10173 O  OG1 . THR C  1 231 ? 25.320  6.586   34.096  1.00 47.29  ?  231  THR C OG1 1 
ATOM   10174 C  CG2 . THR C  1 231 ? 27.166  5.455   33.011  1.00 47.03  ?  231  THR C CG2 1 
ATOM   10175 N  N   . PRO C  1 232 ? 23.209  4.413   31.410  1.00 46.00  ?  232  PRO C N   1 
ATOM   10176 C  CA  . PRO C  1 232 ? 21.811  3.985   31.607  1.00 47.03  ?  232  PRO C CA  1 
ATOM   10177 C  C   . PRO C  1 232 ? 21.429  3.839   33.074  1.00 49.47  ?  232  PRO C C   1 
ATOM   10178 O  O   . PRO C  1 232 ? 20.286  4.132   33.453  1.00 51.44  ?  232  PRO C O   1 
ATOM   10179 C  CB  . PRO C  1 232 ? 21.758  2.647   30.860  1.00 46.35  ?  232  PRO C CB  1 
ATOM   10180 C  CG  . PRO C  1 232 ? 23.150  2.132   30.940  1.00 44.75  ?  232  PRO C CG  1 
ATOM   10181 C  CD  . PRO C  1 232 ? 24.047  3.332   30.864  1.00 47.24  ?  232  PRO C CD  1 
ATOM   10182 N  N   . ASN C  1 233 ? 22.352  3.364   33.904  1.00 48.92  ?  233  ASN C N   1 
ATOM   10183 C  CA  . ASN C  1 233 ? 22.206  3.332   35.349  1.00 47.52  ?  233  ASN C CA  1 
ATOM   10184 C  C   . ASN C  1 233 ? 22.380  4.727   35.952  1.00 47.59  ?  233  ASN C C   1 
ATOM   10185 O  O   . ASN C  1 233 ? 22.884  5.656   35.315  1.00 45.16  ?  233  ASN C O   1 
ATOM   10186 C  CB  . ASN C  1 233 ? 23.206  2.357   35.965  1.00 46.96  ?  233  ASN C CB  1 
ATOM   10187 C  CG  . ASN C  1 233 ? 24.633  2.677   35.593  1.00 48.98  ?  233  ASN C CG  1 
ATOM   10188 O  OD1 . ASN C  1 233 ? 24.932  2.901   34.427  1.00 50.53  ?  233  ASN C OD1 1 
ATOM   10189 N  ND2 . ASN C  1 233 ? 25.525  2.686   36.577  1.00 50.94  ?  233  ASN C ND2 1 
ATOM   10190 N  N   . GLY C  1 234 ? 21.933  4.867   37.196  1.00 49.67  ?  234  GLY C N   1 
ATOM   10191 C  CA  . GLY C  1 234 ? 22.117  6.089   37.942  1.00 49.46  ?  234  GLY C CA  1 
ATOM   10192 C  C   . GLY C  1 234 ? 20.852  6.895   38.158  1.00 49.33  ?  234  GLY C C   1 
ATOM   10193 O  O   . GLY C  1 234 ? 19.752  6.514   37.742  1.00 51.47  ?  234  GLY C O   1 
ATOM   10194 N  N   . PRO C  1 235 ? 20.994  8.020   38.864  1.00 47.55  ?  235  PRO C N   1 
ATOM   10195 C  CA  . PRO C  1 235 ? 19.799  8.717   39.375  1.00 46.87  ?  235  PRO C CA  1 
ATOM   10196 C  C   . PRO C  1 235 ? 18.891  9.346   38.324  1.00 49.31  ?  235  PRO C C   1 
ATOM   10197 O  O   . PRO C  1 235 ? 17.663  9.262   38.467  1.00 49.38  ?  235  PRO C O   1 
ATOM   10198 C  CB  . PRO C  1 235 ? 20.405  9.781   40.300  1.00 45.02  ?  235  PRO C CB  1 
ATOM   10199 C  CG  . PRO C  1 235 ? 21.783  9.998   39.773  1.00 45.04  ?  235  PRO C CG  1 
ATOM   10200 C  CD  . PRO C  1 235 ? 22.245  8.658   39.300  1.00 44.68  ?  235  PRO C CD  1 
ATOM   10201 N  N   . TRP C  1 236 ? 19.440  10.017  37.303  1.00 50.12  ?  236  TRP C N   1 
ATOM   10202 C  CA  . TRP C  1 236 ? 18.620  10.863  36.437  1.00 48.92  ?  236  TRP C CA  1 
ATOM   10203 C  C   . TRP C  1 236 ? 18.108  10.206  35.157  1.00 48.60  ?  236  TRP C C   1 
ATOM   10204 O  O   . TRP C  1 236 ? 17.194  10.760  34.533  1.00 49.63  ?  236  TRP C O   1 
ATOM   10205 C  CB  . TRP C  1 236 ? 19.407  12.117  36.046  1.00 47.01  ?  236  TRP C CB  1 
ATOM   10206 C  CG  . TRP C  1 236 ? 20.701  11.797  35.368  1.00 44.45  ?  236  TRP C CG  1 
ATOM   10207 C  CD1 . TRP C  1 236 ? 21.911  11.603  35.963  1.00 44.21  ?  236  TRP C CD1 1 
ATOM   10208 C  CD2 . TRP C  1 236 ? 20.911  11.621  33.963  1.00 43.15  ?  236  TRP C CD2 1 
ATOM   10209 N  NE1 . TRP C  1 236 ? 22.864  11.325  35.015  1.00 44.35  ?  236  TRP C NE1 1 
ATOM   10210 C  CE2 . TRP C  1 236 ? 22.275  11.329  33.779  1.00 43.38  ?  236  TRP C CE2 1 
ATOM   10211 C  CE3 . TRP C  1 236 ? 20.078  11.683  32.841  1.00 42.27  ?  236  TRP C CE3 1 
ATOM   10212 C  CZ2 . TRP C  1 236 ? 22.824  11.098  32.521  1.00 42.29  ?  236  TRP C CZ2 1 
ATOM   10213 C  CZ3 . TRP C  1 236 ? 20.624  11.452  31.597  1.00 41.64  ?  236  TRP C CZ3 1 
ATOM   10214 C  CH2 . TRP C  1 236 ? 21.984  11.164  31.446  1.00 41.60  ?  236  TRP C CH2 1 
ATOM   10215 N  N   . ALA C  1 237 ? 18.620  9.040   34.761  1.00 46.70  ?  237  ALA C N   1 
ATOM   10216 C  CA  . ALA C  1 237 ? 18.379  8.583   33.395  1.00 44.67  ?  237  ALA C CA  1 
ATOM   10217 C  C   . ALA C  1 237 ? 17.136  7.721   33.246  1.00 44.86  ?  237  ALA C C   1 
ATOM   10218 O  O   . ALA C  1 237 ? 16.739  7.433   32.114  1.00 43.52  ?  237  ALA C O   1 
ATOM   10219 C  CB  . ALA C  1 237 ? 19.590  7.807   32.866  1.00 43.38  ?  237  ALA C CB  1 
ATOM   10220 N  N   . THR C  1 238 ? 16.514  7.304   34.344  1.00 45.20  ?  238  THR C N   1 
ATOM   10221 C  CA  . THR C  1 238 ? 15.316  6.483   34.285  1.00 45.34  ?  238  THR C CA  1 
ATOM   10222 C  C   . THR C  1 238 ? 14.362  6.922   35.382  1.00 44.88  ?  238  THR C C   1 
ATOM   10223 O  O   . THR C  1 238 ? 14.758  7.555   36.364  1.00 43.70  ?  238  THR C O   1 
ATOM   10224 C  CB  . THR C  1 238 ? 15.618  4.984   34.449  1.00 46.40  ?  238  THR C CB  1 
ATOM   10225 O  OG1 . THR C  1 238 ? 16.549  4.790   35.522  1.00 48.74  ?  238  THR C OG1 1 
ATOM   10226 C  CG2 . THR C  1 238 ? 16.199  4.414   33.179  1.00 44.36  ?  238  THR C CG2 1 
ATOM   10227 N  N   . VAL C  1 239 ? 13.092  6.583   35.192  1.00 44.27  ?  239  VAL C N   1 
ATOM   10228 C  CA  . VAL C  1 239 ? 12.088  6.700   36.237  1.00 44.72  ?  239  VAL C CA  1 
ATOM   10229 C  C   . VAL C  1 239 ? 11.275  5.418   36.236  1.00 46.54  ?  239  VAL C C   1 
ATOM   10230 O  O   . VAL C  1 239 ? 11.118  4.757   35.204  1.00 45.49  ?  239  VAL C O   1 
ATOM   10231 C  CB  . VAL C  1 239 ? 11.166  7.930   36.060  1.00 44.55  ?  239  VAL C CB  1 
ATOM   10232 C  CG1 . VAL C  1 239 ? 11.958  9.226   36.214  1.00 43.93  ?  239  VAL C CG1 1 
ATOM   10233 C  CG2 . VAL C  1 239 ? 10.427  7.877   34.733  1.00 44.31  ?  239  VAL C CG2 1 
ATOM   10234 N  N   . SER C  1 240 ? 10.766  5.062   37.412  1.00 49.37  ?  240  SER C N   1 
ATOM   10235 C  CA  . SER C  1 240 ? 9.918   3.892   37.546  1.00 53.48  ?  240  SER C CA  1 
ATOM   10236 C  C   . SER C  1 240 ? 8.601   4.112   36.812  1.00 57.09  ?  240  SER C C   1 
ATOM   10237 O  O   . SER C  1 240 ? 8.216   5.240   36.497  1.00 59.77  ?  240  SER C O   1 
ATOM   10238 C  CB  . SER C  1 240 ? 9.650   3.595   39.015  1.00 56.87  ?  240  SER C CB  1 
ATOM   10239 O  OG  . SER C  1 240 ? 8.933   4.661   39.614  1.00 59.65  ?  240  SER C OG  1 
ATOM   10240 N  N   . ALA C  1 241 ? 7.918   3.008   36.509  1.00 58.50  ?  241  ALA C N   1 
ATOM   10241 C  CA  . ALA C  1 241 ? 6.617   3.109   35.858  1.00 58.12  ?  241  ALA C CA  1 
ATOM   10242 C  C   . ALA C  1 241 ? 5.674   4.005   36.654  1.00 59.84  ?  241  ALA C C   1 
ATOM   10243 O  O   . ALA C  1 241 ? 5.023   4.898   36.095  1.00 60.98  ?  241  ALA C O   1 
ATOM   10244 C  CB  . ALA C  1 241 ? 6.015   1.716   35.673  1.00 57.59  ?  241  ALA C CB  1 
ATOM   10245 N  N   . GLY C  1 242 ? 5.610   3.795   37.973  1.00 59.92  ?  242  GLY C N   1 
ATOM   10246 C  CA  . GLY C  1 242 ? 4.713   4.580   38.805  1.00 59.59  ?  242  GLY C CA  1 
ATOM   10247 C  C   . GLY C  1 242 ? 5.076   6.048   38.869  1.00 58.29  ?  242  GLY C C   1 
ATOM   10248 O  O   . GLY C  1 242 ? 4.191   6.907   38.954  1.00 58.71  ?  242  GLY C O   1 
ATOM   10249 N  N   . GLU C  1 243 ? 6.374   6.359   38.835  1.00 57.74  ?  243  GLU C N   1 
ATOM   10250 C  CA  . GLU C  1 243 ? 6.795   7.756   38.831  1.00 57.64  ?  243  GLU C CA  1 
ATOM   10251 C  C   . GLU C  1 243 ? 6.479   8.420   37.496  1.00 57.89  ?  243  GLU C C   1 
ATOM   10252 O  O   . GLU C  1 243 ? 6.030   9.571   37.462  1.00 61.18  ?  243  GLU C O   1 
ATOM   10253 C  CB  . GLU C  1 243 ? 8.288   7.859   39.155  1.00 56.45  ?  243  GLU C CB  1 
ATOM   10254 C  CG  . GLU C  1 243 ? 8.864   9.269   39.072  1.00 55.57  ?  243  GLU C CG  1 
ATOM   10255 C  CD  . GLU C  1 243 ? 8.368   10.189  40.181  1.00 56.56  ?  243  GLU C CD  1 
ATOM   10256 O  OE1 . GLU C  1 243 ? 7.764   9.693   41.157  1.00 58.88  ?  243  GLU C OE1 1 
ATOM   10257 O  OE2 . GLU C  1 243 ? 8.581   11.414  40.070  1.00 54.52  ?  243  GLU C OE2 1 
ATOM   10258 N  N   . ALA C  1 244 ? 6.697   7.711   36.386  1.00 54.89  ?  244  ALA C N   1 
ATOM   10259 C  CA  . ALA C  1 244 ? 6.346   8.269   35.084  1.00 52.09  ?  244  ALA C CA  1 
ATOM   10260 C  C   . ALA C  1 244 ? 4.846   8.509   34.980  1.00 52.51  ?  244  ALA C C   1 
ATOM   10261 O  O   . ALA C  1 244 ? 4.407   9.520   34.418  1.00 53.64  ?  244  ALA C O   1 
ATOM   10262 C  CB  . ALA C  1 244 ? 6.823   7.343   33.966  1.00 50.21  ?  244  ALA C CB  1 
ATOM   10263 N  N   . ARG C  1 245 ? 4.042   7.593   35.521  1.00 51.80  ?  245  ARG C N   1 
ATOM   10264 C  CA  . ARG C  1 245 ? 2.599   7.801   35.531  1.00 54.62  ?  245  ARG C CA  1 
ATOM   10265 C  C   . ARG C  1 245 ? 2.221   8.995   36.400  1.00 56.06  ?  245  ARG C C   1 
ATOM   10266 O  O   . ARG C  1 245 ? 1.347   9.789   36.032  1.00 55.32  ?  245  ARG C O   1 
ATOM   10267 C  CB  . ARG C  1 245 ? 1.891   6.534   36.011  1.00 54.31  ?  245  ARG C CB  1 
ATOM   10268 C  CG  . ARG C  1 245 ? 0.395   6.693   36.182  1.00 52.53  ?  245  ARG C CG  1 
ATOM   10269 C  CD  . ARG C  1 245 ? -0.275  5.353   36.352  1.00 55.74  ?  245  ARG C CD  1 
ATOM   10270 N  NE  . ARG C  1 245 ? -0.326  4.627   35.092  1.00 56.77  ?  245  ARG C NE  1 
ATOM   10271 C  CZ  . ARG C  1 245 ? -1.319  4.749   34.217  1.00 60.18  ?  245  ARG C CZ  1 
ATOM   10272 N  NH1 . ARG C  1 245 ? -2.333  5.563   34.484  1.00 62.93  ?  245  ARG C NH1 1 
ATOM   10273 N  NH2 . ARG C  1 245 ? -1.299  4.063   33.082  1.00 60.01  ?  245  ARG C NH2 1 
ATOM   10274 N  N   . ARG C  1 246 ? 2.870   9.135   37.560  1.00 58.30  ?  246  ARG C N   1 
ATOM   10275 C  CA  . ARG C  1 246 ? 2.604   10.281  38.426  1.00 57.87  ?  246  ARG C CA  1 
ATOM   10276 C  C   . ARG C  1 246 ? 2.903   11.596  37.712  1.00 58.97  ?  246  ARG C C   1 
ATOM   10277 O  O   . ARG C  1 246 ? 2.085   12.527  37.729  1.00 62.26  ?  246  ARG C O   1 
ATOM   10278 C  CB  . ARG C  1 246 ? 3.429   10.176  39.705  1.00 55.74  ?  246  ARG C CB  1 
ATOM   10279 C  CG  . ARG C  1 246 ? 3.054   11.211  40.736  1.00 55.40  ?  246  ARG C CG  1 
ATOM   10280 C  CD  . ARG C  1 246 ? 4.145   11.379  41.771  1.00 55.44  ?  246  ARG C CD  1 
ATOM   10281 N  NE  . ARG C  1 246 ? 5.316   12.062  41.224  1.00 56.23  ?  246  ARG C NE  1 
ATOM   10282 C  CZ  . ARG C  1 246 ? 5.413   13.383  41.080  1.00 58.46  ?  246  ARG C CZ  1 
ATOM   10283 N  NH1 . ARG C  1 246 ? 4.407   14.173  41.435  1.00 60.42  ?  246  ARG C NH1 1 
ATOM   10284 N  NH2 . ARG C  1 246 ? 6.519   13.915  40.580  1.00 57.81  ?  246  ARG C NH2 1 
ATOM   10285 N  N   . ARG C  1 247 ? 4.080   11.692  37.081  1.00 55.05  ?  247  ARG C N   1 
ATOM   10286 C  CA  . ARG C  1 247 ? 4.454   12.926  36.397  1.00 51.91  ?  247  ARG C CA  1 
ATOM   10287 C  C   . ARG C  1 247 ? 3.532   13.204  35.219  1.00 50.53  ?  247  ARG C C   1 
ATOM   10288 O  O   . ARG C  1 247 ? 3.107   14.348  35.014  1.00 51.07  ?  247  ARG C O   1 
ATOM   10289 C  CB  . ARG C  1 247 ? 5.915   12.858  35.948  1.00 46.38  ?  247  ARG C CB  1 
ATOM   10290 C  CG  . ARG C  1 247 ? 6.900   12.689  37.098  1.00 46.30  ?  247  ARG C CG  1 
ATOM   10291 C  CD  . ARG C  1 247 ? 8.353   12.664  36.635  1.00 49.44  ?  247  ARG C CD  1 
ATOM   10292 N  NE  . ARG C  1 247 ? 9.290   12.500  37.749  1.00 48.15  ?  247  ARG C NE  1 
ATOM   10293 C  CZ  . ARG C  1 247 ? 10.615  12.496  37.619  1.00 47.60  ?  247  ARG C CZ  1 
ATOM   10294 N  NH1 . ARG C  1 247 ? 11.166  12.629  36.422  1.00 46.64  ?  247  ARG C NH1 1 
ATOM   10295 N  NH2 . ARG C  1 247 ? 11.392  12.336  38.683  1.00 47.89  ?  247  ARG C NH2 1 
ATOM   10296 N  N   . ALA C  1 248 ? 3.191   12.169  34.447  1.00 50.17  ?  248  ALA C N   1 
ATOM   10297 C  CA  . ALA C  1 248 ? 2.324   12.365  33.290  1.00 50.52  ?  248  ALA C CA  1 
ATOM   10298 C  C   . ALA C  1 248 ? 0.933   12.830  33.710  1.00 51.84  ?  248  ALA C C   1 
ATOM   10299 O  O   . ALA C  1 248 ? 0.362   13.738  33.092  1.00 53.55  ?  248  ALA C O   1 
ATOM   10300 C  CB  . ALA C  1 248 ? 2.242   11.075  32.476  1.00 48.07  ?  248  ALA C CB  1 
ATOM   10301 N  N   . THR C  1 249 ? 0.375   12.228  34.766  1.00 51.43  ?  249  THR C N   1 
ATOM   10302 C  CA  . THR C  1 249 ? -0.954  12.629  35.222  1.00 52.69  ?  249  THR C CA  1 
ATOM   10303 C  C   . THR C  1 249 ? -0.931  14.039  35.800  1.00 52.65  ?  249  THR C C   1 
ATOM   10304 O  O   . THR C  1 249 ? -1.854  14.831  35.563  1.00 53.16  ?  249  THR C O   1 
ATOM   10305 C  CB  . THR C  1 249 ? -1.487  11.641  36.260  1.00 53.25  ?  249  THR C CB  1 
ATOM   10306 O  OG1 . THR C  1 249 ? -1.431  10.313  35.733  1.00 53.15  ?  249  THR C OG1 1 
ATOM   10307 C  CG2 . THR C  1 249 ? -2.933  11.961  36.596  1.00 55.02  ?  249  THR C CG2 1 
ATOM   10308 N  N   . LEU C  1 250 ? 0.117   14.370  36.560  1.00 51.55  ?  250  LEU C N   1 
ATOM   10309 C  CA  . LEU C  1 250 ? 0.220   15.717  37.109  1.00 53.11  ?  250  LEU C CA  1 
ATOM   10310 C  C   . LEU C  1 250 ? 0.310   16.751  35.996  1.00 55.83  ?  250  LEU C C   1 
ATOM   10311 O  O   . LEU C  1 250 ? -0.386  17.770  36.032  1.00 60.99  ?  250  LEU C O   1 
ATOM   10312 C  CB  . LEU C  1 250 ? 1.422   15.826  38.048  1.00 51.51  ?  250  LEU C CB  1 
ATOM   10313 C  CG  . LEU C  1 250 ? 1.657   17.225  38.627  1.00 51.40  ?  250  LEU C CG  1 
ATOM   10314 C  CD1 . LEU C  1 250 ? 0.483   17.658  39.487  1.00 53.12  ?  250  LEU C CD1 1 
ATOM   10315 C  CD2 . LEU C  1 250 ? 2.949   17.279  39.422  1.00 50.72  ?  250  LEU C CD2 1 
ATOM   10316 N  N   . LEU C  1 251 ? 1.150   16.500  34.987  1.00 53.11  ?  251  LEU C N   1 
ATOM   10317 C  CA  . LEU C  1 251 ? 1.250   17.439  33.873  1.00 53.31  ?  251  LEU C CA  1 
ATOM   10318 C  C   . LEU C  1 251 ? -0.087  17.581  33.162  1.00 56.18  ?  251  LEU C C   1 
ATOM   10319 O  O   . LEU C  1 251 ? -0.532  18.697  32.864  1.00 58.63  ?  251  LEU C O   1 
ATOM   10320 C  CB  . LEU C  1 251 ? 2.331   16.993  32.889  1.00 51.23  ?  251  LEU C CB  1 
ATOM   10321 C  CG  . LEU C  1 251 ? 2.477   17.906  31.669  1.00 51.55  ?  251  LEU C CG  1 
ATOM   10322 C  CD1 . LEU C  1 251 ? 3.938   18.221  31.433  1.00 52.12  ?  251  LEU C CD1 1 
ATOM   10323 C  CD2 . LEU C  1 251 ? 1.862   17.277  30.423  1.00 47.69  ?  251  LEU C CD2 1 
ATOM   10324 N  N   . ALA C  1 252 ? -0.743  16.451  32.881  1.00 57.07  ?  252  ALA C N   1 
ATOM   10325 C  CA  . ALA C  1 252 ? -2.060  16.492  32.258  1.00 59.87  ?  252  ALA C CA  1 
ATOM   10326 C  C   . ALA C  1 252 ? -3.007  17.381  33.047  1.00 63.01  ?  252  ALA C C   1 
ATOM   10327 O  O   . ALA C  1 252 ? -3.737  18.194  32.473  1.00 63.98  ?  252  ALA C O   1 
ATOM   10328 C  CB  . ALA C  1 252 ? -2.627  15.077  32.141  1.00 52.62  ?  252  ALA C CB  1 
ATOM   10329 N  N   . ARG C  1 253 ? -2.983  17.270  34.372  1.00 66.07  ?  253  ARG C N   1 
ATOM   10330 C  CA  . ARG C  1 253 ? -3.892  18.082  35.164  1.00 67.53  ?  253  ARG C CA  1 
ATOM   10331 C  C   . ARG C  1 253 ? -3.460  19.548  35.165  1.00 64.20  ?  253  ARG C C   1 
ATOM   10332 O  O   . ARG C  1 253 ? -4.310  20.444  35.218  1.00 65.21  ?  253  ARG C O   1 
ATOM   10333 C  CB  . ARG C  1 253 ? -3.961  17.527  36.584  1.00 70.56  ?  253  ARG C CB  1 
ATOM   10334 C  CG  . ARG C  1 253 ? -4.934  18.253  37.475  1.00 76.32  ?  253  ARG C CG  1 
ATOM   10335 C  CD  . ARG C  1 253 ? -4.639  18.009  38.910  1.00 80.06  ?  253  ARG C CD  1 
ATOM   10336 N  NE  . ARG C  1 253 ? -4.671  19.265  39.629  1.00 83.68  ?  253  ARG C NE  1 
ATOM   10337 C  CZ  . ARG C  1 253 ? -3.843  19.551  40.613  1.00 85.30  ?  253  ARG C CZ  1 
ATOM   10338 N  NH1 . ARG C  1 253 ? -2.901  18.674  40.909  1.00 85.24  ?  253  ARG C NH1 1 
ATOM   10339 N  NH2 . ARG C  1 253 ? -3.898  20.712  41.234  1.00 85.78  ?  253  ARG C NH2 1 
ATOM   10340 N  N   . LEU C  1 254 ? -2.151  19.815  35.079  1.00 59.74  ?  254  LEU C N   1 
ATOM   10341 C  CA  . LEU C  1 254 ? -1.670  21.193  35.112  1.00 57.02  ?  254  LEU C CA  1 
ATOM   10342 C  C   . LEU C  1 254 ? -1.976  21.931  33.820  1.00 56.89  ?  254  LEU C C   1 
ATOM   10343 O  O   . LEU C  1 254 ? -2.127  23.159  33.831  1.00 54.66  ?  254  LEU C O   1 
ATOM   10344 C  CB  . LEU C  1 254 ? -0.169  21.236  35.386  1.00 54.68  ?  254  LEU C CB  1 
ATOM   10345 C  CG  . LEU C  1 254 ? 0.290   20.806  36.775  1.00 52.56  ?  254  LEU C CG  1 
ATOM   10346 C  CD1 . LEU C  1 254 ? 1.795   20.833  36.854  1.00 51.16  ?  254  LEU C CD1 1 
ATOM   10347 C  CD2 . LEU C  1 254 ? -0.321  21.701  37.829  1.00 54.07  ?  254  LEU C CD2 1 
ATOM   10348 N  N   . VAL C  1 255 ? -2.089  21.207  32.709  1.00 58.72  ?  255  VAL C N   1 
ATOM   10349 C  CA  . VAL C  1 255 ? -2.386  21.821  31.419  1.00 56.09  ?  255  VAL C CA  1 
ATOM   10350 C  C   . VAL C  1 255 ? -3.899  21.885  31.273  1.00 60.42  ?  255  VAL C C   1 
ATOM   10351 O  O   . VAL C  1 255 ? -4.421  22.146  30.184  1.00 55.64  ?  255  VAL C O   1 
ATOM   10352 C  CB  . VAL C  1 255 ? -1.725  21.082  30.244  1.00 52.12  ?  255  VAL C CB  1 
ATOM   10353 C  CG1 . VAL C  1 255 ? -0.215  21.219  30.328  1.00 50.60  ?  255  VAL C CG1 1 
ATOM   10354 C  CG2 . VAL C  1 255 ? -2.144  19.645  30.215  1.00 52.15  ?  255  VAL C CG2 1 
ATOM   10355 N  N   . GLY C  1 256 ? -4.612  21.574  32.352  1.00 62.85  ?  256  GLY C N   1 
ATOM   10356 C  CA  . GLY C  1 256 ? -6.052  21.758  32.356  1.00 67.86  ?  256  GLY C CA  1 
ATOM   10357 C  C   . GLY C  1 256 ? -6.762  20.631  31.659  1.00 70.96  ?  256  GLY C C   1 
ATOM   10358 O  O   . GLY C  1 256 ? -7.770  20.854  30.975  1.00 72.33  ?  256  GLY C O   1 
ATOM   10359 N  N   . CYS C  1 257 ? -6.259  19.419  31.828  1.00 72.50  ?  257  CYS C N   1 
ATOM   10360 C  CA  . CYS C  1 257 ? -6.591  18.285  30.974  1.00 74.26  ?  257  CYS C CA  1 
ATOM   10361 C  C   . CYS C  1 257 ? -6.853  17.052  31.828  1.00 80.96  ?  257  CYS C C   1 
ATOM   10362 O  O   . CYS C  1 257 ? -6.214  16.014  31.636  1.00 81.76  ?  257  CYS C O   1 
ATOM   10363 C  CB  . CYS C  1 257 ? -5.401  18.066  30.043  1.00 68.81  ?  257  CYS C CB  1 
ATOM   10364 S  SG  . CYS C  1 257 ? -5.477  17.273  28.462  1.00 66.78  ?  257  CYS C SG  1 
ATOM   10365 N  N   . PRO C  1 258 ? -7.788  17.125  32.799  1.00 87.49  ?  258  PRO C N   1 
ATOM   10366 C  CA  . PRO C  1 258 ? -8.167  15.826  33.359  1.00 92.29  ?  258  PRO C CA  1 
ATOM   10367 C  C   . PRO C  1 258 ? -8.977  14.930  32.390  1.00 98.21  ?  258  PRO C C   1 
ATOM   10368 O  O   . PRO C  1 258 ? -8.660  13.741  32.336  1.00 99.03  ?  258  PRO C O   1 
ATOM   10369 C  CB  . PRO C  1 258 ? -8.973  16.204  34.609  1.00 93.57  ?  258  PRO C CB  1 
ATOM   10370 C  CG  . PRO C  1 258 ? -8.484  17.598  34.967  1.00 92.54  ?  258  PRO C CG  1 
ATOM   10371 C  CD  . PRO C  1 258 ? -8.275  18.242  33.633  1.00 90.54  ?  258  PRO C CD  1 
ATOM   10372 N  N   . PRO C  1 259 ? -9.971  15.463  31.621  1.00 102.63 ?  259  PRO C N   1 
ATOM   10373 C  CA  . PRO C  1 259 ? -10.652 16.769  31.500  1.00 104.62 ?  259  PRO C CA  1 
ATOM   10374 C  C   . PRO C  1 259 ? -11.829 17.032  32.469  1.00 106.84 ?  259  PRO C C   1 
ATOM   10375 O  O   . PRO C  1 259 ? -13.009 16.839  32.156  1.00 108.09 ?  259  PRO C O   1 
ATOM   10376 C  CB  . PRO C  1 259 ? -11.150 16.778  30.042  1.00 105.52 ?  259  PRO C CB  1 
ATOM   10377 C  CG  . PRO C  1 259 ? -11.026 15.358  29.534  1.00 104.99 ?  259  PRO C CG  1 
ATOM   10378 C  CD  . PRO C  1 259 ? -10.564 14.493  30.683  1.00 104.20 ?  259  PRO C CD  1 
ATOM   10379 N  N   . GLY C  1 260 ? -11.436 17.465  33.666  1.00 107.56 ?  260  GLY C N   1 
ATOM   10380 C  CA  . GLY C  1 260 ? -12.247 18.185  34.623  1.00 110.32 ?  260  GLY C CA  1 
ATOM   10381 C  C   . GLY C  1 260 ? -12.737 17.390  35.826  1.00 112.95 ?  260  GLY C C   1 
ATOM   10382 O  O   . GLY C  1 260 ? -12.961 17.994  36.884  1.00 113.50 ?  260  GLY C O   1 
ATOM   10383 N  N   . GLY C  1 261 ? -12.917 16.071  35.721  1.00 114.74 ?  261  GLY C N   1 
ATOM   10384 C  CA  . GLY C  1 261 ? -12.891 15.364  36.989  1.00 116.15 ?  261  GLY C CA  1 
ATOM   10385 C  C   . GLY C  1 261 ? -11.547 15.024  37.616  1.00 114.40 ?  261  GLY C C   1 
ATOM   10386 O  O   . GLY C  1 261 ? -11.143 15.607  38.628  1.00 115.92 ?  261  GLY C O   1 
ATOM   10387 N  N   . ALA C  1 262 ? -10.843 14.070  37.000  1.00 110.58 ?  262  ALA C N   1 
ATOM   10388 C  CA  . ALA C  1 262 ? -9.516  13.626  37.436  1.00 106.12 ?  262  ALA C CA  1 
ATOM   10389 C  C   . ALA C  1 262 ? -8.505  13.252  36.332  1.00 105.48 ?  262  ALA C C   1 
ATOM   10390 O  O   . ALA C  1 262 ? -7.485  13.909  36.092  1.00 102.30 ?  262  ALA C O   1 
ATOM   10391 C  CB  . ALA C  1 262 ? -9.672  12.460  38.404  1.00 103.72 ?  262  ALA C CB  1 
ATOM   10392 N  N   . GLY C  1 263 ? -8.886  12.171  35.645  1.00 108.74 ?  263  GLY C N   1 
ATOM   10393 C  CA  . GLY C  1 263 ? -8.071  10.974  35.490  1.00 109.62 ?  263  GLY C CA  1 
ATOM   10394 C  C   . GLY C  1 263 ? -8.977  9.839   35.016  1.00 111.94 ?  263  GLY C C   1 
ATOM   10395 O  O   . GLY C  1 263 ? -9.936  10.070  34.264  1.00 114.45 ?  263  GLY C O   1 
ATOM   10396 N  N   . GLY C  1 264 ? -8.660  8.608   35.436  1.00 109.71 ?  264  GLY C N   1 
ATOM   10397 C  CA  . GLY C  1 264 ? -9.306  7.416   34.915  1.00 106.80 ?  264  GLY C CA  1 
ATOM   10398 C  C   . GLY C  1 264 ? -8.823  7.038   33.531  1.00 101.20 ?  264  GLY C C   1 
ATOM   10399 O  O   . GLY C  1 264 ? -7.623  6.800   33.355  1.00 99.22  ?  264  GLY C O   1 
ATOM   10400 N  N   . ASN C  1 265 ? -9.738  6.939   32.564  1.00 96.94  ?  265  ASN C N   1 
ATOM   10401 C  CA  . ASN C  1 265 ? -9.435  6.355   31.263  1.00 90.62  ?  265  ASN C CA  1 
ATOM   10402 C  C   . ASN C  1 265 ? -8.149  6.950   30.708  1.00 81.46  ?  265  ASN C C   1 
ATOM   10403 O  O   . ASN C  1 265 ? -8.003  8.171   30.604  1.00 79.71  ?  265  ASN C O   1 
ATOM   10404 C  CB  . ASN C  1 265 ? -10.610 6.667   30.323  1.00 95.85  ?  265  ASN C CB  1 
ATOM   10405 C  CG  . ASN C  1 265 ? -10.871 5.601   29.255  1.00 101.27 ?  265  ASN C CG  1 
ATOM   10406 O  OD1 . ASN C  1 265 ? -10.179 4.584   29.153  1.00 102.88 ?  265  ASN C OD1 1 
ATOM   10407 N  ND2 . ASN C  1 265 ? -11.906 5.869   28.438  1.00 103.28 ?  265  ASN C ND2 1 
ATOM   10408 N  N   . ASP C  1 266 ? -7.207  6.076   30.354  1.00 76.59  ?  266  ASP C N   1 
ATOM   10409 C  CA  . ASP C  1 266 ? -5.943  6.563   29.818  1.00 71.66  ?  266  ASP C CA  1 
ATOM   10410 C  C   . ASP C  1 266 ? -6.105  7.009   28.382  1.00 72.61  ?  266  ASP C C   1 
ATOM   10411 O  O   . ASP C  1 266 ? -5.378  7.898   27.924  1.00 73.20  ?  266  ASP C O   1 
ATOM   10412 C  CB  . ASP C  1 266 ? -4.859  5.491   29.909  1.00 67.86  ?  266  ASP C CB  1 
ATOM   10413 C  CG  . ASP C  1 266 ? -4.111  5.526   31.225  1.00 65.93  ?  266  ASP C CG  1 
ATOM   10414 O  OD1 . ASP C  1 266 ? -4.578  6.194   32.173  1.00 66.79  ?  266  ASP C OD1 1 
ATOM   10415 O  OD2 . ASP C  1 266 ? -3.027  4.913   31.296  1.00 63.81  ?  266  ASP C OD2 1 
ATOM   10416 N  N   . THR C  1 267 ? -7.052  6.402   27.668  1.00 73.61  ?  267  THR C N   1 
ATOM   10417 C  CA  . THR C  1 267 ? -7.377  6.871   26.331  1.00 73.61  ?  267  THR C CA  1 
ATOM   10418 C  C   . THR C  1 267 ? -7.861  8.314   26.371  1.00 73.54  ?  267  THR C C   1 
ATOM   10419 O  O   . THR C  1 267 ? -7.543  9.106   25.478  1.00 73.04  ?  267  THR C O   1 
ATOM   10420 C  CB  . THR C  1 267 ? -8.434  5.963   25.709  1.00 75.50  ?  267  THR C CB  1 
ATOM   10421 O  OG1 . THR C  1 267 ? -8.183  4.608   26.100  1.00 75.34  ?  267  THR C OG1 1 
ATOM   10422 C  CG2 . THR C  1 267 ? -8.365  6.056   24.197  1.00 75.91  ?  267  THR C CG2 1 
ATOM   10423 N  N   . GLU C  1 268 ? -8.615  8.680   27.413  1.00 74.23  ?  268  GLU C N   1 
ATOM   10424 C  CA  . GLU C  1 268 ? -9.141  10.037  27.513  1.00 75.66  ?  268  GLU C CA  1 
ATOM   10425 C  C   . GLU C  1 268 ? -8.080  11.022  27.984  1.00 73.75  ?  268  GLU C C   1 
ATOM   10426 O  O   . GLU C  1 268 ? -8.034  12.165  27.511  1.00 75.83  ?  268  GLU C O   1 
ATOM   10427 C  CB  . GLU C  1 268 ? -10.351 10.066  28.445  1.00 79.87  ?  268  GLU C CB  1 
ATOM   10428 C  CG  . GLU C  1 268 ? -11.569 10.723  27.830  1.00 86.16  ?  268  GLU C CG  1 
ATOM   10429 C  CD  . GLU C  1 268 ? -12.016 10.030  26.556  1.00 91.46  ?  268  GLU C CD  1 
ATOM   10430 O  OE1 . GLU C  1 268 ? -12.557 8.911   26.632  1.00 94.32  ?  268  GLU C OE1 1 
ATOM   10431 O  OE2 . GLU C  1 268 ? -11.828 10.601  25.465  1.00 91.85  ?  268  GLU C OE2 1 
ATOM   10432 N  N   . LEU C  1 269 ? -7.222  10.602  28.915  1.00 69.35  ?  269  LEU C N   1 
ATOM   10433 C  CA  . LEU C  1 269 ? -6.146  11.478  29.366  1.00 64.40  ?  269  LEU C CA  1 
ATOM   10434 C  C   . LEU C  1 269 ? -5.174  11.772  28.228  1.00 62.89  ?  269  LEU C C   1 
ATOM   10435 O  O   . LEU C  1 269 ? -4.796  12.927  28.003  1.00 62.85  ?  269  LEU C O   1 
ATOM   10436 C  CB  . LEU C  1 269 ? -5.415  10.848  30.551  1.00 60.54  ?  269  LEU C CB  1 
ATOM   10437 C  CG  . LEU C  1 269 ? -4.598  11.838  31.383  1.00 57.38  ?  269  LEU C CG  1 
ATOM   10438 C  CD1 . LEU C  1 269 ? -5.508  12.568  32.361  1.00 58.62  ?  269  LEU C CD1 1 
ATOM   10439 C  CD2 . LEU C  1 269 ? -3.455  11.165  32.115  1.00 55.30  ?  269  LEU C CD2 1 
ATOM   10440 N  N   . ILE C  1 270 ? -4.764  10.735  27.490  1.00 61.71  ?  270  ILE C N   1 
ATOM   10441 C  CA  . ILE C  1 270 ? -3.845  10.935  26.373  1.00 58.94  ?  270  ILE C CA  1 
ATOM   10442 C  C   . ILE C  1 270 ? -4.538  11.668  25.230  1.00 59.14  ?  270  ILE C C   1 
ATOM   10443 O  O   . ILE C  1 270 ? -3.933  12.517  24.560  1.00 57.50  ?  270  ILE C O   1 
ATOM   10444 C  CB  . ILE C  1 270 ? -3.262  9.586   25.912  1.00 59.05  ?  270  ILE C CB  1 
ATOM   10445 C  CG1 . ILE C  1 270 ? -2.499  8.915   27.055  1.00 60.37  ?  270  ILE C CG1 1 
ATOM   10446 C  CG2 . ILE C  1 270 ? -2.339  9.783   24.726  1.00 58.05  ?  270  ILE C CG2 1 
ATOM   10447 C  CD1 . ILE C  1 270 ? -1.350  9.751   27.575  1.00 60.87  ?  270  ILE C CD1 1 
ATOM   10448 N  N   . ALA C  1 271 ? -5.814  11.354  24.990  1.00 61.16  ?  271  ALA C N   1 
ATOM   10449 C  CA  . ALA C  1 271 ? -6.568  12.031  23.940  1.00 61.68  ?  271  ALA C CA  1 
ATOM   10450 C  C   . ALA C  1 271 ? -6.636  13.525  24.201  1.00 60.18  ?  271  ALA C C   1 
ATOM   10451 O  O   . ALA C  1 271 ? -6.415  14.336  23.291  1.00 58.52  ?  271  ALA C O   1 
ATOM   10452 C  CB  . ALA C  1 271 ? -7.977  11.446  23.844  1.00 64.93  ?  271  ALA C CB  1 
ATOM   10453 N  N   . CYS C  1 272 ? -6.940  13.906  25.444  1.00 61.77  ?  272  CYS C N   1 
ATOM   10454 C  CA  . CYS C  1 272 ? -6.914  15.317  25.810  1.00 63.40  ?  272  CYS C CA  1 
ATOM   10455 C  C   . CYS C  1 272 ? -5.506  15.897  25.711  1.00 59.69  ?  272  CYS C C   1 
ATOM   10456 O  O   . CYS C  1 272 ? -5.336  17.041  25.271  1.00 54.45  ?  272  CYS C O   1 
ATOM   10457 C  CB  . CYS C  1 272 ? -7.496  15.511  27.216  1.00 68.26  ?  272  CYS C CB  1 
ATOM   10458 S  SG  . CYS C  1 272 ? -7.392  17.224  27.830  1.00 69.08  ?  272  CYS C SG  1 
ATOM   10459 N  N   . LEU C  1 273 ? -4.487  15.143  26.141  1.00 57.14  ?  273  LEU C N   1 
ATOM   10460 C  CA  . LEU C  1 273 ? -3.121  15.667  26.094  1.00 55.54  ?  273  LEU C CA  1 
ATOM   10461 C  C   . LEU C  1 273 ? -2.666  15.927  24.669  1.00 57.67  ?  273  LEU C C   1 
ATOM   10462 O  O   . LEU C  1 273 ? -1.794  16.772  24.446  1.00 58.88  ?  273  LEU C O   1 
ATOM   10463 C  CB  . LEU C  1 273 ? -2.139  14.715  26.778  1.00 52.61  ?  273  LEU C CB  1 
ATOM   10464 C  CG  . LEU C  1 273 ? -1.887  14.824  28.282  1.00 50.70  ?  273  LEU C CG  1 
ATOM   10465 C  CD1 . LEU C  1 273 ? -1.011  13.677  28.739  1.00 49.87  ?  273  LEU C CD1 1 
ATOM   10466 C  CD2 . LEU C  1 273 ? -1.240  16.147  28.622  1.00 50.15  ?  273  LEU C CD2 1 
ATOM   10467 N  N   . ARG C  1 274 ? -3.227  15.209  23.695  1.00 59.91  ?  274  ARG C N   1 
ATOM   10468 C  CA  . ARG C  1 274 ? -2.830  15.406  22.308  1.00 59.41  ?  274  ARG C CA  1 
ATOM   10469 C  C   . ARG C  1 274 ? -3.398  16.684  21.705  1.00 59.36  ?  274  ARG C C   1 
ATOM   10470 O  O   . ARG C  1 274 ? -2.955  17.077  20.622  1.00 61.43  ?  274  ARG C O   1 
ATOM   10471 C  CB  . ARG C  1 274 ? -3.259  14.206  21.465  1.00 61.42  ?  274  ARG C CB  1 
ATOM   10472 C  CG  . ARG C  1 274 ? -2.259  13.060  21.446  1.00 59.94  ?  274  ARG C CG  1 
ATOM   10473 C  CD  . ARG C  1 274 ? -2.633  12.069  20.365  1.00 60.90  ?  274  ARG C CD  1 
ATOM   10474 N  NE  . ARG C  1 274 ? -3.826  11.318  20.727  1.00 62.12  ?  274  ARG C NE  1 
ATOM   10475 C  CZ  . ARG C  1 274 ? -3.803  10.083  21.207  1.00 62.74  ?  274  ARG C CZ  1 
ATOM   10476 N  NH1 . ARG C  1 274 ? -2.642  9.454   21.365  1.00 61.36  ?  274  ARG C NH1 1 
ATOM   10477 N  NH2 . ARG C  1 274 ? -4.942  9.476   21.518  1.00 64.28  ?  274  ARG C NH2 1 
ATOM   10478 N  N   . THR C  1 275 ? -4.354  17.334  22.366  1.00 61.05  ?  275  THR C N   1 
ATOM   10479 C  CA  . THR C  1 275 ? -4.942  18.572  21.871  1.00 64.91  ?  275  THR C CA  1 
ATOM   10480 C  C   . THR C  1 275 ? -4.213  19.814  22.372  1.00 64.75  ?  275  THR C C   1 
ATOM   10481 O  O   . THR C  1 275 ? -4.650  20.933  22.084  1.00 64.59  ?  275  THR C O   1 
ATOM   10482 C  CB  . THR C  1 275 ? -6.416  18.664  22.276  1.00 55.94  ?  275  THR C CB  1 
ATOM   10483 O  OG1 . THR C  1 275 ? -6.508  18.907  23.682  1.00 56.16  ?  275  THR C OG1 1 
ATOM   10484 C  CG2 . THR C  1 275 ? -7.133  17.370  21.962  1.00 56.67  ?  275  THR C CG2 1 
ATOM   10485 N  N   . ARG C  1 276 ? -3.155  19.650  23.102  1.00 65.16  ?  276  ARG C N   1 
ATOM   10486 C  CA  . ARG C  1 276 ? -2.421  20.729  23.743  1.00 62.17  ?  276  ARG C CA  1 
ATOM   10487 C  C   . ARG C  1 276 ? -1.359  21.289  22.803  1.00 50.65  ?  276  ARG C C   1 
ATOM   10488 O  O   . ARG C  1 276 ? -0.657  20.523  22.139  1.00 49.68  ?  276  ARG C O   1 
ATOM   10489 C  CB  . ARG C  1 276 ? -1.754  20.233  25.023  1.00 60.98  ?  276  ARG C CB  1 
ATOM   10490 C  CG  . ARG C  1 276 ? -2.529  20.521  26.294  1.00 67.57  ?  276  ARG C CG  1 
ATOM   10491 C  CD  . ARG C  1 276 ? -3.996  20.191  26.137  1.00 53.56  ?  276  ARG C CD  1 
ATOM   10492 N  NE  . ARG C  1 276 ? -4.816  20.929  27.088  1.00 54.95  ?  276  ARG C NE  1 
ATOM   10493 C  CZ  . ARG C  1 276 ? -6.098  21.215  26.900  1.00 56.66  ?  276  ARG C CZ  1 
ATOM   10494 N  NH1 . ARG C  1 276 ? -6.711  20.813  25.800  1.00 57.17  ?  276  ARG C NH1 1 
ATOM   10495 N  NH2 . ARG C  1 276 ? -6.769  21.895  27.816  1.00 59.56  ?  276  ARG C NH2 1 
ATOM   10496 N  N   . PRO C  1 277 ? -1.237  22.615  22.725  1.00 51.01  ?  277  PRO C N   1 
ATOM   10497 C  CA  . PRO C  1 277 ? -0.140  23.202  21.952  1.00 50.14  ?  277  PRO C CA  1 
ATOM   10498 C  C   . PRO C  1 277 ? 1.199   22.713  22.472  1.00 51.50  ?  277  PRO C C   1 
ATOM   10499 O  O   . PRO C  1 277 ? 1.376   22.487  23.669  1.00 51.92  ?  277  PRO C O   1 
ATOM   10500 C  CB  . PRO C  1 277 ? -0.311  24.710  22.170  1.00 51.02  ?  277  PRO C CB  1 
ATOM   10501 C  CG  . PRO C  1 277 ? -1.734  24.880  22.548  1.00 52.58  ?  277  PRO C CG  1 
ATOM   10502 C  CD  . PRO C  1 277 ? -2.128  23.641  23.290  1.00 52.43  ?  277  PRO C CD  1 
ATOM   10503 N  N   . ALA C  1 278 ? 2.142   22.529  21.548  1.00 47.76  ?  278  ALA C N   1 
ATOM   10504 C  CA  . ALA C  1 278 ? 3.455   22.019  21.926  1.00 47.06  ?  278  ALA C CA  1 
ATOM   10505 C  C   . ALA C  1 278 ? 4.108   22.906  22.980  1.00 47.40  ?  278  ALA C C   1 
ATOM   10506 O  O   . ALA C  1 278 ? 4.679   22.411  23.964  1.00 47.31  ?  278  ALA C O   1 
ATOM   10507 C  CB  . ALA C  1 278 ? 4.338   21.902  20.684  1.00 45.81  ?  278  ALA C CB  1 
ATOM   10508 N  N   . GLN C  1 279 ? 4.010   24.224  22.805  1.00 48.60  ?  279  GLN C N   1 
ATOM   10509 C  CA  . GLN C  1 279 ? 4.589   25.142  23.772  1.00 50.62  ?  279  GLN C CA  1 
ATOM   10510 C  C   . GLN C  1 279 ? 3.867   25.091  25.111  1.00 54.24  ?  279  GLN C C   1 
ATOM   10511 O  O   . GLN C  1 279 ? 4.456   25.459  26.127  1.00 56.04  ?  279  GLN C O   1 
ATOM   10512 C  CB  . GLN C  1 279 ? 4.587   26.567  23.214  1.00 47.80  ?  279  GLN C CB  1 
ATOM   10513 C  CG  . GLN C  1 279 ? 5.474   27.513  23.989  1.00 47.78  ?  279  GLN C CG  1 
ATOM   10514 C  CD  . GLN C  1 279 ? 6.904   27.011  24.084  1.00 48.69  ?  279  GLN C CD  1 
ATOM   10515 O  OE1 . GLN C  1 279 ? 7.465   26.504  23.113  1.00 47.55  ?  279  GLN C OE1 1 
ATOM   10516 N  NE2 . GLN C  1 279 ? 7.491   27.119  25.272  1.00 47.91  ?  279  GLN C NE2 1 
ATOM   10517 N  N   . ASP C  1 280 ? 2.609   24.645  25.137  1.00 48.43  ?  280  ASP C N   1 
ATOM   10518 C  CA  . ASP C  1 280 ? 1.916   24.457  26.408  1.00 55.05  ?  280  ASP C CA  1 
ATOM   10519 C  C   . ASP C  1 280 ? 2.595   23.367  27.229  1.00 55.56  ?  280  ASP C C   1 
ATOM   10520 O  O   . ASP C  1 280 ? 2.941   23.565  28.406  1.00 56.03  ?  280  ASP C O   1 
ATOM   10521 C  CB  . ASP C  1 280 ? 0.453   24.112  26.134  1.00 50.24  ?  280  ASP C CB  1 
ATOM   10522 C  CG  . ASP C  1 280 ? -0.409  24.167  27.372  1.00 52.95  ?  280  ASP C CG  1 
ATOM   10523 O  OD1 . ASP C  1 280 ? 0.042   24.717  28.397  1.00 52.71  ?  280  ASP C OD1 1 
ATOM   10524 O  OD2 . ASP C  1 280 ? -1.545  23.652  27.315  1.00 52.26  ?  280  ASP C OD2 1 
ATOM   10525 N  N   . LEU C  1 281 ? 2.808   22.206  26.605  1.00 54.22  ?  281  LEU C N   1 
ATOM   10526 C  CA  . LEU C  1 281 ? 3.557   21.127  27.238  1.00 47.73  ?  281  LEU C CA  1 
ATOM   10527 C  C   . LEU C  1 281 ? 4.936   21.592  27.679  1.00 45.63  ?  281  LEU C C   1 
ATOM   10528 O  O   . LEU C  1 281 ? 5.339   21.357  28.823  1.00 47.34  ?  281  LEU C O   1 
ATOM   10529 C  CB  . LEU C  1 281 ? 3.656   19.942  26.279  1.00 48.84  ?  281  LEU C CB  1 
ATOM   10530 C  CG  . LEU C  1 281 ? 2.540   18.894  26.328  1.00 49.59  ?  281  LEU C CG  1 
ATOM   10531 C  CD1 . LEU C  1 281 ? 1.190   19.518  26.489  1.00 49.93  ?  281  LEU C CD1 1 
ATOM   10532 C  CD2 . LEU C  1 281 ? 2.560   18.069  25.055  1.00 46.22  ?  281  LEU C CD2 1 
ATOM   10533 N  N   . VAL C  1 282 ? 5.674   22.271  26.796  1.00 45.38  ?  282  VAL C N   1 
ATOM   10534 C  CA  . VAL C  1 282 ? 7.017   22.717  27.174  1.00 46.36  ?  282  VAL C CA  1 
ATOM   10535 C  C   . VAL C  1 282 ? 6.954   23.688  28.349  1.00 46.82  ?  282  VAL C C   1 
ATOM   10536 O  O   . VAL C  1 282 ? 7.808   23.660  29.246  1.00 45.59  ?  282  VAL C O   1 
ATOM   10537 C  CB  . VAL C  1 282 ? 7.738   23.343  25.967  1.00 45.85  ?  282  VAL C CB  1 
ATOM   10538 C  CG1 . VAL C  1 282 ? 9.126   23.796  26.370  1.00 43.75  ?  282  VAL C CG1 1 
ATOM   10539 C  CG2 . VAL C  1 282 ? 7.823   22.346  24.842  1.00 45.45  ?  282  VAL C CG2 1 
ATOM   10540 N  N   . ASP C  1 283 ? 5.943   24.559  28.363  1.00 48.50  ?  283  ASP C N   1 
ATOM   10541 C  CA  . ASP C  1 283 ? 5.801   25.525  29.447  1.00 51.06  ?  283  ASP C CA  1 
ATOM   10542 C  C   . ASP C  1 283 ? 5.576   24.825  30.780  1.00 56.78  ?  283  ASP C C   1 
ATOM   10543 O  O   . ASP C  1 283 ? 6.094   25.267  31.813  1.00 60.35  ?  283  ASP C O   1 
ATOM   10544 C  CB  . ASP C  1 283 ? 4.650   26.499  29.164  1.00 50.07  ?  283  ASP C CB  1 
ATOM   10545 C  CG  . ASP C  1 283 ? 5.010   27.564  28.129  1.00 50.25  ?  283  ASP C CG  1 
ATOM   10546 O  OD1 . ASP C  1 283 ? 6.206   27.708  27.795  1.00 49.11  ?  283  ASP C OD1 1 
ATOM   10547 O  OD2 . ASP C  1 283 ? 4.090   28.269  27.653  1.00 49.74  ?  283  ASP C OD2 1 
ATOM   10548 N  N   . HIS C  1 284 ? 4.788   23.746  30.788  1.00 57.68  ?  284  HIS C N   1 
ATOM   10549 C  CA  . HIS C  1 284 ? 4.458   23.053  32.034  1.00 55.45  ?  284  HIS C CA  1 
ATOM   10550 C  C   . HIS C  1 284 ? 5.323   21.835  32.354  1.00 51.52  ?  284  HIS C C   1 
ATOM   10551 O  O   . HIS C  1 284 ? 5.035   21.146  33.335  1.00 49.69  ?  284  HIS C O   1 
ATOM   10552 C  CB  . HIS C  1 284 ? 2.980   22.655  32.030  1.00 54.99  ?  284  HIS C CB  1 
ATOM   10553 C  CG  . HIS C  1 284 ? 2.053   23.828  32.040  1.00 54.25  ?  284  HIS C CG  1 
ATOM   10554 N  ND1 . HIS C  1 284 ? 1.772   24.566  30.911  1.00 53.63  ?  284  HIS C ND1 1 
ATOM   10555 C  CD2 . HIS C  1 284 ? 1.353   24.400  33.048  1.00 55.01  ?  284  HIS C CD2 1 
ATOM   10556 C  CE1 . HIS C  1 284 ? 0.933   25.538  31.223  1.00 54.97  ?  284  HIS C CE1 1 
ATOM   10557 N  NE2 . HIS C  1 284 ? 0.662   25.459  32.513  1.00 55.08  ?  284  HIS C NE2 1 
ATOM   10558 N  N   . GLU C  1 285 ? 6.359   21.535  31.568  1.00 50.81  ?  285  GLU C N   1 
ATOM   10559 C  CA  . GLU C  1 285 ? 7.034   20.248  31.740  1.00 50.64  ?  285  GLU C CA  1 
ATOM   10560 C  C   . GLU C  1 285 ? 7.893   20.195  33.004  1.00 50.59  ?  285  GLU C C   1 
ATOM   10561 O  O   . GLU C  1 285 ? 8.020   19.127  33.611  1.00 51.32  ?  285  GLU C O   1 
ATOM   10562 C  CB  . GLU C  1 285 ? 7.859   19.909  30.493  1.00 51.05  ?  285  GLU C CB  1 
ATOM   10563 C  CG  . GLU C  1 285 ? 9.358   20.143  30.576  1.00 53.56  ?  285  GLU C CG  1 
ATOM   10564 C  CD  . GLU C  1 285 ? 10.097  19.567  29.371  1.00 57.23  ?  285  GLU C CD  1 
ATOM   10565 O  OE1 . GLU C  1 285 ? 10.042  20.179  28.283  1.00 58.02  ?  285  GLU C OE1 1 
ATOM   10566 O  OE2 . GLU C  1 285 ? 10.744  18.507  29.511  1.00 58.87  ?  285  GLU C OE2 1 
ATOM   10567 N  N   . TRP C  1 286 ? 8.475   21.315  33.430  1.00 50.69  ?  286  TRP C N   1 
ATOM   10568 C  CA  . TRP C  1 286 ? 9.322   21.302  34.619  1.00 49.75  ?  286  TRP C CA  1 
ATOM   10569 C  C   . TRP C  1 286 ? 8.527   21.315  35.921  1.00 51.16  ?  286  TRP C C   1 
ATOM   10570 O  O   . TRP C  1 286 ? 9.118   21.121  36.989  1.00 49.92  ?  286  TRP C O   1 
ATOM   10571 C  CB  . TRP C  1 286 ? 10.281  22.498  34.600  1.00 50.36  ?  286  TRP C CB  1 
ATOM   10572 C  CG  . TRP C  1 286 ? 11.265  22.481  33.467  1.00 51.70  ?  286  TRP C CG  1 
ATOM   10573 C  CD1 . TRP C  1 286 ? 11.126  23.090  32.246  1.00 54.22  ?  286  TRP C CD1 1 
ATOM   10574 C  CD2 . TRP C  1 286 ? 12.539  21.827  33.443  1.00 49.14  ?  286  TRP C CD2 1 
ATOM   10575 N  NE1 . TRP C  1 286 ? 12.235  22.848  31.467  1.00 53.09  ?  286  TRP C NE1 1 
ATOM   10576 C  CE2 . TRP C  1 286 ? 13.116  22.077  32.179  1.00 50.02  ?  286  T