data_5FL4
# 
_entry.id   5FL4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.303 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5FL4         
PDBE  EBI-65346    
WWPDB D_1290065346 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 5FL5 unspecified 
;THREE DIMENSIONAL STRUCTURE OF HUMAN CARBONIC ANHYDRASE IX IN COMPLEX WITH 5-(1-(4-METHOXYPHENYL)-1H-1,2, 3-TRIAZOL-4-YL)THIOPHENE-2-SULFONAMIDE
;
PDB 5FL6 unspecified 
;THREE DIMENSIONAL STRUCTURE OF HUMAN CARBONIC ANHYDRASE IX IN COMPLEX WITH 5-(1-(4-METHYLPHENYL)-1H-1,2, 3-TRIAZOL-4-YL)THIOPHENE-2-SULFONAMIDE
;
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        5FL4 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2015-10-21 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Leitans, J.'     1 
'Tars, K.'        2 
'Zalubovskis, R.' 3 
# 
_citation.id                        primary 
_citation.title                     
'An Efficient Expression and Crystallization System of the Cancer Asociated Carbonic Anhydrase Isoform Ix.' 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            58 
_citation.page_first                9004 
_citation.page_last                 ? 
_citation.year                      2015 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26522624 
_citation.pdbx_database_id_DOI      10.1021/ACS.JMEDCHEM.5B01343 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Leitans, J.'     1 ? 
primary 'Kazaks, A.'      2 ? 
primary 'Balode, A.'      3 ? 
primary 'Ivanova, J.'     4 ? 
primary 'Zalubovskis, R.' 5 ? 
primary 'Supuran, C.T.'   6 ? 
primary 'Tars, K.'        7 ? 
# 
_cell.entry_id           5FL4 
_cell.length_a           152.290 
_cell.length_b           152.290 
_cell.length_c           172.130 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              36 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5FL4 
_symmetry.space_group_name_H-M             'H 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                146 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CARBONIC ANHYDRASE 9'                                            28172.684 4    4.2.1.1 YES 
'UNP RESIDUES 137-391' ? 
2 non-polymer syn 'ZINC ION'                                                        65.409    4    ?       ?   ? ? 
3 non-polymer syn '5-(1-naphthalen-1-yl-1,2,3-triazol-4-yl)thiophene-2-sulfonamide' 356.422   4    ?       ?   ? ? 
4 non-polymer syn GLYCEROL                                                          92.094    4    ?       ?   ? ? 
5 non-polymer syn 'ACETIC ACID'                                                     60.052    6    ?       ?   ? ? 
6 water       nat water                                                             18.015    1050 ?       ?   ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;CARBONATE DEHYDRATASE IX, CARBONIC ANHYDRASE IX, CA-IX, CAIX, MEMBRANE ANTIGEN MN, P54/58N, RENAL CELL CARCINOMA-ASSOCIATED ANTIGEN G250, RCC-ASSOCIATED ANTIGEN G250, PMW1
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPDQSHWRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFSPALRPLELLGFQLPPLPELRLRNNGHSVQLTLPPGLEMAL
GPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLSTAFARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLS
RLEEIAEEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVMLSAKQLHTLSDTLWGPGDSRLQLN
FRATQPLNGRVIEASFP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPDQSHWRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFSPALRPLELLGFQLPPLPELRLRNNGHSVQLTLPPGLEMAL
GPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLSTAFARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLS
RLEEIAEEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVMLSAKQLHTLSDTLWGPGDSRLQLN
FRATQPLNGRVIEASFP
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   ASP n 
1 4   GLN n 
1 5   SER n 
1 6   HIS n 
1 7   TRP n 
1 8   ARG n 
1 9   TYR n 
1 10  GLY n 
1 11  GLY n 
1 12  ASP n 
1 13  PRO n 
1 14  PRO n 
1 15  TRP n 
1 16  PRO n 
1 17  ARG n 
1 18  VAL n 
1 19  SER n 
1 20  PRO n 
1 21  ALA n 
1 22  CYS n 
1 23  ALA n 
1 24  GLY n 
1 25  ARG n 
1 26  PHE n 
1 27  GLN n 
1 28  SER n 
1 29  PRO n 
1 30  VAL n 
1 31  ASP n 
1 32  ILE n 
1 33  ARG n 
1 34  PRO n 
1 35  GLN n 
1 36  LEU n 
1 37  ALA n 
1 38  ALA n 
1 39  PHE n 
1 40  SER n 
1 41  PRO n 
1 42  ALA n 
1 43  LEU n 
1 44  ARG n 
1 45  PRO n 
1 46  LEU n 
1 47  GLU n 
1 48  LEU n 
1 49  LEU n 
1 50  GLY n 
1 51  PHE n 
1 52  GLN n 
1 53  LEU n 
1 54  PRO n 
1 55  PRO n 
1 56  LEU n 
1 57  PRO n 
1 58  GLU n 
1 59  LEU n 
1 60  ARG n 
1 61  LEU n 
1 62  ARG n 
1 63  ASN n 
1 64  ASN n 
1 65  GLY n 
1 66  HIS n 
1 67  SER n 
1 68  VAL n 
1 69  GLN n 
1 70  LEU n 
1 71  THR n 
1 72  LEU n 
1 73  PRO n 
1 74  PRO n 
1 75  GLY n 
1 76  LEU n 
1 77  GLU n 
1 78  MET n 
1 79  ALA n 
1 80  LEU n 
1 81  GLY n 
1 82  PRO n 
1 83  GLY n 
1 84  ARG n 
1 85  GLU n 
1 86  TYR n 
1 87  ARG n 
1 88  ALA n 
1 89  LEU n 
1 90  GLN n 
1 91  LEU n 
1 92  HIS n 
1 93  LEU n 
1 94  HIS n 
1 95  TRP n 
1 96  GLY n 
1 97  ALA n 
1 98  ALA n 
1 99  GLY n 
1 100 ARG n 
1 101 PRO n 
1 102 GLY n 
1 103 SER n 
1 104 GLU n 
1 105 HIS n 
1 106 THR n 
1 107 VAL n 
1 108 GLU n 
1 109 GLY n 
1 110 HIS n 
1 111 ARG n 
1 112 PHE n 
1 113 PRO n 
1 114 ALA n 
1 115 GLU n 
1 116 ILE n 
1 117 HIS n 
1 118 VAL n 
1 119 VAL n 
1 120 HIS n 
1 121 LEU n 
1 122 SER n 
1 123 THR n 
1 124 ALA n 
1 125 PHE n 
1 126 ALA n 
1 127 ARG n 
1 128 VAL n 
1 129 ASP n 
1 130 GLU n 
1 131 ALA n 
1 132 LEU n 
1 133 GLY n 
1 134 ARG n 
1 135 PRO n 
1 136 GLY n 
1 137 GLY n 
1 138 LEU n 
1 139 ALA n 
1 140 VAL n 
1 141 LEU n 
1 142 ALA n 
1 143 ALA n 
1 144 PHE n 
1 145 LEU n 
1 146 GLU n 
1 147 GLU n 
1 148 GLY n 
1 149 PRO n 
1 150 GLU n 
1 151 GLU n 
1 152 ASN n 
1 153 SER n 
1 154 ALA n 
1 155 TYR n 
1 156 GLU n 
1 157 GLN n 
1 158 LEU n 
1 159 LEU n 
1 160 SER n 
1 161 ARG n 
1 162 LEU n 
1 163 GLU n 
1 164 GLU n 
1 165 ILE n 
1 166 ALA n 
1 167 GLU n 
1 168 GLU n 
1 169 GLY n 
1 170 SER n 
1 171 GLU n 
1 172 THR n 
1 173 GLN n 
1 174 VAL n 
1 175 PRO n 
1 176 GLY n 
1 177 LEU n 
1 178 ASP n 
1 179 ILE n 
1 180 SER n 
1 181 ALA n 
1 182 LEU n 
1 183 LEU n 
1 184 PRO n 
1 185 SER n 
1 186 ASP n 
1 187 PHE n 
1 188 SER n 
1 189 ARG n 
1 190 TYR n 
1 191 PHE n 
1 192 GLN n 
1 193 TYR n 
1 194 GLU n 
1 195 GLY n 
1 196 SER n 
1 197 LEU n 
1 198 THR n 
1 199 THR n 
1 200 PRO n 
1 201 PRO n 
1 202 CYS n 
1 203 ALA n 
1 204 GLN n 
1 205 GLY n 
1 206 VAL n 
1 207 ILE n 
1 208 TRP n 
1 209 THR n 
1 210 VAL n 
1 211 PHE n 
1 212 ASN n 
1 213 GLN n 
1 214 THR n 
1 215 VAL n 
1 216 MET n 
1 217 LEU n 
1 218 SER n 
1 219 ALA n 
1 220 LYS n 
1 221 GLN n 
1 222 LEU n 
1 223 HIS n 
1 224 THR n 
1 225 LEU n 
1 226 SER n 
1 227 ASP n 
1 228 THR n 
1 229 LEU n 
1 230 TRP n 
1 231 GLY n 
1 232 PRO n 
1 233 GLY n 
1 234 ASP n 
1 235 SER n 
1 236 ARG n 
1 237 LEU n 
1 238 GLN n 
1 239 LEU n 
1 240 ASN n 
1 241 PHE n 
1 242 ARG n 
1 243 ALA n 
1 244 THR n 
1 245 GLN n 
1 246 PRO n 
1 247 LEU n 
1 248 ASN n 
1 249 GLY n 
1 250 ARG n 
1 251 VAL n 
1 252 ILE n 
1 253 GLU n 
1 254 ALA n 
1 255 SER n 
1 256 PHE n 
1 257 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'KOMAGATAELLA PASTORIS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4922 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CAH9_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q16790 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5FL4 A 3 ? 257 ? Q16790 137 ? 391 ? 5 259 
2 1 5FL4 B 3 ? 257 ? Q16790 137 ? 391 ? 5 259 
3 1 5FL4 C 3 ? 257 ? Q16790 137 ? 391 ? 5 259 
4 1 5FL4 D 3 ? 257 ? Q16790 137 ? 391 ? 5 259 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5FL4 GLY A 1  ? UNP Q16790 ?   ?   'expression tag'      3  1  
1 5FL4 PRO A 2  ? UNP Q16790 ?   ?   'expression tag'      4  2  
1 5FL4 SER A 40 ? UNP Q16790 CYS 174 'engineered mutation' 42 3  
2 5FL4 GLY B 1  ? UNP Q16790 ?   ?   'expression tag'      3  4  
2 5FL4 PRO B 2  ? UNP Q16790 ?   ?   'expression tag'      4  5  
2 5FL4 SER B 40 ? UNP Q16790 CYS 174 'engineered mutation' 42 6  
3 5FL4 GLY C 1  ? UNP Q16790 ?   ?   'expression tag'      3  7  
3 5FL4 PRO C 2  ? UNP Q16790 ?   ?   'expression tag'      4  8  
3 5FL4 SER C 40 ? UNP Q16790 CYS 174 'engineered mutation' 42 9  
4 5FL4 GLY D 1  ? UNP Q16790 ?   ?   'expression tag'      3  10 
4 5FL4 PRO D 2  ? UNP Q16790 ?   ?   'expression tag'      4  11 
4 5FL4 SER D 40 ? UNP Q16790 CYS 174 'engineered mutation' 42 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
9FK non-polymer         . '5-(1-naphthalen-1-yl-1,2,3-triazol-4-yl)thiophene-2-sulfonamide' ?                               
'C16 H12 N4 O2 S2' 356.422 
ACY non-polymer         . 'ACETIC ACID'                                                     ?                               
'C2 H4 O2'         60.052  
ALA 'L-peptide linking' y ALANINE                                                           ?                               
'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                                          ?                               
'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                        ?                               
'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                   ?                               
'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                                                          ?                               
'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                         ?                               
'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                   ?                               
'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                                           ?                               
'C2 H5 N O2'       75.067  
GOL non-polymer         . GLYCEROL                                                          'GLYCERIN; PROPANE-1,2,3-TRIOL' 
'C3 H8 O3'         92.094  
HIS 'L-peptide linking' y HISTIDINE                                                         ?                               
'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                                             ?                               'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                        ?                               
'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                                           ?                               
'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                                            ?                               
'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                                        ?                               
'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                     ?                               
'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                                           ?                               
'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                                            ?                               
'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                                         ?                               
'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                        ?                               
'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                                          ?                               
'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                                            ?                               
'C5 H11 N O2'      117.146 
ZN  non-polymer         . 'ZINC ION'                                                        ?                               'Zn 2' 
65.409  
# 
_exptl.entry_id          5FL4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.41 
_exptl_crystal.density_percent_sol   63.97 
_exptl_crystal.description           NONE 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;1.0 M DI-AMMONIUM HYDROGEN PHOSPHATE, 0.1 M SODIUM ACETATE PH 4.5, PROTEIN 10 MG/ML 5-10 MM INHIBITOR (STOCK SOLUTION WAS 100 MM INHIBITOR DISSOLVED IN 100% DIMETHYL SULFOXIDE) VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 294K
;
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2015-04-15 
_diffrn_detector.details                MULTILAYER 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.91922 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I911-3' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I911-3 
_diffrn_source.pdbx_wavelength             0.91922 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5FL4 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             61.55 
_reflns.d_resolution_high            1.82 
_reflns.number_obs                   133470 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.90 
_reflns.B_iso_Wilson_estimate        20.9 
_reflns.pdbx_redundancy              2.9 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.82 
_reflns_shell.d_res_low              1.92 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.49 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.00 
_reflns_shell.pdbx_redundancy        2.5 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5FL4 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     126519 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             61.56 
_refine.ls_d_res_high                            1.82 
_refine.ls_percent_reflns_obs                    99.98 
_refine.ls_R_factor_obs                          0.19215 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19034 
_refine.ls_R_factor_R_free                       0.22431 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_number_reflns_R_free                  6944 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.962 
_refine.correlation_coeff_Fo_to_Fc_free          0.945 
_refine.B_iso_mean                               31.758 
_refine.aniso_B[1][1]                            0.55 
_refine.aniso_B[2][2]                            0.55 
_refine.aniso_B[3][3]                            -1.77 
_refine.aniso_B[1][2]                            0.27 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES REFINED INDIVIDUALLY' 
_refine.pdbx_starting_model                      'PDB ENTRY 3IAI' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.111 
_refine.pdbx_overall_ESU_R_Free                  0.111 
_refine.overall_SU_ML                            0.096 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             3.349 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7738 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         148 
_refine_hist.number_atoms_solvent             1050 
_refine_hist.number_atoms_total               8936 
_refine_hist.d_res_high                       1.82 
_refine_hist.d_res_low                        61.56 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010  0.019  ? 8156  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002  0.020  ? 7566  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.725  1.985  ? 11146 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.911  3.000  ? 17386 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.838  5.000  ? 1012  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.842 22.967 ? 364   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       12.359 15.000 ? 1170  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.197 15.000 ? 70    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.079  0.200  ? 1186  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.021  ? 9298  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.002  0.020  ? 1932  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.762  3.005  ? 4030  'X-RAY DIFFRACTION' ? 
r_mcbond_other               1.758  3.001  ? 4023  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.744  4.495  ? 5026  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.162  3.262  ? 4126  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.820 
_refine_ls_shell.d_res_low                        1.867 
_refine_ls_shell.number_reflns_R_work             9382 
_refine_ls_shell.R_factor_R_work                  0.323 
_refine_ls_shell.percent_reflns_obs               99.95 
_refine_ls_shell.R_factor_R_free                  0.330 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             496 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  5FL4 
_struct.title                     
;Three dimensional structure of human carbonic anhydrase IX in complex with 5-(1-naphthalen-1-yl-1,2,3-triazol-4-yl)thiophene-2-sulfonamide
;
_struct.pdbx_descriptor           'CARBONIC ANHYDRASE 9 (E.C.4.2.1.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        5FL4 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            LYASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 5 ? 
J N N 2 ? 
K N N 3 ? 
L N N 4 ? 
M N N 5 ? 
N N N 2 ? 
O N N 3 ? 
P N N 4 ? 
Q N N 5 ? 
R N N 5 ? 
S N N 5 ? 
T N N 2 ? 
U N N 3 ? 
V N N 4 ? 
W N N 6 ? 
X N N 6 ? 
Y N N 6 ? 
Z N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 14  ? SER A 19  ? PRO A 16  SER A 21  1 ? 6  
HELX_P HELX_P2  2  PRO A 20  ? GLY A 24  ? PRO A 22  GLY A 26  5 ? 5  
HELX_P HELX_P3  3  ARG A 127 ? LEU A 132 ? ARG A 129 LEU A 134 1 ? 6  
HELX_P HELX_P4  4  ASN A 152 ? SER A 160 ? ASN A 154 SER A 162 1 ? 9  
HELX_P HELX_P5  5  ARG A 161 ? ALA A 166 ? ARG A 163 ALA A 168 5 ? 6  
HELX_P HELX_P6  6  ILE A 179 ? LEU A 183 ? ILE A 181 LEU A 185 5 ? 5  
HELX_P HELX_P7  7  SER A 218 ? THR A 228 ? SER A 220 THR A 230 1 ? 11 
HELX_P HELX_P8  8  PRO B 14  ? VAL B 18  ? PRO B 16  VAL B 20  5 ? 5  
HELX_P HELX_P9  9  SER B 19  ? GLY B 24  ? SER B 21  GLY B 26  5 ? 6  
HELX_P HELX_P10 10 ARG B 33  ? ALA B 37  ? ARG B 35  ALA B 39  5 ? 5  
HELX_P HELX_P11 11 ARG B 127 ? LEU B 132 ? ARG B 129 LEU B 134 1 ? 6  
HELX_P HELX_P12 12 ASN B 152 ? SER B 160 ? ASN B 154 SER B 162 1 ? 9  
HELX_P HELX_P13 13 ARG B 161 ? ALA B 166 ? ARG B 163 ALA B 168 5 ? 6  
HELX_P HELX_P14 14 ILE B 179 ? LEU B 183 ? ILE B 181 LEU B 185 5 ? 5  
HELX_P HELX_P15 15 SER B 218 ? THR B 228 ? SER B 220 THR B 230 1 ? 11 
HELX_P HELX_P16 16 PRO C 14  ? SER C 19  ? PRO C 16  SER C 21  1 ? 6  
HELX_P HELX_P17 17 PRO C 20  ? GLY C 24  ? PRO C 22  GLY C 26  5 ? 5  
HELX_P HELX_P18 18 ARG C 33  ? ALA C 37  ? ARG C 35  ALA C 39  5 ? 5  
HELX_P HELX_P19 19 ARG C 127 ? LEU C 132 ? ARG C 129 LEU C 134 1 ? 6  
HELX_P HELX_P20 20 ASN C 152 ? SER C 160 ? ASN C 154 SER C 162 1 ? 9  
HELX_P HELX_P21 21 ARG C 161 ? ALA C 166 ? ARG C 163 ALA C 168 5 ? 6  
HELX_P HELX_P22 22 ILE C 179 ? LEU C 183 ? ILE C 181 LEU C 185 5 ? 5  
HELX_P HELX_P23 23 ALA C 219 ? LEU C 229 ? ALA C 221 LEU C 231 1 ? 11 
HELX_P HELX_P24 24 PRO D 14  ? SER D 19  ? PRO D 16  SER D 21  1 ? 6  
HELX_P HELX_P25 25 PRO D 20  ? GLY D 24  ? PRO D 22  GLY D 26  5 ? 5  
HELX_P HELX_P26 26 ARG D 127 ? LEU D 132 ? ARG D 129 LEU D 134 1 ? 6  
HELX_P HELX_P27 27 ASN D 152 ? SER D 160 ? ASN D 154 SER D 162 1 ? 9  
HELX_P HELX_P28 28 ARG D 161 ? ALA D 166 ? ARG D 163 ALA D 168 5 ? 6  
HELX_P HELX_P29 29 ILE D 179 ? LEU D 183 ? ILE D 181 LEU D 185 5 ? 5  
HELX_P HELX_P30 30 SER D 218 ? THR D 228 ? SER D 220 THR D 230 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 202 SG  ? ? A CYS 24  A CYS 204 1_555 ? ? ? ? ? ? ? 2.087 ? 
disulf2  disulf ? ? B CYS 22 SG ? ? ? 1_555 B CYS 202 SG  ? ? B CYS 24  B CYS 204 1_555 ? ? ? ? ? ? ? 2.068 ? 
disulf3  disulf ? ? C CYS 22 SG ? ? ? 1_555 C CYS 202 SG  ? ? C CYS 24  C CYS 204 1_555 ? ? ? ? ? ? ? 2.091 ? 
disulf4  disulf ? ? D CYS 22 SG ? ? ? 1_555 D CYS 202 SG  ? ? D CYS 24  D CYS 204 1_555 ? ? ? ? ? ? ? 2.081 ? 
metalc1  metalc ? ? E ZN  .  ZN ? ? ? 1_555 A HIS 92  NE2 ? ? A ZN  264 A HIS 94  1_555 ? ? ? ? ? ? ? 2.101 ? 
metalc2  metalc ? ? E ZN  .  ZN ? ? ? 1_555 A HIS 94  NE2 ? ? A ZN  264 A HIS 96  1_555 ? ? ? ? ? ? ? 2.097 ? 
metalc3  metalc ? ? E ZN  .  ZN ? ? ? 1_555 A HIS 117 ND1 ? ? A ZN  264 A HIS 119 1_555 ? ? ? ? ? ? ? 2.097 ? 
metalc4  metalc ? ? E ZN  .  ZN ? ? ? 1_555 F 9FK .   N24 ? ? A ZN  264 A 9FK 269 1_555 ? ? ? ? ? ? ? 2.066 ? 
metalc5  metalc ? ? J ZN  .  ZN ? ? ? 1_555 B HIS 92  NE2 ? ? B ZN  264 B HIS 94  1_555 ? ? ? ? ? ? ? 2.133 ? 
metalc6  metalc ? ? J ZN  .  ZN ? ? ? 1_555 K 9FK .   N24 ? ? B ZN  264 B 9FK 268 1_555 ? ? ? ? ? ? ? 2.128 ? 
metalc7  metalc ? ? J ZN  .  ZN ? ? ? 1_555 B HIS 94  NE2 ? ? B ZN  264 B HIS 96  1_555 ? ? ? ? ? ? ? 2.205 ? 
metalc8  metalc ? ? J ZN  .  ZN ? ? ? 1_555 B HIS 117 ND1 ? ? B ZN  264 B HIS 119 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc9  metalc ? ? N ZN  .  ZN ? ? ? 1_555 C HIS 92  NE2 ? ? C ZN  264 C HIS 94  1_555 ? ? ? ? ? ? ? 2.191 ? 
metalc10 metalc ? ? N ZN  .  ZN ? ? ? 1_555 C HIS 94  NE2 ? ? C ZN  264 C HIS 96  1_555 ? ? ? ? ? ? ? 2.137 ? 
metalc11 metalc ? ? N ZN  .  ZN ? ? ? 1_555 C HIS 117 ND1 ? ? C ZN  264 C HIS 119 1_555 ? ? ? ? ? ? ? 2.099 ? 
metalc12 metalc ? ? N ZN  .  ZN ? ? ? 1_555 O 9FK .   N24 ? ? C ZN  264 C 9FK 267 1_555 ? ? ? ? ? ? ? 2.099 ? 
metalc13 metalc ? ? T ZN  .  ZN ? ? ? 1_555 D HIS 94  NE2 ? ? D ZN  264 D HIS 96  1_555 ? ? ? ? ? ? ? 2.235 ? 
metalc14 metalc ? ? T ZN  .  ZN ? ? ? 1_555 U 9FK .   N24 ? ? D ZN  264 D 9FK 266 1_555 ? ? ? ? ? ? ? 2.102 ? 
metalc15 metalc ? ? T ZN  .  ZN ? ? ? 1_555 U 9FK .   S21 ? ? D ZN  264 D 9FK 266 1_555 ? ? ? ? ? ? ? 2.967 ? 
metalc16 metalc ? ? T ZN  .  ZN ? ? ? 1_555 D HIS 117 ND1 ? ? D ZN  264 D HIS 119 1_555 ? ? ? ? ? ? ? 2.052 ? 
metalc17 metalc ? ? T ZN  .  ZN ? ? ? 1_555 D HIS 92  NE2 ? ? D ZN  264 D HIS 94  1_555 ? ? ? ? ? ? ? 2.138 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ASP 12  A . ? ASP 14  A PRO 13  A ? PRO 15  A 1 0.90  
2  SER 28  A . ? SER 30  A PRO 29  A ? PRO 31  A 1 -0.07 
3  LEU 56  A . ? LEU 58  A PRO 57  A ? PRO 59  A 1 8.97  
4  PRO 200 A . ? PRO 202 A PRO 201 A ? PRO 203 A 1 10.05 
5  ASP 12  B . ? ASP 14  B PRO 13  B ? PRO 15  B 1 15.40 
6  SER 28  B . ? SER 30  B PRO 29  B ? PRO 31  B 1 -1.26 
7  LEU 56  B . ? LEU 58  B PRO 57  B ? PRO 59  B 1 4.17  
8  PRO 200 B . ? PRO 202 B PRO 201 B ? PRO 203 B 1 9.37  
9  ASP 12  C . ? ASP 14  C PRO 13  C ? PRO 15  C 1 -1.91 
10 SER 28  C . ? SER 30  C PRO 29  C ? PRO 31  C 1 -0.39 
11 LEU 56  C . ? LEU 58  C PRO 57  C ? PRO 59  C 1 7.97  
12 PRO 200 C . ? PRO 202 C PRO 201 C ? PRO 203 C 1 8.75  
13 ASP 12  D . ? ASP 14  D PRO 13  D ? PRO 15  D 1 3.55  
14 SER 28  D . ? SER 30  D PRO 29  D ? PRO 31  D 1 3.54  
15 LEU 56  D . ? LEU 58  D PRO 57  D ? PRO 59  D 1 2.73  
16 PRO 200 D . ? PRO 202 D PRO 201 D ? PRO 203 D 1 14.56 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2  ? 
AB ? 6  ? 
AC ? 9  ? 
AD ? 10 ? 
AE ? 2  ? 
BA ? 2  ? 
BB ? 6  ? 
BC ? 9  ? 
BD ? 10 ? 
BE ? 2  ? 
CA ? 2  ? 
CB ? 6  ? 
CC ? 9  ? 
CD ? 10 ? 
CE ? 2  ? 
CF ? 2  ? 
DA ? 2  ? 
DB ? 6  ? 
DC ? 9  ? 
DD ? 10 ? 
DE ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2  ? parallel      
AB 1 2  ? parallel      
AB 2 3  ? anti-parallel 
AB 3 4  ? anti-parallel 
AB 4 5  ? parallel      
AB 5 6  ? parallel      
AC 1 2  ? parallel      
AC 2 3  ? anti-parallel 
AC 3 4  ? anti-parallel 
AC 4 5  ? parallel      
AC 5 6  ? anti-parallel 
AC 6 7  ? anti-parallel 
AC 7 8  ? anti-parallel 
AC 8 9  ? parallel      
AD 1 2  ? parallel      
AD 2 3  ? anti-parallel 
AD 3 4  ? anti-parallel 
AD 4 5  ? parallel      
AD 5 6  ? anti-parallel 
AD 6 7  ? anti-parallel 
AD 7 8  ? anti-parallel 
AD 8 9  ? anti-parallel 
AD 9 10 ? anti-parallel 
AE 1 2  ? parallel      
BA 1 2  ? parallel      
BB 1 2  ? parallel      
BB 2 3  ? anti-parallel 
BB 3 4  ? anti-parallel 
BB 4 5  ? parallel      
BB 5 6  ? parallel      
BC 1 2  ? parallel      
BC 2 3  ? anti-parallel 
BC 3 4  ? anti-parallel 
BC 4 5  ? parallel      
BC 5 6  ? anti-parallel 
BC 6 7  ? anti-parallel 
BC 7 8  ? anti-parallel 
BC 8 9  ? parallel      
BD 1 2  ? parallel      
BD 2 3  ? anti-parallel 
BD 3 4  ? anti-parallel 
BD 4 5  ? parallel      
BD 5 6  ? anti-parallel 
BD 6 7  ? anti-parallel 
BD 7 8  ? anti-parallel 
BD 8 9  ? anti-parallel 
BD 9 10 ? anti-parallel 
BE 1 2  ? parallel      
CA 1 2  ? parallel      
CB 1 2  ? parallel      
CB 2 3  ? anti-parallel 
CB 3 4  ? anti-parallel 
CB 4 5  ? parallel      
CB 5 6  ? parallel      
CC 1 2  ? parallel      
CC 2 3  ? anti-parallel 
CC 3 4  ? anti-parallel 
CC 4 5  ? parallel      
CC 5 6  ? anti-parallel 
CC 6 7  ? anti-parallel 
CC 7 8  ? anti-parallel 
CC 8 9  ? parallel      
CD 1 2  ? parallel      
CD 2 3  ? anti-parallel 
CD 3 4  ? anti-parallel 
CD 4 5  ? parallel      
CD 5 6  ? anti-parallel 
CD 6 7  ? anti-parallel 
CD 7 8  ? anti-parallel 
CD 8 9  ? anti-parallel 
CD 9 10 ? anti-parallel 
CE 1 2  ? parallel      
CF 1 2  ? anti-parallel 
DA 1 2  ? parallel      
DB 1 2  ? parallel      
DB 2 3  ? anti-parallel 
DB 3 4  ? anti-parallel 
DB 4 5  ? parallel      
DB 5 6  ? parallel      
DC 1 2  ? parallel      
DC 2 3  ? anti-parallel 
DC 3 4  ? anti-parallel 
DC 4 5  ? parallel      
DC 5 6  ? anti-parallel 
DC 6 7  ? anti-parallel 
DC 7 8  ? anti-parallel 
DC 8 9  ? parallel      
DD 1 2  ? parallel      
DD 2 3  ? anti-parallel 
DD 3 4  ? anti-parallel 
DD 4 5  ? parallel      
DD 5 6  ? anti-parallel 
DD 6 7  ? anti-parallel 
DD 7 8  ? anti-parallel 
DD 8 9  ? anti-parallel 
DD 9 10 ? anti-parallel 
DE 1 2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  ASP A 31  ? ILE A 32  ? ASP A 33  ILE A 34  
AA 2  THR A 106 ? VAL A 107 ? THR A 108 VAL A 109 
AB 1  ALA A 38  ? PHE A 39  ? ALA A 40  PHE A 41  
AB 2  GLU A 253 ? ALA A 254 ? GLU A 255 ALA A 256 
AB 3  TYR A 190 ? SER A 196 ? TYR A 192 SER A 198 
AB 4  GLN A 204 ? PHE A 211 ? GLN A 206 PHE A 213 
AB 5  LEU A 138 ? GLU A 147 ? LEU A 140 GLU A 149 
AB 6  VAL A 215 ? LEU A 217 ? VAL A 217 LEU A 219 
AC 1  ALA A 38  ? PHE A 39  ? ALA A 40  PHE A 41  
AC 2  GLU A 253 ? ALA A 254 ? GLU A 255 ALA A 256 
AC 3  TYR A 190 ? SER A 196 ? TYR A 192 SER A 198 
AC 4  GLN A 204 ? PHE A 211 ? GLN A 206 PHE A 213 
AC 5  LEU A 138 ? GLU A 147 ? LEU A 140 GLU A 149 
AC 6  ALA A 114 ? SER A 122 ? ALA A 116 SER A 124 
AC 7  GLU A 85  ? TRP A 95  ? GLU A 87  TRP A 97  
AC 8  GLU A 77  ? ALA A 79  ? GLU A 79  ALA A 81  
AC 9  GLU A 47  ? LEU A 49  ? GLU A 49  LEU A 51  
AD 1  ALA A 38  ? PHE A 39  ? ALA A 40  PHE A 41  
AD 2  GLU A 253 ? ALA A 254 ? GLU A 255 ALA A 256 
AD 3  TYR A 190 ? SER A 196 ? TYR A 192 SER A 198 
AD 4  GLN A 204 ? PHE A 211 ? GLN A 206 PHE A 213 
AD 5  LEU A 138 ? GLU A 147 ? LEU A 140 GLU A 149 
AD 6  ALA A 114 ? SER A 122 ? ALA A 116 SER A 124 
AD 7  GLU A 85  ? TRP A 95  ? GLU A 87  TRP A 97  
AD 8  VAL A 68  ? THR A 71  ? VAL A 70  THR A 73  
AD 9  LEU A 59  ? ASN A 63  ? LEU A 61  ASN A 65  
AD 10 GLU A 171 ? VAL A 174 ? GLU A 173 VAL A 176 
AE 1  VAL A 215 ? LEU A 217 ? VAL A 217 LEU A 219 
AE 2  LEU A 138 ? GLU A 147 ? LEU A 140 GLU A 149 
BA 1  ASP B 31  ? ILE B 32  ? ASP B 33  ILE B 34  
BA 2  THR B 106 ? VAL B 107 ? THR B 108 VAL B 109 
BB 1  ALA B 38  ? PHE B 39  ? ALA B 40  PHE B 41  
BB 2  GLU B 253 ? ALA B 254 ? GLU B 255 ALA B 256 
BB 3  TYR B 190 ? SER B 196 ? TYR B 192 SER B 198 
BB 4  GLN B 204 ? PHE B 211 ? GLN B 206 PHE B 213 
BB 5  LEU B 138 ? GLU B 147 ? LEU B 140 GLU B 149 
BB 6  VAL B 215 ? LEU B 217 ? VAL B 217 LEU B 219 
BC 1  ALA B 38  ? PHE B 39  ? ALA B 40  PHE B 41  
BC 2  GLU B 253 ? ALA B 254 ? GLU B 255 ALA B 256 
BC 3  TYR B 190 ? SER B 196 ? TYR B 192 SER B 198 
BC 4  GLN B 204 ? PHE B 211 ? GLN B 206 PHE B 213 
BC 5  LEU B 138 ? GLU B 147 ? LEU B 140 GLU B 149 
BC 6  ALA B 114 ? SER B 122 ? ALA B 116 SER B 124 
BC 7  ARG B 84  ? TRP B 95  ? ARG B 86  TRP B 97  
BC 8  GLU B 77  ? GLY B 81  ? GLU B 79  GLY B 83  
BC 9  GLU B 47  ? LEU B 49  ? GLU B 49  LEU B 51  
BD 1  ALA B 38  ? PHE B 39  ? ALA B 40  PHE B 41  
BD 2  GLU B 253 ? ALA B 254 ? GLU B 255 ALA B 256 
BD 3  TYR B 190 ? SER B 196 ? TYR B 192 SER B 198 
BD 4  GLN B 204 ? PHE B 211 ? GLN B 206 PHE B 213 
BD 5  LEU B 138 ? GLU B 147 ? LEU B 140 GLU B 149 
BD 6  ALA B 114 ? SER B 122 ? ALA B 116 SER B 124 
BD 7  ARG B 84  ? TRP B 95  ? ARG B 86  TRP B 97  
BD 8  VAL B 68  ? THR B 71  ? VAL B 70  THR B 73  
BD 9  LEU B 59  ? ASN B 63  ? LEU B 61  ASN B 65  
BD 10 GLU B 171 ? VAL B 174 ? GLU B 173 VAL B 176 
BE 1  VAL B 215 ? LEU B 217 ? VAL B 217 LEU B 219 
BE 2  LEU B 138 ? GLU B 147 ? LEU B 140 GLU B 149 
CA 1  ASP C 31  ? ILE C 32  ? ASP C 33  ILE C 34  
CA 2  THR C 106 ? VAL C 107 ? THR C 108 VAL C 109 
CB 1  ALA C 38  ? PHE C 39  ? ALA C 40  PHE C 41  
CB 2  GLU C 253 ? ALA C 254 ? GLU C 255 ALA C 256 
CB 3  TYR C 190 ? SER C 196 ? TYR C 192 SER C 198 
CB 4  GLN C 204 ? PHE C 211 ? GLN C 206 PHE C 213 
CB 5  LEU C 138 ? GLY C 148 ? LEU C 140 GLY C 150 
CB 6  VAL C 215 ? SER C 218 ? VAL C 217 SER C 220 
CC 1  ALA C 38  ? PHE C 39  ? ALA C 40  PHE C 41  
CC 2  GLU C 253 ? ALA C 254 ? GLU C 255 ALA C 256 
CC 3  TYR C 190 ? SER C 196 ? TYR C 192 SER C 198 
CC 4  GLN C 204 ? PHE C 211 ? GLN C 206 PHE C 213 
CC 5  LEU C 138 ? GLY C 148 ? LEU C 140 GLY C 150 
CC 6  ALA C 114 ? SER C 122 ? ALA C 116 SER C 124 
CC 7  ARG C 84  ? TRP C 95  ? ARG C 86  TRP C 97  
CC 8  GLU C 77  ? GLY C 81  ? GLU C 79  GLY C 83  
CC 9  GLU C 47  ? LEU C 49  ? GLU C 49  LEU C 51  
CD 1  ALA C 38  ? PHE C 39  ? ALA C 40  PHE C 41  
CD 2  GLU C 253 ? ALA C 254 ? GLU C 255 ALA C 256 
CD 3  TYR C 190 ? SER C 196 ? TYR C 192 SER C 198 
CD 4  GLN C 204 ? PHE C 211 ? GLN C 206 PHE C 213 
CD 5  LEU C 138 ? GLY C 148 ? LEU C 140 GLY C 150 
CD 6  ALA C 114 ? SER C 122 ? ALA C 116 SER C 124 
CD 7  ARG C 84  ? TRP C 95  ? ARG C 86  TRP C 97  
CD 8  VAL C 68  ? THR C 71  ? VAL C 70  THR C 73  
CD 9  LEU C 59  ? ASN C 63  ? LEU C 61  ASN C 65  
CD 10 GLU C 171 ? VAL C 174 ? GLU C 173 VAL C 176 
CE 1  VAL C 215 ? SER C 218 ? VAL C 217 SER C 220 
CE 2  LEU C 138 ? GLY C 148 ? LEU C 140 GLY C 150 
CF 1  TRP C 230 ? GLY C 231 ? TRP C 232 GLY C 233 
CF 2  SER C 235 ? ARG C 236 ? SER C 237 ARG C 238 
DA 1  ASP D 31  ? ILE D 32  ? ASP D 33  ILE D 34  
DA 2  THR D 106 ? VAL D 107 ? THR D 108 VAL D 109 
DB 1  ALA D 38  ? PHE D 39  ? ALA D 40  PHE D 41  
DB 2  GLU D 253 ? ALA D 254 ? GLU D 255 ALA D 256 
DB 3  TYR D 190 ? SER D 196 ? TYR D 192 SER D 198 
DB 4  GLN D 204 ? PHE D 211 ? GLN D 206 PHE D 213 
DB 5  LEU D 138 ? GLU D 147 ? LEU D 140 GLU D 149 
DB 6  VAL D 215 ? LEU D 217 ? VAL D 217 LEU D 219 
DC 1  ALA D 38  ? PHE D 39  ? ALA D 40  PHE D 41  
DC 2  GLU D 253 ? ALA D 254 ? GLU D 255 ALA D 256 
DC 3  TYR D 190 ? SER D 196 ? TYR D 192 SER D 198 
DC 4  GLN D 204 ? PHE D 211 ? GLN D 206 PHE D 213 
DC 5  LEU D 138 ? GLU D 147 ? LEU D 140 GLU D 149 
DC 6  ALA D 114 ? SER D 122 ? ALA D 116 SER D 124 
DC 7  ARG D 84  ? TRP D 95  ? ARG D 86  TRP D 97  
DC 8  GLU D 77  ? GLY D 81  ? GLU D 79  GLY D 83  
DC 9  GLU D 47  ? LEU D 49  ? GLU D 49  LEU D 51  
DD 1  ALA D 38  ? PHE D 39  ? ALA D 40  PHE D 41  
DD 2  GLU D 253 ? ALA D 254 ? GLU D 255 ALA D 256 
DD 3  TYR D 190 ? SER D 196 ? TYR D 192 SER D 198 
DD 4  GLN D 204 ? PHE D 211 ? GLN D 206 PHE D 213 
DD 5  LEU D 138 ? GLU D 147 ? LEU D 140 GLU D 149 
DD 6  ALA D 114 ? SER D 122 ? ALA D 116 SER D 124 
DD 7  ARG D 84  ? TRP D 95  ? ARG D 86  TRP D 97  
DD 8  VAL D 68  ? THR D 71  ? VAL D 70  THR D 73  
DD 9  LEU D 59  ? ASN D 63  ? LEU D 61  ASN D 65  
DD 10 GLU D 171 ? VAL D 174 ? GLU D 173 VAL D 176 
DE 1  VAL D 215 ? LEU D 217 ? VAL D 217 LEU D 219 
DE 2  LEU D 138 ? GLU D 147 ? LEU D 140 GLU D 149 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2  N ILE A 32  ? N ILE A 34  O THR A 106 ? O THR A 108 
AB 1 2  O ALA A 38  ? O ALA A 40  N ALA A 254 ? N ALA A 256 
AB 2 3  N GLU A 253 ? N GLU A 255 O GLN A 192 ? O GLN A 194 
AB 3 4  O GLY A 195 ? O GLY A 197 N GLY A 205 ? N GLY A 207 
AB 4 5  N ILE A 207 ? N ILE A 209 O LEU A 138 ? O LEU A 140 
AB 5 6  N GLU A 146 ? N GLU A 148 O VAL A 215 ? O VAL A 217 
AC 1 2  O ALA A 38  ? O ALA A 40  N ALA A 254 ? N ALA A 256 
AC 2 3  N GLU A 253 ? N GLU A 255 O GLN A 192 ? O GLN A 194 
AC 3 4  O GLY A 195 ? O GLY A 197 N GLY A 205 ? N GLY A 207 
AC 4 5  N ILE A 207 ? N ILE A 209 O LEU A 138 ? O LEU A 140 
AC 5 6  N LEU A 145 ? N LEU A 147 O ALA A 114 ? O ALA A 116 
AC 6 7  N LEU A 121 ? N LEU A 123 O ARG A 87  ? O ARG A 89  
AC 7 8  N TYR A 86  ? N TYR A 88  O MET A 78  ? O MET A 80  
AC 8 9  N ALA A 79  ? N ALA A 81  O GLU A 47  ? O GLU A 49  
AD 1 2  O ALA A 38  ? O ALA A 40  N ALA A 254 ? N ALA A 256 
AD 2 3  N GLU A 253 ? N GLU A 255 O GLN A 192 ? O GLN A 194 
AD 3 4  O GLY A 195 ? O GLY A 197 N GLY A 205 ? N GLY A 207 
AD 4 5  N ILE A 207 ? N ILE A 209 O LEU A 138 ? O LEU A 140 
AD 5 6  N LEU A 145 ? N LEU A 147 O ALA A 114 ? O ALA A 116 
AD 6 7  N LEU A 121 ? N LEU A 123 O ARG A 87  ? O ARG A 89  
AD 7 8  N LEU A 93  ? N LEU A 95  O VAL A 68  ? O VAL A 70  
AD 8 9  N THR A 71  ? N THR A 73  O ARG A 60  ? O ARG A 62  
AD 9 10 N LEU A 61  ? N LEU A 63  O THR A 172 ? O THR A 174 
AE 1 2  N VAL A 215 ? N VAL A 217 O PHE A 144 ? O PHE A 146 
BA 1 2  N ILE B 32  ? N ILE B 34  O THR B 106 ? O THR B 108 
BB 1 2  O ALA B 38  ? O ALA B 40  N ALA B 254 ? N ALA B 256 
BB 2 3  N GLU B 253 ? N GLU B 255 O GLN B 192 ? O GLN B 194 
BB 3 4  O GLY B 195 ? O GLY B 197 N GLY B 205 ? N GLY B 207 
BB 4 5  N ILE B 207 ? N ILE B 209 O LEU B 138 ? O LEU B 140 
BB 5 6  N GLU B 146 ? N GLU B 148 O VAL B 215 ? O VAL B 217 
BC 1 2  O ALA B 38  ? O ALA B 40  N ALA B 254 ? N ALA B 256 
BC 2 3  N GLU B 253 ? N GLU B 255 O GLN B 192 ? O GLN B 194 
BC 3 4  O GLY B 195 ? O GLY B 197 N GLY B 205 ? N GLY B 207 
BC 4 5  N ILE B 207 ? N ILE B 209 O LEU B 138 ? O LEU B 140 
BC 5 6  N LEU B 145 ? N LEU B 147 O ALA B 114 ? O ALA B 116 
BC 6 7  N LEU B 121 ? N LEU B 123 O ARG B 87  ? O ARG B 89  
BC 7 8  N TYR B 86  ? N TYR B 88  O MET B 78  ? O MET B 80  
BC 8 9  N ALA B 79  ? N ALA B 81  O GLU B 47  ? O GLU B 49  
BD 1 2  O ALA B 38  ? O ALA B 40  N ALA B 254 ? N ALA B 256 
BD 2 3  N GLU B 253 ? N GLU B 255 O GLN B 192 ? O GLN B 194 
BD 3 4  O GLY B 195 ? O GLY B 197 N GLY B 205 ? N GLY B 207 
BD 4 5  N ILE B 207 ? N ILE B 209 O LEU B 138 ? O LEU B 140 
BD 5 6  N LEU B 145 ? N LEU B 147 O ALA B 114 ? O ALA B 116 
BD 6 7  N LEU B 121 ? N LEU B 123 O ARG B 87  ? O ARG B 89  
BD 7 8  N LEU B 93  ? N LEU B 95  O VAL B 68  ? O VAL B 70  
BD 8 9  N THR B 71  ? N THR B 73  O ARG B 60  ? O ARG B 62  
BD 9 10 N LEU B 61  ? N LEU B 63  O THR B 172 ? O THR B 174 
BE 1 2  N VAL B 215 ? N VAL B 217 O PHE B 144 ? O PHE B 146 
CA 1 2  N ILE C 32  ? N ILE C 34  O THR C 106 ? O THR C 108 
CB 1 2  O ALA C 38  ? O ALA C 40  N ALA C 254 ? N ALA C 256 
CB 2 3  N GLU C 253 ? N GLU C 255 O GLN C 192 ? O GLN C 194 
CB 3 4  O GLY C 195 ? O GLY C 197 N GLY C 205 ? N GLY C 207 
CB 4 5  N ILE C 207 ? N ILE C 209 O LEU C 138 ? O LEU C 140 
CB 5 6  N GLU C 146 ? N GLU C 148 O VAL C 215 ? O VAL C 217 
CC 1 2  O ALA C 38  ? O ALA C 40  N ALA C 254 ? N ALA C 256 
CC 2 3  N GLU C 253 ? N GLU C 255 O GLN C 192 ? O GLN C 194 
CC 3 4  O GLY C 195 ? O GLY C 197 N GLY C 205 ? N GLY C 207 
CC 4 5  N ILE C 207 ? N ILE C 209 O LEU C 138 ? O LEU C 140 
CC 5 6  N LEU C 145 ? N LEU C 147 O ALA C 114 ? O ALA C 116 
CC 6 7  N LEU C 121 ? N LEU C 123 O ARG C 87  ? O ARG C 89  
CC 7 8  N TYR C 86  ? N TYR C 88  O MET C 78  ? O MET C 80  
CC 8 9  N ALA C 79  ? N ALA C 81  O GLU C 47  ? O GLU C 49  
CD 1 2  O ALA C 38  ? O ALA C 40  N ALA C 254 ? N ALA C 256 
CD 2 3  N GLU C 253 ? N GLU C 255 O GLN C 192 ? O GLN C 194 
CD 3 4  O GLY C 195 ? O GLY C 197 N GLY C 205 ? N GLY C 207 
CD 4 5  N ILE C 207 ? N ILE C 209 O LEU C 138 ? O LEU C 140 
CD 5 6  N LEU C 145 ? N LEU C 147 O ALA C 114 ? O ALA C 116 
CD 6 7  N LEU C 121 ? N LEU C 123 O ARG C 87  ? O ARG C 89  
CD 7 8  N LEU C 93  ? N LEU C 95  O VAL C 68  ? O VAL C 70  
CD 8 9  N THR C 71  ? N THR C 73  O ARG C 60  ? O ARG C 62  
CD 9 10 N LEU C 61  ? N LEU C 63  O THR C 172 ? O THR C 174 
CE 1 2  N VAL C 215 ? N VAL C 217 O PHE C 144 ? O PHE C 146 
CF 1 2  N GLY C 231 ? N GLY C 233 O SER C 235 ? O SER C 237 
DA 1 2  N ILE D 32  ? N ILE D 34  O THR D 106 ? O THR D 108 
DB 1 2  O ALA D 38  ? O ALA D 40  N ALA D 254 ? N ALA D 256 
DB 2 3  N GLU D 253 ? N GLU D 255 O GLN D 192 ? O GLN D 194 
DB 3 4  O GLY D 195 ? O GLY D 197 N GLY D 205 ? N GLY D 207 
DB 4 5  N ILE D 207 ? N ILE D 209 O LEU D 138 ? O LEU D 140 
DB 5 6  N GLU D 146 ? N GLU D 148 O VAL D 215 ? O VAL D 217 
DC 1 2  O ALA D 38  ? O ALA D 40  N ALA D 254 ? N ALA D 256 
DC 2 3  N GLU D 253 ? N GLU D 255 O GLN D 192 ? O GLN D 194 
DC 3 4  O GLY D 195 ? O GLY D 197 N GLY D 205 ? N GLY D 207 
DC 4 5  N ILE D 207 ? N ILE D 209 O LEU D 138 ? O LEU D 140 
DC 5 6  N LEU D 145 ? N LEU D 147 O ALA D 114 ? O ALA D 116 
DC 6 7  N LEU D 121 ? N LEU D 123 O ARG D 87  ? O ARG D 89  
DC 7 8  N TYR D 86  ? N TYR D 88  O MET D 78  ? O MET D 80  
DC 8 9  N ALA D 79  ? N ALA D 81  O GLU D 47  ? O GLU D 49  
DD 1 2  O ALA D 38  ? O ALA D 40  N ALA D 254 ? N ALA D 256 
DD 2 3  N GLU D 253 ? N GLU D 255 O GLN D 192 ? O GLN D 194 
DD 3 4  O GLY D 195 ? O GLY D 197 N GLY D 205 ? N GLY D 207 
DD 4 5  N ILE D 207 ? N ILE D 209 O LEU D 138 ? O LEU D 140 
DD 5 6  N LEU D 145 ? N LEU D 147 O ALA D 114 ? O ALA D 116 
DD 6 7  N LEU D 121 ? N LEU D 123 O ARG D 87  ? O ARG D 89  
DD 7 8  N LEU D 93  ? N LEU D 95  O VAL D 68  ? O VAL D 70  
DD 8 9  N THR D 71  ? N THR D 73  O ARG D 60  ? O ARG D 62  
DD 9 10 N LEU D 61  ? N LEU D 63  O THR D 172 ? O THR D 174 
DE 1 2  N VAL D 215 ? N VAL D 217 O PHE D 144 ? O PHE D 146 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ZN A 264'   
AC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE 9FK A 269'  
AC3 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE GOL A 273'  
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 264'   
AC5 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE 9FK B 268'  
AC6 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL B 272'  
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN C 264'   
AC8 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE 9FK C 267'  
AC9 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL C 271'  
BC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN D 264'   
BC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE 9FK D 266'  
BC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL D 271'  
BC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE ACY A 1260' 
BC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE ACY B 1260' 
BC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ACY C 1260' 
BC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ACY C 1261' 
BC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE ACY A 1261' 
BC9 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE ACY C 1262' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 5  HIS A 92  ? HIS A 94   . ? 1_555 ? 
2   AC1 5  HIS A 94  ? HIS A 96   . ? 1_555 ? 
3   AC1 5  HIS A 117 ? HIS A 119  . ? 1_555 ? 
4   AC1 5  9FK F .   ? 9FK A 269  . ? 1_555 ? 
5   AC1 5  GOL G .   ? GOL A 273  . ? 1_555 ? 
6   AC2 14 GLN A 90  ? GLN A 92   . ? 1_555 ? 
7   AC2 14 HIS A 92  ? HIS A 94   . ? 1_555 ? 
8   AC2 14 HIS A 94  ? HIS A 96   . ? 1_555 ? 
9   AC2 14 HIS A 117 ? HIS A 119  . ? 1_555 ? 
10  AC2 14 VAL A 128 ? VAL A 130  . ? 1_555 ? 
11  AC2 14 LEU A 132 ? LEU A 134  . ? 1_555 ? 
12  AC2 14 LEU A 197 ? LEU A 199  . ? 1_555 ? 
13  AC2 14 THR A 198 ? THR A 200  . ? 1_555 ? 
14  AC2 14 THR A 199 ? THR A 201  . ? 1_555 ? 
15  AC2 14 TRP A 208 ? TRP A 210  . ? 1_555 ? 
16  AC2 14 ZN  E .   ? ZN  A 264  . ? 1_555 ? 
17  AC2 14 GOL G .   ? GOL A 273  . ? 1_555 ? 
18  AC2 14 HOH W .   ? HOH A 2348 . ? 1_555 ? 
19  AC2 14 ARG C 127 ? ARG C 129  . ? 1_555 ? 
20  AC3 11 ASN A 64  ? ASN A 66   . ? 1_555 ? 
21  AC3 11 HIS A 66  ? HIS A 68   . ? 1_555 ? 
22  AC3 11 SER A 67  ? SER A 69   . ? 1_555 ? 
23  AC3 11 GLN A 69  ? GLN A 71   . ? 1_555 ? 
24  AC3 11 GLN A 90  ? GLN A 92   . ? 1_555 ? 
25  AC3 11 HIS A 92  ? HIS A 94   . ? 1_555 ? 
26  AC3 11 THR A 199 ? THR A 201  . ? 1_555 ? 
27  AC3 11 ZN  E .   ? ZN  A 264  . ? 1_555 ? 
28  AC3 11 9FK F .   ? 9FK A 269  . ? 1_555 ? 
29  AC3 11 HOH W .   ? HOH A 2005 . ? 1_555 ? 
30  AC3 11 HOH W .   ? HOH A 2134 . ? 1_555 ? 
31  AC4 4  HIS B 92  ? HIS B 94   . ? 1_555 ? 
32  AC4 4  HIS B 94  ? HIS B 96   . ? 1_555 ? 
33  AC4 4  HIS B 117 ? HIS B 119  . ? 1_555 ? 
34  AC4 4  9FK K .   ? 9FK B 268  . ? 1_555 ? 
35  AC5 11 HIS B 92  ? HIS B 94   . ? 1_555 ? 
36  AC5 11 HIS B 94  ? HIS B 96   . ? 1_555 ? 
37  AC5 11 HIS B 117 ? HIS B 119  . ? 1_555 ? 
38  AC5 11 LEU B 132 ? LEU B 134  . ? 1_555 ? 
39  AC5 11 LEU B 197 ? LEU B 199  . ? 1_555 ? 
40  AC5 11 THR B 198 ? THR B 200  . ? 1_555 ? 
41  AC5 11 THR B 199 ? THR B 201  . ? 1_555 ? 
42  AC5 11 TRP B 208 ? TRP B 210  . ? 1_555 ? 
43  AC5 11 ZN  J .   ? ZN  B 264  . ? 1_555 ? 
44  AC5 11 GOL L .   ? GOL B 272  . ? 1_555 ? 
45  AC5 11 HOH X .   ? HOH B 2143 . ? 1_555 ? 
46  AC6 9  ASN B 64  ? ASN B 66   . ? 1_555 ? 
47  AC6 9  HIS B 66  ? HIS B 68   . ? 1_555 ? 
48  AC6 9  SER B 67  ? SER B 69   . ? 1_555 ? 
49  AC6 9  GLN B 69  ? GLN B 71   . ? 1_555 ? 
50  AC6 9  GLN B 90  ? GLN B 92   . ? 1_555 ? 
51  AC6 9  HIS B 92  ? HIS B 94   . ? 1_555 ? 
52  AC6 9  9FK K .   ? 9FK B 268  . ? 1_555 ? 
53  AC6 9  HOH X .   ? HOH B 2005 . ? 1_555 ? 
54  AC6 9  HOH X .   ? HOH B 2244 . ? 1_555 ? 
55  AC7 4  HIS C 92  ? HIS C 94   . ? 1_555 ? 
56  AC7 4  HIS C 94  ? HIS C 96   . ? 1_555 ? 
57  AC7 4  HIS C 117 ? HIS C 119  . ? 1_555 ? 
58  AC7 4  9FK O .   ? 9FK C 267  . ? 1_555 ? 
59  AC8 15 ARG A 127 ? ARG A 129  . ? 1_555 ? 
60  AC8 15 GLN C 90  ? GLN C 92   . ? 1_555 ? 
61  AC8 15 HIS C 92  ? HIS C 94   . ? 1_555 ? 
62  AC8 15 HIS C 94  ? HIS C 96   . ? 1_555 ? 
63  AC8 15 HIS C 117 ? HIS C 119  . ? 1_555 ? 
64  AC8 15 VAL C 119 ? VAL C 121  . ? 1_555 ? 
65  AC8 15 VAL C 128 ? VAL C 130  . ? 1_555 ? 
66  AC8 15 ASP C 129 ? ASP C 131  . ? 1_555 ? 
67  AC8 15 LEU C 132 ? LEU C 134  . ? 1_555 ? 
68  AC8 15 LEU C 197 ? LEU C 199  . ? 1_555 ? 
69  AC8 15 THR C 198 ? THR C 200  . ? 1_555 ? 
70  AC8 15 THR C 199 ? THR C 201  . ? 1_555 ? 
71  AC8 15 TRP C 208 ? TRP C 210  . ? 1_555 ? 
72  AC8 15 ZN  N .   ? ZN  C 264  . ? 1_555 ? 
73  AC8 15 GOL P .   ? GOL C 271  . ? 1_555 ? 
74  AC9 9  ASN C 64  ? ASN C 66   . ? 1_555 ? 
75  AC9 9  HIS C 66  ? HIS C 68   . ? 1_555 ? 
76  AC9 9  GLN C 69  ? GLN C 71   . ? 1_555 ? 
77  AC9 9  GLN C 90  ? GLN C 92   . ? 1_555 ? 
78  AC9 9  HIS C 92  ? HIS C 94   . ? 1_555 ? 
79  AC9 9  THR C 199 ? THR C 201  . ? 1_555 ? 
80  AC9 9  9FK O .   ? 9FK C 267  . ? 1_555 ? 
81  AC9 9  HOH Y .   ? HOH C 2005 . ? 1_555 ? 
82  AC9 9  HOH Y .   ? HOH C 2224 . ? 1_555 ? 
83  BC1 4  HIS D 92  ? HIS D 94   . ? 1_555 ? 
84  BC1 4  HIS D 94  ? HIS D 96   . ? 1_555 ? 
85  BC1 4  HIS D 117 ? HIS D 119  . ? 1_555 ? 
86  BC1 4  9FK U .   ? 9FK D 266  . ? 1_555 ? 
87  BC2 11 HIS D 92  ? HIS D 94   . ? 1_555 ? 
88  BC2 11 HIS D 94  ? HIS D 96   . ? 1_555 ? 
89  BC2 11 HIS D 117 ? HIS D 119  . ? 1_555 ? 
90  BC2 11 LEU D 132 ? LEU D 134  . ? 1_555 ? 
91  BC2 11 LEU D 197 ? LEU D 199  . ? 1_555 ? 
92  BC2 11 THR D 198 ? THR D 200  . ? 1_555 ? 
93  BC2 11 THR D 199 ? THR D 201  . ? 1_555 ? 
94  BC2 11 TRP D 208 ? TRP D 210  . ? 1_555 ? 
95  BC2 11 ZN  T .   ? ZN  D 264  . ? 1_555 ? 
96  BC2 11 GOL V .   ? GOL D 271  . ? 1_555 ? 
97  BC2 11 HOH Z .   ? HOH D 2102 . ? 1_555 ? 
98  BC3 8  ASN D 64  ? ASN D 66   . ? 1_555 ? 
99  BC3 8  HIS D 66  ? HIS D 68   . ? 1_555 ? 
100 BC3 8  SER D 67  ? SER D 69   . ? 1_555 ? 
101 BC3 8  GLN D 69  ? GLN D 71   . ? 1_555 ? 
102 BC3 8  GLN D 90  ? GLN D 92   . ? 1_555 ? 
103 BC3 8  HIS D 92  ? HIS D 94   . ? 1_555 ? 
104 BC3 8  9FK U .   ? 9FK D 266  . ? 1_555 ? 
105 BC3 8  HOH Z .   ? HOH D 2003 . ? 1_555 ? 
106 BC4 7  GLY A 96  ? GLY A 98   . ? 1_555 ? 
107 BC4 7  ALA A 97  ? ALA A 99   . ? 1_555 ? 
108 BC4 7  ARG A 100 ? ARG A 102  . ? 1_555 ? 
109 BC4 7  PRO A 113 ? PRO A 115  . ? 1_555 ? 
110 BC4 7  LEU A 222 ? LEU A 224  . ? 1_555 ? 
111 BC4 7  SER A 226 ? SER A 228  . ? 1_555 ? 
112 BC4 7  HOH W .   ? HOH A 2350 . ? 1_555 ? 
113 BC5 2  HIS B 110 ? HIS B 112  . ? 1_555 ? 
114 BC5 2  HOH X .   ? HOH B 2161 . ? 1_555 ? 
115 BC6 5  SER B 185 ? SER B 187  . ? 9_544 ? 
116 BC6 5  HOH X .   ? HOH B 2253 . ? 9_544 ? 
117 BC6 5  PRO C 246 ? PRO C 248  . ? 1_555 ? 
118 BC6 5  LEU C 247 ? LEU C 249  . ? 1_555 ? 
119 BC6 5  ASN C 248 ? ASN C 250  . ? 1_555 ? 
120 BC7 5  HOH X .   ? HOH B 2225 . ? 9_544 ? 
121 BC7 5  ARG C 25  ? ARG C 27   . ? 1_555 ? 
122 BC7 5  PHE C 26  ? PHE C 28   . ? 1_555 ? 
123 BC7 5  ASN C 248 ? ASN C 250  . ? 1_555 ? 
124 BC7 5  HOH Y .   ? HOH C 2225 . ? 1_555 ? 
125 BC8 6  LEU A 247 ? LEU A 249  . ? 1_555 ? 
126 BC8 6  ASN A 248 ? ASN A 250  . ? 1_555 ? 
127 BC8 6  HOH W .   ? HOH A 2340 . ? 1_555 ? 
128 BC8 6  HOH W .   ? HOH A 2351 . ? 1_555 ? 
129 BC8 6  HOH W .   ? HOH A 2352 . ? 1_555 ? 
130 BC8 6  SER D 185 ? SER D 187  . ? 5_445 ? 
131 BC9 8  PHE C 26  ? PHE C 28   . ? 1_555 ? 
132 BC9 8  GLU C 194 ? GLU C 196  . ? 1_555 ? 
133 BC9 8  GLY C 195 ? GLY C 197  . ? 1_555 ? 
134 BC9 8  GLN C 204 ? GLN C 206  . ? 1_555 ? 
135 BC9 8  GLY C 205 ? GLY C 207  . ? 1_555 ? 
136 BC9 8  HOH Y .   ? HOH C 2202 . ? 1_555 ? 
137 BC9 8  HOH Y .   ? HOH C 2226 . ? 1_555 ? 
138 BC9 8  PRO D 82  ? PRO D 84   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          5FL4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5FL4 
_atom_sites.fract_transf_matrix[1][1]   0.006566 
_atom_sites.fract_transf_matrix[1][2]   0.003791 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007582 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005810 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . TRP A 1 7   ? 13.231  -38.825 53.713  1.00 36.79 ? 9    TRP A N   1 
ATOM   2    C  CA  . TRP A 1 7   ? 11.797  -38.781 54.159  1.00 35.96 ? 9    TRP A CA  1 
ATOM   3    C  C   . TRP A 1 7   ? 10.878  -38.155 53.098  1.00 37.12 ? 9    TRP A C   1 
ATOM   4    O  O   . TRP A 1 7   ? 11.325  -37.357 52.266  1.00 35.22 ? 9    TRP A O   1 
ATOM   5    C  CB  . TRP A 1 7   ? 11.647  -38.020 55.496  1.00 35.27 ? 9    TRP A CB  1 
ATOM   6    C  CG  . TRP A 1 7   ? 11.877  -36.538 55.390  1.00 33.49 ? 9    TRP A CG  1 
ATOM   7    C  CD1 . TRP A 1 7   ? 13.054  -35.869 55.582  1.00 32.15 ? 9    TRP A CD1 1 
ATOM   8    C  CD2 . TRP A 1 7   ? 10.904  -35.546 55.046  1.00 33.32 ? 9    TRP A CD2 1 
ATOM   9    N  NE1 . TRP A 1 7   ? 12.871  -34.522 55.383  1.00 32.24 ? 9    TRP A NE1 1 
ATOM   10   C  CE2 . TRP A 1 7   ? 11.560  -34.295 55.053  1.00 32.84 ? 9    TRP A CE2 1 
ATOM   11   C  CE3 . TRP A 1 7   ? 9.539   -35.591 54.743  1.00 32.19 ? 9    TRP A CE3 1 
ATOM   12   C  CZ2 . TRP A 1 7   ? 10.893  -33.100 54.763  1.00 33.33 ? 9    TRP A CZ2 1 
ATOM   13   C  CZ3 . TRP A 1 7   ? 8.877   -34.409 54.454  1.00 34.04 ? 9    TRP A CZ3 1 
ATOM   14   C  CH2 . TRP A 1 7   ? 9.557   -33.179 54.463  1.00 32.17 ? 9    TRP A CH2 1 
ATOM   15   N  N   . ARG A 1 8   ? 9.592   -38.479 53.167  1.00 37.78 ? 10   ARG A N   1 
ATOM   16   C  CA  . ARG A 1 8   ? 8.598   -37.889 52.260  1.00 42.09 ? 10   ARG A CA  1 
ATOM   17   C  C   . ARG A 1 8   ? 7.219   -37.740 52.912  1.00 38.82 ? 10   ARG A C   1 
ATOM   18   O  O   . ARG A 1 8   ? 6.938   -38.371 53.928  1.00 35.20 ? 10   ARG A O   1 
ATOM   19   C  CB  . ARG A 1 8   ? 8.498   -38.741 50.994  1.00 48.62 ? 10   ARG A CB  1 
ATOM   20   C  CG  . ARG A 1 8   ? 8.387   -40.236 51.246  1.00 53.34 ? 10   ARG A CG  1 
ATOM   21   C  CD  . ARG A 1 8   ? 8.104   -40.965 49.948  1.00 59.31 ? 10   ARG A CD  1 
ATOM   22   N  NE  . ARG A 1 8   ? 6.707   -40.772 49.546  1.00 64.87 ? 10   ARG A NE  1 
ATOM   23   C  CZ  . ARG A 1 8   ? 6.265   -40.567 48.299  1.00 71.33 ? 10   ARG A CZ  1 
ATOM   24   N  NH1 . ARG A 1 8   ? 7.090   -40.506 47.246  1.00 69.06 ? 10   ARG A NH1 1 
ATOM   25   N  NH2 . ARG A 1 8   ? 4.956   -40.411 48.100  1.00 75.55 ? 10   ARG A NH2 1 
ATOM   26   N  N   . TYR A 1 9   ? 6.382   -36.872 52.346  1.00 35.91 ? 11   TYR A N   1 
ATOM   27   C  CA  . TYR A 1 9   ? 4.945   -36.870 52.644  1.00 36.93 ? 11   TYR A CA  1 
ATOM   28   C  C   . TYR A 1 9   ? 4.248   -38.065 51.962  1.00 41.53 ? 11   TYR A C   1 
ATOM   29   O  O   . TYR A 1 9   ? 4.611   -38.449 50.853  1.00 43.35 ? 11   TYR A O   1 
ATOM   30   C  CB  . TYR A 1 9   ? 4.270   -35.559 52.187  1.00 35.49 ? 11   TYR A CB  1 
ATOM   31   C  CG  . TYR A 1 9   ? 4.768   -34.311 52.900  1.00 31.78 ? 11   TYR A CG  1 
ATOM   32   C  CD1 . TYR A 1 9   ? 4.330   -34.002 54.185  1.00 29.37 ? 11   TYR A CD1 1 
ATOM   33   C  CD2 . TYR A 1 9   ? 5.663   -33.436 52.285  1.00 29.28 ? 11   TYR A CD2 1 
ATOM   34   C  CE1 . TYR A 1 9   ? 4.784   -32.883 54.843  1.00 27.50 ? 11   TYR A CE1 1 
ATOM   35   C  CE2 . TYR A 1 9   ? 6.110   -32.302 52.932  1.00 28.60 ? 11   TYR A CE2 1 
ATOM   36   C  CZ  . TYR A 1 9   ? 5.658   -32.018 54.200  1.00 26.65 ? 11   TYR A CZ  1 
ATOM   37   O  OH  . TYR A 1 9   ? 6.098   -30.900 54.842  1.00 26.86 ? 11   TYR A OH  1 
ATOM   38   N  N   . GLY A 1 10  ? 3.252   -38.634 52.636  1.00 44.15 ? 12   GLY A N   1 
ATOM   39   C  CA  . GLY A 1 10  ? 2.378   -39.653 52.053  1.00 48.65 ? 12   GLY A CA  1 
ATOM   40   C  C   . GLY A 1 10  ? 2.962   -41.046 51.869  1.00 53.12 ? 12   GLY A C   1 
ATOM   41   O  O   . GLY A 1 10  ? 2.501   -41.787 51.000  1.00 56.66 ? 12   GLY A O   1 
ATOM   42   N  N   . GLY A 1 11  ? 3.959   -41.419 52.675  1.00 52.96 ? 13   GLY A N   1 
ATOM   43   C  CA  . GLY A 1 11  ? 4.569   -42.747 52.558  1.00 53.68 ? 13   GLY A CA  1 
ATOM   44   C  C   . GLY A 1 11  ? 5.881   -42.909 53.293  1.00 54.20 ? 13   GLY A C   1 
ATOM   45   O  O   . GLY A 1 11  ? 6.377   -41.972 53.908  1.00 51.90 ? 13   GLY A O   1 
ATOM   46   N  N   . ASP A 1 12  ? 6.453   -44.105 53.189  1.00 53.07 ? 14   ASP A N   1 
ATOM   47   C  CA  . ASP A 1 12  ? 7.636   -44.498 53.962  1.00 52.10 ? 14   ASP A CA  1 
ATOM   48   C  C   . ASP A 1 12  ? 8.906   -43.744 53.527  1.00 50.15 ? 14   ASP A C   1 
ATOM   49   O  O   . ASP A 1 12  ? 8.921   -43.185 52.433  1.00 53.41 ? 14   ASP A O   1 
ATOM   50   C  CB  . ASP A 1 12  ? 7.824   -46.024 53.861  1.00 55.49 ? 14   ASP A CB  1 
ATOM   51   C  CG  . ASP A 1 12  ? 6.741   -46.801 54.611  1.00 58.37 ? 14   ASP A CG  1 
ATOM   52   O  OD1 . ASP A 1 12  ? 6.191   -46.304 55.627  1.00 60.53 ? 14   ASP A OD1 1 
ATOM   53   O  OD2 . ASP A 1 12  ? 6.440   -47.927 54.179  1.00 62.13 ? 14   ASP A OD2 1 
ATOM   54   N  N   . PRO A 1 13  ? 9.964   -43.699 54.349  1.00 47.13 ? 15   PRO A N   1 
ATOM   55   C  CA  . PRO A 1 13  ? 10.047  -44.340 55.677  1.00 46.06 ? 15   PRO A CA  1 
ATOM   56   C  C   . PRO A 1 13  ? 9.162   -43.673 56.755  1.00 47.47 ? 15   PRO A C   1 
ATOM   57   O  O   . PRO A 1 13  ? 8.892   -42.470 56.665  1.00 45.34 ? 15   PRO A O   1 
ATOM   58   C  CB  . PRO A 1 13  ? 11.533  -44.194 56.039  1.00 46.34 ? 15   PRO A CB  1 
ATOM   59   C  CG  . PRO A 1 13  ? 11.997  -42.992 55.286  1.00 46.36 ? 15   PRO A CG  1 
ATOM   60   C  CD  . PRO A 1 13  ? 11.188  -42.941 54.021  1.00 45.97 ? 15   PRO A CD  1 
ATOM   61   N  N   . PRO A 1 14  ? 8.715   -44.445 57.773  1.00 45.23 ? 16   PRO A N   1 
ATOM   62   C  CA  . PRO A 1 14  ? 8.035   -43.806 58.908  1.00 43.16 ? 16   PRO A CA  1 
ATOM   63   C  C   . PRO A 1 14  ? 8.954   -42.762 59.560  1.00 37.89 ? 16   PRO A C   1 
ATOM   64   O  O   . PRO A 1 14  ? 10.142  -43.036 59.782  1.00 37.00 ? 16   PRO A O   1 
ATOM   65   C  CB  . PRO A 1 14  ? 7.759   -44.980 59.867  1.00 45.42 ? 16   PRO A CB  1 
ATOM   66   C  CG  . PRO A 1 14  ? 7.837   -46.205 59.010  1.00 45.60 ? 16   PRO A CG  1 
ATOM   67   C  CD  . PRO A 1 14  ? 8.895   -45.894 57.994  1.00 45.14 ? 16   PRO A CD  1 
ATOM   68   N  N   . TRP A 1 15  ? 8.420   -41.571 59.808  1.00 33.53 ? 17   TRP A N   1 
ATOM   69   C  CA  . TRP A 1 15  ? 9.218   -40.456 60.336  1.00 33.43 ? 17   TRP A CA  1 
ATOM   70   C  C   . TRP A 1 15  ? 9.962   -40.723 61.661  1.00 33.55 ? 17   TRP A C   1 
ATOM   71   O  O   . TRP A 1 15  ? 11.125  -40.326 61.776  1.00 34.25 ? 17   TRP A O   1 
ATOM   72   C  CB  . TRP A 1 15  ? 8.348   -39.195 60.452  1.00 32.47 ? 17   TRP A CB  1 
ATOM   73   C  CG  . TRP A 1 15  ? 8.023   -38.547 59.126  1.00 31.48 ? 17   TRP A CG  1 
ATOM   74   C  CD1 . TRP A 1 15  ? 8.201   -39.074 57.867  1.00 30.95 ? 17   TRP A CD1 1 
ATOM   75   C  CD2 . TRP A 1 15  ? 7.427   -37.262 58.938  1.00 29.97 ? 17   TRP A CD2 1 
ATOM   76   N  NE1 . TRP A 1 15  ? 7.773   -38.179 56.916  1.00 30.89 ? 17   TRP A NE1 1 
ATOM   77   C  CE2 . TRP A 1 15  ? 7.293   -37.059 57.547  1.00 30.19 ? 17   TRP A CE2 1 
ATOM   78   C  CE3 . TRP A 1 15  ? 7.030   -36.239 59.813  1.00 30.72 ? 17   TRP A CE3 1 
ATOM   79   C  CZ2 . TRP A 1 15  ? 6.751   -35.881 57.011  1.00 28.79 ? 17   TRP A CZ2 1 
ATOM   80   C  CZ3 . TRP A 1 15  ? 6.487   -35.070 59.273  1.00 28.79 ? 17   TRP A CZ3 1 
ATOM   81   C  CH2 . TRP A 1 15  ? 6.357   -34.906 57.891  1.00 28.51 ? 17   TRP A CH2 1 
ATOM   82   N  N   . PRO A 1 16  ? 9.317   -41.400 62.652  1.00 34.84 ? 18   PRO A N   1 
ATOM   83   C  CA  . PRO A 1 16  ? 10.053  -41.822 63.875  1.00 34.98 ? 18   PRO A CA  1 
ATOM   84   C  C   . PRO A 1 16  ? 11.295  -42.699 63.613  1.00 35.60 ? 18   PRO A C   1 
ATOM   85   O  O   . PRO A 1 16  ? 12.266  -42.647 64.373  1.00 33.48 ? 18   PRO A O   1 
ATOM   86   C  CB  . PRO A 1 16  ? 8.990   -42.580 64.691  1.00 34.71 ? 18   PRO A CB  1 
ATOM   87   C  CG  . PRO A 1 16  ? 7.700   -41.991 64.264  1.00 35.86 ? 18   PRO A CG  1 
ATOM   88   C  CD  . PRO A 1 16  ? 7.877   -41.693 62.779  1.00 36.51 ? 18   PRO A CD  1 
ATOM   89   N  N   . ARG A 1 17  ? 11.268  -43.480 62.537  1.00 37.80 ? 19   ARG A N   1 
ATOM   90   C  CA  . ARG A 1 17  ? 12.440  -44.249 62.117  1.00 40.52 ? 19   ARG A CA  1 
ATOM   91   C  C   . ARG A 1 17  ? 13.548  -43.327 61.594  1.00 38.92 ? 19   ARG A C   1 
ATOM   92   O  O   . ARG A 1 17  ? 14.726  -43.588 61.819  1.00 37.05 ? 19   ARG A O   1 
ATOM   93   C  CB  . ARG A 1 17  ? 12.036  -45.279 61.047  1.00 46.27 ? 19   ARG A CB  1 
ATOM   94   C  CG  . ARG A 1 17  ? 13.104  -46.291 60.669  1.00 50.73 ? 19   ARG A CG  1 
ATOM   95   C  CD  . ARG A 1 17  ? 12.464  -47.566 60.126  1.00 56.69 ? 19   ARG A CD  1 
ATOM   96   N  NE  . ARG A 1 17  ? 11.905  -48.380 61.217  1.00 61.67 ? 19   ARG A NE  1 
ATOM   97   C  CZ  . ARG A 1 17  ? 12.481  -49.451 61.782  1.00 63.92 ? 19   ARG A CZ  1 
ATOM   98   N  NH1 . ARG A 1 17  ? 13.667  -49.916 61.382  1.00 63.27 ? 19   ARG A NH1 1 
ATOM   99   N  NH2 . ARG A 1 17  ? 11.852  -50.082 62.768  1.00 63.10 ? 19   ARG A NH2 1 
ATOM   100  N  N   . VAL A 1 18  ? 13.160  -42.251 60.904  1.00 35.56 ? 20   VAL A N   1 
ATOM   101  C  CA  . VAL A 1 18  ? 14.109  -41.241 60.422  1.00 34.49 ? 20   VAL A CA  1 
ATOM   102  C  C   . VAL A 1 18  ? 14.670  -40.412 61.587  1.00 32.64 ? 20   VAL A C   1 
ATOM   103  O  O   . VAL A 1 18  ? 15.870  -40.151 61.648  1.00 32.66 ? 20   VAL A O   1 
ATOM   104  C  CB  . VAL A 1 18  ? 13.464  -40.301 59.369  1.00 35.67 ? 20   VAL A CB  1 
ATOM   105  C  CG1 . VAL A 1 18  ? 14.458  -39.242 58.911  1.00 36.06 ? 20   VAL A CG1 1 
ATOM   106  C  CG2 . VAL A 1 18  ? 12.948  -41.110 58.178  1.00 36.58 ? 20   VAL A CG2 1 
ATOM   107  N  N   . SER A 1 19  ? 13.793  -39.999 62.495  1.00 30.11 ? 21   SER A N   1 
ATOM   108  C  CA  . SER A 1 19  ? 14.178  -39.209 63.654  1.00 28.14 ? 21   SER A CA  1 
ATOM   109  C  C   . SER A 1 19  ? 13.266  -39.540 64.822  1.00 28.45 ? 21   SER A C   1 
ATOM   110  O  O   . SER A 1 19  ? 12.055  -39.327 64.721  1.00 27.86 ? 21   SER A O   1 
ATOM   111  C  CB  . SER A 1 19  ? 14.052  -37.718 63.347  1.00 29.41 ? 21   SER A CB  1 
ATOM   112  O  OG  . SER A 1 19  ? 14.327  -36.967 64.533  1.00 31.40 ? 21   SER A OG  1 
ATOM   113  N  N   . PRO A 1 20  ? 13.825  -40.025 65.950  1.00 27.87 ? 22   PRO A N   1 
ATOM   114  C  CA  . PRO A 1 20  ? 12.932  -40.362 67.063  1.00 27.81 ? 22   PRO A CA  1 
ATOM   115  C  C   . PRO A 1 20  ? 12.112  -39.191 67.576  1.00 26.76 ? 22   PRO A C   1 
ATOM   116  O  O   . PRO A 1 20  ? 11.028  -39.407 68.093  1.00 27.20 ? 22   PRO A O   1 
ATOM   117  C  CB  . PRO A 1 20  ? 13.891  -40.865 68.149  1.00 28.27 ? 22   PRO A CB  1 
ATOM   118  C  CG  . PRO A 1 20  ? 15.089  -41.322 67.420  1.00 27.65 ? 22   PRO A CG  1 
ATOM   119  C  CD  . PRO A 1 20  ? 15.222  -40.340 66.279  1.00 28.05 ? 22   PRO A CD  1 
ATOM   120  N  N   . ALA A 1 21  ? 12.609  -37.961 67.397  1.00 26.88 ? 23   ALA A N   1 
ATOM   121  C  CA  . ALA A 1 21  ? 11.906  -36.775 67.856  1.00 26.01 ? 23   ALA A CA  1 
ATOM   122  C  C   . ALA A 1 21  ? 10.537  -36.570 67.176  1.00 25.72 ? 23   ALA A C   1 
ATOM   123  O  O   . ALA A 1 21  ? 9.651   -35.970 67.767  1.00 26.30 ? 23   ALA A O   1 
ATOM   124  C  CB  . ALA A 1 21  ? 12.796  -35.541 67.728  1.00 26.68 ? 23   ALA A CB  1 
ATOM   125  N  N   . CYS A 1 22  ? 10.336  -37.148 65.990  1.00 25.60 ? 24   CYS A N   1 
ATOM   126  C  CA  . CYS A 1 22  ? 9.013   -37.165 65.341  1.00 25.63 ? 24   CYS A CA  1 
ATOM   127  C  C   . CYS A 1 22  ? 7.913   -37.891 66.124  1.00 25.39 ? 24   CYS A C   1 
ATOM   128  O  O   . CYS A 1 22  ? 6.726   -37.692 65.843  1.00 25.07 ? 24   CYS A O   1 
ATOM   129  C  CB  . CYS A 1 22  ? 9.129   -37.695 63.915  1.00 26.21 ? 24   CYS A CB  1 
ATOM   130  S  SG  . CYS A 1 22  ? 10.173  -36.685 62.826  1.00 28.33 ? 24   CYS A SG  1 
ATOM   131  N  N   . ALA A 1 23  ? 8.307   -38.686 67.131  1.00 26.07 ? 25   ALA A N   1 
ATOM   132  C  CA  . ALA A 1 23  ? 7.360   -39.350 68.041  1.00 26.41 ? 25   ALA A CA  1 
ATOM   133  C  C   . ALA A 1 23  ? 7.328   -38.689 69.402  1.00 25.78 ? 25   ALA A C   1 
ATOM   134  O  O   . ALA A 1 23  ? 6.882   -39.304 70.382  1.00 26.07 ? 25   ALA A O   1 
ATOM   135  C  CB  . ALA A 1 23  ? 7.732   -40.823 68.185  1.00 27.65 ? 25   ALA A CB  1 
ATOM   136  N  N   . GLY A 1 24  ? 7.795   -37.441 69.496  1.00 22.83 ? 26   GLY A N   1 
ATOM   137  C  CA  . GLY A 1 24  ? 7.681   -36.704 70.731  1.00 23.66 ? 26   GLY A CA  1 
ATOM   138  C  C   . GLY A 1 24  ? 6.237   -36.405 71.073  1.00 23.54 ? 26   GLY A C   1 
ATOM   139  O  O   . GLY A 1 24  ? 5.345   -36.484 70.220  1.00 23.83 ? 26   GLY A O   1 
ATOM   140  N  N   . ARG A 1 25  ? 6.020   -36.072 72.340  1.00 24.24 ? 27   ARG A N   1 
ATOM   141  C  CA  . ARG A 1 25  ? 4.703   -35.764 72.861  1.00 24.48 ? 27   ARG A CA  1 
ATOM   142  C  C   . ARG A 1 25  ? 4.209   -34.388 72.407  1.00 23.57 ? 27   ARG A C   1 
ATOM   143  O  O   . ARG A 1 25  ? 3.024   -34.182 72.354  1.00 23.29 ? 27   ARG A O   1 
ATOM   144  C  CB  . ARG A 1 25  ? 4.710   -35.827 74.401  1.00 24.61 ? 27   ARG A CB  1 
ATOM   145  C  CG  . ARG A 1 25  ? 3.332   -35.801 75.046  1.00 24.48 ? 27   ARG A CG  1 
ATOM   146  C  CD  . ARG A 1 25  ? 3.332   -36.003 76.557  1.00 23.81 ? 27   ARG A CD  1 
ATOM   147  N  NE  . ARG A 1 25  ? 2.016   -35.636 77.095  1.00 25.63 ? 27   ARG A NE  1 
ATOM   148  C  CZ  . ARG A 1 25  ? 0.908   -36.388 77.052  1.00 23.14 ? 27   ARG A CZ  1 
ATOM   149  N  NH1 . ARG A 1 25  ? 0.898   -37.612 76.544  1.00 24.02 ? 27   ARG A NH1 1 
ATOM   150  N  NH2 . ARG A 1 25  ? -0.218  -35.896 77.528  1.00 24.42 ? 27   ARG A NH2 1 
ATOM   151  N  N   . PHE A 1 26  ? 5.125   -33.479 72.065  1.00 24.82 ? 28   PHE A N   1 
ATOM   152  C  CA  . PHE A 1 26  ? 4.824   -32.055 71.913  1.00 23.73 ? 28   PHE A CA  1 
ATOM   153  C  C   . PHE A 1 26  ? 5.200   -31.556 70.504  1.00 24.85 ? 28   PHE A C   1 
ATOM   154  O  O   . PHE A 1 26  ? 6.086   -30.686 70.327  1.00 23.84 ? 28   PHE A O   1 
ATOM   155  C  CB  . PHE A 1 26  ? 5.521   -31.280 73.032  1.00 24.49 ? 28   PHE A CB  1 
ATOM   156  C  CG  . PHE A 1 26  ? 5.160   -31.771 74.402  1.00 24.63 ? 28   PHE A CG  1 
ATOM   157  C  CD1 . PHE A 1 26  ? 3.844   -31.688 74.854  1.00 25.15 ? 28   PHE A CD1 1 
ATOM   158  C  CD2 . PHE A 1 26  ? 6.103   -32.373 75.216  1.00 25.55 ? 28   PHE A CD2 1 
ATOM   159  C  CE1 . PHE A 1 26  ? 3.491   -32.164 76.117  1.00 26.67 ? 28   PHE A CE1 1 
ATOM   160  C  CE2 . PHE A 1 26  ? 5.755   -32.851 76.481  1.00 25.13 ? 28   PHE A CE2 1 
ATOM   161  C  CZ  . PHE A 1 26  ? 4.456   -32.733 76.933  1.00 25.17 ? 28   PHE A CZ  1 
ATOM   162  N  N   . GLN A 1 27  ? 4.474   -32.101 69.524  1.00 23.49 ? 29   GLN A N   1 
ATOM   163  C  CA  . GLN A 1 27  ? 4.751   -31.874 68.101  1.00 24.17 ? 29   GLN A CA  1 
ATOM   164  C  C   . GLN A 1 27  ? 3.863   -30.793 67.482  1.00 23.79 ? 29   GLN A C   1 
ATOM   165  O  O   . GLN A 1 27  ? 2.864   -30.358 68.073  1.00 22.99 ? 29   GLN A O   1 
ATOM   166  C  CB  . GLN A 1 27  ? 4.633   -33.174 67.318  1.00 24.58 ? 29   GLN A CB  1 
ATOM   167  C  CG  . GLN A 1 27  ? 5.629   -34.236 67.748  1.00 26.13 ? 29   GLN A CG  1 
ATOM   168  C  CD  . GLN A 1 27  ? 6.975   -34.038 67.106  1.00 26.00 ? 29   GLN A CD  1 
ATOM   169  O  OE1 . GLN A 1 27  ? 7.121   -34.274 65.910  1.00 25.52 ? 29   GLN A OE1 1 
ATOM   170  N  NE2 . GLN A 1 27  ? 7.970   -33.585 67.888  1.00 25.27 ? 29   GLN A NE2 1 
ATOM   171  N  N   . SER A 1 28  ? 4.287   -30.352 66.304  1.00 23.12 ? 30   SER A N   1 
ATOM   172  C  CA  . SER A 1 28  ? 3.571   -29.378 65.467  1.00 22.27 ? 30   SER A CA  1 
ATOM   173  C  C   . SER A 1 28  ? 3.310   -30.019 64.120  1.00 21.99 ? 30   SER A C   1 
ATOM   174  O  O   . SER A 1 28  ? 4.022   -30.964 63.752  1.00 24.29 ? 30   SER A O   1 
ATOM   175  C  CB  . SER A 1 28  ? 4.448   -28.150 65.288  1.00 20.98 ? 30   SER A CB  1 
ATOM   176  O  OG  . SER A 1 28  ? 4.674   -27.508 66.519  1.00 20.08 ? 30   SER A OG  1 
ATOM   177  N  N   . PRO A 1 29  ? 2.315   -29.545 63.355  1.00 21.22 ? 31   PRO A N   1 
ATOM   178  C  CA  . PRO A 1 29  ? 1.432   -28.433 63.715  1.00 21.28 ? 31   PRO A CA  1 
ATOM   179  C  C   . PRO A 1 29  ? 0.276   -28.914 64.621  1.00 23.58 ? 31   PRO A C   1 
ATOM   180  O  O   . PRO A 1 29  ? 0.143   -30.129 64.895  1.00 24.41 ? 31   PRO A O   1 
ATOM   181  C  CB  . PRO A 1 29  ? 0.885   -27.994 62.352  1.00 21.33 ? 31   PRO A CB  1 
ATOM   182  C  CG  . PRO A 1 29  ? 0.745   -29.295 61.629  1.00 21.19 ? 31   PRO A CG  1 
ATOM   183  C  CD  . PRO A 1 29  ? 1.943   -30.127 62.065  1.00 21.04 ? 31   PRO A CD  1 
ATOM   184  N  N   . VAL A 1 30  ? -0.556  -27.965 65.030  1.00 24.21 ? 32   VAL A N   1 
ATOM   185  C  CA  . VAL A 1 30  ? -1.678  -28.230 65.903  1.00 25.10 ? 32   VAL A CA  1 
ATOM   186  C  C   . VAL A 1 30  ? -2.933  -27.530 65.412  1.00 26.48 ? 32   VAL A C   1 
ATOM   187  O  O   . VAL A 1 30  ? -2.880  -26.593 64.588  1.00 26.26 ? 32   VAL A O   1 
ATOM   188  C  CB  . VAL A 1 30  ? -1.382  -27.783 67.363  1.00 23.67 ? 32   VAL A CB  1 
ATOM   189  C  CG1 . VAL A 1 30  ? -0.159  -28.514 67.902  1.00 24.11 ? 32   VAL A CG1 1 
ATOM   190  C  CG2 . VAL A 1 30  ? -1.172  -26.285 67.500  1.00 24.29 ? 32   VAL A CG2 1 
ATOM   191  N  N   . ASP A 1 31  ? -4.060  -27.977 65.967  1.00 27.62 ? 33   ASP A N   1 
ATOM   192  C  CA  . ASP A 1 31  ? -5.343  -27.348 65.731  1.00 27.95 ? 33   ASP A CA  1 
ATOM   193  C  C   . ASP A 1 31  ? -5.492  -26.294 66.790  1.00 26.57 ? 33   ASP A C   1 
ATOM   194  O  O   . ASP A 1 31  ? -5.516  -26.608 67.972  1.00 28.02 ? 33   ASP A O   1 
ATOM   195  C  CB  . ASP A 1 31  ? -6.490  -28.360 65.822  1.00 28.59 ? 33   ASP A CB  1 
ATOM   196  C  CG  . ASP A 1 31  ? -7.866  -27.708 65.588  1.00 31.22 ? 33   ASP A CG  1 
ATOM   197  O  OD1 . ASP A 1 31  ? -8.018  -26.909 64.625  1.00 29.26 ? 33   ASP A OD1 1 
ATOM   198  O  OD2 . ASP A 1 31  ? -8.791  -27.993 66.376  1.00 31.00 ? 33   ASP A OD2 1 
ATOM   199  N  N   . ILE A 1 32  ? -5.565  -25.034 66.374  1.00 26.65 ? 34   ILE A N   1 
ATOM   200  C  CA  . ILE A 1 32  ? -5.796  -23.929 67.266  1.00 26.15 ? 34   ILE A CA  1 
ATOM   201  C  C   . ILE A 1 32  ? -7.314  -23.839 67.511  1.00 29.89 ? 34   ILE A C   1 
ATOM   202  O  O   . ILE A 1 32  ? -8.093  -23.602 66.586  1.00 26.63 ? 34   ILE A O   1 
ATOM   203  C  CB  . ILE A 1 32  ? -5.281  -22.587 66.668  1.00 25.30 ? 34   ILE A CB  1 
ATOM   204  C  CG1 . ILE A 1 32  ? -3.762  -22.664 66.373  1.00 25.25 ? 34   ILE A CG1 1 
ATOM   205  C  CG2 . ILE A 1 32  ? -5.562  -21.421 67.599  1.00 25.88 ? 34   ILE A CG2 1 
ATOM   206  C  CD1 . ILE A 1 32  ? -3.232  -21.516 65.499  1.00 25.51 ? 34   ILE A CD1 1 
ATOM   207  N  N   . ARG A 1 33  ? -7.718  -24.045 68.759  1.00 33.18 ? 35   ARG A N   1 
ATOM   208  C  CA  . ARG A 1 33  ? -9.113  -23.852 69.176  1.00 35.23 ? 35   ARG A CA  1 
ATOM   209  C  C   . ARG A 1 33  ? -9.111  -22.598 70.021  1.00 29.64 ? 35   ARG A C   1 
ATOM   210  O  O   . ARG A 1 33  ? -8.752  -22.664 71.183  1.00 34.25 ? 35   ARG A O   1 
ATOM   211  C  CB  . ARG A 1 33  ? -9.615  -25.072 69.942  1.00 37.42 ? 35   ARG A CB  1 
ATOM   212  C  CG  . ARG A 1 33  ? -9.598  -26.338 69.099  1.00 44.50 ? 35   ARG A CG  1 
ATOM   213  C  CD  . ARG A 1 33  ? -10.226 -27.496 69.843  1.00 51.41 ? 35   ARG A CD  1 
ATOM   214  N  NE  . ARG A 1 33  ? -11.624 -27.207 70.199  1.00 56.80 ? 35   ARG A NE  1 
ATOM   215  C  CZ  . ARG A 1 33  ? -12.334 -27.845 71.134  1.00 60.40 ? 35   ARG A CZ  1 
ATOM   216  N  NH1 . ARG A 1 33  ? -11.811 -28.847 71.847  1.00 60.08 ? 35   ARG A NH1 1 
ATOM   217  N  NH2 . ARG A 1 33  ? -13.591 -27.471 71.363  1.00 65.38 ? 35   ARG A NH2 1 
ATOM   218  N  N   . PRO A 1 34  ? -9.480  -21.438 69.441  1.00 30.10 ? 36   PRO A N   1 
ATOM   219  C  CA  . PRO A 1 34  ? -9.222  -20.162 70.131  1.00 29.59 ? 36   PRO A CA  1 
ATOM   220  C  C   . PRO A 1 34  ? -10.008 -19.905 71.432  1.00 32.89 ? 36   PRO A C   1 
ATOM   221  O  O   . PRO A 1 34  ? -9.598  -19.049 72.227  1.00 32.39 ? 36   PRO A O   1 
ATOM   222  C  CB  . PRO A 1 34  ? -9.586  -19.102 69.082  1.00 29.68 ? 36   PRO A CB  1 
ATOM   223  C  CG  . PRO A 1 34  ? -9.713  -19.814 67.801  1.00 29.34 ? 36   PRO A CG  1 
ATOM   224  C  CD  . PRO A 1 34  ? -10.121 -21.213 68.138  1.00 30.35 ? 36   PRO A CD  1 
ATOM   225  N  N   . GLN A 1 35  ? -11.109 -20.620 71.654  1.00 35.14 ? 37   GLN A N   1 
ATOM   226  C  CA  . GLN A 1 35  ? -11.780 -20.558 72.967  1.00 40.29 ? 37   GLN A CA  1 
ATOM   227  C  C   . GLN A 1 35  ? -10.898 -21.150 74.075  1.00 40.34 ? 37   GLN A C   1 
ATOM   228  O  O   . GLN A 1 35  ? -10.931 -20.668 75.194  1.00 43.95 ? 37   GLN A O   1 
ATOM   229  C  CB  . GLN A 1 35  ? -13.133 -21.276 72.960  1.00 40.60 ? 37   GLN A CB  1 
ATOM   230  C  CG  . GLN A 1 35  ? -14.190 -20.566 72.135  1.00 42.71 ? 37   GLN A CG  1 
ATOM   231  C  CD  . GLN A 1 35  ? -15.602 -21.089 72.384  1.00 46.00 ? 37   GLN A CD  1 
ATOM   232  O  OE1 . GLN A 1 35  ? -16.384 -21.248 71.442  1.00 44.97 ? 37   GLN A OE1 1 
ATOM   233  N  NE2 . GLN A 1 35  ? -15.940 -21.338 73.650  1.00 44.93 ? 37   GLN A NE2 1 
ATOM   234  N  N   . LEU A 1 36  ? -10.132 -22.192 73.750  1.00 37.62 ? 38   LEU A N   1 
ATOM   235  C  CA  . LEU A 1 36  ? -9.209  -22.814 74.688  1.00 37.12 ? 38   LEU A CA  1 
ATOM   236  C  C   . LEU A 1 36  ? -7.833  -22.140 74.742  1.00 35.98 ? 38   LEU A C   1 
ATOM   237  O  O   . LEU A 1 36  ? -7.006  -22.548 75.553  1.00 34.64 ? 38   LEU A O   1 
ATOM   238  C  CB  . LEU A 1 36  ? -9.029  -24.304 74.351  1.00 39.72 ? 38   LEU A CB  1 
ATOM   239  C  CG  . LEU A 1 36  ? -10.284 -25.161 74.132  1.00 41.80 ? 38   LEU A CG  1 
ATOM   240  C  CD1 . LEU A 1 36  ? -9.927  -26.650 74.160  1.00 43.62 ? 38   LEU A CD1 1 
ATOM   241  C  CD2 . LEU A 1 36  ? -11.361 -24.832 75.151  1.00 43.73 ? 38   LEU A CD2 1 
ATOM   242  N  N   . ALA A 1 37  ? -7.577  -21.138 73.882  1.00 34.61 ? 39   ALA A N   1 
ATOM   243  C  CA  . ALA A 1 37  ? -6.338  -20.347 73.961  1.00 34.65 ? 39   ALA A CA  1 
ATOM   244  C  C   . ALA A 1 37  ? -6.360  -19.520 75.201  1.00 33.35 ? 39   ALA A C   1 
ATOM   245  O  O   . ALA A 1 37  ? -7.419  -19.103 75.621  1.00 38.85 ? 39   ALA A O   1 
ATOM   246  C  CB  . ALA A 1 37  ? -6.159  -19.431 72.753  1.00 34.35 ? 39   ALA A CB  1 
ATOM   247  N  N   . ALA A 1 38  ? -5.178  -19.260 75.753  1.00 30.94 ? 40   ALA A N   1 
ATOM   248  C  CA  . ALA A 1 38  ? -5.003  -18.496 76.970  1.00 28.58 ? 40   ALA A CA  1 
ATOM   249  C  C   . ALA A 1 38  ? -4.548  -17.099 76.647  1.00 29.41 ? 40   ALA A C   1 
ATOM   250  O  O   . ALA A 1 38  ? -3.493  -16.915 76.039  1.00 28.56 ? 40   ALA A O   1 
ATOM   251  C  CB  . ALA A 1 38  ? -3.982  -19.173 77.892  1.00 29.62 ? 40   ALA A CB  1 
ATOM   252  N  N   . PHE A 1 39  ? -5.307  -16.095 77.102  1.00 28.15 ? 41   PHE A N   1 
ATOM   253  C  CA  . PHE A 1 39  ? -4.936  -14.705 76.848  1.00 26.79 ? 41   PHE A CA  1 
ATOM   254  C  C   . PHE A 1 39  ? -3.757  -14.379 77.701  1.00 29.40 ? 41   PHE A C   1 
ATOM   255  O  O   . PHE A 1 39  ? -3.754  -14.676 78.892  1.00 28.77 ? 41   PHE A O   1 
ATOM   256  C  CB  . PHE A 1 39  ? -6.071  -13.736 77.154  1.00 28.09 ? 41   PHE A CB  1 
ATOM   257  C  CG  . PHE A 1 39  ? -5.662  -12.291 77.164  1.00 26.46 ? 41   PHE A CG  1 
ATOM   258  C  CD1 . PHE A 1 39  ? -4.992  -11.729 76.083  1.00 28.16 ? 41   PHE A CD1 1 
ATOM   259  C  CD2 . PHE A 1 39  ? -5.968  -11.474 78.248  1.00 27.87 ? 41   PHE A CD2 1 
ATOM   260  C  CE1 . PHE A 1 39  ? -4.612  -10.392 76.097  1.00 25.60 ? 41   PHE A CE1 1 
ATOM   261  C  CE2 . PHE A 1 39  ? -5.610  -10.125 78.260  1.00 25.82 ? 41   PHE A CE2 1 
ATOM   262  C  CZ  . PHE A 1 39  ? -4.943  -9.586  77.185  1.00 27.59 ? 41   PHE A CZ  1 
ATOM   263  N  N   . SER A 1 40  ? -2.746  -13.782 77.079  1.00 30.66 ? 42   SER A N   1 
ATOM   264  C  CA  . SER A 1 40  ? -1.477  -13.528 77.720  1.00 33.16 ? 42   SER A CA  1 
ATOM   265  C  C   . SER A 1 40  ? -0.956  -12.148 77.317  1.00 30.81 ? 42   SER A C   1 
ATOM   266  O  O   . SER A 1 40  ? -0.321  -12.028 76.261  1.00 32.16 ? 42   SER A O   1 
ATOM   267  C  CB  . SER A 1 40  ? -0.501  -14.635 77.293  1.00 37.44 ? 42   SER A CB  1 
ATOM   268  O  OG  . SER A 1 40  ? 0.836   -14.251 77.575  1.00 43.75 ? 42   SER A OG  1 
ATOM   269  N  N   . PRO A 1 41  ? -1.161  -11.107 78.168  1.00 29.56 ? 43   PRO A N   1 
ATOM   270  C  CA  . PRO A 1 41  ? -0.787  -9.735  77.743  1.00 28.42 ? 43   PRO A CA  1 
ATOM   271  C  C   . PRO A 1 41  ? 0.686   -9.405  77.705  1.00 27.33 ? 43   PRO A C   1 
ATOM   272  O  O   . PRO A 1 41  ? 1.051   -8.319  77.269  1.00 27.30 ? 43   PRO A O   1 
ATOM   273  C  CB  . PRO A 1 41  ? -1.501  -8.819  78.764  1.00 28.62 ? 43   PRO A CB  1 
ATOM   274  C  CG  . PRO A 1 41  ? -1.815  -9.679  79.922  1.00 27.80 ? 43   PRO A CG  1 
ATOM   275  C  CD  . PRO A 1 41  ? -1.932  -11.094 79.427  1.00 28.65 ? 43   PRO A CD  1 
ATOM   276  N  N   . ALA A 1 42  ? 1.544   -10.303 78.173  1.00 26.54 ? 44   ALA A N   1 
ATOM   277  C  CA  . ALA A 1 42  ? 2.974   -10.133 77.950  1.00 27.04 ? 44   ALA A CA  1 
ATOM   278  C  C   . ALA A 1 42  ? 3.349   -10.378 76.463  1.00 24.37 ? 44   ALA A C   1 
ATOM   279  O  O   . ALA A 1 42  ? 4.438   -10.048 76.065  1.00 26.04 ? 44   ALA A O   1 
ATOM   280  C  CB  . ALA A 1 42  ? 3.778   -11.067 78.861  1.00 26.64 ? 44   ALA A CB  1 
ATOM   281  N  N   . LEU A 1 43  ? 2.469   -10.973 75.657  1.00 24.66 ? 45   LEU A N   1 
ATOM   282  C  CA  . LEU A 1 43  ? 2.751   -11.140 74.221  1.00 24.41 ? 45   LEU A CA  1 
ATOM   283  C  C   . LEU A 1 43  ? 2.553   -9.811  73.477  1.00 27.46 ? 45   LEU A C   1 
ATOM   284  O  O   . LEU A 1 43  ? 1.415   -9.462  73.126  1.00 27.26 ? 45   LEU A O   1 
ATOM   285  C  CB  . LEU A 1 43  ? 1.866   -12.209 73.616  1.00 25.94 ? 45   LEU A CB  1 
ATOM   286  C  CG  . LEU A 1 43  ? 2.094   -13.613 74.151  1.00 25.92 ? 45   LEU A CG  1 
ATOM   287  C  CD1 . LEU A 1 43  ? 1.110   -14.544 73.470  1.00 28.13 ? 45   LEU A CD1 1 
ATOM   288  C  CD2 . LEU A 1 43  ? 3.529   -14.081 73.937  1.00 27.87 ? 45   LEU A CD2 1 
ATOM   289  N  N   . ARG A 1 44  ? 3.665   -9.112  73.239  1.00 26.03 ? 46   ARG A N   1 
ATOM   290  C  CA  . ARG A 1 44  ? 3.697   -7.814  72.560  1.00 29.76 ? 46   ARG A CA  1 
ATOM   291  C  C   . ARG A 1 44  ? 3.858   -7.939  71.045  1.00 29.92 ? 46   ARG A C   1 
ATOM   292  O  O   . ARG A 1 44  ? 4.127   -9.033  70.550  1.00 29.42 ? 46   ARG A O   1 
ATOM   293  C  CB  . ARG A 1 44  ? 4.863   -6.989  73.077  1.00 32.08 ? 46   ARG A CB  1 
ATOM   294  C  CG  . ARG A 1 44  ? 4.965   -6.885  74.588  1.00 37.31 ? 46   ARG A CG  1 
ATOM   295  C  CD  . ARG A 1 44  ? 3.646   -6.569  75.288  1.00 39.07 ? 46   ARG A CD  1 
ATOM   296  N  NE  . ARG A 1 44  ? 2.952   -5.446  74.660  1.00 42.35 ? 46   ARG A NE  1 
ATOM   297  C  CZ  . ARG A 1 44  ? 1.630   -5.256  74.657  1.00 47.55 ? 46   ARG A CZ  1 
ATOM   298  N  NH1 . ARG A 1 44  ? 0.800   -6.106  75.273  1.00 51.75 ? 46   ARG A NH1 1 
ATOM   299  N  NH2 . ARG A 1 44  ? 1.128   -4.199  74.023  1.00 47.88 ? 46   ARG A NH2 1 
ATOM   300  N  N   . PRO A 1 45  ? 3.722   -6.806  70.309  1.00 31.31 ? 47   PRO A N   1 
ATOM   301  C  CA  . PRO A 1 45  ? 3.850   -6.926  68.852  1.00 30.04 ? 47   PRO A CA  1 
ATOM   302  C  C   . PRO A 1 45  ? 5.229   -7.449  68.393  1.00 28.40 ? 47   PRO A C   1 
ATOM   303  O  O   . PRO A 1 45  ? 6.243   -7.035  68.912  1.00 23.14 ? 47   PRO A O   1 
ATOM   304  C  CB  . PRO A 1 45  ? 3.559   -5.494  68.359  1.00 31.08 ? 47   PRO A CB  1 
ATOM   305  C  CG  . PRO A 1 45  ? 2.631   -4.925  69.404  1.00 31.73 ? 47   PRO A CG  1 
ATOM   306  C  CD  . PRO A 1 45  ? 3.235   -5.456  70.691  1.00 32.22 ? 47   PRO A CD  1 
ATOM   307  N  N   . LEU A 1 46  ? 5.230   -8.387  67.449  1.00 28.27 ? 48   LEU A N   1 
ATOM   308  C  CA  . LEU A 1 46  ? 6.500   -8.890  66.878  1.00 28.74 ? 48   LEU A CA  1 
ATOM   309  C  C   . LEU A 1 46  ? 7.270   -7.758  66.237  1.00 27.22 ? 48   LEU A C   1 
ATOM   310  O  O   . LEU A 1 46  ? 6.654   -6.889  65.619  1.00 28.22 ? 48   LEU A O   1 
ATOM   311  C  CB  . LEU A 1 46  ? 6.228   -9.943  65.814  1.00 30.14 ? 48   LEU A CB  1 
ATOM   312  C  CG  . LEU A 1 46  ? 5.356   -11.108 66.227  1.00 34.42 ? 48   LEU A CG  1 
ATOM   313  C  CD1 . LEU A 1 46  ? 5.334   -12.117 65.095  1.00 38.66 ? 48   LEU A CD1 1 
ATOM   314  C  CD2 . LEU A 1 46  ? 5.821   -11.723 67.545  1.00 33.50 ? 48   LEU A CD2 1 
ATOM   315  N  N   . GLU A 1 47  ? 8.601   -7.746  66.373  1.00 26.33 ? 49   GLU A N   1 
ATOM   316  C  CA  . GLU A 1 47  ? 9.438   -6.725  65.744  1.00 26.17 ? 49   GLU A CA  1 
ATOM   317  C  C   . GLU A 1 47  ? 10.454  -7.314  64.742  1.00 26.33 ? 49   GLU A C   1 
ATOM   318  O  O   . GLU A 1 47  ? 11.169  -8.250  65.082  1.00 23.82 ? 49   GLU A O   1 
ATOM   319  C  CB  . GLU A 1 47  ? 10.192  -5.946  66.796  1.00 27.74 ? 49   GLU A CB  1 
ATOM   320  C  CG  . GLU A 1 47  ? 9.257   -5.237  67.783  1.00 29.71 ? 49   GLU A CG  1 
ATOM   321  C  CD  . GLU A 1 47  ? 8.393   -4.139  67.149  1.00 32.63 ? 49   GLU A CD  1 
ATOM   322  O  OE1 . GLU A 1 47  ? 8.637   -3.743  65.979  1.00 32.16 ? 49   GLU A OE1 1 
ATOM   323  O  OE2 . GLU A 1 47  ? 7.451   -3.659  67.825  1.00 35.73 ? 49   GLU A OE2 1 
ATOM   324  N  N   . LEU A 1 48  ? 10.528  -6.708  63.553  1.00 22.84 ? 50   LEU A N   1 
ATOM   325  C  CA  . LEU A 1 48  ? 11.374  -7.182  62.432  1.00 22.85 ? 50   LEU A CA  1 
ATOM   326  C  C   . LEU A 1 48  ? 12.292  -6.069  61.951  1.00 23.34 ? 50   LEU A C   1 
ATOM   327  O  O   . LEU A 1 48  ? 11.815  -4.982  61.667  1.00 25.78 ? 50   LEU A O   1 
ATOM   328  C  CB  . LEU A 1 48  ? 10.503  -7.578  61.251  1.00 24.33 ? 50   LEU A CB  1 
ATOM   329  C  CG  . LEU A 1 48  ? 9.476   -8.698  61.336  1.00 26.17 ? 50   LEU A CG  1 
ATOM   330  C  CD1 . LEU A 1 48  ? 8.902   -9.078  59.970  1.00 26.99 ? 50   LEU A CD1 1 
ATOM   331  C  CD2 . LEU A 1 48  ? 10.056  -9.899  61.997  1.00 28.06 ? 50   LEU A CD2 1 
ATOM   332  N  N   . LEU A 1 49  ? 13.600  -6.314  61.854  1.00 22.13 ? 51   LEU A N   1 
ATOM   333  C  CA  . LEU A 1 49  ? 14.548  -5.304  61.336  1.00 22.20 ? 51   LEU A CA  1 
ATOM   334  C  C   . LEU A 1 49  ? 15.321  -5.916  60.200  1.00 20.16 ? 51   LEU A C   1 
ATOM   335  O  O   . LEU A 1 49  ? 15.655  -7.086  60.283  1.00 19.19 ? 51   LEU A O   1 
ATOM   336  C  CB  . LEU A 1 49  ? 15.569  -4.866  62.396  1.00 24.13 ? 51   LEU A CB  1 
ATOM   337  C  CG  . LEU A 1 49  ? 15.036  -4.265  63.696  1.00 27.87 ? 51   LEU A CG  1 
ATOM   338  C  CD1 . LEU A 1 49  ? 16.193  -3.971  64.646  1.00 28.32 ? 51   LEU A CD1 1 
ATOM   339  C  CD2 . LEU A 1 49  ? 14.210  -3.025  63.403  1.00 28.79 ? 51   LEU A CD2 1 
ATOM   340  N  N   . GLY A 1 50  ? 15.588  -5.129  59.158  1.00 18.84 ? 52   GLY A N   1 
ATOM   341  C  CA  . GLY A 1 50  ? 16.357  -5.578  58.013  1.00 19.28 ? 52   GLY A CA  1 
ATOM   342  C  C   . GLY A 1 50  ? 15.583  -6.433  57.006  1.00 18.45 ? 52   GLY A C   1 
ATOM   343  O  O   . GLY A 1 50  ? 16.196  -7.027  56.122  1.00 19.78 ? 52   GLY A O   1 
ATOM   344  N  N   . PHE A 1 51  ? 14.261  -6.493  57.096  1.00 18.15 ? 53   PHE A N   1 
ATOM   345  C  CA  . PHE A 1 51  ? 13.487  -7.341  56.163  1.00 17.86 ? 53   PHE A CA  1 
ATOM   346  C  C   . PHE A 1 51  ? 13.257  -6.683  54.804  1.00 18.83 ? 53   PHE A C   1 
ATOM   347  O  O   . PHE A 1 51  ? 12.871  -7.364  53.842  1.00 16.89 ? 53   PHE A O   1 
ATOM   348  C  CB  . PHE A 1 51  ? 12.162  -7.770  56.769  1.00 18.31 ? 53   PHE A CB  1 
ATOM   349  C  CG  . PHE A 1 51  ? 12.248  -8.981  57.670  1.00 17.34 ? 53   PHE A CG  1 
ATOM   350  C  CD1 . PHE A 1 51  ? 12.995  -8.963  58.831  1.00 18.19 ? 53   PHE A CD1 1 
ATOM   351  C  CD2 . PHE A 1 51  ? 11.547  -10.130 57.352  1.00 18.71 ? 53   PHE A CD2 1 
ATOM   352  C  CE1 . PHE A 1 51  ? 13.057  -10.076 59.660  1.00 17.66 ? 53   PHE A CE1 1 
ATOM   353  C  CE2 . PHE A 1 51  ? 11.597  -11.249 58.178  1.00 18.37 ? 53   PHE A CE2 1 
ATOM   354  C  CZ  . PHE A 1 51  ? 12.357  -11.214 59.332  1.00 17.71 ? 53   PHE A CZ  1 
ATOM   355  N  N   . GLN A 1 52  ? 13.461  -5.362  54.722  1.00 18.49 ? 54   GLN A N   1 
ATOM   356  C  CA  . GLN A 1 52  ? 13.285  -4.629  53.462  1.00 20.08 ? 54   GLN A CA  1 
ATOM   357  C  C   . GLN A 1 52  ? 14.616  -4.623  52.711  1.00 20.55 ? 54   GLN A C   1 
ATOM   358  O  O   . GLN A 1 52  ? 15.476  -3.782  52.934  1.00 20.94 ? 54   GLN A O   1 
ATOM   359  C  CB  . GLN A 1 52  ? 12.812  -3.202  53.731  1.00 22.50 ? 54   GLN A CB  1 
ATOM   360  C  CG  . GLN A 1 52  ? 11.472  -3.116  54.444  1.00 24.62 ? 54   GLN A CG  1 
ATOM   361  C  CD  . GLN A 1 52  ? 11.062  -1.662  54.673  1.00 27.97 ? 54   GLN A CD  1 
ATOM   362  O  OE1 . GLN A 1 52  ? 11.489  -1.030  55.632  1.00 35.02 ? 54   GLN A OE1 1 
ATOM   363  N  NE2 . GLN A 1 52  ? 10.267  -1.121  53.770  1.00 31.40 ? 54   GLN A NE2 1 
ATOM   364  N  N   . LEU A 1 53  ? 14.761  -5.593  51.829  1.00 20.57 ? 55   LEU A N   1 
ATOM   365  C  CA  . LEU A 1 53  ? 16.040  -5.886  51.181  1.00 20.84 ? 55   LEU A CA  1 
ATOM   366  C  C   . LEU A 1 53  ? 16.211  -5.108  49.884  1.00 19.96 ? 55   LEU A C   1 
ATOM   367  O  O   . LEU A 1 53  ? 15.223  -4.883  49.187  1.00 19.63 ? 55   LEU A O   1 
ATOM   368  C  CB  . LEU A 1 53  ? 16.093  -7.363  50.815  1.00 20.39 ? 55   LEU A CB  1 
ATOM   369  C  CG  . LEU A 1 53  ? 16.078  -8.308  52.013  1.00 21.13 ? 55   LEU A CG  1 
ATOM   370  C  CD1 . LEU A 1 53  ? 15.951  -9.733  51.538  1.00 22.07 ? 55   LEU A CD1 1 
ATOM   371  C  CD2 . LEU A 1 53  ? 17.320  -8.111  52.873  1.00 22.57 ? 55   LEU A CD2 1 
ATOM   372  N  N   . PRO A 1 54  ? 17.470  -4.770  49.537  1.00 21.32 ? 56   PRO A N   1 
ATOM   373  C  CA  . PRO A 1 54  ? 17.753  -4.254  48.213  1.00 21.94 ? 56   PRO A CA  1 
ATOM   374  C  C   . PRO A 1 54  ? 17.682  -5.413  47.192  1.00 21.59 ? 56   PRO A C   1 
ATOM   375  O  O   . PRO A 1 54  ? 17.741  -6.575  47.595  1.00 20.53 ? 56   PRO A O   1 
ATOM   376  C  CB  . PRO A 1 54  ? 19.179  -3.717  48.353  1.00 21.98 ? 56   PRO A CB  1 
ATOM   377  C  CG  . PRO A 1 54  ? 19.817  -4.625  49.323  1.00 21.89 ? 56   PRO A CG  1 
ATOM   378  C  CD  . PRO A 1 54  ? 18.715  -4.923  50.325  1.00 22.54 ? 56   PRO A CD  1 
ATOM   379  N  N   . PRO A 1 55  ? 17.535  -5.101  45.903  1.00 21.38 ? 57   PRO A N   1 
ATOM   380  C  CA  . PRO A 1 55  ? 17.381  -6.131  44.893  1.00 21.97 ? 57   PRO A CA  1 
ATOM   381  C  C   . PRO A 1 55  ? 18.637  -7.003  44.736  1.00 22.58 ? 57   PRO A C   1 
ATOM   382  O  O   . PRO A 1 55  ? 18.492  -8.196  44.539  1.00 22.37 ? 57   PRO A O   1 
ATOM   383  C  CB  . PRO A 1 55  ? 17.071  -5.360  43.615  1.00 22.01 ? 57   PRO A CB  1 
ATOM   384  C  CG  . PRO A 1 55  ? 17.508  -3.960  43.863  1.00 22.80 ? 57   PRO A CG  1 
ATOM   385  C  CD  . PRO A 1 55  ? 17.402  -3.737  45.334  1.00 22.19 ? 57   PRO A CD  1 
ATOM   386  N  N   . LEU A 1 56  ? 19.821  -6.415  44.886  1.00 22.98 ? 58   LEU A N   1 
ATOM   387  C  CA  . LEU A 1 56  ? 21.078  -7.174  44.903  1.00 23.92 ? 58   LEU A CA  1 
ATOM   388  C  C   . LEU A 1 56  ? 21.721  -7.068  46.272  1.00 23.70 ? 58   LEU A C   1 
ATOM   389  O  O   . LEU A 1 56  ? 21.752  -5.983  46.823  1.00 24.82 ? 58   LEU A O   1 
ATOM   390  C  CB  . LEU A 1 56  ? 22.028  -6.667  43.819  1.00 24.69 ? 58   LEU A CB  1 
ATOM   391  C  CG  . LEU A 1 56  ? 21.460  -6.665  42.402  1.00 25.09 ? 58   LEU A CG  1 
ATOM   392  C  CD1 . LEU A 1 56  ? 22.505  -6.094  41.449  1.00 27.01 ? 58   LEU A CD1 1 
ATOM   393  C  CD2 . LEU A 1 56  ? 21.009  -8.039  41.932  1.00 25.95 ? 58   LEU A CD2 1 
ATOM   394  N  N   . PRO A 1 57  ? 22.259  -8.162  46.826  1.00 23.59 ? 59   PRO A N   1 
ATOM   395  C  CA  . PRO A 1 57  ? 22.443  -9.443  46.118  1.00 23.39 ? 59   PRO A CA  1 
ATOM   396  C  C   . PRO A 1 57  ? 21.154  -10.281 46.038  1.00 22.56 ? 59   PRO A C   1 
ATOM   397  O  O   . PRO A 1 57  ? 20.232  -10.103 46.847  1.00 21.63 ? 59   PRO A O   1 
ATOM   398  C  CB  . PRO A 1 57  ? 23.490  -10.148 46.978  1.00 24.12 ? 59   PRO A CB  1 
ATOM   399  C  CG  . PRO A 1 57  ? 23.208  -9.629  48.350  1.00 24.62 ? 59   PRO A CG  1 
ATOM   400  C  CD  . PRO A 1 57  ? 22.958  -8.171  48.121  1.00 23.78 ? 59   PRO A CD  1 
ATOM   401  N  N   . GLU A 1 58  ? 21.090  -11.160 45.045  1.00 20.16 ? 60   GLU A N   1 
ATOM   402  C  CA  . GLU A 1 58  ? 19.965  -12.034 44.848  1.00 20.72 ? 60   GLU A CA  1 
ATOM   403  C  C   . GLU A 1 58  ? 19.910  -13.130 45.909  1.00 19.85 ? 60   GLU A C   1 
ATOM   404  O  O   . GLU A 1 58  ? 20.883  -13.387 46.591  1.00 19.14 ? 60   GLU A O   1 
ATOM   405  C  CB  . GLU A 1 58  ? 19.973  -12.631 43.454  1.00 21.51 ? 60   GLU A CB  1 
ATOM   406  C  CG  . GLU A 1 58  ? 19.652  -11.613 42.352  1.00 23.70 ? 60   GLU A CG  1 
ATOM   407  C  CD  . GLU A 1 58  ? 19.514  -12.281 41.012  1.00 26.00 ? 60   GLU A CD  1 
ATOM   408  O  OE1 . GLU A 1 58  ? 20.544  -12.758 40.517  1.00 28.61 ? 60   GLU A OE1 1 
ATOM   409  O  OE2 . GLU A 1 58  ? 18.397  -12.380 40.490  1.00 27.83 ? 60   GLU A OE2 1 
ATOM   410  N  N   . LEU A 1 59  ? 18.724  -13.704 46.058  1.00 19.39 ? 61   LEU A N   1 
ATOM   411  C  CA  . LEU A 1 59  ? 18.451  -14.794 47.000  1.00 20.31 ? 61   LEU A CA  1 
ATOM   412  C  C   . LEU A 1 59  ? 18.202  -16.067 46.238  1.00 19.78 ? 61   LEU A C   1 
ATOM   413  O  O   . LEU A 1 59  ? 17.737  -16.019 45.102  1.00 22.22 ? 61   LEU A O   1 
ATOM   414  C  CB  . LEU A 1 59  ? 17.175  -14.490 47.812  1.00 20.41 ? 61   LEU A CB  1 
ATOM   415  C  CG  . LEU A 1 59  ? 17.111  -13.134 48.505  1.00 22.03 ? 61   LEU A CG  1 
ATOM   416  C  CD1 . LEU A 1 59  ? 15.893  -13.123 49.445  1.00 23.70 ? 61   LEU A CD1 1 
ATOM   417  C  CD2 . LEU A 1 59  ? 18.385  -12.857 49.261  1.00 22.37 ? 61   LEU A CD2 1 
ATOM   418  N  N   . ARG A 1 60  ? 18.479  -17.201 46.875  1.00 20.15 ? 62   ARG A N   1 
ATOM   419  C  CA  . ARG A 1 60  ? 18.295  -18.495 46.238  1.00 20.97 ? 62   ARG A CA  1 
ATOM   420  C  C   . ARG A 1 60  ? 16.947  -19.074 46.612  1.00 19.50 ? 62   ARG A C   1 
ATOM   421  O  O   . ARG A 1 60  ? 16.609  -19.128 47.794  1.00 17.86 ? 62   ARG A O   1 
ATOM   422  C  CB  . ARG A 1 60  ? 19.417  -19.441 46.644  1.00 22.67 ? 62   ARG A CB  1 
ATOM   423  C  CG  . ARG A 1 60  ? 20.808  -18.855 46.378  1.00 24.54 ? 62   ARG A CG  1 
ATOM   424  C  CD  . ARG A 1 60  ? 21.884  -19.927 46.432  1.00 25.41 ? 62   ARG A CD  1 
ATOM   425  N  NE  . ARG A 1 60  ? 21.930  -20.671 45.178  1.00 24.19 ? 62   ARG A NE  1 
ATOM   426  C  CZ  . ARG A 1 60  ? 22.496  -20.234 44.064  1.00 24.47 ? 62   ARG A CZ  1 
ATOM   427  N  NH1 . ARG A 1 60  ? 23.103  -19.054 44.024  1.00 25.23 ? 62   ARG A NH1 1 
ATOM   428  N  NH2 . ARG A 1 60  ? 22.471  -20.998 42.978  1.00 24.57 ? 62   ARG A NH2 1 
ATOM   429  N  N   . LEU A 1 61  ? 16.194  -19.481 45.591  1.00 19.24 ? 63   LEU A N   1 
ATOM   430  C  CA  . LEU A 1 61  ? 14.873  -20.085 45.710  1.00 19.37 ? 63   LEU A CA  1 
ATOM   431  C  C   . LEU A 1 61  ? 14.933  -21.505 45.169  1.00 19.79 ? 63   LEU A C   1 
ATOM   432  O  O   . LEU A 1 61  ? 15.272  -21.704 44.005  1.00 20.64 ? 63   LEU A O   1 
ATOM   433  C  CB  . LEU A 1 61  ? 13.880  -19.276 44.886  1.00 18.59 ? 63   LEU A CB  1 
ATOM   434  C  CG  . LEU A 1 61  ? 12.402  -19.658 44.960  1.00 19.20 ? 63   LEU A CG  1 
ATOM   435  C  CD1 . LEU A 1 61  ? 11.819  -19.335 46.345  1.00 19.20 ? 63   LEU A CD1 1 
ATOM   436  C  CD2 . LEU A 1 61  ? 11.646  -18.940 43.873  1.00 19.24 ? 63   LEU A CD2 1 
ATOM   437  N  N   . ARG A 1 62  ? 14.594  -22.479 46.000  1.00 19.49 ? 64   ARG A N   1 
ATOM   438  C  CA  . ARG A 1 62  ? 14.848  -23.881 45.681  1.00 22.28 ? 64   ARG A CA  1 
ATOM   439  C  C   . ARG A 1 62  ? 13.592  -24.734 45.808  1.00 20.67 ? 64   ARG A C   1 
ATOM   440  O  O   . ARG A 1 62  ? 12.860  -24.604 46.793  1.00 19.54 ? 64   ARG A O   1 
ATOM   441  C  CB  . ARG A 1 62  ? 15.924  -24.395 46.624  1.00 24.65 ? 64   ARG A CB  1 
ATOM   442  C  CG  . ARG A 1 62  ? 16.319  -25.836 46.375  1.00 28.32 ? 64   ARG A CG  1 
ATOM   443  C  CD  . ARG A 1 62  ? 17.520  -26.245 47.206  1.00 33.53 ? 64   ARG A CD  1 
ATOM   444  N  NE  . ARG A 1 62  ? 18.134  -27.392 46.543  1.00 40.24 ? 64   ARG A NE  1 
ATOM   445  C  CZ  . ARG A 1 62  ? 17.964  -28.673 46.846  1.00 45.93 ? 64   ARG A CZ  1 
ATOM   446  N  NH1 . ARG A 1 62  ? 17.223  -29.058 47.884  1.00 50.27 ? 64   ARG A NH1 1 
ATOM   447  N  NH2 . ARG A 1 62  ? 18.578  -29.594 46.096  1.00 45.76 ? 64   ARG A NH2 1 
ATOM   448  N  N   . ASN A 1 63  ? 13.370  -25.596 44.808  1.00 19.86 ? 65   ASN A N   1 
ATOM   449  C  CA  . ASN A 1 63  ? 12.446  -26.709 44.921  1.00 19.92 ? 65   ASN A CA  1 
ATOM   450  C  C   . ASN A 1 63  ? 13.214  -27.854 45.547  1.00 20.45 ? 65   ASN A C   1 
ATOM   451  O  O   . ASN A 1 63  ? 14.041  -28.494 44.886  1.00 21.12 ? 65   ASN A O   1 
ATOM   452  C  CB  . ASN A 1 63  ? 11.876  -27.090 43.560  1.00 20.77 ? 65   ASN A CB  1 
ATOM   453  C  CG  . ASN A 1 63  ? 10.995  -28.338 43.601  1.00 20.22 ? 65   ASN A CG  1 
ATOM   454  O  OD1 . ASN A 1 63  ? 10.898  -29.035 44.619  1.00 21.66 ? 65   ASN A OD1 1 
ATOM   455  N  ND2 . ASN A 1 63  ? 10.346  -28.618 42.493  1.00 21.14 ? 65   ASN A ND2 1 
ATOM   456  N  N   . ASN A 1 64  ? 12.968  -28.103 46.820  1.00 20.47 ? 66   ASN A N   1 
ATOM   457  C  CA  . ASN A 1 64  ? 13.703  -29.159 47.518  1.00 21.73 ? 66   ASN A CA  1 
ATOM   458  C  C   . ASN A 1 64  ? 12.977  -30.496 47.540  1.00 22.38 ? 66   ASN A C   1 
ATOM   459  O  O   . ASN A 1 64  ? 13.370  -31.387 48.280  1.00 24.66 ? 66   ASN A O   1 
ATOM   460  C  CB  . ASN A 1 64  ? 14.150  -28.723 48.918  1.00 22.16 ? 66   ASN A CB  1 
ATOM   461  C  CG  . ASN A 1 64  ? 12.991  -28.350 49.842  1.00 22.91 ? 66   ASN A CG  1 
ATOM   462  O  OD1 . ASN A 1 64  ? 11.898  -28.902 49.751  1.00 21.34 ? 66   ASN A OD1 1 
ATOM   463  N  ND2 . ASN A 1 64  ? 13.237  -27.376 50.727  1.00 24.37 ? 66   ASN A ND2 1 
ATOM   464  N  N   . GLY A 1 65  ? 11.935  -30.642 46.732  1.00 23.87 ? 67   GLY A N   1 
ATOM   465  C  CA  . GLY A 1 65  ? 11.171  -31.875 46.691  1.00 24.12 ? 67   GLY A CA  1 
ATOM   466  C  C   . GLY A 1 65  ? 10.022  -31.932 47.682  1.00 24.58 ? 67   GLY A C   1 
ATOM   467  O  O   . GLY A 1 65  ? 9.057   -32.646 47.431  1.00 27.01 ? 67   GLY A O   1 
ATOM   468  N  N   . HIS A 1 66  ? 10.116  -31.206 48.794  1.00 24.69 ? 68   HIS A N   1 
ATOM   469  C  CA  . HIS A 1 66  ? 9.003   -31.118 49.779  1.00 25.77 ? 68   HIS A CA  1 
ATOM   470  C  C   . HIS A 1 66  ? 8.442   -29.717 50.043  1.00 23.83 ? 68   HIS A C   1 
ATOM   471  O  O   . HIS A 1 66  ? 7.424   -29.589 50.715  1.00 21.72 ? 68   HIS A O   1 
ATOM   472  C  CB  . HIS A 1 66  ? 9.394   -31.765 51.097  1.00 27.98 ? 68   HIS A CB  1 
ATOM   473  C  CG  . HIS A 1 66  ? 10.693  -31.294 51.646  1.00 31.53 ? 68   HIS A CG  1 
ATOM   474  N  ND1 . HIS A 1 66  ? 11.882  -31.936 51.381  1.00 36.19 ? 68   HIS A ND1 1 
ATOM   475  C  CD2 . HIS A 1 66  ? 10.998  -30.259 52.459  1.00 34.88 ? 68   HIS A CD2 1 
ATOM   476  C  CE1 . HIS A 1 66  ? 12.869  -31.311 51.996  1.00 37.09 ? 68   HIS A CE1 1 
ATOM   477  N  NE2 . HIS A 1 66  ? 12.359  -30.293 52.665  1.00 39.48 ? 68   HIS A NE2 1 
ATOM   478  N  N   . SER A 1 67  ? 9.093   -28.682 49.527  1.00 22.22 ? 69   SER A N   1 
ATOM   479  C  CA  . SER A 1 67  ? 8.569   -27.336 49.581  1.00 20.34 ? 69   SER A CA  1 
ATOM   480  C  C   . SER A 1 67  ? 9.316   -26.496 48.558  1.00 19.41 ? 69   SER A C   1 
ATOM   481  O  O   . SER A 1 67  ? 10.214  -27.002 47.861  1.00 19.44 ? 69   SER A O   1 
ATOM   482  C  CB  . SER A 1 67  ? 8.722   -26.728 50.980  1.00 19.95 ? 69   SER A CB  1 
ATOM   483  O  OG  . SER A 1 67  ? 8.030   -25.482 51.083  1.00 21.17 ? 69   SER A OG  1 
ATOM   484  N  N   . VAL A 1 68  ? 8.904   -25.237 48.440  1.00 17.61 ? 70   VAL A N   1 
ATOM   485  C  CA  . VAL A 1 68  ? 9.716   -24.211 47.765  1.00 17.14 ? 70   VAL A CA  1 
ATOM   486  C  C   . VAL A 1 68  ? 10.295  -23.363 48.903  1.00 17.13 ? 70   VAL A C   1 
ATOM   487  O  O   . VAL A 1 68  ? 9.561   -22.856 49.751  1.00 16.95 ? 70   VAL A O   1 
ATOM   488  C  CB  . VAL A 1 68  ? 8.941   -23.403 46.702  1.00 17.35 ? 70   VAL A CB  1 
ATOM   489  C  CG1 . VAL A 1 68  ? 7.672   -22.754 47.249  1.00 16.67 ? 70   VAL A CG1 1 
ATOM   490  C  CG2 . VAL A 1 68  ? 9.834   -22.346 46.083  1.00 16.96 ? 70   VAL A CG2 1 
ATOM   491  N  N   . GLN A 1 69  ? 11.613  -23.230 48.945  1.00 16.56 ? 71   GLN A N   1 
ATOM   492  C  CA  . GLN A 1 69  ? 12.292  -22.561 50.048  1.00 16.68 ? 71   GLN A CA  1 
ATOM   493  C  C   . GLN A 1 69  ? 13.165  -21.401 49.543  1.00 17.23 ? 71   GLN A C   1 
ATOM   494  O  O   . GLN A 1 69  ? 13.939  -21.560 48.619  1.00 17.18 ? 71   GLN A O   1 
ATOM   495  C  CB  . GLN A 1 69  ? 13.100  -23.563 50.859  1.00 17.75 ? 71   GLN A CB  1 
ATOM   496  C  CG  . GLN A 1 69  ? 13.915  -22.960 52.009  1.00 18.57 ? 71   GLN A CG  1 
ATOM   497  C  CD  . GLN A 1 69  ? 14.448  -23.976 53.010  1.00 20.02 ? 71   GLN A CD  1 
ATOM   498  O  OE1 . GLN A 1 69  ? 15.539  -23.823 53.545  1.00 22.90 ? 71   GLN A OE1 1 
ATOM   499  N  NE2 . GLN A 1 69  ? 13.649  -24.943 53.341  1.00 21.80 ? 71   GLN A NE2 1 
ATOM   500  N  N   . LEU A 1 70  ? 13.013  -20.242 50.176  1.00 16.39 ? 72   LEU A N   1 
ATOM   501  C  CA  . LEU A 1 70  ? 13.793  -19.062 49.873  1.00 16.58 ? 72   LEU A CA  1 
ATOM   502  C  C   . LEU A 1 70  ? 14.805  -18.916 51.000  1.00 16.84 ? 72   LEU A C   1 
ATOM   503  O  O   . LEU A 1 70  ? 14.441  -18.834 52.202  1.00 15.57 ? 72   LEU A O   1 
ATOM   504  C  CB  . LEU A 1 70  ? 12.901  -17.818 49.808  1.00 16.64 ? 72   LEU A CB  1 
ATOM   505  C  CG  . LEU A 1 70  ? 13.594  -16.504 49.479  1.00 17.14 ? 72   LEU A CG  1 
ATOM   506  C  CD1 . LEU A 1 70  ? 14.030  -16.465 48.023  1.00 17.13 ? 72   LEU A CD1 1 
ATOM   507  C  CD2 . LEU A 1 70  ? 12.645  -15.351 49.800  1.00 17.35 ? 72   LEU A CD2 1 
ATOM   508  N  N   . THR A 1 71  ? 16.078  -18.897 50.626  1.00 16.29 ? 73   THR A N   1 
ATOM   509  C  CA  . THR A 1 71  ? 17.174  -18.684 51.578  1.00 17.27 ? 73   THR A CA  1 
ATOM   510  C  C   . THR A 1 71  ? 17.290  -17.197 51.849  1.00 18.33 ? 73   THR A C   1 
ATOM   511  O  O   . THR A 1 71  ? 17.395  -16.392 50.917  1.00 18.59 ? 73   THR A O   1 
ATOM   512  C  CB  . THR A 1 71  ? 18.524  -19.222 51.017  1.00 19.21 ? 73   THR A CB  1 
ATOM   513  O  OG1 . THR A 1 71  ? 18.424  -20.634 50.832  1.00 19.82 ? 73   THR A OG1 1 
ATOM   514  C  CG2 . THR A 1 71  ? 19.683  -18.918 51.931  1.00 20.38 ? 73   THR A CG2 1 
ATOM   515  N  N   . LEU A 1 72  ? 17.268  -16.826 53.120  1.00 18.19 ? 74   LEU A N   1 
ATOM   516  C  CA  . LEU A 1 72  ? 17.348  -15.426 53.498  1.00 18.38 ? 74   LEU A CA  1 
ATOM   517  C  C   . LEU A 1 72  ? 18.785  -15.040 53.811  1.00 17.88 ? 74   LEU A C   1 
ATOM   518  O  O   . LEU A 1 72  ? 19.513  -15.835 54.361  1.00 19.47 ? 74   LEU A O   1 
ATOM   519  C  CB  . LEU A 1 72  ? 16.424  -15.155 54.700  1.00 17.38 ? 74   LEU A CB  1 
ATOM   520  C  CG  . LEU A 1 72  ? 14.973  -15.371 54.277  1.00 17.39 ? 74   LEU A CG  1 
ATOM   521  C  CD1 . LEU A 1 72  ? 14.037  -15.318 55.474  1.00 18.43 ? 74   LEU A CD1 1 
ATOM   522  C  CD2 . LEU A 1 72  ? 14.569  -14.361 53.208  1.00 17.91 ? 74   LEU A CD2 1 
ATOM   523  N  N   . PRO A 1 73  ? 19.184  -13.797 53.497  1.00 19.80 ? 75   PRO A N   1 
ATOM   524  C  CA  . PRO A 1 73  ? 20.555  -13.363 53.736  1.00 20.77 ? 75   PRO A CA  1 
ATOM   525  C  C   . PRO A 1 73  ? 20.807  -13.043 55.197  1.00 21.68 ? 75   PRO A C   1 
ATOM   526  O  O   . PRO A 1 73  ? 19.862  -12.946 55.972  1.00 21.15 ? 75   PRO A O   1 
ATOM   527  C  CB  . PRO A 1 73  ? 20.663  -12.081 52.876  1.00 21.15 ? 75   PRO A CB  1 
ATOM   528  C  CG  . PRO A 1 73  ? 19.290  -11.516 52.925  1.00 21.12 ? 75   PRO A CG  1 
ATOM   529  C  CD  . PRO A 1 73  ? 18.355  -12.701 52.962  1.00 20.36 ? 75   PRO A CD  1 
ATOM   530  N  N   . PRO A 1 74  ? 22.074  -12.838 55.577  1.00 24.53 ? 76   PRO A N   1 
ATOM   531  C  CA  . PRO A 1 74  ? 22.322  -12.325 56.916  1.00 25.02 ? 76   PRO A CA  1 
ATOM   532  C  C   . PRO A 1 74  ? 21.673  -10.956 57.153  1.00 23.39 ? 76   PRO A C   1 
ATOM   533  O  O   . PRO A 1 74  ? 21.397  -10.204 56.199  1.00 24.70 ? 76   PRO A O   1 
ATOM   534  C  CB  . PRO A 1 74  ? 23.862  -12.222 56.978  1.00 26.63 ? 76   PRO A CB  1 
ATOM   535  C  CG  . PRO A 1 74  ? 24.353  -13.135 55.901  1.00 26.16 ? 76   PRO A CG  1 
ATOM   536  C  CD  . PRO A 1 74  ? 23.336  -13.031 54.820  1.00 25.18 ? 76   PRO A CD  1 
ATOM   537  N  N   . GLY A 1 75  ? 21.389  -10.677 58.413  1.00 21.67 ? 77   GLY A N   1 
ATOM   538  C  CA  . GLY A 1 75  ? 20.947  -9.362  58.856  1.00 22.61 ? 77   GLY A CA  1 
ATOM   539  C  C   . GLY A 1 75  ? 19.453  -9.155  59.003  1.00 22.63 ? 77   GLY A C   1 
ATOM   540  O  O   . GLY A 1 75  ? 19.017  -8.003  59.083  1.00 21.57 ? 77   GLY A O   1 
ATOM   541  N  N   . LEU A 1 76  ? 18.661  -10.231 58.998  1.00 20.77 ? 78   LEU A N   1 
ATOM   542  C  CA  . LEU A 1 76  ? 17.211  -10.126 59.191  1.00 20.00 ? 78   LEU A CA  1 
ATOM   543  C  C   . LEU A 1 76  ? 16.985  -10.445 60.659  1.00 20.93 ? 78   LEU A C   1 
ATOM   544  O  O   . LEU A 1 76  ? 17.201  -11.578 61.084  1.00 20.38 ? 78   LEU A O   1 
ATOM   545  C  CB  . LEU A 1 76  ? 16.416  -11.062 58.256  1.00 20.28 ? 78   LEU A CB  1 
ATOM   546  C  CG  . LEU A 1 76  ? 16.125  -10.464 56.882  1.00 20.14 ? 78   LEU A CG  1 
ATOM   547  C  CD1 . LEU A 1 76  ? 17.400  -10.313 56.072  1.00 21.83 ? 78   LEU A CD1 1 
ATOM   548  C  CD2 . LEU A 1 76  ? 15.108  -11.303 56.137  1.00 20.41 ? 78   LEU A CD2 1 
ATOM   549  N  N   . GLU A 1 77  ? 16.646  -9.427  61.451  1.00 20.67 ? 79   GLU A N   1 
ATOM   550  C  CA  . GLU A 1 77  ? 16.486  -9.594  62.896  1.00 24.39 ? 79   GLU A CA  1 
ATOM   551  C  C   . GLU A 1 77  ? 15.007  -9.610  63.248  1.00 22.72 ? 79   GLU A C   1 
ATOM   552  O  O   . GLU A 1 77  ? 14.206  -8.894  62.657  1.00 19.90 ? 79   GLU A O   1 
ATOM   553  C  CB  . GLU A 1 77  ? 17.232  -8.515  63.650  1.00 28.55 ? 79   GLU A CB  1 
ATOM   554  C  CG  . GLU A 1 77  ? 18.738  -8.596  63.440  1.00 34.53 ? 79   GLU A CG  1 
ATOM   555  C  CD  . GLU A 1 77  ? 19.478  -7.344  63.881  1.00 40.89 ? 79   GLU A CD  1 
ATOM   556  O  OE1 . GLU A 1 77  ? 18.927  -6.237  63.754  1.00 46.80 ? 79   GLU A OE1 1 
ATOM   557  O  OE2 . GLU A 1 77  ? 20.630  -7.457  64.335  1.00 49.18 ? 79   GLU A OE2 1 
ATOM   558  N  N   . MET A 1 78  ? 14.647  -10.537 64.125  1.00 20.67 ? 80   MET A N   1 
ATOM   559  C  CA  . MET A 1 78  ? 13.304  -10.686 64.600  1.00 20.41 ? 80   MET A CA  1 
ATOM   560  C  C   . MET A 1 78  ? 13.327  -10.825 66.111  1.00 20.58 ? 80   MET A C   1 
ATOM   561  O  O   . MET A 1 78  ? 14.111  -11.625 66.646  1.00 20.02 ? 80   MET A O   1 
ATOM   562  C  CB  . MET A 1 78  ? 12.653  -11.912 63.955  1.00 20.81 ? 80   MET A CB  1 
ATOM   563  C  CG  . MET A 1 78  ? 11.174  -12.028 64.247  1.00 21.34 ? 80   MET A CG  1 
ATOM   564  S  SD  . MET A 1 78  ? 10.755  -12.857 65.771  1.00 21.00 ? 80   MET A SD  1 
ATOM   565  C  CE  . MET A 1 78  ? 11.233  -14.549 65.383  1.00 22.01 ? 80   MET A CE  1 
ATOM   566  N  N   . ALA A 1 79  ? 12.426  -10.098 66.793  1.00 20.34 ? 81   ALA A N   1 
ATOM   567  C  CA  . ALA A 1 79  ? 12.290  -10.214 68.246  1.00 21.89 ? 81   ALA A CA  1 
ATOM   568  C  C   . ALA A 1 79  ? 10.876  -10.610 68.608  1.00 22.33 ? 81   ALA A C   1 
ATOM   569  O  O   . ALA A 1 79  ? 9.903   -10.000 68.152  1.00 23.28 ? 81   ALA A O   1 
ATOM   570  C  CB  . ALA A 1 79  ? 12.726  -8.914  68.926  1.00 22.36 ? 81   ALA A CB  1 
ATOM   571  N  N   . LEU A 1 80  ? 10.739  -11.669 69.404  1.00 21.53 ? 82   LEU A N   1 
ATOM   572  C  CA  . LEU A 1 80  ? 9.427   -12.072 69.937  1.00 21.16 ? 82   LEU A CA  1 
ATOM   573  C  C   . LEU A 1 80  ? 9.002   -11.218 71.129  1.00 21.80 ? 82   LEU A C   1 
ATOM   574  O  O   . LEU A 1 80  ? 7.861   -11.299 71.575  1.00 24.95 ? 82   LEU A O   1 
ATOM   575  C  CB  . LEU A 1 80  ? 9.444   -13.537 70.383  1.00 20.54 ? 82   LEU A CB  1 
ATOM   576  C  CG  . LEU A 1 80  ? 9.666   -14.543 69.269  1.00 20.30 ? 82   LEU A CG  1 
ATOM   577  C  CD1 . LEU A 1 80  ? 9.748   -15.938 69.875  1.00 20.64 ? 82   LEU A CD1 1 
ATOM   578  C  CD2 . LEU A 1 80  ? 8.541   -14.457 68.247  1.00 21.38 ? 82   LEU A CD2 1 
ATOM   579  N  N   . GLY A 1 81  ? 9.944   -10.457 71.640  1.00 21.56 ? 83   GLY A N   1 
ATOM   580  C  CA  . GLY A 1 81  ? 9.734   -9.587  72.767  1.00 23.07 ? 83   GLY A CA  1 
ATOM   581  C  C   . GLY A 1 81  ? 11.088  -9.146  73.237  1.00 21.25 ? 83   GLY A C   1 
ATOM   582  O  O   . GLY A 1 81  ? 12.119  -9.624  72.710  1.00 20.94 ? 83   GLY A O   1 
ATOM   583  N  N   . PRO A 1 82  ? 11.130  -8.262  74.249  1.00 22.67 ? 84   PRO A N   1 
ATOM   584  C  CA  . PRO A 1 82  ? 12.390  -7.785  74.803  1.00 23.07 ? 84   PRO A CA  1 
ATOM   585  C  C   . PRO A 1 82  ? 13.292  -8.925  75.317  1.00 24.96 ? 84   PRO A C   1 
ATOM   586  O  O   . PRO A 1 82  ? 12.848  -9.728  76.116  1.00 24.02 ? 84   PRO A O   1 
ATOM   587  C  CB  . PRO A 1 82  ? 11.935  -6.909  75.979  1.00 23.19 ? 84   PRO A CB  1 
ATOM   588  C  CG  . PRO A 1 82  ? 10.628  -6.397  75.533  1.00 23.76 ? 84   PRO A CG  1 
ATOM   589  C  CD  . PRO A 1 82  ? 9.973   -7.555  74.844  1.00 23.44 ? 84   PRO A CD  1 
ATOM   590  N  N   . GLY A 1 83  ? 14.517  -9.000  74.820  1.00 25.70 ? 85   GLY A N   1 
ATOM   591  C  CA  . GLY A 1 83  ? 15.415  -10.107 75.163  1.00 27.79 ? 85   GLY A CA  1 
ATOM   592  C  C   . GLY A 1 83  ? 15.132  -11.475 74.509  1.00 28.34 ? 85   GLY A C   1 
ATOM   593  O  O   . GLY A 1 83  ? 15.697  -12.477 74.938  1.00 28.69 ? 85   GLY A O   1 
ATOM   594  N  N   . ARG A 1 84  ? 14.254  -11.527 73.509  1.00 24.23 ? 86   ARG A N   1 
ATOM   595  C  CA  . ARG A 1 84  ? 13.882  -12.766 72.809  1.00 23.19 ? 86   ARG A CA  1 
ATOM   596  C  C   . ARG A 1 84  ? 14.242  -12.584 71.319  1.00 19.96 ? 86   ARG A C   1 
ATOM   597  O  O   . ARG A 1 84  ? 13.388  -12.434 70.476  1.00 18.96 ? 86   ARG A O   1 
ATOM   598  C  CB  . ARG A 1 84  ? 12.401  -13.078 72.998  1.00 23.70 ? 86   ARG A CB  1 
ATOM   599  C  CG  . ARG A 1 84  ? 11.980  -13.361 74.445  1.00 25.87 ? 86   ARG A CG  1 
ATOM   600  C  CD  . ARG A 1 84  ? 10.460  -13.497 74.602  1.00 27.43 ? 86   ARG A CD  1 
ATOM   601  N  NE  . ARG A 1 84  ? 9.962   -14.743 74.027  1.00 26.29 ? 86   ARG A NE  1 
ATOM   602  C  CZ  . ARG A 1 84  ? 8.718   -14.987 73.613  1.00 29.08 ? 86   ARG A CZ  1 
ATOM   603  N  NH1 . ARG A 1 84  ? 7.727   -14.082 73.705  1.00 29.37 ? 86   ARG A NH1 1 
ATOM   604  N  NH2 . ARG A 1 84  ? 8.453   -16.187 73.103  1.00 29.01 ? 86   ARG A NH2 1 
ATOM   605  N  N   . GLU A 1 85  ? 15.530  -12.636 71.014  1.00 19.17 ? 87   GLU A N   1 
ATOM   606  C  CA  . GLU A 1 85  ? 16.025  -12.185 69.711  1.00 20.75 ? 87   GLU A CA  1 
ATOM   607  C  C   . GLU A 1 85  ? 16.516  -13.293 68.823  1.00 19.32 ? 87   GLU A C   1 
ATOM   608  O  O   . GLU A 1 85  ? 17.184  -14.241 69.287  1.00 18.19 ? 87   GLU A O   1 
ATOM   609  C  CB  . GLU A 1 85  ? 17.125  -11.185 69.939  1.00 24.25 ? 87   GLU A CB  1 
ATOM   610  C  CG  . GLU A 1 85  ? 16.561  -9.959  70.638  1.00 28.24 ? 87   GLU A CG  1 
ATOM   611  C  CD  . GLU A 1 85  ? 17.565  -8.884  70.825  1.00 32.30 ? 87   GLU A CD  1 
ATOM   612  O  OE1 . GLU A 1 85  ? 18.754  -9.144  70.583  1.00 34.53 ? 87   GLU A OE1 1 
ATOM   613  O  OE2 . GLU A 1 85  ? 17.156  -7.788  71.261  1.00 36.38 ? 87   GLU A OE2 1 
ATOM   614  N  N   . TYR A 1 86  ? 16.171  -13.157 67.547  1.00 17.97 ? 88   TYR A N   1 
ATOM   615  C  CA  . TYR A 1 86  ? 16.353  -14.181 66.516  1.00 17.00 ? 88   TYR A CA  1 
ATOM   616  C  C   . TYR A 1 86  ? 16.905  -13.581 65.234  1.00 18.50 ? 88   TYR A C   1 
ATOM   617  O  O   . TYR A 1 86  ? 16.837  -12.349 65.035  1.00 19.03 ? 88   TYR A O   1 
ATOM   618  C  CB  . TYR A 1 86  ? 15.009  -14.894 66.243  1.00 16.37 ? 88   TYR A CB  1 
ATOM   619  C  CG  . TYR A 1 86  ? 14.576  -15.705 67.405  1.00 16.18 ? 88   TYR A CG  1 
ATOM   620  C  CD1 . TYR A 1 86  ? 13.911  -15.110 68.482  1.00 16.63 ? 88   TYR A CD1 1 
ATOM   621  C  CD2 . TYR A 1 86  ? 14.844  -17.074 67.475  1.00 15.76 ? 88   TYR A CD2 1 
ATOM   622  C  CE1 . TYR A 1 86  ? 13.567  -15.846 69.588  1.00 17.03 ? 88   TYR A CE1 1 
ATOM   623  C  CE2 . TYR A 1 86  ? 14.461  -17.823 68.574  1.00 16.62 ? 88   TYR A CE2 1 
ATOM   624  C  CZ  . TYR A 1 86  ? 13.832  -17.198 69.639  1.00 16.38 ? 88   TYR A CZ  1 
ATOM   625  O  OH  . TYR A 1 86  ? 13.470  -17.890 70.771  1.00 16.39 ? 88   TYR A OH  1 
ATOM   626  N  N   . ARG A 1 87  ? 17.474  -14.443 64.380  1.00 19.06 ? 89   ARG A N   1 
ATOM   627  C  CA  . ARG A 1 87  ? 17.858  -14.100 63.011  1.00 20.40 ? 89   ARG A CA  1 
ATOM   628  C  C   . ARG A 1 87  ? 17.142  -15.021 62.035  1.00 17.94 ? 89   ARG A C   1 
ATOM   629  O  O   . ARG A 1 87  ? 17.091  -16.231 62.253  1.00 17.09 ? 89   ARG A O   1 
ATOM   630  C  CB  . ARG A 1 87  ? 19.354  -14.298 62.789  1.00 26.09 ? 89   ARG A CB  1 
ATOM   631  C  CG  . ARG A 1 87  ? 20.230  -13.480 63.696  1.00 32.49 ? 89   ARG A CG  1 
ATOM   632  C  CD  . ARG A 1 87  ? 21.699  -13.847 63.526  1.00 38.60 ? 89   ARG A CD  1 
ATOM   633  N  NE  . ARG A 1 87  ? 22.472  -13.536 64.742  1.00 43.35 ? 89   ARG A NE  1 
ATOM   634  C  CZ  . ARG A 1 87  ? 22.754  -12.307 65.179  1.00 43.04 ? 89   ARG A CZ  1 
ATOM   635  N  NH1 . ARG A 1 87  ? 22.345  -11.221 64.515  1.00 43.91 ? 89   ARG A NH1 1 
ATOM   636  N  NH2 . ARG A 1 87  ? 23.477  -12.163 66.285  1.00 45.38 ? 89   ARG A NH2 1 
ATOM   637  N  N   . ALA A 1 88  ? 16.610  -14.462 60.962  1.00 17.53 ? 90   ALA A N   1 
ATOM   638  C  CA  . ALA A 1 88  ? 15.876  -15.236 59.985  1.00 17.78 ? 90   ALA A CA  1 
ATOM   639  C  C   . ALA A 1 88  ? 16.865  -16.030 59.115  1.00 18.90 ? 90   ALA A C   1 
ATOM   640  O  O   . ALA A 1 88  ? 17.922  -15.508 58.735  1.00 19.06 ? 90   ALA A O   1 
ATOM   641  C  CB  . ALA A 1 88  ? 15.020  -14.340 59.128  1.00 18.75 ? 90   ALA A CB  1 
ATOM   642  N  N   . LEU A 1 89  ? 16.519  -17.284 58.851  1.00 18.62 ? 91   LEU A N   1 
ATOM   643  C  CA  . LEU A 1 89  ? 17.328  -18.195 58.015  1.00 19.11 ? 91   LEU A CA  1 
ATOM   644  C  C   . LEU A 1 89  ? 16.718  -18.428 56.652  1.00 17.77 ? 91   LEU A C   1 
ATOM   645  O  O   . LEU A 1 89  ? 17.428  -18.454 55.643  1.00 17.47 ? 91   LEU A O   1 
ATOM   646  C  CB  . LEU A 1 89  ? 17.458  -19.550 58.687  1.00 20.41 ? 91   LEU A CB  1 
ATOM   647  C  CG  . LEU A 1 89  ? 18.010  -19.579 60.108  1.00 23.21 ? 91   LEU A CG  1 
ATOM   648  C  CD1 . LEU A 1 89  ? 17.764  -20.948 60.723  1.00 23.85 ? 91   LEU A CD1 1 
ATOM   649  C  CD2 . LEU A 1 89  ? 19.482  -19.192 60.137  1.00 24.17 ? 91   LEU A CD2 1 
ATOM   650  N  N   . GLN A 1 90  ? 15.409  -18.649 56.614  1.00 15.73 ? 92   GLN A N   1 
ATOM   651  C  CA  . GLN A 1 90  ? 14.755  -19.086 55.386  1.00 15.72 ? 92   GLN A CA  1 
ATOM   652  C  C   . GLN A 1 90  ? 13.279  -19.022 55.569  1.00 15.93 ? 92   GLN A C   1 
ATOM   653  O  O   . GLN A 1 90  ? 12.799  -18.939 56.733  1.00 16.89 ? 92   GLN A O   1 
ATOM   654  C  CB  . GLN A 1 90  ? 15.150  -20.531 55.012  1.00 16.01 ? 92   GLN A CB  1 
ATOM   655  C  CG  . GLN A 1 90  ? 14.952  -21.571 56.119  1.00 15.86 ? 92   GLN A CG  1 
ATOM   656  C  CD  . GLN A 1 90  ? 13.706  -22.443 55.958  1.00 16.87 ? 92   GLN A CD  1 
ATOM   657  O  OE1 . GLN A 1 90  ? 12.743  -22.076 55.281  1.00 15.96 ? 92   GLN A OE1 1 
ATOM   658  N  NE2 . GLN A 1 90  ? 13.728  -23.636 56.601  1.00 18.32 ? 92   GLN A NE2 1 
ATOM   659  N  N   . LEU A 1 91  ? 12.565  -19.052 54.454  1.00 15.74 ? 93   LEU A N   1 
ATOM   660  C  CA  . LEU A 1 91  ? 11.110  -19.203 54.467  1.00 15.91 ? 93   LEU A CA  1 
ATOM   661  C  C   . LEU A 1 91  ? 10.692  -20.214 53.413  1.00 16.88 ? 93   LEU A C   1 
ATOM   662  O  O   . LEU A 1 91  ? 11.412  -20.458 52.413  1.00 16.38 ? 93   LEU A O   1 
ATOM   663  C  CB  . LEU A 1 91  ? 10.417  -17.834 54.276  1.00 15.61 ? 93   LEU A CB  1 
ATOM   664  C  CG  . LEU A 1 91  ? 10.582  -17.050 52.968  1.00 15.02 ? 93   LEU A CG  1 
ATOM   665  C  CD1 . LEU A 1 91  ? 9.657   -17.522 51.861  1.00 14.57 ? 93   LEU A CD1 1 
ATOM   666  C  CD2 . LEU A 1 91  ? 10.369  -15.541 53.226  1.00 15.10 ? 93   LEU A CD2 1 
ATOM   667  N  N   . HIS A 1 92  ? 9.545   -20.846 53.646  1.00 16.36 ? 94   HIS A N   1 
ATOM   668  C  CA  . HIS A 1 92  ? 9.000   -21.792 52.705  1.00 16.35 ? 94   HIS A CA  1 
ATOM   669  C  C   . HIS A 1 92  ? 7.496   -21.918 52.885  1.00 16.65 ? 94   HIS A C   1 
ATOM   670  O  O   . HIS A 1 92  ? 6.923   -21.327 53.818  1.00 16.58 ? 94   HIS A O   1 
ATOM   671  C  CB  . HIS A 1 92  ? 9.701   -23.149 52.917  1.00 17.00 ? 94   HIS A CB  1 
ATOM   672  C  CG  . HIS A 1 92  ? 9.453   -23.704 54.267  1.00 15.98 ? 94   HIS A CG  1 
ATOM   673  N  ND1 . HIS A 1 92  ? 10.254  -23.401 55.347  1.00 15.65 ? 94   HIS A ND1 1 
ATOM   674  C  CD2 . HIS A 1 92  ? 8.389   -24.375 54.760  1.00 15.93 ? 94   HIS A CD2 1 
ATOM   675  C  CE1 . HIS A 1 92  ? 9.734   -23.921 56.436  1.00 15.54 ? 94   HIS A CE1 1 
ATOM   676  N  NE2 . HIS A 1 92  ? 8.612   -24.531 56.100  1.00 16.58 ? 94   HIS A NE2 1 
ATOM   677  N  N   . LEU A 1 93  ? 6.882   -22.714 52.029  1.00 17.58 ? 95   LEU A N   1 
ATOM   678  C  CA  . LEU A 1 93  ? 5.444   -22.801 51.938  1.00 19.63 ? 95   LEU A CA  1 
ATOM   679  C  C   . LEU A 1 93  ? 4.902   -24.236 52.072  1.00 19.23 ? 95   LEU A C   1 
ATOM   680  O  O   . LEU A 1 93  ? 5.593   -25.220 51.758  1.00 18.82 ? 95   LEU A O   1 
ATOM   681  C  CB  . LEU A 1 93  ? 4.965   -22.169 50.618  1.00 19.50 ? 95   LEU A CB  1 
ATOM   682  C  CG  . LEU A 1 93  ? 5.433   -20.728 50.357  1.00 20.89 ? 95   LEU A CG  1 
ATOM   683  C  CD1 . LEU A 1 93  ? 5.075   -20.276 48.959  1.00 21.98 ? 95   LEU A CD1 1 
ATOM   684  C  CD2 . LEU A 1 93  ? 4.835   -19.783 51.371  1.00 22.52 ? 95   LEU A CD2 1 
ATOM   685  N  N   . HIS A 1 94  ? 3.673   -24.339 52.581  1.00 17.99 ? 96   HIS A N   1 
ATOM   686  C  CA  . HIS A 1 94  ? 2.917   -25.591 52.565  1.00 18.75 ? 96   HIS A CA  1 
ATOM   687  C  C   . HIS A 1 94  ? 1.555   -25.311 51.926  1.00 19.39 ? 96   HIS A C   1 
ATOM   688  O  O   . HIS A 1 94  ? 0.932   -24.297 52.220  1.00 18.50 ? 96   HIS A O   1 
ATOM   689  C  CB  . HIS A 1 94  ? 2.710   -26.140 53.985  1.00 17.97 ? 96   HIS A CB  1 
ATOM   690  C  CG  . HIS A 1 94  ? 3.973   -26.345 54.759  1.00 17.39 ? 96   HIS A CG  1 
ATOM   691  N  ND1 . HIS A 1 94  ? 4.600   -27.569 54.844  1.00 17.25 ? 96   HIS A ND1 1 
ATOM   692  C  CD2 . HIS A 1 94  ? 4.731   -25.486 55.476  1.00 17.85 ? 96   HIS A CD2 1 
ATOM   693  C  CE1 . HIS A 1 94  ? 5.684   -27.456 55.583  1.00 17.12 ? 96   HIS A CE1 1 
ATOM   694  N  NE2 . HIS A 1 94  ? 5.779   -26.206 55.991  1.00 16.01 ? 96   HIS A NE2 1 
ATOM   695  N  N   . TRP A 1 95  ? 1.096   -26.232 51.095  1.00 20.93 ? 97   TRP A N   1 
ATOM   696  C  CA  . TRP A 1 95  ? -0.079  -26.012 50.280  1.00 20.55 ? 97   TRP A CA  1 
ATOM   697  C  C   . TRP A 1 95  ? -0.787  -27.316 49.969  1.00 21.57 ? 97   TRP A C   1 
ATOM   698  O  O   . TRP A 1 95  ? -0.308  -28.399 50.301  1.00 22.72 ? 97   TRP A O   1 
ATOM   699  C  CB  . TRP A 1 95  ? 0.323   -25.297 48.995  1.00 19.94 ? 97   TRP A CB  1 
ATOM   700  C  CG  . TRP A 1 95  ? 1.287   -26.064 48.110  1.00 19.71 ? 97   TRP A CG  1 
ATOM   701  C  CD1 . TRP A 1 95  ? 0.972   -26.979 47.164  1.00 21.04 ? 97   TRP A CD1 1 
ATOM   702  C  CD2 . TRP A 1 95  ? 2.724   -25.913 48.059  1.00 20.19 ? 97   TRP A CD2 1 
ATOM   703  N  NE1 . TRP A 1 95  ? 2.125   -27.438 46.528  1.00 21.02 ? 97   TRP A NE1 1 
ATOM   704  C  CE2 . TRP A 1 95  ? 3.208   -26.799 47.070  1.00 20.27 ? 97   TRP A CE2 1 
ATOM   705  C  CE3 . TRP A 1 95  ? 3.643   -25.138 48.772  1.00 19.72 ? 97   TRP A CE3 1 
ATOM   706  C  CZ2 . TRP A 1 95  ? 4.566   -26.907 46.761  1.00 20.48 ? 97   TRP A CZ2 1 
ATOM   707  C  CZ3 . TRP A 1 95  ? 5.002   -25.259 48.461  1.00 19.28 ? 97   TRP A CZ3 1 
ATOM   708  C  CH2 . TRP A 1 95  ? 5.445   -26.143 47.480  1.00 19.75 ? 97   TRP A CH2 1 
ATOM   709  N  N   . GLY A 1 96  ? -1.948  -27.208 49.336  1.00 24.80 ? 98   GLY A N   1 
ATOM   710  C  CA  . GLY A 1 96  ? -2.790  -28.379 49.078  1.00 25.57 ? 98   GLY A CA  1 
ATOM   711  C  C   . GLY A 1 96  ? -2.772  -28.798 47.620  1.00 29.22 ? 98   GLY A C   1 
ATOM   712  O  O   . GLY A 1 96  ? -1.720  -29.172 47.068  1.00 26.78 ? 98   GLY A O   1 
ATOM   713  N  N   . ALA A 1 97  ? -3.948  -28.764 47.002  1.00 29.21 ? 99   ALA A N   1 
ATOM   714  C  CA  . ALA A 1 97  ? -4.118  -29.128 45.598  1.00 31.75 ? 99   ALA A CA  1 
ATOM   715  C  C   . ALA A 1 97  ? -5.476  -28.594 45.112  1.00 34.41 ? 99   ALA A C   1 
ATOM   716  O  O   . ALA A 1 97  ? -6.199  -27.947 45.885  1.00 35.41 ? 99   ALA A O   1 
ATOM   717  C  CB  . ALA A 1 97  ? -4.024  -30.642 45.434  1.00 31.22 ? 99   ALA A CB  1 
ATOM   718  N  N   . ALA A 1 98  ? -5.818  -28.824 43.847  1.00 36.05 ? 100  ALA A N   1 
ATOM   719  C  CA  . ALA A 1 98  ? -7.085  -28.305 43.283  1.00 37.74 ? 100  ALA A CA  1 
ATOM   720  C  C   . ALA A 1 98  ? -8.273  -28.598 44.209  1.00 38.33 ? 100  ALA A C   1 
ATOM   721  O  O   . ALA A 1 98  ? -8.564  -29.761 44.515  1.00 38.48 ? 100  ALA A O   1 
ATOM   722  C  CB  . ALA A 1 98  ? -7.333  -28.901 41.907  1.00 39.76 ? 100  ALA A CB  1 
ATOM   723  N  N   . GLY A 1 99  ? -8.901  -27.536 44.709  1.00 38.03 ? 101  GLY A N   1 
ATOM   724  C  CA  . GLY A 1 99  ? -10.010 -27.644 45.653  1.00 40.71 ? 101  GLY A CA  1 
ATOM   725  C  C   . GLY A 1 99  ? -9.722  -28.416 46.933  1.00 42.11 ? 101  GLY A C   1 
ATOM   726  O  O   . GLY A 1 99  ? -10.630 -29.030 47.489  1.00 43.28 ? 101  GLY A O   1 
ATOM   727  N  N   . ARG A 1 100 ? -8.465  -28.413 47.391  1.00 38.11 ? 102  ARG A N   1 
ATOM   728  C  CA  . ARG A 1 100 ? -8.094  -29.053 48.661  1.00 36.94 ? 102  ARG A CA  1 
ATOM   729  C  C   . ARG A 1 100 ? -7.106  -28.132 49.376  1.00 33.91 ? 102  ARG A C   1 
ATOM   730  O  O   . ARG A 1 100 ? -6.045  -27.815 48.829  1.00 33.12 ? 102  ARG A O   1 
ATOM   731  C  CB  . ARG A 1 100 ? -7.486  -30.430 48.448  1.00 38.24 ? 102  ARG A CB  1 
ATOM   732  C  CG  . ARG A 1 100 ? -8.468  -31.461 47.898  1.00 42.75 ? 102  ARG A CG  1 
ATOM   733  C  CD  . ARG A 1 100 ? -7.785  -32.755 47.496  1.00 45.55 ? 102  ARG A CD  1 
ATOM   734  N  NE  . ARG A 1 100 ? -7.396  -33.552 48.662  1.00 51.33 ? 102  ARG A NE  1 
ATOM   735  C  CZ  . ARG A 1 100 ? -6.825  -34.760 48.614  1.00 53.90 ? 102  ARG A CZ  1 
ATOM   736  N  NH1 . ARG A 1 100 ? -6.552  -35.351 47.444  1.00 55.46 ? 102  ARG A NH1 1 
ATOM   737  N  NH2 . ARG A 1 100 ? -6.518  -35.388 49.750  1.00 55.07 ? 102  ARG A NH2 1 
ATOM   738  N  N   . PRO A 1 101 ? -7.455  -27.681 50.581  1.00 31.26 ? 103  PRO A N   1 
ATOM   739  C  CA  . PRO A 1 101 ? -6.547  -26.787 51.295  1.00 30.20 ? 103  PRO A CA  1 
ATOM   740  C  C   . PRO A 1 101 ? -5.342  -27.553 51.845  1.00 28.30 ? 103  PRO A C   1 
ATOM   741  O  O   . PRO A 1 101 ? -5.393  -28.774 51.977  1.00 28.63 ? 103  PRO A O   1 
ATOM   742  C  CB  . PRO A 1 101 ? -7.417  -26.236 52.416  1.00 30.63 ? 103  PRO A CB  1 
ATOM   743  C  CG  . PRO A 1 101 ? -8.423  -27.298 52.675  1.00 30.75 ? 103  PRO A CG  1 
ATOM   744  C  CD  . PRO A 1 101 ? -8.679  -27.969 51.359  1.00 31.98 ? 103  PRO A CD  1 
ATOM   745  N  N   . GLY A 1 102 ? -4.267  -26.842 52.140  1.00 25.12 ? 104  GLY A N   1 
ATOM   746  C  CA  . GLY A 1 102 ? -3.058  -27.491 52.635  1.00 24.16 ? 104  GLY A CA  1 
ATOM   747  C  C   . GLY A 1 102 ? -2.262  -26.721 53.649  1.00 22.64 ? 104  GLY A C   1 
ATOM   748  O  O   . GLY A 1 102 ? -1.059  -26.959 53.755  1.00 23.35 ? 104  GLY A O   1 
ATOM   749  N  N   . SER A 1 103 ? -2.900  -25.855 54.442  1.00 21.60 ? 105  SER A N   1 
ATOM   750  C  CA  . SER A 1 103 ? -2.217  -25.283 55.606  1.00 21.09 ? 105  SER A CA  1 
ATOM   751  C  C   . SER A 1 103 ? -1.845  -26.400 56.600  1.00 22.42 ? 105  SER A C   1 
ATOM   752  O  O   . SER A 1 103 ? -2.440  -27.479 56.573  1.00 22.86 ? 105  SER A O   1 
ATOM   753  C  CB  . SER A 1 103 ? -2.991  -24.159 56.275  1.00 22.17 ? 105  SER A CB  1 
ATOM   754  O  OG  . SER A 1 103 ? -4.076  -24.606 57.055  1.00 23.21 ? 105  SER A OG  1 
ATOM   755  N  N   . GLU A 1 104 ? -0.813  -26.152 57.404  1.00 20.76 ? 106  GLU A N   1 
ATOM   756  C  CA  . GLU A 1 104 ? -0.365  -27.103 58.430  1.00 20.57 ? 106  GLU A CA  1 
ATOM   757  C  C   . GLU A 1 104 ? -1.204  -26.927 59.685  1.00 21.68 ? 106  GLU A C   1 
ATOM   758  O  O   . GLU A 1 104 ? -1.800  -27.896 60.188  1.00 22.87 ? 106  GLU A O   1 
ATOM   759  C  CB  . GLU A 1 104 ? 1.104   -26.866 58.758  1.00 20.16 ? 106  GLU A CB  1 
ATOM   760  C  CG  . GLU A 1 104 ? 2.000   -27.124 57.564  1.00 19.65 ? 106  GLU A CG  1 
ATOM   761  C  CD  . GLU A 1 104 ? 3.191   -27.945 57.946  1.00 21.06 ? 106  GLU A CD  1 
ATOM   762  O  OE1 . GLU A 1 104 ? 4.150   -27.381 58.496  1.00 19.44 ? 106  GLU A OE1 1 
ATOM   763  O  OE2 . GLU A 1 104 ? 3.124   -29.163 57.741  1.00 23.20 ? 106  GLU A OE2 1 
ATOM   764  N  N   . HIS A 1 105 ? -1.209  -25.707 60.203  1.00 20.93 ? 107  HIS A N   1 
ATOM   765  C  CA  . HIS A 1 105 ? -2.059  -25.353 61.325  1.00 23.22 ? 107  HIS A CA  1 
ATOM   766  C  C   . HIS A 1 105 ? -3.505  -25.265 60.846  1.00 25.03 ? 107  HIS A C   1 
ATOM   767  O  O   . HIS A 1 105 ? -3.764  -24.995 59.658  1.00 22.68 ? 107  HIS A O   1 
ATOM   768  C  CB  . HIS A 1 105 ? -1.599  -24.066 61.966  1.00 23.13 ? 107  HIS A CB  1 
ATOM   769  C  CG  . HIS A 1 105 ? -0.318  -24.229 62.723  1.00 24.59 ? 107  HIS A CG  1 
ATOM   770  N  ND1 . HIS A 1 105 ? 0.915   -24.120 62.121  1.00 23.68 ? 107  HIS A ND1 1 
ATOM   771  C  CD2 . HIS A 1 105 ? -0.080  -24.585 64.009  1.00 25.32 ? 107  HIS A CD2 1 
ATOM   772  C  CE1 . HIS A 1 105 ? 1.860   -24.363 63.013  1.00 24.68 ? 107  HIS A CE1 1 
ATOM   773  N  NE2 . HIS A 1 105 ? 1.285   -24.644 64.167  1.00 25.71 ? 107  HIS A NE2 1 
ATOM   774  N  N   . THR A 1 106 ? -4.425  -25.585 61.752  1.00 25.08 ? 108  THR A N   1 
ATOM   775  C  CA  . THR A 1 106 ? -5.858  -25.395 61.517  1.00 26.05 ? 108  THR A CA  1 
ATOM   776  C  C   . THR A 1 106 ? -6.413  -24.516 62.640  1.00 26.99 ? 108  THR A C   1 
ATOM   777  O  O   . THR A 1 106 ? -5.786  -24.362 63.707  1.00 29.24 ? 108  THR A O   1 
ATOM   778  C  CB  . THR A 1 106 ? -6.601  -26.751 61.407  1.00 27.42 ? 108  THR A CB  1 
ATOM   779  O  OG1 . THR A 1 106 ? -6.391  -27.533 62.592  1.00 27.02 ? 108  THR A OG1 1 
ATOM   780  C  CG2 . THR A 1 106 ? -6.097  -27.544 60.241  1.00 28.70 ? 108  THR A CG2 1 
ATOM   781  N  N   . VAL A 1 107 ? -7.572  -23.901 62.404  1.00 28.06 ? 109  VAL A N   1 
ATOM   782  C  CA  . VAL A 1 107 ? -8.264  -23.102 63.414  1.00 30.74 ? 109  VAL A CA  1 
ATOM   783  C  C   . VAL A 1 107 ? -9.691  -23.668 63.521  1.00 34.46 ? 109  VAL A C   1 
ATOM   784  O  O   . VAL A 1 107 ? -10.426 -23.688 62.530  1.00 31.42 ? 109  VAL A O   1 
ATOM   785  C  CB  . VAL A 1 107 ? -8.292  -21.598 63.065  1.00 31.25 ? 109  VAL A CB  1 
ATOM   786  C  CG1 . VAL A 1 107 ? -9.142  -20.806 64.062  1.00 31.74 ? 109  VAL A CG1 1 
ATOM   787  C  CG2 . VAL A 1 107 ? -6.876  -21.032 62.996  1.00 31.53 ? 109  VAL A CG2 1 
ATOM   788  N  N   . GLU A 1 108 ? -10.040 -24.184 64.703  1.00 36.90 ? 110  GLU A N   1 
ATOM   789  C  CA  . GLU A 1 108 ? -11.296 -24.912 64.930  1.00 36.76 ? 110  GLU A CA  1 
ATOM   790  C  C   . GLU A 1 108 ? -11.570 -25.925 63.821  1.00 35.50 ? 110  GLU A C   1 
ATOM   791  O  O   . GLU A 1 108 ? -12.689 -26.049 63.322  1.00 32.09 ? 110  GLU A O   1 
ATOM   792  C  CB  . GLU A 1 108 ? -12.467 -23.938 65.100  1.00 39.78 ? 110  GLU A CB  1 
ATOM   793  C  CG  . GLU A 1 108 ? -12.261 -22.902 66.199  1.00 43.29 ? 110  GLU A CG  1 
ATOM   794  C  CD  . GLU A 1 108 ? -13.413 -21.903 66.354  1.00 48.56 ? 110  GLU A CD  1 
ATOM   795  O  OE1 . GLU A 1 108 ? -14.426 -22.021 65.636  1.00 57.55 ? 110  GLU A OE1 1 
ATOM   796  O  OE2 . GLU A 1 108 ? -13.305 -20.978 67.192  1.00 49.88 ? 110  GLU A OE2 1 
ATOM   797  N  N   . GLY A 1 109 ? -10.530 -26.644 63.415  1.00 31.71 ? 111  GLY A N   1 
ATOM   798  C  CA  . GLY A 1 109 ? -10.644 -27.644 62.378  1.00 30.30 ? 111  GLY A CA  1 
ATOM   799  C  C   . GLY A 1 109 ? -10.584 -27.145 60.943  1.00 28.49 ? 111  GLY A C   1 
ATOM   800  O  O   . GLY A 1 109 ? -10.467 -27.963 60.036  1.00 32.68 ? 111  GLY A O   1 
ATOM   801  N  N   . HIS A 1 110 ? -10.679 -25.835 60.733  1.00 27.92 ? 112  HIS A N   1 
ATOM   802  C  CA  . HIS A 1 110 ? -10.611 -25.239 59.399  1.00 27.92 ? 112  HIS A CA  1 
ATOM   803  C  C   . HIS A 1 110 ? -9.170  -25.257 58.891  1.00 25.66 ? 112  HIS A C   1 
ATOM   804  O  O   . HIS A 1 110 ? -8.288  -24.705 59.532  1.00 25.33 ? 112  HIS A O   1 
ATOM   805  C  CB  . HIS A 1 110 ? -11.103 -23.793 59.426  1.00 29.24 ? 112  HIS A CB  1 
ATOM   806  C  CG  . HIS A 1 110 ? -11.112 -23.125 58.082  1.00 30.82 ? 112  HIS A CG  1 
ATOM   807  N  ND1 . HIS A 1 110 ? -11.978 -23.491 57.072  1.00 32.45 ? 112  HIS A ND1 1 
ATOM   808  C  CD2 . HIS A 1 110 ? -10.355 -22.117 57.581  1.00 31.14 ? 112  HIS A CD2 1 
ATOM   809  C  CE1 . HIS A 1 110 ? -11.754 -22.737 56.008  1.00 32.28 ? 112  HIS A CE1 1 
ATOM   810  N  NE2 . HIS A 1 110 ? -10.774 -21.896 56.289  1.00 31.66 ? 112  HIS A NE2 1 
ATOM   811  N  N   . ARG A 1 111 ? -8.959  -25.910 57.759  1.00 26.23 ? 113  ARG A N   1 
ATOM   812  C  CA  . ARG A 1 111 ? -7.674  -25.878 57.061  1.00 26.28 ? 113  ARG A CA  1 
ATOM   813  C  C   . ARG A 1 111 ? -7.713  -24.774 55.997  1.00 25.96 ? 113  ARG A C   1 
ATOM   814  O  O   . ARG A 1 111 ? -8.665  -24.690 55.219  1.00 22.46 ? 113  ARG A O   1 
ATOM   815  C  CB  . ARG A 1 111 ? -7.379  -27.218 56.429  1.00 27.72 ? 113  ARG A CB  1 
ATOM   816  C  CG  . ARG A 1 111 ? -5.912  -27.404 56.047  1.00 28.45 ? 113  ARG A CG  1 
ATOM   817  C  CD  . ARG A 1 111 ? -5.621  -28.776 55.475  1.00 29.92 ? 113  ARG A CD  1 
ATOM   818  N  NE  . ARG A 1 111 ? -5.854  -29.860 56.437  1.00 30.52 ? 113  ARG A NE  1 
ATOM   819  C  CZ  . ARG A 1 111 ? -5.063  -30.147 57.465  1.00 32.11 ? 113  ARG A CZ  1 
ATOM   820  N  NH1 . ARG A 1 111 ? -3.954  -29.444 57.703  1.00 32.40 ? 113  ARG A NH1 1 
ATOM   821  N  NH2 . ARG A 1 111 ? -5.373  -31.159 58.269  1.00 30.58 ? 113  ARG A NH2 1 
ATOM   822  N  N   . PHE A 1 112 ? -6.660  -23.958 55.954  1.00 24.49 ? 114  PHE A N   1 
ATOM   823  C  CA  . PHE A 1 112 ? -6.585  -22.815 55.041  1.00 23.82 ? 114  PHE A CA  1 
ATOM   824  C  C   . PHE A 1 112 ? -5.906  -23.252 53.750  1.00 22.84 ? 114  PHE A C   1 
ATOM   825  O  O   . PHE A 1 112 ? -5.240  -24.278 53.728  1.00 21.68 ? 114  PHE A O   1 
ATOM   826  C  CB  . PHE A 1 112 ? -5.848  -21.647 55.692  1.00 23.21 ? 114  PHE A CB  1 
ATOM   827  C  CG  . PHE A 1 112 ? -6.554  -21.080 56.896  1.00 25.27 ? 114  PHE A CG  1 
ATOM   828  C  CD1 . PHE A 1 112 ? -6.505  -21.733 58.138  1.00 24.61 ? 114  PHE A CD1 1 
ATOM   829  C  CD2 . PHE A 1 112 ? -7.247  -19.875 56.799  1.00 25.76 ? 114  PHE A CD2 1 
ATOM   830  C  CE1 . PHE A 1 112 ? -7.155  -21.190 59.245  1.00 25.63 ? 114  PHE A CE1 1 
ATOM   831  C  CE2 . PHE A 1 112 ? -7.896  -19.332 57.900  1.00 26.63 ? 114  PHE A CE2 1 
ATOM   832  C  CZ  . PHE A 1 112 ? -7.843  -19.993 59.128  1.00 26.99 ? 114  PHE A CZ  1 
ATOM   833  N  N   . PRO A 1 113 ? -6.089  -22.493 52.652  1.00 22.52 ? 115  PRO A N   1 
ATOM   834  C  CA  . PRO A 1 113 ? -5.469  -22.925 51.391  1.00 21.74 ? 115  PRO A CA  1 
ATOM   835  C  C   . PRO A 1 113 ? -3.960  -23.229 51.488  1.00 20.70 ? 115  PRO A C   1 
ATOM   836  O  O   . PRO A 1 113 ? -3.519  -24.285 51.009  1.00 21.54 ? 115  PRO A O   1 
ATOM   837  C  CB  . PRO A 1 113 ? -5.758  -21.747 50.432  1.00 21.56 ? 115  PRO A CB  1 
ATOM   838  C  CG  . PRO A 1 113 ? -7.049  -21.174 50.949  1.00 23.02 ? 115  PRO A CG  1 
ATOM   839  C  CD  . PRO A 1 113 ? -6.968  -21.312 52.455  1.00 22.98 ? 115  PRO A CD  1 
ATOM   840  N  N   . ALA A 1 114 ? -3.205  -22.341 52.128  1.00 20.24 ? 116  ALA A N   1 
ATOM   841  C  CA  . ALA A 1 114 ? -1.760  -22.530 52.254  1.00 20.88 ? 116  ALA A CA  1 
ATOM   842  C  C   . ALA A 1 114 ? -1.190  -21.814 53.459  1.00 19.94 ? 116  ALA A C   1 
ATOM   843  O  O   . ALA A 1 114 ? -1.907  -21.132 54.174  1.00 20.07 ? 116  ALA A O   1 
ATOM   844  C  CB  . ALA A 1 114 ? -1.063  -22.123 50.962  1.00 20.93 ? 116  ALA A CB  1 
ATOM   845  N  N   . GLU A 1 115 ? 0.101   -22.015 53.714  1.00 19.85 ? 117  GLU A N   1 
ATOM   846  C  CA  . GLU A 1 115 ? 0.748   -21.450 54.873  1.00 18.55 ? 117  GLU A CA  1 
ATOM   847  C  C   . GLU A 1 115 ? 2.211   -21.124 54.579  1.00 18.55 ? 117  GLU A C   1 
ATOM   848  O  O   . GLU A 1 115 ? 2.909   -21.888 53.926  1.00 19.00 ? 117  GLU A O   1 
ATOM   849  C  CB  . GLU A 1 115 ? 0.624   -22.448 56.046  1.00 19.44 ? 117  GLU A CB  1 
ATOM   850  C  CG  . GLU A 1 115 ? 1.095   -21.955 57.407  1.00 19.64 ? 117  GLU A CG  1 
ATOM   851  C  CD  . GLU A 1 115 ? 0.697   -22.881 58.579  1.00 21.35 ? 117  GLU A CD  1 
ATOM   852  O  OE1 . GLU A 1 115 ? -0.371  -23.542 58.483  1.00 20.78 ? 117  GLU A OE1 1 
ATOM   853  O  OE2 . GLU A 1 115 ? 1.436   -22.898 59.612  1.00 18.54 ? 117  GLU A OE2 1 
ATOM   854  N  N   . ILE A 1 116 ? 2.649   -19.983 55.087  1.00 18.40 ? 118  ILE A N   1 
ATOM   855  C  CA  . ILE A 1 116 ? 4.035   -19.573 55.035  1.00 17.55 ? 118  ILE A CA  1 
ATOM   856  C  C   . ILE A 1 116 ? 4.680   -19.753 56.406  1.00 17.46 ? 118  ILE A C   1 
ATOM   857  O  O   . ILE A 1 116 ? 4.088   -19.411 57.435  1.00 17.44 ? 118  ILE A O   1 
ATOM   858  C  CB  . ILE A 1 116 ? 4.232   -18.128 54.506  1.00 17.74 ? 118  ILE A CB  1 
ATOM   859  C  CG1 . ILE A 1 116 ? 5.720   -17.791 54.459  1.00 18.78 ? 118  ILE A CG1 1 
ATOM   860  C  CG2 . ILE A 1 116 ? 3.532   -17.062 55.364  1.00 18.50 ? 118  ILE A CG2 1 
ATOM   861  C  CD1 . ILE A 1 116 ? 6.019   -16.519 53.680  1.00 20.00 ? 118  ILE A CD1 1 
ATOM   862  N  N   . HIS A 1 117 ? 5.906   -20.266 56.390  1.00 16.68 ? 119  HIS A N   1 
ATOM   863  C  CA  . HIS A 1 117 ? 6.766   -20.330 57.571  1.00 16.66 ? 119  HIS A CA  1 
ATOM   864  C  C   . HIS A 1 117 ? 8.064   -19.599 57.353  1.00 15.71 ? 119  HIS A C   1 
ATOM   865  O  O   . HIS A 1 117 ? 8.757   -19.896 56.389  1.00 15.28 ? 119  HIS A O   1 
ATOM   866  C  CB  . HIS A 1 117 ? 7.115   -21.766 57.880  1.00 15.70 ? 119  HIS A CB  1 
ATOM   867  C  CG  . HIS A 1 117 ? 5.957   -22.577 58.305  1.00 16.51 ? 119  HIS A CG  1 
ATOM   868  N  ND1 . HIS A 1 117 ? 5.961   -23.944 58.239  1.00 16.62 ? 119  HIS A ND1 1 
ATOM   869  C  CD2 . HIS A 1 117 ? 4.747   -22.223 58.804  1.00 16.91 ? 119  HIS A CD2 1 
ATOM   870  C  CE1 . HIS A 1 117 ? 4.796   -24.407 58.656  1.00 17.39 ? 119  HIS A CE1 1 
ATOM   871  N  NE2 . HIS A 1 117 ? 4.050   -23.380 59.026  1.00 16.50 ? 119  HIS A NE2 1 
ATOM   872  N  N   . VAL A 1 118 ? 8.407   -18.698 58.259  1.00 15.33 ? 120  VAL A N   1 
ATOM   873  C  CA  . VAL A 1 118 ? 9.685   -17.989 58.239  1.00 16.06 ? 120  VAL A CA  1 
ATOM   874  C  C   . VAL A 1 118 ? 10.445  -18.470 59.476  1.00 15.46 ? 120  VAL A C   1 
ATOM   875  O  O   . VAL A 1 118 ? 10.056  -18.205 60.622  1.00 15.36 ? 120  VAL A O   1 
ATOM   876  C  CB  . VAL A 1 118 ? 9.504   -16.462 58.269  1.00 17.20 ? 120  VAL A CB  1 
ATOM   877  C  CG1 . VAL A 1 118 ? 10.852  -15.771 58.156  1.00 16.77 ? 120  VAL A CG1 1 
ATOM   878  C  CG2 . VAL A 1 118 ? 8.569   -16.005 57.150  1.00 18.13 ? 120  VAL A CG2 1 
ATOM   879  N  N   . VAL A 1 119 ? 11.548  -19.177 59.233  1.00 15.03 ? 121  VAL A N   1 
ATOM   880  C  CA  . VAL A 1 119 ? 12.278  -19.933 60.261  1.00 14.94 ? 121  VAL A CA  1 
ATOM   881  C  C   . VAL A 1 119 ? 13.450  -19.087 60.741  1.00 15.11 ? 121  VAL A C   1 
ATOM   882  O  O   . VAL A 1 119 ? 14.198  -18.544 59.900  1.00 15.95 ? 121  VAL A O   1 
ATOM   883  C  CB  . VAL A 1 119 ? 12.789  -21.268 59.658  1.00 15.39 ? 121  VAL A CB  1 
ATOM   884  C  CG1 . VAL A 1 119 ? 13.450  -22.145 60.719  1.00 16.90 ? 121  VAL A CG1 1 
ATOM   885  C  CG2 . VAL A 1 119 ? 11.630  -22.008 58.992  1.00 15.55 ? 121  VAL A CG2 1 
ATOM   886  N  N   . HIS A 1 120 ? 13.619  -19.009 62.055  1.00 13.51 ? 122  HIS A N   1 
ATOM   887  C  CA  . HIS A 1 120 ? 14.601  -18.182 62.712  1.00 14.12 ? 122  HIS A CA  1 
ATOM   888  C  C   . HIS A 1 120 ? 15.435  -18.966 63.730  1.00 15.62 ? 122  HIS A C   1 
ATOM   889  O  O   . HIS A 1 120 ? 14.965  -19.940 64.325  1.00 15.92 ? 122  HIS A O   1 
ATOM   890  C  CB  . HIS A 1 120 ? 13.930  -17.015 63.473  1.00 14.93 ? 122  HIS A CB  1 
ATOM   891  C  CG  . HIS A 1 120 ? 13.128  -16.068 62.626  1.00 14.34 ? 122  HIS A CG  1 
ATOM   892  N  ND1 . HIS A 1 120 ? 11.887  -16.380 62.113  1.00 15.86 ? 122  HIS A ND1 1 
ATOM   893  C  CD2 . HIS A 1 120 ? 13.373  -14.792 62.259  1.00 15.05 ? 122  HIS A CD2 1 
ATOM   894  C  CE1 . HIS A 1 120 ? 11.415  -15.335 61.453  1.00 14.88 ? 122  HIS A CE1 1 
ATOM   895  N  NE2 . HIS A 1 120 ? 12.302  -14.368 61.521  1.00 14.53 ? 122  HIS A NE2 1 
ATOM   896  N  N   . LEU A 1 121 ? 16.674  -18.506 63.908  1.00 16.10 ? 123  LEU A N   1 
ATOM   897  C  CA  . LEU A 1 121 ? 17.654  -19.046 64.833  1.00 17.63 ? 123  LEU A CA  1 
ATOM   898  C  C   . LEU A 1 121 ? 17.873  -18.051 65.959  1.00 17.36 ? 123  LEU A C   1 
ATOM   899  O  O   . LEU A 1 121 ? 18.176  -16.867 65.701  1.00 17.17 ? 123  LEU A O   1 
ATOM   900  C  CB  . LEU A 1 121 ? 18.993  -19.234 64.088  1.00 18.27 ? 123  LEU A CB  1 
ATOM   901  C  CG  . LEU A 1 121 ? 20.189  -19.799 64.850  1.00 18.18 ? 123  LEU A CG  1 
ATOM   902  C  CD1 . LEU A 1 121 ? 19.811  -21.124 65.479  1.00 18.47 ? 123  LEU A CD1 1 
ATOM   903  C  CD2 . LEU A 1 121 ? 21.404  -19.942 63.928  1.00 17.55 ? 123  LEU A CD2 1 
ATOM   904  N  N   . SER A 1 122 ? 17.751  -18.518 67.204  1.00 16.67 ? 124  SER A N   1 
ATOM   905  C  CA  . SER A 1 122 ? 18.126  -17.698 68.356  1.00 16.68 ? 124  SER A CA  1 
ATOM   906  C  C   . SER A 1 122 ? 19.551  -17.164 68.225  1.00 18.25 ? 124  SER A C   1 
ATOM   907  O  O   . SER A 1 122 ? 20.493  -17.904 67.822  1.00 16.32 ? 124  SER A O   1 
ATOM   908  C  CB  . SER A 1 122 ? 17.952  -18.442 69.692  1.00 16.26 ? 124  SER A CB  1 
ATOM   909  O  OG  . SER A 1 122 ? 18.684  -17.794 70.735  1.00 15.07 ? 124  SER A OG  1 
ATOM   910  N  N   . THR A 1 123 ? 19.705  -15.875 68.566  1.00 17.61 ? 125  THR A N   1 
ATOM   911  C  CA  . THR A 1 123 ? 21.012  -15.237 68.532  1.00 18.78 ? 125  THR A CA  1 
ATOM   912  C  C   . THR A 1 123 ? 22.004  -15.862 69.510  1.00 19.02 ? 125  THR A C   1 
ATOM   913  O  O   . THR A 1 123 ? 23.192  -15.572 69.427  1.00 19.42 ? 125  THR A O   1 
ATOM   914  C  CB  . THR A 1 123 ? 20.957  -13.704 68.741  1.00 19.14 ? 125  THR A CB  1 
ATOM   915  O  OG1 . THR A 1 123 ? 20.423  -13.403 70.019  1.00 20.04 ? 125  THR A OG1 1 
ATOM   916  C  CG2 . THR A 1 123 ? 20.145  -13.037 67.615  1.00 20.26 ? 125  THR A CG2 1 
ATOM   917  N  N   . ALA A 1 124 ? 21.543  -16.733 70.422  1.00 18.67 ? 126  ALA A N   1 
ATOM   918  C  CA  . ALA A 1 124 ? 22.460  -17.408 71.339  1.00 19.43 ? 126  ALA A CA  1 
ATOM   919  C  C   . ALA A 1 124 ? 23.230  -18.570 70.669  1.00 19.56 ? 126  ALA A C   1 
ATOM   920  O  O   . ALA A 1 124 ? 24.181  -19.065 71.257  1.00 20.96 ? 126  ALA A O   1 
ATOM   921  C  CB  . ALA A 1 124 ? 21.724  -17.923 72.553  1.00 20.25 ? 126  ALA A CB  1 
ATOM   922  N  N   . PHE A 1 125 ? 22.802  -18.992 69.481  1.00 18.72 ? 127  PHE A N   1 
ATOM   923  C  CA  . PHE A 1 125 ? 23.399  -20.124 68.755  1.00 20.23 ? 127  PHE A CA  1 
ATOM   924  C  C   . PHE A 1 125 ? 23.953  -19.675 67.417  1.00 22.21 ? 127  PHE A C   1 
ATOM   925  O  O   . PHE A 1 125 ? 23.313  -18.882 66.706  1.00 21.37 ? 127  PHE A O   1 
ATOM   926  C  CB  . PHE A 1 125 ? 22.339  -21.202 68.513  1.00 19.59 ? 127  PHE A CB  1 
ATOM   927  C  CG  . PHE A 1 125 ? 21.761  -21.770 69.771  1.00 18.75 ? 127  PHE A CG  1 
ATOM   928  C  CD1 . PHE A 1 125 ? 22.438  -22.733 70.491  1.00 19.53 ? 127  PHE A CD1 1 
ATOM   929  C  CD2 . PHE A 1 125 ? 20.548  -21.291 70.275  1.00 19.43 ? 127  PHE A CD2 1 
ATOM   930  C  CE1 . PHE A 1 125 ? 21.926  -23.217 71.673  1.00 19.31 ? 127  PHE A CE1 1 
ATOM   931  C  CE2 . PHE A 1 125 ? 20.012  -21.801 71.451  1.00 19.91 ? 127  PHE A CE2 1 
ATOM   932  C  CZ  . PHE A 1 125 ? 20.692  -22.764 72.152  1.00 19.71 ? 127  PHE A CZ  1 
ATOM   933  N  N   . ALA A 1 126 ? 25.124  -20.201 67.053  1.00 22.39 ? 128  ALA A N   1 
ATOM   934  C  CA  . ALA A 1 126 ? 25.736  -19.894 65.768  1.00 24.77 ? 128  ALA A CA  1 
ATOM   935  C  C   . ALA A 1 126 ? 25.166  -20.761 64.652  1.00 24.88 ? 128  ALA A C   1 
ATOM   936  O  O   . ALA A 1 126 ? 25.199  -20.366 63.494  1.00 25.49 ? 128  ALA A O   1 
ATOM   937  C  CB  . ALA A 1 126 ? 27.237  -20.088 65.841  1.00 26.39 ? 128  ALA A CB  1 
ATOM   938  N  N   . ARG A 1 127 ? 24.675  -21.949 64.984  1.00 24.37 ? 129  ARG A N   1 
ATOM   939  C  CA  . ARG A 1 127 ? 24.220  -22.893 63.970  1.00 28.02 ? 129  ARG A CA  1 
ATOM   940  C  C   . ARG A 1 127 ? 22.941  -23.561 64.359  1.00 23.89 ? 129  ARG A C   1 
ATOM   941  O  O   . ARG A 1 127 ? 22.742  -23.837 65.528  1.00 22.65 ? 129  ARG A O   1 
ATOM   942  C  CB  . ARG A 1 127 ? 25.263  -23.999 63.784  1.00 31.82 ? 129  ARG A CB  1 
ATOM   943  C  CG  . ARG A 1 127 ? 26.608  -23.523 63.270  1.00 38.40 ? 129  ARG A CG  1 
ATOM   944  C  CD  . ARG A 1 127 ? 27.706  -24.469 63.734  1.00 43.54 ? 129  ARG A CD  1 
ATOM   945  N  NE  . ARG A 1 127 ? 27.504  -25.815 63.196  1.00 47.87 ? 129  ARG A NE  1 
ATOM   946  C  CZ  . ARG A 1 127 ? 27.954  -26.945 63.744  1.00 57.50 ? 129  ARG A CZ  1 
ATOM   947  N  NH1 . ARG A 1 127 ? 28.622  -26.949 64.902  1.00 62.49 ? 129  ARG A NH1 1 
ATOM   948  N  NH2 . ARG A 1 127 ? 27.701  -28.103 63.136  1.00 58.59 ? 129  ARG A NH2 1 
ATOM   949  N  N   . VAL A 1 128 ? 22.119  -23.886 63.362  1.00 24.66 ? 130  VAL A N   1 
ATOM   950  C  CA  . VAL A 1 128 ? 20.846  -24.568 63.586  1.00 25.77 ? 130  VAL A CA  1 
ATOM   951  C  C   . VAL A 1 128 ? 21.015  -25.866 64.362  1.00 25.37 ? 130  VAL A C   1 
ATOM   952  O  O   . VAL A 1 128 ? 20.249  -26.148 65.281  1.00 22.52 ? 130  VAL A O   1 
ATOM   953  C  CB  . VAL A 1 128 ? 20.090  -24.864 62.281  1.00 27.29 ? 130  VAL A CB  1 
ATOM   954  C  CG1 . VAL A 1 128 ? 18.843  -25.707 62.560  1.00 29.80 ? 130  VAL A CG1 1 
ATOM   955  C  CG2 . VAL A 1 128 ? 19.684  -23.573 61.605  1.00 28.44 ? 130  VAL A CG2 1 
ATOM   956  N  N   . ASP A 1 129 ? 22.020  -26.657 64.020  1.00 24.70 ? 131  ASP A N   1 
ATOM   957  C  CA  . ASP A 1 129 ? 22.143  -27.976 64.670  1.00 27.94 ? 131  ASP A CA  1 
ATOM   958  C  C   . ASP A 1 129 ? 22.485  -27.873 66.142  1.00 24.46 ? 131  ASP A C   1 
ATOM   959  O  O   . ASP A 1 129 ? 22.183  -28.782 66.867  1.00 26.53 ? 131  ASP A O   1 
ATOM   960  C  CB  . ASP A 1 129 ? 23.126  -28.887 63.946  1.00 31.91 ? 131  ASP A CB  1 
ATOM   961  C  CG  . ASP A 1 129 ? 24.195  -28.119 63.310  1.00 39.83 ? 131  ASP A CG  1 
ATOM   962  O  OD1 . ASP A 1 129 ? 23.941  -27.571 62.186  1.00 48.37 ? 131  ASP A OD1 1 
ATOM   963  O  OD2 . ASP A 1 129 ? 25.212  -27.953 63.997  1.00 43.37 ? 131  ASP A OD2 1 
ATOM   964  N  N   . GLU A 1 130 ? 23.073  -26.769 66.593  1.00 23.62 ? 132  GLU A N   1 
ATOM   965  C  CA  . GLU A 1 130 ? 23.296  -26.562 68.017  1.00 25.88 ? 132  GLU A CA  1 
ATOM   966  C  C   . GLU A 1 130 ? 22.009  -26.094 68.737  1.00 23.50 ? 132  GLU A C   1 
ATOM   967  O  O   . GLU A 1 130 ? 21.842  -26.304 69.931  1.00 21.77 ? 132  GLU A O   1 
ATOM   968  C  CB  . GLU A 1 130 ? 24.365  -25.516 68.236  1.00 30.09 ? 132  GLU A CB  1 
ATOM   969  C  CG  . GLU A 1 130 ? 25.725  -25.832 67.636  1.00 34.82 ? 132  GLU A CG  1 
ATOM   970  C  CD  . GLU A 1 130 ? 26.613  -24.594 67.566  1.00 42.06 ? 132  GLU A CD  1 
ATOM   971  O  OE1 . GLU A 1 130 ? 26.114  -23.425 67.710  1.00 42.53 ? 132  GLU A OE1 1 
ATOM   972  O  OE2 . GLU A 1 130 ? 27.823  -24.808 67.371  1.00 49.01 ? 132  GLU A OE2 1 
ATOM   973  N  N   . ALA A 1 131 ? 21.132  -25.431 67.993  1.00 23.38 ? 133  ALA A N   1 
ATOM   974  C  CA  . ALA A 1 131 ? 19.860  -24.931 68.514  1.00 22.84 ? 133  ALA A CA  1 
ATOM   975  C  C   . ALA A 1 131 ? 18.788  -26.018 68.594  1.00 22.32 ? 133  ALA A C   1 
ATOM   976  O  O   . ALA A 1 131 ? 17.836  -25.880 69.375  1.00 20.32 ? 133  ALA A O   1 
ATOM   977  C  CB  . ALA A 1 131 ? 19.375  -23.793 67.644  1.00 22.12 ? 133  ALA A CB  1 
ATOM   978  N  N   . LEU A 1 132 ? 18.902  -27.063 67.773  1.00 21.98 ? 134  LEU A N   1 
ATOM   979  C  CA  . LEU A 1 132 ? 17.862  -28.110 67.686  1.00 23.14 ? 134  LEU A CA  1 
ATOM   980  C  C   . LEU A 1 132 ? 17.538  -28.738 69.011  1.00 22.67 ? 134  LEU A C   1 
ATOM   981  O  O   . LEU A 1 132 ? 18.433  -29.198 69.726  1.00 21.57 ? 134  LEU A O   1 
ATOM   982  C  CB  . LEU A 1 132 ? 18.284  -29.265 66.786  1.00 25.81 ? 134  LEU A CB  1 
ATOM   983  C  CG  . LEU A 1 132 ? 18.305  -29.051 65.287  1.00 28.22 ? 134  LEU A CG  1 
ATOM   984  C  CD1 . LEU A 1 132 ? 18.881  -30.331 64.689  1.00 30.41 ? 134  LEU A CD1 1 
ATOM   985  C  CD2 . LEU A 1 132 ? 16.919  -28.754 64.713  1.00 27.89 ? 134  LEU A CD2 1 
ATOM   986  N  N   . GLY A 1 133 ? 16.251  -28.771 69.346  1.00 20.70 ? 135  GLY A N   1 
ATOM   987  C  CA  . GLY A 1 133 ? 15.836  -29.332 70.614  1.00 20.72 ? 135  GLY A CA  1 
ATOM   988  C  C   . GLY A 1 133 ? 16.120  -28.495 71.846  1.00 20.40 ? 135  GLY A C   1 
ATOM   989  O  O   . GLY A 1 133 ? 15.727  -28.912 72.923  1.00 21.92 ? 135  GLY A O   1 
ATOM   990  N  N   . ARG A 1 134 ? 16.777  -27.327 71.731  1.00 19.24 ? 136  ARG A N   1 
ATOM   991  C  CA  . ARG A 1 134 ? 17.045  -26.494 72.892  1.00 20.35 ? 136  ARG A CA  1 
ATOM   992  C  C   . ARG A 1 134 ? 15.852  -25.532 73.038  1.00 20.80 ? 136  ARG A C   1 
ATOM   993  O  O   . ARG A 1 134 ? 15.298  -25.089 72.028  1.00 19.01 ? 136  ARG A O   1 
ATOM   994  C  CB  . ARG A 1 134 ? 18.344  -25.700 72.767  1.00 22.66 ? 136  ARG A CB  1 
ATOM   995  C  CG  . ARG A 1 134 ? 19.598  -26.441 73.213  1.00 26.47 ? 136  ARG A CG  1 
ATOM   996  C  CD  . ARG A 1 134 ? 19.938  -27.690 72.417  1.00 29.76 ? 136  ARG A CD  1 
ATOM   997  N  NE  . ARG A 1 134 ? 21.008  -28.381 73.128  1.00 33.19 ? 136  ARG A NE  1 
ATOM   998  C  CZ  . ARG A 1 134 ? 22.310  -28.100 73.076  1.00 38.46 ? 136  ARG A CZ  1 
ATOM   999  N  NH1 . ARG A 1 134 ? 22.804  -27.171 72.255  1.00 39.88 ? 136  ARG A NH1 1 
ATOM   1000 N  NH2 . ARG A 1 134 ? 23.153  -28.793 73.856  1.00 38.16 ? 136  ARG A NH2 1 
ATOM   1001 N  N   . PRO A 1 135 ? 15.471  -25.189 74.285  1.00 22.40 ? 137  PRO A N   1 
ATOM   1002 C  CA  . PRO A 1 135 ? 14.288  -24.346 74.505  1.00 21.89 ? 137  PRO A CA  1 
ATOM   1003 C  C   . PRO A 1 135 ? 14.383  -22.992 73.809  1.00 20.35 ? 137  PRO A C   1 
ATOM   1004 O  O   . PRO A 1 135 ? 15.291  -22.200 74.077  1.00 19.85 ? 137  PRO A O   1 
ATOM   1005 C  CB  . PRO A 1 135 ? 14.263  -24.126 76.024  1.00 23.37 ? 137  PRO A CB  1 
ATOM   1006 C  CG  . PRO A 1 135 ? 15.195  -25.087 76.591  1.00 22.96 ? 137  PRO A CG  1 
ATOM   1007 C  CD  . PRO A 1 135 ? 16.183  -25.474 75.541  1.00 22.64 ? 137  PRO A CD  1 
ATOM   1008 N  N   . GLY A 1 136 ? 13.444  -22.736 72.920  1.00 18.95 ? 138  GLY A N   1 
ATOM   1009 C  CA  . GLY A 1 136 ? 13.463  -21.461 72.180  1.00 18.64 ? 138  GLY A CA  1 
ATOM   1010 C  C   . GLY A 1 136 ? 14.630  -21.280 71.223  1.00 17.74 ? 138  GLY A C   1 
ATOM   1011 O  O   . GLY A 1 136 ? 14.872  -20.168 70.737  1.00 18.94 ? 138  GLY A O   1 
ATOM   1012 N  N   . GLY A 1 137 ? 15.348  -22.365 70.925  1.00 16.31 ? 139  GLY A N   1 
ATOM   1013 C  CA  . GLY A 1 137 ? 16.463  -22.301 70.001  1.00 16.87 ? 139  GLY A CA  1 
ATOM   1014 C  C   . GLY A 1 137 ? 16.084  -21.840 68.617  1.00 17.04 ? 139  GLY A C   1 
ATOM   1015 O  O   . GLY A 1 137 ? 16.845  -21.144 67.983  1.00 17.65 ? 139  GLY A O   1 
ATOM   1016 N  N   . LEU A 1 138 ? 14.936  -22.326 68.144  1.00 18.00 ? 140  LEU A N   1 
ATOM   1017 C  CA  . LEU A 1 138 ? 14.362  -21.987 66.864  1.00 18.81 ? 140  LEU A CA  1 
ATOM   1018 C  C   . LEU A 1 138 ? 12.977  -21.369 67.064  1.00 19.19 ? 140  LEU A C   1 
ATOM   1019 O  O   . LEU A 1 138 ? 12.236  -21.777 67.988  1.00 18.81 ? 140  LEU A O   1 
ATOM   1020 C  CB  . LEU A 1 138 ? 14.240  -23.237 66.012  1.00 19.86 ? 140  LEU A CB  1 
ATOM   1021 C  CG  . LEU A 1 138 ? 15.567  -23.927 65.682  1.00 19.82 ? 140  LEU A CG  1 
ATOM   1022 C  CD1 . LEU A 1 138 ? 15.269  -25.188 64.890  1.00 19.95 ? 140  LEU A CD1 1 
ATOM   1023 C  CD2 . LEU A 1 138 ? 16.492  -22.991 64.923  1.00 20.13 ? 140  LEU A CD2 1 
ATOM   1024 N  N   . ALA A 1 139 ? 12.669  -20.362 66.238  1.00 18.60 ? 141  ALA A N   1 
ATOM   1025 C  CA  . ALA A 1 139 ? 11.338  -19.735 66.239  1.00 18.41 ? 141  ALA A CA  1 
ATOM   1026 C  C   . ALA A 1 139 ? 10.817  -19.607 64.809  1.00 17.91 ? 141  ALA A C   1 
ATOM   1027 O  O   . ALA A 1 139 ? 11.558  -19.225 63.899  1.00 17.62 ? 141  ALA A O   1 
ATOM   1028 C  CB  . ALA A 1 139 ? 11.383  -18.390 66.934  1.00 18.11 ? 141  ALA A CB  1 
ATOM   1029 N  N   . VAL A 1 140 ? 9.557   -19.972 64.597  1.00 17.26 ? 142  VAL A N   1 
ATOM   1030 C  CA  . VAL A 1 140 ? 8.937   -19.933 63.287  1.00 16.90 ? 142  VAL A CA  1 
ATOM   1031 C  C   . VAL A 1 140 ? 7.757   -18.959 63.330  1.00 17.18 ? 142  VAL A C   1 
ATOM   1032 O  O   . VAL A 1 140 ? 6.931   -19.035 64.269  1.00 17.21 ? 142  VAL A O   1 
ATOM   1033 C  CB  . VAL A 1 140 ? 8.472   -21.321 62.808  1.00 17.41 ? 142  VAL A CB  1 
ATOM   1034 C  CG1 . VAL A 1 140 ? 7.896   -21.219 61.390  1.00 17.20 ? 142  VAL A CG1 1 
ATOM   1035 C  CG2 . VAL A 1 140 ? 9.623   -22.329 62.860  1.00 17.77 ? 142  VAL A CG2 1 
ATOM   1036 N  N   . LEU A 1 141 ? 7.721   -18.015 62.385  1.00 16.47 ? 143  LEU A N   1 
ATOM   1037 C  CA  . LEU A 1 141 ? 6.500   -17.189 62.148  1.00 18.10 ? 143  LEU A CA  1 
ATOM   1038 C  C   . LEU A 1 141 ? 5.670   -17.848 61.065  1.00 18.38 ? 143  LEU A C   1 
ATOM   1039 O  O   . LEU A 1 141 ? 6.195   -18.209 59.989  1.00 18.01 ? 143  LEU A O   1 
ATOM   1040 C  CB  . LEU A 1 141 ? 6.832   -15.753 61.743  1.00 18.04 ? 143  LEU A CB  1 
ATOM   1041 C  CG  . LEU A 1 141 ? 7.833   -14.983 62.586  1.00 18.72 ? 143  LEU A CG  1 
ATOM   1042 C  CD1 . LEU A 1 141 ? 7.951   -13.568 62.058  1.00 19.46 ? 143  LEU A CD1 1 
ATOM   1043 C  CD2 . LEU A 1 141 ? 7.473   -14.949 64.046  1.00 19.33 ? 143  LEU A CD2 1 
ATOM   1044 N  N   . ALA A 1 142 ? 4.371   -18.007 61.345  1.00 19.03 ? 144  ALA A N   1 
ATOM   1045 C  CA  . ALA A 1 142 ? 3.467   -18.694 60.458  1.00 19.39 ? 144  ALA A CA  1 
ATOM   1046 C  C   . ALA A 1 142 ? 2.270   -17.809 60.130  1.00 19.62 ? 144  ALA A C   1 
ATOM   1047 O  O   . ALA A 1 142 ? 1.719   -17.145 61.028  1.00 20.32 ? 144  ALA A O   1 
ATOM   1048 C  CB  . ALA A 1 142 ? 3.000   -20.002 61.066  1.00 19.08 ? 144  ALA A CB  1 
ATOM   1049 N  N   . ALA A 1 143 ? 1.888   -17.798 58.851  1.00 18.90 ? 145  ALA A N   1 
ATOM   1050 C  CA  . ALA A 1 143 ? 0.687   -17.090 58.400  1.00 18.43 ? 145  ALA A CA  1 
ATOM   1051 C  C   . ALA A 1 143 ? -0.056  -17.941 57.390  1.00 18.34 ? 145  ALA A C   1 
ATOM   1052 O  O   . ALA A 1 143 ? 0.535   -18.609 56.568  1.00 18.81 ? 145  ALA A O   1 
ATOM   1053 C  CB  . ALA A 1 143 ? 1.021   -15.718 57.806  1.00 18.27 ? 145  ALA A CB  1 
ATOM   1054 N  N   . PHE A 1 144 ? -1.374  -17.925 57.490  1.00 18.71 ? 146  PHE A N   1 
ATOM   1055 C  CA  . PHE A 1 144 ? -2.239  -18.588 56.525  1.00 19.59 ? 146  PHE A CA  1 
ATOM   1056 C  C   . PHE A 1 144 ? -2.348  -17.751 55.262  1.00 19.23 ? 146  PHE A C   1 
ATOM   1057 O  O   . PHE A 1 144 ? -2.345  -16.533 55.331  1.00 19.22 ? 146  PHE A O   1 
ATOM   1058 C  CB  . PHE A 1 144 ? -3.616  -18.781 57.141  1.00 21.23 ? 146  PHE A CB  1 
ATOM   1059 C  CG  . PHE A 1 144 ? -3.597  -19.635 58.385  1.00 21.59 ? 146  PHE A CG  1 
ATOM   1060 C  CD1 . PHE A 1 144 ? -3.158  -20.954 58.314  1.00 21.63 ? 146  PHE A CD1 1 
ATOM   1061 C  CD2 . PHE A 1 144 ? -3.994  -19.126 59.602  1.00 22.82 ? 146  PHE A CD2 1 
ATOM   1062 C  CE1 . PHE A 1 144 ? -3.098  -21.741 59.461  1.00 22.74 ? 146  PHE A CE1 1 
ATOM   1063 C  CE2 . PHE A 1 144 ? -3.970  -19.913 60.752  1.00 23.26 ? 146  PHE A CE2 1 
ATOM   1064 C  CZ  . PHE A 1 144 ? -3.534  -21.220 60.672  1.00 22.34 ? 146  PHE A CZ  1 
ATOM   1065 N  N   . LEU A 1 145 ? -2.436  -18.424 54.120  1.00 20.40 ? 147  LEU A N   1 
ATOM   1066 C  CA  . LEU A 1 145 ? -2.654  -17.774 52.834  1.00 21.09 ? 147  LEU A CA  1 
ATOM   1067 C  C   . LEU A 1 145 ? -4.068  -18.142 52.392  1.00 20.19 ? 147  LEU A C   1 
ATOM   1068 O  O   . LEU A 1 145 ? -4.403  -19.319 52.355  1.00 20.70 ? 147  LEU A O   1 
ATOM   1069 C  CB  . LEU A 1 145 ? -1.637  -18.243 51.786  1.00 21.11 ? 147  LEU A CB  1 
ATOM   1070 C  CG  . LEU A 1 145 ? -0.148  -18.257 52.162  1.00 22.46 ? 147  LEU A CG  1 
ATOM   1071 C  CD1 . LEU A 1 145 ? 0.686   -18.535 50.913  1.00 22.43 ? 147  LEU A CD1 1 
ATOM   1072 C  CD2 . LEU A 1 145 ? 0.293   -17.016 52.874  1.00 24.22 ? 147  LEU A CD2 1 
ATOM   1073 N  N   . GLU A 1 146 ? -4.880  -17.116 52.113  1.00 22.22 ? 148  GLU A N   1 
ATOM   1074 C  CA  . GLU A 1 146 ? -6.254  -17.259 51.634  1.00 22.47 ? 148  GLU A CA  1 
ATOM   1075 C  C   . GLU A 1 146 ? -6.414  -16.597 50.269  1.00 22.07 ? 148  GLU A C   1 
ATOM   1076 O  O   . GLU A 1 146 ? -5.567  -15.833 49.851  1.00 19.87 ? 148  GLU A O   1 
ATOM   1077 C  CB  . GLU A 1 146 ? -7.200  -16.576 52.608  1.00 23.86 ? 148  GLU A CB  1 
ATOM   1078 C  CG  . GLU A 1 146 ? -7.284  -17.277 53.946  1.00 24.85 ? 148  GLU A CG  1 
ATOM   1079 C  CD  . GLU A 1 146 ? -8.414  -16.734 54.791  1.00 24.67 ? 148  GLU A CD  1 
ATOM   1080 O  OE1 . GLU A 1 146 ? -8.335  -15.583 55.249  1.00 25.57 ? 148  GLU A OE1 1 
ATOM   1081 O  OE2 . GLU A 1 146 ? -9.357  -17.493 55.010  1.00 26.06 ? 148  GLU A OE2 1 
ATOM   1082 N  N   . GLU A 1 147 ? -7.540  -16.872 49.623  1.00 21.73 ? 149  GLU A N   1 
ATOM   1083 C  CA  . GLU A 1 147 ? -7.867  -16.248 48.370  1.00 21.51 ? 149  GLU A CA  1 
ATOM   1084 C  C   . GLU A 1 147 ? -8.414  -14.834 48.548  1.00 21.37 ? 149  GLU A C   1 
ATOM   1085 O  O   . GLU A 1 147 ? -9.414  -14.630 49.234  1.00 21.46 ? 149  GLU A O   1 
ATOM   1086 C  CB  . GLU A 1 147 ? -8.876  -17.069 47.577  1.00 22.47 ? 149  GLU A CB  1 
ATOM   1087 C  CG  . GLU A 1 147 ? -9.006  -16.536 46.135  1.00 25.52 ? 149  GLU A CG  1 
ATOM   1088 C  CD  . GLU A 1 147 ? -10.286 -16.964 45.438  1.00 28.39 ? 149  GLU A CD  1 
ATOM   1089 O  OE1 . GLU A 1 147 ? -10.911 -17.879 45.958  1.00 31.81 ? 149  GLU A OE1 1 
ATOM   1090 O  OE2 . GLU A 1 147 ? -10.652 -16.382 44.384  1.00 28.84 ? 149  GLU A OE2 1 
ATOM   1091 N  N   . GLY A 1 148 ? -7.778  -13.886 47.874  1.00 21.07 ? 150  GLY A N   1 
ATOM   1092 C  CA  . GLY A 1 148 ? -8.280  -12.523 47.711  1.00 22.41 ? 150  GLY A CA  1 
ATOM   1093 C  C   . GLY A 1 148 ? -8.478  -12.172 46.249  1.00 23.17 ? 150  GLY A C   1 
ATOM   1094 O  O   . GLY A 1 148 ? -8.110  -12.946 45.370  1.00 25.11 ? 150  GLY A O   1 
ATOM   1095 N  N   . PRO A 1 149 ? -9.070  -11.002 45.972  1.00 24.55 ? 151  PRO A N   1 
ATOM   1096 C  CA  . PRO A 1 149 ? -9.366  -10.572 44.589  1.00 25.78 ? 151  PRO A CA  1 
ATOM   1097 C  C   . PRO A 1 149 ? -8.163  -10.075 43.792  1.00 25.32 ? 151  PRO A C   1 
ATOM   1098 O  O   . PRO A 1 149 ? -8.184  -10.144 42.559  1.00 24.55 ? 151  PRO A O   1 
ATOM   1099 C  CB  . PRO A 1 149 ? -10.389 -9.446  44.779  1.00 26.67 ? 151  PRO A CB  1 
ATOM   1100 C  CG  . PRO A 1 149 ? -10.105 -8.921  46.149  1.00 27.22 ? 151  PRO A CG  1 
ATOM   1101 C  CD  . PRO A 1 149 ? -9.578  -10.057 46.976  1.00 25.00 ? 151  PRO A CD  1 
ATOM   1102 N  N   . GLU A 1 150 ? -7.118  -9.605  44.474  1.00 24.39 ? 152  GLU A N   1 
ATOM   1103 C  CA  . GLU A 1 150 ? -5.976  -9.009  43.803  1.00 24.93 ? 152  GLU A CA  1 
ATOM   1104 C  C   . GLU A 1 150 ? -4.769  -9.950  43.770  1.00 23.27 ? 152  GLU A C   1 
ATOM   1105 O  O   . GLU A 1 150 ? -4.584  -10.803 44.645  1.00 24.01 ? 152  GLU A O   1 
ATOM   1106 C  CB  . GLU A 1 150 ? -5.548  -7.710  44.495  1.00 25.49 ? 152  GLU A CB  1 
ATOM   1107 C  CG  . GLU A 1 150 ? -6.619  -6.645  44.636  1.00 28.77 ? 152  GLU A CG  1 
ATOM   1108 C  CD  . GLU A 1 150 ? -7.128  -6.117  43.309  1.00 31.09 ? 152  GLU A CD  1 
ATOM   1109 O  OE1 . GLU A 1 150 ? -6.293  -5.917  42.401  1.00 32.52 ? 152  GLU A OE1 1 
ATOM   1110 O  OE2 . GLU A 1 150 ? -8.364  -5.917  43.167  1.00 30.14 ? 152  GLU A OE2 1 
ATOM   1111 N  N   . GLU A 1 151 ? -3.922  -9.727  42.783  1.00 23.13 ? 153  GLU A N   1 
ATOM   1112 C  CA  . GLU A 1 151 ? -2.638  -10.389 42.695  1.00 23.57 ? 153  GLU A CA  1 
ATOM   1113 C  C   . GLU A 1 151 ? -1.769  -9.808  43.794  1.00 21.39 ? 153  GLU A C   1 
ATOM   1114 O  O   . GLU A 1 151 ? -1.689  -8.597  43.939  1.00 21.83 ? 153  GLU A O   1 
ATOM   1115 C  CB  . GLU A 1 151 ? -2.011  -10.124 41.332  1.00 26.30 ? 153  GLU A CB  1 
ATOM   1116 C  CG  . GLU A 1 151 ? -0.746  -10.912 41.076  1.00 29.16 ? 153  GLU A CG  1 
ATOM   1117 C  CD  . GLU A 1 151 ? -0.332  -10.857 39.619  1.00 30.94 ? 153  GLU A CD  1 
ATOM   1118 O  OE1 . GLU A 1 151 ? -0.983  -11.533 38.792  1.00 35.23 ? 153  GLU A OE1 1 
ATOM   1119 O  OE2 . GLU A 1 151 ? 0.621   -10.129 39.320  1.00 30.72 ? 153  GLU A OE2 1 
ATOM   1120 N  N   . ASN A 1 152 ? -1.174  -10.676 44.608  1.00 20.90 ? 154  ASN A N   1 
ATOM   1121 C  CA  . ASN A 1 152 ? -0.252  -10.243 45.640  1.00 19.87 ? 154  ASN A CA  1 
ATOM   1122 C  C   . ASN A 1 152 ? 1.115   -10.026 45.028  1.00 21.46 ? 154  ASN A C   1 
ATOM   1123 O  O   . ASN A 1 152 ? 1.810   -10.995 44.619  1.00 20.55 ? 154  ASN A O   1 
ATOM   1124 C  CB  . ASN A 1 152 ? -0.198  -11.273 46.760  1.00 19.77 ? 154  ASN A CB  1 
ATOM   1125 C  CG  . ASN A 1 152 ? 0.587   -10.794 47.961  1.00 18.55 ? 154  ASN A CG  1 
ATOM   1126 O  OD1 . ASN A 1 152 ? 1.736   -10.380 47.836  1.00 18.95 ? 154  ASN A OD1 1 
ATOM   1127 N  ND2 . ASN A 1 152 ? -0.022  -10.867 49.136  1.00 18.18 ? 154  ASN A ND2 1 
ATOM   1128 N  N   . SER A 1 153 ? 1.521   -8.763  44.984  1.00 21.77 ? 155  SER A N   1 
ATOM   1129 C  CA  . SER A 1 153 ? 2.743   -8.388  44.281  1.00 23.55 ? 155  SER A CA  1 
ATOM   1130 C  C   . SER A 1 153 ? 4.036   -8.943  44.916  1.00 21.98 ? 155  SER A C   1 
ATOM   1131 O  O   . SER A 1 153 ? 4.964   -9.297  44.193  1.00 19.90 ? 155  SER A O   1 
ATOM   1132 C  CB  . SER A 1 153 ? 2.823   -6.875  44.104  1.00 25.21 ? 155  SER A CB  1 
ATOM   1133 O  OG  . SER A 1 153 ? 3.087   -6.246  45.326  1.00 30.08 ? 155  SER A OG  1 
ATOM   1134 N  N   . ALA A 1 154 ? 4.093   -9.047  46.240  1.00 20.10 ? 156  ALA A N   1 
ATOM   1135 C  CA  . ALA A 1 154 ? 5.268   -9.649  46.887  1.00 20.74 ? 156  ALA A CA  1 
ATOM   1136 C  C   . ALA A 1 154 ? 5.342   -11.145 46.562  1.00 20.94 ? 156  ALA A C   1 
ATOM   1137 O  O   . ALA A 1 154 ? 6.374   -11.628 46.092  1.00 20.29 ? 156  ALA A O   1 
ATOM   1138 C  CB  . ALA A 1 154 ? 5.262   -9.388  48.382  1.00 20.23 ? 156  ALA A CB  1 
ATOM   1139 N  N   . TYR A 1 155 ? 4.235   -11.865 46.729  1.00 19.74 ? 157  TYR A N   1 
ATOM   1140 C  CA  . TYR A 1 155 ? 4.196   -13.281 46.353  1.00 20.23 ? 157  TYR A CA  1 
ATOM   1141 C  C   . TYR A 1 155 ? 4.453   -13.550 44.867  1.00 20.93 ? 157  TYR A C   1 
ATOM   1142 O  O   . TYR A 1 155 ? 5.074   -14.554 44.527  1.00 20.02 ? 157  TYR A O   1 
ATOM   1143 C  CB  . TYR A 1 155 ? 2.887   -13.956 46.802  1.00 18.90 ? 157  TYR A CB  1 
ATOM   1144 C  CG  . TYR A 1 155 ? 2.948   -14.371 48.229  1.00 17.93 ? 157  TYR A CG  1 
ATOM   1145 C  CD1 . TYR A 1 155 ? 2.639   -13.475 49.242  1.00 18.60 ? 157  TYR A CD1 1 
ATOM   1146 C  CD2 . TYR A 1 155 ? 3.339   -15.674 48.586  1.00 19.18 ? 157  TYR A CD2 1 
ATOM   1147 C  CE1 . TYR A 1 155 ? 2.728   -13.844 50.580  1.00 19.50 ? 157  TYR A CE1 1 
ATOM   1148 C  CE2 . TYR A 1 155 ? 3.434   -16.058 49.918  1.00 18.64 ? 157  TYR A CE2 1 
ATOM   1149 C  CZ  . TYR A 1 155 ? 3.096   -15.143 50.920  1.00 19.09 ? 157  TYR A CZ  1 
ATOM   1150 O  OH  . TYR A 1 155 ? 3.203   -15.505 52.248  1.00 20.06 ? 157  TYR A OH  1 
ATOM   1151 N  N   . GLU A 1 156 ? 3.987   -12.664 43.992  1.00 22.13 ? 158  GLU A N   1 
ATOM   1152 C  CA  . GLU A 1 156 ? 4.182   -12.836 42.559  1.00 23.24 ? 158  GLU A CA  1 
ATOM   1153 C  C   . GLU A 1 156 ? 5.655   -12.934 42.175  1.00 22.72 ? 158  GLU A C   1 
ATOM   1154 O  O   . GLU A 1 156 ? 6.002   -13.637 41.225  1.00 21.82 ? 158  GLU A O   1 
ATOM   1155 C  CB  . GLU A 1 156 ? 3.499   -11.710 41.753  1.00 23.73 ? 158  GLU A CB  1 
ATOM   1156 C  CG  . GLU A 1 156 ? 3.457   -11.932 40.240  1.00 24.66 ? 158  GLU A CG  1 
ATOM   1157 C  CD  . GLU A 1 156 ? 2.692   -13.177 39.831  1.00 25.89 ? 158  GLU A CD  1 
ATOM   1158 O  OE1 . GLU A 1 156 ? 1.838   -13.686 40.609  1.00 27.59 ? 158  GLU A OE1 1 
ATOM   1159 O  OE2 . GLU A 1 156 ? 2.933   -13.652 38.710  1.00 25.76 ? 158  GLU A OE2 1 
ATOM   1160 N  N   . GLN A 1 157 ? 6.519   -12.267 42.929  1.00 23.37 ? 159  GLN A N   1 
ATOM   1161 C  CA  . GLN A 1 157 ? 7.955   -12.357 42.703  1.00 24.87 ? 159  GLN A CA  1 
ATOM   1162 C  C   . GLN A 1 157 ? 8.543   -13.752 42.883  1.00 24.35 ? 159  GLN A C   1 
ATOM   1163 O  O   . GLN A 1 157 ? 9.534   -14.093 42.249  1.00 22.88 ? 159  GLN A O   1 
ATOM   1164 C  CB  . GLN A 1 157 ? 8.669   -11.404 43.619  1.00 27.17 ? 159  GLN A CB  1 
ATOM   1165 C  CG  . GLN A 1 157 ? 8.300   -9.981  43.284  1.00 31.52 ? 159  GLN A CG  1 
ATOM   1166 C  CD  . GLN A 1 157 ? 9.139   -9.011  44.019  1.00 35.61 ? 159  GLN A CD  1 
ATOM   1167 O  OE1 . GLN A 1 157 ? 8.626   -8.140  44.721  1.00 38.24 ? 159  GLN A OE1 1 
ATOM   1168 N  NE2 . GLN A 1 157 ? 10.449  -9.146  43.873  1.00 39.26 ? 159  GLN A NE2 1 
ATOM   1169 N  N   . LEU A 1 158 ? 7.939   -14.545 43.759  1.00 22.90 ? 160  LEU A N   1 
ATOM   1170 C  CA  . LEU A 1 158 ? 8.349   -15.926 43.943  1.00 22.27 ? 160  LEU A CA  1 
ATOM   1171 C  C   . LEU A 1 158 ? 7.562   -16.838 43.032  1.00 21.89 ? 160  LEU A C   1 
ATOM   1172 O  O   . LEU A 1 158 ? 8.121   -17.725 42.370  1.00 21.63 ? 160  LEU A O   1 
ATOM   1173 C  CB  . LEU A 1 158 ? 8.142   -16.331 45.404  1.00 22.41 ? 160  LEU A CB  1 
ATOM   1174 C  CG  . LEU A 1 158 ? 8.851   -15.441 46.412  1.00 23.06 ? 160  LEU A CG  1 
ATOM   1175 C  CD1 . LEU A 1 158 ? 8.652   -15.984 47.806  1.00 24.15 ? 160  LEU A CD1 1 
ATOM   1176 C  CD2 . LEU A 1 158 ? 10.332  -15.257 46.087  1.00 24.18 ? 160  LEU A CD2 1 
ATOM   1177 N  N   . LEU A 1 159 ? 6.257   -16.610 42.972  1.00 20.94 ? 161  LEU A N   1 
ATOM   1178 C  CA  . LEU A 1 159 ? 5.378   -17.511 42.239  1.00 21.06 ? 161  LEU A CA  1 
ATOM   1179 C  C   . LEU A 1 159 ? 5.643   -17.503 40.738  1.00 21.36 ? 161  LEU A C   1 
ATOM   1180 O  O   . LEU A 1 159 ? 5.552   -18.541 40.090  1.00 21.73 ? 161  LEU A O   1 
ATOM   1181 C  CB  . LEU A 1 159 ? 3.913   -17.184 42.541  1.00 21.55 ? 161  LEU A CB  1 
ATOM   1182 C  CG  . LEU A 1 159 ? 3.519   -17.403 44.007  1.00 22.31 ? 161  LEU A CG  1 
ATOM   1183 C  CD1 . LEU A 1 159 ? 2.050   -17.049 44.209  1.00 21.34 ? 161  LEU A CD1 1 
ATOM   1184 C  CD2 . LEU A 1 159 ? 3.819   -18.812 44.515  1.00 21.75 ? 161  LEU A CD2 1 
ATOM   1185 N  N   . SER A 1 160 ? 6.018   -16.346 40.201  1.00 21.60 ? 162  SER A N   1 
ATOM   1186 C  CA  . SER A 1 160 ? 6.356   -16.220 38.784  1.00 23.78 ? 162  SER A CA  1 
ATOM   1187 C  C   . SER A 1 160 ? 7.634   -17.001 38.386  1.00 24.69 ? 162  SER A C   1 
ATOM   1188 O  O   . SER A 1 160 ? 7.889   -17.192 37.196  1.00 24.31 ? 162  SER A O   1 
ATOM   1189 C  CB  . SER A 1 160 ? 6.513   -14.752 38.391  1.00 22.99 ? 162  SER A CB  1 
ATOM   1190 O  OG  . SER A 1 160 ? 7.604   -14.154 39.060  1.00 23.71 ? 162  SER A OG  1 
ATOM   1191 N  N   . ARG A 1 161 ? 8.415   -17.435 39.374  1.00 24.16 ? 163  ARG A N   1 
ATOM   1192 C  CA  . ARG A 1 161 ? 9.629   -18.186 39.154  1.00 25.43 ? 163  ARG A CA  1 
ATOM   1193 C  C   . ARG A 1 161 ? 9.488   -19.699 39.360  1.00 25.66 ? 163  ARG A C   1 
ATOM   1194 O  O   . ARG A 1 161 ? 10.443  -20.419 39.098  1.00 24.29 ? 163  ARG A O   1 
ATOM   1195 C  CB  . ARG A 1 161 ? 10.719  -17.647 40.071  1.00 27.20 ? 163  ARG A CB  1 
ATOM   1196 C  CG  . ARG A 1 161 ? 10.936  -16.143 39.991  1.00 29.59 ? 163  ARG A CG  1 
ATOM   1197 C  CD  . ARG A 1 161 ? 11.466  -15.710 38.637  1.00 33.84 ? 163  ARG A CD  1 
ATOM   1198 N  NE  . ARG A 1 161 ? 12.507  -14.686 38.806  1.00 42.73 ? 163  ARG A NE  1 
ATOM   1199 C  CZ  . ARG A 1 161 ? 13.831  -14.886 38.745  1.00 44.90 ? 163  ARG A CZ  1 
ATOM   1200 N  NH1 . ARG A 1 161 ? 14.365  -16.084 38.480  1.00 44.82 ? 163  ARG A NH1 1 
ATOM   1201 N  NH2 . ARG A 1 161 ? 14.645  -13.849 38.933  1.00 51.76 ? 163  ARG A NH2 1 
ATOM   1202 N  N   . LEU A 1 162 ? 8.326   -20.193 39.797  1.00 23.20 ? 164  LEU A N   1 
ATOM   1203 C  CA  . LEU A 1 162 ? 8.182   -21.629 40.046  1.00 23.55 ? 164  LEU A CA  1 
ATOM   1204 C  C   . LEU A 1 162 ? 8.334   -22.494 38.793  1.00 24.34 ? 164  LEU A C   1 
ATOM   1205 O  O   . LEU A 1 162 ? 8.810   -23.627 38.910  1.00 23.83 ? 164  LEU A O   1 
ATOM   1206 C  CB  . LEU A 1 162 ? 6.861   -21.967 40.723  1.00 23.15 ? 164  LEU A CB  1 
ATOM   1207 C  CG  . LEU A 1 162 ? 6.586   -21.311 42.077  1.00 21.67 ? 164  LEU A CG  1 
ATOM   1208 C  CD1 . LEU A 1 162 ? 5.274   -21.845 42.640  1.00 21.86 ? 164  LEU A CD1 1 
ATOM   1209 C  CD2 . LEU A 1 162 ? 7.736   -21.472 43.071  1.00 21.68 ? 164  LEU A CD2 1 
ATOM   1210 N  N   . GLU A 1 163 ? 7.933   -21.989 37.617  1.00 24.37 ? 165  GLU A N   1 
ATOM   1211 C  CA  . GLU A 1 163 ? 8.067   -22.769 36.375  1.00 25.41 ? 165  GLU A CA  1 
ATOM   1212 C  C   . GLU A 1 163 ? 9.537   -23.133 36.158  1.00 26.65 ? 165  GLU A C   1 
ATOM   1213 O  O   . GLU A 1 163 ? 9.843   -24.282 35.790  1.00 27.66 ? 165  GLU A O   1 
ATOM   1214 C  CB  . GLU A 1 163 ? 7.518   -22.015 35.148  1.00 27.27 ? 165  GLU A CB  1 
ATOM   1215 N  N   . GLU A 1 164 ? 10.425  -22.165 36.408  1.00 25.60 ? 166  GLU A N   1 
ATOM   1216 C  CA  . GLU A 1 164 ? 11.889  -22.361 36.326  1.00 28.77 ? 166  GLU A CA  1 
ATOM   1217 C  C   . GLU A 1 164 ? 12.408  -23.430 37.263  1.00 26.46 ? 166  GLU A C   1 
ATOM   1218 O  O   . GLU A 1 164 ? 13.477  -23.987 37.007  1.00 28.15 ? 166  GLU A O   1 
ATOM   1219 C  CB  . GLU A 1 164 ? 12.658  -21.079 36.683  1.00 30.77 ? 166  GLU A CB  1 
ATOM   1220 C  CG  . GLU A 1 164 ? 12.542  -19.954 35.689  1.00 35.24 ? 166  GLU A CG  1 
ATOM   1221 C  CD  . GLU A 1 164 ? 12.814  -18.594 36.314  1.00 38.94 ? 166  GLU A CD  1 
ATOM   1222 O  OE1 . GLU A 1 164 ? 13.820  -18.453 37.058  1.00 39.23 ? 166  GLU A OE1 1 
ATOM   1223 O  OE2 . GLU A 1 164 ? 12.011  -17.668 36.059  1.00 40.11 ? 166  GLU A OE2 1 
ATOM   1224 N  N   . ILE A 1 165 ? 11.704  -23.676 38.372  1.00 24.94 ? 167  ILE A N   1 
ATOM   1225 C  CA  . ILE A 1 165 ? 12.143  -24.678 39.354  1.00 23.53 ? 167  ILE A CA  1 
ATOM   1226 C  C   . ILE A 1 165 ? 11.154  -25.825 39.510  1.00 22.67 ? 167  ILE A C   1 
ATOM   1227 O  O   . ILE A 1 165 ? 11.041  -26.427 40.573  1.00 22.74 ? 167  ILE A O   1 
ATOM   1228 C  CB  . ILE A 1 165 ? 12.520  -24.049 40.715  1.00 23.09 ? 167  ILE A CB  1 
ATOM   1229 C  CG1 . ILE A 1 165 ? 11.364  -23.234 41.324  1.00 22.89 ? 167  ILE A CG1 1 
ATOM   1230 C  CG2 . ILE A 1 165 ? 13.740  -23.158 40.558  1.00 23.45 ? 167  ILE A CG2 1 
ATOM   1231 C  CD1 . ILE A 1 165 ? 11.633  -22.811 42.753  1.00 23.15 ? 167  ILE A CD1 1 
ATOM   1232 N  N   . ALA A 1 166 ? 10.495  -26.173 38.414  1.00 24.02 ? 168  ALA A N   1 
ATOM   1233 C  CA  . ALA A 1 166 ? 9.480   -27.205 38.429  1.00 24.20 ? 168  ALA A CA  1 
ATOM   1234 C  C   . ALA A 1 166 ? 10.053  -28.556 38.850  1.00 24.90 ? 168  ALA A C   1 
ATOM   1235 O  O   . ALA A 1 166 ? 9.448   -29.270 39.633  1.00 24.67 ? 168  ALA A O   1 
ATOM   1236 C  CB  . ALA A 1 166 ? 8.830   -27.303 37.064  1.00 25.43 ? 168  ALA A CB  1 
ATOM   1237 N  N   . GLU A 1 167 ? 11.243  -28.880 38.346  1.00 26.73 ? 169  GLU A N   1 
ATOM   1238 C  CA  . GLU A 1 167 ? 11.911  -30.150 38.665  1.00 28.47 ? 169  GLU A CA  1 
ATOM   1239 C  C   . GLU A 1 167 ? 12.373  -30.213 40.116  1.00 26.30 ? 169  GLU A C   1 
ATOM   1240 O  O   . GLU A 1 167 ? 12.980  -29.264 40.618  1.00 24.32 ? 169  GLU A O   1 
ATOM   1241 C  CB  . GLU A 1 167 ? 13.131  -30.345 37.719  1.00 32.12 ? 169  GLU A CB  1 
ATOM   1242 C  CG  . GLU A 1 167 ? 13.773  -31.719 37.773  1.00 38.39 ? 169  GLU A CG  1 
ATOM   1243 C  CD  . GLU A 1 167 ? 15.129  -31.832 37.057  1.00 44.15 ? 169  GLU A CD  1 
ATOM   1244 O  OE1 . GLU A 1 167 ? 15.550  -30.922 36.309  1.00 45.39 ? 169  GLU A OE1 1 
ATOM   1245 O  OE2 . GLU A 1 167 ? 15.801  -32.866 37.264  1.00 48.50 ? 169  GLU A OE2 1 
ATOM   1246 N  N   . GLU A 1 168 ? 12.155  -31.360 40.767  1.00 25.58 ? 170  GLU A N   1 
ATOM   1247 C  CA  . GLU A 1 168 ? 12.691  -31.616 42.099  1.00 27.64 ? 170  GLU A CA  1 
ATOM   1248 C  C   . GLU A 1 168 ? 14.191  -31.334 42.107  1.00 27.35 ? 170  GLU A C   1 
ATOM   1249 O  O   . GLU A 1 168 ? 14.895  -31.721 41.174  1.00 26.49 ? 170  GLU A O   1 
ATOM   1250 C  CB  . GLU A 1 168 ? 12.398  -33.062 42.553  1.00 31.05 ? 170  GLU A CB  1 
ATOM   1251 C  CG  . GLU A 1 168 ? 13.200  -33.513 43.766  1.00 34.02 ? 170  GLU A CG  1 
ATOM   1252 C  CD  . GLU A 1 168 ? 12.844  -34.904 44.262  1.00 38.78 ? 170  GLU A CD  1 
ATOM   1253 O  OE1 . GLU A 1 168 ? 12.549  -35.789 43.433  1.00 42.34 ? 170  GLU A OE1 1 
ATOM   1254 O  OE2 . GLU A 1 168 ? 12.883  -35.111 45.500  1.00 44.66 ? 170  GLU A OE2 1 
ATOM   1255 N  N   . GLY A 1 169 ? 14.665  -30.615 43.125  1.00 24.97 ? 171  GLY A N   1 
ATOM   1256 C  CA  . GLY A 1 169 ? 16.081  -30.316 43.264  1.00 25.27 ? 171  GLY A CA  1 
ATOM   1257 C  C   . GLY A 1 169 ? 16.605  -29.141 42.452  1.00 25.68 ? 171  GLY A C   1 
ATOM   1258 O  O   . GLY A 1 169 ? 17.800  -28.885 42.466  1.00 30.48 ? 171  GLY A O   1 
ATOM   1259 N  N   . SER A 1 170 ? 15.736  -28.411 41.762  1.00 23.98 ? 172  SER A N   1 
ATOM   1260 C  CA  . SER A 1 170 ? 16.168  -27.265 40.999  1.00 22.61 ? 172  SER A CA  1 
ATOM   1261 C  C   . SER A 1 170 ? 16.094  -25.985 41.823  1.00 22.17 ? 172  SER A C   1 
ATOM   1262 O  O   . SER A 1 170 ? 15.381  -25.902 42.836  1.00 20.27 ? 172  SER A O   1 
ATOM   1263 C  CB  . SER A 1 170 ? 15.362  -27.148 39.711  1.00 24.20 ? 172  SER A CB  1 
ATOM   1264 O  OG  . SER A 1 170 ? 14.018  -26.979 39.999  1.00 28.82 ? 172  SER A OG  1 
ATOM   1265 N  N   . GLU A 1 171 ? 16.851  -24.990 41.393  1.00 21.72 ? 173  GLU A N   1 
ATOM   1266 C  CA  . GLU A 1 171 ? 16.848  -23.693 42.075  1.00 23.42 ? 173  GLU A CA  1 
ATOM   1267 C  C   . GLU A 1 171 ? 17.046  -22.556 41.099  1.00 22.66 ? 173  GLU A C   1 
ATOM   1268 O  O   . GLU A 1 171 ? 17.432  -22.765 39.946  1.00 19.62 ? 173  GLU A O   1 
ATOM   1269 C  CB  . GLU A 1 171 ? 17.879  -23.653 43.201  1.00 24.35 ? 173  GLU A CB  1 
ATOM   1270 C  CG  . GLU A 1 171 ? 19.313  -23.872 42.806  1.00 26.42 ? 173  GLU A CG  1 
ATOM   1271 C  CD  . GLU A 1 171 ? 20.236  -23.837 44.013  1.00 30.15 ? 173  GLU A CD  1 
ATOM   1272 O  OE1 . GLU A 1 171 ? 20.163  -24.736 44.850  1.00 34.59 ? 173  GLU A OE1 1 
ATOM   1273 O  OE2 . GLU A 1 171 ? 21.026  -22.900 44.151  1.00 32.72 ? 173  GLU A OE2 1 
ATOM   1274 N  N   . THR A 1 172 ? 16.765  -21.356 41.575  1.00 21.15 ? 174  THR A N   1 
ATOM   1275 C  CA  . THR A 1 172 ? 16.939  -20.152 40.790  1.00 22.77 ? 174  THR A CA  1 
ATOM   1276 C  C   . THR A 1 172 ? 17.282  -18.987 41.720  1.00 24.74 ? 174  THR A C   1 
ATOM   1277 O  O   . THR A 1 172 ? 17.123  -19.104 42.939  1.00 23.92 ? 174  THR A O   1 
ATOM   1278 C  CB  . THR A 1 172 ? 15.700  -19.886 39.921  1.00 23.44 ? 174  THR A CB  1 
ATOM   1279 O  OG1 . THR A 1 172 ? 16.009  -18.872 38.964  1.00 23.57 ? 174  THR A OG1 1 
ATOM   1280 C  CG2 . THR A 1 172 ? 14.457  -19.481 40.769  1.00 22.99 ? 174  THR A CG2 1 
ATOM   1281 N  N   . GLN A 1 173 ? 17.794  -17.896 41.150  1.00 24.53 ? 175  GLN A N   1 
ATOM   1282 C  CA  . GLN A 1 173 ? 18.111  -16.696 41.909  1.00 25.15 ? 175  GLN A CA  1 
ATOM   1283 C  C   . GLN A 1 173 ? 16.975  -15.700 41.702  1.00 24.45 ? 175  GLN A C   1 
ATOM   1284 O  O   . GLN A 1 173 ? 16.452  -15.561 40.595  1.00 25.85 ? 175  GLN A O   1 
ATOM   1285 C  CB  . GLN A 1 173 ? 19.446  -16.100 41.495  1.00 26.66 ? 175  GLN A CB  1 
ATOM   1286 C  CG  . GLN A 1 173 ? 20.659  -16.941 41.884  1.00 27.33 ? 175  GLN A CG  1 
ATOM   1287 C  CD  . GLN A 1 173 ? 21.949  -16.142 41.848  1.00 28.12 ? 175  GLN A CD  1 
ATOM   1288 O  OE1 . GLN A 1 173 ? 22.489  -15.763 42.894  1.00 31.30 ? 175  GLN A OE1 1 
ATOM   1289 N  NE2 . GLN A 1 173 ? 22.438  -15.860 40.653  1.00 29.77 ? 175  GLN A NE2 1 
ATOM   1290 N  N   . VAL A 1 174 ? 16.583  -15.023 42.771  1.00 24.34 ? 176  VAL A N   1 
ATOM   1291 C  CA  . VAL A 1 174 ? 15.597  -13.956 42.677  1.00 23.01 ? 176  VAL A CA  1 
ATOM   1292 C  C   . VAL A 1 174 ? 16.083  -12.677 43.373  1.00 21.88 ? 176  VAL A C   1 
ATOM   1293 O  O   . VAL A 1 174 ? 16.766  -12.743 44.376  1.00 20.74 ? 176  VAL A O   1 
ATOM   1294 C  CB  . VAL A 1 174 ? 14.233  -14.396 43.234  1.00 23.71 ? 176  VAL A CB  1 
ATOM   1295 C  CG1 . VAL A 1 174 ? 13.796  -15.705 42.562  1.00 25.21 ? 176  VAL A CG1 1 
ATOM   1296 C  CG2 . VAL A 1 174 ? 14.260  -14.544 44.750  1.00 22.57 ? 176  VAL A CG2 1 
ATOM   1297 N  N   . PRO A 1 175 ? 15.707  -11.505 42.840  1.00 23.01 ? 177  PRO A N   1 
ATOM   1298 C  CA  . PRO A 1 175 ? 16.083  -10.247 43.511  1.00 22.50 ? 177  PRO A CA  1 
ATOM   1299 C  C   . PRO A 1 175 ? 15.522  -10.168 44.933  1.00 20.33 ? 177  PRO A C   1 
ATOM   1300 O  O   . PRO A 1 175 ? 14.454  -10.697 45.209  1.00 20.42 ? 177  PRO A O   1 
ATOM   1301 C  CB  . PRO A 1 175 ? 15.430  -9.164  42.636  1.00 23.62 ? 177  PRO A CB  1 
ATOM   1302 C  CG  . PRO A 1 175 ? 15.160  -9.814  41.329  1.00 24.46 ? 177  PRO A CG  1 
ATOM   1303 C  CD  . PRO A 1 175 ? 14.899  -11.267 41.630  1.00 23.80 ? 177  PRO A CD  1 
ATOM   1304 N  N   . GLY A 1 176 ? 16.262  -9.538  45.825  1.00 20.39 ? 178  GLY A N   1 
ATOM   1305 C  CA  . GLY A 1 176 ? 15.752  -9.214  47.138  1.00 20.39 ? 178  GLY A CA  1 
ATOM   1306 C  C   . GLY A 1 176 ? 14.477  -8.390  47.031  1.00 19.82 ? 178  GLY A C   1 
ATOM   1307 O  O   . GLY A 1 176 ? 14.262  -7.674  46.049  1.00 20.28 ? 178  GLY A O   1 
ATOM   1308 N  N   . LEU A 1 177 ? 13.623  -8.556  48.030  1.00 20.03 ? 179  LEU A N   1 
ATOM   1309 C  CA  . LEU A 1 177 ? 12.330  -7.905  48.098  1.00 20.07 ? 179  LEU A CA  1 
ATOM   1310 C  C   . LEU A 1 177 ? 12.055  -7.613  49.567  1.00 19.19 ? 179  LEU A C   1 
ATOM   1311 O  O   . LEU A 1 177 ? 12.821  -8.008  50.461  1.00 18.73 ? 179  LEU A O   1 
ATOM   1312 C  CB  . LEU A 1 177 ? 11.215  -8.774  47.484  1.00 21.48 ? 179  LEU A CB  1 
ATOM   1313 C  CG  . LEU A 1 177 ? 10.870  -10.091 48.219  1.00 22.27 ? 179  LEU A CG  1 
ATOM   1314 C  CD1 . LEU A 1 177 ? 9.395   -10.446 48.083  1.00 23.43 ? 179  LEU A CD1 1 
ATOM   1315 C  CD2 . LEU A 1 177 ? 11.727  -11.245 47.743  1.00 22.69 ? 179  LEU A CD2 1 
ATOM   1316 N  N   . ASP A 1 178 ? 10.950  -6.930  49.819  1.00 19.96 ? 180  ASP A N   1 
ATOM   1317 C  CA  . ASP A 1 178 ? 10.492  -6.734  51.183  1.00 19.36 ? 180  ASP A CA  1 
ATOM   1318 C  C   . ASP A 1 178 ? 9.924   -8.062  51.697  1.00 18.13 ? 180  ASP A C   1 
ATOM   1319 O  O   . ASP A 1 178 ? 8.769   -8.413  51.439  1.00 17.60 ? 180  ASP A O   1 
ATOM   1320 C  CB  . ASP A 1 178 ? 9.437   -5.645  51.258  1.00 20.16 ? 180  ASP A CB  1 
ATOM   1321 C  CG  . ASP A 1 178 ? 8.991   -5.373  52.682  1.00 21.33 ? 180  ASP A CG  1 
ATOM   1322 O  OD1 . ASP A 1 178 ? 9.480   -6.038  53.623  1.00 19.83 ? 180  ASP A OD1 1 
ATOM   1323 O  OD2 . ASP A 1 178 ? 8.150   -4.462  52.852  1.00 22.11 ? 180  ASP A OD2 1 
ATOM   1324 N  N   . ILE A 1 179 ? 10.738  -8.753  52.478  1.00 18.26 ? 181  ILE A N   1 
ATOM   1325 C  CA  . ILE A 1 179 ? 10.366  -10.072 52.975  1.00 18.51 ? 181  ILE A CA  1 
ATOM   1326 C  C   . ILE A 1 179 ? 9.147   -9.943  53.891  1.00 18.23 ? 181  ILE A C   1 
ATOM   1327 O  O   . ILE A 1 179 ? 8.284   -10.832 53.898  1.00 17.44 ? 181  ILE A O   1 
ATOM   1328 C  CB  . ILE A 1 179 ? 11.546  -10.770 53.678  1.00 18.17 ? 181  ILE A CB  1 
ATOM   1329 C  CG1 . ILE A 1 179 ? 12.699  -11.029 52.695  1.00 18.17 ? 181  ILE A CG1 1 
ATOM   1330 C  CG2 . ILE A 1 179 ? 11.116  -12.082 54.338  1.00 17.91 ? 181  ILE A CG2 1 
ATOM   1331 C  CD1 . ILE A 1 179 ? 12.327  -11.877 51.494  1.00 18.09 ? 181  ILE A CD1 1 
ATOM   1332 N  N   . SER A 1 180 ? 9.053   -8.832  54.624  1.00 18.70 ? 182  SER A N   1 
ATOM   1333 C  CA  . SER A 1 180 ? 7.902   -8.629  55.525  1.00 19.08 ? 182  SER A CA  1 
ATOM   1334 C  C   . SER A 1 180 ? 6.567   -8.462  54.751  1.00 19.24 ? 182  SER A C   1 
ATOM   1335 O  O   . SER A 1 180 ? 5.500   -8.650  55.326  1.00 19.76 ? 182  SER A O   1 
ATOM   1336 C  CB  . SER A 1 180 ? 8.160   -7.462  56.480  1.00 18.67 ? 182  SER A CB  1 
ATOM   1337 O  OG  . SER A 1 180 ? 7.887   -6.242  55.825  1.00 20.36 ? 182  SER A OG  1 
ATOM   1338 N  N   . ALA A 1 181 ? 6.622   -8.162  53.450  1.00 18.15 ? 183  ALA A N   1 
ATOM   1339 C  CA  . ALA A 1 181 ? 5.422   -8.088  52.612  1.00 18.73 ? 183  ALA A CA  1 
ATOM   1340 C  C   . ALA A 1 181 ? 4.821   -9.451  52.282  1.00 20.62 ? 183  ALA A C   1 
ATOM   1341 O  O   . ALA A 1 181 ? 3.738   -9.518  51.730  1.00 21.02 ? 183  ALA A O   1 
ATOM   1342 C  CB  . ALA A 1 181 ? 5.706   -7.296  51.335  1.00 19.42 ? 183  ALA A CB  1 
ATOM   1343 N  N   . LEU A 1 182 ? 5.523   -10.538 52.609  1.00 19.61 ? 184  LEU A N   1 
ATOM   1344 C  CA  . LEU A 1 182 ? 4.959   -11.888 52.513  1.00 19.30 ? 184  LEU A CA  1 
ATOM   1345 C  C   . LEU A 1 182 ? 4.194   -12.270 53.774  1.00 18.51 ? 184  LEU A C   1 
ATOM   1346 O  O   . LEU A 1 182 ? 3.581   -13.341 53.820  1.00 19.58 ? 184  LEU A O   1 
ATOM   1347 C  CB  . LEU A 1 182 ? 6.088   -12.904 52.277  1.00 18.38 ? 184  LEU A CB  1 
ATOM   1348 C  CG  . LEU A 1 182 ? 6.976   -12.612 51.065  1.00 17.91 ? 184  LEU A CG  1 
ATOM   1349 C  CD1 . LEU A 1 182 ? 8.300   -13.366 51.122  1.00 17.42 ? 184  LEU A CD1 1 
ATOM   1350 C  CD2 . LEU A 1 182 ? 6.219   -12.924 49.774  1.00 18.00 ? 184  LEU A CD2 1 
ATOM   1351 N  N   . LEU A 1 183 ? 4.277   -11.423 54.805  1.00 19.90 ? 185  LEU A N   1 
ATOM   1352 C  CA  . LEU A 1 183 ? 3.558   -11.605 56.060  1.00 20.12 ? 185  LEU A CA  1 
ATOM   1353 C  C   . LEU A 1 183 ? 2.378   -10.620 56.195  1.00 21.15 ? 185  LEU A C   1 
ATOM   1354 O  O   . LEU A 1 183 ? 2.352   -9.587  55.537  1.00 21.17 ? 185  LEU A O   1 
ATOM   1355 C  CB  . LEU A 1 183 ? 4.526   -11.459 57.239  1.00 19.91 ? 185  LEU A CB  1 
ATOM   1356 C  CG  . LEU A 1 183 ? 5.624   -12.550 57.338  1.00 21.02 ? 185  LEU A CG  1 
ATOM   1357 C  CD1 . LEU A 1 183 ? 6.641   -12.194 58.405  1.00 22.63 ? 185  LEU A CD1 1 
ATOM   1358 C  CD2 . LEU A 1 183 ? 5.039   -13.910 57.626  1.00 21.06 ? 185  LEU A CD2 1 
ATOM   1359 N  N   . PRO A 1 184 ? 1.417   -10.927 57.085  1.00 21.26 ? 186  PRO A N   1 
ATOM   1360 C  CA  . PRO A 1 184 ? 0.341   -9.950  57.383  1.00 22.68 ? 186  PRO A CA  1 
ATOM   1361 C  C   . PRO A 1 184 ? 0.893   -8.646  57.936  1.00 23.18 ? 186  PRO A C   1 
ATOM   1362 O  O   . PRO A 1 184 ? 1.969   -8.637  58.538  1.00 23.32 ? 186  PRO A O   1 
ATOM   1363 C  CB  . PRO A 1 184 ? -0.503  -10.659 58.454  1.00 22.96 ? 186  PRO A CB  1 
ATOM   1364 C  CG  . PRO A 1 184 ? -0.038  -12.056 58.512  1.00 22.96 ? 186  PRO A CG  1 
ATOM   1365 C  CD  . PRO A 1 184 ? 1.321   -12.135 57.911  1.00 21.51 ? 186  PRO A CD  1 
ATOM   1366 N  N   . SER A 1 185 ? 0.171   -7.541  57.760  1.00 25.76 ? 187  SER A N   1 
ATOM   1367 C  CA  . SER A 1 185 ? 0.614   -6.275  58.341  1.00 27.29 ? 187  SER A CA  1 
ATOM   1368 C  C   . SER A 1 185 ? 0.311   -6.239  59.845  1.00 27.69 ? 187  SER A C   1 
ATOM   1369 O  O   . SER A 1 185 ? 0.967   -5.515  60.582  1.00 26.64 ? 187  SER A O   1 
ATOM   1370 C  CB  . SER A 1 185 ? -0.061  -5.093  57.650  1.00 30.65 ? 187  SER A CB  1 
ATOM   1371 O  OG  . SER A 1 185 ? -1.450  -5.231  57.786  1.00 31.70 ? 187  SER A OG  1 
ATOM   1372 N  N   . ASP A 1 186 ? -0.664  -7.023  60.304  1.00 26.92 ? 188  ASP A N   1 
ATOM   1373 C  CA  . ASP A 1 186 ? -0.989  -7.045  61.743  1.00 28.78 ? 188  ASP A CA  1 
ATOM   1374 C  C   . ASP A 1 186 ? -0.012  -7.970  62.516  1.00 26.29 ? 188  ASP A C   1 
ATOM   1375 O  O   . ASP A 1 186 ? -0.248  -9.171  62.593  1.00 28.70 ? 188  ASP A O   1 
ATOM   1376 C  CB  . ASP A 1 186 ? -2.447  -7.492  61.938  1.00 30.17 ? 188  ASP A CB  1 
ATOM   1377 C  CG  . ASP A 1 186 ? -2.873  -7.537  63.405  1.00 32.42 ? 188  ASP A CG  1 
ATOM   1378 O  OD1 . ASP A 1 186 ? -2.015  -7.355  64.305  1.00 33.37 ? 188  ASP A OD1 1 
ATOM   1379 O  OD2 . ASP A 1 186 ? -4.078  -7.780  63.647  1.00 30.28 ? 188  ASP A OD2 1 
ATOM   1380 N  N   . PHE A 1 187 ? 1.036   -7.389  63.098  1.00 26.14 ? 189  PHE A N   1 
ATOM   1381 C  CA  . PHE A 1 187 ? 1.985   -8.111  63.965  1.00 29.28 ? 189  PHE A CA  1 
ATOM   1382 C  C   . PHE A 1 187 ? 1.595   -8.152  65.457  1.00 29.17 ? 189  PHE A C   1 
ATOM   1383 O  O   . PHE A 1 187 ? 2.379   -8.654  66.272  1.00 26.66 ? 189  PHE A O   1 
ATOM   1384 C  CB  . PHE A 1 187 ? 3.403   -7.506  63.854  1.00 30.94 ? 189  PHE A CB  1 
ATOM   1385 C  CG  . PHE A 1 187 ? 4.086   -7.691  62.503  1.00 35.80 ? 189  PHE A CG  1 
ATOM   1386 C  CD1 . PHE A 1 187 ? 3.773   -8.734  61.640  1.00 37.91 ? 189  PHE A CD1 1 
ATOM   1387 C  CD2 . PHE A 1 187 ? 5.119   -6.815  62.128  1.00 41.33 ? 189  PHE A CD2 1 
ATOM   1388 C  CE1 . PHE A 1 187 ? 4.440   -8.879  60.417  1.00 39.56 ? 189  PHE A CE1 1 
ATOM   1389 C  CE2 . PHE A 1 187 ? 5.781   -6.955  60.908  1.00 40.21 ? 189  PHE A CE2 1 
ATOM   1390 C  CZ  . PHE A 1 187 ? 5.431   -7.983  60.052  1.00 37.88 ? 189  PHE A CZ  1 
ATOM   1391 N  N   . SER A 1 188 ? 0.397   -7.658  65.804  1.00 28.06 ? 190  SER A N   1 
ATOM   1392 C  CA  . SER A 1 188 ? -0.067  -7.567  67.196  1.00 26.83 ? 190  SER A CA  1 
ATOM   1393 C  C   . SER A 1 188 ? -0.883  -8.727  67.652  1.00 24.66 ? 190  SER A C   1 
ATOM   1394 O  O   . SER A 1 188 ? -0.913  -9.006  68.854  1.00 26.71 ? 190  SER A O   1 
ATOM   1395 C  CB  . SER A 1 188 ? -0.939  -6.312  67.396  1.00 29.83 ? 190  SER A CB  1 
ATOM   1396 O  OG  . SER A 1 188 ? -0.152  -5.163  67.194  1.00 29.58 ? 190  SER A OG  1 
ATOM   1397 N  N   . ARG A 1 189 ? -1.590  -9.378  66.735  1.00 22.76 ? 191  ARG A N   1 
ATOM   1398 C  CA  . ARG A 1 189 ? -2.537  -10.410 67.091  1.00 24.38 ? 191  ARG A CA  1 
ATOM   1399 C  C   . ARG A 1 189 ? -2.090  -11.767 66.562  1.00 23.70 ? 191  ARG A C   1 
ATOM   1400 O  O   . ARG A 1 189 ? -2.001  -11.989 65.352  1.00 22.10 ? 191  ARG A O   1 
ATOM   1401 C  CB  . ARG A 1 189 ? -3.941  -10.036 66.605  1.00 25.68 ? 191  ARG A CB  1 
ATOM   1402 C  CG  . ARG A 1 189 ? -4.347  -8.629  67.064  1.00 26.73 ? 191  ARG A CG  1 
ATOM   1403 C  CD  . ARG A 1 189 ? -5.687  -8.203  66.502  1.00 27.43 ? 191  ARG A CD  1 
ATOM   1404 N  NE  . ARG A 1 189 ? -6.826  -8.993  66.984  1.00 30.33 ? 191  ARG A NE  1 
ATOM   1405 C  CZ  . ARG A 1 189 ? -7.485  -8.788  68.126  1.00 28.62 ? 191  ARG A CZ  1 
ATOM   1406 N  NH1 . ARG A 1 189 ? -7.092  -7.851  68.955  1.00 26.64 ? 191  ARG A NH1 1 
ATOM   1407 N  NH2 . ARG A 1 189 ? -8.562  -9.542  68.433  1.00 30.16 ? 191  ARG A NH2 1 
ATOM   1408 N  N   . TYR A 1 190 ? -1.799  -12.678 67.483  1.00 22.91 ? 192  TYR A N   1 
ATOM   1409 C  CA  . TYR A 1 190 ? -1.219  -13.962 67.117  1.00 20.51 ? 192  TYR A CA  1 
ATOM   1410 C  C   . TYR A 1 190 ? -1.349  -14.942 68.256  1.00 21.47 ? 192  TYR A C   1 
ATOM   1411 O  O   . TYR A 1 190 ? -1.578  -14.524 69.416  1.00 23.82 ? 192  TYR A O   1 
ATOM   1412 C  CB  . TYR A 1 190 ? 0.253   -13.795 66.737  1.00 20.19 ? 192  TYR A CB  1 
ATOM   1413 C  CG  . TYR A 1 190 ? 1.115   -13.203 67.794  1.00 19.67 ? 192  TYR A CG  1 
ATOM   1414 C  CD1 . TYR A 1 190 ? 1.617   -13.986 68.860  1.00 19.50 ? 192  TYR A CD1 1 
ATOM   1415 C  CD2 . TYR A 1 190 ? 1.458   -11.859 67.768  1.00 19.79 ? 192  TYR A CD2 1 
ATOM   1416 C  CE1 . TYR A 1 190 ? 2.430   -13.414 69.834  1.00 19.24 ? 192  TYR A CE1 1 
ATOM   1417 C  CE2 . TYR A 1 190 ? 2.271   -11.302 68.735  1.00 20.09 ? 192  TYR A CE2 1 
ATOM   1418 C  CZ  . TYR A 1 190 ? 2.746   -12.093 69.780  1.00 19.53 ? 192  TYR A CZ  1 
ATOM   1419 O  OH  . TYR A 1 190 ? 3.554   -11.493 70.741  1.00 22.46 ? 192  TYR A OH  1 
ATOM   1420 N  N   . PHE A 1 191 ? -1.297  -16.218 67.892  1.00 21.55 ? 193  PHE A N   1 
ATOM   1421 C  CA  . PHE A 1 191 ? -1.236  -17.316 68.813  1.00 21.97 ? 193  PHE A CA  1 
ATOM   1422 C  C   . PHE A 1 191 ? 0.245   -17.679 68.974  1.00 24.27 ? 193  PHE A C   1 
ATOM   1423 O  O   . PHE A 1 191 ? 1.061   -17.397 68.089  1.00 21.91 ? 193  PHE A O   1 
ATOM   1424 C  CB  . PHE A 1 191 ? -2.042  -18.489 68.312  1.00 25.03 ? 193  PHE A CB  1 
ATOM   1425 C  CG  . PHE A 1 191 ? -3.483  -18.161 68.056  1.00 27.33 ? 193  PHE A CG  1 
ATOM   1426 C  CD1 . PHE A 1 191 ? -4.395  -18.136 69.099  1.00 29.49 ? 193  PHE A CD1 1 
ATOM   1427 C  CD2 . PHE A 1 191 ? -3.923  -17.847 66.776  1.00 28.39 ? 193  PHE A CD2 1 
ATOM   1428 C  CE1 . PHE A 1 191 ? -5.741  -17.816 68.860  1.00 31.57 ? 193  PHE A CE1 1 
ATOM   1429 C  CE2 . PHE A 1 191 ? -5.257  -17.537 66.535  1.00 30.46 ? 193  PHE A CE2 1 
ATOM   1430 C  CZ  . PHE A 1 191 ? -6.165  -17.518 67.571  1.00 29.79 ? 193  PHE A CZ  1 
ATOM   1431 N  N   . GLN A 1 192 ? 0.600   -18.244 70.126  1.00 22.44 ? 194  GLN A N   1 
ATOM   1432 C  CA  . GLN A 1 192 ? 1.974   -18.674 70.349  1.00 21.47 ? 194  GLN A CA  1 
ATOM   1433 C  C   . GLN A 1 192 ? 1.976   -19.884 71.245  1.00 21.70 ? 194  GLN A C   1 
ATOM   1434 O  O   . GLN A 1 192 ? 1.289   -19.904 72.285  1.00 22.84 ? 194  GLN A O   1 
ATOM   1435 C  CB  . GLN A 1 192 ? 2.794   -17.575 70.962  1.00 20.36 ? 194  GLN A CB  1 
ATOM   1436 C  CG  . GLN A 1 192 ? 4.295   -17.843 70.973  1.00 20.31 ? 194  GLN A CG  1 
ATOM   1437 C  CD  . GLN A 1 192 ? 5.106   -16.635 71.338  1.00 18.56 ? 194  GLN A CD  1 
ATOM   1438 O  OE1 . GLN A 1 192 ? 5.463   -16.417 72.503  1.00 20.00 ? 194  GLN A OE1 1 
ATOM   1439 N  NE2 . GLN A 1 192 ? 5.359   -15.781 70.354  1.00 20.29 ? 194  GLN A NE2 1 
ATOM   1440 N  N   . TYR A 1 193 ? 2.710   -20.896 70.815  1.00 20.33 ? 195  TYR A N   1 
ATOM   1441 C  CA  . TYR A 1 193 ? 2.825   -22.133 71.583  1.00 19.75 ? 195  TYR A CA  1 
ATOM   1442 C  C   . TYR A 1 193 ? 4.206   -22.757 71.331  1.00 21.29 ? 195  TYR A C   1 
ATOM   1443 O  O   . TYR A 1 193 ? 4.889   -22.404 70.356  1.00 19.79 ? 195  TYR A O   1 
ATOM   1444 C  CB  . TYR A 1 193 ? 1.711   -23.084 71.216  1.00 19.25 ? 195  TYR A CB  1 
ATOM   1445 C  CG  . TYR A 1 193 ? 1.870   -23.782 69.920  1.00 19.42 ? 195  TYR A CG  1 
ATOM   1446 C  CD1 . TYR A 1 193 ? 1.530   -23.162 68.719  1.00 19.31 ? 195  TYR A CD1 1 
ATOM   1447 C  CD2 . TYR A 1 193 ? 2.384   -25.046 69.872  1.00 19.01 ? 195  TYR A CD2 1 
ATOM   1448 C  CE1 . TYR A 1 193 ? 1.675   -23.804 67.510  1.00 19.42 ? 195  TYR A CE1 1 
ATOM   1449 C  CE2 . TYR A 1 193 ? 2.532   -25.709 68.682  1.00 20.04 ? 195  TYR A CE2 1 
ATOM   1450 C  CZ  . TYR A 1 193 ? 2.202   -25.082 67.491  1.00 18.99 ? 195  TYR A CZ  1 
ATOM   1451 O  OH  . TYR A 1 193 ? 2.370   -25.786 66.340  1.00 19.32 ? 195  TYR A OH  1 
ATOM   1452 N  N   . GLU A 1 194 ? 4.605   -23.674 72.203  1.00 20.63 ? 196  GLU A N   1 
ATOM   1453 C  CA  . GLU A 1 194 ? 5.852   -24.401 71.983  1.00 22.88 ? 196  GLU A CA  1 
ATOM   1454 C  C   . GLU A 1 194 ? 5.600   -25.756 71.349  1.00 21.73 ? 196  GLU A C   1 
ATOM   1455 O  O   . GLU A 1 194 ? 4.761   -26.533 71.815  1.00 20.97 ? 196  GLU A O   1 
ATOM   1456 C  CB  . GLU A 1 194 ? 6.651   -24.549 73.276  1.00 26.55 ? 196  GLU A CB  1 
ATOM   1457 C  CG  . GLU A 1 194 ? 8.083   -25.018 73.007  1.00 30.07 ? 196  GLU A CG  1 
ATOM   1458 C  CD  . GLU A 1 194 ? 8.952   -25.070 74.257  1.00 33.53 ? 196  GLU A CD  1 
ATOM   1459 O  OE1 . GLU A 1 194 ? 8.896   -24.125 75.069  1.00 35.56 ? 196  GLU A OE1 1 
ATOM   1460 O  OE2 . GLU A 1 194 ? 9.680   -26.072 74.422  1.00 37.92 ? 196  GLU A OE2 1 
ATOM   1461 N  N   . GLY A 1 195 ? 6.361   -26.065 70.296  1.00 18.99 ? 197  GLY A N   1 
ATOM   1462 C  CA  . GLY A 1 195 ? 6.198   -27.313 69.596  1.00 18.44 ? 197  GLY A CA  1 
ATOM   1463 C  C   . GLY A 1 195 ? 7.468   -27.772 68.903  1.00 18.57 ? 197  GLY A C   1 
ATOM   1464 O  O   . GLY A 1 195 ? 8.548   -27.695 69.472  1.00 17.90 ? 197  GLY A O   1 
ATOM   1465 N  N   . SER A 1 196 ? 7.313   -28.234 67.679  1.00 19.61 ? 198  SER A N   1 
ATOM   1466 C  CA  . SER A 1 196 ? 8.382   -28.901 66.949  1.00 19.58 ? 198  SER A CA  1 
ATOM   1467 C  C   . SER A 1 196 ? 8.483   -28.402 65.542  1.00 19.35 ? 198  SER A C   1 
ATOM   1468 O  O   . SER A 1 196 ? 7.577   -27.740 65.033  1.00 20.05 ? 198  SER A O   1 
ATOM   1469 C  CB  . SER A 1 196 ? 8.139   -30.429 66.911  1.00 19.13 ? 198  SER A CB  1 
ATOM   1470 O  OG  . SER A 1 196 ? 7.161   -30.813 65.953  1.00 20.75 ? 198  SER A OG  1 
ATOM   1471 N  N   . LEU A 1 197 ? 9.560   -28.806 64.880  1.00 18.61 ? 199  LEU A N   1 
ATOM   1472 C  CA  . LEU A 1 197 ? 9.608   -28.743 63.431  1.00 19.66 ? 199  LEU A CA  1 
ATOM   1473 C  C   . LEU A 1 197 ? 8.567   -29.732 62.890  1.00 19.37 ? 199  LEU A C   1 
ATOM   1474 O  O   . LEU A 1 197 ? 8.341   -30.804 63.482  1.00 18.99 ? 199  LEU A O   1 
ATOM   1475 C  CB  . LEU A 1 197 ? 11.007  -29.088 62.915  1.00 19.50 ? 199  LEU A CB  1 
ATOM   1476 C  CG  . LEU A 1 197 ? 12.138  -28.189 63.436  1.00 20.49 ? 199  LEU A CG  1 
ATOM   1477 C  CD1 . LEU A 1 197 ? 13.493  -28.717 62.966  1.00 21.80 ? 199  LEU A CD1 1 
ATOM   1478 C  CD2 . LEU A 1 197 ? 11.937  -26.742 63.006  1.00 20.95 ? 199  LEU A CD2 1 
ATOM   1479 N  N   . THR A 1 198 ? 7.925   -29.371 61.780  1.00 19.16 ? 200  THR A N   1 
ATOM   1480 C  CA  . THR A 1 198 ? 6.822   -30.170 61.247  1.00 20.94 ? 200  THR A CA  1 
ATOM   1481 C  C   . THR A 1 198 ? 7.283   -31.188 60.242  1.00 20.32 ? 200  THR A C   1 
ATOM   1482 O  O   . THR A 1 198 ? 6.453   -31.831 59.589  1.00 20.90 ? 200  THR A O   1 
ATOM   1483 C  CB  . THR A 1 198 ? 5.736   -29.300 60.595  1.00 20.93 ? 200  THR A CB  1 
ATOM   1484 O  OG1 . THR A 1 198 ? 6.251   -28.743 59.388  1.00 22.52 ? 200  THR A OG1 1 
ATOM   1485 C  CG2 . THR A 1 198 ? 5.280   -28.202 61.539  1.00 21.00 ? 200  THR A CG2 1 
ATOM   1486 N  N   . THR A 1 199 ? 8.592   -31.285 60.036  1.00 20.48 ? 201  THR A N   1 
ATOM   1487 C  CA  . THR A 1 199 ? 9.150   -32.357 59.219  1.00 21.33 ? 201  THR A CA  1 
ATOM   1488 C  C   . THR A 1 199 ? 10.351  -32.877 59.989  1.00 21.71 ? 201  THR A C   1 
ATOM   1489 O  O   . THR A 1 199 ? 10.821  -32.203 60.906  1.00 20.74 ? 201  THR A O   1 
ATOM   1490 C  CB  . THR A 1 199 ? 9.651   -31.876 57.840  1.00 21.82 ? 201  THR A CB  1 
ATOM   1491 O  OG1 . THR A 1 199 ? 10.787  -31.043 58.020  1.00 22.74 ? 201  THR A OG1 1 
ATOM   1492 C  CG2 . THR A 1 199 ? 8.565   -31.125 57.039  1.00 21.80 ? 201  THR A CG2 1 
ATOM   1493 N  N   . PRO A 1 200 ? 10.878  -34.053 59.601  1.00 22.73 ? 202  PRO A N   1 
ATOM   1494 C  CA  . PRO A 1 200 ? 12.086  -34.485 60.254  1.00 23.08 ? 202  PRO A CA  1 
ATOM   1495 C  C   . PRO A 1 200 ? 13.165  -33.428 60.182  1.00 24.21 ? 202  PRO A C   1 
ATOM   1496 O  O   . PRO A 1 200 ? 13.286  -32.759 59.155  1.00 24.52 ? 202  PRO A O   1 
ATOM   1497 C  CB  . PRO A 1 200 ? 12.462  -35.754 59.497  1.00 23.95 ? 202  PRO A CB  1 
ATOM   1498 C  CG  . PRO A 1 200 ? 11.137  -36.307 59.042  1.00 24.20 ? 202  PRO A CG  1 
ATOM   1499 C  CD  . PRO A 1 200 ? 10.370  -35.074 58.656  1.00 23.79 ? 202  PRO A CD  1 
ATOM   1500 N  N   . PRO A 1 201 ? 13.954  -33.258 61.232  1.00 24.29 ? 203  PRO A N   1 
ATOM   1501 C  CA  . PRO A 1 201 ? 14.017  -34.149 62.403  1.00 25.55 ? 203  PRO A CA  1 
ATOM   1502 C  C   . PRO A 1 201 ? 12.946  -33.929 63.497  1.00 25.19 ? 203  PRO A C   1 
ATOM   1503 O  O   . PRO A 1 201 ? 13.007  -34.587 64.530  1.00 26.52 ? 203  PRO A O   1 
ATOM   1504 C  CB  . PRO A 1 201 ? 15.408  -33.842 62.957  1.00 24.99 ? 203  PRO A CB  1 
ATOM   1505 C  CG  . PRO A 1 201 ? 15.572  -32.403 62.671  1.00 24.05 ? 203  PRO A CG  1 
ATOM   1506 C  CD  . PRO A 1 201 ? 14.872  -32.116 61.365  1.00 23.97 ? 203  PRO A CD  1 
ATOM   1507 N  N   . CYS A 1 202 ? 11.952  -33.071 63.259  1.00 25.08 ? 204  CYS A N   1 
ATOM   1508 C  CA  . CYS A 1 202 ? 10.848  -32.827 64.211  1.00 23.88 ? 204  CYS A CA  1 
ATOM   1509 C  C   . CYS A 1 202 ? 11.311  -32.472 65.625  1.00 22.57 ? 204  CYS A C   1 
ATOM   1510 O  O   . CYS A 1 202 ? 10.641  -32.812 66.609  1.00 21.81 ? 204  CYS A O   1 
ATOM   1511 C  CB  . CYS A 1 202 ? 9.900   -34.023 64.315  1.00 26.05 ? 204  CYS A CB  1 
ATOM   1512 S  SG  . CYS A 1 202 ? 9.286   -34.796 62.812  1.00 25.19 ? 204  CYS A SG  1 
ATOM   1513 N  N   . ALA A 1 203 ? 12.452  -31.788 65.737  1.00 20.91 ? 205  ALA A N   1 
ATOM   1514 C  CA  . ALA A 1 203 ? 12.977  -31.427 67.034  1.00 20.73 ? 205  ALA A CA  1 
ATOM   1515 C  C   . ALA A 1 203 ? 11.990  -30.524 67.745  1.00 20.59 ? 205  ALA A C   1 
ATOM   1516 O  O   . ALA A 1 203 ? 11.406  -29.648 67.120  1.00 20.82 ? 205  ALA A O   1 
ATOM   1517 C  CB  . ALA A 1 203 ? 14.299  -30.726 66.914  1.00 20.59 ? 205  ALA A CB  1 
ATOM   1518 N  N   . GLN A 1 204 ? 11.863  -30.725 69.049  1.00 19.83 ? 206  GLN A N   1 
ATOM   1519 C  CA  . GLN A 1 204 ? 11.039  -29.875 69.907  1.00 20.81 ? 206  GLN A CA  1 
ATOM   1520 C  C   . GLN A 1 204 ? 11.778  -28.626 70.409  1.00 19.29 ? 206  GLN A C   1 
ATOM   1521 O  O   . GLN A 1 204 ? 12.923  -28.375 70.028  1.00 19.39 ? 206  GLN A O   1 
ATOM   1522 C  CB  . GLN A 1 204 ? 10.447  -30.750 71.037  1.00 21.93 ? 206  GLN A CB  1 
ATOM   1523 C  CG  . GLN A 1 204 ? 9.529   -31.807 70.443  1.00 23.27 ? 206  GLN A CG  1 
ATOM   1524 C  CD  . GLN A 1 204 ? 8.825   -32.724 71.442  1.00 24.71 ? 206  GLN A CD  1 
ATOM   1525 O  OE1 . GLN A 1 204 ? 7.885   -33.438 71.070  1.00 23.68 ? 206  GLN A OE1 1 
ATOM   1526 N  NE2 . GLN A 1 204 ? 9.271   -32.709 72.707  1.00 25.05 ? 206  GLN A NE2 1 
ATOM   1527 N  N   . GLY A 1 205 ? 11.115  -27.817 71.226  1.00 17.95 ? 207  GLY A N   1 
ATOM   1528 C  CA  . GLY A 1 205 ? 11.692  -26.582 71.712  1.00 18.39 ? 207  GLY A CA  1 
ATOM   1529 C  C   . GLY A 1 205 ? 11.462  -25.412 70.761  1.00 18.73 ? 207  GLY A C   1 
ATOM   1530 O  O   . GLY A 1 205 ? 12.033  -24.348 70.962  1.00 20.23 ? 207  GLY A O   1 
ATOM   1531 N  N   . VAL A 1 206 ? 10.639  -25.609 69.738  1.00 18.12 ? 208  VAL A N   1 
ATOM   1532 C  CA  . VAL A 1 206 ? 10.426  -24.574 68.708  1.00 17.97 ? 208  VAL A CA  1 
ATOM   1533 C  C   . VAL A 1 206 ? 9.290   -23.663 69.191  1.00 18.29 ? 208  VAL A C   1 
ATOM   1534 O  O   . VAL A 1 206 ? 8.233   -24.175 69.544  1.00 18.43 ? 208  VAL A O   1 
ATOM   1535 C  CB  . VAL A 1 206 ? 10.045  -25.215 67.366  1.00 17.41 ? 208  VAL A CB  1 
ATOM   1536 C  CG1 . VAL A 1 206 ? 9.807   -24.161 66.295  1.00 17.57 ? 208  VAL A CG1 1 
ATOM   1537 C  CG2 . VAL A 1 206 ? 11.139  -26.172 66.899  1.00 17.60 ? 208  VAL A CG2 1 
ATOM   1538 N  N   . ILE A 1 207 ? 9.498   -22.351 69.157  1.00 17.96 ? 209  ILE A N   1 
ATOM   1539 C  CA  . ILE A 1 207 ? 8.442   -21.375 69.468  1.00 19.33 ? 209  ILE A CA  1 
ATOM   1540 C  C   . ILE A 1 207 ? 7.704   -21.028 68.174  1.00 18.72 ? 209  ILE A C   1 
ATOM   1541 O  O   . ILE A 1 207 ? 8.293   -20.430 67.236  1.00 18.01 ? 209  ILE A O   1 
ATOM   1542 C  CB  . ILE A 1 207 ? 8.990   -20.088 70.091  1.00 20.24 ? 209  ILE A CB  1 
ATOM   1543 C  CG1 . ILE A 1 207 ? 9.918   -20.378 71.285  1.00 22.61 ? 209  ILE A CG1 1 
ATOM   1544 C  CG2 . ILE A 1 207 ? 7.852   -19.135 70.483  1.00 20.82 ? 209  ILE A CG2 1 
ATOM   1545 C  CD1 . ILE A 1 207 ? 9.251   -21.089 72.432  1.00 24.11 ? 209  ILE A CD1 1 
ATOM   1546 N  N   . TRP A 1 208 ? 6.428   -21.412 68.130  1.00 18.32 ? 210  TRP A N   1 
ATOM   1547 C  CA  . TRP A 1 208 ? 5.547   -21.146 67.009  1.00 17.68 ? 210  TRP A CA  1 
ATOM   1548 C  C   . TRP A 1 208 ? 4.718   -19.905 67.303  1.00 19.04 ? 210  TRP A C   1 
ATOM   1549 O  O   . TRP A 1 208 ? 4.146   -19.786 68.382  1.00 17.78 ? 210  TRP A O   1 
ATOM   1550 C  CB  . TRP A 1 208 ? 4.619   -22.330 66.749  1.00 17.99 ? 210  TRP A CB  1 
ATOM   1551 C  CG  . TRP A 1 208 ? 5.296   -23.399 66.036  1.00 18.71 ? 210  TRP A CG  1 
ATOM   1552 C  CD1 . TRP A 1 208 ? 5.954   -24.485 66.579  1.00 18.44 ? 210  TRP A CD1 1 
ATOM   1553 C  CD2 . TRP A 1 208 ? 5.450   -23.491 64.637  1.00 17.88 ? 210  TRP A CD2 1 
ATOM   1554 N  NE1 . TRP A 1 208 ? 6.493   -25.234 65.586  1.00 19.01 ? 210  TRP A NE1 1 
ATOM   1555 C  CE2 . TRP A 1 208 ? 6.206   -24.646 64.378  1.00 17.67 ? 210  TRP A CE2 1 
ATOM   1556 C  CE3 . TRP A 1 208 ? 5.038   -22.685 63.557  1.00 17.71 ? 210  TRP A CE3 1 
ATOM   1557 C  CZ2 . TRP A 1 208 ? 6.537   -25.038 63.085  1.00 18.13 ? 210  TRP A CZ2 1 
ATOM   1558 C  CZ3 . TRP A 1 208 ? 5.359   -23.087 62.270  1.00 17.86 ? 210  TRP A CZ3 1 
ATOM   1559 C  CH2 . TRP A 1 208 ? 6.110   -24.230 62.042  1.00 18.35 ? 210  TRP A CH2 1 
ATOM   1560 N  N   . THR A 1 209 ? 4.682   -18.990 66.343  1.00 18.91 ? 211  THR A N   1 
ATOM   1561 C  CA  . THR A 1 209 ? 3.866   -17.788 66.406  1.00 20.52 ? 211  THR A CA  1 
ATOM   1562 C  C   . THR A 1 209 ? 2.994   -17.812 65.146  1.00 21.14 ? 211  THR A C   1 
ATOM   1563 O  O   . THR A 1 209 ? 3.526   -17.835 64.037  1.00 18.33 ? 211  THR A O   1 
ATOM   1564 C  CB  . THR A 1 209 ? 4.733   -16.534 66.438  1.00 20.38 ? 211  THR A CB  1 
ATOM   1565 O  OG1 . THR A 1 209 ? 5.551   -16.534 67.611  1.00 19.48 ? 211  THR A OG1 1 
ATOM   1566 C  CG2 . THR A 1 209 ? 3.881   -15.256 66.434  1.00 22.43 ? 211  THR A CG2 1 
ATOM   1567 N  N   . VAL A 1 210 ? 1.659   -17.805 65.319  1.00 19.32 ? 212  VAL A N   1 
ATOM   1568 C  CA  . VAL A 1 210 ? 0.731   -17.973 64.207  1.00 20.42 ? 212  VAL A CA  1 
ATOM   1569 C  C   . VAL A 1 210 ? -0.147  -16.734 64.189  1.00 21.37 ? 212  VAL A C   1 
ATOM   1570 O  O   . VAL A 1 210 ? -0.878  -16.489 65.175  1.00 20.68 ? 212  VAL A O   1 
ATOM   1571 C  CB  . VAL A 1 210 ? -0.140  -19.223 64.343  1.00 21.25 ? 212  VAL A CB  1 
ATOM   1572 C  CG1 . VAL A 1 210 ? -1.114  -19.301 63.172  1.00 21.00 ? 212  VAL A CG1 1 
ATOM   1573 C  CG2 . VAL A 1 210 ? 0.712   -20.486 64.458  1.00 21.68 ? 212  VAL A CG2 1 
ATOM   1574 N  N   . PHE A 1 211 ? -0.049  -15.942 63.110  1.00 21.28 ? 213  PHE A N   1 
ATOM   1575 C  CA  . PHE A 1 211 ? -0.785  -14.658 62.997  1.00 21.24 ? 213  PHE A CA  1 
ATOM   1576 C  C   . PHE A 1 211 ? -2.309  -14.871 62.927  1.00 19.82 ? 213  PHE A C   1 
ATOM   1577 O  O   . PHE A 1 211 ? -2.792  -15.836 62.336  1.00 20.69 ? 213  PHE A O   1 
ATOM   1578 C  CB  . PHE A 1 211 ? -0.336  -13.819 61.772  1.00 23.17 ? 213  PHE A CB  1 
ATOM   1579 C  CG  . PHE A 1 211 ? 1.083   -13.319 61.856  1.00 26.80 ? 213  PHE A CG  1 
ATOM   1580 C  CD1 . PHE A 1 211 ? 1.406   -12.224 62.622  1.00 30.44 ? 213  PHE A CD1 1 
ATOM   1581 C  CD2 . PHE A 1 211 ? 2.105   -13.976 61.178  1.00 27.27 ? 213  PHE A CD2 1 
ATOM   1582 C  CE1 . PHE A 1 211 ? 2.726   -11.789 62.711  1.00 34.69 ? 213  PHE A CE1 1 
ATOM   1583 C  CE2 . PHE A 1 211 ? 3.408   -13.540 61.253  1.00 26.88 ? 213  PHE A CE2 1 
ATOM   1584 C  CZ  . PHE A 1 211 ? 3.728   -12.453 62.002  1.00 30.16 ? 213  PHE A CZ  1 
ATOM   1585 N  N   . ASN A 1 212 ? -3.045  -13.979 63.586  1.00 21.24 ? 214  ASN A N   1 
ATOM   1586 C  CA  . ASN A 1 212 ? -4.518  -13.894 63.500  1.00 22.29 ? 214  ASN A CA  1 
ATOM   1587 C  C   . ASN A 1 212 ? -4.874  -13.515 62.041  1.00 20.61 ? 214  ASN A C   1 
ATOM   1588 O  O   . ASN A 1 212 ? -5.639  -14.198 61.370  1.00 20.93 ? 214  ASN A O   1 
ATOM   1589 C  CB  . ASN A 1 212 ? -5.019  -12.780 64.510  1.00 24.14 ? 214  ASN A CB  1 
ATOM   1590 C  CG  . ASN A 1 212 ? -6.554  -12.681 64.647  1.00 27.68 ? 214  ASN A CG  1 
ATOM   1591 O  OD1 . ASN A 1 212 ? -7.141  -11.696 65.259  1.00 25.69 ? 214  ASN A OD1 1 
ATOM   1592 N  ND2 . ASN A 1 212 ? -7.219  -13.702 64.152  1.00 31.45 ? 214  ASN A ND2 1 
ATOM   1593 N  N   . GLN A 1 213 ? -4.263  -12.457 61.552  1.00 21.08 ? 215  GLN A N   1 
ATOM   1594 C  CA  . GLN A 1 213 ? -4.554  -11.979 60.204  1.00 22.82 ? 215  GLN A CA  1 
ATOM   1595 C  C   . GLN A 1 213 ? -3.923  -12.897 59.131  1.00 23.47 ? 215  GLN A C   1 
ATOM   1596 O  O   . GLN A 1 213 ? -2.799  -13.404 59.304  1.00 23.66 ? 215  GLN A O   1 
ATOM   1597 C  CB  . GLN A 1 213 ? -4.105  -10.563 60.048  1.00 24.62 ? 215  GLN A CB  1 
ATOM   1598 C  CG  . GLN A 1 213 ? -4.530  -9.975  58.716  1.00 26.53 ? 215  GLN A CG  1 
ATOM   1599 C  CD  . GLN A 1 213 ? -4.012  -8.588  58.463  1.00 29.80 ? 215  GLN A CD  1 
ATOM   1600 O  OE1 . GLN A 1 213 ? -2.956  -8.194  58.932  1.00 28.72 ? 215  GLN A OE1 1 
ATOM   1601 N  NE2 . GLN A 1 213 ? -4.756  -7.840  57.655  1.00 34.79 ? 215  GLN A NE2 1 
ATOM   1602 N  N   . THR A 1 214 ? -4.671  -13.137 58.054  1.00 22.58 ? 216  THR A N   1 
ATOM   1603 C  CA  . THR A 1 214 ? -4.201  -13.930 56.931  1.00 22.00 ? 216  THR A CA  1 
ATOM   1604 C  C   . THR A 1 214 ? -3.620  -13.062 55.813  1.00 21.06 ? 216  THR A C   1 
ATOM   1605 O  O   . THR A 1 214 ? -3.803  -11.863 55.800  1.00 21.10 ? 216  THR A O   1 
ATOM   1606 C  CB  . THR A 1 214 ? -5.316  -14.811 56.362  1.00 23.08 ? 216  THR A CB  1 
ATOM   1607 O  OG1 . THR A 1 214 ? -6.339  -13.986 55.775  1.00 23.79 ? 216  THR A OG1 1 
ATOM   1608 C  CG2 . THR A 1 214 ? -5.913  -15.679 57.475  1.00 24.23 ? 216  THR A CG2 1 
ATOM   1609 N  N   . VAL A 1 215 ? -2.881  -13.693 54.904  1.00 20.21 ? 217  VAL A N   1 
ATOM   1610 C  CA  . VAL A 1 215 ? -2.351  -13.037 53.726  1.00 21.00 ? 217  VAL A CA  1 
ATOM   1611 C  C   . VAL A 1 215 ? -3.210  -13.446 52.506  1.00 20.74 ? 217  VAL A C   1 
ATOM   1612 O  O   . VAL A 1 215 ? -3.629  -14.594 52.392  1.00 19.18 ? 217  VAL A O   1 
ATOM   1613 C  CB  . VAL A 1 215 ? -0.868  -13.425 53.536  1.00 23.50 ? 217  VAL A CB  1 
ATOM   1614 C  CG1 . VAL A 1 215 ? -0.339  -12.909 52.220  1.00 24.62 ? 217  VAL A CG1 1 
ATOM   1615 C  CG2 . VAL A 1 215 ? -0.040  -12.868 54.699  1.00 24.41 ? 217  VAL A CG2 1 
ATOM   1616 N  N   . MET A 1 216 ? -3.479  -12.483 51.627  1.00 20.20 ? 218  MET A N   1 
ATOM   1617 C  CA  . MET A 1 216 ? -4.337  -12.681 50.454  1.00 22.18 ? 218  MET A CA  1 
ATOM   1618 C  C   . MET A 1 216 ? -3.539  -12.930 49.160  1.00 20.35 ? 218  MET A C   1 
ATOM   1619 O  O   . MET A 1 216 ? -2.732  -12.094 48.759  1.00 18.42 ? 218  MET A O   1 
ATOM   1620 C  CB  . MET A 1 216 ? -5.184  -11.422 50.234  1.00 25.38 ? 218  MET A CB  1 
ATOM   1621 C  CG  . MET A 1 216 ? -6.006  -10.989 51.438  1.00 28.48 ? 218  MET A CG  1 
ATOM   1622 S  SD  . MET A 1 216 ? -7.036  -12.302 52.103  1.00 38.24 ? 218  MET A SD  1 
ATOM   1623 C  CE  . MET A 1 216 ? -8.110  -12.387 50.766  1.00 33.70 ? 218  MET A CE  1 
ATOM   1624 N  N   . LEU A 1 217 ? -3.788  -14.071 48.525  1.00 19.77 ? 219  LEU A N   1 
ATOM   1625 C  CA  . LEU A 1 217 ? -3.267  -14.361 47.183  1.00 19.78 ? 219  LEU A CA  1 
ATOM   1626 C  C   . LEU A 1 217 ? -4.442  -14.520 46.222  1.00 20.19 ? 219  LEU A C   1 
ATOM   1627 O  O   . LEU A 1 217 ? -5.526  -14.882 46.652  1.00 19.14 ? 219  LEU A O   1 
ATOM   1628 C  CB  . LEU A 1 217 ? -2.474  -15.669 47.198  1.00 19.87 ? 219  LEU A CB  1 
ATOM   1629 C  CG  . LEU A 1 217 ? -1.000  -15.616 47.597  1.00 20.53 ? 219  LEU A CG  1 
ATOM   1630 C  CD1 . LEU A 1 217 ? -0.826  -15.110 49.013  1.00 20.16 ? 219  LEU A CD1 1 
ATOM   1631 C  CD2 . LEU A 1 217 ? -0.326  -16.987 47.395  1.00 20.36 ? 219  LEU A CD2 1 
ATOM   1632 N  N   . SER A 1 218 ? -4.228  -14.255 44.940  1.00 19.81 ? 220  SER A N   1 
ATOM   1633 C  CA  . SER A 1 218 ? -5.266  -14.522 43.931  1.00 19.45 ? 220  SER A CA  1 
ATOM   1634 C  C   . SER A 1 218 ? -5.474  -16.007 43.720  1.00 20.27 ? 220  SER A C   1 
ATOM   1635 O  O   . SER A 1 218 ? -4.588  -16.798 43.991  1.00 18.35 ? 220  SER A O   1 
ATOM   1636 C  CB  . SER A 1 218 ? -4.948  -13.857 42.604  1.00 19.97 ? 220  SER A CB  1 
ATOM   1637 O  OG  . SER A 1 218 ? -3.834  -14.471 41.957  1.00 20.39 ? 220  SER A OG  1 
ATOM   1638 N  N   . ALA A 1 219 ? -6.643  -16.373 43.182  1.00 20.79 ? 221  ALA A N   1 
ATOM   1639 C  CA  . ALA A 1 219 ? -6.909  -17.750 42.805  1.00 22.56 ? 221  ALA A CA  1 
ATOM   1640 C  C   . ALA A 1 219 ? -5.805  -18.286 41.874  1.00 22.57 ? 221  ALA A C   1 
ATOM   1641 O  O   . ALA A 1 219 ? -5.336  -19.406 42.049  1.00 22.89 ? 221  ALA A O   1 
ATOM   1642 C  CB  . ALA A 1 219 ? -8.280  -17.890 42.136  1.00 22.46 ? 221  ALA A CB  1 
ATOM   1643 N  N   . LYS A 1 220 ? -5.401  -17.477 40.908  1.00 22.58 ? 222  LYS A N   1 
ATOM   1644 C  CA  . LYS A 1 220 ? -4.393  -17.880 39.936  1.00 25.20 ? 222  LYS A CA  1 
ATOM   1645 C  C   . LYS A 1 220 ? -3.075  -18.174 40.649  1.00 23.28 ? 222  LYS A C   1 
ATOM   1646 O  O   . LYS A 1 220 ? -2.405  -19.155 40.327  1.00 23.78 ? 222  LYS A O   1 
ATOM   1647 C  CB  . LYS A 1 220 ? -4.164  -16.782 38.902  1.00 27.95 ? 222  LYS A CB  1 
ATOM   1648 C  CG  . LYS A 1 220 ? -3.127  -17.120 37.839  1.00 33.10 ? 222  LYS A CG  1 
ATOM   1649 C  CD  . LYS A 1 220 ? -2.890  -15.948 36.903  1.00 37.95 ? 222  LYS A CD  1 
ATOM   1650 C  CE  . LYS A 1 220 ? -2.090  -16.397 35.688  1.00 44.81 ? 222  LYS A CE  1 
ATOM   1651 N  NZ  . LYS A 1 220 ? -1.653  -15.243 34.852  1.00 49.55 ? 222  LYS A NZ  1 
ATOM   1652 N  N   . GLN A 1 221 ? -2.717  -17.305 41.588  1.00 21.30 ? 223  GLN A N   1 
ATOM   1653 C  CA  . GLN A 1 221 ? -1.497  -17.486 42.401  1.00 21.65 ? 223  GLN A CA  1 
ATOM   1654 C  C   . GLN A 1 221 ? -1.540  -18.762 43.225  1.00 20.25 ? 223  GLN A C   1 
ATOM   1655 O  O   . GLN A 1 221 ? -0.533  -19.489 43.284  1.00 20.91 ? 223  GLN A O   1 
ATOM   1656 C  CB  . GLN A 1 221 ? -1.239  -16.286 43.307  1.00 20.66 ? 223  GLN A CB  1 
ATOM   1657 C  CG  . GLN A 1 221 ? -0.732  -15.074 42.563  1.00 20.69 ? 223  GLN A CG  1 
ATOM   1658 C  CD  . GLN A 1 221 ? -0.494  -13.890 43.470  1.00 20.85 ? 223  GLN A CD  1 
ATOM   1659 O  OE1 . GLN A 1 221 ? -1.333  -13.544 44.320  1.00 21.74 ? 223  GLN A OE1 1 
ATOM   1660 N  NE2 . GLN A 1 221 ? 0.648   -13.239 43.297  1.00 21.19 ? 223  GLN A NE2 1 
ATOM   1661 N  N   . LEU A 1 222 ? -2.678  -19.045 43.859  1.00 20.66 ? 224  LEU A N   1 
ATOM   1662 C  CA  . LEU A 1 222 ? -2.808  -20.261 44.646  1.00 20.96 ? 224  LEU A CA  1 
ATOM   1663 C  C   . LEU A 1 222 ? -2.695  -21.498 43.753  1.00 22.76 ? 224  LEU A C   1 
ATOM   1664 O  O   . LEU A 1 222 ? -2.081  -22.507 44.150  1.00 23.20 ? 224  LEU A O   1 
ATOM   1665 C  CB  . LEU A 1 222 ? -4.119  -20.297 45.433  1.00 21.54 ? 224  LEU A CB  1 
ATOM   1666 C  CG  . LEU A 1 222 ? -4.127  -19.298 46.588  1.00 21.45 ? 224  LEU A CG  1 
ATOM   1667 C  CD1 . LEU A 1 222 ? -5.536  -19.063 47.138  1.00 21.90 ? 224  LEU A CD1 1 
ATOM   1668 C  CD2 . LEU A 1 222 ? -3.152  -19.755 47.661  1.00 21.37 ? 224  LEU A CD2 1 
ATOM   1669 N  N   . HIS A 1 223 ? -3.294  -21.423 42.566  1.00 23.48 ? 225  HIS A N   1 
ATOM   1670 C  CA  . HIS A 1 223 ? -3.181  -22.514 41.583  1.00 26.25 ? 225  HIS A CA  1 
ATOM   1671 C  C   . HIS A 1 223 ? -1.726  -22.705 41.103  1.00 25.50 ? 225  HIS A C   1 
ATOM   1672 O  O   . HIS A 1 223 ? -1.240  -23.851 41.027  1.00 26.27 ? 225  HIS A O   1 
ATOM   1673 C  CB  . HIS A 1 223 ? -4.149  -22.298 40.412  1.00 29.46 ? 225  HIS A CB  1 
ATOM   1674 C  CG  . HIS A 1 223 ? -4.114  -23.381 39.377  1.00 34.99 ? 225  HIS A CG  1 
ATOM   1675 N  ND1 . HIS A 1 223 ? -3.248  -23.357 38.299  1.00 37.83 ? 225  HIS A ND1 1 
ATOM   1676 C  CD2 . HIS A 1 223 ? -4.862  -24.502 39.233  1.00 37.87 ? 225  HIS A CD2 1 
ATOM   1677 C  CE1 . HIS A 1 223 ? -3.456  -24.423 37.544  1.00 38.74 ? 225  HIS A CE1 1 
ATOM   1678 N  NE2 . HIS A 1 223 ? -4.429  -25.134 38.089  1.00 38.94 ? 225  HIS A NE2 1 
ATOM   1679 N  N   . THR A 1 224 ? -1.036  -21.603 40.815  1.00 24.76 ? 226  THR A N   1 
ATOM   1680 C  CA  . THR A 1 224 ? 0.372   -21.656 40.425  1.00 24.53 ? 226  THR A CA  1 
ATOM   1681 C  C   . THR A 1 224 ? 1.199   -22.385 41.485  1.00 23.82 ? 226  THR A C   1 
ATOM   1682 O  O   . THR A 1 224 ? 1.985   -23.264 41.156  1.00 25.95 ? 226  THR A O   1 
ATOM   1683 C  CB  . THR A 1 224 ? 0.949   -20.255 40.195  1.00 23.15 ? 226  THR A CB  1 
ATOM   1684 O  OG1 . THR A 1 224 ? 0.300   -19.665 39.068  1.00 24.02 ? 226  THR A OG1 1 
ATOM   1685 C  CG2 . THR A 1 224 ? 2.466   -20.295 39.927  1.00 24.73 ? 226  THR A CG2 1 
ATOM   1686 N  N   . LEU A 1 225 ? 0.997   -22.025 42.747  1.00 23.30 ? 227  LEU A N   1 
ATOM   1687 C  CA  . LEU A 1 225 ? 1.721   -22.659 43.878  1.00 22.49 ? 227  LEU A CA  1 
ATOM   1688 C  C   . LEU A 1 225 ? 1.518   -24.168 43.941  1.00 23.16 ? 227  LEU A C   1 
ATOM   1689 O  O   . LEU A 1 225 ? 2.468   -24.933 44.152  1.00 22.98 ? 227  LEU A O   1 
ATOM   1690 C  CB  . LEU A 1 225 ? 1.267   -22.049 45.211  1.00 21.44 ? 227  LEU A CB  1 
ATOM   1691 C  CG  . LEU A 1 225 ? 1.978   -22.560 46.471  1.00 20.95 ? 227  LEU A CG  1 
ATOM   1692 C  CD1 . LEU A 1 225 ? 3.492   -22.438 46.326  1.00 21.01 ? 227  LEU A CD1 1 
ATOM   1693 C  CD2 . LEU A 1 225 ? 1.506   -21.825 47.719  1.00 22.08 ? 227  LEU A CD2 1 
ATOM   1694 N  N   . SER A 1 226 ? 0.280   -24.599 43.772  1.00 24.09 ? 228  SER A N   1 
ATOM   1695 C  CA  . SER A 1 226 ? -0.037  -26.007 43.925  1.00 27.68 ? 228  SER A CA  1 
ATOM   1696 C  C   . SER A 1 226 ? 0.095   -26.866 42.647  1.00 28.07 ? 228  SER A C   1 
ATOM   1697 O  O   . SER A 1 226 ? 0.149   -28.088 42.770  1.00 29.02 ? 228  SER A O   1 
ATOM   1698 C  CB  . SER A 1 226 ? -1.436  -26.159 44.529  1.00 28.12 ? 228  SER A CB  1 
ATOM   1699 O  OG  . SER A 1 226 ? -2.402  -25.750 43.601  1.00 27.78 ? 228  SER A OG  1 
ATOM   1700 N  N   . ASP A 1 227 ? 0.160   -26.260 41.459  1.00 28.77 ? 229  ASP A N   1 
ATOM   1701 C  CA  A ASP A 1 227 ? 0.136   -27.031 40.203  0.50 30.82 ? 229  ASP A CA  1 
ATOM   1702 C  CA  B ASP A 1 227 ? 0.113   -26.989 40.168  0.50 29.63 ? 229  ASP A CA  1 
ATOM   1703 C  C   . ASP A 1 227 ? 1.421   -26.932 39.376  1.00 29.83 ? 229  ASP A C   1 
ATOM   1704 O  O   . ASP A 1 227 ? 1.486   -27.453 38.259  1.00 29.78 ? 229  ASP A O   1 
ATOM   1705 C  CB  A ASP A 1 227 ? -1.082  -26.625 39.363  0.50 33.43 ? 229  ASP A CB  1 
ATOM   1706 C  CB  B ASP A 1 227 ? -1.023  -26.429 39.283  0.50 30.37 ? 229  ASP A CB  1 
ATOM   1707 C  CG  A ASP A 1 227 ? -2.400  -27.033 40.009  0.50 35.26 ? 229  ASP A CG  1 
ATOM   1708 C  CG  B ASP A 1 227 ? -1.348  -27.331 38.081  0.50 30.33 ? 229  ASP A CG  1 
ATOM   1709 O  OD1 A ASP A 1 227 ? -2.431  -27.334 41.216  0.50 36.18 ? 229  ASP A OD1 1 
ATOM   1710 O  OD1 B ASP A 1 227 ? -1.765  -28.482 38.292  0.50 30.50 ? 229  ASP A OD1 1 
ATOM   1711 O  OD2 A ASP A 1 227 ? -3.421  -27.074 39.296  0.50 40.52 ? 229  ASP A OD2 1 
ATOM   1712 O  OD2 B ASP A 1 227 ? -1.177  -26.885 36.928  0.50 31.57 ? 229  ASP A OD2 1 
ATOM   1713 N  N   . THR A 1 228 ? 2.463   -26.302 39.930  1.00 28.05 ? 230  THR A N   1 
ATOM   1714 C  CA  . THR A 1 228 ? 3.676   -26.064 39.162  1.00 27.02 ? 230  THR A CA  1 
ATOM   1715 C  C   . THR A 1 228 ? 4.844   -26.981 39.526  1.00 27.11 ? 230  THR A C   1 
ATOM   1716 O  O   . THR A 1 228 ? 5.577   -27.404 38.630  1.00 27.04 ? 230  THR A O   1 
ATOM   1717 C  CB  . THR A 1 228 ? 4.107   -24.598 39.219  1.00 27.89 ? 230  THR A CB  1 
ATOM   1718 O  OG1 . THR A 1 228 ? 3.000   -23.770 38.829  1.00 26.52 ? 230  THR A OG1 1 
ATOM   1719 C  CG2 . THR A 1 228 ? 5.300   -24.344 38.277  1.00 27.79 ? 230  THR A CG2 1 
ATOM   1720 N  N   . LEU A 1 229 ? 5.020   -27.295 40.805  1.00 24.69 ? 231  LEU A N   1 
ATOM   1721 C  CA  . LEU A 1 229 ? 6.220   -27.997 41.232  1.00 24.48 ? 231  LEU A CA  1 
ATOM   1722 C  C   . LEU A 1 229 ? 6.034   -29.511 41.280  1.00 25.62 ? 231  LEU A C   1 
ATOM   1723 O  O   . LEU A 1 229 ? 4.928   -30.010 41.552  1.00 22.60 ? 231  LEU A O   1 
ATOM   1724 C  CB  . LEU A 1 229 ? 6.672   -27.480 42.594  1.00 24.42 ? 231  LEU A CB  1 
ATOM   1725 C  CG  . LEU A 1 229 ? 6.896   -25.970 42.766  1.00 23.50 ? 231  LEU A CG  1 
ATOM   1726 C  CD1 . LEU A 1 229 ? 7.335   -25.723 44.191  1.00 23.37 ? 231  LEU A CD1 1 
ATOM   1727 C  CD2 . LEU A 1 229 ? 7.942   -25.440 41.792  1.00 23.74 ? 231  LEU A CD2 1 
ATOM   1728 N  N   . TRP A 1 230 ? 7.137   -30.224 41.025  1.00 27.79 ? 232  TRP A N   1 
ATOM   1729 C  CA  . TRP A 1 230 ? 7.190   -31.690 41.058  1.00 29.10 ? 232  TRP A CA  1 
ATOM   1730 C  C   . TRP A 1 230 ? 8.106   -32.140 42.174  1.00 28.23 ? 232  TRP A C   1 
ATOM   1731 O  O   . TRP A 1 230 ? 9.102   -31.486 42.477  1.00 27.29 ? 232  TRP A O   1 
ATOM   1732 C  CB  . TRP A 1 230 ? 7.628   -32.233 39.683  1.00 31.43 ? 232  TRP A CB  1 
ATOM   1733 C  CG  . TRP A 1 230 ? 6.564   -31.932 38.669  1.00 35.06 ? 232  TRP A CG  1 
ATOM   1734 C  CD1 . TRP A 1 230 ? 6.344   -30.738 38.063  1.00 39.21 ? 232  TRP A CD1 1 
ATOM   1735 C  CD2 . TRP A 1 230 ? 5.521   -32.809 38.217  1.00 37.29 ? 232  TRP A CD2 1 
ATOM   1736 N  NE1 . TRP A 1 230 ? 5.247   -30.817 37.241  1.00 42.23 ? 232  TRP A NE1 1 
ATOM   1737 C  CE2 . TRP A 1 230 ? 4.724   -32.079 37.315  1.00 39.59 ? 232  TRP A CE2 1 
ATOM   1738 C  CE3 . TRP A 1 230 ? 5.190   -34.141 38.480  1.00 38.56 ? 232  TRP A CE3 1 
ATOM   1739 C  CZ2 . TRP A 1 230 ? 3.616   -32.633 36.667  1.00 40.89 ? 232  TRP A CZ2 1 
ATOM   1740 C  CZ3 . TRP A 1 230 ? 4.080   -34.701 37.828  1.00 41.15 ? 232  TRP A CZ3 1 
ATOM   1741 C  CH2 . TRP A 1 230 ? 3.313   -33.944 36.933  1.00 40.38 ? 232  TRP A CH2 1 
ATOM   1742 N  N   . GLY A 1 231 ? 7.746   -33.249 42.811  1.00 30.29 ? 233  GLY A N   1 
ATOM   1743 C  CA  . GLY A 1 231 ? 8.460   -33.753 43.973  1.00 34.39 ? 233  GLY A CA  1 
ATOM   1744 C  C   . GLY A 1 231 ? 9.060   -35.112 43.686  1.00 40.85 ? 233  GLY A C   1 
ATOM   1745 O  O   . GLY A 1 231 ? 9.318   -35.428 42.515  1.00 42.64 ? 233  GLY A O   1 
ATOM   1746 N  N   . PRO A 1 232 ? 9.281   -35.931 44.744  1.00 44.63 ? 234  PRO A N   1 
ATOM   1747 C  CA  . PRO A 1 232 ? 9.873   -37.267 44.622  1.00 48.01 ? 234  PRO A CA  1 
ATOM   1748 C  C   . PRO A 1 232 ? 9.275   -38.099 43.495  1.00 53.48 ? 234  PRO A C   1 
ATOM   1749 O  O   . PRO A 1 232 ? 8.054   -38.132 43.345  1.00 52.50 ? 234  PRO A O   1 
ATOM   1750 C  CB  . PRO A 1 232 ? 9.552   -37.907 45.973  1.00 47.05 ? 234  PRO A CB  1 
ATOM   1751 C  CG  . PRO A 1 232 ? 9.590   -36.770 46.924  1.00 45.96 ? 234  PRO A CG  1 
ATOM   1752 C  CD  . PRO A 1 232 ? 9.056   -35.583 46.160  1.00 44.73 ? 234  PRO A CD  1 
ATOM   1753 N  N   . GLY A 1 233 ? 10.136  -38.741 42.706  1.00 58.20 ? 235  GLY A N   1 
ATOM   1754 C  CA  . GLY A 1 233 ? 9.690   -39.607 41.616  1.00 60.69 ? 235  GLY A CA  1 
ATOM   1755 C  C   . GLY A 1 233 ? 9.055   -38.817 40.486  1.00 60.94 ? 235  GLY A C   1 
ATOM   1756 O  O   . GLY A 1 233 ? 9.587   -37.786 40.075  1.00 60.80 ? 235  GLY A O   1 
ATOM   1757 N  N   . ASP A 1 234 ? 7.913   -39.300 39.996  1.00 60.30 ? 236  ASP A N   1 
ATOM   1758 C  CA  . ASP A 1 234 ? 7.147   -38.608 38.958  1.00 59.84 ? 236  ASP A CA  1 
ATOM   1759 C  C   . ASP A 1 234 ? 5.882   -37.957 39.537  1.00 55.30 ? 236  ASP A C   1 
ATOM   1760 O  O   . ASP A 1 234 ? 4.865   -37.893 38.851  1.00 59.79 ? 236  ASP A O   1 
ATOM   1761 C  CB  . ASP A 1 234 ? 6.777   -39.596 37.836  1.00 59.68 ? 236  ASP A CB  1 
ATOM   1762 N  N   . SER A 1 235 ? 5.952   -37.454 40.776  1.00 50.67 ? 237  SER A N   1 
ATOM   1763 C  CA  . SER A 1 235 ? 4.767   -36.940 41.496  1.00 46.89 ? 237  SER A CA  1 
ATOM   1764 C  C   . SER A 1 235 ? 4.727   -35.418 41.585  1.00 40.95 ? 237  SER A C   1 
ATOM   1765 O  O   . SER A 1 235 ? 5.759   -34.785 41.732  1.00 35.61 ? 237  SER A O   1 
ATOM   1766 C  CB  . SER A 1 235 ? 4.741   -37.482 42.923  1.00 50.66 ? 237  SER A CB  1 
ATOM   1767 O  OG  . SER A 1 235 ? 4.759   -38.895 42.922  1.00 58.50 ? 237  SER A OG  1 
ATOM   1768 N  N   . ARG A 1 236 ? 3.527   -34.848 41.527  1.00 37.88 ? 238  ARG A N   1 
ATOM   1769 C  CA  . ARG A 1 236 ? 3.325   -33.420 41.780  1.00 36.77 ? 238  ARG A CA  1 
ATOM   1770 C  C   . ARG A 1 236 ? 3.622   -33.089 43.246  1.00 33.35 ? 238  ARG A C   1 
ATOM   1771 O  O   . ARG A 1 236 ? 3.303   -33.859 44.140  1.00 34.67 ? 238  ARG A O   1 
ATOM   1772 C  CB  . ARG A 1 236 ? 1.888   -33.021 41.480  1.00 40.71 ? 238  ARG A CB  1 
ATOM   1773 C  CG  . ARG A 1 236 ? 1.499   -33.113 40.018  1.00 43.24 ? 238  ARG A CG  1 
ATOM   1774 C  CD  . ARG A 1 236 ? 0.055   -32.673 39.836  1.00 46.07 ? 238  ARG A CD  1 
ATOM   1775 N  NE  . ARG A 1 236 ? -0.225  -32.280 38.461  1.00 49.29 ? 238  ARG A NE  1 
ATOM   1776 C  CZ  . ARG A 1 236 ? 0.203   -31.156 37.880  1.00 49.24 ? 238  ARG A CZ  1 
ATOM   1777 N  NH1 . ARG A 1 236 ? 0.954   -30.275 38.541  1.00 48.95 ? 238  ARG A NH1 1 
ATOM   1778 N  NH2 . ARG A 1 236 ? -0.120  -30.915 36.614  1.00 49.14 ? 238  ARG A NH2 1 
ATOM   1779 N  N   . LEU A 1 237 ? 4.228   -31.935 43.487  1.00 30.08 ? 239  LEU A N   1 
ATOM   1780 C  CA  . LEU A 1 237 ? 4.510   -31.495 44.845  1.00 27.93 ? 239  LEU A CA  1 
ATOM   1781 C  C   . LEU A 1 237 ? 3.262   -30.771 45.333  1.00 27.81 ? 239  LEU A C   1 
ATOM   1782 O  O   . LEU A 1 237 ? 3.022   -29.628 44.979  1.00 26.27 ? 239  LEU A O   1 
ATOM   1783 C  CB  . LEU A 1 237 ? 5.767   -30.623 44.865  1.00 28.52 ? 239  LEU A CB  1 
ATOM   1784 C  CG  . LEU A 1 237 ? 6.296   -30.047 46.188  1.00 30.15 ? 239  LEU A CG  1 
ATOM   1785 C  CD1 . LEU A 1 237 ? 5.971   -30.877 47.401  1.00 30.13 ? 239  LEU A CD1 1 
ATOM   1786 C  CD2 . LEU A 1 237 ? 7.785   -29.733 46.085  1.00 30.07 ? 239  LEU A CD2 1 
ATOM   1787 N  N   . GLN A 1 238 ? 2.454   -31.492 46.104  1.00 27.14 ? 240  GLN A N   1 
ATOM   1788 C  CA  . GLN A 1 238 ? 1.118   -31.063 46.523  1.00 27.98 ? 240  GLN A CA  1 
ATOM   1789 C  C   . GLN A 1 238 ? 0.837   -31.660 47.872  1.00 25.40 ? 240  GLN A C   1 
ATOM   1790 O  O   . GLN A 1 238 ? 1.454   -32.655 48.217  1.00 25.13 ? 240  GLN A O   1 
ATOM   1791 C  CB  . GLN A 1 238 ? 0.077   -31.597 45.546  1.00 28.51 ? 240  GLN A CB  1 
ATOM   1792 C  CG  . GLN A 1 238 ? 0.016   -30.811 44.273  1.00 30.58 ? 240  GLN A CG  1 
ATOM   1793 C  CD  . GLN A 1 238 ? -1.120  -31.248 43.362  1.00 31.30 ? 240  GLN A CD  1 
ATOM   1794 O  OE1 . GLN A 1 238 ? -1.559  -32.406 43.394  1.00 28.83 ? 240  GLN A OE1 1 
ATOM   1795 N  NE2 . GLN A 1 238 ? -1.613  -30.312 42.557  1.00 29.79 ? 240  GLN A NE2 1 
ATOM   1796 N  N   . LEU A 1 239 ? -0.101  -31.063 48.611  1.00 26.06 ? 241  LEU A N   1 
ATOM   1797 C  CA  . LEU A 1 239 ? -0.552  -31.576 49.909  1.00 28.07 ? 241  LEU A CA  1 
ATOM   1798 C  C   . LEU A 1 239 ? 0.654   -31.838 50.830  1.00 27.97 ? 241  LEU A C   1 
ATOM   1799 O  O   . LEU A 1 239 ? 0.713   -32.842 51.549  1.00 27.72 ? 241  LEU A O   1 
ATOM   1800 C  CB  . LEU A 1 239 ? -1.385  -32.862 49.722  1.00 29.51 ? 241  LEU A CB  1 
ATOM   1801 C  CG  . LEU A 1 239 ? -2.590  -32.770 48.761  1.00 30.60 ? 241  LEU A CG  1 
ATOM   1802 C  CD1 . LEU A 1 239 ? -2.971  -34.144 48.242  1.00 32.18 ? 241  LEU A CD1 1 
ATOM   1803 C  CD2 . LEU A 1 239 ? -3.792  -32.099 49.411  1.00 31.33 ? 241  LEU A CD2 1 
ATOM   1804 N  N   . ASN A 1 240 ? 1.626   -30.927 50.787  1.00 25.84 ? 242  ASN A N   1 
ATOM   1805 C  CA  . ASN A 1 240 ? 2.862   -31.077 51.540  1.00 24.36 ? 242  ASN A CA  1 
ATOM   1806 C  C   . ASN A 1 240 ? 2.721   -30.496 52.951  1.00 24.84 ? 242  ASN A C   1 
ATOM   1807 O  O   . ASN A 1 240 ? 3.435   -29.563 53.329  1.00 23.63 ? 242  ASN A O   1 
ATOM   1808 C  CB  . ASN A 1 240 ? 4.052   -30.464 50.770  1.00 24.23 ? 242  ASN A CB  1 
ATOM   1809 C  CG  . ASN A 1 240 ? 3.891   -28.966 50.526  1.00 22.74 ? 242  ASN A CG  1 
ATOM   1810 O  OD1 . ASN A 1 240 ? 2.780   -28.469 50.395  1.00 22.24 ? 242  ASN A OD1 1 
ATOM   1811 N  ND2 . ASN A 1 240 ? 5.013   -28.245 50.493  1.00 21.23 ? 242  ASN A ND2 1 
ATOM   1812 N  N   . PHE A 1 241 ? 1.789   -31.071 53.723  1.00 23.93 ? 243  PHE A N   1 
ATOM   1813 C  CA  . PHE A 1 241 ? 1.540   -30.703 55.099  1.00 24.12 ? 243  PHE A CA  1 
ATOM   1814 C  C   . PHE A 1 241 ? 1.441   -31.958 55.979  1.00 23.99 ? 243  PHE A C   1 
ATOM   1815 O  O   . PHE A 1 241 ? 1.028   -33.028 55.508  1.00 24.71 ? 243  PHE A O   1 
ATOM   1816 C  CB  . PHE A 1 241 ? 0.278   -29.857 55.243  1.00 25.40 ? 243  PHE A CB  1 
ATOM   1817 C  CG  . PHE A 1 241 ? -1.000  -30.560 54.856  1.00 25.96 ? 243  PHE A CG  1 
ATOM   1818 C  CD1 . PHE A 1 241 ? -1.478  -30.504 53.549  1.00 26.33 ? 243  PHE A CD1 1 
ATOM   1819 C  CD2 . PHE A 1 241 ? -1.751  -31.238 55.819  1.00 26.06 ? 243  PHE A CD2 1 
ATOM   1820 C  CE1 . PHE A 1 241 ? -2.665  -31.133 53.198  1.00 27.32 ? 243  PHE A CE1 1 
ATOM   1821 C  CE2 . PHE A 1 241 ? -2.935  -31.886 55.469  1.00 27.10 ? 243  PHE A CE2 1 
ATOM   1822 C  CZ  . PHE A 1 241 ? -3.399  -31.818 54.165  1.00 27.15 ? 243  PHE A CZ  1 
ATOM   1823 N  N   . ARG A 1 242 ? 1.815   -31.793 57.239  1.00 23.96 ? 244  ARG A N   1 
ATOM   1824 C  CA  . ARG A 1 242 ? 1.709   -32.853 58.252  1.00 23.89 ? 244  ARG A CA  1 
ATOM   1825 C  C   . ARG A 1 242 ? 0.351   -32.739 58.926  1.00 24.79 ? 244  ARG A C   1 
ATOM   1826 O  O   . ARG A 1 242 ? -0.127  -31.624 59.200  1.00 25.88 ? 244  ARG A O   1 
ATOM   1827 C  CB  . ARG A 1 242 ? 2.808   -32.660 59.300  1.00 24.05 ? 244  ARG A CB  1 
ATOM   1828 C  CG  . ARG A 1 242 ? 2.964   -33.792 60.302  1.00 23.83 ? 244  ARG A CG  1 
ATOM   1829 C  CD  . ARG A 1 242 ? 3.901   -33.395 61.435  1.00 23.51 ? 244  ARG A CD  1 
ATOM   1830 N  NE  . ARG A 1 242 ? 4.387   -34.562 62.178  1.00 23.88 ? 244  ARG A NE  1 
ATOM   1831 C  CZ  . ARG A 1 242 ? 5.205   -34.503 63.233  1.00 25.33 ? 244  ARG A CZ  1 
ATOM   1832 N  NH1 . ARG A 1 242 ? 5.653   -33.322 63.696  1.00 23.22 ? 244  ARG A NH1 1 
ATOM   1833 N  NH2 . ARG A 1 242 ? 5.605   -35.631 63.828  1.00 27.09 ? 244  ARG A NH2 1 
ATOM   1834 N  N   . ALA A 1 243 ? -0.255  -33.882 59.240  1.00 25.95 ? 245  ALA A N   1 
ATOM   1835 C  CA  . ALA A 1 243 ? -1.490  -33.932 60.052  1.00 26.28 ? 245  ALA A CA  1 
ATOM   1836 C  C   . ALA A 1 243 ? -1.322  -33.201 61.375  1.00 27.18 ? 245  ALA A C   1 
ATOM   1837 O  O   . ALA A 1 243 ? -0.229  -33.177 61.929  1.00 29.08 ? 245  ALA A O   1 
ATOM   1838 C  CB  . ALA A 1 243 ? -1.861  -35.377 60.328  1.00 27.63 ? 245  ALA A CB  1 
ATOM   1839 N  N   . THR A 1 244 ? -2.390  -32.594 61.882  1.00 28.06 ? 246  THR A N   1 
ATOM   1840 C  CA  . THR A 1 244 ? -2.320  -31.887 63.136  1.00 29.96 ? 246  THR A CA  1 
ATOM   1841 C  C   . THR A 1 244 ? -2.028  -32.883 64.284  1.00 28.30 ? 246  THR A C   1 
ATOM   1842 O  O   . THR A 1 244 ? -2.440  -34.052 64.260  1.00 28.94 ? 246  THR A O   1 
ATOM   1843 C  CB  . THR A 1 244 ? -3.609  -31.107 63.435  1.00 32.12 ? 246  THR A CB  1 
ATOM   1844 O  OG1 . THR A 1 244 ? -4.712  -31.974 63.208  1.00 34.18 ? 246  THR A OG1 1 
ATOM   1845 C  CG2 . THR A 1 244 ? -3.733  -29.844 62.524  1.00 33.19 ? 246  THR A CG2 1 
ATOM   1846 N  N   . GLN A 1 245 ? -1.284  -32.388 65.256  1.00 28.57 ? 247  GLN A N   1 
ATOM   1847 C  CA  . GLN A 1 245 ? -0.755  -33.178 66.350  1.00 28.12 ? 247  GLN A CA  1 
ATOM   1848 C  C   . GLN A 1 245 ? -1.482  -32.732 67.609  1.00 26.99 ? 247  GLN A C   1 
ATOM   1849 O  O   . GLN A 1 245 ? -1.714  -31.550 67.785  1.00 26.02 ? 247  GLN A O   1 
ATOM   1850 C  CB  . GLN A 1 245 ? 0.748   -32.902 66.494  1.00 28.17 ? 247  GLN A CB  1 
ATOM   1851 C  CG  . GLN A 1 245 ? 1.571   -33.172 65.236  1.00 29.05 ? 247  GLN A CG  1 
ATOM   1852 C  CD  . GLN A 1 245 ? 1.608   -34.640 64.872  1.00 31.53 ? 247  GLN A CD  1 
ATOM   1853 O  OE1 . GLN A 1 245 ? 2.093   -35.466 65.663  1.00 31.03 ? 247  GLN A OE1 1 
ATOM   1854 N  NE2 . GLN A 1 245 ? 1.099   -34.988 63.684  1.00 29.93 ? 247  GLN A NE2 1 
ATOM   1855 N  N   . PRO A 1 246 ? -1.791  -33.668 68.531  1.00 26.05 ? 248  PRO A N   1 
ATOM   1856 C  CA  . PRO A 1 246 ? -2.528  -33.273 69.733  1.00 25.16 ? 248  PRO A CA  1 
ATOM   1857 C  C   . PRO A 1 246 ? -1.737  -32.323 70.600  1.00 25.33 ? 248  PRO A C   1 
ATOM   1858 O  O   . PRO A 1 246 ? -0.522  -32.481 70.717  1.00 29.00 ? 248  PRO A O   1 
ATOM   1859 C  CB  . PRO A 1 246 ? -2.737  -34.610 70.468  1.00 25.84 ? 248  PRO A CB  1 
ATOM   1860 C  CG  . PRO A 1 246 ? -1.658  -35.502 69.957  1.00 26.82 ? 248  PRO A CG  1 
ATOM   1861 C  CD  . PRO A 1 246 ? -1.461  -35.103 68.526  1.00 26.72 ? 248  PRO A CD  1 
ATOM   1862 N  N   . LEU A 1 247 ? -2.386  -31.330 71.192  1.00 22.90 ? 249  LEU A N   1 
ATOM   1863 C  CA  . LEU A 1 247 ? -1.704  -30.436 72.120  1.00 24.91 ? 249  LEU A CA  1 
ATOM   1864 C  C   . LEU A 1 247 ? -1.102  -31.176 73.353  1.00 27.55 ? 249  LEU A C   1 
ATOM   1865 O  O   . LEU A 1 247 ? -0.063  -30.758 73.903  1.00 26.12 ? 249  LEU A O   1 
ATOM   1866 C  CB  . LEU A 1 247 ? -2.610  -29.304 72.575  1.00 25.26 ? 249  LEU A CB  1 
ATOM   1867 C  CG  . LEU A 1 247 ? -2.756  -28.128 71.606  1.00 25.59 ? 249  LEU A CG  1 
ATOM   1868 C  CD1 . LEU A 1 247 ? -3.837  -27.205 72.146  1.00 25.89 ? 249  LEU A CD1 1 
ATOM   1869 C  CD2 . LEU A 1 247 ? -1.450  -27.362 71.463  1.00 24.91 ? 249  LEU A CD2 1 
ATOM   1870 N  N   . ASN A 1 248 ? -1.748  -32.266 73.767  1.00 28.52 ? 250  ASN A N   1 
ATOM   1871 C  CA  . ASN A 1 248 ? -1.234  -33.121 74.851  1.00 29.34 ? 250  ASN A CA  1 
ATOM   1872 C  C   . ASN A 1 248 ? -0.933  -32.394 76.136  1.00 27.57 ? 250  ASN A C   1 
ATOM   1873 O  O   . ASN A 1 248 ? 0.053   -32.690 76.824  1.00 30.96 ? 250  ASN A O   1 
ATOM   1874 C  CB  . ASN A 1 248 ? -0.015  -33.917 74.369  1.00 28.45 ? 250  ASN A CB  1 
ATOM   1875 C  CG  . ASN A 1 248 ? -0.396  -35.156 73.633  1.00 29.03 ? 250  ASN A CG  1 
ATOM   1876 O  OD1 . ASN A 1 248 ? -1.536  -35.621 73.732  1.00 33.04 ? 250  ASN A OD1 1 
ATOM   1877 N  ND2 . ASN A 1 248 ? 0.554   -35.721 72.876  1.00 29.12 ? 250  ASN A ND2 1 
ATOM   1878 N  N   . GLY A 1 249 ? -1.807  -31.445 76.470  1.00 26.80 ? 251  GLY A N   1 
ATOM   1879 C  CA  . GLY A 1 249 ? -1.712  -30.665 77.681  1.00 24.96 ? 251  GLY A CA  1 
ATOM   1880 C  C   . GLY A 1 249 ? -1.157  -29.277 77.530  1.00 24.86 ? 251  GLY A C   1 
ATOM   1881 O  O   . GLY A 1 249 ? -1.319  -28.456 78.404  1.00 24.91 ? 251  GLY A O   1 
ATOM   1882 N  N   . ARG A 1 250 ? -0.469  -29.006 76.420  1.00 25.26 ? 252  ARG A N   1 
ATOM   1883 C  CA  . ARG A 1 250 ? 0.000   -27.667 76.146  1.00 25.05 ? 252  ARG A CA  1 
ATOM   1884 C  C   . ARG A 1 250 ? -1.186  -26.727 75.993  1.00 25.07 ? 252  ARG A C   1 
ATOM   1885 O  O   . ARG A 1 250 ? -2.241  -27.126 75.485  1.00 26.79 ? 252  ARG A O   1 
ATOM   1886 C  CB  . ARG A 1 250 ? 0.795   -27.620 74.847  1.00 25.13 ? 252  ARG A CB  1 
ATOM   1887 C  CG  . ARG A 1 250 ? 2.155   -28.271 74.907  1.00 25.52 ? 252  ARG A CG  1 
ATOM   1888 C  CD  . ARG A 1 250 ? 2.753   -28.310 73.520  1.00 24.58 ? 252  ARG A CD  1 
ATOM   1889 N  NE  . ARG A 1 250 ? 2.062   -29.264 72.669  1.00 24.21 ? 252  ARG A NE  1 
ATOM   1890 C  CZ  . ARG A 1 250 ? 2.359   -29.476 71.393  1.00 23.61 ? 252  ARG A CZ  1 
ATOM   1891 N  NH1 . ARG A 1 250 ? 3.338   -28.785 70.807  1.00 24.16 ? 252  ARG A NH1 1 
ATOM   1892 N  NH2 . ARG A 1 250 ? 1.682   -30.362 70.702  1.00 23.01 ? 252  ARG A NH2 1 
ATOM   1893 N  N   . VAL A 1 251 ? -0.984  -25.501 76.420  1.00 23.37 ? 253  VAL A N   1 
ATOM   1894 C  CA  . VAL A 1 251 ? -1.940  -24.437 76.280  1.00 27.62 ? 253  VAL A CA  1 
ATOM   1895 C  C   . VAL A 1 251 ? -1.369  -23.427 75.289  1.00 27.72 ? 253  VAL A C   1 
ATOM   1896 O  O   . VAL A 1 251 ? -0.274  -22.894 75.498  1.00 31.09 ? 253  VAL A O   1 
ATOM   1897 C  CB  . VAL A 1 251 ? -2.218  -23.758 77.634  1.00 29.10 ? 253  VAL A CB  1 
ATOM   1898 C  CG1 . VAL A 1 251 ? -3.273  -22.657 77.479  1.00 30.89 ? 253  VAL A CG1 1 
ATOM   1899 C  CG2 . VAL A 1 251 ? -2.680  -24.815 78.657  1.00 30.83 ? 253  VAL A CG2 1 
ATOM   1900 N  N   . ILE A 1 252 ? -2.113  -23.183 74.208  1.00 26.28 ? 254  ILE A N   1 
ATOM   1901 C  CA  . ILE A 1 252 ? -1.758  -22.124 73.239  1.00 25.70 ? 254  ILE A CA  1 
ATOM   1902 C  C   . ILE A 1 252 ? -2.038  -20.781 73.868  1.00 25.16 ? 254  ILE A C   1 
ATOM   1903 O  O   . ILE A 1 252 ? -3.095  -20.588 74.459  1.00 27.52 ? 254  ILE A O   1 
ATOM   1904 C  CB  . ILE A 1 252 ? -2.517  -22.294 71.891  1.00 25.83 ? 254  ILE A CB  1 
ATOM   1905 C  CG1 . ILE A 1 252 ? -2.184  -23.655 71.272  1.00 25.77 ? 254  ILE A CG1 1 
ATOM   1906 C  CG2 . ILE A 1 252 ? -2.170  -21.142 70.948  1.00 27.17 ? 254  ILE A CG2 1 
ATOM   1907 C  CD1 . ILE A 1 252 ? -3.042  -24.066 70.085  1.00 24.64 ? 254  ILE A CD1 1 
ATOM   1908 N  N   . GLU A 1 253 ? -1.089  -19.847 73.784  1.00 25.64 ? 255  GLU A N   1 
ATOM   1909 C  CA  . GLU A 1 253 ? -1.305  -18.483 74.235  1.00 26.34 ? 255  GLU A CA  1 
ATOM   1910 C  C   . GLU A 1 253 ? -1.781  -17.624 73.064  1.00 28.00 ? 255  GLU A C   1 
ATOM   1911 O  O   . GLU A 1 253 ? -1.511  -17.921 71.888  1.00 25.20 ? 255  GLU A O   1 
ATOM   1912 C  CB  . GLU A 1 253 ? -0.068  -17.861 74.845  1.00 27.85 ? 255  GLU A CB  1 
ATOM   1913 C  CG  . GLU A 1 253 ? 0.474   -18.612 76.072  1.00 32.71 ? 255  GLU A CG  1 
ATOM   1914 C  CD  . GLU A 1 253 ? 1.526   -17.824 76.850  1.00 33.86 ? 255  GLU A CD  1 
ATOM   1915 O  OE1 . GLU A 1 253 ? 2.403   -17.202 76.247  1.00 34.13 ? 255  GLU A OE1 1 
ATOM   1916 O  OE2 . GLU A 1 253 ? 1.464   -17.802 78.088  1.00 39.00 ? 255  GLU A OE2 1 
ATOM   1917 N  N   . ALA A 1 254 ? -2.518  -16.572 73.400  1.00 27.04 ? 256  ALA A N   1 
ATOM   1918 C  CA  . ALA A 1 254 ? -3.008  -15.623 72.416  1.00 27.35 ? 256  ALA A CA  1 
ATOM   1919 C  C   . ALA A 1 254 ? -2.609  -14.283 72.950  1.00 26.11 ? 256  ALA A C   1 
ATOM   1920 O  O   . ALA A 1 254 ? -2.687  -14.031 74.172  1.00 28.37 ? 256  ALA A O   1 
ATOM   1921 C  CB  . ALA A 1 254 ? -4.529  -15.740 72.233  1.00 27.53 ? 256  ALA A CB  1 
ATOM   1922 N  N   . SER A 1 255 ? -2.153  -13.415 72.055  1.00 23.57 ? 257  SER A N   1 
ATOM   1923 C  CA  . SER A 1 255 ? -1.840  -12.060 72.419  1.00 22.55 ? 257  SER A CA  1 
ATOM   1924 C  C   . SER A 1 255 ? -3.136  -11.201 72.530  1.00 22.82 ? 257  SER A C   1 
ATOM   1925 O  O   . SER A 1 255 ? -3.021  -10.036 72.699  1.00 21.86 ? 257  SER A O   1 
ATOM   1926 C  CB  . SER A 1 255 ? -0.889  -11.403 71.433  1.00 24.22 ? 257  SER A CB  1 
ATOM   1927 O  OG  . SER A 1 255 ? -1.470  -11.291 70.129  1.00 25.14 ? 257  SER A OG  1 
ATOM   1928 N  N   . PHE A 1 256 ? -4.327  -11.789 72.448  1.00 24.61 ? 258  PHE A N   1 
ATOM   1929 C  CA  . PHE A 1 256 ? -5.580  -11.010 72.526  1.00 25.02 ? 258  PHE A CA  1 
ATOM   1930 C  C   . PHE A 1 256 ? -6.674  -11.765 73.267  1.00 29.01 ? 258  PHE A C   1 
ATOM   1931 O  O   . PHE A 1 256 ? -6.717  -13.025 73.268  1.00 28.91 ? 258  PHE A O   1 
ATOM   1932 C  CB  . PHE A 1 256 ? -6.027  -10.616 71.074  1.00 26.78 ? 258  PHE A CB  1 
ATOM   1933 C  CG  . PHE A 1 256 ? -6.155  -11.784 70.144  1.00 25.73 ? 258  PHE A CG  1 
ATOM   1934 C  CD1 . PHE A 1 256 ? -5.041  -12.275 69.457  1.00 25.49 ? 258  PHE A CD1 1 
ATOM   1935 C  CD2 . PHE A 1 256 ? -7.361  -12.428 69.989  1.00 26.63 ? 258  PHE A CD2 1 
ATOM   1936 C  CE1 . PHE A 1 256 ? -5.148  -13.352 68.631  1.00 24.72 ? 258  PHE A CE1 1 
ATOM   1937 C  CE2 . PHE A 1 256 ? -7.489  -13.528 69.158  1.00 28.18 ? 258  PHE A CE2 1 
ATOM   1938 C  CZ  . PHE A 1 256 ? -6.370  -13.991 68.465  1.00 27.76 ? 258  PHE A CZ  1 
ATOM   1939 N  N   . PRO A 1 257 ? -7.601  -11.015 73.914  1.00 33.89 ? 259  PRO A N   1 
ATOM   1940 C  CA  . PRO A 1 257 ? -8.761  -11.627 74.601  1.00 35.12 ? 259  PRO A CA  1 
ATOM   1941 C  C   . PRO A 1 257 ? -9.751  -12.379 73.688  1.00 36.18 ? 259  PRO A C   1 
ATOM   1942 O  O   . PRO A 1 257 ? -10.326 -13.437 73.984  1.00 37.81 ? 259  PRO A O   1 
ATOM   1943 C  CB  . PRO A 1 257 ? -9.474  -10.424 75.227  1.00 35.22 ? 259  PRO A CB  1 
ATOM   1944 C  CG  . PRO A 1 257 ? -8.489  -9.306  75.234  1.00 33.68 ? 259  PRO A CG  1 
ATOM   1945 C  CD  . PRO A 1 257 ? -7.519  -9.562  74.131  1.00 32.47 ? 259  PRO A CD  1 
ATOM   1946 O  OXT . PRO A 1 257 ? -10.025 -11.927 72.595  1.00 36.34 ? 259  PRO A OXT 1 
ATOM   1947 N  N   . TRP B 1 7   ? 35.686  -11.488 92.420  1.00 38.67 ? 9    TRP B N   1 
ATOM   1948 C  CA  . TRP B 1 7   ? 34.694  -10.373 92.627  1.00 36.46 ? 9    TRP B CA  1 
ATOM   1949 C  C   . TRP B 1 7   ? 34.214  -10.356 94.073  1.00 35.81 ? 9    TRP B C   1 
ATOM   1950 O  O   . TRP B 1 7   ? 34.431  -11.308 94.816  1.00 39.85 ? 9    TRP B O   1 
ATOM   1951 C  CB  . TRP B 1 7   ? 33.493  -10.502 91.664  1.00 34.79 ? 9    TRP B CB  1 
ATOM   1952 C  CG  . TRP B 1 7   ? 32.689  -11.759 91.873  1.00 34.10 ? 9    TRP B CG  1 
ATOM   1953 C  CD1 . TRP B 1 7   ? 32.897  -12.971 91.277  1.00 33.16 ? 9    TRP B CD1 1 
ATOM   1954 C  CD2 . TRP B 1 7   ? 31.560  -11.929 92.749  1.00 32.48 ? 9    TRP B CD2 1 
ATOM   1955 N  NE1 . TRP B 1 7   ? 31.966  -13.887 91.728  1.00 33.77 ? 9    TRP B NE1 1 
ATOM   1956 C  CE2 . TRP B 1 7   ? 31.132  -13.276 92.626  1.00 31.81 ? 9    TRP B CE2 1 
ATOM   1957 C  CE3 . TRP B 1 7   ? 30.861  -11.074 93.615  1.00 30.74 ? 9    TRP B CE3 1 
ATOM   1958 C  CZ2 . TRP B 1 7   ? 30.047  -13.796 93.353  1.00 31.27 ? 9    TRP B CZ2 1 
ATOM   1959 C  CZ3 . TRP B 1 7   ? 29.767  -11.589 94.327  1.00 32.42 ? 9    TRP B CZ3 1 
ATOM   1960 C  CH2 . TRP B 1 7   ? 29.375  -12.937 94.187  1.00 30.24 ? 9    TRP B CH2 1 
ATOM   1961 N  N   . ARG B 1 8   ? 33.538  -9.276  94.441  1.00 35.13 ? 10   ARG B N   1 
ATOM   1962 C  CA  . ARG B 1 8   ? 33.096  -9.045  95.806  1.00 36.39 ? 10   ARG B CA  1 
ATOM   1963 C  C   . ARG B 1 8   ? 31.785  -8.279  95.803  1.00 35.42 ? 10   ARG B C   1 
ATOM   1964 O  O   . ARG B 1 8   ? 31.480  -7.561  94.852  1.00 35.39 ? 10   ARG B O   1 
ATOM   1965 C  CB  . ARG B 1 8   ? 34.167  -8.245  96.574  1.00 38.98 ? 10   ARG B CB  1 
ATOM   1966 N  N   . TYR B 1 9   ? 31.016  -8.433  96.875  1.00 36.68 ? 11   TYR B N   1 
ATOM   1967 C  CA  . TYR B 1 9   ? 29.853  -7.577  97.117  1.00 38.68 ? 11   TYR B CA  1 
ATOM   1968 C  C   . TYR B 1 9   ? 30.283  -6.196  97.614  1.00 44.67 ? 11   TYR B C   1 
ATOM   1969 O  O   . TYR B 1 9   ? 31.268  -6.080  98.348  1.00 45.20 ? 11   TYR B O   1 
ATOM   1970 C  CB  . TYR B 1 9   ? 28.910  -8.225  98.128  1.00 35.59 ? 11   TYR B CB  1 
ATOM   1971 C  CG  . TYR B 1 9   ? 28.077  -9.319  97.514  1.00 31.58 ? 11   TYR B CG  1 
ATOM   1972 C  CD1 . TYR B 1 9   ? 27.060  -9.009  96.624  1.00 30.52 ? 11   TYR B CD1 1 
ATOM   1973 C  CD2 . TYR B 1 9   ? 28.300  -10.660 97.821  1.00 30.38 ? 11   TYR B CD2 1 
ATOM   1974 C  CE1 . TYR B 1 9   ? 26.279  -10.005 96.057  1.00 29.62 ? 11   TYR B CE1 1 
ATOM   1975 C  CE2 . TYR B 1 9   ? 27.527  -11.668 97.245  1.00 29.67 ? 11   TYR B CE2 1 
ATOM   1976 C  CZ  . TYR B 1 9   ? 26.520  -11.333 96.370  1.00 28.58 ? 11   TYR B CZ  1 
ATOM   1977 O  OH  . TYR B 1 9   ? 25.724  -12.315 95.806  1.00 27.14 ? 11   TYR B OH  1 
ATOM   1978 N  N   . GLY B 1 10  ? 29.538  -5.166  97.200  1.00 53.07 ? 12   GLY B N   1 
ATOM   1979 C  CA  . GLY B 1 10  ? 29.869  -3.768  97.512  1.00 58.69 ? 12   GLY B CA  1 
ATOM   1980 C  C   . GLY B 1 10  ? 31.232  -3.325  96.986  1.00 64.54 ? 12   GLY B C   1 
ATOM   1981 O  O   . GLY B 1 10  ? 31.874  -2.458  97.582  1.00 64.85 ? 12   GLY B O   1 
ATOM   1982 N  N   . GLY B 1 11  ? 31.672  -3.921  95.873  1.00 66.89 ? 13   GLY B N   1 
ATOM   1983 C  CA  . GLY B 1 11  ? 32.976  -3.618  95.298  1.00 70.40 ? 13   GLY B CA  1 
ATOM   1984 C  C   . GLY B 1 11  ? 32.943  -2.307  94.533  1.00 72.89 ? 13   GLY B C   1 
ATOM   1985 O  O   . GLY B 1 11  ? 31.904  -1.910  93.985  1.00 69.82 ? 13   GLY B O   1 
ATOM   1986 N  N   . ASP B 1 12  ? 34.081  -1.624  94.519  1.00 71.96 ? 14   ASP B N   1 
ATOM   1987 C  CA  . ASP B 1 12  ? 34.287  -0.460  93.660  1.00 73.12 ? 14   ASP B CA  1 
ATOM   1988 C  C   . ASP B 1 12  ? 35.722  -0.620  93.114  1.00 75.75 ? 14   ASP B C   1 
ATOM   1989 O  O   . ASP B 1 12  ? 36.673  -0.523  93.898  1.00 78.73 ? 14   ASP B O   1 
ATOM   1990 C  CB  . ASP B 1 12  ? 34.093  0.853   94.449  1.00 71.41 ? 14   ASP B CB  1 
ATOM   1991 C  CG  . ASP B 1 12  ? 33.248  1.891   93.688  1.00 70.62 ? 14   ASP B CG  1 
ATOM   1992 O  OD1 . ASP B 1 12  ? 33.512  2.145   92.492  1.00 73.07 ? 14   ASP B OD1 1 
ATOM   1993 O  OD2 . ASP B 1 12  ? 32.318  2.459   94.294  1.00 66.30 ? 14   ASP B OD2 1 
ATOM   1994 N  N   . PRO B 1 13  ? 35.909  -0.864  91.807  1.00 76.58 ? 15   PRO B N   1 
ATOM   1995 C  CA  . PRO B 1 13  ? 34.888  -0.684  90.754  1.00 73.41 ? 15   PRO B CA  1 
ATOM   1996 C  C   . PRO B 1 13  ? 33.751  -1.706  90.732  1.00 65.69 ? 15   PRO B C   1 
ATOM   1997 O  O   . PRO B 1 13  ? 33.942  -2.850  91.174  1.00 62.44 ? 15   PRO B O   1 
ATOM   1998 C  CB  . PRO B 1 13  ? 35.697  -0.807  89.445  1.00 76.61 ? 15   PRO B CB  1 
ATOM   1999 C  CG  . PRO B 1 13  ? 37.137  -0.704  89.844  1.00 78.61 ? 15   PRO B CG  1 
ATOM   2000 C  CD  . PRO B 1 13  ? 37.214  -1.248  91.233  1.00 80.24 ? 15   PRO B CD  1 
ATOM   2001 N  N   . PRO B 1 14  ? 32.577  -1.299  90.201  1.00 60.12 ? 16   PRO B N   1 
ATOM   2002 C  CA  . PRO B 1 14  ? 31.478  -2.254  90.110  1.00 57.80 ? 16   PRO B CA  1 
ATOM   2003 C  C   . PRO B 1 14  ? 31.773  -3.383  89.102  1.00 51.09 ? 16   PRO B C   1 
ATOM   2004 O  O   . PRO B 1 14  ? 32.780  -3.356  88.367  1.00 48.81 ? 16   PRO B O   1 
ATOM   2005 C  CB  . PRO B 1 14  ? 30.283  -1.384  89.681  1.00 57.91 ? 16   PRO B CB  1 
ATOM   2006 C  CG  . PRO B 1 14  ? 30.889  -0.241  88.948  1.00 60.10 ? 16   PRO B CG  1 
ATOM   2007 C  CD  . PRO B 1 14  ? 32.233  0.000   89.580  1.00 60.04 ? 16   PRO B CD  1 
ATOM   2008 N  N   . TRP B 1 15  ? 30.886  -4.364  89.088  1.00 45.27 ? 17   TRP B N   1 
ATOM   2009 C  CA  . TRP B 1 15  ? 31.114  -5.607  88.355  1.00 41.36 ? 17   TRP B CA  1 
ATOM   2010 C  C   . TRP B 1 15  ? 31.340  -5.482  86.838  1.00 40.31 ? 17   TRP B C   1 
ATOM   2011 O  O   . TRP B 1 15  ? 32.160  -6.232  86.305  1.00 37.55 ? 17   TRP B O   1 
ATOM   2012 C  CB  . TRP B 1 15  ? 29.971  -6.578  88.618  1.00 38.81 ? 17   TRP B CB  1 
ATOM   2013 C  CG  . TRP B 1 15  ? 29.855  -7.030  90.033  1.00 37.09 ? 17   TRP B CG  1 
ATOM   2014 C  CD1 . TRP B 1 15  ? 30.795  -6.948  91.012  1.00 36.15 ? 17   TRP B CD1 1 
ATOM   2015 C  CD2 . TRP B 1 15  ? 28.726  -7.678  90.612  1.00 35.09 ? 17   TRP B CD2 1 
ATOM   2016 N  NE1 . TRP B 1 15  ? 30.309  -7.492  92.172  1.00 37.71 ? 17   TRP B NE1 1 
ATOM   2017 C  CE2 . TRP B 1 15  ? 29.042  -7.955  91.949  1.00 35.51 ? 17   TRP B CE2 1 
ATOM   2018 C  CE3 . TRP B 1 15  ? 27.468  -8.057  90.122  1.00 34.48 ? 17   TRP B CE3 1 
ATOM   2019 C  CZ2 . TRP B 1 15  ? 28.147  -8.597  92.810  1.00 34.38 ? 17   TRP B CZ2 1 
ATOM   2020 C  CZ3 . TRP B 1 15  ? 26.589  -8.691  90.966  1.00 31.89 ? 17   TRP B CZ3 1 
ATOM   2021 C  CH2 . TRP B 1 15  ? 26.923  -8.951  92.296  1.00 33.09 ? 17   TRP B CH2 1 
ATOM   2022 N  N   . PRO B 1 16  ? 30.635  -4.546  86.148  1.00 39.50 ? 18   PRO B N   1 
ATOM   2023 C  CA  . PRO B 1 16  ? 30.798  -4.438  84.700  1.00 41.34 ? 18   PRO B CA  1 
ATOM   2024 C  C   . PRO B 1 16  ? 32.235  -4.314  84.197  1.00 45.55 ? 18   PRO B C   1 
ATOM   2025 O  O   . PRO B 1 16  ? 32.541  -4.803  83.106  1.00 44.09 ? 18   PRO B O   1 
ATOM   2026 C  CB  . PRO B 1 16  ? 29.972  -3.198  84.355  1.00 39.97 ? 18   PRO B CB  1 
ATOM   2027 C  CG  . PRO B 1 16  ? 28.848  -3.255  85.327  1.00 40.40 ? 18   PRO B CG  1 
ATOM   2028 C  CD  . PRO B 1 16  ? 29.514  -3.699  86.606  1.00 40.40 ? 18   PRO B CD  1 
ATOM   2029 N  N   . ARG B 1 17  ? 33.106  -3.677  84.982  1.00 50.58 ? 19   ARG B N   1 
ATOM   2030 C  CA  . ARG B 1 17  ? 34.515  -3.538  84.601  1.00 55.44 ? 19   ARG B CA  1 
ATOM   2031 C  C   . ARG B 1 17  ? 35.213  -4.869  84.386  1.00 54.03 ? 19   ARG B C   1 
ATOM   2032 O  O   . ARG B 1 17  ? 35.963  -5.024  83.426  1.00 58.87 ? 19   ARG B O   1 
ATOM   2033 C  CB  . ARG B 1 17  ? 35.301  -2.704  85.619  1.00 58.61 ? 19   ARG B CB  1 
ATOM   2034 C  CG  . ARG B 1 17  ? 35.153  -1.211  85.397  1.00 63.14 ? 19   ARG B CG  1 
ATOM   2035 C  CD  . ARG B 1 17  ? 36.470  -0.470  85.566  1.00 65.79 ? 19   ARG B CD  1 
ATOM   2036 N  NE  . ARG B 1 17  ? 37.374  -0.558  84.406  1.00 64.60 ? 19   ARG B NE  1 
ATOM   2037 C  CZ  . ARG B 1 17  ? 38.604  -1.091  84.386  1.00 64.57 ? 19   ARG B CZ  1 
ATOM   2038 N  NH1 . ARG B 1 17  ? 39.173  -1.640  85.468  1.00 62.35 ? 19   ARG B NH1 1 
ATOM   2039 N  NH2 . ARG B 1 17  ? 39.291  -1.071  83.243  1.00 66.31 ? 19   ARG B NH2 1 
ATOM   2040 N  N   . VAL B 1 18  ? 34.958  -5.814  85.278  1.00 52.71 ? 20   VAL B N   1 
ATOM   2041 C  CA  . VAL B 1 18  ? 35.563  -7.145  85.213  1.00 53.39 ? 20   VAL B CA  1 
ATOM   2042 C  C   . VAL B 1 18  ? 34.678  -8.152  84.458  1.00 52.84 ? 20   VAL B C   1 
ATOM   2043 O  O   . VAL B 1 18  ? 35.198  -9.092  83.858  1.00 55.33 ? 20   VAL B O   1 
ATOM   2044 C  CB  . VAL B 1 18  ? 35.918  -7.633  86.642  1.00 55.44 ? 20   VAL B CB  1 
ATOM   2045 C  CG1 . VAL B 1 18  ? 36.445  -9.067  86.640  1.00 57.14 ? 20   VAL B CG1 1 
ATOM   2046 C  CG2 . VAL B 1 18  ? 36.936  -6.681  87.269  1.00 54.91 ? 20   VAL B CG2 1 
ATOM   2047 N  N   . SER B 1 19  ? 33.356  -7.951  84.475  1.00 47.89 ? 21   SER B N   1 
ATOM   2048 C  CA  . SER B 1 19  ? 32.400  -8.856  83.820  1.00 44.11 ? 21   SER B CA  1 
ATOM   2049 C  C   . SER B 1 19  ? 31.377  -8.022  83.032  1.00 40.93 ? 21   SER B C   1 
ATOM   2050 O  O   . SER B 1 19  ? 30.308  -7.703  83.555  1.00 35.01 ? 21   SER B O   1 
ATOM   2051 C  CB  . SER B 1 19  ? 31.701  -9.702  84.881  1.00 46.25 ? 21   SER B CB  1 
ATOM   2052 O  OG  . SER B 1 19  ? 32.645  -10.406 85.669  1.00 48.42 ? 21   SER B OG  1 
ATOM   2053 N  N   . PRO B 1 20  ? 31.717  -7.631  81.783  1.00 38.15 ? 22   PRO B N   1 
ATOM   2054 C  CA  . PRO B 1 20  ? 30.853  -6.730  80.997  1.00 34.45 ? 22   PRO B CA  1 
ATOM   2055 C  C   . PRO B 1 20  ? 29.418  -7.180  80.809  1.00 29.85 ? 22   PRO B C   1 
ATOM   2056 O  O   . PRO B 1 20  ? 28.549  -6.326  80.621  1.00 28.33 ? 22   PRO B O   1 
ATOM   2057 C  CB  . PRO B 1 20  ? 31.560  -6.620  79.633  1.00 37.26 ? 22   PRO B CB  1 
ATOM   2058 C  CG  . PRO B 1 20  ? 32.731  -7.532  79.700  1.00 40.81 ? 22   PRO B CG  1 
ATOM   2059 C  CD  . PRO B 1 20  ? 33.031  -7.813  81.138  1.00 39.89 ? 22   PRO B CD  1 
ATOM   2060 N  N   . ALA B 1 21  ? 29.163  -8.487  80.874  1.00 26.47 ? 23   ALA B N   1 
ATOM   2061 C  CA  . ALA B 1 21  ? 27.802  -9.028  80.835  1.00 26.32 ? 23   ALA B CA  1 
ATOM   2062 C  C   . ALA B 1 21  ? 26.898  -8.478  81.951  1.00 22.84 ? 23   ALA B C   1 
ATOM   2063 O  O   . ALA B 1 21  ? 25.682  -8.456  81.799  1.00 22.14 ? 23   ALA B O   1 
ATOM   2064 C  CB  . ALA B 1 21  ? 27.826  -10.554 80.910  1.00 27.65 ? 23   ALA B CB  1 
ATOM   2065 N  N   . CYS B 1 22  ? 27.496  -8.081  83.064  1.00 23.02 ? 24   CYS B N   1 
ATOM   2066 C  CA  . CYS B 1 22  ? 26.755  -7.485  84.182  1.00 25.23 ? 24   CYS B CA  1 
ATOM   2067 C  C   . CYS B 1 22  ? 26.089  -6.150  83.822  1.00 26.71 ? 24   CYS B C   1 
ATOM   2068 O  O   . CYS B 1 22  ? 25.168  -5.715  84.516  1.00 29.84 ? 24   CYS B O   1 
ATOM   2069 C  CB  . CYS B 1 22  ? 27.680  -7.347  85.395  1.00 25.51 ? 24   CYS B CB  1 
ATOM   2070 S  SG  . CYS B 1 22  ? 28.337  -8.926  86.031  1.00 28.22 ? 24   CYS B SG  1 
ATOM   2071 N  N   . ALA B 1 23  ? 26.520  -5.532  82.725  1.00 26.25 ? 25   ALA B N   1 
ATOM   2072 C  CA  . ALA B 1 23  ? 25.844  -4.359  82.177  1.00 27.29 ? 25   ALA B CA  1 
ATOM   2073 C  C   . ALA B 1 23  ? 24.927  -4.670  80.987  1.00 26.38 ? 25   ALA B C   1 
ATOM   2074 O  O   . ALA B 1 23  ? 24.557  -3.761  80.243  1.00 23.99 ? 25   ALA B O   1 
ATOM   2075 C  CB  . ALA B 1 23  ? 26.866  -3.289  81.811  1.00 28.37 ? 25   ALA B CB  1 
ATOM   2076 N  N   . GLY B 1 24  ? 24.508  -5.924  80.824  1.00 23.30 ? 26   GLY B N   1 
ATOM   2077 C  CA  . GLY B 1 24  ? 23.491  -6.245  79.815  1.00 23.68 ? 26   GLY B CA  1 
ATOM   2078 C  C   . GLY B 1 24  ? 22.143  -5.606  80.148  1.00 24.62 ? 26   GLY B C   1 
ATOM   2079 O  O   . GLY B 1 24  ? 21.952  -5.114  81.259  1.00 24.70 ? 26   GLY B O   1 
ATOM   2080 N  N   . ARG B 1 25  ? 21.215  -5.636  79.199  1.00 25.14 ? 27   ARG B N   1 
ATOM   2081 C  CA  . ARG B 1 25  ? 19.918  -4.971  79.356  1.00 26.05 ? 27   ARG B CA  1 
ATOM   2082 C  C   . ARG B 1 25  ? 18.907  -5.729  80.210  1.00 25.28 ? 27   ARG B C   1 
ATOM   2083 O  O   . ARG B 1 25  ? 17.926  -5.127  80.675  1.00 24.10 ? 27   ARG B O   1 
ATOM   2084 C  CB  . ARG B 1 25  ? 19.293  -4.701  77.988  1.00 29.79 ? 27   ARG B CB  1 
ATOM   2085 C  CG  . ARG B 1 25  ? 20.071  -3.696  77.136  1.00 34.57 ? 27   ARG B CG  1 
ATOM   2086 C  CD  . ARG B 1 25  ? 19.208  -3.134  76.007  1.00 38.64 ? 27   ARG B CD  1 
ATOM   2087 N  NE  . ARG B 1 25  ? 18.316  -2.060  76.461  1.00 44.23 ? 27   ARG B NE  1 
ATOM   2088 C  CZ  . ARG B 1 25  ? 18.501  -0.745  76.293  1.00 46.01 ? 27   ARG B CZ  1 
ATOM   2089 N  NH1 . ARG B 1 25  ? 19.564  -0.233  75.665  1.00 47.99 ? 27   ARG B NH1 1 
ATOM   2090 N  NH2 . ARG B 1 25  ? 17.595  0.078   76.782  1.00 50.15 ? 27   ARG B NH2 1 
ATOM   2091 N  N   . PHE B 1 26  ? 19.126  -7.040  80.394  1.00 22.15 ? 28   PHE B N   1 
ATOM   2092 C  CA  . PHE B 1 26  ? 18.117  -7.939  80.945  1.00 22.23 ? 28   PHE B CA  1 
ATOM   2093 C  C   . PHE B 1 26  ? 18.679  -8.741  82.113  1.00 22.33 ? 28   PHE B C   1 
ATOM   2094 O  O   . PHE B 1 26  ? 18.832  -9.968  82.059  1.00 20.68 ? 28   PHE B O   1 
ATOM   2095 C  CB  . PHE B 1 26  ? 17.526  -8.807  79.851  1.00 21.78 ? 28   PHE B CB  1 
ATOM   2096 C  CG  . PHE B 1 26  ? 17.046  -8.012  78.658  1.00 22.10 ? 28   PHE B CG  1 
ATOM   2097 C  CD1 . PHE B 1 26  ? 16.043  -7.049  78.813  1.00 22.12 ? 28   PHE B CD1 1 
ATOM   2098 C  CD2 . PHE B 1 26  ? 17.608  -8.199  77.392  1.00 21.43 ? 28   PHE B CD2 1 
ATOM   2099 C  CE1 . PHE B 1 26  ? 15.606  -6.293  77.734  1.00 20.61 ? 28   PHE B CE1 1 
ATOM   2100 C  CE2 . PHE B 1 26  ? 17.183  -7.442  76.311  1.00 20.98 ? 28   PHE B CE2 1 
ATOM   2101 C  CZ  . PHE B 1 26  ? 16.164  -6.494  76.485  1.00 20.84 ? 28   PHE B CZ  1 
ATOM   2102 N  N   . GLN B 1 27  ? 18.982  -7.988  83.168  1.00 21.62 ? 29   GLN B N   1 
ATOM   2103 C  CA  . GLN B 1 27  ? 19.616  -8.485  84.371  1.00 21.38 ? 29   GLN B CA  1 
ATOM   2104 C  C   . GLN B 1 27  ? 18.620  -8.764  85.509  1.00 21.86 ? 29   GLN B C   1 
ATOM   2105 O  O   . GLN B 1 27  ? 17.438  -8.435  85.435  1.00 20.81 ? 29   GLN B O   1 
ATOM   2106 C  CB  . GLN B 1 27  ? 20.687  -7.496  84.822  1.00 21.01 ? 29   GLN B CB  1 
ATOM   2107 C  CG  . GLN B 1 27  ? 21.813  -7.304  83.813  1.00 21.74 ? 29   GLN B CG  1 
ATOM   2108 C  CD  . GLN B 1 27  ? 22.854  -8.435  83.861  1.00 21.47 ? 29   GLN B CD  1 
ATOM   2109 O  OE1 . GLN B 1 27  ? 23.566  -8.596  84.856  1.00 21.26 ? 29   GLN B OE1 1 
ATOM   2110 N  NE2 . GLN B 1 27  ? 22.923  -9.225  82.800  1.00 22.44 ? 29   GLN B NE2 1 
ATOM   2111 N  N   . SER B 1 28  ? 19.131  -9.436  86.536  1.00 21.62 ? 30   SER B N   1 
ATOM   2112 C  CA  . SER B 1 28  ? 18.362  -9.838  87.708  1.00 20.20 ? 30   SER B CA  1 
ATOM   2113 C  C   . SER B 1 28  ? 19.188  -9.405  88.908  1.00 19.73 ? 30   SER B C   1 
ATOM   2114 O  O   . SER B 1 28  ? 20.399  -9.266  88.777  1.00 19.77 ? 30   SER B O   1 
ATOM   2115 C  CB  . SER B 1 28  ? 18.192  -11.353 87.721  1.00 18.44 ? 30   SER B CB  1 
ATOM   2116 O  OG  . SER B 1 28  ? 17.301  -11.783 86.719  1.00 19.22 ? 30   SER B OG  1 
ATOM   2117 N  N   . PRO B 1 29  ? 18.592  -9.190  90.087  1.00 19.88 ? 31   PRO B N   1 
ATOM   2118 C  CA  . PRO B 1 29  ? 17.170  -9.306  90.357  1.00 21.05 ? 31   PRO B CA  1 
ATOM   2119 C  C   . PRO B 1 29  ? 16.430  -8.026  89.962  1.00 21.92 ? 31   PRO B C   1 
ATOM   2120 O  O   . PRO B 1 29  ? 17.065  -7.060  89.537  1.00 22.15 ? 31   PRO B O   1 
ATOM   2121 C  CB  . PRO B 1 29  ? 17.139  -9.468  91.880  1.00 21.65 ? 31   PRO B CB  1 
ATOM   2122 C  CG  . PRO B 1 29  ? 18.270  -8.606  92.326  1.00 20.51 ? 31   PRO B CG  1 
ATOM   2123 C  CD  . PRO B 1 29  ? 19.346  -8.751  91.275  1.00 19.77 ? 31   PRO B CD  1 
ATOM   2124 N  N   . VAL B 1 30  ? 15.108  -8.061  90.107  1.00 24.20 ? 32   VAL B N   1 
ATOM   2125 C  CA  . VAL B 1 30  ? 14.185  -6.968  89.745  1.00 23.37 ? 32   VAL B CA  1 
ATOM   2126 C  C   . VAL B 1 30  ? 13.107  -6.746  90.841  1.00 25.67 ? 32   VAL B C   1 
ATOM   2127 O  O   . VAL B 1 30  ? 12.842  -7.626  91.680  1.00 23.24 ? 32   VAL B O   1 
ATOM   2128 C  CB  . VAL B 1 30  ? 13.420  -7.244  88.433  1.00 22.36 ? 32   VAL B CB  1 
ATOM   2129 C  CG1 . VAL B 1 30  ? 14.383  -7.495  87.285  1.00 23.17 ? 32   VAL B CG1 1 
ATOM   2130 C  CG2 . VAL B 1 30  ? 12.436  -8.409  88.563  1.00 22.99 ? 32   VAL B CG2 1 
ATOM   2131 N  N   . ASP B 1 31  ? 12.450  -5.587  90.788  1.00 26.15 ? 33   ASP B N   1 
ATOM   2132 C  CA  . ASP B 1 31  ? 11.308  -5.323  91.671  1.00 26.00 ? 33   ASP B CA  1 
ATOM   2133 C  C   . ASP B 1 31  ? 10.028  -5.817  91.048  1.00 26.55 ? 33   ASP B C   1 
ATOM   2134 O  O   . ASP B 1 31  ? 9.725   -5.470  89.912  1.00 29.32 ? 33   ASP B O   1 
ATOM   2135 C  CB  . ASP B 1 31  ? 11.221  -3.830  91.967  1.00 30.80 ? 33   ASP B CB  1 
ATOM   2136 C  CG  . ASP B 1 31  ? 10.116  -3.498  92.954  1.00 31.34 ? 33   ASP B CG  1 
ATOM   2137 O  OD1 . ASP B 1 31  ? 10.018  -4.170  94.018  1.00 29.38 ? 33   ASP B OD1 1 
ATOM   2138 O  OD2 . ASP B 1 31  ? 9.344   -2.563  92.654  1.00 30.76 ? 33   ASP B OD2 1 
ATOM   2139 N  N   . ILE B 1 32  ? 9.281   -6.643  91.785  1.00 23.00 ? 34   ILE B N   1 
ATOM   2140 C  CA  . ILE B 1 32  ? 8.061   -7.235  91.310  1.00 25.34 ? 34   ILE B CA  1 
ATOM   2141 C  C   . ILE B 1 32  ? 6.937   -6.286  91.742  1.00 28.41 ? 34   ILE B C   1 
ATOM   2142 O  O   . ILE B 1 32  ? 6.841   -5.954  92.939  1.00 29.91 ? 34   ILE B O   1 
ATOM   2143 C  CB  . ILE B 1 32  ? 7.847   -8.622  91.917  1.00 23.68 ? 34   ILE B CB  1 
ATOM   2144 C  CG1 . ILE B 1 32  ? 8.993   -9.561  91.502  1.00 25.20 ? 34   ILE B CG1 1 
ATOM   2145 C  CG2 . ILE B 1 32  ? 6.514   -9.212  91.497  1.00 24.69 ? 34   ILE B CG2 1 
ATOM   2146 C  CD1 . ILE B 1 32  ? 8.987   -10.895 92.240  1.00 24.23 ? 34   ILE B CD1 1 
ATOM   2147 N  N   . ARG B 1 33  ? 6.128   -5.859  90.770  1.00 28.32 ? 35   ARG B N   1 
ATOM   2148 C  CA  . ARG B 1 33  ? 4.929   -5.029  91.010  1.00 25.43 ? 35   ARG B CA  1 
ATOM   2149 C  C   . ARG B 1 33  ? 3.747   -5.785  90.576  1.00 24.02 ? 35   ARG B C   1 
ATOM   2150 O  O   . ARG B 1 33  ? 3.425   -5.798  89.403  1.00 22.56 ? 35   ARG B O   1 
ATOM   2151 C  CB  . ARG B 1 33  ? 5.060   -3.722  90.245  1.00 29.17 ? 35   ARG B CB  1 
ATOM   2152 C  CG  . ARG B 1 33  ? 6.018   -2.820  90.987  1.00 29.88 ? 35   ARG B CG  1 
ATOM   2153 C  CD  . ARG B 1 33  ? 6.577   -1.690  90.160  1.00 33.97 ? 35   ARG B CD  1 
ATOM   2154 N  NE  . ARG B 1 33  ? 7.957   -1.426  90.575  1.00 37.74 ? 35   ARG B NE  1 
ATOM   2155 C  CZ  . ARG B 1 33  ? 8.727   -0.433  90.131  1.00 40.08 ? 35   ARG B CZ  1 
ATOM   2156 N  NH1 . ARG B 1 33  ? 8.259   0.462   89.246  1.00 38.31 ? 35   ARG B NH1 1 
ATOM   2157 N  NH2 . ARG B 1 33  ? 9.986   -0.340  90.599  1.00 37.52 ? 35   ARG B NH2 1 
ATOM   2158 N  N   . PRO B 1 34  ? 3.094   -6.499  91.523  1.00 23.42 ? 36   PRO B N   1 
ATOM   2159 C  CA  . PRO B 1 34  ? 2.059   -7.431  91.121  1.00 23.27 ? 36   PRO B CA  1 
ATOM   2160 C  C   . PRO B 1 34  ? 0.909   -6.870  90.308  1.00 22.61 ? 36   PRO B C   1 
ATOM   2161 O  O   . PRO B 1 34  ? 0.381   -7.558  89.417  1.00 21.04 ? 36   PRO B O   1 
ATOM   2162 C  CB  . PRO B 1 34  ? 1.572   -8.016  92.463  1.00 24.51 ? 36   PRO B CB  1 
ATOM   2163 C  CG  . PRO B 1 34  ? 2.731   -7.918  93.355  1.00 23.78 ? 36   PRO B CG  1 
ATOM   2164 C  CD  . PRO B 1 34  ? 3.515   -6.711  92.912  1.00 24.47 ? 36   PRO B CD  1 
ATOM   2165 N  N   . GLN B 1 35  ? 0.546   -5.607  90.528  1.00 25.46 ? 37   GLN B N   1 
ATOM   2166 C  CA  . GLN B 1 35  ? -0.535  -5.027  89.721  1.00 27.54 ? 37   GLN B CA  1 
ATOM   2167 C  C   . GLN B 1 35  ? -0.148  -4.867  88.261  1.00 26.33 ? 37   GLN B C   1 
ATOM   2168 O  O   . GLN B 1 35  ? -1.013  -4.824  87.389  1.00 28.25 ? 37   GLN B O   1 
ATOM   2169 C  CB  . GLN B 1 35  ? -0.998  -3.706  90.312  1.00 30.49 ? 37   GLN B CB  1 
ATOM   2170 C  CG  . GLN B 1 35  ? -1.461  -3.799  91.761  1.00 31.61 ? 37   GLN B CG  1 
ATOM   2171 C  CD  . GLN B 1 35  ? -1.985  -2.461  92.319  1.00 30.29 ? 37   GLN B CD  1 
ATOM   2172 O  OE1 . GLN B 1 35  ? -2.046  -2.266  93.528  1.00 34.61 ? 37   GLN B OE1 1 
ATOM   2173 N  NE2 . GLN B 1 35  ? -2.287  -1.536  91.438  1.00 29.11 ? 37   GLN B NE2 1 
ATOM   2174 N  N   . LEU B 1 36  ? 1.161   -4.822  87.985  1.00 26.56 ? 38   LEU B N   1 
ATOM   2175 C  CA  . LEU B 1 36  ? 1.677   -4.737  86.620  1.00 26.25 ? 38   LEU B CA  1 
ATOM   2176 C  C   . LEU B 1 36  ? 2.093   -6.076  86.021  1.00 25.09 ? 38   LEU B C   1 
ATOM   2177 O  O   . LEU B 1 36  ? 2.508   -6.142  84.865  1.00 24.45 ? 38   LEU B O   1 
ATOM   2178 C  CB  . LEU B 1 36  ? 2.865   -3.765  86.580  1.00 28.09 ? 38   LEU B CB  1 
ATOM   2179 C  CG  . LEU B 1 36  ? 2.599   -2.411  87.235  1.00 30.27 ? 38   LEU B CG  1 
ATOM   2180 C  CD1 . LEU B 1 36  ? 3.821   -1.520  87.105  1.00 31.54 ? 38   LEU B CD1 1 
ATOM   2181 C  CD2 . LEU B 1 36  ? 1.378   -1.740  86.619  1.00 32.88 ? 38   LEU B CD2 1 
ATOM   2182 N  N   . ALA B 1 37  ? 1.938   -7.165  86.772  1.00 23.74 ? 39   ALA B N   1 
ATOM   2183 C  CA  . ALA B 1 37  ? 2.266   -8.459  86.240  1.00 23.27 ? 39   ALA B CA  1 
ATOM   2184 C  C   . ALA B 1 37  ? 1.183   -8.859  85.268  1.00 23.77 ? 39   ALA B C   1 
ATOM   2185 O  O   . ALA B 1 37  ? -0.003  -8.547  85.467  1.00 23.79 ? 39   ALA B O   1 
ATOM   2186 C  CB  . ALA B 1 37  ? 2.402   -9.493  87.364  1.00 24.26 ? 39   ALA B CB  1 
ATOM   2187 N  N   . ALA B 1 38  ? 1.594   -9.532  84.210  1.00 22.59 ? 40   ALA B N   1 
ATOM   2188 C  CA  . ALA B 1 38  ? 0.696   -10.129 83.248  1.00 25.64 ? 40   ALA B CA  1 
ATOM   2189 C  C   . ALA B 1 38  ? 0.255   -11.517 83.709  1.00 28.01 ? 40   ALA B C   1 
ATOM   2190 O  O   . ALA B 1 38  ? 1.067   -12.442 83.716  1.00 29.66 ? 40   ALA B O   1 
ATOM   2191 C  CB  . ALA B 1 38  ? 1.393   -10.236 81.898  1.00 25.69 ? 40   ALA B CB  1 
ATOM   2192 N  N   . PHE B 1 39  ? -1.034  -11.674 84.019  1.00 25.62 ? 41   PHE B N   1 
ATOM   2193 C  CA  . PHE B 1 39  ? -1.605  -12.974 84.318  1.00 25.89 ? 41   PHE B CA  1 
ATOM   2194 C  C   . PHE B 1 39  ? -1.654  -13.809 83.060  1.00 25.51 ? 41   PHE B C   1 
ATOM   2195 O  O   . PHE B 1 39  ? -2.188  -13.381 82.049  1.00 24.48 ? 41   PHE B O   1 
ATOM   2196 C  CB  . PHE B 1 39  ? -3.009  -12.849 84.930  1.00 24.78 ? 41   PHE B CB  1 
ATOM   2197 C  CG  . PHE B 1 39  ? -3.774  -14.147 85.019  1.00 25.03 ? 41   PHE B CG  1 
ATOM   2198 C  CD1 . PHE B 1 39  ? -3.230  -15.273 85.677  1.00 24.22 ? 41   PHE B CD1 1 
ATOM   2199 C  CD2 . PHE B 1 39  ? -5.066  -14.240 84.503  1.00 24.90 ? 41   PHE B CD2 1 
ATOM   2200 C  CE1 . PHE B 1 39  ? -3.960  -16.449 85.765  1.00 24.71 ? 41   PHE B CE1 1 
ATOM   2201 C  CE2 . PHE B 1 39  ? -5.793  -15.412 84.596  1.00 26.54 ? 41   PHE B CE2 1 
ATOM   2202 C  CZ  . PHE B 1 39  ? -5.242  -16.524 85.232  1.00 25.18 ? 41   PHE B CZ  1 
ATOM   2203 N  N   . SER B 1 40  ? -1.063  -14.994 83.117  1.00 24.74 ? 42   SER B N   1 
ATOM   2204 C  CA  A SER B 1 40  ? -1.190  -15.943 82.012  0.50 25.45 ? 42   SER B CA  1 
ATOM   2205 C  CA  B SER B 1 40  ? -1.087  -15.929 82.017  0.50 26.51 ? 42   SER B CA  1 
ATOM   2206 C  C   . SER B 1 40  ? -1.633  -17.267 82.535  1.00 27.02 ? 42   SER B C   1 
ATOM   2207 O  O   . SER B 1 40  ? -0.888  -17.955 83.250  1.00 29.61 ? 42   SER B O   1 
ATOM   2208 C  CB  A SER B 1 40  ? 0.064   -16.147 81.179  0.50 25.37 ? 42   SER B CB  1 
ATOM   2209 C  CB  B SER B 1 40  ? 0.350   -16.074 81.471  0.50 27.60 ? 42   SER B CB  1 
ATOM   2210 O  OG  A SER B 1 40  ? -0.279  -16.999 80.086  0.50 22.71 ? 42   SER B OG  1 
ATOM   2211 O  OG  B SER B 1 40  ? 1.183   -14.959 81.823  0.50 27.39 ? 42   SER B OG  1 
ATOM   2212 N  N   . PRO B 1 41  ? -2.887  -17.640 82.186  1.00 28.76 ? 43   PRO B N   1 
ATOM   2213 C  CA  . PRO B 1 41  ? -3.350  -18.959 82.595  1.00 29.95 ? 43   PRO B CA  1 
ATOM   2214 C  C   . PRO B 1 41  ? -2.578  -20.135 82.016  1.00 29.97 ? 43   PRO B C   1 
ATOM   2215 O  O   . PRO B 1 41  ? -2.832  -21.256 82.427  1.00 28.82 ? 43   PRO B O   1 
ATOM   2216 C  CB  . PRO B 1 41  ? -4.799  -19.016 82.112  1.00 30.64 ? 43   PRO B CB  1 
ATOM   2217 C  CG  . PRO B 1 41  ? -5.030  -17.806 81.290  1.00 29.89 ? 43   PRO B CG  1 
ATOM   2218 C  CD  . PRO B 1 41  ? -4.006  -16.812 81.671  1.00 29.36 ? 43   PRO B CD  1 
ATOM   2219 N  N   . ALA B 1 42  ? -1.694  -19.880 81.055  1.00 30.41 ? 44   ALA B N   1 
ATOM   2220 C  CA  . ALA B 1 42  ? -0.768  -20.897 80.555  1.00 31.07 ? 44   ALA B CA  1 
ATOM   2221 C  C   . ALA B 1 42  ? 0.264   -21.370 81.593  1.00 29.35 ? 44   ALA B C   1 
ATOM   2222 O  O   . ALA B 1 42  ? 0.745   -22.491 81.481  1.00 30.51 ? 44   ALA B O   1 
ATOM   2223 C  CB  . ALA B 1 42  ? -0.033  -20.374 79.323  1.00 31.66 ? 44   ALA B CB  1 
ATOM   2224 N  N   . LEU B 1 43  ? 0.634   -20.512 82.545  1.00 28.47 ? 45   LEU B N   1 
ATOM   2225 C  CA  . LEU B 1 43  ? 1.585   -20.874 83.607  1.00 28.36 ? 45   LEU B CA  1 
ATOM   2226 C  C   . LEU B 1 43  ? 0.977   -21.920 84.554  1.00 29.77 ? 45   LEU B C   1 
ATOM   2227 O  O   . LEU B 1 43  ? 0.153   -21.575 85.416  1.00 31.46 ? 45   LEU B O   1 
ATOM   2228 C  CB  . LEU B 1 43  ? 2.011   -19.638 84.398  1.00 27.64 ? 45   LEU B CB  1 
ATOM   2229 C  CG  . LEU B 1 43  ? 2.781   -18.536 83.684  1.00 28.64 ? 45   LEU B CG  1 
ATOM   2230 C  CD1 . LEU B 1 43  ? 3.138   -17.439 84.664  1.00 30.71 ? 45   LEU B CD1 1 
ATOM   2231 C  CD2 . LEU B 1 43  ? 4.040   -19.078 83.024  1.00 29.55 ? 45   LEU B CD2 1 
ATOM   2232 N  N   . ARG B 1 44  ? 1.370   -23.183 84.396  1.00 27.71 ? 46   ARG B N   1 
ATOM   2233 C  CA  . ARG B 1 44  ? 0.819   -24.280 85.224  1.00 28.80 ? 46   ARG B CA  1 
ATOM   2234 C  C   . ARG B 1 44  ? 1.590   -24.462 86.557  1.00 24.98 ? 46   ARG B C   1 
ATOM   2235 O  O   . ARG B 1 44  ? 2.649   -23.879 86.754  1.00 23.27 ? 46   ARG B O   1 
ATOM   2236 C  CB  . ARG B 1 44  ? 0.761   -25.583 84.414  1.00 31.77 ? 46   ARG B CB  1 
ATOM   2237 C  CG  . ARG B 1 44  ? 2.102   -26.232 84.177  1.00 36.67 ? 46   ARG B CG  1 
ATOM   2238 C  CD  . ARG B 1 44  ? 2.010   -27.654 83.638  1.00 40.56 ? 46   ARG B CD  1 
ATOM   2239 N  NE  . ARG B 1 44  ? 3.328   -28.287 83.721  1.00 42.98 ? 46   ARG B NE  1 
ATOM   2240 C  CZ  . ARG B 1 44  ? 3.626   -29.500 83.272  1.00 45.94 ? 46   ARG B CZ  1 
ATOM   2241 N  NH1 . ARG B 1 44  ? 2.702   -30.260 82.674  1.00 49.50 ? 46   ARG B NH1 1 
ATOM   2242 N  NH2 . ARG B 1 44  ? 4.861   -29.964 83.439  1.00 45.59 ? 46   ARG B NH2 1 
ATOM   2243 N  N   . PRO B 1 45  ? 1.037   -25.255 87.495  1.00 23.76 ? 47   PRO B N   1 
ATOM   2244 C  CA  . PRO B 1 45  ? 1.754   -25.433 88.763  1.00 23.55 ? 47   PRO B CA  1 
ATOM   2245 C  C   . PRO B 1 45  ? 3.146   -26.032 88.562  1.00 19.97 ? 47   PRO B C   1 
ATOM   2246 O  O   . PRO B 1 45  ? 3.329   -26.841 87.678  1.00 21.05 ? 47   PRO B O   1 
ATOM   2247 C  CB  . PRO B 1 45  ? 0.846   -26.398 89.534  1.00 25.14 ? 47   PRO B CB  1 
ATOM   2248 C  CG  . PRO B 1 45  ? -0.528  -26.097 89.008  1.00 26.50 ? 47   PRO B CG  1 
ATOM   2249 C  CD  . PRO B 1 45  ? -0.297  -25.887 87.535  1.00 25.54 ? 47   PRO B CD  1 
ATOM   2250 N  N   . LEU B 1 46  ? 4.112   -25.609 89.350  1.00 21.21 ? 48   LEU B N   1 
ATOM   2251 C  CA  . LEU B 1 46  ? 5.469   -26.155 89.226  1.00 21.63 ? 48   LEU B CA  1 
ATOM   2252 C  C   . LEU B 1 46  ? 5.436   -27.626 89.633  1.00 21.60 ? 48   LEU B C   1 
ATOM   2253 O  O   . LEU B 1 46  ? 4.719   -27.972 90.549  1.00 20.75 ? 48   LEU B O   1 
ATOM   2254 C  CB  . LEU B 1 46  ? 6.432   -25.414 90.136  1.00 22.82 ? 48   LEU B CB  1 
ATOM   2255 C  CG  . LEU B 1 46  ? 6.606   -23.917 89.881  1.00 22.82 ? 48   LEU B CG  1 
ATOM   2256 C  CD1 . LEU B 1 46  ? 7.431   -23.308 90.983  1.00 22.74 ? 48   LEU B CD1 1 
ATOM   2257 C  CD2 . LEU B 1 46  ? 7.242   -23.655 88.515  1.00 24.09 ? 48   LEU B CD2 1 
ATOM   2258 N  N   . GLU B 1 47  ? 6.194   -28.476 88.951  1.00 21.39 ? 49   GLU B N   1 
ATOM   2259 C  CA  . GLU B 1 47  ? 6.287   -29.885 89.352  1.00 21.40 ? 49   GLU B CA  1 
ATOM   2260 C  C   . GLU B 1 47  ? 7.734   -30.137 89.779  1.00 20.63 ? 49   GLU B C   1 
ATOM   2261 O  O   . GLU B 1 47  ? 8.656   -29.876 89.001  1.00 17.91 ? 49   GLU B O   1 
ATOM   2262 C  CB  . GLU B 1 47  ? 5.872   -30.776 88.213  1.00 22.92 ? 49   GLU B CB  1 
ATOM   2263 C  CG  . GLU B 1 47  ? 4.517   -30.406 87.631  1.00 24.37 ? 49   GLU B CG  1 
ATOM   2264 C  CD  . GLU B 1 47  ? 4.035   -31.328 86.538  1.00 25.82 ? 49   GLU B CD  1 
ATOM   2265 O  OE1 . GLU B 1 47  ? 4.771   -32.255 86.108  1.00 27.35 ? 49   GLU B OE1 1 
ATOM   2266 O  OE2 . GLU B 1 47  ? 2.880   -31.141 86.103  1.00 26.54 ? 49   GLU B OE2 1 
ATOM   2267 N  N   . LEU B 1 48  ? 7.916   -30.594 91.018  1.00 19.69 ? 50   LEU B N   1 
ATOM   2268 C  CA  . LEU B 1 48  ? 9.232   -30.899 91.583  1.00 20.62 ? 50   LEU B CA  1 
ATOM   2269 C  C   . LEU B 1 48  ? 9.208   -32.339 92.129  1.00 20.51 ? 50   LEU B C   1 
ATOM   2270 O  O   . LEU B 1 48  ? 8.546   -32.604 93.140  1.00 20.28 ? 50   LEU B O   1 
ATOM   2271 C  CB  . LEU B 1 48  ? 9.566   -29.913 92.710  1.00 21.11 ? 50   LEU B CB  1 
ATOM   2272 C  CG  . LEU B 1 48  ? 10.094  -28.515 92.406  1.00 21.25 ? 50   LEU B CG  1 
ATOM   2273 C  CD1 . LEU B 1 48  ? 9.066   -27.643 91.667  1.00 21.34 ? 50   LEU B CD1 1 
ATOM   2274 C  CD2 . LEU B 1 48  ? 10.539  -27.848 93.692  1.00 21.67 ? 50   LEU B CD2 1 
ATOM   2275 N  N   . LEU B 1 49  ? 9.856   -33.266 91.416  1.00 20.44 ? 51   LEU B N   1 
ATOM   2276 C  CA  . LEU B 1 49  ? 9.909   -34.678 91.835  1.00 21.04 ? 51   LEU B CA  1 
ATOM   2277 C  C   . LEU B 1 49  ? 11.330  -35.074 92.213  1.00 21.59 ? 51   LEU B C   1 
ATOM   2278 O  O   . LEU B 1 49  ? 12.296  -34.527 91.674  1.00 20.34 ? 51   LEU B O   1 
ATOM   2279 C  CB  . LEU B 1 49  ? 9.401   -35.588 90.714  1.00 20.45 ? 51   LEU B CB  1 
ATOM   2280 C  CG  . LEU B 1 49  ? 7.963   -35.308 90.271  1.00 20.49 ? 51   LEU B CG  1 
ATOM   2281 C  CD1 . LEU B 1 49  ? 7.509   -36.359 89.281  1.00 19.36 ? 51   LEU B CD1 1 
ATOM   2282 C  CD2 . LEU B 1 49  ? 7.008   -35.243 91.454  1.00 21.18 ? 51   LEU B CD2 1 
ATOM   2283 N  N   . GLY B 1 50  ? 11.453  -36.049 93.126  1.00 21.78 ? 52   GLY B N   1 
ATOM   2284 C  CA  . GLY B 1 50  ? 12.759  -36.494 93.611  1.00 20.84 ? 52   GLY B CA  1 
ATOM   2285 C  C   . GLY B 1 50  ? 13.432  -35.599 94.628  1.00 21.87 ? 52   GLY B C   1 
ATOM   2286 O  O   . GLY B 1 50  ? 14.600  -35.833 94.966  1.00 21.20 ? 52   GLY B O   1 
ATOM   2287 N  N   . PHE B 1 51  ? 12.722  -34.597 95.160  1.00 20.59 ? 53   PHE B N   1 
ATOM   2288 C  CA  . PHE B 1 51  ? 13.313  -33.672 96.111  1.00 21.11 ? 53   PHE B CA  1 
ATOM   2289 C  C   . PHE B 1 51  ? 13.388  -34.170 97.567  1.00 21.37 ? 53   PHE B C   1 
ATOM   2290 O  O   . PHE B 1 51  ? 14.118  -33.570 98.378  1.00 21.24 ? 53   PHE B O   1 
ATOM   2291 C  CB  . PHE B 1 51  ? 12.574  -32.323 96.110  1.00 20.95 ? 53   PHE B CB  1 
ATOM   2292 C  CG  . PHE B 1 51  ? 12.932  -31.431 94.950  1.00 21.33 ? 53   PHE B CG  1 
ATOM   2293 C  CD1 . PHE B 1 51  ? 12.756  -31.862 93.634  1.00 20.65 ? 53   PHE B CD1 1 
ATOM   2294 C  CD2 . PHE B 1 51  ? 13.453  -30.162 95.176  1.00 21.45 ? 53   PHE B CD2 1 
ATOM   2295 C  CE1 . PHE B 1 51  ? 13.084  -31.033 92.569  1.00 20.61 ? 53   PHE B CE1 1 
ATOM   2296 C  CE2 . PHE B 1 51  ? 13.808  -29.353 94.105  1.00 21.58 ? 53   PHE B CE2 1 
ATOM   2297 C  CZ  . PHE B 1 51  ? 13.620  -29.797 92.811  1.00 21.17 ? 53   PHE B CZ  1 
ATOM   2298 N  N   . GLN B 1 52  ? 12.637  -35.212 97.890  1.00 22.55 ? 54   GLN B N   1 
ATOM   2299 C  CA  . GLN B 1 52  ? 12.534  -35.725 99.263  1.00 25.48 ? 54   GLN B CA  1 
ATOM   2300 C  C   . GLN B 1 52  ? 13.675  -36.716 99.502  1.00 26.14 ? 54   GLN B C   1 
ATOM   2301 O  O   . GLN B 1 52  ? 13.511  -37.939 99.324  1.00 25.71 ? 54   GLN B O   1 
ATOM   2302 C  CB  . GLN B 1 52  ? 11.193  -36.441 99.442  1.00 26.00 ? 54   GLN B CB  1 
ATOM   2303 C  CG  . GLN B 1 52  ? 9.980   -35.584 99.173  1.00 27.81 ? 54   GLN B CG  1 
ATOM   2304 C  CD  . GLN B 1 52  ? 8.710   -36.415 99.217  1.00 29.38 ? 54   GLN B CD  1 
ATOM   2305 O  OE1 . GLN B 1 52  ? 7.935   -36.315 100.156 1.00 30.52 ? 54   GLN B OE1 1 
ATOM   2306 N  NE2 . GLN B 1 52  ? 8.516   -37.268 98.211  1.00 31.73 ? 54   GLN B NE2 1 
ATOM   2307 N  N   . LEU B 1 53  ? 14.840  -36.184 99.851  1.00 24.92 ? 55   LEU B N   1 
ATOM   2308 C  CA  . LEU B 1 53  ? 16.046  -37.008 99.923  1.00 25.68 ? 55   LEU B CA  1 
ATOM   2309 C  C   . LEU B 1 53  ? 16.122  -37.801 101.229 1.00 25.48 ? 55   LEU B C   1 
ATOM   2310 O  O   . LEU B 1 53  ? 15.716  -37.317 102.281 1.00 23.83 ? 55   LEU B O   1 
ATOM   2311 C  CB  . LEU B 1 53  ? 17.300  -36.164 99.788  1.00 25.18 ? 55   LEU B CB  1 
ATOM   2312 C  CG  . LEU B 1 53  ? 17.448  -35.377 98.488  1.00 24.37 ? 55   LEU B CG  1 
ATOM   2313 C  CD1 . LEU B 1 53  ? 18.711  -34.550 98.568  1.00 23.60 ? 55   LEU B CD1 1 
ATOM   2314 C  CD2 . LEU B 1 53  ? 17.458  -36.317 97.297  1.00 24.14 ? 55   LEU B CD2 1 
ATOM   2315 N  N   . PRO B 1 54  ? 16.654  -39.028 101.151 1.00 27.89 ? 56   PRO B N   1 
ATOM   2316 C  CA  . PRO B 1 54  ? 16.815  -39.840 102.365 1.00 28.92 ? 56   PRO B CA  1 
ATOM   2317 C  C   . PRO B 1 54  ? 18.015  -39.342 103.188 1.00 28.59 ? 56   PRO B C   1 
ATOM   2318 O  O   . PRO B 1 54  ? 18.810  -38.559 102.681 1.00 26.62 ? 56   PRO B O   1 
ATOM   2319 C  CB  . PRO B 1 54  ? 17.069  -41.245 101.806 1.00 29.03 ? 56   PRO B CB  1 
ATOM   2320 C  CG  . PRO B 1 54  ? 17.734  -41.006 100.493 1.00 28.55 ? 56   PRO B CG  1 
ATOM   2321 C  CD  . PRO B 1 54  ? 17.161  -39.721 99.951  1.00 27.73 ? 56   PRO B CD  1 
ATOM   2322 N  N   . PRO B 1 55  ? 18.162  -39.800 104.444 1.00 30.05 ? 57   PRO B N   1 
ATOM   2323 C  CA  . PRO B 1 55  ? 19.292  -39.274 105.238 1.00 29.91 ? 57   PRO B CA  1 
ATOM   2324 C  C   . PRO B 1 55  ? 20.700  -39.576 104.684 1.00 28.48 ? 57   PRO B C   1 
ATOM   2325 O  O   . PRO B 1 55  ? 21.644  -38.813 104.954 1.00 27.06 ? 57   PRO B O   1 
ATOM   2326 C  CB  . PRO B 1 55  ? 19.083  -39.916 106.611 1.00 32.48 ? 57   PRO B CB  1 
ATOM   2327 C  CG  . PRO B 1 55  ? 17.619  -40.193 106.682 1.00 32.66 ? 57   PRO B CG  1 
ATOM   2328 C  CD  . PRO B 1 55  ? 17.203  -40.552 105.278 1.00 32.14 ? 57   PRO B CD  1 
ATOM   2329 N  N   . LEU B 1 56  ? 20.842  -40.660 103.928 1.00 29.15 ? 58   LEU B N   1 
ATOM   2330 C  CA  . LEU B 1 56  ? 22.088  -40.976 103.244 1.00 29.99 ? 58   LEU B CA  1 
ATOM   2331 C  C   . LEU B 1 56  ? 21.827  -41.209 101.762 1.00 29.73 ? 58   LEU B C   1 
ATOM   2332 O  O   . LEU B 1 56  ? 20.806  -41.814 101.422 1.00 29.65 ? 58   LEU B O   1 
ATOM   2333 C  CB  . LEU B 1 56  ? 22.734  -42.234 103.861 1.00 33.57 ? 58   LEU B CB  1 
ATOM   2334 C  CG  . LEU B 1 56  ? 23.197  -42.097 105.314 1.00 34.27 ? 58   LEU B CG  1 
ATOM   2335 C  CD1 . LEU B 1 56  ? 23.514  -43.471 105.896 1.00 37.15 ? 58   LEU B CD1 1 
ATOM   2336 C  CD2 . LEU B 1 56  ? 24.407  -41.177 105.427 1.00 34.58 ? 58   LEU B CD2 1 
ATOM   2337 N  N   . PRO B 1 57  ? 22.728  -40.789 100.864 1.00 28.13 ? 59   PRO B N   1 
ATOM   2338 C  CA  . PRO B 1 57  ? 24.021  -40.182 101.189 1.00 30.08 ? 59   PRO B CA  1 
ATOM   2339 C  C   . PRO B 1 57  ? 23.932  -38.744 101.680 1.00 28.77 ? 59   PRO B C   1 
ATOM   2340 O  O   . PRO B 1 57  ? 22.903  -38.082 101.536 1.00 28.40 ? 59   PRO B O   1 
ATOM   2341 C  CB  . PRO B 1 57  ? 24.775  -40.235 99.863  1.00 29.87 ? 59   PRO B CB  1 
ATOM   2342 C  CG  . PRO B 1 57  ? 23.703  -40.214 98.834  1.00 29.81 ? 59   PRO B CG  1 
ATOM   2343 C  CD  . PRO B 1 57  ? 22.566  -40.986 99.420  1.00 28.97 ? 59   PRO B CD  1 
ATOM   2344 N  N   . GLU B 1 58  ? 25.016  -38.294 102.285 1.00 29.19 ? 60   GLU B N   1 
ATOM   2345 C  CA  . GLU B 1 58  ? 25.123  -36.951 102.796 1.00 30.06 ? 60   GLU B CA  1 
ATOM   2346 C  C   . GLU B 1 58  ? 25.338  -35.970 101.633 1.00 29.50 ? 60   GLU B C   1 
ATOM   2347 O  O   . GLU B 1 58  ? 25.709  -36.376 100.517 1.00 29.72 ? 60   GLU B O   1 
ATOM   2348 C  CB  . GLU B 1 58  ? 26.288  -36.869 103.783 1.00 33.37 ? 60   GLU B CB  1 
ATOM   2349 C  CG  . GLU B 1 58  ? 26.095  -37.726 105.018 1.00 36.27 ? 60   GLU B CG  1 
ATOM   2350 C  CD  . GLU B 1 58  ? 27.194  -37.515 106.041 1.00 41.37 ? 60   GLU B CD  1 
ATOM   2351 O  OE1 . GLU B 1 58  ? 28.390  -37.567 105.664 1.00 41.93 ? 60   GLU B OE1 1 
ATOM   2352 O  OE2 . GLU B 1 58  ? 26.857  -37.296 107.220 1.00 43.34 ? 60   GLU B OE2 1 
ATOM   2353 N  N   . LEU B 1 59  ? 25.127  -34.688 101.911 1.00 28.88 ? 61   LEU B N   1 
ATOM   2354 C  CA  . LEU B 1 59  ? 25.291  -33.608 100.925 1.00 29.37 ? 61   LEU B CA  1 
ATOM   2355 C  C   . LEU B 1 59  ? 26.379  -32.628 101.338 1.00 27.91 ? 61   LEU B C   1 
ATOM   2356 O  O   . LEU B 1 59  ? 26.512  -32.320 102.508 1.00 27.61 ? 61   LEU B O   1 
ATOM   2357 C  CB  . LEU B 1 59  ? 23.983  -32.810 100.782 1.00 30.10 ? 61   LEU B CB  1 
ATOM   2358 C  CG  . LEU B 1 59  ? 22.818  -33.447 100.013 1.00 32.47 ? 61   LEU B CG  1 
ATOM   2359 C  CD1 . LEU B 1 59  ? 22.249  -34.642 100.743 1.00 33.91 ? 61   LEU B CD1 1 
ATOM   2360 C  CD2 . LEU B 1 59  ? 21.723  -32.413 99.774  1.00 32.09 ? 61   LEU B CD2 1 
ATOM   2361 N  N   . ARG B 1 60  ? 27.107  -32.101 100.360 1.00 27.53 ? 62   ARG B N   1 
ATOM   2362 C  CA  . ARG B 1 60  ? 28.136  -31.100 100.609 1.00 30.77 ? 62   ARG B CA  1 
ATOM   2363 C  C   . ARG B 1 60  ? 27.499  -29.729 100.854 1.00 30.27 ? 62   ARG B C   1 
ATOM   2364 O  O   . ARG B 1 60  ? 26.696  -29.263 100.030 1.00 29.40 ? 62   ARG B O   1 
ATOM   2365 C  CB  . ARG B 1 60  ? 29.087  -31.027 99.414  1.00 33.93 ? 62   ARG B CB  1 
ATOM   2366 C  CG  . ARG B 1 60  ? 30.256  -30.078 99.586  1.00 38.33 ? 62   ARG B CG  1 
ATOM   2367 C  CD  . ARG B 1 60  ? 31.046  -30.017 98.301  1.00 42.44 ? 62   ARG B CD  1 
ATOM   2368 N  NE  . ARG B 1 60  ? 32.289  -29.261 98.435  1.00 48.65 ? 62   ARG B NE  1 
ATOM   2369 C  CZ  . ARG B 1 60  ? 33.091  -28.933 97.415  1.00 53.36 ? 62   ARG B CZ  1 
ATOM   2370 N  NH1 . ARG B 1 60  ? 32.783  -29.268 96.159  1.00 54.62 ? 62   ARG B NH1 1 
ATOM   2371 N  NH2 . ARG B 1 60  ? 34.206  -28.238 97.647  1.00 53.74 ? 62   ARG B NH2 1 
ATOM   2372 N  N   . LEU B 1 61  ? 27.854  -29.109 101.987 1.00 28.74 ? 63   LEU B N   1 
ATOM   2373 C  CA  . LEU B 1 61  ? 27.462  -27.733 102.335 1.00 27.83 ? 63   LEU B CA  1 
ATOM   2374 C  C   . LEU B 1 61  ? 28.731  -26.916 102.442 1.00 29.61 ? 63   LEU B C   1 
ATOM   2375 O  O   . LEU B 1 61  ? 29.638  -27.281 103.210 1.00 28.32 ? 63   LEU B O   1 
ATOM   2376 C  CB  . LEU B 1 61  ? 26.708  -27.714 103.664 1.00 27.85 ? 63   LEU B CB  1 
ATOM   2377 C  CG  . LEU B 1 61  ? 26.034  -26.419 104.088 1.00 27.66 ? 63   LEU B CG  1 
ATOM   2378 C  CD1 . LEU B 1 61  ? 24.868  -26.100 103.165 1.00 26.92 ? 63   LEU B CD1 1 
ATOM   2379 C  CD2 . LEU B 1 61  ? 25.531  -26.542 105.522 1.00 28.44 ? 63   LEU B CD2 1 
ATOM   2380 N  N   . ARG B 1 62  ? 28.819  -25.823 101.690 1.00 29.70 ? 64   ARG B N   1 
ATOM   2381 C  CA  . ARG B 1 62  ? 30.081  -25.099 101.552 1.00 31.27 ? 64   ARG B CA  1 
ATOM   2382 C  C   . ARG B 1 62  ? 29.892  -23.603 101.741 1.00 30.87 ? 64   ARG B C   1 
ATOM   2383 O  O   . ARG B 1 62  ? 28.933  -23.027 101.236 1.00 31.67 ? 64   ARG B O   1 
ATOM   2384 C  CB  . ARG B 1 62  ? 30.668  -25.389 100.174 1.00 34.52 ? 64   ARG B CB  1 
ATOM   2385 C  CG  . ARG B 1 62  ? 31.945  -24.637 99.859  1.00 40.77 ? 64   ARG B CG  1 
ATOM   2386 C  CD  . ARG B 1 62  ? 32.705  -25.245 98.687  1.00 45.26 ? 64   ARG B CD  1 
ATOM   2387 N  NE  . ARG B 1 62  ? 34.131  -24.926 98.816  1.00 55.97 ? 64   ARG B NE  1 
ATOM   2388 C  CZ  . ARG B 1 62  ? 34.737  -23.826 98.354  1.00 60.57 ? 64   ARG B CZ  1 
ATOM   2389 N  NH1 . ARG B 1 62  ? 34.066  -22.884 97.686  1.00 61.85 ? 64   ARG B NH1 1 
ATOM   2390 N  NH2 . ARG B 1 62  ? 36.048  -23.669 98.557  1.00 60.86 ? 64   ARG B NH2 1 
ATOM   2391 N  N   . ASN B 1 63  ? 30.800  -22.985 102.495 1.00 29.83 ? 65   ASN B N   1 
ATOM   2392 C  CA  . ASN B 1 63  ? 30.923  -21.539 102.539 1.00 29.64 ? 65   ASN B CA  1 
ATOM   2393 C  C   . ASN B 1 63  ? 31.899  -21.198 101.439 1.00 29.60 ? 65   ASN B C   1 
ATOM   2394 O  O   . ASN B 1 63  ? 33.095  -21.451 101.562 1.00 32.83 ? 65   ASN B O   1 
ATOM   2395 C  CB  . ASN B 1 63  ? 31.430  -21.057 103.908 1.00 30.49 ? 65   ASN B CB  1 
ATOM   2396 C  CG  . ASN B 1 63  ? 31.710  -19.552 103.957 1.00 30.38 ? 65   ASN B CG  1 
ATOM   2397 O  OD1 . ASN B 1 63  ? 31.722  -18.870 102.939 1.00 30.74 ? 65   ASN B OD1 1 
ATOM   2398 N  ND2 . ASN B 1 63  ? 31.962  -19.040 105.156 1.00 32.76 ? 65   ASN B ND2 1 
ATOM   2399 N  N   . ASN B 1 64  ? 31.386  -20.631 100.354 1.00 28.89 ? 66   ASN B N   1 
ATOM   2400 C  CA  . ASN B 1 64  ? 32.227  -20.245 99.218  1.00 29.24 ? 66   ASN B CA  1 
ATOM   2401 C  C   . ASN B 1 64  ? 32.605  -18.772 99.280  1.00 30.88 ? 66   ASN B C   1 
ATOM   2402 O  O   . ASN B 1 64  ? 33.143  -18.230 98.312  1.00 33.59 ? 66   ASN B O   1 
ATOM   2403 C  CB  . ASN B 1 64  ? 31.546  -20.593 97.878  1.00 29.07 ? 66   ASN B CB  1 
ATOM   2404 C  CG  . ASN B 1 64  ? 30.240  -19.839 97.653  1.00 29.27 ? 66   ASN B CG  1 
ATOM   2405 O  OD1 . ASN B 1 64  ? 30.060  -18.696 98.101  1.00 28.92 ? 66   ASN B OD1 1 
ATOM   2406 N  ND2 . ASN B 1 64  ? 29.302  -20.492 96.962  1.00 30.54 ? 66   ASN B ND2 1 
ATOM   2407 N  N   . GLY B 1 65  ? 32.282  -18.100 100.386 1.00 32.63 ? 67   GLY B N   1 
ATOM   2408 C  CA  . GLY B 1 65  ? 32.627  -16.687 100.553 1.00 33.52 ? 67   GLY B CA  1 
ATOM   2409 C  C   . GLY B 1 65  ? 31.589  -15.690 100.063 1.00 34.37 ? 67   GLY B C   1 
ATOM   2410 O  O   . GLY B 1 65  ? 31.569  -14.563 100.543 1.00 36.57 ? 67   GLY B O   1 
ATOM   2411 N  N   . HIS B 1 66  ? 30.754  -16.091 99.099  1.00 33.44 ? 68   HIS B N   1 
ATOM   2412 C  CA  . HIS B 1 66  ? 29.641  -15.283 98.605  1.00 34.32 ? 68   HIS B CA  1 
ATOM   2413 C  C   . HIS B 1 66  ? 28.290  -15.764 99.110  1.00 29.89 ? 68   HIS B C   1 
ATOM   2414 O  O   . HIS B 1 66  ? 27.303  -15.031 99.014  1.00 28.57 ? 68   HIS B O   1 
ATOM   2415 C  CB  . HIS B 1 66  ? 29.605  -15.330 97.074  1.00 38.76 ? 68   HIS B CB  1 
ATOM   2416 C  CG  . HIS B 1 66  ? 30.918  -15.047 96.433  1.00 43.67 ? 68   HIS B CG  1 
ATOM   2417 N  ND1 . HIS B 1 66  ? 31.609  -13.870 96.642  1.00 48.34 ? 68   HIS B ND1 1 
ATOM   2418 C  CD2 . HIS B 1 66  ? 31.667  -15.781 95.576  1.00 47.57 ? 68   HIS B CD2 1 
ATOM   2419 C  CE1 . HIS B 1 66  ? 32.730  -13.892 95.941  1.00 48.53 ? 68   HIS B CE1 1 
ATOM   2420 N  NE2 . HIS B 1 66  ? 32.788  -15.038 95.283  1.00 51.48 ? 68   HIS B NE2 1 
ATOM   2421 N  N   . SER B 1 67  ? 28.241  -17.003 99.611  1.00 29.22 ? 69   SER B N   1 
ATOM   2422 C  CA  . SER B 1 67  ? 27.026  -17.626 100.096 1.00 26.48 ? 69   SER B CA  1 
ATOM   2423 C  C   . SER B 1 67  ? 27.381  -18.936 100.805 1.00 26.73 ? 69   SER B C   1 
ATOM   2424 O  O   . SER B 1 67  ? 28.543  -19.347 100.837 1.00 27.13 ? 69   SER B O   1 
ATOM   2425 C  CB  . SER B 1 67  ? 26.076  -17.926 98.919  1.00 25.88 ? 69   SER B CB  1 
ATOM   2426 O  OG  . SER B 1 67  ? 24.798  -18.323 99.364  1.00 23.95 ? 69   SER B OG  1 
ATOM   2427 N  N   . VAL B 1 68  ? 26.354  -19.594 101.330 1.00 26.59 ? 70   VAL B N   1 
ATOM   2428 C  CA  . VAL B 1 68  ? 26.441  -20.990 101.725 1.00 24.83 ? 70   VAL B CA  1 
ATOM   2429 C  C   . VAL B 1 68  ? 25.674  -21.758 100.644 1.00 24.66 ? 70   VAL B C   1 
ATOM   2430 O  O   . VAL B 1 68  ? 24.503  -21.425 100.332 1.00 22.20 ? 70   VAL B O   1 
ATOM   2431 C  CB  . VAL B 1 68  ? 25.926  -21.255 103.165 1.00 24.87 ? 70   VAL B CB  1 
ATOM   2432 C  CG1 . VAL B 1 68  ? 24.536  -20.678 103.402 1.00 24.97 ? 70   VAL B CG1 1 
ATOM   2433 C  CG2 . VAL B 1 68  ? 25.955  -22.732 103.494 1.00 25.62 ? 70   VAL B CG2 1 
ATOM   2434 N  N   . GLN B 1 69  ? 26.350  -22.756 100.066 1.00 23.72 ? 71   GLN B N   1 
ATOM   2435 C  CA  . GLN B 1 69  ? 25.815  -23.538 98.973  1.00 23.62 ? 71   GLN B CA  1 
ATOM   2436 C  C   . GLN B 1 69  ? 25.748  -25.030 99.306  1.00 23.78 ? 71   GLN B C   1 
ATOM   2437 O  O   . GLN B 1 69  ? 26.716  -25.626 99.793  1.00 24.24 ? 71   GLN B O   1 
ATOM   2438 C  CB  . GLN B 1 69  ? 26.622  -23.308 97.707  1.00 24.13 ? 71   GLN B CB  1 
ATOM   2439 C  CG  . GLN B 1 69  ? 26.059  -23.995 96.457  1.00 23.10 ? 71   GLN B CG  1 
ATOM   2440 C  CD  . GLN B 1 69  ? 26.727  -23.508 95.189  1.00 24.51 ? 71   GLN B CD  1 
ATOM   2441 O  OE1 . GLN B 1 69  ? 27.149  -24.294 94.335  1.00 26.06 ? 71   GLN B OE1 1 
ATOM   2442 N  NE2 . GLN B 1 69  ? 26.809  -22.209 95.049  1.00 24.01 ? 71   GLN B NE2 1 
ATOM   2443 N  N   . LEU B 1 70  ? 24.589  -25.606 99.020  1.00 22.38 ? 72   LEU B N   1 
ATOM   2444 C  CA  . LEU B 1 70  ? 24.334  -27.028 99.189  1.00 21.82 ? 72   LEU B CA  1 
ATOM   2445 C  C   . LEU B 1 70  ? 24.320  -27.693 97.832  1.00 22.32 ? 72   LEU B C   1 
ATOM   2446 O  O   . LEU B 1 70  ? 23.508  -27.339 96.959  1.00 22.21 ? 72   LEU B O   1 
ATOM   2447 C  CB  . LEU B 1 70  ? 22.974  -27.196 99.841  1.00 22.00 ? 72   LEU B CB  1 
ATOM   2448 C  CG  . LEU B 1 70  ? 22.529  -28.609 100.209 1.00 22.59 ? 72   LEU B CG  1 
ATOM   2449 C  CD1 . LEU B 1 70  ? 23.373  -29.100 101.395 1.00 23.54 ? 72   LEU B CD1 1 
ATOM   2450 C  CD2 . LEU B 1 70  ? 21.048  -28.595 100.549 1.00 23.49 ? 72   LEU B CD2 1 
ATOM   2451 N  N   . THR B 1 71  ? 25.213  -28.652 97.634  1.00 22.07 ? 73   THR B N   1 
ATOM   2452 C  CA  . THR B 1 71  ? 25.232  -29.428 96.416  1.00 21.70 ? 73   THR B CA  1 
ATOM   2453 C  C   . THR B 1 71  ? 24.125  -30.468 96.426  1.00 22.75 ? 73   THR B C   1 
ATOM   2454 O  O   . THR B 1 71  ? 23.996  -31.262 97.357  1.00 22.27 ? 73   THR B O   1 
ATOM   2455 C  CB  . THR B 1 71  ? 26.594  -30.133 96.244  1.00 22.99 ? 73   THR B CB  1 
ATOM   2456 O  OG1 . THR B 1 71  ? 27.619  -29.138 96.223  1.00 21.18 ? 73   THR B OG1 1 
ATOM   2457 C  CG2 . THR B 1 71  ? 26.624  -30.944 94.956  1.00 22.81 ? 73   THR B CG2 1 
ATOM   2458 N  N   . LEU B 1 72  ? 23.351  -30.485 95.360  1.00 21.52 ? 74   LEU B N   1 
ATOM   2459 C  CA  . LEU B 1 72  ? 22.265  -31.417 95.224  1.00 21.25 ? 74   LEU B CA  1 
ATOM   2460 C  C   . LEU B 1 72  ? 22.681  -32.588 94.357  1.00 21.22 ? 74   LEU B C   1 
ATOM   2461 O  O   . LEU B 1 72  ? 23.444  -32.424 93.396  1.00 22.79 ? 74   LEU B O   1 
ATOM   2462 C  CB  . LEU B 1 72  ? 21.040  -30.704 94.627  1.00 21.02 ? 74   LEU B CB  1 
ATOM   2463 C  CG  . LEU B 1 72  ? 20.529  -29.553 95.513  1.00 20.93 ? 74   LEU B CG  1 
ATOM   2464 C  CD1 . LEU B 1 72  ? 19.466  -28.697 94.819  1.00 21.95 ? 74   LEU B CD1 1 
ATOM   2465 C  CD2 . LEU B 1 72  ? 19.962  -30.082 96.815  1.00 20.85 ? 74   LEU B CD2 1 
ATOM   2466 N  N   . PRO B 1 73  ? 22.172  -33.780 94.680  1.00 22.11 ? 75   PRO B N   1 
ATOM   2467 C  CA  . PRO B 1 73  ? 22.501  -34.982 93.917  1.00 23.15 ? 75   PRO B CA  1 
ATOM   2468 C  C   . PRO B 1 73  ? 21.700  -35.063 92.614  1.00 24.67 ? 75   PRO B C   1 
ATOM   2469 O  O   . PRO B 1 73  ? 20.728  -34.322 92.463  1.00 24.71 ? 75   PRO B O   1 
ATOM   2470 C  CB  . PRO B 1 73  ? 22.043  -36.100 94.848  1.00 23.29 ? 75   PRO B CB  1 
ATOM   2471 C  CG  . PRO B 1 73  ? 20.837  -35.501 95.533  1.00 23.67 ? 75   PRO B CG  1 
ATOM   2472 C  CD  . PRO B 1 73  ? 21.201  -34.062 95.760  1.00 22.13 ? 75   PRO B CD  1 
ATOM   2473 N  N   . PRO B 1 74  ? 22.047  -36.007 91.718  1.00 25.35 ? 76   PRO B N   1 
ATOM   2474 C  CA  . PRO B 1 74  ? 21.180  -36.289 90.589  1.00 25.39 ? 76   PRO B CA  1 
ATOM   2475 C  C   . PRO B 1 74  ? 19.774  -36.710 91.032  1.00 25.26 ? 76   PRO B C   1 
ATOM   2476 O  O   . PRO B 1 74  ? 19.605  -37.247 92.128  1.00 26.07 ? 76   PRO B O   1 
ATOM   2477 C  CB  . PRO B 1 74  ? 21.871  -37.479 89.892  1.00 27.08 ? 76   PRO B CB  1 
ATOM   2478 C  CG  . PRO B 1 74  ? 23.305  -37.385 90.309  1.00 26.83 ? 76   PRO B CG  1 
ATOM   2479 C  CD  . PRO B 1 74  ? 23.245  -36.871 91.715  1.00 26.80 ? 76   PRO B CD  1 
ATOM   2480 N  N   . GLY B 1 75  ? 18.801  -36.464 90.166  1.00 22.34 ? 77   GLY B N   1 
ATOM   2481 C  CA  . GLY B 1 75  ? 17.466  -37.016 90.282  1.00 23.00 ? 77   GLY B CA  1 
ATOM   2482 C  C   . GLY B 1 75  ? 16.392  -36.066 90.800  1.00 21.01 ? 77   GLY B C   1 
ATOM   2483 O  O   . GLY B 1 75  ? 15.271  -36.495 91.047  1.00 20.98 ? 77   GLY B O   1 
ATOM   2484 N  N   . LEU B 1 76  ? 16.736  -34.801 90.974  1.00 19.47 ? 78   LEU B N   1 
ATOM   2485 C  CA  . LEU B 1 76  ? 15.760  -33.783 91.390  1.00 19.82 ? 78   LEU B CA  1 
ATOM   2486 C  C   . LEU B 1 76  ? 15.258  -33.152 90.102  1.00 19.66 ? 78   LEU B C   1 
ATOM   2487 O  O   . LEU B 1 76  ? 15.934  -32.290 89.516  1.00 20.74 ? 78   LEU B O   1 
ATOM   2488 C  CB  . LEU B 1 76  ? 16.380  -32.755 92.342  1.00 20.60 ? 78   LEU B CB  1 
ATOM   2489 C  CG  . LEU B 1 76  ? 16.537  -33.223 93.804  1.00 22.21 ? 78   LEU B CG  1 
ATOM   2490 C  CD1 . LEU B 1 76  ? 17.681  -34.213 93.954  1.00 23.72 ? 78   LEU B CD1 1 
ATOM   2491 C  CD2 . LEU B 1 76  ? 16.749  -32.075 94.773  1.00 23.31 ? 78   LEU B CD2 1 
ATOM   2492 N  N   . GLU B 1 77  ? 14.097  -33.615 89.650  1.00 19.88 ? 79   GLU B N   1 
ATOM   2493 C  CA  . GLU B 1 77  ? 13.504  -33.196 88.384  1.00 19.58 ? 79   GLU B CA  1 
ATOM   2494 C  C   . GLU B 1 77  ? 12.452  -32.119 88.624  1.00 19.51 ? 79   GLU B C   1 
ATOM   2495 O  O   . GLU B 1 77  ? 11.672  -32.169 89.578  1.00 18.30 ? 79   GLU B O   1 
ATOM   2496 C  CB  . GLU B 1 77  ? 12.923  -34.391 87.637  1.00 21.18 ? 79   GLU B CB  1 
ATOM   2497 C  CG  . GLU B 1 77  ? 13.922  -35.551 87.566  1.00 24.16 ? 79   GLU B CG  1 
ATOM   2498 C  CD  . GLU B 1 77  ? 13.469  -36.756 86.777  1.00 26.61 ? 79   GLU B CD  1 
ATOM   2499 O  OE1 . GLU B 1 77  ? 12.316  -36.790 86.343  1.00 31.73 ? 79   GLU B OE1 1 
ATOM   2500 O  OE2 . GLU B 1 77  ? 14.267  -37.712 86.620  1.00 26.85 ? 79   GLU B OE2 1 
ATOM   2501 N  N   . MET B 1 78  ? 12.470  -31.116 87.752  1.00 19.77 ? 80   MET B N   1 
ATOM   2502 C  CA  . MET B 1 78  ? 11.573  -29.974 87.875  1.00 19.34 ? 80   MET B CA  1 
ATOM   2503 C  C   . MET B 1 78  ? 11.081  -29.591 86.488  1.00 19.19 ? 80   MET B C   1 
ATOM   2504 O  O   . MET B 1 78  ? 11.854  -29.654 85.537  1.00 19.25 ? 80   MET B O   1 
ATOM   2505 C  CB  . MET B 1 78  ? 12.308  -28.805 88.505  1.00 19.09 ? 80   MET B CB  1 
ATOM   2506 C  CG  . MET B 1 78  ? 11.418  -27.601 88.787  1.00 19.06 ? 80   MET B CG  1 
ATOM   2507 S  SD  . MET B 1 78  ? 11.255  -26.414 87.419  1.00 21.31 ? 80   MET B SD  1 
ATOM   2508 C  CE  . MET B 1 78  ? 12.836  -25.585 87.532  1.00 22.13 ? 80   MET B CE  1 
ATOM   2509 N  N   . ALA B 1 79  ? 9.797   -29.257 86.376  1.00 18.88 ? 81   ALA B N   1 
ATOM   2510 C  CA  . ALA B 1 79  ? 9.202   -28.818 85.106  1.00 19.18 ? 81   ALA B CA  1 
ATOM   2511 C  C   . ALA B 1 79  ? 8.528   -27.461 85.273  1.00 19.65 ? 81   ALA B C   1 
ATOM   2512 O  O   . ALA B 1 79  ? 7.812   -27.238 86.255  1.00 19.71 ? 81   ALA B O   1 
ATOM   2513 C  CB  . ALA B 1 79  ? 8.208   -29.822 84.590  1.00 19.95 ? 81   ALA B CB  1 
ATOM   2514 N  N   . LEU B 1 80  ? 8.815   -26.543 84.342  1.00 20.23 ? 82   LEU B N   1 
ATOM   2515 C  CA  . LEU B 1 80  ? 8.166   -25.236 84.258  1.00 20.96 ? 82   LEU B CA  1 
ATOM   2516 C  C   . LEU B 1 80  ? 6.907   -25.309 83.386  1.00 21.31 ? 82   LEU B C   1 
ATOM   2517 O  O   . LEU B 1 80  ? 6.069   -24.414 83.430  1.00 23.45 ? 82   LEU B O   1 
ATOM   2518 C  CB  . LEU B 1 80  ? 9.129   -24.190 83.663  1.00 20.91 ? 82   LEU B CB  1 
ATOM   2519 C  CG  . LEU B 1 80  ? 10.375  -23.809 84.479  1.00 20.45 ? 82   LEU B CG  1 
ATOM   2520 C  CD1 . LEU B 1 80  ? 11.173  -22.766 83.700  1.00 20.81 ? 82   LEU B CD1 1 
ATOM   2521 C  CD2 . LEU B 1 80  ? 10.037  -23.308 85.879  1.00 20.65 ? 82   LEU B CD2 1 
ATOM   2522 N  N   . GLY B 1 81  ? 6.812   -26.347 82.581  1.00 22.06 ? 83   GLY B N   1 
ATOM   2523 C  CA  . GLY B 1 81  ? 5.649   -26.597 81.741  1.00 22.14 ? 83   GLY B CA  1 
ATOM   2524 C  C   . GLY B 1 81  ? 5.804   -27.917 81.026  1.00 23.51 ? 83   GLY B C   1 
ATOM   2525 O  O   . GLY B 1 81  ? 6.805   -28.632 81.240  1.00 22.93 ? 83   GLY B O   1 
ATOM   2526 N  N   . PRO B 1 82  ? 4.819   -28.273 80.177  1.00 25.07 ? 84   PRO B N   1 
ATOM   2527 C  CA  . PRO B 1 82  ? 4.808   -29.585 79.542  1.00 25.54 ? 84   PRO B CA  1 
ATOM   2528 C  C   . PRO B 1 82  ? 6.073   -29.824 78.720  1.00 26.69 ? 84   PRO B C   1 
ATOM   2529 O  O   . PRO B 1 82  ? 6.395   -29.038 77.844  1.00 27.49 ? 84   PRO B O   1 
ATOM   2530 C  CB  . PRO B 1 82  ? 3.557   -29.549 78.660  1.00 26.17 ? 84   PRO B CB  1 
ATOM   2531 C  CG  . PRO B 1 82  ? 2.681   -28.513 79.260  1.00 24.46 ? 84   PRO B CG  1 
ATOM   2532 C  CD  . PRO B 1 82  ? 3.583   -27.509 79.901  1.00 25.70 ? 84   PRO B CD  1 
ATOM   2533 N  N   . GLY B 1 83  ? 6.838   -30.847 79.086  1.00 27.79 ? 85   GLY B N   1 
ATOM   2534 C  CA  . GLY B 1 83  ? 8.093   -31.148 78.395  1.00 28.27 ? 85   GLY B CA  1 
ATOM   2535 C  C   . GLY B 1 83  ? 9.238   -30.148 78.560  1.00 27.87 ? 85   GLY B C   1 
ATOM   2536 O  O   . GLY B 1 83  ? 10.242  -30.264 77.858  1.00 34.08 ? 85   GLY B O   1 
ATOM   2537 N  N   . ARG B 1 84  ? 9.109   -29.184 79.473  1.00 23.78 ? 86   ARG B N   1 
ATOM   2538 C  CA  . ARG B 1 84  ? 10.128  -28.171 79.715  1.00 22.49 ? 86   ARG B CA  1 
ATOM   2539 C  C   . ARG B 1 84  ? 10.813  -28.451 81.058  1.00 20.46 ? 86   ARG B C   1 
ATOM   2540 O  O   . ARG B 1 84  ? 10.466  -27.885 82.107  1.00 17.44 ? 86   ARG B O   1 
ATOM   2541 C  CB  . ARG B 1 84  ? 9.492   -26.788 79.660  1.00 23.93 ? 86   ARG B CB  1 
ATOM   2542 C  CG  . ARG B 1 84  ? 8.904   -26.467 78.286  1.00 24.73 ? 86   ARG B CG  1 
ATOM   2543 C  CD  . ARG B 1 84  ? 8.152   -25.141 78.291  1.00 25.32 ? 86   ARG B CD  1 
ATOM   2544 N  NE  . ARG B 1 84  ? 9.015   -24.105 78.830  1.00 27.14 ? 86   ARG B NE  1 
ATOM   2545 C  CZ  . ARG B 1 84  ? 8.660   -23.133 79.678  1.00 26.83 ? 86   ARG B CZ  1 
ATOM   2546 N  NH1 . ARG B 1 84  ? 7.412   -22.970 80.109  1.00 26.90 ? 86   ARG B NH1 1 
ATOM   2547 N  NH2 . ARG B 1 84  ? 9.599   -22.303 80.102  1.00 27.92 ? 86   ARG B NH2 1 
ATOM   2548 N  N   . GLU B 1 85  ? 11.774  -29.378 81.011  1.00 19.94 ? 87   GLU B N   1 
ATOM   2549 C  CA  . GLU B 1 85  ? 12.300  -30.001 82.225  1.00 20.75 ? 87   GLU B CA  1 
ATOM   2550 C  C   . GLU B 1 85  ? 13.722  -29.592 82.532  1.00 19.15 ? 87   GLU B C   1 
ATOM   2551 O  O   . GLU B 1 85  ? 14.499  -29.160 81.646  1.00 18.56 ? 87   GLU B O   1 
ATOM   2552 C  CB  . GLU B 1 85  ? 12.173  -31.528 82.144  1.00 21.41 ? 87   GLU B CB  1 
ATOM   2553 C  CG  . GLU B 1 85  ? 10.724  -31.944 81.949  1.00 24.08 ? 87   GLU B CG  1 
ATOM   2554 C  CD  . GLU B 1 85  ? 10.496  -33.438 81.936  1.00 25.42 ? 87   GLU B CD  1 
ATOM   2555 O  OE1 . GLU B 1 85  ? 11.400  -34.182 82.390  1.00 25.14 ? 87   GLU B OE1 1 
ATOM   2556 O  OE2 . GLU B 1 85  ? 9.395   -33.857 81.481  1.00 24.93 ? 87   GLU B OE2 1 
ATOM   2557 N  N   . TYR B 1 86  ? 14.017  -29.713 83.815  1.00 18.16 ? 88   TYR B N   1 
ATOM   2558 C  CA  . TYR B 1 86  ? 15.193  -29.176 84.462  1.00 18.66 ? 88   TYR B CA  1 
ATOM   2559 C  C   . TYR B 1 86  ? 15.667  -30.209 85.502  1.00 19.13 ? 88   TYR B C   1 
ATOM   2560 O  O   . TYR B 1 86  ? 14.891  -31.071 85.907  1.00 20.16 ? 88   TYR B O   1 
ATOM   2561 C  CB  . TYR B 1 86  ? 14.837  -27.853 85.131  1.00 18.12 ? 88   TYR B CB  1 
ATOM   2562 C  CG  . TYR B 1 86  ? 14.663  -26.740 84.095  1.00 18.18 ? 88   TYR B CG  1 
ATOM   2563 C  CD1 . TYR B 1 86  ? 13.451  -26.546 83.441  1.00 18.90 ? 88   TYR B CD1 1 
ATOM   2564 C  CD2 . TYR B 1 86  ? 15.735  -25.958 83.727  1.00 18.73 ? 88   TYR B CD2 1 
ATOM   2565 C  CE1 . TYR B 1 86  ? 13.316  -25.589 82.442  1.00 19.41 ? 88   TYR B CE1 1 
ATOM   2566 C  CE2 . TYR B 1 86  ? 15.616  -24.990 82.745  1.00 18.23 ? 88   TYR B CE2 1 
ATOM   2567 C  CZ  . TYR B 1 86  ? 14.405  -24.803 82.110  1.00 18.98 ? 88   TYR B CZ  1 
ATOM   2568 O  OH  . TYR B 1 86  ? 14.301  -23.849 81.114  1.00 19.26 ? 88   TYR B OH  1 
ATOM   2569 N  N   . ARG B 1 87  ? 16.936  -30.129 85.899  1.00 20.49 ? 89   ARG B N   1 
ATOM   2570 C  CA  . ARG B 1 87  ? 17.446  -30.913 87.024  1.00 22.06 ? 89   ARG B CA  1 
ATOM   2571 C  C   . ARG B 1 87  ? 18.135  -29.940 87.940  1.00 19.27 ? 89   ARG B C   1 
ATOM   2572 O  O   . ARG B 1 87  ? 18.874  -29.072 87.479  1.00 19.55 ? 89   ARG B O   1 
ATOM   2573 C  CB  . ARG B 1 87  ? 18.418  -32.006 86.553  1.00 26.44 ? 89   ARG B CB  1 
ATOM   2574 C  CG  . ARG B 1 87  ? 17.819  -32.942 85.504  1.00 34.86 ? 89   ARG B CG  1 
ATOM   2575 C  CD  . ARG B 1 87  ? 16.745  -33.893 86.034  1.00 39.13 ? 89   ARG B CD  1 
ATOM   2576 N  NE  . ARG B 1 87  ? 15.459  -33.802 85.304  1.00 42.89 ? 89   ARG B NE  1 
ATOM   2577 C  CZ  . ARG B 1 87  ? 14.975  -34.667 84.390  1.00 47.88 ? 89   ARG B CZ  1 
ATOM   2578 N  NH1 . ARG B 1 87  ? 15.663  -35.758 84.000  1.00 50.27 ? 89   ARG B NH1 1 
ATOM   2579 N  NH2 . ARG B 1 87  ? 13.773  -34.430 83.834  1.00 40.15 ? 89   ARG B NH2 1 
ATOM   2580 N  N   . ALA B 1 88  ? 17.873  -30.066 89.236  1.00 19.58 ? 90   ALA B N   1 
ATOM   2581 C  CA  . ALA B 1 88  ? 18.420  -29.180 90.256  1.00 19.66 ? 90   ALA B CA  1 
ATOM   2582 C  C   . ALA B 1 88  ? 19.904  -29.486 90.506  1.00 20.85 ? 90   ALA B C   1 
ATOM   2583 O  O   . ALA B 1 88  ? 20.280  -30.648 90.643  1.00 22.54 ? 90   ALA B O   1 
ATOM   2584 C  CB  . ALA B 1 88  ? 17.613  -29.323 91.543  1.00 20.60 ? 90   ALA B CB  1 
ATOM   2585 N  N   . LEU B 1 89  ? 20.734  -28.452 90.565  1.00 20.02 ? 91   LEU B N   1 
ATOM   2586 C  CA  . LEU B 1 89  ? 22.178  -28.604 90.762  1.00 21.37 ? 91   LEU B CA  1 
ATOM   2587 C  C   . LEU B 1 89  ? 22.615  -28.294 92.173  1.00 21.64 ? 91   LEU B C   1 
ATOM   2588 O  O   . LEU B 1 89  ? 23.437  -29.030 92.753  1.00 21.37 ? 91   LEU B O   1 
ATOM   2589 C  CB  . LEU B 1 89  ? 22.946  -27.681 89.832  1.00 22.71 ? 91   LEU B CB  1 
ATOM   2590 C  CG  . LEU B 1 89  ? 22.665  -27.771 88.348  1.00 24.14 ? 91   LEU B CG  1 
ATOM   2591 C  CD1 . LEU B 1 89  ? 23.500  -26.717 87.634  1.00 26.55 ? 91   LEU B CD1 1 
ATOM   2592 C  CD2 . LEU B 1 89  ? 22.998  -29.162 87.841  1.00 25.58 ? 91   LEU B CD2 1 
ATOM   2593 N  N   . GLN B 1 90  ? 22.080  -27.196 92.719  1.00 19.29 ? 92   GLN B N   1 
ATOM   2594 C  CA  . GLN B 1 90  ? 22.497  -26.646 93.994  1.00 20.00 ? 92   GLN B CA  1 
ATOM   2595 C  C   . GLN B 1 90  ? 21.456  -25.649 94.504  1.00 20.01 ? 92   GLN B C   1 
ATOM   2596 O  O   . GLN B 1 90  ? 20.578  -25.200 93.743  1.00 17.94 ? 92   GLN B O   1 
ATOM   2597 C  CB  . GLN B 1 90  ? 23.860  -25.963 93.875  1.00 19.88 ? 92   GLN B CB  1 
ATOM   2598 C  CG  . GLN B 1 90  ? 23.924  -24.897 92.784  1.00 20.98 ? 92   GLN B CG  1 
ATOM   2599 C  CD  . GLN B 1 90  ? 23.957  -23.464 93.261  1.00 22.10 ? 92   GLN B CD  1 
ATOM   2600 O  OE1 . GLN B 1 90  ? 23.509  -23.118 94.361  1.00 22.10 ? 92   GLN B OE1 1 
ATOM   2601 N  NE2 . GLN B 1 90  ? 24.459  -22.593 92.394  1.00 24.15 ? 92   GLN B NE2 1 
ATOM   2602 N  N   . LEU B 1 91  ? 21.540  -25.337 95.784  1.00 20.93 ? 93   LEU B N   1 
ATOM   2603 C  CA  . LEU B 1 91  ? 20.795  -24.207 96.338  1.00 21.27 ? 93   LEU B CA  1 
ATOM   2604 C  C   . LEU B 1 91  ? 21.702  -23.388 97.227  1.00 22.56 ? 93   LEU B C   1 
ATOM   2605 O  O   . LEU B 1 91  ? 22.690  -23.886 97.750  1.00 21.78 ? 93   LEU B O   1 
ATOM   2606 C  CB  . LEU B 1 91  ? 19.527  -24.668 97.058  1.00 22.01 ? 93   LEU B CB  1 
ATOM   2607 C  CG  . LEU B 1 91  ? 19.674  -25.571 98.303  1.00 22.60 ? 93   LEU B CG  1 
ATOM   2608 C  CD1 . LEU B 1 91  ? 19.977  -24.750 99.560  1.00 23.84 ? 93   LEU B CD1 1 
ATOM   2609 C  CD2 . LEU B 1 91  ? 18.415  -26.398 98.502  1.00 22.05 ? 93   LEU B CD2 1 
ATOM   2610 N  N   . HIS B 1 92  ? 21.382  -22.111 97.371  1.00 19.99 ? 94   HIS B N   1 
ATOM   2611 C  CA  . HIS B 1 92  ? 22.161  -21.236 98.211  1.00 20.63 ? 94   HIS B CA  1 
ATOM   2612 C  C   . HIS B 1 92  ? 21.260  -20.070 98.644  1.00 20.66 ? 94   HIS B C   1 
ATOM   2613 O  O   . HIS B 1 92  ? 20.079  -19.999 98.266  1.00 19.35 ? 94   HIS B O   1 
ATOM   2614 C  CB  . HIS B 1 92  ? 23.391  -20.749 97.452  1.00 21.27 ? 94   HIS B CB  1 
ATOM   2615 C  CG  . HIS B 1 92  ? 23.036  -19.948 96.244  1.00 21.88 ? 94   HIS B CG  1 
ATOM   2616 N  ND1 . HIS B 1 92  ? 22.817  -20.525 95.012  1.00 21.59 ? 94   HIS B ND1 1 
ATOM   2617 C  CD2 . HIS B 1 92  ? 22.771  -18.629 96.098  1.00 21.58 ? 94   HIS B CD2 1 
ATOM   2618 C  CE1 . HIS B 1 92  ? 22.441  -19.598 94.153  1.00 22.45 ? 94   HIS B CE1 1 
ATOM   2619 N  NE2 . HIS B 1 92  ? 22.405  -18.443 94.789  1.00 23.04 ? 94   HIS B NE2 1 
ATOM   2620 N  N   . LEU B 1 93  ? 21.794  -19.192 99.470  1.00 22.33 ? 95   LEU B N   1 
ATOM   2621 C  CA  . LEU B 1 93  ? 20.963  -18.168 100.105 1.00 23.92 ? 95   LEU B CA  1 
ATOM   2622 C  C   . LEU B 1 93  ? 21.589  -16.798 99.990  1.00 22.84 ? 95   LEU B C   1 
ATOM   2623 O  O   . LEU B 1 93  ? 22.815  -16.650 99.789  1.00 22.41 ? 95   LEU B O   1 
ATOM   2624 C  CB  . LEU B 1 93  ? 20.731  -18.516 101.579 1.00 26.61 ? 95   LEU B CB  1 
ATOM   2625 C  CG  . LEU B 1 93  ? 20.209  -19.911 101.926 1.00 29.04 ? 95   LEU B CG  1 
ATOM   2626 C  CD1 . LEU B 1 93  ? 20.599  -20.230 103.368 1.00 30.36 ? 95   LEU B CD1 1 
ATOM   2627 C  CD2 . LEU B 1 93  ? 18.716  -20.000 101.756 1.00 30.82 ? 95   LEU B CD2 1 
ATOM   2628 N  N   . HIS B 1 94  ? 20.716  -15.806 100.110 1.00 23.46 ? 96   HIS B N   1 
ATOM   2629 C  CA  . HIS B 1 94  ? 21.085  -14.400 100.149 1.00 24.38 ? 96   HIS B CA  1 
ATOM   2630 C  C   . HIS B 1 94  ? 20.426  -13.788 101.362 1.00 24.73 ? 96   HIS B C   1 
ATOM   2631 O  O   . HIS B 1 94  ? 19.250  -14.000 101.579 1.00 26.49 ? 96   HIS B O   1 
ATOM   2632 C  CB  . HIS B 1 94  ? 20.605  -13.690 98.893  1.00 23.32 ? 96   HIS B CB  1 
ATOM   2633 C  CG  . HIS B 1 94  ? 21.263  -14.197 97.653  1.00 23.60 ? 96   HIS B CG  1 
ATOM   2634 N  ND1 . HIS B 1 94  ? 22.496  -13.747 97.246  1.00 24.64 ? 96   HIS B ND1 1 
ATOM   2635 C  CD2 . HIS B 1 94  ? 20.909  -15.162 96.778  1.00 24.01 ? 96   HIS B CD2 1 
ATOM   2636 C  CE1 . HIS B 1 94  ? 22.859  -14.375 96.148  1.00 24.31 ? 96   HIS B CE1 1 
ATOM   2637 N  NE2 . HIS B 1 94  ? 21.924  -15.247 95.850  1.00 23.93 ? 96   HIS B NE2 1 
ATOM   2638 N  N   . TRP B 1 95  ? 21.184  -13.012 102.118 1.00 27.63 ? 97   TRP B N   1 
ATOM   2639 C  CA  . TRP B 1 95  ? 20.701  -12.467 103.383 1.00 29.36 ? 97   TRP B CA  1 
ATOM   2640 C  C   . TRP B 1 95  ? 21.338  -11.124 103.706 1.00 28.91 ? 97   TRP B C   1 
ATOM   2641 O  O   . TRP B 1 95  ? 22.215  -10.653 102.998 1.00 28.54 ? 97   TRP B O   1 
ATOM   2642 C  CB  . TRP B 1 95  ? 20.950  -13.484 104.484 1.00 28.18 ? 97   TRP B CB  1 
ATOM   2643 C  CG  . TRP B 1 95  ? 22.380  -13.779 104.688 1.00 28.28 ? 97   TRP B CG  1 
ATOM   2644 C  CD1 . TRP B 1 95  ? 23.239  -13.089 105.470 1.00 28.95 ? 97   TRP B CD1 1 
ATOM   2645 C  CD2 . TRP B 1 95  ? 23.131  -14.858 104.123 1.00 28.86 ? 97   TRP B CD2 1 
ATOM   2646 N  NE1 . TRP B 1 95  ? 24.474  -13.652 105.432 1.00 28.71 ? 97   TRP B NE1 1 
ATOM   2647 C  CE2 . TRP B 1 95  ? 24.442  -14.746 104.618 1.00 27.79 ? 97   TRP B CE2 1 
ATOM   2648 C  CE3 . TRP B 1 95  ? 22.826  -15.904 103.247 1.00 26.87 ? 97   TRP B CE3 1 
ATOM   2649 C  CZ2 . TRP B 1 95  ? 25.464  -15.625 104.255 1.00 29.38 ? 97   TRP B CZ2 1 
ATOM   2650 C  CZ3 . TRP B 1 95  ? 23.846  -16.795 102.890 1.00 27.86 ? 97   TRP B CZ3 1 
ATOM   2651 C  CH2 . TRP B 1 95  ? 25.149  -16.655 103.411 1.00 26.92 ? 97   TRP B CH2 1 
ATOM   2652 N  N   . GLY B 1 96  ? 20.873  -10.501 104.786 1.00 33.40 ? 98   GLY B N   1 
ATOM   2653 C  CA  . GLY B 1 96  ? 21.257  -9.135  105.122 1.00 33.13 ? 98   GLY B CA  1 
ATOM   2654 C  C   . GLY B 1 96  ? 22.246  -9.090  106.264 1.00 36.05 ? 98   GLY B C   1 
ATOM   2655 O  O   . GLY B 1 96  ? 23.314  -9.695  106.197 1.00 34.53 ? 98   GLY B O   1 
ATOM   2656 N  N   . ALA B 1 97  ? 21.896  -8.354  107.311 1.00 38.80 ? 99   ALA B N   1 
ATOM   2657 C  CA  . ALA B 1 97  ? 22.782  -8.173  108.467 1.00 41.05 ? 99   ALA B CA  1 
ATOM   2658 C  C   . ALA B 1 97  ? 21.901  -7.899  109.661 1.00 46.60 ? 99   ALA B C   1 
ATOM   2659 O  O   . ALA B 1 97  ? 20.671  -7.932  109.530 1.00 48.36 ? 99   ALA B O   1 
ATOM   2660 C  CB  . ALA B 1 97  ? 23.749  -7.029  108.237 1.00 38.50 ? 99   ALA B CB  1 
ATOM   2661 N  N   . ALA B 1 98  ? 22.527  -7.669  110.816 1.00 47.10 ? 100  ALA B N   1 
ATOM   2662 C  CA  . ALA B 1 98  ? 21.825  -7.334  112.062 1.00 49.80 ? 100  ALA B CA  1 
ATOM   2663 C  C   . ALA B 1 98  ? 20.590  -6.464  111.828 1.00 48.40 ? 100  ALA B C   1 
ATOM   2664 O  O   . ALA B 1 98  ? 20.695  -5.246  111.721 1.00 48.95 ? 100  ALA B O   1 
ATOM   2665 C  CB  . ALA B 1 98  ? 22.789  -6.630  113.014 1.00 52.56 ? 100  ALA B CB  1 
ATOM   2666 N  N   . GLY B 1 99  ? 19.435  -7.107  111.683 1.00 49.37 ? 101  GLY B N   1 
ATOM   2667 C  CA  . GLY B 1 99  ? 18.169  -6.404  111.459 1.00 50.85 ? 101  GLY B CA  1 
ATOM   2668 C  C   . GLY B 1 99  ? 17.841  -6.026  110.019 1.00 51.40 ? 101  GLY B C   1 
ATOM   2669 O  O   . GLY B 1 99  ? 16.663  -6.048  109.639 1.00 58.94 ? 101  GLY B O   1 
ATOM   2670 N  N   . ARG B 1 100 ? 18.857  -5.685  109.217 1.00 46.93 ? 102  ARG B N   1 
ATOM   2671 C  CA  . ARG B 1 100 ? 18.649  -5.155  107.860 1.00 45.26 ? 102  ARG B CA  1 
ATOM   2672 C  C   . ARG B 1 100 ? 18.375  -6.307  106.878 1.00 39.17 ? 102  ARG B C   1 
ATOM   2673 O  O   . ARG B 1 100 ? 19.050  -7.328  106.949 1.00 38.55 ? 102  ARG B O   1 
ATOM   2674 C  CB  . ARG B 1 100 ? 19.863  -4.325  107.431 1.00 50.77 ? 102  ARG B CB  1 
ATOM   2675 C  CG  . ARG B 1 100 ? 19.974  -3.000  108.192 1.00 55.27 ? 102  ARG B CG  1 
ATOM   2676 C  CD  . ARG B 1 100 ? 21.329  -2.800  108.857 1.00 58.87 ? 102  ARG B CD  1 
ATOM   2677 N  NE  . ARG B 1 100 ? 22.412  -2.614  107.884 1.00 62.20 ? 102  ARG B NE  1 
ATOM   2678 C  CZ  . ARG B 1 100 ? 23.722  -2.670  108.160 1.00 62.86 ? 102  ARG B CZ  1 
ATOM   2679 N  NH1 . ARG B 1 100 ? 24.160  -2.910  109.400 1.00 61.75 ? 102  ARG B NH1 1 
ATOM   2680 N  NH2 . ARG B 1 100 ? 24.610  -2.491  107.177 1.00 59.15 ? 102  ARG B NH2 1 
ATOM   2681 N  N   . PRO B 1 101 ? 17.354  -6.169  106.005 1.00 35.89 ? 103  PRO B N   1 
ATOM   2682 C  CA  . PRO B 1 101 ? 16.947  -7.289  105.132 1.00 34.38 ? 103  PRO B CA  1 
ATOM   2683 C  C   . PRO B 1 101 ? 17.924  -7.503  103.974 1.00 31.91 ? 103  PRO B C   1 
ATOM   2684 O  O   . PRO B 1 101 ? 18.732  -6.619  103.680 1.00 30.31 ? 103  PRO B O   1 
ATOM   2685 C  CB  . PRO B 1 101 ? 15.583  -6.852  104.627 1.00 36.04 ? 103  PRO B CB  1 
ATOM   2686 C  CG  . PRO B 1 101 ? 15.651  -5.364  104.622 1.00 37.12 ? 103  PRO B CG  1 
ATOM   2687 C  CD  . PRO B 1 101 ? 16.520  -4.973  105.772 1.00 36.15 ? 103  PRO B CD  1 
ATOM   2688 N  N   . GLY B 1 102 ? 17.885  -8.682  103.358 1.00 29.31 ? 104  GLY B N   1 
ATOM   2689 C  CA  . GLY B 1 102 ? 18.833  -8.998  102.281 1.00 28.98 ? 104  GLY B CA  1 
ATOM   2690 C  C   . GLY B 1 102 ? 18.348  -9.888  101.157 1.00 26.10 ? 104  GLY B C   1 
ATOM   2691 O  O   . GLY B 1 102 ? 19.165  -10.562 100.534 1.00 28.87 ? 104  GLY B O   1 
ATOM   2692 N  N   . SER B 1 103 ? 17.053  -9.903  100.872 1.00 25.62 ? 105  SER B N   1 
ATOM   2693 C  CA  . SER B 1 103 ? 16.566  -10.571 99.669  1.00 23.95 ? 105  SER B CA  1 
ATOM   2694 C  C   . SER B 1 103 ? 17.099  -9.832  98.435  1.00 26.03 ? 105  SER B C   1 
ATOM   2695 O  O   . SER B 1 103 ? 17.541  -8.673  98.531  1.00 23.70 ? 105  SER B O   1 
ATOM   2696 C  CB  . SER B 1 103 ? 15.038  -10.691 99.633  1.00 24.78 ? 105  SER B CB  1 
ATOM   2697 O  OG  . SER B 1 103 ? 14.355  -9.459  99.457  1.00 23.58 ? 105  SER B OG  1 
ATOM   2698 N  N   . GLU B 1 104 ? 17.072  -10.535 97.301  1.00 23.96 ? 106  GLU B N   1 
ATOM   2699 C  CA  . GLU B 1 104 ? 17.541  -10.019 96.014  1.00 24.12 ? 106  GLU B CA  1 
ATOM   2700 C  C   . GLU B 1 104 ? 16.375  -9.388  95.269  1.00 23.39 ? 106  GLU B C   1 
ATOM   2701 O  O   . GLU B 1 104 ? 16.421  -8.199  94.939  1.00 25.91 ? 106  GLU B O   1 
ATOM   2702 C  CB  . GLU B 1 104 ? 18.208  -11.149 95.208  1.00 24.29 ? 106  GLU B CB  1 
ATOM   2703 C  CG  . GLU B 1 104 ? 19.476  -11.677 95.875  1.00 24.02 ? 106  GLU B CG  1 
ATOM   2704 C  CD  . GLU B 1 104 ? 20.613  -11.859 94.903  1.00 24.63 ? 106  GLU B CD  1 
ATOM   2705 O  OE1 . GLU B 1 104 ? 20.640  -12.881 94.210  1.00 24.54 ? 106  GLU B OE1 1 
ATOM   2706 O  OE2 . GLU B 1 104 ? 21.456  -10.955 94.791  1.00 25.52 ? 106  GLU B OE2 1 
ATOM   2707 N  N   . HIS B 1 105 ? 15.323  -10.162 95.031  1.00 22.72 ? 107  HIS B N   1 
ATOM   2708 C  CA  . HIS B 1 105 ? 14.087  -9.615  94.488  1.00 24.39 ? 107  HIS B CA  1 
ATOM   2709 C  C   . HIS B 1 105 ? 13.398  -8.771  95.586  1.00 27.71 ? 107  HIS B C   1 
ATOM   2710 O  O   . HIS B 1 105 ? 13.703  -8.920  96.791  1.00 27.86 ? 107  HIS B O   1 
ATOM   2711 C  CB  . HIS B 1 105 ? 13.183  -10.705 93.937  1.00 25.68 ? 107  HIS B CB  1 
ATOM   2712 C  CG  . HIS B 1 105 ? 13.763  -11.374 92.735  1.00 25.57 ? 107  HIS B CG  1 
ATOM   2713 N  ND1 . HIS B 1 105 ? 14.671  -12.409 92.829  1.00 24.30 ? 107  HIS B ND1 1 
ATOM   2714 C  CD2 . HIS B 1 105 ? 13.643  -11.089 91.417  1.00 25.45 ? 107  HIS B CD2 1 
ATOM   2715 C  CE1 . HIS B 1 105 ? 15.066  -12.747 91.614  1.00 24.97 ? 107  HIS B CE1 1 
ATOM   2716 N  NE2 . HIS B 1 105 ? 14.461  -11.962 90.741  1.00 24.62 ? 107  HIS B NE2 1 
ATOM   2717 N  N   . THR B 1 106 ? 12.542  -7.857  95.142  1.00 26.40 ? 108  THR B N   1 
ATOM   2718 C  CA  . THR B 1 106 ? 11.706  -7.035  96.032  1.00 26.14 ? 108  THR B CA  1 
ATOM   2719 C  C   . THR B 1 106 ? 10.305  -7.068  95.490  1.00 27.64 ? 108  THR B C   1 
ATOM   2720 O  O   . THR B 1 106 ? 10.106  -7.412  94.321  1.00 25.74 ? 108  THR B O   1 
ATOM   2721 C  CB  . THR B 1 106 ? 12.250  -5.604  96.149  1.00 27.72 ? 108  THR B CB  1 
ATOM   2722 O  OG1 . THR B 1 106 ? 12.455  -5.044  94.847  1.00 29.60 ? 108  THR B OG1 1 
ATOM   2723 C  CG2 . THR B 1 106 ? 13.561  -5.602  96.870  1.00 27.45 ? 108  THR B CG2 1 
ATOM   2724 N  N   . VAL B 1 107 ? 9.318   -6.783  96.353  1.00 27.36 ? 109  VAL B N   1 
ATOM   2725 C  CA  . VAL B 1 107 ? 7.917   -6.719  95.956  1.00 28.00 ? 109  VAL B CA  1 
ATOM   2726 C  C   . VAL B 1 107 ? 7.438   -5.328  96.344  1.00 31.06 ? 109  VAL B C   1 
ATOM   2727 O  O   . VAL B 1 107 ? 7.585   -4.907  97.512  1.00 29.07 ? 109  VAL B O   1 
ATOM   2728 C  CB  . VAL B 1 107 ? 7.057   -7.791  96.624  1.00 29.38 ? 109  VAL B CB  1 
ATOM   2729 C  CG1 . VAL B 1 107 ? 5.598   -7.640  96.238  1.00 29.53 ? 109  VAL B CG1 1 
ATOM   2730 C  CG2 . VAL B 1 107 ? 7.539   -9.182  96.210  1.00 28.72 ? 109  VAL B CG2 1 
ATOM   2731 N  N   . GLU B 1 108 ? 6.957   -4.596  95.335  1.00 29.81 ? 110  GLU B N   1 
ATOM   2732 C  CA  . GLU B 1 108 ? 6.576   -3.189  95.474  1.00 30.05 ? 110  GLU B CA  1 
ATOM   2733 C  C   . GLU B 1 108 ? 7.541   -2.446  96.359  1.00 28.56 ? 110  GLU B C   1 
ATOM   2734 O  O   . GLU B 1 108 ? 7.124   -1.685  97.214  1.00 33.81 ? 110  GLU B O   1 
ATOM   2735 C  CB  . GLU B 1 108 ? 5.146   -3.094  95.999  1.00 27.64 ? 110  GLU B CB  1 
ATOM   2736 C  CG  . GLU B 1 108 ? 4.182   -3.716  95.016  1.00 29.98 ? 110  GLU B CG  1 
ATOM   2737 C  CD  . GLU B 1 108 ? 2.739   -3.580  95.407  1.00 29.47 ? 110  GLU B CD  1 
ATOM   2738 O  OE1 . GLU B 1 108 ? 2.447   -3.762  96.579  1.00 32.30 ? 110  GLU B OE1 1 
ATOM   2739 O  OE2 . GLU B 1 108 ? 1.890   -3.338  94.522  1.00 33.52 ? 110  GLU B OE2 1 
ATOM   2740 N  N   . GLY B 1 109 ? 8.830   -2.708  96.176  1.00 28.05 ? 111  GLY B N   1 
ATOM   2741 C  CA  . GLY B 1 109 ? 9.902   -2.061  96.929  1.00 25.45 ? 111  GLY B CA  1 
ATOM   2742 C  C   . GLY B 1 109 ? 10.291  -2.702  98.261  1.00 28.70 ? 111  GLY B C   1 
ATOM   2743 O  O   . GLY B 1 109 ? 11.332  -2.363  98.811  1.00 27.40 ? 111  GLY B O   1 
ATOM   2744 N  N   . HIS B 1 110 ? 9.485   -3.628  98.786  1.00 29.61 ? 112  HIS B N   1 
ATOM   2745 C  CA  . HIS B 1 110 ? 9.823   -4.284  100.075 1.00 31.91 ? 112  HIS B CA  1 
ATOM   2746 C  C   . HIS B 1 110 ? 10.937  -5.323  99.868  1.00 32.10 ? 112  HIS B C   1 
ATOM   2747 O  O   . HIS B 1 110 ? 10.774  -6.234  99.048  1.00 28.39 ? 112  HIS B O   1 
ATOM   2748 C  CB  . HIS B 1 110 ? 8.575   -4.948  100.654 1.00 34.16 ? 112  HIS B CB  1 
ATOM   2749 C  CG  . HIS B 1 110 ? 8.795   -5.627  101.971 1.00 37.34 ? 112  HIS B CG  1 
ATOM   2750 N  ND1 . HIS B 1 110 ? 9.200   -4.952  103.103 1.00 37.57 ? 112  HIS B ND1 1 
ATOM   2751 C  CD2 . HIS B 1 110 ? 8.639   -6.924  102.340 1.00 37.09 ? 112  HIS B CD2 1 
ATOM   2752 C  CE1 . HIS B 1 110 ? 9.309   -5.807  104.105 1.00 38.77 ? 112  HIS B CE1 1 
ATOM   2753 N  NE2 . HIS B 1 110 ? 8.973   -7.009  103.669 1.00 36.46 ? 112  HIS B NE2 1 
ATOM   2754 N  N   . ARG B 1 111 ? 12.055  -5.137  100.573 1.00 31.61 ? 113  ARG B N   1 
ATOM   2755 C  CA  . ARG B 1 111 ? 13.104  -6.152  100.707 1.00 32.82 ? 113  ARG B CA  1 
ATOM   2756 C  C   . ARG B 1 111 ? 12.821  -7.091  101.885 1.00 34.34 ? 113  ARG B C   1 
ATOM   2757 O  O   . ARG B 1 111 ? 12.595  -6.626  103.009 1.00 32.28 ? 113  ARG B O   1 
ATOM   2758 C  CB  . ARG B 1 111 ? 14.466  -5.497  100.894 1.00 32.17 ? 113  ARG B CB  1 
ATOM   2759 C  CG  . ARG B 1 111 ? 15.647  -6.473  100.770 1.00 34.26 ? 113  ARG B CG  1 
ATOM   2760 C  CD  . ARG B 1 111 ? 16.999  -5.801  100.755 1.00 33.79 ? 113  ARG B CD  1 
ATOM   2761 N  NE  . ARG B 1 111 ? 17.084  -4.748  99.735  1.00 34.30 ? 113  ARG B NE  1 
ATOM   2762 C  CZ  . ARG B 1 111 ? 17.202  -4.948  98.422  1.00 34.69 ? 113  ARG B CZ  1 
ATOM   2763 N  NH1 . ARG B 1 111 ? 17.257  -6.175  97.925  1.00 33.04 ? 113  ARG B NH1 1 
ATOM   2764 N  NH2 . ARG B 1 111 ? 17.273  -3.906  97.587  1.00 33.11 ? 113  ARG B NH2 1 
ATOM   2765 N  N   . PHE B 1 112 ? 12.863  -8.400  101.618 1.00 31.34 ? 114  PHE B N   1 
ATOM   2766 C  CA  . PHE B 1 112 ? 12.572  -9.425  102.613 1.00 29.73 ? 114  PHE B CA  1 
ATOM   2767 C  C   . PHE B 1 112 ? 13.861  -9.807  103.355 1.00 28.31 ? 114  PHE B C   1 
ATOM   2768 O  O   . PHE B 1 112 ? 14.967  -9.544  102.875 1.00 26.59 ? 114  PHE B O   1 
ATOM   2769 C  CB  . PHE B 1 112 ? 11.946  -10.646 101.944 1.00 29.32 ? 114  PHE B CB  1 
ATOM   2770 C  CG  . PHE B 1 112 ? 10.631  -10.367 101.292 1.00 31.65 ? 114  PHE B CG  1 
ATOM   2771 C  CD1 . PHE B 1 112 ? 10.569  -9.769  100.030 1.00 31.48 ? 114  PHE B CD1 1 
ATOM   2772 C  CD2 . PHE B 1 112 ? 9.442   -10.670 101.949 1.00 31.36 ? 114  PHE B CD2 1 
ATOM   2773 C  CE1 . PHE B 1 112 ? 9.351   -9.497  99.447  1.00 33.35 ? 114  PHE B CE1 1 
ATOM   2774 C  CE2 . PHE B 1 112 ? 8.218   -10.413 101.360 1.00 33.03 ? 114  PHE B CE2 1 
ATOM   2775 C  CZ  . PHE B 1 112 ? 8.174   -9.822  100.106 1.00 34.12 ? 114  PHE B CZ  1 
ATOM   2776 N  N   . PRO B 1 113 ? 13.739  -10.435 104.546 1.00 29.30 ? 115  PRO B N   1 
ATOM   2777 C  CA  . PRO B 1 113 ? 14.962  -10.752 105.289 1.00 28.20 ? 115  PRO B CA  1 
ATOM   2778 C  C   . PRO B 1 113 ? 16.014  -11.558 104.512 1.00 26.42 ? 115  PRO B C   1 
ATOM   2779 O  O   . PRO B 1 113 ? 17.209  -11.274 104.616 1.00 26.58 ? 115  PRO B O   1 
ATOM   2780 C  CB  . PRO B 1 113 ? 14.434  -11.568 106.479 1.00 28.94 ? 115  PRO B CB  1 
ATOM   2781 C  CG  . PRO B 1 113 ? 13.100  -10.957 106.747 1.00 30.04 ? 115  PRO B CG  1 
ATOM   2782 C  CD  . PRO B 1 113 ? 12.531  -10.626 105.378 1.00 30.06 ? 115  PRO B CD  1 
ATOM   2783 N  N   . ALA B 1 114 ? 15.563  -12.523 103.716 1.00 26.59 ? 116  ALA B N   1 
ATOM   2784 C  CA  . ALA B 1 114 ? 16.484  -13.385 102.975 1.00 25.95 ? 116  ALA B CA  1 
ATOM   2785 C  C   . ALA B 1 114 ? 15.761  -14.049 101.821 1.00 23.76 ? 116  ALA B C   1 
ATOM   2786 O  O   . ALA B 1 114 ? 14.530  -13.946 101.694 1.00 24.10 ? 116  ALA B O   1 
ATOM   2787 C  CB  . ALA B 1 114 ? 17.115  -14.421 103.914 1.00 26.75 ? 116  ALA B CB  1 
ATOM   2788 N  N   . GLU B 1 115 ? 16.527  -14.732 100.972 1.00 22.76 ? 117  GLU B N   1 
ATOM   2789 C  CA  . GLU B 1 115 ? 15.978  -15.372 99.784  1.00 22.49 ? 117  GLU B CA  1 
ATOM   2790 C  C   . GLU B 1 115 ? 16.767  -16.642 99.519  1.00 21.19 ? 117  GLU B C   1 
ATOM   2791 O  O   . GLU B 1 115 ? 17.976  -16.651 99.684  1.00 21.57 ? 117  GLU B O   1 
ATOM   2792 C  CB  . GLU B 1 115 ? 16.102  -14.398 98.584  1.00 23.15 ? 117  GLU B CB  1 
ATOM   2793 C  CG  . GLU B 1 115 ? 15.432  -14.811 97.271  1.00 23.28 ? 117  GLU B CG  1 
ATOM   2794 C  CD  . GLU B 1 115 ? 15.381  -13.654 96.238  1.00 25.22 ? 117  GLU B CD  1 
ATOM   2795 O  OE1 . GLU B 1 115 ? 15.260  -12.464 96.651  1.00 24.88 ? 117  GLU B OE1 1 
ATOM   2796 O  OE2 . GLU B 1 115 ? 15.470  -13.914 95.001  1.00 22.92 ? 117  GLU B OE2 1 
ATOM   2797 N  N   . ILE B 1 116 ? 16.065  -17.682 99.112  1.00 22.12 ? 118  ILE B N   1 
ATOM   2798 C  CA  . ILE B 1 116 ? 16.671  -18.960 98.723  1.00 21.83 ? 118  ILE B CA  1 
ATOM   2799 C  C   . ILE B 1 116 ? 16.567  -19.114 97.212  1.00 21.40 ? 118  ILE B C   1 
ATOM   2800 O  O   . ILE B 1 116 ? 15.523  -18.821 96.622  1.00 21.30 ? 118  ILE B O   1 
ATOM   2801 C  CB  . ILE B 1 116 ? 16.033  -20.184 99.444  1.00 22.37 ? 118  ILE B CB  1 
ATOM   2802 C  CG1 . ILE B 1 116 ? 16.722  -21.481 98.994  1.00 22.89 ? 118  ILE B CG1 1 
ATOM   2803 C  CG2 . ILE B 1 116 ? 14.533  -20.293 99.216  1.00 22.64 ? 118  ILE B CG2 1 
ATOM   2804 C  CD1 . ILE B 1 116 ? 16.354  -22.692 99.831  1.00 23.64 ? 118  ILE B CD1 1 
ATOM   2805 N  N   . HIS B 1 117 ? 17.646  -19.614 96.610  1.00 20.49 ? 119  HIS B N   1 
ATOM   2806 C  CA  . HIS B 1 117 ? 17.710  -19.914 95.200  1.00 20.77 ? 119  HIS B CA  1 
ATOM   2807 C  C   . HIS B 1 117 ? 18.064  -21.360 94.986  1.00 20.31 ? 119  HIS B C   1 
ATOM   2808 O  O   . HIS B 1 117 ? 19.059  -21.823 95.527  1.00 20.50 ? 119  HIS B O   1 
ATOM   2809 C  CB  . HIS B 1 117 ? 18.777  -19.055 94.548  1.00 20.74 ? 119  HIS B CB  1 
ATOM   2810 C  CG  . HIS B 1 117 ? 18.418  -17.609 94.498  1.00 21.01 ? 119  HIS B CG  1 
ATOM   2811 N  ND1 . HIS B 1 117 ? 19.348  -16.632 94.240  1.00 21.23 ? 119  HIS B ND1 1 
ATOM   2812 C  CD2 . HIS B 1 117 ? 17.245  -16.968 94.721  1.00 20.73 ? 119  HIS B CD2 1 
ATOM   2813 C  CE1 . HIS B 1 117 ? 18.764  -15.450 94.280  1.00 20.64 ? 119  HIS B CE1 1 
ATOM   2814 N  NE2 . HIS B 1 117 ? 17.492  -15.628 94.582  1.00 21.29 ? 119  HIS B NE2 1 
ATOM   2815 N  N   . VAL B 1 118 ? 17.222  -22.057 94.239  1.00 20.67 ? 120  VAL B N   1 
ATOM   2816 C  CA  . VAL B 1 118 ? 17.458  -23.424 93.815  1.00 20.42 ? 120  VAL B CA  1 
ATOM   2817 C  C   . VAL B 1 118 ? 17.721  -23.361 92.315  1.00 20.12 ? 120  VAL B C   1 
ATOM   2818 O  O   . VAL B 1 118 ? 16.803  -23.108 91.496  1.00 19.90 ? 120  VAL B O   1 
ATOM   2819 C  CB  . VAL B 1 118 ? 16.266  -24.331 94.108  1.00 20.74 ? 120  VAL B CB  1 
ATOM   2820 C  CG1 . VAL B 1 118 ? 16.628  -25.800 93.852  1.00 22.08 ? 120  VAL B CG1 1 
ATOM   2821 C  CG2 . VAL B 1 118 ? 15.792  -24.132 95.536  1.00 21.26 ? 120  VAL B CG2 1 
ATOM   2822 N  N   . VAL B 1 119 ? 18.967  -23.623 91.953  1.00 18.54 ? 121  VAL B N   1 
ATOM   2823 C  CA  . VAL B 1 119 ? 19.451  -23.452 90.591  1.00 18.97 ? 121  VAL B CA  1 
ATOM   2824 C  C   . VAL B 1 119 ? 19.344  -24.773 89.804  1.00 19.59 ? 121  VAL B C   1 
ATOM   2825 O  O   . VAL B 1 119 ? 19.777  -25.850 90.290  1.00 19.68 ? 121  VAL B O   1 
ATOM   2826 C  CB  . VAL B 1 119 ? 20.912  -22.946 90.603  1.00 20.29 ? 121  VAL B CB  1 
ATOM   2827 C  CG1 . VAL B 1 119 ? 21.414  -22.670 89.198  1.00 20.74 ? 121  VAL B CG1 1 
ATOM   2828 C  CG2 . VAL B 1 119 ? 21.043  -21.691 91.462  1.00 21.01 ? 121  VAL B CG2 1 
ATOM   2829 N  N   . HIS B 1 120 ? 18.751  -24.703 88.610  1.00 17.28 ? 122  HIS B N   1 
ATOM   2830 C  CA  . HIS B 1 120 ? 18.523  -25.859 87.793  1.00 17.12 ? 122  HIS B CA  1 
ATOM   2831 C  C   . HIS B 1 120 ? 19.101  -25.721 86.393  1.00 17.34 ? 122  HIS B C   1 
ATOM   2832 O  O   . HIS B 1 120 ? 19.199  -24.631 85.845  1.00 16.98 ? 122  HIS B O   1 
ATOM   2833 C  CB  . HIS B 1 120 ? 17.042  -26.134 87.589  1.00 17.41 ? 122  HIS B CB  1 
ATOM   2834 C  CG  . HIS B 1 120 ? 16.250  -26.312 88.834  1.00 17.47 ? 122  HIS B CG  1 
ATOM   2835 N  ND1 . HIS B 1 120 ? 16.007  -25.289 89.725  1.00 18.13 ? 122  HIS B ND1 1 
ATOM   2836 C  CD2 . HIS B 1 120 ? 15.565  -27.381 89.290  1.00 18.25 ? 122  HIS B CD2 1 
ATOM   2837 C  CE1 . HIS B 1 120 ? 15.231  -25.735 90.697  1.00 18.58 ? 122  HIS B CE1 1 
ATOM   2838 N  NE2 . HIS B 1 120 ? 14.941  -26.994 90.453  1.00 19.72 ? 122  HIS B NE2 1 
ATOM   2839 N  N   . LEU B 1 121 ? 19.412  -26.864 85.793  1.00 16.40 ? 123  LEU B N   1 
ATOM   2840 C  CA  . LEU B 1 121 ? 19.946  -26.943 84.444  1.00 16.98 ? 123  LEU B CA  1 
ATOM   2841 C  C   . LEU B 1 121 ? 18.901  -27.627 83.556  1.00 16.99 ? 123  LEU B C   1 
ATOM   2842 O  O   . LEU B 1 121 ? 18.378  -28.706 83.879  1.00 17.30 ? 123  LEU B O   1 
ATOM   2843 C  CB  . LEU B 1 121 ? 21.228  -27.775 84.459  1.00 17.67 ? 123  LEU B CB  1 
ATOM   2844 C  CG  . LEU B 1 121 ? 21.911  -28.004 83.111  1.00 18.67 ? 123  LEU B CG  1 
ATOM   2845 C  CD1 . LEU B 1 121 ? 22.331  -26.666 82.509  1.00 19.34 ? 123  LEU B CD1 1 
ATOM   2846 C  CD2 . LEU B 1 121 ? 23.094  -28.941 83.314  1.00 19.77 ? 123  LEU B CD2 1 
ATOM   2847 N  N   . SER B 1 122 ? 18.611  -27.013 82.422  1.00 15.93 ? 124  SER B N   1 
ATOM   2848 C  CA  . SER B 1 122 ? 17.729  -27.605 81.424  1.00 16.60 ? 124  SER B CA  1 
ATOM   2849 C  C   . SER B 1 122 ? 18.263  -28.952 80.978  1.00 18.54 ? 124  SER B C   1 
ATOM   2850 O  O   . SER B 1 122 ? 19.441  -29.069 80.647  1.00 18.99 ? 124  SER B O   1 
ATOM   2851 C  CB  . SER B 1 122 ? 17.634  -26.703 80.186  1.00 16.12 ? 124  SER B CB  1 
ATOM   2852 O  OG  . SER B 1 122 ? 16.971  -27.362 79.126  1.00 16.46 ? 124  SER B OG  1 
ATOM   2853 N  N   . THR B 1 123 ? 17.371  -29.916 80.873  1.00 20.12 ? 125  THR B N   1 
ATOM   2854 C  CA  . THR B 1 123 ? 17.728  -31.255 80.397  1.00 22.11 ? 125  THR B CA  1 
ATOM   2855 C  C   . THR B 1 123 ? 18.198  -31.245 78.950  1.00 21.98 ? 125  THR B C   1 
ATOM   2856 O  O   . THR B 1 123 ? 18.812  -32.218 78.521  1.00 21.84 ? 125  THR B O   1 
ATOM   2857 C  CB  . THR B 1 123 ? 16.574  -32.279 80.524  1.00 24.13 ? 125  THR B CB  1 
ATOM   2858 O  OG1 . THR B 1 123 ? 15.473  -31.897 79.692  1.00 26.75 ? 125  THR B OG1 1 
ATOM   2859 C  CG2 . THR B 1 123 ? 16.128  -32.412 81.923  1.00 26.00 ? 125  THR B CG2 1 
ATOM   2860 N  N   . ALA B 1 124 ? 17.935  -30.161 78.202  1.00 20.54 ? 126  ALA B N   1 
ATOM   2861 C  CA  . ALA B 1 124 ? 18.478  -29.999 76.853  1.00 22.82 ? 126  ALA B CA  1 
ATOM   2862 C  C   . ALA B 1 124 ? 19.972  -29.703 76.801  1.00 22.72 ? 126  ALA B C   1 
ATOM   2863 O  O   . ALA B 1 124 ? 20.551  -29.688 75.707  1.00 23.78 ? 126  ALA B O   1 
ATOM   2864 C  CB  . ALA B 1 124 ? 17.707  -28.900 76.093  1.00 22.92 ? 126  ALA B CB  1 
ATOM   2865 N  N   . PHE B 1 125 ? 20.592  -29.411 77.948  1.00 22.70 ? 127  PHE B N   1 
ATOM   2866 C  CA  . PHE B 1 125 ? 22.014  -29.104 78.012  1.00 24.86 ? 127  PHE B CA  1 
ATOM   2867 C  C   . PHE B 1 125 ? 22.721  -30.073 78.964  1.00 25.23 ? 127  PHE B C   1 
ATOM   2868 O  O   . PHE B 1 125 ? 22.258  -30.304 80.070  1.00 25.30 ? 127  PHE B O   1 
ATOM   2869 C  CB  . PHE B 1 125 ? 22.244  -27.661 78.496  1.00 24.66 ? 127  PHE B CB  1 
ATOM   2870 C  CG  . PHE B 1 125 ? 21.701  -26.606 77.565  1.00 23.96 ? 127  PHE B CG  1 
ATOM   2871 C  CD1 . PHE B 1 125 ? 22.462  -26.124 76.514  1.00 23.60 ? 127  PHE B CD1 1 
ATOM   2872 C  CD2 . PHE B 1 125 ? 20.430  -26.114 77.735  1.00 24.68 ? 127  PHE B CD2 1 
ATOM   2873 C  CE1 . PHE B 1 125 ? 21.950  -25.154 75.656  1.00 23.63 ? 127  PHE B CE1 1 
ATOM   2874 C  CE2 . PHE B 1 125 ? 19.907  -25.142 76.882  1.00 24.50 ? 127  PHE B CE2 1 
ATOM   2875 C  CZ  . PHE B 1 125 ? 20.680  -24.653 75.850  1.00 23.71 ? 127  PHE B CZ  1 
ATOM   2876 N  N   . ALA B 1 126 ? 23.858  -30.622 78.534  1.00 26.00 ? 128  ALA B N   1 
ATOM   2877 C  CA  . ALA B 1 126 ? 24.600  -31.589 79.357  1.00 27.31 ? 128  ALA B CA  1 
ATOM   2878 C  C   . ALA B 1 126 ? 25.415  -30.890 80.428  1.00 25.99 ? 128  ALA B C   1 
ATOM   2879 O  O   . ALA B 1 126 ? 25.651  -31.445 81.498  1.00 25.64 ? 128  ALA B O   1 
ATOM   2880 C  CB  . ALA B 1 126 ? 25.511  -32.439 78.475  1.00 29.03 ? 128  ALA B CB  1 
ATOM   2881 N  N   . ARG B 1 127 ? 25.819  -29.652 80.156  1.00 24.41 ? 129  ARG B N   1 
ATOM   2882 C  CA  . ARG B 1 127 ? 26.685  -28.901 81.032  1.00 23.91 ? 129  ARG B CA  1 
ATOM   2883 C  C   . ARG B 1 127 ? 26.145  -27.491 81.258  1.00 23.53 ? 129  ARG B C   1 
ATOM   2884 O  O   . ARG B 1 127 ? 25.537  -26.901 80.344  1.00 23.00 ? 129  ARG B O   1 
ATOM   2885 C  CB  . ARG B 1 127 ? 28.071  -28.766 80.377  1.00 26.69 ? 129  ARG B CB  1 
ATOM   2886 C  CG  . ARG B 1 127 ? 28.772  -30.100 80.069  1.00 28.66 ? 129  ARG B CG  1 
ATOM   2887 C  CD  . ARG B 1 127 ? 29.975  -29.897 79.156  1.00 29.65 ? 129  ARG B CD  1 
ATOM   2888 N  NE  . ARG B 1 127 ? 30.897  -28.952 79.764  1.00 30.99 ? 129  ARG B NE  1 
ATOM   2889 C  CZ  . ARG B 1 127 ? 31.891  -29.272 80.587  1.00 32.75 ? 129  ARG B CZ  1 
ATOM   2890 N  NH1 . ARG B 1 127 ? 32.146  -30.547 80.886  1.00 35.27 ? 129  ARG B NH1 1 
ATOM   2891 N  NH2 . ARG B 1 127 ? 32.643  -28.315 81.114  1.00 30.15 ? 129  ARG B NH2 1 
ATOM   2892 N  N   . VAL B 1 128 ? 26.450  -26.949 82.438  1.00 22.75 ? 130  VAL B N   1 
ATOM   2893 C  CA  . VAL B 1 128 ? 26.143  -25.557 82.779  1.00 23.12 ? 130  VAL B CA  1 
ATOM   2894 C  C   . VAL B 1 128 ? 26.811  -24.606 81.799  1.00 22.51 ? 130  VAL B C   1 
ATOM   2895 O  O   . VAL B 1 128 ? 26.183  -23.640 81.348  1.00 19.18 ? 130  VAL B O   1 
ATOM   2896 C  CB  . VAL B 1 128 ? 26.560  -25.211 84.233  1.00 24.72 ? 130  VAL B CB  1 
ATOM   2897 C  CG1 . VAL B 1 128 ? 26.520  -23.712 84.502  1.00 23.46 ? 130  VAL B CG1 1 
ATOM   2898 C  CG2 . VAL B 1 128 ? 25.669  -25.929 85.240  1.00 25.54 ? 130  VAL B CG2 1 
ATOM   2899 N  N   . ASP B 1 129 ? 28.074  -24.865 81.423  1.00 22.00 ? 131  ASP B N   1 
ATOM   2900 C  CA  . ASP B 1 129 ? 28.747  -23.921 80.525  1.00 21.47 ? 131  ASP B CA  1 
ATOM   2901 C  C   . ASP B 1 129 ? 28.117  -23.782 79.135  1.00 20.90 ? 131  ASP B C   1 
ATOM   2902 O  O   . ASP B 1 129 ? 28.183  -22.711 78.551  1.00 21.84 ? 131  ASP B O   1 
ATOM   2903 C  CB  . ASP B 1 129 ? 30.277  -24.103 80.503  1.00 22.26 ? 131  ASP B CB  1 
ATOM   2904 C  CG  . ASP B 1 129 ? 30.719  -25.436 79.992  1.00 24.25 ? 131  ASP B CG  1 
ATOM   2905 O  OD1 . ASP B 1 129 ? 29.907  -26.216 79.461  1.00 24.11 ? 131  ASP B OD1 1 
ATOM   2906 O  OD2 . ASP B 1 129 ? 31.942  -25.712 80.122  1.00 26.50 ? 131  ASP B OD2 1 
ATOM   2907 N  N   . GLU B 1 130 ? 27.436  -24.818 78.654  1.00 21.43 ? 132  GLU B N   1 
ATOM   2908 C  CA  . GLU B 1 130 ? 26.633  -24.740 77.422  1.00 23.12 ? 132  GLU B CA  1 
ATOM   2909 C  C   . GLU B 1 130 ? 25.336  -23.947 77.614  1.00 21.79 ? 132  GLU B C   1 
ATOM   2910 O  O   . GLU B 1 130 ? 24.846  -23.271 76.689  1.00 21.09 ? 132  GLU B O   1 
ATOM   2911 C  CB  . GLU B 1 130 ? 26.252  -26.133 76.912  1.00 26.00 ? 132  GLU B CB  1 
ATOM   2912 C  CG  . GLU B 1 130 ? 27.448  -27.024 76.604  1.00 33.26 ? 132  GLU B CG  1 
ATOM   2913 C  CD  . GLU B 1 130 ? 27.086  -28.493 76.334  1.00 38.44 ? 132  GLU B CD  1 
ATOM   2914 O  OE1 . GLU B 1 130 ? 25.934  -28.933 76.593  1.00 40.16 ? 132  GLU B OE1 1 
ATOM   2915 O  OE2 . GLU B 1 130 ? 27.986  -29.217 75.853  1.00 44.79 ? 132  GLU B OE2 1 
ATOM   2916 N  N   . ALA B 1 131 ? 24.759  -24.079 78.800  1.00 21.29 ? 133  ALA B N   1 
ATOM   2917 C  CA  . ALA B 1 131 ? 23.499  -23.398 79.152  1.00 20.86 ? 133  ALA B CA  1 
ATOM   2918 C  C   . ALA B 1 131 ? 23.663  -21.882 79.389  1.00 21.47 ? 133  ALA B C   1 
ATOM   2919 O  O   . ALA B 1 131 ? 22.699  -21.109 79.161  1.00 20.34 ? 133  ALA B O   1 
ATOM   2920 C  CB  . ALA B 1 131 ? 22.900  -24.047 80.372  1.00 20.77 ? 133  ALA B CB  1 
ATOM   2921 N  N   . LEU B 1 132 ? 24.849  -21.455 79.842  1.00 19.85 ? 134  LEU B N   1 
ATOM   2922 C  CA  . LEU B 1 132 ? 25.090  -20.052 80.186  1.00 22.00 ? 134  LEU B CA  1 
ATOM   2923 C  C   . LEU B 1 132 ? 24.860  -19.175 78.972  1.00 21.74 ? 134  LEU B C   1 
ATOM   2924 O  O   . LEU B 1 132 ? 25.419  -19.423 77.905  1.00 20.36 ? 134  LEU B O   1 
ATOM   2925 C  CB  . LEU B 1 132 ? 26.513  -19.820 80.721  1.00 24.19 ? 134  LEU B CB  1 
ATOM   2926 C  CG  . LEU B 1 132 ? 26.814  -20.343 82.133  1.00 24.94 ? 134  LEU B CG  1 
ATOM   2927 C  CD1 . LEU B 1 132 ? 28.309  -20.447 82.388  1.00 26.42 ? 134  LEU B CD1 1 
ATOM   2928 C  CD2 . LEU B 1 132 ? 26.175  -19.485 83.206  1.00 25.45 ? 134  LEU B CD2 1 
ATOM   2929 N  N   . GLY B 1 133 ? 23.976  -18.191 79.107  1.00 20.65 ? 135  GLY B N   1 
ATOM   2930 C  CA  . GLY B 1 133 ? 23.691  -17.261 78.017  1.00 20.12 ? 135  GLY B CA  1 
ATOM   2931 C  C   . GLY B 1 133 ? 22.643  -17.757 77.027  1.00 19.89 ? 135  GLY B C   1 
ATOM   2932 O  O   . GLY B 1 133 ? 22.220  -16.996 76.181  1.00 21.80 ? 135  GLY B O   1 
ATOM   2933 N  N   . ARG B 1 134 ? 22.207  -19.010 77.129  1.00 17.83 ? 136  ARG B N   1 
ATOM   2934 C  CA  . ARG B 1 134 ? 21.214  -19.562 76.213  1.00 18.56 ? 136  ARG B CA  1 
ATOM   2935 C  C   . ARG B 1 134 ? 19.813  -19.418 76.870  1.00 18.76 ? 136  ARG B C   1 
ATOM   2936 O  O   . ARG B 1 134 ? 19.668  -19.651 78.044  1.00 19.95 ? 136  ARG B O   1 
ATOM   2937 C  CB  . ARG B 1 134 ? 21.494  -21.040 75.913  1.00 19.26 ? 136  ARG B CB  1 
ATOM   2938 C  CG  . ARG B 1 134 ? 22.450  -21.276 74.742  1.00 19.67 ? 136  ARG B CG  1 
ATOM   2939 C  CD  . ARG B 1 134 ? 23.812  -20.594 74.854  1.00 20.54 ? 136  ARG B CD  1 
ATOM   2940 N  NE  . ARG B 1 134 ? 24.517  -20.765 73.569  1.00 20.71 ? 136  ARG B NE  1 
ATOM   2941 C  CZ  . ARG B 1 134 ? 25.197  -21.841 73.168  1.00 21.90 ? 136  ARG B CZ  1 
ATOM   2942 N  NH1 . ARG B 1 134 ? 25.392  -22.883 73.964  1.00 22.93 ? 136  ARG B NH1 1 
ATOM   2943 N  NH2 . ARG B 1 134 ? 25.721  -21.863 71.950  1.00 21.08 ? 136  ARG B NH2 1 
ATOM   2944 N  N   . PRO B 1 135 ? 18.791  -19.078 76.089  1.00 19.66 ? 137  PRO B N   1 
ATOM   2945 C  CA  . PRO B 1 135 ? 17.469  -18.826 76.677  1.00 19.64 ? 137  PRO B CA  1 
ATOM   2946 C  C   . PRO B 1 135 ? 16.871  -20.081 77.341  1.00 19.46 ? 137  PRO B C   1 
ATOM   2947 O  O   . PRO B 1 135 ? 16.771  -21.137 76.721  1.00 18.55 ? 137  PRO B O   1 
ATOM   2948 C  CB  . PRO B 1 135 ? 16.646  -18.332 75.489  1.00 20.80 ? 137  PRO B CB  1 
ATOM   2949 C  CG  . PRO B 1 135 ? 17.334  -18.864 74.279  1.00 21.54 ? 137  PRO B CG  1 
ATOM   2950 C  CD  . PRO B 1 135 ? 18.789  -18.943 74.619  1.00 20.08 ? 137  PRO B CD  1 
ATOM   2951 N  N   . GLY B 1 136 ? 16.519  -19.952 78.616  1.00 19.33 ? 138  GLY B N   1 
ATOM   2952 C  CA  . GLY B 1 136 ? 16.018  -21.075 79.389  1.00 20.14 ? 138  GLY B CA  1 
ATOM   2953 C  C   . GLY B 1 136 ? 17.024  -22.171 79.714  1.00 20.00 ? 138  GLY B C   1 
ATOM   2954 O  O   . GLY B 1 136 ? 16.621  -23.229 80.204  1.00 18.41 ? 138  GLY B O   1 
ATOM   2955 N  N   . GLY B 1 137 ? 18.321  -21.929 79.494  1.00 18.46 ? 139  GLY B N   1 
ATOM   2956 C  CA  . GLY B 1 137 ? 19.329  -22.928 79.809  1.00 19.91 ? 139  GLY B CA  1 
ATOM   2957 C  C   . GLY B 1 137 ? 19.377  -23.242 81.285  1.00 18.92 ? 139  GLY B C   1 
ATOM   2958 O  O   . GLY B 1 137 ? 19.467  -24.414 81.686  1.00 18.56 ? 139  GLY B O   1 
ATOM   2959 N  N   . LEU B 1 138 ? 19.317  -22.180 82.090  1.00 18.71 ? 140  LEU B N   1 
ATOM   2960 C  CA  . LEU B 1 138 ? 19.254  -22.256 83.525  1.00 18.51 ? 140  LEU B CA  1 
ATOM   2961 C  C   . LEU B 1 138 ? 17.908  -21.712 84.006  1.00 19.11 ? 140  LEU B C   1 
ATOM   2962 O  O   . LEU B 1 138 ? 17.372  -20.750 83.419  1.00 18.33 ? 140  LEU B O   1 
ATOM   2963 C  CB  . LEU B 1 138 ? 20.376  -21.435 84.141  1.00 19.24 ? 140  LEU B CB  1 
ATOM   2964 C  CG  . LEU B 1 138 ? 21.794  -21.901 83.804  1.00 20.97 ? 140  LEU B CG  1 
ATOM   2965 C  CD1 . LEU B 1 138 ? 22.754  -20.972 84.502  1.00 21.59 ? 140  LEU B CD1 1 
ATOM   2966 C  CD2 . LEU B 1 138 ? 22.019  -23.342 84.232  1.00 21.89 ? 140  LEU B CD2 1 
ATOM   2967 N  N   . ALA B 1 139 ? 17.370  -22.355 85.039  1.00 16.86 ? 141  ALA B N   1 
ATOM   2968 C  CA  . ALA B 1 139 ? 16.145  -21.903 85.704  1.00 17.40 ? 141  ALA B CA  1 
ATOM   2969 C  C   . ALA B 1 139 ? 16.398  -21.866 87.190  1.00 18.97 ? 141  ALA B C   1 
ATOM   2970 O  O   . ALA B 1 139 ? 16.900  -22.854 87.766  1.00 17.67 ? 141  ALA B O   1 
ATOM   2971 C  CB  . ALA B 1 139 ? 14.980  -22.817 85.376  1.00 17.07 ? 141  ALA B CB  1 
ATOM   2972 N  N   . VAL B 1 140 ? 16.061  -20.744 87.834  1.00 18.90 ? 142  VAL B N   1 
ATOM   2973 C  CA  . VAL B 1 140 ? 16.214  -20.626 89.279  1.00 19.05 ? 142  VAL B CA  1 
ATOM   2974 C  C   . VAL B 1 140 ? 14.832  -20.498 89.941  1.00 20.19 ? 142  VAL B C   1 
ATOM   2975 O  O   . VAL B 1 140 ? 14.008  -19.710 89.498  1.00 18.38 ? 142  VAL B O   1 
ATOM   2976 C  CB  . VAL B 1 140 ? 17.103  -19.444 89.660  1.00 19.37 ? 142  VAL B CB  1 
ATOM   2977 C  CG1 . VAL B 1 140 ? 17.331  -19.413 91.163  1.00 19.34 ? 142  VAL B CG1 1 
ATOM   2978 C  CG2 . VAL B 1 140 ? 18.437  -19.510 88.920  1.00 20.48 ? 142  VAL B CG2 1 
ATOM   2979 N  N   . LEU B 1 141 ? 14.563  -21.303 90.970  1.00 19.95 ? 143  LEU B N   1 
ATOM   2980 C  CA  . LEU B 1 141 ? 13.374  -21.092 91.839  1.00 21.04 ? 143  LEU B CA  1 
ATOM   2981 C  C   . LEU B 1 141 ? 13.814  -20.230 92.994  1.00 21.37 ? 143  LEU B C   1 
ATOM   2982 O  O   . LEU B 1 141 ? 14.831  -20.520 93.646  1.00 20.75 ? 143  LEU B O   1 
ATOM   2983 C  CB  . LEU B 1 141 ? 12.799  -22.419 92.333  1.00 21.37 ? 143  LEU B CB  1 
ATOM   2984 C  CG  . LEU B 1 141 ? 12.456  -23.455 91.264  1.00 21.94 ? 143  LEU B CG  1 
ATOM   2985 C  CD1 . LEU B 1 141 ? 11.791  -24.663 91.927  1.00 21.56 ? 143  LEU B CD1 1 
ATOM   2986 C  CD2 . LEU B 1 141 ? 11.568  -22.922 90.146  1.00 22.61 ? 143  LEU B CD2 1 
ATOM   2987 N  N   . ALA B 1 142 ? 13.069  -19.146 93.251  1.00 21.20 ? 144  ALA B N   1 
ATOM   2988 C  CA  . ALA B 1 142 ? 13.423  -18.187 94.282  1.00 20.47 ? 144  ALA B CA  1 
ATOM   2989 C  C   . ALA B 1 142 ? 12.255  -18.051 95.249  1.00 20.59 ? 144  ALA B C   1 
ATOM   2990 O  O   . ALA B 1 142 ? 11.087  -18.067 94.830  1.00 18.79 ? 144  ALA B O   1 
ATOM   2991 C  CB  . ALA B 1 142 ? 13.777  -16.834 93.678  1.00 21.16 ? 144  ALA B CB  1 
ATOM   2992 N  N   . ALA B 1 143 ? 12.570  -18.034 96.535  1.00 21.46 ? 145  ALA B N   1 
ATOM   2993 C  CA  . ALA B 1 143 ? 11.536  -17.838 97.573  1.00 22.36 ? 145  ALA B CA  1 
ATOM   2994 C  C   . ALA B 1 143 ? 12.045  -16.918 98.647  1.00 22.99 ? 145  ALA B C   1 
ATOM   2995 O  O   . ALA B 1 143 ? 13.214  -16.973 99.054  1.00 23.94 ? 145  ALA B O   1 
ATOM   2996 C  CB  . ALA B 1 143 ? 11.061  -19.160 98.167  1.00 22.00 ? 145  ALA B CB  1 
ATOM   2997 N  N   . PHE B 1 144 ? 11.159  -16.033 99.086  1.00 23.55 ? 146  PHE B N   1 
ATOM   2998 C  CA  . PHE B 1 144 ? 11.471  -15.101 100.144 1.00 23.75 ? 146  PHE B CA  1 
ATOM   2999 C  C   . PHE B 1 144 ? 11.364  -15.807 101.503 1.00 23.92 ? 146  PHE B C   1 
ATOM   3000 O  O   . PHE B 1 144 ? 10.449  -16.624 101.727 1.00 24.86 ? 146  PHE B O   1 
ATOM   3001 C  CB  . PHE B 1 144 ? 10.489  -13.923 100.101 1.00 24.44 ? 146  PHE B CB  1 
ATOM   3002 C  CG  . PHE B 1 144 ? 10.551  -13.116 98.827  1.00 22.85 ? 146  PHE B CG  1 
ATOM   3003 C  CD1 . PHE B 1 144 ? 11.726  -12.509 98.436  1.00 23.44 ? 146  PHE B CD1 1 
ATOM   3004 C  CD2 . PHE B 1 144 ? 9.415   -12.963 98.023  1.00 24.91 ? 146  PHE B CD2 1 
ATOM   3005 C  CE1 . PHE B 1 144 ? 11.782  -11.755 97.275  1.00 22.49 ? 146  PHE B CE1 1 
ATOM   3006 C  CE2 . PHE B 1 144 ? 9.461   -12.208 96.854  1.00 23.97 ? 146  PHE B CE2 1 
ATOM   3007 C  CZ  . PHE B 1 144 ? 10.652  -11.604 96.484  1.00 22.80 ? 146  PHE B CZ  1 
ATOM   3008 N  N   . LEU B 1 145 ? 12.307  -15.482 102.373 1.00 26.35 ? 147  LEU B N   1 
ATOM   3009 C  CA  . LEU B 1 145 ? 12.333  -15.930 103.763 1.00 27.78 ? 147  LEU B CA  1 
ATOM   3010 C  C   . LEU B 1 145 ? 11.957  -14.739 104.655 1.00 28.92 ? 147  LEU B C   1 
ATOM   3011 O  O   . LEU B 1 145 ? 12.637  -13.719 104.623 1.00 28.58 ? 147  LEU B O   1 
ATOM   3012 C  CB  . LEU B 1 145 ? 13.721  -16.424 104.168 1.00 27.13 ? 147  LEU B CB  1 
ATOM   3013 C  CG  . LEU B 1 145 ? 14.504  -17.396 103.272 1.00 29.79 ? 147  LEU B CG  1 
ATOM   3014 C  CD1 . LEU B 1 145 ? 15.661  -18.043 104.018 1.00 30.20 ? 147  LEU B CD1 1 
ATOM   3015 C  CD2 . LEU B 1 145 ? 13.641  -18.457 102.660 1.00 29.75 ? 147  LEU B CD2 1 
ATOM   3016 N  N   . GLU B 1 146 ? 10.885  -14.897 105.434 1.00 31.22 ? 148  GLU B N   1 
ATOM   3017 C  CA  . GLU B 1 146 ? 10.380  -13.849 106.357 1.00 32.48 ? 148  GLU B CA  1 
ATOM   3018 C  C   . GLU B 1 146 ? 10.519  -14.293 107.813 1.00 33.81 ? 148  GLU B C   1 
ATOM   3019 O  O   . GLU B 1 146 ? 10.693  -15.482 108.107 1.00 30.86 ? 148  GLU B O   1 
ATOM   3020 C  CB  . GLU B 1 146 ? 8.895   -13.600 106.121 1.00 32.22 ? 148  GLU B CB  1 
ATOM   3021 C  CG  . GLU B 1 146 ? 8.561   -12.963 104.800 1.00 36.32 ? 148  GLU B CG  1 
ATOM   3022 C  CD  . GLU B 1 146 ? 7.184   -12.331 104.806 1.00 36.93 ? 148  GLU B CD  1 
ATOM   3023 O  OE1 . GLU B 1 146 ? 6.163   -13.061 104.757 1.00 38.68 ? 148  GLU B OE1 1 
ATOM   3024 O  OE2 . GLU B 1 146 ? 7.143   -11.093 104.853 1.00 39.53 ? 148  GLU B OE2 1 
ATOM   3025 N  N   . GLU B 1 147 ? 10.390  -13.320 108.713 1.00 36.94 ? 149  GLU B N   1 
ATOM   3026 C  CA  . GLU B 1 147 ? 10.335  -13.599 110.153 1.00 39.61 ? 149  GLU B CA  1 
ATOM   3027 C  C   . GLU B 1 147 ? 8.931   -14.059 110.572 1.00 38.04 ? 149  GLU B C   1 
ATOM   3028 O  O   . GLU B 1 147 ? 7.933   -13.423 110.245 1.00 37.36 ? 149  GLU B O   1 
ATOM   3029 C  CB  . GLU B 1 147 ? 10.750  -12.377 110.960 1.00 41.85 ? 149  GLU B CB  1 
ATOM   3030 C  CG  . GLU B 1 147 ? 10.910  -12.652 112.448 1.00 44.38 ? 149  GLU B CG  1 
ATOM   3031 C  CD  . GLU B 1 147 ? 11.397  -11.436 113.212 1.00 45.52 ? 149  GLU B CD  1 
ATOM   3032 O  OE1 . GLU B 1 147 ? 12.571  -11.051 113.050 1.00 49.93 ? 149  GLU B OE1 1 
ATOM   3033 O  OE2 . GLU B 1 147 ? 10.604  -10.869 113.979 1.00 51.46 ? 149  GLU B OE2 1 
ATOM   3034 N  N   . GLY B 1 148 ? 8.882   -15.179 111.287 1.00 38.97 ? 150  GLY B N   1 
ATOM   3035 C  CA  . GLY B 1 148 ? 7.656   -15.724 111.860 1.00 39.05 ? 150  GLY B CA  1 
ATOM   3036 C  C   . GLY B 1 148 ? 7.930   -16.157 113.298 1.00 38.12 ? 150  GLY B C   1 
ATOM   3037 O  O   . GLY B 1 148 ? 9.083   -16.137 113.744 1.00 37.42 ? 150  GLY B O   1 
ATOM   3038 N  N   . PRO B 1 149 ? 6.875   -16.520 114.040 1.00 40.56 ? 151  PRO B N   1 
ATOM   3039 C  CA  . PRO B 1 149 ? 7.082   -16.843 115.458 1.00 44.18 ? 151  PRO B CA  1 
ATOM   3040 C  C   . PRO B 1 149 ? 7.795   -18.179 115.697 1.00 45.34 ? 151  PRO B C   1 
ATOM   3041 O  O   . PRO B 1 149 ? 8.510   -18.305 116.689 1.00 47.89 ? 151  PRO B O   1 
ATOM   3042 C  CB  . PRO B 1 149 ? 5.654   -16.866 116.028 1.00 43.62 ? 151  PRO B CB  1 
ATOM   3043 C  CG  . PRO B 1 149 ? 4.774   -17.153 114.856 1.00 44.40 ? 151  PRO B CG  1 
ATOM   3044 C  CD  . PRO B 1 149 ? 5.448   -16.510 113.675 1.00 41.94 ? 151  PRO B CD  1 
ATOM   3045 N  N   . GLU B 1 150 ? 7.614   -19.146 114.797 1.00 45.75 ? 152  GLU B N   1 
ATOM   3046 C  CA  . GLU B 1 150 ? 8.097   -20.514 115.019 1.00 47.72 ? 152  GLU B CA  1 
ATOM   3047 C  C   . GLU B 1 150 ? 9.466   -20.793 114.418 1.00 47.43 ? 152  GLU B C   1 
ATOM   3048 O  O   . GLU B 1 150 ? 9.884   -20.172 113.434 1.00 47.96 ? 152  GLU B O   1 
ATOM   3049 C  CB  . GLU B 1 150 ? 7.108   -21.530 114.455 1.00 50.50 ? 152  GLU B CB  1 
ATOM   3050 C  CG  . GLU B 1 150 ? 5.753   -21.528 115.143 1.00 55.58 ? 152  GLU B CG  1 
ATOM   3051 C  CD  . GLU B 1 150 ? 4.772   -22.509 114.519 1.00 60.32 ? 152  GLU B CD  1 
ATOM   3052 O  OE1 . GLU B 1 150 ? 5.214   -23.487 113.870 1.00 66.24 ? 152  GLU B OE1 1 
ATOM   3053 O  OE2 . GLU B 1 150 ? 3.548   -22.309 114.675 1.00 64.45 ? 152  GLU B OE2 1 
ATOM   3054 N  N   . GLU B 1 151 ? 10.153  -21.753 115.026 1.00 42.22 ? 153  GLU B N   1 
ATOM   3055 C  CA  . GLU B 1 151 ? 11.363  -22.319 114.461 1.00 40.39 ? 153  GLU B CA  1 
ATOM   3056 C  C   . GLU B 1 151 ? 11.002  -23.148 113.222 1.00 36.05 ? 153  GLU B C   1 
ATOM   3057 O  O   . GLU B 1 151 ? 10.100  -23.992 113.270 1.00 31.37 ? 153  GLU B O   1 
ATOM   3058 C  CB  . GLU B 1 151 ? 12.082  -23.198 115.498 1.00 43.10 ? 153  GLU B CB  1 
ATOM   3059 C  CG  . GLU B 1 151 ? 12.733  -22.400 116.621 1.00 44.30 ? 153  GLU B CG  1 
ATOM   3060 C  CD  . GLU B 1 151 ? 13.970  -21.647 116.159 1.00 48.70 ? 153  GLU B CD  1 
ATOM   3061 O  OE1 . GLU B 1 151 ? 14.685  -22.181 115.286 1.00 51.98 ? 153  GLU B OE1 1 
ATOM   3062 O  OE2 . GLU B 1 151 ? 14.237  -20.531 116.663 1.00 44.38 ? 153  GLU B OE2 1 
ATOM   3063 N  N   . ASN B 1 152 ? 11.686  -22.865 112.108 1.00 32.49 ? 154  ASN B N   1 
ATOM   3064 C  CA  . ASN B 1 152 ? 11.480  -23.583 110.859 1.00 29.82 ? 154  ASN B CA  1 
ATOM   3065 C  C   . ASN B 1 152 ? 12.287  -24.879 110.843 1.00 28.49 ? 154  ASN B C   1 
ATOM   3066 O  O   . ASN B 1 152 ? 13.517  -24.846 110.838 1.00 27.27 ? 154  ASN B O   1 
ATOM   3067 C  CB  . ASN B 1 152 ? 11.884  -22.690 109.667 1.00 30.44 ? 154  ASN B CB  1 
ATOM   3068 C  CG  . ASN B 1 152 ? 11.619  -23.354 108.334 1.00 29.79 ? 154  ASN B CG  1 
ATOM   3069 O  OD1 . ASN B 1 152 ? 12.231  -24.380 108.015 1.00 28.34 ? 154  ASN B OD1 1 
ATOM   3070 N  ND2 . ASN B 1 152 ? 10.723  -22.776 107.538 1.00 31.29 ? 154  ASN B ND2 1 
ATOM   3071 N  N   . SER B 1 153 ? 11.600  -26.016 110.794 1.00 28.08 ? 155  SER B N   1 
ATOM   3072 C  CA  . SER B 1 153 ? 12.289  -27.309 110.880 1.00 28.72 ? 155  SER B CA  1 
ATOM   3073 C  C   . SER B 1 153 ? 13.255  -27.528 109.702 1.00 27.83 ? 155  SER B C   1 
ATOM   3074 O  O   . SER B 1 153 ? 14.431  -27.898 109.895 1.00 28.03 ? 155  SER B O   1 
ATOM   3075 C  CB  . SER B 1 153 ? 11.258  -28.440 110.971 1.00 30.41 ? 155  SER B CB  1 
ATOM   3076 O  OG  . SER B 1 153 ? 10.380  -28.269 112.091 1.00 30.48 ? 155  SER B OG  1 
ATOM   3077 N  N   . ALA B 1 154 ? 12.775  -27.256 108.487 1.00 26.71 ? 156  ALA B N   1 
ATOM   3078 C  CA  . ALA B 1 154 ? 13.573  -27.479 107.272 1.00 26.30 ? 156  ALA B CA  1 
ATOM   3079 C  C   . ALA B 1 154 ? 14.881  -26.688 107.265 1.00 26.08 ? 156  ALA B C   1 
ATOM   3080 O  O   . ALA B 1 154 ? 15.971  -27.249 107.061 1.00 25.27 ? 156  ALA B O   1 
ATOM   3081 C  CB  . ALA B 1 154 ? 12.743  -27.179 106.039 1.00 25.90 ? 156  ALA B CB  1 
ATOM   3082 N  N   . TYR B 1 155 ? 14.785  -25.386 107.513 1.00 25.34 ? 157  TYR B N   1 
ATOM   3083 C  CA  . TYR B 1 155 ? 15.975  -24.528 107.539 1.00 26.44 ? 157  TYR B CA  1 
ATOM   3084 C  C   . TYR B 1 155 ? 16.932  -24.779 108.703 1.00 28.10 ? 157  TYR B C   1 
ATOM   3085 O  O   . TYR B 1 155 ? 18.146  -24.547 108.571 1.00 26.24 ? 157  TYR B O   1 
ATOM   3086 C  CB  . TYR B 1 155 ? 15.572  -23.050 107.466 1.00 26.08 ? 157  TYR B CB  1 
ATOM   3087 C  CG  . TYR B 1 155 ? 15.123  -22.674 106.067 1.00 25.27 ? 157  TYR B CG  1 
ATOM   3088 C  CD1 . TYR B 1 155 ? 13.839  -22.928 105.636 1.00 24.74 ? 157  TYR B CD1 1 
ATOM   3089 C  CD2 . TYR B 1 155 ? 16.012  -22.083 105.168 1.00 25.67 ? 157  TYR B CD2 1 
ATOM   3090 C  CE1 . TYR B 1 155 ? 13.427  -22.587 104.357 1.00 24.75 ? 157  TYR B CE1 1 
ATOM   3091 C  CE2 . TYR B 1 155 ? 15.615  -21.745 103.892 1.00 24.38 ? 157  TYR B CE2 1 
ATOM   3092 C  CZ  . TYR B 1 155 ? 14.323  -22.004 103.489 1.00 24.31 ? 157  TYR B CZ  1 
ATOM   3093 O  OH  . TYR B 1 155 ? 13.917  -21.700 102.207 1.00 23.81 ? 157  TYR B OH  1 
ATOM   3094 N  N   . GLU B 1 156 ? 16.401  -25.270 109.825 1.00 31.20 ? 158  GLU B N   1 
ATOM   3095 C  CA  . GLU B 1 156 ? 17.238  -25.662 110.983 1.00 31.94 ? 158  GLU B CA  1 
ATOM   3096 C  C   . GLU B 1 156 ? 18.343  -26.651 110.603 1.00 30.04 ? 158  GLU B C   1 
ATOM   3097 O  O   . GLU B 1 156 ? 19.451  -26.556 111.111 1.00 28.47 ? 158  GLU B O   1 
ATOM   3098 C  CB  . GLU B 1 156 ? 16.367  -26.229 112.130 1.00 36.09 ? 158  GLU B CB  1 
ATOM   3099 C  CG  . GLU B 1 156 ? 17.090  -26.576 113.433 1.00 40.60 ? 158  GLU B CG  1 
ATOM   3100 C  CD  . GLU B 1 156 ? 17.826  -25.405 114.081 1.00 42.98 ? 158  GLU B CD  1 
ATOM   3101 O  OE1 . GLU B 1 156 ? 17.534  -24.197 113.783 1.00 45.32 ? 158  GLU B OE1 1 
ATOM   3102 O  OE2 . GLU B 1 156 ? 18.737  -25.708 114.887 1.00 49.26 ? 158  GLU B OE2 1 
ATOM   3103 N  N   . GLN B 1 157 ? 18.047  -27.580 109.699 1.00 29.74 ? 159  GLN B N   1 
ATOM   3104 C  CA  . GLN B 1 157 ? 19.071  -28.504 109.193 1.00 28.56 ? 159  GLN B CA  1 
ATOM   3105 C  C   . GLN B 1 157 ? 20.258  -27.811 108.529 1.00 29.80 ? 159  GLN B C   1 
ATOM   3106 O  O   . GLN B 1 157 ? 21.380  -28.298 108.600 1.00 32.06 ? 159  GLN B O   1 
ATOM   3107 C  CB  . GLN B 1 157 ? 18.474  -29.471 108.191 1.00 28.71 ? 159  GLN B CB  1 
ATOM   3108 C  CG  . GLN B 1 157 ? 17.414  -30.392 108.745 1.00 28.15 ? 159  GLN B CG  1 
ATOM   3109 C  CD  . GLN B 1 157 ? 16.489  -30.886 107.649 1.00 29.71 ? 159  GLN B CD  1 
ATOM   3110 O  OE1 . GLN B 1 157 ? 15.926  -30.075 106.879 1.00 31.78 ? 159  GLN B OE1 1 
ATOM   3111 N  NE2 . GLN B 1 157 ? 16.313  -32.197 107.557 1.00 26.91 ? 159  GLN B NE2 1 
ATOM   3112 N  N   . LEU B 1 158 ? 20.007  -26.696 107.852 1.00 29.24 ? 160  LEU B N   1 
ATOM   3113 C  CA  . LEU B 1 158 ? 21.082  -25.942 107.259 1.00 29.31 ? 160  LEU B CA  1 
ATOM   3114 C  C   . LEU B 1 158 ? 21.698  -24.997 108.267 1.00 27.58 ? 160  LEU B C   1 
ATOM   3115 O  O   . LEU B 1 158 ? 22.901  -24.955 108.394 1.00 28.08 ? 160  LEU B O   1 
ATOM   3116 C  CB  . LEU B 1 158 ? 20.595  -25.174 106.049 1.00 30.01 ? 160  LEU B CB  1 
ATOM   3117 C  CG  . LEU B 1 158 ? 19.981  -26.039 104.955 1.00 30.62 ? 160  LEU B CG  1 
ATOM   3118 C  CD1 . LEU B 1 158 ? 19.570  -25.139 103.797 1.00 32.00 ? 160  LEU B CD1 1 
ATOM   3119 C  CD2 . LEU B 1 158 ? 20.944  -27.114 104.496 1.00 33.06 ? 160  LEU B CD2 1 
ATOM   3120 N  N   . LEU B 1 159 ? 20.871  -24.254 108.983 1.00 28.36 ? 161  LEU B N   1 
ATOM   3121 C  CA  . LEU B 1 159 ? 21.375  -23.202 109.885 1.00 30.89 ? 161  LEU B CA  1 
ATOM   3122 C  C   . LEU B 1 159 ? 22.226  -23.752 111.043 1.00 30.52 ? 161  LEU B C   1 
ATOM   3123 O  O   . LEU B 1 159 ? 23.232  -23.158 111.411 1.00 31.19 ? 161  LEU B O   1 
ATOM   3124 C  CB  . LEU B 1 159 ? 20.213  -22.365 110.416 1.00 31.98 ? 161  LEU B CB  1 
ATOM   3125 C  CG  . LEU B 1 159 ? 19.440  -21.588 109.345 1.00 33.43 ? 161  LEU B CG  1 
ATOM   3126 C  CD1 . LEU B 1 159 ? 18.114  -21.091 109.897 1.00 34.54 ? 161  LEU B CD1 1 
ATOM   3127 C  CD2 . LEU B 1 159 ? 20.278  -20.428 108.820 1.00 34.13 ? 161  LEU B CD2 1 
ATOM   3128 N  N   . SER B 1 160 ? 21.856  -24.924 111.555 1.00 32.07 ? 162  SER B N   1 
ATOM   3129 C  CA  . SER B 1 160 ? 22.598  -25.571 112.652 1.00 32.37 ? 162  SER B CA  1 
ATOM   3130 C  C   . SER B 1 160 ? 24.008  -26.035 112.260 1.00 33.31 ? 162  SER B C   1 
ATOM   3131 O  O   . SER B 1 160 ? 24.811  -26.310 113.131 1.00 35.22 ? 162  SER B O   1 
ATOM   3132 C  CB  . SER B 1 160 ? 21.810  -26.766 113.205 1.00 32.79 ? 162  SER B CB  1 
ATOM   3133 O  OG  . SER B 1 160 ? 21.758  -27.841 112.268 1.00 31.99 ? 162  SER B OG  1 
ATOM   3134 N  N   . ARG B 1 161 ? 24.305  -26.111 110.964 1.00 32.23 ? 163  ARG B N   1 
ATOM   3135 C  CA  . ARG B 1 161 ? 25.589  -26.573 110.470 1.00 32.18 ? 163  ARG B CA  1 
ATOM   3136 C  C   . ARG B 1 161 ? 26.512  -25.437 110.060 1.00 31.58 ? 163  ARG B C   1 
ATOM   3137 O  O   . ARG B 1 161 ? 27.660  -25.680 109.674 1.00 31.07 ? 163  ARG B O   1 
ATOM   3138 C  CB  . ARG B 1 161 ? 25.367  -27.485 109.267 1.00 35.01 ? 163  ARG B CB  1 
ATOM   3139 C  CG  . ARG B 1 161 ? 24.432  -28.657 109.532 1.00 39.01 ? 163  ARG B CG  1 
ATOM   3140 C  CD  . ARG B 1 161 ? 25.071  -29.710 110.416 1.00 42.02 ? 163  ARG B CD  1 
ATOM   3141 N  NE  . ARG B 1 161 ? 24.206  -30.884 110.530 1.00 48.12 ? 163  ARG B NE  1 
ATOM   3142 C  CZ  . ARG B 1 161 ? 24.470  -31.968 111.263 1.00 51.01 ? 163  ARG B CZ  1 
ATOM   3143 N  NH1 . ARG B 1 161 ? 25.596  -32.061 111.976 1.00 52.12 ? 163  ARG B NH1 1 
ATOM   3144 N  NH2 . ARG B 1 161 ? 23.591  -32.968 111.294 1.00 51.13 ? 163  ARG B NH2 1 
ATOM   3145 N  N   . LEU B 1 162 ? 26.024  -24.200 110.120 1.00 30.17 ? 164  LEU B N   1 
ATOM   3146 C  CA  . LEU B 1 162 ? 26.827  -23.061 109.659 1.00 31.67 ? 164  LEU B CA  1 
ATOM   3147 C  C   . LEU B 1 162 ? 28.065  -22.833 110.511 1.00 33.18 ? 164  LEU B C   1 
ATOM   3148 O  O   . LEU B 1 162 ? 29.108  -22.432 109.988 1.00 32.75 ? 164  LEU B O   1 
ATOM   3149 C  CB  . LEU B 1 162 ? 25.995  -21.787 109.580 1.00 30.29 ? 164  LEU B CB  1 
ATOM   3150 C  CG  . LEU B 1 162 ? 24.824  -21.827 108.592 1.00 30.07 ? 164  LEU B CG  1 
ATOM   3151 C  CD1 . LEU B 1 162 ? 24.204  -20.438 108.582 1.00 29.70 ? 164  LEU B CD1 1 
ATOM   3152 C  CD2 . LEU B 1 162 ? 25.228  -22.283 107.189 1.00 28.69 ? 164  LEU B CD2 1 
ATOM   3153 N  N   . GLU B 1 163 ? 27.979  -23.132 111.804 1.00 38.44 ? 165  GLU B N   1 
ATOM   3154 C  CA  . GLU B 1 163 ? 29.145  -22.982 112.682 1.00 42.82 ? 165  GLU B CA  1 
ATOM   3155 C  C   . GLU B 1 163 ? 30.312  -23.855 112.222 1.00 40.31 ? 165  GLU B C   1 
ATOM   3156 O  O   . GLU B 1 163 ? 31.461  -23.427 112.297 1.00 43.11 ? 165  GLU B O   1 
ATOM   3157 C  CB  . GLU B 1 163 ? 28.791  -23.260 114.151 1.00 48.48 ? 165  GLU B CB  1 
ATOM   3158 C  CG  . GLU B 1 163 ? 29.719  -22.561 115.144 1.00 53.60 ? 165  GLU B CG  1 
ATOM   3159 C  CD  . GLU B 1 163 ? 29.649  -21.028 115.069 1.00 58.39 ? 165  GLU B CD  1 
ATOM   3160 O  OE1 . GLU B 1 163 ? 28.696  -20.417 115.622 1.00 63.01 ? 165  GLU B OE1 1 
ATOM   3161 O  OE2 . GLU B 1 163 ? 30.565  -20.429 114.462 1.00 59.89 ? 165  GLU B OE2 1 
ATOM   3162 N  N   . GLU B 1 164 ? 29.998  -25.032 111.681 1.00 39.05 ? 166  GLU B N   1 
ATOM   3163 C  CA  . GLU B 1 164 ? 31.004  -25.946 111.121 1.00 39.69 ? 166  GLU B CA  1 
ATOM   3164 C  C   . GLU B 1 164 ? 31.774  -25.335 109.943 1.00 40.35 ? 166  GLU B C   1 
ATOM   3165 O  O   . GLU B 1 164 ? 32.917  -25.722 109.694 1.00 40.22 ? 166  GLU B O   1 
ATOM   3166 C  CB  . GLU B 1 164 ? 30.368  -27.277 110.656 1.00 41.93 ? 166  GLU B CB  1 
ATOM   3167 C  CG  . GLU B 1 164 ? 29.602  -28.047 111.730 1.00 44.72 ? 166  GLU B CG  1 
ATOM   3168 C  CD  . GLU B 1 164 ? 28.919  -29.304 111.221 1.00 45.94 ? 166  GLU B CD  1 
ATOM   3169 O  OE1 . GLU B 1 164 ? 29.426  -29.944 110.272 1.00 45.40 ? 166  GLU B OE1 1 
ATOM   3170 O  OE2 . GLU B 1 164 ? 27.863  -29.661 111.785 1.00 51.03 ? 166  GLU B OE2 1 
ATOM   3171 N  N   . ILE B 1 165 ? 31.159  -24.391 109.226 1.00 36.61 ? 167  ILE B N   1 
ATOM   3172 C  CA  . ILE B 1 165 ? 31.746  -23.824 108.014 1.00 36.05 ? 167  ILE B CA  1 
ATOM   3173 C  C   . ILE B 1 165 ? 31.861  -22.283 108.064 1.00 35.27 ? 167  ILE B C   1 
ATOM   3174 O  O   . ILE B 1 165 ? 31.768  -21.606 107.034 1.00 34.78 ? 167  ILE B O   1 
ATOM   3175 C  CB  . ILE B 1 165 ? 30.973  -24.299 106.753 1.00 34.84 ? 167  ILE B CB  1 
ATOM   3176 C  CG1 . ILE B 1 165 ? 29.487  -23.930 106.838 1.00 35.29 ? 167  ILE B CG1 1 
ATOM   3177 C  CG2 . ILE B 1 165 ? 31.119  -25.814 106.593 1.00 34.65 ? 167  ILE B CG2 1 
ATOM   3178 C  CD1 . ILE B 1 165 ? 28.753  -23.942 105.510 1.00 35.55 ? 167  ILE B CD1 1 
ATOM   3179 N  N   . ALA B 1 166 ? 32.098  -21.738 109.256 1.00 35.72 ? 168  ALA B N   1 
ATOM   3180 C  CA  . ALA B 1 166 ? 32.179  -20.283 109.439 1.00 36.92 ? 168  ALA B CA  1 
ATOM   3181 C  C   . ALA B 1 166 ? 33.298  -19.632 108.617 1.00 35.99 ? 168  ALA B C   1 
ATOM   3182 O  O   . ALA B 1 166 ? 33.127  -18.524 108.128 1.00 36.30 ? 168  ALA B O   1 
ATOM   3183 C  CB  . ALA B 1 166 ? 32.331  -19.931 110.917 1.00 37.44 ? 168  ALA B CB  1 
ATOM   3184 N  N   . GLU B 1 167 ? 34.427  -20.324 108.463 1.00 36.39 ? 169  GLU B N   1 
ATOM   3185 C  CA  . GLU B 1 167 ? 35.558  -19.798 107.693 1.00 38.26 ? 169  GLU B CA  1 
ATOM   3186 C  C   . GLU B 1 167 ? 35.281  -19.884 106.194 1.00 39.98 ? 169  GLU B C   1 
ATOM   3187 O  O   . GLU B 1 167 ? 34.847  -20.925 105.690 1.00 37.68 ? 169  GLU B O   1 
ATOM   3188 C  CB  . GLU B 1 167 ? 36.853  -20.549 108.022 1.00 38.77 ? 169  GLU B CB  1 
ATOM   3189 N  N   . GLU B 1 168 ? 35.520  -18.777 105.490 1.00 38.76 ? 170  GLU B N   1 
ATOM   3190 C  CA  . GLU B 1 168 ? 35.473  -18.746 104.024 1.00 40.37 ? 170  GLU B CA  1 
ATOM   3191 C  C   . GLU B 1 168 ? 36.200  -19.966 103.464 1.00 39.31 ? 170  GLU B C   1 
ATOM   3192 O  O   . GLU B 1 168 ? 37.311  -20.263 103.887 1.00 36.52 ? 170  GLU B O   1 
ATOM   3193 C  CB  . GLU B 1 168 ? 36.144  -17.455 103.525 1.00 42.93 ? 170  GLU B CB  1 
ATOM   3194 C  CG  . GLU B 1 168 ? 36.359  -17.337 102.018 1.00 45.92 ? 170  GLU B CG  1 
ATOM   3195 C  CD  . GLU B 1 168 ? 37.187  -16.109 101.634 1.00 51.40 ? 170  GLU B CD  1 
ATOM   3196 O  OE1 . GLU B 1 168 ? 38.016  -15.653 102.453 1.00 53.48 ? 170  GLU B OE1 1 
ATOM   3197 O  OE2 . GLU B 1 168 ? 37.020  -15.600 100.502 1.00 56.03 ? 170  GLU B OE2 1 
ATOM   3198 N  N   . GLY B 1 169 ? 35.563  -20.682 102.539 1.00 35.66 ? 171  GLY B N   1 
ATOM   3199 C  CA  . GLY B 1 169 ? 36.205  -21.811 101.865 1.00 34.73 ? 171  GLY B CA  1 
ATOM   3200 C  C   . GLY B 1 169 ? 36.074  -23.165 102.556 1.00 35.53 ? 171  GLY B C   1 
ATOM   3201 O  O   . GLY B 1 169 ? 36.533  -24.171 102.015 1.00 37.98 ? 171  GLY B O   1 
ATOM   3202 N  N   . SER B 1 170 ? 35.456  -23.212 103.732 1.00 32.81 ? 172  SER B N   1 
ATOM   3203 C  CA  . SER B 1 170 ? 35.305  -24.468 104.441 1.00 35.02 ? 172  SER B CA  1 
ATOM   3204 C  C   . SER B 1 170 ? 34.022  -25.144 103.993 1.00 34.18 ? 172  SER B C   1 
ATOM   3205 O  O   . SER B 1 170 ? 33.139  -24.517 103.396 1.00 35.50 ? 172  SER B O   1 
ATOM   3206 C  CB  . SER B 1 170 ? 35.307  -24.260 105.949 1.00 36.94 ? 172  SER B CB  1 
ATOM   3207 O  OG  . SER B 1 170 ? 34.306  -23.352 106.336 1.00 39.30 ? 172  SER B OG  1 
ATOM   3208 N  N   . GLU B 1 171 ? 33.940  -26.433 104.261 1.00 34.28 ? 173  GLU B N   1 
ATOM   3209 C  CA  . GLU B 1 171 ? 32.783  -27.225 103.858 1.00 34.78 ? 173  GLU B CA  1 
ATOM   3210 C  C   . GLU B 1 171 ? 32.566  -28.356 104.845 1.00 35.13 ? 173  GLU B C   1 
ATOM   3211 O  O   . GLU B 1 171 ? 33.476  -28.724 105.585 1.00 33.83 ? 173  GLU B O   1 
ATOM   3212 C  CB  . GLU B 1 171 ? 32.994  -27.783 102.451 1.00 35.16 ? 173  GLU B CB  1 
ATOM   3213 C  CG  . GLU B 1 171 ? 34.057  -28.866 102.383 1.00 36.17 ? 173  GLU B CG  1 
ATOM   3214 C  CD  . GLU B 1 171 ? 34.337  -29.306 100.983 1.00 35.84 ? 173  GLU B CD  1 
ATOM   3215 O  OE1 . GLU B 1 171 ? 34.982  -28.545 100.249 1.00 40.70 ? 173  GLU B OE1 1 
ATOM   3216 O  OE2 . GLU B 1 171 ? 33.921  -30.415 100.611 1.00 40.41 ? 173  GLU B OE2 1 
ATOM   3217 N  N   . THR B 1 172 ? 31.360  -28.900 104.837 1.00 32.83 ? 174  THR B N   1 
ATOM   3218 C  CA  . THR B 1 172 ? 31.016  -30.024 105.682 1.00 32.71 ? 174  THR B CA  1 
ATOM   3219 C  C   . THR B 1 172 ? 30.003  -30.887 104.951 1.00 33.42 ? 174  THR B C   1 
ATOM   3220 O  O   . THR B 1 172 ? 29.403  -30.458 103.975 1.00 32.47 ? 174  THR B O   1 
ATOM   3221 C  CB  . THR B 1 172 ? 30.503  -29.554 107.063 1.00 33.28 ? 174  THR B CB  1 
ATOM   3222 O  OG1 . THR B 1 172 ? 30.424  -30.668 107.956 1.00 32.77 ? 174  THR B OG1 1 
ATOM   3223 C  CG2 . THR B 1 172 ? 29.135  -28.879 106.981 1.00 32.81 ? 174  THR B CG2 1 
ATOM   3224 N  N   . GLN B 1 173 ? 29.863  -32.121 105.399 1.00 34.05 ? 175  GLN B N   1 
ATOM   3225 C  CA  . GLN B 1 173 ? 28.868  -33.036 104.861 1.00 34.52 ? 175  GLN B CA  1 
ATOM   3226 C  C   . GLN B 1 173 ? 27.688  -33.033 105.820 1.00 33.69 ? 175  GLN B C   1 
ATOM   3227 O  O   . GLN B 1 173 ? 27.890  -33.095 107.026 1.00 33.77 ? 175  GLN B O   1 
ATOM   3228 C  CB  . GLN B 1 173 ? 29.454  -34.438 104.726 1.00 36.19 ? 175  GLN B CB  1 
ATOM   3229 C  CG  . GLN B 1 173 ? 30.621  -34.536 103.751 1.00 37.78 ? 175  GLN B CG  1 
ATOM   3230 C  CD  . GLN B 1 173 ? 30.178  -34.398 102.306 1.00 38.63 ? 175  GLN B CD  1 
ATOM   3231 O  OE1 . GLN B 1 173 ? 29.426  -35.228 101.797 1.00 40.20 ? 175  GLN B OE1 1 
ATOM   3232 N  NE2 . GLN B 1 173 ? 30.644  -33.350 101.638 1.00 38.45 ? 175  GLN B NE2 1 
ATOM   3233 N  N   . VAL B 1 174 ? 26.465  -32.924 105.292 1.00 29.92 ? 176  VAL B N   1 
ATOM   3234 C  CA  . VAL B 1 174 ? 25.253  -32.893 106.118 1.00 30.81 ? 176  VAL B CA  1 
ATOM   3235 C  C   . VAL B 1 174 ? 24.327  -34.032 105.698 1.00 29.43 ? 176  VAL B C   1 
ATOM   3236 O  O   . VAL B 1 174 ? 24.374  -34.457 104.551 1.00 27.51 ? 176  VAL B O   1 
ATOM   3237 C  CB  . VAL B 1 174 ? 24.506  -31.534 106.048 1.00 30.79 ? 176  VAL B CB  1 
ATOM   3238 C  CG1 . VAL B 1 174 ? 25.441  -30.406 106.452 1.00 31.98 ? 176  VAL B CG1 1 
ATOM   3239 C  CG2 . VAL B 1 174 ? 23.931  -31.259 104.652 1.00 32.24 ? 176  VAL B CG2 1 
ATOM   3240 N  N   . PRO B 1 175 ? 23.478  -34.516 106.618 1.00 29.73 ? 177  PRO B N   1 
ATOM   3241 C  CA  . PRO B 1 175 ? 22.503  -35.540 106.245 1.00 29.87 ? 177  PRO B CA  1 
ATOM   3242 C  C   . PRO B 1 175 ? 21.593  -35.087 105.096 1.00 30.04 ? 177  PRO B C   1 
ATOM   3243 O  O   . PRO B 1 175 ? 21.354  -33.890 104.924 1.00 29.68 ? 177  PRO B O   1 
ATOM   3244 C  CB  . PRO B 1 175 ? 21.679  -35.728 107.521 1.00 31.66 ? 177  PRO B CB  1 
ATOM   3245 C  CG  . PRO B 1 175 ? 22.551  -35.251 108.627 1.00 32.31 ? 177  PRO B CG  1 
ATOM   3246 C  CD  . PRO B 1 175 ? 23.336  -34.123 108.032 1.00 32.21 ? 177  PRO B CD  1 
ATOM   3247 N  N   . GLY B 1 176 ? 21.101  -36.042 104.312 1.00 28.20 ? 178  GLY B N   1 
ATOM   3248 C  CA  . GLY B 1 176 ? 20.057  -35.756 103.340 1.00 27.97 ? 178  GLY B CA  1 
ATOM   3249 C  C   . GLY B 1 176 ? 18.839  -35.149 104.007 1.00 27.35 ? 178  GLY B C   1 
ATOM   3250 O  O   . GLY B 1 176 ? 18.547  -35.432 105.168 1.00 28.00 ? 178  GLY B O   1 
ATOM   3251 N  N   . LEU B 1 177 ? 18.144  -34.280 103.274 1.00 26.05 ? 179  LEU B N   1 
ATOM   3252 C  CA  . LEU B 1 177 ? 16.961  -33.583 103.792 1.00 25.26 ? 179  LEU B CA  1 
ATOM   3253 C  C   . LEU B 1 177 ? 15.939  -33.394 102.693 1.00 24.63 ? 179  LEU B C   1 
ATOM   3254 O  O   . LEU B 1 177 ? 16.268  -33.484 101.506 1.00 24.05 ? 179  LEU B O   1 
ATOM   3255 C  CB  . LEU B 1 177 ? 17.334  -32.209 104.342 1.00 24.91 ? 179  LEU B CB  1 
ATOM   3256 C  CG  . LEU B 1 177 ? 17.905  -31.205 103.337 1.00 25.53 ? 179  LEU B CG  1 
ATOM   3257 C  CD1 . LEU B 1 177 ? 17.476  -29.799 103.716 1.00 25.46 ? 179  LEU B CD1 1 
ATOM   3258 C  CD2 . LEU B 1 177 ? 19.419  -31.305 103.225 1.00 26.40 ? 179  LEU B CD2 1 
ATOM   3259 N  N   . ASP B 1 178 ? 14.710  -33.095 103.087 1.00 23.48 ? 180  ASP B N   1 
ATOM   3260 C  CA  . ASP B 1 178 ? 13.659  -32.878 102.112 1.00 24.44 ? 180  ASP B CA  1 
ATOM   3261 C  C   . ASP B 1 178 ? 13.839  -31.457 101.542 1.00 22.62 ? 180  ASP B C   1 
ATOM   3262 O  O   . ASP B 1 178 ? 13.484  -30.474 102.171 1.00 23.06 ? 180  ASP B O   1 
ATOM   3263 C  CB  . ASP B 1 178 ? 12.296  -33.046 102.755 1.00 25.30 ? 180  ASP B CB  1 
ATOM   3264 C  CG  . ASP B 1 178 ? 11.160  -32.809 101.788 1.00 26.24 ? 180  ASP B CG  1 
ATOM   3265 O  OD1 . ASP B 1 178 ? 11.392  -32.404 100.617 1.00 28.02 ? 180  ASP B OD1 1 
ATOM   3266 O  OD2 . ASP B 1 178 ? 10.018  -33.018 102.226 1.00 26.71 ? 180  ASP B OD2 1 
ATOM   3267 N  N   . ILE B 1 179 ? 14.381  -31.374 100.343 1.00 22.95 ? 181  ILE B N   1 
ATOM   3268 C  CA  . ILE B 1 179 ? 14.674  -30.069 99.724  1.00 22.66 ? 181  ILE B CA  1 
ATOM   3269 C  C   . ILE B 1 179 ? 13.374  -29.280 99.480  1.00 22.89 ? 181  ILE B C   1 
ATOM   3270 O  O   . ILE B 1 179 ? 13.353  -28.066 99.623  1.00 22.99 ? 181  ILE B O   1 
ATOM   3271 C  CB  . ILE B 1 179 ? 15.473  -30.240 98.418  1.00 22.70 ? 181  ILE B CB  1 
ATOM   3272 C  CG1 . ILE B 1 179 ? 16.783  -31.019 98.665  1.00 22.83 ? 181  ILE B CG1 1 
ATOM   3273 C  CG2 . ILE B 1 179 ? 15.784  -28.874 97.769  1.00 23.06 ? 181  ILE B CG2 1 
ATOM   3274 C  CD1 . ILE B 1 179 ? 17.740  -30.381 99.655  1.00 23.32 ? 181  ILE B CD1 1 
ATOM   3275 N  N   . SER B 1 180 ? 12.306  -29.976 99.117  1.00 22.32 ? 182  SER B N   1 
ATOM   3276 C  CA  . SER B 1 180 ? 11.004  -29.339 98.850  1.00 23.22 ? 182  SER B CA  1 
ATOM   3277 C  C   . SER B 1 180 ? 10.359  -28.679 100.073 1.00 24.29 ? 182  SER B C   1 
ATOM   3278 O  O   . SER B 1 180 ? 9.555   -27.754 99.899  1.00 22.24 ? 182  SER B O   1 
ATOM   3279 C  CB  . SER B 1 180 ? 10.008  -30.292 98.187  1.00 22.83 ? 182  SER B CB  1 
ATOM   3280 O  OG  . SER B 1 180 ? 9.561   -31.325 99.052  1.00 24.43 ? 182  SER B OG  1 
ATOM   3281 N  N   . ALA B 1 181 ? 10.716  -29.125 101.285 1.00 22.78 ? 183  ALA B N   1 
ATOM   3282 C  CA  . ALA B 1 181 ? 10.219  -28.495 102.516 1.00 22.81 ? 183  ALA B CA  1 
ATOM   3283 C  C   . ALA B 1 181 ? 10.820  -27.111 102.754 1.00 22.32 ? 183  ALA B C   1 
ATOM   3284 O  O   . ALA B 1 181 ? 10.304  -26.349 103.578 1.00 23.13 ? 183  ALA B O   1 
ATOM   3285 C  CB  . ALA B 1 181 ? 10.448  -29.404 103.735 1.00 23.05 ? 183  ALA B CB  1 
ATOM   3286 N  N   . LEU B 1 182 ? 11.897  -26.764 102.043 1.00 22.38 ? 184  LEU B N   1 
ATOM   3287 C  CA  . LEU B 1 182 ? 12.445  -25.406 102.090 1.00 22.79 ? 184  LEU B CA  1 
ATOM   3288 C  C   . LEU B 1 182 ? 11.600  -24.363 101.334 1.00 22.34 ? 184  LEU B C   1 
ATOM   3289 O  O   . LEU B 1 182 ? 11.872  -23.153 101.445 1.00 23.59 ? 184  LEU B O   1 
ATOM   3290 C  CB  . LEU B 1 182 ? 13.878  -25.378 101.541 1.00 22.77 ? 184  LEU B CB  1 
ATOM   3291 C  CG  . LEU B 1 182 ? 14.895  -26.294 102.218 1.00 22.20 ? 184  LEU B CG  1 
ATOM   3292 C  CD1 . LEU B 1 182 ? 16.139  -26.513 101.364 1.00 21.82 ? 184  LEU B CD1 1 
ATOM   3293 C  CD2 . LEU B 1 182 ? 15.272  -25.743 103.594 1.00 22.38 ? 184  LEU B CD2 1 
ATOM   3294 N  N   . LEU B 1 183 ? 10.588  -24.819 100.599 1.00 22.66 ? 185  LEU B N   1 
ATOM   3295 C  CA  . LEU B 1 183 ? 9.848   -23.979 99.674  1.00 22.73 ? 185  LEU B CA  1 
ATOM   3296 C  C   . LEU B 1 183 ? 8.437   -23.700 100.172 1.00 23.91 ? 185  LEU B C   1 
ATOM   3297 O  O   . LEU B 1 183 ? 7.905   -24.458 101.018 1.00 21.32 ? 185  LEU B O   1 
ATOM   3298 C  CB  . LEU B 1 183 ? 9.796   -24.652 98.301  1.00 23.73 ? 185  LEU B CB  1 
ATOM   3299 C  CG  . LEU B 1 183 ? 11.190  -24.846 97.693  1.00 24.68 ? 185  LEU B CG  1 
ATOM   3300 C  CD1 . LEU B 1 183 ? 11.075  -25.609 96.386  1.00 25.96 ? 185  LEU B CD1 1 
ATOM   3301 C  CD2 . LEU B 1 183 ? 11.895  -23.513 97.467  1.00 25.37 ? 185  LEU B CD2 1 
ATOM   3302 N  N   . PRO B 1 184 ? 7.794   -22.637 99.618  1.00 22.25 ? 186  PRO B N   1 
ATOM   3303 C  CA  . PRO B 1 184 ? 6.453   -22.242 100.071 1.00 21.34 ? 186  PRO B CA  1 
ATOM   3304 C  C   . PRO B 1 184 ? 5.351   -23.221 99.751  1.00 21.17 ? 186  PRO B C   1 
ATOM   3305 O  O   . PRO B 1 184 ? 5.551   -24.229 99.060  1.00 20.86 ? 186  PRO B O   1 
ATOM   3306 C  CB  . PRO B 1 184 ? 6.211   -20.903 99.323  1.00 20.96 ? 186  PRO B CB  1 
ATOM   3307 C  CG  . PRO B 1 184 ? 7.564   -20.423 98.970  1.00 20.88 ? 186  PRO B CG  1 
ATOM   3308 C  CD  . PRO B 1 184 ? 8.292   -21.688 98.606  1.00 21.74 ? 186  PRO B CD  1 
ATOM   3309 N  N   . SER B 1 185 ? 4.162   -22.922 100.256 1.00 22.65 ? 187  SER B N   1 
ATOM   3310 C  CA  . SER B 1 185 ? 3.050   -23.862 100.212 1.00 23.20 ? 187  SER B CA  1 
ATOM   3311 C  C   . SER B 1 185 ? 2.451   -24.142 98.815  1.00 23.69 ? 187  SER B C   1 
ATOM   3312 O  O   . SER B 1 185 ? 2.218   -25.299 98.459  1.00 23.68 ? 187  SER B O   1 
ATOM   3313 C  CB  . SER B 1 185 ? 1.956   -23.411 101.196 1.00 24.38 ? 187  SER B CB  1 
ATOM   3314 O  OG  . SER B 1 185 ? 0.776   -24.173 101.017 1.00 28.14 ? 187  SER B OG  1 
ATOM   3315 N  N   . ASP B 1 186 ? 2.188   -23.089 98.033  1.00 23.23 ? 188  ASP B N   1 
ATOM   3316 C  CA  . ASP B 1 186 ? 1.374   -23.200 96.831  1.00 24.45 ? 188  ASP B CA  1 
ATOM   3317 C  C   . ASP B 1 186 ? 2.261   -23.132 95.594  1.00 22.57 ? 188  ASP B C   1 
ATOM   3318 O  O   . ASP B 1 186 ? 2.719   -22.061 95.220  1.00 25.35 ? 188  ASP B O   1 
ATOM   3319 C  CB  . ASP B 1 186 ? 0.333   -22.067 96.781  1.00 24.76 ? 188  ASP B CB  1 
ATOM   3320 C  CG  . ASP B 1 186 ? -0.767  -22.332 95.773  1.00 24.97 ? 188  ASP B CG  1 
ATOM   3321 O  OD1 . ASP B 1 186 ? -0.560  -23.084 94.787  1.00 24.18 ? 188  ASP B OD1 1 
ATOM   3322 O  OD2 . ASP B 1 186 ? -1.883  -21.805 95.980  1.00 26.89 ? 188  ASP B OD2 1 
ATOM   3323 N  N   . PHE B 1 187 ? 2.479   -24.274 94.957  1.00 21.99 ? 189  PHE B N   1 
ATOM   3324 C  CA  . PHE B 1 187 ? 3.309   -24.327 93.743  1.00 22.29 ? 189  PHE B CA  1 
ATOM   3325 C  C   . PHE B 1 187 ? 2.601   -23.755 92.480  1.00 23.93 ? 189  PHE B C   1 
ATOM   3326 O  O   . PHE B 1 187 ? 3.234   -23.697 91.426  1.00 23.40 ? 189  PHE B O   1 
ATOM   3327 C  CB  . PHE B 1 187 ? 3.768   -25.762 93.478  1.00 22.09 ? 189  PHE B CB  1 
ATOM   3328 C  CG  . PHE B 1 187 ? 4.905   -26.231 94.386  1.00 21.14 ? 189  PHE B CG  1 
ATOM   3329 C  CD1 . PHE B 1 187 ? 5.301   -25.521 95.521  1.00 21.70 ? 189  PHE B CD1 1 
ATOM   3330 C  CD2 . PHE B 1 187 ? 5.551   -27.426 94.103  1.00 22.16 ? 189  PHE B CD2 1 
ATOM   3331 C  CE1 . PHE B 1 187 ? 6.354   -25.950 96.325  1.00 22.29 ? 189  PHE B CE1 1 
ATOM   3332 C  CE2 . PHE B 1 187 ? 6.583   -27.880 94.911  1.00 22.07 ? 189  PHE B CE2 1 
ATOM   3333 C  CZ  . PHE B 1 187 ? 6.979   -27.149 96.024  1.00 22.30 ? 189  PHE B CZ  1 
ATOM   3334 N  N   . SER B 1 188 ? 1.325   -23.353 92.604  1.00 24.29 ? 190  SER B N   1 
ATOM   3335 C  CA  . SER B 1 188 ? 0.548   -22.736 91.502  1.00 24.12 ? 190  SER B CA  1 
ATOM   3336 C  C   . SER B 1 188 ? 0.598   -21.214 91.502  1.00 24.96 ? 190  SER B C   1 
ATOM   3337 O  O   . SER B 1 188 ? 0.034   -20.597 90.604  1.00 28.90 ? 190  SER B O   1 
ATOM   3338 C  CB  . SER B 1 188 ? -0.916  -23.166 91.551  1.00 24.44 ? 190  SER B CB  1 
ATOM   3339 O  OG  . SER B 1 188 ? -1.640  -22.446 92.554  1.00 22.82 ? 190  SER B OG  1 
ATOM   3340 N  N   . ARG B 1 189 ? 1.237   -20.611 92.500  1.00 25.20 ? 191  ARG B N   1 
ATOM   3341 C  CA  . ARG B 1 189 ? 1.280   -19.174 92.662  1.00 24.77 ? 191  ARG B CA  1 
ATOM   3342 C  C   . ARG B 1 189 ? 2.684   -18.637 92.620  1.00 23.13 ? 191  ARG B C   1 
ATOM   3343 O  O   . ARG B 1 189 ? 3.410   -18.677 93.597  1.00 23.53 ? 191  ARG B O   1 
ATOM   3344 C  CB  . ARG B 1 189 ? 0.585   -18.744 93.967  1.00 25.46 ? 191  ARG B CB  1 
ATOM   3345 C  CG  . ARG B 1 189 ? -0.909  -18.977 93.928  1.00 27.82 ? 191  ARG B CG  1 
ATOM   3346 C  CD  . ARG B 1 189 ? -1.551  -18.574 95.242  1.00 29.10 ? 191  ARG B CD  1 
ATOM   3347 N  NE  . ARG B 1 189 ? -1.605  -17.125 95.377  1.00 31.97 ? 191  ARG B NE  1 
ATOM   3348 C  CZ  . ARG B 1 189 ? -2.562  -16.342 94.868  1.00 30.79 ? 191  ARG B CZ  1 
ATOM   3349 N  NH1 . ARG B 1 189 ? -3.563  -16.844 94.143  1.00 31.96 ? 191  ARG B NH1 1 
ATOM   3350 N  NH2 . ARG B 1 189 ? -2.495  -15.031 95.056  1.00 29.88 ? 191  ARG B NH2 1 
ATOM   3351 N  N   . TYR B 1 190 ? 3.051   -18.073 91.463  1.00 22.26 ? 192  TYR B N   1 
ATOM   3352 C  CA  . TYR B 1 190 ? 4.361   -17.536 91.268  1.00 21.06 ? 192  TYR B CA  1 
ATOM   3353 C  C   . TYR B 1 190 ? 4.400   -16.415 90.203  1.00 19.49 ? 192  TYR B C   1 
ATOM   3354 O  O   . TYR B 1 190 ? 3.482   -16.265 89.413  1.00 20.68 ? 192  TYR B O   1 
ATOM   3355 C  CB  . TYR B 1 190 ? 5.342   -18.661 90.857  1.00 21.09 ? 192  TYR B CB  1 
ATOM   3356 C  CG  . TYR B 1 190 ? 4.951   -19.469 89.645  1.00 20.94 ? 192  TYR B CG  1 
ATOM   3357 C  CD1 . TYR B 1 190 ? 5.328   -19.069 88.350  1.00 21.08 ? 192  TYR B CD1 1 
ATOM   3358 C  CD2 . TYR B 1 190 ? 4.234   -20.646 89.764  1.00 21.73 ? 192  TYR B CD2 1 
ATOM   3359 C  CE1 . TYR B 1 190 ? 4.976   -19.815 87.225  1.00 20.49 ? 192  TYR B CE1 1 
ATOM   3360 C  CE2 . TYR B 1 190 ? 3.881   -21.391 88.650  1.00 22.46 ? 192  TYR B CE2 1 
ATOM   3361 C  CZ  . TYR B 1 190 ? 4.276   -20.977 87.368  1.00 21.01 ? 192  TYR B CZ  1 
ATOM   3362 O  OH  . TYR B 1 190 ? 3.934   -21.729 86.265  1.00 21.08 ? 192  TYR B OH  1 
ATOM   3363 N  N   . PHE B 1 191 ? 5.500   -15.687 90.226  1.00 19.34 ? 193  PHE B N   1 
ATOM   3364 C  CA  . PHE B 1 191 ? 5.860   -14.727 89.209  1.00 20.53 ? 193  PHE B CA  1 
ATOM   3365 C  C   . PHE B 1 191 ? 6.966   -15.362 88.358  1.00 21.27 ? 193  PHE B C   1 
ATOM   3366 O  O   . PHE B 1 191 ? 7.684   -16.236 88.833  1.00 20.85 ? 193  PHE B O   1 
ATOM   3367 C  CB  . PHE B 1 191 ? 6.399   -13.491 89.865  1.00 19.90 ? 193  PHE B CB  1 
ATOM   3368 C  CG  . PHE B 1 191 ? 5.402   -12.801 90.738  1.00 22.30 ? 193  PHE B CG  1 
ATOM   3369 C  CD1 . PHE B 1 191 ? 4.321   -12.162 90.164  1.00 22.14 ? 193  PHE B CD1 1 
ATOM   3370 C  CD2 . PHE B 1 191 ? 5.540   -12.803 92.135  1.00 23.40 ? 193  PHE B CD2 1 
ATOM   3371 C  CE1 . PHE B 1 191 ? 3.362   -11.526 90.963  1.00 23.60 ? 193  PHE B CE1 1 
ATOM   3372 C  CE2 . PHE B 1 191 ? 4.586   -12.160 92.939  1.00 23.87 ? 193  PHE B CE2 1 
ATOM   3373 C  CZ  . PHE B 1 191 ? 3.509   -11.523 92.340  1.00 23.67 ? 193  PHE B CZ  1 
ATOM   3374 N  N   . GLN B 1 192 ? 7.100   -14.921 87.114  1.00 20.55 ? 194  GLN B N   1 
ATOM   3375 C  CA  . GLN B 1 192 ? 8.125   -15.468 86.250  1.00 20.07 ? 194  GLN B CA  1 
ATOM   3376 C  C   . GLN B 1 192 ? 8.577   -14.430 85.217  1.00 22.20 ? 194  GLN B C   1 
ATOM   3377 O  O   . GLN B 1 192 ? 7.731   -13.719 84.623  1.00 22.95 ? 194  GLN B O   1 
ATOM   3378 C  CB  . GLN B 1 192 ? 7.592   -16.707 85.568  1.00 19.40 ? 194  GLN B CB  1 
ATOM   3379 C  CG  . GLN B 1 192 ? 8.652   -17.535 84.838  1.00 18.83 ? 194  GLN B CG  1 
ATOM   3380 C  CD  . GLN B 1 192 ? 8.087   -18.807 84.334  1.00 19.26 ? 194  GLN B CD  1 
ATOM   3381 O  OE1 . GLN B 1 192 ? 7.510   -18.858 83.253  1.00 19.72 ? 194  GLN B OE1 1 
ATOM   3382 N  NE2 . GLN B 1 192 ? 8.189   -19.870 85.149  1.00 21.28 ? 194  GLN B NE2 1 
ATOM   3383 N  N   . TYR B 1 193 ? 9.895   -14.350 85.018  1.00 21.36 ? 195  TYR B N   1 
ATOM   3384 C  CA  . TYR B 1 193 ? 10.479  -13.520 83.949  1.00 20.07 ? 195  TYR B CA  1 
ATOM   3385 C  C   . TYR B 1 193 ? 11.842  -14.106 83.574  1.00 20.86 ? 195  TYR B C   1 
ATOM   3386 O  O   . TYR B 1 193 ? 12.364  -15.010 84.257  1.00 20.18 ? 195  TYR B O   1 
ATOM   3387 C  CB  . TYR B 1 193 ? 10.619  -12.054 84.389  1.00 18.66 ? 195  TYR B CB  1 
ATOM   3388 C  CG  . TYR B 1 193 ? 11.710  -11.816 85.391  1.00 17.51 ? 195  TYR B CG  1 
ATOM   3389 C  CD1 . TYR B 1 193 ? 11.576  -12.221 86.728  1.00 18.26 ? 195  TYR B CD1 1 
ATOM   3390 C  CD2 . TYR B 1 193 ? 12.901  -11.271 85.017  1.00 17.49 ? 195  TYR B CD2 1 
ATOM   3391 C  CE1 . TYR B 1 193 ? 12.600  -12.039 87.640  1.00 17.62 ? 195  TYR B CE1 1 
ATOM   3392 C  CE2 . TYR B 1 193 ? 13.934  -11.088 85.921  1.00 18.08 ? 195  TYR B CE2 1 
ATOM   3393 C  CZ  . TYR B 1 193 ? 13.780  -11.494 87.236  1.00 17.57 ? 195  TYR B CZ  1 
ATOM   3394 O  OH  . TYR B 1 193 ? 14.821  -11.307 88.091  1.00 18.42 ? 195  TYR B OH  1 
ATOM   3395 N  N   . GLU B 1 194 ? 12.412  -13.579 82.504  1.00 20.77 ? 196  GLU B N   1 
ATOM   3396 C  CA  . GLU B 1 194 ? 13.762  -13.965 82.102  1.00 21.76 ? 196  GLU B CA  1 
ATOM   3397 C  C   . GLU B 1 194 ? 14.774  -12.862 82.410  1.00 20.83 ? 196  GLU B C   1 
ATOM   3398 O  O   . GLU B 1 194 ? 14.594  -11.688 82.068  1.00 19.76 ? 196  GLU B O   1 
ATOM   3399 C  CB  . GLU B 1 194 ? 13.769  -14.336 80.626  1.00 25.40 ? 196  GLU B CB  1 
ATOM   3400 C  CG  . GLU B 1 194 ? 15.089  -14.913 80.141  1.00 27.31 ? 196  GLU B CG  1 
ATOM   3401 C  CD  . GLU B 1 194 ? 14.967  -15.525 78.745  1.00 33.02 ? 196  GLU B CD  1 
ATOM   3402 O  OE1 . GLU B 1 194 ? 14.005  -16.283 78.469  1.00 36.99 ? 196  GLU B OE1 1 
ATOM   3403 O  OE2 . GLU B 1 194 ? 15.837  -15.231 77.915  1.00 34.63 ? 196  GLU B OE2 1 
ATOM   3404 N  N   . GLY B 1 195 ? 15.874  -13.241 83.055  1.00 19.57 ? 197  GLY B N   1 
ATOM   3405 C  CA  . GLY B 1 195 ? 16.920  -12.331 83.374  1.00 18.54 ? 197  GLY B CA  1 
ATOM   3406 C  C   . GLY B 1 195 ? 18.279  -13.017 83.400  1.00 19.49 ? 197  GLY B C   1 
ATOM   3407 O  O   . GLY B 1 195 ? 18.631  -13.755 82.473  1.00 18.53 ? 197  GLY B O   1 
ATOM   3408 N  N   . SER B 1 196 ? 19.027  -12.755 84.464  1.00 18.50 ? 198  SER B N   1 
ATOM   3409 C  CA  . SER B 1 196 ? 20.408  -13.139 84.563  1.00 19.20 ? 198  SER B CA  1 
ATOM   3410 C  C   . SER B 1 196 ? 20.768  -13.803 85.881  1.00 19.13 ? 198  SER B C   1 
ATOM   3411 O  O   . SER B 1 196 ? 19.992  -13.809 86.840  1.00 19.55 ? 198  SER B O   1 
ATOM   3412 C  CB  . SER B 1 196 ? 21.301  -11.908 84.365  1.00 19.40 ? 198  SER B CB  1 
ATOM   3413 O  OG  . SER B 1 196 ? 21.359  -11.089 85.531  1.00 20.78 ? 198  SER B OG  1 
ATOM   3414 N  N   . LEU B 1 197 ? 21.985  -14.328 85.928  1.00 19.29 ? 199  LEU B N   1 
ATOM   3415 C  CA  . LEU B 1 197 ? 22.603  -14.648 87.197  1.00 20.02 ? 199  LEU B CA  1 
ATOM   3416 C  C   . LEU B 1 197 ? 22.789  -13.322 87.942  1.00 19.80 ? 199  LEU B C   1 
ATOM   3417 O  O   . LEU B 1 197 ? 23.098  -12.302 87.321  1.00 19.44 ? 199  LEU B O   1 
ATOM   3418 C  CB  . LEU B 1 197 ? 23.964  -15.335 87.001  1.00 20.84 ? 199  LEU B CB  1 
ATOM   3419 C  CG  . LEU B 1 197 ? 23.994  -16.640 86.200  1.00 21.33 ? 199  LEU B CG  1 
ATOM   3420 C  CD1 . LEU B 1 197 ? 25.440  -17.101 86.054  1.00 22.03 ? 199  LEU B CD1 1 
ATOM   3421 C  CD2 . LEU B 1 197 ? 23.171  -17.707 86.889  1.00 22.75 ? 199  LEU B CD2 1 
ATOM   3422 N  N   . THR B 1 198 ? 22.589  -13.336 89.257  1.00 20.16 ? 200  THR B N   1 
ATOM   3423 C  CA  . THR B 1 198 ? 22.732  -12.116 90.086  1.00 21.94 ? 200  THR B CA  1 
ATOM   3424 C  C   . THR B 1 198 ? 24.150  -11.898 90.591  1.00 23.50 ? 200  THR B C   1 
ATOM   3425 O  O   . THR B 1 198 ? 24.405  -10.972 91.375  1.00 22.21 ? 200  THR B O   1 
ATOM   3426 C  CB  . THR B 1 198 ? 21.776  -12.125 91.304  1.00 21.96 ? 200  THR B CB  1 
ATOM   3427 O  OG1 . THR B 1 198 ? 22.110  -13.214 92.194  1.00 20.33 ? 200  THR B OG1 1 
ATOM   3428 C  CG2 . THR B 1 198 ? 20.350  -12.225 90.859  1.00 21.77 ? 200  THR B CG2 1 
ATOM   3429 N  N   . THR B 1 199 ? 25.085  -12.761 90.183  1.00 24.44 ? 201  THR B N   1 
ATOM   3430 C  CA  . THR B 1 199 ? 26.498  -12.507 90.380  1.00 23.96 ? 201  THR B CA  1 
ATOM   3431 C  C   . THR B 1 199 ? 27.225  -12.672 89.056  1.00 25.09 ? 201  THR B C   1 
ATOM   3432 O  O   . THR B 1 199 ? 26.655  -13.209 88.106  1.00 25.07 ? 201  THR B O   1 
ATOM   3433 C  CB  . THR B 1 199 ? 27.145  -13.460 91.403  1.00 26.02 ? 201  THR B CB  1 
ATOM   3434 O  OG1 . THR B 1 199 ? 27.331  -14.755 90.825  1.00 24.29 ? 201  THR B OG1 1 
ATOM   3435 C  CG2 . THR B 1 199 ? 26.316  -13.553 92.690  1.00 25.92 ? 201  THR B CG2 1 
ATOM   3436 N  N   . PRO B 1 200 ? 28.484  -12.203 88.976  1.00 24.26 ? 202  PRO B N   1 
ATOM   3437 C  CA  . PRO B 1 200 ? 29.271  -12.542 87.807  1.00 24.40 ? 202  PRO B CA  1 
ATOM   3438 C  C   . PRO B 1 200 ? 29.250  -14.053 87.607  1.00 24.13 ? 202  PRO B C   1 
ATOM   3439 O  O   . PRO B 1 200 ? 29.246  -14.778 88.590  1.00 25.39 ? 202  PRO B O   1 
ATOM   3440 C  CB  . PRO B 1 200 ? 30.675  -12.039 88.165  1.00 25.13 ? 202  PRO B CB  1 
ATOM   3441 C  CG  . PRO B 1 200 ? 30.419  -10.907 89.078  1.00 25.86 ? 202  PRO B CG  1 
ATOM   3442 C  CD  . PRO B 1 200 ? 29.246  -11.354 89.906  1.00 25.68 ? 202  PRO B CD  1 
ATOM   3443 N  N   . PRO B 1 201 ? 29.204  -14.545 86.373  1.00 24.37 ? 203  PRO B N   1 
ATOM   3444 C  CA  . PRO B 1 201 ? 29.367  -13.750 85.155  1.00 24.69 ? 203  PRO B CA  1 
ATOM   3445 C  C   . PRO B 1 201 ? 28.116  -13.039 84.614  1.00 23.59 ? 203  PRO B C   1 
ATOM   3446 O  O   . PRO B 1 201 ? 28.154  -12.523 83.493  1.00 25.53 ? 203  PRO B O   1 
ATOM   3447 C  CB  . PRO B 1 201 ? 29.889  -14.792 84.161  1.00 24.84 ? 203  PRO B CB  1 
ATOM   3448 C  CG  . PRO B 1 201 ? 29.193  -16.050 84.578  1.00 25.04 ? 203  PRO B CG  1 
ATOM   3449 C  CD  . PRO B 1 201 ? 29.033  -15.980 86.071  1.00 24.50 ? 203  PRO B CD  1 
ATOM   3450 N  N   . CYS B 1 202 ? 27.040  -12.968 85.397  1.00 22.75 ? 204  CYS B N   1 
ATOM   3451 C  CA  . CYS B 1 202 ? 25.821  -12.224 85.017  1.00 22.19 ? 204  CYS B CA  1 
ATOM   3452 C  C   . CYS B 1 202 ? 25.250  -12.648 83.672  1.00 21.81 ? 204  CYS B C   1 
ATOM   3453 O  O   . CYS B 1 202 ? 24.705  -11.822 82.927  1.00 19.72 ? 204  CYS B O   1 
ATOM   3454 C  CB  . CYS B 1 202 ? 26.070  -10.709 85.003  1.00 23.23 ? 204  CYS B CB  1 
ATOM   3455 S  SG  . CYS B 1 202 ? 26.661  -10.016 86.559  1.00 25.13 ? 204  CYS B SG  1 
ATOM   3456 N  N   . ALA B 1 203 ? 25.357  -13.946 83.369  1.00 21.35 ? 205  ALA B N   1 
ATOM   3457 C  CA  . ALA B 1 203 ? 24.867  -14.464 82.101  1.00 20.28 ? 205  ALA B CA  1 
ATOM   3458 C  C   . ALA B 1 203 ? 23.344  -14.327 82.022  1.00 19.68 ? 205  ALA B C   1 
ATOM   3459 O  O   . ALA B 1 203 ? 22.633  -14.624 82.976  1.00 17.67 ? 205  ALA B O   1 
ATOM   3460 C  CB  . ALA B 1 203 ? 25.269  -15.917 81.937  1.00 20.46 ? 205  ALA B CB  1 
ATOM   3461 N  N   . GLN B 1 204 ? 22.873  -13.913 80.857  1.00 19.63 ? 206  GLN B N   1 
ATOM   3462 C  CA  . GLN B 1 204 ? 21.455  -13.723 80.597  1.00 20.44 ? 206  GLN B CA  1 
ATOM   3463 C  C   . GLN B 1 204 ? 20.813  -15.015 80.083  1.00 20.24 ? 206  GLN B C   1 
ATOM   3464 O  O   . GLN B 1 204 ? 21.493  -16.042 79.928  1.00 20.39 ? 206  GLN B O   1 
ATOM   3465 C  CB  . GLN B 1 204 ? 21.259  -12.515 79.651  1.00 21.61 ? 206  GLN B CB  1 
ATOM   3466 C  CG  . GLN B 1 204 ? 21.508  -11.201 80.388  1.00 21.31 ? 206  GLN B CG  1 
ATOM   3467 C  CD  . GLN B 1 204 ? 21.387  -9.911  79.573  1.00 22.25 ? 206  GLN B CD  1 
ATOM   3468 O  OE1 . GLN B 1 204 ? 21.587  -8.831  80.120  1.00 22.90 ? 206  GLN B OE1 1 
ATOM   3469 N  NE2 . GLN B 1 204 ? 21.080  -10.013 78.291  1.00 20.82 ? 206  GLN B NE2 1 
ATOM   3470 N  N   . GLY B 1 205 ? 19.504  -14.977 79.871  1.00 18.43 ? 207  GLY B N   1 
ATOM   3471 C  CA  . GLY B 1 205 ? 18.723  -16.142 79.496  1.00 18.70 ? 207  GLY B CA  1 
ATOM   3472 C  C   . GLY B 1 205 ? 18.257  -17.054 80.644  1.00 19.69 ? 207  GLY B C   1 
ATOM   3473 O  O   . GLY B 1 205 ? 17.755  -18.172 80.390  1.00 21.54 ? 207  GLY B O   1 
ATOM   3474 N  N   . VAL B 1 206 ? 18.387  -16.593 81.892  1.00 18.71 ? 208  VAL B N   1 
ATOM   3475 C  CA  . VAL B 1 206 ? 18.009  -17.375 83.078  1.00 18.48 ? 208  VAL B CA  1 
ATOM   3476 C  C   . VAL B 1 206 ? 16.512  -17.162 83.332  1.00 19.93 ? 208  VAL B C   1 
ATOM   3477 O  O   . VAL B 1 206 ? 16.069  -16.020 83.437  1.00 19.91 ? 208  VAL B O   1 
ATOM   3478 C  CB  . VAL B 1 206 ? 18.783  -16.926 84.339  1.00 19.60 ? 208  VAL B CB  1 
ATOM   3479 C  CG1 . VAL B 1 206 ? 18.386  -17.774 85.557  1.00 21.02 ? 208  VAL B CG1 1 
ATOM   3480 C  CG2 . VAL B 1 206 ? 20.289  -16.964 84.115  1.00 20.48 ? 208  VAL B CG2 1 
ATOM   3481 N  N   . ILE B 1 207 ? 15.743  -18.239 83.421  1.00 19.62 ? 209  ILE B N   1 
ATOM   3482 C  CA  . ILE B 1 207 ? 14.341  -18.137 83.789  1.00 20.17 ? 209  ILE B CA  1 
ATOM   3483 C  C   . ILE B 1 207 ? 14.220  -18.112 85.316  1.00 21.18 ? 209  ILE B C   1 
ATOM   3484 O  O   . ILE B 1 207 ? 14.547  -19.104 85.989  1.00 19.08 ? 209  ILE B O   1 
ATOM   3485 C  CB  . ILE B 1 207 ? 13.490  -19.257 83.198  1.00 20.80 ? 209  ILE B CB  1 
ATOM   3486 C  CG1 . ILE B 1 207 ? 13.534  -19.187 81.675  1.00 21.90 ? 209  ILE B CG1 1 
ATOM   3487 C  CG2 . ILE B 1 207 ? 12.021  -19.105 83.631  1.00 20.77 ? 209  ILE B CG2 1 
ATOM   3488 C  CD1 . ILE B 1 207 ? 12.869  -20.358 80.991  1.00 21.20 ? 209  ILE B CD1 1 
ATOM   3489 N  N   . TRP B 1 208 ? 13.703  -16.988 85.826  1.00 20.17 ? 210  TRP B N   1 
ATOM   3490 C  CA  . TRP B 1 208 ? 13.471  -16.740 87.234  1.00 20.64 ? 210  TRP B CA  1 
ATOM   3491 C  C   . TRP B 1 208 ? 12.004  -16.975 87.575  1.00 21.58 ? 210  TRP B C   1 
ATOM   3492 O  O   . TRP B 1 208 ? 11.102  -16.466 86.884  1.00 18.57 ? 210  TRP B O   1 
ATOM   3493 C  CB  . TRP B 1 208 ? 13.851  -15.311 87.590  1.00 21.05 ? 210  TRP B CB  1 
ATOM   3494 C  CG  . TRP B 1 208 ? 15.287  -15.153 87.725  1.00 21.58 ? 210  TRP B CG  1 
ATOM   3495 C  CD1 . TRP B 1 208 ? 16.167  -14.735 86.753  1.00 19.70 ? 210  TRP B CD1 1 
ATOM   3496 C  CD2 . TRP B 1 208 ? 16.069  -15.441 88.881  1.00 20.60 ? 210  TRP B CD2 1 
ATOM   3497 N  NE1 . TRP B 1 208 ? 17.431  -14.733 87.247  1.00 20.25 ? 210  TRP B NE1 1 
ATOM   3498 C  CE2 . TRP B 1 208 ? 17.410  -15.175 88.547  1.00 19.56 ? 210  TRP B CE2 1 
ATOM   3499 C  CE3 . TRP B 1 208 ? 15.767  -15.908 90.179  1.00 21.51 ? 210  TRP B CE3 1 
ATOM   3500 C  CZ2 . TRP B 1 208 ? 18.456  -15.342 89.459  1.00 19.32 ? 210  TRP B CZ2 1 
ATOM   3501 C  CZ3 . TRP B 1 208 ? 16.810  -16.057 91.094  1.00 20.51 ? 210  TRP B CZ3 1 
ATOM   3502 C  CH2 . TRP B 1 208 ? 18.135  -15.784 90.726  1.00 20.98 ? 210  TRP B CH2 1 
ATOM   3503 N  N   . THR B 1 209 ? 11.773  -17.833 88.573  1.00 20.52 ? 211  THR B N   1 
ATOM   3504 C  CA  . THR B 1 209 ? 10.427  -18.134 89.067  1.00 21.41 ? 211  THR B CA  1 
ATOM   3505 C  C   . THR B 1 209 ? 10.453  -17.788 90.532  1.00 21.82 ? 211  THR B C   1 
ATOM   3506 O  O   . THR B 1 209 ? 11.248  -18.369 91.290  1.00 21.15 ? 211  THR B O   1 
ATOM   3507 C  CB  . THR B 1 209 ? 10.039  -19.603 88.856  1.00 21.42 ? 211  THR B CB  1 
ATOM   3508 O  OG1 . THR B 1 209 ? 10.092  -19.929 87.466  1.00 21.27 ? 211  THR B OG1 1 
ATOM   3509 C  CG2 . THR B 1 209 ? 8.618   -19.879 89.356  1.00 22.55 ? 211  THR B CG2 1 
ATOM   3510 N  N   . VAL B 1 210 ? 9.611   -16.834 90.946  1.00 21.00 ? 212  VAL B N   1 
ATOM   3511 C  CA  . VAL B 1 210 ? 9.665   -16.284 92.304  1.00 21.45 ? 212  VAL B CA  1 
ATOM   3512 C  C   . VAL B 1 210 ? 8.319   -16.611 92.917  1.00 22.63 ? 212  VAL B C   1 
ATOM   3513 O  O   . VAL B 1 210 ? 7.292   -16.193 92.381  1.00 20.85 ? 212  VAL B O   1 
ATOM   3514 C  CB  . VAL B 1 210 ? 9.914   -14.746 92.317  1.00 21.41 ? 212  VAL B CB  1 
ATOM   3515 C  CG1 . VAL B 1 210 ? 10.004  -14.223 93.758  1.00 20.58 ? 212  VAL B CG1 1 
ATOM   3516 C  CG2 . VAL B 1 210 ? 11.192  -14.393 91.570  1.00 21.42 ? 212  VAL B CG2 1 
ATOM   3517 N  N   . PHE B 1 211 ? 8.297   -17.419 93.989  1.00 21.47 ? 213  PHE B N   1 
ATOM   3518 C  CA  . PHE B 1 211 ? 7.025   -17.828 94.570  1.00 20.67 ? 213  PHE B CA  1 
ATOM   3519 C  C   . PHE B 1 211 ? 6.305   -16.572 95.103  1.00 18.67 ? 213  PHE B C   1 
ATOM   3520 O  O   . PHE B 1 211 ? 6.964   -15.657 95.581  1.00 20.11 ? 213  PHE B O   1 
ATOM   3521 C  CB  . PHE B 1 211 ? 7.251   -18.798 95.742  1.00 20.07 ? 213  PHE B CB  1 
ATOM   3522 C  CG  . PHE B 1 211 ? 7.673   -20.174 95.324  1.00 20.61 ? 213  PHE B CG  1 
ATOM   3523 C  CD1 . PHE B 1 211 ? 6.733   -21.151 95.070  1.00 22.02 ? 213  PHE B CD1 1 
ATOM   3524 C  CD2 . PHE B 1 211 ? 9.017   -20.493 95.206  1.00 21.11 ? 213  PHE B CD2 1 
ATOM   3525 C  CE1 . PHE B 1 211 ? 7.124   -22.438 94.696  1.00 22.60 ? 213  PHE B CE1 1 
ATOM   3526 C  CE2 . PHE B 1 211 ? 9.411   -21.770 94.822  1.00 20.78 ? 213  PHE B CE2 1 
ATOM   3527 C  CZ  . PHE B 1 211 ? 8.473   -22.731 94.555  1.00 21.02 ? 213  PHE B CZ  1 
ATOM   3528 N  N   . ASN B 1 212 ? 4.983   -16.562 95.004  1.00 22.86 ? 214  ASN B N   1 
ATOM   3529 C  CA  . ASN B 1 212 ? 4.112   -15.522 95.636  1.00 25.47 ? 214  ASN B CA  1 
ATOM   3530 C  C   . ASN B 1 212 ? 4.220   -15.601 97.158  1.00 25.35 ? 214  ASN B C   1 
ATOM   3531 O  O   . ASN B 1 212 ? 4.588   -14.634 97.811  1.00 25.06 ? 214  ASN B O   1 
ATOM   3532 C  CB  . ASN B 1 212 ? 2.628   -15.700 95.229  1.00 28.83 ? 214  ASN B CB  1 
ATOM   3533 C  CG  . ASN B 1 212 ? 1.657   -14.925 96.145  1.00 33.88 ? 214  ASN B CG  1 
ATOM   3534 O  OD1 . ASN B 1 212 ? 0.770   -15.496 96.827  1.00 29.28 ? 214  ASN B OD1 1 
ATOM   3535 N  ND2 . ASN B 1 212 ? 1.843   -13.625 96.182  1.00 39.77 ? 214  ASN B ND2 1 
ATOM   3536 N  N   . GLN B 1 213 ? 3.958   -16.787 97.700  1.00 26.49 ? 215  GLN B N   1 
ATOM   3537 C  CA  . GLN B 1 213 ? 4.020   -17.009 99.162  1.00 28.00 ? 215  GLN B CA  1 
ATOM   3538 C  C   . GLN B 1 213 ? 5.432   -17.149 99.675  1.00 29.09 ? 215  GLN B C   1 
ATOM   3539 O  O   . GLN B 1 213 ? 6.347   -17.547 98.941  1.00 29.74 ? 215  GLN B O   1 
ATOM   3540 C  CB  . GLN B 1 213 ? 3.280   -18.273 99.535  1.00 29.77 ? 215  GLN B CB  1 
ATOM   3541 C  CG  . GLN B 1 213 ? 1.818   -18.265 99.156  1.00 30.96 ? 215  GLN B CG  1 
ATOM   3542 C  CD  . GLN B 1 213 ? 1.227   -19.641 99.122  1.00 34.07 ? 215  GLN B CD  1 
ATOM   3543 O  OE1 . GLN B 1 213 ? 1.934   -20.632 98.941  1.00 39.67 ? 215  GLN B OE1 1 
ATOM   3544 N  NE2 . GLN B 1 213 ? -0.083  -19.719 99.269  1.00 35.13 ? 215  GLN B NE2 1 
ATOM   3545 N  N   . THR B 1 214 ? 5.612   -16.846 100.953 1.00 27.92 ? 216  THR B N   1 
ATOM   3546 C  CA  . THR B 1 214 ? 6.926   -16.873 101.585 1.00 27.86 ? 216  THR B CA  1 
ATOM   3547 C  C   . THR B 1 214 ? 7.033   -18.077 102.525 1.00 27.12 ? 216  THR B C   1 
ATOM   3548 O  O   . THR B 1 214 ? 6.053   -18.779 102.769 1.00 27.97 ? 216  THR B O   1 
ATOM   3549 C  CB  . THR B 1 214 ? 7.172   -15.615 102.400 1.00 29.71 ? 216  THR B CB  1 
ATOM   3550 O  OG1 . THR B 1 214 ? 6.238   -15.574 103.481 1.00 30.91 ? 216  THR B OG1 1 
ATOM   3551 C  CG2 . THR B 1 214 ? 6.983   -14.379 101.539 1.00 29.92 ? 216  THR B CG2 1 
ATOM   3552 N  N   . VAL B 1 215 ? 8.234   -18.301 103.025 1.00 27.96 ? 217  VAL B N   1 
ATOM   3553 C  CA  . VAL B 1 215 ? 8.446   -19.237 104.121 1.00 29.92 ? 217  VAL B CA  1 
ATOM   3554 C  C   . VAL B 1 215 ? 8.924   -18.419 105.304 1.00 29.14 ? 217  VAL B C   1 
ATOM   3555 O  O   . VAL B 1 215 ? 9.558   -17.393 105.139 1.00 26.62 ? 217  VAL B O   1 
ATOM   3556 C  CB  . VAL B 1 215 ? 9.451   -20.366 103.777 1.00 30.94 ? 217  VAL B CB  1 
ATOM   3557 C  CG1 . VAL B 1 215 ? 8.982   -21.125 102.558 1.00 31.55 ? 217  VAL B CG1 1 
ATOM   3558 C  CG2 . VAL B 1 215 ? 10.841  -19.824 103.533 1.00 32.53 ? 217  VAL B CG2 1 
ATOM   3559 N  N   . MET B 1 216 ? 8.630   -18.905 106.505 1.00 31.41 ? 218  MET B N   1 
ATOM   3560 C  CA  . MET B 1 216 ? 8.952   -18.176 107.732 1.00 32.27 ? 218  MET B CA  1 
ATOM   3561 C  C   . MET B 1 216 ? 10.057  -18.884 108.497 1.00 30.84 ? 218  MET B C   1 
ATOM   3562 O  O   . MET B 1 216 ? 10.014  -20.101 108.652 1.00 27.99 ? 218  MET B O   1 
ATOM   3563 C  CB  . MET B 1 216 ? 7.699   -18.037 108.594 1.00 35.03 ? 218  MET B CB  1 
ATOM   3564 C  CG  . MET B 1 216 ? 6.757   -16.948 108.100 1.00 38.66 ? 218  MET B CG  1 
ATOM   3565 S  SD  . MET B 1 216 ? 5.222   -16.922 109.042 1.00 48.15 ? 218  MET B SD  1 
ATOM   3566 C  CE  . MET B 1 216 ? 4.415   -18.432 108.501 1.00 47.63 ? 218  MET B CE  1 
ATOM   3567 N  N   . LEU B 1 217 ? 11.050  -18.102 108.920 1.00 30.20 ? 219  LEU B N   1 
ATOM   3568 C  CA  . LEU B 1 217 ? 12.098  -18.501 109.851 1.00 30.18 ? 219  LEU B CA  1 
ATOM   3569 C  C   . LEU B 1 217 ? 11.887  -17.670 111.113 1.00 33.47 ? 219  LEU B C   1 
ATOM   3570 O  O   . LEU B 1 217 ? 11.258  -16.628 111.056 1.00 30.91 ? 219  LEU B O   1 
ATOM   3571 C  CB  . LEU B 1 217 ? 13.493  -18.197 109.292 1.00 27.16 ? 219  LEU B CB  1 
ATOM   3572 C  CG  . LEU B 1 217 ? 14.062  -19.246 108.323 1.00 24.92 ? 219  LEU B CG  1 
ATOM   3573 C  CD1 . LEU B 1 217 ? 13.146  -19.450 107.134 1.00 25.18 ? 219  LEU B CD1 1 
ATOM   3574 C  CD2 . LEU B 1 217 ? 15.454  -18.889 107.892 1.00 25.17 ? 219  LEU B CD2 1 
ATOM   3575 N  N   . SER B 1 218 ? 12.413  -18.139 112.244 1.00 35.95 ? 220  SER B N   1 
ATOM   3576 C  CA  . SER B 1 218 ? 12.377  -17.363 113.489 1.00 34.29 ? 220  SER B CA  1 
ATOM   3577 C  C   . SER B 1 218 ? 13.459  -16.288 113.460 1.00 33.46 ? 220  SER B C   1 
ATOM   3578 O  O   . SER B 1 218 ? 14.423  -16.362 112.680 1.00 32.61 ? 220  SER B O   1 
ATOM   3579 C  CB  . SER B 1 218 ? 12.568  -18.266 114.719 1.00 34.43 ? 220  SER B CB  1 
ATOM   3580 O  OG  . SER B 1 218 ? 13.899  -18.743 114.784 1.00 31.60 ? 220  SER B OG  1 
ATOM   3581 N  N   . ALA B 1 219 ? 13.321  -15.298 114.336 1.00 33.29 ? 221  ALA B N   1 
ATOM   3582 C  CA  . ALA B 1 219 ? 14.349  -14.264 114.478 1.00 33.83 ? 221  ALA B CA  1 
ATOM   3583 C  C   . ALA B 1 219 ? 15.718  -14.862 114.820 1.00 33.82 ? 221  ALA B C   1 
ATOM   3584 O  O   . ALA B 1 219 ? 16.730  -14.472 114.244 1.00 31.74 ? 221  ALA B O   1 
ATOM   3585 C  CB  . ALA B 1 219 ? 13.934  -13.238 115.531 1.00 36.26 ? 221  ALA B CB  1 
ATOM   3586 N  N   . LYS B 1 220 ? 15.750  -15.836 115.737 1.00 33.65 ? 222  LYS B N   1 
ATOM   3587 C  CA  . LYS B 1 220 ? 17.002  -16.529 116.072 1.00 33.35 ? 222  LYS B CA  1 
ATOM   3588 C  C   . LYS B 1 220 ? 17.649  -17.176 114.825 1.00 31.09 ? 222  LYS B C   1 
ATOM   3589 O  O   . LYS B 1 220 ? 18.856  -17.094 114.634 1.00 33.64 ? 222  LYS B O   1 
ATOM   3590 C  CB  . LYS B 1 220 ? 16.772  -17.590 117.165 1.00 31.77 ? 222  LYS B CB  1 
ATOM   3591 N  N   . GLN B 1 221 ? 16.827  -17.794 113.990 1.00 31.57 ? 223  GLN B N   1 
ATOM   3592 C  CA  . GLN B 1 221 ? 17.307  -18.455 112.765 1.00 32.31 ? 223  GLN B CA  1 
ATOM   3593 C  C   . GLN B 1 221 ? 17.891  -17.452 111.764 1.00 32.74 ? 223  GLN B C   1 
ATOM   3594 O  O   . GLN B 1 221 ? 18.996  -17.636 111.255 1.00 31.93 ? 223  GLN B O   1 
ATOM   3595 C  CB  . GLN B 1 221 ? 16.168  -19.258 112.123 1.00 32.06 ? 223  GLN B CB  1 
ATOM   3596 C  CG  . GLN B 1 221 ? 15.956  -20.597 112.805 1.00 32.52 ? 223  GLN B CG  1 
ATOM   3597 C  CD  . GLN B 1 221 ? 14.835  -21.400 112.215 1.00 32.21 ? 223  GLN B CD  1 
ATOM   3598 O  OE1 . GLN B 1 221 ? 13.783  -20.860 111.860 1.00 35.07 ? 223  GLN B OE1 1 
ATOM   3599 N  NE2 . GLN B 1 221 ? 15.031  -22.716 112.129 1.00 36.31 ? 223  GLN B NE2 1 
ATOM   3600 N  N   . LEU B 1 222 ? 17.163  -16.370 111.523 1.00 33.59 ? 224  LEU B N   1 
ATOM   3601 C  CA  . LEU B 1 222 ? 17.653  -15.316 110.629 1.00 33.12 ? 224  LEU B CA  1 
ATOM   3602 C  C   . LEU B 1 222 ? 18.949  -14.708 111.137 1.00 34.58 ? 224  LEU B C   1 
ATOM   3603 O  O   . LEU B 1 222 ? 19.880  -14.484 110.366 1.00 34.74 ? 224  LEU B O   1 
ATOM   3604 C  CB  . LEU B 1 222 ? 16.577  -14.245 110.415 1.00 34.03 ? 224  LEU B CB  1 
ATOM   3605 C  CG  . LEU B 1 222 ? 15.367  -14.737 109.625 1.00 33.92 ? 224  LEU B CG  1 
ATOM   3606 C  CD1 . LEU B 1 222 ? 14.197  -13.776 109.736 1.00 32.86 ? 224  LEU B CD1 1 
ATOM   3607 C  CD2 . LEU B 1 222 ? 15.745  -14.960 108.166 1.00 35.49 ? 224  LEU B CD2 1 
ATOM   3608 N  N   . HIS B 1 223 ? 19.029  -14.470 112.443 1.00 37.09 ? 225  HIS B N   1 
ATOM   3609 C  CA  . HIS B 1 223 ? 20.274  -14.039 113.065 1.00 37.62 ? 225  HIS B CA  1 
ATOM   3610 C  C   . HIS B 1 223 ? 21.395  -15.067 112.859 1.00 34.28 ? 225  HIS B C   1 
ATOM   3611 O  O   . HIS B 1 223 ? 22.512  -14.706 112.535 1.00 34.94 ? 225  HIS B O   1 
ATOM   3612 C  CB  . HIS B 1 223 ? 20.064  -13.766 114.565 1.00 43.23 ? 225  HIS B CB  1 
ATOM   3613 C  CG  . HIS B 1 223 ? 21.246  -13.129 115.229 1.00 49.02 ? 225  HIS B CG  1 
ATOM   3614 N  ND1 . HIS B 1 223 ? 22.144  -13.841 116.002 1.00 52.41 ? 225  HIS B ND1 1 
ATOM   3615 C  CD2 . HIS B 1 223 ? 21.691  -11.849 115.216 1.00 51.76 ? 225  HIS B CD2 1 
ATOM   3616 C  CE1 . HIS B 1 223 ? 23.084  -13.023 116.445 1.00 53.31 ? 225  HIS B CE1 1 
ATOM   3617 N  NE2 . HIS B 1 223 ? 22.833  -11.810 115.980 1.00 54.97 ? 225  HIS B NE2 1 
ATOM   3618 N  N   . THR B 1 224 ? 21.097  -16.351 113.044 1.00 33.15 ? 226  THR B N   1 
ATOM   3619 C  CA  . THR B 1 224 ? 22.092  -17.402 112.781 1.00 34.13 ? 226  THR B CA  1 
ATOM   3620 C  C   . THR B 1 224 ? 22.621  -17.344 111.331 1.00 32.40 ? 226  THR B C   1 
ATOM   3621 O  O   . THR B 1 224 ? 23.825  -17.476 111.101 1.00 29.52 ? 226  THR B O   1 
ATOM   3622 C  CB  . THR B 1 224 ? 21.512  -18.798 113.100 1.00 35.08 ? 226  THR B CB  1 
ATOM   3623 O  OG1 . THR B 1 224 ? 21.171  -18.860 114.499 1.00 33.15 ? 226  THR B OG1 1 
ATOM   3624 C  CG2 . THR B 1 224 ? 22.512  -19.908 112.760 1.00 35.59 ? 226  THR B CG2 1 
ATOM   3625 N  N   . LEU B 1 225 ? 21.709  -17.131 110.380 1.00 33.58 ? 227  LEU B N   1 
ATOM   3626 C  CA  . LEU B 1 225 ? 22.066  -17.016 108.951 1.00 32.96 ? 227  LEU B CA  1 
ATOM   3627 C  C   . LEU B 1 225 ? 23.024  -15.855 108.700 1.00 33.34 ? 227  LEU B C   1 
ATOM   3628 O  O   . LEU B 1 225 ? 24.050  -16.030 108.046 1.00 32.76 ? 227  LEU B O   1 
ATOM   3629 C  CB  . LEU B 1 225 ? 20.800  -16.852 108.097 1.00 32.56 ? 227  LEU B CB  1 
ATOM   3630 C  CG  . LEU B 1 225 ? 20.967  -16.693 106.585 1.00 31.67 ? 227  LEU B CG  1 
ATOM   3631 C  CD1 . LEU B 1 225 ? 21.719  -17.875 105.998 1.00 32.49 ? 227  LEU B CD1 1 
ATOM   3632 C  CD2 . LEU B 1 225 ? 19.620  -16.512 105.916 1.00 31.96 ? 227  LEU B CD2 1 
ATOM   3633 N  N   . SER B 1 226 ? 22.698  -14.681 109.244 1.00 35.39 ? 228  SER B N   1 
ATOM   3634 C  CA  . SER B 1 226 ? 23.471  -13.459 108.957 1.00 38.04 ? 228  SER B CA  1 
ATOM   3635 C  C   . SER B 1 226 ? 24.701  -13.256 109.830 1.00 38.54 ? 228  SER B C   1 
ATOM   3636 O  O   . SER B 1 226 ? 25.564  -12.456 109.478 1.00 39.86 ? 228  SER B O   1 
ATOM   3637 C  CB  . SER B 1 226 ? 22.575  -12.209 109.034 1.00 37.80 ? 228  SER B CB  1 
ATOM   3638 O  OG  . SER B 1 226 ? 21.910  -12.129 110.282 1.00 39.55 ? 228  SER B OG  1 
ATOM   3639 N  N   . ASP B 1 227 ? 24.810  -13.984 110.937 1.00 41.68 ? 229  ASP B N   1 
ATOM   3640 C  CA  . ASP B 1 227 ? 25.853  -13.709 111.927 1.00 45.03 ? 229  ASP B CA  1 
ATOM   3641 C  C   . ASP B 1 227 ? 26.980  -14.754 111.994 1.00 43.33 ? 229  ASP B C   1 
ATOM   3642 O  O   . ASP B 1 227 ? 28.006  -14.507 112.631 1.00 44.17 ? 229  ASP B O   1 
ATOM   3643 C  CB  . ASP B 1 227 ? 25.190  -13.537 113.304 1.00 50.08 ? 229  ASP B CB  1 
ATOM   3644 C  CG  . ASP B 1 227 ? 26.093  -12.844 114.318 1.00 55.62 ? 229  ASP B CG  1 
ATOM   3645 O  OD1 . ASP B 1 227 ? 26.339  -11.623 114.177 1.00 58.00 ? 229  ASP B OD1 1 
ATOM   3646 O  OD2 . ASP B 1 227 ? 26.545  -13.527 115.265 1.00 59.01 ? 229  ASP B OD2 1 
ATOM   3647 N  N   . THR B 1 228 ? 26.833  -15.900 111.331 1.00 37.69 ? 230  THR B N   1 
ATOM   3648 C  CA  . THR B 1 228 ? 27.771  -17.018 111.540 1.00 35.47 ? 230  THR B CA  1 
ATOM   3649 C  C   . THR B 1 228 ? 28.921  -17.123 110.540 1.00 34.87 ? 230  THR B C   1 
ATOM   3650 O  O   . THR B 1 228 ? 30.006  -17.553 110.908 1.00 33.09 ? 230  THR B O   1 
ATOM   3651 C  CB  . THR B 1 228 ? 26.989  -18.339 111.608 1.00 34.44 ? 230  THR B CB  1 
ATOM   3652 O  OG1 . THR B 1 228 ? 25.918  -18.182 112.552 1.00 34.82 ? 230  THR B OG1 1 
ATOM   3653 C  CG2 . THR B 1 228 ? 27.872  -19.490 112.041 1.00 34.73 ? 230  THR B CG2 1 
ATOM   3654 N  N   . LEU B 1 229 ? 28.711  -16.723 109.285 1.00 35.91 ? 231  LEU B N   1 
ATOM   3655 C  CA  . LEU B 1 229 ? 29.680  -17.006 108.232 1.00 35.93 ? 231  LEU B CA  1 
ATOM   3656 C  C   . LEU B 1 229 ? 30.585  -15.828 107.958 1.00 37.15 ? 231  LEU B C   1 
ATOM   3657 O  O   . LEU B 1 229 ? 30.143  -14.675 108.010 1.00 35.72 ? 231  LEU B O   1 
ATOM   3658 C  CB  . LEU B 1 229 ? 28.965  -17.398 106.936 1.00 35.46 ? 231  LEU B CB  1 
ATOM   3659 C  CG  . LEU B 1 229 ? 27.960  -18.539 107.025 1.00 35.18 ? 231  LEU B CG  1 
ATOM   3660 C  CD1 . LEU B 1 229 ? 27.392  -18.818 105.633 1.00 36.27 ? 231  LEU B CD1 1 
ATOM   3661 C  CD2 . LEU B 1 229 ? 28.580  -19.796 107.607 1.00 36.22 ? 231  LEU B CD2 1 
ATOM   3662 N  N   . TRP B 1 230 ? 31.838  -16.140 107.625 1.00 39.16 ? 232  TRP B N   1 
ATOM   3663 C  CA  . TRP B 1 230 ? 32.848  -15.137 107.285 1.00 44.65 ? 232  TRP B CA  1 
ATOM   3664 C  C   . TRP B 1 230 ? 33.249  -15.259 105.814 1.00 43.52 ? 232  TRP B C   1 
ATOM   3665 O  O   . TRP B 1 230 ? 33.345  -16.365 105.266 1.00 39.62 ? 232  TRP B O   1 
ATOM   3666 C  CB  . TRP B 1 230 ? 34.056  -15.236 108.241 1.00 47.27 ? 232  TRP B CB  1 
ATOM   3667 C  CG  . TRP B 1 230 ? 33.654  -14.832 109.630 1.00 53.71 ? 232  TRP B CG  1 
ATOM   3668 C  CD1 . TRP B 1 230 ? 32.953  -15.588 110.530 1.00 56.58 ? 232  TRP B CD1 1 
ATOM   3669 C  CD2 . TRP B 1 230 ? 33.857  -13.557 110.254 1.00 57.66 ? 232  TRP B CD2 1 
ATOM   3670 N  NE1 . TRP B 1 230 ? 32.720  -14.868 111.678 1.00 60.21 ? 232  TRP B NE1 1 
ATOM   3671 C  CE2 . TRP B 1 230 ? 33.267  -13.621 111.539 1.00 60.51 ? 232  TRP B CE2 1 
ATOM   3672 C  CE3 . TRP B 1 230 ? 34.489  -12.370 109.859 1.00 59.80 ? 232  TRP B CE3 1 
ATOM   3673 C  CZ2 . TRP B 1 230 ? 33.292  -12.542 112.437 1.00 62.64 ? 232  TRP B CZ2 1 
ATOM   3674 C  CZ3 . TRP B 1 230 ? 34.509  -11.292 110.749 1.00 62.47 ? 232  TRP B CZ3 1 
ATOM   3675 C  CH2 . TRP B 1 230 ? 33.914  -11.390 112.025 1.00 62.28 ? 232  TRP B CH2 1 
ATOM   3676 N  N   . GLY B 1 231 ? 33.475  -14.100 105.198 1.00 43.49 ? 233  GLY B N   1 
ATOM   3677 C  CA  . GLY B 1 231 ? 33.698  -13.971 103.765 1.00 46.94 ? 233  GLY B CA  1 
ATOM   3678 C  C   . GLY B 1 231 ? 35.107  -13.506 103.443 1.00 49.73 ? 233  GLY B C   1 
ATOM   3679 O  O   . GLY B 1 231 ? 36.017  -13.706 104.252 1.00 50.00 ? 233  GLY B O   1 
ATOM   3680 N  N   . PRO B 1 232 ? 35.302  -12.876 102.264 1.00 52.71 ? 234  PRO B N   1 
ATOM   3681 C  CA  . PRO B 1 232 ? 36.642  -12.462 101.819 1.00 53.98 ? 234  PRO B CA  1 
ATOM   3682 C  C   . PRO B 1 232 ? 37.367  -11.546 102.811 1.00 57.25 ? 234  PRO B C   1 
ATOM   3683 O  O   . PRO B 1 232 ? 36.725  -10.730 103.484 1.00 52.75 ? 234  PRO B O   1 
ATOM   3684 C  CB  . PRO B 1 232 ? 36.366  -11.713 100.507 1.00 53.34 ? 234  PRO B CB  1 
ATOM   3685 C  CG  . PRO B 1 232 ? 35.031  -12.176 100.059 1.00 53.18 ? 234  PRO B CG  1 
ATOM   3686 C  CD  . PRO B 1 232 ? 34.263  -12.431 101.318 1.00 53.38 ? 234  PRO B CD  1 
ATOM   3687 N  N   . GLY B 1 233 ? 38.692  -11.693 102.890 1.00 59.96 ? 235  GLY B N   1 
ATOM   3688 C  CA  . GLY B 1 233 ? 39.514  -10.932 103.835 1.00 63.51 ? 235  GLY B CA  1 
ATOM   3689 C  C   . GLY B 1 233 ? 39.191  -11.300 105.275 1.00 65.15 ? 235  GLY B C   1 
ATOM   3690 O  O   . GLY B 1 233 ? 39.143  -12.488 105.618 1.00 66.22 ? 235  GLY B O   1 
ATOM   3691 N  N   . ASP B 1 234 ? 38.956  -10.284 106.108 1.00 64.08 ? 236  ASP B N   1 
ATOM   3692 C  CA  . ASP B 1 234 ? 38.530  -10.482 107.494 1.00 61.81 ? 236  ASP B CA  1 
ATOM   3693 C  C   . ASP B 1 234 ? 37.089  -9.998  107.708 1.00 60.14 ? 236  ASP B C   1 
ATOM   3694 O  O   . ASP B 1 234 ? 36.726  -9.623  108.823 1.00 62.08 ? 236  ASP B O   1 
ATOM   3695 C  CB  . ASP B 1 234 ? 39.497  -9.757  108.441 1.00 60.83 ? 236  ASP B CB  1 
ATOM   3696 N  N   . SER B 1 235 ? 36.264  -10.035 106.654 1.00 58.08 ? 237  SER B N   1 
ATOM   3697 C  CA  . SER B 1 235 ? 34.897  -9.475  106.684 1.00 54.07 ? 237  SER B CA  1 
ATOM   3698 C  C   . SER B 1 235 ? 33.824  -10.536 106.959 1.00 50.06 ? 237  SER B C   1 
ATOM   3699 O  O   . SER B 1 235 ? 34.000  -11.713 106.628 1.00 50.69 ? 237  SER B O   1 
ATOM   3700 C  CB  . SER B 1 235 ? 34.586  -8.780  105.353 1.00 55.44 ? 237  SER B CB  1 
ATOM   3701 O  OG  . SER B 1 235 ? 34.457  -9.719  104.288 1.00 56.22 ? 237  SER B OG  1 
ATOM   3702 N  N   . ARG B 1 236 ? 32.712  -10.111 107.552 1.00 46.79 ? 238  ARG B N   1 
ATOM   3703 C  CA  . ARG B 1 236 ? 31.559  -10.988 107.759 1.00 45.76 ? 238  ARG B CA  1 
ATOM   3704 C  C   . ARG B 1 236 ? 30.827  -11.258 106.429 1.00 43.91 ? 238  ARG B C   1 
ATOM   3705 O  O   . ARG B 1 236 ? 30.709  -10.373 105.581 1.00 42.11 ? 238  ARG B O   1 
ATOM   3706 C  CB  . ARG B 1 236 ? 30.562  -10.373 108.743 1.00 46.77 ? 238  ARG B CB  1 
ATOM   3707 C  CG  . ARG B 1 236 ? 30.984  -10.358 110.204 1.00 48.86 ? 238  ARG B CG  1 
ATOM   3708 C  CD  . ARG B 1 236 ? 29.931  -9.630  111.032 1.00 50.19 ? 238  ARG B CD  1 
ATOM   3709 N  NE  . ARG B 1 236 ? 30.025  -9.924  112.460 1.00 51.71 ? 238  ARG B NE  1 
ATOM   3710 C  CZ  . ARG B 1 236 ? 29.632  -11.061 113.046 1.00 56.98 ? 238  ARG B CZ  1 
ATOM   3711 N  NH1 . ARG B 1 236 ? 29.107  -12.076 112.345 1.00 54.18 ? 238  ARG B NH1 1 
ATOM   3712 N  NH2 . ARG B 1 236 ? 29.778  -11.194 114.359 1.00 57.39 ? 238  ARG B NH2 1 
ATOM   3713 N  N   . LEU B 1 237 ? 30.317  -12.474 106.262 1.00 41.45 ? 239  LEU B N   1 
ATOM   3714 C  CA  . LEU B 1 237 ? 29.541  -12.799 105.073 1.00 37.93 ? 239  LEU B CA  1 
ATOM   3715 C  C   . LEU B 1 237 ? 28.109  -12.341 105.331 1.00 38.08 ? 239  LEU B C   1 
ATOM   3716 O  O   . LEU B 1 237 ? 27.291  -13.054 105.933 1.00 38.82 ? 239  LEU B O   1 
ATOM   3717 C  CB  . LEU B 1 237 ? 29.655  -14.285 104.730 1.00 38.80 ? 239  LEU B CB  1 
ATOM   3718 C  CG  . LEU B 1 237 ? 28.922  -14.826 103.485 1.00 38.19 ? 239  LEU B CG  1 
ATOM   3719 C  CD1 . LEU B 1 237 ? 28.743  -13.822 102.361 1.00 37.64 ? 239  LEU B CD1 1 
ATOM   3720 C  CD2 . LEU B 1 237 ? 29.566  -16.116 102.987 1.00 36.37 ? 239  LEU B CD2 1 
ATOM   3721 N  N   . GLN B 1 238 ? 27.849  -11.103 104.906 1.00 35.51 ? 240  GLN B N   1 
ATOM   3722 C  CA  . GLN B 1 238 ? 26.574  -10.420 105.103 1.00 36.88 ? 240  GLN B CA  1 
ATOM   3723 C  C   . GLN B 1 238 ? 26.247  -9.582  103.889 1.00 34.22 ? 240  GLN B C   1 
ATOM   3724 O  O   . GLN B 1 238 ? 27.132  -9.290  103.107 1.00 33.13 ? 240  GLN B O   1 
ATOM   3725 C  CB  . GLN B 1 238 ? 26.664  -9.452  106.281 1.00 39.25 ? 240  GLN B CB  1 
ATOM   3726 C  CG  . GLN B 1 238 ? 27.179  -10.074 107.546 1.00 42.01 ? 240  GLN B CG  1 
ATOM   3727 C  CD  . GLN B 1 238 ? 26.910  -9.189  108.728 1.00 42.09 ? 240  GLN B CD  1 
ATOM   3728 O  OE1 . GLN B 1 238 ? 27.388  -8.058  108.777 1.00 41.72 ? 240  GLN B OE1 1 
ATOM   3729 N  NE2 . GLN B 1 238 ? 26.116  -9.679  109.672 1.00 42.65 ? 240  GLN B NE2 1 
ATOM   3730 N  N   . LEU B 1 239 ? 24.979  -9.184  103.779 1.00 34.16 ? 241  LEU B N   1 
ATOM   3731 C  CA  . LEU B 1 239 ? 24.506  -8.265  102.742 1.00 33.61 ? 241  LEU B CA  1 
ATOM   3732 C  C   . LEU B 1 239 ? 24.923  -8.758  101.337 1.00 31.11 ? 241  LEU B C   1 
ATOM   3733 O  O   . LEU B 1 239 ? 25.338  -7.973  100.469 1.00 29.51 ? 241  LEU B O   1 
ATOM   3734 C  CB  . LEU B 1 239 ? 25.036  -6.853  103.011 1.00 34.22 ? 241  LEU B CB  1 
ATOM   3735 C  CG  . LEU B 1 239 ? 24.729  -6.286  104.409 1.00 35.73 ? 241  LEU B CG  1 
ATOM   3736 C  CD1 . LEU B 1 239 ? 25.595  -5.061  104.706 1.00 38.32 ? 241  LEU B CD1 1 
ATOM   3737 C  CD2 . LEU B 1 239 ? 23.253  -5.951  104.551 1.00 37.06 ? 241  LEU B CD2 1 
ATOM   3738 N  N   . ASN B 1 240 ? 24.787  -10.066 101.130 1.00 27.01 ? 242  ASN B N   1 
ATOM   3739 C  CA  . ASN B 1 240 ? 25.306  -10.727 99.938  1.00 28.10 ? 242  ASN B CA  1 
ATOM   3740 C  C   . ASN B 1 240 ? 24.198  -10.796 98.884  1.00 29.15 ? 242  ASN B C   1 
ATOM   3741 O  O   . ASN B 1 240 ? 23.742  -11.886 98.497  1.00 28.76 ? 242  ASN B O   1 
ATOM   3742 C  CB  . ASN B 1 240 ? 25.890  -12.105 100.299 1.00 28.46 ? 242  ASN B CB  1 
ATOM   3743 C  CG  . ASN B 1 240 ? 24.854  -13.053 100.870 1.00 28.27 ? 242  ASN B CG  1 
ATOM   3744 O  OD1 . ASN B 1 240 ? 23.930  -12.629 101.578 1.00 29.03 ? 242  ASN B OD1 1 
ATOM   3745 N  ND2 . ASN B 1 240 ? 24.986  -14.350 100.548 1.00 30.54 ? 242  ASN B ND2 1 
ATOM   3746 N  N   . PHE B 1 241 ? 23.753  -9.611  98.457  1.00 26.03 ? 243  PHE B N   1 
ATOM   3747 C  CA  . PHE B 1 241 ? 22.719  -9.451  97.452  1.00 27.64 ? 243  PHE B CA  1 
ATOM   3748 C  C   . PHE B 1 241 ? 23.079  -8.328  96.498  1.00 25.26 ? 243  PHE B C   1 
ATOM   3749 O  O   . PHE B 1 241 ? 23.824  -7.425  96.830  1.00 25.71 ? 243  PHE B O   1 
ATOM   3750 C  CB  . PHE B 1 241 ? 21.330  -9.184  98.061  1.00 29.67 ? 243  PHE B CB  1 
ATOM   3751 C  CG  . PHE B 1 241 ? 21.251  -7.928  98.880  1.00 32.01 ? 243  PHE B CG  1 
ATOM   3752 C  CD1 . PHE B 1 241 ? 21.608  -7.937  100.229 1.00 32.27 ? 243  PHE B CD1 1 
ATOM   3753 C  CD2 . PHE B 1 241 ? 20.820  -6.730  98.308  1.00 31.93 ? 243  PHE B CD2 1 
ATOM   3754 C  CE1 . PHE B 1 241 ? 21.517  -6.770  100.998 1.00 33.96 ? 243  PHE B CE1 1 
ATOM   3755 C  CE2 . PHE B 1 241 ? 20.749  -5.566  99.067  1.00 33.94 ? 243  PHE B CE2 1 
ATOM   3756 C  CZ  . PHE B 1 241 ? 21.091  -5.581  100.409 1.00 31.87 ? 243  PHE B CZ  1 
ATOM   3757 N  N   . ARG B 1 242 ? 22.544  -8.429  95.299  1.00 25.76 ? 244  ARG B N   1 
ATOM   3758 C  CA  . ARG B 1 242 ? 22.776  -7.442  94.245  1.00 25.94 ? 244  ARG B CA  1 
ATOM   3759 C  C   . ARG B 1 242 ? 21.651  -6.438  94.279  1.00 24.78 ? 244  ARG B C   1 
ATOM   3760 O  O   . ARG B 1 242 ? 20.512  -6.787  94.561  1.00 24.15 ? 244  ARG B O   1 
ATOM   3761 C  CB  . ARG B 1 242 ? 22.770  -8.136  92.872  1.00 25.29 ? 244  ARG B CB  1 
ATOM   3762 C  CG  . ARG B 1 242 ? 23.308  -7.283  91.723  1.00 25.80 ? 244  ARG B CG  1 
ATOM   3763 C  CD  . ARG B 1 242 ? 22.907  -7.863  90.364  1.00 25.38 ? 244  ARG B CD  1 
ATOM   3764 N  NE  . ARG B 1 242 ? 23.623  -7.224  89.263  1.00 25.79 ? 244  ARG B NE  1 
ATOM   3765 C  CZ  . ARG B 1 242 ? 23.624  -7.630  87.990  1.00 24.92 ? 244  ARG B CZ  1 
ATOM   3766 N  NH1 . ARG B 1 242 ? 22.911  -8.686  87.586  1.00 24.11 ? 244  ARG B NH1 1 
ATOM   3767 N  NH2 . ARG B 1 242 ? 24.324  -6.932  87.097  1.00 25.11 ? 244  ARG B NH2 1 
ATOM   3768 N  N   . ALA B 1 243 ? 21.960  -5.204  93.891  1.00 26.20 ? 245  ALA B N   1 
ATOM   3769 C  CA  . ALA B 1 243 ? 20.941  -4.190  93.718  1.00 26.35 ? 245  ALA B CA  1 
ATOM   3770 C  C   . ALA B 1 243 ? 19.946  -4.588  92.635  1.00 27.79 ? 245  ALA B C   1 
ATOM   3771 O  O   . ALA B 1 243 ? 20.310  -5.296  91.684  1.00 23.89 ? 245  ALA B O   1 
ATOM   3772 C  CB  . ALA B 1 243 ? 21.596  -2.853  93.370  1.00 26.48 ? 245  ALA B CB  1 
ATOM   3773 N  N   . THR B 1 244 ? 18.699  -4.137  92.814  1.00 26.68 ? 246  THR B N   1 
ATOM   3774 C  CA  . THR B 1 244 ? 17.607  -4.187  91.831  1.00 28.72 ? 246  THR B CA  1 
ATOM   3775 C  C   . THR B 1 244 ? 18.038  -3.648  90.475  1.00 27.71 ? 246  THR B C   1 
ATOM   3776 O  O   . THR B 1 244 ? 18.748  -2.643  90.415  1.00 27.70 ? 246  THR B O   1 
ATOM   3777 C  CB  . THR B 1 244 ? 16.428  -3.264  92.254  1.00 32.65 ? 246  THR B CB  1 
ATOM   3778 O  OG1 . THR B 1 244 ? 16.167  -3.389  93.644  1.00 38.02 ? 246  THR B OG1 1 
ATOM   3779 C  CG2 . THR B 1 244 ? 15.170  -3.597  91.477  1.00 36.59 ? 246  THR B CG2 1 
ATOM   3780 N  N   . GLN B 1 245 ? 17.584  -4.306  89.410  1.00 24.76 ? 247  GLN B N   1 
ATOM   3781 C  CA  . GLN B 1 245 ? 17.970  -3.994  88.035  1.00 25.17 ? 247  GLN B CA  1 
ATOM   3782 C  C   . GLN B 1 245 ? 16.720  -3.651  87.266  1.00 24.04 ? 247  GLN B C   1 
ATOM   3783 O  O   . GLN B 1 245 ? 15.681  -4.227  87.524  1.00 23.77 ? 247  GLN B O   1 
ATOM   3784 C  CB  . GLN B 1 245 ? 18.619  -5.217  87.361  1.00 25.42 ? 247  GLN B CB  1 
ATOM   3785 C  CG  . GLN B 1 245 ? 19.845  -5.739  88.071  1.00 26.51 ? 247  GLN B CG  1 
ATOM   3786 C  CD  . GLN B 1 245 ? 20.970  -4.728  88.126  1.00 27.57 ? 247  GLN B CD  1 
ATOM   3787 O  OE1 . GLN B 1 245 ? 21.351  -4.160  87.104  1.00 31.89 ? 247  GLN B OE1 1 
ATOM   3788 N  NE2 . GLN B 1 245 ? 21.506  -4.492  89.313  1.00 27.17 ? 247  GLN B NE2 1 
ATOM   3789 N  N   . PRO B 1 246 ? 16.811  -2.723  86.292  1.00 24.96 ? 248  PRO B N   1 
ATOM   3790 C  CA  . PRO B 1 246 ? 15.634  -2.361  85.479  1.00 24.77 ? 248  PRO B CA  1 
ATOM   3791 C  C   . PRO B 1 246 ? 15.056  -3.475  84.591  1.00 24.35 ? 248  PRO B C   1 
ATOM   3792 O  O   . PRO B 1 246 ? 15.800  -4.237  83.963  1.00 21.81 ? 248  PRO B O   1 
ATOM   3793 C  CB  . PRO B 1 246 ? 16.153  -1.215  84.589  1.00 25.67 ? 248  PRO B CB  1 
ATOM   3794 C  CG  . PRO B 1 246 ? 17.620  -1.345  84.588  1.00 25.26 ? 248  PRO B CG  1 
ATOM   3795 C  CD  . PRO B 1 246 ? 18.013  -1.965  85.901  1.00 25.52 ? 248  PRO B CD  1 
ATOM   3796 N  N   . LEU B 1 247 ? 13.738  -3.540  84.515  1.00 23.56 ? 249  LEU B N   1 
ATOM   3797 C  CA  . LEU B 1 247 ? 13.069  -4.477  83.640  1.00 25.02 ? 249  LEU B CA  1 
ATOM   3798 C  C   . LEU B 1 247 ? 13.350  -4.226  82.147  1.00 25.14 ? 249  LEU B C   1 
ATOM   3799 O  O   . LEU B 1 247 ? 13.355  -5.165  81.357  1.00 23.03 ? 249  LEU B O   1 
ATOM   3800 C  CB  . LEU B 1 247 ? 11.566  -4.506  83.926  1.00 25.00 ? 249  LEU B CB  1 
ATOM   3801 C  CG  . LEU B 1 247 ? 11.164  -5.317  85.169  1.00 25.85 ? 249  LEU B CG  1 
ATOM   3802 C  CD1 . LEU B 1 247 ? 9.701   -5.065  85.527  1.00 25.83 ? 249  LEU B CD1 1 
ATOM   3803 C  CD2 . LEU B 1 247 ? 11.369  -6.819  84.954  1.00 24.35 ? 249  LEU B CD2 1 
ATOM   3804 N  N   . ASN B 1 248 ? 13.588  -2.971  81.769  1.00 25.58 ? 250  ASN B N   1 
ATOM   3805 C  CA  . ASN B 1 248 ? 13.818  -2.619  80.368  1.00 25.32 ? 250  ASN B CA  1 
ATOM   3806 C  C   . ASN B 1 248 ? 12.809  -3.195  79.400  1.00 24.06 ? 250  ASN B C   1 
ATOM   3807 O  O   . ASN B 1 248 ? 13.168  -3.745  78.371  1.00 25.40 ? 250  ASN B O   1 
ATOM   3808 C  CB  . ASN B 1 248 ? 15.279  -2.958  79.967  1.00 28.38 ? 250  ASN B CB  1 
ATOM   3809 C  CG  . ASN B 1 248 ? 16.276  -1.940  80.490  1.00 29.32 ? 250  ASN B CG  1 
ATOM   3810 O  OD1 . ASN B 1 248 ? 15.996  -0.742  80.516  1.00 35.92 ? 250  ASN B OD1 1 
ATOM   3811 N  ND2 . ASN B 1 248 ? 17.458  -2.404  80.895  1.00 30.16 ? 250  ASN B ND2 1 
ATOM   3812 N  N   . GLY B 1 249 ? 11.514  -3.090  79.730  1.00 20.34 ? 251  GLY B N   1 
ATOM   3813 C  CA  . GLY B 1 249 ? 10.470  -3.602  78.852  1.00 20.12 ? 251  GLY B CA  1 
ATOM   3814 C  C   . GLY B 1 249 ? 9.990   -5.036  79.069  1.00 18.97 ? 251  GLY B C   1 
ATOM   3815 O  O   . GLY B 1 249 ? 8.922   -5.428  78.570  1.00 20.74 ? 251  GLY B O   1 
ATOM   3816 N  N   . ARG B 1 250 ? 10.757  -5.805  79.821  1.00 19.46 ? 252  ARG B N   1 
ATOM   3817 C  CA  . ARG B 1 250 ? 10.307  -7.129  80.271  1.00 20.13 ? 252  ARG B CA  1 
ATOM   3818 C  C   . ARG B 1 250 ? 9.086   -6.974  81.139  1.00 20.28 ? 252  ARG B C   1 
ATOM   3819 O  O   . ARG B 1 250 ? 9.066   -6.098  81.981  1.00 21.12 ? 252  ARG B O   1 
ATOM   3820 C  CB  . ARG B 1 250 ? 11.395  -7.800  81.087  1.00 20.65 ? 252  ARG B CB  1 
ATOM   3821 C  CG  . ARG B 1 250 ? 12.564  -8.262  80.251  1.00 20.42 ? 252  ARG B CG  1 
ATOM   3822 C  CD  . ARG B 1 250 ? 13.653  -8.837  81.122  1.00 20.36 ? 252  ARG B CD  1 
ATOM   3823 N  NE  . ARG B 1 250 ? 14.321  -7.817  81.926  1.00 20.24 ? 252  ARG B NE  1 
ATOM   3824 C  CZ  . ARG B 1 250 ? 15.175  -8.058  82.918  1.00 20.73 ? 252  ARG B CZ  1 
ATOM   3825 N  NH1 . ARG B 1 250 ? 15.500  -9.307  83.275  1.00 21.56 ? 252  ARG B NH1 1 
ATOM   3826 N  NH2 . ARG B 1 250 ? 15.726  -7.038  83.577  1.00 20.20 ? 252  ARG B NH2 1 
ATOM   3827 N  N   . VAL B 1 251 ? 8.108   -7.834  80.927  1.00 21.70 ? 253  VAL B N   1 
ATOM   3828 C  CA  . VAL B 1 251 ? 6.865   -7.823  81.669  1.00 22.91 ? 253  VAL B CA  1 
ATOM   3829 C  C   . VAL B 1 251 ? 6.883   -9.089  82.505  1.00 24.12 ? 253  VAL B C   1 
ATOM   3830 O  O   . VAL B 1 251 ? 7.050   -10.183 81.975  1.00 25.05 ? 253  VAL B O   1 
ATOM   3831 C  CB  . VAL B 1 251 ? 5.669   -7.846  80.711  1.00 23.02 ? 253  VAL B CB  1 
ATOM   3832 C  CG1 . VAL B 1 251 ? 4.364   -8.030  81.472  1.00 23.41 ? 253  VAL B CG1 1 
ATOM   3833 C  CG2 . VAL B 1 251 ? 5.632   -6.569  79.872  1.00 23.38 ? 253  VAL B CG2 1 
ATOM   3834 N  N   . ILE B 1 252 ? 6.702   -8.933  83.806  1.00 25.73 ? 254  ILE B N   1 
ATOM   3835 C  CA  . ILE B 1 252 ? 6.687   -10.083 84.710  1.00 24.02 ? 254  ILE B CA  1 
ATOM   3836 C  C   . ILE B 1 252 ? 5.356   -10.785 84.549  1.00 25.37 ? 254  ILE B C   1 
ATOM   3837 O  O   . ILE B 1 252 ? 4.290   -10.139 84.563  1.00 24.07 ? 254  ILE B O   1 
ATOM   3838 C  CB  . ILE B 1 252 ? 6.910   -9.665  86.162  1.00 23.67 ? 254  ILE B CB  1 
ATOM   3839 C  CG1 . ILE B 1 252 ? 8.275   -8.987  86.298  1.00 24.13 ? 254  ILE B CG1 1 
ATOM   3840 C  CG2 . ILE B 1 252 ? 6.786   -10.887 87.085  1.00 23.21 ? 254  ILE B CG2 1 
ATOM   3841 C  CD1 . ILE B 1 252 ? 8.583   -8.397  87.654  1.00 25.33 ? 254  ILE B CD1 1 
ATOM   3842 N  N   . GLU B 1 253 ? 5.404   -12.105 84.431  1.00 22.85 ? 255  GLU B N   1 
ATOM   3843 C  CA  . GLU B 1 253 ? 4.198   -12.882 84.342  1.00 23.81 ? 255  GLU B CA  1 
ATOM   3844 C  C   . GLU B 1 253 ? 3.774   -13.378 85.729  1.00 22.76 ? 255  GLU B C   1 
ATOM   3845 O  O   . GLU B 1 253 ? 4.611   -13.510 86.633  1.00 22.50 ? 255  GLU B O   1 
ATOM   3846 C  CB  . GLU B 1 253 ? 4.369   -14.011 83.371  1.00 27.47 ? 255  GLU B CB  1 
ATOM   3847 C  CG  . GLU B 1 253 ? 4.608   -13.535 81.945  1.00 31.56 ? 255  GLU B CG  1 
ATOM   3848 C  CD  . GLU B 1 253 ? 4.361   -14.634 80.942  1.00 35.47 ? 255  GLU B CD  1 
ATOM   3849 O  OE1 . GLU B 1 253 ? 5.023   -15.645 81.049  1.00 36.48 ? 255  GLU B OE1 1 
ATOM   3850 O  OE2 . GLU B 1 253 ? 3.475   -14.523 80.066  1.00 45.41 ? 255  GLU B OE2 1 
ATOM   3851 N  N   . ALA B 1 254 ? 2.472   -13.598 85.889  1.00 22.07 ? 256  ALA B N   1 
ATOM   3852 C  CA  . ALA B 1 254 ? 1.906   -14.173 87.118  1.00 22.67 ? 256  ALA B CA  1 
ATOM   3853 C  C   . ALA B 1 254 ? 1.069   -15.362 86.759  1.00 22.71 ? 256  ALA B C   1 
ATOM   3854 O  O   . ALA B 1 254 ? 0.358   -15.358 85.751  1.00 21.41 ? 256  ALA B O   1 
ATOM   3855 C  CB  . ALA B 1 254 ? 1.111   -13.101 87.913  1.00 23.54 ? 256  ALA B CB  1 
ATOM   3856 N  N   . SER B 1 255 ? 1.164   -16.424 87.576  1.00 22.04 ? 257  SER B N   1 
ATOM   3857 C  CA  . SER B 1 255 ? 0.394   -17.628 87.365  1.00 24.11 ? 257  SER B CA  1 
ATOM   3858 C  C   . SER B 1 255 ? -1.020  -17.532 87.948  1.00 24.93 ? 257  SER B C   1 
ATOM   3859 O  O   . SER B 1 255 ? -1.754  -18.497 87.901  1.00 26.08 ? 257  SER B O   1 
ATOM   3860 C  CB  . SER B 1 255 ? 1.095   -18.835 88.031  1.00 24.12 ? 257  SER B CB  1 
ATOM   3861 O  OG  . SER B 1 255 ? 1.342   -18.554 89.400  1.00 22.75 ? 257  SER B OG  1 
ATOM   3862 N  N   . PHE B 1 256 ? -1.375  -16.378 88.497  1.00 26.78 ? 258  PHE B N   1 
ATOM   3863 C  CA  . PHE B 1 256 ? -2.651  -16.183 89.192  1.00 28.11 ? 258  PHE B CA  1 
ATOM   3864 C  C   . PHE B 1 256 ? -3.191  -14.784 88.891  1.00 30.44 ? 258  PHE B C   1 
ATOM   3865 O  O   . PHE B 1 256 ? -2.399  -13.872 88.717  1.00 29.73 ? 258  PHE B O   1 
ATOM   3866 C  CB  . PHE B 1 256 ? -2.448  -16.308 90.701  1.00 26.52 ? 258  PHE B CB  1 
ATOM   3867 C  CG  . PHE B 1 256 ? -1.437  -15.370 91.251  1.00 26.39 ? 258  PHE B CG  1 
ATOM   3868 C  CD1 . PHE B 1 256 ? -0.085  -15.680 91.195  1.00 25.52 ? 258  PHE B CD1 1 
ATOM   3869 C  CD2 . PHE B 1 256 ? -1.825  -14.159 91.826  1.00 26.02 ? 258  PHE B CD2 1 
ATOM   3870 C  CE1 . PHE B 1 256 ? 0.861   -14.810 91.687  1.00 25.29 ? 258  PHE B CE1 1 
ATOM   3871 C  CE2 . PHE B 1 256 ? -0.886  -13.286 92.327  1.00 26.37 ? 258  PHE B CE2 1 
ATOM   3872 C  CZ  . PHE B 1 256 ? 0.465   -13.604 92.262  1.00 27.32 ? 258  PHE B CZ  1 
ATOM   3873 N  N   . PRO B 1 257 ? -4.528  -14.615 88.855  1.00 36.53 ? 259  PRO B N   1 
ATOM   3874 C  CA  . PRO B 1 257 ? -5.108  -13.286 88.569  1.00 39.45 ? 259  PRO B CA  1 
ATOM   3875 C  C   . PRO B 1 257 ? -4.863  -12.256 89.691  1.00 47.05 ? 259  PRO B C   1 
ATOM   3876 O  O   . PRO B 1 257 ? -4.653  -11.055 89.438  1.00 50.02 ? 259  PRO B O   1 
ATOM   3877 C  CB  . PRO B 1 257 ? -6.594  -13.592 88.361  1.00 39.51 ? 259  PRO B CB  1 
ATOM   3878 C  CG  . PRO B 1 257 ? -6.840  -14.882 89.069  1.00 37.64 ? 259  PRO B CG  1 
ATOM   3879 C  CD  . PRO B 1 257 ? -5.564  -15.662 88.947  1.00 37.14 ? 259  PRO B CD  1 
ATOM   3880 O  OXT . PRO B 1 257 ? -4.804  -12.584 90.880  1.00 48.56 ? 259  PRO B OXT 1 
ATOM   3881 N  N   . TRP C 1 7   ? 37.545  -38.092 65.622  1.00 37.16 ? 9    TRP C N   1 
ATOM   3882 C  CA  . TRP C 1 7   ? 38.951  -37.928 65.115  1.00 36.33 ? 9    TRP C CA  1 
ATOM   3883 C  C   . TRP C 1 7   ? 39.854  -37.230 66.138  1.00 36.64 ? 9    TRP C C   1 
ATOM   3884 O  O   . TRP C 1 7   ? 39.385  -36.455 66.977  1.00 32.17 ? 9    TRP C O   1 
ATOM   3885 C  CB  . TRP C 1 7   ? 38.993  -37.159 63.774  1.00 34.74 ? 9    TRP C CB  1 
ATOM   3886 C  CG  . TRP C 1 7   ? 38.690  -35.678 63.879  1.00 32.24 ? 9    TRP C CG  1 
ATOM   3887 C  CD1 . TRP C 1 7   ? 37.480  -35.078 63.674  1.00 31.85 ? 9    TRP C CD1 1 
ATOM   3888 C  CD2 . TRP C 1 7   ? 39.613  -34.617 64.207  1.00 30.51 ? 9    TRP C CD2 1 
ATOM   3889 N  NE1 . TRP C 1 7   ? 37.592  -33.715 63.856  1.00 31.35 ? 9    TRP C NE1 1 
ATOM   3890 C  CE2 . TRP C 1 7   ? 38.884  -33.408 64.191  1.00 30.38 ? 9    TRP C CE2 1 
ATOM   3891 C  CE3 . TRP C 1 7   ? 40.973  -34.574 64.518  1.00 30.26 ? 9    TRP C CE3 1 
ATOM   3892 C  CZ2 . TRP C 1 7   ? 39.477  -32.165 64.471  1.00 30.18 ? 9    TRP C CZ2 1 
ATOM   3893 C  CZ3 . TRP C 1 7   ? 41.567  -33.334 64.788  1.00 31.55 ? 9    TRP C CZ3 1 
ATOM   3894 C  CH2 . TRP C 1 7   ? 40.813  -32.150 64.772  1.00 29.31 ? 9    TRP C CH2 1 
ATOM   3895 N  N   . ARG C 1 8   ? 41.154  -37.478 66.038  1.00 37.97 ? 10   ARG C N   1 
ATOM   3896 C  CA  . ARG C 1 8   ? 42.118  -36.801 66.901  1.00 43.53 ? 10   ARG C CA  1 
ATOM   3897 C  C   . ARG C 1 8   ? 43.478  -36.672 66.241  1.00 42.07 ? 10   ARG C C   1 
ATOM   3898 O  O   . ARG C 1 8   ? 43.750  -37.317 65.226  1.00 41.57 ? 10   ARG C O   1 
ATOM   3899 C  CB  . ARG C 1 8   ? 42.253  -37.563 68.221  1.00 48.72 ? 10   ARG C CB  1 
ATOM   3900 C  CG  . ARG C 1 8   ? 42.398  -39.067 68.051  1.00 52.47 ? 10   ARG C CG  1 
ATOM   3901 C  CD  . ARG C 1 8   ? 43.278  -39.663 69.131  1.00 59.08 ? 10   ARG C CD  1 
ATOM   3902 N  NE  . ARG C 1 8   ? 43.423  -41.104 68.951  1.00 67.24 ? 10   ARG C NE  1 
ATOM   3903 C  CZ  . ARG C 1 8   ? 44.318  -41.875 69.577  1.00 76.16 ? 10   ARG C CZ  1 
ATOM   3904 N  NH1 . ARG C 1 8   ? 45.190  -41.363 70.450  1.00 76.50 ? 10   ARG C NH1 1 
ATOM   3905 N  NH2 . ARG C 1 8   ? 44.347  -43.185 69.317  1.00 79.34 ? 10   ARG C NH2 1 
ATOM   3906 N  N   . TYR C 1 9   ? 44.318  -35.827 66.830  1.00 40.91 ? 11   TYR C N   1 
ATOM   3907 C  CA  . TYR C 1 9   ? 45.718  -35.739 66.459  1.00 43.00 ? 11   TYR C CA  1 
ATOM   3908 C  C   . TYR C 1 9   ? 46.460  -36.940 67.045  1.00 48.67 ? 11   TYR C C   1 
ATOM   3909 O  O   . TYR C 1 9   ? 46.048  -37.499 68.065  1.00 53.24 ? 11   TYR C O   1 
ATOM   3910 C  CB  . TYR C 1 9   ? 46.335  -34.425 66.947  1.00 39.92 ? 11   TYR C CB  1 
ATOM   3911 C  CG  . TYR C 1 9   ? 45.792  -33.191 66.238  1.00 38.47 ? 11   TYR C CG  1 
ATOM   3912 C  CD1 . TYR C 1 9   ? 46.140  -32.906 64.920  1.00 35.85 ? 11   TYR C CD1 1 
ATOM   3913 C  CD2 . TYR C 1 9   ? 44.926  -32.309 66.881  1.00 36.61 ? 11   TYR C CD2 1 
ATOM   3914 C  CE1 . TYR C 1 9   ? 45.659  -31.776 64.266  1.00 34.51 ? 11   TYR C CE1 1 
ATOM   3915 C  CE2 . TYR C 1 9   ? 44.439  -31.178 66.229  1.00 34.66 ? 11   TYR C CE2 1 
ATOM   3916 C  CZ  . TYR C 1 9   ? 44.799  -30.914 64.926  1.00 33.77 ? 11   TYR C CZ  1 
ATOM   3917 O  OH  . TYR C 1 9   ? 44.292  -29.793 64.300  1.00 29.70 ? 11   TYR C OH  1 
ATOM   3918 N  N   . GLY C 1 10  ? 47.526  -37.350 66.362  1.00 53.10 ? 12   GLY C N   1 
ATOM   3919 C  CA  . GLY C 1 10  ? 48.432  -38.395 66.834  1.00 55.69 ? 12   GLY C CA  1 
ATOM   3920 C  C   . GLY C 1 10  ? 47.827  -39.765 67.088  1.00 59.27 ? 12   GLY C C   1 
ATOM   3921 O  O   . GLY C 1 10  ? 48.260  -40.457 68.011  1.00 63.44 ? 12   GLY C O   1 
ATOM   3922 N  N   . GLY C 1 11  ? 46.837  -40.166 66.286  1.00 57.97 ? 13   GLY C N   1 
ATOM   3923 C  CA  . GLY C 1 11  ? 46.245  -41.495 66.435  1.00 55.78 ? 13   GLY C CA  1 
ATOM   3924 C  C   . GLY C 1 11  ? 44.938  -41.771 65.714  1.00 53.67 ? 13   GLY C C   1 
ATOM   3925 O  O   . GLY C 1 11  ? 44.424  -40.938 64.974  1.00 48.89 ? 13   GLY C O   1 
ATOM   3926 N  N   . ASP C 1 12  ? 44.413  -42.968 65.968  1.00 54.04 ? 14   ASP C N   1 
ATOM   3927 C  CA  . ASP C 1 12  ? 43.217  -43.490 65.310  1.00 54.20 ? 14   ASP C CA  1 
ATOM   3928 C  C   . ASP C 1 12  ? 41.933  -42.725 65.659  1.00 53.33 ? 14   ASP C C   1 
ATOM   3929 O  O   . ASP C 1 12  ? 41.873  -42.083 66.704  1.00 56.27 ? 14   ASP C O   1 
ATOM   3930 C  CB  . ASP C 1 12  ? 43.033  -44.975 65.670  1.00 57.51 ? 14   ASP C CB  1 
ATOM   3931 C  CG  . ASP C 1 12  ? 43.811  -45.905 64.758  1.00 61.92 ? 14   ASP C CG  1 
ATOM   3932 O  OD1 . ASP C 1 12  ? 44.753  -45.456 64.065  1.00 60.53 ? 14   ASP C OD1 1 
ATOM   3933 O  OD2 . ASP C 1 12  ? 43.461  -47.106 64.733  1.00 71.11 ? 14   ASP C OD2 1 
ATOM   3934 N  N   . PRO C 1 13  ? 40.905  -42.786 64.805  1.00 49.39 ? 15   PRO C N   1 
ATOM   3935 C  CA  . PRO C 1 13  ? 40.922  -43.508 63.518  1.00 47.45 ? 15   PRO C CA  1 
ATOM   3936 C  C   . PRO C 1 13  ? 41.641  -42.738 62.402  1.00 43.45 ? 15   PRO C C   1 
ATOM   3937 O  O   . PRO C 1 13  ? 41.733  -41.509 62.483  1.00 37.16 ? 15   PRO C O   1 
ATOM   3938 C  CB  . PRO C 1 13  ? 39.439  -43.641 63.183  1.00 48.44 ? 15   PRO C CB  1 
ATOM   3939 C  CG  . PRO C 1 13  ? 38.831  -42.417 63.779  1.00 49.77 ? 15   PRO C CG  1 
ATOM   3940 C  CD  . PRO C 1 13  ? 39.605  -42.136 65.043  1.00 50.39 ? 15   PRO C CD  1 
ATOM   3941 N  N   . PRO C 1 14  ? 42.129  -43.451 61.359  1.00 40.86 ? 16   PRO C N   1 
ATOM   3942 C  CA  . PRO C 1 14  ? 42.733  -42.750 60.220  1.00 38.29 ? 16   PRO C CA  1 
ATOM   3943 C  C   . PRO C 1 14  ? 41.753  -41.742 59.629  1.00 34.68 ? 16   PRO C C   1 
ATOM   3944 O  O   . PRO C 1 14  ? 40.587  -42.073 59.410  1.00 35.50 ? 16   PRO C O   1 
ATOM   3945 C  CB  . PRO C 1 14  ? 43.020  -43.879 59.208  1.00 39.74 ? 16   PRO C CB  1 
ATOM   3946 C  CG  . PRO C 1 14  ? 42.997  -45.139 59.995  1.00 40.87 ? 16   PRO C CG  1 
ATOM   3947 C  CD  . PRO C 1 14  ? 41.992  -44.897 61.086  1.00 42.61 ? 16   PRO C CD  1 
ATOM   3948 N  N   . TRP C 1 15  ? 42.222  -40.523 59.382  1.00 32.21 ? 17   TRP C N   1 
ATOM   3949 C  CA  . TRP C 1 15  ? 41.354  -39.452 58.869  1.00 30.46 ? 17   TRP C CA  1 
ATOM   3950 C  C   . TRP C 1 15  ? 40.611  -39.808 57.570  1.00 29.85 ? 17   TRP C C   1 
ATOM   3951 O  O   . TRP C 1 15  ? 39.442  -39.444 57.426  1.00 30.67 ? 17   TRP C O   1 
ATOM   3952 C  CB  . TRP C 1 15  ? 42.141  -38.146 58.730  1.00 29.52 ? 17   TRP C CB  1 
ATOM   3953 C  CG  . TRP C 1 15  ? 42.532  -37.521 60.053  1.00 29.05 ? 17   TRP C CG  1 
ATOM   3954 C  CD1 . TRP C 1 15  ? 42.460  -38.090 61.306  1.00 29.38 ? 17   TRP C CD1 1 
ATOM   3955 C  CD2 . TRP C 1 15  ? 43.068  -36.221 60.244  1.00 27.08 ? 17   TRP C CD2 1 
ATOM   3956 N  NE1 . TRP C 1 15  ? 42.903  -37.207 62.251  1.00 27.96 ? 17   TRP C NE1 1 
ATOM   3957 C  CE2 . TRP C 1 15  ? 43.292  -36.055 61.629  1.00 27.52 ? 17   TRP C CE2 1 
ATOM   3958 C  CE3 . TRP C 1 15  ? 43.387  -35.174 59.380  1.00 27.75 ? 17   TRP C CE3 1 
ATOM   3959 C  CZ2 . TRP C 1 15  ? 43.826  -34.878 62.168  1.00 27.99 ? 17   TRP C CZ2 1 
ATOM   3960 C  CZ3 . TRP C 1 15  ? 43.912  -34.004 59.917  1.00 27.75 ? 17   TRP C CZ3 1 
ATOM   3961 C  CH2 . TRP C 1 15  ? 44.114  -33.862 61.298  1.00 26.69 ? 17   TRP C CH2 1 
ATOM   3962 N  N   . PRO C 1 16  ? 41.254  -40.559 56.641  1.00 31.93 ? 18   PRO C N   1 
ATOM   3963 C  CA  . PRO C 1 16  ? 40.519  -40.953 55.436  1.00 31.73 ? 18   PRO C CA  1 
ATOM   3964 C  C   . PRO C 1 16  ? 39.286  -41.819 55.698  1.00 31.83 ? 18   PRO C C   1 
ATOM   3965 O  O   . PRO C 1 16  ? 38.357  -41.769 54.897  1.00 33.21 ? 18   PRO C O   1 
ATOM   3966 C  CB  . PRO C 1 16  ? 41.563  -41.721 54.609  1.00 32.63 ? 18   PRO C CB  1 
ATOM   3967 C  CG  . PRO C 1 16  ? 42.860  -41.163 55.052  1.00 32.60 ? 18   PRO C CG  1 
ATOM   3968 C  CD  . PRO C 1 16  ? 42.674  -40.939 56.538  1.00 32.29 ? 18   PRO C CD  1 
ATOM   3969 N  N   . ARG C 1 17  ? 39.277  -42.615 56.772  1.00 33.74 ? 19   ARG C N   1 
ATOM   3970 C  CA  . ARG C 1 17  ? 38.046  -43.308 57.182  1.00 36.23 ? 19   ARG C CA  1 
ATOM   3971 C  C   . ARG C 1 17  ? 36.990  -42.321 57.677  1.00 34.74 ? 19   ARG C C   1 
ATOM   3972 O  O   . ARG C 1 17  ? 35.813  -42.494 57.384  1.00 34.78 ? 19   ARG C O   1 
ATOM   3973 C  CB  . ARG C 1 17  ? 38.296  -44.360 58.273  1.00 41.39 ? 19   ARG C CB  1 
ATOM   3974 C  CG  . ARG C 1 17  ? 38.944  -45.655 57.798  1.00 48.27 ? 19   ARG C CG  1 
ATOM   3975 C  CD  . ARG C 1 17  ? 38.049  -46.431 56.828  1.00 52.55 ? 19   ARG C CD  1 
ATOM   3976 N  NE  . ARG C 1 17  ? 38.559  -47.775 56.522  1.00 56.27 ? 19   ARG C NE  1 
ATOM   3977 C  CZ  . ARG C 1 17  ? 38.087  -48.931 57.007  1.00 59.90 ? 19   ARG C CZ  1 
ATOM   3978 N  NH1 . ARG C 1 17  ? 37.048  -48.982 57.846  1.00 61.22 ? 19   ARG C NH1 1 
ATOM   3979 N  NH2 . ARG C 1 17  ? 38.662  -50.071 56.635  1.00 63.63 ? 19   ARG C NH2 1 
ATOM   3980 N  N   . VAL C 1 18  ? 37.415  -41.294 58.410  1.00 31.56 ? 20   VAL C N   1 
ATOM   3981 C  CA  . VAL C 1 18  ? 36.500  -40.266 58.921  1.00 32.60 ? 20   VAL C CA  1 
ATOM   3982 C  C   . VAL C 1 18  ? 35.848  -39.484 57.766  1.00 32.95 ? 20   VAL C C   1 
ATOM   3983 O  O   . VAL C 1 18  ? 34.616  -39.326 57.695  1.00 33.31 ? 20   VAL C O   1 
ATOM   3984 C  CB  . VAL C 1 18  ? 37.214  -39.291 59.895  1.00 32.88 ? 20   VAL C CB  1 
ATOM   3985 C  CG1 . VAL C 1 18  ? 36.228  -38.247 60.430  1.00 33.22 ? 20   VAL C CG1 1 
ATOM   3986 C  CG2 . VAL C 1 18  ? 37.876  -40.056 61.044  1.00 34.43 ? 20   VAL C CG2 1 
ATOM   3987 N  N   . SER C 1 19  ? 36.688  -38.990 56.863  1.00 33.62 ? 21   SER C N   1 
ATOM   3988 C  CA  . SER C 1 19  ? 36.229  -38.294 55.661  1.00 32.48 ? 21   SER C CA  1 
ATOM   3989 C  C   . SER C 1 19  ? 37.177  -38.629 54.504  1.00 30.06 ? 21   SER C C   1 
ATOM   3990 O  O   . SER C 1 19  ? 38.379  -38.386 54.638  1.00 27.07 ? 21   SER C O   1 
ATOM   3991 C  CB  . SER C 1 19  ? 36.244  -36.792 55.892  1.00 31.97 ? 21   SER C CB  1 
ATOM   3992 O  OG  . SER C 1 19  ? 35.945  -36.109 54.678  1.00 34.25 ? 21   SER C OG  1 
ATOM   3993 N  N   . PRO C 1 20  ? 36.642  -39.165 53.380  1.00 30.36 ? 22   PRO C N   1 
ATOM   3994 C  CA  . PRO C 1 20  ? 37.461  -39.444 52.179  1.00 30.48 ? 22   PRO C CA  1 
ATOM   3995 C  C   . PRO C 1 20  ? 38.275  -38.256 51.667  1.00 29.13 ? 22   PRO C C   1 
ATOM   3996 O  O   . PRO C 1 20  ? 39.377  -38.445 51.139  1.00 27.78 ? 22   PRO C O   1 
ATOM   3997 C  CB  . PRO C 1 20  ? 36.421  -39.837 51.131  1.00 30.74 ? 22   PRO C CB  1 
ATOM   3998 C  CG  . PRO C 1 20  ? 35.320  -40.434 51.918  1.00 32.67 ? 22   PRO C CG  1 
ATOM   3999 C  CD  . PRO C 1 20  ? 35.251  -39.634 53.191  1.00 31.31 ? 22   PRO C CD  1 
ATOM   4000 N  N   . ALA C 1 21  ? 37.743  -37.041 51.842  1.00 28.11 ? 23   ALA C N   1 
ATOM   4001 C  CA  . ALA C 1 21  ? 38.416  -35.830 51.390  1.00 26.58 ? 23   ALA C CA  1 
ATOM   4002 C  C   . ALA C 1 21  ? 39.805  -35.614 52.031  1.00 24.99 ? 23   ALA C C   1 
ATOM   4003 O  O   . ALA C 1 21  ? 40.648  -34.943 51.442  1.00 26.02 ? 23   ALA C O   1 
ATOM   4004 C  CB  . ALA C 1 21  ? 37.523  -34.609 51.600  1.00 26.56 ? 23   ALA C CB  1 
ATOM   4005 N  N   . CYS C 1 22  ? 40.044  -36.202 53.204  1.00 23.91 ? 24   CYS C N   1 
ATOM   4006 C  CA  . CYS C 1 22  ? 41.348  -36.162 53.869  1.00 24.02 ? 24   CYS C CA  1 
ATOM   4007 C  C   . CYS C 1 22  ? 42.446  -36.877 53.057  1.00 23.97 ? 24   CYS C C   1 
ATOM   4008 O  O   . CYS C 1 22  ? 43.613  -36.678 53.336  1.00 23.64 ? 24   CYS C O   1 
ATOM   4009 C  CB  . CYS C 1 22  ? 41.275  -36.757 55.272  1.00 25.52 ? 24   CYS C CB  1 
ATOM   4010 S  SG  . CYS C 1 22  ? 40.200  -35.811 56.412  1.00 28.55 ? 24   CYS C SG  1 
ATOM   4011 N  N   . ALA C 1 23  ? 42.050  -37.710 52.093  1.00 24.06 ? 25   ALA C N   1 
ATOM   4012 C  CA  . ALA C 1 23  ? 42.988  -38.341 51.130  1.00 24.28 ? 25   ALA C CA  1 
ATOM   4013 C  C   . ALA C 1 23  ? 43.010  -37.641 49.755  1.00 25.05 ? 25   ALA C C   1 
ATOM   4014 O  O   . ALA C 1 23  ? 43.518  -38.210 48.770  1.00 25.69 ? 25   ALA C O   1 
ATOM   4015 C  CB  . ALA C 1 23  ? 42.623  -39.811 50.964  1.00 24.97 ? 25   ALA C CB  1 
ATOM   4016 N  N   . GLY C 1 24  ? 42.492  -36.413 49.669  1.00 21.99 ? 26   GLY C N   1 
ATOM   4017 C  CA  . GLY C 1 24  ? 42.528  -35.670 48.419  1.00 23.08 ? 26   GLY C CA  1 
ATOM   4018 C  C   . GLY C 1 24  ? 43.966  -35.272 48.042  1.00 24.05 ? 26   GLY C C   1 
ATOM   4019 O  O   . GLY C 1 24  ? 44.864  -35.217 48.891  1.00 22.88 ? 26   GLY C O   1 
ATOM   4020 N  N   . ARG C 1 25  ? 44.168  -34.978 46.770  1.00 24.44 ? 27   ARG C N   1 
ATOM   4021 C  CA  . ARG C 1 25  ? 45.496  -34.645 46.253  1.00 24.31 ? 27   ARG C CA  1 
ATOM   4022 C  C   . ARG C 1 25  ? 46.019  -33.275 46.716  1.00 25.07 ? 27   ARG C C   1 
ATOM   4023 O  O   . ARG C 1 25  ? 47.231  -33.072 46.750  1.00 25.38 ? 27   ARG C O   1 
ATOM   4024 C  CB  . ARG C 1 25  ? 45.486  -34.719 44.721  1.00 23.26 ? 27   ARG C CB  1 
ATOM   4025 C  CG  . ARG C 1 25  ? 46.860  -34.580 44.075  1.00 23.68 ? 27   ARG C CG  1 
ATOM   4026 C  CD  . ARG C 1 25  ? 46.891  -34.856 42.568  1.00 23.69 ? 27   ARG C CD  1 
ATOM   4027 N  NE  . ARG C 1 25  ? 48.171  -34.373 42.023  1.00 24.36 ? 27   ARG C NE  1 
ATOM   4028 C  CZ  . ARG C 1 25  ? 49.341  -35.028 42.045  1.00 22.82 ? 27   ARG C CZ  1 
ATOM   4029 N  NH1 . ARG C 1 25  ? 49.446  -36.242 42.536  1.00 22.44 ? 27   ARG C NH1 1 
ATOM   4030 N  NH2 . ARG C 1 25  ? 50.430  -34.430 41.565  1.00 23.56 ? 27   ARG C NH2 1 
ATOM   4031 N  N   . PHE C 1 26  ? 45.112  -32.365 47.098  1.00 24.20 ? 28   PHE C N   1 
ATOM   4032 C  CA  . PHE C 1 26  ? 45.426  -30.951 47.253  1.00 25.49 ? 28   PHE C CA  1 
ATOM   4033 C  C   . PHE C 1 26  ? 45.035  -30.457 48.648  1.00 25.85 ? 28   PHE C C   1 
ATOM   4034 O  O   . PHE C 1 26  ? 44.129  -29.639 48.813  1.00 23.25 ? 28   PHE C O   1 
ATOM   4035 C  CB  . PHE C 1 26  ? 44.727  -30.156 46.152  1.00 25.43 ? 28   PHE C CB  1 
ATOM   4036 C  CG  . PHE C 1 26  ? 45.070  -30.620 44.759  1.00 25.66 ? 28   PHE C CG  1 
ATOM   4037 C  CD1 . PHE C 1 26  ? 46.355  -30.439 44.254  1.00 25.07 ? 28   PHE C CD1 1 
ATOM   4038 C  CD2 . PHE C 1 26  ? 44.120  -31.255 43.958  1.00 26.25 ? 28   PHE C CD2 1 
ATOM   4039 C  CE1 . PHE C 1 26  ? 46.680  -30.873 42.975  1.00 25.22 ? 28   PHE C CE1 1 
ATOM   4040 C  CE2 . PHE C 1 26  ? 44.436  -31.680 42.673  1.00 26.72 ? 28   PHE C CE2 1 
ATOM   4041 C  CZ  . PHE C 1 26  ? 45.715  -31.489 42.183  1.00 25.80 ? 28   PHE C CZ  1 
ATOM   4042 N  N   . GLN C 1 27  ? 45.765  -30.974 49.629  1.00 25.97 ? 29   GLN C N   1 
ATOM   4043 C  CA  . GLN C 1 27  ? 45.485  -30.775 51.045  1.00 26.98 ? 29   GLN C CA  1 
ATOM   4044 C  C   . GLN C 1 27  ? 46.324  -29.640 51.638  1.00 27.18 ? 29   GLN C C   1 
ATOM   4045 O  O   . GLN C 1 27  ? 47.285  -29.166 51.018  1.00 26.36 ? 29   GLN C O   1 
ATOM   4046 C  CB  . GLN C 1 27  ? 45.742  -32.071 51.802  1.00 25.82 ? 29   GLN C CB  1 
ATOM   4047 C  CG  . GLN C 1 27  ? 44.776  -33.188 51.438  1.00 26.53 ? 29   GLN C CG  1 
ATOM   4048 C  CD  . GLN C 1 27  ? 43.393  -32.977 52.057  1.00 26.49 ? 29   GLN C CD  1 
ATOM   4049 O  OE1 . GLN C 1 27  ? 43.210  -33.173 53.253  1.00 25.30 ? 29   GLN C OE1 1 
ATOM   4050 N  NE2 . GLN C 1 27  ? 42.436  -32.567 51.248  1.00 25.85 ? 29   GLN C NE2 1 
ATOM   4051 N  N   . SER C 1 28  ? 45.910  -29.193 52.823  1.00 24.71 ? 30   SER C N   1 
ATOM   4052 C  CA  . SER C 1 28  ? 46.614  -28.160 53.609  1.00 23.32 ? 30   SER C CA  1 
ATOM   4053 C  C   . SER C 1 28  ? 46.960  -28.783 54.958  1.00 23.49 ? 30   SER C C   1 
ATOM   4054 O  O   . SER C 1 28  ? 46.358  -29.792 55.349  1.00 24.22 ? 30   SER C O   1 
ATOM   4055 C  CB  . SER C 1 28  ? 45.717  -26.932 53.795  1.00 22.67 ? 30   SER C CB  1 
ATOM   4056 O  OG  . SER C 1 28  ? 45.504  -26.251 52.579  1.00 21.35 ? 30   SER C OG  1 
ATOM   4057 N  N   . PRO C 1 29  ? 47.944  -28.250 55.690  1.00 22.29 ? 31   PRO C N   1 
ATOM   4058 C  CA  . PRO C 1 29  ? 48.757  -27.111 55.336  1.00 23.09 ? 31   PRO C CA  1 
ATOM   4059 C  C   . PRO C 1 29  ? 49.935  -27.549 54.460  1.00 25.32 ? 31   PRO C C   1 
ATOM   4060 O  O   . PRO C 1 29  ? 50.108  -28.751 54.217  1.00 25.00 ? 31   PRO C O   1 
ATOM   4061 C  CB  . PRO C 1 29  ? 49.277  -26.646 56.690  1.00 22.73 ? 31   PRO C CB  1 
ATOM   4062 C  CG  . PRO C 1 29  ? 49.447  -27.921 57.428  1.00 22.46 ? 31   PRO C CG  1 
ATOM   4063 C  CD  . PRO C 1 29  ? 48.299  -28.786 57.004  1.00 22.53 ? 31   PRO C CD  1 
ATOM   4064 N  N   . VAL C 1 30  ? 50.708  -26.564 54.019  1.00 27.26 ? 32   VAL C N   1 
ATOM   4065 C  CA  . VAL C 1 30  ? 51.818  -26.764 53.072  1.00 28.66 ? 32   VAL C CA  1 
ATOM   4066 C  C   . VAL C 1 30  ? 53.082  -26.048 53.541  1.00 30.61 ? 32   VAL C C   1 
ATOM   4067 O  O   . VAL C 1 30  ? 53.046  -25.182 54.420  1.00 30.97 ? 32   VAL C O   1 
ATOM   4068 C  CB  . VAL C 1 30  ? 51.462  -26.293 51.648  1.00 26.08 ? 32   VAL C CB  1 
ATOM   4069 C  CG1 . VAL C 1 30  ? 50.259  -27.070 51.099  1.00 27.47 ? 32   VAL C CG1 1 
ATOM   4070 C  CG2 . VAL C 1 30  ? 51.187  -24.790 51.564  1.00 26.65 ? 32   VAL C CG2 1 
ATOM   4071 N  N   . ASP C 1 31  ? 54.210  -26.437 52.950  1.00 32.52 ? 33   ASP C N   1 
ATOM   4072 C  CA  . ASP C 1 31  ? 55.462  -25.700 53.117  1.00 31.71 ? 33   ASP C CA  1 
ATOM   4073 C  C   . ASP C 1 31  ? 55.521  -24.599 52.079  1.00 30.68 ? 33   ASP C C   1 
ATOM   4074 O  O   . ASP C 1 31  ? 55.475  -24.865 50.878  1.00 32.52 ? 33   ASP C O   1 
ATOM   4075 C  CB  . ASP C 1 31  ? 56.665  -26.639 52.989  1.00 34.95 ? 33   ASP C CB  1 
ATOM   4076 C  CG  . ASP C 1 31  ? 57.972  -25.930 53.228  1.00 35.61 ? 33   ASP C CG  1 
ATOM   4077 O  OD1 . ASP C 1 31  ? 58.116  -25.279 54.291  1.00 35.36 ? 33   ASP C OD1 1 
ATOM   4078 O  OD2 . ASP C 1 31  ? 58.840  -25.986 52.338  1.00 38.03 ? 33   ASP C OD2 1 
ATOM   4079 N  N   . ILE C 1 32  ? 55.587  -23.355 52.534  1.00 29.26 ? 34   ILE C N   1 
ATOM   4080 C  CA  . ILE C 1 32  ? 55.708  -22.214 51.640  1.00 31.26 ? 34   ILE C CA  1 
ATOM   4081 C  C   . ILE C 1 32  ? 57.202  -21.992 51.362  1.00 35.34 ? 34   ILE C C   1 
ATOM   4082 O  O   . ILE C 1 32  ? 58.009  -21.887 52.298  1.00 35.24 ? 34   ILE C O   1 
ATOM   4083 C  CB  . ILE C 1 32  ? 55.104  -20.942 52.255  1.00 32.43 ? 34   ILE C CB  1 
ATOM   4084 C  CG1 . ILE C 1 32  ? 53.589  -21.127 52.498  1.00 34.40 ? 34   ILE C CG1 1 
ATOM   4085 C  CG2 . ILE C 1 32  ? 55.344  -19.741 51.360  1.00 33.15 ? 34   ILE C CG2 1 
ATOM   4086 C  CD1 . ILE C 1 32  ? 53.067  -20.260 53.620  1.00 34.81 ? 34   ILE C CD1 1 
ATOM   4087 N  N   . ARG C 1 33  ? 57.546  -21.947 50.077  1.00 35.98 ? 35   ARG C N   1 
ATOM   4088 C  CA  . ARG C 1 33  ? 58.906  -21.690 49.625  1.00 37.60 ? 35   ARG C CA  1 
ATOM   4089 C  C   . ARG C 1 33  ? 58.864  -20.388 48.865  1.00 34.21 ? 35   ARG C C   1 
ATOM   4090 O  O   . ARG C 1 33  ? 58.486  -20.366 47.695  1.00 36.99 ? 35   ARG C O   1 
ATOM   4091 C  CB  . ARG C 1 33  ? 59.398  -22.835 48.751  1.00 41.78 ? 35   ARG C CB  1 
ATOM   4092 C  CG  . ARG C 1 33  ? 59.412  -24.168 49.478  1.00 45.19 ? 35   ARG C CG  1 
ATOM   4093 C  CD  . ARG C 1 33  ? 60.217  -25.199 48.718  1.00 51.03 ? 35   ARG C CD  1 
ATOM   4094 N  NE  . ARG C 1 33  ? 61.628  -24.813 48.648  1.00 57.22 ? 35   ARG C NE  1 
ATOM   4095 C  CZ  . ARG C 1 33  ? 62.554  -25.376 47.866  1.00 61.20 ? 35   ARG C CZ  1 
ATOM   4096 N  NH1 . ARG C 1 33  ? 62.254  -26.391 47.050  1.00 59.72 ? 35   ARG C NH1 1 
ATOM   4097 N  NH2 . ARG C 1 33  ? 63.803  -24.910 47.902  1.00 62.63 ? 35   ARG C NH2 1 
ATOM   4098 N  N   . PRO C 1 34  ? 59.228  -19.274 49.528  1.00 35.29 ? 36   PRO C N   1 
ATOM   4099 C  CA  . PRO C 1 34  ? 59.027  -17.980 48.878  1.00 37.52 ? 36   PRO C CA  1 
ATOM   4100 C  C   . PRO C 1 34  ? 59.756  -17.803 47.538  1.00 40.01 ? 36   PRO C C   1 
ATOM   4101 O  O   . PRO C 1 34  ? 59.233  -17.102 46.668  1.00 37.85 ? 36   PRO C O   1 
ATOM   4102 C  CB  . PRO C 1 34  ? 59.520  -16.981 49.930  1.00 37.78 ? 36   PRO C CB  1 
ATOM   4103 C  CG  . PRO C 1 34  ? 59.337  -17.692 51.220  1.00 36.87 ? 36   PRO C CG  1 
ATOM   4104 C  CD  . PRO C 1 34  ? 59.716  -19.108 50.908  1.00 36.07 ? 36   PRO C CD  1 
ATOM   4105 N  N   . GLN C 1 35  ? 60.928  -18.442 47.383  1.00 46.59 ? 37   GLN C N   1 
ATOM   4106 C  CA  . GLN C 1 35  ? 61.676  -18.463 46.103  1.00 47.68 ? 37   GLN C CA  1 
ATOM   4107 C  C   . GLN C 1 35  ? 60.811  -18.989 44.960  1.00 48.28 ? 37   GLN C C   1 
ATOM   4108 O  O   . GLN C 1 35  ? 60.862  -18.452 43.851  1.00 50.27 ? 37   GLN C O   1 
ATOM   4109 C  CB  . GLN C 1 35  ? 62.951  -19.326 46.213  1.00 47.51 ? 37   GLN C CB  1 
ATOM   4110 N  N   . LEU C 1 36  ? 60.002  -20.012 45.248  1.00 46.71 ? 38   LEU C N   1 
ATOM   4111 C  CA  . LEU C 1 36  ? 59.131  -20.656 44.253  1.00 43.59 ? 38   LEU C CA  1 
ATOM   4112 C  C   . LEU C 1 36  ? 57.698  -20.095 44.118  1.00 42.14 ? 38   LEU C C   1 
ATOM   4113 O  O   . LEU C 1 36  ? 56.897  -20.648 43.365  1.00 40.12 ? 38   LEU C O   1 
ATOM   4114 C  CB  . LEU C 1 36  ? 59.079  -22.167 44.537  1.00 44.73 ? 38   LEU C CB  1 
ATOM   4115 C  CG  . LEU C 1 36  ? 60.442  -22.881 44.645  1.00 46.83 ? 38   LEU C CG  1 
ATOM   4116 C  CD1 . LEU C 1 36  ? 60.260  -24.387 44.795  1.00 47.74 ? 38   LEU C CD1 1 
ATOM   4117 C  CD2 . LEU C 1 36  ? 61.354  -22.582 43.457  1.00 45.83 ? 38   LEU C CD2 1 
ATOM   4118 N  N   . ALA C 1 37  ? 57.367  -19.011 44.821  1.00 39.79 ? 39   ALA C N   1 
ATOM   4119 C  CA  . ALA C 1 37  ? 56.023  -18.453 44.746  1.00 36.49 ? 39   ALA C CA  1 
ATOM   4120 C  C   . ALA C 1 37  ? 55.904  -17.537 43.542  1.00 38.35 ? 39   ALA C C   1 
ATOM   4121 O  O   . ALA C 1 37  ? 56.869  -16.868 43.166  1.00 38.38 ? 39   ALA C O   1 
ATOM   4122 C  CB  . ALA C 1 37  ? 55.675  -17.701 46.021  1.00 36.56 ? 39   ALA C CB  1 
ATOM   4123 N  N   . ALA C 1 38  ? 54.722  -17.508 42.937  1.00 35.61 ? 40   ALA C N   1 
ATOM   4124 C  CA  . ALA C 1 38  ? 54.457  -16.643 41.803  1.00 35.28 ? 40   ALA C CA  1 
ATOM   4125 C  C   . ALA C 1 38  ? 53.983  -15.289 42.283  1.00 39.28 ? 40   ALA C C   1 
ATOM   4126 O  O   . ALA C 1 38  ? 52.889  -15.179 42.853  1.00 38.01 ? 40   ALA C O   1 
ATOM   4127 C  CB  . ALA C 1 38  ? 53.414  -17.255 40.882  1.00 36.15 ? 40   ALA C CB  1 
ATOM   4128 N  N   . PHE C 1 39  ? 54.780  -14.253 42.020  1.00 38.79 ? 41   PHE C N   1 
ATOM   4129 C  CA  . PHE C 1 39  ? 54.340  -12.890 42.238  1.00 40.54 ? 41   PHE C CA  1 
ATOM   4130 C  C   . PHE C 1 39  ? 53.122  -12.583 41.376  1.00 38.96 ? 41   PHE C C   1 
ATOM   4131 O  O   . PHE C 1 39  ? 53.166  -12.772 40.169  1.00 42.24 ? 41   PHE C O   1 
ATOM   4132 C  CB  . PHE C 1 39  ? 55.474  -11.888 41.952  1.00 42.43 ? 41   PHE C CB  1 
ATOM   4133 C  CG  . PHE C 1 39  ? 55.046  -10.444 42.029  1.00 44.77 ? 41   PHE C CG  1 
ATOM   4134 C  CD1 . PHE C 1 39  ? 54.293  -9.974  43.118  1.00 45.90 ? 41   PHE C CD1 1 
ATOM   4135 C  CD2 . PHE C 1 39  ? 55.394  -9.547  41.021  1.00 45.80 ? 41   PHE C CD2 1 
ATOM   4136 C  CE1 . PHE C 1 39  ? 53.896  -8.649  43.184  1.00 46.65 ? 41   PHE C CE1 1 
ATOM   4137 C  CE2 . PHE C 1 39  ? 55.005  -8.213  41.084  1.00 46.09 ? 41   PHE C CE2 1 
ATOM   4138 C  CZ  . PHE C 1 39  ? 54.251  -7.764  42.164  1.00 47.74 ? 41   PHE C CZ  1 
ATOM   4139 N  N   . SER C 1 40  ? 52.032  -12.140 42.008  1.00 36.35 ? 42   SER C N   1 
ATOM   4140 C  CA  A SER C 1 40  ? 50.803  -11.801 41.309  0.50 37.06 ? 42   SER C CA  1 
ATOM   4141 C  CA  B SER C 1 40  ? 50.822  -11.756 41.273  0.50 38.17 ? 42   SER C CA  1 
ATOM   4142 C  C   . SER C 1 40  ? 50.323  -10.394 41.730  1.00 38.56 ? 42   SER C C   1 
ATOM   4143 O  O   . SER C 1 40  ? 49.768  -10.252 42.828  1.00 37.37 ? 42   SER C O   1 
ATOM   4144 C  CB  A SER C 1 40  ? 49.748  -12.873 41.633  0.50 36.85 ? 42   SER C CB  1 
ATOM   4145 C  CB  B SER C 1 40  ? 49.691  -12.777 41.392  0.50 39.35 ? 42   SER C CB  1 
ATOM   4146 O  OG  A SER C 1 40  ? 50.331  -14.170 41.663  0.50 34.70 ? 42   SER C OG  1 
ATOM   4147 O  OG  B SER C 1 40  ? 48.594  -12.339 40.591  0.50 39.32 ? 42   SER C OG  1 
ATOM   4148 N  N   . PRO C 1 41  ? 50.519  -9.360  40.873  1.00 40.23 ? 43   PRO C N   1 
ATOM   4149 C  CA  . PRO C 1 41  ? 50.075  -8.010  41.273  1.00 40.03 ? 43   PRO C CA  1 
ATOM   4150 C  C   . PRO C 1 41  ? 48.570  -7.791  41.327  1.00 38.78 ? 43   PRO C C   1 
ATOM   4151 O  O   . PRO C 1 41  ? 48.136  -6.718  41.742  1.00 39.16 ? 43   PRO C O   1 
ATOM   4152 C  CB  . PRO C 1 41  ? 50.708  -7.082  40.222  1.00 42.22 ? 43   PRO C CB  1 
ATOM   4153 C  CG  . PRO C 1 41  ? 51.126  -7.952  39.097  1.00 41.55 ? 43   PRO C CG  1 
ATOM   4154 C  CD  . PRO C 1 41  ? 51.340  -9.324  39.644  1.00 41.38 ? 43   PRO C CD  1 
ATOM   4155 N  N   . ALA C 1 42  ? 47.784  -8.777  40.898  1.00 34.68 ? 44   ALA C N   1 
ATOM   4156 C  CA  . ALA C 1 42  ? 46.341  -8.763  41.101  1.00 35.39 ? 44   ALA C CA  1 
ATOM   4157 C  C   . ALA C 1 42  ? 45.944  -8.860  42.580  1.00 32.55 ? 44   ALA C C   1 
ATOM   4158 O  O   . ALA C 1 42  ? 44.833  -8.460  42.939  1.00 35.64 ? 44   ALA C O   1 
ATOM   4159 C  CB  . ALA C 1 42  ? 45.693  -9.912  40.331  1.00 35.77 ? 44   ALA C CB  1 
ATOM   4160 N  N   . LEU C 1 43  ? 46.825  -9.431  43.402  1.00 33.47 ? 45   LEU C N   1 
ATOM   4161 C  CA  . LEU C 1 43  ? 46.571  -9.656  44.828  1.00 32.68 ? 45   LEU C CA  1 
ATOM   4162 C  C   . LEU C 1 43  ? 46.734  -8.368  45.634  1.00 33.88 ? 45   LEU C C   1 
ATOM   4163 O  O   . LEU C 1 43  ? 47.848  -8.004  46.034  1.00 33.25 ? 45   LEU C O   1 
ATOM   4164 C  CB  . LEU C 1 43  ? 47.496  -10.742 45.366  1.00 31.85 ? 45   LEU C CB  1 
ATOM   4165 C  CG  . LEU C 1 43  ? 47.352  -12.132 44.723  1.00 32.38 ? 45   LEU C CG  1 
ATOM   4166 C  CD1 . LEU C 1 43  ? 48.336  -13.078 45.369  1.00 32.39 ? 45   LEU C CD1 1 
ATOM   4167 C  CD2 . LEU C 1 43  ? 45.934  -12.667 44.843  1.00 33.90 ? 45   LEU C CD2 1 
ATOM   4168 N  N   . ARG C 1 44  ? 45.600  -7.709  45.860  1.00 34.58 ? 46   ARG C N   1 
ATOM   4169 C  CA  . ARG C 1 44  ? 45.527  -6.415  46.529  1.00 36.79 ? 46   ARG C CA  1 
ATOM   4170 C  C   . ARG C 1 44  ? 45.439  -6.561  48.057  1.00 34.11 ? 46   ARG C C   1 
ATOM   4171 O  O   . ARG C 1 44  ? 45.296  -7.673  48.575  1.00 29.95 ? 46   ARG C O   1 
ATOM   4172 C  CB  . ARG C 1 44  ? 44.329  -5.624  45.993  1.00 39.27 ? 46   ARG C CB  1 
ATOM   4173 C  CG  . ARG C 1 44  ? 44.270  -5.405  44.477  1.00 44.73 ? 46   ARG C CG  1 
ATOM   4174 C  CD  . ARG C 1 44  ? 45.604  -5.041  43.817  1.00 47.77 ? 46   ARG C CD  1 
ATOM   4175 N  NE  . ARG C 1 44  ? 46.382  -4.041  44.563  1.00 52.08 ? 46   ARG C NE  1 
ATOM   4176 C  CZ  . ARG C 1 44  ? 47.690  -3.794  44.408  1.00 57.11 ? 46   ARG C CZ  1 
ATOM   4177 N  NH1 . ARG C 1 44  ? 48.423  -4.449  43.505  1.00 59.08 ? 46   ARG C NH1 1 
ATOM   4178 N  NH2 . ARG C 1 44  ? 48.283  -2.867  45.168  1.00 58.09 ? 46   ARG C NH2 1 
ATOM   4179 N  N   . PRO C 1 45  ? 45.564  -5.441  48.792  1.00 32.48 ? 47   PRO C N   1 
ATOM   4180 C  CA  . PRO C 1 45  ? 45.422  -5.577  50.234  1.00 32.29 ? 47   PRO C CA  1 
ATOM   4181 C  C   . PRO C 1 45  ? 44.036  -6.101  50.643  1.00 27.83 ? 47   PRO C C   1 
ATOM   4182 O  O   . PRO C 1 45  ? 43.027  -5.737  50.056  1.00 28.07 ? 47   PRO C O   1 
ATOM   4183 C  CB  . PRO C 1 45  ? 45.648  -4.142  50.742  1.00 34.08 ? 47   PRO C CB  1 
ATOM   4184 C  CG  . PRO C 1 45  ? 46.556  -3.545  49.726  1.00 33.87 ? 47   PRO C CG  1 
ATOM   4185 C  CD  . PRO C 1 45  ? 46.014  -4.084  48.428  1.00 33.91 ? 47   PRO C CD  1 
ATOM   4186 N  N   . LEU C 1 46  ? 44.034  -6.978  51.625  1.00 30.58 ? 48   LEU C N   1 
ATOM   4187 C  CA  . LEU C 1 46  ? 42.802  -7.526  52.196  1.00 32.25 ? 48   LEU C CA  1 
ATOM   4188 C  C   . LEU C 1 46  ? 42.069  -6.411  52.904  1.00 33.67 ? 48   LEU C C   1 
ATOM   4189 O  O   . LEU C 1 46  ? 42.702  -5.506  53.433  1.00 32.82 ? 48   LEU C O   1 
ATOM   4190 C  CB  . LEU C 1 46  ? 43.116  -8.604  53.226  1.00 33.52 ? 48   LEU C CB  1 
ATOM   4191 C  CG  . LEU C 1 46  ? 44.036  -9.737  52.790  1.00 37.12 ? 48   LEU C CG  1 
ATOM   4192 C  CD1 . LEU C 1 46  ? 44.196  -10.709 53.946  1.00 40.01 ? 48   LEU C CD1 1 
ATOM   4193 C  CD2 . LEU C 1 46  ? 43.518  -10.416 51.528  1.00 36.09 ? 48   LEU C CD2 1 
ATOM   4194 N  N   . GLU C 1 47  ? 40.746  -6.499  52.921  1.00 33.25 ? 49   GLU C N   1 
ATOM   4195 C  CA  . GLU C 1 47  ? 39.898  -5.521  53.579  1.00 35.53 ? 49   GLU C CA  1 
ATOM   4196 C  C   . GLU C 1 47  ? 38.929  -6.219  54.528  1.00 35.72 ? 49   GLU C C   1 
ATOM   4197 O  O   . GLU C 1 47  ? 38.169  -7.100  54.102  1.00 34.75 ? 49   GLU C O   1 
ATOM   4198 C  CB  . GLU C 1 47  ? 39.143  -4.713  52.536  1.00 39.36 ? 49   GLU C CB  1 
ATOM   4199 C  CG  . GLU C 1 47  ? 40.081  -3.854  51.701  1.00 43.11 ? 49   GLU C CG  1 
ATOM   4200 C  CD  . GLU C 1 47  ? 39.386  -2.992  50.670  1.00 46.01 ? 49   GLU C CD  1 
ATOM   4201 O  OE1 . GLU C 1 47  ? 38.152  -3.088  50.502  1.00 50.99 ? 49   GLU C OE1 1 
ATOM   4202 O  OE2 . GLU C 1 47  ? 40.095  -2.218  50.001  1.00 51.32 ? 49   GLU C OE2 1 
ATOM   4203 N  N   . LEU C 1 48  ? 39.000  -5.843  55.807  1.00 34.10 ? 50   LEU C N   1 
ATOM   4204 C  CA  . LEU C 1 48  ? 38.103  -6.339  56.855  1.00 35.18 ? 50   LEU C CA  1 
ATOM   4205 C  C   . LEU C 1 48  ? 37.163  -5.208  57.274  1.00 34.74 ? 50   LEU C C   1 
ATOM   4206 O  O   . LEU C 1 48  ? 37.609  -4.073  57.430  1.00 37.71 ? 50   LEU C O   1 
ATOM   4207 C  CB  . LEU C 1 48  ? 38.897  -6.801  58.071  1.00 35.00 ? 50   LEU C CB  1 
ATOM   4208 C  CG  . LEU C 1 48  ? 40.098  -7.719  57.870  1.00 37.63 ? 50   LEU C CG  1 
ATOM   4209 C  CD1 . LEU C 1 48  ? 40.556  -8.321  59.176  1.00 38.52 ? 50   LEU C CD1 1 
ATOM   4210 C  CD2 . LEU C 1 48  ? 39.775  -8.824  56.903  1.00 40.27 ? 50   LEU C CD2 1 
ATOM   4211 N  N   . LEU C 1 49  ? 35.876  -5.510  57.413  1.00 32.51 ? 51   LEU C N   1 
ATOM   4212 C  CA  . LEU C 1 49  ? 34.884  -4.574  57.991  1.00 33.49 ? 51   LEU C CA  1 
ATOM   4213 C  C   . LEU C 1 49  ? 34.124  -5.280  59.114  1.00 31.48 ? 51   LEU C C   1 
ATOM   4214 O  O   . LEU C 1 49  ? 33.773  -6.468  58.999  1.00 29.59 ? 51   LEU C O   1 
ATOM   4215 C  CB  . LEU C 1 49  ? 33.887  -4.070  56.934  1.00 35.54 ? 51   LEU C CB  1 
ATOM   4216 C  CG  . LEU C 1 49  ? 34.467  -3.390  55.678  1.00 38.90 ? 51   LEU C CG  1 
ATOM   4217 C  CD1 . LEU C 1 49  ? 33.425  -3.299  54.566  1.00 41.06 ? 51   LEU C CD1 1 
ATOM   4218 C  CD2 . LEU C 1 49  ? 35.017  -2.006  56.010  1.00 40.69 ? 51   LEU C CD2 1 
ATOM   4219 N  N   . GLY C 1 50  ? 33.876  -4.544  60.199  1.00 29.96 ? 52   GLY C N   1 
ATOM   4220 C  CA  . GLY C 1 50  ? 33.125  -5.041  61.328  1.00 27.77 ? 52   GLY C CA  1 
ATOM   4221 C  C   . GLY C 1 50  ? 33.915  -5.810  62.362  1.00 27.03 ? 52   GLY C C   1 
ATOM   4222 O  O   . GLY C 1 50  ? 33.323  -6.367  63.282  1.00 27.73 ? 52   GLY C O   1 
ATOM   4223 N  N   . PHE C 1 51  ? 35.237  -5.854  62.234  1.00 25.91 ? 53   PHE C N   1 
ATOM   4224 C  CA  . PHE C 1 51  ? 36.083  -6.632  63.144  1.00 25.89 ? 53   PHE C CA  1 
ATOM   4225 C  C   . PHE C 1 51  ? 36.323  -5.962  64.513  1.00 26.64 ? 53   PHE C C   1 
ATOM   4226 O  O   . PHE C 1 51  ? 36.766  -6.635  65.454  1.00 24.43 ? 53   PHE C O   1 
ATOM   4227 C  CB  . PHE C 1 51  ? 37.428  -6.993  62.482  1.00 26.08 ? 53   PHE C CB  1 
ATOM   4228 C  CG  . PHE C 1 51  ? 37.355  -8.193  61.557  1.00 25.86 ? 53   PHE C CG  1 
ATOM   4229 C  CD1 . PHE C 1 51  ? 36.555  -8.169  60.430  1.00 26.32 ? 53   PHE C CD1 1 
ATOM   4230 C  CD2 . PHE C 1 51  ? 38.088  -9.350  61.828  1.00 26.47 ? 53   PHE C CD2 1 
ATOM   4231 C  CE1 . PHE C 1 51  ? 36.479  -9.272  59.581  1.00 26.42 ? 53   PHE C CE1 1 
ATOM   4232 C  CE2 . PHE C 1 51  ? 38.023  -10.459 60.987  1.00 27.42 ? 53   PHE C CE2 1 
ATOM   4233 C  CZ  . PHE C 1 51  ? 37.215  -10.416 59.862  1.00 26.99 ? 53   PHE C CZ  1 
ATOM   4234 N  N   . GLN C 1 52  ? 36.020  -4.664  64.628  1.00 27.94 ? 54   GLN C N   1 
ATOM   4235 C  CA  . GLN C 1 52  ? 36.187  -3.937  65.913  1.00 31.11 ? 54   GLN C CA  1 
ATOM   4236 C  C   . GLN C 1 52  ? 34.917  -4.070  66.728  1.00 28.51 ? 54   GLN C C   1 
ATOM   4237 O  O   . GLN C 1 52  ? 34.008  -3.240  66.640  1.00 26.27 ? 54   GLN C O   1 
ATOM   4238 C  CB  . GLN C 1 52  ? 36.525  -2.452  65.704  1.00 33.36 ? 54   GLN C CB  1 
ATOM   4239 C  CG  . GLN C 1 52  ? 37.938  -2.215  65.228  1.00 37.63 ? 54   GLN C CG  1 
ATOM   4240 C  CD  . GLN C 1 52  ? 38.111  -2.520  63.755  1.00 42.13 ? 54   GLN C CD  1 
ATOM   4241 O  OE1 . GLN C 1 52  ? 37.477  -1.888  62.902  1.00 51.03 ? 54   GLN C OE1 1 
ATOM   4242 N  NE2 . GLN C 1 52  ? 38.963  -3.486  63.442  1.00 43.03 ? 54   GLN C NE2 1 
ATOM   4243 N  N   . LEU C 1 53  ? 34.853  -5.136  67.502  1.00 27.05 ? 55   LEU C N   1 
ATOM   4244 C  CA  . LEU C 1 53  ? 33.629  -5.464  68.223  1.00 27.59 ? 55   LEU C CA  1 
ATOM   4245 C  C   . LEU C 1 53  ? 33.559  -4.723  69.551  1.00 26.71 ? 55   LEU C C   1 
ATOM   4246 O  O   . LEU C 1 53  ? 34.582  -4.574  70.211  1.00 25.39 ? 55   LEU C O   1 
ATOM   4247 C  CB  . LEU C 1 53  ? 33.562  -6.960  68.489  1.00 26.75 ? 55   LEU C CB  1 
ATOM   4248 C  CG  . LEU C 1 53  ? 33.498  -7.862  67.257  1.00 27.95 ? 55   LEU C CG  1 
ATOM   4249 C  CD1 . LEU C 1 53  ? 33.642  -9.321  67.678  1.00 28.36 ? 55   LEU C CD1 1 
ATOM   4250 C  CD2 . LEU C 1 53  ? 32.180  -7.680  66.527  1.00 28.90 ? 55   LEU C CD2 1 
ATOM   4251 N  N   . PRO C 1 54  ? 32.342  -4.326  69.969  1.00 26.86 ? 56   PRO C N   1 
ATOM   4252 C  CA  . PRO C 1 54  ? 32.145  -3.800  71.314  1.00 27.79 ? 56   PRO C CA  1 
ATOM   4253 C  C   . PRO C 1 54  ? 32.140  -4.931  72.368  1.00 29.25 ? 56   PRO C C   1 
ATOM   4254 O  O   . PRO C 1 54  ? 32.037  -6.118  72.007  1.00 27.24 ? 56   PRO C O   1 
ATOM   4255 C  CB  . PRO C 1 54  ? 30.772  -3.157  71.223  1.00 27.66 ? 56   PRO C CB  1 
ATOM   4256 C  CG  . PRO C 1 54  ? 30.031  -4.014  70.276  1.00 27.63 ? 56   PRO C CG  1 
ATOM   4257 C  CD  . PRO C 1 54  ? 31.055  -4.455  69.257  1.00 27.66 ? 56   PRO C CD  1 
ATOM   4258 N  N   . PRO C 1 55  ? 32.246  -4.572  73.663  1.00 28.62 ? 57   PRO C N   1 
ATOM   4259 C  CA  . PRO C 1 55  ? 32.305  -5.620  74.699  1.00 27.21 ? 57   PRO C CA  1 
ATOM   4260 C  C   . PRO C 1 55  ? 31.110  -6.586  74.700  1.00 26.46 ? 57   PRO C C   1 
ATOM   4261 O  O   . PRO C 1 55  ? 31.311  -7.782  74.937  1.00 24.71 ? 57   PRO C O   1 
ATOM   4262 C  CB  . PRO C 1 55  ? 32.402  -4.826  76.006  1.00 28.53 ? 57   PRO C CB  1 
ATOM   4263 C  CG  . PRO C 1 55  ? 33.046  -3.528  75.608  1.00 30.20 ? 57   PRO C CG  1 
ATOM   4264 C  CD  . PRO C 1 55  ? 32.602  -3.238  74.197  1.00 28.25 ? 57   PRO C CD  1 
ATOM   4265 N  N   . LEU C 1 56  ? 29.908  -6.075  74.397  1.00 26.29 ? 58   LEU C N   1 
ATOM   4266 C  CA  . LEU C 1 56  ? 28.688  -6.866  74.344  1.00 25.03 ? 58   LEU C CA  1 
ATOM   4267 C  C   . LEU C 1 56  ? 28.092  -6.823  72.932  1.00 25.95 ? 58   LEU C C   1 
ATOM   4268 O  O   . LEU C 1 56  ? 28.044  -5.762  72.316  1.00 24.82 ? 58   LEU C O   1 
ATOM   4269 C  CB  . LEU C 1 56  ? 27.633  -6.349  75.349  1.00 26.12 ? 58   LEU C CB  1 
ATOM   4270 C  CG  . LEU C 1 56  ? 28.019  -6.378  76.820  1.00 26.00 ? 58   LEU C CG  1 
ATOM   4271 C  CD1 . LEU C 1 56  ? 26.864  -5.870  77.672  1.00 28.47 ? 58   LEU C CD1 1 
ATOM   4272 C  CD2 . LEU C 1 56  ? 28.451  -7.778  77.260  1.00 27.06 ? 58   LEU C CD2 1 
ATOM   4273 N  N   . PRO C 1 57  ? 27.571  -7.935  72.429  1.00 26.52 ? 59   PRO C N   1 
ATOM   4274 C  CA  . PRO C 1 57  ? 27.368  -9.175  73.182  1.00 26.19 ? 59   PRO C CA  1 
ATOM   4275 C  C   . PRO C 1 57  ? 28.676  -9.948  73.318  1.00 26.36 ? 59   PRO C C   1 
ATOM   4276 O  O   . PRO C 1 57  ? 29.613  -9.739  72.535  1.00 25.85 ? 59   PRO C O   1 
ATOM   4277 C  CB  . PRO C 1 57  ? 26.364  -9.954  72.304  1.00 26.96 ? 59   PRO C CB  1 
ATOM   4278 C  CG  . PRO C 1 57  ? 26.519  -9.353  70.935  1.00 27.76 ? 59   PRO C CG  1 
ATOM   4279 C  CD  . PRO C 1 57  ? 26.762  -7.901  71.197  1.00 27.59 ? 59   PRO C CD  1 
ATOM   4280 N  N   . GLU C 1 58  ? 28.742  -10.822 74.305  1.00 25.43 ? 60   GLU C N   1 
ATOM   4281 C  CA  . GLU C 1 58  ? 29.939  -11.633 74.494  1.00 26.56 ? 60   GLU C CA  1 
ATOM   4282 C  C   . GLU C 1 58  ? 30.011  -12.716 73.414  1.00 25.21 ? 60   GLU C C   1 
ATOM   4283 O  O   . GLU C 1 58  ? 29.012  -13.022 72.770  1.00 25.45 ? 60   GLU C O   1 
ATOM   4284 C  CB  . GLU C 1 58  ? 29.930  -12.269 75.874  1.00 28.05 ? 60   GLU C CB  1 
ATOM   4285 C  CG  . GLU C 1 58  ? 30.123  -11.254 76.984  1.00 30.99 ? 60   GLU C CG  1 
ATOM   4286 C  CD  . GLU C 1 58  ? 30.240  -11.925 78.330  1.00 31.98 ? 60   GLU C CD  1 
ATOM   4287 O  OE1 . GLU C 1 58  ? 29.276  -12.609 78.709  1.00 32.87 ? 60   GLU C OE1 1 
ATOM   4288 O  OE2 . GLU C 1 58  ? 31.288  -11.785 78.980  1.00 33.90 ? 60   GLU C OE2 1 
ATOM   4289 N  N   . LEU C 1 59  ? 31.204  -13.281 73.259  1.00 26.14 ? 61   LEU C N   1 
ATOM   4290 C  CA  . LEU C 1 59  ? 31.496  -14.364 72.315  1.00 25.78 ? 61   LEU C CA  1 
ATOM   4291 C  C   . LEU C 1 59  ? 31.824  -15.652 73.065  1.00 25.33 ? 61   LEU C C   1 
ATOM   4292 O  O   . LEU C 1 59  ? 32.457  -15.597 74.121  1.00 25.90 ? 61   LEU C O   1 
ATOM   4293 C  CB  . LEU C 1 59  ? 32.728  -14.003 71.491  1.00 26.76 ? 61   LEU C CB  1 
ATOM   4294 C  CG  . LEU C 1 59  ? 32.808  -12.624 70.853  1.00 30.04 ? 61   LEU C CG  1 
ATOM   4295 C  CD1 . LEU C 1 59  ? 33.992  -12.539 69.908  1.00 30.59 ? 61   LEU C CD1 1 
ATOM   4296 C  CD2 . LEU C 1 59  ? 31.523  -12.313 70.111  1.00 32.30 ? 61   LEU C CD2 1 
ATOM   4297 N  N   . ARG C 1 60  ? 31.464  -16.797 72.487  1.00 22.79 ? 62   ARG C N   1 
ATOM   4298 C  CA  . ARG C 1 60  ? 31.726  -18.093 73.104  1.00 23.03 ? 62   ARG C CA  1 
ATOM   4299 C  C   . ARG C 1 60  ? 33.161  -18.565 72.728  1.00 23.54 ? 62   ARG C C   1 
ATOM   4300 O  O   . ARG C 1 60  ? 33.548  -18.502 71.556  1.00 21.92 ? 62   ARG C O   1 
ATOM   4301 C  CB  . ARG C 1 60  ? 30.664  -19.095 72.676  1.00 23.89 ? 62   ARG C CB  1 
ATOM   4302 C  CG  . ARG C 1 60  ? 29.242  -18.592 72.969  1.00 25.22 ? 62   ARG C CG  1 
ATOM   4303 C  CD  . ARG C 1 60  ? 28.194  -19.683 72.845  1.00 24.61 ? 62   ARG C CD  1 
ATOM   4304 N  NE  . ARG C 1 60  ? 28.076  -20.495 74.053  1.00 23.82 ? 62   ARG C NE  1 
ATOM   4305 C  CZ  . ARG C 1 60  ? 27.427  -20.134 75.163  1.00 25.07 ? 62   ARG C CZ  1 
ATOM   4306 N  NH1 . ARG C 1 60  ? 26.839  -18.957 75.257  1.00 22.67 ? 62   ARG C NH1 1 
ATOM   4307 N  NH2 . ARG C 1 60  ? 27.381  -20.964 76.202  1.00 24.96 ? 62   ARG C NH2 1 
ATOM   4308 N  N   . LEU C 1 61  ? 33.932  -18.953 73.741  1.00 22.77 ? 63   LEU C N   1 
ATOM   4309 C  CA  . LEU C 1 61  ? 35.306  -19.451 73.602  1.00 23.26 ? 63   LEU C CA  1 
ATOM   4310 C  C   . LEU C 1 61  ? 35.317  -20.862 74.142  1.00 24.36 ? 63   LEU C C   1 
ATOM   4311 O  O   . LEU C 1 61  ? 34.997  -21.091 75.317  1.00 24.26 ? 63   LEU C O   1 
ATOM   4312 C  CB  . LEU C 1 61  ? 36.253  -18.604 74.417  1.00 23.05 ? 63   LEU C CB  1 
ATOM   4313 C  CG  . LEU C 1 61  ? 37.746  -18.910 74.311  1.00 24.37 ? 63   LEU C CG  1 
ATOM   4314 C  CD1 . LEU C 1 61  ? 38.294  -18.386 72.988  1.00 24.14 ? 63   LEU C CD1 1 
ATOM   4315 C  CD2 . LEU C 1 61  ? 38.484  -18.286 75.480  1.00 25.37 ? 63   LEU C CD2 1 
ATOM   4316 N  N   . ARG C 1 62  ? 35.711  -21.811 73.306  1.00 23.82 ? 64   ARG C N   1 
ATOM   4317 C  CA  . ARG C 1 62  ? 35.515  -23.188 73.614  1.00 23.77 ? 64   ARG C CA  1 
ATOM   4318 C  C   . ARG C 1 62  ? 36.790  -23.996 73.442  1.00 24.67 ? 64   ARG C C   1 
ATOM   4319 O  O   . ARG C 1 62  ? 37.466  -23.864 72.432  1.00 22.85 ? 64   ARG C O   1 
ATOM   4320 C  CB  . ARG C 1 62  ? 34.452  -23.733 72.686  1.00 25.45 ? 64   ARG C CB  1 
ATOM   4321 C  CG  . ARG C 1 62  ? 34.161  -25.183 72.934  1.00 28.30 ? 64   ARG C CG  1 
ATOM   4322 C  CD  . ARG C 1 62  ? 32.877  -25.625 72.285  1.00 32.15 ? 64   ARG C CD  1 
ATOM   4323 N  NE  . ARG C 1 62  ? 32.505  -26.922 72.855  1.00 36.50 ? 64   ARG C NE  1 
ATOM   4324 C  CZ  . ARG C 1 62  ? 32.598  -28.097 72.251  1.00 43.13 ? 64   ARG C CZ  1 
ATOM   4325 N  NH1 . ARG C 1 62  ? 33.040  -28.211 70.988  1.00 46.67 ? 64   ARG C NH1 1 
ATOM   4326 N  NH2 . ARG C 1 62  ? 32.218  -29.186 72.926  1.00 47.02 ? 64   ARG C NH2 1 
ATOM   4327 N  N   . ASN C 1 63  ? 37.070  -24.828 74.432  1.00 23.08 ? 65   ASN C N   1 
ATOM   4328 C  CA  . ASN C 1 63  ? 38.026  -25.923 74.300  1.00 25.30 ? 65   ASN C CA  1 
ATOM   4329 C  C   . ASN C 1 63  ? 37.296  -27.125 73.709  1.00 24.21 ? 65   ASN C C   1 
ATOM   4330 O  O   . ASN C 1 63  ? 36.624  -27.856 74.419  1.00 24.97 ? 65   ASN C O   1 
ATOM   4331 C  CB  . ASN C 1 63  ? 38.633  -26.268 75.657  1.00 25.72 ? 65   ASN C CB  1 
ATOM   4332 C  CG  . ASN C 1 63  ? 39.575  -27.482 75.602  1.00 27.86 ? 65   ASN C CG  1 
ATOM   4333 O  OD1 . ASN C 1 63  ? 39.600  -28.242 74.624  1.00 26.61 ? 65   ASN C OD1 1 
ATOM   4334 N  ND2 . ASN C 1 63  ? 40.323  -27.688 76.686  1.00 27.69 ? 65   ASN C ND2 1 
ATOM   4335 N  N   . ASN C 1 64  ? 37.453  -27.335 72.413  1.00 23.34 ? 66   ASN C N   1 
ATOM   4336 C  CA  . ASN C 1 64  ? 36.778  -28.444 71.744  1.00 24.91 ? 66   ASN C CA  1 
ATOM   4337 C  C   . ASN C 1 64  ? 37.575  -29.770 71.738  1.00 25.48 ? 66   ASN C C   1 
ATOM   4338 O  O   . ASN C 1 64  ? 37.144  -30.738 71.127  1.00 25.43 ? 66   ASN C O   1 
ATOM   4339 C  CB  . ASN C 1 64  ? 36.336  -28.042 70.340  1.00 24.45 ? 66   ASN C CB  1 
ATOM   4340 C  CG  . ASN C 1 64  ? 37.488  -27.610 69.452  1.00 24.94 ? 66   ASN C CG  1 
ATOM   4341 O  OD1 . ASN C 1 64  ? 38.595  -28.120 69.574  1.00 23.24 ? 66   ASN C OD1 1 
ATOM   4342 N  ND2 . ASN C 1 64  ? 37.238  -26.638 68.584  1.00 23.73 ? 66   ASN C ND2 1 
ATOM   4343 N  N   . GLY C 1 65  ? 38.716  -29.799 72.420  1.00 27.53 ? 67   GLY C N   1 
ATOM   4344 C  CA  . GLY C 1 65  ? 39.544  -31.002 72.529  1.00 28.84 ? 67   GLY C CA  1 
ATOM   4345 C  C   . GLY C 1 65  ? 40.656  -31.045 71.498  1.00 30.41 ? 67   GLY C C   1 
ATOM   4346 O  O   . GLY C 1 65  ? 41.656  -31.737 71.690  1.00 32.38 ? 67   GLY C O   1 
ATOM   4347 N  N   . HIS C 1 66  ? 40.526  -30.278 70.422  1.00 30.38 ? 68   HIS C N   1 
ATOM   4348 C  CA  . HIS C 1 66  ? 41.608  -30.177 69.438  1.00 30.45 ? 68   HIS C CA  1 
ATOM   4349 C  C   . HIS C 1 66  ? 42.105  -28.754 69.150  1.00 27.60 ? 68   HIS C C   1 
ATOM   4350 O  O   . HIS C 1 66  ? 43.117  -28.569 68.452  1.00 24.55 ? 68   HIS C O   1 
ATOM   4351 C  CB  . HIS C 1 66  ? 41.216  -30.924 68.174  1.00 32.75 ? 68   HIS C CB  1 
ATOM   4352 C  CG  . HIS C 1 66  ? 39.874  -30.559 67.647  1.00 34.99 ? 68   HIS C CG  1 
ATOM   4353 N  ND1 . HIS C 1 66  ? 39.671  -29.460 66.843  1.00 35.92 ? 68   HIS C ND1 1 
ATOM   4354 C  CD2 . HIS C 1 66  ? 38.664  -31.146 67.803  1.00 38.60 ? 68   HIS C CD2 1 
ATOM   4355 C  CE1 . HIS C 1 66  ? 38.387  -29.384 66.525  1.00 38.69 ? 68   HIS C CE1 1 
ATOM   4356 N  NE2 . HIS C 1 66  ? 37.754  -30.395 67.096  1.00 38.89 ? 68   HIS C NE2 1 
ATOM   4357 N  N   . SER C 1 67  ? 41.412  -27.745 69.679  1.00 24.15 ? 69   SER C N   1 
ATOM   4358 C  CA  . SER C 1 67  ? 41.889  -26.365 69.663  1.00 22.03 ? 69   SER C CA  1 
ATOM   4359 C  C   . SER C 1 67  ? 41.092  -25.544 70.686  1.00 20.38 ? 69   SER C C   1 
ATOM   4360 O  O   . SER C 1 67  ? 40.245  -26.072 71.367  1.00 21.90 ? 69   SER C O   1 
ATOM   4361 C  CB  . SER C 1 67  ? 41.744  -25.765 68.276  1.00 21.75 ? 69   SER C CB  1 
ATOM   4362 O  OG  . SER C 1 67  ? 42.285  -24.477 68.231  1.00 24.59 ? 69   SER C OG  1 
ATOM   4363 N  N   . VAL C 1 68  ? 41.406  -24.269 70.782  1.00 22.05 ? 70   VAL C N   1 
ATOM   4364 C  CA  . VAL C 1 68  ? 40.537  -23.304 71.432  1.00 22.79 ? 70   VAL C CA  1 
ATOM   4365 C  C   . VAL C 1 68  ? 39.925  -22.507 70.304  1.00 21.87 ? 70   VAL C C   1 
ATOM   4366 O  O   . VAL C 1 68  ? 40.655  -21.986 69.449  1.00 20.47 ? 70   VAL C O   1 
ATOM   4367 C  CB  . VAL C 1 68  ? 41.260  -22.433 72.481  1.00 23.30 ? 70   VAL C CB  1 
ATOM   4368 C  CG1 . VAL C 1 68  ? 42.497  -21.739 71.944  1.00 22.18 ? 70   VAL C CG1 1 
ATOM   4369 C  CG2 . VAL C 1 68  ? 40.294  -21.404 73.070  1.00 24.77 ? 70   VAL C CG2 1 
ATOM   4370 N  N   . GLN C 1 69  ? 38.588  -22.458 70.264  1.00 21.71 ? 71   GLN C N   1 
ATOM   4371 C  CA  . GLN C 1 69  ? 37.861  -21.801 69.177  1.00 21.05 ? 71   GLN C CA  1 
ATOM   4372 C  C   . GLN C 1 69  ? 36.974  -20.682 69.705  1.00 20.66 ? 71   GLN C C   1 
ATOM   4373 O  O   . GLN C 1 69  ? 36.185  -20.902 70.622  1.00 20.97 ? 71   GLN C O   1 
ATOM   4374 C  CB  . GLN C 1 69  ? 36.960  -22.801 68.448  1.00 21.42 ? 71   GLN C CB  1 
ATOM   4375 C  CG  . GLN C 1 69  ? 36.283  -22.242 67.193  1.00 22.70 ? 71   GLN C CG  1 
ATOM   4376 C  CD  . GLN C 1 69  ? 35.668  -23.317 66.272  1.00 25.13 ? 71   GLN C CD  1 
ATOM   4377 O  OE1 . GLN C 1 69  ? 34.539  -23.180 65.783  1.00 27.94 ? 71   GLN C OE1 1 
ATOM   4378 N  NE2 . GLN C 1 69  ? 36.420  -24.354 65.998  1.00 26.37 ? 71   GLN C NE2 1 
ATOM   4379 N  N   . LEU C 1 70  ? 37.055  -19.532 69.068  1.00 19.17 ? 72   LEU C N   1 
ATOM   4380 C  CA  . LEU C 1 70  ? 36.226  -18.388 69.396  1.00 21.05 ? 72   LEU C CA  1 
ATOM   4381 C  C   . LEU C 1 70  ? 35.194  -18.298 68.300  1.00 21.52 ? 72   LEU C C   1 
ATOM   4382 O  O   . LEU C 1 70  ? 35.544  -18.189 67.116  1.00 20.91 ? 72   LEU C O   1 
ATOM   4383 C  CB  . LEU C 1 70  ? 37.071  -17.110 69.419  1.00 21.72 ? 72   LEU C CB  1 
ATOM   4384 C  CG  . LEU C 1 70  ? 36.372  -15.792 69.783  1.00 22.11 ? 72   LEU C CG  1 
ATOM   4385 C  CD1 . LEU C 1 70  ? 35.959  -15.764 71.250  1.00 24.05 ? 72   LEU C CD1 1 
ATOM   4386 C  CD2 . LEU C 1 70  ? 37.280  -14.625 69.460  1.00 22.78 ? 72   LEU C CD2 1 
ATOM   4387 N  N   . THR C 1 71  ? 33.920  -18.327 68.683  1.00 20.56 ? 73   THR C N   1 
ATOM   4388 C  CA  . THR C 1 71  ? 32.838  -18.156 67.730  1.00 20.27 ? 73   THR C CA  1 
ATOM   4389 C  C   . THR C 1 71  ? 32.684  -16.688 67.425  1.00 20.66 ? 73   THR C C   1 
ATOM   4390 O  O   . THR C 1 71  ? 32.581  -15.885 68.346  1.00 24.36 ? 73   THR C O   1 
ATOM   4391 C  CB  . THR C 1 71  ? 31.524  -18.688 68.304  1.00 20.92 ? 73   THR C CB  1 
ATOM   4392 O  OG1 . THR C 1 71  ? 31.704  -20.061 68.626  1.00 22.02 ? 73   THR C OG1 1 
ATOM   4393 C  CG2 . THR C 1 71  ? 30.363  -18.531 67.336  1.00 20.08 ? 73   THR C CG2 1 
ATOM   4394 N  N   . LEU C 1 72  ? 32.627  -16.340 66.150  1.00 19.06 ? 74   LEU C N   1 
ATOM   4395 C  CA  . LEU C 1 72  ? 32.518  -14.938 65.754  1.00 20.77 ? 74   LEU C CA  1 
ATOM   4396 C  C   . LEU C 1 72  ? 31.064  -14.606 65.390  1.00 20.96 ? 74   LEU C C   1 
ATOM   4397 O  O   . LEU C 1 72  ? 30.337  -15.455 64.880  1.00 23.16 ? 74   LEU C O   1 
ATOM   4398 C  CB  . LEU C 1 72  ? 33.455  -14.621 64.598  1.00 20.32 ? 74   LEU C CB  1 
ATOM   4399 C  CG  . LEU C 1 72  ? 34.945  -14.748 64.929  1.00 20.74 ? 74   LEU C CG  1 
ATOM   4400 C  CD1 . LEU C 1 72  ? 35.802  -14.576 63.675  1.00 20.82 ? 74   LEU C CD1 1 
ATOM   4401 C  CD2 . LEU C 1 72  ? 35.400  -13.765 65.990  1.00 21.70 ? 74   LEU C CD2 1 
ATOM   4402 N  N   . PRO C 1 73  ? 30.641  -13.367 65.641  1.00 23.70 ? 75   PRO C N   1 
ATOM   4403 C  CA  . PRO C 1 73  ? 29.244  -13.007 65.387  1.00 25.03 ? 75   PRO C CA  1 
ATOM   4404 C  C   . PRO C 1 73  ? 29.011  -12.683 63.910  1.00 25.94 ? 75   PRO C C   1 
ATOM   4405 O  O   . PRO C 1 73  ? 29.962  -12.499 63.179  1.00 25.43 ? 75   PRO C O   1 
ATOM   4406 C  CB  . PRO C 1 73  ? 29.064  -11.753 66.233  1.00 25.68 ? 75   PRO C CB  1 
ATOM   4407 C  CG  . PRO C 1 73  ? 30.404  -11.107 66.184  1.00 25.41 ? 75   PRO C CG  1 
ATOM   4408 C  CD  . PRO C 1 73  ? 31.383  -12.261 66.263  1.00 23.55 ? 75   PRO C CD  1 
ATOM   4409 N  N   . PRO C 1 74  ? 27.744  -12.567 63.482  1.00 30.04 ? 76   PRO C N   1 
ATOM   4410 C  CA  . PRO C 1 74  ? 27.478  -12.040 62.134  1.00 29.99 ? 76   PRO C CA  1 
ATOM   4411 C  C   . PRO C 1 74  ? 28.018  -10.633 61.966  1.00 28.81 ? 76   PRO C C   1 
ATOM   4412 O  O   . PRO C 1 74  ? 28.231  -9.937  62.960  1.00 28.07 ? 76   PRO C O   1 
ATOM   4413 C  CB  . PRO C 1 74  ? 25.945  -12.007 62.050  1.00 32.45 ? 76   PRO C CB  1 
ATOM   4414 C  CG  . PRO C 1 74  ? 25.466  -12.891 63.137  1.00 31.82 ? 76   PRO C CG  1 
ATOM   4415 C  CD  . PRO C 1 74  ? 26.498  -12.827 64.225  1.00 32.08 ? 76   PRO C CD  1 
ATOM   4416 N  N   . GLY C 1 75  ? 28.254  -10.249 60.718  1.00 29.66 ? 77   GLY C N   1 
ATOM   4417 C  CA  . GLY C 1 75  ? 28.687  -8.913  60.355  1.00 30.14 ? 77   GLY C CA  1 
ATOM   4418 C  C   . GLY C 1 75  ? 30.177  -8.664  60.217  1.00 30.21 ? 77   GLY C C   1 
ATOM   4419 O  O   . GLY C 1 75  ? 30.575  -7.509  60.081  1.00 31.05 ? 77   GLY C O   1 
ATOM   4420 N  N   . LEU C 1 76  ? 31.015  -9.699  60.269  1.00 28.29 ? 78   LEU C N   1 
ATOM   4421 C  CA  . LEU C 1 76  ? 32.451  -9.511  60.047  1.00 26.74 ? 78   LEU C CA  1 
ATOM   4422 C  C   . LEU C 1 76  ? 32.726  -9.831  58.583  1.00 28.19 ? 78   LEU C C   1 
ATOM   4423 O  O   . LEU C 1 76  ? 32.717  -10.992 58.206  1.00 27.37 ? 78   LEU C O   1 
ATOM   4424 C  CB  . LEU C 1 76  ? 33.295  -10.395 60.970  1.00 26.27 ? 78   LEU C CB  1 
ATOM   4425 C  CG  . LEU C 1 76  ? 33.553  -9.792  62.346  1.00 25.45 ? 78   LEU C CG  1 
ATOM   4426 C  CD1 . LEU C 1 76  ? 32.239  -9.591  63.097  1.00 25.72 ? 78   LEU C CD1 1 
ATOM   4427 C  CD2 . LEU C 1 76  ? 34.520  -10.625 63.158  1.00 25.27 ? 78   LEU C CD2 1 
ATOM   4428 N  N   . GLU C 1 77  ? 32.912  -8.789  57.774  1.00 28.02 ? 79   GLU C N   1 
ATOM   4429 C  CA  . GLU C 1 77  ? 33.084  -8.910  56.329  1.00 28.98 ? 79   GLU C CA  1 
ATOM   4430 C  C   . GLU C 1 77  ? 34.558  -8.900  55.985  1.00 29.07 ? 79   GLU C C   1 
ATOM   4431 O  O   . GLU C 1 77  ? 35.352  -8.138  56.566  1.00 26.80 ? 79   GLU C O   1 
ATOM   4432 C  CB  . GLU C 1 77  ? 32.360  -7.784  55.593  1.00 31.45 ? 79   GLU C CB  1 
ATOM   4433 C  CG  . GLU C 1 77  ? 30.846  -7.869  55.724  1.00 34.79 ? 79   GLU C CG  1 
ATOM   4434 C  CD  . GLU C 1 77  ? 30.115  -6.645  55.192  1.00 39.15 ? 79   GLU C CD  1 
ATOM   4435 O  OE1 . GLU C 1 77  ? 30.109  -5.617  55.878  1.00 46.52 ? 79   GLU C OE1 1 
ATOM   4436 O  OE2 . GLU C 1 77  ? 29.501  -6.707  54.103  1.00 42.41 ? 79   GLU C OE2 1 
ATOM   4437 N  N   . MET C 1 78  ? 34.926  -9.767  55.048  1.00 27.41 ? 80   MET C N   1 
ATOM   4438 C  CA  . MET C 1 78  ? 36.304  -9.875  54.580  1.00 29.14 ? 80   MET C CA  1 
ATOM   4439 C  C   . MET C 1 78  ? 36.291  -10.011 53.060  1.00 29.07 ? 80   MET C C   1 
ATOM   4440 O  O   . MET C 1 78  ? 35.555  -10.825 52.519  1.00 29.22 ? 80   MET C O   1 
ATOM   4441 C  CB  . MET C 1 78  ? 36.999  -11.059 55.248  1.00 29.26 ? 80   MET C CB  1 
ATOM   4442 C  CG  . MET C 1 78  ? 38.481  -11.147 54.989  1.00 31.18 ? 80   MET C CG  1 
ATOM   4443 S  SD  . MET C 1 78  ? 38.899  -12.021 53.466  1.00 29.50 ? 80   MET C SD  1 
ATOM   4444 C  CE  . MET C 1 78  ? 38.713  -13.722 54.010  1.00 30.29 ? 80   MET C CE  1 
ATOM   4445 N  N   . ALA C 1 79  ? 37.077  -9.185  52.380  1.00 28.36 ? 81   ALA C N   1 
ATOM   4446 C  CA  . ALA C 1 79  ? 37.188  -9.252  50.930  1.00 28.68 ? 81   ALA C CA  1 
ATOM   4447 C  C   . ALA C 1 79  ? 38.613  -9.629  50.576  1.00 29.77 ? 81   ALA C C   1 
ATOM   4448 O  O   . ALA C 1 79  ? 39.561  -8.978  51.017  1.00 28.50 ? 81   ALA C O   1 
ATOM   4449 C  CB  . ALA C 1 79  ? 36.817  -7.925  50.307  1.00 28.75 ? 81   ALA C CB  1 
ATOM   4450 N  N   . LEU C 1 80  ? 38.763  -10.686 49.777  1.00 30.22 ? 82   LEU C N   1 
ATOM   4451 C  CA  . LEU C 1 80  ? 40.088  -11.083 49.276  1.00 30.63 ? 82   LEU C CA  1 
ATOM   4452 C  C   . LEU C 1 80  ? 40.487  -10.231 48.085  1.00 31.59 ? 82   LEU C C   1 
ATOM   4453 O  O   . LEU C 1 80  ? 41.646  -10.215 47.684  1.00 32.63 ? 82   LEU C O   1 
ATOM   4454 C  CB  . LEU C 1 80  ? 40.102  -12.555 48.870  1.00 28.84 ? 82   LEU C CB  1 
ATOM   4455 C  CG  . LEU C 1 80  ? 39.934  -13.566 49.990  1.00 28.66 ? 82   LEU C CG  1 
ATOM   4456 C  CD1 . LEU C 1 80  ? 39.827  -14.956 49.382  1.00 29.04 ? 82   LEU C CD1 1 
ATOM   4457 C  CD2 . LEU C 1 80  ? 41.066  -13.491 51.004  1.00 28.15 ? 82   LEU C CD2 1 
ATOM   4458 N  N   . GLY C 1 81  ? 39.515  -9.529  47.532  1.00 32.99 ? 83   GLY C N   1 
ATOM   4459 C  CA  . GLY C 1 81  ? 39.720  -8.666  46.406  1.00 32.84 ? 83   GLY C CA  1 
ATOM   4460 C  C   . GLY C 1 81  ? 38.340  -8.299  45.938  1.00 32.82 ? 83   GLY C C   1 
ATOM   4461 O  O   . GLY C 1 81  ? 37.358  -8.822  46.474  1.00 32.63 ? 83   GLY C O   1 
ATOM   4462 N  N   . PRO C 1 82  ? 38.243  -7.422  44.929  1.00 33.74 ? 84   PRO C N   1 
ATOM   4463 C  CA  . PRO C 1 82  ? 36.958  -7.069  44.315  1.00 35.36 ? 84   PRO C CA  1 
ATOM   4464 C  C   . PRO C 1 82  ? 36.163  -8.305  43.870  1.00 35.37 ? 84   PRO C C   1 
ATOM   4465 O  O   . PRO C 1 82  ? 36.707  -9.192  43.215  1.00 37.22 ? 84   PRO C O   1 
ATOM   4466 C  CB  . PRO C 1 82  ? 37.358  -6.215  43.114  1.00 36.09 ? 84   PRO C CB  1 
ATOM   4467 C  CG  . PRO C 1 82  ? 38.701  -5.671  43.468  1.00 36.46 ? 84   PRO C CG  1 
ATOM   4468 C  CD  . PRO C 1 82  ? 39.375  -6.695  44.320  1.00 36.16 ? 84   PRO C CD  1 
ATOM   4469 N  N   . GLY C 1 83  ? 34.898  -8.373  44.262  1.00 35.36 ? 85   GLY C N   1 
ATOM   4470 C  CA  . GLY C 1 83  ? 34.052  -9.532  43.963  1.00 35.15 ? 85   GLY C CA  1 
ATOM   4471 C  C   . GLY C 1 83  ? 34.374  -10.850 44.655  1.00 34.86 ? 85   GLY C C   1 
ATOM   4472 O  O   . GLY C 1 83  ? 33.835  -11.876 44.251  1.00 36.81 ? 85   GLY C O   1 
ATOM   4473 N  N   . ARG C 1 84  ? 35.228  -10.843 45.686  1.00 31.32 ? 86   ARG C N   1 
ATOM   4474 C  CA  . ARG C 1 84  ? 35.628  -12.067 46.396  1.00 29.39 ? 86   ARG C CA  1 
ATOM   4475 C  C   . ARG C 1 84  ? 35.319  -11.852 47.883  1.00 27.50 ? 86   ARG C C   1 
ATOM   4476 O  O   . ARG C 1 84  ? 36.216  -11.632 48.706  1.00 24.67 ? 86   ARG C O   1 
ATOM   4477 C  CB  . ARG C 1 84  ? 37.108  -12.373 46.181  1.00 30.35 ? 86   ARG C CB  1 
ATOM   4478 C  CG  . ARG C 1 84  ? 37.508  -12.625 44.728  1.00 32.48 ? 86   ARG C CG  1 
ATOM   4479 C  CD  . ARG C 1 84  ? 39.024  -12.597 44.563  1.00 32.66 ? 86   ARG C CD  1 
ATOM   4480 N  NE  . ARG C 1 84  ? 39.646  -13.765 45.173  1.00 34.48 ? 86   ARG C NE  1 
ATOM   4481 C  CZ  . ARG C 1 84  ? 40.930  -13.887 45.500  1.00 36.72 ? 86   ARG C CZ  1 
ATOM   4482 N  NH1 . ARG C 1 84  ? 41.816  -12.922 45.275  1.00 39.52 ? 86   ARG C NH1 1 
ATOM   4483 N  NH2 . ARG C 1 84  ? 41.336  -15.010 46.082  1.00 40.14 ? 86   ARG C NH2 1 
ATOM   4484 N  N   . GLU C 1 85  ? 34.029  -11.894 48.200  1.00 25.61 ? 87   GLU C N   1 
ATOM   4485 C  CA  . GLU C 1 85  ? 33.543  -11.488 49.528  1.00 26.80 ? 87   GLU C CA  1 
ATOM   4486 C  C   . GLU C 1 85  ? 33.179  -12.650 50.435  1.00 24.47 ? 87   GLU C C   1 
ATOM   4487 O  O   . GLU C 1 85  ? 32.566  -13.624 49.994  1.00 22.18 ? 87   GLU C O   1 
ATOM   4488 C  CB  . GLU C 1 85  ? 32.374  -10.538 49.369  1.00 30.55 ? 87   GLU C CB  1 
ATOM   4489 C  CG  . GLU C 1 85  ? 32.875  -9.098  49.348  1.00 38.55 ? 87   GLU C CG  1 
ATOM   4490 C  CD  . GLU C 1 85  ? 32.077  -8.173  48.485  1.00 45.37 ? 87   GLU C CD  1 
ATOM   4491 O  OE1 . GLU C 1 85  ? 31.112  -8.608  47.819  1.00 51.83 ? 87   GLU C OE1 1 
ATOM   4492 O  OE2 . GLU C 1 85  ? 32.449  -6.981  48.473  1.00 56.66 ? 87   GLU C OE2 1 
ATOM   4493 N  N   . TYR C 1 86  ? 33.578  -12.513 51.700  1.00 22.21 ? 88   TYR C N   1 
ATOM   4494 C  CA  . TYR C 1 86  ? 33.446  -13.548 52.719  1.00 22.00 ? 88   TYR C CA  1 
ATOM   4495 C  C   . TYR C 1 86  ? 32.905  -12.937 54.012  1.00 23.73 ? 88   TYR C C   1 
ATOM   4496 O  O   . TYR C 1 86  ? 32.969  -11.709 54.202  1.00 23.71 ? 88   TYR C O   1 
ATOM   4497 C  CB  . TYR C 1 86  ? 34.815  -14.177 52.979  1.00 22.80 ? 88   TYR C CB  1 
ATOM   4498 C  CG  . TYR C 1 86  ? 35.283  -14.961 51.789  1.00 21.72 ? 88   TYR C CG  1 
ATOM   4499 C  CD1 . TYR C 1 86  ? 35.867  -14.323 50.693  1.00 22.44 ? 88   TYR C CD1 1 
ATOM   4500 C  CD2 . TYR C 1 86  ? 35.067  -16.338 51.719  1.00 22.94 ? 88   TYR C CD2 1 
ATOM   4501 C  CE1 . TYR C 1 86  ? 36.234  -15.042 49.565  1.00 22.65 ? 88   TYR C CE1 1 
ATOM   4502 C  CE2 . TYR C 1 86  ? 35.442  -17.064 50.597  1.00 22.83 ? 88   TYR C CE2 1 
ATOM   4503 C  CZ  . TYR C 1 86  ? 36.022  -16.415 49.530  1.00 22.96 ? 88   TYR C CZ  1 
ATOM   4504 O  OH  . TYR C 1 86  ? 36.364  -17.139 48.402  1.00 22.16 ? 88   TYR C OH  1 
ATOM   4505 N  N   . ARG C 1 87  ? 32.397  -13.807 54.894  1.00 24.23 ? 89   ARG C N   1 
ATOM   4506 C  CA  . ARG C 1 87  ? 32.019  -13.435 56.266  1.00 26.07 ? 89   ARG C CA  1 
ATOM   4507 C  C   . ARG C 1 87  ? 32.691  -14.381 57.254  1.00 23.00 ? 89   ARG C C   1 
ATOM   4508 O  O   . ARG C 1 87  ? 32.729  -15.597 57.029  1.00 22.74 ? 89   ARG C O   1 
ATOM   4509 C  CB  . ARG C 1 87  ? 30.498  -13.499 56.459  1.00 30.44 ? 89   ARG C CB  1 
ATOM   4510 C  CG  . ARG C 1 87  ? 29.709  -12.810 55.355  1.00 37.45 ? 89   ARG C CG  1 
ATOM   4511 C  CD  . ARG C 1 87  ? 28.512  -12.049 55.887  1.00 45.28 ? 89   ARG C CD  1 
ATOM   4512 N  NE  . ARG C 1 87  ? 27.843  -11.231 54.869  1.00 50.12 ? 89   ARG C NE  1 
ATOM   4513 C  CZ  . ARG C 1 87  ? 27.152  -10.109 55.107  1.00 56.56 ? 89   ARG C CZ  1 
ATOM   4514 N  NH1 . ARG C 1 87  ? 27.010  -9.610  56.344  1.00 57.00 ? 89   ARG C NH1 1 
ATOM   4515 N  NH2 . ARG C 1 87  ? 26.597  -9.463  54.084  1.00 60.49 ? 89   ARG C NH2 1 
ATOM   4516 N  N   . ALA C 1 88  ? 33.211  -13.837 58.351  1.00 21.87 ? 90   ALA C N   1 
ATOM   4517 C  CA  . ALA C 1 88  ? 33.953  -14.656 59.307  1.00 21.90 ? 90   ALA C CA  1 
ATOM   4518 C  C   . ALA C 1 88  ? 33.019  -15.497 60.174  1.00 23.15 ? 90   ALA C C   1 
ATOM   4519 O  O   . ALA C 1 88  ? 31.927  -15.021 60.584  1.00 22.31 ? 90   ALA C O   1 
ATOM   4520 C  CB  . ALA C 1 88  ? 34.817  -13.789 60.169  1.00 22.35 ? 90   ALA C CB  1 
ATOM   4521 N  N   . LEU C 1 89  ? 33.424  -16.736 60.434  1.00 20.48 ? 91   LEU C N   1 
ATOM   4522 C  CA  . LEU C 1 89  ? 32.682  -17.670 61.267  1.00 21.89 ? 91   LEU C CA  1 
ATOM   4523 C  C   . LEU C 1 89  ? 33.266  -17.891 62.641  1.00 21.84 ? 91   LEU C C   1 
ATOM   4524 O  O   . LEU C 1 89  ? 32.539  -17.996 63.637  1.00 19.43 ? 91   LEU C O   1 
ATOM   4525 C  CB  . LEU C 1 89  ? 32.633  -19.031 60.596  1.00 22.98 ? 91   LEU C CB  1 
ATOM   4526 C  CG  . LEU C 1 89  ? 32.011  -19.039 59.208  1.00 24.57 ? 91   LEU C CG  1 
ATOM   4527 C  CD1 . LEU C 1 89  ? 32.125  -20.456 58.661  1.00 26.23 ? 91   LEU C CD1 1 
ATOM   4528 C  CD2 . LEU C 1 89  ? 30.583  -18.515 59.242  1.00 25.72 ? 91   LEU C CD2 1 
ATOM   4529 N  N   . GLN C 1 90  ? 34.579  -18.053 62.682  1.00 20.55 ? 92   GLN C N   1 
ATOM   4530 C  CA  . GLN C 1 90  ? 35.254  -18.425 63.896  1.00 20.77 ? 92   GLN C CA  1 
ATOM   4531 C  C   . GLN C 1 90  ? 36.748  -18.250 63.695  1.00 22.12 ? 92   GLN C C   1 
ATOM   4532 O  O   . GLN C 1 90  ? 37.215  -18.117 62.539  1.00 20.41 ? 92   GLN C O   1 
ATOM   4533 C  CB  . GLN C 1 90  ? 34.928  -19.872 64.274  1.00 20.91 ? 92   GLN C CB  1 
ATOM   4534 C  CG  . GLN C 1 90  ? 35.105  -20.896 63.150  1.00 21.59 ? 92   GLN C CG  1 
ATOM   4535 C  CD  . GLN C 1 90  ? 36.343  -21.754 63.292  1.00 21.32 ? 92   GLN C CD  1 
ATOM   4536 O  OE1 . GLN C 1 90  ? 37.299  -21.400 63.987  1.00 20.01 ? 92   GLN C OE1 1 
ATOM   4537 N  NE2 . GLN C 1 90  ? 36.310  -22.922 62.660  1.00 21.97 ? 92   GLN C NE2 1 
ATOM   4538 N  N   . LEU C 1 91  ? 37.456  -18.186 64.823  1.00 21.08 ? 93   LEU C N   1 
ATOM   4539 C  CA  . LEU C 1 91  ? 38.884  -18.288 64.827  1.00 21.07 ? 93   LEU C CA  1 
ATOM   4540 C  C   . LEU C 1 91  ? 39.340  -19.328 65.830  1.00 20.70 ? 93   LEU C C   1 
ATOM   4541 O  O   . LEU C 1 91  ? 38.671  -19.638 66.831  1.00 20.49 ? 93   LEU C O   1 
ATOM   4542 C  CB  . LEU C 1 91  ? 39.558  -16.919 65.019  1.00 21.72 ? 93   LEU C CB  1 
ATOM   4543 C  CG  . LEU C 1 91  ? 39.381  -16.135 66.331  1.00 21.29 ? 93   LEU C CG  1 
ATOM   4544 C  CD1 . LEU C 1 91  ? 40.281  -16.688 67.421  1.00 22.25 ? 93   LEU C CD1 1 
ATOM   4545 C  CD2 . LEU C 1 91  ? 39.649  -14.658 66.076  1.00 22.31 ? 93   LEU C CD2 1 
ATOM   4546 N  N   . HIS C 1 92  ? 40.493  -19.914 65.548  1.00 19.10 ? 94   HIS C N   1 
ATOM   4547 C  CA  . HIS C 1 92  ? 41.105  -20.849 66.465  1.00 18.96 ? 94   HIS C CA  1 
ATOM   4548 C  C   . HIS C 1 92  ? 42.625  -20.885 66.232  1.00 19.93 ? 94   HIS C C   1 
ATOM   4549 O  O   . HIS C 1 92  ? 43.145  -20.231 65.314  1.00 20.29 ? 94   HIS C O   1 
ATOM   4550 C  CB  . HIS C 1 92  ? 40.483  -22.231 66.280  1.00 19.92 ? 94   HIS C CB  1 
ATOM   4551 C  CG  . HIS C 1 92  ? 40.666  -22.755 64.905  1.00 20.20 ? 94   HIS C CG  1 
ATOM   4552 N  ND1 . HIS C 1 92  ? 39.813  -22.410 63.884  1.00 20.38 ? 94   HIS C ND1 1 
ATOM   4553 C  CD2 . HIS C 1 92  ? 41.676  -23.463 64.337  1.00 20.97 ? 94   HIS C CD2 1 
ATOM   4554 C  CE1 . HIS C 1 92  ? 40.264  -22.916 62.751  1.00 21.87 ? 94   HIS C CE1 1 
ATOM   4555 N  NE2 . HIS C 1 92  ? 41.382  -23.556 63.002  1.00 19.95 ? 94   HIS C NE2 1 
ATOM   4556 N  N   . LEU C 1 93  ? 43.313  -21.624 67.072  1.00 21.61 ? 95   LEU C N   1 
ATOM   4557 C  CA  . LEU C 1 93  ? 44.764  -21.620 67.092  1.00 23.87 ? 95   LEU C CA  1 
ATOM   4558 C  C   . LEU C 1 93  ? 45.353  -23.036 67.022  1.00 23.11 ? 95   LEU C C   1 
ATOM   4559 O  O   . LEU C 1 93  ? 44.714  -24.026 67.372  1.00 24.93 ? 95   LEU C O   1 
ATOM   4560 C  CB  . LEU C 1 93  ? 45.247  -20.895 68.365  1.00 25.60 ? 95   LEU C CB  1 
ATOM   4561 C  CG  . LEU C 1 93  ? 44.716  -19.495 68.703  1.00 27.00 ? 95   LEU C CG  1 
ATOM   4562 C  CD1 . LEU C 1 93  ? 44.983  -19.130 70.152  1.00 29.67 ? 95   LEU C CD1 1 
ATOM   4563 C  CD2 . LEU C 1 93  ? 45.324  -18.442 67.806  1.00 28.82 ? 95   LEU C CD2 1 
ATOM   4564 N  N   . HIS C 1 94  ? 46.593  -23.118 66.541  1.00 24.46 ? 96   HIS C N   1 
ATOM   4565 C  CA  . HIS C 1 94  ? 47.353  -24.373 66.531  1.00 25.12 ? 96   HIS C CA  1 
ATOM   4566 C  C   . HIS C 1 94  ? 48.693  -24.050 67.185  1.00 24.46 ? 96   HIS C C   1 
ATOM   4567 O  O   . HIS C 1 94  ? 49.254  -22.996 66.919  1.00 26.05 ? 96   HIS C O   1 
ATOM   4568 C  CB  . HIS C 1 94  ? 47.576  -24.869 65.105  1.00 25.21 ? 96   HIS C CB  1 
ATOM   4569 C  CG  . HIS C 1 94  ? 46.314  -25.183 64.368  1.00 24.31 ? 96   HIS C CG  1 
ATOM   4570 N  ND1 . HIS C 1 94  ? 45.759  -26.438 64.364  1.00 24.71 ? 96   HIS C ND1 1 
ATOM   4571 C  CD2 . HIS C 1 94  ? 45.500  -24.411 63.614  1.00 24.38 ? 96   HIS C CD2 1 
ATOM   4572 C  CE1 . HIS C 1 94  ? 44.654  -26.429 63.648  1.00 22.72 ? 96   HIS C CE1 1 
ATOM   4573 N  NE2 . HIS C 1 94  ? 44.476  -25.215 63.181  1.00 22.69 ? 96   HIS C NE2 1 
ATOM   4574 N  N   . TRP C 1 95  ? 49.181  -24.948 68.022  1.00 27.27 ? 97   TRP C N   1 
ATOM   4575 C  CA  . TRP C 1 95  ? 50.376  -24.670 68.825  1.00 29.36 ? 97   TRP C CA  1 
ATOM   4576 C  C   . TRP C 1 95  ? 51.148  -25.936 69.133  1.00 31.10 ? 97   TRP C C   1 
ATOM   4577 O  O   . TRP C 1 95  ? 50.690  -27.045 68.853  1.00 29.98 ? 97   TRP C O   1 
ATOM   4578 C  CB  . TRP C 1 95  ? 49.977  -23.957 70.125  1.00 28.89 ? 97   TRP C CB  1 
ATOM   4579 C  CG  . TRP C 1 95  ? 49.070  -24.744 70.994  1.00 29.13 ? 97   TRP C CG  1 
ATOM   4580 C  CD1 . TRP C 1 95  ? 49.414  -25.704 71.894  1.00 30.54 ? 97   TRP C CD1 1 
ATOM   4581 C  CD2 . TRP C 1 95  ? 47.646  -24.634 71.054  1.00 28.74 ? 97   TRP C CD2 1 
ATOM   4582 N  NE1 . TRP C 1 95  ? 48.300  -26.199 72.520  1.00 30.31 ? 97   TRP C NE1 1 
ATOM   4583 C  CE2 . TRP C 1 95  ? 47.196  -25.566 72.009  1.00 29.91 ? 97   TRP C CE2 1 
ATOM   4584 C  CE3 . TRP C 1 95  ? 46.708  -23.868 70.359  1.00 28.76 ? 97   TRP C CE3 1 
ATOM   4585 C  CZ2 . TRP C 1 95  ? 45.840  -25.731 72.320  1.00 28.00 ? 97   TRP C CZ2 1 
ATOM   4586 C  CZ3 . TRP C 1 95  ? 45.346  -24.029 70.679  1.00 27.70 ? 97   TRP C CZ3 1 
ATOM   4587 C  CH2 . TRP C 1 95  ? 44.938  -24.962 71.646  1.00 27.53 ? 97   TRP C CH2 1 
ATOM   4588 N  N   . GLY C 1 96  ? 52.327  -25.752 69.724  1.00 34.99 ? 98   GLY C N   1 
ATOM   4589 C  CA  . GLY C 1 96  ? 53.244  -26.846 69.954  1.00 36.72 ? 98   GLY C CA  1 
ATOM   4590 C  C   . GLY C 1 96  ? 53.247  -27.360 71.381  1.00 39.46 ? 98   GLY C C   1 
ATOM   4591 O  O   . GLY C 1 96  ? 52.198  -27.725 71.932  1.00 38.05 ? 98   GLY C O   1 
ATOM   4592 N  N   . ALA C 1 97  ? 54.445  -27.398 71.964  1.00 41.31 ? 99   ALA C N   1 
ATOM   4593 C  CA  . ALA C 1 97  ? 54.662  -27.814 73.343  1.00 43.10 ? 99   ALA C CA  1 
ATOM   4594 C  C   . ALA C 1 97  ? 55.901  -27.082 73.874  1.00 45.99 ? 99   ALA C C   1 
ATOM   4595 O  O   . ALA C 1 97  ? 56.436  -26.196 73.189  1.00 47.29 ? 99   ALA C O   1 
ATOM   4596 C  CB  . ALA C 1 97  ? 54.831  -29.325 73.417  1.00 43.00 ? 99   ALA C CB  1 
ATOM   4597 N  N   . ALA C 1 98  ? 56.332  -27.419 75.092  1.00 49.03 ? 100  ALA C N   1 
ATOM   4598 C  CA  . ALA C 1 98  ? 57.524  -26.796 75.696  1.00 51.32 ? 100  ALA C CA  1 
ATOM   4599 C  C   . ALA C 1 98  ? 58.748  -26.929 74.770  1.00 50.95 ? 100  ALA C C   1 
ATOM   4600 O  O   . ALA C 1 98  ? 59.201  -28.040 74.499  1.00 50.00 ? 100  ALA C O   1 
ATOM   4601 C  CB  . ALA C 1 98  ? 57.811  -27.418 77.054  1.00 51.90 ? 100  ALA C CB  1 
ATOM   4602 N  N   . GLY C 1 99  ? 59.233  -25.794 74.259  1.00 52.14 ? 101  GLY C N   1 
ATOM   4603 C  CA  . GLY C 1 99  ? 60.348  -25.755 73.293  1.00 57.02 ? 101  GLY C CA  1 
ATOM   4604 C  C   . GLY C 1 99  ? 60.177  -26.582 72.018  1.00 58.03 ? 101  GLY C C   1 
ATOM   4605 O  O   . GLY C 1 99  ? 61.151  -27.123 71.490  1.00 58.46 ? 101  GLY C O   1 
ATOM   4606 N  N   . ARG C 1 100 ? 58.939  -26.702 71.538  1.00 55.54 ? 102  ARG C N   1 
ATOM   4607 C  CA  . ARG C 1 100 ? 58.629  -27.435 70.306  1.00 50.38 ? 102  ARG C CA  1 
ATOM   4608 C  C   . ARG C 1 100 ? 57.574  -26.637 69.552  1.00 46.63 ? 102  ARG C C   1 
ATOM   4609 O  O   . ARG C 1 100 ? 56.511  -26.382 70.098  1.00 45.27 ? 102  ARG C O   1 
ATOM   4610 C  CB  . ARG C 1 100 ? 58.090  -28.822 70.623  1.00 50.97 ? 102  ARG C CB  1 
ATOM   4611 C  CG  . ARG C 1 100 ? 59.096  -29.735 71.296  1.00 54.51 ? 102  ARG C CG  1 
ATOM   4612 C  CD  . ARG C 1 100 ? 58.451  -31.009 71.809  1.00 55.36 ? 102  ARG C CD  1 
ATOM   4613 N  NE  . ARG C 1 100 ? 58.167  -31.962 70.739  1.00 57.28 ? 102  ARG C NE  1 
ATOM   4614 C  CZ  . ARG C 1 100 ? 57.556  -33.139 70.907  1.00 60.23 ? 102  ARG C CZ  1 
ATOM   4615 N  NH1 . ARG C 1 100 ? 57.140  -33.529 72.117  1.00 62.08 ? 102  ARG C NH1 1 
ATOM   4616 N  NH2 . ARG C 1 100 ? 57.345  -33.935 69.854  1.00 58.58 ? 102  ARG C NH2 1 
ATOM   4617 N  N   . PRO C 1 101 ? 57.865  -26.226 68.308  1.00 43.38 ? 103  PRO C N   1 
ATOM   4618 C  CA  . PRO C 1 101 ? 56.934  -25.373 67.592  1.00 40.71 ? 103  PRO C CA  1 
ATOM   4619 C  C   . PRO C 1 101 ? 55.711  -26.152 67.087  1.00 38.57 ? 103  PRO C C   1 
ATOM   4620 O  O   . PRO C 1 101 ? 55.711  -27.386 67.064  1.00 36.29 ? 103  PRO C O   1 
ATOM   4621 C  CB  . PRO C 1 101 ? 57.776  -24.848 66.434  1.00 42.18 ? 103  PRO C CB  1 
ATOM   4622 C  CG  . PRO C 1 101 ? 58.714  -25.974 66.139  1.00 42.28 ? 103  PRO C CG  1 
ATOM   4623 C  CD  . PRO C 1 101 ? 58.996  -26.638 67.453  1.00 42.97 ? 103  PRO C CD  1 
ATOM   4624 N  N   . GLY C 1 102 ? 54.663  -25.416 66.733  1.00 37.92 ? 104  GLY C N   1 
ATOM   4625 C  CA  . GLY C 1 102 ? 53.390  -26.028 66.356  1.00 34.79 ? 104  GLY C CA  1 
ATOM   4626 C  C   . GLY C 1 102 ? 52.516  -25.302 65.353  1.00 33.20 ? 104  GLY C C   1 
ATOM   4627 O  O   . GLY C 1 102 ? 51.313  -25.614 65.272  1.00 32.20 ? 104  GLY C O   1 
ATOM   4628 N  N   . SER C 1 103 ? 53.087  -24.380 64.568  1.00 30.18 ? 105  SER C N   1 
ATOM   4629 C  CA  . SER C 1 103 ? 52.393  -23.844 63.408  1.00 30.43 ? 105  SER C CA  1 
ATOM   4630 C  C   . SER C 1 103 ? 52.062  -24.977 62.425  1.00 30.16 ? 105  SER C C   1 
ATOM   4631 O  O   . SER C 1 103 ? 52.643  -26.064 62.485  1.00 28.67 ? 105  SER C O   1 
ATOM   4632 C  CB  . SER C 1 103 ? 53.173  -22.713 62.731  1.00 32.63 ? 105  SER C CB  1 
ATOM   4633 O  OG  . SER C 1 103 ? 54.307  -23.173 61.991  1.00 32.28 ? 105  SER C OG  1 
ATOM   4634 N  N   . GLU C 1 104 ? 51.074  -24.725 61.572  1.00 29.38 ? 106  GLU C N   1 
ATOM   4635 C  CA  . GLU C 1 104 ? 50.626  -25.709 60.580  1.00 29.14 ? 106  GLU C CA  1 
ATOM   4636 C  C   . GLU C 1 104 ? 51.394  -25.494 59.279  1.00 27.61 ? 106  GLU C C   1 
ATOM   4637 O  O   . GLU C 1 104 ? 52.013  -26.409 58.752  1.00 30.49 ? 106  GLU C O   1 
ATOM   4638 C  CB  . GLU C 1 104 ? 49.114  -25.574 60.350  1.00 27.04 ? 106  GLU C CB  1 
ATOM   4639 C  CG  . GLU C 1 104 ? 48.260  -25.986 61.555  1.00 26.14 ? 106  GLU C CG  1 
ATOM   4640 C  CD  . GLU C 1 104 ? 47.059  -26.830 61.163  1.00 26.50 ? 106  GLU C CD  1 
ATOM   4641 O  OE1 . GLU C 1 104 ? 46.090  -26.273 60.633  1.00 25.35 ? 106  GLU C OE1 1 
ATOM   4642 O  OE2 . GLU C 1 104 ? 47.095  -28.061 61.356  1.00 25.61 ? 106  GLU C OE2 1 
ATOM   4643 N  N   . HIS C 1 105 ? 51.337  -24.284 58.754  1.00 28.88 ? 107  HIS C N   1 
ATOM   4644 C  CA  . HIS C 1 105 ? 52.180  -23.923 57.627  1.00 29.67 ? 107  HIS C CA  1 
ATOM   4645 C  C   . HIS C 1 105 ? 53.634  -23.807 58.090  1.00 31.65 ? 107  HIS C C   1 
ATOM   4646 O  O   . HIS C 1 105 ? 53.900  -23.575 59.274  1.00 27.93 ? 107  HIS C O   1 
ATOM   4647 C  CB  . HIS C 1 105 ? 51.693  -22.641 56.971  1.00 29.83 ? 107  HIS C CB  1 
ATOM   4648 C  CG  . HIS C 1 105 ? 50.390  -22.827 56.272  1.00 31.20 ? 107  HIS C CG  1 
ATOM   4649 N  ND1 . HIS C 1 105 ? 49.182  -22.735 56.930  1.00 30.20 ? 107  HIS C ND1 1 
ATOM   4650 C  CD2 . HIS C 1 105 ? 50.104  -23.183 54.999  1.00 30.54 ? 107  HIS C CD2 1 
ATOM   4651 C  CE1 . HIS C 1 105 ? 48.205  -22.987 56.077  1.00 32.78 ? 107  HIS C CE1 1 
ATOM   4652 N  NE2 . HIS C 1 105 ? 48.736  -23.268 54.901  1.00 31.98 ? 107  HIS C NE2 1 
ATOM   4653 N  N   . THR C 1 106 ? 54.551  -24.043 57.157  1.00 34.19 ? 108  THR C N   1 
ATOM   4654 C  CA  . THR C 1 106 ? 55.969  -23.798 57.375  1.00 33.66 ? 108  THR C CA  1 
ATOM   4655 C  C   . THR C 1 106 ? 56.498  -22.931 56.251  1.00 35.32 ? 108  THR C C   1 
ATOM   4656 O  O   . THR C 1 106 ? 55.850  -22.789 55.200  1.00 31.93 ? 108  THR C O   1 
ATOM   4657 C  CB  . THR C 1 106 ? 56.761  -25.109 57.474  1.00 34.81 ? 108  THR C CB  1 
ATOM   4658 O  OG1 . THR C 1 106 ? 56.533  -25.913 56.311  1.00 35.55 ? 108  THR C OG1 1 
ATOM   4659 C  CG2 . THR C 1 106 ? 56.350  -25.883 58.682  1.00 32.84 ? 108  THR C CG2 1 
ATOM   4660 N  N   . VAL C 1 107 ? 57.662  -22.316 56.492  1.00 35.13 ? 109  VAL C N   1 
ATOM   4661 C  CA  . VAL C 1 107 ? 58.316  -21.466 55.503  1.00 37.88 ? 109  VAL C CA  1 
ATOM   4662 C  C   . VAL C 1 107 ? 59.759  -21.966 55.376  1.00 39.70 ? 109  VAL C C   1 
ATOM   4663 O  O   . VAL C 1 107 ? 60.510  -21.932 56.347  1.00 38.62 ? 109  VAL C O   1 
ATOM   4664 C  CB  . VAL C 1 107 ? 58.238  -19.971 55.886  1.00 38.58 ? 109  VAL C CB  1 
ATOM   4665 C  CG1 . VAL C 1 107 ? 58.955  -19.098 54.868  1.00 39.13 ? 109  VAL C CG1 1 
ATOM   4666 C  CG2 . VAL C 1 107 ? 56.779  -19.528 55.997  1.00 39.27 ? 109  VAL C CG2 1 
ATOM   4667 N  N   . GLU C 1 108 ? 60.109  -22.491 54.199  1.00 41.94 ? 110  GLU C N   1 
ATOM   4668 C  CA  . GLU C 1 108 ? 61.394  -23.180 53.978  1.00 43.72 ? 110  GLU C CA  1 
ATOM   4669 C  C   . GLU C 1 108 ? 61.665  -24.227 55.049  1.00 41.83 ? 110  GLU C C   1 
ATOM   4670 O  O   . GLU C 1 108 ? 62.772  -24.324 55.580  1.00 41.76 ? 110  GLU C O   1 
ATOM   4671 C  CB  . GLU C 1 108 ? 62.557  -22.169 53.895  1.00 47.20 ? 110  GLU C CB  1 
ATOM   4672 C  CG  . GLU C 1 108 ? 62.682  -21.453 52.560  1.00 52.42 ? 110  GLU C CG  1 
ATOM   4673 C  CD  . GLU C 1 108 ? 62.791  -22.396 51.358  1.00 57.37 ? 110  GLU C CD  1 
ATOM   4674 O  OE1 . GLU C 1 108 ? 63.445  -23.469 51.465  1.00 56.90 ? 110  GLU C OE1 1 
ATOM   4675 O  OE2 . GLU C 1 108 ? 62.208  -22.061 50.297  1.00 62.63 ? 110  GLU C OE2 1 
ATOM   4676 N  N   . GLY C 1 109 ? 60.626  -24.981 55.404  1.00 36.31 ? 111  GLY C N   1 
ATOM   4677 C  CA  . GLY C 1 109 ? 60.738  -26.001 56.425  1.00 34.10 ? 111  GLY C CA  1 
ATOM   4678 C  C   . GLY C 1 109 ? 60.732  -25.487 57.858  1.00 33.19 ? 111  GLY C C   1 
ATOM   4679 O  O   . GLY C 1 109 ? 60.712  -26.289 58.773  1.00 31.51 ? 111  GLY C O   1 
ATOM   4680 N  N   . HIS C 1 110 ? 60.734  -24.167 58.070  1.00 35.29 ? 112  HIS C N   1 
ATOM   4681 C  CA  . HIS C 1 110 ? 60.732  -23.616 59.425  1.00 37.86 ? 112  HIS C CA  1 
ATOM   4682 C  C   . HIS C 1 110 ? 59.297  -23.612 60.014  1.00 37.18 ? 112  HIS C C   1 
ATOM   4683 O  O   . HIS C 1 110 ? 58.404  -22.984 59.449  1.00 34.70 ? 112  HIS C O   1 
ATOM   4684 C  CB  . HIS C 1 110 ? 61.305  -22.195 59.419  1.00 40.06 ? 112  HIS C CB  1 
ATOM   4685 C  CG  . HIS C 1 110 ? 61.268  -21.525 60.753  1.00 42.13 ? 112  HIS C CG  1 
ATOM   4686 N  ND1 . HIS C 1 110 ? 61.990  -21.981 61.834  1.00 45.46 ? 112  HIS C ND1 1 
ATOM   4687 C  CD2 . HIS C 1 110 ? 60.575  -20.448 61.186  1.00 42.72 ? 112  HIS C CD2 1 
ATOM   4688 C  CE1 . HIS C 1 110 ? 61.749  -21.206 62.877  1.00 45.92 ? 112  HIS C CE1 1 
ATOM   4689 N  NE2 . HIS C 1 110 ? 60.896  -20.266 62.508  1.00 45.88 ? 112  HIS C NE2 1 
ATOM   4690 N  N   . ARG C 1 111 ? 59.111  -24.315 61.132  1.00 36.06 ? 113  ARG C N   1 
ATOM   4691 C  CA  . ARG C 1 111 ? 57.849  -24.329 61.880  1.00 37.96 ? 113  ARG C CA  1 
ATOM   4692 C  C   . ARG C 1 111 ? 57.867  -23.244 62.962  1.00 38.14 ? 113  ARG C C   1 
ATOM   4693 O  O   . ARG C 1 111 ? 58.802  -23.172 63.756  1.00 38.24 ? 113  ARG C O   1 
ATOM   4694 C  CB  . ARG C 1 111 ? 57.622  -25.696 62.511  1.00 37.53 ? 113  ARG C CB  1 
ATOM   4695 C  CG  . ARG C 1 111 ? 56.191  -25.896 63.013  1.00 38.96 ? 113  ARG C CG  1 
ATOM   4696 C  CD  . ARG C 1 111 ? 55.911  -27.303 63.519  1.00 39.34 ? 113  ARG C CD  1 
ATOM   4697 N  NE  . ARG C 1 111 ? 56.125  -28.370 62.528  1.00 41.67 ? 113  ARG C NE  1 
ATOM   4698 C  CZ  . ARG C 1 111 ? 55.380  -28.580 61.435  1.00 44.10 ? 113  ARG C CZ  1 
ATOM   4699 N  NH1 . ARG C 1 111 ? 54.349  -27.786 61.117  1.00 45.98 ? 113  ARG C NH1 1 
ATOM   4700 N  NH2 . ARG C 1 111 ? 55.671  -29.598 60.631  1.00 40.42 ? 113  ARG C NH2 1 
ATOM   4701 N  N   . PHE C 1 112 ? 56.843  -22.401 62.979  1.00 38.15 ? 114  PHE C N   1 
ATOM   4702 C  CA  . PHE C 1 112 ? 56.751  -21.286 63.933  1.00 37.47 ? 114  PHE C CA  1 
ATOM   4703 C  C   . PHE C 1 112 ? 56.072  -21.790 65.211  1.00 35.96 ? 114  PHE C C   1 
ATOM   4704 O  O   . PHE C 1 112 ? 55.450  -22.860 65.205  1.00 32.85 ? 114  PHE C O   1 
ATOM   4705 C  CB  . PHE C 1 112 ? 55.983  -20.121 63.324  1.00 37.95 ? 114  PHE C CB  1 
ATOM   4706 C  CG  . PHE C 1 112 ? 56.628  -19.539 62.096  1.00 40.84 ? 114  PHE C CG  1 
ATOM   4707 C  CD1 . PHE C 1 112 ? 56.513  -20.171 60.854  1.00 41.10 ? 114  PHE C CD1 1 
ATOM   4708 C  CD2 . PHE C 1 112 ? 57.331  -18.333 62.167  1.00 42.95 ? 114  PHE C CD2 1 
ATOM   4709 C  CE1 . PHE C 1 112 ? 57.094  -19.621 59.720  1.00 42.46 ? 114  PHE C CE1 1 
ATOM   4710 C  CE2 . PHE C 1 112 ? 57.915  -17.777 61.033  1.00 42.91 ? 114  PHE C CE2 1 
ATOM   4711 C  CZ  . PHE C 1 112 ? 57.795  -18.422 59.807  1.00 42.71 ? 114  PHE C CZ  1 
ATOM   4712 N  N   . PRO C 1 113 ? 56.221  -21.056 66.333  1.00 36.52 ? 115  PRO C N   1 
ATOM   4713 C  CA  . PRO C 1 113 ? 55.645  -21.546 67.602  1.00 36.25 ? 115  PRO C CA  1 
ATOM   4714 C  C   . PRO C 1 113 ? 54.135  -21.877 67.537  1.00 33.12 ? 115  PRO C C   1 
ATOM   4715 O  O   . PRO C 1 113 ? 53.715  -22.938 68.009  1.00 30.37 ? 115  PRO C O   1 
ATOM   4716 C  CB  . PRO C 1 113 ? 55.910  -20.390 68.575  1.00 37.14 ? 115  PRO C CB  1 
ATOM   4717 C  CG  . PRO C 1 113 ? 57.101  -19.689 68.017  1.00 37.60 ? 115  PRO C CG  1 
ATOM   4718 C  CD  . PRO C 1 113 ? 57.035  -19.837 66.529  1.00 36.91 ? 115  PRO C CD  1 
ATOM   4719 N  N   . ALA C 1 114 ? 53.355  -20.993 66.924  1.00 32.41 ? 116  ALA C N   1 
ATOM   4720 C  CA  . ALA C 1 114 ? 51.913  -21.210 66.795  1.00 31.75 ? 116  ALA C CA  1 
ATOM   4721 C  C   . ALA C 1 114 ? 51.335  -20.463 65.594  1.00 30.13 ? 116  ALA C C   1 
ATOM   4722 O  O   . ALA C 1 114 ? 52.062  -19.745 64.891  1.00 30.66 ? 116  ALA C O   1 
ATOM   4723 C  CB  . ALA C 1 114 ? 51.215  -20.826 68.104  1.00 30.35 ? 116  ALA C CB  1 
ATOM   4724 N  N   . GLU C 1 115 ? 50.033  -20.660 65.341  1.00 28.97 ? 117  GLU C N   1 
ATOM   4725 C  CA  . GLU C 1 115 ? 49.390  -20.102 64.167  1.00 27.33 ? 117  GLU C CA  1 
ATOM   4726 C  C   . GLU C 1 115 ? 47.904  -19.854 64.443  1.00 25.44 ? 117  GLU C C   1 
ATOM   4727 O  O   . GLU C 1 115 ? 47.246  -20.713 65.020  1.00 24.38 ? 117  GLU C O   1 
ATOM   4728 C  CB  . GLU C 1 115 ? 49.563  -21.101 63.008  1.00 27.54 ? 117  GLU C CB  1 
ATOM   4729 C  CG  . GLU C 1 115 ? 49.035  -20.678 61.647  1.00 26.80 ? 117  GLU C CG  1 
ATOM   4730 C  CD  . GLU C 1 115 ? 49.388  -21.675 60.524  1.00 28.00 ? 117  GLU C CD  1 
ATOM   4731 O  OE1 . GLU C 1 115 ? 50.445  -22.338 60.605  1.00 28.14 ? 117  GLU C OE1 1 
ATOM   4732 O  OE2 . GLU C 1 115 ? 48.622  -21.801 59.538  1.00 26.05 ? 117  GLU C OE2 1 
ATOM   4733 N  N   . ILE C 1 116 ? 47.412  -18.698 64.006  1.00 25.01 ? 118  ILE C N   1 
ATOM   4734 C  CA  . ILE C 1 116 ? 45.982  -18.360 64.091  1.00 25.01 ? 118  ILE C CA  1 
ATOM   4735 C  C   . ILE C 1 116 ? 45.289  -18.516 62.733  1.00 23.16 ? 118  ILE C C   1 
ATOM   4736 O  O   . ILE C 1 116 ? 45.804  -18.066 61.711  1.00 22.49 ? 118  ILE C O   1 
ATOM   4737 C  CB  . ILE C 1 116 ? 45.734  -16.939 64.680  1.00 25.25 ? 118  ILE C CB  1 
ATOM   4738 C  CG1 . ILE C 1 116 ? 44.219  -16.669 64.773  1.00 25.57 ? 118  ILE C CG1 1 
ATOM   4739 C  CG2 . ILE C 1 116 ? 46.432  -15.836 63.888  1.00 26.00 ? 118  ILE C CG2 1 
ATOM   4740 C  CD1 . ILE C 1 116 ? 43.865  -15.399 65.519  1.00 27.04 ? 118  ILE C CD1 1 
ATOM   4741 N  N   . HIS C 1 117 ? 44.103  -19.126 62.756  1.00 22.03 ? 119  HIS C N   1 
ATOM   4742 C  CA  . HIS C 1 117 ? 43.201  -19.218 61.621  1.00 21.02 ? 119  HIS C CA  1 
ATOM   4743 C  C   . HIS C 1 117 ? 41.883  -18.535 61.903  1.00 21.20 ? 119  HIS C C   1 
ATOM   4744 O  O   . HIS C 1 117 ? 41.252  -18.870 62.902  1.00 21.74 ? 119  HIS C O   1 
ATOM   4745 C  CB  . HIS C 1 117 ? 42.886  -20.663 61.358  1.00 21.25 ? 119  HIS C CB  1 
ATOM   4746 C  CG  . HIS C 1 117 ? 44.072  -21.433 60.894  1.00 21.44 ? 119  HIS C CG  1 
ATOM   4747 N  ND1 . HIS C 1 117 ? 44.139  -22.793 61.001  1.00 20.93 ? 119  HIS C ND1 1 
ATOM   4748 C  CD2 . HIS C 1 117 ? 45.229  -21.030 60.329  1.00 21.49 ? 119  HIS C CD2 1 
ATOM   4749 C  CE1 . HIS C 1 117 ? 45.305  -23.209 60.520  1.00 21.03 ? 119  HIS C CE1 1 
ATOM   4750 N  NE2 . HIS C 1 117 ? 45.986  -22.154 60.115  1.00 20.26 ? 119  HIS C NE2 1 
ATOM   4751 N  N   . VAL C 1 118 ? 41.520  -17.600 61.030  1.00 19.73 ? 120  VAL C N   1 
ATOM   4752 C  CA  . VAL C 1 118 ? 40.216  -16.983 60.972  1.00 21.13 ? 120  VAL C CA  1 
ATOM   4753 C  C   . VAL C 1 118 ? 39.499  -17.569 59.751  1.00 20.34 ? 120  VAL C C   1 
ATOM   4754 O  O   . VAL C 1 118 ? 39.848  -17.276 58.609  1.00 21.73 ? 120  VAL C O   1 
ATOM   4755 C  CB  . VAL C 1 118 ? 40.302  -15.459 60.860  1.00 20.38 ? 120  VAL C CB  1 
ATOM   4756 C  CG1 . VAL C 1 118 ? 38.935  -14.841 61.091  1.00 21.96 ? 120  VAL C CG1 1 
ATOM   4757 C  CG2 . VAL C 1 118 ? 41.320  -14.898 61.869  1.00 21.31 ? 120  VAL C CG2 1 
ATOM   4758 N  N   . VAL C 1 119 ? 38.480  -18.373 60.031  1.00 19.09 ? 121  VAL C N   1 
ATOM   4759 C  CA  . VAL C 1 119 ? 37.730  -19.125 59.017  1.00 19.81 ? 121  VAL C CA  1 
ATOM   4760 C  C   . VAL C 1 119 ? 36.522  -18.319 58.533  1.00 19.53 ? 121  VAL C C   1 
ATOM   4761 O  O   . VAL C 1 119 ? 35.760  -17.759 59.353  1.00 20.57 ? 121  VAL C O   1 
ATOM   4762 C  CB  . VAL C 1 119 ? 37.272  -20.480 59.582  1.00 19.00 ? 121  VAL C CB  1 
ATOM   4763 C  CG1 . VAL C 1 119 ? 36.549  -21.267 58.516  1.00 19.43 ? 121  VAL C CG1 1 
ATOM   4764 C  CG2 . VAL C 1 119 ? 38.456  -21.261 60.161  1.00 19.91 ? 121  VAL C CG2 1 
ATOM   4765 N  N   . HIS C 1 120 ? 36.369  -18.225 57.209  1.00 19.19 ? 122  HIS C N   1 
ATOM   4766 C  CA  . HIS C 1 120 ? 35.342  -17.448 56.555  1.00 19.34 ? 122  HIS C CA  1 
ATOM   4767 C  C   . HIS C 1 120 ? 34.551  -18.254 55.536  1.00 20.37 ? 122  HIS C C   1 
ATOM   4768 O  O   . HIS C 1 120 ? 35.090  -19.173 54.883  1.00 21.56 ? 122  HIS C O   1 
ATOM   4769 C  CB  . HIS C 1 120 ? 35.911  -16.246 55.776  1.00 20.44 ? 122  HIS C CB  1 
ATOM   4770 C  CG  . HIS C 1 120 ? 36.718  -15.282 56.592  1.00 20.90 ? 122  HIS C CG  1 
ATOM   4771 N  ND1 . HIS C 1 120 ? 37.978  -15.569 57.059  1.00 21.99 ? 122  HIS C ND1 1 
ATOM   4772 C  CD2 . HIS C 1 120 ? 36.443  -14.021 57.001  1.00 21.94 ? 122  HIS C CD2 1 
ATOM   4773 C  CE1 . HIS C 1 120 ? 38.445  -14.532 57.734  1.00 21.92 ? 122  HIS C CE1 1 
ATOM   4774 N  NE2 . HIS C 1 120 ? 37.531  -13.576 57.711  1.00 22.43 ? 122  HIS C NE2 1 
ATOM   4775 N  N   . LEU C 1 121 ? 33.303  -17.819 55.341  1.00 19.71 ? 123  LEU C N   1 
ATOM   4776 C  CA  . LEU C 1 121 ? 32.340  -18.426 54.423  1.00 20.02 ? 123  LEU C CA  1 
ATOM   4777 C  C   . LEU C 1 121 ? 32.064  -17.458 53.297  1.00 19.65 ? 123  LEU C C   1 
ATOM   4778 O  O   . LEU C 1 121 ? 31.759  -16.310 53.528  1.00 19.33 ? 123  LEU C O   1 
ATOM   4779 C  CB  . LEU C 1 121 ? 31.036  -18.729 55.176  1.00 20.18 ? 123  LEU C CB  1 
ATOM   4780 C  CG  . LEU C 1 121 ? 29.853  -19.356 54.431  1.00 20.42 ? 123  LEU C CG  1 
ATOM   4781 C  CD1 . LEU C 1 121 ? 30.267  -20.683 53.827  1.00 20.52 ? 123  LEU C CD1 1 
ATOM   4782 C  CD2 . LEU C 1 121 ? 28.631  -19.544 55.348  1.00 20.93 ? 123  LEU C CD2 1 
ATOM   4783 N  N   . SER C 1 122 ? 32.127  -17.924 52.059  1.00 19.04 ? 124  SER C N   1 
ATOM   4784 C  CA  . SER C 1 122 ? 31.752  -17.079 50.924  1.00 20.05 ? 124  SER C CA  1 
ATOM   4785 C  C   . SER C 1 122 ? 30.296  -16.615 51.071  1.00 21.84 ? 124  SER C C   1 
ATOM   4786 O  O   . SER C 1 122 ? 29.425  -17.406 51.473  1.00 21.50 ? 124  SER C O   1 
ATOM   4787 C  CB  . SER C 1 122 ? 31.924  -17.813 49.588  1.00 19.72 ? 124  SER C CB  1 
ATOM   4788 O  OG  . SER C 1 122 ? 31.137  -17.235 48.568  1.00 18.40 ? 124  SER C OG  1 
ATOM   4789 N  N   . THR C 1 123 ? 30.047  -15.362 50.691  1.00 21.69 ? 125  THR C N   1 
ATOM   4790 C  CA  . THR C 1 123 ? 28.701  -14.797 50.722  1.00 24.33 ? 125  THR C CA  1 
ATOM   4791 C  C   . THR C 1 123 ? 27.723  -15.481 49.765  1.00 23.20 ? 125  THR C C   1 
ATOM   4792 O  O   . THR C 1 123 ? 26.524  -15.239 49.835  1.00 23.10 ? 125  THR C O   1 
ATOM   4793 C  CB  . THR C 1 123 ? 28.701  -13.284 50.420  1.00 26.52 ? 125  THR C CB  1 
ATOM   4794 O  OG1 . THR C 1 123 ? 29.270  -13.049 49.125  1.00 26.67 ? 125  THR C OG1 1 
ATOM   4795 C  CG2 . THR C 1 123 ? 29.496  -12.518 51.481  1.00 28.89 ? 125  THR C CG2 1 
ATOM   4796 N  N   . ALA C 1 124 ? 28.219  -16.320 48.864  1.00 21.24 ? 126  ALA C N   1 
ATOM   4797 C  CA  . ALA C 1 124 ? 27.356  -17.094 47.969  1.00 20.63 ? 126  ALA C CA  1 
ATOM   4798 C  C   . ALA C 1 124 ? 26.716  -18.312 48.638  1.00 20.10 ? 126  ALA C C   1 
ATOM   4799 O  O   . ALA C 1 124 ? 25.835  -18.934 48.056  1.00 20.08 ? 126  ALA C O   1 
ATOM   4800 C  CB  . ALA C 1 124 ? 28.131  -17.491 46.715  1.00 20.84 ? 126  ALA C CB  1 
ATOM   4801 N  N   . PHE C 1 125 ? 27.145  -18.641 49.853  1.00 20.15 ? 127  PHE C N   1 
ATOM   4802 C  CA  . PHE C 1 125 ? 26.617  -19.779 50.598  1.00 22.98 ? 127  PHE C CA  1 
ATOM   4803 C  C   . PHE C 1 125 ? 26.033  -19.338 51.936  1.00 24.57 ? 127  PHE C C   1 
ATOM   4804 O  O   . PHE C 1 125 ? 26.575  -18.452 52.597  1.00 24.12 ? 127  PHE C O   1 
ATOM   4805 C  CB  . PHE C 1 125 ? 27.690  -20.831 50.845  1.00 23.43 ? 127  PHE C CB  1 
ATOM   4806 C  CG  . PHE C 1 125 ? 28.298  -21.368 49.586  1.00 24.22 ? 127  PHE C CG  1 
ATOM   4807 C  CD1 . PHE C 1 125 ? 27.685  -22.391 48.884  1.00 23.14 ? 127  PHE C CD1 1 
ATOM   4808 C  CD2 . PHE C 1 125 ? 29.456  -20.807 49.078  1.00 25.03 ? 127  PHE C CD2 1 
ATOM   4809 C  CE1 . PHE C 1 125 ? 28.245  -22.861 47.699  1.00 24.35 ? 127  PHE C CE1 1 
ATOM   4810 C  CE2 . PHE C 1 125 ? 30.029  -21.282 47.902  1.00 25.27 ? 127  PHE C CE2 1 
ATOM   4811 C  CZ  . PHE C 1 125 ? 29.417  -22.301 47.217  1.00 24.60 ? 127  PHE C CZ  1 
ATOM   4812 N  N   . ALA C 1 126 ? 24.946  -19.993 52.326  1.00 26.10 ? 128  ALA C N   1 
ATOM   4813 C  CA  . ALA C 1 126 ? 24.290  -19.725 53.613  1.00 27.62 ? 128  ALA C CA  1 
ATOM   4814 C  C   . ALA C 1 126 ? 24.898  -20.518 54.753  1.00 27.94 ? 128  ALA C C   1 
ATOM   4815 O  O   . ALA C 1 126 ? 24.830  -20.100 55.921  1.00 26.91 ? 128  ALA C O   1 
ATOM   4816 C  CB  . ALA C 1 126 ? 22.798  -20.024 53.508  1.00 28.83 ? 128  ALA C CB  1 
ATOM   4817 N  N   . ARG C 1 127 ? 25.463  -21.680 54.438  1.00 28.20 ? 129  ARG C N   1 
ATOM   4818 C  CA  . ARG C 1 127 ? 25.986  -22.578 55.455  1.00 33.15 ? 129  ARG C CA  1 
ATOM   4819 C  C   . ARG C 1 127 ? 27.282  -23.203 55.006  1.00 30.25 ? 129  ARG C C   1 
ATOM   4820 O  O   . ARG C 1 127 ? 27.464  -23.473 53.818  1.00 28.85 ? 129  ARG C O   1 
ATOM   4821 C  CB  . ARG C 1 127 ? 25.011  -23.729 55.702  1.00 37.39 ? 129  ARG C CB  1 
ATOM   4822 C  CG  . ARG C 1 127 ? 23.596  -23.316 56.053  1.00 43.64 ? 129  ARG C CG  1 
ATOM   4823 C  CD  . ARG C 1 127 ? 22.634  -24.392 55.622  1.00 48.05 ? 129  ARG C CD  1 
ATOM   4824 N  NE  . ARG C 1 127 ? 22.912  -25.615 56.365  1.00 52.63 ? 129  ARG C NE  1 
ATOM   4825 C  CZ  . ARG C 1 127 ? 22.676  -26.852 55.932  1.00 58.12 ? 129  ARG C CZ  1 
ATOM   4826 N  NH1 . ARG C 1 127 ? 22.184  -27.087 54.712  1.00 61.61 ? 129  ARG C NH1 1 
ATOM   4827 N  NH2 . ARG C 1 127 ? 22.965  -27.879 56.726  1.00 59.92 ? 129  ARG C NH2 1 
ATOM   4828 N  N   . VAL C 1 128 ? 28.132  -23.508 55.977  1.00 29.82 ? 130  VAL C N   1 
ATOM   4829 C  CA  . VAL C 1 128 ? 29.414  -24.172 55.707  1.00 30.40 ? 130  VAL C CA  1 
ATOM   4830 C  C   . VAL C 1 128 ? 29.216  -25.479 54.940  1.00 30.61 ? 130  VAL C C   1 
ATOM   4831 O  O   . VAL C 1 128 ? 29.938  -25.759 53.985  1.00 29.18 ? 130  VAL C O   1 
ATOM   4832 C  CB  . VAL C 1 128 ? 30.178  -24.475 57.007  1.00 31.67 ? 130  VAL C CB  1 
ATOM   4833 C  CG1 . VAL C 1 128 ? 31.408  -25.351 56.733  1.00 32.96 ? 130  VAL C CG1 1 
ATOM   4834 C  CG2 . VAL C 1 128 ? 30.586  -23.177 57.689  1.00 32.23 ? 130  VAL C CG2 1 
ATOM   4835 N  N   . ASP C 1 129 ? 28.210  -26.257 55.324  1.00 30.43 ? 131  ASP C N   1 
ATOM   4836 C  CA  A ASP C 1 129 ? 27.912  -27.579 54.744  0.50 31.22 ? 131  ASP C CA  1 
ATOM   4837 C  CA  B ASP C 1 129 ? 28.100  -27.584 54.719  0.50 31.65 ? 131  ASP C CA  1 
ATOM   4838 C  C   . ASP C 1 129 ? 27.742  -27.541 53.216  1.00 31.25 ? 131  ASP C C   1 
ATOM   4839 O  O   . ASP C 1 129 ? 28.121  -28.458 52.505  1.00 31.22 ? 131  ASP C O   1 
ATOM   4840 C  CB  A ASP C 1 129 ? 26.630  -28.155 55.386  0.50 32.18 ? 131  ASP C CB  1 
ATOM   4841 C  CB  B ASP C 1 129 ? 27.237  -28.546 55.547  0.50 33.60 ? 131  ASP C CB  1 
ATOM   4842 C  CG  A ASP C 1 129 ? 26.630  -28.057 56.917  0.50 32.33 ? 131  ASP C CG  1 
ATOM   4843 C  CG  B ASP C 1 129 ? 25.781  -28.217 55.501  0.50 34.08 ? 131  ASP C CG  1 
ATOM   4844 O  OD1 A ASP C 1 129 ? 26.683  -26.917 57.462  0.50 30.25 ? 131  ASP C OD1 1 
ATOM   4845 O  OD1 B ASP C 1 129 ? 25.419  -27.114 55.045  0.50 35.88 ? 131  ASP C OD1 1 
ATOM   4846 O  OD2 A ASP C 1 129 ? 26.573  -29.124 57.566  0.50 34.77 ? 131  ASP C OD2 1 
ATOM   4847 O  OD2 B ASP C 1 129 ? 24.997  -29.077 55.942  0.50 37.33 ? 131  ASP C OD2 1 
ATOM   4848 N  N   . GLU C 1 130 ? 27.132  -26.456 52.727  1.00 31.21 ? 132  GLU C N   1 
ATOM   4849 C  CA  . GLU C 1 130 ? 26.917  -26.230 51.288  1.00 31.60 ? 132  GLU C CA  1 
ATOM   4850 C  C   . GLU C 1 130 ? 28.216  -25.754 50.569  1.00 29.04 ? 132  GLU C C   1 
ATOM   4851 O  O   . GLU C 1 130 ? 28.387  -25.969 49.373  1.00 28.09 ? 132  GLU C O   1 
ATOM   4852 C  CB  . GLU C 1 130 ? 25.866  -25.136 51.038  1.00 36.02 ? 132  GLU C CB  1 
ATOM   4853 C  CG  . GLU C 1 130 ? 24.493  -25.277 51.705  1.00 40.78 ? 132  GLU C CG  1 
ATOM   4854 C  CD  . GLU C 1 130 ? 23.672  -23.973 51.688  1.00 43.61 ? 132  GLU C CD  1 
ATOM   4855 O  OE1 . GLU C 1 130 ? 24.209  -22.858 51.409  1.00 44.36 ? 132  GLU C OE1 1 
ATOM   4856 O  OE2 . GLU C 1 130 ? 22.451  -24.056 51.954  1.00 52.11 ? 132  GLU C OE2 1 
ATOM   4857 N  N   . ALA C 1 131 ? 29.079  -25.058 51.297  1.00 25.22 ? 133  ALA C N   1 
ATOM   4858 C  CA  . ALA C 1 131 ? 30.304  -24.488 50.752  1.00 25.65 ? 133  ALA C CA  1 
ATOM   4859 C  C   . ALA C 1 131 ? 31.450  -25.501 50.680  1.00 23.87 ? 133  ALA C C   1 
ATOM   4860 O  O   . ALA C 1 131 ? 32.396  -25.316 49.899  1.00 22.09 ? 133  ALA C O   1 
ATOM   4861 C  CB  . ALA C 1 131 ? 30.720  -23.283 51.580  1.00 23.30 ? 133  ALA C CB  1 
ATOM   4862 N  N   . LEU C 1 132 ? 31.369  -26.562 51.481  1.00 23.92 ? 134  LEU C N   1 
ATOM   4863 C  CA  . LEU C 1 132 ? 32.446  -27.547 51.555  1.00 24.96 ? 134  LEU C CA  1 
ATOM   4864 C  C   . LEU C 1 132 ? 32.695  -28.161 50.184  1.00 25.29 ? 134  LEU C C   1 
ATOM   4865 O  O   . LEU C 1 132 ? 31.744  -28.547 49.490  1.00 23.69 ? 134  LEU C O   1 
ATOM   4866 C  CB  . LEU C 1 132 ? 32.116  -28.683 52.527  1.00 25.04 ? 134  LEU C CB  1 
ATOM   4867 C  CG  . LEU C 1 132 ? 32.074  -28.444 54.027  1.00 26.20 ? 134  LEU C CG  1 
ATOM   4868 C  CD1 . LEU C 1 132 ? 31.511  -29.692 54.712  1.00 27.13 ? 134  LEU C CD1 1 
ATOM   4869 C  CD2 . LEU C 1 132 ? 33.454  -28.101 54.570  1.00 25.56 ? 134  LEU C CD2 1 
ATOM   4870 N  N   . GLY C 1 133 ? 33.968  -28.215 49.795  1.00 24.19 ? 135  GLY C N   1 
ATOM   4871 C  CA  . GLY C 1 133 ? 34.355  -28.774 48.504  1.00 24.60 ? 135  GLY C CA  1 
ATOM   4872 C  C   . GLY C 1 133 ? 34.078  -27.889 47.303  1.00 24.50 ? 135  GLY C C   1 
ATOM   4873 O  O   . GLY C 1 133 ? 34.430  -28.263 46.209  1.00 24.10 ? 135  GLY C O   1 
ATOM   4874 N  N   . ARG C 1 134 ? 33.432  -26.727 47.479  1.00 23.08 ? 136  ARG C N   1 
ATOM   4875 C  CA  . ARG C 1 134 ? 33.072  -25.874 46.352  1.00 22.61 ? 136  ARG C CA  1 
ATOM   4876 C  C   . ARG C 1 134 ? 34.213  -24.867 46.153  1.00 22.25 ? 136  ARG C C   1 
ATOM   4877 O  O   . ARG C 1 134 ? 34.851  -24.474 47.130  1.00 22.13 ? 136  ARG C O   1 
ATOM   4878 C  CB  . ARG C 1 134 ? 31.747  -25.143 46.601  1.00 24.38 ? 136  ARG C CB  1 
ATOM   4879 C  CG  . ARG C 1 134 ? 30.522  -25.918 46.166  1.00 27.92 ? 136  ARG C CG  1 
ATOM   4880 C  CD  . ARG C 1 134 ? 30.392  -27.282 46.801  1.00 29.80 ? 136  ARG C CD  1 
ATOM   4881 N  NE  . ARG C 1 134 ? 29.434  -28.077 46.050  1.00 33.99 ? 136  ARG C NE  1 
ATOM   4882 C  CZ  . ARG C 1 134 ? 28.113  -28.033 46.181  1.00 37.37 ? 136  ARG C CZ  1 
ATOM   4883 N  NH1 . ARG C 1 134 ? 27.525  -27.214 47.057  1.00 40.81 ? 136  ARG C NH1 1 
ATOM   4884 N  NH2 . ARG C 1 134 ? 27.366  -28.805 45.394  1.00 38.94 ? 136  ARG C NH2 1 
ATOM   4885 N  N   . PRO C 1 135 ? 34.481  -24.462 44.901  1.00 23.39 ? 137  PRO C N   1 
ATOM   4886 C  CA  . PRO C 1 135 ? 35.653  -23.591 44.666  1.00 24.05 ? 137  PRO C CA  1 
ATOM   4887 C  C   . PRO C 1 135 ? 35.527  -22.252 45.389  1.00 21.41 ? 137  PRO C C   1 
ATOM   4888 O  O   . PRO C 1 135 ? 34.576  -21.539 45.176  1.00 22.00 ? 137  PRO C O   1 
ATOM   4889 C  CB  . PRO C 1 135 ? 35.678  -23.384 43.140  1.00 23.63 ? 137  PRO C CB  1 
ATOM   4890 C  CG  . PRO C 1 135 ? 34.599  -24.200 42.569  1.00 24.54 ? 137  PRO C CG  1 
ATOM   4891 C  CD  . PRO C 1 135 ? 33.752  -24.783 43.660  1.00 23.91 ? 137  PRO C CD  1 
ATOM   4892 N  N   . GLY C 1 136 ? 36.467  -21.945 46.270  1.00 20.92 ? 138  GLY C N   1 
ATOM   4893 C  CA  . GLY C 1 136 ? 36.419  -20.678 47.011  1.00 22.43 ? 138  GLY C CA  1 
ATOM   4894 C  C   . GLY C 1 136 ? 35.262  -20.535 48.001  1.00 22.04 ? 138  GLY C C   1 
ATOM   4895 O  O   . GLY C 1 136 ? 34.945  -19.413 48.436  1.00 22.28 ? 138  GLY C O   1 
ATOM   4896 N  N   . GLY C 1 137 ? 34.609  -21.648 48.343  1.00 22.08 ? 139  GLY C N   1 
ATOM   4897 C  CA  . GLY C 1 137 ? 33.479  -21.617 49.294  1.00 22.13 ? 139  GLY C CA  1 
ATOM   4898 C  C   . GLY C 1 137 ? 33.879  -21.204 50.696  1.00 20.44 ? 139  GLY C C   1 
ATOM   4899 O  O   . GLY C 1 137 ? 33.109  -20.540 51.398  1.00 20.11 ? 139  GLY C O   1 
ATOM   4900 N  N   . LEU C 1 138 ? 35.078  -21.599 51.102  1.00 19.37 ? 140  LEU C N   1 
ATOM   4901 C  CA  . LEU C 1 138 ? 35.654  -21.226 52.382  1.00 20.84 ? 140  LEU C CA  1 
ATOM   4902 C  C   . LEU C 1 138 ? 36.990  -20.534 52.151  1.00 21.37 ? 140  LEU C C   1 
ATOM   4903 O  O   . LEU C 1 138 ? 37.720  -20.890 51.206  1.00 21.58 ? 140  LEU C O   1 
ATOM   4904 C  CB  . LEU C 1 138 ? 35.858  -22.463 53.247  1.00 20.56 ? 140  LEU C CB  1 
ATOM   4905 C  CG  . LEU C 1 138 ? 34.589  -23.256 53.581  1.00 21.45 ? 140  LEU C CG  1 
ATOM   4906 C  CD1 . LEU C 1 138 ? 34.892  -24.524 54.352  1.00 22.70 ? 140  LEU C CD1 1 
ATOM   4907 C  CD2 . LEU C 1 138 ? 33.638  -22.364 54.368  1.00 21.05 ? 140  LEU C CD2 1 
ATOM   4908 N  N   . ALA C 1 139 ? 37.292  -19.541 52.984  1.00 21.93 ? 141  ALA C N   1 
ATOM   4909 C  CA  . ALA C 1 139 ? 38.609  -18.874 52.978  1.00 21.51 ? 141  ALA C CA  1 
ATOM   4910 C  C   . ALA C 1 139 ? 39.117  -18.725 54.393  1.00 22.02 ? 141  ALA C C   1 
ATOM   4911 O  O   . ALA C 1 139 ? 38.355  -18.335 55.299  1.00 22.11 ? 141  ALA C O   1 
ATOM   4912 C  CB  . ALA C 1 139 ? 38.515  -17.526 52.294  1.00 20.38 ? 141  ALA C CB  1 
ATOM   4913 N  N   . VAL C 1 140 ? 40.385  -19.073 54.613  1.00 22.63 ? 142  VAL C N   1 
ATOM   4914 C  CA  . VAL C 1 140 ? 41.012  -18.974 55.926  1.00 22.97 ? 142  VAL C CA  1 
ATOM   4915 C  C   . VAL C 1 140 ? 42.149  -17.934 55.855  1.00 25.63 ? 142  VAL C C   1 
ATOM   4916 O  O   . VAL C 1 140 ? 42.951  -17.953 54.904  1.00 27.12 ? 142  VAL C O   1 
ATOM   4917 C  CB  . VAL C 1 140 ? 41.544  -20.323 56.427  1.00 22.54 ? 142  VAL C CB  1 
ATOM   4918 C  CG1 . VAL C 1 140 ? 42.022  -20.212 57.859  1.00 23.10 ? 142  VAL C CG1 1 
ATOM   4919 C  CG2 . VAL C 1 140 ? 40.493  -21.431 56.318  1.00 21.93 ? 142  VAL C CG2 1 
ATOM   4920 N  N   . LEU C 1 141 ? 42.164  -16.999 56.809  1.00 25.05 ? 143  LEU C N   1 
ATOM   4921 C  CA  . LEU C 1 141 ? 43.306  -16.100 57.027  1.00 25.61 ? 143  LEU C CA  1 
ATOM   4922 C  C   . LEU C 1 141 ? 44.187  -16.716 58.100  1.00 26.98 ? 143  LEU C C   1 
ATOM   4923 O  O   . LEU C 1 141 ? 43.705  -17.089 59.189  1.00 24.46 ? 143  LEU C O   1 
ATOM   4924 C  CB  . LEU C 1 141 ? 42.854  -14.704 57.433  1.00 25.92 ? 143  LEU C CB  1 
ATOM   4925 C  CG  . LEU C 1 141 ? 41.887  -13.950 56.518  1.00 26.38 ? 143  LEU C CG  1 
ATOM   4926 C  CD1 . LEU C 1 141 ? 41.677  -12.540 57.059  1.00 26.01 ? 143  LEU C CD1 1 
ATOM   4927 C  CD2 . LEU C 1 141 ? 42.316  -13.904 55.056  1.00 27.54 ? 143  LEU C CD2 1 
ATOM   4928 N  N   . ALA C 1 142 ? 45.484  -16.870 57.779  1.00 25.24 ? 144  ALA C N   1 
ATOM   4929 C  CA  . ALA C 1 142 ? 46.429  -17.532 58.649  1.00 25.97 ? 144  ALA C CA  1 
ATOM   4930 C  C   . ALA C 1 142 ? 47.617  -16.604 58.939  1.00 27.10 ? 144  ALA C C   1 
ATOM   4931 O  O   . ALA C 1 142 ? 48.133  -15.929 58.027  1.00 25.43 ? 144  ALA C O   1 
ATOM   4932 C  CB  . ALA C 1 142 ? 46.928  -18.830 58.034  1.00 27.15 ? 144  ALA C CB  1 
ATOM   4933 N  N   . ALA C 1 143 ? 48.029  -16.591 60.196  1.00 26.14 ? 145  ALA C N   1 
ATOM   4934 C  CA  . ALA C 1 143 ? 49.177  -15.782 60.638  1.00 26.79 ? 145  ALA C CA  1 
ATOM   4935 C  C   . ALA C 1 143 ? 49.984  -16.588 61.612  1.00 27.78 ? 145  ALA C C   1 
ATOM   4936 O  O   . ALA C 1 143 ? 49.448  -17.339 62.431  1.00 26.46 ? 145  ALA C O   1 
ATOM   4937 C  CB  . ALA C 1 143 ? 48.718  -14.470 61.247  1.00 28.40 ? 145  ALA C CB  1 
ATOM   4938 N  N   . PHE C 1 144 ? 51.307  -16.473 61.499  1.00 28.91 ? 146  PHE C N   1 
ATOM   4939 C  CA  . PHE C 1 144 ? 52.200  -17.117 62.434  1.00 28.55 ? 146  PHE C CA  1 
ATOM   4940 C  C   . PHE C 1 144 ? 52.306  -16.249 63.687  1.00 27.43 ? 146  PHE C C   1 
ATOM   4941 O  O   . PHE C 1 144 ? 52.286  -15.010 63.611  1.00 26.53 ? 146  PHE C O   1 
ATOM   4942 C  CB  . PHE C 1 144 ? 53.587  -17.322 61.811  1.00 28.90 ? 146  PHE C CB  1 
ATOM   4943 C  CG  . PHE C 1 144 ? 53.568  -18.176 60.574  1.00 29.21 ? 146  PHE C CG  1 
ATOM   4944 C  CD1 . PHE C 1 144 ? 53.225  -19.523 60.650  1.00 31.07 ? 146  PHE C CD1 1 
ATOM   4945 C  CD2 . PHE C 1 144 ? 53.871  -17.631 59.326  1.00 30.37 ? 146  PHE C CD2 1 
ATOM   4946 C  CE1 . PHE C 1 144 ? 53.190  -20.315 59.499  1.00 29.98 ? 146  PHE C CE1 1 
ATOM   4947 C  CE2 . PHE C 1 144 ? 53.841  -18.419 58.177  1.00 29.64 ? 146  PHE C CE2 1 
ATOM   4948 C  CZ  . PHE C 1 144 ? 53.510  -19.758 58.271  1.00 29.12 ? 146  PHE C CZ  1 
ATOM   4949 N  N   . LEU C 1 145 ? 52.395  -16.926 64.821  1.00 28.56 ? 147  LEU C N   1 
ATOM   4950 C  CA  . LEU C 1 145 ? 52.686  -16.302 66.090  1.00 31.76 ? 147  LEU C CA  1 
ATOM   4951 C  C   . LEU C 1 145 ? 54.127  -16.642 66.469  1.00 33.17 ? 147  LEU C C   1 
ATOM   4952 O  O   . LEU C 1 145 ? 54.496  -17.817 66.487  1.00 32.40 ? 147  LEU C O   1 
ATOM   4953 C  CB  . LEU C 1 145 ? 51.732  -16.801 67.173  1.00 31.15 ? 147  LEU C CB  1 
ATOM   4954 C  CG  . LEU C 1 145 ? 50.228  -16.796 66.863  1.00 32.08 ? 147  LEU C CG  1 
ATOM   4955 C  CD1 . LEU C 1 145 ? 49.444  -17.093 68.141  1.00 32.36 ? 147  LEU C CD1 1 
ATOM   4956 C  CD2 . LEU C 1 145 ? 49.776  -15.482 66.252  1.00 32.95 ? 147  LEU C CD2 1 
ATOM   4957 N  N   . GLU C 1 146 ? 54.913  -15.607 66.776  1.00 37.05 ? 148  GLU C N   1 
ATOM   4958 C  CA  . GLU C 1 146 ? 56.334  -15.743 67.181  1.00 40.00 ? 148  GLU C CA  1 
ATOM   4959 C  C   . GLU C 1 146 ? 56.563  -15.180 68.575  1.00 43.01 ? 148  GLU C C   1 
ATOM   4960 O  O   . GLU C 1 146 ? 55.779  -14.332 69.053  1.00 40.42 ? 148  GLU C O   1 
ATOM   4961 C  CB  . GLU C 1 146 ? 57.247  -14.989 66.208  1.00 41.33 ? 148  GLU C CB  1 
ATOM   4962 C  CG  . GLU C 1 146 ? 57.388  -15.682 64.872  1.00 42.94 ? 148  GLU C CG  1 
ATOM   4963 C  CD  . GLU C 1 146 ? 58.432  -15.055 63.973  1.00 41.99 ? 148  GLU C CD  1 
ATOM   4964 O  OE1 . GLU C 1 146 ? 58.322  -13.852 63.668  1.00 41.98 ? 148  GLU C OE1 1 
ATOM   4965 O  OE2 . GLU C 1 146 ? 59.345  -15.782 63.547  1.00 45.05 ? 148  GLU C OE2 1 
ATOM   4966 N  N   . GLU C 1 147 ? 57.645  -15.644 69.210  1.00 46.42 ? 149  GLU C N   1 
ATOM   4967 C  CA  . GLU C 1 147 ? 58.071  -15.137 70.517  1.00 46.86 ? 149  GLU C CA  1 
ATOM   4968 C  C   . GLU C 1 147 ? 58.624  -13.730 70.368  1.00 50.06 ? 149  GLU C C   1 
ATOM   4969 O  O   . GLU C 1 147 ? 59.486  -13.483 69.529  1.00 51.54 ? 149  GLU C O   1 
ATOM   4970 C  CB  . GLU C 1 147 ? 59.113  -16.045 71.161  1.00 50.28 ? 149  GLU C CB  1 
ATOM   4971 C  CG  . GLU C 1 147 ? 59.590  -15.566 72.534  1.00 51.69 ? 149  GLU C CG  1 
ATOM   4972 C  CD  . GLU C 1 147 ? 60.333  -16.635 73.313  1.00 54.19 ? 149  GLU C CD  1 
ATOM   4973 O  OE1 . GLU C 1 147 ? 59.778  -17.733 73.530  1.00 56.75 ? 149  GLU C OE1 1 
ATOM   4974 O  OE2 . GLU C 1 147 ? 61.474  -16.370 73.730  1.00 56.23 ? 149  GLU C OE2 1 
ATOM   4975 N  N   . GLY C 1 148 ? 58.102  -12.812 71.173  1.00 52.64 ? 150  GLY C N   1 
ATOM   4976 C  CA  . GLY C 1 148 ? 58.556  -11.424 71.202  1.00 55.75 ? 150  GLY C CA  1 
ATOM   4977 C  C   . GLY C 1 148 ? 58.874  -10.990 72.623  1.00 55.06 ? 150  GLY C C   1 
ATOM   4978 O  O   . GLY C 1 148 ? 58.652  -11.754 73.567  1.00 53.58 ? 150  GLY C O   1 
ATOM   4979 N  N   . PRO C 1 149 ? 59.422  -9.771  72.783  1.00 56.39 ? 151  PRO C N   1 
ATOM   4980 C  CA  . PRO C 1 149 ? 59.699  -9.221  74.116  1.00 56.66 ? 151  PRO C CA  1 
ATOM   4981 C  C   . PRO C 1 149 ? 58.477  -8.664  74.862  1.00 55.49 ? 151  PRO C C   1 
ATOM   4982 O  O   . PRO C 1 149 ? 58.361  -8.903  76.062  1.00 59.34 ? 151  PRO C O   1 
ATOM   4983 C  CB  . PRO C 1 149 ? 60.719  -8.115  73.834  1.00 56.27 ? 151  PRO C CB  1 
ATOM   4984 C  CG  . PRO C 1 149 ? 60.478  -7.721  72.423  1.00 56.67 ? 151  PRO C CG  1 
ATOM   4985 C  CD  . PRO C 1 149 ? 60.065  -8.975  71.720  1.00 57.10 ? 151  PRO C CD  1 
ATOM   4986 N  N   . GLU C 1 150 ? 57.587  -7.939  74.175  1.00 51.94 ? 152  GLU C N   1 
ATOM   4987 C  CA  . GLU C 1 150 ? 56.402  -7.351  74.814  1.00 51.05 ? 152  GLU C CA  1 
ATOM   4988 C  C   . GLU C 1 150 ? 55.231  -8.350  74.917  1.00 53.73 ? 152  GLU C C   1 
ATOM   4989 O  O   . GLU C 1 150 ? 55.146  -9.325  74.155  1.00 54.13 ? 152  GLU C O   1 
ATOM   4990 C  CB  . GLU C 1 150 ? 55.950  -6.088  74.079  1.00 49.30 ? 152  GLU C CB  1 
ATOM   4991 N  N   . GLU C 1 151 ? 54.349  -8.106  75.886  1.00 49.84 ? 153  GLU C N   1 
ATOM   4992 C  CA  . GLU C 1 151 ? 53.099  -8.849  76.022  1.00 48.14 ? 153  GLU C CA  1 
ATOM   4993 C  C   . GLU C 1 151 ? 52.120  -8.314  74.982  1.00 45.59 ? 153  GLU C C   1 
ATOM   4994 O  O   . GLU C 1 151 ? 51.927  -7.103  74.856  1.00 42.69 ? 153  GLU C O   1 
ATOM   4995 C  CB  . GLU C 1 151 ? 52.523  -8.700  77.441  1.00 50.44 ? 153  GLU C CB  1 
ATOM   4996 C  CG  . GLU C 1 151 ? 51.342  -9.613  77.746  1.00 52.12 ? 153  GLU C CG  1 
ATOM   4997 C  CD  . GLU C 1 151 ? 50.712  -9.349  79.109  1.00 55.09 ? 153  GLU C CD  1 
ATOM   4998 O  OE1 . GLU C 1 151 ? 50.041  -8.307  79.287  1.00 53.17 ? 153  GLU C OE1 1 
ATOM   4999 O  OE2 . GLU C 1 151 ? 50.860  -10.205 80.000  1.00 58.63 ? 153  GLU C OE2 1 
ATOM   5000 N  N   . ASN C 1 152 ? 51.532  -9.222  74.205  1.00 46.17 ? 154  ASN C N   1 
ATOM   5001 C  CA  . ASN C 1 152 ? 50.489  -8.861  73.250  1.00 41.48 ? 154  ASN C CA  1 
ATOM   5002 C  C   . ASN C 1 152 ? 49.193  -8.697  74.022  1.00 38.60 ? 154  ASN C C   1 
ATOM   5003 O  O   . ASN C 1 152 ? 48.682  -9.668  74.588  1.00 38.70 ? 154  ASN C O   1 
ATOM   5004 C  CB  . ASN C 1 152 ? 50.343  -9.953  72.182  1.00 41.34 ? 154  ASN C CB  1 
ATOM   5005 C  CG  . ASN C 1 152 ? 49.527  -9.495  70.988  1.00 40.22 ? 154  ASN C CG  1 
ATOM   5006 O  OD1 . ASN C 1 152 ? 48.397  -9.029  71.131  1.00 39.59 ? 154  ASN C OD1 1 
ATOM   5007 N  ND2 . ASN C 1 152 ? 50.100  -9.615  69.796  1.00 42.13 ? 154  ASN C ND2 1 
ATOM   5008 N  N   . SER C 1 153 ? 48.680  -7.474  74.070  1.00 40.41 ? 155  SER C N   1 
ATOM   5009 C  CA  . SER C 1 153 ? 47.514  -7.184  74.894  1.00 39.62 ? 155  SER C CA  1 
ATOM   5010 C  C   . SER C 1 153 ? 46.242  -7.676  74.216  1.00 40.69 ? 155  SER C C   1 
ATOM   5011 O  O   . SER C 1 153 ? 45.295  -8.050  74.901  1.00 39.87 ? 155  SER C O   1 
ATOM   5012 C  CB  . SER C 1 153 ? 47.422  -5.694  75.237  1.00 40.94 ? 155  SER C CB  1 
ATOM   5013 O  OG  . SER C 1 153 ? 47.457  -4.885  74.086  1.00 41.66 ? 155  SER C OG  1 
ATOM   5014 N  N   . ALA C 1 154 ? 46.221  -7.703  72.882  1.00 40.49 ? 156  ALA C N   1 
ATOM   5015 C  CA  . ALA C 1 154 ? 45.073  -8.273  72.173  1.00 39.97 ? 156  ALA C CA  1 
ATOM   5016 C  C   . ALA C 1 154 ? 44.917  -9.769  72.508  1.00 37.57 ? 156  ALA C C   1 
ATOM   5017 O  O   . ALA C 1 154 ? 43.837  -10.194 72.909  1.00 36.54 ? 156  ALA C O   1 
ATOM   5018 C  CB  . ALA C 1 154 ? 45.170  -8.018  70.673  1.00 39.95 ? 156  ALA C CB  1 
ATOM   5019 N  N   . TYR C 1 155 ? 46.002  -10.541 72.420  1.00 36.86 ? 157  TYR C N   1 
ATOM   5020 C  CA  . TYR C 1 155 ? 45.957  -11.969 72.760  1.00 35.07 ? 157  TYR C CA  1 
ATOM   5021 C  C   . TYR C 1 155 ? 45.718  -12.234 74.247  1.00 37.17 ? 157  TYR C C   1 
ATOM   5022 O  O   . TYR C 1 155 ? 45.098  -13.235 74.607  1.00 35.86 ? 157  TYR C O   1 
ATOM   5023 C  CB  . TYR C 1 155 ? 47.224  -12.714 72.286  1.00 34.96 ? 157  TYR C CB  1 
ATOM   5024 C  CG  . TYR C 1 155 ? 47.142  -13.081 70.827  1.00 33.06 ? 157  TYR C CG  1 
ATOM   5025 C  CD1 . TYR C 1 155 ? 47.361  -12.126 69.841  1.00 34.22 ? 157  TYR C CD1 1 
ATOM   5026 C  CD2 . TYR C 1 155 ? 46.773  -14.357 70.430  1.00 33.01 ? 157  TYR C CD2 1 
ATOM   5027 C  CE1 . TYR C 1 155 ? 47.252  -12.449 68.492  1.00 33.65 ? 157  TYR C CE1 1 
ATOM   5028 C  CE2 . TYR C 1 155 ? 46.658  -14.687 69.083  1.00 32.57 ? 157  TYR C CE2 1 
ATOM   5029 C  CZ  . TYR C 1 155 ? 46.896  -13.730 68.125  1.00 32.42 ? 157  TYR C CZ  1 
ATOM   5030 O  OH  . TYR C 1 155 ? 46.779  -14.033 66.789  1.00 34.72 ? 157  TYR C OH  1 
ATOM   5031 N  N   . GLU C 1 156 ? 46.194  -11.345 75.113  1.00 37.82 ? 158  GLU C N   1 
ATOM   5032 C  CA  . GLU C 1 156 ? 46.026  -11.546 76.560  1.00 38.30 ? 158  GLU C CA  1 
ATOM   5033 C  C   . GLU C 1 156 ? 44.546  -11.681 76.947  1.00 36.08 ? 158  GLU C C   1 
ATOM   5034 O  O   . GLU C 1 156 ? 44.219  -12.471 77.825  1.00 34.21 ? 158  GLU C O   1 
ATOM   5035 C  CB  . GLU C 1 156 ? 46.706  -10.418 77.357  1.00 38.58 ? 158  GLU C CB  1 
ATOM   5036 C  CG  . GLU C 1 156 ? 46.823  -10.647 78.859  1.00 39.81 ? 158  GLU C CG  1 
ATOM   5037 C  CD  . GLU C 1 156 ? 47.564  -11.920 79.249  1.00 40.66 ? 158  GLU C CD  1 
ATOM   5038 O  OE1 . GLU C 1 156 ? 48.377  -12.451 78.461  1.00 42.56 ? 158  GLU C OE1 1 
ATOM   5039 O  OE2 . GLU C 1 156 ? 47.328  -12.413 80.359  1.00 40.27 ? 158  GLU C OE2 1 
ATOM   5040 N  N   . GLN C 1 157 ? 43.669  -10.935 76.271  1.00 36.34 ? 159  GLN C N   1 
ATOM   5041 C  CA  . GLN C 1 157 ? 42.215  -11.060 76.476  1.00 36.88 ? 159  GLN C CA  1 
ATOM   5042 C  C   . GLN C 1 157 ? 41.683  -12.479 76.299  1.00 36.53 ? 159  GLN C C   1 
ATOM   5043 O  O   . GLN C 1 157 ? 40.788  -12.892 77.021  1.00 34.98 ? 159  GLN C O   1 
ATOM   5044 C  CB  . GLN C 1 157 ? 41.446  -10.133 75.542  1.00 38.44 ? 159  GLN C CB  1 
ATOM   5045 C  CG  . GLN C 1 157 ? 41.557  -8.657  75.878  1.00 40.28 ? 159  GLN C CG  1 
ATOM   5046 C  CD  . GLN C 1 157 ? 40.571  -7.823  75.087  1.00 42.19 ? 159  GLN C CD  1 
ATOM   5047 O  OE1 . GLN C 1 157 ? 40.958  -7.038  74.235  1.00 42.74 ? 159  GLN C OE1 1 
ATOM   5048 N  NE2 . GLN C 1 157 ? 39.276  -8.006  75.360  1.00 45.98 ? 159  GLN C NE2 1 
ATOM   5049 N  N   . LEU C 1 158 ? 42.232  -13.221 75.342  1.00 34.19 ? 160  LEU C N   1 
ATOM   5050 C  CA  . LEU C 1 158 ? 41.857  -14.614 75.163  1.00 35.23 ? 160  LEU C CA  1 
ATOM   5051 C  C   . LEU C 1 158 ? 42.708  -15.543 76.024  1.00 34.09 ? 160  LEU C C   1 
ATOM   5052 O  O   . LEU C 1 158 ? 42.169  -16.480 76.633  1.00 31.73 ? 160  LEU C O   1 
ATOM   5053 C  CB  . LEU C 1 158 ? 41.958  -15.021 73.686  1.00 36.64 ? 160  LEU C CB  1 
ATOM   5054 C  CG  . LEU C 1 158 ? 41.099  -14.253 72.690  1.00 36.88 ? 160  LEU C CG  1 
ATOM   5055 C  CD1 . LEU C 1 158 ? 41.365  -14.769 71.280  1.00 35.79 ? 160  LEU C CD1 1 
ATOM   5056 C  CD2 . LEU C 1 158 ? 39.616  -14.340 73.039  1.00 37.16 ? 160  LEU C CD2 1 
ATOM   5057 N  N   . LEU C 1 159 ? 44.023  -15.293 76.085  1.00 30.84 ? 161  LEU C N   1 
ATOM   5058 C  CA  . LEU C 1 159 ? 44.929  -16.187 76.818  1.00 32.48 ? 161  LEU C CA  1 
ATOM   5059 C  C   . LEU C 1 159 ? 44.643  -16.216 78.324  1.00 31.18 ? 161  LEU C C   1 
ATOM   5060 O  O   . LEU C 1 159 ? 44.787  -17.249 78.934  1.00 31.27 ? 161  LEU C O   1 
ATOM   5061 C  CB  . LEU C 1 159 ? 46.402  -15.839 76.565  1.00 32.95 ? 161  LEU C CB  1 
ATOM   5062 C  CG  . LEU C 1 159 ? 46.867  -15.996 75.108  1.00 33.69 ? 161  LEU C CG  1 
ATOM   5063 C  CD1 . LEU C 1 159 ? 48.244  -15.387 74.914  1.00 33.78 ? 161  LEU C CD1 1 
ATOM   5064 C  CD2 . LEU C 1 159 ? 46.838  -17.448 74.654  1.00 34.17 ? 161  LEU C CD2 1 
ATOM   5065 N  N   . SER C 1 160 ? 44.203  -15.097 78.901  1.00 32.60 ? 162  SER C N   1 
ATOM   5066 C  CA  . SER C 1 160 ? 43.826  -15.061 80.334  1.00 33.83 ? 162  SER C CA  1 
ATOM   5067 C  C   . SER C 1 160 ? 42.563  -15.874 80.689  1.00 34.63 ? 162  SER C C   1 
ATOM   5068 O  O   . SER C 1 160 ? 42.282  -16.093 81.868  1.00 35.41 ? 162  SER C O   1 
ATOM   5069 C  CB  . SER C 1 160 ? 43.619  -13.617 80.784  1.00 34.49 ? 162  SER C CB  1 
ATOM   5070 O  OG  . SER C 1 160 ? 42.537  -13.034 80.079  1.00 31.32 ? 162  SER C OG  1 
ATOM   5071 N  N   . ARG C 1 161 ? 41.804  -16.311 79.681  1.00 33.02 ? 163  ARG C N   1 
ATOM   5072 C  CA  . ARG C 1 161 ? 40.589  -17.097 79.892  1.00 34.34 ? 163  ARG C CA  1 
ATOM   5073 C  C   . ARG C 1 161 ? 40.746  -18.592 79.675  1.00 32.49 ? 163  ARG C C   1 
ATOM   5074 O  O   . ARG C 1 161 ? 39.797  -19.324 79.885  1.00 31.73 ? 163  ARG C O   1 
ATOM   5075 C  CB  . ARG C 1 161 ? 39.490  -16.566 78.982  1.00 35.34 ? 163  ARG C CB  1 
ATOM   5076 C  CG  . ARG C 1 161 ? 39.218  -15.081 79.174  1.00 37.22 ? 163  ARG C CG  1 
ATOM   5077 C  CD  . ARG C 1 161 ? 38.712  -14.789 80.578  1.00 37.92 ? 163  ARG C CD  1 
ATOM   5078 N  NE  . ARG C 1 161 ? 37.649  -13.813 80.492  1.00 44.74 ? 163  ARG C NE  1 
ATOM   5079 C  CZ  . ARG C 1 161 ? 36.340  -14.038 80.606  1.00 44.08 ? 163  ARG C CZ  1 
ATOM   5080 N  NH1 . ARG C 1 161 ? 35.828  -15.236 80.880  1.00 45.35 ? 163  ARG C NH1 1 
ATOM   5081 N  NH2 . ARG C 1 161 ? 35.523  -13.009 80.472  1.00 49.29 ? 163  ARG C NH2 1 
ATOM   5082 N  N   . LEU C 1 162 ? 41.935  -19.049 79.265  1.00 30.85 ? 164  LEU C N   1 
ATOM   5083 C  CA  . LEU C 1 162 ? 42.134  -20.458 78.974  1.00 30.70 ? 164  LEU C CA  1 
ATOM   5084 C  C   . LEU C 1 162 ? 41.990  -21.336 80.197  1.00 32.07 ? 164  LEU C C   1 
ATOM   5085 O  O   . LEU C 1 162 ? 41.450  -22.440 80.100  1.00 32.26 ? 164  LEU C O   1 
ATOM   5086 C  CB  . LEU C 1 162 ? 43.503  -20.711 78.317  1.00 29.66 ? 164  LEU C CB  1 
ATOM   5087 C  CG  . LEU C 1 162 ? 43.811  -20.010 76.996  1.00 30.06 ? 164  LEU C CG  1 
ATOM   5088 C  CD1 . LEU C 1 162 ? 45.092  -20.589 76.412  1.00 29.41 ? 164  LEU C CD1 1 
ATOM   5089 C  CD2 . LEU C 1 162 ? 42.669  -20.125 75.998  1.00 30.78 ? 164  LEU C CD2 1 
ATOM   5090 N  N   . GLU C 1 163 ? 42.457  -20.856 81.348  1.00 35.97 ? 165  GLU C N   1 
ATOM   5091 C  CA  . GLU C 1 163 ? 42.373  -21.627 82.588  1.00 37.36 ? 165  GLU C CA  1 
ATOM   5092 C  C   . GLU C 1 163 ? 40.943  -22.059 82.902  1.00 34.91 ? 165  GLU C C   1 
ATOM   5093 O  O   . GLU C 1 163 ? 40.724  -23.214 83.277  1.00 32.12 ? 165  GLU C O   1 
ATOM   5094 C  CB  . GLU C 1 163 ? 42.965  -20.845 83.762  1.00 42.79 ? 165  GLU C CB  1 
ATOM   5095 C  CG  . GLU C 1 163 ? 43.298  -21.718 84.954  1.00 49.31 ? 165  GLU C CG  1 
ATOM   5096 C  CD  . GLU C 1 163 ? 44.290  -21.046 85.885  1.00 57.55 ? 165  GLU C CD  1 
ATOM   5097 O  OE1 . GLU C 1 163 ? 44.020  -19.904 86.332  1.00 60.44 ? 165  GLU C OE1 1 
ATOM   5098 O  OE2 . GLU C 1 163 ? 45.354  -21.650 86.145  1.00 64.29 ? 165  GLU C OE2 1 
ATOM   5099 N  N   . GLU C 1 164 ? 39.984  -21.146 82.697  1.00 35.30 ? 166  GLU C N   1 
ATOM   5100 C  CA  . GLU C 1 164 ? 38.544  -21.449 82.832  1.00 36.99 ? 166  GLU C CA  1 
ATOM   5101 C  C   . GLU C 1 164 ? 38.055  -22.567 81.936  1.00 33.75 ? 166  GLU C C   1 
ATOM   5102 O  O   . GLU C 1 164 ? 37.050  -23.192 82.244  1.00 32.15 ? 166  GLU C O   1 
ATOM   5103 C  CB  . GLU C 1 164 ? 37.677  -20.234 82.493  1.00 38.61 ? 166  GLU C CB  1 
ATOM   5104 C  CG  . GLU C 1 164 ? 37.724  -19.114 83.494  1.00 42.43 ? 166  GLU C CG  1 
ATOM   5105 C  CD  . GLU C 1 164 ? 37.407  -17.778 82.850  1.00 45.31 ? 166  GLU C CD  1 
ATOM   5106 O  OE1 . GLU C 1 164 ? 36.303  -17.624 82.264  1.00 43.37 ? 166  GLU C OE1 1 
ATOM   5107 O  OE2 . GLU C 1 164 ? 38.281  -16.889 82.918  1.00 50.77 ? 166  GLU C OE2 1 
ATOM   5108 N  N   . ILE C 1 165 ? 38.721  -22.794 80.806  1.00 30.41 ? 167  ILE C N   1 
ATOM   5109 C  CA  . ILE C 1 165 ? 38.295  -23.845 79.891  1.00 28.59 ? 167  ILE C CA  1 
ATOM   5110 C  C   . ILE C 1 165 ? 39.351  -24.939 79.737  1.00 30.76 ? 167  ILE C C   1 
ATOM   5111 O  O   . ILE C 1 165 ? 39.431  -25.596 78.700  1.00 28.56 ? 167  ILE C O   1 
ATOM   5112 C  CB  . ILE C 1 165 ? 37.848  -23.264 78.527  1.00 28.26 ? 167  ILE C CB  1 
ATOM   5113 C  CG1 . ILE C 1 165 ? 38.936  -22.402 77.895  1.00 26.68 ? 167  ILE C CG1 1 
ATOM   5114 C  CG2 . ILE C 1 165 ? 36.567  -22.436 78.714  1.00 27.54 ? 167  ILE C CG2 1 
ATOM   5115 C  CD1 . ILE C 1 165 ? 38.658  -22.010 76.462  1.00 27.35 ? 167  ILE C CD1 1 
ATOM   5116 N  N   . ALA C 1 166 ? 40.141  -25.149 80.789  1.00 31.14 ? 168  ALA C N   1 
ATOM   5117 C  CA  . ALA C 1 166 ? 41.196  -26.168 80.772  1.00 31.76 ? 168  ALA C CA  1 
ATOM   5118 C  C   . ALA C 1 166 ? 40.629  -27.537 80.397  1.00 31.98 ? 168  ALA C C   1 
ATOM   5119 O  O   . ALA C 1 166 ? 41.250  -28.283 79.648  1.00 32.39 ? 168  ALA C O   1 
ATOM   5120 C  CB  . ALA C 1 166 ? 41.881  -26.229 82.130  1.00 32.78 ? 168  ALA C CB  1 
ATOM   5121 N  N   . GLU C 1 167 ? 39.432  -27.838 80.897  1.00 31.23 ? 169  GLU C N   1 
ATOM   5122 C  CA  . GLU C 1 167 ? 38.782  -29.121 80.671  1.00 34.14 ? 169  GLU C CA  1 
ATOM   5123 C  C   . GLU C 1 167 ? 38.346  -29.279 79.209  1.00 32.83 ? 169  GLU C C   1 
ATOM   5124 O  O   . GLU C 1 167 ? 37.756  -28.372 78.632  1.00 29.28 ? 169  GLU C O   1 
ATOM   5125 C  CB  . GLU C 1 167 ? 37.552  -29.227 81.570  1.00 36.33 ? 169  GLU C CB  1 
ATOM   5126 C  CG  . GLU C 1 167 ? 36.818  -30.559 81.523  1.00 38.19 ? 169  GLU C CG  1 
ATOM   5127 C  CD  . GLU C 1 167 ? 35.432  -30.509 82.164  1.00 41.34 ? 169  GLU C CD  1 
ATOM   5128 O  OE1 . GLU C 1 167 ? 34.976  -29.417 82.604  1.00 41.61 ? 169  GLU C OE1 1 
ATOM   5129 O  OE2 . GLU C 1 167 ? 34.787  -31.573 82.209  1.00 41.01 ? 169  GLU C OE2 1 
ATOM   5130 N  N   . GLU C 1 168 ? 38.628  -30.444 78.634  1.00 30.36 ? 170  GLU C N   1 
ATOM   5131 C  CA  . GLU C 1 168 ? 38.183  -30.765 77.285  1.00 31.98 ? 170  GLU C CA  1 
ATOM   5132 C  C   . GLU C 1 168 ? 36.661  -30.641 77.204  1.00 29.58 ? 170  GLU C C   1 
ATOM   5133 O  O   . GLU C 1 168 ? 35.940  -31.203 78.041  1.00 26.96 ? 170  GLU C O   1 
ATOM   5134 C  CB  . GLU C 1 168 ? 38.593  -32.204 76.927  1.00 34.63 ? 170  GLU C CB  1 
ATOM   5135 C  CG  . GLU C 1 168 ? 37.939  -32.765 75.669  1.00 38.77 ? 170  GLU C CG  1 
ATOM   5136 C  CD  . GLU C 1 168 ? 38.192  -34.248 75.484  1.00 41.74 ? 170  GLU C CD  1 
ATOM   5137 O  OE1 . GLU C 1 168 ? 38.461  -34.940 76.487  1.00 47.56 ? 170  GLU C OE1 1 
ATOM   5138 O  OE2 . GLU C 1 168 ? 38.119  -34.720 74.333  1.00 45.21 ? 170  GLU C OE2 1 
ATOM   5139 N  N   . GLY C 1 169 ? 36.190  -29.920 76.193  1.00 29.23 ? 171  GLY C N   1 
ATOM   5140 C  CA  . GLY C 1 169 ? 34.769  -29.774 75.946  1.00 29.20 ? 171  GLY C CA  1 
ATOM   5141 C  C   . GLY C 1 169 ? 34.123  -28.667 76.766  1.00 28.71 ? 171  GLY C C   1 
ATOM   5142 O  O   . GLY C 1 169 ? 32.923  -28.571 76.794  1.00 30.75 ? 171  GLY C O   1 
ATOM   5143 N  N   . SER C 1 170 ? 34.910  -27.829 77.423  1.00 27.57 ? 172  SER C N   1 
ATOM   5144 C  CA  . SER C 1 170 ? 34.358  -26.765 78.238  1.00 26.24 ? 172  SER C CA  1 
ATOM   5145 C  C   . SER C 1 170 ? 34.386  -25.471 77.454  1.00 25.27 ? 172  SER C C   1 
ATOM   5146 O  O   . SER C 1 170 ? 35.064  -25.339 76.427  1.00 23.47 ? 172  SER C O   1 
ATOM   5147 C  CB  . SER C 1 170 ? 35.115  -26.647 79.553  1.00 28.30 ? 172  SER C CB  1 
ATOM   5148 O  OG  . SER C 1 170 ? 36.405  -26.130 79.334  1.00 27.33 ? 172  SER C OG  1 
ATOM   5149 N  N   . GLU C 1 171 ? 33.616  -24.507 77.921  1.00 24.20 ? 173  GLU C N   1 
ATOM   5150 C  CA  . GLU C 1 171 ? 33.537  -23.217 77.240  1.00 25.06 ? 173  GLU C CA  1 
ATOM   5151 C  C   . GLU C 1 171 ? 33.247  -22.088 78.216  1.00 23.74 ? 173  GLU C C   1 
ATOM   5152 O  O   . GLU C 1 171 ? 32.858  -22.323 79.354  1.00 22.40 ? 173  GLU C O   1 
ATOM   5153 C  CB  . GLU C 1 171 ? 32.487  -23.279 76.126  1.00 26.69 ? 173  GLU C CB  1 
ATOM   5154 C  CG  . GLU C 1 171 ? 31.056  -23.492 76.584  1.00 29.87 ? 173  GLU C CG  1 
ATOM   5155 C  CD  . GLU C 1 171 ? 30.060  -23.517 75.425  1.00 33.08 ? 173  GLU C CD  1 
ATOM   5156 O  OE1 . GLU C 1 171 ? 29.824  -24.582 74.856  1.00 33.67 ? 173  GLU C OE1 1 
ATOM   5157 O  OE2 . GLU C 1 171 ? 29.495  -22.470 75.085  1.00 35.73 ? 173  GLU C OE2 1 
ATOM   5158 N  N   . THR C 1 172 ? 33.467  -20.872 77.763  1.00 24.74 ? 174  THR C N   1 
ATOM   5159 C  CA  . THR C 1 172 ? 33.187  -19.702 78.554  1.00 26.77 ? 174  THR C CA  1 
ATOM   5160 C  C   . THR C 1 172 ? 32.810  -18.567 77.618  1.00 27.01 ? 174  THR C C   1 
ATOM   5161 O  O   . THR C 1 172 ? 33.110  -18.613 76.431  1.00 26.96 ? 174  THR C O   1 
ATOM   5162 C  CB  . THR C 1 172 ? 34.379  -19.344 79.462  1.00 28.34 ? 174  THR C CB  1 
ATOM   5163 O  OG1 . THR C 1 172 ? 33.976  -18.335 80.401  1.00 27.66 ? 174  THR C OG1 1 
ATOM   5164 C  CG2 . THR C 1 172 ? 35.578  -18.857 78.643  1.00 28.60 ? 174  THR C CG2 1 
ATOM   5165 N  N   . GLN C 1 173 ? 32.082  -17.586 78.143  1.00 27.41 ? 175  GLN C N   1 
ATOM   5166 C  CA  . GLN C 1 173 ? 31.720  -16.400 77.367  1.00 26.51 ? 175  GLN C CA  1 
ATOM   5167 C  C   . GLN C 1 173 ? 32.767  -15.330 77.650  1.00 26.26 ? 175  GLN C C   1 
ATOM   5168 O  O   . GLN C 1 173 ? 33.145  -15.152 78.812  1.00 27.29 ? 175  GLN C O   1 
ATOM   5169 C  CB  . GLN C 1 173 ? 30.308  -15.924 77.741  1.00 28.10 ? 175  GLN C CB  1 
ATOM   5170 C  CG  . GLN C 1 173 ? 29.189  -16.822 77.215  1.00 29.87 ? 175  GLN C CG  1 
ATOM   5171 C  CD  . GLN C 1 173 ? 27.824  -16.164 77.279  1.00 32.24 ? 175  GLN C CD  1 
ATOM   5172 O  OE1 . GLN C 1 173 ? 27.155  -16.183 78.317  1.00 35.37 ? 175  GLN C OE1 1 
ATOM   5173 N  NE2 . GLN C 1 173 ? 27.401  -15.573 76.166  1.00 33.92 ? 175  GLN C NE2 1 
ATOM   5174 N  N   . VAL C 1 174 ? 33.237  -14.630 76.609  1.00 25.02 ? 176  VAL C N   1 
ATOM   5175 C  CA  . VAL C 1 174 ? 34.255  -13.568 76.750  1.00 25.78 ? 176  VAL C CA  1 
ATOM   5176 C  C   . VAL C 1 174 ? 33.792  -12.279 76.061  1.00 25.96 ? 176  VAL C C   1 
ATOM   5177 O  O   . VAL C 1 174 ? 32.987  -12.332 75.141  1.00 26.02 ? 176  VAL C O   1 
ATOM   5178 C  CB  . VAL C 1 174 ? 35.654  -13.984 76.198  1.00 26.33 ? 176  VAL C CB  1 
ATOM   5179 C  CG1 . VAL C 1 174 ? 36.115  -15.284 76.834  1.00 27.41 ? 176  VAL C CG1 1 
ATOM   5180 C  CG2 . VAL C 1 174 ? 35.687  -14.069 74.674  1.00 26.71 ? 176  VAL C CG2 1 
ATOM   5181 N  N   . PRO C 1 175 ? 34.292  -11.115 76.511  1.00 27.47 ? 177  PRO C N   1 
ATOM   5182 C  CA  . PRO C 1 175 ? 33.860  -9.867  75.866  1.00 27.25 ? 177  PRO C CA  1 
ATOM   5183 C  C   . PRO C 1 175 ? 34.371  -9.722  74.442  1.00 28.59 ? 177  PRO C C   1 
ATOM   5184 O  O   . PRO C 1 175 ? 35.468  -10.185 74.140  1.00 25.88 ? 177  PRO C O   1 
ATOM   5185 C  CB  . PRO C 1 175 ? 34.457  -8.755  76.749  1.00 28.90 ? 177  PRO C CB  1 
ATOM   5186 C  CG  . PRO C 1 175 ? 35.401  -9.407  77.688  1.00 30.64 ? 177  PRO C CG  1 
ATOM   5187 C  CD  . PRO C 1 175 ? 35.074  -10.878 77.742  1.00 29.09 ? 177  PRO C CD  1 
ATOM   5188 N  N   . GLY C 1 176 ? 33.578  -9.074  73.585  1.00 26.34 ? 178  GLY C N   1 
ATOM   5189 C  CA  . GLY C 1 176 ? 34.013  -8.740  72.247  1.00 27.83 ? 178  GLY C CA  1 
ATOM   5190 C  C   . GLY C 1 176 ? 35.277  -7.907  72.301  1.00 28.88 ? 178  GLY C C   1 
ATOM   5191 O  O   . GLY C 1 176 ? 35.541  -7.222  73.286  1.00 28.67 ? 178  GLY C O   1 
ATOM   5192 N  N   . LEU C 1 177 ? 36.091  -8.026  71.267  1.00 29.07 ? 179  LEU C N   1 
ATOM   5193 C  CA  . LEU C 1 177 ? 37.365  -7.315  71.195  1.00 29.45 ? 179  LEU C CA  1 
ATOM   5194 C  C   . LEU C 1 177 ? 37.623  -6.994  69.736  1.00 29.74 ? 179  LEU C C   1 
ATOM   5195 O  O   . LEU C 1 177 ? 36.841  -7.374  68.862  1.00 25.63 ? 179  LEU C O   1 
ATOM   5196 C  CB  . LEU C 1 177 ? 38.498  -8.139  71.800  1.00 31.17 ? 179  LEU C CB  1 
ATOM   5197 C  CG  . LEU C 1 177 ? 38.948  -9.432  71.081  1.00 33.12 ? 179  LEU C CG  1 
ATOM   5198 C  CD1 . LEU C 1 177 ? 40.370  -9.780  71.491  1.00 33.85 ? 179  LEU C CD1 1 
ATOM   5199 C  CD2 . LEU C 1 177 ? 38.016  -10.602 71.362  1.00 32.53 ? 179  LEU C CD2 1 
ATOM   5200 N  N   . ASP C 1 178 ? 38.706  -6.276  69.480  1.00 29.40 ? 180  ASP C N   1 
ATOM   5201 C  CA  . ASP C 1 178 ? 39.112  -5.978  68.122  1.00 29.68 ? 180  ASP C CA  1 
ATOM   5202 C  C   . ASP C 1 178 ? 39.753  -7.240  67.562  1.00 28.93 ? 180  ASP C C   1 
ATOM   5203 O  O   . ASP C 1 178 ? 40.920  -7.535  67.822  1.00 27.90 ? 180  ASP C O   1 
ATOM   5204 C  CB  . ASP C 1 178 ? 40.100  -4.814  68.080  1.00 30.44 ? 180  ASP C CB  1 
ATOM   5205 C  CG  . ASP C 1 178 ? 40.517  -4.459  66.665  1.00 32.18 ? 180  ASP C CG  1 
ATOM   5206 O  OD1 . ASP C 1 178 ? 40.202  -5.206  65.712  1.00 30.49 ? 180  ASP C OD1 1 
ATOM   5207 O  OD2 . ASP C 1 178 ? 41.150  -3.406  66.493  1.00 34.78 ? 180  ASP C OD2 1 
ATOM   5208 N  N   . ILE C 1 179 ? 38.985  -7.967  66.770  1.00 28.53 ? 181  ILE C N   1 
ATOM   5209 C  CA  . ILE C 1 179 ? 39.439  -9.247  66.244  1.00 27.69 ? 181  ILE C CA  1 
ATOM   5210 C  C   . ILE C 1 179 ? 40.658  -9.059  65.315  1.00 28.19 ? 181  ILE C C   1 
ATOM   5211 O  O   . ILE C 1 179 ? 41.573  -9.891  65.332  1.00 27.68 ? 181  ILE C O   1 
ATOM   5212 C  CB  . ILE C 1 179 ? 38.269  -9.995  65.538  1.00 27.75 ? 181  ILE C CB  1 
ATOM   5213 C  CG1 . ILE C 1 179 ? 37.127  -10.294 66.541  1.00 27.71 ? 181  ILE C CG1 1 
ATOM   5214 C  CG2 . ILE C 1 179 ? 38.748  -11.295 64.884  1.00 27.37 ? 181  ILE C CG2 1 
ATOM   5215 C  CD1 . ILE C 1 179 ? 37.530  -11.122 67.744  1.00 27.19 ? 181  ILE C CD1 1 
ATOM   5216 N  N   . SER C 1 180 ? 40.681  -7.945  64.578  1.00 29.86 ? 182  SER C N   1 
ATOM   5217 C  CA  . SER C 1 180 ? 41.755  -7.630  63.636  1.00 32.27 ? 182  SER C CA  1 
ATOM   5218 C  C   . SER C 1 180 ? 43.072  -7.342  64.345  1.00 34.79 ? 182  SER C C   1 
ATOM   5219 O  O   . SER C 1 180 ? 44.131  -7.534  63.767  1.00 35.18 ? 182  SER C O   1 
ATOM   5220 C  CB  . SER C 1 180 ? 41.354  -6.499  62.675  1.00 32.96 ? 182  SER C CB  1 
ATOM   5221 O  OG  . SER C 1 180 ? 41.365  -5.227  63.291  1.00 32.86 ? 182  SER C OG  1 
ATOM   5222 N  N   . ALA C 1 181 ? 43.016  -6.970  65.623  1.00 33.13 ? 183  ALA C N   1 
ATOM   5223 C  CA  . ALA C 1 181 ? 44.236  -6.833  66.422  1.00 33.37 ? 183  ALA C CA  1 
ATOM   5224 C  C   . ALA C 1 181 ? 44.910  -8.159  66.778  1.00 32.10 ? 183  ALA C C   1 
ATOM   5225 O  O   . ALA C 1 181 ? 46.019  -8.145  67.299  1.00 33.49 ? 183  ALA C O   1 
ATOM   5226 C  CB  . ALA C 1 181 ? 43.958  -6.010  67.682  1.00 33.06 ? 183  ALA C CB  1 
ATOM   5227 N  N   . LEU C 1 182 ? 44.255  -9.298  66.521  1.00 31.38 ? 184  LEU C N   1 
ATOM   5228 C  CA  . LEU C 1 182 ? 44.894  -10.617 66.624  1.00 29.89 ? 184  LEU C CA  1 
ATOM   5229 C  C   . LEU C 1 182 ? 45.676  -11.017 65.365  1.00 30.00 ? 184  LEU C C   1 
ATOM   5230 O  O   . LEU C 1 182 ? 46.325  -12.075 65.334  1.00 30.47 ? 184  LEU C O   1 
ATOM   5231 C  CB  . LEU C 1 182 ? 43.854  -11.700 66.891  1.00 29.64 ? 184  LEU C CB  1 
ATOM   5232 C  CG  . LEU C 1 182 ? 43.013  -11.515 68.149  1.00 30.27 ? 184  LEU C CG  1 
ATOM   5233 C  CD1 . LEU C 1 182 ? 41.789  -12.417 68.077  1.00 30.66 ? 184  LEU C CD1 1 
ATOM   5234 C  CD2 . LEU C 1 182 ? 43.834  -11.795 69.403  1.00 30.27 ? 184  LEU C CD2 1 
ATOM   5235 N  N   . LEU C 1 183 ? 45.565  -10.205 64.321  1.00 29.80 ? 185  LEU C N   1 
ATOM   5236 C  CA  . LEU C 1 183 ? 46.250  -10.429 63.058  1.00 30.25 ? 185  LEU C CA  1 
ATOM   5237 C  C   . LEU C 1 183 ? 47.365  -9.389  62.884  1.00 33.45 ? 185  LEU C C   1 
ATOM   5238 O  O   . LEU C 1 183 ? 47.400  -8.385  63.609  1.00 32.25 ? 185  LEU C O   1 
ATOM   5239 C  CB  . LEU C 1 183 ? 45.252  -10.296 61.912  1.00 29.16 ? 185  LEU C CB  1 
ATOM   5240 C  CG  . LEU C 1 183 ? 44.124  -11.333 61.871  1.00 28.83 ? 185  LEU C CG  1 
ATOM   5241 C  CD1 . LEU C 1 183 ? 43.140  -10.991 60.768  1.00 29.90 ? 185  LEU C CD1 1 
ATOM   5242 C  CD2 . LEU C 1 183 ? 44.684  -12.708 61.650  1.00 29.97 ? 185  LEU C CD2 1 
ATOM   5243 N  N   . PRO C 1 184 ? 48.275  -9.619  61.915  1.00 34.90 ? 186  PRO C N   1 
ATOM   5244 C  CA  . PRO C 1 184 ? 49.266  -8.592  61.564  1.00 35.04 ? 186  PRO C CA  1 
ATOM   5245 C  C   . PRO C 1 184 ? 48.634  -7.314  61.021  1.00 35.27 ? 186  PRO C C   1 
ATOM   5246 O  O   . PRO C 1 184 ? 47.561  -7.356  60.415  1.00 35.67 ? 186  PRO C O   1 
ATOM   5247 C  CB  . PRO C 1 184 ? 50.100  -9.267  60.466  1.00 36.34 ? 186  PRO C CB  1 
ATOM   5248 C  CG  . PRO C 1 184 ? 49.921  -10.741 60.685  1.00 35.33 ? 186  PRO C CG  1 
ATOM   5249 C  CD  . PRO C 1 184 ? 48.535  -10.901 61.223  1.00 35.46 ? 186  PRO C CD  1 
ATOM   5250 N  N   . SER C 1 185 ? 49.321  -6.190  61.212  1.00 35.31 ? 187  SER C N   1 
ATOM   5251 C  CA  . SER C 1 185 ? 48.889  -4.904  60.662  1.00 37.18 ? 187  SER C CA  1 
ATOM   5252 C  C   . SER C 1 185 ? 49.085  -4.796  59.154  1.00 34.05 ? 187  SER C C   1 
ATOM   5253 O  O   . SER C 1 185 ? 48.402  -4.019  58.506  1.00 35.02 ? 187  SER C O   1 
ATOM   5254 C  CB  . SER C 1 185 ? 49.660  -3.769  61.345  1.00 40.03 ? 187  SER C CB  1 
ATOM   5255 O  OG  . SER C 1 185 ? 51.029  -4.135  61.439  1.00 42.84 ? 187  SER C OG  1 
ATOM   5256 N  N   . ASP C 1 186 ? 50.039  -5.542  58.602  1.00 36.46 ? 188  ASP C N   1 
ATOM   5257 C  CA  . ASP C 1 186 ? 50.269  -5.535  57.160  1.00 36.79 ? 188  ASP C CA  1 
ATOM   5258 C  C   . ASP C 1 186 ? 49.337  -6.555  56.474  1.00 34.42 ? 188  ASP C C   1 
ATOM   5259 O  O   . ASP C 1 186 ? 49.557  -7.761  56.575  1.00 37.51 ? 188  ASP C O   1 
ATOM   5260 C  CB  . ASP C 1 186 ? 51.726  -5.864  56.860  1.00 38.47 ? 188  ASP C CB  1 
ATOM   5261 C  CG  . ASP C 1 186 ? 52.105  -5.588  55.418  1.00 41.22 ? 188  ASP C CG  1 
ATOM   5262 O  OD1 . ASP C 1 186 ? 51.237  -5.222  54.593  1.00 41.97 ? 188  ASP C OD1 1 
ATOM   5263 O  OD2 . ASP C 1 186 ? 53.306  -5.711  55.118  1.00 47.35 ? 188  ASP C OD2 1 
ATOM   5264 N  N   . PHE C 1 187 ? 48.304  -6.041  55.811  1.00 35.30 ? 189  PHE C N   1 
ATOM   5265 C  CA  . PHE C 1 187 ? 47.356  -6.837  55.034  1.00 38.85 ? 189  PHE C CA  1 
ATOM   5266 C  C   . PHE C 1 187 ? 47.693  -6.823  53.538  1.00 38.17 ? 189  PHE C C   1 
ATOM   5267 O  O   . PHE C 1 187 ? 46.934  -7.369  52.747  1.00 33.30 ? 189  PHE C O   1 
ATOM   5268 C  CB  . PHE C 1 187 ? 45.911  -6.300  55.192  1.00 41.47 ? 189  PHE C CB  1 
ATOM   5269 C  CG  . PHE C 1 187 ? 45.273  -6.529  56.551  1.00 46.86 ? 189  PHE C CG  1 
ATOM   5270 C  CD1 . PHE C 1 187 ? 45.593  -7.622  57.357  1.00 49.22 ? 189  PHE C CD1 1 
ATOM   5271 C  CD2 . PHE C 1 187 ? 44.279  -5.656  56.994  1.00 53.16 ? 189  PHE C CD2 1 
ATOM   5272 C  CE1 . PHE C 1 187 ? 44.970  -7.815  58.583  1.00 53.85 ? 189  PHE C CE1 1 
ATOM   5273 C  CE2 . PHE C 1 187 ? 43.652  -5.838  58.227  1.00 53.92 ? 189  PHE C CE2 1 
ATOM   5274 C  CZ  . PHE C 1 187 ? 43.998  -6.921  59.019  1.00 53.01 ? 189  PHE C CZ  1 
ATOM   5275 N  N   . SER C 1 188 ? 48.810  -6.193  53.152  1.00 36.98 ? 190  SER C N   1 
ATOM   5276 C  CA  . SER C 1 188 ? 49.203  -6.077  51.748  1.00 37.34 ? 190  SER C CA  1 
ATOM   5277 C  C   . SER C 1 188 ? 50.174  -7.204  51.324  1.00 35.00 ? 190  SER C C   1 
ATOM   5278 O  O   . SER C 1 188 ? 50.235  -7.540  50.147  1.00 38.91 ? 190  SER C O   1 
ATOM   5279 C  CB  . SER C 1 188 ? 49.807  -4.681  51.479  1.00 38.40 ? 190  SER C CB  1 
ATOM   5280 O  OG  . SER C 1 188 ? 51.148  -4.617  51.949  1.00 42.17 ? 190  SER C OG  1 
ATOM   5281 N  N   . ARG C 1 189 ? 50.886  -7.805  52.277  1.00 34.64 ? 191  ARG C N   1 
ATOM   5282 C  CA  . ARG C 1 189 ? 51.923  -8.796  51.982  1.00 34.50 ? 191  ARG C CA  1 
ATOM   5283 C  C   . ARG C 1 189 ? 51.552  -10.203 52.456  1.00 31.65 ? 191  ARG C C   1 
ATOM   5284 O  O   . ARG C 1 189 ? 51.556  -10.496 53.645  1.00 30.70 ? 191  ARG C O   1 
ATOM   5285 C  CB  . ARG C 1 189 ? 53.256  -8.362  52.578  1.00 36.42 ? 191  ARG C CB  1 
ATOM   5286 C  CG  . ARG C 1 189 ? 53.781  -7.088  51.919  1.00 38.77 ? 191  ARG C CG  1 
ATOM   5287 C  CD  . ARG C 1 189 ? 55.039  -6.571  52.589  1.00 40.50 ? 191  ARG C CD  1 
ATOM   5288 N  NE  . ARG C 1 189 ? 56.225  -7.316  52.192  1.00 43.83 ? 191  ARG C NE  1 
ATOM   5289 C  CZ  . ARG C 1 189 ? 56.920  -7.123  51.069  1.00 45.80 ? 191  ARG C CZ  1 
ATOM   5290 N  NH1 . ARG C 1 189 ? 56.547  -6.211  50.166  1.00 45.59 ? 191  ARG C NH1 1 
ATOM   5291 N  NH2 . ARG C 1 189 ? 58.000  -7.873  50.839  1.00 46.20 ? 191  ARG C NH2 1 
ATOM   5292 N  N   . TYR C 1 190 ? 51.253  -11.082 51.504  1.00 30.06 ? 192  TYR C N   1 
ATOM   5293 C  CA  . TYR C 1 190 ? 50.807  -12.431 51.846  1.00 29.12 ? 192  TYR C CA  1 
ATOM   5294 C  C   . TYR C 1 190 ? 51.035  -13.427 50.727  1.00 28.73 ? 192  TYR C C   1 
ATOM   5295 O  O   . TYR C 1 190 ? 51.217  -13.057 49.573  1.00 29.73 ? 192  TYR C O   1 
ATOM   5296 C  CB  . TYR C 1 190 ? 49.310  -12.423 52.206  1.00 27.20 ? 192  TYR C CB  1 
ATOM   5297 C  CG  . TYR C 1 190 ? 48.414  -11.814 51.170  1.00 26.51 ? 192  TYR C CG  1 
ATOM   5298 C  CD1 . TYR C 1 190 ? 47.937  -12.572 50.090  1.00 26.32 ? 192  TYR C CD1 1 
ATOM   5299 C  CD2 . TYR C 1 190 ? 47.999  -10.497 51.265  1.00 25.71 ? 192  TYR C CD2 1 
ATOM   5300 C  CE1 . TYR C 1 190 ? 47.098  -12.018 49.143  1.00 25.70 ? 192  TYR C CE1 1 
ATOM   5301 C  CE2 . TYR C 1 190 ? 47.157  -9.943  50.325  1.00 25.99 ? 192  TYR C CE2 1 
ATOM   5302 C  CZ  . TYR C 1 190 ? 46.701  -10.715 49.263  1.00 25.51 ? 192  TYR C CZ  1 
ATOM   5303 O  OH  . TYR C 1 190 ? 45.873  -10.171 48.304  1.00 27.54 ? 192  TYR C OH  1 
ATOM   5304 N  N   . PHE C 1 191 ? 50.981  -14.692 51.110  1.00 29.38 ? 193  PHE C N   1 
ATOM   5305 C  CA  . PHE C 1 191 ? 50.933  -15.793 50.182  1.00 29.23 ? 193  PHE C CA  1 
ATOM   5306 C  C   . PHE C 1 191 ? 49.486  -16.269 50.067  1.00 31.47 ? 193  PHE C C   1 
ATOM   5307 O  O   . PHE C 1 191 ? 48.732  -16.207 51.052  1.00 29.17 ? 193  PHE C O   1 
ATOM   5308 C  CB  . PHE C 1 191 ? 51.782  -16.917 50.713  1.00 30.44 ? 193  PHE C CB  1 
ATOM   5309 C  CG  . PHE C 1 191 ? 53.200  -16.518 50.964  1.00 32.29 ? 193  PHE C CG  1 
ATOM   5310 C  CD1 . PHE C 1 191 ? 54.115  -16.459 49.908  1.00 35.13 ? 193  PHE C CD1 1 
ATOM   5311 C  CD2 . PHE C 1 191 ? 53.620  -16.178 52.241  1.00 32.20 ? 193  PHE C CD2 1 
ATOM   5312 C  CE1 . PHE C 1 191 ? 55.439  -16.082 50.136  1.00 33.72 ? 193  PHE C CE1 1 
ATOM   5313 C  CE2 . PHE C 1 191 ? 54.937  -15.791 52.475  1.00 34.73 ? 193  PHE C CE2 1 
ATOM   5314 C  CZ  . PHE C 1 191 ? 55.846  -15.748 51.426  1.00 34.29 ? 193  PHE C CZ  1 
ATOM   5315 N  N   . GLN C 1 192 ? 49.109  -16.763 48.889  1.00 27.34 ? 194  GLN C N   1 
ATOM   5316 C  CA  . GLN C 1 192 ? 47.770  -17.306 48.689  1.00 26.48 ? 194  GLN C CA  1 
ATOM   5317 C  C   . GLN C 1 192 ? 47.815  -18.577 47.847  1.00 26.52 ? 194  GLN C C   1 
ATOM   5318 O  O   . GLN C 1 192 ? 48.587  -18.676 46.893  1.00 26.25 ? 194  GLN C O   1 
ATOM   5319 C  CB  . GLN C 1 192 ? 46.896  -16.252 48.063  1.00 26.34 ? 194  GLN C CB  1 
ATOM   5320 C  CG  . GLN C 1 192 ? 45.426  -16.601 48.028  1.00 26.00 ? 194  GLN C CG  1 
ATOM   5321 C  CD  . GLN C 1 192 ? 44.578  -15.408 47.752  1.00 25.49 ? 194  GLN C CD  1 
ATOM   5322 O  OE1 . GLN C 1 192 ? 44.211  -15.161 46.623  1.00 25.73 ? 194  GLN C OE1 1 
ATOM   5323 N  NE2 . GLN C 1 192 ? 44.276  -14.630 48.792  1.00 27.77 ? 194  GLN C NE2 1 
ATOM   5324 N  N   . TYR C 1 193 ? 47.018  -19.565 48.232  1.00 24.74 ? 195  TYR C N   1 
ATOM   5325 C  CA  . TYR C 1 193 ? 46.928  -20.816 47.471  1.00 25.00 ? 195  TYR C CA  1 
ATOM   5326 C  C   . TYR C 1 193 ? 45.613  -21.519 47.813  1.00 25.22 ? 195  TYR C C   1 
ATOM   5327 O  O   . TYR C 1 193 ? 44.993  -21.236 48.843  1.00 24.83 ? 195  TYR C O   1 
ATOM   5328 C  CB  . TYR C 1 193 ? 48.117  -21.735 47.774  1.00 23.73 ? 195  TYR C CB  1 
ATOM   5329 C  CG  . TYR C 1 193 ? 48.028  -22.475 49.075  1.00 23.24 ? 195  TYR C CG  1 
ATOM   5330 C  CD1 . TYR C 1 193 ? 48.323  -21.839 50.290  1.00 23.21 ? 195  TYR C CD1 1 
ATOM   5331 C  CD2 . TYR C 1 193 ? 47.624  -23.797 49.116  1.00 22.66 ? 195  TYR C CD2 1 
ATOM   5332 C  CE1 . TYR C 1 193 ? 48.250  -22.520 51.497  1.00 23.18 ? 195  TYR C CE1 1 
ATOM   5333 C  CE2 . TYR C 1 193 ? 47.537  -24.483 50.316  1.00 23.14 ? 195  TYR C CE2 1 
ATOM   5334 C  CZ  . TYR C 1 193 ? 47.842  -23.828 51.513  1.00 23.52 ? 195  TYR C CZ  1 
ATOM   5335 O  OH  . TYR C 1 193 ? 47.750  -24.500 52.705  1.00 22.60 ? 195  TYR C OH  1 
ATOM   5336 N  N   . GLU C 1 194 ? 45.226  -22.442 46.949  1.00 25.62 ? 196  GLU C N   1 
ATOM   5337 C  CA  . GLU C 1 194 ? 44.044  -23.240 47.159  1.00 25.95 ? 196  GLU C CA  1 
ATOM   5338 C  C   . GLU C 1 194 ? 44.410  -24.582 47.766  1.00 25.49 ? 196  GLU C C   1 
ATOM   5339 O  O   . GLU C 1 194 ? 45.282  -25.294 47.258  1.00 26.25 ? 196  GLU C O   1 
ATOM   5340 C  CB  . GLU C 1 194 ? 43.287  -23.436 45.850  1.00 28.61 ? 196  GLU C CB  1 
ATOM   5341 C  CG  . GLU C 1 194 ? 41.857  -23.908 46.089  1.00 30.62 ? 196  GLU C CG  1 
ATOM   5342 C  CD  . GLU C 1 194 ? 40.971  -23.830 44.859  1.00 32.80 ? 196  GLU C CD  1 
ATOM   5343 O  OE1 . GLU C 1 194 ? 41.062  -22.862 44.083  1.00 35.79 ? 196  GLU C OE1 1 
ATOM   5344 O  OE2 . GLU C 1 194 ? 40.137  -24.735 44.686  1.00 34.47 ? 196  GLU C OE2 1 
ATOM   5345 N  N   . GLY C 1 195 ? 43.727  -24.940 48.849  1.00 22.75 ? 197  GLY C N   1 
ATOM   5346 C  CA  . GLY C 1 195 ? 43.945  -26.205 49.517  1.00 22.36 ? 197  GLY C CA  1 
ATOM   5347 C  C   . GLY C 1 195 ? 42.712  -26.739 50.225  1.00 22.83 ? 197  GLY C C   1 
ATOM   5348 O  O   . GLY C 1 195 ? 41.622  -26.745 49.655  1.00 23.03 ? 197  GLY C O   1 
ATOM   5349 N  N   . SER C 1 196 ? 42.908  -27.224 51.444  1.00 23.14 ? 198  SER C N   1 
ATOM   5350 C  CA  . SER C 1 196 ? 41.853  -27.899 52.205  1.00 22.97 ? 198  SER C CA  1 
ATOM   5351 C  C   . SER C 1 196 ? 41.712  -27.398 53.639  1.00 23.06 ? 198  SER C C   1 
ATOM   5352 O  O   . SER C 1 196 ? 42.538  -26.626 54.132  1.00 21.56 ? 198  SER C O   1 
ATOM   5353 C  CB  . SER C 1 196 ? 42.121  -29.403 52.237  1.00 21.34 ? 198  SER C CB  1 
ATOM   5354 O  OG  . SER C 1 196 ? 43.096  -29.754 53.209  1.00 21.09 ? 198  SER C OG  1 
ATOM   5355 N  N   . LEU C 1 197 ? 40.658  -27.864 54.311  1.00 24.05 ? 199  LEU C N   1 
ATOM   5356 C  CA  . LEU C 1 197 ? 40.611  -27.770 55.773  1.00 23.97 ? 199  LEU C CA  1 
ATOM   5357 C  C   . LEU C 1 197 ? 41.663  -28.726 56.309  1.00 24.23 ? 199  LEU C C   1 
ATOM   5358 O  O   . LEU C 1 197 ? 41.873  -29.802 55.742  1.00 22.49 ? 199  LEU C O   1 
ATOM   5359 C  CB  . LEU C 1 197 ? 39.235  -28.147 56.325  1.00 23.92 ? 199  LEU C CB  1 
ATOM   5360 C  CG  . LEU C 1 197 ? 38.071  -27.332 55.744  1.00 24.95 ? 199  LEU C CG  1 
ATOM   5361 C  CD1 . LEU C 1 197 ? 36.772  -27.839 56.327  1.00 25.87 ? 199  LEU C CD1 1 
ATOM   5362 C  CD2 . LEU C 1 197 ? 38.249  -25.853 56.029  1.00 26.21 ? 199  LEU C CD2 1 
ATOM   5363 N  N   . THR C 1 198 ? 42.316  -28.336 57.399  1.00 24.47 ? 200  THR C N   1 
ATOM   5364 C  CA  . THR C 1 198 ? 43.418  -29.117 57.960  1.00 24.91 ? 200  THR C CA  1 
ATOM   5365 C  C   . THR C 1 198 ? 42.996  -30.155 58.985  1.00 25.57 ? 200  THR C C   1 
ATOM   5366 O  O   . THR C 1 198 ? 43.843  -30.800 59.597  1.00 25.33 ? 200  THR C O   1 
ATOM   5367 C  CB  . THR C 1 198 ? 44.518  -28.203 58.539  1.00 26.24 ? 200  THR C CB  1 
ATOM   5368 O  OG1 . THR C 1 198 ? 44.093  -27.614 59.783  1.00 24.23 ? 200  THR C OG1 1 
ATOM   5369 C  CG2 . THR C 1 198 ? 44.876  -27.128 57.547  1.00 25.45 ? 200  THR C CG2 1 
ATOM   5370 N  N   . THR C 1 199 ? 41.690  -30.314 59.206  1.00 24.60 ? 201  THR C N   1 
ATOM   5371 C  CA  . THR C 1 199 ? 41.186  -31.381 60.040  1.00 24.96 ? 201  THR C CA  1 
ATOM   5372 C  C   . THR C 1 199 ? 40.021  -31.976 59.249  1.00 24.02 ? 201  THR C C   1 
ATOM   5373 O  O   . THR C 1 199 ? 39.581  -31.366 58.292  1.00 25.47 ? 201  THR C O   1 
ATOM   5374 C  CB  . THR C 1 199 ? 40.710  -30.880 61.432  1.00 26.22 ? 201  THR C CB  1 
ATOM   5375 O  OG1 . THR C 1 199 ? 39.501  -30.123 61.288  1.00 24.17 ? 201  THR C OG1 1 
ATOM   5376 C  CG2 . THR C 1 199 ? 41.790  -30.024 62.109  1.00 27.22 ? 201  THR C CG2 1 
ATOM   5377 N  N   . PRO C 1 200 ? 39.519  -33.154 59.642  1.00 23.35 ? 202  PRO C N   1 
ATOM   5378 C  CA  . PRO C 1 200 ? 38.306  -33.618 58.994  1.00 24.73 ? 202  PRO C CA  1 
ATOM   5379 C  C   . PRO C 1 200 ? 37.205  -32.555 59.078  1.00 26.26 ? 202  PRO C C   1 
ATOM   5380 O  O   . PRO C 1 200 ? 37.131  -31.850 60.087  1.00 26.01 ? 202  PRO C O   1 
ATOM   5381 C  CB  . PRO C 1 200 ? 37.940  -34.874 59.781  1.00 25.27 ? 202  PRO C CB  1 
ATOM   5382 C  CG  . PRO C 1 200 ? 39.244  -35.357 60.315  1.00 25.90 ? 202  PRO C CG  1 
ATOM   5383 C  CD  . PRO C 1 200 ? 40.010  -34.119 60.631  1.00 25.50 ? 202  PRO C CD  1 
ATOM   5384 N  N   . PRO C 1 201 ? 36.373  -32.417 58.052  1.00 26.04 ? 203  PRO C N   1 
ATOM   5385 C  CA  . PRO C 1 201 ? 36.312  -33.328 56.915  1.00 26.19 ? 203  PRO C CA  1 
ATOM   5386 C  C   . PRO C 1 201 ? 37.362  -33.121 55.789  1.00 26.17 ? 203  PRO C C   1 
ATOM   5387 O  O   . PRO C 1 201 ? 37.302  -33.843 54.805  1.00 25.98 ? 203  PRO C O   1 
ATOM   5388 C  CB  . PRO C 1 201 ? 34.906  -33.071 56.362  1.00 26.51 ? 203  PRO C CB  1 
ATOM   5389 C  CG  . PRO C 1 201 ? 34.700  -31.626 56.624  1.00 25.48 ? 203  PRO C CG  1 
ATOM   5390 C  CD  . PRO C 1 201 ? 35.413  -31.306 57.917  1.00 26.05 ? 203  PRO C CD  1 
ATOM   5391 N  N   . CYS C 1 202 ? 38.313  -32.200 55.953  1.00 25.27 ? 204  CYS C N   1 
ATOM   5392 C  CA  . CYS C 1 202 ? 39.400  -31.976 54.975  1.00 26.09 ? 204  CYS C CA  1 
ATOM   5393 C  C   . CYS C 1 202 ? 38.978  -31.582 53.568  1.00 25.12 ? 204  CYS C C   1 
ATOM   5394 O  O   . CYS C 1 202 ? 39.693  -31.871 52.596  1.00 24.95 ? 204  CYS C O   1 
ATOM   5395 C  CB  . CYS C 1 202 ? 40.281  -33.217 54.852  1.00 27.01 ? 204  CYS C CB  1 
ATOM   5396 S  SG  . CYS C 1 202 ? 40.976  -33.870 56.361  1.00 25.77 ? 204  CYS C SG  1 
ATOM   5397 N  N   . ALA C 1 203 ? 37.829  -30.925 53.455  1.00 23.27 ? 205  ALA C N   1 
ATOM   5398 C  CA  . ALA C 1 203 ? 37.270  -30.561 52.182  1.00 22.28 ? 205  ALA C CA  1 
ATOM   5399 C  C   . ALA C 1 203 ? 38.187  -29.609 51.437  1.00 22.81 ? 205  ALA C C   1 
ATOM   5400 O  O   . ALA C 1 203 ? 38.770  -28.694 52.039  1.00 22.34 ? 205  ALA C O   1 
ATOM   5401 C  CB  . ALA C 1 203 ? 35.899  -29.910 52.373  1.00 22.36 ? 205  ALA C CB  1 
ATOM   5402 N  N   . GLN C 1 204 ? 38.300  -29.815 50.125  1.00 22.16 ? 206  GLN C N   1 
ATOM   5403 C  CA  . GLN C 1 204 ? 39.141  -28.963 49.270  1.00 22.73 ? 206  GLN C CA  1 
ATOM   5404 C  C   . GLN C 1 204 ? 38.368  -27.734 48.759  1.00 22.75 ? 206  GLN C C   1 
ATOM   5405 O  O   . GLN C 1 204 ? 37.213  -27.512 49.139  1.00 24.38 ? 206  GLN C O   1 
ATOM   5406 C  CB  . GLN C 1 204 ? 39.810  -29.822 48.163  1.00 23.65 ? 206  GLN C CB  1 
ATOM   5407 C  CG  . GLN C 1 204 ? 40.860  -30.750 48.776  1.00 24.54 ? 206  GLN C CG  1 
ATOM   5408 C  CD  . GLN C 1 204 ? 41.546  -31.742 47.817  1.00 25.43 ? 206  GLN C CD  1 
ATOM   5409 O  OE1 . GLN C 1 204 ? 42.424  -32.473 48.231  1.00 24.62 ? 206  GLN C OE1 1 
ATOM   5410 N  NE2 . GLN C 1 204 ? 41.145  -31.763 46.565  1.00 26.05 ? 206  GLN C NE2 1 
ATOM   5411 N  N   . GLY C 1 205 ? 39.014  -26.871 47.981  1.00 21.43 ? 207  GLY C N   1 
ATOM   5412 C  CA  . GLY C 1 205 ? 38.383  -25.630 47.510  1.00 22.25 ? 207  GLY C CA  1 
ATOM   5413 C  C   . GLY C 1 205 ? 38.588  -24.460 48.471  1.00 22.00 ? 207  GLY C C   1 
ATOM   5414 O  O   . GLY C 1 205 ? 38.054  -23.387 48.244  1.00 24.69 ? 207  GLY C O   1 
ATOM   5415 N  N   . VAL C 1 206 ? 39.395  -24.651 49.512  1.00 22.13 ? 208  VAL C N   1 
ATOM   5416 C  CA  . VAL C 1 206 ? 39.601  -23.617 50.529  1.00 21.73 ? 208  VAL C CA  1 
ATOM   5417 C  C   . VAL C 1 206 ? 40.695  -22.676 50.016  1.00 22.32 ? 208  VAL C C   1 
ATOM   5418 O  O   . VAL C 1 206 ? 41.781  -23.144 49.637  1.00 24.26 ? 208  VAL C O   1 
ATOM   5419 C  CB  . VAL C 1 206 ? 40.019  -24.210 51.884  1.00 21.39 ? 208  VAL C CB  1 
ATOM   5420 C  CG1 . VAL C 1 206 ? 40.262  -23.107 52.938  1.00 20.54 ? 208  VAL C CG1 1 
ATOM   5421 C  CG2 . VAL C 1 206 ? 38.996  -25.238 52.372  1.00 21.79 ? 208  VAL C CG2 1 
ATOM   5422 N  N   . ILE C 1 207 ? 40.409  -21.374 50.010  1.00 22.65 ? 209  ILE C N   1 
ATOM   5423 C  CA  . ILE C 1 207 ? 41.420  -20.360 49.705  1.00 22.40 ? 209  ILE C CA  1 
ATOM   5424 C  C   . ILE C 1 207 ? 42.165  -19.974 50.979  1.00 23.30 ? 209  ILE C C   1 
ATOM   5425 O  O   . ILE C 1 207 ? 41.565  -19.404 51.902  1.00 23.12 ? 209  ILE C O   1 
ATOM   5426 C  CB  . ILE C 1 207 ? 40.817  -19.097 49.064  1.00 23.52 ? 209  ILE C CB  1 
ATOM   5427 C  CG1 . ILE C 1 207 ? 39.977  -19.423 47.822  1.00 26.03 ? 209  ILE C CG1 1 
ATOM   5428 C  CG2 . ILE C 1 207 ? 41.915  -18.097 48.719  1.00 24.15 ? 209  ILE C CG2 1 
ATOM   5429 C  CD1 . ILE C 1 207 ? 40.709  -20.212 46.753  1.00 27.22 ? 209  ILE C CD1 1 
ATOM   5430 N  N   . TRP C 1 208 ? 43.457  -20.297 51.025  1.00 23.16 ? 210  TRP C N   1 
ATOM   5431 C  CA  . TRP C 1 208 ? 44.338  -19.997 52.170  1.00 23.80 ? 210  TRP C CA  1 
ATOM   5432 C  C   . TRP C 1 208 ? 45.137  -18.749 51.892  1.00 26.85 ? 210  TRP C C   1 
ATOM   5433 O  O   . TRP C 1 208 ? 45.774  -18.650 50.826  1.00 25.53 ? 210  TRP C O   1 
ATOM   5434 C  CB  . TRP C 1 208 ? 45.302  -21.137 52.424  1.00 24.01 ? 210  TRP C CB  1 
ATOM   5435 C  CG  . TRP C 1 208 ? 44.682  -22.238 53.133  1.00 23.84 ? 210  TRP C CG  1 
ATOM   5436 C  CD1 . TRP C 1 208 ? 44.043  -23.322 52.585  1.00 22.65 ? 210  TRP C CD1 1 
ATOM   5437 C  CD2 . TRP C 1 208 ? 44.566  -22.375 54.545  1.00 22.93 ? 210  TRP C CD2 1 
ATOM   5438 N  NE1 . TRP C 1 208 ? 43.586  -24.141 53.570  1.00 21.57 ? 210  TRP C NE1 1 
ATOM   5439 C  CE2 . TRP C 1 208 ? 43.868  -23.574 54.787  1.00 23.03 ? 210  TRP C CE2 1 
ATOM   5440 C  CE3 . TRP C 1 208 ? 44.992  -21.600 55.636  1.00 22.70 ? 210  TRP C CE3 1 
ATOM   5441 C  CZ2 . TRP C 1 208 ? 43.583  -24.023 56.082  1.00 23.54 ? 210  TRP C CZ2 1 
ATOM   5442 C  CZ3 . TRP C 1 208 ? 44.716  -22.034 56.902  1.00 22.76 ? 210  TRP C CZ3 1 
ATOM   5443 C  CH2 . TRP C 1 208 ? 44.017  -23.243 57.128  1.00 22.96 ? 210  TRP C CH2 1 
ATOM   5444 N  N   . THR C 1 209 ? 45.092  -17.790 52.828  1.00 26.24 ? 211  THR C N   1 
ATOM   5445 C  CA  . THR C 1 209 ? 45.885  -16.557 52.738  1.00 26.60 ? 211  THR C CA  1 
ATOM   5446 C  C   . THR C 1 209 ? 46.754  -16.531 53.986  1.00 28.72 ? 211  THR C C   1 
ATOM   5447 O  O   . THR C 1 209 ? 46.218  -16.533 55.105  1.00 26.70 ? 211  THR C O   1 
ATOM   5448 C  CB  . THR C 1 209 ? 45.017  -15.309 52.681  1.00 25.80 ? 211  THR C CB  1 
ATOM   5449 O  OG1 . THR C 1 209 ? 44.180  -15.354 51.534  1.00 25.71 ? 211  THR C OG1 1 
ATOM   5450 C  CG2 . THR C 1 209 ? 45.868  -14.019 52.626  1.00 26.22 ? 211  THR C CG2 1 
ATOM   5451 N  N   . VAL C 1 210 ? 48.085  -16.552 53.801  1.00 27.29 ? 212  VAL C N   1 
ATOM   5452 C  CA  . VAL C 1 210 ? 49.041  -16.652 54.904  1.00 28.11 ? 212  VAL C CA  1 
ATOM   5453 C  C   . VAL C 1 210 ? 49.836  -15.356 54.903  1.00 30.06 ? 212  VAL C C   1 
ATOM   5454 O  O   . VAL C 1 210 ? 50.470  -15.016 53.908  1.00 29.20 ? 212  VAL C O   1 
ATOM   5455 C  CB  . VAL C 1 210 ? 49.993  -17.860 54.760  1.00 28.73 ? 212  VAL C CB  1 
ATOM   5456 C  CG1 . VAL C 1 210 ? 50.831  -18.055 56.013  1.00 28.53 ? 212  VAL C CG1 1 
ATOM   5457 C  CG2 . VAL C 1 210 ? 49.208  -19.140 54.456  1.00 29.19 ? 212  VAL C CG2 1 
ATOM   5458 N  N   . PHE C 1 211 ? 49.780  -14.615 56.009  1.00 30.82 ? 213  PHE C N   1 
ATOM   5459 C  CA  . PHE C 1 211 ? 50.451  -13.308 56.074  1.00 31.53 ? 213  PHE C CA  1 
ATOM   5460 C  C   . PHE C 1 211 ? 51.966  -13.484 56.068  1.00 30.86 ? 213  PHE C C   1 
ATOM   5461 O  O   . PHE C 1 211 ? 52.475  -14.447 56.633  1.00 28.67 ? 213  PHE C O   1 
ATOM   5462 C  CB  . PHE C 1 211 ? 50.010  -12.537 57.324  1.00 32.99 ? 213  PHE C CB  1 
ATOM   5463 C  CG  . PHE C 1 211 ? 48.592  -12.084 57.261  1.00 34.17 ? 213  PHE C CG  1 
ATOM   5464 C  CD1 . PHE C 1 211 ? 48.241  -11.003 56.470  1.00 36.66 ? 213  PHE C CD1 1 
ATOM   5465 C  CD2 . PHE C 1 211 ? 47.593  -12.764 57.945  1.00 34.70 ? 213  PHE C CD2 1 
ATOM   5466 C  CE1 . PHE C 1 211 ? 46.924  -10.588 56.390  1.00 41.20 ? 213  PHE C CE1 1 
ATOM   5467 C  CE2 . PHE C 1 211 ? 46.276  -12.347 57.877  1.00 34.09 ? 213  PHE C CE2 1 
ATOM   5468 C  CZ  . PHE C 1 211 ? 45.936  -11.254 57.107  1.00 37.23 ? 213  PHE C CZ  1 
ATOM   5469 N  N   . ASN C 1 212 ? 52.660  -12.561 55.406  1.00 33.95 ? 214  ASN C N   1 
ATOM   5470 C  CA  . ASN C 1 212 ? 54.135  -12.460 55.481  1.00 37.01 ? 214  ASN C CA  1 
ATOM   5471 C  C   . ASN C 1 212 ? 54.550  -12.019 56.896  1.00 34.84 ? 214  ASN C C   1 
ATOM   5472 O  O   . ASN C 1 212 ? 55.355  -12.674 57.545  1.00 32.77 ? 214  ASN C O   1 
ATOM   5473 C  CB  . ASN C 1 212 ? 54.652  -11.468 54.406  1.00 39.38 ? 214  ASN C CB  1 
ATOM   5474 C  CG  . ASN C 1 212 ? 56.187  -11.352 54.350  1.00 44.17 ? 214  ASN C CG  1 
ATOM   5475 O  OD1 . ASN C 1 212 ? 56.736  -10.412 53.739  1.00 47.16 ? 214  ASN C OD1 1 
ATOM   5476 N  ND2 . ASN C 1 212 ? 56.881  -12.309 54.944  1.00 46.98 ? 214  ASN C ND2 1 
ATOM   5477 N  N   . GLN C 1 213 ? 53.960  -10.930 57.374  1.00 36.12 ? 215  GLN C N   1 
ATOM   5478 C  CA  . GLN C 1 213 ? 54.264  -10.403 58.708  1.00 38.13 ? 215  GLN C CA  1 
ATOM   5479 C  C   . GLN C 1 213 ? 53.695  -11.340 59.777  1.00 38.83 ? 215  GLN C C   1 
ATOM   5480 O  O   . GLN C 1 213 ? 52.564  -11.798 59.640  1.00 39.73 ? 215  GLN C O   1 
ATOM   5481 C  CB  . GLN C 1 213 ? 53.660  -9.003  58.844  1.00 41.86 ? 215  GLN C CB  1 
ATOM   5482 C  CG  . GLN C 1 213 ? 53.923  -8.289  60.163  1.00 44.70 ? 215  GLN C CG  1 
ATOM   5483 C  CD  . GLN C 1 213 ? 53.376  -6.876  60.155  1.00 49.71 ? 215  GLN C CD  1 
ATOM   5484 O  OE1 . GLN C 1 213 ? 52.170  -6.658  59.983  1.00 51.47 ? 215  GLN C OE1 1 
ATOM   5485 N  NE2 . GLN C 1 213 ? 54.260  -5.900  60.318  1.00 54.07 ? 215  GLN C NE2 1 
ATOM   5486 N  N   . THR C 1 214 ? 54.480  -11.632 60.819  1.00 37.18 ? 216  THR C N   1 
ATOM   5487 C  CA  . THR C 1 214 ? 54.023  -12.438 61.948  1.00 36.40 ? 216  THR C CA  1 
ATOM   5488 C  C   . THR C 1 214 ? 53.518  -11.543 63.102  1.00 35.75 ? 216  THR C C   1 
ATOM   5489 O  O   . THR C 1 214 ? 53.665  -10.323 63.081  1.00 34.72 ? 216  THR C O   1 
ATOM   5490 C  CB  . THR C 1 214 ? 55.119  -13.405 62.471  1.00 38.42 ? 216  THR C CB  1 
ATOM   5491 O  OG1 . THR C 1 214 ? 56.085  -12.688 63.250  1.00 40.05 ? 216  THR C OG1 1 
ATOM   5492 C  CG2 . THR C 1 214 ? 55.834  -14.136 61.328  1.00 37.87 ? 216  THR C CG2 1 
ATOM   5493 N  N   . VAL C 1 215 ? 52.921  -12.185 64.098  1.00 36.58 ? 217  VAL C N   1 
ATOM   5494 C  CA  . VAL C 1 215 ? 52.378  -11.536 65.278  1.00 36.53 ? 217  VAL C CA  1 
ATOM   5495 C  C   . VAL C 1 215 ? 53.256  -11.970 66.434  1.00 36.59 ? 217  VAL C C   1 
ATOM   5496 O  O   . VAL C 1 215 ? 53.625  -13.152 66.528  1.00 32.21 ? 217  VAL C O   1 
ATOM   5497 C  CB  . VAL C 1 215 ? 50.921  -11.991 65.530  1.00 37.11 ? 217  VAL C CB  1 
ATOM   5498 C  CG1 . VAL C 1 215 ? 50.434  -11.544 66.897  1.00 38.59 ? 217  VAL C CG1 1 
ATOM   5499 C  CG2 . VAL C 1 215 ? 50.009  -11.465 64.436  1.00 36.71 ? 217  VAL C CG2 1 
ATOM   5500 N  N   . MET C 1 216 ? 53.570  -11.030 67.328  1.00 37.07 ? 218  MET C N   1 
ATOM   5501 C  CA  . MET C 1 216 ? 54.458  -11.324 68.453  1.00 38.36 ? 218  MET C CA  1 
ATOM   5502 C  C   . MET C 1 216 ? 53.697  -11.568 69.757  1.00 36.14 ? 218  MET C C   1 
ATOM   5503 O  O   . MET C 1 216 ? 52.902  -10.738 70.179  1.00 35.29 ? 218  MET C O   1 
ATOM   5504 C  CB  . MET C 1 216 ? 55.462  -10.188 68.632  1.00 42.17 ? 218  MET C CB  1 
ATOM   5505 C  CG  . MET C 1 216 ? 56.345  -9.959  67.408  1.00 48.18 ? 218  MET C CG  1 
ATOM   5506 S  SD  . MET C 1 216 ? 57.567  -11.258 67.162  1.00 59.03 ? 218  MET C SD  1 
ATOM   5507 C  CE  . MET C 1 216 ? 58.989  -10.496 67.949  1.00 64.03 ? 218  MET C CE  1 
ATOM   5508 N  N   . LEU C 1 217 ? 53.931  -12.725 70.360  1.00 33.75 ? 219  LEU C N   1 
ATOM   5509 C  CA  . LEU C 1 217 ? 53.461  -13.029 71.701  1.00 38.07 ? 219  LEU C CA  1 
ATOM   5510 C  C   . LEU C 1 217 ? 54.673  -13.132 72.617  1.00 41.06 ? 219  LEU C C   1 
ATOM   5511 O  O   . LEU C 1 217 ? 55.755  -13.524 72.166  1.00 36.07 ? 219  LEU C O   1 
ATOM   5512 C  CB  . LEU C 1 217 ? 52.718  -14.364 71.724  1.00 38.20 ? 219  LEU C CB  1 
ATOM   5513 C  CG  . LEU C 1 217 ? 51.207  -14.271 71.528  1.00 38.31 ? 219  LEU C CG  1 
ATOM   5514 C  CD1 . LEU C 1 217 ? 50.857  -13.655 70.186  1.00 37.78 ? 219  LEU C CD1 1 
ATOM   5515 C  CD2 . LEU C 1 217 ? 50.601  -15.661 71.684  1.00 39.02 ? 219  LEU C CD2 1 
ATOM   5516 N  N   . SER C 1 218 ? 54.480  -12.834 73.900  1.00 40.49 ? 220  SER C N   1 
ATOM   5517 C  CA  . SER C 1 218 ? 55.545  -13.013 74.892  1.00 41.26 ? 220  SER C CA  1 
ATOM   5518 C  C   . SER C 1 218 ? 55.742  -14.495 75.143  1.00 40.42 ? 220  SER C C   1 
ATOM   5519 O  O   . SER C 1 218 ? 54.864  -15.309 74.857  1.00 41.98 ? 220  SER C O   1 
ATOM   5520 C  CB  . SER C 1 218 ? 55.225  -12.292 76.216  1.00 40.19 ? 220  SER C CB  1 
ATOM   5521 O  OG  . SER C 1 218 ? 54.543  -13.148 77.128  1.00 38.67 ? 220  SER C OG  1 
ATOM   5522 N  N   . ALA C 1 219 ? 56.900  -14.840 75.689  1.00 40.70 ? 221  ALA C N   1 
ATOM   5523 C  CA  . ALA C 1 219 ? 57.216  -16.230 76.004  1.00 40.86 ? 221  ALA C CA  1 
ATOM   5524 C  C   . ALA C 1 219 ? 56.219  -16.807 77.016  1.00 41.53 ? 221  ALA C C   1 
ATOM   5525 O  O   . ALA C 1 219 ? 55.809  -17.974 76.920  1.00 36.66 ? 221  ALA C O   1 
ATOM   5526 C  CB  . ALA C 1 219 ? 58.639  -16.336 76.536  1.00 41.99 ? 221  ALA C CB  1 
ATOM   5527 N  N   . LYS C 1 220 ? 55.854  -15.984 77.998  1.00 42.42 ? 222  LYS C N   1 
ATOM   5528 C  CA  . LYS C 1 220 ? 54.847  -16.352 78.989  1.00 44.35 ? 222  LYS C CA  1 
ATOM   5529 C  C   . LYS C 1 220 ? 53.517  -16.718 78.299  1.00 39.32 ? 222  LYS C C   1 
ATOM   5530 O  O   . LYS C 1 220 ? 52.914  -17.740 78.612  1.00 38.05 ? 222  LYS C O   1 
ATOM   5531 C  CB  . LYS C 1 220 ? 54.652  -15.190 79.982  1.00 48.31 ? 222  LYS C CB  1 
ATOM   5532 C  CG  . LYS C 1 220 ? 53.580  -15.390 81.041  1.00 53.60 ? 222  LYS C CG  1 
ATOM   5533 C  CD  . LYS C 1 220 ? 53.822  -16.642 81.871  1.00 59.33 ? 222  LYS C CD  1 
ATOM   5534 C  CE  . LYS C 1 220 ? 52.785  -16.783 82.977  1.00 64.40 ? 222  LYS C CE  1 
ATOM   5535 N  NZ  . LYS C 1 220 ? 52.821  -15.639 83.936  1.00 67.81 ? 222  LYS C NZ  1 
ATOM   5536 N  N   . GLN C 1 221 ? 53.096  -15.865 77.371  1.00 37.85 ? 223  GLN C N   1 
ATOM   5537 C  CA  . GLN C 1 221 ? 51.865  -16.062 76.591  1.00 37.92 ? 223  GLN C CA  1 
ATOM   5538 C  C   . GLN C 1 221 ? 51.889  -17.328 75.749  1.00 38.27 ? 223  GLN C C   1 
ATOM   5539 O  O   . GLN C 1 221 ? 50.889  -18.030 75.675  1.00 36.63 ? 223  GLN C O   1 
ATOM   5540 C  CB  . GLN C 1 221 ? 51.611  -14.865 75.685  1.00 37.65 ? 223  GLN C CB  1 
ATOM   5541 C  CG  . GLN C 1 221 ? 51.143  -13.643 76.438  1.00 37.42 ? 223  GLN C CG  1 
ATOM   5542 C  CD  . GLN C 1 221 ? 50.862  -12.472 75.528  1.00 38.16 ? 223  GLN C CD  1 
ATOM   5543 O  OE1 . GLN C 1 221 ? 51.669  -12.129 74.660  1.00 40.27 ? 223  GLN C OE1 1 
ATOM   5544 N  NE2 . GLN C 1 221 ? 49.710  -11.839 75.718  1.00 39.18 ? 223  GLN C NE2 1 
ATOM   5545 N  N   . LEU C 1 222 ? 53.029  -17.623 75.123  1.00 37.18 ? 224  LEU C N   1 
ATOM   5546 C  CA  . LEU C 1 222 ? 53.146  -18.849 74.341  1.00 37.98 ? 224  LEU C CA  1 
ATOM   5547 C  C   . LEU C 1 222 ? 53.096  -20.073 75.249  1.00 39.02 ? 224  LEU C C   1 
ATOM   5548 O  O   . LEU C 1 222 ? 52.484  -21.078 74.880  1.00 35.80 ? 224  LEU C O   1 
ATOM   5549 C  CB  . LEU C 1 222 ? 54.384  -18.835 73.432  1.00 37.17 ? 224  LEU C CB  1 
ATOM   5550 C  CG  . LEU C 1 222 ? 54.321  -17.757 72.347  1.00 38.24 ? 224  LEU C CG  1 
ATOM   5551 C  CD1 . LEU C 1 222 ? 55.689  -17.519 71.702  1.00 38.94 ? 224  LEU C CD1 1 
ATOM   5552 C  CD2 . LEU C 1 222 ? 53.277  -18.111 71.294  1.00 38.19 ? 224  LEU C CD2 1 
ATOM   5553 N  N   . HIS C 1 223 ? 53.685  -19.981 76.445  1.00 38.58 ? 225  HIS C N   1 
ATOM   5554 C  CA  . HIS C 1 223 ? 53.579  -21.065 77.426  1.00 39.95 ? 225  HIS C CA  1 
ATOM   5555 C  C   . HIS C 1 223 ? 52.128  -21.268 77.919  1.00 37.13 ? 225  HIS C C   1 
ATOM   5556 O  O   . HIS C 1 223 ? 51.681  -22.401 78.093  1.00 34.90 ? 225  HIS C O   1 
ATOM   5557 C  CB  . HIS C 1 223 ? 54.516  -20.850 78.633  1.00 41.80 ? 225  HIS C CB  1 
ATOM   5558 C  CG  . HIS C 1 223 ? 54.401  -21.932 79.662  1.00 44.98 ? 225  HIS C CG  1 
ATOM   5559 N  ND1 . HIS C 1 223 ? 53.649  -21.790 80.811  1.00 49.39 ? 225  HIS C ND1 1 
ATOM   5560 C  CD2 . HIS C 1 223 ? 54.870  -23.202 79.674  1.00 48.44 ? 225  HIS C CD2 1 
ATOM   5561 C  CE1 . HIS C 1 223 ? 53.684  -22.918 81.500  1.00 49.33 ? 225  HIS C CE1 1 
ATOM   5562 N  NE2 . HIS C 1 223 ? 54.422  -23.789 80.835  1.00 50.24 ? 225  HIS C NE2 1 
ATOM   5563 N  N   . THR C 1 224 ? 51.409  -20.175 78.164  1.00 37.56 ? 226  THR C N   1 
ATOM   5564 C  CA  . THR C 1 224 ? 49.998  -20.263 78.570  1.00 37.94 ? 226  THR C CA  1 
ATOM   5565 C  C   . THR C 1 224 ? 49.181  -20.996 77.497  1.00 36.19 ? 226  THR C C   1 
ATOM   5566 O  O   . THR C 1 224 ? 48.439  -21.929 77.811  1.00 35.23 ? 226  THR C O   1 
ATOM   5567 C  CB  . THR C 1 224 ? 49.380  -18.866 78.818  1.00 39.33 ? 226  THR C CB  1 
ATOM   5568 O  OG1 . THR C 1 224 ? 50.108  -18.191 79.854  1.00 40.19 ? 226  THR C OG1 1 
ATOM   5569 C  CG2 . THR C 1 224 ? 47.899  -18.979 79.217  1.00 38.60 ? 226  THR C CG2 1 
ATOM   5570 N  N   . LEU C 1 225 ? 49.350  -20.583 76.241  1.00 36.71 ? 227  LEU C N   1 
ATOM   5571 C  CA  . LEU C 1 225 ? 48.640  -21.210 75.114  1.00 36.41 ? 227  LEU C CA  1 
ATOM   5572 C  C   . LEU C 1 225 ? 48.910  -22.713 75.049  1.00 37.72 ? 227  LEU C C   1 
ATOM   5573 O  O   . LEU C 1 225 ? 47.979  -23.524 74.978  1.00 38.27 ? 227  LEU C O   1 
ATOM   5574 C  CB  . LEU C 1 225 ? 49.010  -20.529 73.793  1.00 35.44 ? 227  LEU C CB  1 
ATOM   5575 C  CG  . LEU C 1 225 ? 48.402  -21.113 72.496  1.00 33.73 ? 227  LEU C CG  1 
ATOM   5576 C  CD1 . LEU C 1 225 ? 46.889  -21.117 72.595  1.00 34.23 ? 227  LEU C CD1 1 
ATOM   5577 C  CD2 . LEU C 1 225 ? 48.854  -20.314 71.287  1.00 32.79 ? 227  LEU C CD2 1 
ATOM   5578 N  N   . SER C 1 226 ? 50.181  -23.086 75.144  1.00 36.34 ? 228  SER C N   1 
ATOM   5579 C  CA  . SER C 1 226 ? 50.570  -24.487 75.024  1.00 37.53 ? 228  SER C CA  1 
ATOM   5580 C  C   . SER C 1 226 ? 50.412  -25.342 76.282  1.00 38.07 ? 228  SER C C   1 
ATOM   5581 O  O   . SER C 1 226 ? 50.369  -26.567 76.163  1.00 37.92 ? 228  SER C O   1 
ATOM   5582 C  CB  . SER C 1 226 ? 52.013  -24.600 74.487  1.00 39.56 ? 228  SER C CB  1 
ATOM   5583 O  OG  . SER C 1 226 ? 52.880  -23.670 75.114  1.00 40.60 ? 228  SER C OG  1 
ATOM   5584 N  N   . ASP C 1 227 ? 50.316  -24.742 77.468  1.00 39.85 ? 229  ASP C N   1 
ATOM   5585 C  CA  . ASP C 1 227 ? 50.358  -25.532 78.712  1.00 43.35 ? 229  ASP C CA  1 
ATOM   5586 C  C   . ASP C 1 227 ? 49.094  -25.534 79.571  1.00 42.68 ? 229  ASP C C   1 
ATOM   5587 O  O   . ASP C 1 227 ? 49.095  -26.134 80.643  1.00 39.80 ? 229  ASP C O   1 
ATOM   5588 C  CB  . ASP C 1 227 ? 51.548  -25.090 79.571  1.00 48.91 ? 229  ASP C CB  1 
ATOM   5589 C  CG  . ASP C 1 227 ? 52.211  -26.250 80.265  1.00 53.83 ? 229  ASP C CG  1 
ATOM   5590 O  OD1 . ASP C 1 227 ? 52.846  -27.074 79.562  1.00 56.71 ? 229  ASP C OD1 1 
ATOM   5591 O  OD2 . ASP C 1 227 ? 52.079  -26.348 81.502  1.00 57.49 ? 229  ASP C OD2 1 
ATOM   5592 N  N   . THR C 1 228 ? 48.020  -24.896 79.106  1.00 40.17 ? 230  THR C N   1 
ATOM   5593 C  CA  . THR C 1 228 ? 46.800  -24.752 79.913  1.00 38.08 ? 230  THR C CA  1 
ATOM   5594 C  C   . THR C 1 228 ? 45.715  -25.770 79.554  1.00 37.17 ? 230  THR C C   1 
ATOM   5595 O  O   . THR C 1 228 ? 45.110  -26.360 80.448  1.00 39.20 ? 230  THR C O   1 
ATOM   5596 C  CB  . THR C 1 228 ? 46.262  -23.316 79.818  1.00 38.07 ? 230  THR C CB  1 
ATOM   5597 O  OG1 . THR C 1 228 ? 47.321  -22.400 80.121  1.00 35.23 ? 230  THR C OG1 1 
ATOM   5598 C  CG2 . THR C 1 228 ? 45.086  -23.080 80.790  1.00 38.85 ? 230  THR C CG2 1 
ATOM   5599 N  N   . LEU C 1 229 ? 45.483  -26.018 78.266  1.00 35.31 ? 231  LEU C N   1 
ATOM   5600 C  CA  . LEU C 1 229 ? 44.322  -26.823 77.862  1.00 33.12 ? 231  LEU C CA  1 
ATOM   5601 C  C   . LEU C 1 229 ? 44.581  -28.323 77.834  1.00 34.35 ? 231  LEU C C   1 
ATOM   5602 O  O   . LEU C 1 229 ? 45.689  -28.778 77.518  1.00 36.62 ? 231  LEU C O   1 
ATOM   5603 C  CB  . LEU C 1 229 ? 43.815  -26.380 76.499  1.00 31.79 ? 231  LEU C CB  1 
ATOM   5604 C  CG  . LEU C 1 229 ? 43.494  -24.896 76.359  1.00 31.89 ? 231  LEU C CG  1 
ATOM   5605 C  CD1 . LEU C 1 229 ? 42.980  -24.636 74.965  1.00 32.69 ? 231  LEU C CD1 1 
ATOM   5606 C  CD2 . LEU C 1 229 ? 42.482  -24.434 77.395  1.00 32.37 ? 231  LEU C CD2 1 
ATOM   5607 N  N   . TRP C 1 230 ? 43.530  -29.075 78.138  1.00 33.05 ? 232  TRP C N   1 
ATOM   5608 C  CA  . TRP C 1 230 ? 43.558  -30.524 78.164  1.00 36.18 ? 232  TRP C CA  1 
ATOM   5609 C  C   . TRP C 1 230 ? 42.691  -31.076 77.042  1.00 36.85 ? 232  TRP C C   1 
ATOM   5610 O  O   . TRP C 1 230 ? 41.702  -30.457 76.645  1.00 34.72 ? 232  TRP C O   1 
ATOM   5611 C  CB  . TRP C 1 230 ? 43.150  -31.028 79.557  1.00 37.48 ? 232  TRP C CB  1 
ATOM   5612 C  CG  . TRP C 1 230 ? 44.262  -30.775 80.511  1.00 42.21 ? 232  TRP C CG  1 
ATOM   5613 C  CD1 . TRP C 1 230 ? 44.626  -29.570 81.045  1.00 43.59 ? 232  TRP C CD1 1 
ATOM   5614 C  CD2 . TRP C 1 230 ? 45.235  -31.724 80.959  1.00 44.40 ? 232  TRP C CD2 1 
ATOM   5615 N  NE1 . TRP C 1 230 ? 45.750  -29.717 81.824  1.00 47.43 ? 232  TRP C NE1 1 
ATOM   5616 C  CE2 . TRP C 1 230 ? 46.143  -31.030 81.794  1.00 46.32 ? 232  TRP C CE2 1 
ATOM   5617 C  CE3 . TRP C 1 230 ? 45.417  -33.096 80.754  1.00 45.57 ? 232  TRP C CE3 1 
ATOM   5618 C  CZ2 . TRP C 1 230 ? 47.222  -31.667 82.429  1.00 46.72 ? 232  TRP C CZ2 1 
ATOM   5619 C  CZ3 . TRP C 1 230 ? 46.490  -33.735 81.390  1.00 48.52 ? 232  TRP C CZ3 1 
ATOM   5620 C  CH2 . TRP C 1 230 ? 47.382  -33.011 82.212  1.00 46.04 ? 232  TRP C CH2 1 
ATOM   5621 N  N   . GLY C 1 231 ? 43.096  -32.225 76.512  1.00 34.85 ? 233  GLY C N   1 
ATOM   5622 C  CA  . GLY C 1 231 ? 42.479  -32.804 75.326  1.00 38.46 ? 233  GLY C CA  1 
ATOM   5623 C  C   . GLY C 1 231 ? 41.943  -34.187 75.605  1.00 42.44 ? 233  GLY C C   1 
ATOM   5624 O  O   . GLY C 1 231 ? 41.722  -34.531 76.755  1.00 46.65 ? 233  GLY C O   1 
ATOM   5625 N  N   . PRO C 1 232 ? 41.740  -35.004 74.557  1.00 47.70 ? 234  PRO C N   1 
ATOM   5626 C  CA  . PRO C 1 232 ? 41.194  -36.354 74.767  1.00 51.14 ? 234  PRO C CA  1 
ATOM   5627 C  C   . PRO C 1 232 ? 42.124  -37.247 75.606  1.00 57.93 ? 234  PRO C C   1 
ATOM   5628 O  O   . PRO C 1 232 ? 43.350  -37.061 75.586  1.00 61.46 ? 234  PRO C O   1 
ATOM   5629 C  CB  . PRO C 1 232 ? 41.029  -36.906 73.340  1.00 49.73 ? 234  PRO C CB  1 
ATOM   5630 C  CG  . PRO C 1 232 ? 41.219  -35.741 72.422  1.00 48.67 ? 234  PRO C CG  1 
ATOM   5631 C  CD  . PRO C 1 232 ? 42.085  -34.766 73.149  1.00 46.59 ? 234  PRO C CD  1 
ATOM   5632 N  N   . GLY C 1 233 ? 41.537  -38.193 76.343  1.00 64.49 ? 235  GLY C N   1 
ATOM   5633 C  CA  . GLY C 1 233 ? 42.266  -38.963 77.364  1.00 67.81 ? 235  GLY C CA  1 
ATOM   5634 C  C   . GLY C 1 233 ? 42.595  -38.092 78.569  1.00 71.45 ? 235  GLY C C   1 
ATOM   5635 O  O   . GLY C 1 233 ? 42.069  -36.985 78.705  1.00 76.12 ? 235  GLY C O   1 
ATOM   5636 N  N   . ASP C 1 234 ? 43.464  -38.583 79.448  1.00 73.18 ? 236  ASP C N   1 
ATOM   5637 C  CA  . ASP C 1 234 ? 43.971  -37.781 80.565  1.00 71.26 ? 236  ASP C CA  1 
ATOM   5638 C  C   . ASP C 1 234 ? 45.251  -37.076 80.106  1.00 67.64 ? 236  ASP C C   1 
ATOM   5639 O  O   . ASP C 1 234 ? 46.314  -37.278 80.690  1.00 70.77 ? 236  ASP C O   1 
ATOM   5640 C  CB  . ASP C 1 234 ? 44.242  -38.672 81.784  1.00 70.47 ? 236  ASP C CB  1 
ATOM   5641 N  N   . SER C 1 235 ? 45.134  -36.232 79.076  1.00 62.36 ? 237  SER C N   1 
ATOM   5642 C  CA  . SER C 1 235 ? 46.291  -35.817 78.270  1.00 57.06 ? 237  SER C CA  1 
ATOM   5643 C  C   . SER C 1 235 ? 46.241  -34.368 77.751  1.00 52.05 ? 237  SER C C   1 
ATOM   5644 O  O   . SER C 1 235 ? 45.189  -33.881 77.350  1.00 47.69 ? 237  SER C O   1 
ATOM   5645 C  CB  . SER C 1 235 ? 46.431  -36.795 77.099  1.00 57.95 ? 237  SER C CB  1 
ATOM   5646 O  OG  . SER C 1 235 ? 47.013  -36.183 75.967  1.00 58.98 ? 237  SER C OG  1 
ATOM   5647 N  N   . ARG C 1 236 ? 47.404  -33.715 77.718  1.00 47.36 ? 238  ARG C N   1 
ATOM   5648 C  CA  . ARG C 1 236 ? 47.511  -32.292 77.349  1.00 45.88 ? 238  ARG C CA  1 
ATOM   5649 C  C   . ARG C 1 236 ? 47.144  -31.981 75.891  1.00 41.41 ? 238  ARG C C   1 
ATOM   5650 O  O   . ARG C 1 236 ? 47.445  -32.768 74.980  1.00 37.20 ? 238  ARG C O   1 
ATOM   5651 C  CB  . ARG C 1 236 ? 48.926  -31.782 77.578  1.00 47.90 ? 238  ARG C CB  1 
ATOM   5652 C  CG  . ARG C 1 236 ? 49.342  -31.708 79.029  1.00 52.87 ? 238  ARG C CG  1 
ATOM   5653 C  CD  . ARG C 1 236 ? 50.732  -31.102 79.138  1.00 55.93 ? 238  ARG C CD  1 
ATOM   5654 N  NE  . ARG C 1 236 ? 51.079  -30.777 80.516  1.00 58.73 ? 238  ARG C NE  1 
ATOM   5655 C  CZ  . ARG C 1 236 ? 50.614  -29.731 81.199  1.00 60.12 ? 238  ARG C CZ  1 
ATOM   5656 N  NH1 . ARG C 1 236 ? 49.753  -28.869 80.653  1.00 60.12 ? 238  ARG C NH1 1 
ATOM   5657 N  NH2 . ARG C 1 236 ? 51.017  -29.546 82.453  1.00 62.75 ? 238  ARG C NH2 1 
ATOM   5658 N  N   . LEU C 1 237 ? 46.529  -30.815 75.679  1.00 35.47 ? 239  LEU C N   1 
ATOM   5659 C  CA  . LEU C 1 237 ? 46.196  -30.350 74.332  1.00 34.88 ? 239  LEU C CA  1 
ATOM   5660 C  C   . LEU C 1 237 ? 47.388  -29.565 73.794  1.00 32.50 ? 239  LEU C C   1 
ATOM   5661 O  O   . LEU C 1 237 ? 47.580  -28.381 74.076  1.00 29.11 ? 239  LEU C O   1 
ATOM   5662 C  CB  . LEU C 1 237 ? 44.889  -29.529 74.316  1.00 34.95 ? 239  LEU C CB  1 
ATOM   5663 C  CG  . LEU C 1 237 ? 44.347  -28.989 72.976  1.00 35.74 ? 239  LEU C CG  1 
ATOM   5664 C  CD1 . LEU C 1 237 ? 44.569  -29.897 71.795  1.00 36.38 ? 239  LEU C CD1 1 
ATOM   5665 C  CD2 . LEU C 1 237 ? 42.873  -28.589 73.090  1.00 35.51 ? 239  LEU C CD2 1 
ATOM   5666 N  N   . GLN C 1 238 ? 48.216  -30.275 73.035  1.00 33.67 ? 240  GLN C N   1 
ATOM   5667 C  CA  . GLN C 1 238 ? 49.480  -29.755 72.520  1.00 33.67 ? 240  GLN C CA  1 
ATOM   5668 C  C   . GLN C 1 238 ? 49.776  -30.398 71.179  1.00 30.71 ? 240  GLN C C   1 
ATOM   5669 O  O   . GLN C 1 238 ? 49.303  -31.507 70.907  1.00 29.19 ? 240  GLN C O   1 
ATOM   5670 C  CB  . GLN C 1 238 ? 50.627  -30.148 73.451  1.00 34.80 ? 240  GLN C CB  1 
ATOM   5671 C  CG  . GLN C 1 238 ? 50.597  -29.532 74.818  1.00 35.88 ? 240  GLN C CG  1 
ATOM   5672 C  CD  . GLN C 1 238 ? 51.794  -29.944 75.656  1.00 37.58 ? 240  GLN C CD  1 
ATOM   5673 O  OE1 . GLN C 1 238 ? 52.174  -31.117 75.682  1.00 38.15 ? 240  GLN C OE1 1 
ATOM   5674 N  NE2 . GLN C 1 238 ? 52.406  -28.974 76.327  1.00 38.28 ? 240  GLN C NE2 1 
ATOM   5675 N  N   . LEU C 1 239 ? 50.598  -29.712 70.390  1.00 31.87 ? 241  LEU C N   1 
ATOM   5676 C  CA  . LEU C 1 239 ? 51.101  -30.218 69.106  1.00 34.99 ? 241  LEU C CA  1 
ATOM   5677 C  C   . LEU C 1 239 ? 49.923  -30.510 68.169  1.00 33.62 ? 241  LEU C C   1 
ATOM   5678 O  O   . LEU C 1 239 ? 49.902  -31.524 67.461  1.00 33.93 ? 241  LEU C O   1 
ATOM   5679 C  CB  . LEU C 1 239 ? 51.976  -31.476 69.311  1.00 35.67 ? 241  LEU C CB  1 
ATOM   5680 C  CG  . LEU C 1 239 ? 53.201  -31.339 70.235  1.00 37.07 ? 241  LEU C CG  1 
ATOM   5681 C  CD1 . LEU C 1 239 ? 53.773  -32.712 70.567  1.00 38.10 ? 241  LEU C CD1 1 
ATOM   5682 C  CD2 . LEU C 1 239 ? 54.256  -30.452 69.606  1.00 36.57 ? 241  LEU C CD2 1 
ATOM   5683 N  N   . ASN C 1 240 ? 48.941  -29.604 68.183  1.00 31.56 ? 242  ASN C N   1 
ATOM   5684 C  CA  . ASN C 1 240 ? 47.644  -29.832 67.542  1.00 30.59 ? 242  ASN C CA  1 
ATOM   5685 C  C   . ASN C 1 240 ? 47.692  -29.272 66.132  1.00 30.45 ? 242  ASN C C   1 
ATOM   5686 O  O   . ASN C 1 240 ? 47.011  -28.305 65.799  1.00 28.02 ? 242  ASN C O   1 
ATOM   5687 C  CB  . ASN C 1 240 ? 46.477  -29.261 68.391  1.00 29.84 ? 242  ASN C CB  1 
ATOM   5688 C  CG  . ASN C 1 240 ? 46.596  -27.779 68.668  1.00 31.08 ? 242  ASN C CG  1 
ATOM   5689 O  OD1 . ASN C 1 240 ? 47.697  -27.242 68.848  1.00 29.67 ? 242  ASN C OD1 1 
ATOM   5690 N  ND2 . ASN C 1 240 ? 45.439  -27.094 68.720  1.00 31.56 ? 242  ASN C ND2 1 
ATOM   5691 N  N   . PHE C 1 241 ? 48.569  -29.868 65.321  1.00 30.04 ? 243  PHE C N   1 
ATOM   5692 C  CA  . PHE C 1 241 ? 48.777  -29.466 63.932  1.00 30.43 ? 243  PHE C CA  1 
ATOM   5693 C  C   . PHE C 1 241 ? 48.888  -30.709 63.052  1.00 28.92 ? 243  PHE C C   1 
ATOM   5694 O  O   . PHE C 1 241 ? 49.202  -31.796 63.541  1.00 27.78 ? 243  PHE C O   1 
ATOM   5695 C  CB  . PHE C 1 241 ? 50.005  -28.564 63.779  1.00 31.88 ? 243  PHE C CB  1 
ATOM   5696 C  CG  . PHE C 1 241 ? 51.303  -29.214 64.176  1.00 33.34 ? 243  PHE C CG  1 
ATOM   5697 C  CD1 . PHE C 1 241 ? 51.770  -29.122 65.472  1.00 34.97 ? 243  PHE C CD1 1 
ATOM   5698 C  CD2 . PHE C 1 241 ? 52.073  -29.895 63.233  1.00 35.65 ? 243  PHE C CD2 1 
ATOM   5699 C  CE1 . PHE C 1 241 ? 52.974  -29.715 65.844  1.00 37.22 ? 243  PHE C CE1 1 
ATOM   5700 C  CE2 . PHE C 1 241 ? 53.275  -30.491 63.593  1.00 36.71 ? 243  PHE C CE2 1 
ATOM   5701 C  CZ  . PHE C 1 241 ? 53.730  -30.400 64.902  1.00 37.14 ? 243  PHE C CZ  1 
ATOM   5702 N  N   . ARG C 1 242 ? 48.532  -30.548 61.779  1.00 27.94 ? 244  ARG C N   1 
ATOM   5703 C  CA  . ARG C 1 242 ? 48.605  -31.618 60.806  1.00 26.92 ? 244  ARG C CA  1 
ATOM   5704 C  C   . ARG C 1 242 ? 49.974  -31.540 60.130  1.00 26.66 ? 244  ARG C C   1 
ATOM   5705 O  O   . ARG C 1 242 ? 50.512  -30.449 59.903  1.00 27.72 ? 244  ARG C O   1 
ATOM   5706 C  CB  . ARG C 1 242 ? 47.526  -31.443 59.746  1.00 25.55 ? 244  ARG C CB  1 
ATOM   5707 C  CG  . ARG C 1 242 ? 47.324  -32.653 58.865  1.00 25.17 ? 244  ARG C CG  1 
ATOM   5708 C  CD  . ARG C 1 242 ? 46.523  -32.296 57.643  1.00 25.48 ? 244  ARG C CD  1 
ATOM   5709 N  NE  . ARG C 1 242 ? 45.989  -33.488 57.007  1.00 24.22 ? 244  ARG C NE  1 
ATOM   5710 C  CZ  . ARG C 1 242 ? 45.175  -33.490 55.966  1.00 23.38 ? 244  ARG C CZ  1 
ATOM   5711 N  NH1 . ARG C 1 242 ? 44.797  -32.352 55.401  1.00 23.63 ? 244  ARG C NH1 1 
ATOM   5712 N  NH2 . ARG C 1 242 ? 44.746  -34.656 55.482  1.00 25.06 ? 244  ARG C NH2 1 
ATOM   5713 N  N   . ALA C 1 243 ? 50.513  -32.696 59.773  1.00 29.72 ? 245  ALA C N   1 
ATOM   5714 C  CA  . ALA C 1 243 ? 51.752  -32.746 58.986  1.00 29.32 ? 245  ALA C CA  1 
ATOM   5715 C  C   . ALA C 1 243 ? 51.616  -31.984 57.660  1.00 29.80 ? 245  ALA C C   1 
ATOM   5716 O  O   . ALA C 1 243 ? 50.538  -31.904 57.058  1.00 28.96 ? 245  ALA C O   1 
ATOM   5717 C  CB  . ALA C 1 243 ? 52.171  -34.185 58.741  1.00 30.34 ? 245  ALA C CB  1 
ATOM   5718 N  N   . THR C 1 244 ? 52.715  -31.382 57.234  1.00 30.74 ? 246  THR C N   1 
ATOM   5719 C  CA  . THR C 1 244 ? 52.793  -30.679 55.960  1.00 32.69 ? 246  THR C CA  1 
ATOM   5720 C  C   . THR C 1 244 ? 52.398  -31.616 54.821  1.00 29.76 ? 246  THR C C   1 
ATOM   5721 O  O   . THR C 1 244 ? 52.747  -32.793 54.844  1.00 30.76 ? 246  THR C O   1 
ATOM   5722 C  CB  . THR C 1 244 ? 54.233  -30.172 55.743  1.00 35.28 ? 246  THR C CB  1 
ATOM   5723 O  OG1 . THR C 1 244 ? 54.575  -29.329 56.839  1.00 41.62 ? 246  THR C OG1 1 
ATOM   5724 C  CG2 . THR C 1 244 ? 54.342  -29.381 54.477  1.00 38.56 ? 246  THR C CG2 1 
ATOM   5725 N  N   . GLN C 1 245 ? 51.668  -31.077 53.848  1.00 29.07 ? 247  GLN C N   1 
ATOM   5726 C  CA  . GLN C 1 245 ? 51.096  -31.844 52.752  1.00 28.69 ? 247  GLN C CA  1 
ATOM   5727 C  C   . GLN C 1 245 ? 51.742  -31.358 51.476  1.00 26.84 ? 247  GLN C C   1 
ATOM   5728 O  O   . GLN C 1 245 ? 51.978  -30.171 51.338  1.00 28.15 ? 247  GLN C O   1 
ATOM   5729 C  CB  . GLN C 1 245 ? 49.580  -31.598 52.657  1.00 28.02 ? 247  GLN C CB  1 
ATOM   5730 C  CG  . GLN C 1 245 ? 48.823  -31.915 53.951  1.00 27.15 ? 247  GLN C CG  1 
ATOM   5731 C  CD  . GLN C 1 245 ? 48.815  -33.386 54.272  1.00 28.04 ? 247  GLN C CD  1 
ATOM   5732 O  OE1 . GLN C 1 245 ? 49.232  -33.811 55.355  1.00 30.68 ? 247  GLN C OE1 1 
ATOM   5733 N  NE2 . GLN C 1 245 ? 48.368  -34.184 53.321  1.00 28.23 ? 247  GLN C NE2 1 
ATOM   5734 N  N   . PRO C 1 246 ? 51.970  -32.258 50.501  1.00 27.24 ? 248  PRO C N   1 
ATOM   5735 C  CA  . PRO C 1 246 ? 52.666  -31.795 49.294  1.00 26.49 ? 248  PRO C CA  1 
ATOM   5736 C  C   . PRO C 1 246 ? 51.846  -30.858 48.437  1.00 26.40 ? 248  PRO C C   1 
ATOM   5737 O  O   . PRO C 1 246 ? 50.616  -31.022 48.319  1.00 25.90 ? 248  PRO C O   1 
ATOM   5738 C  CB  . PRO C 1 246 ? 52.994  -33.106 48.542  1.00 26.99 ? 248  PRO C CB  1 
ATOM   5739 C  CG  . PRO C 1 246 ? 52.098  -34.150 49.117  1.00 27.43 ? 248  PRO C CG  1 
ATOM   5740 C  CD  . PRO C 1 246 ? 51.769  -33.719 50.518  1.00 26.59 ? 248  PRO C CD  1 
ATOM   5741 N  N   . LEU C 1 247 ? 52.494  -29.873 47.826  1.00 24.21 ? 249  LEU C N   1 
ATOM   5742 C  CA  . LEU C 1 247 ? 51.806  -29.022 46.877  1.00 25.62 ? 249  LEU C CA  1 
ATOM   5743 C  C   . LEU C 1 247 ? 51.214  -29.797 45.670  1.00 25.38 ? 249  LEU C C   1 
ATOM   5744 O  O   . LEU C 1 247 ? 50.192  -29.390 45.133  1.00 23.72 ? 249  LEU C O   1 
ATOM   5745 C  CB  . LEU C 1 247 ? 52.708  -27.897 46.379  1.00 27.64 ? 249  LEU C CB  1 
ATOM   5746 C  CG  . LEU C 1 247 ? 52.915  -26.717 47.323  1.00 29.12 ? 249  LEU C CG  1 
ATOM   5747 C  CD1 . LEU C 1 247 ? 53.983  -25.780 46.766  1.00 29.89 ? 249  LEU C CD1 1 
ATOM   5748 C  CD2 . LEU C 1 247 ? 51.593  -25.972 47.539  1.00 27.98 ? 249  LEU C CD2 1 
ATOM   5749 N  N   . ASN C 1 248 ? 51.870  -30.880 45.246  1.00 24.58 ? 250  ASN C N   1 
ATOM   5750 C  CA  . ASN C 1 248 ? 51.403  -31.695 44.111  1.00 24.46 ? 250  ASN C CA  1 
ATOM   5751 C  C   . ASN C 1 248 ? 51.090  -30.938 42.816  1.00 23.71 ? 250  ASN C C   1 
ATOM   5752 O  O   . ASN C 1 248 ? 50.102  -31.214 42.116  1.00 25.44 ? 250  ASN C O   1 
ATOM   5753 C  CB  . ASN C 1 248 ? 50.198  -32.533 44.547  1.00 24.29 ? 250  ASN C CB  1 
ATOM   5754 C  CG  . ASN C 1 248 ? 50.589  -33.745 45.316  1.00 24.74 ? 250  ASN C CG  1 
ATOM   5755 O  OD1 . ASN C 1 248 ? 51.694  -34.286 45.131  1.00 26.50 ? 250  ASN C OD1 1 
ATOM   5756 N  ND2 . ASN C 1 248 ? 49.681  -34.229 46.174  1.00 24.59 ? 250  ASN C ND2 1 
ATOM   5757 N  N   . GLY C 1 249 ? 51.938  -29.976 42.494  1.00 24.26 ? 251  GLY C N   1 
ATOM   5758 C  CA  . GLY C 1 249 ? 51.788  -29.181 41.284  1.00 24.47 ? 251  GLY C CA  1 
ATOM   5759 C  C   . GLY C 1 249 ? 51.155  -27.835 41.477  1.00 22.96 ? 251  GLY C C   1 
ATOM   5760 O  O   . GLY C 1 249 ? 51.147  -27.024 40.552  1.00 23.30 ? 251  GLY C O   1 
ATOM   5761 N  N   . ARG C 1 250 ? 50.572  -27.580 42.658  1.00 23.91 ? 252  ARG C N   1 
ATOM   5762 C  CA  . ARG C 1 250 ? 50.007  -26.270 42.935  1.00 24.00 ? 252  ARG C CA  1 
ATOM   5763 C  C   . ARG C 1 250 ? 51.117  -25.261 43.035  1.00 23.69 ? 252  ARG C C   1 
ATOM   5764 O  O   . ARG C 1 250 ? 52.165  -25.578 43.564  1.00 25.32 ? 252  ARG C O   1 
ATOM   5765 C  CB  . ARG C 1 250 ? 49.239  -26.257 44.260  1.00 24.60 ? 252  ARG C CB  1 
ATOM   5766 C  CG  . ARG C 1 250 ? 47.896  -26.937 44.188  1.00 24.91 ? 252  ARG C CG  1 
ATOM   5767 C  CD  . ARG C 1 250 ? 47.292  -27.059 45.577  1.00 24.56 ? 252  ARG C CD  1 
ATOM   5768 N  NE  . ARG C 1 250 ? 47.996  -28.031 46.395  1.00 24.31 ? 252  ARG C NE  1 
ATOM   5769 C  CZ  . ARG C 1 250 ? 47.745  -28.261 47.682  1.00 25.58 ? 252  ARG C CZ  1 
ATOM   5770 N  NH1 . ARG C 1 250 ? 46.801  -27.568 48.307  1.00 25.92 ? 252  ARG C NH1 1 
ATOM   5771 N  NH2 . ARG C 1 250 ? 48.425  -29.185 48.343  1.00 25.00 ? 252  ARG C NH2 1 
ATOM   5772 N  N   . VAL C 1 251 ? 50.840  -24.058 42.565  1.00 25.37 ? 253  VAL C N   1 
ATOM   5773 C  CA  . VAL C 1 251 ? 51.732  -22.924 42.708  1.00 28.04 ? 253  VAL C CA  1 
ATOM   5774 C  C   . VAL C 1 251 ? 51.180  -21.943 43.734  1.00 29.34 ? 253  VAL C C   1 
ATOM   5775 O  O   . VAL C 1 251 ? 50.024  -21.559 43.653  1.00 32.14 ? 253  VAL C O   1 
ATOM   5776 C  CB  . VAL C 1 251 ? 51.886  -22.251 41.347  1.00 30.52 ? 253  VAL C CB  1 
ATOM   5777 C  CG1 . VAL C 1 251 ? 52.736  -20.985 41.445  1.00 32.47 ? 253  VAL C CG1 1 
ATOM   5778 C  CG2 . VAL C 1 251 ? 52.477  -23.277 40.356  1.00 31.61 ? 253  VAL C CG2 1 
ATOM   5779 N  N   . ILE C 1 252 ? 52.004  -21.562 44.703  1.00 29.33 ? 254  ILE C N   1 
ATOM   5780 C  CA  . ILE C 1 252 ? 51.614  -20.565 45.712  1.00 30.45 ? 254  ILE C CA  1 
ATOM   5781 C  C   . ILE C 1 252 ? 51.836  -19.177 45.129  1.00 32.17 ? 254  ILE C C   1 
ATOM   5782 O  O   . ILE C 1 252 ? 52.918  -18.905 44.581  1.00 31.54 ? 254  ILE C O   1 
ATOM   5783 C  CB  . ILE C 1 252 ? 52.447  -20.691 46.994  1.00 30.96 ? 254  ILE C CB  1 
ATOM   5784 C  CG1 . ILE C 1 252 ? 52.280  -22.077 47.613  1.00 30.27 ? 254  ILE C CG1 1 
ATOM   5785 C  CG2 . ILE C 1 252 ? 52.045  -19.591 47.985  1.00 32.21 ? 254  ILE C CG2 1 
ATOM   5786 C  CD1 . ILE C 1 252 ? 53.161  -22.334 48.805  1.00 32.25 ? 254  ILE C CD1 1 
ATOM   5787 N  N   . GLU C 1 253 ? 50.820  -18.321 45.214  1.00 28.86 ? 255  GLU C N   1 
ATOM   5788 C  CA  . GLU C 1 253 ? 50.934  -16.931 44.772  1.00 30.43 ? 255  GLU C CA  1 
ATOM   5789 C  C   . GLU C 1 253 ? 51.463  -16.062 45.938  1.00 31.35 ? 255  GLU C C   1 
ATOM   5790 O  O   . GLU C 1 253 ? 51.430  -16.479 47.116  1.00 27.87 ? 255  GLU C O   1 
ATOM   5791 C  CB  . GLU C 1 253 ? 49.634  -16.398 44.185  1.00 31.52 ? 255  GLU C CB  1 
ATOM   5792 C  CG  . GLU C 1 253 ? 49.200  -17.065 42.872  1.00 34.92 ? 255  GLU C CG  1 
ATOM   5793 C  CD  . GLU C 1 253 ? 48.055  -16.345 42.176  1.00 36.18 ? 255  GLU C CD  1 
ATOM   5794 O  OE1 . GLU C 1 253 ? 47.129  -15.884 42.847  1.00 41.78 ? 255  GLU C OE1 1 
ATOM   5795 O  OE2 . GLU C 1 253 ? 48.061  -16.219 40.940  1.00 42.38 ? 255  GLU C OE2 1 
ATOM   5796 N  N   . ALA C 1 254 ? 52.021  -14.901 45.583  1.00 32.43 ? 256  ALA C N   1 
ATOM   5797 C  CA  . ALA C 1 254 ? 52.532  -13.926 46.563  1.00 31.74 ? 256  ALA C CA  1 
ATOM   5798 C  C   . ALA C 1 254 ? 52.083  -12.546 46.132  1.00 32.94 ? 256  ALA C C   1 
ATOM   5799 O  O   . ALA C 1 254 ? 52.090  -12.243 44.940  1.00 35.16 ? 256  ALA C O   1 
ATOM   5800 C  CB  . ALA C 1 254 ? 54.052  -13.994 46.657  1.00 33.31 ? 256  ALA C CB  1 
ATOM   5801 N  N   . SER C 1 255 ? 51.670  -11.712 47.091  1.00 30.06 ? 257  SER C N   1 
ATOM   5802 C  CA  . SER C 1 255 ? 51.162  -10.378 46.782  1.00 32.35 ? 257  SER C CA  1 
ATOM   5803 C  C   . SER C 1 255 ? 52.282  -9.349  46.583  1.00 33.81 ? 257  SER C C   1 
ATOM   5804 O  O   . SER C 1 255 ? 52.001  -8.190  46.332  1.00 34.31 ? 257  SER C O   1 
ATOM   5805 C  CB  . SER C 1 255 ? 50.236  -9.888  47.901  1.00 32.09 ? 257  SER C CB  1 
ATOM   5806 O  OG  . SER C 1 255 ? 50.957  -9.810  49.113  1.00 32.92 ? 257  SER C OG  1 
ATOM   5807 N  N   . PHE C 1 256 ? 53.531  -9.784  46.684  1.00 36.29 ? 258  PHE C N   1 
ATOM   5808 C  CA  . PHE C 1 256 ? 54.690  -8.894  46.643  1.00 39.51 ? 258  PHE C CA  1 
ATOM   5809 C  C   . PHE C 1 256 ? 55.820  -9.571  45.854  1.00 43.36 ? 258  PHE C C   1 
ATOM   5810 O  O   . PHE C 1 256 ? 55.941  -10.804 45.897  1.00 40.99 ? 258  PHE C O   1 
ATOM   5811 C  CB  . PHE C 1 256 ? 55.171  -8.616  48.064  1.00 36.78 ? 258  PHE C CB  1 
ATOM   5812 C  CG  . PHE C 1 256 ? 55.441  -9.859  48.858  1.00 37.97 ? 258  PHE C CG  1 
ATOM   5813 C  CD1 . PHE C 1 256 ? 54.399  -10.510 49.540  1.00 36.71 ? 258  PHE C CD1 1 
ATOM   5814 C  CD2 . PHE C 1 256 ? 56.721  -10.400 48.924  1.00 37.56 ? 258  PHE C CD2 1 
ATOM   5815 C  CE1 . PHE C 1 256 ? 54.643  -11.665 50.261  1.00 34.99 ? 258  PHE C CE1 1 
ATOM   5816 C  CE2 . PHE C 1 256 ? 56.967  -11.560 49.646  1.00 38.46 ? 258  PHE C CE2 1 
ATOM   5817 C  CZ  . PHE C 1 256 ? 55.924  -12.194 50.317  1.00 38.60 ? 258  PHE C CZ  1 
ATOM   5818 N  N   . PRO C 1 257 ? 56.660  -8.772  45.153  1.00 47.30 ? 259  PRO C N   1 
ATOM   5819 C  CA  . PRO C 1 257 ? 57.788  -9.340  44.384  1.00 51.28 ? 259  PRO C CA  1 
ATOM   5820 C  C   . PRO C 1 257 ? 58.846  -10.046 45.245  1.00 53.10 ? 259  PRO C C   1 
ATOM   5821 O  O   . PRO C 1 257 ? 59.559  -10.925 44.753  1.00 55.32 ? 259  PRO C O   1 
ATOM   5822 C  CB  . PRO C 1 257 ? 58.389  -8.122  43.668  1.00 50.64 ? 259  PRO C CB  1 
ATOM   5823 C  CG  . PRO C 1 257 ? 57.920  -6.941  44.445  1.00 50.01 ? 259  PRO C CG  1 
ATOM   5824 C  CD  . PRO C 1 257 ? 56.579  -7.306  45.005  1.00 48.58 ? 259  PRO C CD  1 
ATOM   5825 O  OXT . PRO C 1 257 ? 59.011  -9.782  46.443  1.00 53.94 ? 259  PRO C OXT 1 
ATOM   5826 N  N   . TRP D 1 7   ? 13.641  -10.541 26.916  1.00 47.98 ? 9    TRP D N   1 
ATOM   5827 C  CA  . TRP D 1 7   ? 14.780  -9.621  26.577  1.00 47.51 ? 9    TRP D CA  1 
ATOM   5828 C  C   . TRP D 1 7   ? 15.196  -9.779  25.112  1.00 46.57 ? 9    TRP D C   1 
ATOM   5829 O  O   . TRP D 1 7   ? 14.906  -10.795 24.473  1.00 47.70 ? 9    TRP D O   1 
ATOM   5830 C  CB  . TRP D 1 7   ? 15.991  -9.847  27.506  1.00 45.35 ? 9    TRP D CB  1 
ATOM   5831 C  CG  . TRP D 1 7   ? 16.647  -11.206 27.359  1.00 45.44 ? 9    TRP D CG  1 
ATOM   5832 C  CD1 . TRP D 1 7   ? 16.296  -12.361 27.995  1.00 46.35 ? 9    TRP D CD1 1 
ATOM   5833 C  CD2 . TRP D 1 7   ? 17.766  -11.535 26.522  1.00 45.19 ? 9    TRP D CD2 1 
ATOM   5834 N  NE1 . TRP D 1 7   ? 17.122  -13.389 27.603  1.00 46.43 ? 9    TRP D NE1 1 
ATOM   5835 C  CE2 . TRP D 1 7   ? 18.036  -12.909 26.704  1.00 46.34 ? 9    TRP D CE2 1 
ATOM   5836 C  CE3 . TRP D 1 7   ? 18.567  -10.801 25.644  1.00 44.15 ? 9    TRP D CE3 1 
ATOM   5837 C  CZ2 . TRP D 1 7   ? 19.074  -13.568 26.031  1.00 47.87 ? 9    TRP D CZ2 1 
ATOM   5838 C  CZ3 . TRP D 1 7   ? 19.596  -11.458 24.969  1.00 47.04 ? 9    TRP D CZ3 1 
ATOM   5839 C  CH2 . TRP D 1 7   ? 19.837  -12.830 25.168  1.00 46.96 ? 9    TRP D CH2 1 
ATOM   5840 N  N   . ARG D 1 8   ? 15.874  -8.758  24.600  1.00 47.67 ? 10   ARG D N   1 
ATOM   5841 C  CA  . ARG D 1 8   ? 16.333  -8.724  23.210  1.00 46.45 ? 10   ARG D CA  1 
ATOM   5842 C  C   . ARG D 1 8   ? 17.584  -7.868  23.117  1.00 44.93 ? 10   ARG D C   1 
ATOM   5843 O  O   . ARG D 1 8   ? 17.916  -7.150  24.058  1.00 42.47 ? 10   ARG D O   1 
ATOM   5844 C  CB  . ARG D 1 8   ? 15.236  -8.166  22.288  1.00 45.10 ? 10   ARG D CB  1 
ATOM   5845 N  N   . TYR D 1 9   ? 18.298  -7.984  21.994  1.00 45.85 ? 11   TYR D N   1 
ATOM   5846 C  CA  . TYR D 1 9   ? 19.448  -7.111  21.696  1.00 46.15 ? 11   TYR D CA  1 
ATOM   5847 C  C   . TYR D 1 9   ? 18.972  -5.858  20.960  1.00 46.38 ? 11   TYR D C   1 
ATOM   5848 O  O   . TYR D 1 9   ? 18.025  -5.924  20.175  1.00 45.82 ? 11   TYR D O   1 
ATOM   5849 C  CB  . TYR D 1 9   ? 20.486  -7.834  20.827  1.00 44.15 ? 11   TYR D CB  1 
ATOM   5850 C  CG  . TYR D 1 9   ? 21.298  -8.878  21.555  1.00 44.13 ? 11   TYR D CG  1 
ATOM   5851 C  CD1 . TYR D 1 9   ? 22.368  -8.511  22.359  1.00 42.55 ? 11   TYR D CD1 1 
ATOM   5852 C  CD2 . TYR D 1 9   ? 21.011  -10.243 21.420  1.00 43.92 ? 11   TYR D CD2 1 
ATOM   5853 C  CE1 . TYR D 1 9   ? 23.120  -9.463  23.025  1.00 42.17 ? 11   TYR D CE1 1 
ATOM   5854 C  CE2 . TYR D 1 9   ? 21.768  -11.199 22.076  1.00 42.48 ? 11   TYR D CE2 1 
ATOM   5855 C  CZ  . TYR D 1 9   ? 22.817  -10.799 22.878  1.00 41.68 ? 11   TYR D CZ  1 
ATOM   5856 O  OH  . TYR D 1 9   ? 23.571  -11.736 23.534  1.00 42.56 ? 11   TYR D OH  1 
ATOM   5857 N  N   . GLY D 1 10  ? 19.640  -4.736  21.221  1.00 49.15 ? 12   GLY D N   1 
ATOM   5858 C  CA  . GLY D 1 10  ? 19.384  -3.472  20.523  1.00 54.47 ? 12   GLY D CA  1 
ATOM   5859 C  C   . GLY D 1 10  ? 18.011  -2.855  20.748  1.00 58.16 ? 12   GLY D C   1 
ATOM   5860 O  O   . GLY D 1 10  ? 17.323  -2.500  19.786  1.00 58.74 ? 12   GLY D O   1 
ATOM   5861 N  N   . GLY D 1 11  ? 17.605  -2.730  22.011  1.00 62.83 ? 13   GLY D N   1 
ATOM   5862 C  CA  . GLY D 1 11  ? 16.316  -2.122  22.350  1.00 62.94 ? 13   GLY D CA  1 
ATOM   5863 C  C   . GLY D 1 11  ? 15.624  -2.746  23.541  1.00 66.39 ? 13   GLY D C   1 
ATOM   5864 O  O   . GLY D 1 11  ? 15.984  -3.834  23.990  1.00 67.40 ? 13   GLY D O   1 
ATOM   5865 N  N   . ASP D 1 12  ? 14.597  -2.042  24.014  1.00 67.18 ? 14   ASP D N   1 
ATOM   5866 C  CA  . ASP D 1 12  ? 13.856  -2.381  25.234  1.00 66.05 ? 14   ASP D CA  1 
ATOM   5867 C  C   . ASP D 1 12  ? 13.238  -3.794  25.224  1.00 65.39 ? 14   ASP D C   1 
ATOM   5868 O  O   . ASP D 1 12  ? 13.008  -4.343  24.146  1.00 65.10 ? 14   ASP D O   1 
ATOM   5869 C  CB  . ASP D 1 12  ? 12.764  -1.323  25.479  1.00 67.74 ? 14   ASP D CB  1 
ATOM   5870 C  CG  . ASP D 1 12  ? 13.324  -0.009  26.019  1.00 70.55 ? 14   ASP D CG  1 
ATOM   5871 O  OD1 . ASP D 1 12  ? 14.564  0.138   26.141  1.00 70.75 ? 14   ASP D OD1 1 
ATOM   5872 O  OD2 . ASP D 1 12  ? 12.510  0.886   26.325  1.00 74.76 ? 14   ASP D OD2 1 
ATOM   5873 N  N   . PRO D 1 13  ? 12.960  -4.387  26.397  1.00 63.65 ? 15   PRO D N   1 
ATOM   5874 C  CA  . PRO D 1 13  ? 13.130  -3.763  27.728  1.00 60.93 ? 15   PRO D CA  1 
ATOM   5875 C  C   . PRO D 1 13  ? 14.596  -3.633  28.155  1.00 57.48 ? 15   PRO D C   1 
ATOM   5876 O  O   . PRO D 1 13  ? 15.402  -4.479  27.762  1.00 57.49 ? 15   PRO D O   1 
ATOM   5877 C  CB  . PRO D 1 13  ? 12.400  -4.737  28.659  1.00 62.20 ? 15   PRO D CB  1 
ATOM   5878 C  CG  . PRO D 1 13  ? 12.508  -6.061  27.978  1.00 62.33 ? 15   PRO D CG  1 
ATOM   5879 C  CD  . PRO D 1 13  ? 12.524  -5.794  26.499  1.00 62.19 ? 15   PRO D CD  1 
ATOM   5880 N  N   . PRO D 1 14  ? 14.944  -2.583  28.943  1.00 54.16 ? 16   PRO D N   1 
ATOM   5881 C  CA  . PRO D 1 14  ? 16.306  -2.536  29.478  1.00 51.10 ? 16   PRO D CA  1 
ATOM   5882 C  C   . PRO D 1 14  ? 16.539  -3.743  30.377  1.00 48.88 ? 16   PRO D C   1 
ATOM   5883 O  O   . PRO D 1 14  ? 15.612  -4.203  31.060  1.00 45.35 ? 16   PRO D O   1 
ATOM   5884 C  CB  . PRO D 1 14  ? 16.350  -1.225  30.289  1.00 52.74 ? 16   PRO D CB  1 
ATOM   5885 C  CG  . PRO D 1 14  ? 15.106  -0.482  29.938  1.00 52.87 ? 16   PRO D CG  1 
ATOM   5886 C  CD  . PRO D 1 14  ? 14.105  -1.516  29.519  1.00 54.00 ? 16   PRO D CD  1 
ATOM   5887 N  N   . TRP D 1 15  ? 17.765  -4.253  30.355  1.00 47.43 ? 17   TRP D N   1 
ATOM   5888 C  CA  . TRP D 1 15  ? 18.063  -5.568  30.930  1.00 44.69 ? 17   TRP D CA  1 
ATOM   5889 C  C   . TRP D 1 15  ? 17.886  -5.665  32.452  1.00 44.19 ? 17   TRP D C   1 
ATOM   5890 O  O   . TRP D 1 15  ? 17.359  -6.677  32.925  1.00 42.13 ? 17   TRP D O   1 
ATOM   5891 C  CB  . TRP D 1 15  ? 19.457  -6.048  30.488  1.00 43.14 ? 17   TRP D CB  1 
ATOM   5892 C  CG  . TRP D 1 15  ? 19.498  -6.582  29.069  1.00 41.38 ? 17   TRP D CG  1 
ATOM   5893 C  CD1 . TRP D 1 15  ? 18.511  -6.520  28.126  1.00 40.02 ? 17   TRP D CD1 1 
ATOM   5894 C  CD2 . TRP D 1 15  ? 20.605  -7.236  28.446  1.00 40.26 ? 17   TRP D CD2 1 
ATOM   5895 N  NE1 . TRP D 1 15  ? 18.929  -7.118  26.963  1.00 40.46 ? 17   TRP D NE1 1 
ATOM   5896 C  CE2 . TRP D 1 15  ? 20.213  -7.564  27.133  1.00 40.79 ? 17   TRP D CE2 1 
ATOM   5897 C  CE3 . TRP D 1 15  ? 21.888  -7.591  28.879  1.00 40.35 ? 17   TRP D CE3 1 
ATOM   5898 C  CZ2 . TRP D 1 15  ? 21.071  -8.228  26.234  1.00 42.03 ? 17   TRP D CZ2 1 
ATOM   5899 C  CZ3 . TRP D 1 15  ? 22.740  -8.250  27.996  1.00 40.16 ? 17   TRP D CZ3 1 
ATOM   5900 C  CH2 . TRP D 1 15  ? 22.326  -8.560  26.685  1.00 40.26 ? 17   TRP D CH2 1 
ATOM   5901 N  N   . PRO D 1 16  ? 18.312  -4.631  33.216  1.00 43.90 ? 18   PRO D N   1 
ATOM   5902 C  CA  . PRO D 1 16  ? 18.028  -4.647  34.660  1.00 44.08 ? 18   PRO D CA  1 
ATOM   5903 C  C   . PRO D 1 16  ? 16.526  -4.706  35.024  1.00 47.69 ? 18   PRO D C   1 
ATOM   5904 O  O   . PRO D 1 16  ? 16.188  -5.201  36.104  1.00 47.36 ? 18   PRO D O   1 
ATOM   5905 C  CB  . PRO D 1 16  ? 18.691  -3.363  35.166  1.00 43.06 ? 18   PRO D CB  1 
ATOM   5906 C  CG  . PRO D 1 16  ? 19.766  -3.073  34.173  1.00 42.03 ? 18   PRO D CG  1 
ATOM   5907 C  CD  . PRO D 1 16  ? 19.201  -3.508  32.854  1.00 42.21 ? 18   PRO D CD  1 
ATOM   5908 N  N   . ARG D 1 17  ? 15.645  -4.248  34.128  1.00 49.55 ? 19   ARG D N   1 
ATOM   5909 C  CA  . ARG D 1 17  ? 14.194  -4.445  34.285  1.00 51.89 ? 19   ARG D CA  1 
ATOM   5910 C  C   . ARG D 1 17  ? 13.778  -5.923  34.170  1.00 53.53 ? 19   ARG D C   1 
ATOM   5911 O  O   . ARG D 1 17  ? 12.885  -6.362  34.882  1.00 53.78 ? 19   ARG D O   1 
ATOM   5912 C  CB  . ARG D 1 17  ? 13.397  -3.581  33.291  1.00 52.69 ? 19   ARG D CB  1 
ATOM   5913 N  N   . VAL D 1 18  ? 14.426  -6.683  33.291  1.00 54.32 ? 20   VAL D N   1 
ATOM   5914 C  CA  . VAL D 1 18  ? 14.171  -8.129  33.172  1.00 53.50 ? 20   VAL D CA  1 
ATOM   5915 C  C   . VAL D 1 18  ? 14.898  -8.896  34.279  1.00 48.89 ? 20   VAL D C   1 
ATOM   5916 O  O   . VAL D 1 18  ? 14.320  -9.784  34.906  1.00 46.35 ? 20   VAL D O   1 
ATOM   5917 C  CB  . VAL D 1 18  ? 14.626  -8.689  31.799  1.00 56.11 ? 20   VAL D CB  1 
ATOM   5918 C  CG1 . VAL D 1 18  ? 14.377  -10.198 31.709  1.00 57.83 ? 20   VAL D CG1 1 
ATOM   5919 C  CG2 . VAL D 1 18  ? 13.922  -7.962  30.660  1.00 55.39 ? 20   VAL D CG2 1 
ATOM   5920 N  N   . SER D 1 19  ? 16.170  -8.555  34.478  1.00 42.94 ? 21   SER D N   1 
ATOM   5921 C  CA  . SER D 1 19  ? 17.054  -9.215  35.427  1.00 41.84 ? 21   SER D CA  1 
ATOM   5922 C  C   . SER D 1 19  ? 17.877  -8.177  36.182  1.00 38.49 ? 21   SER D C   1 
ATOM   5923 O  O   . SER D 1 19  ? 18.922  -7.742  35.694  1.00 36.84 ? 21   SER D O   1 
ATOM   5924 C  CB  . SER D 1 19  ? 18.001  -10.168 34.683  1.00 42.33 ? 21   SER D CB  1 
ATOM   5925 O  OG  . SER D 1 19  ? 17.317  -11.331 34.256  1.00 43.88 ? 21   SER D OG  1 
ATOM   5926 N  N   . PRO D 1 20  ? 17.424  -7.780  37.385  1.00 35.96 ? 22   PRO D N   1 
ATOM   5927 C  CA  . PRO D 1 20  ? 18.194  -6.839  38.194  1.00 33.40 ? 22   PRO D CA  1 
ATOM   5928 C  C   . PRO D 1 20  ? 19.669  -7.184  38.413  1.00 33.42 ? 22   PRO D C   1 
ATOM   5929 O  O   . PRO D 1 20  ? 20.476  -6.276  38.625  1.00 32.12 ? 22   PRO D O   1 
ATOM   5930 C  CB  . PRO D 1 20  ? 17.430  -6.824  39.522  1.00 35.23 ? 22   PRO D CB  1 
ATOM   5931 C  CG  . PRO D 1 20  ? 16.017  -7.042  39.113  1.00 35.28 ? 22   PRO D CG  1 
ATOM   5932 C  CD  . PRO D 1 20  ? 16.065  -7.977  37.933  1.00 36.74 ? 22   PRO D CD  1 
ATOM   5933 N  N   . ALA D 1 21  ? 20.021  -8.473  38.377  1.00 30.99 ? 23   ALA D N   1 
ATOM   5934 C  CA  . ALA D 1 21  ? 21.422  -8.903  38.388  1.00 30.96 ? 23   ALA D CA  1 
ATOM   5935 C  C   . ALA D 1 21  ? 22.288  -8.269  37.286  1.00 29.98 ? 23   ALA D C   1 
ATOM   5936 O  O   . ALA D 1 21  ? 23.478  -8.048  37.495  1.00 30.11 ? 23   ALA D O   1 
ATOM   5937 C  CB  . ALA D 1 21  ? 21.507  -10.417 38.287  1.00 31.69 ? 23   ALA D CB  1 
ATOM   5938 N  N   . CYS D 1 22  ? 21.695  -7.954  36.139  1.00 30.49 ? 24   CYS D N   1 
ATOM   5939 C  CA  . CYS D 1 22  ? 22.441  -7.254  35.062  1.00 31.94 ? 24   CYS D CA  1 
ATOM   5940 C  C   . CYS D 1 22  ? 23.014  -5.890  35.463  1.00 33.39 ? 24   CYS D C   1 
ATOM   5941 O  O   . CYS D 1 22  ? 23.962  -5.414  34.827  1.00 32.86 ? 24   CYS D O   1 
ATOM   5942 C  CB  . CYS D 1 22  ? 21.581  -7.111  33.820  1.00 32.36 ? 24   CYS D CB  1 
ATOM   5943 S  SG  . CYS D 1 22  ? 20.928  -8.674  33.186  1.00 33.40 ? 24   CYS D SG  1 
ATOM   5944 N  N   . ALA D 1 23  ? 22.470  -5.285  36.528  1.00 32.60 ? 25   ALA D N   1 
ATOM   5945 C  CA  . ALA D 1 23  ? 23.045  -4.076  37.124  1.00 31.22 ? 25   ALA D CA  1 
ATOM   5946 C  C   . ALA D 1 23  ? 24.049  -4.362  38.222  1.00 30.83 ? 25   ALA D C   1 
ATOM   5947 O  O   . ALA D 1 23  ? 24.421  -3.454  38.936  1.00 31.08 ? 25   ALA D O   1 
ATOM   5948 C  CB  . ALA D 1 23  ? 21.924  -3.164  37.639  1.00 32.76 ? 25   ALA D CB  1 
ATOM   5949 N  N   . GLY D 1 24  ? 24.523  -5.609  38.367  1.00 30.85 ? 26   GLY D N   1 
ATOM   5950 C  CA  . GLY D 1 24  ? 25.601  -5.933  39.317  1.00 30.21 ? 26   GLY D CA  1 
ATOM   5951 C  C   . GLY D 1 24  ? 26.914  -5.247  39.004  1.00 30.50 ? 26   GLY D C   1 
ATOM   5952 O  O   . GLY D 1 24  ? 27.087  -4.707  37.914  1.00 33.18 ? 26   GLY D O   1 
ATOM   5953 N  N   . ARG D 1 25  ? 27.843  -5.280  39.950  1.00 32.57 ? 27   ARG D N   1 
ATOM   5954 C  CA  . ARG D 1 25  ? 29.129  -4.552  39.839  1.00 35.10 ? 27   ARG D CA  1 
ATOM   5955 C  C   . ARG D 1 25  ? 30.246  -5.266  39.062  1.00 34.04 ? 27   ARG D C   1 
ATOM   5956 O  O   . ARG D 1 25  ? 31.290  -4.661  38.789  1.00 31.57 ? 27   ARG D O   1 
ATOM   5957 C  CB  . ARG D 1 25  ? 29.676  -4.249  41.224  1.00 38.97 ? 27   ARG D CB  1 
ATOM   5958 C  CG  . ARG D 1 25  ? 28.758  -3.393  42.079  1.00 44.96 ? 27   ARG D CG  1 
ATOM   5959 C  CD  . ARG D 1 25  ? 29.197  -1.945  42.089  1.00 48.48 ? 27   ARG D CD  1 
ATOM   5960 N  NE  . ARG D 1 25  ? 30.532  -1.822  42.682  1.00 51.50 ? 27   ARG D NE  1 
ATOM   5961 C  CZ  . ARG D 1 25  ? 31.404  -0.852  42.411  1.00 52.19 ? 27   ARG D CZ  1 
ATOM   5962 N  NH1 . ARG D 1 25  ? 31.104  0.129   41.553  1.00 53.02 ? 27   ARG D NH1 1 
ATOM   5963 N  NH2 . ARG D 1 25  ? 32.595  -0.864  43.003  1.00 52.11 ? 27   ARG D NH2 1 
ATOM   5964 N  N   . PHE D 1 26  ? 30.057  -6.542  38.737  1.00 32.99 ? 28   PHE D N   1 
ATOM   5965 C  CA  . PHE D 1 26  ? 31.149  -7.367  38.205  1.00 32.15 ? 28   PHE D CA  1 
ATOM   5966 C  C   . PHE D 1 26  ? 30.615  -8.147  37.018  1.00 30.55 ? 28   PHE D C   1 
ATOM   5967 O  O   . PHE D 1 26  ? 30.404  -9.365  37.071  1.00 31.16 ? 28   PHE D O   1 
ATOM   5968 C  CB  . PHE D 1 26  ? 31.696  -8.259  39.313  1.00 32.02 ? 28   PHE D CB  1 
ATOM   5969 C  CG  . PHE D 1 26  ? 32.182  -7.491  40.513  1.00 33.25 ? 28   PHE D CG  1 
ATOM   5970 C  CD1 . PHE D 1 26  ? 33.188  -6.544  40.381  1.00 32.13 ? 28   PHE D CD1 1 
ATOM   5971 C  CD2 . PHE D 1 26  ? 31.613  -7.693  41.778  1.00 33.41 ? 28   PHE D CD2 1 
ATOM   5972 C  CE1 . PHE D 1 26  ? 33.644  -5.820  41.475  1.00 33.71 ? 28   PHE D CE1 1 
ATOM   5973 C  CE2 . PHE D 1 26  ? 32.063  -6.972  42.879  1.00 33.25 ? 28   PHE D CE2 1 
ATOM   5974 C  CZ  . PHE D 1 26  ? 33.083  -6.037  42.728  1.00 34.06 ? 28   PHE D CZ  1 
ATOM   5975 N  N   . GLN D 1 27  ? 30.328  -7.395  35.963  1.00 29.12 ? 29   GLN D N   1 
ATOM   5976 C  CA  . GLN D 1 27  ? 29.655  -7.917  34.790  1.00 29.50 ? 29   GLN D CA  1 
ATOM   5977 C  C   . GLN D 1 27  ? 30.653  -8.153  33.648  1.00 29.86 ? 29   GLN D C   1 
ATOM   5978 O  O   . GLN D 1 27  ? 31.807  -7.722  33.717  1.00 28.42 ? 29   GLN D O   1 
ATOM   5979 C  CB  . GLN D 1 27  ? 28.543  -6.973  34.355  1.00 31.52 ? 29   GLN D CB  1 
ATOM   5980 C  CG  . GLN D 1 27  ? 27.403  -6.851  35.359  1.00 31.05 ? 29   GLN D CG  1 
ATOM   5981 C  CD  . GLN D 1 27  ? 26.498  -8.065  35.365  1.00 29.94 ? 29   GLN D CD  1 
ATOM   5982 O  OE1 . GLN D 1 27  ? 25.746  -8.288  34.418  1.00 29.34 ? 29   GLN D OE1 1 
ATOM   5983 N  NE2 . GLN D 1 27  ? 26.544  -8.841  36.444  1.00 31.34 ? 29   GLN D NE2 1 
ATOM   5984 N  N   . SER D 1 28  ? 30.168  -8.861  32.633  1.00 30.83 ? 30   SER D N   1 
ATOM   5985 C  CA  . SER D 1 28  ? 30.930  -9.210  31.439  1.00 30.21 ? 30   SER D CA  1 
ATOM   5986 C  C   . SER D 1 28  ? 30.060  -8.865  30.241  1.00 30.74 ? 30   SER D C   1 
ATOM   5987 O  O   . SER D 1 28  ? 28.832  -8.881  30.354  1.00 28.65 ? 30   SER D O   1 
ATOM   5988 C  CB  . SER D 1 28  ? 31.242  -10.711 31.441  1.00 28.32 ? 30   SER D CB  1 
ATOM   5989 O  OG  . SER D 1 28  ? 32.170  -11.044 32.450  1.00 26.80 ? 30   SER D OG  1 
ATOM   5990 N  N   . PRO D 1 29  ? 30.646  -8.563  29.077  1.00 32.28 ? 31   PRO D N   1 
ATOM   5991 C  CA  . PRO D 1 29  ? 32.074  -8.597  28.803  1.00 32.93 ? 31   PRO D CA  1 
ATOM   5992 C  C   . PRO D 1 29  ? 32.781  -7.319  29.230  1.00 35.02 ? 31   PRO D C   1 
ATOM   5993 O  O   . PRO D 1 29  ? 32.138  -6.348  29.630  1.00 33.53 ? 31   PRO D O   1 
ATOM   5994 C  CB  . PRO D 1 29  ? 32.116  -8.699  27.273  1.00 33.42 ? 31   PRO D CB  1 
ATOM   5995 C  CG  . PRO D 1 29  ? 30.920  -7.923  26.841  1.00 34.02 ? 31   PRO D CG  1 
ATOM   5996 C  CD  . PRO D 1 29  ? 29.866  -8.137  27.904  1.00 33.46 ? 31   PRO D CD  1 
ATOM   5997 N  N   . VAL D 1 30  ? 34.099  -7.341  29.117  1.00 35.15 ? 32   VAL D N   1 
ATOM   5998 C  CA  . VAL D 1 30  ? 34.939  -6.207  29.460  1.00 37.11 ? 32   VAL D CA  1 
ATOM   5999 C  C   . VAL D 1 30  ? 35.886  -5.886  28.316  1.00 40.65 ? 32   VAL D C   1 
ATOM   6000 O  O   . VAL D 1 30  ? 36.063  -6.683  27.380  1.00 38.95 ? 32   VAL D O   1 
ATOM   6001 C  CB  . VAL D 1 30  ? 35.776  -6.457  30.731  1.00 36.44 ? 32   VAL D CB  1 
ATOM   6002 C  CG1 . VAL D 1 30  ? 34.850  -6.660  31.927  1.00 37.54 ? 32   VAL D CG1 1 
ATOM   6003 C  CG2 . VAL D 1 30  ? 36.740  -7.640  30.573  1.00 35.47 ? 32   VAL D CG2 1 
ATOM   6004 N  N   . ASP D 1 31  ? 36.489  -4.709  28.419  1.00 40.12 ? 33   ASP D N   1 
ATOM   6005 C  CA  . ASP D 1 31  ? 37.523  -4.286  27.513  1.00 39.17 ? 33   ASP D CA  1 
ATOM   6006 C  C   . ASP D 1 31  ? 38.840  -4.686  28.137  1.00 37.02 ? 33   ASP D C   1 
ATOM   6007 O  O   . ASP D 1 31  ? 39.150  -4.300  29.268  1.00 38.09 ? 33   ASP D O   1 
ATOM   6008 C  CB  . ASP D 1 31  ? 37.444  -2.779  27.280  1.00 39.78 ? 33   ASP D CB  1 
ATOM   6009 C  CG  . ASP D 1 31  ? 38.456  -2.306  26.262  1.00 42.76 ? 33   ASP D CG  1 
ATOM   6010 O  OD1 . ASP D 1 31  ? 38.407  -2.800  25.103  1.00 39.41 ? 33   ASP D OD1 1 
ATOM   6011 O  OD2 . ASP D 1 31  ? 39.311  -1.468  26.636  1.00 43.37 ? 33   ASP D OD2 1 
ATOM   6012 N  N   . ILE D 1 32  ? 39.610  -5.487  27.406  1.00 38.22 ? 34   ILE D N   1 
ATOM   6013 C  CA  . ILE D 1 32  ? 40.897  -5.988  27.885  1.00 39.04 ? 34   ILE D CA  1 
ATOM   6014 C  C   . ILE D 1 32  ? 41.939  -4.997  27.407  1.00 42.93 ? 34   ILE D C   1 
ATOM   6015 O  O   . ILE D 1 32  ? 41.973  -4.668  26.221  1.00 44.32 ? 34   ILE D O   1 
ATOM   6016 C  CB  . ILE D 1 32  ? 41.219  -7.396  27.324  1.00 37.86 ? 34   ILE D CB  1 
ATOM   6017 C  CG1 . ILE D 1 32  ? 40.148  -8.409  27.771  1.00 39.44 ? 34   ILE D CG1 1 
ATOM   6018 C  CG2 . ILE D 1 32  ? 42.612  -7.846  27.750  1.00 36.51 ? 34   ILE D CG2 1 
ATOM   6019 C  CD1 . ILE D 1 32  ? 40.119  -9.697  26.966  1.00 39.56 ? 34   ILE D CD1 1 
ATOM   6020 N  N   . ARG D 1 33  ? 42.774  -4.524  28.327  1.00 44.99 ? 35   ARG D N   1 
ATOM   6021 C  CA  . ARG D 1 33  ? 43.847  -3.596  28.003  1.00 46.83 ? 35   ARG D CA  1 
ATOM   6022 C  C   . ARG D 1 33  ? 45.108  -4.296  28.414  1.00 42.53 ? 35   ARG D C   1 
ATOM   6023 O  O   . ARG D 1 33  ? 45.476  -4.254  29.586  1.00 42.98 ? 35   ARG D O   1 
ATOM   6024 C  CB  . ARG D 1 33  ? 43.660  -2.269  28.739  1.00 51.24 ? 35   ARG D CB  1 
ATOM   6025 C  CG  . ARG D 1 33  ? 42.327  -1.609  28.429  1.00 56.72 ? 35   ARG D CG  1 
ATOM   6026 C  CD  . ARG D 1 33  ? 42.387  -0.120  28.675  1.00 61.86 ? 35   ARG D CD  1 
ATOM   6027 N  NE  . ARG D 1 33  ? 43.044  0.533   27.549  1.00 68.18 ? 35   ARG D NE  1 
ATOM   6028 C  CZ  . ARG D 1 33  ? 43.794  1.632   27.617  1.00 73.84 ? 35   ARG D CZ  1 
ATOM   6029 N  NH1 . ARG D 1 33  ? 44.021  2.258   28.776  1.00 74.05 ? 35   ARG D NH1 1 
ATOM   6030 N  NH2 . ARG D 1 33  ? 44.336  2.108   26.498  1.00 74.10 ? 35   ARG D NH2 1 
ATOM   6031 N  N   . PRO D 1 34  ? 45.776  -4.981  27.456  1.00 41.45 ? 36   PRO D N   1 
ATOM   6032 C  CA  . PRO D 1 34  ? 46.891  -5.860  27.803  1.00 41.38 ? 36   PRO D CA  1 
ATOM   6033 C  C   . PRO D 1 34  ? 48.007  -5.221  28.612  1.00 44.04 ? 36   PRO D C   1 
ATOM   6034 O  O   . PRO D 1 34  ? 48.667  -5.930  29.385  1.00 43.02 ? 36   PRO D O   1 
ATOM   6035 C  CB  . PRO D 1 34  ? 47.414  -6.321  26.441  1.00 40.64 ? 36   PRO D CB  1 
ATOM   6036 C  CG  . PRO D 1 34  ? 46.237  -6.266  25.554  1.00 40.92 ? 36   PRO D CG  1 
ATOM   6037 C  CD  . PRO D 1 34  ? 45.415  -5.109  26.032  1.00 41.88 ? 36   PRO D CD  1 
ATOM   6038 N  N   . GLN D 1 35  ? 48.203  -3.906  28.445  1.00 49.58 ? 37   GLN D N   1 
ATOM   6039 C  CA  . GLN D 1 35  ? 49.207  -3.139  29.212  1.00 53.98 ? 37   GLN D CA  1 
ATOM   6040 C  C   . GLN D 1 35  ? 48.877  -3.128  30.702  1.00 50.84 ? 37   GLN D C   1 
ATOM   6041 O  O   . GLN D 1 35  ? 49.771  -3.241  31.536  1.00 50.61 ? 37   GLN D O   1 
ATOM   6042 C  CB  . GLN D 1 35  ? 49.308  -1.674  28.738  1.00 59.04 ? 37   GLN D CB  1 
ATOM   6043 C  CG  . GLN D 1 35  ? 49.400  -1.411  27.237  1.00 64.48 ? 37   GLN D CG  1 
ATOM   6044 C  CD  . GLN D 1 35  ? 50.357  -2.333  26.498  1.00 68.62 ? 37   GLN D CD  1 
ATOM   6045 O  OE1 . GLN D 1 35  ? 50.090  -2.734  25.361  1.00 77.88 ? 37   GLN D OE1 1 
ATOM   6046 N  NE2 . GLN D 1 35  ? 51.477  -2.666  27.128  1.00 67.90 ? 37   GLN D NE2 1 
ATOM   6047 N  N   . LEU D 1 36  ? 47.588  -2.994  31.008  1.00 48.43 ? 38   LEU D N   1 
ATOM   6048 C  CA  . LEU D 1 36  ? 47.087  -2.955  32.382  1.00 49.92 ? 38   LEU D CA  1 
ATOM   6049 C  C   . LEU D 1 36  ? 46.709  -4.337  32.944  1.00 49.50 ? 38   LEU D C   1 
ATOM   6050 O  O   . LEU D 1 36  ? 46.268  -4.442  34.095  1.00 48.96 ? 38   LEU D O   1 
ATOM   6051 C  CB  . LEU D 1 36  ? 45.881  -2.011  32.449  1.00 52.42 ? 38   LEU D CB  1 
ATOM   6052 C  CG  . LEU D 1 36  ? 46.089  -0.626  31.807  1.00 53.93 ? 38   LEU D CG  1 
ATOM   6053 C  CD1 . LEU D 1 36  ? 44.843  0.230   31.969  1.00 53.95 ? 38   LEU D CD1 1 
ATOM   6054 C  CD2 . LEU D 1 36  ? 47.320  0.068   32.377  1.00 53.06 ? 38   LEU D CD2 1 
ATOM   6055 N  N   . ALA D 1 37  ? 46.871  -5.387  32.137  1.00 45.21 ? 39   ALA D N   1 
ATOM   6056 C  CA  . ALA D 1 37  ? 46.673  -6.760  32.598  1.00 42.52 ? 39   ALA D CA  1 
ATOM   6057 C  C   . ALA D 1 37  ? 47.830  -7.158  33.470  1.00 39.93 ? 39   ALA D C   1 
ATOM   6058 O  O   . ALA D 1 37  ? 48.967  -6.773  33.208  1.00 40.81 ? 39   ALA D O   1 
ATOM   6059 C  CB  . ALA D 1 37  ? 46.546  -7.720  31.421  1.00 42.97 ? 39   ALA D CB  1 
ATOM   6060 N  N   . ALA D 1 38  ? 47.541  -7.925  34.513  1.00 38.00 ? 40   ALA D N   1 
ATOM   6061 C  CA  . ALA D 1 38  ? 48.552  -8.354  35.463  1.00 36.96 ? 40   ALA D CA  1 
ATOM   6062 C  C   . ALA D 1 38  ? 49.103  -9.716  35.081  1.00 38.36 ? 40   ALA D C   1 
ATOM   6063 O  O   . ALA D 1 38  ? 48.356  -10.688 35.020  1.00 40.22 ? 40   ALA D O   1 
ATOM   6064 C  CB  . ALA D 1 38  ? 47.965  -8.423  36.866  1.00 37.50 ? 40   ALA D CB  1 
ATOM   6065 N  N   . PHE D 1 39  ? 50.417  -9.794  34.867  1.00 39.32 ? 41   PHE D N   1 
ATOM   6066 C  CA  . PHE D 1 39  ? 51.073  -11.060 34.566  1.00 38.83 ? 41   PHE D CA  1 
ATOM   6067 C  C   . PHE D 1 39  ? 51.070  -11.899 35.817  1.00 37.49 ? 41   PHE D C   1 
ATOM   6068 O  O   . PHE D 1 39  ? 51.622  -11.484 36.835  1.00 35.96 ? 41   PHE D O   1 
ATOM   6069 C  CB  . PHE D 1 39  ? 52.522  -10.848 34.061  1.00 39.48 ? 41   PHE D CB  1 
ATOM   6070 C  CG  . PHE D 1 39  ? 53.307  -12.125 33.897  1.00 39.74 ? 41   PHE D CG  1 
ATOM   6071 C  CD1 . PHE D 1 39  ? 52.774  -13.203 33.179  1.00 41.64 ? 41   PHE D CD1 1 
ATOM   6072 C  CD2 . PHE D 1 39  ? 54.563  -12.269 34.463  1.00 38.59 ? 41   PHE D CD2 1 
ATOM   6073 C  CE1 . PHE D 1 39  ? 53.484  -14.385 33.038  1.00 40.59 ? 41   PHE D CE1 1 
ATOM   6074 C  CE2 . PHE D 1 39  ? 55.282  -13.447 34.316  1.00 40.52 ? 41   PHE D CE2 1 
ATOM   6075 C  CZ  . PHE D 1 39  ? 54.741  -14.509 33.601  1.00 40.26 ? 41   PHE D CZ  1 
ATOM   6076 N  N   . SER D 1 40  ? 50.442  -13.074 35.752  1.00 37.52 ? 42   SER D N   1 
ATOM   6077 C  CA  . SER D 1 40  ? 50.486  -14.007 36.863  1.00 38.42 ? 42   SER D CA  1 
ATOM   6078 C  C   . SER D 1 40  ? 50.985  -15.384 36.429  1.00 38.12 ? 42   SER D C   1 
ATOM   6079 O  O   . SER D 1 40  ? 50.225  -16.145 35.822  1.00 37.48 ? 42   SER D O   1 
ATOM   6080 C  CB  . SER D 1 40  ? 49.126  -14.154 37.536  1.00 40.41 ? 42   SER D CB  1 
ATOM   6081 O  OG  . SER D 1 40  ? 49.284  -15.084 38.625  1.00 43.80 ? 42   SER D OG  1 
ATOM   6082 N  N   . PRO D 1 41  ? 52.240  -15.723 36.775  1.00 40.31 ? 43   PRO D N   1 
ATOM   6083 C  CA  . PRO D 1 41  ? 52.825  -16.990 36.324  1.00 38.92 ? 43   PRO D CA  1 
ATOM   6084 C  C   . PRO D 1 41  ? 52.302  -18.256 36.999  1.00 37.69 ? 43   PRO D C   1 
ATOM   6085 O  O   . PRO D 1 41  ? 52.760  -19.343 36.657  1.00 36.49 ? 43   PRO D O   1 
ATOM   6086 C  CB  . PRO D 1 41  ? 54.316  -16.815 36.609  1.00 41.19 ? 43   PRO D CB  1 
ATOM   6087 C  CG  . PRO D 1 41  ? 54.419  -15.742 37.630  1.00 40.44 ? 43   PRO D CG  1 
ATOM   6088 C  CD  . PRO D 1 41  ? 53.234  -14.867 37.465  1.00 39.51 ? 43   PRO D CD  1 
ATOM   6089 N  N   . ALA D 1 42  ? 51.382  -18.129 37.962  1.00 34.22 ? 44   ALA D N   1 
ATOM   6090 C  CA  . ALA D 1 42  ? 50.646  -19.291 38.467  1.00 32.16 ? 44   ALA D CA  1 
ATOM   6091 C  C   . ALA D 1 42  ? 49.655  -19.837 37.431  1.00 29.10 ? 44   ALA D C   1 
ATOM   6092 O  O   . ALA D 1 42  ? 49.298  -20.986 37.517  1.00 32.50 ? 44   ALA D O   1 
ATOM   6093 C  CB  . ALA D 1 42  ? 49.909  -18.947 39.764  1.00 31.57 ? 44   ALA D CB  1 
ATOM   6094 N  N   . LEU D 1 43  ? 49.214  -19.017 36.481  1.00 29.76 ? 45   LEU D N   1 
ATOM   6095 C  CA  . LEU D 1 43  ? 48.234  -19.433 35.479  1.00 29.98 ? 45   LEU D CA  1 
ATOM   6096 C  C   . LEU D 1 43  ? 48.849  -20.481 34.558  1.00 32.00 ? 45   LEU D C   1 
ATOM   6097 O  O   . LEU D 1 43  ? 49.794  -20.171 33.839  1.00 30.04 ? 45   LEU D O   1 
ATOM   6098 C  CB  . LEU D 1 43  ? 47.740  -18.234 34.668  1.00 29.91 ? 45   LEU D CB  1 
ATOM   6099 C  CG  . LEU D 1 43  ? 46.943  -17.192 35.452  1.00 31.79 ? 45   LEU D CG  1 
ATOM   6100 C  CD1 . LEU D 1 43  ? 46.578  -16.024 34.547  1.00 32.33 ? 45   LEU D CD1 1 
ATOM   6101 C  CD2 . LEU D 1 43  ? 45.698  -17.817 36.079  1.00 32.30 ? 45   LEU D CD2 1 
ATOM   6102 N  N   . ARG D 1 44  ? 48.319  -21.708 34.608  1.00 31.21 ? 46   ARG D N   1 
ATOM   6103 C  CA  . ARG D 1 44  ? 48.880  -22.861 33.900  1.00 32.02 ? 46   ARG D CA  1 
ATOM   6104 C  C   . ARG D 1 44  ? 48.238  -22.986 32.534  1.00 28.67 ? 46   ARG D C   1 
ATOM   6105 O  O   . ARG D 1 44  ? 47.188  -22.381 32.275  1.00 27.51 ? 46   ARG D O   1 
ATOM   6106 C  CB  . ARG D 1 44  ? 48.586  -24.153 34.666  1.00 37.91 ? 46   ARG D CB  1 
ATOM   6107 C  CG  . ARG D 1 44  ? 49.150  -24.229 36.079  1.00 44.66 ? 46   ARG D CG  1 
ATOM   6108 C  CD  . ARG D 1 44  ? 50.593  -24.717 36.144  1.00 50.34 ? 46   ARG D CD  1 
ATOM   6109 N  NE  . ARG D 1 44  ? 51.505  -23.671 36.621  1.00 57.00 ? 46   ARG D NE  1 
ATOM   6110 C  CZ  . ARG D 1 44  ? 52.418  -23.007 35.900  1.00 62.04 ? 46   ARG D CZ  1 
ATOM   6111 N  NH1 . ARG D 1 44  ? 52.626  -23.249 34.598  1.00 61.93 ? 46   ARG D NH1 1 
ATOM   6112 N  NH2 . ARG D 1 44  ? 53.156  -22.077 36.507  1.00 64.27 ? 46   ARG D NH2 1 
ATOM   6113 N  N   . PRO D 1 45  ? 48.854  -23.775 31.638  1.00 26.41 ? 47   PRO D N   1 
ATOM   6114 C  CA  . PRO D 1 45  ? 48.171  -24.050 30.380  1.00 26.10 ? 47   PRO D CA  1 
ATOM   6115 C  C   . PRO D 1 45  ? 46.825  -24.770 30.593  1.00 23.37 ? 47   PRO D C   1 
ATOM   6116 O  O   . PRO D 1 45  ? 46.731  -25.666 31.417  1.00 24.48 ? 47   PRO D O   1 
ATOM   6117 C  CB  . PRO D 1 45  ? 49.168  -24.962 29.634  1.00 27.33 ? 47   PRO D CB  1 
ATOM   6118 C  CG  . PRO D 1 45  ? 50.500  -24.634 30.235  1.00 27.21 ? 47   PRO D CG  1 
ATOM   6119 C  CD  . PRO D 1 45  ? 50.172  -24.436 31.686  1.00 27.84 ? 47   PRO D CD  1 
ATOM   6120 N  N   . LEU D 1 46  ? 45.821  -24.367 29.835  1.00 24.73 ? 48   LEU D N   1 
ATOM   6121 C  CA  . LEU D 1 46  ? 44.497  -24.999 29.882  1.00 24.62 ? 48   LEU D CA  1 
ATOM   6122 C  C   . LEU D 1 46  ? 44.590  -26.485 29.493  1.00 25.23 ? 48   LEU D C   1 
ATOM   6123 O  O   . LEU D 1 46  ? 45.384  -26.860 28.613  1.00 22.18 ? 48   LEU D O   1 
ATOM   6124 C  CB  . LEU D 1 46  ? 43.538  -24.267 28.955  1.00 25.41 ? 48   LEU D CB  1 
ATOM   6125 C  CG  . LEU D 1 46  ? 43.356  -22.753 29.134  1.00 26.85 ? 48   LEU D CG  1 
ATOM   6126 C  CD1 . LEU D 1 46  ? 42.301  -22.264 28.166  1.00 27.96 ? 48   LEU D CD1 1 
ATOM   6127 C  CD2 . LEU D 1 46  ? 42.966  -22.403 30.563  1.00 27.67 ? 48   LEU D CD2 1 
ATOM   6128 N  N   . GLU D 1 47  ? 43.818  -27.342 30.165  1.00 22.63 ? 49   GLU D N   1 
ATOM   6129 C  CA  . GLU D 1 47  ? 43.752  -28.756 29.781  1.00 22.00 ? 49   GLU D CA  1 
ATOM   6130 C  C   . GLU D 1 47  ? 42.329  -29.072 29.331  1.00 22.69 ? 49   GLU D C   1 
ATOM   6131 O  O   . GLU D 1 47  ? 41.376  -28.745 30.029  1.00 21.86 ? 49   GLU D O   1 
ATOM   6132 C  CB  . GLU D 1 47  ? 44.179  -29.623 30.929  1.00 22.53 ? 49   GLU D CB  1 
ATOM   6133 C  CG  . GLU D 1 47  ? 45.574  -29.264 31.448  1.00 23.61 ? 49   GLU D CG  1 
ATOM   6134 C  CD  . GLU D 1 47  ? 46.076  -30.161 32.554  1.00 24.78 ? 49   GLU D CD  1 
ATOM   6135 O  OE1 . GLU D 1 47  ? 45.344  -31.072 32.982  1.00 27.11 ? 49   GLU D OE1 1 
ATOM   6136 O  OE2 . GLU D 1 47  ? 47.235  -29.971 33.018  1.00 27.17 ? 49   GLU D OE2 1 
ATOM   6137 N  N   . LEU D 1 48  ? 42.185  -29.626 28.135  1.00 21.76 ? 50   LEU D N   1 
ATOM   6138 C  CA  . LEU D 1 48  ? 40.888  -29.902 27.544  1.00 22.11 ? 50   LEU D CA  1 
ATOM   6139 C  C   . LEU D 1 48  ? 40.932  -31.315 26.978  1.00 22.64 ? 50   LEU D C   1 
ATOM   6140 O  O   . LEU D 1 48  ? 41.567  -31.529 25.934  1.00 22.00 ? 50   LEU D O   1 
ATOM   6141 C  CB  . LEU D 1 48  ? 40.593  -28.889 26.440  1.00 22.74 ? 50   LEU D CB  1 
ATOM   6142 C  CG  . LEU D 1 48  ? 40.030  -27.493 26.757  1.00 23.51 ? 50   LEU D CG  1 
ATOM   6143 C  CD1 . LEU D 1 48  ? 41.061  -26.558 27.387  1.00 23.40 ? 50   LEU D CD1 1 
ATOM   6144 C  CD2 . LEU D 1 48  ? 39.508  -26.893 25.468  1.00 23.86 ? 50   LEU D CD2 1 
ATOM   6145 N  N   . LEU D 1 49  ? 40.306  -32.273 27.683  1.00 21.22 ? 51   LEU D N   1 
ATOM   6146 C  CA  . LEU D 1 49  ? 40.275  -33.692 27.266  1.00 21.16 ? 51   LEU D CA  1 
ATOM   6147 C  C   . LEU D 1 49  ? 38.866  -34.123 26.895  1.00 21.53 ? 51   LEU D C   1 
ATOM   6148 O  O   . LEU D 1 49  ? 37.884  -33.581 27.415  1.00 19.73 ? 51   LEU D O   1 
ATOM   6149 C  CB  . LEU D 1 49  ? 40.818  -34.604 28.355  1.00 20.40 ? 51   LEU D CB  1 
ATOM   6150 C  CG  . LEU D 1 49  ? 42.236  -34.260 28.857  1.00 20.03 ? 51   LEU D CG  1 
ATOM   6151 C  CD1 . LEU D 1 49  ? 42.628  -35.342 29.850  1.00 19.98 ? 51   LEU D CD1 1 
ATOM   6152 C  CD2 . LEU D 1 49  ? 43.235  -34.156 27.708  1.00 21.15 ? 51   LEU D CD2 1 
ATOM   6153 N  N   . GLY D 1 50  ? 38.765  -35.065 25.959  1.00 20.84 ? 52   GLY D N   1 
ATOM   6154 C  CA  . GLY D 1 50  ? 37.461  -35.571 25.493  1.00 21.12 ? 52   GLY D CA  1 
ATOM   6155 C  C   . GLY D 1 50  ? 36.758  -34.754 24.446  1.00 20.74 ? 52   GLY D C   1 
ATOM   6156 O  O   . GLY D 1 50  ? 35.602  -35.024 24.135  1.00 22.88 ? 52   GLY D O   1 
ATOM   6157 N  N   . PHE D 1 51  ? 37.438  -33.749 23.901  1.00 21.17 ? 53   PHE D N   1 
ATOM   6158 C  CA  . PHE D 1 51  ? 36.850  -32.780 22.968  1.00 21.52 ? 53   PHE D CA  1 
ATOM   6159 C  C   . PHE D 1 51  ? 36.817  -33.263 21.521  1.00 21.98 ? 53   PHE D C   1 
ATOM   6160 O  O   . PHE D 1 51  ? 36.117  -32.672 20.692  1.00 20.55 ? 53   PHE D O   1 
ATOM   6161 C  CB  . PHE D 1 51  ? 37.602  -31.430 23.028  1.00 21.36 ? 53   PHE D CB  1 
ATOM   6162 C  CG  . PHE D 1 51  ? 37.192  -30.541 24.187  1.00 21.94 ? 53   PHE D CG  1 
ATOM   6163 C  CD1 . PHE D 1 51  ? 37.361  -30.960 25.497  1.00 21.80 ? 53   PHE D CD1 1 
ATOM   6164 C  CD2 . PHE D 1 51  ? 36.623  -29.299 23.953  1.00 22.88 ? 53   PHE D CD2 1 
ATOM   6165 C  CE1 . PHE D 1 51  ? 36.997  -30.149 26.551  1.00 22.33 ? 53   PHE D CE1 1 
ATOM   6166 C  CE2 . PHE D 1 51  ? 36.221  -28.485 25.008  1.00 23.34 ? 53   PHE D CE2 1 
ATOM   6167 C  CZ  . PHE D 1 51  ? 36.408  -28.922 26.309  1.00 22.31 ? 53   PHE D CZ  1 
ATOM   6168 N  N   . GLN D 1 52  ? 37.578  -34.319 21.215  1.00 23.12 ? 54   GLN D N   1 
ATOM   6169 C  CA  . GLN D 1 52  ? 37.679  -34.832 19.847  1.00 25.11 ? 54   GLN D CA  1 
ATOM   6170 C  C   . GLN D 1 52  ? 36.554  -35.825 19.604  1.00 24.57 ? 54   GLN D C   1 
ATOM   6171 O  O   . GLN D 1 52  ? 36.748  -37.025 19.720  1.00 25.58 ? 54   GLN D O   1 
ATOM   6172 C  CB  . GLN D 1 52  ? 39.031  -35.550 19.613  1.00 26.27 ? 54   GLN D CB  1 
ATOM   6173 C  CG  . GLN D 1 52  ? 40.268  -34.762 20.003  1.00 28.59 ? 54   GLN D CG  1 
ATOM   6174 C  CD  . GLN D 1 52  ? 41.536  -35.613 19.922  1.00 31.07 ? 54   GLN D CD  1 
ATOM   6175 O  OE1 . GLN D 1 52  ? 41.706  -36.596 20.678  1.00 34.80 ? 54   GLN D OE1 1 
ATOM   6176 N  NE2 . GLN D 1 52  ? 42.423  -35.249 19.026  1.00 31.20 ? 54   GLN D NE2 1 
ATOM   6177 N  N   . LEU D 1 53  ? 35.368  -35.333 19.277  1.00 24.78 ? 55   LEU D N   1 
ATOM   6178 C  CA  . LEU D 1 53  ? 34.200  -36.202 19.250  1.00 25.28 ? 55   LEU D CA  1 
ATOM   6179 C  C   . LEU D 1 53  ? 34.152  -36.997 17.962  1.00 25.58 ? 55   LEU D C   1 
ATOM   6180 O  O   . LEU D 1 53  ? 34.518  -36.483 16.932  1.00 26.01 ? 55   LEU D O   1 
ATOM   6181 C  CB  . LEU D 1 53  ? 32.911  -35.397 19.379  1.00 26.20 ? 55   LEU D CB  1 
ATOM   6182 C  CG  . LEU D 1 53  ? 32.756  -34.631 20.692  1.00 26.65 ? 55   LEU D CG  1 
ATOM   6183 C  CD1 . LEU D 1 53  ? 31.516  -33.752 20.611  1.00 27.42 ? 55   LEU D CD1 1 
ATOM   6184 C  CD2 . LEU D 1 53  ? 32.678  -35.601 21.864  1.00 27.73 ? 55   LEU D CD2 1 
ATOM   6185 N  N   . PRO D 1 54  ? 33.678  -38.249 18.030  1.00 26.56 ? 56   PRO D N   1 
ATOM   6186 C  CA  . PRO D 1 54  ? 33.556  -39.051 16.826  1.00 28.34 ? 56   PRO D CA  1 
ATOM   6187 C  C   . PRO D 1 54  ? 32.302  -38.650 16.037  1.00 30.07 ? 56   PRO D C   1 
ATOM   6188 O  O   . PRO D 1 54  ? 31.456  -37.913 16.563  1.00 29.96 ? 56   PRO D O   1 
ATOM   6189 C  CB  . PRO D 1 54  ? 33.447  -40.481 17.370  1.00 28.45 ? 56   PRO D CB  1 
ATOM   6190 C  CG  . PRO D 1 54  ? 32.762  -40.315 18.684  1.00 28.43 ? 56   PRO D CG  1 
ATOM   6191 C  CD  . PRO D 1 54  ? 33.245  -38.990 19.234  1.00 26.79 ? 56   PRO D CD  1 
ATOM   6192 N  N   . PRO D 1 55  ? 32.171  -39.125 14.792  1.00 30.96 ? 57   PRO D N   1 
ATOM   6193 C  CA  . PRO D 1 55  ? 31.045  -38.701 13.956  1.00 30.73 ? 57   PRO D CA  1 
ATOM   6194 C  C   . PRO D 1 55  ? 29.638  -38.942 14.547  1.00 30.75 ? 57   PRO D C   1 
ATOM   6195 O  O   . PRO D 1 55  ? 28.743  -38.127 14.319  1.00 30.42 ? 57   PRO D O   1 
ATOM   6196 C  CB  . PRO D 1 55  ? 31.247  -39.510 12.677  1.00 33.51 ? 57   PRO D CB  1 
ATOM   6197 C  CG  . PRO D 1 55  ? 32.735  -39.668 12.585  1.00 33.30 ? 57   PRO D CG  1 
ATOM   6198 C  CD  . PRO D 1 55  ? 33.177  -39.878 14.013  1.00 33.02 ? 57   PRO D CD  1 
ATOM   6199 N  N   . LEU D 1 56  ? 29.466  -40.032 15.290  1.00 30.38 ? 58   LEU D N   1 
ATOM   6200 C  CA  . LEU D 1 56  ? 28.212  -40.344 15.986  1.00 32.64 ? 58   LEU D CA  1 
ATOM   6201 C  C   . LEU D 1 56  ? 28.488  -40.523 17.480  1.00 32.62 ? 58   LEU D C   1 
ATOM   6202 O  O   . LEU D 1 56  ? 29.541  -41.033 17.828  1.00 33.57 ? 58   LEU D O   1 
ATOM   6203 C  CB  . LEU D 1 56  ? 27.566  -41.615 15.409  1.00 34.25 ? 58   LEU D CB  1 
ATOM   6204 C  CG  . LEU D 1 56  ? 27.185  -41.534 13.919  1.00 36.15 ? 58   LEU D CG  1 
ATOM   6205 C  CD1 . LEU D 1 56  ? 26.951  -42.924 13.347  1.00 36.44 ? 58   LEU D CD1 1 
ATOM   6206 C  CD2 . LEU D 1 56  ? 25.973  -40.628 13.687  1.00 35.12 ? 58   LEU D CD2 1 
ATOM   6207 N  N   . PRO D 1 57  ? 27.567  -40.147 18.376  1.00 33.33 ? 59   PRO D N   1 
ATOM   6208 C  CA  . PRO D 1 57  ? 26.257  -39.614 18.033  1.00 33.08 ? 59   PRO D CA  1 
ATOM   6209 C  C   . PRO D 1 57  ? 26.311  -38.185 17.506  1.00 33.32 ? 59   PRO D C   1 
ATOM   6210 O  O   . PRO D 1 57  ? 27.341  -37.503 17.598  1.00 31.45 ? 59   PRO D O   1 
ATOM   6211 C  CB  . PRO D 1 57  ? 25.493  -39.702 19.353  1.00 33.58 ? 59   PRO D CB  1 
ATOM   6212 C  CG  . PRO D 1 57  ? 26.540  -39.591 20.397  1.00 33.00 ? 59   PRO D CG  1 
ATOM   6213 C  CD  . PRO D 1 57  ? 27.739  -40.288 19.832  1.00 33.29 ? 59   PRO D CD  1 
ATOM   6214 N  N   . GLU D 1 58  ? 25.204  -37.763 16.916  1.00 32.78 ? 60   GLU D N   1 
ATOM   6215 C  CA  . GLU D 1 58  ? 25.068  -36.413 16.388  1.00 34.19 ? 60   GLU D CA  1 
ATOM   6216 C  C   . GLU D 1 58  ? 24.846  -35.434 17.542  1.00 31.66 ? 60   GLU D C   1 
ATOM   6217 O  O   . GLU D 1 58  ? 24.535  -35.846 18.656  1.00 30.25 ? 60   GLU D O   1 
ATOM   6218 C  CB  . GLU D 1 58  ? 23.896  -36.340 15.410  1.00 37.92 ? 60   GLU D CB  1 
ATOM   6219 C  CG  . GLU D 1 58  ? 24.132  -37.051 14.090  1.00 41.05 ? 60   GLU D CG  1 
ATOM   6220 C  CD  . GLU D 1 58  ? 22.992  -36.832 13.112  1.00 44.28 ? 60   GLU D CD  1 
ATOM   6221 O  OE1 . GLU D 1 58  ? 21.866  -37.284 13.406  1.00 45.03 ? 60   GLU D OE1 1 
ATOM   6222 O  OE2 . GLU D 1 58  ? 23.217  -36.192 12.064  1.00 47.98 ? 60   GLU D OE2 1 
ATOM   6223 N  N   . LEU D 1 59  ? 25.018  -34.146 17.263  1.00 30.03 ? 61   LEU D N   1 
ATOM   6224 C  CA  . LEU D 1 59  ? 24.828  -33.088 18.253  1.00 30.89 ? 61   LEU D CA  1 
ATOM   6225 C  C   . LEU D 1 59  ? 23.709  -32.131 17.816  1.00 30.30 ? 61   LEU D C   1 
ATOM   6226 O  O   . LEU D 1 59  ? 23.595  -31.776 16.643  1.00 29.10 ? 61   LEU D O   1 
ATOM   6227 C  CB  . LEU D 1 59  ? 26.116  -32.281 18.442  1.00 31.06 ? 61   LEU D CB  1 
ATOM   6228 C  CG  . LEU D 1 59  ? 27.299  -32.924 19.164  1.00 32.75 ? 61   LEU D CG  1 
ATOM   6229 C  CD1 . LEU D 1 59  ? 27.864  -34.117 18.418  1.00 34.42 ? 61   LEU D CD1 1 
ATOM   6230 C  CD2 . LEU D 1 59  ? 28.377  -31.856 19.346  1.00 33.76 ? 61   LEU D CD2 1 
ATOM   6231 N  N   . ARG D 1 60  ? 22.915  -31.700 18.784  1.00 31.35 ? 62   ARG D N   1 
ATOM   6232 C  CA  . ARG D 1 60  ? 21.870  -30.712 18.570  1.00 32.48 ? 62   ARG D CA  1 
ATOM   6233 C  C   . ARG D 1 60  ? 22.460  -29.339 18.297  1.00 31.11 ? 62   ARG D C   1 
ATOM   6234 O  O   . ARG D 1 60  ? 23.274  -28.826 19.085  1.00 29.44 ? 62   ARG D O   1 
ATOM   6235 C  CB  . ARG D 1 60  ? 20.984  -30.636 19.810  1.00 35.79 ? 62   ARG D CB  1 
ATOM   6236 C  CG  . ARG D 1 60  ? 19.675  -29.886 19.628  1.00 39.54 ? 62   ARG D CG  1 
ATOM   6237 C  CD  . ARG D 1 60  ? 19.028  -29.659 20.984  1.00 41.43 ? 62   ARG D CD  1 
ATOM   6238 N  NE  . ARG D 1 60  ? 17.646  -29.208 20.876  1.00 47.95 ? 62   ARG D NE  1 
ATOM   6239 C  CZ  . ARG D 1 60  ? 16.902  -28.785 21.905  1.00 50.25 ? 62   ARG D CZ  1 
ATOM   6240 N  NH1 . ARG D 1 60  ? 17.403  -28.717 23.143  1.00 50.41 ? 62   ARG D NH1 1 
ATOM   6241 N  NH2 . ARG D 1 60  ? 15.648  -28.398 21.691  1.00 49.01 ? 62   ARG D NH2 1 
ATOM   6242 N  N   . LEU D 1 61  ? 22.049  -28.739 17.184  1.00 32.59 ? 63   LEU D N   1 
ATOM   6243 C  CA  . LEU D 1 61  ? 22.400  -27.352 16.873  1.00 31.31 ? 63   LEU D CA  1 
ATOM   6244 C  C   . LEU D 1 61  ? 21.100  -26.574 16.722  1.00 34.91 ? 63   LEU D C   1 
ATOM   6245 O  O   . LEU D 1 61  ? 20.219  -26.963 15.922  1.00 34.18 ? 63   LEU D O   1 
ATOM   6246 C  CB  . LEU D 1 61  ? 23.235  -27.277 15.596  1.00 31.97 ? 63   LEU D CB  1 
ATOM   6247 C  CG  . LEU D 1 61  ? 23.837  -25.933 15.182  1.00 30.81 ? 63   LEU D CG  1 
ATOM   6248 C  CD1 . LEU D 1 61  ? 25.067  -25.614 16.006  1.00 31.35 ? 63   LEU D CD1 1 
ATOM   6249 C  CD2 . LEU D 1 61  ? 24.210  -25.952 13.708  1.00 31.87 ? 63   LEU D CD2 1 
ATOM   6250 N  N   . ARG D 1 62  ? 20.998  -25.474 17.476  1.00 36.14 ? 64   ARG D N   1 
ATOM   6251 C  CA  . ARG D 1 62  ? 19.743  -24.761 17.668  1.00 39.24 ? 64   ARG D CA  1 
ATOM   6252 C  C   . ARG D 1 62  ? 19.902  -23.257 17.420  1.00 35.68 ? 64   ARG D C   1 
ATOM   6253 O  O   . ARG D 1 62  ? 20.837  -22.642 17.921  1.00 33.77 ? 64   ARG D O   1 
ATOM   6254 C  CB  . ARG D 1 62  ? 19.222  -25.015 19.093  1.00 43.48 ? 64   ARG D CB  1 
ATOM   6255 C  CG  . ARG D 1 62  ? 17.915  -24.288 19.406  1.00 49.98 ? 64   ARG D CG  1 
ATOM   6256 C  CD  . ARG D 1 62  ? 17.096  -24.955 20.504  1.00 55.64 ? 64   ARG D CD  1 
ATOM   6257 N  NE  . ARG D 1 62  ? 15.693  -24.518 20.438  1.00 62.78 ? 64   ARG D NE  1 
ATOM   6258 C  CZ  . ARG D 1 62  ? 15.175  -23.427 21.017  1.00 68.07 ? 64   ARG D CZ  1 
ATOM   6259 N  NH1 . ARG D 1 62  ? 15.920  -22.602 21.760  1.00 70.81 ? 64   ARG D NH1 1 
ATOM   6260 N  NH2 . ARG D 1 62  ? 13.880  -23.154 20.853  1.00 68.43 ? 64   ARG D NH2 1 
ATOM   6261 N  N   . ASN D 1 63  ? 18.996  -22.683 16.626  1.00 35.30 ? 65   ASN D N   1 
ATOM   6262 C  CA  . ASN D 1 63  ? 18.805  -21.232 16.582  1.00 35.84 ? 65   ASN D CA  1 
ATOM   6263 C  C   . ASN D 1 63  ? 17.822  -20.926 17.693  1.00 36.16 ? 65   ASN D C   1 
ATOM   6264 O  O   . ASN D 1 63  ? 16.665  -21.313 17.607  1.00 37.25 ? 65   ASN D O   1 
ATOM   6265 C  CB  . ASN D 1 63  ? 18.232  -20.768 15.233  1.00 37.48 ? 65   ASN D CB  1 
ATOM   6266 C  CG  . ASN D 1 63  ? 18.023  -19.246 15.147  1.00 38.76 ? 65   ASN D CG  1 
ATOM   6267 O  OD1 . ASN D 1 63  ? 18.018  -18.523 16.154  1.00 37.04 ? 65   ASN D OD1 1 
ATOM   6268 N  ND2 . ASN D 1 63  ? 17.846  -18.756 13.927  1.00 39.78 ? 65   ASN D ND2 1 
ATOM   6269 N  N   . ASN D 1 64  ? 18.286  -20.244 18.733  1.00 36.06 ? 66   ASN D N   1 
ATOM   6270 C  CA  . ASN D 1 64  ? 17.433  -19.936 19.881  1.00 39.46 ? 66   ASN D CA  1 
ATOM   6271 C  C   . ASN D 1 64  ? 16.918  -18.495 19.894  1.00 41.96 ? 66   ASN D C   1 
ATOM   6272 O  O   . ASN D 1 64  ? 16.328  -18.059 20.880  1.00 41.62 ? 66   ASN D O   1 
ATOM   6273 C  CB  . ASN D 1 64  ? 18.143  -20.293 21.197  1.00 37.75 ? 66   ASN D CB  1 
ATOM   6274 C  CG  . ASN D 1 64  ? 19.405  -19.496 21.438  1.00 37.13 ? 66   ASN D CG  1 
ATOM   6275 O  OD1 . ASN D 1 64  ? 19.572  -18.363 20.966  1.00 36.46 ? 66   ASN D OD1 1 
ATOM   6276 N  ND2 . ASN D 1 64  ? 20.313  -20.091 22.193  1.00 38.99 ? 66   ASN D ND2 1 
ATOM   6277 N  N   . GLY D 1 65  ? 17.176  -17.758 18.810  1.00 43.60 ? 67   GLY D N   1 
ATOM   6278 C  CA  . GLY D 1 65  ? 16.779  -16.365 18.687  1.00 42.26 ? 67   GLY D CA  1 
ATOM   6279 C  C   . GLY D 1 65  ? 17.815  -15.369 19.143  1.00 41.79 ? 67   GLY D C   1 
ATOM   6280 O  O   . GLY D 1 65  ? 17.781  -14.235 18.697  1.00 42.26 ? 67   GLY D O   1 
ATOM   6281 N  N   . HIS D 1 66  ? 18.706  -15.776 20.050  1.00 41.86 ? 68   HIS D N   1 
ATOM   6282 C  CA  . HIS D 1 66  ? 19.802  -14.939 20.556  1.00 40.71 ? 68   HIS D CA  1 
ATOM   6283 C  C   . HIS D 1 66  ? 21.187  -15.371 20.050  1.00 37.98 ? 68   HIS D C   1 
ATOM   6284 O  O   . HIS D 1 66  ? 22.156  -14.611 20.158  1.00 35.22 ? 68   HIS D O   1 
ATOM   6285 C  CB  . HIS D 1 66  ? 19.819  -15.016 22.083  1.00 45.61 ? 68   HIS D CB  1 
ATOM   6286 C  CG  . HIS D 1 66  ? 18.477  -14.825 22.715  1.00 53.74 ? 68   HIS D CG  1 
ATOM   6287 N  ND1 . HIS D 1 66  ? 17.660  -13.749 22.428  1.00 58.18 ? 68   HIS D ND1 1 
ATOM   6288 C  CD2 . HIS D 1 66  ? 17.810  -15.570 23.628  1.00 57.29 ? 68   HIS D CD2 1 
ATOM   6289 C  CE1 . HIS D 1 66  ? 16.546  -13.844 23.133  1.00 58.37 ? 68   HIS D CE1 1 
ATOM   6290 N  NE2 . HIS D 1 66  ? 16.614  -14.938 23.872  1.00 58.23 ? 68   HIS D NE2 1 
ATOM   6291 N  N   . SER D 1 67  ? 21.292  -16.608 19.564  1.00 37.01 ? 69   SER D N   1 
ATOM   6292 C  CA  . SER D 1 67  ? 22.570  -17.188 19.123  1.00 33.62 ? 69   SER D CA  1 
ATOM   6293 C  C   . SER D 1 67  ? 22.310  -18.512 18.417  1.00 31.27 ? 69   SER D C   1 
ATOM   6294 O  O   . SER D 1 67  ? 21.165  -18.968 18.312  1.00 31.56 ? 69   SER D O   1 
ATOM   6295 C  CB  . SER D 1 67  ? 23.510  -17.424 20.317  1.00 34.03 ? 69   SER D CB  1 
ATOM   6296 O  OG  . SER D 1 67  ? 24.797  -17.809 19.889  1.00 32.52 ? 69   SER D OG  1 
ATOM   6297 N  N   . VAL D 1 68  ? 23.379  -19.103 17.896  1.00 31.07 ? 70   VAL D N   1 
ATOM   6298 C  CA  . VAL D 1 68  ? 23.335  -20.501 17.465  1.00 29.86 ? 70   VAL D CA  1 
ATOM   6299 C  C   . VAL D 1 68  ? 24.091  -21.259 18.543  1.00 27.30 ? 70   VAL D C   1 
ATOM   6300 O  O   . VAL D 1 68  ? 25.196  -20.862 18.928  1.00 27.09 ? 70   VAL D O   1 
ATOM   6301 C  CB  . VAL D 1 68  ? 23.893  -20.753 16.045  1.00 28.98 ? 70   VAL D CB  1 
ATOM   6302 C  CG1 . VAL D 1 68  ? 25.276  -20.166 15.837  1.00 29.51 ? 70   VAL D CG1 1 
ATOM   6303 C  CG2 . VAL D 1 68  ? 23.886  -22.238 15.742  1.00 28.68 ? 70   VAL D CG2 1 
ATOM   6304 N  N   . GLN D 1 69  ? 23.467  -22.308 19.058  1.00 28.07 ? 71   GLN D N   1 
ATOM   6305 C  CA  . GLN D 1 69  ? 24.016  -23.046 20.176  1.00 28.19 ? 71   GLN D CA  1 
ATOM   6306 C  C   . GLN D 1 69  ? 24.108  -24.518 19.847  1.00 26.98 ? 71   GLN D C   1 
ATOM   6307 O  O   . GLN D 1 69  ? 23.147  -25.127 19.376  1.00 28.91 ? 71   GLN D O   1 
ATOM   6308 C  CB  . GLN D 1 69  ? 23.184  -22.836 21.444  1.00 28.60 ? 71   GLN D CB  1 
ATOM   6309 C  CG  . GLN D 1 69  ? 23.805  -23.483 22.678  1.00 29.73 ? 71   GLN D CG  1 
ATOM   6310 C  CD  . GLN D 1 69  ? 23.203  -23.013 23.993  1.00 30.87 ? 71   GLN D CD  1 
ATOM   6311 O  OE1 . GLN D 1 69  ? 22.905  -23.821 24.887  1.00 31.84 ? 71   GLN D OE1 1 
ATOM   6312 N  NE2 . GLN D 1 69  ? 23.070  -21.714 24.143  1.00 29.07 ? 71   GLN D NE2 1 
ATOM   6313 N  N   . LEU D 1 70  ? 25.290  -25.072 20.129  1.00 26.57 ? 72   LEU D N   1 
ATOM   6314 C  CA  . LEU D 1 70  ? 25.589  -26.473 19.967  1.00 26.58 ? 72   LEU D CA  1 
ATOM   6315 C  C   . LEU D 1 70  ? 25.599  -27.119 21.336  1.00 26.05 ? 72   LEU D C   1 
ATOM   6316 O  O   . LEU D 1 70  ? 26.366  -26.705 22.216  1.00 26.42 ? 72   LEU D O   1 
ATOM   6317 C  CB  . LEU D 1 70  ? 26.975  -26.616 19.328  1.00 25.89 ? 72   LEU D CB  1 
ATOM   6318 C  CG  . LEU D 1 70  ? 27.462  -28.031 19.010  1.00 27.11 ? 72   LEU D CG  1 
ATOM   6319 C  CD1 . LEU D 1 70  ? 26.627  -28.659 17.902  1.00 27.89 ? 72   LEU D CD1 1 
ATOM   6320 C  CD2 . LEU D 1 70  ? 28.923  -28.006 18.615  1.00 25.99 ? 72   LEU D CD2 1 
ATOM   6321 N  N   . THR D 1 71  ? 24.781  -28.146 21.519  1.00 25.45 ? 73   THR D N   1 
ATOM   6322 C  CA  . THR D 1 71  ? 24.770  -28.874 22.774  1.00 25.74 ? 73   THR D CA  1 
ATOM   6323 C  C   . THR D 1 71  ? 25.928  -29.870 22.779  1.00 26.55 ? 73   THR D C   1 
ATOM   6324 O  O   . THR D 1 71  ? 26.086  -30.643 21.832  1.00 26.95 ? 73   THR D O   1 
ATOM   6325 C  CB  . THR D 1 71  ? 23.444  -29.615 22.974  1.00 26.43 ? 73   THR D CB  1 
ATOM   6326 O  OG1 . THR D 1 71  ? 22.383  -28.656 23.032  1.00 28.28 ? 73   THR D OG1 1 
ATOM   6327 C  CG2 . THR D 1 71  ? 23.477  -30.438 24.258  1.00 25.89 ? 73   THR D CG2 1 
ATOM   6328 N  N   . LEU D 1 72  ? 26.737  -29.844 23.838  1.00 24.93 ? 74   LEU D N   1 
ATOM   6329 C  CA  . LEU D 1 72  ? 27.863  -30.761 23.958  1.00 25.33 ? 74   LEU D CA  1 
ATOM   6330 C  C   . LEU D 1 72  ? 27.514  -31.972 24.814  1.00 26.37 ? 74   LEU D C   1 
ATOM   6331 O  O   . LEU D 1 72  ? 26.744  -31.860 25.783  1.00 27.99 ? 74   LEU D O   1 
ATOM   6332 C  CB  . LEU D 1 72  ? 29.084  -30.034 24.510  1.00 24.59 ? 74   LEU D CB  1 
ATOM   6333 C  CG  . LEU D 1 72  ? 29.548  -28.869 23.645  1.00 24.28 ? 74   LEU D CG  1 
ATOM   6334 C  CD1 . LEU D 1 72  ? 30.657  -28.113 24.349  1.00 24.82 ? 74   LEU D CD1 1 
ATOM   6335 C  CD2 . LEU D 1 72  ? 29.987  -29.335 22.265  1.00 25.43 ? 74   LEU D CD2 1 
ATOM   6336 N  N   . PRO D 1 73  ? 28.082  -33.143 24.475  1.00 25.22 ? 75   PRO D N   1 
ATOM   6337 C  CA  . PRO D 1 73  ? 27.792  -34.359 25.218  1.00 25.04 ? 75   PRO D CA  1 
ATOM   6338 C  C   . PRO D 1 73  ? 28.550  -34.415 26.524  1.00 24.91 ? 75   PRO D C   1 
ATOM   6339 O  O   . PRO D 1 73  ? 29.439  -33.576 26.743  1.00 23.63 ? 75   PRO D O   1 
ATOM   6340 C  CB  . PRO D 1 73  ? 28.292  -35.461 24.276  1.00 25.65 ? 75   PRO D CB  1 
ATOM   6341 C  CG  . PRO D 1 73  ? 29.439  -34.835 23.598  1.00 26.16 ? 75   PRO D CG  1 
ATOM   6342 C  CD  . PRO D 1 73  ? 29.048  -33.398 23.384  1.00 25.96 ? 75   PRO D CD  1 
ATOM   6343 N  N   . PRO D 1 74  ? 28.226  -35.396 27.391  1.00 25.31 ? 76   PRO D N   1 
ATOM   6344 C  CA  . PRO D 1 74  ? 29.074  -35.633 28.562  1.00 25.97 ? 76   PRO D CA  1 
ATOM   6345 C  C   . PRO D 1 74  ? 30.506  -36.051 28.160  1.00 25.25 ? 76   PRO D C   1 
ATOM   6346 O  O   . PRO D 1 74  ? 30.703  -36.583 27.079  1.00 25.07 ? 76   PRO D O   1 
ATOM   6347 C  CB  . PRO D 1 74  ? 28.375  -36.800 29.293  1.00 28.19 ? 76   PRO D CB  1 
ATOM   6348 C  CG  . PRO D 1 74  ? 27.018  -36.917 28.669  1.00 27.95 ? 76   PRO D CG  1 
ATOM   6349 C  CD  . PRO D 1 74  ? 27.177  -36.430 27.269  1.00 27.51 ? 76   PRO D CD  1 
ATOM   6350 N  N   . GLY D 1 75  ? 31.472  -35.773 29.026  1.00 24.15 ? 77   GLY D N   1 
ATOM   6351 C  CA  . GLY D 1 75  ? 32.866  -36.239 28.862  1.00 24.77 ? 77   GLY D CA  1 
ATOM   6352 C  C   . GLY D 1 75  ? 33.876  -35.224 28.326  1.00 23.90 ? 77   GLY D C   1 
ATOM   6353 O  O   . GLY D 1 75  ? 35.048  -35.574 28.130  1.00 23.21 ? 77   GLY D O   1 
ATOM   6354 N  N   . LEU D 1 76  ? 33.441  -33.985 28.090  1.00 22.97 ? 78   LEU D N   1 
ATOM   6355 C  CA  . LEU D 1 76  ? 34.352  -32.910 27.715  1.00 23.45 ? 78   LEU D CA  1 
ATOM   6356 C  C   . LEU D 1 76  ? 34.889  -32.278 28.985  1.00 23.94 ? 78   LEU D C   1 
ATOM   6357 O  O   . LEU D 1 76  ? 34.243  -31.401 29.591  1.00 22.46 ? 78   LEU D O   1 
ATOM   6358 C  CB  . LEU D 1 76  ? 33.683  -31.882 26.791  1.00 23.98 ? 78   LEU D CB  1 
ATOM   6359 C  CG  . LEU D 1 76  ? 33.607  -32.304 25.318  1.00 24.24 ? 78   LEU D CG  1 
ATOM   6360 C  CD1 . LEU D 1 76  ? 32.560  -33.393 25.073  1.00 24.92 ? 78   LEU D CD1 1 
ATOM   6361 C  CD2 . LEU D 1 76  ? 33.374  -31.117 24.403  1.00 25.49 ? 78   LEU D CD2 1 
ATOM   6362 N  N   . GLU D 1 77  ? 36.085  -32.708 29.382  1.00 22.09 ? 79   GLU D N   1 
ATOM   6363 C  CA  . GLU D 1 77  ? 36.659  -32.324 30.674  1.00 22.82 ? 79   GLU D CA  1 
ATOM   6364 C  C   . GLU D 1 77  ? 37.704  -31.218 30.510  1.00 23.13 ? 79   GLU D C   1 
ATOM   6365 O  O   . GLU D 1 77  ? 38.508  -31.244 29.558  1.00 20.26 ? 79   GLU D O   1 
ATOM   6366 C  CB  . GLU D 1 77  ? 37.234  -33.553 31.388  1.00 23.82 ? 79   GLU D CB  1 
ATOM   6367 C  CG  . GLU D 1 77  ? 36.174  -34.643 31.604  1.00 25.42 ? 79   GLU D CG  1 
ATOM   6368 C  CD  . GLU D 1 77  ? 36.661  -35.885 32.337  1.00 28.94 ? 79   GLU D CD  1 
ATOM   6369 O  OE1 . GLU D 1 77  ? 37.781  -35.865 32.874  1.00 34.23 ? 79   GLU D OE1 1 
ATOM   6370 O  OE2 . GLU D 1 77  ? 35.922  -36.908 32.372  1.00 32.44 ? 79   GLU D OE2 1 
ATOM   6371 N  N   . MET D 1 78  ? 37.676  -30.238 31.421  1.00 21.70 ? 80   MET D N   1 
ATOM   6372 C  CA  . MET D 1 78  ? 38.500  -29.046 31.274  1.00 22.19 ? 80   MET D CA  1 
ATOM   6373 C  C   . MET D 1 78  ? 39.015  -28.618 32.632  1.00 23.27 ? 80   MET D C   1 
ATOM   6374 O  O   . MET D 1 78  ? 38.276  -28.679 33.624  1.00 21.72 ? 80   MET D O   1 
ATOM   6375 C  CB  . MET D 1 78  ? 37.719  -27.946 30.575  1.00 23.00 ? 80   MET D CB  1 
ATOM   6376 C  CG  . MET D 1 78  ? 38.481  -26.645 30.331  1.00 24.47 ? 80   MET D CG  1 
ATOM   6377 S  SD  . MET D 1 78  ? 38.715  -25.517 31.744  1.00 26.42 ? 80   MET D SD  1 
ATOM   6378 C  CE  . MET D 1 78  ? 37.141  -24.659 31.653  1.00 26.41 ? 80   MET D CE  1 
ATOM   6379 N  N   . ALA D 1 79  ? 40.295  -28.239 32.695  1.00 20.94 ? 81   ALA D N   1 
ATOM   6380 C  CA  . ALA D 1 79  ? 40.896  -27.812 33.939  1.00 21.47 ? 81   ALA D CA  1 
ATOM   6381 C  C   . ALA D 1 79  ? 41.496  -26.430 33.816  1.00 23.47 ? 81   ALA D C   1 
ATOM   6382 O  O   . ALA D 1 79  ? 42.244  -26.147 32.864  1.00 21.94 ? 81   ALA D O   1 
ATOM   6383 C  CB  . ALA D 1 79  ? 41.952  -28.799 34.404  1.00 21.67 ? 81   ALA D CB  1 
ATOM   6384 N  N   . LEU D 1 80  ? 41.150  -25.561 34.773  1.00 22.58 ? 82   LEU D N   1 
ATOM   6385 C  CA  . LEU D 1 80  ? 41.761  -24.224 34.884  1.00 23.58 ? 82   LEU D CA  1 
ATOM   6386 C  C   . LEU D 1 80  ? 43.052  -24.234 35.702  1.00 24.06 ? 82   LEU D C   1 
ATOM   6387 O  O   . LEU D 1 80  ? 43.826  -23.270 35.647  1.00 25.95 ? 82   LEU D O   1 
ATOM   6388 C  CB  . LEU D 1 80  ? 40.765  -23.224 35.495  1.00 23.36 ? 82   LEU D CB  1 
ATOM   6389 C  CG  . LEU D 1 80  ? 39.514  -22.959 34.680  1.00 23.30 ? 82   LEU D CG  1 
ATOM   6390 C  CD1 . LEU D 1 80  ? 38.571  -22.028 35.439  1.00 23.71 ? 82   LEU D CD1 1 
ATOM   6391 C  CD2 . LEU D 1 80  ? 39.872  -22.403 33.304  1.00 23.11 ? 82   LEU D CD2 1 
ATOM   6392 N  N   . GLY D 1 81  ? 43.268  -25.304 36.456  1.00 23.89 ? 83   GLY D N   1 
ATOM   6393 C  CA  . GLY D 1 81  ? 44.382  -25.443 37.378  1.00 23.79 ? 83   GLY D CA  1 
ATOM   6394 C  C   . GLY D 1 81  ? 44.287  -26.803 38.040  1.00 24.11 ? 83   GLY D C   1 
ATOM   6395 O  O   . GLY D 1 81  ? 43.319  -27.540 37.795  1.00 25.43 ? 83   GLY D O   1 
ATOM   6396 N  N   . PRO D 1 82  ? 45.261  -27.158 38.881  1.00 25.34 ? 84   PRO D N   1 
ATOM   6397 C  CA  . PRO D 1 82  ? 45.309  -28.492 39.492  1.00 24.99 ? 84   PRO D CA  1 
ATOM   6398 C  C   . PRO D 1 82  ? 44.061  -28.780 40.351  1.00 26.51 ? 84   PRO D C   1 
ATOM   6399 O  O   . PRO D 1 82  ? 43.805  -28.078 41.314  1.00 26.21 ? 84   PRO D O   1 
ATOM   6400 C  CB  . PRO D 1 82  ? 46.563  -28.446 40.363  1.00 26.52 ? 84   PRO D CB  1 
ATOM   6401 C  CG  . PRO D 1 82  ? 47.345  -27.292 39.873  1.00 25.23 ? 84   PRO D CG  1 
ATOM   6402 C  CD  . PRO D 1 82  ? 46.410  -26.320 39.279  1.00 26.24 ? 84   PRO D CD  1 
ATOM   6403 N  N   . GLY D 1 83  ? 43.270  -29.767 39.944  1.00 27.77 ? 85   GLY D N   1 
ATOM   6404 C  CA  . GLY D 1 83  ? 42.015  -30.096 40.630  1.00 28.39 ? 85   GLY D CA  1 
ATOM   6405 C  C   . GLY D 1 83  ? 40.841  -29.143 40.419  1.00 27.47 ? 85   GLY D C   1 
ATOM   6406 O  O   . GLY D 1 83  ? 39.787  -29.321 41.042  1.00 29.72 ? 85   GLY D O   1 
ATOM   6407 N  N   . ARG D 1 84  ? 40.991  -28.144 39.552  1.00 23.32 ? 86   ARG D N   1 
ATOM   6408 C  CA  . ARG D 1 84  ? 39.972  -27.143 39.358  1.00 23.15 ? 86   ARG D CA  1 
ATOM   6409 C  C   . ARG D 1 84  ? 39.346  -27.444 38.028  1.00 22.23 ? 86   ARG D C   1 
ATOM   6410 O  O   . ARG D 1 84  ? 39.689  -26.831 37.016  1.00 21.58 ? 86   ARG D O   1 
ATOM   6411 C  CB  . ARG D 1 84  ? 40.588  -25.745 39.408  1.00 23.58 ? 86   ARG D CB  1 
ATOM   6412 C  CG  . ARG D 1 84  ? 41.106  -25.410 40.795  1.00 24.42 ? 86   ARG D CG  1 
ATOM   6413 C  CD  . ARG D 1 84  ? 41.811  -24.075 40.845  1.00 24.98 ? 86   ARG D CD  1 
ATOM   6414 N  NE  . ARG D 1 84  ? 40.919  -23.047 40.315  1.00 26.66 ? 86   ARG D NE  1 
ATOM   6415 C  CZ  . ARG D 1 84  ? 41.225  -22.116 39.412  1.00 29.04 ? 86   ARG D CZ  1 
ATOM   6416 N  NH1 . ARG D 1 84  ? 42.457  -21.979 38.928  1.00 29.80 ? 86   ARG D NH1 1 
ATOM   6417 N  NH2 . ARG D 1 84  ? 40.275  -21.279 39.005  1.00 28.50 ? 86   ARG D NH2 1 
ATOM   6418 N  N   . GLU D 1 85  ? 38.415  -28.400 38.054  1.00 21.04 ? 87   GLU D N   1 
ATOM   6419 C  CA  . GLU D 1 85  ? 37.905  -29.045 36.868  1.00 21.86 ? 87   GLU D CA  1 
ATOM   6420 C  C   . GLU D 1 85  ? 36.464  -28.736 36.557  1.00 23.47 ? 87   GLU D C   1 
ATOM   6421 O  O   . GLU D 1 85  ? 35.674  -28.390 37.465  1.00 22.64 ? 87   GLU D O   1 
ATOM   6422 C  CB  . GLU D 1 85  ? 38.075  -30.554 36.996  1.00 22.32 ? 87   GLU D CB  1 
ATOM   6423 C  CG  . GLU D 1 85  ? 39.532  -30.948 37.039  1.00 23.75 ? 87   GLU D CG  1 
ATOM   6424 C  CD  . GLU D 1 85  ? 39.756  -32.434 37.167  1.00 23.72 ? 87   GLU D CD  1 
ATOM   6425 O  OE1 . GLU D 1 85  ? 38.842  -33.226 36.810  1.00 23.83 ? 87   GLU D OE1 1 
ATOM   6426 O  OE2 . GLU D 1 85  ? 40.860  -32.819 37.608  1.00 23.62 ? 87   GLU D OE2 1 
ATOM   6427 N  N   . TYR D 1 86  ? 36.155  -28.884 35.265  1.00 21.59 ? 88   TYR D N   1 
ATOM   6428 C  CA  . TYR D 1 86  ? 34.915  -28.439 34.638  1.00 21.62 ? 88   TYR D CA  1 
ATOM   6429 C  C   . TYR D 1 86  ? 34.484  -29.461 33.593  1.00 22.32 ? 88   TYR D C   1 
ATOM   6430 O  O   . TYR D 1 86  ? 35.311  -30.266 33.146  1.00 22.81 ? 88   TYR D O   1 
ATOM   6431 C  CB  . TYR D 1 86  ? 35.090  -27.058 33.988  1.00 21.87 ? 88   TYR D CB  1 
ATOM   6432 C  CG  . TYR D 1 86  ? 35.272  -25.957 35.016  1.00 22.60 ? 88   TYR D CG  1 
ATOM   6433 C  CD1 . TYR D 1 86  ? 36.502  -25.764 35.644  1.00 22.90 ? 88   TYR D CD1 1 
ATOM   6434 C  CD2 . TYR D 1 86  ? 34.207  -25.140 35.389  1.00 22.78 ? 88   TYR D CD2 1 
ATOM   6435 C  CE1 . TYR D 1 86  ? 36.660  -24.800 36.615  1.00 22.56 ? 88   TYR D CE1 1 
ATOM   6436 C  CE2 . TYR D 1 86  ? 34.352  -24.163 36.362  1.00 22.23 ? 88   TYR D CE2 1 
ATOM   6437 C  CZ  . TYR D 1 86  ? 35.560  -24.000 36.980  1.00 22.98 ? 88   TYR D CZ  1 
ATOM   6438 O  OH  . TYR D 1 86  ? 35.715  -23.028 37.945  1.00 22.90 ? 88   TYR D OH  1 
ATOM   6439 N  N   . ARG D 1 87  ? 33.195  -29.454 33.255  1.00 21.42 ? 89   ARG D N   1 
ATOM   6440 C  CA  A ARG D 1 87  ? 32.665  -30.225 32.132  0.50 21.96 ? 89   ARG D CA  1 
ATOM   6441 C  CA  B ARG D 1 87  ? 32.664  -30.231 32.136  0.50 22.72 ? 89   ARG D CA  1 
ATOM   6442 C  C   . ARG D 1 87  ? 32.007  -29.259 31.158  1.00 22.22 ? 89   ARG D C   1 
ATOM   6443 O  O   . ARG D 1 87  ? 31.212  -28.363 31.573  1.00 22.73 ? 89   ARG D O   1 
ATOM   6444 C  CB  A ARG D 1 87  ? 31.678  -31.324 32.591  0.50 22.88 ? 89   ARG D CB  1 
ATOM   6445 C  CB  B ARG D 1 87  ? 31.690  -31.339 32.616  0.50 24.83 ? 89   ARG D CB  1 
ATOM   6446 C  CG  A ARG D 1 87  ? 30.650  -30.910 33.646  0.50 24.06 ? 89   ARG D CG  1 
ATOM   6447 C  CG  B ARG D 1 87  ? 30.277  -30.887 32.998  0.50 27.37 ? 89   ARG D CG  1 
ATOM   6448 C  CD  A ARG D 1 87  ? 29.442  -31.849 33.656  0.50 25.30 ? 89   ARG D CD  1 
ATOM   6449 C  CD  B ARG D 1 87  ? 29.481  -31.964 33.763  0.50 30.87 ? 89   ARG D CD  1 
ATOM   6450 N  NE  A ARG D 1 87  ? 28.883  -32.064 34.982  0.50 24.12 ? 89   ARG D NE  1 
ATOM   6451 N  NE  B ARG D 1 87  ? 28.039  -31.869 33.496  0.50 32.59 ? 89   ARG D NE  1 
ATOM   6452 C  CZ  A ARG D 1 87  ? 29.282  -31.415 36.074  0.50 24.80 ? 89   ARG D CZ  1 
ATOM   6453 C  CZ  B ARG D 1 87  ? 27.082  -31.901 34.414  0.50 35.09 ? 89   ARG D CZ  1 
ATOM   6454 N  NH1 A ARG D 1 87  ? 30.218  -30.486 35.975  0.50 24.02 ? 89   ARG D NH1 1 
ATOM   6455 N  NH1 B ARG D 1 87  ? 27.367  -32.061 35.701  0.50 37.17 ? 89   ARG D NH1 1 
ATOM   6456 N  NH2 A ARG D 1 87  ? 28.736  -31.682 37.253  0.50 22.96 ? 89   ARG D NH2 1 
ATOM   6457 N  NH2 B ARG D 1 87  ? 25.819  -31.791 34.035  0.50 37.69 ? 89   ARG D NH2 1 
ATOM   6458 N  N   . ALA D 1 88  ? 32.313  -29.391 29.864  1.00 21.49 ? 90   ALA D N   1 
ATOM   6459 C  CA  . ALA D 1 88  ? 31.705  -28.505 28.849  1.00 21.12 ? 90   ALA D CA  1 
ATOM   6460 C  C   . ALA D 1 88  ? 30.232  -28.842 28.639  1.00 21.56 ? 90   ALA D C   1 
ATOM   6461 O  O   . ALA D 1 88  ? 29.881  -30.010 28.582  1.00 21.58 ? 90   ALA D O   1 
ATOM   6462 C  CB  . ALA D 1 88  ? 32.449  -28.578 27.519  1.00 21.89 ? 90   ALA D CB  1 
ATOM   6463 N  N   . LEU D 1 89  ? 29.375  -27.822 28.588  1.00 21.42 ? 91   LEU D N   1 
ATOM   6464 C  CA  . LEU D 1 89  ? 27.931  -27.991 28.379  1.00 24.32 ? 91   LEU D CA  1 
ATOM   6465 C  C   . LEU D 1 89  ? 27.460  -27.691 26.972  1.00 22.87 ? 91   LEU D C   1 
ATOM   6466 O  O   . LEU D 1 89  ? 26.629  -28.402 26.408  1.00 22.25 ? 91   LEU D O   1 
ATOM   6467 C  CB  . LEU D 1 89  ? 27.150  -27.055 29.337  1.00 24.94 ? 91   LEU D CB  1 
ATOM   6468 C  CG  . LEU D 1 89  ? 27.405  -27.215 30.835  1.00 26.22 ? 91   LEU D CG  1 
ATOM   6469 C  CD1 . LEU D 1 89  ? 26.481  -26.293 31.602  1.00 28.52 ? 91   LEU D CD1 1 
ATOM   6470 C  CD2 . LEU D 1 89  ? 27.197  -28.654 31.272  1.00 26.92 ? 91   LEU D CD2 1 
ATOM   6471 N  N   . GLN D 1 90  ? 27.953  -26.587 26.430  1.00 23.98 ? 92   GLN D N   1 
ATOM   6472 C  CA  . GLN D 1 90  ? 27.488  -26.076 25.160  1.00 24.29 ? 92   GLN D CA  1 
ATOM   6473 C  C   . GLN D 1 90  ? 28.470  -25.046 24.673  1.00 22.84 ? 92   GLN D C   1 
ATOM   6474 O  O   . GLN D 1 90  ? 29.315  -24.572 25.431  1.00 22.62 ? 92   GLN D O   1 
ATOM   6475 C  CB  . GLN D 1 90  ? 26.095  -25.433 25.301  1.00 23.37 ? 92   GLN D CB  1 
ATOM   6476 C  CG  . GLN D 1 90  ? 25.994  -24.392 26.414  1.00 25.32 ? 92   GLN D CG  1 
ATOM   6477 C  CD  . GLN D 1 90  ? 25.908  -22.943 25.931  1.00 26.85 ? 92   GLN D CD  1 
ATOM   6478 O  OE1 . GLN D 1 90  ? 26.362  -22.605 24.839  1.00 25.68 ? 92   GLN D OE1 1 
ATOM   6479 N  NE2 . GLN D 1 90  ? 25.327  -22.082 26.764  1.00 28.84 ? 92   GLN D NE2 1 
ATOM   6480 N  N   . LEU D 1 91  ? 28.357  -24.730 23.397  1.00 23.72 ? 93   LEU D N   1 
ATOM   6481 C  CA  . LEU D 1 91  ? 29.037  -23.580 22.843  1.00 25.27 ? 93   LEU D CA  1 
ATOM   6482 C  C   . LEU D 1 91  ? 28.096  -22.790 21.947  1.00 25.18 ? 93   LEU D C   1 
ATOM   6483 O  O   . LEU D 1 91  ? 27.128  -23.316 21.401  1.00 25.68 ? 93   LEU D O   1 
ATOM   6484 C  CB  . LEU D 1 91  ? 30.329  -24.001 22.112  1.00 26.45 ? 93   LEU D CB  1 
ATOM   6485 C  CG  . LEU D 1 91  ? 30.220  -24.885 20.848  1.00 27.40 ? 93   LEU D CG  1 
ATOM   6486 C  CD1 . LEU D 1 91  ? 29.822  -24.099 19.594  1.00 27.58 ? 93   LEU D CD1 1 
ATOM   6487 C  CD2 . LEU D 1 91  ? 31.531  -25.627 20.585  1.00 26.47 ? 93   LEU D CD2 1 
ATOM   6488 N  N   . HIS D 1 92  ? 28.399  -21.512 21.797  1.00 26.46 ? 94   HIS D N   1 
ATOM   6489 C  CA  . HIS D 1 92  ? 27.593  -20.635 20.951  1.00 26.94 ? 94   HIS D CA  1 
ATOM   6490 C  C   . HIS D 1 92  ? 28.435  -19.440 20.531  1.00 26.52 ? 94   HIS D C   1 
ATOM   6491 O  O   . HIS D 1 92  ? 29.569  -19.260 21.012  1.00 27.18 ? 94   HIS D O   1 
ATOM   6492 C  CB  . HIS D 1 92  ? 26.356  -20.173 21.725  1.00 26.11 ? 94   HIS D CB  1 
ATOM   6493 C  CG  . HIS D 1 92  ? 26.708  -19.423 22.957  1.00 26.78 ? 94   HIS D CG  1 
ATOM   6494 N  ND1 . HIS D 1 92  ? 26.915  -20.049 24.166  1.00 26.62 ? 94   HIS D ND1 1 
ATOM   6495 C  CD2 . HIS D 1 92  ? 26.992  -18.119 23.149  1.00 26.70 ? 94   HIS D CD2 1 
ATOM   6496 C  CE1 . HIS D 1 92  ? 27.288  -19.152 25.056  1.00 27.22 ? 94   HIS D CE1 1 
ATOM   6497 N  NE2 . HIS D 1 92  ? 27.334  -17.975 24.466  1.00 27.97 ? 94   HIS D NE2 1 
ATOM   6498 N  N   . LEU D 1 93  ? 27.866  -18.626 19.651  1.00 28.93 ? 95   LEU D N   1 
ATOM   6499 C  CA  . LEU D 1 93  ? 28.593  -17.512 19.043  1.00 30.71 ? 95   LEU D CA  1 
ATOM   6500 C  C   . LEU D 1 93  ? 27.912  -16.152 19.239  1.00 29.57 ? 95   LEU D C   1 
ATOM   6501 O  O   . LEU D 1 93  ? 26.690  -16.064 19.463  1.00 30.41 ? 95   LEU D O   1 
ATOM   6502 C  CB  . LEU D 1 93  ? 28.775  -17.790 17.548  1.00 31.62 ? 95   LEU D CB  1 
ATOM   6503 C  CG  . LEU D 1 93  ? 29.430  -19.131 17.200  1.00 32.54 ? 95   LEU D CG  1 
ATOM   6504 C  CD1 . LEU D 1 93  ? 29.207  -19.476 15.739  1.00 34.59 ? 95   LEU D CD1 1 
ATOM   6505 C  CD2 . LEU D 1 93  ? 30.904  -19.087 17.517  1.00 33.50 ? 95   LEU D CD2 1 
ATOM   6506 N  N   . HIS D 1 94  ? 28.739  -15.115 19.148  1.00 31.51 ? 96   HIS D N   1 
ATOM   6507 C  CA  . HIS D 1 94  ? 28.320  -13.717 19.055  1.00 32.75 ? 96   HIS D CA  1 
ATOM   6508 C  C   . HIS D 1 94  ? 28.952  -13.088 17.818  1.00 33.03 ? 96   HIS D C   1 
ATOM   6509 O  O   . HIS D 1 94  ? 30.138  -13.261 17.581  1.00 33.59 ? 96   HIS D O   1 
ATOM   6510 C  CB  . HIS D 1 94  ? 28.772  -12.970 20.303  1.00 32.82 ? 96   HIS D CB  1 
ATOM   6511 C  CG  . HIS D 1 94  ? 28.161  -13.515 21.548  1.00 33.74 ? 96   HIS D CG  1 
ATOM   6512 N  ND1 . HIS D 1 94  ? 26.880  -13.186 21.938  1.00 32.54 ? 96   HIS D ND1 1 
ATOM   6513 C  CD2 . HIS D 1 94  ? 28.603  -14.434 22.436  1.00 31.94 ? 96   HIS D CD2 1 
ATOM   6514 C  CE1 . HIS D 1 94  ? 26.575  -13.843 23.038  1.00 32.74 ? 96   HIS D CE1 1 
ATOM   6515 N  NE2 . HIS D 1 94  ? 27.599  -14.606 23.360  1.00 31.27 ? 96   HIS D NE2 1 
ATOM   6516 N  N   . TRP D 1 95  ? 28.168  -12.319 17.076  1.00 34.68 ? 97   TRP D N   1 
ATOM   6517 C  CA  . TRP D 1 95  ? 28.609  -11.763 15.803  1.00 37.30 ? 97   TRP D CA  1 
ATOM   6518 C  C   . TRP D 1 95  ? 27.920  -10.440 15.467  1.00 42.86 ? 97   TRP D C   1 
ATOM   6519 O  O   . TRP D 1 95  ? 26.937  -10.055 16.111  1.00 41.94 ? 97   TRP D O   1 
ATOM   6520 C  CB  . TRP D 1 95  ? 28.341  -12.778 14.704  1.00 35.60 ? 97   TRP D CB  1 
ATOM   6521 C  CG  . TRP D 1 95  ? 26.899  -13.127 14.513  1.00 35.07 ? 97   TRP D CG  1 
ATOM   6522 C  CD1 . TRP D 1 95  ? 25.992  -12.445 13.770  1.00 35.00 ? 97   TRP D CD1 1 
ATOM   6523 C  CD2 . TRP D 1 95  ? 26.209  -14.268 15.040  1.00 34.84 ? 97   TRP D CD2 1 
ATOM   6524 N  NE1 . TRP D 1 95  ? 24.777  -13.078 13.797  1.00 36.66 ? 97   TRP D NE1 1 
ATOM   6525 C  CE2 . TRP D 1 95  ? 24.880  -14.200 14.574  1.00 34.69 ? 97   TRP D CE2 1 
ATOM   6526 C  CE3 . TRP D 1 95  ? 26.578  -15.333 15.872  1.00 34.59 ? 97   TRP D CE3 1 
ATOM   6527 C  CZ2 . TRP D 1 95  ? 23.916  -15.154 14.909  1.00 34.03 ? 97   TRP D CZ2 1 
ATOM   6528 C  CZ3 . TRP D 1 95  ? 25.615  -16.287 16.199  1.00 32.28 ? 97   TRP D CZ3 1 
ATOM   6529 C  CH2 . TRP D 1 95  ? 24.301  -16.189 15.719  1.00 33.53 ? 97   TRP D CH2 1 
ATOM   6530 N  N   . GLY D 1 96  ? 28.436  -9.761  14.441  1.00 47.35 ? 98   GLY D N   1 
ATOM   6531 C  CA  . GLY D 1 96  ? 27.961  -8.429  14.059  1.00 47.25 ? 98   GLY D CA  1 
ATOM   6532 C  C   . GLY D 1 96  ? 26.932  -8.441  12.949  1.00 49.01 ? 98   GLY D C   1 
ATOM   6533 O  O   . GLY D 1 96  ? 25.920  -9.128  13.035  1.00 47.98 ? 98   GLY D O   1 
ATOM   6534 N  N   . ALA D 1 97  ? 27.169  -7.629  11.923  1.00 53.72 ? 99   ALA D N   1 
ATOM   6535 C  CA  . ALA D 1 97  ? 26.351  -7.627  10.709  1.00 54.54 ? 99   ALA D CA  1 
ATOM   6536 C  C   . ALA D 1 97  ? 27.211  -7.168  9.532   1.00 56.80 ? 99   ALA D C   1 
ATOM   6537 O  O   . ALA D 1 97  ? 28.416  -6.916  9.696   1.00 55.09 ? 99   ALA D O   1 
ATOM   6538 C  CB  . ALA D 1 97  ? 25.147  -6.714  10.884  1.00 54.65 ? 99   ALA D CB  1 
ATOM   6539 N  N   . ALA D 1 98  ? 26.595  -7.079  8.352   1.00 59.17 ? 100  ALA D N   1 
ATOM   6540 C  CA  . ALA D 1 98  ? 27.266  -6.564  7.153   1.00 60.68 ? 100  ALA D CA  1 
ATOM   6541 C  C   . ALA D 1 98  ? 28.167  -5.373  7.504   1.00 57.52 ? 100  ALA D C   1 
ATOM   6542 O  O   . ALA D 1 98  ? 27.678  -4.319  7.908   1.00 59.14 ? 100  ALA D O   1 
ATOM   6543 C  CB  . ALA D 1 98  ? 26.235  -6.164  6.107   1.00 60.04 ? 100  ALA D CB  1 
ATOM   6544 N  N   . GLY D 1 99  ? 29.479  -5.583  7.423   1.00 57.37 ? 101  GLY D N   1 
ATOM   6545 C  CA  . GLY D 1 99  ? 30.466  -4.524  7.639   1.00 58.36 ? 101  GLY D CA  1 
ATOM   6546 C  C   . GLY D 1 99  ? 30.704  -4.030  9.061   1.00 65.13 ? 101  GLY D C   1 
ATOM   6547 O  O   . GLY D 1 99  ? 31.403  -3.026  9.241   1.00 70.11 ? 101  GLY D O   1 
ATOM   6548 N  N   . ARG D 1 100 ? 30.151  -4.707  10.073  1.00 62.72 ? 102  ARG D N   1 
ATOM   6549 C  CA  . ARG D 1 100 ? 30.279  -4.261  11.473  1.00 61.63 ? 102  ARG D CA  1 
ATOM   6550 C  C   . ARG D 1 100 ? 30.658  -5.442  12.381  1.00 55.36 ? 102  ARG D C   1 
ATOM   6551 O  O   . ARG D 1 100 ? 30.002  -6.481  12.320  1.00 50.82 ? 102  ARG D O   1 
ATOM   6552 C  CB  . ARG D 1 100 ? 28.972  -3.620  11.943  1.00 66.03 ? 102  ARG D CB  1 
ATOM   6553 C  CG  . ARG D 1 100 ? 28.629  -2.321  11.209  1.00 70.54 ? 102  ARG D CG  1 
ATOM   6554 C  CD  . ARG D 1 100 ? 27.131  -2.132  11.026  1.00 72.98 ? 102  ARG D CD  1 
ATOM   6555 N  NE  . ARG D 1 100 ? 26.484  -1.731  12.272  1.00 76.96 ? 102  ARG D NE  1 
ATOM   6556 C  CZ  . ARG D 1 100 ? 25.167  -1.630  12.462  1.00 79.12 ? 102  ARG D CZ  1 
ATOM   6557 N  NH1 . ARG D 1 100 ? 24.297  -1.911  11.488  1.00 80.95 ? 102  ARG D NH1 1 
ATOM   6558 N  NH2 . ARG D 1 100 ? 24.710  -1.247  13.651  1.00 78.95 ? 102  ARG D NH2 1 
ATOM   6559 N  N   . PRO D 1 101 ? 31.718  -5.290  13.212  1.00 50.44 ? 103  PRO D N   1 
ATOM   6560 C  CA  . PRO D 1 101 ? 32.145  -6.393  14.084  1.00 51.04 ? 103  PRO D CA  1 
ATOM   6561 C  C   . PRO D 1 101 ? 31.163  -6.630  15.238  1.00 49.98 ? 103  PRO D C   1 
ATOM   6562 O  O   . PRO D 1 101 ? 30.367  -5.751  15.556  1.00 50.96 ? 103  PRO D O   1 
ATOM   6563 C  CB  . PRO D 1 101 ? 33.520  -5.935  14.596  1.00 48.99 ? 103  PRO D CB  1 
ATOM   6564 C  CG  . PRO D 1 101 ? 33.495  -4.453  14.506  1.00 49.07 ? 103  PRO D CG  1 
ATOM   6565 C  CD  . PRO D 1 101 ? 32.526  -4.074  13.430  1.00 48.91 ? 103  PRO D CD  1 
ATOM   6566 N  N   . GLY D 1 102 ? 31.201  -7.820  15.833  1.00 47.82 ? 104  GLY D N   1 
ATOM   6567 C  CA  . GLY D 1 102 ? 30.304  -8.141  16.939  1.00 45.50 ? 104  GLY D CA  1 
ATOM   6568 C  C   . GLY D 1 102 ? 30.836  -9.099  17.976  1.00 42.73 ? 104  GLY D C   1 
ATOM   6569 O  O   . GLY D 1 102 ? 30.051  -9.842  18.566  1.00 44.28 ? 104  GLY D O   1 
ATOM   6570 N  N   . SER D 1 103 ? 32.147  -9.091  18.223  1.00 38.78 ? 105  SER D N   1 
ATOM   6571 C  CA  . SER D 1 103 ? 32.687  -9.773  19.401  1.00 37.32 ? 105  SER D CA  1 
ATOM   6572 C  C   . SER D 1 103 ? 32.141  -9.080  20.662  1.00 39.49 ? 105  SER D C   1 
ATOM   6573 O  O   . SER D 1 103 ? 31.719  -7.914  20.603  1.00 37.61 ? 105  SER D O   1 
ATOM   6574 C  CB  . SER D 1 103 ? 34.211  -9.761  19.427  1.00 37.09 ? 105  SER D CB  1 
ATOM   6575 O  OG  . SER D 1 103 ? 34.727  -8.500  19.796  1.00 36.55 ? 105  SER D OG  1 
ATOM   6576 N  N   . GLU D 1 104 ? 32.155  -9.805  21.782  1.00 36.28 ? 106  GLU D N   1 
ATOM   6577 C  CA  . GLU D 1 104 ? 31.662  -9.292  23.062  1.00 35.06 ? 106  GLU D CA  1 
ATOM   6578 C  C   . GLU D 1 104 ? 32.766  -8.587  23.812  1.00 33.39 ? 106  GLU D C   1 
ATOM   6579 O  O   . GLU D 1 104 ? 32.634  -7.432  24.180  1.00 37.60 ? 106  GLU D O   1 
ATOM   6580 C  CB  . GLU D 1 104 ? 31.108  -10.433 23.914  1.00 34.24 ? 106  GLU D CB  1 
ATOM   6581 C  CG  . GLU D 1 104 ? 29.910  -11.104 23.294  1.00 34.07 ? 106  GLU D CG  1 
ATOM   6582 C  CD  . GLU D 1 104 ? 28.786  -11.246 24.283  1.00 36.72 ? 106  GLU D CD  1 
ATOM   6583 O  OE1 . GLU D 1 104 ? 28.022  -10.270 24.441  1.00 36.11 ? 106  GLU D OE1 1 
ATOM   6584 O  OE2 . GLU D 1 104 ? 28.667  -12.332 24.880  1.00 33.49 ? 106  GLU D OE2 1 
ATOM   6585 N  N   . HIS D 1 105 ? 33.848  -9.302  24.065  1.00 33.64 ? 107  HIS D N   1 
ATOM   6586 C  CA  . HIS D 1 105 ? 35.046  -8.715  24.635  1.00 33.04 ? 107  HIS D CA  1 
ATOM   6587 C  C   . HIS D 1 105 ? 35.705  -7.823  23.561  1.00 36.42 ? 107  HIS D C   1 
ATOM   6588 O  O   . HIS D 1 105 ? 35.401  -7.939  22.369  1.00 33.77 ? 107  HIS D O   1 
ATOM   6589 C  CB  . HIS D 1 105 ? 35.990  -9.801  25.153  1.00 34.49 ? 107  HIS D CB  1 
ATOM   6590 C  CG  . HIS D 1 105 ? 35.466  -10.507 26.372  1.00 34.97 ? 107  HIS D CG  1 
ATOM   6591 N  ND1 . HIS D 1 105 ? 34.490  -11.480 26.308  1.00 36.67 ? 107  HIS D ND1 1 
ATOM   6592 C  CD2 . HIS D 1 105 ? 35.739  -10.337 27.691  1.00 36.68 ? 107  HIS D CD2 1 
ATOM   6593 C  CE1 . HIS D 1 105 ? 34.198  -11.893 27.529  1.00 34.77 ? 107  HIS D CE1 1 
ATOM   6594 N  NE2 . HIS D 1 105 ? 34.940  -11.215 28.387  1.00 34.66 ? 107  HIS D NE2 1 
ATOM   6595 N  N   . THR D 1 106 ? 36.547  -6.904  24.009  1.00 36.52 ? 108  THR D N   1 
ATOM   6596 C  CA  . THR D 1 106 ? 37.267  -5.987  23.124  1.00 37.67 ? 108  THR D CA  1 
ATOM   6597 C  C   . THR D 1 106 ? 38.688  -5.904  23.659  1.00 39.47 ? 108  THR D C   1 
ATOM   6598 O  O   . THR D 1 106 ? 38.919  -6.176  24.839  1.00 40.10 ? 108  THR D O   1 
ATOM   6599 C  CB  . THR D 1 106 ? 36.591  -4.580  23.042  1.00 37.90 ? 108  THR D CB  1 
ATOM   6600 O  OG1 . THR D 1 106 ? 36.463  -3.995  24.346  1.00 38.60 ? 108  THR D OG1 1 
ATOM   6601 C  CG2 . THR D 1 106 ? 35.213  -4.657  22.421  1.00 37.24 ? 108  THR D CG2 1 
ATOM   6602 N  N   . VAL D 1 107 ? 39.652  -5.586  22.795  1.00 40.39 ? 109  VAL D N   1 
ATOM   6603 C  CA  . VAL D 1 107 ? 41.052  -5.444  23.219  1.00 40.88 ? 109  VAL D CA  1 
ATOM   6604 C  C   . VAL D 1 107 ? 41.483  -4.018  22.882  1.00 44.99 ? 109  VAL D C   1 
ATOM   6605 O  O   . VAL D 1 107 ? 41.344  -3.595  21.728  1.00 40.22 ? 109  VAL D O   1 
ATOM   6606 C  CB  . VAL D 1 107 ? 41.966  -6.477  22.527  1.00 41.43 ? 109  VAL D CB  1 
ATOM   6607 C  CG1 . VAL D 1 107 ? 43.434  -6.224  22.846  1.00 40.70 ? 109  VAL D CG1 1 
ATOM   6608 C  CG2 . VAL D 1 107 ? 41.581  -7.890  22.959  1.00 42.78 ? 109  VAL D CG2 1 
ATOM   6609 N  N   . GLU D 1 108 ? 41.967  -3.285  23.888  1.00 47.08 ? 110  GLU D N   1 
ATOM   6610 C  CA  . GLU D 1 108 ? 42.289  -1.848  23.768  1.00 49.96 ? 110  GLU D CA  1 
ATOM   6611 C  C   . GLU D 1 108 ? 41.275  -1.089  22.904  1.00 48.04 ? 110  GLU D C   1 
ATOM   6612 O  O   . GLU D 1 108 ? 41.640  -0.254  22.083  1.00 54.31 ? 110  GLU D O   1 
ATOM   6613 C  CB  . GLU D 1 108 ? 43.739  -1.667  23.264  1.00 51.56 ? 110  GLU D CB  1 
ATOM   6614 C  CG  . GLU D 1 108 ? 44.758  -1.608  24.397  1.00 56.97 ? 110  GLU D CG  1 
ATOM   6615 C  CD  . GLU D 1 108 ? 46.194  -1.911  23.976  1.00 60.63 ? 110  GLU D CD  1 
ATOM   6616 O  OE1 . GLU D 1 108 ? 46.510  -1.886  22.767  1.00 64.69 ? 110  GLU D OE1 1 
ATOM   6617 O  OE2 . GLU D 1 108 ? 47.025  -2.171  24.877  1.00 65.32 ? 110  GLU D OE2 1 
ATOM   6618 N  N   . GLY D 1 109 ? 39.994  -1.406  23.083  1.00 46.70 ? 111  GLY D N   1 
ATOM   6619 C  CA  . GLY D 1 109 ? 38.913  -0.805  22.310  1.00 44.59 ? 111  GLY D CA  1 
ATOM   6620 C  C   . GLY D 1 109 ? 38.532  -1.513  21.017  1.00 45.26 ? 111  GLY D C   1 
ATOM   6621 O  O   . GLY D 1 109 ? 37.464  -1.244  20.477  1.00 44.66 ? 111  GLY D O   1 
ATOM   6622 N  N   . HIS D 1 110 ? 39.377  -2.413  20.512  1.00 47.29 ? 112  HIS D N   1 
ATOM   6623 C  CA  . HIS D 1 110 ? 39.105  -3.093  19.244  1.00 46.86 ? 112  HIS D CA  1 
ATOM   6624 C  C   . HIS D 1 110 ? 38.085  -4.223  19.400  1.00 44.15 ? 112  HIS D C   1 
ATOM   6625 O  O   . HIS D 1 110 ? 38.284  -5.141  20.185  1.00 43.19 ? 112  HIS D O   1 
ATOM   6626 C  CB  . HIS D 1 110 ? 40.403  -3.631  18.620  1.00 49.22 ? 112  HIS D CB  1 
ATOM   6627 C  CG  . HIS D 1 110 ? 40.197  -4.310  17.299  1.00 54.23 ? 112  HIS D CG  1 
ATOM   6628 N  ND1 . HIS D 1 110 ? 39.707  -3.650  16.191  1.00 56.86 ? 112  HIS D ND1 1 
ATOM   6629 C  CD2 . HIS D 1 110 ? 40.398  -5.593  16.914  1.00 55.23 ? 112  HIS D CD2 1 
ATOM   6630 C  CE1 . HIS D 1 110 ? 39.619  -4.497  15.180  1.00 57.42 ? 112  HIS D CE1 1 
ATOM   6631 N  NE2 . HIS D 1 110 ? 40.031  -5.683  15.593  1.00 57.20 ? 112  HIS D NE2 1 
ATOM   6632 N  N   . ARG D 1 111 ? 37.003  -4.134  18.632  1.00 45.66 ? 113  ARG D N   1 
ATOM   6633 C  CA  . ARG D 1 111 ? 36.002  -5.178  18.534  1.00 45.69 ? 113  ARG D CA  1 
ATOM   6634 C  C   . ARG D 1 111 ? 36.329  -6.076  17.339  1.00 48.47 ? 113  ARG D C   1 
ATOM   6635 O  O   . ARG D 1 111 ? 36.531  -5.596  16.218  1.00 47.63 ? 113  ARG D O   1 
ATOM   6636 C  CB  . ARG D 1 111 ? 34.613  -4.569  18.373  1.00 47.33 ? 113  ARG D CB  1 
ATOM   6637 C  CG  . ARG D 1 111 ? 33.479  -5.581  18.467  1.00 47.56 ? 113  ARG D CG  1 
ATOM   6638 C  CD  . ARG D 1 111 ? 32.116  -4.945  18.273  1.00 49.12 ? 113  ARG D CD  1 
ATOM   6639 N  NE  . ARG D 1 111 ? 31.893  -3.880  19.246  1.00 52.25 ? 113  ARG D NE  1 
ATOM   6640 C  CZ  . ARG D 1 111 ? 31.649  -4.061  20.544  1.00 54.09 ? 113  ARG D CZ  1 
ATOM   6641 N  NH1 . ARG D 1 111 ? 31.567  -5.282  21.073  1.00 55.68 ? 113  ARG D NH1 1 
ATOM   6642 N  NH2 . ARG D 1 111 ? 31.476  -3.003  21.327  1.00 52.40 ? 113  ARG D NH2 1 
ATOM   6643 N  N   . PHE D 1 112 ? 36.371  -7.380  17.584  1.00 44.36 ? 114  PHE D N   1 
ATOM   6644 C  CA  . PHE D 1 112 ? 36.710  -8.349  16.550  1.00 40.79 ? 114  PHE D CA  1 
ATOM   6645 C  C   . PHE D 1 112 ? 35.436  -8.755  15.822  1.00 40.31 ? 114  PHE D C   1 
ATOM   6646 O  O   . PHE D 1 112 ? 34.340  -8.490  16.313  1.00 40.13 ? 114  PHE D O   1 
ATOM   6647 C  CB  . PHE D 1 112 ? 37.395  -9.552  17.170  1.00 39.79 ? 114  PHE D CB  1 
ATOM   6648 C  CG  . PHE D 1 112 ? 38.713  -9.232  17.807  1.00 40.43 ? 114  PHE D CG  1 
ATOM   6649 C  CD1 . PHE D 1 112 ? 38.777  -8.740  19.109  1.00 39.28 ? 114  PHE D CD1 1 
ATOM   6650 C  CD2 . PHE D 1 112 ? 39.901  -9.435  17.112  1.00 39.72 ? 114  PHE D CD2 1 
ATOM   6651 C  CE1 . PHE D 1 112 ? 39.993  -8.461  19.704  1.00 40.42 ? 114  PHE D CE1 1 
ATOM   6652 C  CE2 . PHE D 1 112 ? 41.124  -9.157  17.699  1.00 40.80 ? 114  PHE D CE2 1 
ATOM   6653 C  CZ  . PHE D 1 112 ? 41.174  -8.671  19.002  1.00 41.64 ? 114  PHE D CZ  1 
ATOM   6654 N  N   . PRO D 1 113 ? 35.563  -9.364  14.623  1.00 40.96 ? 115  PRO D N   1 
ATOM   6655 C  CA  . PRO D 1 113 ? 34.355  -9.752  13.881  1.00 40.29 ? 115  PRO D CA  1 
ATOM   6656 C  C   . PRO D 1 113 ? 33.340  -10.597 14.657  1.00 38.31 ? 115  PRO D C   1 
ATOM   6657 O  O   . PRO D 1 113 ? 32.139  -10.322 14.582  1.00 39.64 ? 115  PRO D O   1 
ATOM   6658 C  CB  . PRO D 1 113 ? 34.909  -10.538 12.685  1.00 40.98 ? 115  PRO D CB  1 
ATOM   6659 C  CG  . PRO D 1 113 ? 36.259  -9.959  12.459  1.00 42.27 ? 115  PRO D CG  1 
ATOM   6660 C  CD  . PRO D 1 113 ? 36.782  -9.526  13.806  1.00 41.53 ? 115  PRO D CD  1 
ATOM   6661 N  N   . ALA D 1 114 ? 33.814  -11.608 15.381  1.00 38.21 ? 116  ALA D N   1 
ATOM   6662 C  CA  . ALA D 1 114 ? 32.926  -12.511 16.114  1.00 36.90 ? 116  ALA D CA  1 
ATOM   6663 C  C   . ALA D 1 114 ? 33.647  -13.155 17.295  1.00 34.49 ? 116  ALA D C   1 
ATOM   6664 O  O   . ALA D 1 114 ? 34.850  -12.940 17.489  1.00 33.54 ? 116  ALA D O   1 
ATOM   6665 C  CB  . ALA D 1 114 ? 32.347  -13.565 15.170  1.00 38.09 ? 116  ALA D CB  1 
ATOM   6666 N  N   . GLU D 1 115 ? 32.900  -13.910 18.101  1.00 31.28 ? 117  GLU D N   1 
ATOM   6667 C  CA  . GLU D 1 115 ? 33.437  -14.506 19.321  1.00 30.73 ? 117  GLU D CA  1 
ATOM   6668 C  C   . GLU D 1 115 ? 32.752  -15.834 19.600  1.00 28.56 ? 117  GLU D C   1 
ATOM   6669 O  O   . GLU D 1 115 ? 31.546  -15.960 19.408  1.00 31.23 ? 117  GLU D O   1 
ATOM   6670 C  CB  . GLU D 1 115 ? 33.261  -13.536 20.507  1.00 32.32 ? 117  GLU D CB  1 
ATOM   6671 C  CG  . GLU D 1 115 ? 33.999  -13.936 21.787  1.00 32.56 ? 117  GLU D CG  1 
ATOM   6672 C  CD  . GLU D 1 115 ? 34.064  -12.831 22.841  1.00 34.55 ? 117  GLU D CD  1 
ATOM   6673 O  OE1 . GLU D 1 115 ? 34.209  -11.639 22.465  1.00 33.53 ? 117  GLU D OE1 1 
ATOM   6674 O  OE2 . GLU D 1 115 ? 33.997  -13.144 24.060  1.00 33.97 ? 117  GLU D OE2 1 
ATOM   6675 N  N   . ILE D 1 116 ? 33.534  -16.819 20.034  1.00 29.59 ? 118  ILE D N   1 
ATOM   6676 C  CA  . ILE D 1 116 ? 33.011  -18.135 20.430  1.00 29.20 ? 118  ILE D CA  1 
ATOM   6677 C  C   . ILE D 1 116 ? 33.124  -18.315 21.942  1.00 25.50 ? 118  ILE D C   1 
ATOM   6678 O  O   . ILE D 1 116 ? 34.130  -17.949 22.525  1.00 26.00 ? 118  ILE D O   1 
ATOM   6679 C  CB  . ILE D 1 116 ? 33.715  -19.324 19.701  1.00 30.02 ? 118  ILE D CB  1 
ATOM   6680 C  CG1 . ILE D 1 116 ? 33.030  -20.652 20.050  1.00 30.97 ? 118  ILE D CG1 1 
ATOM   6681 C  CG2 . ILE D 1 116 ? 35.195  -19.432 20.035  1.00 30.37 ? 118  ILE D CG2 1 
ATOM   6682 C  CD1 . ILE D 1 116 ? 33.381  -21.792 19.114  1.00 31.98 ? 118  ILE D CD1 1 
ATOM   6683 N  N   . HIS D 1 117 ? 32.083  -18.898 22.542  1.00 26.43 ? 119  HIS D N   1 
ATOM   6684 C  CA  . HIS D 1 117 ? 32.018  -19.167 23.965  1.00 24.56 ? 119  HIS D CA  1 
ATOM   6685 C  C   . HIS D 1 117 ? 31.749  -20.630 24.178  1.00 24.18 ? 119  HIS D C   1 
ATOM   6686 O  O   . HIS D 1 117 ? 30.798  -21.171 23.626  1.00 23.61 ? 119  HIS D O   1 
ATOM   6687 C  CB  . HIS D 1 117 ? 30.886  -18.366 24.621  1.00 26.37 ? 119  HIS D CB  1 
ATOM   6688 C  CG  . HIS D 1 117 ? 31.155  -16.898 24.698  1.00 27.75 ? 119  HIS D CG  1 
ATOM   6689 N  ND1 . HIS D 1 117 ? 30.164  -15.966 24.953  1.00 28.31 ? 119  HIS D ND1 1 
ATOM   6690 C  CD2 . HIS D 1 117 ? 32.305  -16.196 24.548  1.00 27.50 ? 119  HIS D CD2 1 
ATOM   6691 C  CE1 . HIS D 1 117 ? 30.701  -14.759 24.961  1.00 29.18 ? 119  HIS D CE1 1 
ATOM   6692 N  NE2 . HIS D 1 117 ? 31.995  -14.871 24.725  1.00 28.50 ? 119  HIS D NE2 1 
ATOM   6693 N  N   . VAL D 1 118 ? 32.603  -21.261 24.964  1.00 23.71 ? 120  VAL D N   1 
ATOM   6694 C  CA  . VAL D 1 118 ? 32.422  -22.649 25.344  1.00 23.15 ? 120  VAL D CA  1 
ATOM   6695 C  C   . VAL D 1 118 ? 32.130  -22.602 26.831  1.00 20.78 ? 120  VAL D C   1 
ATOM   6696 O  O   . VAL D 1 118 ? 33.004  -22.290 27.637  1.00 20.14 ? 120  VAL D O   1 
ATOM   6697 C  CB  . VAL D 1 118 ? 33.667  -23.486 25.061  1.00 23.48 ? 120  VAL D CB  1 
ATOM   6698 C  CG1 . VAL D 1 118 ? 33.373  -24.954 25.330  1.00 23.68 ? 120  VAL D CG1 1 
ATOM   6699 C  CG2 . VAL D 1 118 ? 34.089  -23.295 23.610  1.00 23.52 ? 120  VAL D CG2 1 
ATOM   6700 N  N   . VAL D 1 119 ? 30.895  -22.945 27.174  1.00 21.42 ? 121  VAL D N   1 
ATOM   6701 C  CA  . VAL D 1 119 ? 30.397  -22.801 28.543  1.00 20.64 ? 121  VAL D CA  1 
ATOM   6702 C  C   . VAL D 1 119 ? 30.564  -24.108 29.321  1.00 20.60 ? 121  VAL D C   1 
ATOM   6703 O  O   . VAL D 1 119 ? 30.142  -25.173 28.837  1.00 20.75 ? 121  VAL D O   1 
ATOM   6704 C  CB  . VAL D 1 119 ? 28.900  -22.377 28.529  1.00 20.89 ? 121  VAL D CB  1 
ATOM   6705 C  CG1 . VAL D 1 119 ? 28.398  -22.128 29.939  1.00 21.69 ? 121  VAL D CG1 1 
ATOM   6706 C  CG2 . VAL D 1 119 ? 28.693  -21.138 27.670  1.00 21.81 ? 121  VAL D CG2 1 
ATOM   6707 N  N   . HIS D 1 120 ? 31.162  -24.016 30.515  1.00 20.06 ? 122  HIS D N   1 
ATOM   6708 C  CA  . HIS D 1 120 ? 31.424  -25.186 31.368  1.00 19.92 ? 122  HIS D CA  1 
ATOM   6709 C  C   . HIS D 1 120 ? 30.839  -25.040 32.775  1.00 20.79 ? 122  HIS D C   1 
ATOM   6710 O  O   . HIS D 1 120 ? 30.735  -23.923 33.297  1.00 22.07 ? 122  HIS D O   1 
ATOM   6711 C  CB  . HIS D 1 120 ? 32.916  -25.386 31.585  1.00 19.78 ? 122  HIS D CB  1 
ATOM   6712 C  CG  . HIS D 1 120 ? 33.712  -25.566 30.334  1.00 20.16 ? 122  HIS D CG  1 
ATOM   6713 N  ND1 . HIS D 1 120 ? 33.891  -24.557 29.405  1.00 20.48 ? 122  HIS D ND1 1 
ATOM   6714 C  CD2 . HIS D 1 120 ? 34.423  -26.625 29.887  1.00 21.67 ? 122  HIS D CD2 1 
ATOM   6715 C  CE1 . HIS D 1 120 ? 34.672  -25.002 28.434  1.00 21.35 ? 122  HIS D CE1 1 
ATOM   6716 N  NE2 . HIS D 1 120 ? 34.999  -26.255 28.697  1.00 21.46 ? 122  HIS D NE2 1 
ATOM   6717 N  N   . LEU D 1 121 ? 30.621  -26.192 33.414  1.00 20.10 ? 123  LEU D N   1 
ATOM   6718 C  CA  . LEU D 1 121 ? 30.139  -26.311 34.770  1.00 20.89 ? 123  LEU D CA  1 
ATOM   6719 C  C   . LEU D 1 121 ? 31.203  -26.940 35.643  1.00 21.22 ? 123  LEU D C   1 
ATOM   6720 O  O   . LEU D 1 121 ? 31.728  -28.015 35.310  1.00 22.64 ? 123  LEU D O   1 
ATOM   6721 C  CB  . LEU D 1 121 ? 28.893  -27.204 34.757  1.00 21.24 ? 123  LEU D CB  1 
ATOM   6722 C  CG  . LEU D 1 121 ? 28.268  -27.551 36.121  1.00 20.83 ? 123  LEU D CG  1 
ATOM   6723 C  CD1 . LEU D 1 121 ? 27.836  -26.283 36.827  1.00 20.94 ? 123  LEU D CD1 1 
ATOM   6724 C  CD2 . LEU D 1 121 ? 27.113  -28.526 35.948  1.00 20.53 ? 123  LEU D CD2 1 
ATOM   6725 N  N   . SER D 1 122 ? 31.535  -26.287 36.759  1.00 20.66 ? 124  SER D N   1 
ATOM   6726 C  CA  . SER D 1 122 ? 32.411  -26.875 37.764  1.00 20.59 ? 124  SER D CA  1 
ATOM   6727 C  C   . SER D 1 122 ? 31.885  -28.248 38.188  1.00 21.34 ? 124  SER D C   1 
ATOM   6728 O  O   . SER D 1 122 ? 30.683  -28.419 38.450  1.00 21.54 ? 124  SER D O   1 
ATOM   6729 C  CB  . SER D 1 122 ? 32.585  -25.973 38.992  1.00 18.91 ? 124  SER D CB  1 
ATOM   6730 O  OG  . SER D 1 122 ? 33.147  -26.686 40.082  1.00 19.51 ? 124  SER D OG  1 
ATOM   6731 N  N   . THR D 1 123 ? 32.785  -29.228 38.226  1.00 21.19 ? 125  THR D N   1 
ATOM   6732 C  CA  . THR D 1 123 ? 32.443  -30.574 38.667  1.00 23.44 ? 125  THR D CA  1 
ATOM   6733 C  C   . THR D 1 123 ? 32.117  -30.613 40.162  1.00 24.28 ? 125  THR D C   1 
ATOM   6734 O  O   . THR D 1 123 ? 31.686  -31.645 40.647  1.00 23.84 ? 125  THR D O   1 
ATOM   6735 C  CB  . THR D 1 123 ? 33.546  -31.619 38.344  1.00 26.00 ? 125  THR D CB  1 
ATOM   6736 O  OG1 . THR D 1 123 ? 34.762  -31.264 39.000  1.00 29.91 ? 125  THR D OG1 1 
ATOM   6737 C  CG2 . THR D 1 123 ? 33.783  -31.708 36.844  1.00 27.00 ? 125  THR D CG2 1 
ATOM   6738 N  N   . ALA D 1 124 ? 32.340  -29.509 40.891  1.00 23.51 ? 126  ALA D N   1 
ATOM   6739 C  CA  . ALA D 1 124 ? 31.848  -29.393 42.278  1.00 24.48 ? 126  ALA D CA  1 
ATOM   6740 C  C   . ALA D 1 124 ? 30.339  -29.225 42.384  1.00 24.51 ? 126  ALA D C   1 
ATOM   6741 O  O   . ALA D 1 124 ? 29.802  -29.363 43.482  1.00 26.43 ? 126  ALA D O   1 
ATOM   6742 C  CB  . ALA D 1 124 ? 32.536  -28.238 43.004  1.00 25.62 ? 126  ALA D CB  1 
ATOM   6743 N  N   . PHE D 1 125 ? 29.667  -28.908 41.280  1.00 23.53 ? 127  PHE D N   1 
ATOM   6744 C  CA  . PHE D 1 125 ? 28.217  -28.741 41.260  1.00 25.00 ? 127  PHE D CA  1 
ATOM   6745 C  C   . PHE D 1 125 ? 27.596  -29.748 40.293  1.00 26.39 ? 127  PHE D C   1 
ATOM   6746 O  O   . PHE D 1 125 ? 28.133  -29.986 39.224  1.00 23.69 ? 127  PHE D O   1 
ATOM   6747 C  CB  . PHE D 1 125 ? 27.877  -27.320 40.827  1.00 23.40 ? 127  PHE D CB  1 
ATOM   6748 C  CG  . PHE D 1 125 ? 28.406  -26.251 41.743  1.00 22.65 ? 127  PHE D CG  1 
ATOM   6749 C  CD1 . PHE D 1 125 ? 27.675  -25.842 42.851  1.00 22.75 ? 127  PHE D CD1 1 
ATOM   6750 C  CD2 . PHE D 1 125 ? 29.594  -25.601 41.464  1.00 22.46 ? 127  PHE D CD2 1 
ATOM   6751 C  CE1 . PHE D 1 125 ? 28.138  -24.816 43.671  1.00 23.21 ? 127  PHE D CE1 1 
ATOM   6752 C  CE2 . PHE D 1 125 ? 30.066  -24.568 42.265  1.00 22.50 ? 127  PHE D CE2 1 
ATOM   6753 C  CZ  . PHE D 1 125 ? 29.334  -24.180 43.380  1.00 23.43 ? 127  PHE D CZ  1 
ATOM   6754 N  N   . ALA D 1 126 ? 26.472  -30.342 40.691  1.00 27.91 ? 128  ALA D N   1 
ATOM   6755 C  CA  . ALA D 1 126 ? 25.761  -31.324 39.884  1.00 28.46 ? 128  ALA D CA  1 
ATOM   6756 C  C   . ALA D 1 126 ? 24.994  -30.693 38.737  1.00 28.80 ? 128  ALA D C   1 
ATOM   6757 O  O   . ALA D 1 126 ? 24.879  -31.287 37.665  1.00 28.78 ? 128  ALA D O   1 
ATOM   6758 C  CB  . ALA D 1 126 ? 24.803  -32.135 40.765  1.00 29.71 ? 128  ALA D CB  1 
ATOM   6759 N  N   . ARG D 1 127 ? 24.450  -29.499 38.963  1.00 27.13 ? 129  ARG D N   1 
ATOM   6760 C  CA  . ARG D 1 127 ? 23.602  -28.829 38.000  1.00 28.06 ? 129  ARG D CA  1 
ATOM   6761 C  C   . ARG D 1 127 ? 24.020  -27.361 37.814  1.00 24.70 ? 129  ARG D C   1 
ATOM   6762 O  O   . ARG D 1 127 ? 24.567  -26.739 38.737  1.00 23.56 ? 129  ARG D O   1 
ATOM   6763 C  CB  . ARG D 1 127 ? 22.147  -28.856 38.502  1.00 31.06 ? 129  ARG D CB  1 
ATOM   6764 C  CG  . ARG D 1 127 ? 21.593  -30.217 38.925  1.00 34.40 ? 129  ARG D CG  1 
ATOM   6765 C  CD  . ARG D 1 127 ? 20.348  -30.048 39.808  1.00 36.93 ? 129  ARG D CD  1 
ATOM   6766 N  NE  . ARG D 1 127 ? 19.379  -29.175 39.146  1.00 39.11 ? 129  ARG D NE  1 
ATOM   6767 C  CZ  . ARG D 1 127 ? 18.429  -29.577 38.293  1.00 45.24 ? 129  ARG D CZ  1 
ATOM   6768 N  NH1 . ARG D 1 127 ? 18.261  -30.873 37.998  1.00 49.42 ? 129  ARG D NH1 1 
ATOM   6769 N  NH2 . ARG D 1 127 ? 17.623  -28.672 37.730  1.00 43.47 ? 129  ARG D NH2 1 
ATOM   6770 N  N   . VAL D 1 128 ? 23.688  -26.806 36.653  1.00 23.32 ? 130  VAL D N   1 
ATOM   6771 C  CA  . VAL D 1 128 ? 23.970  -25.397 36.354  1.00 25.02 ? 130  VAL D CA  1 
ATOM   6772 C  C   . VAL D 1 128 ? 23.306  -24.479 37.380  1.00 25.47 ? 130  VAL D C   1 
ATOM   6773 O  O   . VAL D 1 128 ? 23.926  -23.531 37.874  1.00 24.09 ? 130  VAL D O   1 
ATOM   6774 C  CB  . VAL D 1 128 ? 23.520  -24.996 34.941  1.00 26.86 ? 130  VAL D CB  1 
ATOM   6775 C  CG1 . VAL D 1 128 ? 23.626  -23.481 34.721  1.00 28.62 ? 130  VAL D CG1 1 
ATOM   6776 C  CG2 . VAL D 1 128 ? 24.359  -25.718 33.915  1.00 28.83 ? 130  VAL D CG2 1 
ATOM   6777 N  N   . ASP D 1 129 ? 22.057  -24.778 37.729  1.00 26.75 ? 131  ASP D N   1 
ATOM   6778 C  CA  . ASP D 1 129 ? 21.341  -23.886 38.674  1.00 27.00 ? 131  ASP D CA  1 
ATOM   6779 C  C   . ASP D 1 129 ? 21.988  -23.729 40.069  1.00 26.05 ? 131  ASP D C   1 
ATOM   6780 O  O   . ASP D 1 129 ? 21.934  -22.640 40.649  1.00 26.94 ? 131  ASP D O   1 
ATOM   6781 C  CB  . ASP D 1 129 ? 19.844  -24.182 38.735  1.00 28.64 ? 131  ASP D CB  1 
ATOM   6782 C  CG  . ASP D 1 129 ? 19.512  -25.559 39.172  1.00 29.26 ? 131  ASP D CG  1 
ATOM   6783 O  OD1 . ASP D 1 129 ? 20.346  -26.272 39.756  1.00 33.01 ? 131  ASP D OD1 1 
ATOM   6784 O  OD2 . ASP D 1 129 ? 18.348  -25.931 38.941  1.00 34.15 ? 131  ASP D OD2 1 
ATOM   6785 N  N   . GLU D 1 130 ? 22.652  -24.772 40.570  1.00 25.52 ? 132  GLU D N   1 
ATOM   6786 C  CA  . GLU D 1 130 ? 23.459  -24.646 41.791  1.00 26.22 ? 132  GLU D CA  1 
ATOM   6787 C  C   . GLU D 1 130 ? 24.705  -23.769 41.607  1.00 24.69 ? 132  GLU D C   1 
ATOM   6788 O  O   . GLU D 1 130 ? 25.147  -23.090 42.533  1.00 21.59 ? 132  GLU D O   1 
ATOM   6789 C  CB  . GLU D 1 130 ? 23.927  -25.995 42.302  1.00 30.98 ? 132  GLU D CB  1 
ATOM   6790 C  CG  . GLU D 1 130 ? 22.847  -26.967 42.734  1.00 36.75 ? 132  GLU D CG  1 
ATOM   6791 C  CD  . GLU D 1 130 ? 23.424  -28.349 42.995  1.00 42.62 ? 132  GLU D CD  1 
ATOM   6792 O  OE1 . GLU D 1 130 ? 24.604  -28.434 43.397  1.00 47.56 ? 132  GLU D OE1 1 
ATOM   6793 O  OE2 . GLU D 1 130 ? 22.707  -29.345 42.776  1.00 49.19 ? 132  GLU D OE2 1 
ATOM   6794 N  N   . ALA D 1 131 ? 25.288  -23.806 40.416  1.00 21.88 ? 133  ALA D N   1 
ATOM   6795 C  CA  . ALA D 1 131 ? 26.484  -23.055 40.127  1.00 21.99 ? 133  ALA D CA  1 
ATOM   6796 C  C   . ALA D 1 131 ? 26.239  -21.555 39.889  1.00 22.53 ? 133  ALA D C   1 
ATOM   6797 O  O   . ALA D 1 131 ? 27.133  -20.752 40.150  1.00 22.72 ? 133  ALA D O   1 
ATOM   6798 C  CB  . ALA D 1 131 ? 27.181  -23.673 38.915  1.00 21.34 ? 133  ALA D CB  1 
ATOM   6799 N  N   . LEU D 1 132 ? 25.052  -21.181 39.405  1.00 23.37 ? 134  LEU D N   1 
ATOM   6800 C  CA  . LEU D 1 132 ? 24.720  -19.773 39.144  1.00 25.41 ? 134  LEU D CA  1 
ATOM   6801 C  C   . LEU D 1 132 ? 24.949  -18.917 40.385  1.00 25.83 ? 134  LEU D C   1 
ATOM   6802 O  O   . LEU D 1 132 ? 24.431  -19.236 41.470  1.00 26.18 ? 134  LEU D O   1 
ATOM   6803 C  CB  . LEU D 1 132 ? 23.252  -19.619 38.693  1.00 28.47 ? 134  LEU D CB  1 
ATOM   6804 C  CG  . LEU D 1 132 ? 22.913  -20.132 37.289  1.00 31.44 ? 134  LEU D CG  1 
ATOM   6805 C  CD1 . LEU D 1 132 ? 21.413  -20.234 37.102  1.00 33.74 ? 134  LEU D CD1 1 
ATOM   6806 C  CD2 . LEU D 1 132 ? 23.527  -19.264 36.203  1.00 32.17 ? 134  LEU D CD2 1 
ATOM   6807 N  N   . GLY D 1 133 ? 25.753  -17.865 40.233  1.00 25.73 ? 135  GLY D N   1 
ATOM   6808 C  CA  . GLY D 1 133 ? 26.101  -16.971 41.326  1.00 24.40 ? 135  GLY D CA  1 
ATOM   6809 C  C   . GLY D 1 133 ? 27.211  -17.411 42.251  1.00 24.35 ? 135  GLY D C   1 
ATOM   6810 O  O   . GLY D 1 133 ? 27.631  -16.638 43.103  1.00 24.67 ? 135  GLY D O   1 
ATOM   6811 N  N   . ARG D 1 134 ? 27.699  -18.642 42.121  1.00 22.24 ? 136  ARG D N   1 
ATOM   6812 C  CA  . ARG D 1 134 ? 28.734  -19.132 43.005  1.00 22.87 ? 136  ARG D CA  1 
ATOM   6813 C  C   . ARG D 1 134 ? 30.094  -18.871 42.328  1.00 23.10 ? 136  ARG D C   1 
ATOM   6814 O  O   . ARG D 1 134 ? 30.210  -19.058 41.123  1.00 22.86 ? 136  ARG D O   1 
ATOM   6815 C  CB  . ARG D 1 134 ? 28.539  -20.623 43.305  1.00 23.13 ? 136  ARG D CB  1 
ATOM   6816 C  CG  . ARG D 1 134 ? 27.630  -20.944 44.498  1.00 24.82 ? 136  ARG D CG  1 
ATOM   6817 C  CD  . ARG D 1 134 ? 26.194  -20.445 44.363  1.00 24.93 ? 136  ARG D CD  1 
ATOM   6818 N  NE  . ARG D 1 134 ? 25.534  -20.641 45.655  1.00 23.99 ? 136  ARG D NE  1 
ATOM   6819 C  CZ  . ARG D 1 134 ? 24.939  -21.750 46.094  1.00 24.93 ? 136  ARG D CZ  1 
ATOM   6820 N  NH1 . ARG D 1 134 ? 24.794  -22.828 45.325  1.00 24.91 ? 136  ARG D NH1 1 
ATOM   6821 N  NH2 . ARG D 1 134 ? 24.423  -21.760 47.342  1.00 23.88 ? 136  ARG D NH2 1 
ATOM   6822 N  N   . PRO D 1 135 ? 31.108  -18.441 43.095  1.00 23.91 ? 137  PRO D N   1 
ATOM   6823 C  CA  . PRO D 1 135 ? 32.418  -18.153 42.493  1.00 24.57 ? 137  PRO D CA  1 
ATOM   6824 C  C   . PRO D 1 135 ? 33.027  -19.396 41.815  1.00 23.22 ? 137  PRO D C   1 
ATOM   6825 O  O   . PRO D 1 135 ? 33.203  -20.447 42.445  1.00 22.37 ? 137  PRO D O   1 
ATOM   6826 C  CB  . PRO D 1 135 ? 33.268  -17.698 43.674  1.00 25.26 ? 137  PRO D CB  1 
ATOM   6827 C  CG  . PRO D 1 135 ? 32.630  -18.332 44.870  1.00 28.06 ? 137  PRO D CG  1 
ATOM   6828 C  CD  . PRO D 1 135 ? 31.158  -18.413 44.574  1.00 26.08 ? 137  PRO D CD  1 
ATOM   6829 N  N   . GLY D 1 136 ? 33.318  -19.267 40.530  1.00 24.45 ? 138  GLY D N   1 
ATOM   6830 C  CA  . GLY D 1 136 ? 33.896  -20.362 39.771  1.00 23.52 ? 138  GLY D CA  1 
ATOM   6831 C  C   . GLY D 1 136 ? 32.919  -21.471 39.435  1.00 23.14 ? 138  GLY D C   1 
ATOM   6832 O  O   . GLY D 1 136 ? 33.327  -22.536 38.977  1.00 22.83 ? 138  GLY D O   1 
ATOM   6833 N  N   . GLY D 1 137 ? 31.623  -21.231 39.629  1.00 22.40 ? 139  GLY D N   1 
ATOM   6834 C  CA  . GLY D 1 137 ? 30.626  -22.252 39.392  1.00 22.05 ? 139  GLY D CA  1 
ATOM   6835 C  C   . GLY D 1 137 ? 30.554  -22.595 37.910  1.00 22.55 ? 139  GLY D C   1 
ATOM   6836 O  O   . GLY D 1 137 ? 30.479  -23.771 37.532  1.00 20.79 ? 139  GLY D O   1 
ATOM   6837 N  N   . LEU D 1 138 ? 30.554  -21.547 37.093  1.00 22.61 ? 140  LEU D N   1 
ATOM   6838 C  CA  . LEU D 1 138 ? 30.608  -21.637 35.643  1.00 24.43 ? 140  LEU D CA  1 
ATOM   6839 C  C   . LEU D 1 138 ? 31.913  -21.001 35.175  1.00 24.23 ? 140  LEU D C   1 
ATOM   6840 O  O   . LEU D 1 138 ? 32.450  -20.085 35.818  1.00 22.69 ? 140  LEU D O   1 
ATOM   6841 C  CB  . LEU D 1 138 ? 29.422  -20.923 35.012  1.00 25.51 ? 140  LEU D CB  1 
ATOM   6842 C  CG  . LEU D 1 138 ? 28.041  -21.440 35.433  1.00 26.16 ? 140  LEU D CG  1 
ATOM   6843 C  CD1 . LEU D 1 138 ? 26.964  -20.556 34.812  1.00 27.84 ? 140  LEU D CD1 1 
ATOM   6844 C  CD2 . LEU D 1 138 ? 27.829  -22.895 35.028  1.00 26.43 ? 140  LEU D CD2 1 
ATOM   6845 N  N   . ALA D 1 139 ? 32.445  -21.529 34.079  1.00 24.17 ? 141  ALA D N   1 
ATOM   6846 C  CA  . ALA D 1 139 ? 33.673  -21.024 33.467  1.00 23.80 ? 141  ALA D CA  1 
ATOM   6847 C  C   . ALA D 1 139 ? 33.456  -21.029 31.954  1.00 24.64 ? 141  ALA D C   1 
ATOM   6848 O  O   . ALA D 1 139 ? 32.956  -22.022 31.402  1.00 24.05 ? 141  ALA D O   1 
ATOM   6849 C  CB  . ALA D 1 139 ? 34.841  -21.901 33.844  1.00 23.48 ? 141  ALA D CB  1 
ATOM   6850 N  N   . VAL D 1 140 ? 33.754  -19.906 31.299  1.00 23.46 ? 142  VAL D N   1 
ATOM   6851 C  CA  . VAL D 1 140 ? 33.579  -19.786 29.853  1.00 24.82 ? 142  VAL D CA  1 
ATOM   6852 C  C   . VAL D 1 140 ? 34.961  -19.613 29.228  1.00 23.51 ? 142  VAL D C   1 
ATOM   6853 O  O   . VAL D 1 140 ? 35.796  -18.865 29.750  1.00 23.56 ? 142  VAL D O   1 
ATOM   6854 C  CB  . VAL D 1 140 ? 32.638  -18.629 29.447  1.00 25.25 ? 142  VAL D CB  1 
ATOM   6855 C  CG1 . VAL D 1 140 ? 32.333  -18.665 27.954  1.00 25.12 ? 142  VAL D CG1 1 
ATOM   6856 C  CG2 . VAL D 1 140 ? 31.330  -18.702 30.239  1.00 26.53 ? 142  VAL D CG2 1 
ATOM   6857 N  N   . LEU D 1 141 ? 35.213  -20.372 28.167  1.00 24.39 ? 143  LEU D N   1 
ATOM   6858 C  CA  . LEU D 1 141 ? 36.401  -20.171 27.308  1.00 23.56 ? 143  LEU D CA  1 
ATOM   6859 C  C   . LEU D 1 141 ? 35.950  -19.378 26.129  1.00 22.43 ? 143  LEU D C   1 
ATOM   6860 O  O   . LEU D 1 141 ? 35.011  -19.774 25.424  1.00 22.79 ? 143  LEU D O   1 
ATOM   6861 C  CB  . LEU D 1 141 ? 36.969  -21.505 26.827  1.00 24.83 ? 143  LEU D CB  1 
ATOM   6862 C  CG  . LEU D 1 141 ? 37.484  -22.475 27.891  1.00 25.34 ? 143  LEU D CG  1 
ATOM   6863 C  CD1 . LEU D 1 141 ? 38.147  -23.701 27.253  1.00 27.31 ? 143  LEU D CD1 1 
ATOM   6864 C  CD2 . LEU D 1 141 ? 38.446  -21.819 28.856  1.00 26.42 ? 143  LEU D CD2 1 
ATOM   6865 N  N   . ALA D 1 142 ? 36.617  -18.251 25.903  1.00 24.18 ? 144  ALA D N   1 
ATOM   6866 C  CA  . ALA D 1 142 ? 36.223  -17.312 24.860  1.00 24.23 ? 144  ALA D CA  1 
ATOM   6867 C  C   . ALA D 1 142 ? 37.382  -17.116 23.888  1.00 23.79 ? 144  ALA D C   1 
ATOM   6868 O  O   . ALA D 1 142 ? 38.519  -16.952 24.311  1.00 25.89 ? 144  ALA D O   1 
ATOM   6869 C  CB  . ALA D 1 142 ? 35.832  -15.975 25.457  1.00 23.33 ? 144  ALA D CB  1 
ATOM   6870 N  N   . ALA D 1 143 ? 37.068  -17.126 22.602  1.00 26.53 ? 145  ALA D N   1 
ATOM   6871 C  CA  . ALA D 1 143 ? 38.076  -16.861 21.559  1.00 29.33 ? 145  ALA D CA  1 
ATOM   6872 C  C   . ALA D 1 143 ? 37.522  -15.925 20.499  1.00 29.43 ? 145  ALA D C   1 
ATOM   6873 O  O   . ALA D 1 143 ? 36.373  -16.063 20.051  1.00 30.19 ? 145  ALA D O   1 
ATOM   6874 C  CB  . ALA D 1 143 ? 38.556  -18.165 20.928  1.00 29.71 ? 145  ALA D CB  1 
ATOM   6875 N  N   . PHE D 1 144 ? 38.340  -14.957 20.109  1.00 30.56 ? 146  PHE D N   1 
ATOM   6876 C  CA  . PHE D 1 144 ? 37.965  -14.030 19.041  1.00 30.90 ? 146  PHE D CA  1 
ATOM   6877 C  C   . PHE D 1 144 ? 38.076  -14.677 17.668  1.00 30.90 ? 146  PHE D C   1 
ATOM   6878 O  O   . PHE D 1 144 ? 39.030  -15.384 17.416  1.00 32.08 ? 146  PHE D O   1 
ATOM   6879 C  CB  . PHE D 1 144 ? 38.874  -12.819 19.075  1.00 31.15 ? 146  PHE D CB  1 
ATOM   6880 C  CG  . PHE D 1 144 ? 38.762  -12.019 20.325  1.00 30.84 ? 146  PHE D CG  1 
ATOM   6881 C  CD1 . PHE D 1 144 ? 37.560  -11.420 20.662  1.00 32.60 ? 146  PHE D CD1 1 
ATOM   6882 C  CD2 . PHE D 1 144 ? 39.853  -11.846 21.155  1.00 31.84 ? 146  PHE D CD2 1 
ATOM   6883 C  CE1 . PHE D 1 144 ? 37.457  -10.648 21.813  1.00 32.56 ? 146  PHE D CE1 1 
ATOM   6884 C  CE2 . PHE D 1 144 ? 39.757  -11.077 22.305  1.00 32.18 ? 146  PHE D CE2 1 
ATOM   6885 C  CZ  . PHE D 1 144 ? 38.559  -10.475 22.631  1.00 30.45 ? 146  PHE D CZ  1 
ATOM   6886 N  N   . LEU D 1 145 ? 37.086  -14.442 16.807  1.00 33.90 ? 147  LEU D N   1 
ATOM   6887 C  CA  . LEU D 1 145 ? 37.121  -14.877 15.413  1.00 36.17 ? 147  LEU D CA  1 
ATOM   6888 C  C   . LEU D 1 145 ? 37.410  -13.671 14.513  1.00 41.10 ? 147  LEU D C   1 
ATOM   6889 O  O   . LEU D 1 145 ? 36.632  -12.707 14.506  1.00 42.93 ? 147  LEU D O   1 
ATOM   6890 C  CB  . LEU D 1 145 ? 35.804  -15.506 14.988  1.00 34.65 ? 147  LEU D CB  1 
ATOM   6891 C  CG  . LEU D 1 145 ? 35.164  -16.535 15.922  1.00 34.80 ? 147  LEU D CG  1 
ATOM   6892 C  CD1 . LEU D 1 145 ? 34.009  -17.208 15.208  1.00 34.63 ? 147  LEU D CD1 1 
ATOM   6893 C  CD2 . LEU D 1 145 ? 36.149  -17.559 16.438  1.00 35.98 ? 147  LEU D CD2 1 
ATOM   6894 N  N   . GLU D 1 146 ? 38.513  -13.764 13.757  1.00 44.66 ? 148  GLU D N   1 
ATOM   6895 C  CA  . GLU D 1 146 ? 38.999  -12.732 12.811  1.00 45.77 ? 148  GLU D CA  1 
ATOM   6896 C  C   . GLU D 1 146 ? 38.883  -13.200 11.361  1.00 45.67 ? 148  GLU D C   1 
ATOM   6897 O  O   . GLU D 1 146 ? 38.676  -14.385 11.096  1.00 42.70 ? 148  GLU D O   1 
ATOM   6898 C  CB  . GLU D 1 146 ? 40.480  -12.437 13.073  1.00 46.61 ? 148  GLU D CB  1 
ATOM   6899 C  CG  . GLU D 1 146 ? 40.735  -11.266 13.988  1.00 48.81 ? 148  GLU D CG  1 
ATOM   6900 C  CD  . GLU D 1 146 ? 42.209  -11.009 14.219  1.00 49.53 ? 148  GLU D CD  1 
ATOM   6901 O  OE1 . GLU D 1 146 ? 43.018  -11.963 14.171  1.00 51.34 ? 148  GLU D OE1 1 
ATOM   6902 O  OE2 . GLU D 1 146 ? 42.557  -9.840  14.474  1.00 52.13 ? 148  GLU D OE2 1 
ATOM   6903 N  N   . GLU D 1 147 ? 39.053  -12.256 10.432  1.00 46.80 ? 149  GLU D N   1 
ATOM   6904 C  CA  . GLU D 1 147 ? 39.130  -12.562 8.999   1.00 47.55 ? 149  GLU D CA  1 
ATOM   6905 C  C   . GLU D 1 147 ? 40.538  -13.032 8.617   1.00 44.60 ? 149  GLU D C   1 
ATOM   6906 O  O   . GLU D 1 147 ? 41.527  -12.395 8.967   1.00 45.18 ? 149  GLU D O   1 
ATOM   6907 C  CB  . GLU D 1 147 ? 38.748  -11.351 8.147   1.00 51.36 ? 149  GLU D CB  1 
ATOM   6908 C  CG  . GLU D 1 147 ? 38.283  -11.731 6.742   1.00 54.97 ? 149  GLU D CG  1 
ATOM   6909 C  CD  . GLU D 1 147 ? 38.107  -10.535 5.821   1.00 57.43 ? 149  GLU D CD  1 
ATOM   6910 O  OE1 . GLU D 1 147 ? 39.124  -9.917  5.447   1.00 59.76 ? 149  GLU D OE1 1 
ATOM   6911 O  OE2 . GLU D 1 147 ? 36.953  -10.216 5.469   1.00 58.14 ? 149  GLU D OE2 1 
ATOM   6912 N  N   . GLY D 1 148 ? 40.608  -14.162 7.919   1.00 45.24 ? 150  GLY D N   1 
ATOM   6913 C  CA  . GLY D 1 148 ? 41.854  -14.665 7.321   1.00 45.79 ? 150  GLY D CA  1 
ATOM   6914 C  C   . GLY D 1 148 ? 41.612  -15.095 5.883   1.00 44.37 ? 150  GLY D C   1 
ATOM   6915 O  O   . GLY D 1 148 ? 40.472  -15.129 5.442   1.00 45.97 ? 150  GLY D O   1 
ATOM   6916 N  N   . PRO D 1 149 ? 42.684  -15.428 5.144   1.00 45.94 ? 151  PRO D N   1 
ATOM   6917 C  CA  . PRO D 1 149 ? 42.529  -15.779 3.728   1.00 47.44 ? 151  PRO D CA  1 
ATOM   6918 C  C   . PRO D 1 149 ? 41.815  -17.105 3.430   1.00 48.44 ? 151  PRO D C   1 
ATOM   6919 O  O   . PRO D 1 149 ? 41.141  -17.191 2.406   1.00 47.78 ? 151  PRO D O   1 
ATOM   6920 C  CB  . PRO D 1 149 ? 43.976  -15.823 3.217   1.00 47.52 ? 151  PRO D CB  1 
ATOM   6921 C  CG  . PRO D 1 149 ? 44.808  -16.075 4.431   1.00 47.58 ? 151  PRO D CG  1 
ATOM   6922 C  CD  . PRO D 1 149 ? 44.102  -15.378 5.550   1.00 46.50 ? 151  PRO D CD  1 
ATOM   6923 N  N   . GLU D 1 150 ? 41.967  -18.121 4.285   1.00 47.39 ? 152  GLU D N   1 
ATOM   6924 C  CA  . GLU D 1 150 ? 41.464  -19.474 3.982   1.00 48.22 ? 152  GLU D CA  1 
ATOM   6925 C  C   . GLU D 1 150 ? 40.119  -19.785 4.621   1.00 47.64 ? 152  GLU D C   1 
ATOM   6926 O  O   . GLU D 1 150 ? 39.741  -19.189 5.629   1.00 47.52 ? 152  GLU D O   1 
ATOM   6927 C  CB  . GLU D 1 150 ? 42.436  -20.543 4.470   1.00 51.38 ? 152  GLU D CB  1 
ATOM   6928 C  CG  . GLU D 1 150 ? 43.825  -20.502 3.864   1.00 57.45 ? 152  GLU D CG  1 
ATOM   6929 C  CD  . GLU D 1 150 ? 44.760  -21.501 4.535   1.00 61.14 ? 152  GLU D CD  1 
ATOM   6930 O  OE1 . GLU D 1 150 ? 44.431  -22.710 4.545   1.00 65.11 ? 152  GLU D OE1 1 
ATOM   6931 O  OE2 . GLU D 1 150 ? 45.816  -21.079 5.060   1.00 62.67 ? 152  GLU D OE2 1 
ATOM   6932 N  N   . GLU D 1 151 ? 39.429  -20.757 4.029   1.00 46.54 ? 153  GLU D N   1 
ATOM   6933 C  CA  . GLU D 1 151 ? 38.249  -21.381 4.627   1.00 45.98 ? 153  GLU D CA  1 
ATOM   6934 C  C   . GLU D 1 151 ? 38.694  -22.141 5.877   1.00 41.03 ? 153  GLU D C   1 
ATOM   6935 O  O   . GLU D 1 151 ? 39.643  -22.931 5.835   1.00 37.68 ? 153  GLU D O   1 
ATOM   6936 C  CB  . GLU D 1 151 ? 37.576  -22.355 3.636   1.00 50.31 ? 153  GLU D CB  1 
ATOM   6937 C  CG  . GLU D 1 151 ? 36.059  -22.267 3.581   1.00 54.44 ? 153  GLU D CG  1 
ATOM   6938 C  CD  . GLU D 1 151 ? 35.566  -20.932 3.033   1.00 58.91 ? 153  GLU D CD  1 
ATOM   6939 O  OE1 . GLU D 1 151 ? 36.387  -20.048 2.686   1.00 60.69 ? 153  GLU D OE1 1 
ATOM   6940 O  OE2 . GLU D 1 151 ? 34.343  -20.754 2.946   1.00 59.56 ? 153  GLU D OE2 1 
ATOM   6941 N  N   . ASN D 1 152 ? 38.045  -21.857 7.001   1.00 37.88 ? 154  ASN D N   1 
ATOM   6942 C  CA  . ASN D 1 152 ? 38.306  -22.577 8.236   1.00 34.54 ? 154  ASN D CA  1 
ATOM   6943 C  C   . ASN D 1 152 ? 37.514  -23.883 8.238   1.00 32.92 ? 154  ASN D C   1 
ATOM   6944 O  O   . ASN D 1 152 ? 36.297  -23.866 8.101   1.00 34.49 ? 154  ASN D O   1 
ATOM   6945 C  CB  . ASN D 1 152 ? 37.933  -21.711 9.439   1.00 32.66 ? 154  ASN D CB  1 
ATOM   6946 C  CG  . ASN D 1 152 ? 38.309  -22.361 10.752  1.00 29.19 ? 154  ASN D CG  1 
ATOM   6947 O  OD1 . ASN D 1 152 ? 37.826  -23.438 11.059  1.00 31.70 ? 154  ASN D OD1 1 
ATOM   6948 N  ND2 . ASN D 1 152 ? 39.158  -21.718 11.530  1.00 29.38 ? 154  ASN D ND2 1 
ATOM   6949 N  N   . SER D 1 153 ? 38.202  -25.006 8.422   1.00 33.10 ? 155  SER D N   1 
ATOM   6950 C  CA  . SER D 1 153 ? 37.560  -26.324 8.328   1.00 34.99 ? 155  SER D CA  1 
ATOM   6951 C  C   . SER D 1 153 ? 36.631  -26.647 9.480   1.00 32.14 ? 155  SER D C   1 
ATOM   6952 O  O   . SER D 1 153 ? 35.550  -27.201 9.275   1.00 32.13 ? 155  SER D O   1 
ATOM   6953 C  CB  . SER D 1 153 ? 38.616  -27.424 8.266   1.00 36.21 ? 155  SER D CB  1 
ATOM   6954 O  OG  . SER D 1 153 ? 39.345  -27.325 7.072   1.00 39.45 ? 155  SER D OG  1 
ATOM   6955 N  N   . ALA D 1 154 ? 37.098  -26.367 10.689  1.00 32.12 ? 156  ALA D N   1 
ATOM   6956 C  CA  . ALA D 1 154 ? 36.320  -26.619 11.901  1.00 30.42 ? 156  ALA D CA  1 
ATOM   6957 C  C   . ALA D 1 154 ? 34.995  -25.846 11.854  1.00 29.88 ? 156  ALA D C   1 
ATOM   6958 O  O   . ALA D 1 154 ? 33.929  -26.432 11.965  1.00 28.79 ? 156  ALA D O   1 
ATOM   6959 C  CB  . ALA D 1 154 ? 37.141  -26.254 13.120  1.00 31.32 ? 156  ALA D CB  1 
ATOM   6960 N  N   . TYR D 1 155 ? 35.073  -24.554 11.574  1.00 31.40 ? 157  TYR D N   1 
ATOM   6961 C  CA  . TYR D 1 155 ? 33.870  -23.706 11.534  1.00 31.01 ? 157  TYR D CA  1 
ATOM   6962 C  C   . TYR D 1 155 ? 32.900  -24.024 10.407  1.00 32.39 ? 157  TYR D C   1 
ATOM   6963 O  O   . TYR D 1 155 ? 31.687  -23.881 10.602  1.00 31.35 ? 157  TYR D O   1 
ATOM   6964 C  CB  . TYR D 1 155 ? 34.248  -22.227 11.572  1.00 31.60 ? 157  TYR D CB  1 
ATOM   6965 C  CG  . TYR D 1 155 ? 34.628  -21.819 12.964  1.00 30.61 ? 157  TYR D CG  1 
ATOM   6966 C  CD1 . TYR D 1 155 ? 35.902  -22.030 13.441  1.00 29.12 ? 157  TYR D CD1 1 
ATOM   6967 C  CD2 . TYR D 1 155 ? 33.671  -21.295 13.844  1.00 30.39 ? 157  TYR D CD2 1 
ATOM   6968 C  CE1 . TYR D 1 155 ? 36.251  -21.697 14.731  1.00 30.40 ? 157  TYR D CE1 1 
ATOM   6969 C  CE2 . TYR D 1 155 ? 34.019  -20.942 15.134  1.00 30.85 ? 157  TYR D CE2 1 
ATOM   6970 C  CZ  . TYR D 1 155 ? 35.304  -21.149 15.576  1.00 29.81 ? 157  TYR D CZ  1 
ATOM   6971 O  OH  . TYR D 1 155 ? 35.663  -20.836 16.865  1.00 30.10 ? 157  TYR D OH  1 
ATOM   6972 N  N   . GLU D 1 156 ? 33.395  -24.519 9.261   1.00 34.15 ? 158  GLU D N   1 
ATOM   6973 C  CA  A GLU D 1 156 ? 32.514  -24.870 8.129   0.50 34.01 ? 158  GLU D CA  1 
ATOM   6974 C  CA  B GLU D 1 156 ? 32.521  -24.869 8.128   0.50 33.61 ? 158  GLU D CA  1 
ATOM   6975 C  C   . GLU D 1 156 ? 31.490  -25.932 8.527   1.00 33.11 ? 158  GLU D C   1 
ATOM   6976 O  O   . GLU D 1 156 ? 30.384  -25.964 7.992   1.00 34.41 ? 158  GLU D O   1 
ATOM   6977 C  CB  A GLU D 1 156 ? 33.319  -25.329 6.897   0.50 36.71 ? 158  GLU D CB  1 
ATOM   6978 C  CB  B GLU D 1 156 ? 33.355  -25.331 6.919   0.50 35.68 ? 158  GLU D CB  1 
ATOM   6979 C  CG  A GLU D 1 156 ? 32.484  -25.514 5.620   0.50 37.47 ? 158  GLU D CG  1 
ATOM   6980 C  CG  B GLU D 1 156 ? 32.566  -25.616 5.635   0.50 36.07 ? 158  GLU D CG  1 
ATOM   6981 C  CD  A GLU D 1 156 ? 31.954  -26.929 5.470   0.50 36.77 ? 158  GLU D CD  1 
ATOM   6982 C  CD  B GLU D 1 156 ? 31.800  -24.419 5.093   0.50 34.69 ? 158  GLU D CD  1 
ATOM   6983 O  OE1 A GLU D 1 156 ? 32.529  -27.829 6.115   0.50 39.25 ? 158  GLU D OE1 1 
ATOM   6984 O  OE1 B GLU D 1 156 ? 31.962  -23.277 5.588   0.50 33.62 ? 158  GLU D OE1 1 
ATOM   6985 O  OE2 A GLU D 1 156 ? 30.963  -27.142 4.735   0.50 36.22 ? 158  GLU D OE2 1 
ATOM   6986 O  OE2 B GLU D 1 156 ? 31.022  -24.638 4.146   0.50 36.60 ? 158  GLU D OE2 1 
ATOM   6987 N  N   . GLN D 1 157 ? 31.846  -26.795 9.476   1.00 31.38 ? 159  GLN D N   1 
ATOM   6988 C  CA  . GLN D 1 157 ? 30.913  -27.799 9.985   1.00 30.48 ? 159  GLN D CA  1 
ATOM   6989 C  C   . GLN D 1 157 ? 29.666  -27.184 10.638  1.00 32.17 ? 159  GLN D C   1 
ATOM   6990 O  O   . GLN D 1 157 ? 28.582  -27.754 10.559  1.00 32.11 ? 159  GLN D O   1 
ATOM   6991 C  CB  . GLN D 1 157 ? 31.608  -28.697 10.994  1.00 31.10 ? 159  GLN D CB  1 
ATOM   6992 C  CG  . GLN D 1 157 ? 32.756  -29.527 10.423  1.00 30.32 ? 159  GLN D CG  1 
ATOM   6993 C  CD  . GLN D 1 157 ? 33.633  -30.071 11.517  1.00 29.72 ? 159  GLN D CD  1 
ATOM   6994 O  OE1 . GLN D 1 157 ? 34.169  -29.301 12.313  1.00 33.29 ? 159  GLN D OE1 1 
ATOM   6995 N  NE2 . GLN D 1 157 ? 33.783  -31.387 11.584  1.00 27.70 ? 159  GLN D NE2 1 
ATOM   6996 N  N   . LEU D 1 158 ? 29.826  -26.039 11.294  1.00 33.48 ? 160  LEU D N   1 
ATOM   6997 C  CA  . LEU D 1 158 ? 28.687  -25.327 11.884  1.00 34.03 ? 160  LEU D CA  1 
ATOM   6998 C  C   . LEU D 1 158 ? 28.043  -24.384 10.879  1.00 33.86 ? 160  LEU D C   1 
ATOM   6999 O  O   . LEU D 1 158 ? 26.819  -24.369 10.726  1.00 34.53 ? 160  LEU D O   1 
ATOM   7000 C  CB  . LEU D 1 158 ? 29.137  -24.569 13.133  1.00 34.00 ? 160  LEU D CB  1 
ATOM   7001 C  CG  . LEU D 1 158 ? 29.784  -25.453 14.208  1.00 33.69 ? 160  LEU D CG  1 
ATOM   7002 C  CD1 . LEU D 1 158 ? 30.190  -24.622 15.405  1.00 35.50 ? 160  LEU D CD1 1 
ATOM   7003 C  CD2 . LEU D 1 158 ? 28.894  -26.612 14.628  1.00 35.91 ? 160  LEU D CD2 1 
ATOM   7004 N  N   . LEU D 1 159 ? 28.875  -23.632 10.168  1.00 34.74 ? 161  LEU D N   1 
ATOM   7005 C  CA  . LEU D 1 159 ? 28.398  -22.589 9.260   1.00 35.61 ? 161  LEU D CA  1 
ATOM   7006 C  C   . LEU D 1 159 ? 27.584  -23.144 8.101   1.00 36.58 ? 161  LEU D C   1 
ATOM   7007 O  O   . LEU D 1 159 ? 26.578  -22.554 7.702   1.00 37.07 ? 161  LEU D O   1 
ATOM   7008 C  CB  . LEU D 1 159 ? 29.566  -21.752 8.756   1.00 36.02 ? 161  LEU D CB  1 
ATOM   7009 C  CG  . LEU D 1 159 ? 30.342  -21.032 9.864   1.00 37.08 ? 161  LEU D CG  1 
ATOM   7010 C  CD1 . LEU D 1 159 ? 31.520  -20.268 9.273   1.00 37.24 ? 161  LEU D CD1 1 
ATOM   7011 C  CD2 . LEU D 1 159 ? 29.437  -20.114 10.685  1.00 38.85 ? 161  LEU D CD2 1 
ATOM   7012 N  N   . SER D 1 160 ? 27.982  -24.312 7.608   1.00 38.35 ? 162  SER D N   1 
ATOM   7013 C  CA  . SER D 1 160 ? 27.249  -24.973 6.533   1.00 38.26 ? 162  SER D CA  1 
ATOM   7014 C  C   . SER D 1 160 ? 25.859  -25.466 6.940   1.00 39.78 ? 162  SER D C   1 
ATOM   7015 O  O   . SER D 1 160 ? 25.064  -25.814 6.075   1.00 40.22 ? 162  SER D O   1 
ATOM   7016 C  CB  . SER D 1 160 ? 28.074  -26.127 5.968   1.00 37.57 ? 162  SER D CB  1 
ATOM   7017 O  OG  . SER D 1 160 ? 28.224  -27.176 6.914   1.00 37.83 ? 162  SER D OG  1 
ATOM   7018 N  N   . ARG D 1 161 ? 25.560  -25.498 8.241   1.00 41.39 ? 163  ARG D N   1 
ATOM   7019 C  CA  . ARG D 1 161 ? 24.261  -25.943 8.731   1.00 40.90 ? 163  ARG D CA  1 
ATOM   7020 C  C   . ARG D 1 161 ? 23.325  -24.827 9.169   1.00 40.93 ? 163  ARG D C   1 
ATOM   7021 O  O   . ARG D 1 161 ? 22.181  -25.108 9.546   1.00 41.95 ? 163  ARG D O   1 
ATOM   7022 C  CB  . ARG D 1 161 ? 24.456  -26.923 9.896   1.00 44.57 ? 163  ARG D CB  1 
ATOM   7023 C  CG  . ARG D 1 161 ? 25.524  -27.985 9.652   1.00 46.74 ? 163  ARG D CG  1 
ATOM   7024 C  CD  . ARG D 1 161 ? 25.273  -28.794 8.391   1.00 49.09 ? 163  ARG D CD  1 
ATOM   7025 N  NE  . ARG D 1 161 ? 24.548  -30.017 8.691   1.00 52.99 ? 163  ARG D NE  1 
ATOM   7026 C  CZ  . ARG D 1 161 ? 25.018  -31.259 8.551   1.00 57.33 ? 163  ARG D CZ  1 
ATOM   7027 N  NH1 . ARG D 1 161 ? 26.247  -31.509 8.074   1.00 56.42 ? 163  ARG D NH1 1 
ATOM   7028 N  NH2 . ARG D 1 161 ? 24.229  -32.280 8.885   1.00 58.91 ? 163  ARG D NH2 1 
ATOM   7029 N  N   . LEU D 1 162 ? 23.782  -23.577 9.134   1.00 40.01 ? 164  LEU D N   1 
ATOM   7030 C  CA  . LEU D 1 162 ? 22.957  -22.472 9.619   1.00 39.91 ? 164  LEU D CA  1 
ATOM   7031 C  C   . LEU D 1 162 ? 21.723  -22.252 8.751   1.00 43.58 ? 164  LEU D C   1 
ATOM   7032 O  O   . LEU D 1 162 ? 20.683  -21.831 9.256   1.00 43.27 ? 164  LEU D O   1 
ATOM   7033 C  CB  . LEU D 1 162 ? 23.766  -21.187 9.714   1.00 38.16 ? 164  LEU D CB  1 
ATOM   7034 C  CG  . LEU D 1 162 ? 24.913  -21.150 10.709  1.00 38.59 ? 164  LEU D CG  1 
ATOM   7035 C  CD1 . LEU D 1 162 ? 25.528  -19.762 10.685  1.00 37.57 ? 164  LEU D CD1 1 
ATOM   7036 C  CD2 . LEU D 1 162 ? 24.463  -21.511 12.115  1.00 38.40 ? 164  LEU D CD2 1 
ATOM   7037 N  N   . GLU D 1 163 ? 21.835  -22.575 7.462   1.00 46.49 ? 165  GLU D N   1 
ATOM   7038 C  CA  . GLU D 1 163 ? 20.715  -22.488 6.530   1.00 50.07 ? 165  GLU D CA  1 
ATOM   7039 C  C   . GLU D 1 163 ? 19.570  -23.437 6.898   1.00 49.09 ? 165  GLU D C   1 
ATOM   7040 O  O   . GLU D 1 163 ? 18.403  -23.101 6.702   1.00 55.64 ? 165  GLU D O   1 
ATOM   7041 C  CB  . GLU D 1 163 ? 21.198  -22.756 5.097   1.00 53.50 ? 165  GLU D CB  1 
ATOM   7042 C  CG  . GLU D 1 163 ? 20.181  -22.457 4.001   1.00 59.11 ? 165  GLU D CG  1 
ATOM   7043 C  CD  . GLU D 1 163 ? 19.760  -20.996 3.973   1.00 61.99 ? 165  GLU D CD  1 
ATOM   7044 O  OE1 . GLU D 1 163 ? 20.613  -20.137 3.654   1.00 67.27 ? 165  GLU D OE1 1 
ATOM   7045 O  OE2 . GLU D 1 163 ? 18.584  -20.703 4.293   1.00 63.03 ? 165  GLU D OE2 1 
ATOM   7046 N  N   . GLU D 1 164 ? 19.901  -24.596 7.458   1.00 45.97 ? 166  GLU D N   1 
ATOM   7047 C  CA  . GLU D 1 164 ? 18.894  -25.552 7.922   1.00 46.62 ? 166  GLU D CA  1 
ATOM   7048 C  C   . GLU D 1 164 ? 18.102  -25.035 9.136   1.00 45.03 ? 166  GLU D C   1 
ATOM   7049 O  O   . GLU D 1 164 ? 17.000  -25.516 9.392   1.00 44.19 ? 166  GLU D O   1 
ATOM   7050 C  CB  . GLU D 1 164 ? 19.531  -26.880 8.340   1.00 48.92 ? 166  GLU D CB  1 
ATOM   7051 C  CG  . GLU D 1 164 ? 20.430  -27.565 7.316   1.00 53.09 ? 166  GLU D CG  1 
ATOM   7052 C  CD  . GLU D 1 164 ? 21.038  -28.836 7.872   1.00 53.01 ? 166  GLU D CD  1 
ATOM   7053 O  OE1 . GLU D 1 164 ? 20.367  -29.519 8.667   1.00 53.90 ? 166  GLU D OE1 1 
ATOM   7054 O  OE2 . GLU D 1 164 ? 22.192  -29.153 7.525   1.00 60.82 ? 166  GLU D OE2 1 
ATOM   7055 N  N   . ILE D 1 165 ? 18.678  -24.095 9.888   1.00 42.98 ? 167  ILE D N   1 
ATOM   7056 C  CA  . ILE D 1 165 ? 18.059  -23.560 11.110  1.00 43.72 ? 167  ILE D CA  1 
ATOM   7057 C  C   . ILE D 1 165 ? 17.902  -22.023 11.088  1.00 41.69 ? 167  ILE D C   1 
ATOM   7058 O  O   . ILE D 1 165 ? 18.032  -21.358 12.120  1.00 40.05 ? 167  ILE D O   1 
ATOM   7059 C  CB  . ILE D 1 165 ? 18.841  -24.019 12.370  1.00 42.90 ? 167  ILE D CB  1 
ATOM   7060 C  CG1 . ILE D 1 165 ? 20.301  -23.555 12.324  1.00 42.11 ? 167  ILE D CG1 1 
ATOM   7061 C  CG2 . ILE D 1 165 ? 18.757  -25.536 12.496  1.00 44.84 ? 167  ILE D CG2 1 
ATOM   7062 C  CD1 . ILE D 1 165 ? 21.023  -23.629 13.654  1.00 42.58 ? 167  ILE D CD1 1 
ATOM   7063 N  N   . ALA D 1 166 ? 17.600  -21.466 9.915   1.00 41.37 ? 168  ALA D N   1 
ATOM   7064 C  CA  . ALA D 1 166 ? 17.466  -20.004 9.755   1.00 41.84 ? 168  ALA D CA  1 
ATOM   7065 C  C   . ALA D 1 166 ? 16.334  -19.401 10.590  1.00 40.88 ? 168  ALA D C   1 
ATOM   7066 O  O   . ALA D 1 166 ? 16.468  -18.283 11.095  1.00 40.98 ? 168  ALA D O   1 
ATOM   7067 C  CB  . ALA D 1 166 ? 17.263  -19.655 8.292   1.00 42.96 ? 168  ALA D CB  1 
ATOM   7068 N  N   . GLU D 1 167 ? 15.232  -20.146 10.716  1.00 44.42 ? 169  GLU D N   1 
ATOM   7069 C  CA  . GLU D 1 167 ? 14.044  -19.699 11.448  1.00 47.14 ? 169  GLU D CA  1 
ATOM   7070 C  C   . GLU D 1 167 ? 14.296  -19.755 12.954  1.00 47.62 ? 169  GLU D C   1 
ATOM   7071 O  O   . GLU D 1 167 ? 14.702  -20.798 13.469  1.00 46.49 ? 169  GLU D O   1 
ATOM   7072 C  CB  . GLU D 1 167 ? 12.834  -20.574 11.090  1.00 46.97 ? 169  GLU D CB  1 
ATOM   7073 N  N   . GLU D 1 168 ? 14.062  -18.639 13.649  1.00 46.28 ? 170  GLU D N   1 
ATOM   7074 C  CA  . GLU D 1 168 ? 14.181  -18.578 15.110  1.00 48.27 ? 170  GLU D CA  1 
ATOM   7075 C  C   . GLU D 1 168 ? 13.513  -19.800 15.727  1.00 48.13 ? 170  GLU D C   1 
ATOM   7076 O  O   . GLU D 1 168 ? 12.423  -20.184 15.302  1.00 47.87 ? 170  GLU D O   1 
ATOM   7077 C  CB  . GLU D 1 168 ? 13.523  -17.310 15.668  1.00 51.73 ? 170  GLU D CB  1 
ATOM   7078 C  CG  . GLU D 1 168 ? 13.536  -17.208 17.195  1.00 55.61 ? 170  GLU D CG  1 
ATOM   7079 C  CD  . GLU D 1 168 ? 12.720  -16.045 17.737  1.00 59.34 ? 170  GLU D CD  1 
ATOM   7080 O  OE1 . GLU D 1 168 ? 11.590  -15.828 17.254  1.00 63.06 ? 170  GLU D OE1 1 
ATOM   7081 O  OE2 . GLU D 1 168 ? 13.200  -15.360 18.665  1.00 62.06 ? 170  GLU D OE2 1 
ATOM   7082 N  N   . GLY D 1 169 ? 14.180  -20.411 16.711  1.00 46.44 ? 171  GLY D N   1 
ATOM   7083 C  CA  . GLY D 1 169 ? 13.649  -21.578 17.401  1.00 43.30 ? 171  GLY D CA  1 
ATOM   7084 C  C   . GLY D 1 169 ? 13.699  -22.896 16.646  1.00 44.83 ? 171  GLY D C   1 
ATOM   7085 O  O   . GLY D 1 169 ? 13.138  -23.884 17.117  1.00 46.90 ? 171  GLY D O   1 
ATOM   7086 N  N   . SER D 1 170 ? 14.339  -22.942 15.479  1.00 43.78 ? 172  SER D N   1 
ATOM   7087 C  CA  . SER D 1 170 ? 14.456  -24.204 14.734  1.00 42.57 ? 172  SER D CA  1 
ATOM   7088 C  C   . SER D 1 170 ? 15.784  -24.858 15.093  1.00 41.62 ? 172  SER D C   1 
ATOM   7089 O  O   . SER D 1 170 ? 16.709  -24.191 15.571  1.00 39.21 ? 172  SER D O   1 
ATOM   7090 C  CB  . SER D 1 170 ? 14.377  -23.972 13.231  1.00 43.28 ? 172  SER D CB  1 
ATOM   7091 O  OG  . SER D 1 170 ? 15.443  -23.159 12.796  1.00 43.51 ? 172  SER D OG  1 
ATOM   7092 N  N   . GLU D 1 171 ? 15.869  -26.159 14.850  1.00 40.60 ? 173  GLU D N   1 
ATOM   7093 C  CA  . GLU D 1 171 ? 17.051  -26.928 15.210  1.00 41.63 ? 173  GLU D CA  1 
ATOM   7094 C  C   . GLU D 1 171 ? 17.313  -28.084 14.263  1.00 42.40 ? 173  GLU D C   1 
ATOM   7095 O  O   . GLU D 1 171 ? 16.419  -28.539 13.541  1.00 40.56 ? 173  GLU D O   1 
ATOM   7096 C  CB  . GLU D 1 171 ? 16.896  -27.477 16.619  1.00 40.61 ? 173  GLU D CB  1 
ATOM   7097 C  CG  . GLU D 1 171 ? 15.790  -28.500 16.754  1.00 41.48 ? 173  GLU D CG  1 
ATOM   7098 C  CD  . GLU D 1 171 ? 15.703  -29.022 18.154  1.00 44.52 ? 173  GLU D CD  1 
ATOM   7099 O  OE1 . GLU D 1 171 ? 15.187  -28.293 19.019  1.00 47.57 ? 173  GLU D OE1 1 
ATOM   7100 O  OE2 . GLU D 1 171 ? 16.176  -30.143 18.400  1.00 44.51 ? 173  GLU D OE2 1 
ATOM   7101 N  N   . THR D 1 172 ? 18.540  -28.587 14.329  1.00 41.74 ? 174  THR D N   1 
ATOM   7102 C  CA  . THR D 1 172 ? 18.979  -29.693 13.496  1.00 40.59 ? 174  THR D CA  1 
ATOM   7103 C  C   . THR D 1 172 ? 20.013  -30.544 14.255  1.00 38.36 ? 174  THR D C   1 
ATOM   7104 O  O   . THR D 1 172 ? 20.558  -30.123 15.263  1.00 40.03 ? 174  THR D O   1 
ATOM   7105 C  CB  . THR D 1 172 ? 19.515  -29.169 12.134  1.00 40.04 ? 174  THR D CB  1 
ATOM   7106 O  OG1 . THR D 1 172 ? 19.641  -30.251 11.208  1.00 41.51 ? 174  THR D OG1 1 
ATOM   7107 C  CG2 . THR D 1 172 ? 20.841  -28.474 12.270  1.00 38.62 ? 174  THR D CG2 1 
ATOM   7108 N  N   . GLN D 1 173 ? 20.225  -31.759 13.782  1.00 38.22 ? 175  GLN D N   1 
ATOM   7109 C  CA  . GLN D 1 173 ? 21.257  -32.641 14.311  1.00 37.05 ? 175  GLN D CA  1 
ATOM   7110 C  C   . GLN D 1 173 ? 22.451  -32.588 13.375  1.00 36.38 ? 175  GLN D C   1 
ATOM   7111 O  O   . GLN D 1 173 ? 22.276  -32.714 12.160  1.00 36.02 ? 175  GLN D O   1 
ATOM   7112 C  CB  . GLN D 1 173 ? 20.722  -34.064 14.402  1.00 38.95 ? 175  GLN D CB  1 
ATOM   7113 C  CG  . GLN D 1 173 ? 19.567  -34.209 15.377  1.00 40.69 ? 175  GLN D CG  1 
ATOM   7114 C  CD  . GLN D 1 173 ? 20.007  -33.983 16.806  1.00 42.83 ? 175  GLN D CD  1 
ATOM   7115 O  OE1 . GLN D 1 173 ? 19.717  -32.947 17.400  1.00 42.35 ? 175  GLN D OE1 1 
ATOM   7116 N  NE2 . GLN D 1 173 ? 20.743  -34.941 17.354  1.00 43.25 ? 175  GLN D NE2 1 
ATOM   7117 N  N   . VAL D 1 174 ? 23.653  -32.382 13.925  1.00 33.14 ? 176  VAL D N   1 
ATOM   7118 C  CA  . VAL D 1 174 ? 24.885  -32.344 13.116  1.00 31.60 ? 176  VAL D CA  1 
ATOM   7119 C  C   . VAL D 1 174 ? 25.814  -33.491 13.491  1.00 31.23 ? 176  VAL D C   1 
ATOM   7120 O  O   . VAL D 1 174 ? 25.761  -33.982 14.611  1.00 28.97 ? 176  VAL D O   1 
ATOM   7121 C  CB  . VAL D 1 174 ? 25.634  -30.989 13.192  1.00 33.22 ? 176  VAL D CB  1 
ATOM   7122 C  CG1 . VAL D 1 174 ? 24.702  -29.871 12.759  1.00 33.48 ? 176  VAL D CG1 1 
ATOM   7123 C  CG2 . VAL D 1 174 ? 26.198  -30.690 14.583  1.00 31.46 ? 176  VAL D CG2 1 
ATOM   7124 N  N   . PRO D 1 175 ? 26.646  -33.955 12.537  1.00 31.33 ? 177  PRO D N   1 
ATOM   7125 C  CA  . PRO D 1 175 ? 27.684  -34.919 12.896  1.00 31.98 ? 177  PRO D CA  1 
ATOM   7126 C  C   . PRO D 1 175 ? 28.595  -34.419 14.016  1.00 29.65 ? 177  PRO D C   1 
ATOM   7127 O  O   . PRO D 1 175 ? 28.797  -33.217 14.154  1.00 28.60 ? 177  PRO D O   1 
ATOM   7128 C  CB  . PRO D 1 175 ? 28.489  -35.044 11.606  1.00 32.22 ? 177  PRO D CB  1 
ATOM   7129 C  CG  . PRO D 1 175 ? 27.464  -34.874 10.546  1.00 34.46 ? 177  PRO D CG  1 
ATOM   7130 C  CD  . PRO D 1 175 ? 26.535  -33.813 11.073  1.00 34.26 ? 177  PRO D CD  1 
ATOM   7131 N  N   . GLY D 1 176 ? 29.109  -35.347 14.819  1.00 30.25 ? 178  GLY D N   1 
ATOM   7132 C  CA  . GLY D 1 176 ? 30.185  -35.046 15.748  1.00 31.23 ? 178  GLY D CA  1 
ATOM   7133 C  C   . GLY D 1 176 ? 31.367  -34.365 15.070  1.00 30.87 ? 178  GLY D C   1 
ATOM   7134 O  O   . GLY D 1 176 ? 31.663  -34.604 13.892  1.00 32.43 ? 178  GLY D O   1 
ATOM   7135 N  N   . LEU D 1 177 ? 32.023  -33.488 15.819  1.00 30.54 ? 179  LEU D N   1 
ATOM   7136 C  CA  . LEU D 1 177 ? 33.176  -32.752 15.331  1.00 27.63 ? 179  LEU D CA  1 
ATOM   7137 C  C   . LEU D 1 177 ? 34.174  -32.577 16.455  1.00 27.27 ? 179  LEU D C   1 
ATOM   7138 O  O   . LEU D 1 177 ? 33.833  -32.706 17.653  1.00 25.39 ? 179  LEU D O   1 
ATOM   7139 C  CB  . LEU D 1 177 ? 32.757  -31.390 14.755  1.00 27.23 ? 179  LEU D CB  1 
ATOM   7140 C  CG  . LEU D 1 177 ? 32.075  -30.417 15.728  1.00 27.64 ? 179  LEU D CG  1 
ATOM   7141 C  CD1 . LEU D 1 177 ? 32.438  -28.976 15.410  1.00 28.42 ? 179  LEU D CD1 1 
ATOM   7142 C  CD2 . LEU D 1 177 ? 30.553  -30.609 15.744  1.00 29.59 ? 179  LEU D CD2 1 
ATOM   7143 N  N   . ASP D 1 178 ? 35.414  -32.294 16.083  1.00 25.74 ? 180  ASP D N   1 
ATOM   7144 C  CA  . ASP D 1 178 ? 36.431  -31.989 17.071  1.00 27.03 ? 180  ASP D CA  1 
ATOM   7145 C  C   . ASP D 1 178 ? 36.217  -30.570 17.586  1.00 25.12 ? 180  ASP D C   1 
ATOM   7146 O  O   . ASP D 1 178 ? 36.513  -29.586 16.895  1.00 24.70 ? 180  ASP D O   1 
ATOM   7147 C  CB  . ASP D 1 178 ? 37.833  -32.127 16.463  1.00 28.30 ? 180  ASP D CB  1 
ATOM   7148 C  CG  . ASP D 1 178 ? 38.945  -31.884 17.476  1.00 30.18 ? 180  ASP D CG  1 
ATOM   7149 O  OD1 . ASP D 1 178 ? 38.686  -31.506 18.652  1.00 30.16 ? 180  ASP D OD1 1 
ATOM   7150 O  OD2 . ASP D 1 178 ? 40.100  -32.059 17.072  1.00 30.79 ? 180  ASP D OD2 1 
ATOM   7151 N  N   . ILE D 1 179 ? 35.743  -30.473 18.824  1.00 24.80 ? 181  ILE D N   1 
ATOM   7152 C  CA  . ILE D 1 179 ? 35.420  -29.188 19.418  1.00 24.32 ? 181  ILE D CA  1 
ATOM   7153 C  C   . ILE D 1 179 ? 36.694  -28.365 19.670  1.00 23.65 ? 181  ILE D C   1 
ATOM   7154 O  O   . ILE D 1 179 ? 36.688  -27.139 19.523  1.00 23.28 ? 181  ILE D O   1 
ATOM   7155 C  CB  . ILE D 1 179 ? 34.577  -29.376 20.707  1.00 24.05 ? 181  ILE D CB  1 
ATOM   7156 C  CG1 . ILE D 1 179 ? 33.284  -30.170 20.400  1.00 24.98 ? 181  ILE D CG1 1 
ATOM   7157 C  CG2 . ILE D 1 179 ? 34.239  -28.037 21.338  1.00 24.55 ? 181  ILE D CG2 1 
ATOM   7158 C  CD1 . ILE D 1 179 ? 32.310  -29.489 19.471  1.00 26.63 ? 181  ILE D CD1 1 
ATOM   7159 N  N   . SER D 1 180 ? 37.782  -29.044 20.000  1.00 22.44 ? 182  SER D N   1 
ATOM   7160 C  CA  . SER D 1 180 ? 39.057  -28.382 20.290  1.00 23.43 ? 182  SER D CA  1 
ATOM   7161 C  C   . SER D 1 180 ? 39.690  -27.688 19.073  1.00 23.81 ? 182  SER D C   1 
ATOM   7162 O  O   . SER D 1 180 ? 40.498  -26.770 19.243  1.00 24.14 ? 182  SER D O   1 
ATOM   7163 C  CB  . SER D 1 180 ? 40.040  -29.367 20.891  1.00 23.88 ? 182  SER D CB  1 
ATOM   7164 O  OG  . SER D 1 180 ? 40.435  -30.324 19.929  1.00 25.54 ? 182  SER D OG  1 
ATOM   7165 N  N   . ALA D 1 181 ? 39.322  -28.118 17.870  1.00 25.06 ? 183  ALA D N   1 
ATOM   7166 C  CA  . ALA D 1 181 ? 39.787  -27.491 16.616  1.00 25.94 ? 183  ALA D CA  1 
ATOM   7167 C  C   . ALA D 1 181 ? 39.171  -26.117 16.366  1.00 26.28 ? 183  ALA D C   1 
ATOM   7168 O  O   . ALA D 1 181 ? 39.652  -25.382 15.504  1.00 24.69 ? 183  ALA D O   1 
ATOM   7169 C  CB  . ALA D 1 181 ? 39.481  -28.396 15.431  1.00 26.09 ? 183  ALA D CB  1 
ATOM   7170 N  N   . LEU D 1 182 ? 38.097  -25.773 17.090  1.00 25.76 ? 184  LEU D N   1 
ATOM   7171 C  CA  . LEU D 1 182 ? 37.480  -24.447 16.999  1.00 26.14 ? 184  LEU D CA  1 
ATOM   7172 C  C   . LEU D 1 182 ? 38.244  -23.390 17.775  1.00 25.37 ? 184  LEU D C   1 
ATOM   7173 O  O   . LEU D 1 182 ? 37.910  -22.203 17.703  1.00 27.23 ? 184  LEU D O   1 
ATOM   7174 C  CB  . LEU D 1 182 ? 36.039  -24.479 17.545  1.00 26.20 ? 184  LEU D CB  1 
ATOM   7175 C  CG  . LEU D 1 182 ? 35.058  -25.417 16.858  1.00 26.70 ? 184  LEU D CG  1 
ATOM   7176 C  CD1 . LEU D 1 182 ? 33.827  -25.708 17.723  1.00 26.52 ? 184  LEU D CD1 1 
ATOM   7177 C  CD2 . LEU D 1 182 ? 34.650  -24.832 15.508  1.00 26.79 ? 184  LEU D CD2 1 
ATOM   7178 N  N   . LEU D 1 183 ? 39.245  -23.808 18.531  1.00 24.88 ? 185  LEU D N   1 
ATOM   7179 C  CA  . LEU D 1 183 ? 39.927  -22.932 19.459  1.00 26.49 ? 185  LEU D CA  1 
ATOM   7180 C  C   . LEU D 1 183 ? 41.330  -22.581 18.963  1.00 27.71 ? 185  LEU D C   1 
ATOM   7181 O  O   . LEU D 1 183 ? 41.885  -23.288 18.097  1.00 27.89 ? 185  LEU D O   1 
ATOM   7182 C  CB  . LEU D 1 183 ? 39.972  -23.591 20.834  1.00 25.91 ? 185  LEU D CB  1 
ATOM   7183 C  CG  . LEU D 1 183 ? 38.592  -23.902 21.417  1.00 27.75 ? 185  LEU D CG  1 
ATOM   7184 C  CD1 . LEU D 1 183 ? 38.769  -24.657 22.720  1.00 28.60 ? 185  LEU D CD1 1 
ATOM   7185 C  CD2 . LEU D 1 183 ? 37.741  -22.652 21.620  1.00 28.47 ? 185  LEU D CD2 1 
ATOM   7186 N  N   . PRO D 1 184 ? 41.922  -21.497 19.505  1.00 28.76 ? 186  PRO D N   1 
ATOM   7187 C  CA  . PRO D 1 184 ? 43.254  -21.069 19.062  1.00 29.38 ? 186  PRO D CA  1 
ATOM   7188 C  C   . PRO D 1 184 ? 44.359  -22.065 19.307  1.00 28.12 ? 186  PRO D C   1 
ATOM   7189 O  O   . PRO D 1 184 ? 44.177  -23.071 19.983  1.00 28.87 ? 186  PRO D O   1 
ATOM   7190 C  CB  . PRO D 1 184 ? 43.508  -19.810 19.899  1.00 30.36 ? 186  PRO D CB  1 
ATOM   7191 C  CG  . PRO D 1 184 ? 42.143  -19.297 20.181  1.00 28.95 ? 186  PRO D CG  1 
ATOM   7192 C  CD  . PRO D 1 184 ? 41.373  -20.538 20.483  1.00 28.84 ? 186  PRO D CD  1 
ATOM   7193 N  N   . SER D 1 185 ? 45.527  -21.749 18.784  1.00 28.48 ? 187  SER D N   1 
ATOM   7194 C  CA  . SER D 1 185 ? 46.655  -22.664 18.827  1.00 28.37 ? 187  SER D CA  1 
ATOM   7195 C  C   . SER D 1 185 ? 47.305  -22.883 20.186  1.00 27.58 ? 187  SER D C   1 
ATOM   7196 O  O   . SER D 1 185 ? 47.649  -24.012 20.523  1.00 28.77 ? 187  SER D O   1 
ATOM   7197 C  CB  . SER D 1 185 ? 47.739  -22.227 17.824  1.00 28.97 ? 187  SER D CB  1 
ATOM   7198 O  OG  . SER D 1 185 ? 48.911  -22.958 18.113  1.00 29.93 ? 187  SER D OG  1 
ATOM   7199 N  N   . ASP D 1 186 ? 47.512  -21.814 20.954  1.00 28.09 ? 188  ASP D N   1 
ATOM   7200 C  CA  . ASP D 1 186 ? 48.306  -21.868 22.182  1.00 28.56 ? 188  ASP D CA  1 
ATOM   7201 C  C   . ASP D 1 186 ? 47.417  -21.789 23.439  1.00 28.99 ? 188  ASP D C   1 
ATOM   7202 O  O   . ASP D 1 186 ? 46.874  -20.721 23.767  1.00 27.52 ? 188  ASP D O   1 
ATOM   7203 C  CB  . ASP D 1 186 ? 49.307  -20.713 22.198  1.00 30.41 ? 188  ASP D CB  1 
ATOM   7204 C  CG  . ASP D 1 186 ? 50.401  -20.878 23.249  1.00 32.23 ? 188  ASP D CG  1 
ATOM   7205 O  OD1 . ASP D 1 186 ? 50.321  -21.709 24.191  1.00 33.23 ? 188  ASP D OD1 1 
ATOM   7206 O  OD2 . ASP D 1 186 ? 51.392  -20.134 23.126  1.00 35.93 ? 188  ASP D OD2 1 
ATOM   7207 N  N   . PHE D 1 187 ? 47.319  -22.907 24.150  1.00 26.61 ? 189  PHE D N   1 
ATOM   7208 C  CA  . PHE D 1 187 ? 46.498  -23.006 25.376  1.00 27.34 ? 189  PHE D CA  1 
ATOM   7209 C  C   . PHE D 1 187 ? 47.193  -22.460 26.630  1.00 27.87 ? 189  PHE D C   1 
ATOM   7210 O  O   . PHE D 1 187 ? 46.609  -22.502 27.729  1.00 26.39 ? 189  PHE D O   1 
ATOM   7211 C  CB  . PHE D 1 187 ? 46.107  -24.489 25.612  1.00 26.68 ? 189  PHE D CB  1 
ATOM   7212 C  CG  . PHE D 1 187 ? 44.996  -25.012 24.719  1.00 24.62 ? 189  PHE D CG  1 
ATOM   7213 C  CD1 . PHE D 1 187 ? 44.477  -24.292 23.640  1.00 24.19 ? 189  PHE D CD1 1 
ATOM   7214 C  CD2 . PHE D 1 187 ? 44.507  -26.290 24.950  1.00 23.45 ? 189  PHE D CD2 1 
ATOM   7215 C  CE1 . PHE D 1 187 ? 43.475  -24.817 22.845  1.00 25.08 ? 189  PHE D CE1 1 
ATOM   7216 C  CE2 . PHE D 1 187 ? 43.503  -26.818 24.162  1.00 24.35 ? 189  PHE D CE2 1 
ATOM   7217 C  CZ  . PHE D 1 187 ? 42.987  -26.090 23.103  1.00 23.59 ? 189  PHE D CZ  1 
ATOM   7218 N  N   . SER D 1 188 ? 48.436  -21.988 26.495  1.00 28.05 ? 190  SER D N   1 
ATOM   7219 C  CA  . SER D 1 188 ? 49.156  -21.359 27.606  1.00 28.60 ? 190  SER D CA  1 
ATOM   7220 C  C   . SER D 1 188 ? 49.034  -19.832 27.622  1.00 28.06 ? 190  SER D C   1 
ATOM   7221 O  O   . SER D 1 188 ? 49.552  -19.202 28.553  1.00 31.47 ? 190  SER D O   1 
ATOM   7222 C  CB  . SER D 1 188 ? 50.637  -21.766 27.587  1.00 28.86 ? 190  SER D CB  1 
ATOM   7223 O  OG  . SER D 1 188 ? 51.347  -21.003 26.611  1.00 27.77 ? 190  SER D OG  1 
ATOM   7224 N  N   . ARG D 1 189 ? 48.387  -19.249 26.612  1.00 28.32 ? 191  ARG D N   1 
ATOM   7225 C  CA  . ARG D 1 189 ? 48.321  -17.788 26.418  1.00 30.04 ? 191  ARG D CA  1 
ATOM   7226 C  C   . ARG D 1 189 ? 46.898  -17.278 26.484  1.00 27.50 ? 191  ARG D C   1 
ATOM   7227 O  O   . ARG D 1 189 ? 46.137  -17.349 25.508  1.00 28.27 ? 191  ARG D O   1 
ATOM   7228 C  CB  . ARG D 1 189 ? 48.949  -17.343 25.073  1.00 31.59 ? 191  ARG D CB  1 
ATOM   7229 C  CG  . ARG D 1 189 ? 50.470  -17.448 25.024  1.00 34.43 ? 191  ARG D CG  1 
ATOM   7230 C  CD  . ARG D 1 189 ? 51.019  -16.986 23.665  1.00 34.80 ? 191  ARG D CD  1 
ATOM   7231 N  NE  . ARG D 1 189 ? 50.995  -15.529 23.531  1.00 37.71 ? 191  ARG D NE  1 
ATOM   7232 C  CZ  . ARG D 1 189 ? 51.885  -14.694 24.081  1.00 37.47 ? 191  ARG D CZ  1 
ATOM   7233 N  NH1 . ARG D 1 189 ? 52.896  -15.146 24.813  1.00 39.04 ? 191  ARG D NH1 1 
ATOM   7234 N  NH2 . ARG D 1 189 ? 51.766  -13.384 23.894  1.00 40.49 ? 191  ARG D NH2 1 
ATOM   7235 N  N   . TYR D 1 190 ? 46.553  -16.692 27.626  1.00 26.86 ? 192  TYR D N   1 
ATOM   7236 C  CA  . TYR D 1 190 ? 45.186  -16.235 27.834  1.00 25.72 ? 192  TYR D CA  1 
ATOM   7237 C  C   . TYR D 1 190 ? 45.066  -15.130 28.883  1.00 25.17 ? 192  TYR D C   1 
ATOM   7238 O  O   . TYR D 1 190 ? 45.947  -14.935 29.727  1.00 25.38 ? 192  TYR D O   1 
ATOM   7239 C  CB  . TYR D 1 190 ? 44.268  -17.420 28.197  1.00 24.39 ? 192  TYR D CB  1 
ATOM   7240 C  CG  . TYR D 1 190 ? 44.703  -18.217 29.396  1.00 24.31 ? 192  TYR D CG  1 
ATOM   7241 C  CD1 . TYR D 1 190 ? 44.412  -17.779 30.702  1.00 24.54 ? 192  TYR D CD1 1 
ATOM   7242 C  CD2 . TYR D 1 190 ? 45.380  -19.435 29.255  1.00 23.93 ? 192  TYR D CD2 1 
ATOM   7243 C  CE1 . TYR D 1 190 ? 44.801  -18.518 31.806  1.00 22.51 ? 192  TYR D CE1 1 
ATOM   7244 C  CE2 . TYR D 1 190 ? 45.782  -20.166 30.367  1.00 23.17 ? 192  TYR D CE2 1 
ATOM   7245 C  CZ  . TYR D 1 190 ? 45.463  -19.701 31.647  1.00 23.00 ? 192  TYR D CZ  1 
ATOM   7246 O  OH  . TYR D 1 190 ? 45.818  -20.386 32.781  1.00 22.08 ? 192  TYR D OH  1 
ATOM   7247 N  N   . PHE D 1 191 ? 43.966  -14.405 28.778  1.00 28.39 ? 193  PHE D N   1 
ATOM   7248 C  CA  . PHE D 1 191 ? 43.538  -13.473 29.817  1.00 30.10 ? 193  PHE D CA  1 
ATOM   7249 C  C   . PHE D 1 191 ? 42.500  -14.194 30.698  1.00 30.37 ? 193  PHE D C   1 
ATOM   7250 O  O   . PHE D 1 191 ? 41.776  -15.058 30.208  1.00 26.38 ? 193  PHE D O   1 
ATOM   7251 C  CB  . PHE D 1 191 ? 42.937  -12.234 29.179  1.00 31.51 ? 193  PHE D CB  1 
ATOM   7252 C  CG  . PHE D 1 191 ? 43.916  -11.468 28.336  1.00 34.16 ? 193  PHE D CG  1 
ATOM   7253 C  CD1 . PHE D 1 191 ? 45.023  -10.862 28.927  1.00 34.52 ? 193  PHE D CD1 1 
ATOM   7254 C  CD2 . PHE D 1 191 ? 43.762  -11.386 26.956  1.00 34.33 ? 193  PHE D CD2 1 
ATOM   7255 C  CE1 . PHE D 1 191 ? 45.949  -10.165 28.155  1.00 36.91 ? 193  PHE D CE1 1 
ATOM   7256 C  CE2 . PHE D 1 191 ? 44.688  -10.689 26.179  1.00 36.61 ? 193  PHE D CE2 1 
ATOM   7257 C  CZ  . PHE D 1 191 ? 45.776  -10.072 26.784  1.00 36.20 ? 193  PHE D CZ  1 
ATOM   7258 N  N   . GLN D 1 192 ? 42.441  -13.838 31.986  1.00 29.03 ? 194  GLN D N   1 
ATOM   7259 C  CA  . GLN D 1 192 ? 41.441  -14.412 32.895  1.00 26.69 ? 194  GLN D CA  1 
ATOM   7260 C  C   . GLN D 1 192 ? 40.972  -13.383 33.931  1.00 26.57 ? 194  GLN D C   1 
ATOM   7261 O  O   . GLN D 1 192 ? 41.790  -12.683 34.540  1.00 26.74 ? 194  GLN D O   1 
ATOM   7262 C  CB  . GLN D 1 192 ? 42.019  -15.631 33.577  1.00 26.03 ? 194  GLN D CB  1 
ATOM   7263 C  CG  . GLN D 1 192 ? 41.037  -16.477 34.366  1.00 25.99 ? 194  GLN D CG  1 
ATOM   7264 C  CD  . GLN D 1 192 ? 41.655  -17.755 34.823  1.00 24.81 ? 194  GLN D CD  1 
ATOM   7265 O  OE1 . GLN D 1 192 ? 42.295  -17.821 35.868  1.00 25.65 ? 194  GLN D OE1 1 
ATOM   7266 N  NE2 . GLN D 1 192 ? 41.492  -18.797 34.020  1.00 27.49 ? 194  GLN D NE2 1 
ATOM   7267 N  N   . TYR D 1 193 ? 39.654  -13.305 34.099  1.00 26.40 ? 195  TYR D N   1 
ATOM   7268 C  CA  . TYR D 1 193 ? 39.025  -12.487 35.144  1.00 26.21 ? 195  TYR D CA  1 
ATOM   7269 C  C   . TYR D 1 193 ? 37.717  -13.157 35.553  1.00 27.96 ? 195  TYR D C   1 
ATOM   7270 O  O   . TYR D 1 193 ? 37.248  -14.097 34.891  1.00 26.31 ? 195  TYR D O   1 
ATOM   7271 C  CB  . TYR D 1 193 ? 38.786  -11.047 34.631  1.00 25.54 ? 195  TYR D CB  1 
ATOM   7272 C  CG  . TYR D 1 193 ? 37.645  -10.897 33.668  1.00 24.67 ? 195  TYR D CG  1 
ATOM   7273 C  CD1 . TYR D 1 193 ? 37.793  -11.236 32.313  1.00 24.27 ? 195  TYR D CD1 1 
ATOM   7274 C  CD2 . TYR D 1 193 ? 36.400  -10.440 34.095  1.00 24.41 ? 195  TYR D CD2 1 
ATOM   7275 C  CE1 . TYR D 1 193 ? 36.740  -11.129 31.430  1.00 23.55 ? 195  TYR D CE1 1 
ATOM   7276 C  CE2 . TYR D 1 193 ? 35.343  -10.323 33.210  1.00 25.09 ? 195  TYR D CE2 1 
ATOM   7277 C  CZ  . TYR D 1 193 ? 35.519  -10.669 31.875  1.00 23.67 ? 195  TYR D CZ  1 
ATOM   7278 O  OH  . TYR D 1 193 ? 34.464  -10.555 31.000  1.00 25.82 ? 195  TYR D OH  1 
ATOM   7279 N  N   . GLU D 1 194 ? 37.114  -12.647 36.626  1.00 29.18 ? 196  GLU D N   1 
ATOM   7280 C  CA  . GLU D 1 194 ? 35.834  -13.137 37.084  1.00 30.68 ? 196  GLU D CA  1 
ATOM   7281 C  C   . GLU D 1 194 ? 34.750  -12.109 36.792  1.00 29.22 ? 196  GLU D C   1 
ATOM   7282 O  O   . GLU D 1 194 ? 34.898  -10.936 37.094  1.00 30.97 ? 196  GLU D O   1 
ATOM   7283 C  CB  . GLU D 1 194 ? 35.915  -13.484 38.566  1.00 33.11 ? 196  GLU D CB  1 
ATOM   7284 C  CG  . GLU D 1 194 ? 34.735  -14.311 39.042  1.00 37.80 ? 196  GLU D CG  1 
ATOM   7285 C  CD  . GLU D 1 194 ? 34.916  -14.826 40.462  1.00 41.72 ? 196  GLU D CD  1 
ATOM   7286 O  OE1 . GLU D 1 194 ? 36.009  -15.345 40.796  1.00 42.26 ? 196  GLU D OE1 1 
ATOM   7287 O  OE2 . GLU D 1 194 ? 33.952  -14.700 41.237  1.00 46.20 ? 196  GLU D OE2 1 
ATOM   7288 N  N   . GLY D 1 195 ? 33.675  -12.551 36.165  1.00 26.72 ? 197  GLY D N   1 
ATOM   7289 C  CA  . GLY D 1 195 ? 32.589  -11.676 35.769  1.00 26.65 ? 197  GLY D CA  1 
ATOM   7290 C  C   . GLY D 1 195 ? 31.260  -12.395 35.785  1.00 27.01 ? 197  GLY D C   1 
ATOM   7291 O  O   . GLY D 1 195 ? 30.957  -13.125 36.749  1.00 26.95 ? 197  GLY D O   1 
ATOM   7292 N  N   . SER D 1 196 ? 30.483  -12.199 34.719  1.00 26.07 ? 198  SER D N   1 
ATOM   7293 C  CA  . SER D 1 196 ? 29.090  -12.629 34.652  1.00 26.48 ? 198  SER D CA  1 
ATOM   7294 C  C   . SER D 1 196 ? 28.757  -13.308 33.348  1.00 26.46 ? 198  SER D C   1 
ATOM   7295 O  O   . SER D 1 196 ? 29.574  -13.325 32.414  1.00 27.19 ? 198  SER D O   1 
ATOM   7296 C  CB  . SER D 1 196 ? 28.153  -11.415 34.843  1.00 26.72 ? 198  SER D CB  1 
ATOM   7297 O  OG  . SER D 1 196 ? 27.948  -10.647 33.644  1.00 26.39 ? 198  SER D OG  1 
ATOM   7298 N  N   . LEU D 1 197 ? 27.544  -13.846 33.283  1.00 25.22 ? 199  LEU D N   1 
ATOM   7299 C  CA  . LEU D 1 197 ? 26.914  -14.171 32.017  1.00 26.30 ? 199  LEU D CA  1 
ATOM   7300 C  C   . LEU D 1 197 ? 26.697  -12.833 31.249  1.00 30.57 ? 199  LEU D C   1 
ATOM   7301 O  O   . LEU D 1 197 ? 26.430  -11.780 31.870  1.00 27.77 ? 199  LEU D O   1 
ATOM   7302 C  CB  . LEU D 1 197 ? 25.576  -14.874 32.240  1.00 27.23 ? 199  LEU D CB  1 
ATOM   7303 C  CG  . LEU D 1 197 ? 25.515  -16.196 33.021  1.00 28.96 ? 199  LEU D CG  1 
ATOM   7304 C  CD1 . LEU D 1 197 ? 24.101  -16.750 33.008  1.00 27.95 ? 199  LEU D CD1 1 
ATOM   7305 C  CD2 . LEU D 1 197 ? 26.468  -17.215 32.416  1.00 28.44 ? 199  LEU D CD2 1 
ATOM   7306 N  N   . THR D 1 198 ? 26.839  -12.865 29.922  1.00 29.86 ? 200  THR D N   1 
ATOM   7307 C  CA  . THR D 1 198 ? 26.667  -11.660 29.093  1.00 30.16 ? 200  THR D CA  1 
ATOM   7308 C  C   . THR D 1 198 ? 25.235  -11.453 28.591  1.00 30.85 ? 200  THR D C   1 
ATOM   7309 O  O   . THR D 1 198 ? 24.975  -10.498 27.835  1.00 31.57 ? 200  THR D O   1 
ATOM   7310 C  CB  . THR D 1 198 ? 27.624  -11.653 27.875  1.00 29.86 ? 200  THR D CB  1 
ATOM   7311 O  OG1 . THR D 1 198 ? 27.179  -12.624 26.925  1.00 31.50 ? 200  THR D OG1 1 
ATOM   7312 C  CG2 . THR D 1 198 ? 29.022  -11.926 28.294  1.00 28.12 ? 200  THR D CG2 1 
ATOM   7313 N  N   . THR D 1 199 ? 24.315  -12.345 28.967  1.00 29.99 ? 201  THR D N   1 
ATOM   7314 C  CA  . THR D 1 199 ? 22.892  -12.150 28.761  1.00 32.22 ? 201  THR D CA  1 
ATOM   7315 C  C   . THR D 1 199 ? 22.182  -12.319 30.105  1.00 32.79 ? 201  THR D C   1 
ATOM   7316 O  O   . THR D 1 199 ? 22.789  -12.829 31.057  1.00 29.79 ? 201  THR D O   1 
ATOM   7317 C  CB  . THR D 1 199 ? 22.301  -13.171 27.782  1.00 34.57 ? 201  THR D CB  1 
ATOM   7318 O  OG1 . THR D 1 199 ? 22.299  -14.474 28.377  1.00 33.45 ? 201  THR D OG1 1 
ATOM   7319 C  CG2 . THR D 1 199 ? 23.100  -13.206 26.477  1.00 35.77 ? 201  THR D CG2 1 
ATOM   7320 N  N   . PRO D 1 200 ? 20.897  -11.914 30.188  1.00 34.13 ? 202  PRO D N   1 
ATOM   7321 C  CA  . PRO D 1 200 ? 20.131  -12.292 31.369  1.00 33.94 ? 202  PRO D CA  1 
ATOM   7322 C  C   . PRO D 1 200 ? 20.174  -13.831 31.528  1.00 33.90 ? 202  PRO D C   1 
ATOM   7323 O  O   . PRO D 1 200 ? 20.141  -14.542 30.520  1.00 33.95 ? 202  PRO D O   1 
ATOM   7324 C  CB  . PRO D 1 200 ? 18.730  -11.759 31.066  1.00 34.11 ? 202  PRO D CB  1 
ATOM   7325 C  CG  . PRO D 1 200 ? 18.977  -10.577 30.185  1.00 34.82 ? 202  PRO D CG  1 
ATOM   7326 C  CD  . PRO D 1 200 ? 20.138  -10.990 29.323  1.00 35.82 ? 202  PRO D CD  1 
ATOM   7327 N  N   . PRO D 1 201 ? 20.275  -14.352 32.749  1.00 32.33 ? 203  PRO D N   1 
ATOM   7328 C  CA  . PRO D 1 201 ? 20.051  -13.623 34.004  1.00 31.75 ? 203  PRO D CA  1 
ATOM   7329 C  C   . PRO D 1 201 ? 21.262  -12.869 34.562  1.00 30.46 ? 203  PRO D C   1 
ATOM   7330 O  O   . PRO D 1 201 ? 21.192  -12.395 35.691  1.00 28.83 ? 203  PRO D O   1 
ATOM   7331 C  CB  . PRO D 1 201 ? 19.642  -14.757 34.951  1.00 31.53 ? 203  PRO D CB  1 
ATOM   7332 C  CG  . PRO D 1 201 ? 20.500  -15.888 34.491  1.00 29.95 ? 203  PRO D CG  1 
ATOM   7333 C  CD  . PRO D 1 201 ? 20.433  -15.793 32.989  1.00 30.31 ? 203  PRO D CD  1 
ATOM   7334 N  N   . CYS D 1 202 ? 22.345  -12.738 33.786  1.00 27.94 ? 204  CYS D N   1 
ATOM   7335 C  CA  . CYS D 1 202 ? 23.530  -11.957 34.177  1.00 29.02 ? 204  CYS D CA  1 
ATOM   7336 C  C   . CYS D 1 202 ? 24.197  -12.397 35.496  1.00 27.84 ? 204  CYS D C   1 
ATOM   7337 O  O   . CYS D 1 202 ? 24.815  -11.598 36.201  1.00 26.98 ? 204  CYS D O   1 
ATOM   7338 C  CB  . CYS D 1 202 ? 23.207  -10.460 34.219  1.00 31.01 ? 204  CYS D CB  1 
ATOM   7339 S  SG  . CYS D 1 202 ? 22.629  -9.753  32.662  1.00 33.92 ? 204  CYS D SG  1 
ATOM   7340 N  N   . ALA D 1 203 ? 24.118  -13.692 35.797  1.00 28.04 ? 205  ALA D N   1 
ATOM   7341 C  CA  . ALA D 1 203 ? 24.674  -14.238 37.054  1.00 25.64 ? 205  ALA D CA  1 
ATOM   7342 C  C   . ALA D 1 203 ? 26.164  -13.986 37.132  1.00 26.19 ? 205  ALA D C   1 
ATOM   7343 O  O   . ALA D 1 203 ? 26.850  -14.159 36.135  1.00 26.05 ? 205  ALA D O   1 
ATOM   7344 C  CB  . ALA D 1 203 ? 24.384  -15.725 37.137  1.00 24.94 ? 205  ALA D CB  1 
ATOM   7345 N  N   . GLN D 1 204 ? 26.665  -13.591 38.300  1.00 24.12 ? 206  GLN D N   1 
ATOM   7346 C  CA  . GLN D 1 204 ? 28.085  -13.328 38.506  1.00 25.36 ? 206  GLN D CA  1 
ATOM   7347 C  C   . GLN D 1 204 ? 28.809  -14.591 39.014  1.00 25.20 ? 206  GLN D C   1 
ATOM   7348 O  O   . GLN D 1 204 ? 28.184  -15.635 39.136  1.00 25.95 ? 206  GLN D O   1 
ATOM   7349 C  CB  . GLN D 1 204 ? 28.281  -12.120 39.446  1.00 26.00 ? 206  GLN D CB  1 
ATOM   7350 C  CG  . GLN D 1 204 ? 27.809  -10.841 38.765  1.00 28.12 ? 206  GLN D CG  1 
ATOM   7351 C  CD  . GLN D 1 204 ? 28.044  -9.540  39.516  1.00 29.70 ? 206  GLN D CD  1 
ATOM   7352 O  OE1 . GLN D 1 204 ? 27.949  -8.468  38.911  1.00 29.91 ? 206  GLN D OE1 1 
ATOM   7353 N  NE2 . GLN D 1 204 ? 28.296  -9.610  40.822  1.00 30.36 ? 206  GLN D NE2 1 
ATOM   7354 N  N   . GLY D 1 205 ? 30.110  -14.489 39.271  1.00 23.64 ? 207  GLY D N   1 
ATOM   7355 C  CA  . GLY D 1 205 ? 30.928  -15.641 39.695  1.00 25.55 ? 207  GLY D CA  1 
ATOM   7356 C  C   . GLY D 1 205 ? 31.510  -16.449 38.526  1.00 25.78 ? 207  GLY D C   1 
ATOM   7357 O  O   . GLY D 1 205 ? 32.188  -17.452 38.739  1.00 27.80 ? 207  GLY D O   1 
ATOM   7358 N  N   . VAL D 1 206 ? 31.245  -16.014 37.297  1.00 26.08 ? 208  VAL D N   1 
ATOM   7359 C  CA  . VAL D 1 206 ? 31.656  -16.745 36.097  1.00 25.29 ? 208  VAL D CA  1 
ATOM   7360 C  C   . VAL D 1 206 ? 33.141  -16.462 35.845  1.00 26.58 ? 208  VAL D C   1 
ATOM   7361 O  O   . VAL D 1 206 ? 33.535  -15.301 35.796  1.00 25.34 ? 208  VAL D O   1 
ATOM   7362 C  CB  . VAL D 1 206 ? 30.809  -16.317 34.882  1.00 25.80 ? 208  VAL D CB  1 
ATOM   7363 C  CG1 . VAL D 1 206 ? 31.252  -17.033 33.622  1.00 25.92 ? 208  VAL D CG1 1 
ATOM   7364 C  CG2 . VAL D 1 206 ? 29.340  -16.601 35.134  1.00 25.63 ? 208  VAL D CG2 1 
ATOM   7365 N  N   . ILE D 1 207 ? 33.964  -17.512 35.726  1.00 24.97 ? 209  ILE D N   1 
ATOM   7366 C  CA  . ILE D 1 207 ? 35.389  -17.330 35.420  1.00 25.30 ? 209  ILE D CA  1 
ATOM   7367 C  C   . ILE D 1 207 ? 35.528  -17.247 33.907  1.00 26.46 ? 209  ILE D C   1 
ATOM   7368 O  O   . ILE D 1 207 ? 35.234  -18.216 33.207  1.00 23.89 ? 209  ILE D O   1 
ATOM   7369 C  CB  . ILE D 1 207 ? 36.289  -18.447 35.973  1.00 26.20 ? 209  ILE D CB  1 
ATOM   7370 C  CG1 . ILE D 1 207 ? 36.352  -18.369 37.491  1.00 26.70 ? 209  ILE D CG1 1 
ATOM   7371 C  CG2 . ILE D 1 207 ? 37.725  -18.308 35.439  1.00 26.29 ? 209  ILE D CG2 1 
ATOM   7372 C  CD1 . ILE D 1 207 ? 36.949  -19.580 38.161  1.00 26.27 ? 209  ILE D CD1 1 
ATOM   7373 N  N   . TRP D 1 208 ? 35.959  -16.090 33.407  1.00 24.92 ? 210  TRP D N   1 
ATOM   7374 C  CA  . TRP D 1 208 ? 36.159  -15.886 31.964  1.00 25.21 ? 210  TRP D CA  1 
ATOM   7375 C  C   . TRP D 1 208 ? 37.621  -16.105 31.636  1.00 24.87 ? 210  TRP D C   1 
ATOM   7376 O  O   . TRP D 1 208 ? 38.515  -15.573 32.314  1.00 26.66 ? 210  TRP D O   1 
ATOM   7377 C  CB  . TRP D 1 208 ? 35.719  -14.477 31.513  1.00 23.55 ? 210  TRP D CB  1 
ATOM   7378 C  CG  . TRP D 1 208 ? 34.280  -14.361 31.386  1.00 23.68 ? 210  TRP D CG  1 
ATOM   7379 C  CD1 . TRP D 1 208 ? 33.395  -13.982 32.370  1.00 23.46 ? 210  TRP D CD1 1 
ATOM   7380 C  CD2 . TRP D 1 208 ? 33.492  -14.681 30.244  1.00 23.02 ? 210  TRP D CD2 1 
ATOM   7381 N  NE1 . TRP D 1 208 ? 32.123  -14.047 31.899  1.00 24.60 ? 210  TRP D NE1 1 
ATOM   7382 C  CE2 . TRP D 1 208 ? 32.141  -14.470 30.599  1.00 22.52 ? 210  TRP D CE2 1 
ATOM   7383 C  CE3 . TRP D 1 208 ? 33.792  -15.136 28.953  1.00 23.21 ? 210  TRP D CE3 1 
ATOM   7384 C  CZ2 . TRP D 1 208 ? 31.097  -14.694 29.721  1.00 22.90 ? 210  TRP D CZ2 1 
ATOM   7385 C  CZ3 . TRP D 1 208 ? 32.760  -15.336 28.073  1.00 22.87 ? 210  TRP D CZ3 1 
ATOM   7386 C  CH2 . TRP D 1 208 ? 31.420  -15.119 28.456  1.00 23.68 ? 210  TRP D CH2 1 
ATOM   7387 N  N   . THR D 1 209 ? 37.864  -16.909 30.605  1.00 26.13 ? 211  THR D N   1 
ATOM   7388 C  CA  . THR D 1 209 ? 39.218  -17.159 30.101  1.00 25.36 ? 211  THR D CA  1 
ATOM   7389 C  C   . THR D 1 209 ? 39.163  -16.811 28.623  1.00 26.96 ? 211  THR D C   1 
ATOM   7390 O  O   . THR D 1 209 ? 38.422  -17.443 27.850  1.00 25.98 ? 211  THR D O   1 
ATOM   7391 C  CB  . THR D 1 209 ? 39.651  -18.618 30.328  1.00 25.11 ? 211  THR D CB  1 
ATOM   7392 O  OG1 . THR D 1 209 ? 39.704  -18.889 31.729  1.00 25.11 ? 211  THR D OG1 1 
ATOM   7393 C  CG2 . THR D 1 209 ? 41.048  -18.881 29.738  1.00 25.19 ? 211  THR D CG2 1 
ATOM   7394 N  N   . VAL D 1 210 ? 39.900  -15.763 28.242  1.00 27.86 ? 212  VAL D N   1 
ATOM   7395 C  CA  . VAL D 1 210 ? 39.889  -15.250 26.871  1.00 27.68 ? 212  VAL D CA  1 
ATOM   7396 C  C   . VAL D 1 210 ? 41.276  -15.519 26.253  1.00 27.00 ? 212  VAL D C   1 
ATOM   7397 O  O   . VAL D 1 210 ? 42.271  -15.024 26.749  1.00 26.33 ? 212  VAL D O   1 
ATOM   7398 C  CB  . VAL D 1 210 ? 39.565  -13.740 26.840  1.00 27.34 ? 212  VAL D CB  1 
ATOM   7399 C  CG1 . VAL D 1 210 ? 39.503  -13.214 25.409  1.00 27.35 ? 212  VAL D CG1 1 
ATOM   7400 C  CG2 . VAL D 1 210 ? 38.241  -13.461 27.557  1.00 27.17 ? 212  VAL D CG2 1 
ATOM   7401 N  N   . PHE D 1 211 ? 41.328  -16.357 25.217  1.00 26.80 ? 213  PHE D N   1 
ATOM   7402 C  CA  . PHE D 1 211 ? 42.611  -16.682 24.543  1.00 26.49 ? 213  PHE D CA  1 
ATOM   7403 C  C   . PHE D 1 211 ? 43.227  -15.399 23.966  1.00 26.77 ? 213  PHE D C   1 
ATOM   7404 O  O   . PHE D 1 211 ? 42.499  -14.565 23.453  1.00 28.47 ? 213  PHE D O   1 
ATOM   7405 C  CB  . PHE D 1 211 ? 42.377  -17.641 23.382  1.00 27.33 ? 213  PHE D CB  1 
ATOM   7406 C  CG  . PHE D 1 211 ? 42.014  -19.027 23.801  1.00 26.73 ? 213  PHE D CG  1 
ATOM   7407 C  CD1 . PHE D 1 211 ? 43.002  -19.947 24.099  1.00 27.58 ? 213  PHE D CD1 1 
ATOM   7408 C  CD2 . PHE D 1 211 ? 40.687  -19.412 23.897  1.00 27.02 ? 213  PHE D CD2 1 
ATOM   7409 C  CE1 . PHE D 1 211 ? 42.677  -21.238 24.486  1.00 29.21 ? 213  PHE D CE1 1 
ATOM   7410 C  CE2 . PHE D 1 211 ? 40.350  -20.698 24.285  1.00 26.22 ? 213  PHE D CE2 1 
ATOM   7411 C  CZ  . PHE D 1 211 ? 41.343  -21.612 24.574  1.00 26.79 ? 213  PHE D CZ  1 
ATOM   7412 N  N   . ASN D 1 212 ? 44.545  -15.257 24.082  1.00 31.65 ? 214  ASN D N   1 
ATOM   7413 C  CA  . ASN D 1 212 ? 45.308  -14.188 23.392  1.00 35.31 ? 214  ASN D CA  1 
ATOM   7414 C  C   . ASN D 1 212 ? 45.099  -14.277 21.878  1.00 33.75 ? 214  ASN D C   1 
ATOM   7415 O  O   . ASN D 1 212 ? 44.638  -13.315 21.226  1.00 32.97 ? 214  ASN D O   1 
ATOM   7416 C  CB  . ASN D 1 212 ? 46.815  -14.301 23.710  1.00 38.88 ? 214  ASN D CB  1 
ATOM   7417 C  CG  . ASN D 1 212 ? 47.696  -13.450 22.768  1.00 47.02 ? 214  ASN D CG  1 
ATOM   7418 O  OD1 . ASN D 1 212 ? 48.579  -13.961 22.045  1.00 43.95 ? 214  ASN D OD1 1 
ATOM   7419 N  ND2 . ASN D 1 212 ? 47.430  -12.158 22.750  1.00 49.71 ? 214  ASN D ND2 1 
ATOM   7420 N  N   . GLN D 1 213 ? 45.400  -15.457 21.337  1.00 34.73 ? 215  GLN D N   1 
ATOM   7421 C  CA  . GLN D 1 213 ? 45.380  -15.673 19.890  1.00 35.83 ? 215  GLN D CA  1 
ATOM   7422 C  C   . GLN D 1 213 ? 43.975  -15.846 19.383  1.00 38.40 ? 215  GLN D C   1 
ATOM   7423 O  O   . GLN D 1 213 ? 43.090  -16.308 20.112  1.00 37.69 ? 215  GLN D O   1 
ATOM   7424 C  CB  . GLN D 1 213 ? 46.175  -16.903 19.519  1.00 36.54 ? 215  GLN D CB  1 
ATOM   7425 C  CG  . GLN D 1 213 ? 47.630  -16.838 19.914  1.00 37.16 ? 215  GLN D CG  1 
ATOM   7426 C  CD  . GLN D 1 213 ? 48.303  -18.188 19.864  1.00 42.54 ? 215  GLN D CD  1 
ATOM   7427 O  OE1 . GLN D 1 213 ? 47.661  -19.224 20.068  1.00 45.24 ? 215  GLN D OE1 1 
ATOM   7428 N  NE2 . GLN D 1 213 ? 49.612  -18.191 19.622  1.00 42.73 ? 215  GLN D NE2 1 
ATOM   7429 N  N   . THR D 1 214 ? 43.791  -15.507 18.116  1.00 38.21 ? 216  THR D N   1 
ATOM   7430 C  CA  . THR D 1 214 ? 42.506  -15.586 17.454  1.00 39.85 ? 216  THR D CA  1 
ATOM   7431 C  C   . THR D 1 214 ? 42.410  -16.797 16.530  1.00 38.10 ? 216  THR D C   1 
ATOM   7432 O  O   . THR D 1 214 ? 43.380  -17.508 16.291  1.00 41.88 ? 216  THR D O   1 
ATOM   7433 C  CB  . THR D 1 214 ? 42.242  -14.306 16.647  1.00 43.49 ? 216  THR D CB  1 
ATOM   7434 O  OG1 . THR D 1 214 ? 43.074  -14.287 15.479  1.00 43.85 ? 216  THR D OG1 1 
ATOM   7435 C  CG2 . THR D 1 214 ? 42.529  -13.075 17.499  1.00 43.68 ? 216  THR D CG2 1 
ATOM   7436 N  N   . VAL D 1 215 ? 41.210  -17.024 16.034  1.00 38.41 ? 217  VAL D N   1 
ATOM   7437 C  CA  . VAL D 1 215 ? 40.949  -18.047 15.040  1.00 37.27 ? 217  VAL D CA  1 
ATOM   7438 C  C   . VAL D 1 215 ? 40.505  -17.297 13.795  1.00 37.35 ? 217  VAL D C   1 
ATOM   7439 O  O   . VAL D 1 215 ? 39.812  -16.291 13.896  1.00 35.30 ? 217  VAL D O   1 
ATOM   7440 C  CB  . VAL D 1 215 ? 39.873  -19.035 15.556  1.00 37.47 ? 217  VAL D CB  1 
ATOM   7441 C  CG1 . VAL D 1 215 ? 39.227  -19.813 14.423  1.00 40.03 ? 217  VAL D CG1 1 
ATOM   7442 C  CG2 . VAL D 1 215 ? 40.505  -19.992 16.556  1.00 36.74 ? 217  VAL D CG2 1 
ATOM   7443 N  N   . MET D 1 216 ? 40.901  -17.797 12.626  1.00 37.25 ? 218  MET D N   1 
ATOM   7444 C  CA  . MET D 1 216 ? 40.612  -17.135 11.364  1.00 37.05 ? 218  MET D CA  1 
ATOM   7445 C  C   . MET D 1 216 ? 39.544  -17.864 10.583  1.00 34.53 ? 218  MET D C   1 
ATOM   7446 O  O   . MET D 1 216 ? 39.605  -19.082 10.420  1.00 34.00 ? 218  MET D O   1 
ATOM   7447 C  CB  . MET D 1 216 ? 41.888  -17.034 10.540  1.00 41.72 ? 218  MET D CB  1 
ATOM   7448 C  CG  . MET D 1 216 ? 42.956  -16.261 11.275  1.00 44.55 ? 218  MET D CG  1 
ATOM   7449 S  SD  . MET D 1 216 ? 44.234  -15.595 10.209  1.00 56.27 ? 218  MET D SD  1 
ATOM   7450 C  CE  . MET D 1 216 ? 45.355  -16.993 10.071  1.00 52.96 ? 218  MET D CE  1 
ATOM   7451 N  N   . LEU D 1 217 ? 38.549  -17.104 10.144  1.00 32.91 ? 219  LEU D N   1 
ATOM   7452 C  CA  . LEU D 1 217 ? 37.499  -17.572 9.250   1.00 36.61 ? 219  LEU D CA  1 
ATOM   7453 C  C   . LEU D 1 217 ? 37.569  -16.725 7.988   1.00 39.26 ? 219  LEU D C   1 
ATOM   7454 O  O   . LEU D 1 217 ? 37.986  -15.566 8.036   1.00 40.79 ? 219  LEU D O   1 
ATOM   7455 C  CB  . LEU D 1 217 ? 36.115  -17.374 9.880   1.00 36.04 ? 219  LEU D CB  1 
ATOM   7456 C  CG  . LEU D 1 217 ? 35.609  -18.451 10.847  1.00 35.02 ? 219  LEU D CG  1 
ATOM   7457 C  CD1 . LEU D 1 217 ? 36.576  -18.641 12.000  1.00 34.63 ? 219  LEU D CD1 1 
ATOM   7458 C  CD2 . LEU D 1 217 ? 34.221  -18.083 11.334  1.00 35.73 ? 219  LEU D CD2 1 
ATOM   7459 N  N   . SER D 1 218 ? 37.122  -17.283 6.871   1.00 41.56 ? 220  SER D N   1 
ATOM   7460 C  CA  . SER D 1 218 ? 37.129  -16.533 5.613   1.00 43.37 ? 220  SER D CA  1 
ATOM   7461 C  C   . SER D 1 218 ? 36.069  -15.442 5.641   1.00 46.43 ? 220  SER D C   1 
ATOM   7462 O  O   . SER D 1 218 ? 35.143  -15.461 6.472   1.00 45.56 ? 220  SER D O   1 
ATOM   7463 C  CB  . SER D 1 218 ? 36.907  -17.462 4.429   1.00 42.05 ? 220  SER D CB  1 
ATOM   7464 O  OG  . SER D 1 218 ? 35.589  -17.965 4.406   1.00 42.75 ? 220  SER D OG  1 
ATOM   7465 N  N   . ALA D 1 219 ? 36.204  -14.491 4.721   1.00 47.34 ? 221  ALA D N   1 
ATOM   7466 C  CA  . ALA D 1 219 ? 35.253  -13.393 4.613   1.00 47.07 ? 221  ALA D CA  1 
ATOM   7467 C  C   . ALA D 1 219 ? 33.856  -13.935 4.345   1.00 46.67 ? 221  ALA D C   1 
ATOM   7468 O  O   . ALA D 1 219 ? 32.882  -13.449 4.922   1.00 46.21 ? 221  ALA D O   1 
ATOM   7469 C  CB  . ALA D 1 219 ? 35.677  -12.423 3.520   1.00 49.05 ? 221  ALA D CB  1 
ATOM   7470 N  N   . LYS D 1 220 ? 33.778  -14.963 3.494   1.00 48.16 ? 222  LYS D N   1 
ATOM   7471 C  CA  . LYS D 1 220 ? 32.518  -15.630 3.154   1.00 47.81 ? 222  LYS D CA  1 
ATOM   7472 C  C   . LYS D 1 220 ? 31.860  -16.325 4.357   1.00 45.46 ? 222  LYS D C   1 
ATOM   7473 O  O   . LYS D 1 220 ? 30.633  -16.350 4.486   1.00 47.27 ? 222  LYS D O   1 
ATOM   7474 C  CB  . LYS D 1 220 ? 32.764  -16.668 2.057   1.00 51.52 ? 222  LYS D CB  1 
ATOM   7475 C  CG  . LYS D 1 220 ? 31.492  -17.245 1.454   1.00 56.99 ? 222  LYS D CG  1 
ATOM   7476 C  CD  . LYS D 1 220 ? 31.718  -18.611 0.832   1.00 64.90 ? 222  LYS D CD  1 
ATOM   7477 C  CE  . LYS D 1 220 ? 30.383  -19.234 0.441   1.00 70.95 ? 222  LYS D CE  1 
ATOM   7478 N  NZ  . LYS D 1 220 ? 30.526  -20.600 -0.141  1.00 74.68 ? 222  LYS D NZ  1 
ATOM   7479 N  N   . GLN D 1 221 ? 32.691  -16.931 5.194   1.00 45.49 ? 223  GLN D N   1 
ATOM   7480 C  CA  . GLN D 1 221 ? 32.236  -17.642 6.394   1.00 43.86 ? 223  GLN D CA  1 
ATOM   7481 C  C   . GLN D 1 221 ? 31.632  -16.690 7.436   1.00 42.29 ? 223  GLN D C   1 
ATOM   7482 O  O   . GLN D 1 221 ? 30.555  -16.948 7.996   1.00 40.46 ? 223  GLN D O   1 
ATOM   7483 C  CB  . GLN D 1 221 ? 33.404  -18.431 6.992   1.00 41.83 ? 223  GLN D CB  1 
ATOM   7484 C  CG  . GLN D 1 221 ? 33.633  -19.744 6.275   1.00 39.89 ? 223  GLN D CG  1 
ATOM   7485 C  CD  . GLN D 1 221 ? 34.755  -20.562 6.874   1.00 37.21 ? 223  GLN D CD  1 
ATOM   7486 O  OE1 . GLN D 1 221 ? 35.792  -20.030 7.287   1.00 36.71 ? 223  GLN D OE1 1 
ATOM   7487 N  NE2 . GLN D 1 221 ? 34.556  -21.868 6.918   1.00 36.86 ? 223  GLN D NE2 1 
ATOM   7488 N  N   . LEU D 1 222 ? 32.346  -15.599 7.679   1.00 43.53 ? 224  LEU D N   1 
ATOM   7489 C  CA  . LEU D 1 222 ? 31.860  -14.527 8.530   1.00 45.53 ? 224  LEU D CA  1 
ATOM   7490 C  C   . LEU D 1 222 ? 30.541  -13.964 8.021   1.00 48.93 ? 224  LEU D C   1 
ATOM   7491 O  O   . LEU D 1 222 ? 29.624  -13.730 8.808   1.00 48.00 ? 224  LEU D O   1 
ATOM   7492 C  CB  . LEU D 1 222 ? 32.918  -13.433 8.665   1.00 45.09 ? 224  LEU D CB  1 
ATOM   7493 C  CG  . LEU D 1 222 ? 34.140  -13.831 9.492   1.00 45.81 ? 224  LEU D CG  1 
ATOM   7494 C  CD1 . LEU D 1 222 ? 35.244  -12.792 9.372   1.00 47.47 ? 224  LEU D CD1 1 
ATOM   7495 C  CD2 . LEU D 1 222 ? 33.777  -14.058 10.959  1.00 46.25 ? 224  LEU D CD2 1 
ATOM   7496 N  N   . HIS D 1 223 ? 30.429  -13.785 6.706   1.00 49.68 ? 225  HIS D N   1 
ATOM   7497 C  CA  . HIS D 1 223 ? 29.170  -13.356 6.105   1.00 50.26 ? 225  HIS D CA  1 
ATOM   7498 C  C   . HIS D 1 223 ? 28.064  -14.385 6.364   1.00 48.05 ? 225  HIS D C   1 
ATOM   7499 O  O   . HIS D 1 223 ? 26.951  -14.013 6.745   1.00 48.36 ? 225  HIS D O   1 
ATOM   7500 C  CB  . HIS D 1 223 ? 29.329  -13.088 4.595   1.00 51.94 ? 225  HIS D CB  1 
ATOM   7501 C  CG  . HIS D 1 223 ? 28.083  -12.575 3.941   1.00 54.74 ? 225  HIS D CG  1 
ATOM   7502 N  ND1 . HIS D 1 223 ? 27.186  -13.402 3.292   1.00 55.43 ? 225  HIS D ND1 1 
ATOM   7503 C  CD2 . HIS D 1 223 ? 27.570  -11.323 3.854   1.00 56.08 ? 225  HIS D CD2 1 
ATOM   7504 C  CE1 . HIS D 1 223 ? 26.180  -12.681 2.829   1.00 56.09 ? 225  HIS D CE1 1 
ATOM   7505 N  NE2 . HIS D 1 223 ? 26.388  -11.417 3.158   1.00 58.21 ? 225  HIS D NE2 1 
ATOM   7506 N  N   . THR D 1 224 ? 28.372  -15.666 6.168   1.00 46.73 ? 226  THR D N   1 
ATOM   7507 C  CA  . THR D 1 224 ? 27.411  -16.747 6.422   1.00 46.84 ? 226  THR D CA  1 
ATOM   7508 C  C   . THR D 1 224 ? 26.884  -16.718 7.865   1.00 46.52 ? 226  THR D C   1 
ATOM   7509 O  O   . THR D 1 224 ? 25.699  -16.967 8.104   1.00 49.33 ? 226  THR D O   1 
ATOM   7510 C  CB  . THR D 1 224 ? 28.038  -18.130 6.142   1.00 49.65 ? 226  THR D CB  1 
ATOM   7511 O  OG1 . THR D 1 224 ? 28.586  -18.155 4.812   1.00 50.66 ? 226  THR D OG1 1 
ATOM   7512 C  CG2 . THR D 1 224 ? 27.005  -19.253 6.303   1.00 49.60 ? 226  THR D CG2 1 
ATOM   7513 N  N   . LEU D 1 225 ? 27.768  -16.402 8.811   1.00 46.03 ? 227  LEU D N   1 
ATOM   7514 C  CA  . LEU D 1 225 ? 27.407  -16.335 10.227  1.00 43.98 ? 227  LEU D CA  1 
ATOM   7515 C  C   . LEU D 1 225 ? 26.399  -15.224 10.557  1.00 45.32 ? 227  LEU D C   1 
ATOM   7516 O  O   . LEU D 1 225 ? 25.481  -15.445 11.354  1.00 43.80 ? 227  LEU D O   1 
ATOM   7517 C  CB  . LEU D 1 225 ? 28.667  -16.180 11.092  1.00 43.43 ? 227  LEU D CB  1 
ATOM   7518 C  CG  . LEU D 1 225 ? 28.496  -16.281 12.619  1.00 41.17 ? 227  LEU D CG  1 
ATOM   7519 C  CD1 . LEU D 1 225 ? 27.724  -17.529 13.013  1.00 40.55 ? 227  LEU D CD1 1 
ATOM   7520 C  CD2 . LEU D 1 225 ? 29.851  -16.250 13.298  1.00 40.79 ? 227  LEU D CD2 1 
ATOM   7521 N  N   . SER D 1 226 ? 26.569  -14.050 9.946   1.00 48.35 ? 228  SER D N   1 
ATOM   7522 C  CA  . SER D 1 226 ? 25.697  -12.882 10.197  1.00 50.33 ? 228  SER D CA  1 
ATOM   7523 C  C   . SER D 1 226 ? 24.472  -12.753 9.282   1.00 53.06 ? 228  SER D C   1 
ATOM   7524 O  O   . SER D 1 226 ? 23.507  -12.071 9.646   1.00 55.14 ? 228  SER D O   1 
ATOM   7525 C  CB  . SER D 1 226 ? 26.512  -11.594 10.119  1.00 51.87 ? 228  SER D CB  1 
ATOM   7526 O  OG  . SER D 1 226 ? 27.238  -11.525 8.908   1.00 55.97 ? 228  SER D OG  1 
ATOM   7527 N  N   . ASP D 1 227 ? 24.494  -13.407 8.124   1.00 51.30 ? 229  ASP D N   1 
ATOM   7528 C  CA  . ASP D 1 227 ? 23.479  -13.197 7.088   1.00 53.61 ? 229  ASP D CA  1 
ATOM   7529 C  C   . ASP D 1 227 ? 22.432  -14.315 7.000   1.00 50.85 ? 229  ASP D C   1 
ATOM   7530 O  O   . ASP D 1 227 ? 21.456  -14.184 6.256   1.00 51.66 ? 229  ASP D O   1 
ATOM   7531 C  CB  . ASP D 1 227 ? 24.175  -13.035 5.727   1.00 57.84 ? 229  ASP D CB  1 
ATOM   7532 C  CG  . ASP D 1 227 ? 23.278  -12.394 4.675   1.00 62.63 ? 229  ASP D CG  1 
ATOM   7533 O  OD1 . ASP D 1 227 ? 22.984  -11.185 4.802   1.00 63.88 ? 229  ASP D OD1 1 
ATOM   7534 O  OD2 . ASP D 1 227 ? 22.865  -13.101 3.726   1.00 66.05 ? 229  ASP D OD2 1 
ATOM   7535 N  N   . THR D 1 228 ? 22.613  -15.407 7.746   1.00 46.73 ? 230  THR D N   1 
ATOM   7536 C  CA  . THR D 1 228 ? 21.767  -16.593 7.577   1.00 42.88 ? 230  THR D CA  1 
ATOM   7537 C  C   . THR D 1 228 ? 20.629  -16.688 8.590   1.00 42.33 ? 230  THR D C   1 
ATOM   7538 O  O   . THR D 1 228 ? 19.516  -17.076 8.229   1.00 43.62 ? 230  THR D O   1 
ATOM   7539 C  CB  . THR D 1 228 ? 22.618  -17.877 7.617   1.00 42.34 ? 230  THR D CB  1 
ATOM   7540 O  OG1 . THR D 1 228 ? 23.682  -17.768 6.662   1.00 41.97 ? 230  THR D OG1 1 
ATOM   7541 C  CG2 . THR D 1 228 ? 21.794  -19.102 7.284   1.00 41.86 ? 230  THR D CG2 1 
ATOM   7542 N  N   . LEU D 1 229 ? 20.891  -16.344 9.849   1.00 42.32 ? 231  LEU D N   1 
ATOM   7543 C  CA  . LEU D 1 229 ? 19.928  -16.625 10.912  1.00 40.83 ? 231  LEU D CA  1 
ATOM   7544 C  C   . LEU D 1 229 ? 18.963  -15.477 11.161  1.00 41.07 ? 231  LEU D C   1 
ATOM   7545 O  O   . LEU D 1 229 ? 19.362  -14.314 11.142  1.00 39.09 ? 231  LEU D O   1 
ATOM   7546 C  CB  . LEU D 1 229 ? 20.650  -16.963 12.213  1.00 42.66 ? 231  LEU D CB  1 
ATOM   7547 C  CG  . LEU D 1 229 ? 21.599  -18.159 12.180  1.00 43.01 ? 231  LEU D CG  1 
ATOM   7548 C  CD1 . LEU D 1 229 ? 22.246  -18.298 13.545  1.00 44.36 ? 231  LEU D CD1 1 
ATOM   7549 C  CD2 . LEU D 1 229 ? 20.872  -19.439 11.801  1.00 41.43 ? 231  LEU D CD2 1 
ATOM   7550 N  N   . TRP D 1 230 ? 17.709  -15.833 11.432  1.00 45.56 ? 232  TRP D N   1 
ATOM   7551 C  CA  . TRP D 1 230 ? 16.653  -14.884 11.795  1.00 52.05 ? 232  TRP D CA  1 
ATOM   7552 C  C   . TRP D 1 230 ? 16.274  -15.038 13.270  1.00 52.04 ? 232  TRP D C   1 
ATOM   7553 O  O   . TRP D 1 230 ? 16.182  -16.162 13.784  1.00 48.02 ? 232  TRP D O   1 
ATOM   7554 C  CB  . TRP D 1 230 ? 15.439  -15.080 10.881  1.00 57.09 ? 232  TRP D CB  1 
ATOM   7555 C  CG  . TRP D 1 230 ? 15.787  -14.741 9.470   1.00 63.21 ? 232  TRP D CG  1 
ATOM   7556 C  CD1 . TRP D 1 230 ? 16.344  -15.569 8.541   1.00 66.27 ? 232  TRP D CD1 1 
ATOM   7557 C  CD2 . TRP D 1 230 ? 15.665  -13.463 8.847   1.00 67.41 ? 232  TRP D CD2 1 
ATOM   7558 N  NE1 . TRP D 1 230 ? 16.558  -14.890 7.369   1.00 68.83 ? 232  TRP D NE1 1 
ATOM   7559 C  CE2 . TRP D 1 230 ? 16.148  -13.593 7.527   1.00 69.68 ? 232  TRP D CE2 1 
ATOM   7560 C  CE3 . TRP D 1 230 ? 15.177  -12.221 9.270   1.00 69.38 ? 232  TRP D CE3 1 
ATOM   7561 C  CZ2 . TRP D 1 230 ? 16.162  -12.523 6.621   1.00 72.83 ? 232  TRP D CZ2 1 
ATOM   7562 C  CZ3 . TRP D 1 230 ? 15.188  -11.154 8.371   1.00 72.26 ? 232  TRP D CZ3 1 
ATOM   7563 C  CH2 . TRP D 1 230 ? 15.682  -11.314 7.061   1.00 73.31 ? 232  TRP D CH2 1 
ATOM   7564 N  N   . GLY D 1 231 ? 16.051  -13.896 13.925  1.00 54.28 ? 233  GLY D N   1 
ATOM   7565 C  CA  . GLY D 1 231 ? 15.824  -13.815 15.367  1.00 59.01 ? 233  GLY D CA  1 
ATOM   7566 C  C   . GLY D 1 231 ? 14.385  -13.487 15.746  1.00 62.79 ? 233  GLY D C   1 
ATOM   7567 O  O   . GLY D 1 231 ? 13.449  -13.917 15.057  1.00 63.57 ? 233  GLY D O   1 
ATOM   7568 N  N   . PRO D 1 232 ? 14.189  -12.739 16.854  1.00 64.88 ? 234  PRO D N   1 
ATOM   7569 C  CA  . PRO D 1 232 ? 12.825  -12.436 17.281  1.00 66.14 ? 234  PRO D CA  1 
ATOM   7570 C  C   . PRO D 1 232 ? 12.127  -11.469 16.329  1.00 70.63 ? 234  PRO D C   1 
ATOM   7571 O  O   . PRO D 1 232 ? 12.777  -10.595 15.741  1.00 71.38 ? 234  PRO D O   1 
ATOM   7572 C  CB  . PRO D 1 232 ? 13.020  -11.817 18.667  1.00 63.86 ? 234  PRO D CB  1 
ATOM   7573 C  CG  . PRO D 1 232 ? 14.372  -11.211 18.616  1.00 65.69 ? 234  PRO D CG  1 
ATOM   7574 C  CD  . PRO D 1 232 ? 15.188  -12.116 17.743  1.00 63.86 ? 234  PRO D CD  1 
ATOM   7575 N  N   . GLY D 1 233 ? 10.814  -11.648 16.185  1.00 77.20 ? 235  GLY D N   1 
ATOM   7576 C  CA  . GLY D 1 233 ? 10.002  -10.861 15.260  1.00 79.90 ? 235  GLY D CA  1 
ATOM   7577 C  C   . GLY D 1 233 ? 10.285  -11.270 13.831  1.00 80.74 ? 235  GLY D C   1 
ATOM   7578 O  O   . GLY D 1 233 ? 10.645  -12.419 13.568  1.00 82.45 ? 235  GLY D O   1 
ATOM   7579 N  N   . ASP D 1 234 ? 10.126  -10.324 12.912  1.00 80.15 ? 236  ASP D N   1 
ATOM   7580 C  CA  . ASP D 1 234 ? 10.513  -10.508 11.521  1.00 79.07 ? 236  ASP D CA  1 
ATOM   7581 C  C   . ASP D 1 234 ? 11.831  -9.761  11.310  1.00 79.97 ? 236  ASP D C   1 
ATOM   7582 O  O   . ASP D 1 234 ? 11.921  -8.876  10.456  1.00 84.14 ? 236  ASP D O   1 
ATOM   7583 C  CB  . ASP D 1 234 ? 9.414   -9.980  10.595  1.00 76.99 ? 236  ASP D CB  1 
ATOM   7584 N  N   . SER D 1 235 ? 12.849  -10.133 12.095  1.00 77.68 ? 237  SER D N   1 
ATOM   7585 C  CA  . SER D 1 235 ? 14.145  -9.432  12.118  1.00 76.48 ? 237  SER D CA  1 
ATOM   7586 C  C   . SER D 1 235 ? 15.328  -10.399 12.145  1.00 71.45 ? 237  SER D C   1 
ATOM   7587 O  O   . SER D 1 235 ? 15.253  -11.468 12.756  1.00 72.60 ? 237  SER D O   1 
ATOM   7588 C  CB  . SER D 1 235 ? 14.228  -8.505  13.329  1.00 78.74 ? 237  SER D CB  1 
ATOM   7589 O  OG  . SER D 1 235 ? 13.129  -7.608  13.362  1.00 84.27 ? 237  SER D OG  1 
ATOM   7590 N  N   . ARG D 1 236 ? 16.416  -10.008 11.479  1.00 66.97 ? 238  ARG D N   1 
ATOM   7591 C  CA  . ARG D 1 236 ? 17.628  -10.828 11.378  1.00 63.32 ? 238  ARG D CA  1 
ATOM   7592 C  C   . ARG D 1 236 ? 18.287  -10.986 12.732  1.00 59.22 ? 238  ARG D C   1 
ATOM   7593 O  O   . ARG D 1 236 ? 18.157  -10.117 13.592  1.00 59.52 ? 238  ARG D O   1 
ATOM   7594 C  CB  . ARG D 1 236 ? 18.654  -10.187 10.439  1.00 63.88 ? 238  ARG D CB  1 
ATOM   7595 C  CG  . ARG D 1 236 ? 18.265  -10.149 8.973   1.00 66.40 ? 238  ARG D CG  1 
ATOM   7596 C  CD  . ARG D 1 236 ? 19.404  -9.577  8.143   1.00 68.46 ? 238  ARG D CD  1 
ATOM   7597 N  NE  . ARG D 1 236 ? 19.213  -9.765  6.704   1.00 69.17 ? 238  ARG D NE  1 
ATOM   7598 C  CZ  . ARG D 1 236 ? 19.461  -10.888 6.025   1.00 71.19 ? 238  ARG D CZ  1 
ATOM   7599 N  NH1 . ARG D 1 236 ? 19.914  -11.985 6.632   1.00 71.40 ? 238  ARG D NH1 1 
ATOM   7600 N  NH2 . ARG D 1 236 ? 19.244  -10.917 4.712   1.00 71.21 ? 238  ARG D NH2 1 
ATOM   7601 N  N   . LEU D 1 237 ? 19.015  -12.087 12.899  1.00 54.46 ? 239  LEU D N   1 
ATOM   7602 C  CA  . LEU D 1 237 ? 19.797  -12.328 14.103  1.00 49.92 ? 239  LEU D CA  1 
ATOM   7603 C  C   . LEU D 1 237 ? 21.204  -11.818 13.860  1.00 47.88 ? 239  LEU D C   1 
ATOM   7604 O  O   . LEU D 1 237 ? 22.025  -12.482 13.209  1.00 45.29 ? 239  LEU D O   1 
ATOM   7605 C  CB  . LEU D 1 237 ? 19.780  -13.816 14.477  1.00 51.32 ? 239  LEU D CB  1 
ATOM   7606 C  CG  . LEU D 1 237 ? 20.414  -14.263 15.806  1.00 52.89 ? 239  LEU D CG  1 
ATOM   7607 C  CD1 . LEU D 1 237 ? 20.290  -13.243 16.929  1.00 53.93 ? 239  LEU D CD1 1 
ATOM   7608 C  CD2 . LEU D 1 237 ? 19.833  -15.609 16.229  1.00 50.22 ? 239  LEU D CD2 1 
ATOM   7609 N  N   . GLN D 1 238 ? 21.455  -10.607 14.362  1.00 45.74 ? 240  GLN D N   1 
ATOM   7610 C  CA  . GLN D 1 238 ? 22.709  -9.892  14.152  1.00 43.88 ? 240  GLN D CA  1 
ATOM   7611 C  C   . GLN D 1 238 ? 23.010  -9.019  15.345  1.00 40.29 ? 240  GLN D C   1 
ATOM   7612 O  O   . GLN D 1 238 ? 22.126  -8.703  16.120  1.00 41.08 ? 240  GLN D O   1 
ATOM   7613 C  CB  . GLN D 1 238 ? 22.597  -8.964  12.942  1.00 48.70 ? 240  GLN D CB  1 
ATOM   7614 C  CG  . GLN D 1 238 ? 22.355  -9.649  11.612  1.00 51.27 ? 240  GLN D CG  1 
ATOM   7615 C  CD  . GLN D 1 238 ? 22.338  -8.673  10.447  1.00 53.73 ? 240  GLN D CD  1 
ATOM   7616 O  OE1 . GLN D 1 238 ? 21.926  -7.513  10.585  1.00 52.81 ? 240  GLN D OE1 1 
ATOM   7617 N  NE2 . GLN D 1 238 ? 22.793  -9.140  9.290   1.00 54.44 ? 240  GLN D NE2 1 
ATOM   7618 N  N   . LEU D 1 239 ? 24.263  -8.604  15.461  1.00 40.06 ? 241  LEU D N   1 
ATOM   7619 C  CA  . LEU D 1 239 ? 24.702  -7.686  16.507  1.00 42.57 ? 241  LEU D CA  1 
ATOM   7620 C  C   . LEU D 1 239 ? 24.285  -8.202  17.896  1.00 44.46 ? 241  LEU D C   1 
ATOM   7621 O  O   . LEU D 1 239 ? 23.875  -7.419  18.772  1.00 40.92 ? 241  LEU D O   1 
ATOM   7622 C  CB  . LEU D 1 239 ? 24.137  -6.280  16.253  1.00 43.48 ? 241  LEU D CB  1 
ATOM   7623 C  CG  . LEU D 1 239 ? 24.478  -5.629  14.904  1.00 43.64 ? 241  LEU D CG  1 
ATOM   7624 C  CD1 . LEU D 1 239 ? 23.501  -4.494  14.626  1.00 44.13 ? 241  LEU D CD1 1 
ATOM   7625 C  CD2 . LEU D 1 239 ? 25.917  -5.127  14.883  1.00 44.09 ? 241  LEU D CD2 1 
ATOM   7626 N  N   . ASN D 1 240 ? 24.420  -9.522  18.083  1.00 40.56 ? 242  ASN D N   1 
ATOM   7627 C  CA  . ASN D 1 240 ? 23.977  -10.210 19.291  1.00 38.99 ? 242  ASN D CA  1 
ATOM   7628 C  C   . ASN D 1 240 ? 25.100  -10.231 20.330  1.00 37.48 ? 242  ASN D C   1 
ATOM   7629 O  O   . ASN D 1 240 ? 25.570  -11.291 20.751  1.00 40.94 ? 242  ASN D O   1 
ATOM   7630 C  CB  . ASN D 1 240 ? 23.457  -11.621 18.948  1.00 38.91 ? 242  ASN D CB  1 
ATOM   7631 C  CG  . ASN D 1 240 ? 24.527  -12.521 18.319  1.00 39.26 ? 242  ASN D CG  1 
ATOM   7632 O  OD1 . ASN D 1 240 ? 25.463  -12.035 17.680  1.00 39.06 ? 242  ASN D OD1 1 
ATOM   7633 N  ND2 . ASN D 1 240 ? 24.395  -13.833 18.518  1.00 36.99 ? 242  ASN D ND2 1 
ATOM   7634 N  N   . PHE D 1 241 ? 25.538  -9.040  20.724  1.00 35.13 ? 243  PHE D N   1 
ATOM   7635 C  CA  . PHE D 1 241 ? 26.607  -8.863  21.699  1.00 36.70 ? 243  PHE D CA  1 
ATOM   7636 C  C   . PHE D 1 241 ? 26.218  -7.809  22.721  1.00 35.66 ? 243  PHE D C   1 
ATOM   7637 O  O   . PHE D 1 241 ? 25.401  -6.926  22.445  1.00 35.58 ? 243  PHE D O   1 
ATOM   7638 C  CB  . PHE D 1 241 ? 27.947  -8.504  21.039  1.00 37.76 ? 243  PHE D CB  1 
ATOM   7639 C  CG  . PHE D 1 241 ? 27.929  -7.217  20.258  1.00 40.54 ? 243  PHE D CG  1 
ATOM   7640 C  CD1 . PHE D 1 241 ? 27.525  -7.199  18.925  1.00 42.53 ? 243  PHE D CD1 1 
ATOM   7641 C  CD2 . PHE D 1 241 ? 28.345  -6.020  20.849  1.00 42.46 ? 243  PHE D CD2 1 
ATOM   7642 C  CE1 . PHE D 1 241 ? 27.513  -6.008  18.199  1.00 43.86 ? 243  PHE D CE1 1 
ATOM   7643 C  CE2 . PHE D 1 241 ? 28.339  -4.829  20.126  1.00 44.31 ? 243  PHE D CE2 1 
ATOM   7644 C  CZ  . PHE D 1 241 ? 27.922  -4.824  18.801  1.00 42.60 ? 243  PHE D CZ  1 
ATOM   7645 N  N   . ARG D 1 242 ? 26.802  -7.921  23.903  1.00 36.28 ? 244  ARG D N   1 
ATOM   7646 C  CA  . ARG D 1 242 ? 26.553  -6.969  24.969  1.00 37.20 ? 244  ARG D CA  1 
ATOM   7647 C  C   . ARG D 1 242 ? 27.673  -5.963  24.997  1.00 36.71 ? 244  ARG D C   1 
ATOM   7648 O  O   . ARG D 1 242 ? 28.834  -6.308  24.802  1.00 36.35 ? 244  ARG D O   1 
ATOM   7649 C  CB  . ARG D 1 242 ? 26.471  -7.667  26.329  1.00 37.33 ? 244  ARG D CB  1 
ATOM   7650 C  CG  . ARG D 1 242 ? 26.000  -6.749  27.460  1.00 36.97 ? 244  ARG D CG  1 
ATOM   7651 C  CD  . ARG D 1 242 ? 26.245  -7.361  28.825  1.00 36.37 ? 244  ARG D CD  1 
ATOM   7652 N  NE  . ARG D 1 242 ? 25.469  -6.689  29.873  1.00 37.53 ? 244  ARG D NE  1 
ATOM   7653 C  CZ  . ARG D 1 242 ? 25.484  -7.031  31.165  1.00 37.90 ? 244  ARG D CZ  1 
ATOM   7654 N  NH1 . ARG D 1 242 ? 26.243  -8.043  31.595  1.00 36.42 ? 244  ARG D NH1 1 
ATOM   7655 N  NH2 . ARG D 1 242 ? 24.734  -6.353  32.037  1.00 36.48 ? 244  ARG D NH2 1 
ATOM   7656 N  N   . ALA D 1 243 ? 27.311  -4.718  25.289  1.00 39.17 ? 245  ALA D N   1 
ATOM   7657 C  CA  . ALA D 1 243 ? 28.281  -3.656  25.469  1.00 39.44 ? 245  ALA D CA  1 
ATOM   7658 C  C   . ALA D 1 243 ? 29.247  -3.997  26.599  1.00 39.85 ? 245  ALA D C   1 
ATOM   7659 O  O   . ALA D 1 243 ? 28.872  -4.632  27.594  1.00 40.42 ? 245  ALA D O   1 
ATOM   7660 C  CB  . ALA D 1 243 ? 27.569  -2.332  25.750  1.00 39.97 ? 245  ALA D CB  1 
ATOM   7661 N  N   . THR D 1 244 ? 30.495  -3.588  26.422  1.00 38.94 ? 246  THR D N   1 
ATOM   7662 C  CA  . THR D 1 244 ? 31.534  -3.757  27.422  1.00 41.63 ? 246  THR D CA  1 
ATOM   7663 C  C   . THR D 1 244 ? 31.104  -3.134  28.772  1.00 40.74 ? 246  THR D C   1 
ATOM   7664 O  O   . THR D 1 244 ? 30.303  -2.192  28.796  1.00 40.31 ? 246  THR D O   1 
ATOM   7665 C  CB  . THR D 1 244 ? 32.868  -3.152  26.924  1.00 45.37 ? 246  THR D CB  1 
ATOM   7666 O  OG1 . THR D 1 244 ? 33.917  -3.500  27.825  1.00 52.35 ? 246  THR D OG1 1 
ATOM   7667 C  CG2 . THR D 1 244 ? 32.802  -1.641  26.817  1.00 46.02 ? 246  THR D CG2 1 
ATOM   7668 N  N   . GLN D 1 245 ? 31.627  -3.673  29.871  1.00 36.93 ? 247  GLN D N   1 
ATOM   7669 C  CA  . GLN D 1 245 ? 31.149  -3.344  31.217  1.00 35.53 ? 247  GLN D CA  1 
ATOM   7670 C  C   . GLN D 1 245 ? 32.300  -2.904  32.071  1.00 33.75 ? 247  GLN D C   1 
ATOM   7671 O  O   . GLN D 1 245 ? 33.416  -3.395  31.884  1.00 32.81 ? 247  GLN D O   1 
ATOM   7672 C  CB  . GLN D 1 245 ? 30.479  -4.565  31.872  1.00 35.14 ? 247  GLN D CB  1 
ATOM   7673 C  CG  . GLN D 1 245 ? 29.250  -5.063  31.140  1.00 34.84 ? 247  GLN D CG  1 
ATOM   7674 C  CD  . GLN D 1 245 ? 28.103  -4.073  31.181  1.00 37.90 ? 247  GLN D CD  1 
ATOM   7675 O  OE1 . GLN D 1 245 ? 27.719  -3.609  32.252  1.00 39.52 ? 247  GLN D OE1 1 
ATOM   7676 N  NE2 . GLN D 1 245 ? 27.531  -3.761  30.019  1.00 37.55 ? 247  GLN D NE2 1 
ATOM   7677 N  N   . PRO D 1 246 ? 32.049  -1.983  33.033  1.00 34.45 ? 248  PRO D N   1 
ATOM   7678 C  CA  . PRO D 1 246 ? 33.144  -1.476  33.862  1.00 35.21 ? 248  PRO D CA  1 
ATOM   7679 C  C   . PRO D 1 246 ? 33.815  -2.537  34.746  1.00 37.12 ? 248  PRO D C   1 
ATOM   7680 O  O   . PRO D 1 246 ? 33.131  -3.358  35.359  1.00 40.30 ? 248  PRO D O   1 
ATOM   7681 C  CB  . PRO D 1 246 ? 32.463  -0.401  34.739  1.00 35.71 ? 248  PRO D CB  1 
ATOM   7682 C  CG  . PRO D 1 246 ? 31.010  -0.677  34.657  1.00 35.10 ? 248  PRO D CG  1 
ATOM   7683 C  CD  . PRO D 1 246 ? 30.773  -1.298  33.321  1.00 34.01 ? 248  PRO D CD  1 
ATOM   7684 N  N   . LEU D 1 247 ? 35.137  -2.493  34.828  1.00 37.70 ? 249  LEU D N   1 
ATOM   7685 C  CA  . LEU D 1 247 ? 35.886  -3.443  35.639  1.00 39.42 ? 249  LEU D CA  1 
ATOM   7686 C  C   . LEU D 1 247 ? 35.631  -3.290  37.133  1.00 40.33 ? 249  LEU D C   1 
ATOM   7687 O  O   . LEU D 1 247 ? 35.670  -4.283  37.864  1.00 38.93 ? 249  LEU D O   1 
ATOM   7688 C  CB  . LEU D 1 247 ? 37.391  -3.356  35.360  1.00 40.21 ? 249  LEU D CB  1 
ATOM   7689 C  CG  . LEU D 1 247 ? 37.908  -4.007  34.063  1.00 42.64 ? 249  LEU D CG  1 
ATOM   7690 C  CD1 . LEU D 1 247 ? 39.394  -3.697  33.908  1.00 43.36 ? 249  LEU D CD1 1 
ATOM   7691 C  CD2 . LEU D 1 247 ? 37.692  -5.520  34.041  1.00 43.51 ? 249  LEU D CD2 1 
ATOM   7692 N  N   . ASN D 1 248 ? 35.394  -2.054  37.578  1.00 39.00 ? 250  ASN D N   1 
ATOM   7693 C  CA  . ASN D 1 248 ? 35.119  -1.747  38.994  1.00 37.77 ? 250  ASN D CA  1 
ATOM   7694 C  C   . ASN D 1 248 ? 36.126  -2.314  39.950  1.00 34.91 ? 250  ASN D C   1 
ATOM   7695 O  O   . ASN D 1 248 ? 35.766  -2.911  40.961  1.00 37.95 ? 250  ASN D O   1 
ATOM   7696 C  CB  . ASN D 1 248 ? 33.701  -2.171  39.391  1.00 36.63 ? 250  ASN D CB  1 
ATOM   7697 C  CG  . ASN D 1 248 ? 32.652  -1.393  38.655  1.00 38.32 ? 250  ASN D CG  1 
ATOM   7698 O  OD1 . ASN D 1 248 ? 32.860  -0.221  38.326  1.00 42.91 ? 250  ASN D OD1 1 
ATOM   7699 N  ND2 . ASN D 1 248 ? 31.521  -2.020  38.385  1.00 36.74 ? 250  ASN D ND2 1 
ATOM   7700 N  N   . GLY D 1 249 ? 37.398  -2.121  39.618  1.00 31.98 ? 251  GLY D N   1 
ATOM   7701 C  CA  . GLY D 1 249 ? 38.506  -2.561  40.452  1.00 31.00 ? 251  GLY D CA  1 
ATOM   7702 C  C   . GLY D 1 249 ? 39.079  -3.938  40.140  1.00 30.00 ? 251  GLY D C   1 
ATOM   7703 O  O   . GLY D 1 249 ? 40.147  -4.278  40.633  1.00 29.65 ? 251  GLY D O   1 
ATOM   7704 N  N   . ARG D 1 250 ? 38.359  -4.746  39.365  1.00 30.54 ? 252  ARG D N   1 
ATOM   7705 C  CA  . ARG D 1 250 ? 38.887  -6.038  38.911  1.00 31.65 ? 252  ARG D CA  1 
ATOM   7706 C  C   . ARG D 1 250 ? 40.131  -5.838  38.053  1.00 33.00 ? 252  ARG D C   1 
ATOM   7707 O  O   . ARG D 1 250 ? 40.106  -5.018  37.143  1.00 34.32 ? 252  ARG D O   1 
ATOM   7708 C  CB  . ARG D 1 250 ? 37.848  -6.780  38.083  1.00 30.72 ? 252  ARG D CB  1 
ATOM   7709 C  CG  . ARG D 1 250 ? 36.762  -7.434  38.910  1.00 30.31 ? 252  ARG D CG  1 
ATOM   7710 C  CD  . ARG D 1 250 ? 35.729  -8.057  38.011  1.00 28.98 ? 252  ARG D CD  1 
ATOM   7711 N  NE  . ARG D 1 250 ? 35.038  -7.034  37.237  1.00 28.90 ? 252  ARG D NE  1 
ATOM   7712 C  CZ  . ARG D 1 250 ? 34.136  -7.269  36.296  1.00 27.70 ? 252  ARG D CZ  1 
ATOM   7713 N  NH1 . ARG D 1 250 ? 33.757  -8.509  35.984  1.00 29.90 ? 252  ARG D NH1 1 
ATOM   7714 N  NH2 . ARG D 1 250 ? 33.583  -6.246  35.670  1.00 27.73 ? 252  ARG D NH2 1 
ATOM   7715 N  N   . VAL D 1 251 ? 41.188  -6.586  38.360  1.00 33.73 ? 253  VAL D N   1 
ATOM   7716 C  CA  . VAL D 1 251 ? 42.425  -6.587  37.578  1.00 34.89 ? 253  VAL D CA  1 
ATOM   7717 C  C   . VAL D 1 251 ? 42.385  -7.814  36.656  1.00 35.79 ? 253  VAL D C   1 
ATOM   7718 O  O   . VAL D 1 251 ? 42.297  -8.944  37.143  1.00 35.65 ? 253  VAL D O   1 
ATOM   7719 C  CB  . VAL D 1 251 ? 43.664  -6.680  38.497  1.00 34.23 ? 253  VAL D CB  1 
ATOM   7720 C  CG1 . VAL D 1 251 ? 44.948  -6.853  37.681  1.00 36.34 ? 253  VAL D CG1 1 
ATOM   7721 C  CG2 . VAL D 1 251 ? 43.764  -5.448  39.398  1.00 34.58 ? 253  VAL D CG2 1 
ATOM   7722 N  N   . ILE D 1 252 ? 42.443  -7.593  35.346  1.00 36.50 ? 254  ILE D N   1 
ATOM   7723 C  CA  . ILE D 1 252 ? 42.505  -8.709  34.384  1.00 38.13 ? 254  ILE D CA  1 
ATOM   7724 C  C   . ILE D 1 252 ? 43.880  -9.337  34.469  1.00 38.87 ? 254  ILE D C   1 
ATOM   7725 O  O   . ILE D 1 252 ? 44.886  -8.627  34.417  1.00 40.04 ? 254  ILE D O   1 
ATOM   7726 C  CB  . ILE D 1 252 ? 42.205  -8.257  32.946  1.00 38.42 ? 254  ILE D CB  1 
ATOM   7727 C  CG1 . ILE D 1 252 ? 40.760  -7.786  32.860  1.00 39.27 ? 254  ILE D CG1 1 
ATOM   7728 C  CG2 . ILE D 1 252 ? 42.437  -9.407  31.956  1.00 38.56 ? 254  ILE D CG2 1 
ATOM   7729 C  CD1 . ILE D 1 252 ? 40.401  -7.112  31.563  1.00 40.90 ? 254  ILE D CD1 1 
ATOM   7730 N  N   . GLU D 1 253 ? 43.928  -10.661 34.632  1.00 36.16 ? 255  GLU D N   1 
ATOM   7731 C  CA  . GLU D 1 253 ? 45.194  -11.377 34.718  1.00 34.11 ? 255  GLU D CA  1 
ATOM   7732 C  C   . GLU D 1 253 ? 45.555  -11.934 33.350  1.00 31.74 ? 255  GLU D C   1 
ATOM   7733 O  O   . GLU D 1 253 ? 44.679  -12.149 32.517  1.00 31.06 ? 255  GLU D O   1 
ATOM   7734 C  CB  . GLU D 1 253 ? 45.138  -12.495 35.744  1.00 36.62 ? 255  GLU D CB  1 
ATOM   7735 C  CG  . GLU D 1 253 ? 44.936  -11.987 37.157  1.00 39.19 ? 255  GLU D CG  1 
ATOM   7736 C  CD  . GLU D 1 253 ? 44.801  -13.093 38.193  1.00 42.40 ? 255  GLU D CD  1 
ATOM   7737 O  OE1 . GLU D 1 253 ? 44.982  -14.285 37.874  1.00 40.79 ? 255  GLU D OE1 1 
ATOM   7738 O  OE2 . GLU D 1 253 ? 44.502  -12.751 39.356  1.00 48.31 ? 255  GLU D OE2 1 
ATOM   7739 N  N   . ALA D 1 254 ? 46.849  -12.126 33.134  1.00 32.32 ? 256  ALA D N   1 
ATOM   7740 C  CA  . ALA D 1 254 ? 47.391  -12.652 31.870  1.00 32.47 ? 256  ALA D CA  1 
ATOM   7741 C  C   . ALA D 1 254 ? 48.373  -13.743 32.205  1.00 30.39 ? 256  ALA D C   1 
ATOM   7742 O  O   . ALA D 1 254 ? 49.178  -13.605 33.144  1.00 31.67 ? 256  ALA D O   1 
ATOM   7743 C  CB  . ALA D 1 254 ? 48.069  -11.535 31.067  1.00 32.52 ? 256  ALA D CB  1 
ATOM   7744 N  N   . SER D 1 255 ? 48.313  -14.852 31.458  1.00 29.57 ? 257  SER D N   1 
ATOM   7745 C  CA  . SER D 1 255 ? 49.183  -16.004 31.725  1.00 30.58 ? 257  SER D CA  1 
ATOM   7746 C  C   . SER D 1 255 ? 50.561  -15.847 31.055  1.00 30.85 ? 257  SER D C   1 
ATOM   7747 O  O   . SER D 1 255 ? 51.394  -16.734 31.170  1.00 30.16 ? 257  SER D O   1 
ATOM   7748 C  CB  . SER D 1 255 ? 48.549  -17.319 31.233  1.00 29.95 ? 257  SER D CB  1 
ATOM   7749 O  OG  . SER D 1 255 ? 48.420  -17.299 29.823  1.00 32.75 ? 257  SER D OG  1 
ATOM   7750 N  N   . PHE D 1 256 ? 50.780  -14.719 30.387  1.00 33.17 ? 258  PHE D N   1 
ATOM   7751 C  CA  . PHE D 1 256 ? 52.008  -14.455 29.630  1.00 36.63 ? 258  PHE D CA  1 
ATOM   7752 C  C   . PHE D 1 256 ? 52.452  -12.995 29.845  1.00 37.48 ? 258  PHE D C   1 
ATOM   7753 O  O   . PHE D 1 256 ? 51.598  -12.112 30.025  1.00 36.38 ? 258  PHE D O   1 
ATOM   7754 C  CB  . PHE D 1 256 ? 51.758  -14.685 28.140  1.00 32.04 ? 258  PHE D CB  1 
ATOM   7755 C  CG  . PHE D 1 256 ? 50.669  -13.834 27.585  1.00 32.50 ? 258  PHE D CG  1 
ATOM   7756 C  CD1 . PHE D 1 256 ? 49.339  -14.236 27.673  1.00 30.69 ? 258  PHE D CD1 1 
ATOM   7757 C  CD2 . PHE D 1 256 ? 50.958  -12.587 27.023  1.00 31.74 ? 258  PHE D CD2 1 
ATOM   7758 C  CE1 . PHE D 1 256 ? 48.327  -13.435 27.182  1.00 32.71 ? 258  PHE D CE1 1 
ATOM   7759 C  CE2 . PHE D 1 256 ? 49.948  -11.788 26.529  1.00 32.23 ? 258  PHE D CE2 1 
ATOM   7760 C  CZ  . PHE D 1 256 ? 48.629  -12.214 26.604  1.00 33.28 ? 258  PHE D CZ  1 
ATOM   7761 N  N   . PRO D 1 257 ? 53.772  -12.731 29.788  1.00 43.56 ? 259  PRO D N   1 
ATOM   7762 C  CA  . PRO D 1 257 ? 54.259  -11.347 29.957  1.00 45.08 ? 259  PRO D CA  1 
ATOM   7763 C  C   . PRO D 1 257 ? 53.999  -10.397 28.778  1.00 47.70 ? 259  PRO D C   1 
ATOM   7764 O  O   . PRO D 1 257 ? 53.909  -9.178  28.958  1.00 46.64 ? 259  PRO D O   1 
ATOM   7765 C  CB  . PRO D 1 257 ? 55.764  -11.526 30.125  1.00 46.09 ? 259  PRO D CB  1 
ATOM   7766 C  CG  . PRO D 1 257 ? 55.970  -12.960 30.483  1.00 46.18 ? 259  PRO D CG  1 
ATOM   7767 C  CD  . PRO D 1 257 ? 54.884  -13.703 29.794  1.00 43.41 ? 259  PRO D CD  1 
ATOM   7768 O  OXT . PRO D 1 257 ? 53.904  -10.786 27.613  1.00 50.96 ? 259  PRO D OXT 1 
HETATM 7769 ZN ZN  . ZN  E 2 .   ? 7.167   -25.410 57.347  1.00 18.59 ? 264  ZN  A ZN  1 
HETATM 7770 O  O22 . 9FK F 3 .   ? 9.041   -24.699 59.587  1.00 18.19 ? 269  9FK A O22 1 
HETATM 7771 S  S21 . 9FK F 3 .   ? 8.987   -26.147 59.637  1.00 20.15 ? 269  9FK A S21 1 
HETATM 7772 O  O23 . 9FK F 3 .   ? 8.600   -26.561 60.952  1.00 18.81 ? 269  9FK A O23 1 
HETATM 7773 N  N24 . 9FK F 3 .   ? 7.981   -26.837 58.600  1.00 20.22 ? 269  9FK A N24 1 
HETATM 7774 C  C19 . 9FK F 3 .   ? 10.516  -26.745 59.365  1.00 20.99 ? 269  9FK A C19 1 
HETATM 7775 S  S20 . 9FK F 3 .   ? 11.928  -25.751 59.429  1.00 21.35 ? 269  9FK A S20 1 
HETATM 7776 C  C16 . 9FK F 3 .   ? 12.915  -27.129 59.136  1.00 25.72 ? 269  9FK A C16 1 
HETATM 7777 C  C17 . 9FK F 3 .   ? 12.196  -28.316 59.037  1.00 23.95 ? 269  9FK A C17 1 
HETATM 7778 C  C18 . 9FK F 3 .   ? 10.801  -28.094 59.172  1.00 21.84 ? 269  9FK A C18 1 
HETATM 7779 C  C14 . 9FK F 3 .   ? 14.381  -26.869 59.126  1.00 29.26 ? 269  9FK A C14 1 
HETATM 7780 C  C15 . 9FK F 3 .   ? 15.471  -27.727 58.954  1.00 32.74 ? 269  9FK A C15 1 
HETATM 7781 N  N11 . 9FK F 3 .   ? 16.504  -26.876 59.133  1.00 34.55 ? 269  9FK A N11 1 
HETATM 7782 N  N12 . 9FK F 3 .   ? 16.106  -25.575 59.436  1.00 33.65 ? 269  9FK A N12 1 
HETATM 7783 N  N13 . 9FK F 3 .   ? 14.706  -25.599 59.440  1.00 31.43 ? 269  9FK A N13 1 
HETATM 7784 C  C10 . 9FK F 3 .   ? 17.849  -27.034 59.090  1.00 38.39 ? 269  9FK A C10 1 
HETATM 7785 C  C9  . 9FK F 3 .   ? 18.711  -26.138 58.434  1.00 38.51 ? 269  9FK A C9  1 
HETATM 7786 C  C8  . 9FK F 3 .   ? 20.110  -26.227 58.435  1.00 41.59 ? 269  9FK A C8  1 
HETATM 7787 C  C7  . 9FK F 3 .   ? 20.759  -27.239 59.121  1.00 40.39 ? 269  9FK A C7  1 
HETATM 7788 C  C4  . 9FK F 3 .   ? 20.021  -28.180 59.827  1.00 41.23 ? 269  9FK A C4  1 
HETATM 7789 C  C3  . 9FK F 3 .   ? 18.525  -28.117 59.867  1.00 37.12 ? 269  9FK A C3  1 
HETATM 7790 C  C5  . 9FK F 3 .   ? 20.692  -29.186 60.500  1.00 40.26 ? 269  9FK A C5  1 
HETATM 7791 C  C6  . 9FK F 3 .   ? 19.969  -30.128 61.219  1.00 41.79 ? 269  9FK A C6  1 
HETATM 7792 C  C1  . 9FK F 3 .   ? 18.569  -30.081 61.257  1.00 41.32 ? 269  9FK A C1  1 
HETATM 7793 C  C2  . 9FK F 3 .   ? 17.853  -29.085 60.605  1.00 38.83 ? 269  9FK A C2  1 
HETATM 7794 C  C1  . GOL G 4 .   ? 12.005  -26.220 55.540  1.00 36.14 ? 273  GOL A C1  1 
HETATM 7795 O  O1  . GOL G 4 .   ? 13.412  -26.407 55.695  1.00 40.97 ? 273  GOL A O1  1 
HETATM 7796 C  C2  . GOL G 4 .   ? 11.439  -27.124 54.417  1.00 39.91 ? 273  GOL A C2  1 
HETATM 7797 O  O2  . GOL G 4 .   ? 11.393  -26.501 53.101  1.00 32.65 ? 273  GOL A O2  1 
HETATM 7798 C  C3  . GOL G 4 .   ? 10.033  -27.629 54.801  1.00 42.70 ? 273  GOL A C3  1 
HETATM 7799 O  O3  . GOL G 4 .   ? 9.790   -27.736 56.214  1.00 41.63 ? 273  GOL A O3  1 
HETATM 7800 C  C   . ACY H 5 .   ? -4.486  -24.721 47.213  1.00 52.24 ? 1260 ACY A C   1 
HETATM 7801 O  O   . ACY H 5 .   ? -3.480  -24.735 48.012  1.00 40.45 ? 1260 ACY A O   1 
HETATM 7802 O  OXT . ACY H 5 .   ? -5.651  -25.079 47.537  1.00 49.74 ? 1260 ACY A OXT 1 
HETATM 7803 C  CH3 . ACY H 5 .   ? -4.348  -24.272 45.786  1.00 49.35 ? 1260 ACY A CH3 1 
HETATM 7804 C  C   . ACY I 5 .   ? -5.699  -32.245 72.706  1.00 45.97 ? 1261 ACY A C   1 
HETATM 7805 O  O   . ACY I 5 .   ? -4.581  -32.555 73.189  1.00 40.14 ? 1261 ACY A O   1 
HETATM 7806 O  OXT . ACY I 5 .   ? -6.267  -32.996 71.879  1.00 50.94 ? 1261 ACY A OXT 1 
HETATM 7807 C  CH3 . ACY I 5 .   ? -6.399  -30.984 73.135  1.00 43.45 ? 1261 ACY A CH3 1 
HETATM 7808 ZN ZN  . ZN  J 2 .   ? 21.430  -16.636 94.210  1.00 21.74 ? 264  ZN  B ZN  1 
HETATM 7809 O  O22 . 9FK K 3 .   ? 21.664  -16.091 90.184  1.00 21.90 ? 268  9FK B O22 1 
HETATM 7810 S  S21 . 9FK K 3 .   ? 22.080  -16.890 91.285  1.00 21.77 ? 268  9FK B S21 1 
HETATM 7811 O  O23 . 9FK K 3 .   ? 21.177  -17.976 91.607  1.00 19.70 ? 268  9FK B O23 1 
HETATM 7812 N  N24 . 9FK K 3 .   ? 22.392  -15.870 92.473  1.00 23.29 ? 268  9FK B N24 1 
HETATM 7813 C  C19 . 9FK K 3 .   ? 23.519  -17.557 90.748  1.00 24.35 ? 268  9FK B C19 1 
HETATM 7814 S  S20 . 9FK K 3 .   ? 23.619  -19.208 90.236  1.00 25.06 ? 268  9FK B S20 1 
HETATM 7815 C  C16 . 9FK K 3 .   ? 25.287  -19.032 89.881  1.00 26.41 ? 268  9FK B C16 1 
HETATM 7816 C  C17 . 9FK K 3 .   ? 25.768  -17.742 90.111  1.00 25.13 ? 268  9FK B C17 1 
HETATM 7817 C  C18 . 9FK K 3 .   ? 24.740  -16.890 90.638  1.00 24.49 ? 268  9FK B C18 1 
HETATM 7818 C  C14 . 9FK K 3 .   ? 25.963  -20.204 89.247  1.00 32.20 ? 268  9FK B C14 1 
HETATM 7819 C  C15 . 9FK K 3 .   ? 27.269  -20.345 88.784  1.00 34.73 ? 268  9FK B C15 1 
HETATM 7820 N  N11 . 9FK K 3 .   ? 27.210  -21.567 88.217  1.00 37.27 ? 268  9FK B N11 1 
HETATM 7821 N  N12 . 9FK K 3 .   ? 25.948  -22.141 88.262  1.00 38.70 ? 268  9FK B N12 1 
HETATM 7822 N  N13 . 9FK K 3 .   ? 25.142  -21.220 88.924  1.00 35.26 ? 268  9FK B N13 1 
HETATM 7823 C  C10 . 9FK K 3 .   ? 28.152  -22.345 87.616  1.00 43.92 ? 268  9FK B C10 1 
HETATM 7824 C  C9  . 9FK K 3 .   ? 28.295  -23.734 87.846  1.00 43.01 ? 268  9FK B C9  1 
HETATM 7825 C  C8  . 9FK K 3 .   ? 29.232  -24.566 87.212  1.00 45.95 ? 268  9FK B C8  1 
HETATM 7826 C  C7  . 9FK K 3 .   ? 30.118  -24.062 86.264  1.00 45.27 ? 268  9FK B C7  1 
HETATM 7827 C  C4  . 9FK K 3 .   ? 30.069  -22.711 85.932  1.00 45.43 ? 268  9FK B C4  1 
HETATM 7828 C  C3  . 9FK K 3 .   ? 29.083  -21.781 86.587  1.00 43.68 ? 268  9FK B C3  1 
HETATM 7829 C  C5  . 9FK K 3 .   ? 30.950  -22.210 84.981  1.00 47.27 ? 268  9FK B C5  1 
HETATM 7830 C  C6  . 9FK K 3 .   ? 30.919  -20.849 84.653  1.00 48.76 ? 268  9FK B C6  1 
HETATM 7831 C  C1  . 9FK K 3 .   ? 30.007  -19.983 85.254  1.00 46.11 ? 268  9FK B C1  1 
HETATM 7832 C  C2  . 9FK K 3 .   ? 29.097  -20.437 86.208  1.00 45.51 ? 268  9FK B C2  1 
HETATM 7833 C  C1  . GOL L 4 .   ? 26.956  -17.572 95.677  1.00 42.23 ? 272  GOL B C1  1 
HETATM 7834 O  O1  . GOL L 4 .   ? 27.376  -16.513 94.814  1.00 42.68 ? 272  GOL B O1  1 
HETATM 7835 C  C2  . GOL L 4 .   ? 26.951  -18.935 95.011  1.00 41.30 ? 272  GOL B C2  1 
HETATM 7836 O  O2  . GOL L 4 .   ? 26.545  -19.857 96.032  1.00 36.06 ? 272  GOL B O2  1 
HETATM 7837 C  C3  . GOL L 4 .   ? 25.967  -18.953 93.837  1.00 40.22 ? 272  GOL B C3  1 
HETATM 7838 O  O3  . GOL L 4 .   ? 26.067  -20.174 93.092  1.00 37.52 ? 272  GOL B O3  1 
HETATM 7839 C  C   . ACY M 5 .   ? 8.362   -1.520  103.383 1.00 64.85 ? 1260 ACY B C   1 
HETATM 7840 O  O   . ACY M 5 .   ? 7.645   -1.570  102.361 1.00 65.89 ? 1260 ACY B O   1 
HETATM 7841 O  OXT . ACY M 5 .   ? 9.543   -1.123  103.316 1.00 64.70 ? 1260 ACY B OXT 1 
HETATM 7842 C  CH3 . ACY M 5 .   ? 7.803   -1.951  104.710 1.00 62.72 ? 1260 ACY B CH3 1 
HETATM 7843 ZN ZN  . ZN  N 2 .   ? 43.043  -24.378 61.834  1.00 22.28 ? 264  ZN  C ZN  1 
HETATM 7844 O  O22 . 9FK O 3 .   ? 41.488  -25.568 58.253  1.00 25.54 ? 267  9FK C O22 1 
HETATM 7845 S  S21 . 9FK O 3 .   ? 41.167  -25.177 59.617  1.00 24.12 ? 267  9FK C S21 1 
HETATM 7846 O  O23 . 9FK O 3 .   ? 41.122  -23.754 59.620  1.00 22.22 ? 267  9FK C O23 1 
HETATM 7847 N  N24 . 9FK O 3 .   ? 42.225  -25.846 60.577  1.00 22.95 ? 267  9FK C N24 1 
HETATM 7848 C  C19 . 9FK O 3 .   ? 39.674  -25.867 59.844  1.00 24.45 ? 267  9FK C C19 1 
HETATM 7849 S  S20 . 9FK O 3 .   ? 38.262  -24.886 59.794  1.00 24.70 ? 267  9FK C S20 1 
HETATM 7850 C  C16 . 9FK O 3 .   ? 37.321  -26.278 60.107  1.00 26.95 ? 267  9FK C C16 1 
HETATM 7851 C  C17 . 9FK O 3 .   ? 38.037  -27.459 60.201  1.00 26.69 ? 267  9FK C C17 1 
HETATM 7852 C  C18 . 9FK O 3 .   ? 39.426  -27.208 60.066  1.00 25.23 ? 267  9FK C C18 1 
HETATM 7853 C  C14 . 9FK O 3 .   ? 35.851  -26.057 60.126  1.00 32.40 ? 267  9FK C C14 1 
HETATM 7854 C  C15 . 9FK O 3 .   ? 34.819  -26.956 60.352  1.00 35.52 ? 267  9FK C C15 1 
HETATM 7855 N  N11 . 9FK O 3 .   ? 33.752  -26.159 60.153  1.00 38.77 ? 267  9FK C N11 1 
HETATM 7856 N  N12 . 9FK O 3 .   ? 34.072  -24.839 59.818  1.00 41.89 ? 267  9FK C N12 1 
HETATM 7857 N  N13 . 9FK O 3 .   ? 35.469  -24.818 59.786  1.00 35.54 ? 267  9FK C N13 1 
HETATM 7858 C  C10 . 9FK O 3 .   ? 32.437  -26.413 60.253  1.00 43.97 ? 267  9FK C C10 1 
HETATM 7859 C  C9  . 9FK O 3 .   ? 31.563  -25.537 60.912  1.00 45.72 ? 267  9FK C C9  1 
HETATM 7860 C  C8  . 9FK O 3 .   ? 30.188  -25.734 60.995  1.00 48.12 ? 267  9FK C C8  1 
HETATM 7861 C  C7  . 9FK O 3 .   ? 29.570  -26.831 60.410  1.00 47.32 ? 267  9FK C C7  1 
HETATM 7862 C  C4  . 9FK O 3 .   ? 30.319  -27.772 59.721  1.00 45.36 ? 267  9FK C C4  1 
HETATM 7863 C  C3  . 9FK O 3 .   ? 31.799  -27.601 59.592  1.00 42.92 ? 267  9FK C C3  1 
HETATM 7864 C  C5  . 9FK O 3 .   ? 29.681  -28.860 59.146  1.00 45.44 ? 267  9FK C C5  1 
HETATM 7865 C  C6  . 9FK O 3 .   ? 30.417  -29.800 58.444  1.00 45.10 ? 267  9FK C C6  1 
HETATM 7866 C  C1  . 9FK O 3 .   ? 31.797  -29.648 58.315  1.00 44.97 ? 267  9FK C C1  1 
HETATM 7867 C  C2  . 9FK O 3 .   ? 32.487  -28.571 58.871  1.00 43.38 ? 267  9FK C C2  1 
HETATM 7868 C  C1  . GOL P 4 .   ? 39.500  -27.375 63.971  1.00 50.87 ? 271  GOL C C1  1 
HETATM 7869 O  O1  . GOL P 4 .   ? 40.620  -27.212 63.089  1.00 51.53 ? 271  GOL C O1  1 
HETATM 7870 C  C2  . GOL P 4 .   ? 39.176  -26.001 64.579  1.00 48.88 ? 271  GOL C C2  1 
HETATM 7871 O  O2  . GOL P 4 .   ? 38.793  -25.984 65.983  1.00 45.12 ? 271  GOL C O2  1 
HETATM 7872 C  C3  . GOL P 4 .   ? 38.142  -25.358 63.647  1.00 43.26 ? 271  GOL C C3  1 
HETATM 7873 O  O3  . GOL P 4 .   ? 36.869  -26.007 63.723  1.00 51.70 ? 271  GOL C O3  1 
HETATM 7874 C  C   . ACY Q 5 .   ? 55.827  -31.070 46.465  1.00 38.71 ? 1260 ACY C C   1 
HETATM 7875 O  O   . ACY Q 5 .   ? 54.727  -31.280 45.922  1.00 36.04 ? 1260 ACY C O   1 
HETATM 7876 O  OXT . ACY Q 5 .   ? 56.418  -29.980 46.281  1.00 40.87 ? 1260 ACY C OXT 1 
HETATM 7877 C  CH3 . ACY Q 5 .   ? 56.435  -32.158 47.315  1.00 39.18 ? 1260 ACY C CH3 1 
HETATM 7878 C  C   . ACY R 5 .   ? 48.687  -31.656 38.728  1.00 42.36 ? 1261 ACY C C   1 
HETATM 7879 O  O   . ACY R 5 .   ? 49.843  -31.221 38.444  1.00 39.26 ? 1261 ACY C O   1 
HETATM 7880 O  OXT . ACY R 5 .   ? 48.386  -32.225 39.834  1.00 36.26 ? 1261 ACY C OXT 1 
HETATM 7881 C  CH3 . ACY R 5 .   ? 47.634  -31.429 37.676  1.00 41.12 ? 1261 ACY C CH3 1 
HETATM 7882 C  C   . ACY S 5 .   ? 41.749  -27.564 45.262  1.00 53.70 ? 1262 ACY C C   1 
HETATM 7883 O  O   . ACY S 5 .   ? 42.499  -27.584 44.254  1.00 53.89 ? 1262 ACY C O   1 
HETATM 7884 O  OXT . ACY S 5 .   ? 42.183  -27.582 46.431  1.00 50.53 ? 1262 ACY C OXT 1 
HETATM 7885 C  CH3 . ACY S 5 .   ? 40.265  -27.535 45.061  1.00 52.14 ? 1262 ACY C CH3 1 
HETATM 7886 ZN ZN  . ZN  T 2 .   ? 28.114  -16.053 24.984  1.00 28.26 ? 264  ZN  D ZN  1 
HETATM 7887 O  O22 . 9FK U 3 .   ? 28.026  -15.595 28.947  1.00 26.31 ? 266  9FK D O22 1 
HETATM 7888 S  S21 . 9FK U 3 .   ? 27.448  -16.346 27.860  1.00 29.00 ? 266  9FK D S21 1 
HETATM 7889 O  O23 . 9FK U 3 .   ? 28.470  -17.318 27.574  1.00 26.99 ? 266  9FK D O23 1 
HETATM 7890 N  N24 . 9FK U 3 .   ? 27.051  -15.371 26.664  1.00 28.37 ? 266  9FK D N24 1 
HETATM 7891 C  C19 . 9FK U 3 .   ? 26.057  -17.047 28.432  1.00 30.08 ? 266  9FK D C19 1 
HETATM 7892 S  S20 . 9FK U 3 .   ? 26.028  -18.689 28.943  1.00 30.79 ? 266  9FK D S20 1 
HETATM 7893 C  C16 . 9FK U 3 .   ? 24.348  -18.565 29.367  1.00 34.60 ? 266  9FK D C16 1 
HETATM 7894 C  C17 . 9FK U 3 .   ? 23.834  -17.285 29.147  1.00 33.76 ? 266  9FK D C17 1 
HETATM 7895 C  C18 . 9FK U 3 .   ? 24.820  -16.416 28.597  1.00 30.76 ? 266  9FK D C18 1 
HETATM 7896 C  C14 . 9FK U 3 .   ? 23.705  -19.760 30.003  1.00 39.91 ? 266  9FK D C14 1 
HETATM 7897 C  C15 . 9FK U 3 .   ? 22.404  -20.016 30.443  1.00 42.20 ? 266  9FK D C15 1 
HETATM 7898 N  N11 . 9FK U 3 .   ? 22.551  -21.240 31.000  1.00 46.85 ? 266  9FK D N11 1 
HETATM 7899 N  N12 . 9FK U 3 .   ? 23.851  -21.720 30.969  1.00 48.01 ? 266  9FK D N12 1 
HETATM 7900 N  N13 . 9FK U 3 .   ? 24.584  -20.723 30.328  1.00 44.67 ? 266  9FK D N13 1 
HETATM 7901 C  C10 . 9FK U 3 .   ? 21.679  -22.100 31.586  1.00 54.78 ? 266  9FK D C10 1 
HETATM 7902 C  C9  . 9FK U 3 .   ? 21.614  -23.488 31.307  1.00 55.83 ? 266  9FK D C9  1 
HETATM 7903 C  C8  . 9FK U 3 .   ? 20.751  -24.396 31.931  1.00 56.71 ? 266  9FK D C8  1 
HETATM 7904 C  C7  . 9FK U 3 .   ? 19.871  -23.980 32.928  1.00 58.16 ? 266  9FK D C7  1 
HETATM 7905 C  C4  . 9FK U 3 .   ? 19.850  -22.643 33.309  1.00 57.81 ? 266  9FK D C4  1 
HETATM 7906 C  C3  . 9FK U 3 .   ? 20.759  -21.634 32.668  1.00 57.04 ? 266  9FK D C3  1 
HETATM 7907 C  C5  . 9FK U 3 .   ? 18.976  -22.232 34.303  1.00 60.61 ? 266  9FK D C5  1 
HETATM 7908 C  C6  . 9FK U 3 .   ? 18.942  -20.892 34.688  1.00 60.54 ? 266  9FK D C6  1 
HETATM 7909 C  C1  . 9FK U 3 .   ? 19.779  -19.944 34.103  1.00 60.63 ? 266  9FK D C1  1 
HETATM 7910 C  C2  . 9FK U 3 .   ? 20.686  -20.302 33.104  1.00 59.99 ? 266  9FK D C2  1 
HETATM 7911 C  C1  . GOL V 4 .   ? 22.869  -19.019 25.905  1.00 56.13 ? 271  GOL D C1  1 
HETATM 7912 O  O1  . GOL V 4 .   ? 24.266  -19.266 26.037  1.00 52.97 ? 271  GOL D O1  1 
HETATM 7913 C  C2  . GOL V 4 .   ? 22.577  -18.398 24.532  1.00 57.28 ? 271  GOL D C2  1 
HETATM 7914 O  O2  . GOL V 4 .   ? 23.113  -19.177 23.448  1.00 52.93 ? 271  GOL D O2  1 
HETATM 7915 C  C3  . GOL V 4 .   ? 23.183  -17.005 24.440  1.00 57.11 ? 271  GOL D C3  1 
HETATM 7916 O  O3  . GOL V 4 .   ? 22.217  -16.218 23.750  1.00 59.15 ? 271  GOL D O3  1 
HETATM 7917 O  O   . HOH W 6 .   ? 10.552  -35.630 49.717  1.00 54.87 ? 2001 HOH A O   1 
HETATM 7918 O  O   . HOH W 6 .   ? 11.570  -34.372 51.855  1.00 47.81 ? 2002 HOH A O   1 
HETATM 7919 O  O   . HOH W 6 .   ? 8.543   -40.546 54.924  1.00 31.40 ? 2003 HOH A O   1 
HETATM 7920 O  O   . HOH W 6 .   ? 7.482   -35.999 49.807  1.00 39.33 ? 2004 HOH A O   1 
HETATM 7921 O  O   . HOH W 6 .   ? 7.778   -29.305 53.711  1.00 32.97 ? 2005 HOH A O   1 
HETATM 7922 O  O   . HOH W 6 .   ? 5.144   -30.802 57.266  1.00 24.66 ? 2006 HOH A O   1 
HETATM 7923 O  O   . HOH W 6 .   ? 3.000   -37.478 55.515  1.00 42.89 ? 2007 HOH A O   1 
HETATM 7924 O  O   . HOH W 6 .   ? 4.081   -38.299 57.829  1.00 50.13 ? 2008 HOH A O   1 
HETATM 7925 O  O   . HOH W 6 .   ? 4.753   -43.480 61.730  1.00 52.06 ? 2009 HOH A O   1 
HETATM 7926 O  O   . HOH W 6 .   ? 15.951  -44.340 65.369  1.00 39.46 ? 2010 HOH A O   1 
HETATM 7927 O  O   . HOH W 6 .   ? 15.774  -33.206 69.088  1.00 33.94 ? 2011 HOH A O   1 
HETATM 7928 O  O   . HOH W 6 .   ? 18.410  -34.181 65.059  1.00 36.75 ? 2012 HOH A O   1 
HETATM 7929 O  O   . HOH W 6 .   ? 5.456   -41.336 59.445  1.00 36.40 ? 2013 HOH A O   1 
HETATM 7930 O  O   . HOH W 6 .   ? 13.499  -44.186 66.202  1.00 31.89 ? 2014 HOH A O   1 
HETATM 7931 O  O   . HOH W 6 .   ? 0.061   -32.594 80.647  1.00 32.15 ? 2015 HOH A O   1 
HETATM 7932 O  O   . HOH W 6 .   ? 15.806  -48.200 60.057  1.00 59.68 ? 2016 HOH A O   1 
HETATM 7933 O  O   . HOH W 6 .   ? 17.245  -37.769 61.849  1.00 49.82 ? 2017 HOH A O   1 
HETATM 7934 O  O   . HOH W 6 .   ? 15.549  -37.066 67.548  1.00 41.36 ? 2018 HOH A O   1 
HETATM 7935 O  O   . HOH W 6 .   ? 15.681  -34.318 66.436  1.00 40.01 ? 2019 HOH A O   1 
HETATM 7936 O  O   . HOH W 6 .   ? -6.164  -21.549 79.697  1.00 50.23 ? 2020 HOH A O   1 
HETATM 7937 O  O   . HOH W 6 .   ? 11.708  -37.854 71.300  1.00 42.02 ? 2021 HOH A O   1 
HETATM 7938 O  O   . HOH W 6 .   ? 14.592  -37.850 70.308  1.00 40.63 ? 2022 HOH A O   1 
HETATM 7939 O  O   . HOH W 6 .   ? 10.775  -34.819 70.092  1.00 42.98 ? 2023 HOH A O   1 
HETATM 7940 O  O   . HOH W 6 .   ? -7.739  -19.129 79.666  1.00 49.06 ? 2024 HOH A O   1 
HETATM 7941 O  O   . HOH W 6 .   ? -4.902  -10.631 81.810  1.00 34.99 ? 2025 HOH A O   1 
HETATM 7942 O  O   . HOH W 6 .   ? 6.072   -13.573 77.222  1.00 41.76 ? 2026 HOH A O   1 
HETATM 7943 O  O   . HOH W 6 .   ? 3.906   -37.645 65.684  1.00 42.02 ? 2027 HOH A O   1 
HETATM 7944 O  O   . HOH W 6 .   ? 5.839   -38.688 62.771  1.00 32.53 ? 2028 HOH A O   1 
HETATM 7945 O  O   . HOH W 6 .   ? -0.988  -5.745  71.325  1.00 40.88 ? 2029 HOH A O   1 
HETATM 7946 O  O   . HOH W 6 .   ? 5.351   -2.583  71.255  1.00 32.98 ? 2030 HOH A O   1 
HETATM 7947 O  O   . HOH W 6 .   ? 7.510   -4.524  74.602  1.00 31.26 ? 2031 HOH A O   1 
HETATM 7948 O  O   . HOH W 6 .   ? 8.480   -5.127  72.145  1.00 27.55 ? 2032 HOH A O   1 
HETATM 7949 O  O   . HOH W 6 .   ? 3.359   -37.984 69.501  1.00 36.02 ? 2033 HOH A O   1 
HETATM 7950 O  O   . HOH W 6 .   ? 16.288  -8.128  67.578  1.00 45.47 ? 2034 HOH A O   1 
HETATM 7951 O  O   . HOH W 6 .   ? 1.843   -33.747 69.795  1.00 24.55 ? 2035 HOH A O   1 
HETATM 7952 O  O   . HOH W 6 .   ? 1.815   -33.351 78.926  1.00 33.95 ? 2036 HOH A O   1 
HETATM 7953 O  O   . HOH W 6 .   ? 22.463  -6.622  55.410  1.00 52.63 ? 2037 HOH A O   1 
HETATM 7954 O  O   . HOH W 6 .   ? 10.772  -2.706  49.128  1.00 24.57 ? 2038 HOH A O   1 
HETATM 7955 O  O   . HOH W 6 .   ? 7.920   1.487   50.418  1.00 44.31 ? 2039 HOH A O   1 
HETATM 7956 O  O   . HOH W 6 .   ? 21.066  -8.425  51.537  1.00 37.40 ? 2040 HOH A O   1 
HETATM 7957 O  O   . HOH W 6 .   ? 22.609  -17.874 49.874  1.00 39.86 ? 2041 HOH A O   1 
HETATM 7958 O  O   . HOH W 6 .   ? -4.134  -30.249 67.576  1.00 28.66 ? 2042 HOH A O   1 
HETATM 7959 O  O   . HOH W 6 .   ? -6.274  -28.552 70.072  1.00 44.86 ? 2043 HOH A O   1 
HETATM 7960 O  O   . HOH W 6 .   ? -8.517  -30.060 68.165  1.00 32.28 ? 2044 HOH A O   1 
HETATM 7961 O  O   . HOH W 6 .   ? -11.593 -27.777 66.575  1.00 41.44 ? 2045 HOH A O   1 
HETATM 7962 O  O   . HOH W 6 .   ? 19.778  -22.040 54.616  1.00 39.61 ? 2046 HOH A O   1 
HETATM 7963 O  O   . HOH W 6 .   ? -15.761 -27.691 73.393  1.00 48.93 ? 2047 HOH A O   1 
HETATM 7964 O  O   . HOH W 6 .   ? -14.049 -24.745 70.999  1.00 47.69 ? 2048 HOH A O   1 
HETATM 7965 O  O   . HOH W 6 .   ? -6.299  -24.039 71.443  1.00 27.40 ? 2049 HOH A O   1 
HETATM 7966 O  O   . HOH W 6 .   ? -12.981 -25.607 68.054  1.00 52.13 ? 2050 HOH A O   1 
HETATM 7967 O  O   . HOH W 6 .   ? -10.107 -30.733 70.609  1.00 51.70 ? 2051 HOH A O   1 
HETATM 7968 O  O   . HOH W 6 .   ? 23.097  -16.235 52.039  1.00 36.36 ? 2052 HOH A O   1 
HETATM 7969 O  O   . HOH W 6 .   ? 22.523  -16.167 57.914  1.00 41.26 ? 2053 HOH A O   1 
HETATM 7970 O  O   . HOH W 6 .   ? -12.286 -22.725 70.105  1.00 37.57 ? 2054 HOH A O   1 
HETATM 7971 O  O   . HOH W 6 .   ? -13.182 -17.008 71.748  1.00 39.99 ? 2055 HOH A O   1 
HETATM 7972 O  O   . HOH W 6 .   ? -15.436 -18.921 75.215  1.00 42.00 ? 2056 HOH A O   1 
HETATM 7973 O  O   . HOH W 6 .   ? 13.113  -6.101  70.762  1.00 38.22 ? 2057 HOH A O   1 
HETATM 7974 O  O   . HOH W 6 .   ? -5.058  -24.168 74.147  1.00 26.07 ? 2058 HOH A O   1 
HETATM 7975 O  O   . HOH W 6 .   ? -7.470  -23.733 78.160  1.00 50.33 ? 2059 HOH A O   1 
HETATM 7976 O  O   . HOH W 6 .   ? 18.999  -10.194 74.478  1.00 48.30 ? 2060 HOH A O   1 
HETATM 7977 O  O   . HOH W 6 .   ? 19.548  -5.557  74.619  1.00 36.45 ? 2061 HOH A O   1 
HETATM 7978 O  O   . HOH W 6 .   ? 26.954  -15.945 67.286  1.00 42.68 ? 2062 HOH A O   1 
HETATM 7979 O  O   . HOH W 6 .   ? 25.945  -9.598  67.465  1.00 50.47 ? 2063 HOH A O   1 
HETATM 7980 O  O   . HOH W 6 .   ? -7.366  -16.483 78.916  1.00 24.72 ? 2064 HOH A O   1 
HETATM 7981 O  O   . HOH W 6 .   ? -4.822  -13.407 80.990  1.00 25.06 ? 2065 HOH A O   1 
HETATM 7982 O  O   . HOH W 6 .   ? 3.483   -14.884 77.324  1.00 42.22 ? 2066 HOH A O   1 
HETATM 7983 O  O   . HOH W 6 .   ? 1.297   -12.774 79.461  1.00 36.90 ? 2067 HOH A O   1 
HETATM 7984 O  O   . HOH W 6 .   ? -1.075  -8.943  74.389  1.00 33.13 ? 2068 HOH A O   1 
HETATM 7985 O  O   . HOH W 6 .   ? 6.323   -9.978  73.388  1.00 27.35 ? 2069 HOH A O   1 
HETATM 7986 O  O   . HOH W 6 .   ? 6.557   -8.758  76.877  1.00 42.99 ? 2070 HOH A O   1 
HETATM 7987 O  O   . HOH W 6 .   ? 0.717   -7.855  70.872  1.00 27.01 ? 2071 HOH A O   1 
HETATM 7988 O  O   . HOH W 6 .   ? 4.888   -3.410  74.074  1.00 33.43 ? 2072 HOH A O   1 
HETATM 7989 O  O   . HOH W 6 .   ? -1.836  -6.527  75.777  1.00 48.94 ? 2073 HOH A O   1 
HETATM 7990 O  O   . HOH W 6 .   ? -6.701  -33.888 55.320  1.00 57.26 ? 2074 HOH A O   1 
HETATM 7991 O  O   . HOH W 6 .   ? -3.463  -35.003 52.349  1.00 49.36 ? 2075 HOH A O   1 
HETATM 7992 O  O   . HOH W 6 .   ? 6.643   -4.768  70.189  1.00 29.69 ? 2076 HOH A O   1 
HETATM 7993 O  O   . HOH W 6 .   ? 8.667   -8.191  69.811  1.00 26.12 ? 2077 HOH A O   1 
HETATM 7994 O  O   . HOH W 6 .   ? 4.998   -4.638  65.360  1.00 35.82 ? 2078 HOH A O   1 
HETATM 7995 O  O   . HOH W 6 .   ? -10.075 -17.985 61.974  1.00 52.43 ? 2079 HOH A O   1 
HETATM 7996 O  O   . HOH W 6 .   ? -11.293 -19.025 59.715  1.00 57.56 ? 2080 HOH A O   1 
HETATM 7997 O  O   . HOH W 6 .   ? -10.916 -15.845 67.382  1.00 51.16 ? 2081 HOH A O   1 
HETATM 7998 O  O   . HOH W 6 .   ? 14.363  -7.134  65.803  1.00 35.62 ? 2082 HOH A O   1 
HETATM 7999 O  O   . HOH W 6 .   ? 9.933   -3.744  63.536  1.00 34.37 ? 2083 HOH A O   1 
HETATM 8000 O  O   . HOH W 6 .   ? 7.063   -1.289  65.395  1.00 46.56 ? 2084 HOH A O   1 
HETATM 8001 O  O   . HOH W 6 .   ? -10.613 -21.003 51.952  1.00 42.32 ? 2085 HOH A O   1 
HETATM 8002 O  O   . HOH W 6 .   ? -10.061 -29.253 54.808  1.00 52.65 ? 2086 HOH A O   1 
HETATM 8003 O  O   . HOH W 6 .   ? -12.232 -27.747 51.896  1.00 57.56 ? 2087 HOH A O   1 
HETATM 8004 O  O   . HOH W 6 .   ? 7.778   -4.911  62.426  1.00 54.25 ? 2088 HOH A O   1 
HETATM 8005 O  O   . HOH W 6 .   ? 12.198  -4.902  58.484  1.00 21.39 ? 2089 HOH A O   1 
HETATM 8006 O  O   . HOH W 6 .   ? 11.911  -1.681  60.755  1.00 31.74 ? 2090 HOH A O   1 
HETATM 8007 O  O   . HOH W 6 .   ? 14.608  -3.396  56.584  1.00 25.13 ? 2091 HOH A O   1 
HETATM 8008 O  O   . HOH W 6 .   ? 14.420  -2.219  59.436  1.00 41.36 ? 2092 HOH A O   1 
HETATM 8009 O  O   . HOH W 6 .   ? 18.849  -6.359  55.605  1.00 24.92 ? 2093 HOH A O   1 
HETATM 8010 O  O   . HOH W 6 .   ? 13.047  -3.628  50.323  1.00 36.84 ? 2094 HOH A O   1 
HETATM 8011 O  O   . HOH W 6 .   ? 16.856  -2.241  55.553  1.00 56.07 ? 2095 HOH A O   1 
HETATM 8012 O  O   . HOH W 6 .   ? 18.222  -4.098  54.123  1.00 50.41 ? 2096 HOH A O   1 
HETATM 8013 O  O   . HOH W 6 .   ? 9.209   -1.797  51.190  1.00 36.72 ? 2097 HOH A O   1 
HETATM 8014 O  O   . HOH W 6 .   ? 28.844  -22.767 61.048  1.00 45.58 ? 2098 HOH A O   1 
HETATM 8015 O  O   . HOH W 6 .   ? 19.312  -8.405  48.813  1.00 25.04 ? 2099 HOH A O   1 
HETATM 8016 O  O   . HOH W 6 .   ? 21.218  -22.769 58.514  1.00 49.45 ? 2100 HOH A O   1 
HETATM 8017 O  O   . HOH W 6 .   ? 30.539  -21.668 64.844  1.00 44.45 ? 2101 HOH A O   1 
HETATM 8018 O  O   . HOH W 6 .   ? 19.152  -33.098 62.590  1.00 43.32 ? 2102 HOH A O   1 
HETATM 8019 O  O   . HOH W 6 .   ? 23.350  -4.794  48.992  1.00 41.90 ? 2103 HOH A O   1 
HETATM 8020 O  O   . HOH W 6 .   ? 14.432  -29.467 77.154  1.00 39.58 ? 2104 HOH A O   1 
HETATM 8021 O  O   . HOH W 6 .   ? 23.427  -11.447 43.508  1.00 23.96 ? 2105 HOH A O   1 
HETATM 8022 O  O   . HOH W 6 .   ? 21.600  -15.974 45.486  1.00 38.00 ? 2106 HOH A O   1 
HETATM 8023 O  O   . HOH W 6 .   ? 20.916  -13.858 38.158  1.00 37.39 ? 2107 HOH A O   1 
HETATM 8024 O  O   . HOH W 6 .   ? 23.053  -11.682 41.080  1.00 37.65 ? 2108 HOH A O   1 
HETATM 8025 O  O   . HOH W 6 .   ? 17.951  -14.368 38.232  1.00 44.96 ? 2109 HOH A O   1 
HETATM 8026 O  O   . HOH W 6 .   ? 17.952  -10.666 38.438  1.00 34.30 ? 2110 HOH A O   1 
HETATM 8027 O  O   . HOH W 6 .   ? 12.155  -21.290 77.661  1.00 43.59 ? 2111 HOH A O   1 
HETATM 8028 O  O   . HOH W 6 .   ? 19.924  -16.657 49.282  1.00 28.17 ? 2112 HOH A O   1 
HETATM 8029 O  O   . HOH W 6 .   ? 16.810  -21.891 49.058  1.00 24.88 ? 2113 HOH A O   1 
HETATM 8030 O  O   . HOH W 6 .   ? 23.990  -17.234 46.231  1.00 27.47 ? 2114 HOH A O   1 
HETATM 8031 O  O   . HOH W 6 .   ? 20.115  -20.366 40.278  1.00 43.88 ? 2115 HOH A O   1 
HETATM 8032 O  O   . HOH W 6 .   ? -9.263  -16.390 59.858  1.00 40.93 ? 2116 HOH A O   1 
HETATM 8033 O  O   . HOH W 6 .   ? -9.284  -13.988 40.767  1.00 29.84 ? 2117 HOH A O   1 
HETATM 8034 O  O   . HOH W 6 .   ? 19.391  -27.267 44.352  1.00 53.81 ? 2118 HOH A O   1 
HETATM 8035 O  O   . HOH W 6 .   ? -12.187 -8.064  41.697  1.00 26.26 ? 2119 HOH A O   1 
HETATM 8036 O  O   . HOH W 6 .   ? -5.463  -13.124 38.710  1.00 48.73 ? 2120 HOH A O   1 
HETATM 8037 O  O   . HOH W 6 .   ? -2.473  -7.583  47.654  1.00 27.09 ? 2121 HOH A O   1 
HETATM 8038 O  O   . HOH W 6 .   ? -5.103  -4.718  37.792  1.00 53.56 ? 2122 HOH A O   1 
HETATM 8039 O  O   . HOH W 6 .   ? -12.972 -6.621  39.634  1.00 48.92 ? 2123 HOH A O   1 
HETATM 8040 O  O   . HOH W 6 .   ? -0.165  -4.191  45.568  1.00 59.64 ? 2124 HOH A O   1 
HETATM 8041 O  O   . HOH W 6 .   ? 1.569   -6.649  36.432  1.00 53.33 ? 2125 HOH A O   1 
HETATM 8042 O  O   . HOH W 6 .   ? -0.429  -3.574  48.510  1.00 58.29 ? 2126 HOH A O   1 
HETATM 8043 O  O   . HOH W 6 .   ? 6.804   -5.431  48.376  1.00 46.96 ? 2127 HOH A O   1 
HETATM 8044 O  O   . HOH W 6 .   ? 5.562   -10.635 37.474  1.00 52.12 ? 2128 HOH A O   1 
HETATM 8045 O  O   . HOH W 6 .   ? 2.974   -17.169 35.762  1.00 58.06 ? 2129 HOH A O   1 
HETATM 8046 O  O   . HOH W 6 .   ? 12.853  -34.514 48.416  1.00 54.12 ? 2130 HOH A O   1 
HETATM 8047 O  O   . HOH W 6 .   ? 16.011  -26.433 50.734  1.00 31.92 ? 2131 HOH A O   1 
HETATM 8048 O  O   . HOH W 6 .   ? 8.644   -19.211 33.143  1.00 46.98 ? 2132 HOH A O   1 
HETATM 8049 O  O   . HOH W 6 .   ? 6.718   -33.708 48.745  1.00 32.41 ? 2133 HOH A O   1 
HETATM 8050 O  O   . HOH W 6 .   ? 11.846  -29.711 55.885  1.00 48.14 ? 2134 HOH A O   1 
HETATM 8051 O  O   . HOH W 6 .   ? 17.280  -24.323 50.367  1.00 31.21 ? 2135 HOH A O   1 
HETATM 8052 O  O   . HOH W 6 .   ? 17.747  -22.042 52.857  1.00 29.53 ? 2136 HOH A O   1 
HETATM 8053 O  O   . HOH W 6 .   ? 20.765  -21.600 49.580  1.00 33.09 ? 2137 HOH A O   1 
HETATM 8054 O  O   . HOH W 6 .   ? 6.875   -1.087  47.322  1.00 38.59 ? 2138 HOH A O   1 
HETATM 8055 O  O   . HOH W 6 .   ? 20.217  -19.051 55.733  1.00 29.87 ? 2139 HOH A O   1 
HETATM 8056 O  O   . HOH W 6 .   ? 22.161  -16.741 54.612  1.00 33.78 ? 2140 HOH A O   1 
HETATM 8057 O  O   . HOH W 6 .   ? 20.161  -16.365 57.031  1.00 36.71 ? 2141 HOH A O   1 
HETATM 8058 O  O   . HOH W 6 .   ? 19.289  -13.116 58.603  1.00 16.69 ? 2142 HOH A O   1 
HETATM 8059 O  O   . HOH W 6 .   ? 20.535  -8.330  54.488  1.00 30.48 ? 2143 HOH A O   1 
HETATM 8060 O  O   . HOH W 6 .   ? 22.486  -11.656 60.689  1.00 43.74 ? 2144 HOH A O   1 
HETATM 8061 O  O   . HOH W 6 .   ? 19.233  -5.831  60.780  1.00 39.54 ? 2145 HOH A O   1 
HETATM 8062 O  O   . HOH W 6 .   ? 20.239  -5.832  57.984  1.00 43.17 ? 2146 HOH A O   1 
HETATM 8063 O  O   . HOH W 6 .   ? -3.766  -6.017  71.610  1.00 59.59 ? 2147 HOH A O   1 
HETATM 8064 O  O   . HOH W 6 .   ? -6.751  -6.790  75.320  1.00 49.47 ? 2148 HOH A O   1 
HETATM 8065 O  O   . HOH W 6 .   ? 20.684  -3.770  63.946  1.00 50.25 ? 2149 HOH A O   1 
HETATM 8066 O  O   . HOH W 6 .   ? 20.515  -9.649  66.521  1.00 47.69 ? 2150 HOH A O   1 
HETATM 8067 O  O   . HOH W 6 .   ? 23.003  -6.790  65.939  1.00 57.04 ? 2151 HOH A O   1 
HETATM 8068 O  O   . HOH W 6 .   ? 5.696   -20.590 73.920  1.00 46.65 ? 2152 HOH A O   1 
HETATM 8069 O  O   . HOH W 6 .   ? 4.145   -25.530 76.455  1.00 38.28 ? 2153 HOH A O   1 
HETATM 8070 O  O   . HOH W 6 .   ? 12.445  -26.051 78.434  1.00 27.86 ? 2154 HOH A O   1 
HETATM 8071 O  O   . HOH W 6 .   ? 5.884   -13.040 71.293  1.00 21.95 ? 2155 HOH A O   1 
HETATM 8072 O  O   . HOH W 6 .   ? 17.566  -31.538 58.210  1.00 52.08 ? 2156 HOH A O   1 
HETATM 8073 O  O   . HOH W 6 .   ? 18.277  -33.654 59.997  1.00 48.30 ? 2157 HOH A O   1 
HETATM 8074 O  O   . HOH W 6 .   ? 10.375  -6.829  71.109  1.00 33.26 ? 2158 HOH A O   1 
HETATM 8075 O  O   . HOH W 6 .   ? 10.167  -10.570 76.614  1.00 25.19 ? 2159 HOH A O   1 
HETATM 8076 O  O   . HOH W 6 .   ? 12.651  -11.656 78.450  1.00 39.64 ? 2160 HOH A O   1 
HETATM 8077 O  O   . HOH W 6 .   ? 15.206  -7.127  72.819  1.00 28.62 ? 2161 HOH A O   1 
HETATM 8078 O  O   . HOH W 6 .   ? 15.099  -15.273 75.517  1.00 38.97 ? 2162 HOH A O   1 
HETATM 8079 O  O   . HOH W 6 .   ? 17.938  -12.565 72.937  1.00 42.19 ? 2163 HOH A O   1 
HETATM 8080 O  O   . HOH W 6 .   ? 7.867   -15.736 76.798  1.00 53.44 ? 2164 HOH A O   1 
HETATM 8081 O  O   . HOH W 6 .   ? 11.690  -17.076 73.069  1.00 41.88 ? 2165 HOH A O   1 
HETATM 8082 O  O   . HOH W 6 .   ? 7.892   -11.551 75.344  1.00 32.80 ? 2166 HOH A O   1 
HETATM 8083 O  O   . HOH W 6 .   ? 17.069  -15.760 71.672  1.00 19.22 ? 2167 HOH A O   1 
HETATM 8084 O  O   . HOH W 6 .   ? 20.712  -11.101 70.970  1.00 38.60 ? 2168 HOH A O   1 
HETATM 8085 O  O   . HOH W 6 .   ? 19.241  -7.520  73.262  1.00 38.20 ? 2169 HOH A O   1 
HETATM 8086 O  O   . HOH W 6 .   ? 18.235  -5.517  70.402  1.00 34.79 ? 2170 HOH A O   1 
HETATM 8087 O  O   . HOH W 6 .   ? 17.577  -4.997  73.266  1.00 41.33 ? 2171 HOH A O   1 
HETATM 8088 O  O   . HOH W 6 .   ? 17.843  -10.219 66.540  1.00 32.77 ? 2172 HOH A O   1 
HETATM 8089 O  O   . HOH W 6 .   ? 14.863  -16.043 73.076  1.00 22.08 ? 2173 HOH A O   1 
HETATM 8090 O  O   . HOH W 6 .   ? -7.677  -16.803 37.917  1.00 37.37 ? 2174 HOH A O   1 
HETATM 8091 O  O   . HOH W 6 .   ? 21.047  -16.639 65.157  1.00 38.45 ? 2175 HOH A O   1 
HETATM 8092 O  O   . HOH W 6 .   ? 23.472  -16.612 65.120  1.00 43.41 ? 2176 HOH A O   1 
HETATM 8093 O  O   . HOH W 6 .   ? 24.579  -14.573 67.237  1.00 35.90 ? 2177 HOH A O   1 
HETATM 8094 O  O   . HOH W 6 .   ? 24.610  -8.752  64.368  1.00 56.47 ? 2178 HOH A O   1 
HETATM 8095 O  O   . HOH W 6 .   ? 26.037  -12.296 68.511  1.00 49.25 ? 2179 HOH A O   1 
HETATM 8096 O  O   . HOH W 6 .   ? 4.032   -22.740 34.218  1.00 45.24 ? 2180 HOH A O   1 
HETATM 8097 O  O   . HOH W 6 .   ? -0.014  -38.212 68.643  1.00 41.97 ? 2181 HOH A O   1 
HETATM 8098 O  O   . HOH W 6 .   ? -4.281  -37.930 72.200  1.00 41.57 ? 2182 HOH A O   1 
HETATM 8099 O  O   . HOH W 6 .   ? 4.839   -20.178 79.702  1.00 42.83 ? 2183 HOH A O   1 
HETATM 8100 O  O   . HOH W 6 .   ? -5.981  -33.760 52.020  1.00 51.83 ? 2184 HOH A O   1 
HETATM 8101 O  O   . HOH W 6 .   ? -10.585 -15.723 70.250  1.00 43.45 ? 2185 HOH A O   1 
HETATM 8102 O  O   . HOH W 6 .   ? -6.869  -31.056 52.265  1.00 30.64 ? 2186 HOH A O   1 
HETATM 8103 O  O   . HOH W 6 .   ? -2.517  -30.487 59.585  1.00 26.73 ? 2187 HOH A O   1 
HETATM 8104 O  O   . HOH W 6 .   ? 16.137  -30.901 52.005  1.00 45.33 ? 2188 HOH A O   1 
HETATM 8105 O  O   . HOH W 6 .   ? -6.957  -30.101 62.559  1.00 37.50 ? 2189 HOH A O   1 
HETATM 8106 O  O   . HOH W 6 .   ? -11.759 -21.191 61.724  1.00 51.19 ? 2190 HOH A O   1 
HETATM 8107 O  O   . HOH W 6 .   ? -14.182 -24.526 61.622  1.00 48.83 ? 2191 HOH A O   1 
HETATM 8108 O  O   . HOH W 6 .   ? -15.312 -27.019 64.671  1.00 49.30 ? 2192 HOH A O   1 
HETATM 8109 O  O   . HOH W 6 .   ? -12.905 -18.035 67.241  1.00 53.42 ? 2193 HOH A O   1 
HETATM 8110 O  O   . HOH W 6 .   ? -13.725 -25.597 57.307  1.00 57.82 ? 2194 HOH A O   1 
HETATM 8111 O  O   . HOH W 6 .   ? -9.612  -20.090 54.448  1.00 29.98 ? 2195 HOH A O   1 
HETATM 8112 O  O   . HOH W 6 .   ? -11.158 -27.073 56.482  1.00 41.53 ? 2196 HOH A O   1 
HETATM 8113 O  O   . HOH W 6 .   ? -10.118 -23.676 52.942  1.00 36.68 ? 2197 HOH A O   1 
HETATM 8114 O  O   . HOH W 6 .   ? -11.743 -25.814 54.083  1.00 53.80 ? 2198 HOH A O   1 
HETATM 8115 O  O   . HOH W 6 .   ? -7.874  -31.036 54.987  1.00 48.53 ? 2199 HOH A O   1 
HETATM 8116 O  O   . HOH W 6 .   ? -4.867  -33.365 60.356  1.00 40.12 ? 2200 HOH A O   1 
HETATM 8117 O  O   . HOH W 6 .   ? -4.547  -34.571 57.859  1.00 41.68 ? 2201 HOH A O   1 
HETATM 8118 O  O   . HOH W 6 .   ? -7.558  -32.135 60.543  1.00 48.06 ? 2202 HOH A O   1 
HETATM 8119 O  O   . HOH W 6 .   ? 22.112  -14.058 72.436  1.00 48.35 ? 2203 HOH A O   1 
HETATM 8120 O  O   . HOH W 6 .   ? 24.530  -12.941 70.931  1.00 46.57 ? 2204 HOH A O   1 
HETATM 8121 O  O   . HOH W 6 .   ? 25.748  -16.164 70.654  1.00 49.56 ? 2205 HOH A O   1 
HETATM 8122 O  O   . HOH W 6 .   ? 19.468  -14.798 72.993  1.00 46.43 ? 2206 HOH A O   1 
HETATM 8123 O  O   . HOH W 6 .   ? 25.883  -17.314 73.233  1.00 32.08 ? 2207 HOH A O   1 
HETATM 8124 O  O   . HOH W 6 .   ? 27.097  -17.941 69.361  1.00 39.11 ? 2208 HOH A O   1 
HETATM 8125 O  O   . HOH W 6 .   ? 26.968  -20.717 69.410  1.00 27.20 ? 2209 HOH A O   1 
HETATM 8126 O  O   . HOH W 6 .   ? 27.849  -20.052 61.813  1.00 45.58 ? 2210 HOH A O   1 
HETATM 8127 O  O   . HOH W 6 .   ? 26.364  -27.837 60.613  1.00 52.29 ? 2211 HOH A O   1 
HETATM 8128 O  O   . HOH W 6 .   ? 23.122  -23.103 60.697  1.00 42.17 ? 2212 HOH A O   1 
HETATM 8129 O  O   . HOH W 6 .   ? 22.129  -31.479 66.057  1.00 37.39 ? 2213 HOH A O   1 
HETATM 8130 O  O   . HOH W 6 .   ? 21.251  -29.550 69.420  1.00 32.25 ? 2214 HOH A O   1 
HETATM 8131 O  O   . HOH W 6 .   ? 23.289  -31.229 60.571  1.00 51.63 ? 2215 HOH A O   1 
HETATM 8132 O  O   . HOH W 6 .   ? 26.190  -24.784 71.049  1.00 39.72 ? 2216 HOH A O   1 
HETATM 8133 O  O   . HOH W 6 .   ? 29.362  -22.778 67.205  1.00 36.00 ? 2217 HOH A O   1 
HETATM 8134 O  O   . HOH W 6 .   ? 14.791  -25.055 69.238  1.00 23.53 ? 2218 HOH A O   1 
HETATM 8135 O  O   . HOH W 6 .   ? 14.369  -27.379 67.848  1.00 20.20 ? 2219 HOH A O   1 
HETATM 8136 O  O   . HOH W 6 .   ? 13.661  -28.219 74.728  1.00 34.79 ? 2220 HOH A O   1 
HETATM 8137 O  O   . HOH W 6 .   ? 16.702  -31.896 73.987  1.00 47.52 ? 2221 HOH A O   1 
HETATM 8138 O  O   . HOH W 6 .   ? 24.315  -30.653 75.716  1.00 39.59 ? 2222 HOH A O   1 
HETATM 8139 O  O   . HOH W 6 .   ? 13.888  -20.629 76.153  1.00 37.96 ? 2223 HOH A O   1 
HETATM 8140 O  O   . HOH W 6 .   ? 18.049  -22.435 74.639  1.00 22.41 ? 2224 HOH A O   1 
HETATM 8141 O  O   . HOH W 6 .   ? 7.751   -17.711 66.715  1.00 16.91 ? 2225 HOH A O   1 
HETATM 8142 O  O   . HOH W 6 .   ? -2.301  -16.020 59.462  1.00 20.42 ? 2226 HOH A O   1 
HETATM 8143 O  O   . HOH W 6 .   ? -11.289 -17.663 57.150  1.00 41.00 ? 2227 HOH A O   1 
HETATM 8144 O  O   . HOH W 6 .   ? -9.540  -18.648 50.730  1.00 29.76 ? 2228 HOH A O   1 
HETATM 8145 O  O   . HOH W 6 .   ? -10.323 -14.116 51.877  1.00 33.93 ? 2229 HOH A O   1 
HETATM 8146 O  O   . HOH W 6 .   ? -11.013 -16.453 51.438  1.00 48.85 ? 2230 HOH A O   1 
HETATM 8147 O  O   . HOH W 6 .   ? -13.594 -16.374 45.018  1.00 28.41 ? 2231 HOH A O   1 
HETATM 8148 O  O   . HOH W 6 .   ? -11.523 -19.469 43.857  1.00 42.38 ? 2232 HOH A O   1 
HETATM 8149 O  O   . HOH W 6 .   ? -8.938  -14.558 43.266  1.00 18.69 ? 2233 HOH A O   1 
HETATM 8150 O  O   . HOH W 6 .   ? -12.502 -16.933 42.223  1.00 43.29 ? 2234 HOH A O   1 
HETATM 8151 O  O   . HOH W 6 .   ? -6.413  -9.566  47.301  1.00 22.80 ? 2235 HOH A O   1 
HETATM 8152 O  O   . HOH W 6 .   ? -10.782 -10.453 41.354  1.00 34.77 ? 2236 HOH A O   1 
HETATM 8153 O  O   . HOH W 6 .   ? -6.432  -10.878 40.281  1.00 46.45 ? 2237 HOH A O   1 
HETATM 8154 O  O   . HOH W 6 .   ? -3.604  -10.029 47.118  1.00 21.34 ? 2238 HOH A O   1 
HETATM 8155 O  O   . HOH W 6 .   ? -4.704  -8.085  40.602  1.00 33.78 ? 2239 HOH A O   1 
HETATM 8156 O  O   . HOH W 6 .   ? -6.846  -4.288  40.124  1.00 47.01 ? 2240 HOH A O   1 
HETATM 8157 O  O   . HOH W 6 .   ? -10.007 -6.319  40.959  1.00 43.44 ? 2241 HOH A O   1 
HETATM 8158 O  O   . HOH W 6 .   ? -1.910  -5.730  43.393  1.00 50.82 ? 2242 HOH A O   1 
HETATM 8159 O  O   . HOH W 6 .   ? 0.045   -6.857  46.560  1.00 26.19 ? 2243 HOH A O   1 
HETATM 8160 O  O   . HOH W 6 .   ? -2.938  -13.099 39.949  1.00 30.91 ? 2244 HOH A O   1 
HETATM 8161 O  O   . HOH W 6 .   ? 0.711   -13.565 36.898  1.00 49.13 ? 2245 HOH A O   1 
HETATM 8162 O  O   . HOH W 6 .   ? -1.285  -11.966 36.033  1.00 55.14 ? 2246 HOH A O   1 
HETATM 8163 O  O   . HOH W 6 .   ? -0.395  -14.694 39.092  1.00 42.12 ? 2247 HOH A O   1 
HETATM 8164 O  O   . HOH W 6 .   ? 1.928   -9.620  37.048  1.00 46.86 ? 2248 HOH A O   1 
HETATM 8165 O  O   . HOH W 6 .   ? 1.633   -8.652  41.011  1.00 49.52 ? 2249 HOH A O   1 
HETATM 8166 O  O   . HOH W 6 .   ? 2.377   -7.340  48.068  1.00 32.50 ? 2250 HOH A O   1 
HETATM 8167 O  O   . HOH W 6 .   ? 1.498   -7.937  50.603  1.00 53.62 ? 2251 HOH A O   1 
HETATM 8168 O  O   . HOH W 6 .   ? 1.142   -10.292 51.813  1.00 41.82 ? 2252 HOH A O   1 
HETATM 8169 O  O   . HOH W 6 .   ? 5.511   -8.596  41.616  1.00 36.63 ? 2253 HOH A O   1 
HETATM 8170 O  O   . HOH W 6 .   ? 2.352   -3.312  44.242  1.00 57.20 ? 2254 HOH A O   1 
HETATM 8171 O  O   . HOH W 6 .   ? 3.962   -5.224  48.473  1.00 57.02 ? 2255 HOH A O   1 
HETATM 8172 O  O   . HOH W 6 .   ? 5.820   -5.979  46.029  1.00 48.63 ? 2256 HOH A O   1 
HETATM 8173 O  O   . HOH W 6 .   ? 6.919   -10.641 39.938  1.00 43.46 ? 2257 HOH A O   1 
HETATM 8174 O  O   . HOH W 6 .   ? 3.038   -16.292 38.406  1.00 40.90 ? 2258 HOH A O   1 
HETATM 8175 O  O   . HOH W 6 .   ? 4.077   -12.483 36.623  1.00 38.23 ? 2259 HOH A O   1 
HETATM 8176 O  O   . HOH W 6 .   ? 11.505  -12.426 41.355  1.00 36.12 ? 2260 HOH A O   1 
HETATM 8177 O  O   . HOH W 6 .   ? 10.094  -5.957  45.201  1.00 24.84 ? 2261 HOH A O   1 
HETATM 8178 O  O   . HOH W 6 .   ? 12.269  -7.341  44.245  1.00 22.50 ? 2262 HOH A O   1 
HETATM 8179 O  O   . HOH W 6 .   ? 12.220  -10.921 43.683  1.00 32.65 ? 2263 HOH A O   1 
HETATM 8180 O  O   . HOH W 6 .   ? 5.735   -19.890 37.603  1.00 27.49 ? 2264 HOH A O   1 
HETATM 8181 O  O   . HOH W 6 .   ? 9.190   -19.438 35.929  1.00 37.43 ? 2265 HOH A O   1 
HETATM 8182 O  O   . HOH W 6 .   ? 5.649   -18.155 35.338  1.00 54.58 ? 2266 HOH A O   1 
HETATM 8183 O  O   . HOH W 6 .   ? 7.064   -15.763 34.703  1.00 52.98 ? 2267 HOH A O   1 
HETATM 8184 O  O   . HOH W 6 .   ? 9.326   -12.920 37.356  1.00 50.54 ? 2268 HOH A O   1 
HETATM 8185 O  O   . HOH W 6 .   ? 15.349  -11.510 37.958  1.00 47.15 ? 2269 HOH A O   1 
HETATM 8186 O  O   . HOH W 6 .   ? 16.927  -12.929 36.295  1.00 51.58 ? 2270 HOH A O   1 
HETATM 8187 O  O   . HOH W 6 .   ? 13.095  -27.214 36.646  1.00 33.17 ? 2271 HOH A O   1 
HETATM 8188 O  O   . HOH W 6 .   ? 16.295  -19.726 36.411  1.00 52.18 ? 2272 HOH A O   1 
HETATM 8189 O  O   . HOH W 6 .   ? 15.169  -28.254 35.684  1.00 38.47 ? 2273 HOH A O   1 
HETATM 8190 O  O   . HOH W 6 .   ? 11.108  -33.531 39.436  1.00 34.35 ? 2274 HOH A O   1 
HETATM 8191 O  O   . HOH W 6 .   ? 13.083  -38.490 44.138  1.00 55.01 ? 2275 HOH A O   1 
HETATM 8192 O  O   . HOH W 6 .   ? 17.107  -22.224 37.279  1.00 38.26 ? 2276 HOH A O   1 
HETATM 8193 O  O   . HOH W 6 .   ? 19.399  -22.832 47.740  1.00 34.83 ? 2277 HOH A O   1 
HETATM 8194 O  O   . HOH W 6 .   ? 22.733  -24.995 46.029  1.00 37.70 ? 2278 HOH A O   1 
HETATM 8195 O  O   . HOH W 6 .   ? 24.346  -14.113 44.105  1.00 43.88 ? 2279 HOH A O   1 
HETATM 8196 O  O   . HOH W 6 .   ? 21.259  -16.504 38.344  1.00 34.19 ? 2280 HOH A O   1 
HETATM 8197 O  O   . HOH W 6 .   ? 24.687  -13.900 40.600  1.00 34.33 ? 2281 HOH A O   1 
HETATM 8198 O  O   . HOH W 6 .   ? 9.700   -5.335  47.868  1.00 25.05 ? 2282 HOH A O   1 
HETATM 8199 O  O   . HOH W 6 .   ? 5.648   -4.712  54.545  1.00 52.67 ? 2283 HOH A O   1 
HETATM 8200 O  O   . HOH W 6 .   ? 6.913   -3.324  50.754  1.00 42.86 ? 2284 HOH A O   1 
HETATM 8201 O  O   . HOH W 6 .   ? 3.909   -7.326  57.034  1.00 26.10 ? 2285 HOH A O   1 
HETATM 8202 O  O   . HOH W 6 .   ? 9.574   -4.604  57.884  1.00 37.56 ? 2286 HOH A O   1 
HETATM 8203 O  O   . HOH W 6 .   ? 0.407   -8.674  53.791  1.00 33.55 ? 2287 HOH A O   1 
HETATM 8204 O  O   . HOH W 6 .   ? -1.817  -7.983  55.534  1.00 27.83 ? 2288 HOH A O   1 
HETATM 8205 O  O   . HOH W 6 .   ? 0.151   -2.421  61.227  1.00 60.01 ? 2289 HOH A O   1 
HETATM 8206 O  O   . HOH W 6 .   ? 0.949   -4.723  63.833  1.00 52.82 ? 2290 HOH A O   1 
HETATM 8207 O  O   . HOH W 6 .   ? -2.270  -10.873 62.855  1.00 26.02 ? 2291 HOH A O   1 
HETATM 8208 O  O   . HOH W 6 .   ? -6.080  -7.036  61.737  1.00 53.58 ? 2292 HOH A O   1 
HETATM 8209 O  O   . HOH W 6 .   ? -6.413  -9.340  63.374  1.00 31.20 ? 2293 HOH A O   1 
HETATM 8210 O  O   . HOH W 6 .   ? -8.421  -7.365  71.460  1.00 30.17 ? 2294 HOH A O   1 
HETATM 8211 O  O   . HOH W 6 .   ? -4.572  -5.701  68.751  1.00 40.93 ? 2295 HOH A O   1 
HETATM 8212 O  O   . HOH W 6 .   ? -11.517 -9.579  67.507  1.00 28.96 ? 2296 HOH A O   1 
HETATM 8213 O  O   . HOH W 6 .   ? -9.500  -9.596  71.514  1.00 34.65 ? 2297 HOH A O   1 
HETATM 8214 O  O   . HOH W 6 .   ? 3.205   -20.401 74.474  1.00 47.30 ? 2298 HOH A O   1 
HETATM 8215 O  O   . HOH W 6 .   ? 4.394   -17.977 74.452  1.00 44.96 ? 2299 HOH A O   1 
HETATM 8216 O  O   . HOH W 6 .   ? 2.778   -24.449 74.283  1.00 24.03 ? 2300 HOH A O   1 
HETATM 8217 O  O   . HOH W 6 .   ? 7.247   -22.102 75.902  1.00 34.79 ? 2301 HOH A O   1 
HETATM 8218 O  O   . HOH W 6 .   ? 10.945  -23.626 76.673  1.00 38.36 ? 2302 HOH A O   1 
HETATM 8219 O  O   . HOH W 6 .   ? 8.573   -28.449 72.980  1.00 38.92 ? 2303 HOH A O   1 
HETATM 8220 O  O   . HOH W 6 .   ? 11.895  -26.735 75.784  1.00 31.24 ? 2304 HOH A O   1 
HETATM 8221 O  O   . HOH W 6 .   ? 14.835  -30.752 57.935  1.00 31.69 ? 2305 HOH A O   1 
HETATM 8222 O  O   . HOH W 6 .   ? 16.133  -35.763 60.235  1.00 43.48 ? 2306 HOH A O   1 
HETATM 8223 O  O   . HOH W 6 .   ? 13.354  -32.702 70.322  1.00 25.33 ? 2307 HOH A O   1 
HETATM 8224 O  O   . HOH W 6 .   ? 9.977   -31.119 74.867  1.00 45.65 ? 2308 HOH A O   1 
HETATM 8225 O  O   . HOH W 6 .   ? 11.046  -35.842 72.487  1.00 50.21 ? 2309 HOH A O   1 
HETATM 8226 O  O   . HOH W 6 .   ? -5.849  -16.943 62.065  1.00 45.54 ? 2310 HOH A O   1 
HETATM 8227 O  O   . HOH W 6 .   ? -8.765  -15.801 65.492  1.00 41.88 ? 2311 HOH A O   1 
HETATM 8228 O  O   . HOH W 6 .   ? -3.614  -9.484  54.633  1.00 32.47 ? 2312 HOH A O   1 
HETATM 8229 O  O   . HOH W 6 .   ? -7.294  -11.747 56.901  1.00 38.53 ? 2313 HOH A O   1 
HETATM 8230 O  O   . HOH W 6 .   ? -2.583  -9.878  51.968  1.00 30.37 ? 2314 HOH A O   1 
HETATM 8231 O  O   . HOH W 6 .   ? -7.003  -15.128 39.785  1.00 23.95 ? 2315 HOH A O   1 
HETATM 8232 O  O   . HOH W 6 .   ? -7.075  -21.293 42.954  1.00 40.27 ? 2316 HOH A O   1 
HETATM 8233 O  O   . HOH W 6 .   ? -2.141  -20.607 37.672  1.00 41.60 ? 2317 HOH A O   1 
HETATM 8234 O  O   . HOH W 6 .   ? -2.759  -24.685 34.307  1.00 51.17 ? 2318 HOH A O   1 
HETATM 8235 O  O   . HOH W 6 .   ? 1.533   -20.027 36.430  1.00 46.51 ? 2319 HOH A O   1 
HETATM 8236 O  O   . HOH W 6 .   ? 0.776   -17.082 39.639  1.00 36.20 ? 2320 HOH A O   1 
HETATM 8237 O  O   . HOH W 6 .   ? 3.231   -27.266 42.970  1.00 24.63 ? 2321 HOH A O   1 
HETATM 8238 O  O   . HOH W 6 .   ? 2.015   -29.756 41.347  1.00 30.08 ? 2322 HOH A O   1 
HETATM 8239 O  O   . HOH W 6 .   ? 3.173   -29.304 36.385  1.00 50.69 ? 2323 HOH A O   1 
HETATM 8240 O  O   . HOH W 6 .   ? 0.615   -28.608 35.443  1.00 54.42 ? 2324 HOH A O   1 
HETATM 8241 O  O   . HOH W 6 .   ? -3.641  -29.856 39.872  1.00 58.21 ? 2325 HOH A O   1 
HETATM 8242 O  O   . HOH W 6 .   ? 5.275   -27.363 35.844  1.00 29.02 ? 2326 HOH A O   1 
HETATM 8243 O  O   . HOH W 6 .   ? 3.676   -21.802 36.896  1.00 39.44 ? 2327 HOH A O   1 
HETATM 8244 O  O   . HOH W 6 .   ? 1.513   -36.916 41.645  1.00 48.58 ? 2328 HOH A O   1 
HETATM 8245 O  O   . HOH W 6 .   ? 1.320   -35.830 44.324  1.00 44.93 ? 2329 HOH A O   1 
HETATM 8246 O  O   . HOH W 6 .   ? 4.248   -33.689 47.630  1.00 40.87 ? 2330 HOH A O   1 
HETATM 8247 O  O   . HOH W 6 .   ? -4.187  -32.928 41.969  1.00 53.74 ? 2331 HOH A O   1 
HETATM 8248 O  O   . HOH W 6 .   ? -0.986  -34.534 53.336  1.00 35.33 ? 2332 HOH A O   1 
HETATM 8249 O  O   . HOH W 6 .   ? -0.434  -35.444 55.432  1.00 37.16 ? 2333 HOH A O   1 
HETATM 8250 O  O   . HOH W 6 .   ? 3.611   -37.087 60.982  1.00 50.11 ? 2334 HOH A O   1 
HETATM 8251 O  O   . HOH W 6 .   ? -2.436  -35.591 56.900  1.00 37.86 ? 2335 HOH A O   1 
HETATM 8252 O  O   . HOH W 6 .   ? 1.370   -36.439 58.727  1.00 34.16 ? 2336 HOH A O   1 
HETATM 8253 O  O   . HOH W 6 .   ? -1.999  -36.813 64.554  1.00 49.76 ? 2337 HOH A O   1 
HETATM 8254 O  O   . HOH W 6 .   ? 1.852   -36.110 68.460  1.00 30.07 ? 2338 HOH A O   1 
HETATM 8255 O  O   . HOH W 6 .   ? 1.758   -37.575 63.015  1.00 52.79 ? 2339 HOH A O   1 
HETATM 8256 O  O   . HOH W 6 .   ? -4.436  -30.631 75.521  1.00 33.23 ? 2340 HOH A O   1 
HETATM 8257 O  O   . HOH W 6 .   ? -1.886  -38.398 73.282  1.00 36.91 ? 2341 HOH A O   1 
HETATM 8258 O  O   . HOH W 6 .   ? -5.211  -26.768 75.422  1.00 46.17 ? 2342 HOH A O   1 
HETATM 8259 O  O   . HOH W 6 .   ? 1.654   -25.198 77.672  1.00 29.74 ? 2343 HOH A O   1 
HETATM 8260 O  O   . HOH W 6 .   ? 2.266   -22.225 76.285  1.00 48.32 ? 2344 HOH A O   1 
HETATM 8261 O  O   . HOH W 6 .   ? 3.321   -17.792 79.728  1.00 51.39 ? 2345 HOH A O   1 
HETATM 8262 O  O   . HOH W 6 .   ? 5.320   -17.071 76.803  1.00 51.62 ? 2346 HOH A O   1 
HETATM 8263 O  O   . HOH W 6 .   ? -11.021 -12.981 70.399  1.00 38.39 ? 2347 HOH A O   1 
HETATM 8264 O  O   . HOH W 6 .   ? 17.129  -23.315 58.243  1.00 40.45 ? 2348 HOH A O   1 
HETATM 8265 O  O   . HOH W 6 .   ? 15.541  -28.359 53.498  1.00 54.66 ? 2349 HOH A O   1 
HETATM 8266 O  O   . HOH W 6 .   ? -7.731  -24.330 49.029  1.00 46.07 ? 2350 HOH A O   1 
HETATM 8267 O  O   . HOH W 6 .   ? -8.082  -34.232 73.914  1.00 48.63 ? 2351 HOH A O   1 
HETATM 8268 O  O   . HOH W 6 .   ? -6.302  -33.377 69.156  1.00 45.81 ? 2352 HOH A O   1 
HETATM 8269 O  O   . HOH X 6 .   ? 31.062  -17.118 91.627  1.00 48.79 ? 2001 HOH B O   1 
HETATM 8270 O  O   . HOH X 6 .   ? 33.742  -6.942  92.812  1.00 42.77 ? 2002 HOH B O   1 
HETATM 8271 O  O   . HOH X 6 .   ? 32.158  -10.595 98.651  1.00 41.79 ? 2003 HOH B O   1 
HETATM 8272 O  O   . HOH X 6 .   ? 23.996  -11.429 94.148  1.00 25.73 ? 2004 HOH B O   1 
HETATM 8273 O  O   . HOH X 6 .   ? 26.203  -14.788 96.310  1.00 37.27 ? 2005 HOH B O   1 
HETATM 8274 O  O   . HOH X 6 .   ? 36.396  -4.140  92.500  1.00 54.55 ? 2006 HOH B O   1 
HETATM 8275 O  O   . HOH X 6 .   ? 24.477  -8.974  76.834  1.00 44.48 ? 2007 HOH B O   1 
HETATM 8276 O  O   . HOH X 6 .   ? 6.876   -3.226  86.451  1.00 32.26 ? 2008 HOH B O   1 
HETATM 8277 O  O   . HOH X 6 .   ? 10.335  1.088   95.161  1.00 49.95 ? 2009 HOH B O   1 
HETATM 8278 O  O   . HOH X 6 .   ? 5.754   2.638   94.289  1.00 42.49 ? 2010 HOH B O   1 
HETATM 8279 O  O   . HOH X 6 .   ? 8.749   4.038   93.450  1.00 37.75 ? 2011 HOH B O   1 
HETATM 8280 O  O   . HOH X 6 .   ? 32.890  -12.892 83.233  1.00 58.83 ? 2012 HOH B O   1 
HETATM 8281 O  O   . HOH X 6 .   ? 33.249  -9.367  88.000  1.00 50.04 ? 2013 HOH B O   1 
HETATM 8282 O  O   . HOH X 6 .   ? -3.793  -9.580  86.168  1.00 42.45 ? 2014 HOH B O   1 
HETATM 8283 O  O   . HOH X 6 .   ? -1.823  -7.003  82.562  1.00 41.79 ? 2015 HOH B O   1 
HETATM 8284 O  O   . HOH X 6 .   ? 4.025   -2.756  82.842  1.00 39.05 ? 2016 HOH B O   1 
HETATM 8285 O  O   . HOH X 6 .   ? 5.999   -4.049  84.085  1.00 25.76 ? 2017 HOH B O   1 
HETATM 8286 O  O   . HOH X 6 .   ? 29.543  -4.060  79.390  1.00 43.32 ? 2018 HOH B O   1 
HETATM 8287 O  O   . HOH X 6 .   ? 24.575  -9.752  79.616  1.00 28.02 ? 2019 HOH B O   1 
HETATM 8288 O  O   . HOH X 6 .   ? 22.970  -3.663  84.904  1.00 43.87 ? 2020 HOH B O   1 
HETATM 8289 O  O   . HOH X 6 .   ? 26.503  -4.790  87.722  1.00 41.37 ? 2021 HOH B O   1 
HETATM 8290 O  O   . HOH X 6 .   ? -3.050  -23.187 88.090  1.00 38.60 ? 2022 HOH B O   1 
HETATM 8291 O  O   . HOH X 6 .   ? 25.132  -2.332  77.483  1.00 49.70 ? 2023 HOH B O   1 
HETATM 8292 O  O   . HOH X 6 .   ? 24.329  -0.921  82.150  1.00 46.73 ? 2024 HOH B O   1 
HETATM 8293 O  O   . HOH X 6 .   ? -1.218  -29.589 86.922  1.00 41.19 ? 2025 HOH B O   1 
HETATM 8294 O  O   . HOH X 6 .   ? -0.967  -31.000 84.562  1.00 28.09 ? 2026 HOH B O   1 
HETATM 8295 O  O   . HOH X 6 .   ? 20.634  -3.512  83.101  1.00 37.22 ? 2027 HOH B O   1 
HETATM 8296 O  O   . HOH X 6 .   ? 0.308   -28.682 92.109  1.00 36.47 ? 2028 HOH B O   1 
HETATM 8297 O  O   . HOH X 6 .   ? 21.700  -7.140  76.836  1.00 30.07 ? 2029 HOH B O   1 
HETATM 8298 O  O   . HOH X 6 .   ? 18.375  -5.158  83.740  1.00 24.23 ? 2030 HOH B O   1 
HETATM 8299 O  O   . HOH X 6 .   ? 13.220  -40.120 94.362  1.00 48.07 ? 2031 HOH B O   1 
HETATM 8300 O  O   . HOH X 6 .   ? 13.381  -40.550 104.069 1.00 40.97 ? 2032 HOH B O   1 
HETATM 8301 O  O   . HOH X 6 .   ? 17.955  -12.321 80.009  1.00 32.84 ? 2033 HOH B O   1 
HETATM 8302 O  O   . HOH X 6 .   ? 21.290  -37.365 98.255  1.00 35.99 ? 2034 HOH B O   1 
HETATM 8303 O  O   . HOH X 6 .   ? 20.718  -38.455 109.718 1.00 41.85 ? 2035 HOH B O   1 
HETATM 8304 O  O   . HOH X 6 .   ? 24.978  -38.384 96.126  1.00 43.58 ? 2036 HOH B O   1 
HETATM 8305 O  O   . HOH X 6 .   ? 24.664  -36.790 110.977 1.00 53.77 ? 2037 HOH B O   1 
HETATM 8306 O  O   . HOH X 6 .   ? 29.477  -32.855 95.993  1.00 43.77 ? 2038 HOH B O   1 
HETATM 8307 O  O   . HOH X 6 .   ? 30.142  -25.894 96.377  1.00 39.91 ? 2039 HOH B O   1 
HETATM 8308 O  O   . HOH X 6 .   ? 29.998  -30.099 92.452  1.00 50.56 ? 2040 HOH B O   1 
HETATM 8309 O  O   . HOH X 6 .   ? 29.817  -26.732 93.541  1.00 44.28 ? 2041 HOH B O   1 
HETATM 8310 O  O   . HOH X 6 .   ? 15.201  -5.696  93.644  1.00 42.19 ? 2042 HOH B O   1 
HETATM 8311 O  O   . HOH X 6 .   ? 13.243  -3.763  88.849  1.00 29.38 ? 2043 HOH B O   1 
HETATM 8312 O  O   . HOH X 6 .   ? 8.843   -2.546  88.015  1.00 47.34 ? 2044 HOH B O   1 
HETATM 8313 O  O   . HOH X 6 .   ? 7.463   -5.152  88.377  1.00 37.64 ? 2045 HOH B O   1 
HETATM 8314 O  O   . HOH X 6 .   ? 8.605   -0.254  93.888  1.00 23.31 ? 2046 HOH B O   1 
HETATM 8315 O  O   . HOH X 6 .   ? 11.673  -0.830  93.189  1.00 41.62 ? 2047 HOH B O   1 
HETATM 8316 O  O   . HOH X 6 .   ? 26.787  -26.418 89.573  1.00 42.64 ? 2048 HOH B O   1 
HETATM 8317 O  O   . HOH X 6 .   ? 5.407   -6.504  87.579  1.00 23.59 ? 2049 HOH B O   1 
HETATM 8318 O  O   . HOH X 6 .   ? 2.059   -3.676  91.932  1.00 27.63 ? 2050 HOH B O   1 
HETATM 8319 O  O   . HOH X 6 .   ? 7.543   1.584   92.303  1.00 36.57 ? 2051 HOH B O   1 
HETATM 8320 O  O   . HOH X 6 .   ? 6.753   -0.434  86.932  1.00 32.37 ? 2052 HOH B O   1 
HETATM 8321 O  O   . HOH X 6 .   ? 21.596  -33.216 88.208  1.00 50.82 ? 2053 HOH B O   1 
HETATM 8322 O  O   . HOH X 6 .   ? 20.509  -39.149 96.469  1.00 32.22 ? 2054 HOH B O   1 
HETATM 8323 O  O   . HOH X 6 .   ? 26.320  -38.332 92.072  1.00 52.59 ? 2055 HOH B O   1 
HETATM 8324 O  O   . HOH X 6 .   ? 22.748  -39.720 95.299  1.00 38.17 ? 2056 HOH B O   1 
HETATM 8325 O  O   . HOH X 6 .   ? 26.733  -37.450 89.536  1.00 49.67 ? 2057 HOH B O   1 
HETATM 8326 O  O   . HOH X 6 .   ? -1.794  -8.724  87.280  1.00 27.45 ? 2058 HOH B O   1 
HETATM 8327 O  O   . HOH X 6 .   ? -2.174  -4.754  84.420  1.00 55.77 ? 2059 HOH B O   1 
HETATM 8328 O  O   . HOH X 6 .   ? -2.985  -5.176  94.539  1.00 32.94 ? 2060 HOH B O   1 
HETATM 8329 O  O   . HOH X 6 .   ? 0.309   0.304   90.349  1.00 65.98 ? 2061 HOH B O   1 
HETATM 8330 O  O   . HOH X 6 .   ? 1.694   -4.808  82.593  1.00 48.74 ? 2062 HOH B O   1 
HETATM 8331 O  O   . HOH X 6 .   ? 5.425   -6.562  84.781  1.00 23.79 ? 2063 HOH B O   1 
HETATM 8332 O  O   . HOH X 6 .   ? -2.890  -9.503  83.448  1.00 21.95 ? 2064 HOH B O   1 
HETATM 8333 O  O   . HOH X 6 .   ? -2.309  -20.128 85.567  1.00 35.12 ? 2065 HOH B O   1 
HETATM 8334 O  O   . HOH X 6 .   ? -2.088  -24.242 82.978  1.00 54.89 ? 2066 HOH B O   1 
HETATM 8335 O  O   . HOH X 6 .   ? -4.965  -23.232 81.611  1.00 52.03 ? 2067 HOH B O   1 
HETATM 8336 O  O   . HOH X 6 .   ? 1.430   -24.809 80.370  1.00 46.42 ? 2068 HOH B O   1 
HETATM 8337 O  O   . HOH X 6 .   ? 3.629   -23.491 82.588  1.00 32.18 ? 2069 HOH B O   1 
HETATM 8338 O  O   . HOH X 6 .   ? 3.159   -22.392 79.853  1.00 50.83 ? 2070 HOH B O   1 
HETATM 8339 O  O   . HOH X 6 .   ? -0.397  -22.365 88.201  1.00 27.69 ? 2071 HOH B O   1 
HETATM 8340 O  O   . HOH X 6 .   ? 1.532   -28.907 86.738  1.00 27.06 ? 2072 HOH B O   1 
HETATM 8341 O  O   . HOH X 6 .   ? 5.051   -27.251 85.562  1.00 27.03 ? 2073 HOH B O   1 
HETATM 8342 O  O   . HOH X 6 .   ? -0.115  -30.038 81.975  1.00 29.39 ? 2074 HOH B O   1 
HETATM 8343 O  O   . HOH X 6 .   ? 5.084   -32.240 82.962  1.00 44.22 ? 2075 HOH B O   1 
HETATM 8344 O  O   . HOH X 6 .   ? 2.957   -29.714 91.712  1.00 27.80 ? 2076 HOH B O   1 
HETATM 8345 O  O   . HOH X 6 .   ? 5.373   -7.754  101.716 1.00 54.25 ? 2077 HOH B O   1 
HETATM 8346 O  O   . HOH X 6 .   ? 2.103   -8.563  97.562  1.00 43.13 ? 2078 HOH B O   1 
HETATM 8347 O  O   . HOH X 6 .   ? 20.948  -1.886  96.988  1.00 39.95 ? 2079 HOH B O   1 
HETATM 8348 O  O   . HOH X 6 .   ? 9.657   -34.171 95.415  1.00 26.97 ? 2080 HOH B O   1 
HETATM 8349 O  O   . HOH X 6 .   ? 6.701   -31.815 95.196  1.00 47.12 ? 2081 HOH B O   1 
HETATM 8350 O  O   . HOH X 6 .   ? 11.165  -37.295 96.272  1.00 24.89 ? 2082 HOH B O   1 
HETATM 8351 O  O   . HOH X 6 .   ? 15.973  -38.120 94.318  1.00 23.46 ? 2083 HOH B O   1 
HETATM 8352 O  O   . HOH X 6 .   ? 12.565  -39.566 97.002  1.00 46.16 ? 2084 HOH B O   1 
HETATM 8353 O  O   . HOH X 6 .   ? 13.200  -40.222 101.268 1.00 50.88 ? 2085 HOH B O   1 
HETATM 8354 O  O   . HOH X 6 .   ? 21.595  -32.266 85.189  1.00 44.43 ? 2086 HOH B O   1 
HETATM 8355 O  O   . HOH X 6 .   ? 13.060  -36.354 102.662 1.00 32.02 ? 2087 HOH B O   1 
HETATM 8356 O  O   . HOH X 6 .   ? 16.422  -37.185 104.946 1.00 28.43 ? 2088 HOH B O   1 
HETATM 8357 O  O   . HOH X 6 .   ? 20.376  -38.282 100.508 1.00 25.48 ? 2089 HOH B O   1 
HETATM 8358 O  O   . HOH X 6 .   ? 29.156  -33.620 78.391  1.00 45.20 ? 2090 HOH B O   1 
HETATM 8359 O  O   . HOH X 6 .   ? 26.212  -31.212 85.235  1.00 49.96 ? 2091 HOH B O   1 
HETATM 8360 O  O   . HOH X 6 .   ? 19.214  -43.153 104.366 1.00 35.28 ? 2092 HOH B O   1 
HETATM 8361 O  O   . HOH X 6 .   ? 22.535  -39.211 107.606 1.00 31.88 ? 2093 HOH B O   1 
HETATM 8362 O  O   . HOH X 6 .   ? 20.157  -43.414 99.262  1.00 49.53 ? 2094 HOH B O   1 
HETATM 8363 O  O   . HOH X 6 .   ? 27.238  -40.191 102.435 1.00 30.72 ? 2095 HOH B O   1 
HETATM 8364 O  O   . HOH X 6 .   ? 24.114  -36.473 98.007  1.00 39.25 ? 2096 HOH B O   1 
HETATM 8365 O  O   . HOH X 6 .   ? 28.229  -35.645 99.335  1.00 48.21 ? 2097 HOH B O   1 
HETATM 8366 O  O   . HOH X 6 .   ? 29.620  -37.919 103.058 1.00 48.84 ? 2098 HOH B O   1 
HETATM 8367 O  O   . HOH X 6 .   ? 29.378  -36.351 108.229 1.00 56.53 ? 2099 HOH B O   1 
HETATM 8368 O  O   . HOH X 6 .   ? 30.514  -38.788 107.349 1.00 57.94 ? 2100 HOH B O   1 
HETATM 8369 O  O   . HOH X 6 .   ? 24.699  -38.199 108.449 1.00 54.20 ? 2101 HOH B O   1 
HETATM 8370 O  O   . HOH X 6 .   ? 26.711  -35.228 109.085 1.00 53.81 ? 2102 HOH B O   1 
HETATM 8371 O  O   . HOH X 6 .   ? 27.279  -33.362 97.734  1.00 33.00 ? 2103 HOH B O   1 
HETATM 8372 O  O   . HOH X 6 .   ? 28.346  -27.094 98.046  1.00 31.24 ? 2104 HOH B O   1 
HETATM 8373 O  O   . HOH X 6 .   ? 29.941  -29.709 95.218  1.00 38.96 ? 2105 HOH B O   1 
HETATM 8374 O  O   . HOH X 6 .   ? 39.030  -23.562 99.487  1.00 57.99 ? 2106 HOH B O   1 
HETATM 8375 O  O   . HOH X 6 .   ? 13.662  -27.121 114.736 1.00 32.80 ? 2107 HOH B O   1 
HETATM 8376 O  O   . HOH X 6 .   ? 7.237   -24.079 105.536 1.00 36.32 ? 2108 HOH B O   1 
HETATM 8377 O  O   . HOH X 6 .   ? 6.995   -25.742 107.764 1.00 39.46 ? 2109 HOH B O   1 
HETATM 8378 O  O   . HOH X 6 .   ? 30.238  -23.051 95.891  1.00 33.13 ? 2110 HOH B O   1 
HETATM 8379 O  O   . HOH X 6 .   ? 30.614  -12.188 100.128 1.00 43.59 ? 2111 HOH B O   1 
HETATM 8380 O  O   . HOH X 6 .   ? 20.591  -36.130 111.285 1.00 43.42 ? 2112 HOH B O   1 
HETATM 8381 O  O   . HOH X 6 .   ? 37.221  -27.172 107.982 1.00 52.14 ? 2113 HOH B O   1 
HETATM 8382 O  O   . HOH X 6 .   ? 27.541  -23.486 91.430  1.00 49.87 ? 2114 HOH B O   1 
HETATM 8383 O  O   . HOH X 6 .   ? 27.230  -27.200 94.342  1.00 30.35 ? 2115 HOH B O   1 
HETATM 8384 O  O   . HOH X 6 .   ? 33.837  -32.712 104.478 1.00 49.47 ? 2116 HOH B O   1 
HETATM 8385 O  O   . HOH X 6 .   ? 24.903  -33.886 96.783  1.00 33.47 ? 2117 HOH B O   1 
HETATM 8386 O  O   . HOH X 6 .   ? 25.354  -30.484 91.247  1.00 40.39 ? 2118 HOH B O   1 
HETATM 8387 O  O   . HOH X 6 .   ? 26.075  -33.269 92.147  1.00 43.76 ? 2119 HOH B O   1 
HETATM 8388 O  O   . HOH X 6 .   ? 22.807  -32.154 90.603  1.00 31.18 ? 2120 HOH B O   1 
HETATM 8389 O  O   . HOH X 6 .   ? 26.024  -34.834 94.328  1.00 42.02 ? 2121 HOH B O   1 
HETATM 8390 O  O   . HOH X 6 .   ? 19.329  -33.252 90.331  1.00 19.68 ? 2122 HOH B O   1 
HETATM 8391 O  O   . HOH X 6 .   ? 4.494   -22.586 104.191 1.00 34.19 ? 2123 HOH B O   1 
HETATM 8392 O  O   . HOH X 6 .   ? 18.877  -38.433 94.219  1.00 40.01 ? 2124 HOH B O   1 
HETATM 8393 O  O   . HOH X 6 .   ? 1.700   -19.523 102.699 1.00 37.96 ? 2125 HOH B O   1 
HETATM 8394 O  O   . HOH X 6 .   ? 19.604  -35.420 87.602  1.00 37.92 ? 2126 HOH B O   1 
HETATM 8395 O  O   . HOH X 6 .   ? -6.512  -17.546 92.027  1.00 50.69 ? 2127 HOH B O   1 
HETATM 8396 O  O   . HOH X 6 .   ? 15.928  -38.376 84.092  1.00 49.70 ? 2128 HOH B O   1 
HETATM 8397 O  O   . HOH X 6 .   ? 17.253  -38.267 86.884  1.00 48.11 ? 2129 HOH B O   1 
HETATM 8398 O  O   . HOH X 6 .   ? 9.418   -15.506 81.501  1.00 43.15 ? 2130 HOH B O   1 
HETATM 8399 O  O   . HOH X 6 .   ? 6.247   -22.036 84.801  1.00 24.09 ? 2131 HOH B O   1 
HETATM 8400 O  O   . HOH X 6 .   ? 6.335   -21.149 82.001  1.00 24.52 ? 2132 HOH B O   1 
HETATM 8401 O  O   . HOH X 6 .   ? 32.417  -17.596 85.575  1.00 49.49 ? 2133 HOH B O   1 
HETATM 8402 O  O   . HOH X 6 .   ? 5.655   -27.599 75.643  1.00 36.04 ? 2134 HOH B O   1 
HETATM 8403 O  O   . HOH X 6 .   ? 7.818   -29.147 75.318  1.00 44.30 ? 2135 HOH B O   1 
HETATM 8404 O  O   . HOH X 6 .   ? 6.898   -32.513 81.334  1.00 33.55 ? 2136 HOH B O   1 
HETATM 8405 O  O   . HOH X 6 .   ? 13.060  -30.785 78.825  1.00 34.71 ? 2137 HOH B O   1 
HETATM 8406 O  O   . HOH X 6 .   ? 12.253  -23.343 79.293  1.00 21.78 ? 2138 HOH B O   1 
HETATM 8407 O  O   . HOH X 6 .   ? 5.025   -24.175 79.139  1.00 39.52 ? 2139 HOH B O   1 
HETATM 8408 O  O   . HOH X 6 .   ? 14.352  -27.708 79.372  1.00 20.91 ? 2140 HOH B O   1 
HETATM 8409 O  O   . HOH X 6 .   ? 8.404   -36.372 81.146  1.00 25.02 ? 2141 HOH B O   1 
HETATM 8410 O  O   . HOH X 6 .   ? 26.598  -28.248 91.897  1.00 38.98 ? 2142 HOH B O   1 
HETATM 8411 O  O   . HOH X 6 .   ? 25.279  -24.197 89.599  1.00 40.43 ? 2143 HOH B O   1 
HETATM 8412 O  O   . HOH X 6 .   ? 27.319  -5.588  93.898  1.00 55.52 ? 2144 HOH B O   1 
HETATM 8413 O  O   . HOH X 6 .   ? 24.968  -1.482  93.327  1.00 45.63 ? 2145 HOH B O   1 
HETATM 8414 O  O   . HOH X 6 .   ? 18.954  -11.171 106.756 1.00 40.38 ? 2146 HOH B O   1 
HETATM 8415 O  O   . HOH X 6 .   ? 21.379  -0.960  78.975  1.00 53.01 ? 2147 HOH B O   1 
HETATM 8416 O  O   . HOH X 6 .   ? 19.005  1.214   82.371  1.00 27.46 ? 2148 HOH B O   1 
HETATM 8417 O  O   . HOH X 6 .   ? 18.809  -9.982  109.066 1.00 48.90 ? 2149 HOH B O   1 
HETATM 8418 O  O   . HOH X 6 .   ? 6.476   -2.577  80.018  1.00 39.17 ? 2150 HOH B O   1 
HETATM 8419 O  O   . HOH X 6 .   ? 24.528  -9.768  112.207 1.00 55.34 ? 2151 HOH B O   1 
HETATM 8420 O  O   . HOH X 6 .   ? 16.592  -8.831  108.403 1.00 48.11 ? 2152 HOH B O   1 
HETATM 8421 O  O   . HOH X 6 .   ? 26.910  -3.458  107.804 1.00 43.93 ? 2153 HOH B O   1 
HETATM 8422 O  O   . HOH X 6 .   ? 18.988  -4.067  103.611 1.00 33.86 ? 2154 HOH B O   1 
HETATM 8423 O  O   . HOH X 6 .   ? 17.929  -5.952  95.240  1.00 37.65 ? 2155 HOH B O   1 
HETATM 8424 O  O   . HOH X 6 .   ? 13.620  -2.704  94.506  1.00 45.10 ? 2156 HOH B O   1 
HETATM 8425 O  O   . HOH X 6 .   ? 5.086   -6.023  99.421  1.00 47.97 ? 2157 HOH B O   1 
HETATM 8426 O  O   . HOH X 6 .   ? 2.753   -6.092  98.252  1.00 45.77 ? 2158 HOH B O   1 
HETATM 8427 O  O   . HOH X 6 .   ? 1.127   -6.222  96.106  1.00 49.52 ? 2159 HOH B O   1 
HETATM 8428 O  O   . HOH X 6 .   ? 2.876   -2.275  98.740  1.00 46.60 ? 2160 HOH B O   1 
HETATM 8429 O  O   . HOH X 6 .   ? 9.978   0.081   100.617 1.00 55.26 ? 2161 HOH B O   1 
HETATM 8430 O  O   . HOH X 6 .   ? 12.237  -3.041  102.634 1.00 40.73 ? 2162 HOH B O   1 
HETATM 8431 O  O   . HOH X 6 .   ? 9.419   -9.306  105.036 1.00 38.31 ? 2163 HOH B O   1 
HETATM 8432 O  O   . HOH X 6 .   ? 12.277  -6.684  105.804 1.00 41.72 ? 2164 HOH B O   1 
HETATM 8433 O  O   . HOH X 6 .   ? 18.822  -2.161  95.230  1.00 38.97 ? 2165 HOH B O   1 
HETATM 8434 O  O   . HOH X 6 .   ? 19.885  -30.973 83.431  1.00 40.03 ? 2166 HOH B O   1 
HETATM 8435 O  O   . HOH X 6 .   ? 15.662  -32.281 76.746  1.00 45.89 ? 2167 HOH B O   1 
HETATM 8436 O  O   . HOH X 6 .   ? 20.297  -34.139 80.228  1.00 51.28 ? 2168 HOH B O   1 
HETATM 8437 O  O   . HOH X 6 .   ? 21.700  -32.042 81.781  1.00 47.27 ? 2169 HOH B O   1 
HETATM 8438 O  O   . HOH X 6 .   ? 30.575  -27.412 77.043  1.00 41.48 ? 2170 HOH B O   1 
HETATM 8439 O  O   . HOH X 6 .   ? 30.741  -33.081 80.825  1.00 55.24 ? 2171 HOH B O   1 
HETATM 8440 O  O   . HOH X 6 .   ? 27.675  -28.710 84.284  1.00 31.14 ? 2172 HOH B O   1 
HETATM 8441 O  O   . HOH X 6 .   ? 29.840  -26.573 82.907  1.00 25.87 ? 2173 HOH B O   1 
HETATM 8442 O  O   . HOH X 6 .   ? 29.783  -20.475 78.904  1.00 26.73 ? 2174 HOH B O   1 
HETATM 8443 O  O   . HOH X 6 .   ? 33.162  -24.729 82.298  1.00 39.59 ? 2175 HOH B O   1 
HETATM 8444 O  O   . HOH X 6 .   ? 31.307  -30.699 75.755  1.00 50.65 ? 2176 HOH B O   1 
HETATM 8445 O  O   . HOH X 6 .   ? 20.463  -19.837 80.754  1.00 20.50 ? 2177 HOH B O   1 
HETATM 8446 O  O   . HOH X 6 .   ? 22.512  -18.148 81.576  1.00 19.74 ? 2178 HOH B O   1 
HETATM 8447 O  O   . HOH X 6 .   ? 19.615  -15.410 76.015  1.00 43.58 ? 2179 HOH B O   1 
HETATM 8448 O  O   . HOH X 6 .   ? 23.900  -15.734 74.014  1.00 46.29 ? 2180 HOH B O   1 
HETATM 8449 O  O   . HOH X 6 .   ? 22.955  -14.257 76.500  1.00 43.25 ? 2181 HOH B O   1 
HETATM 8450 O  O   . HOH X 6 .   ? 27.531  -24.974 73.407  1.00 34.89 ? 2182 HOH B O   1 
HETATM 8451 O  O   . HOH X 6 .   ? 12.619  -20.667 87.112  1.00 19.86 ? 2183 HOH B O   1 
HETATM 8452 O  O   . HOH X 6 .   ? 8.601   -16.268 97.843  1.00 25.40 ? 2184 HOH B O   1 
HETATM 8453 O  O   . HOH X 6 .   ? 3.692   -12.984 103.138 1.00 59.10 ? 2185 HOH B O   1 
HETATM 8454 O  O   . HOH X 6 .   ? 5.068   -9.813  103.693 1.00 48.42 ? 2186 HOH B O   1 
HETATM 8455 O  O   . HOH X 6 .   ? 10.006  -10.570 108.060 1.00 40.18 ? 2187 HOH B O   1 
HETATM 8456 O  O   . HOH X 6 .   ? 7.216   -11.044 108.539 1.00 57.61 ? 2188 HOH B O   1 
HETATM 8457 O  O   . HOH X 6 .   ? 10.700  -14.958 115.707 1.00 36.94 ? 2189 HOH B O   1 
HETATM 8458 O  O   . HOH X 6 .   ? 6.721   -19.096 112.056 1.00 43.02 ? 2190 HOH B O   1 
HETATM 8459 O  O   . HOH X 6 .   ? 8.604   -20.923 110.965 1.00 31.92 ? 2191 HOH B O   1 
HETATM 8460 O  O   . HOH X 6 .   ? 9.694   -22.686 117.650 1.00 43.47 ? 2192 HOH B O   1 
HETATM 8461 O  O   . HOH X 6 .   ? 11.235  -26.575 114.048 1.00 37.23 ? 2193 HOH B O   1 
HETATM 8462 O  O   . HOH X 6 .   ? 15.033  -24.875 115.754 1.00 51.85 ? 2194 HOH B O   1 
HETATM 8463 O  O   . HOH X 6 .   ? 17.215  -21.443 116.060 1.00 50.09 ? 2195 HOH B O   1 
HETATM 8464 O  O   . HOH X 6 .   ? 9.900   -24.343 105.303 1.00 36.08 ? 2196 HOH B O   1 
HETATM 8465 O  O   . HOH X 6 .   ? 9.857   -26.660 107.628 1.00 35.74 ? 2197 HOH B O   1 
HETATM 8466 O  O   . HOH X 6 .   ? 8.845   -25.593 109.913 1.00 37.82 ? 2198 HOH B O   1 
HETATM 8467 O  O   . HOH X 6 .   ? 10.082  -30.577 113.621 1.00 31.03 ? 2199 HOH B O   1 
HETATM 8468 O  O   . HOH X 6 .   ? 8.138   -29.076 110.854 1.00 45.84 ? 2200 HOH B O   1 
HETATM 8469 O  O   . HOH X 6 .   ? 18.769  -29.712 112.356 1.00 43.83 ? 2201 HOH B O   1 
HETATM 8470 O  O   . HOH X 6 .   ? 20.504  -23.436 114.034 1.00 56.01 ? 2202 HOH B O   1 
HETATM 8471 O  O   . HOH X 6 .   ? 21.956  -31.021 109.087 1.00 30.08 ? 2203 HOH B O   1 
HETATM 8472 O  O   . HOH X 6 .   ? 13.708  -30.471 105.004 1.00 25.05 ? 2204 HOH B O   1 
HETATM 8473 O  O   . HOH X 6 .   ? 14.435  -33.610 105.917 1.00 25.89 ? 2205 HOH B O   1 
HETATM 8474 O  O   . HOH X 6 .   ? 18.930  -33.794 106.793 1.00 58.47 ? 2206 HOH B O   1 
HETATM 8475 O  O   . HOH X 6 .   ? 18.285  -33.628 108.037 1.00 32.75 ? 2207 HOH B O   1 
HETATM 8476 O  O   . HOH X 6 .   ? 25.233  -22.841 113.243 1.00 30.94 ? 2208 HOH B O   1 
HETATM 8477 O  O   . HOH X 6 .   ? 25.559  -25.418 115.755 1.00 54.64 ? 2209 HOH B O   1 
HETATM 8478 O  O   . HOH X 6 .   ? 25.276  -34.606 113.738 1.00 54.23 ? 2210 HOH B O   1 
HETATM 8479 O  O   . HOH X 6 .   ? 27.605  -33.090 113.643 1.00 49.42 ? 2211 HOH B O   1 
HETATM 8480 O  O   . HOH X 6 .   ? 22.995  -35.444 112.551 1.00 48.63 ? 2212 HOH B O   1 
HETATM 8481 O  O   . HOH X 6 .   ? 30.665  -17.750 113.562 1.00 38.06 ? 2213 HOH B O   1 
HETATM 8482 O  O   . HOH X 6 .   ? 35.536  -23.201 109.442 1.00 42.91 ? 2214 HOH B O   1 
HETATM 8483 O  O   . HOH X 6 .   ? 36.607  -16.279 106.456 1.00 52.29 ? 2215 HOH B O   1 
HETATM 8484 O  O   . HOH X 6 .   ? 36.460  -27.609 105.191 1.00 35.26 ? 2216 HOH B O   1 
HETATM 8485 O  O   . HOH X 6 .   ? 33.000  -30.332 109.579 1.00 51.24 ? 2217 HOH B O   1 
HETATM 8486 O  O   . HOH X 6 .   ? 30.257  -33.802 108.926 1.00 55.81 ? 2218 HOH B O   1 
HETATM 8487 O  O   . HOH X 6 .   ? 32.382  -33.289 107.000 1.00 49.54 ? 2219 HOH B O   1 
HETATM 8488 O  O   . HOH X 6 .   ? 20.830  -32.060 106.745 1.00 32.55 ? 2220 HOH B O   1 
HETATM 8489 O  O   . HOH X 6 .   ? 8.115   -32.970 97.495  1.00 29.47 ? 2221 HOH B O   1 
HETATM 8490 O  O   . HOH X 6 .   ? 7.642   -27.248 104.620 1.00 32.16 ? 2222 HOH B O   1 
HETATM 8491 O  O   . HOH X 6 .   ? 6.055   -24.430 103.073 1.00 30.23 ? 2223 HOH B O   1 
HETATM 8492 O  O   . HOH X 6 .   ? 4.097   -20.637 102.068 1.00 28.95 ? 2224 HOH B O   1 
HETATM 8493 O  O   . HOH X 6 .   ? 1.348   -26.700 96.128  1.00 34.79 ? 2225 HOH B O   1 
HETATM 8494 O  O   . HOH X 6 .   ? -1.184  -24.575 98.835  1.00 40.30 ? 2226 HOH B O   1 
HETATM 8495 O  O   . HOH X 6 .   ? -1.542  -22.027 100.094 1.00 35.57 ? 2227 HOH B O   1 
HETATM 8496 O  O   . HOH X 6 .   ? 3.543   -19.423 96.179  1.00 23.04 ? 2228 HOH B O   1 
HETATM 8497 O  O   . HOH X 6 .   ? -3.983  -23.167 94.356  1.00 57.47 ? 2229 HOH B O   1 
HETATM 8498 O  O   . HOH X 6 .   ? -1.334  -25.970 96.010  1.00 58.88 ? 2230 HOH B O   1 
HETATM 8499 O  O   . HOH X 6 .   ? -3.077  -20.810 98.151  1.00 41.48 ? 2231 HOH B O   1 
HETATM 8500 O  O   . HOH X 6 .   ? -0.547  -26.303 92.932  1.00 38.68 ? 2232 HOH B O   1 
HETATM 8501 O  O   . HOH X 6 .   ? -3.655  -21.103 91.721  1.00 39.78 ? 2233 HOH B O   1 
HETATM 8502 O  O   . HOH X 6 .   ? -4.122  -24.685 90.243  1.00 44.62 ? 2234 HOH B O   1 
HETATM 8503 O  O   . HOH X 6 .   ? -1.383  -16.592 98.747  1.00 37.15 ? 2235 HOH B O   1 
HETATM 8504 O  O   . HOH X 6 .   ? -4.334  -19.120 93.127  1.00 48.80 ? 2236 HOH B O   1 
HETATM 8505 O  O   . HOH X 6 .   ? -5.809  -14.861 92.579  1.00 56.89 ? 2237 HOH B O   1 
HETATM 8506 O  O   . HOH X 6 .   ? -1.010  -13.057 96.093  1.00 46.67 ? 2238 HOH B O   1 
HETATM 8507 O  O   . HOH X 6 .   ? 7.072   -16.765 81.763  1.00 36.15 ? 2239 HOH B O   1 
HETATM 8508 O  O   . HOH X 6 .   ? 11.053  -11.582 80.889  1.00 26.28 ? 2240 HOH B O   1 
HETATM 8509 O  O   . HOH X 6 .   ? 13.443  -18.309 76.906  1.00 41.82 ? 2241 HOH B O   1 
HETATM 8510 O  O   . HOH X 6 .   ? 10.982  -17.192 79.887  1.00 43.09 ? 2242 HOH B O   1 
HETATM 8511 O  O   . HOH X 6 .   ? 11.852  -14.275 77.618  1.00 50.98 ? 2243 HOH B O   1 
HETATM 8512 O  O   . HOH X 6 .   ? 28.167  -16.698 92.461  1.00 32.59 ? 2244 HOH B O   1 
HETATM 8513 O  O   . HOH X 6 .   ? 29.577  -17.495 89.095  1.00 34.33 ? 2245 HOH B O   1 
HETATM 8514 O  O   . HOH X 6 .   ? 32.631  -14.746 86.535  1.00 44.92 ? 2246 HOH B O   1 
HETATM 8515 O  O   . HOH X 6 .   ? 28.787  -13.892 81.048  1.00 40.74 ? 2247 HOH B O   1 
HETATM 8516 O  O   . HOH X 6 .   ? 24.628  -13.752 78.561  1.00 32.59 ? 2248 HOH B O   1 
HETATM 8517 O  O   . HOH X 6 .   ? 20.842  -12.444 76.347  1.00 40.09 ? 2249 HOH B O   1 
HETATM 8518 O  O   . HOH X 6 .   ? 4.937   -11.746 97.249  1.00 43.62 ? 2250 HOH B O   1 
HETATM 8519 O  O   . HOH X 6 .   ? 0.437   -11.141 94.819  1.00 39.60 ? 2251 HOH B O   1 
HETATM 8520 O  O   . HOH X 6 .   ? 2.917   -10.466 95.842  1.00 47.38 ? 2252 HOH B O   1 
HETATM 8521 O  O   . HOH X 6 .   ? -0.772  -21.126 102.467 1.00 44.26 ? 2253 HOH B O   1 
HETATM 8522 O  O   . HOH X 6 .   ? 3.222   -15.793 102.211 1.00 35.41 ? 2254 HOH B O   1 
HETATM 8523 O  O   . HOH X 6 .   ? 4.424   -17.516 105.008 1.00 38.17 ? 2255 HOH B O   1 
HETATM 8524 O  O   . HOH X 6 .   ? 7.244   -21.311 106.539 1.00 34.22 ? 2256 HOH B O   1 
HETATM 8525 O  O   . HOH X 6 .   ? 13.813  -16.472 117.579 1.00 44.47 ? 2257 HOH B O   1 
HETATM 8526 O  O   . HOH X 6 .   ? 17.251  -11.822 113.571 1.00 52.34 ? 2258 HOH B O   1 
HETATM 8527 O  O   . HOH X 6 .   ? 20.960  -16.766 116.713 1.00 46.75 ? 2259 HOH B O   1 
HETATM 8528 O  O   . HOH X 6 .   ? 19.500  -20.831 114.486 1.00 44.63 ? 2260 HOH B O   1 
HETATM 8529 O  O   . HOH X 6 .   ? 23.446  -20.297 115.817 1.00 51.89 ? 2261 HOH B O   1 
HETATM 8530 O  O   . HOH X 6 .   ? 26.856  -15.130 108.034 1.00 37.63 ? 2262 HOH B O   1 
HETATM 8531 O  O   . HOH X 6 .   ? 28.308  -12.830 109.668 1.00 48.24 ? 2263 HOH B O   1 
HETATM 8532 O  O   . HOH X 6 .   ? 29.659  -10.352 102.137 1.00 46.61 ? 2264 HOH B O   1 
HETATM 8533 O  O   . HOH X 6 .   ? 27.331  -6.179  110.994 1.00 49.15 ? 2265 HOH B O   1 
HETATM 8534 O  O   . HOH X 6 .   ? 24.505  -4.836  98.518  1.00 52.14 ? 2266 HOH B O   1 
HETATM 8535 O  O   . HOH X 6 .   ? 24.991  -4.766  90.216  1.00 37.06 ? 2267 HOH B O   1 
HETATM 8536 O  O   . HOH X 6 .   ? 24.775  -4.552  93.276  1.00 34.02 ? 2268 HOH B O   1 
HETATM 8537 O  O   . HOH X 6 .   ? 18.817  -0.353  92.371  1.00 47.19 ? 2269 HOH B O   1 
HETATM 8538 O  O   . HOH X 6 .   ? 20.255  -0.669  88.725  1.00 49.17 ? 2270 HOH B O   1 
HETATM 8539 O  O   . HOH X 6 .   ? 12.922  -0.629  83.526  1.00 37.92 ? 2271 HOH B O   1 
HETATM 8540 O  O   . HOH X 6 .   ? 12.082  -2.372  86.505  1.00 33.45 ? 2272 HOH B O   1 
HETATM 8541 O  O   . HOH X 6 .   ? 10.424  -1.720  81.970  1.00 35.19 ? 2273 HOH B O   1 
HETATM 8542 O  O   . HOH X 6 .   ? 19.908  -1.301  81.550  1.00 39.05 ? 2274 HOH B O   1 
HETATM 8543 O  O   . HOH X 6 .   ? 6.962   -6.205  76.755  1.00 33.69 ? 2275 HOH B O   1 
HETATM 8544 O  O   . HOH X 6 .   ? 7.947   -3.695  82.015  1.00 27.44 ? 2276 HOH B O   1 
HETATM 8545 O  O   . HOH X 6 .   ? 8.468   -9.678  78.687  1.00 23.49 ? 2277 HOH B O   1 
HETATM 8546 O  O   . HOH X 6 .   ? 7.629   -11.946 80.112  1.00 40.31 ? 2278 HOH B O   1 
HETATM 8547 O  O   . HOH X 6 .   ? -3.512  -19.708 89.717  1.00 46.09 ? 2279 HOH B O   1 
HETATM 8548 O  O   . HOH X 6 .   ? -6.205  -10.717 86.200  1.00 47.02 ? 2280 HOH B O   1 
HETATM 8549 O  O   . HOH Y 6 .   ? 35.364  -31.454 64.083  1.00 50.06 ? 2001 HOH C O   1 
HETATM 8550 O  O   . HOH Y 6 .   ? 41.929  -39.581 64.304  1.00 30.83 ? 2002 HOH C O   1 
HETATM 8551 O  O   . HOH Y 6 .   ? 45.758  -38.575 63.651  1.00 50.36 ? 2003 HOH C O   1 
HETATM 8552 O  O   . HOH Y 6 .   ? 45.153  -29.752 61.843  1.00 26.81 ? 2004 HOH C O   1 
HETATM 8553 O  O   . HOH Y 6 .   ? 42.228  -28.295 65.256  1.00 35.12 ? 2005 HOH C O   1 
HETATM 8554 O  O   . HOH Y 6 .   ? 47.365  -36.354 63.058  1.00 47.54 ? 2006 HOH C O   1 
HETATM 8555 O  O   . HOH Y 6 .   ? 40.697  -46.909 63.693  1.00 54.67 ? 2007 HOH C O   1 
HETATM 8556 O  O   . HOH Y 6 .   ? 31.893  -39.981 52.664  1.00 50.29 ? 2008 HOH C O   1 
HETATM 8557 O  O   . HOH Y 6 .   ? 44.979  -40.185 59.780  1.00 30.31 ? 2009 HOH C O   1 
HETATM 8558 O  O   . HOH Y 6 .   ? 37.047  -43.363 53.108  1.00 31.73 ? 2010 HOH C O   1 
HETATM 8559 O  O   . HOH Y 6 .   ? 37.967  -45.765 53.629  1.00 44.46 ? 2011 HOH C O   1 
HETATM 8560 O  O   . HOH Y 6 .   ? 40.968  -48.019 58.846  1.00 57.22 ? 2012 HOH C O   1 
HETATM 8561 O  O   . HOH Y 6 .   ? 35.183  -47.688 59.108  1.00 61.71 ? 2013 HOH C O   1 
HETATM 8562 O  O   . HOH Y 6 .   ? 32.289  -39.603 55.716  1.00 47.26 ? 2014 HOH C O   1 
HETATM 8563 O  O   . HOH Y 6 .   ? 32.283  -40.418 58.993  1.00 46.34 ? 2015 HOH C O   1 
HETATM 8564 O  O   . HOH Y 6 .   ? 59.169  -20.143 40.207  1.00 56.22 ? 2016 HOH C O   1 
HETATM 8565 O  O   . HOH Y 6 .   ? 63.021  -24.204 40.889  1.00 53.80 ? 2017 HOH C O   1 
HETATM 8566 O  O   . HOH Y 6 .   ? 38.649  -37.041 47.911  1.00 41.61 ? 2018 HOH C O   1 
HETATM 8567 O  O   . HOH Y 6 .   ? 35.868  -37.015 48.781  1.00 40.55 ? 2019 HOH C O   1 
HETATM 8568 O  O   . HOH Y 6 .   ? 39.396  -33.901 49.032  1.00 37.64 ? 2020 HOH C O   1 
HETATM 8569 O  O   . HOH Y 6 .   ? 47.136  -36.849 49.606  1.00 32.30 ? 2021 HOH C O   1 
HETATM 8570 O  O   . HOH Y 6 .   ? 40.876  -1.688  54.189  1.00 51.13 ? 2022 HOH C O   1 
HETATM 8571 O  O   . HOH Y 6 .   ? 41.471  -34.013 44.785  1.00 36.93 ? 2023 HOH C O   1 
HETATM 8572 O  O   . HOH Y 6 .   ? 48.394  -32.412 49.188  1.00 26.10 ? 2024 HOH C O   1 
HETATM 8573 O  O   . HOH Y 6 .   ? 35.852  -0.590  68.866  1.00 59.39 ? 2025 HOH C O   1 
HETATM 8574 O  O   . HOH Y 6 .   ? 36.078  -1.836  73.723  1.00 49.63 ? 2026 HOH C O   1 
HETATM 8575 O  O   . HOH Y 6 .   ? 28.308  -8.445  67.411  1.00 33.00 ? 2027 HOH C O   1 
HETATM 8576 O  O   . HOH Y 6 .   ? 54.226  -28.521 51.150  1.00 28.71 ? 2028 HOH C O   1 
HETATM 8577 O  O   . HOH Y 6 .   ? 56.699  -26.730 49.070  1.00 52.71 ? 2029 HOH C O   1 
HETATM 8578 O  O   . HOH Y 6 .   ? 61.658  -26.222 52.451  1.00 40.87 ? 2030 HOH C O   1 
HETATM 8579 O  O   . HOH Y 6 .   ? 58.651  -28.331 50.686  1.00 42.55 ? 2031 HOH C O   1 
HETATM 8580 O  O   . HOH Y 6 .   ? 31.399  -22.401 62.129  1.00 54.02 ? 2032 HOH C O   1 
HETATM 8581 O  O   . HOH Y 6 .   ? 56.128  -21.897 47.216  1.00 38.16 ? 2033 HOH C O   1 
HETATM 8582 O  O   . HOH Y 6 .   ? 27.345  -15.676 60.888  1.00 50.40 ? 2034 HOH C O   1 
HETATM 8583 O  O   . HOH Y 6 .   ? 63.405  -19.482 42.089  1.00 51.52 ? 2035 HOH C O   1 
HETATM 8584 O  O   . HOH Y 6 .   ? 56.233  -20.198 40.059  1.00 46.89 ? 2036 HOH C O   1 
HETATM 8585 O  O   . HOH Y 6 .   ? 54.834  -22.245 44.751  1.00 27.88 ? 2037 HOH C O   1 
HETATM 8586 O  O   . HOH Y 6 .   ? 33.566  -6.533  52.287  1.00 46.08 ? 2038 HOH C O   1 
HETATM 8587 O  O   . HOH Y 6 .   ? 54.176  -11.118 37.984  1.00 35.94 ? 2039 HOH C O   1 
HETATM 8588 O  O   . HOH Y 6 .   ? 56.931  -14.544 39.980  1.00 37.41 ? 2040 HOH C O   1 
HETATM 8589 O  O   . HOH Y 6 .   ? 50.203  -7.378  44.609  1.00 37.21 ? 2041 HOH C O   1 
HETATM 8590 O  O   . HOH Y 6 .   ? 42.352  -7.164  42.311  1.00 51.14 ? 2042 HOH C O   1 
HETATM 8591 O  O   . HOH Y 6 .   ? 43.120  -8.755  45.677  1.00 32.58 ? 2043 HOH C O   1 
HETATM 8592 O  O   . HOH Y 6 .   ? 48.654  -6.443  48.211  1.00 33.86 ? 2044 HOH C O   1 
HETATM 8593 O  O   . HOH Y 6 .   ? 49.788  -3.902  47.343  1.00 49.62 ? 2045 HOH C O   1 
HETATM 8594 O  O   . HOH Y 6 .   ? 40.660  -7.018  49.334  1.00 36.93 ? 2046 HOH C O   1 
HETATM 8595 O  O   . HOH Y 6 .   ? 42.604  -3.289  48.980  1.00 37.73 ? 2047 HOH C O   1 
HETATM 8596 O  O   . HOH Y 6 .   ? 43.337  -2.609  53.190  1.00 52.25 ? 2048 HOH C O   1 
HETATM 8597 O  O   . HOH Y 6 .   ? 41.006  -3.743  56.512  1.00 33.84 ? 2049 HOH C O   1 
HETATM 8598 O  O   . HOH Y 6 .   ? 37.695  -1.306  58.575  1.00 54.92 ? 2050 HOH C O   1 
HETATM 8599 O  O   . HOH Y 6 .   ? 37.100  -4.014  60.662  1.00 33.36 ? 2051 HOH C O   1 
HETATM 8600 O  O   . HOH Y 6 .   ? 34.467  -1.804  60.365  1.00 42.28 ? 2052 HOH C O   1 
HETATM 8601 O  O   . HOH Y 6 .   ? 34.471  -2.809  63.055  1.00 38.55 ? 2053 HOH C O   1 
HETATM 8602 O  O   . HOH Y 6 .   ? 30.714  -5.949  63.828  1.00 32.75 ? 2054 HOH C O   1 
HETATM 8603 O  O   . HOH Y 6 .   ? 31.248  -3.930  65.792  1.00 51.56 ? 2055 HOH C O   1 
HETATM 8604 O  O   . HOH Y 6 .   ? 32.964  -1.320  68.635  1.00 50.46 ? 2056 HOH C O   1 
HETATM 8605 O  O   . HOH Y 6 .   ? 23.911  -12.169 50.676  1.00 36.86 ? 2057 HOH C O   1 
HETATM 8606 O  O   . HOH Y 6 .   ? 36.945  -3.264  69.163  1.00 35.31 ? 2058 HOH C O   1 
HETATM 8607 O  O   . HOH Y 6 .   ? 35.512  -4.466  72.952  1.00 36.39 ? 2059 HOH C O   1 
HETATM 8608 O  O   . HOH Y 6 .   ? 30.469  -7.839  70.762  1.00 29.51 ? 2060 HOH C O   1 
HETATM 8609 O  O   . HOH Y 6 .   ? 27.662  -31.113 48.255  1.00 54.02 ? 2061 HOH C O   1 
HETATM 8610 O  O   . HOH Y 6 .   ? 31.231  -32.628 56.653  1.00 39.36 ? 2062 HOH C O   1 
HETATM 8611 O  O   . HOH Y 6 .   ? 28.933  -3.236  74.528  1.00 25.74 ? 2063 HOH C O   1 
HETATM 8612 O  O   . HOH Y 6 .   ? 28.534  -12.115 70.038  1.00 44.66 ? 2064 HOH C O   1 
HETATM 8613 O  O   . HOH Y 6 .   ? 29.957  -9.718  69.054  1.00 39.87 ? 2065 HOH C O   1 
HETATM 8614 O  O   . HOH Y 6 .   ? 37.234  -31.585 46.064  1.00 51.18 ? 2066 HOH C O   1 
HETATM 8615 O  O   . HOH Y 6 .   ? 36.010  -28.571 42.239  1.00 45.89 ? 2067 HOH C O   1 
HETATM 8616 O  O   . HOH Y 6 .   ? 28.106  -32.644 43.138  1.00 55.91 ? 2068 HOH C O   1 
HETATM 8617 O  O   . HOH Y 6 .   ? 26.500  -11.133 75.926  1.00 34.18 ? 2069 HOH C O   1 
HETATM 8618 O  O   . HOH Y 6 .   ? 28.283  -15.628 73.256  1.00 45.17 ? 2070 HOH C O   1 
HETATM 8619 O  O   . HOH Y 6 .   ? 26.756  -12.423 78.314  1.00 47.75 ? 2071 HOH C O   1 
HETATM 8620 O  O   . HOH Y 6 .   ? 33.171  -12.483 80.524  1.00 48.79 ? 2072 HOH C O   1 
HETATM 8621 O  O   . HOH Y 6 .   ? 29.892  -16.330 70.153  1.00 29.94 ? 2073 HOH C O   1 
HETATM 8622 O  O   . HOH Y 6 .   ? 33.357  -21.409 70.158  1.00 24.28 ? 2074 HOH C O   1 
HETATM 8623 O  O   . HOH Y 6 .   ? 59.897  -19.316 70.198  1.00 59.34 ? 2075 HOH C O   1 
HETATM 8624 O  O   . HOH Y 6 .   ? 38.318  -33.401 70.455  1.00 46.90 ? 2076 HOH C O   1 
HETATM 8625 O  O   . HOH Y 6 .   ? 35.292  -32.003 73.408  1.00 47.00 ? 2077 HOH C O   1 
HETATM 8626 O  O   . HOH Y 6 .   ? 34.461  -25.821 68.485  1.00 34.56 ? 2078 HOH C O   1 
HETATM 8627 O  O   . HOH Y 6 .   ? 35.733  -5.658  77.911  1.00 46.25 ? 2079 HOH C O   1 
HETATM 8628 O  O   . HOH Y 6 .   ? 43.996  -32.655 70.380  1.00 41.28 ? 2080 HOH C O   1 
HETATM 8629 O  O   . HOH Y 6 .   ? 33.847  -24.837 63.231  1.00 48.17 ? 2081 HOH C O   1 
HETATM 8630 O  O   . HOH Y 6 .   ? 32.957  -23.713 69.017  1.00 36.38 ? 2082 HOH C O   1 
HETATM 8631 O  O   . HOH Y 6 .   ? 32.621  -21.409 66.530  1.00 29.99 ? 2083 HOH C O   1 
HETATM 8632 O  O   . HOH Y 6 .   ? 29.451  -21.301 69.644  1.00 32.71 ? 2084 HOH C O   1 
HETATM 8633 O  O   . HOH Y 6 .   ? 27.913  -16.737 64.812  1.00 32.14 ? 2085 HOH C O   1 
HETATM 8634 O  O   . HOH Y 6 .   ? 29.872  -18.766 63.563  1.00 33.18 ? 2086 HOH C O   1 
HETATM 8635 O  O   . HOH Y 6 .   ? 29.709  -15.931 62.203  1.00 31.58 ? 2087 HOH C O   1 
HETATM 8636 O  O   . HOH Y 6 .   ? 30.508  -12.717 60.492  1.00 21.74 ? 2088 HOH C O   1 
HETATM 8637 O  O   . HOH Y 6 .   ? 28.898  -7.937  64.681  1.00 36.80 ? 2089 HOH C O   1 
HETATM 8638 O  O   . HOH Y 6 .   ? 27.275  -11.846 58.604  1.00 40.53 ? 2090 HOH C O   1 
HETATM 8639 O  O   . HOH Y 6 .   ? 24.939  -9.714  59.383  1.00 52.12 ? 2091 HOH C O   1 
HETATM 8640 O  O   . HOH Y 6 .   ? 30.114  -5.272  58.674  1.00 49.96 ? 2092 HOH C O   1 
HETATM 8641 O  O   . HOH Y 6 .   ? 29.256  -5.213  61.536  1.00 50.15 ? 2093 HOH C O   1 
HETATM 8642 O  O   . HOH Y 6 .   ? 29.334  -9.142  52.846  1.00 46.24 ? 2094 HOH C O   1 
HETATM 8643 O  O   . HOH Y 6 .   ? 44.016  -19.473 44.920  1.00 35.65 ? 2095 HOH C O   1 
HETATM 8644 O  O   . HOH Y 6 .   ? 45.624  -24.054 42.539  1.00 36.02 ? 2096 HOH C O   1 
HETATM 8645 O  O   . HOH Y 6 .   ? 37.629  -25.081 40.629  1.00 29.26 ? 2097 HOH C O   1 
HETATM 8646 O  O   . HOH Y 6 .   ? 37.261  -20.392 41.837  1.00 47.31 ? 2098 HOH C O   1 
HETATM 8647 O  O   . HOH Y 6 .   ? 43.585  -11.853 47.834  1.00 26.79 ? 2099 HOH C O   1 
HETATM 8648 O  O   . HOH Y 6 .   ? 32.269  -32.987 59.284  1.00 52.55 ? 2100 HOH C O   1 
HETATM 8649 O  O   . HOH Y 6 .   ? 39.499  -9.627  42.506  1.00 38.86 ? 2101 HOH C O   1 
HETATM 8650 O  O   . HOH Y 6 .   ? 37.042  -10.850 40.816  1.00 53.74 ? 2102 HOH C O   1 
HETATM 8651 O  O   . HOH Y 6 .   ? 34.565  -32.696 50.049  1.00 35.12 ? 2103 HOH C O   1 
HETATM 8652 O  O   . HOH Y 6 .   ? 33.797  -6.748  46.228  1.00 40.29 ? 2104 HOH C O   1 
HETATM 8653 O  O   . HOH Y 6 .   ? 30.911  -11.464 42.402  1.00 40.92 ? 2105 HOH C O   1 
HETATM 8654 O  O   . HOH Y 6 .   ? 31.880  -12.052 46.225  1.00 41.91 ? 2106 HOH C O   1 
HETATM 8655 O  O   . HOH Y 6 .   ? 38.107  -16.284 46.201  1.00 41.22 ? 2107 HOH C O   1 
HETATM 8656 O  O   . HOH Y 6 .   ? 43.131  -12.402 42.003  1.00 45.15 ? 2108 HOH C O   1 
HETATM 8657 O  O   . HOH Y 6 .   ? 41.742  -10.687 43.952  1.00 44.90 ? 2109 HOH C O   1 
HETATM 8658 O  O   . HOH Y 6 .   ? 32.808  -15.187 47.727  1.00 24.24 ? 2110 HOH C O   1 
HETATM 8659 O  O   . HOH Y 6 .   ? 32.040  -9.612  52.638  1.00 33.57 ? 2111 HOH C O   1 
HETATM 8660 O  O   . HOH Y 6 .   ? 34.892  -15.377 46.021  1.00 32.74 ? 2112 HOH C O   1 
HETATM 8661 O  O   . HOH Y 6 .   ? 24.247  -8.101  57.273  1.00 44.19 ? 2113 HOH C O   1 
HETATM 8662 O  O   . HOH Y 6 .   ? 23.399  -9.749  51.995  1.00 34.10 ? 2114 HOH C O   1 
HETATM 8663 O  O   . HOH Y 6 .   ? 53.676  -23.806 70.839  1.00 49.33 ? 2115 HOH C O   1 
HETATM 8664 O  O   . HOH Y 6 .   ? 56.504  -23.580 70.867  1.00 54.53 ? 2116 HOH C O   1 
HETATM 8665 O  O   . HOH Y 6 .   ? 55.607  -23.046 73.534  1.00 57.59 ? 2117 HOH C O   1 
HETATM 8666 O  O   . HOH Y 6 .   ? 46.544  -20.635 40.627  1.00 44.66 ? 2118 HOH C O   1 
HETATM 8667 O  O   . HOH Y 6 .   ? 61.928  -27.959 68.739  1.00 54.04 ? 2119 HOH C O   1 
HETATM 8668 O  O   . HOH Y 6 .   ? 57.144  -29.940 66.874  1.00 47.76 ? 2120 HOH C O   1 
HETATM 8669 O  O   . HOH Y 6 .   ? 52.731  -28.859 59.372  1.00 37.23 ? 2121 HOH C O   1 
HETATM 8670 O  O   . HOH Y 6 .   ? 57.076  -28.553 56.433  1.00 30.91 ? 2122 HOH C O   1 
HETATM 8671 O  O   . HOH Y 6 .   ? 61.903  -19.242 56.950  1.00 56.26 ? 2123 HOH C O   1 
HETATM 8672 O  O   . HOH Y 6 .   ? 63.187  -18.775 51.352  1.00 46.59 ? 2124 HOH C O   1 
HETATM 8673 O  O   . HOH Y 6 .   ? 59.183  -29.218 58.402  1.00 48.94 ? 2125 HOH C O   1 
HETATM 8674 O  O   . HOH Y 6 .   ? 64.426  -23.567 61.091  1.00 53.84 ? 2126 HOH C O   1 
HETATM 8675 O  O   . HOH Y 6 .   ? 59.606  -18.298 64.395  1.00 39.33 ? 2127 HOH C O   1 
HETATM 8676 O  O   . HOH Y 6 .   ? 61.233  -25.919 62.558  1.00 37.58 ? 2128 HOH C O   1 
HETATM 8677 O  O   . HOH Y 6 .   ? 60.114  -22.261 66.009  1.00 49.17 ? 2129 HOH C O   1 
HETATM 8678 O  O   . HOH Y 6 .   ? 55.260  -31.908 58.670  1.00 41.16 ? 2130 HOH C O   1 
HETATM 8679 O  O   . HOH Y 6 .   ? 28.452  -16.150 54.055  1.00 45.35 ? 2131 HOH C O   1 
HETATM 8680 O  O   . HOH Y 6 .   ? 30.392  -14.517 46.536  1.00 49.84 ? 2132 HOH C O   1 
HETATM 8681 O  O   . HOH Y 6 .   ? 24.109  -15.990 48.786  1.00 35.73 ? 2133 HOH C O   1 
HETATM 8682 O  O   . HOH Y 6 .   ? 27.835  -13.604 47.076  1.00 50.33 ? 2134 HOH C O   1 
HETATM 8683 O  O   . HOH Y 6 .   ? 25.451  -14.032 52.134  1.00 32.86 ? 2135 HOH C O   1 
HETATM 8684 O  O   . HOH Y 6 .   ? 23.212  -20.475 49.853  1.00 32.43 ? 2136 HOH C O   1 
HETATM 8685 O  O   . HOH Y 6 .   ? 26.837  -19.340 58.882  1.00 50.69 ? 2137 HOH C O   1 
HETATM 8686 O  O   . HOH Y 6 .   ? 27.202  -22.636 58.631  1.00 34.29 ? 2138 HOH C O   1 
HETATM 8687 O  O   . HOH Y 6 .   ? 28.325  -31.224 53.564  1.00 45.44 ? 2139 HOH C O   1 
HETATM 8688 O  O   . HOH Y 6 .   ? 29.056  -29.245 49.894  1.00 29.91 ? 2140 HOH C O   1 
HETATM 8689 O  O   . HOH Y 6 .   ? 25.388  -24.814 59.621  1.00 60.34 ? 2141 HOH C O   1 
HETATM 8690 O  O   . HOH Y 6 .   ? 23.625  -24.466 48.511  1.00 50.08 ? 2142 HOH C O   1 
HETATM 8691 O  O   . HOH Y 6 .   ? 35.283  -24.439 50.001  1.00 25.19 ? 2143 HOH C O   1 
HETATM 8692 O  O   . HOH Y 6 .   ? 35.792  -26.673 51.489  1.00 23.62 ? 2144 HOH C O   1 
HETATM 8693 O  O   . HOH Y 6 .   ? 33.875  -31.235 45.240  1.00 45.09 ? 2145 HOH C O   1 
HETATM 8694 O  O   . HOH Y 6 .   ? 36.744  -27.536 44.496  1.00 38.44 ? 2146 HOH C O   1 
HETATM 8695 O  O   . HOH Y 6 .   ? 31.194  -30.963 45.606  1.00 39.91 ? 2147 HOH C O   1 
HETATM 8696 O  O   . HOH Y 6 .   ? 25.981  -30.578 43.730  1.00 41.90 ? 2148 HOH C O   1 
HETATM 8697 O  O   . HOH Y 6 .   ? 31.857  -21.846 44.499  1.00 26.87 ? 2149 HOH C O   1 
HETATM 8698 O  O   . HOH Y 6 .   ? 42.013  -16.761 52.498  1.00 22.08 ? 2150 HOH C O   1 
HETATM 8699 O  O   . HOH Y 6 .   ? 52.162  -14.656 59.512  1.00 27.43 ? 2151 HOH C O   1 
HETATM 8700 O  O   . HOH Y 6 .   ? 61.872  -16.732 62.237  1.00 53.19 ? 2152 HOH C O   1 
HETATM 8701 O  O   . HOH Y 6 .   ? 59.509  -17.225 68.045  1.00 44.41 ? 2153 HOH C O   1 
HETATM 8702 O  O   . HOH Y 6 .   ? 59.288  -13.281 75.782  1.00 55.57 ? 2154 HOH C O   1 
HETATM 8703 O  O   . HOH Y 6 .   ? 56.937  -8.431  71.519  1.00 52.56 ? 2155 HOH C O   1 
HETATM 8704 O  O   . HOH Y 6 .   ? 53.703  -8.654  71.774  1.00 40.96 ? 2156 HOH C O   1 
HETATM 8705 O  O   . HOH Y 6 .   ? 55.601  -6.919  78.050  1.00 46.41 ? 2157 HOH C O   1 
HETATM 8706 O  O   . HOH Y 6 .   ? 49.750  -5.483  72.506  1.00 51.73 ? 2158 HOH C O   1 
HETATM 8707 O  O   . HOH Y 6 .   ? 52.461  -4.065  75.396  1.00 48.62 ? 2159 HOH C O   1 
HETATM 8708 O  O   . HOH Y 6 .   ? 47.984  -8.510  81.889  1.00 57.71 ? 2160 HOH C O   1 
HETATM 8709 O  O   . HOH Y 6 .   ? 50.764  -13.261 79.860  1.00 55.04 ? 2161 HOH C O   1 
HETATM 8710 O  O   . HOH Y 6 .   ? 53.443  -11.664 79.245  1.00 48.85 ? 2162 HOH C O   1 
HETATM 8711 O  O   . HOH Y 6 .   ? 48.570  -9.024  67.370  1.00 44.16 ? 2163 HOH C O   1 
HETATM 8712 O  O   . HOH Y 6 .   ? 44.426  -7.504  77.573  1.00 45.97 ? 2164 HOH C O   1 
HETATM 8713 O  O   . HOH Y 6 .   ? 49.135  -15.593 79.238  1.00 51.01 ? 2165 HOH C O   1 
HETATM 8714 O  O   . HOH Y 6 .   ? 46.024  -10.761 82.014  1.00 40.32 ? 2166 HOH C O   1 
HETATM 8715 O  O   . HOH Y 6 .   ? 38.467  -11.419 77.767  1.00 40.22 ? 2167 HOH C O   1 
HETATM 8716 O  O   . HOH Y 6 .   ? 40.116  -5.026  71.630  1.00 44.05 ? 2168 HOH C O   1 
HETATM 8717 O  O   . HOH Y 6 .   ? 38.753  -4.651  73.906  1.00 45.39 ? 2169 HOH C O   1 
HETATM 8718 O  O   . HOH Y 6 .   ? 37.830  -10.504 75.219  1.00 32.34 ? 2170 HOH C O   1 
HETATM 8719 O  O   . HOH Y 6 .   ? 37.207  -6.612  75.174  1.00 40.61 ? 2171 HOH C O   1 
HETATM 8720 O  O   . HOH Y 6 .   ? 44.509  -18.675 81.453  1.00 38.17 ? 2172 HOH C O   1 
HETATM 8721 O  O   . HOH Y 6 .   ? 40.890  -18.206 83.015  1.00 41.00 ? 2173 HOH C O   1 
HETATM 8722 O  O   . HOH Y 6 .   ? 44.395  -17.019 83.908  1.00 45.79 ? 2174 HOH C O   1 
HETATM 8723 O  O   . HOH Y 6 .   ? 41.406  -18.917 86.873  1.00 58.17 ? 2175 HOH C O   1 
HETATM 8724 O  O   . HOH Y 6 .   ? 37.809  -26.004 82.723  1.00 35.70 ? 2176 HOH C O   1 
HETATM 8725 O  O   . HOH Y 6 .   ? 35.217  -26.850 83.408  1.00 39.88 ? 2177 HOH C O   1 
HETATM 8726 O  O   . HOH Y 6 .   ? 39.908  -32.488 80.318  1.00 39.84 ? 2178 HOH C O   1 
HETATM 8727 O  O   . HOH Y 6 .   ? 37.581  -37.472 74.990  1.00 47.05 ? 2179 HOH C O   1 
HETATM 8728 O  O   . HOH Y 6 .   ? 33.211  -21.747 82.278  1.00 49.92 ? 2180 HOH C O   1 
HETATM 8729 O  O   . HOH Y 6 .   ? 30.534  -22.514 71.833  1.00 38.83 ? 2181 HOH C O   1 
HETATM 8730 O  O   . HOH Y 6 .   ? 30.418  -18.122 80.362  1.00 44.17 ? 2182 HOH C O   1 
HETATM 8731 O  O   . HOH Y 6 .   ? 31.817  -15.280 81.273  1.00 45.71 ? 2183 HOH C O   1 
HETATM 8732 O  O   . HOH Y 6 .   ? 28.426  -16.528 80.808  1.00 32.81 ? 2184 HOH C O   1 
HETATM 8733 O  O   . HOH Y 6 .   ? 25.390  -14.146 75.331  1.00 45.35 ? 2185 HOH C O   1 
HETATM 8734 O  O   . HOH Y 6 .   ? 45.846  -6.089  62.294  1.00 41.96 ? 2186 HOH C O   1 
HETATM 8735 O  O   . HOH Y 6 .   ? 49.527  -7.442  65.302  1.00 50.06 ? 2187 HOH C O   1 
HETATM 8736 O  O   . HOH Y 6 .   ? 51.424  -6.101  62.954  1.00 50.46 ? 2188 HOH C O   1 
HETATM 8737 O  O   . HOH Y 6 .   ? 45.686  -3.414  58.764  1.00 59.11 ? 2189 HOH C O   1 
HETATM 8738 O  O   . HOH Y 6 .   ? 47.796  -2.943  55.105  1.00 42.49 ? 2190 HOH C O   1 
HETATM 8739 O  O   . HOH Y 6 .   ? 51.938  -2.666  63.974  1.00 59.89 ? 2191 HOH C O   1 
HETATM 8740 O  O   . HOH Y 6 .   ? 51.855  -9.431  56.225  1.00 35.99 ? 2192 HOH C O   1 
HETATM 8741 O  O   . HOH Y 6 .   ? 57.368  -4.479  47.499  1.00 54.68 ? 2193 HOH C O   1 
HETATM 8742 O  O   . HOH Y 6 .   ? 44.734  -16.662 44.180  1.00 48.71 ? 2194 HOH C O   1 
HETATM 8743 O  O   . HOH Y 6 .   ? 47.212  -23.150 44.833  1.00 25.68 ? 2195 HOH C O   1 
HETATM 8744 O  O   . HOH Y 6 .   ? 39.047  -22.329 42.494  1.00 36.23 ? 2196 HOH C O   1 
HETATM 8745 O  O   . HOH Y 6 .   ? 42.756  -21.033 43.157  1.00 38.45 ? 2197 HOH C O   1 
HETATM 8746 O  O   . HOH Y 6 .   ? 38.157  -25.697 43.305  1.00 33.39 ? 2198 HOH C O   1 
HETATM 8747 O  O   . HOH Y 6 .   ? 35.211  -30.274 61.317  1.00 37.22 ? 2199 HOH C O   1 
HETATM 8748 O  O   . HOH Y 6 .   ? 34.359  -35.167 59.141  1.00 43.44 ? 2200 HOH C O   1 
HETATM 8749 O  O   . HOH Y 6 .   ? 36.925  -31.942 48.906  1.00 24.30 ? 2201 HOH C O   1 
HETATM 8750 O  O   . HOH Y 6 .   ? 40.158  -30.149 43.914  1.00 36.72 ? 2202 HOH C O   1 
HETATM 8751 O  O   . HOH Y 6 .   ? 39.696  -34.979 46.526  1.00 50.66 ? 2203 HOH C O   1 
HETATM 8752 O  O   . HOH Y 6 .   ? 55.856  -8.599  56.169  1.00 47.15 ? 2204 HOH C O   1 
HETATM 8753 O  O   . HOH Y 6 .   ? 58.556  -14.729 53.583  1.00 42.84 ? 2205 HOH C O   1 
HETATM 8754 O  O   . HOH Y 6 .   ? 57.100  -10.447 60.806  1.00 45.22 ? 2206 HOH C O   1 
HETATM 8755 O  O   . HOH Y 6 .   ? 52.355  -8.103  64.349  1.00 52.39 ? 2207 HOH C O   1 
HETATM 8756 O  O   . HOH Y 6 .   ? 52.974  -8.403  67.178  1.00 40.84 ? 2208 HOH C O   1 
HETATM 8757 O  O   . HOH Y 6 .   ? 57.385  -13.307 78.566  1.00 44.55 ? 2209 HOH C O   1 
HETATM 8758 O  O   . HOH Y 6 .   ? 47.296  -26.111 76.114  1.00 33.01 ? 2210 HOH C O   1 
HETATM 8759 O  O   . HOH Y 6 .   ? 48.649  -28.314 77.736  1.00 47.57 ? 2211 HOH C O   1 
HETATM 8760 O  O   . HOH Y 6 .   ? 53.253  -28.006 83.329  1.00 54.68 ? 2212 HOH C O   1 
HETATM 8761 O  O   . HOH Y 6 .   ? 45.522  -25.720 83.116  1.00 40.72 ? 2213 HOH C O   1 
HETATM 8762 O  O   . HOH Y 6 .   ? 41.704  -34.184 79.260  1.00 48.03 ? 2214 HOH C O   1 
HETATM 8763 O  O   . HOH Y 6 .   ? 51.418  -33.303 65.728  1.00 39.07 ? 2215 HOH C O   1 
HETATM 8764 O  O   . HOH Y 6 .   ? 46.922  -36.104 57.911  1.00 39.62 ? 2216 HOH C O   1 
HETATM 8765 O  O   . HOH Y 6 .   ? 49.293  -35.043 60.433  1.00 41.57 ? 2217 HOH C O   1 
HETATM 8766 O  O   . HOH Y 6 .   ? 52.486  -35.346 54.010  1.00 47.67 ? 2218 HOH C O   1 
HETATM 8767 O  O   . HOH Y 6 .   ? 49.114  -36.697 56.284  1.00 43.15 ? 2219 HOH C O   1 
HETATM 8768 O  O   . HOH Y 6 .   ? 48.513  -34.861 50.657  1.00 30.32 ? 2220 HOH C O   1 
HETATM 8769 O  O   . HOH Y 6 .   ? 54.593  -28.957 43.503  1.00 30.56 ? 2221 HOH C O   1 
HETATM 8770 O  O   . HOH Y 6 .   ? 48.295  -23.802 41.279  1.00 33.10 ? 2222 HOH C O   1 
HETATM 8771 O  O   . HOH Y 6 .   ? 47.848  -20.628 42.905  1.00 50.85 ? 2223 HOH C O   1 
HETATM 8772 O  O   . HOH Y 6 .   ? 35.863  -28.360 63.495  1.00 51.79 ? 2224 HOH C O   1 
HETATM 8773 O  O   . HOH Y 6 .   ? 50.153  -28.582 37.112  1.00 40.51 ? 2225 HOH C O   1 
HETATM 8774 O  O   . HOH Y 6 .   ? 44.460  -26.307 43.169  1.00 26.59 ? 2226 HOH C O   1 
HETATM 8775 O  O   . HOH Z 6 .   ? 16.477  -15.890 28.246  1.00 54.69 ? 2001 HOH D O   1 
HETATM 8776 O  O   . HOH Z 6 .   ? 17.300  -10.065 20.447  1.00 54.20 ? 2002 HOH D O   1 
HETATM 8777 O  O   . HOH Z 6 .   ? 23.279  -14.225 22.839  1.00 36.07 ? 2003 HOH D O   1 
HETATM 8778 O  O   . HOH Z 6 .   ? 25.244  -10.921 25.012  1.00 32.32 ? 2004 HOH D O   1 
HETATM 8779 O  O   . HOH Z 6 .   ? 23.188  -4.674  20.400  1.00 54.93 ? 2005 HOH D O   1 
HETATM 8780 O  O   . HOH Z 6 .   ? 20.035  -3.256  28.663  1.00 45.43 ? 2006 HOH D O   1 
HETATM 8781 O  O   . HOH Z 6 .   ? 12.270  -6.121  37.586  1.00 48.27 ? 2007 HOH D O   1 
HETATM 8782 O  O   . HOH Z 6 .   ? 11.436  -10.304 34.256  1.00 55.13 ? 2008 HOH D O   1 
HETATM 8783 O  O   . HOH Z 6 .   ? 45.564  -1.829  37.426  1.00 56.73 ? 2009 HOH D O   1 
HETATM 8784 O  O   . HOH Z 6 .   ? 50.754  -5.406  36.827  1.00 56.48 ? 2010 HOH D O   1 
HETATM 8785 O  O   . HOH Z 6 .   ? 19.705  -4.183  40.607  1.00 35.62 ? 2011 HOH D O   1 
HETATM 8786 O  O   . HOH Z 6 .   ? 24.510  -9.527  39.591  1.00 31.23 ? 2012 HOH D O   1 
HETATM 8787 O  O   . HOH Z 6 .   ? 53.114  -4.622  38.466  1.00 52.73 ? 2013 HOH D O   1 
HETATM 8788 O  O   . HOH Z 6 .   ? 25.967  -3.435  34.652  1.00 52.58 ? 2014 HOH D O   1 
HETATM 8789 O  O   . HOH Z 6 .   ? 51.147  -28.152 32.426  1.00 45.70 ? 2015 HOH D O   1 
HETATM 8790 O  O   . HOH Z 6 .   ? 28.347  -3.008  35.981  1.00 50.27 ? 2016 HOH D O   1 
HETATM 8791 O  O   . HOH Z 6 .   ? 27.915  -6.966  42.308  1.00 38.32 ? 2017 HOH D O   1 
HETATM 8792 O  O   . HOH Z 6 .   ? 30.659  -4.622  35.502  1.00 34.47 ? 2018 HOH D O   1 
HETATM 8793 O  O   . HOH Z 6 .   ? 28.779  -36.557 20.846  1.00 37.16 ? 2019 HOH D O   1 
HETATM 8794 O  O   . HOH Z 6 .   ? 29.805  -37.704 9.786   1.00 49.03 ? 2020 HOH D O   1 
HETATM 8795 O  O   . HOH Z 6 .   ? 25.238  -37.642 23.489  1.00 40.08 ? 2021 HOH D O   1 
HETATM 8796 O  O   . HOH Z 6 .   ? 27.564  -39.189 23.838  1.00 45.38 ? 2022 HOH D O   1 
HETATM 8797 O  O   . HOH Z 6 .   ? 20.590  -32.463 22.910  1.00 41.40 ? 2023 HOH D O   1 
HETATM 8798 O  O   . HOH Z 6 .   ? 19.897  -25.524 22.843  1.00 39.72 ? 2024 HOH D O   1 
HETATM 8799 O  O   . HOH Z 6 .   ? 35.774  -2.906  30.467  1.00 35.51 ? 2025 HOH D O   1 
HETATM 8800 O  O   . HOH Z 6 .   ? 38.568  -1.934  30.874  1.00 47.31 ? 2026 HOH D O   1 
HETATM 8801 O  O   . HOH Z 6 .   ? 41.576  -3.732  30.933  1.00 50.51 ? 2027 HOH D O   1 
HETATM 8802 O  O   . HOH Z 6 .   ? 34.997  -1.778  24.709  1.00 40.70 ? 2028 HOH D O   1 
HETATM 8803 O  O   . HOH Z 6 .   ? 38.953  0.165   28.955  1.00 48.21 ? 2029 HOH D O   1 
HETATM 8804 O  O   . HOH Z 6 .   ? 39.818  1.291   25.461  1.00 51.83 ? 2030 HOH D O   1 
HETATM 8805 O  O   . HOH Z 6 .   ? 19.873  -26.235 25.599  1.00 43.11 ? 2031 HOH D O   1 
HETATM 8806 O  O   . HOH Z 6 .   ? 23.121  -27.822 27.397  1.00 44.26 ? 2032 HOH D O   1 
HETATM 8807 O  O   . HOH Z 6 .   ? 24.154  -34.488 24.899  1.00 44.83 ? 2033 HOH D O   1 
HETATM 8808 O  O   . HOH Z 6 .   ? 43.747  -5.247  31.500  1.00 43.09 ? 2034 HOH D O   1 
HETATM 8809 O  O   . HOH Z 6 .   ? 29.930  -38.446 22.557  1.00 37.52 ? 2035 HOH D O   1 
HETATM 8810 O  O   . HOH Z 6 .   ? 44.640  -18.791 39.358  1.00 45.80 ? 2036 HOH D O   1 
HETATM 8811 O  O   . HOH Z 6 .   ? 43.350  -5.022  34.258  1.00 32.31 ? 2037 HOH D O   1 
HETATM 8812 O  O   . HOH Z 6 .   ? 47.742  -3.430  36.314  1.00 53.56 ? 2038 HOH D O   1 
HETATM 8813 O  O   . HOH Z 6 .   ? 52.217  -7.599  35.438  1.00 37.77 ? 2039 HOH D O   1 
HETATM 8814 O  O   . HOH Z 6 .   ? 55.133  -20.991 37.720  1.00 57.32 ? 2040 HOH D O   1 
HETATM 8815 O  O   . HOH Z 6 .   ? 46.255  -22.213 36.459  1.00 28.06 ? 2041 HOH D O   1 
HETATM 8816 O  O   . HOH Z 6 .   ? 47.753  -22.501 38.934  1.00 48.09 ? 2042 HOH D O   1 
HETATM 8817 O  O   . HOH Z 6 .   ? 50.241  -20.932 30.952  1.00 38.56 ? 2043 HOH D O   1 
HETATM 8818 O  O   . HOH Z 6 .   ? 51.702  -18.379 33.279  1.00 37.37 ? 2044 HOH D O   1 
HETATM 8819 O  O   . HOH Z 6 .   ? 52.967  -25.960 33.416  1.00 47.73 ? 2045 HOH D O   1 
HETATM 8820 O  O   . HOH Z 6 .   ? 45.014  -26.095 33.617  1.00 31.61 ? 2046 HOH D O   1 
HETATM 8821 O  O   . HOH Z 6 .   ? 48.460  -27.572 32.500  1.00 27.55 ? 2047 HOH D O   1 
HETATM 8822 O  O   . HOH Z 6 .   ? 47.125  -28.653 27.389  1.00 29.53 ? 2048 HOH D O   1 
HETATM 8823 O  O   . HOH Z 6 .   ? 46.279  -32.914 34.854  1.00 25.29 ? 2049 HOH D O   1 
HETATM 8824 O  O   . HOH Z 6 .   ? 45.174  -30.361 35.928  1.00 35.93 ? 2050 HOH D O   1 
HETATM 8825 O  O   . HOH Z 6 .   ? 44.739  -30.458 26.906  1.00 23.82 ? 2051 HOH D O   1 
HETATM 8826 O  O   . HOH Z 6 .   ? 43.641  -30.794 24.182  1.00 37.30 ? 2052 HOH D O   1 
HETATM 8827 O  O   . HOH Z 6 .   ? 39.048  -36.413 22.786  1.00 24.06 ? 2053 HOH D O   1 
HETATM 8828 O  O   . HOH Z 6 .   ? 34.271  -37.259 24.782  1.00 29.11 ? 2054 HOH D O   1 
HETATM 8829 O  O   . HOH Z 6 .   ? 37.127  -35.475 16.477  1.00 29.55 ? 2055 HOH D O   1 
HETATM 8830 O  O   . HOH Z 6 .   ? 37.137  -39.100 17.668  1.00 52.60 ? 2056 HOH D O   1 
HETATM 8831 O  O   . HOH Z 6 .   ? 41.265  -34.146 16.906  1.00 38.67 ? 2057 HOH D O   1 
HETATM 8832 O  O   . HOH Z 6 .   ? 33.904  -36.455 14.242  1.00 29.75 ? 2058 HOH D O   1 
HETATM 8833 O  O   . HOH Z 6 .   ? 29.836  -37.626 18.773  1.00 28.82 ? 2059 HOH D O   1 
HETATM 8834 O  O   . HOH Z 6 .   ? 31.182  -42.284 15.117  1.00 41.71 ? 2060 HOH D O   1 
HETATM 8835 O  O   . HOH Z 6 .   ? 27.651  -38.514 11.574  1.00 32.86 ? 2061 HOH D O   1 
HETATM 8836 O  O   . HOH Z 6 .   ? 30.671  -42.587 19.765  1.00 38.78 ? 2062 HOH D O   1 
HETATM 8837 O  O   . HOH Z 6 .   ? 23.048  -39.443 16.477  1.00 39.58 ? 2063 HOH D O   1 
HETATM 8838 O  O   . HOH Z 6 .   ? 21.939  -35.223 19.896  1.00 47.80 ? 2064 HOH D O   1 
HETATM 8839 O  O   . HOH Z 6 .   ? 26.027  -35.861 21.289  1.00 40.33 ? 2065 HOH D O   1 
HETATM 8840 O  O   . HOH Z 6 .   ? 20.564  -37.462 16.152  1.00 47.06 ? 2066 HOH D O   1 
HETATM 8841 O  O   . HOH Z 6 .   ? 25.185  -37.672 10.916  1.00 50.28 ? 2067 HOH D O   1 
HETATM 8842 O  O   . HOH Z 6 .   ? 23.277  -34.550 9.552   1.00 54.39 ? 2068 HOH D O   1 
HETATM 8843 O  O   . HOH Z 6 .   ? 22.990  -32.787 21.538  1.00 37.01 ? 2069 HOH D O   1 
HETATM 8844 O  O   . HOH Z 6 .   ? 21.643  -26.796 21.160  1.00 32.04 ? 2070 HOH D O   1 
HETATM 8845 O  O   . HOH Z 6 .   ? 15.923  -31.675 20.637  1.00 48.77 ? 2071 HOH D O   1 
HETATM 8846 O  O   . HOH Z 6 .   ? 20.047  -29.839 23.985  1.00 42.44 ? 2072 HOH D O   1 
HETATM 8847 O  O   . HOH Z 6 .   ? 13.898  -25.715 18.781  1.00 56.18 ? 2073 HOH D O   1 
HETATM 8848 O  O   . HOH Z 6 .   ? 15.884  -20.935 24.761  1.00 59.42 ? 2074 HOH D O   1 
HETATM 8849 O  O   . HOH Z 6 .   ? 19.539  -22.800 23.340  1.00 39.31 ? 2075 HOH D O   1 
HETATM 8850 O  O   . HOH Z 6 .   ? 15.160  -17.136 26.220  1.00 53.64 ? 2076 HOH D O   1 
HETATM 8851 O  O   . HOH Z 6 .   ? 22.067  -23.050 27.746  1.00 44.50 ? 2077 HOH D O   1 
HETATM 8852 O  O   . HOH Z 6 .   ? 22.601  -26.803 24.824  1.00 30.29 ? 2078 HOH D O   1 
HETATM 8853 O  O   . HOH Z 6 .   ? 25.406  -33.349 22.457  1.00 36.28 ? 2079 HOH D O   1 
HETATM 8854 O  O   . HOH Z 6 .   ? 27.450  -31.538 28.525  1.00 34.64 ? 2080 HOH D O   1 
HETATM 8855 O  O   . HOH Z 6 .   ? 24.821  -29.990 27.922  1.00 37.60 ? 2081 HOH D O   1 
HETATM 8856 O  O   . HOH Z 6 .   ? 24.336  -32.807 27.187  1.00 51.38 ? 2082 HOH D O   1 
HETATM 8857 O  O   . HOH Z 6 .   ? 30.869  -32.611 28.812  1.00 24.90 ? 2083 HOH D O   1 
HETATM 8858 O  O   . HOH Z 6 .   ? 31.717  -37.802 24.702  1.00 47.26 ? 2084 HOH D O   1 
HETATM 8859 O  O   . HOH Z 6 .   ? 30.696  -34.848 31.485  1.00 43.29 ? 2085 HOH D O   1 
HETATM 8860 O  O   . HOH Z 6 .   ? 48.692  -13.611 18.252  1.00 43.04 ? 2086 HOH D O   1 
HETATM 8861 O  O   . HOH Z 6 .   ? 36.473  -33.467 35.254  1.00 39.94 ? 2087 HOH D O   1 
HETATM 8862 O  O   . HOH Z 6 .   ? 40.194  -14.075 38.249  1.00 52.73 ? 2088 HOH D O   1 
HETATM 8863 O  O   . HOH Z 6 .   ? 43.452  -20.960 34.315  1.00 25.72 ? 2089 HOH D O   1 
HETATM 8864 O  O   . HOH Z 6 .   ? 43.371  -19.940 37.091  1.00 25.50 ? 2090 HOH D O   1 
HETATM 8865 O  O   . HOH Z 6 .   ? 46.153  -27.532 35.608  1.00 38.33 ? 2091 HOH D O   1 
HETATM 8866 O  O   . HOH Z 6 .   ? 43.423  -31.377 37.572  1.00 30.17 ? 2092 HOH D O   1 
HETATM 8867 O  O   . HOH Z 6 .   ? 36.758  -29.813 40.079  1.00 39.03 ? 2093 HOH D O   1 
HETATM 8868 O  O   . HOH Z 6 .   ? 37.645  -22.428 39.732  1.00 24.44 ? 2094 HOH D O   1 
HETATM 8869 O  O   . HOH Z 6 .   ? 40.420  -18.810 37.871  1.00 37.50 ? 2095 HOH D O   1 
HETATM 8870 O  O   . HOH Z 6 .   ? 41.900  -18.914 41.267  1.00 53.03 ? 2096 HOH D O   1 
HETATM 8871 O  O   . HOH Z 6 .   ? 35.775  -26.759 39.729  1.00 22.56 ? 2097 HOH D O   1 
HETATM 8872 O  O   . HOH Z 6 .   ? 29.552  -34.939 35.563  1.00 52.12 ? 2098 HOH D O   1 
HETATM 8873 O  O   . HOH Z 6 .   ? 27.793  -34.270 39.586  1.00 54.11 ? 2099 HOH D O   1 
HETATM 8874 O  O   . HOH Z 6 .   ? 28.510  -32.898 30.903  1.00 46.88 ? 2100 HOH D O   1 
HETATM 8875 O  O   . HOH Z 6 .   ? 25.601  -34.164 37.761  1.00 54.54 ? 2101 HOH D O   1 
HETATM 8876 O  O   . HOH Z 6 .   ? 24.308  -24.006 29.354  1.00 37.75 ? 2102 HOH D O   1 
HETATM 8877 O  O   . HOH Z 6 .   ? 38.812  0.438   34.810  1.00 44.81 ? 2103 HOH D O   1 
HETATM 8878 O  O   . HOH Z 6 .   ? 30.320  -10.632 12.402  1.00 43.15 ? 2104 HOH D O   1 
HETATM 8879 O  O   . HOH Z 6 .   ? 39.644  0.213   41.912  1.00 58.00 ? 2105 HOH D O   1 
HETATM 8880 O  O   . HOH Z 6 .   ? 30.057  -9.617  9.421   1.00 58.67 ? 2106 HOH D O   1 
HETATM 8881 O  O   . HOH Z 6 .   ? 30.035  -3.024  15.842  1.00 43.52 ? 2107 HOH D O   1 
HETATM 8882 O  O   . HOH Z 6 .   ? 31.498  -5.183  23.918  1.00 35.47 ? 2108 HOH D O   1 
HETATM 8883 O  O   . HOH Z 6 .   ? 40.766  -0.805  16.117  1.00 50.16 ? 2109 HOH D O   1 
HETATM 8884 O  O   . HOH Z 6 .   ? 30.657  -1.638  24.185  1.00 42.70 ? 2110 HOH D O   1 
HETATM 8885 O  O   . HOH Z 6 .   ? 20.300  -26.402 36.195  1.00 38.76 ? 2111 HOH D O   1 
HETATM 8886 O  O   . HOH Z 6 .   ? 22.659  -28.714 34.829  1.00 38.03 ? 2112 HOH D O   1 
HETATM 8887 O  O   . HOH Z 6 .   ? 29.327  -19.302 38.502  1.00 26.87 ? 2113 HOH D O   1 
HETATM 8888 O  O   . HOH Z 6 .   ? 27.132  -17.774 37.596  1.00 22.24 ? 2114 HOH D O   1 
HETATM 8889 O  O   . HOH Z 6 .   ? 26.690  -13.996 42.645  1.00 39.14 ? 2115 HOH D O   1 
HETATM 8890 O  O   . HOH Z 6 .   ? 30.474  -15.293 43.622  1.00 50.92 ? 2116 HOH D O   1 
HETATM 8891 O  O   . HOH Z 6 .   ? 37.165  -19.774 32.025  1.00 22.72 ? 2117 HOH D O   1 
HETATM 8892 O  O   . HOH Z 6 .   ? 40.908  -15.102 21.211  1.00 28.65 ? 2118 HOH D O   1 
HETATM 8893 O  O   . HOH Z 6 .   ? 39.467  -9.627  11.170  1.00 46.89 ? 2119 HOH D O   1 
HETATM 8894 O  O   . HOH Z 6 .   ? 38.624  -14.225 3.400   1.00 47.90 ? 2120 HOH D O   1 
HETATM 8895 O  O   . HOH Z 6 .   ? 40.942  -19.716 8.187   1.00 38.54 ? 2121 HOH D O   1 
HETATM 8896 O  O   . HOH Z 6 .   ? 48.380  -22.326 5.485   1.00 41.65 ? 2122 HOH D O   1 
HETATM 8897 O  O   . HOH Z 6 .   ? 38.746  -25.788 5.096   1.00 43.77 ? 2123 HOH D O   1 
HETATM 8898 O  O   . HOH Z 6 .   ? 32.042  -21.307 3.128   1.00 51.12 ? 2124 HOH D O   1 
HETATM 8899 O  O   . HOH Z 6 .   ? 40.113  -25.663 11.360  1.00 33.52 ? 2125 HOH D O   1 
HETATM 8900 O  O   . HOH Z 6 .   ? 39.936  -23.329 13.885  1.00 35.88 ? 2126 HOH D O   1 
HETATM 8901 O  O   . HOH Z 6 .   ? 41.131  -24.624 8.940   1.00 47.84 ? 2127 HOH D O   1 
HETATM 8902 O  O   . HOH Z 6 .   ? 30.516  -29.576 6.967   1.00 50.73 ? 2128 HOH D O   1 
HETATM 8903 O  O   . HOH Z 6 .   ? 30.138  -20.407 4.801   1.00 44.95 ? 2129 HOH D O   1 
HETATM 8904 O  O   . HOH Z 6 .   ? 28.044  -30.285 10.030  1.00 35.91 ? 2130 HOH D O   1 
HETATM 8905 O  O   . HOH Z 6 .   ? 36.295  -29.740 14.184  1.00 26.34 ? 2131 HOH D O   1 
HETATM 8906 O  O   . HOH Z 6 .   ? 31.660  -32.855 11.475  1.00 27.83 ? 2132 HOH D O   1 
HETATM 8907 O  O   . HOH Z 6 .   ? 35.752  -32.708 13.235  1.00 28.11 ? 2133 HOH D O   1 
HETATM 8908 O  O   . HOH Z 6 .   ? 24.357  -22.336 6.038   1.00 44.58 ? 2134 HOH D O   1 
HETATM 8909 O  O   . HOH Z 6 .   ? 21.230  -25.432 3.202   1.00 54.03 ? 2135 HOH D O   1 
HETATM 8910 O  O   . HOH Z 6 .   ? 27.152  -35.447 7.111   1.00 42.75 ? 2136 HOH D O   1 
HETATM 8911 O  O   . HOH Z 6 .   ? 15.331  -23.692 7.473   1.00 54.93 ? 2137 HOH D O   1 
HETATM 8912 O  O   . HOH Z 6 .   ? 18.646  -17.978 5.638   1.00 47.38 ? 2138 HOH D O   1 
HETATM 8913 O  O   . HOH Z 6 .   ? 18.542  -31.924 8.442   1.00 54.63 ? 2139 HOH D O   1 
HETATM 8914 O  O   . HOH Z 6 .   ? 13.326  -27.322 14.148  1.00 39.56 ? 2140 HOH D O   1 
HETATM 8915 O  O   . HOH Z 6 .   ? 19.873  -33.558 10.573  1.00 51.59 ? 2141 HOH D O   1 
HETATM 8916 O  O   . HOH Z 6 .   ? 18.774  -33.201 20.236  1.00 53.74 ? 2142 HOH D O   1 
HETATM 8917 O  O   . HOH Z 6 .   ? 29.383  -31.460 12.147  1.00 28.87 ? 2143 HOH D O   1 
HETATM 8918 O  O   . HOH Z 6 .   ? 42.161  -31.908 21.668  1.00 28.09 ? 2144 HOH D O   1 
HETATM 8919 O  O   . HOH Z 6 .   ? 42.272  -26.243 14.515  1.00 38.37 ? 2145 HOH D O   1 
HETATM 8920 O  O   . HOH Z 6 .   ? 45.364  -19.542 16.925  1.00 35.23 ? 2146 HOH D O   1 
HETATM 8921 O  O   . HOH Z 6 .   ? 48.600  -25.239 22.986  1.00 43.12 ? 2147 HOH D O   1 
HETATM 8922 O  O   . HOH Z 6 .   ? 51.027  -23.053 19.961  1.00 49.11 ? 2148 HOH D O   1 
HETATM 8923 O  O   . HOH Z 6 .   ? 51.376  -20.672 18.932  1.00 48.45 ? 2149 HOH D O   1 
HETATM 8924 O  O   . HOH Z 6 .   ? 45.988  -18.052 22.726  1.00 27.07 ? 2150 HOH D O   1 
HETATM 8925 O  O   . HOH Z 6 .   ? 51.526  -24.294 22.489  1.00 54.57 ? 2151 HOH D O   1 
HETATM 8926 O  O   . HOH Z 6 .   ? 53.653  -20.376 24.606  1.00 42.79 ? 2152 HOH D O   1 
HETATM 8927 O  O   . HOH Z 6 .   ? 52.877  -19.401 20.960  1.00 50.01 ? 2153 HOH D O   1 
HETATM 8928 O  O   . HOH Z 6 .   ? 53.274  -19.396 27.477  1.00 46.97 ? 2154 HOH D O   1 
HETATM 8929 O  O   . HOH Z 6 .   ? 50.359  -25.022 26.141  1.00 35.41 ? 2155 HOH D O   1 
HETATM 8930 O  O   . HOH Z 6 .   ? 50.618  -14.838 20.220  1.00 54.75 ? 2156 HOH D O   1 
HETATM 8931 O  O   . HOH Z 6 .   ? 52.902  -16.405 20.758  1.00 54.88 ? 2157 HOH D O   1 
HETATM 8932 O  O   . HOH Z 6 .   ? 53.737  -17.431 25.498  1.00 45.31 ? 2158 HOH D O   1 
HETATM 8933 O  O   . HOH Z 6 .   ? 55.092  -13.586 26.352  1.00 41.57 ? 2159 HOH D O   1 
HETATM 8934 O  O   . HOH Z 6 .   ? 49.920  -11.164 22.625  1.00 53.42 ? 2160 HOH D O   1 
HETATM 8935 O  O   . HOH Z 6 .   ? 42.434  -15.332 37.270  1.00 47.20 ? 2161 HOH D O   1 
HETATM 8936 O  O   . HOH Z 6 .   ? 38.376  -10.729 38.247  1.00 35.00 ? 2162 HOH D O   1 
HETATM 8937 O  O   . HOH Z 6 .   ? 36.385  -17.748 42.026  1.00 45.75 ? 2163 HOH D O   1 
HETATM 8938 O  O   . HOH Z 6 .   ? 39.060  -16.367 39.384  1.00 40.38 ? 2164 HOH D O   1 
HETATM 8939 O  O   . HOH Z 6 .   ? 38.098  -13.487 41.450  1.00 50.27 ? 2165 HOH D O   1 
HETATM 8940 O  O   . HOH Z 6 .   ? 31.811  -11.831 39.443  1.00 42.57 ? 2166 HOH D O   1 
HETATM 8941 O  O   . HOH Z 6 .   ? 21.028  -16.379 26.666  1.00 49.45 ? 2167 HOH D O   1 
HETATM 8942 O  O   . HOH Z 6 .   ? 19.787  -17.570 30.027  1.00 48.96 ? 2168 HOH D O   1 
HETATM 8943 O  O   . HOH Z 6 .   ? 28.235  -11.794 42.831  1.00 42.60 ? 2169 HOH D O   1 
HETATM 8944 O  O   . HOH Z 6 .   ? 45.290  -10.259 19.386  1.00 45.82 ? 2170 HOH D O   1 
HETATM 8945 O  O   . HOH Z 6 .   ? 44.192  -10.443 22.004  1.00 56.38 ? 2171 HOH D O   1 
HETATM 8946 O  O   . HOH Z 6 .   ? 48.352  -9.446  24.159  1.00 46.64 ? 2172 HOH D O   1 
HETATM 8947 O  O   . HOH Z 6 .   ? 48.086  -18.261 16.647  1.00 44.04 ? 2173 HOH D O   1 
HETATM 8948 O  O   . HOH Z 6 .   ? 46.075  -13.910 16.947  1.00 60.33 ? 2174 HOH D O   1 
HETATM 8949 O  O   . HOH Z 6 .   ? 44.859  -16.321 13.954  1.00 43.96 ? 2175 HOH D O   1 
HETATM 8950 O  O   . HOH Z 6 .   ? 42.901  -19.707 12.550  1.00 43.75 ? 2176 HOH D O   1 
HETATM 8951 O  O   . HOH Z 6 .   ? 35.901  -15.874 1.436   1.00 46.14 ? 2177 HOH D O   1 
HETATM 8952 O  O   . HOH Z 6 .   ? 22.845  -14.793 11.145  1.00 38.27 ? 2178 HOH D O   1 
HETATM 8953 O  O   . HOH Z 6 .   ? 25.254  -3.743  22.054  1.00 54.70 ? 2179 HOH D O   1 
HETATM 8954 O  O   . HOH Z 6 .   ? 23.722  -4.396  28.809  1.00 45.28 ? 2180 HOH D O   1 
HETATM 8955 O  O   . HOH Z 6 .   ? 22.410  -4.401  31.484  1.00 44.34 ? 2181 HOH D O   1 
HETATM 8956 O  O   . HOH Z 6 .   ? 24.137  -4.062  25.917  1.00 43.54 ? 2182 HOH D O   1 
HETATM 8957 O  O   . HOH Z 6 .   ? 34.793  -0.710  28.954  1.00 47.49 ? 2183 HOH D O   1 
HETATM 8958 O  O   . HOH Z 6 .   ? 32.883  0.409   31.056  1.00 47.57 ? 2184 HOH D O   1 
HETATM 8959 O  O   . HOH Z 6 .   ? 35.924  0.520   36.457  1.00 36.57 ? 2185 HOH D O   1 
HETATM 8960 O  O   . HOH Z 6 .   ? 37.025  -0.669  33.331  1.00 47.68 ? 2186 HOH D O   1 
HETATM 8961 O  O   . HOH Z 6 .   ? 38.458  -0.657  37.432  1.00 40.92 ? 2187 HOH D O   1 
HETATM 8962 O  O   . HOH Z 6 .   ? 36.835  0.607   41.956  1.00 50.00 ? 2188 HOH D O   1 
HETATM 8963 O  O   . HOH Z 6 .   ? 41.407  -2.550  37.588  1.00 43.31 ? 2189 HOH D O   1 
HETATM 8964 O  O   . HOH Z 6 .   ? 40.765  -8.535  40.347  1.00 31.11 ? 2190 HOH D O   1 
HETATM 8965 O  O   . HOH Z 6 .   ? 41.122  -11.467 37.962  1.00 50.58 ? 2191 HOH D O   1 
HETATM 8966 O  O   . HOH Z 6 .   ? 53.299  -17.590 29.401  1.00 57.42 ? 2192 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   3   ?   ?   ?   A . n 
A 1 2   PRO 2   4   ?   ?   ?   A . n 
A 1 3   ASP 3   5   ?   ?   ?   A . n 
A 1 4   GLN 4   6   ?   ?   ?   A . n 
A 1 5   SER 5   7   ?   ?   ?   A . n 
A 1 6   HIS 6   8   ?   ?   ?   A . n 
A 1 7   TRP 7   9   9   TRP TRP A . n 
A 1 8   ARG 8   10  10  ARG ARG A . n 
A 1 9   TYR 9   11  11  TYR TYR A . n 
A 1 10  GLY 10  12  12  GLY GLY A . n 
A 1 11  GLY 11  13  13  GLY GLY A . n 
A 1 12  ASP 12  14  14  ASP ASP A . n 
A 1 13  PRO 13  15  15  PRO PRO A . n 
A 1 14  PRO 14  16  16  PRO PRO A . n 
A 1 15  TRP 15  17  17  TRP TRP A . n 
A 1 16  PRO 16  18  18  PRO PRO A . n 
A 1 17  ARG 17  19  19  ARG ARG A . n 
A 1 18  VAL 18  20  20  VAL VAL A . n 
A 1 19  SER 19  21  21  SER SER A . n 
A 1 20  PRO 20  22  22  PRO PRO A . n 
A 1 21  ALA 21  23  23  ALA ALA A . n 
A 1 22  CYS 22  24  24  CYS CYS A . n 
A 1 23  ALA 23  25  25  ALA ALA A . n 
A 1 24  GLY 24  26  26  GLY GLY A . n 
A 1 25  ARG 25  27  27  ARG ARG A . n 
A 1 26  PHE 26  28  28  PHE PHE A . n 
A 1 27  GLN 27  29  29  GLN GLN A . n 
A 1 28  SER 28  30  30  SER SER A . n 
A 1 29  PRO 29  31  31  PRO PRO A . n 
A 1 30  VAL 30  32  32  VAL VAL A . n 
A 1 31  ASP 31  33  33  ASP ASP A . n 
A 1 32  ILE 32  34  34  ILE ILE A . n 
A 1 33  ARG 33  35  35  ARG ARG A . n 
A 1 34  PRO 34  36  36  PRO PRO A . n 
A 1 35  GLN 35  37  37  GLN GLN A . n 
A 1 36  LEU 36  38  38  LEU LEU A . n 
A 1 37  ALA 37  39  39  ALA ALA A . n 
A 1 38  ALA 38  40  40  ALA ALA A . n 
A 1 39  PHE 39  41  41  PHE PHE A . n 
A 1 40  SER 40  42  42  SER SER A . n 
A 1 41  PRO 41  43  43  PRO PRO A . n 
A 1 42  ALA 42  44  44  ALA ALA A . n 
A 1 43  LEU 43  45  45  LEU LEU A . n 
A 1 44  ARG 44  46  46  ARG ARG A . n 
A 1 45  PRO 45  47  47  PRO PRO A . n 
A 1 46  LEU 46  48  48  LEU LEU A . n 
A 1 47  GLU 47  49  49  GLU GLU A . n 
A 1 48  LEU 48  50  50  LEU LEU A . n 
A 1 49  LEU 49  51  51  LEU LEU A . n 
A 1 50  GLY 50  52  52  GLY GLY A . n 
A 1 51  PHE 51  53  53  PHE PHE A . n 
A 1 52  GLN 52  54  54  GLN GLN A . n 
A 1 53  LEU 53  55  55  LEU LEU A . n 
A 1 54  PRO 54  56  56  PRO PRO A . n 
A 1 55  PRO 55  57  57  PRO PRO A . n 
A 1 56  LEU 56  58  58  LEU LEU A . n 
A 1 57  PRO 57  59  59  PRO PRO A . n 
A 1 58  GLU 58  60  60  GLU GLU A . n 
A 1 59  LEU 59  61  61  LEU LEU A . n 
A 1 60  ARG 60  62  62  ARG ARG A . n 
A 1 61  LEU 61  63  63  LEU LEU A . n 
A 1 62  ARG 62  64  64  ARG ARG A . n 
A 1 63  ASN 63  65  65  ASN ASN A . n 
A 1 64  ASN 64  66  66  ASN ASN A . n 
A 1 65  GLY 65  67  67  GLY GLY A . n 
A 1 66  HIS 66  68  68  HIS HIS A . n 
A 1 67  SER 67  69  69  SER SER A . n 
A 1 68  VAL 68  70  70  VAL VAL A . n 
A 1 69  GLN 69  71  71  GLN GLN A . n 
A 1 70  LEU 70  72  72  LEU LEU A . n 
A 1 71  THR 71  73  73  THR THR A . n 
A 1 72  LEU 72  74  74  LEU LEU A . n 
A 1 73  PRO 73  75  75  PRO PRO A . n 
A 1 74  PRO 74  76  76  PRO PRO A . n 
A 1 75  GLY 75  77  77  GLY GLY A . n 
A 1 76  LEU 76  78  78  LEU LEU A . n 
A 1 77  GLU 77  79  79  GLU GLU A . n 
A 1 78  MET 78  80  80  MET MET A . n 
A 1 79  ALA 79  81  81  ALA ALA A . n 
A 1 80  LEU 80  82  82  LEU LEU A . n 
A 1 81  GLY 81  83  83  GLY GLY A . n 
A 1 82  PRO 82  84  84  PRO PRO A . n 
A 1 83  GLY 83  85  85  GLY GLY A . n 
A 1 84  ARG 84  86  86  ARG ARG A . n 
A 1 85  GLU 85  87  87  GLU GLU A . n 
A 1 86  TYR 86  88  88  TYR TYR A . n 
A 1 87  ARG 87  89  89  ARG ARG A . n 
A 1 88  ALA 88  90  90  ALA ALA A . n 
A 1 89  LEU 89  91  91  LEU LEU A . n 
A 1 90  GLN 90  92  92  GLN GLN A . n 
A 1 91  LEU 91  93  93  LEU LEU A . n 
A 1 92  HIS 92  94  94  HIS HIS A . n 
A 1 93  LEU 93  95  95  LEU LEU A . n 
A 1 94  HIS 94  96  96  HIS HIS A . n 
A 1 95  TRP 95  97  97  TRP TRP A . n 
A 1 96  GLY 96  98  98  GLY GLY A . n 
A 1 97  ALA 97  99  99  ALA ALA A . n 
A 1 98  ALA 98  100 100 ALA ALA A . n 
A 1 99  GLY 99  101 101 GLY GLY A . n 
A 1 100 ARG 100 102 102 ARG ARG A . n 
A 1 101 PRO 101 103 103 PRO PRO A . n 
A 1 102 GLY 102 104 104 GLY GLY A . n 
A 1 103 SER 103 105 105 SER SER A . n 
A 1 104 GLU 104 106 106 GLU GLU A . n 
A 1 105 HIS 105 107 107 HIS HIS A . n 
A 1 106 THR 106 108 108 THR THR A . n 
A 1 107 VAL 107 109 109 VAL VAL A . n 
A 1 108 GLU 108 110 110 GLU GLU A . n 
A 1 109 GLY 109 111 111 GLY GLY A . n 
A 1 110 HIS 110 112 112 HIS HIS A . n 
A 1 111 ARG 111 113 113 ARG ARG A . n 
A 1 112 PHE 112 114 114 PHE PHE A . n 
A 1 113 PRO 113 115 115 PRO PRO A . n 
A 1 114 ALA 114 116 116 ALA ALA A . n 
A 1 115 GLU 115 117 117 GLU GLU A . n 
A 1 116 ILE 116 118 118 ILE ILE A . n 
A 1 117 HIS 117 119 119 HIS HIS A . n 
A 1 118 VAL 118 120 120 VAL VAL A . n 
A 1 119 VAL 119 121 121 VAL VAL A . n 
A 1 120 HIS 120 122 122 HIS HIS A . n 
A 1 121 LEU 121 123 123 LEU LEU A . n 
A 1 122 SER 122 124 124 SER SER A . n 
A 1 123 THR 123 125 125 THR THR A . n 
A 1 124 ALA 124 126 126 ALA ALA A . n 
A 1 125 PHE 125 127 127 PHE PHE A . n 
A 1 126 ALA 126 128 128 ALA ALA A . n 
A 1 127 ARG 127 129 129 ARG ARG A . n 
A 1 128 VAL 128 130 130 VAL VAL A . n 
A 1 129 ASP 129 131 131 ASP ASP A . n 
A 1 130 GLU 130 132 132 GLU GLU A . n 
A 1 131 ALA 131 133 133 ALA ALA A . n 
A 1 132 LEU 132 134 134 LEU LEU A . n 
A 1 133 GLY 133 135 135 GLY GLY A . n 
A 1 134 ARG 134 136 136 ARG ARG A . n 
A 1 135 PRO 135 137 137 PRO PRO A . n 
A 1 136 GLY 136 138 138 GLY GLY A . n 
A 1 137 GLY 137 139 139 GLY GLY A . n 
A 1 138 LEU 138 140 140 LEU LEU A . n 
A 1 139 ALA 139 141 141 ALA ALA A . n 
A 1 140 VAL 140 142 142 VAL VAL A . n 
A 1 141 LEU 141 143 143 LEU LEU A . n 
A 1 142 ALA 142 144 144 ALA ALA A . n 
A 1 143 ALA 143 145 145 ALA ALA A . n 
A 1 144 PHE 144 146 146 PHE PHE A . n 
A 1 145 LEU 145 147 147 LEU LEU A . n 
A 1 146 GLU 146 148 148 GLU GLU A . n 
A 1 147 GLU 147 149 149 GLU GLU A . n 
A 1 148 GLY 148 150 150 GLY GLY A . n 
A 1 149 PRO 149 151 151 PRO PRO A . n 
A 1 150 GLU 150 152 152 GLU GLU A . n 
A 1 151 GLU 151 153 153 GLU GLU A . n 
A 1 152 ASN 152 154 154 ASN ASN A . n 
A 1 153 SER 153 155 155 SER SER A . n 
A 1 154 ALA 154 156 156 ALA ALA A . n 
A 1 155 TYR 155 157 157 TYR TYR A . n 
A 1 156 GLU 156 158 158 GLU GLU A . n 
A 1 157 GLN 157 159 159 GLN GLN A . n 
A 1 158 LEU 158 160 160 LEU LEU A . n 
A 1 159 LEU 159 161 161 LEU LEU A . n 
A 1 160 SER 160 162 162 SER SER A . n 
A 1 161 ARG 161 163 163 ARG ARG A . n 
A 1 162 LEU 162 164 164 LEU LEU A . n 
A 1 163 GLU 163 165 165 GLU GLU A . n 
A 1 164 GLU 164 166 166 GLU GLU A . n 
A 1 165 ILE 165 167 167 ILE ILE A . n 
A 1 166 ALA 166 168 168 ALA ALA A . n 
A 1 167 GLU 167 169 169 GLU GLU A . n 
A 1 168 GLU 168 170 170 GLU GLU A . n 
A 1 169 GLY 169 171 171 GLY GLY A . n 
A 1 170 SER 170 172 172 SER SER A . n 
A 1 171 GLU 171 173 173 GLU GLU A . n 
A 1 172 THR 172 174 174 THR THR A . n 
A 1 173 GLN 173 175 175 GLN GLN A . n 
A 1 174 VAL 174 176 176 VAL VAL A . n 
A 1 175 PRO 175 177 177 PRO PRO A . n 
A 1 176 GLY 176 178 178 GLY GLY A . n 
A 1 177 LEU 177 179 179 LEU LEU A . n 
A 1 178 ASP 178 180 180 ASP ASP A . n 
A 1 179 ILE 179 181 181 ILE ILE A . n 
A 1 180 SER 180 182 182 SER SER A . n 
A 1 181 ALA 181 183 183 ALA ALA A . n 
A 1 182 LEU 182 184 184 LEU LEU A . n 
A 1 183 LEU 183 185 185 LEU LEU A . n 
A 1 184 PRO 184 186 186 PRO PRO A . n 
A 1 185 SER 185 187 187 SER SER A . n 
A 1 186 ASP 186 188 188 ASP ASP A . n 
A 1 187 PHE 187 189 189 PHE PHE A . n 
A 1 188 SER 188 190 190 SER SER A . n 
A 1 189 ARG 189 191 191 ARG ARG A . n 
A 1 190 TYR 190 192 192 TYR TYR A . n 
A 1 191 PHE 191 193 193 PHE PHE A . n 
A 1 192 GLN 192 194 194 GLN GLN A . n 
A 1 193 TYR 193 195 195 TYR TYR A . n 
A 1 194 GLU 194 196 196 GLU GLU A . n 
A 1 195 GLY 195 197 197 GLY GLY A . n 
A 1 196 SER 196 198 198 SER SER A . n 
A 1 197 LEU 197 199 199 LEU LEU A . n 
A 1 198 THR 198 200 200 THR THR A . n 
A 1 199 THR 199 201 201 THR THR A . n 
A 1 200 PRO 200 202 202 PRO PRO A . n 
A 1 201 PRO 201 203 203 PRO PRO A . n 
A 1 202 CYS 202 204 204 CYS CYS A . n 
A 1 203 ALA 203 205 205 ALA ALA A . n 
A 1 204 GLN 204 206 206 GLN GLN A . n 
A 1 205 GLY 205 207 207 GLY GLY A . n 
A 1 206 VAL 206 208 208 VAL VAL A . n 
A 1 207 ILE 207 209 209 ILE ILE A . n 
A 1 208 TRP 208 210 210 TRP TRP A . n 
A 1 209 THR 209 211 211 THR THR A . n 
A 1 210 VAL 210 212 212 VAL VAL A . n 
A 1 211 PHE 211 213 213 PHE PHE A . n 
A 1 212 ASN 212 214 214 ASN ASN A . n 
A 1 213 GLN 213 215 215 GLN GLN A . n 
A 1 214 THR 214 216 216 THR THR A . n 
A 1 215 VAL 215 217 217 VAL VAL A . n 
A 1 216 MET 216 218 218 MET MET A . n 
A 1 217 LEU 217 219 219 LEU LEU A . n 
A 1 218 SER 218 220 220 SER SER A . n 
A 1 219 ALA 219 221 221 ALA ALA A . n 
A 1 220 LYS 220 222 222 LYS LYS A . n 
A 1 221 GLN 221 223 223 GLN GLN A . n 
A 1 222 LEU 222 224 224 LEU LEU A . n 
A 1 223 HIS 223 225 225 HIS HIS A . n 
A 1 224 THR 224 226 226 THR THR A . n 
A 1 225 LEU 225 227 227 LEU LEU A . n 
A 1 226 SER 226 228 228 SER SER A . n 
A 1 227 ASP 227 229 229 ASP ASP A . n 
A 1 228 THR 228 230 230 THR THR A . n 
A 1 229 LEU 229 231 231 LEU LEU A . n 
A 1 230 TRP 230 232 232 TRP TRP A . n 
A 1 231 GLY 231 233 233 GLY GLY A . n 
A 1 232 PRO 232 234 234 PRO PRO A . n 
A 1 233 GLY 233 235 235 GLY GLY A . n 
A 1 234 ASP 234 236 236 ASP ASP A . n 
A 1 235 SER 235 237 237 SER SER A . n 
A 1 236 ARG 236 238 238 ARG ARG A . n 
A 1 237 LEU 237 239 239 LEU LEU A . n 
A 1 238 GLN 238 240 240 GLN GLN A . n 
A 1 239 LEU 239 241 241 LEU LEU A . n 
A 1 240 ASN 240 242 242 ASN ASN A . n 
A 1 241 PHE 241 243 243 PHE PHE A . n 
A 1 242 ARG 242 244 244 ARG ARG A . n 
A 1 243 ALA 243 245 245 ALA ALA A . n 
A 1 244 THR 244 246 246 THR THR A . n 
A 1 245 GLN 245 247 247 GLN GLN A . n 
A 1 246 PRO 246 248 248 PRO PRO A . n 
A 1 247 LEU 247 249 249 LEU LEU A . n 
A 1 248 ASN 248 250 250 ASN ASN A . n 
A 1 249 GLY 249 251 251 GLY GLY A . n 
A 1 250 ARG 250 252 252 ARG ARG A . n 
A 1 251 VAL 251 253 253 VAL VAL A . n 
A 1 252 ILE 252 254 254 ILE ILE A . n 
A 1 253 GLU 253 255 255 GLU GLU A . n 
A 1 254 ALA 254 256 256 ALA ALA A . n 
A 1 255 SER 255 257 257 SER SER A . n 
A 1 256 PHE 256 258 258 PHE PHE A . n 
A 1 257 PRO 257 259 259 PRO PRO A . n 
B 1 1   GLY 1   3   ?   ?   ?   B . n 
B 1 2   PRO 2   4   ?   ?   ?   B . n 
B 1 3   ASP 3   5   ?   ?   ?   B . n 
B 1 4   GLN 4   6   ?   ?   ?   B . n 
B 1 5   SER 5   7   ?   ?   ?   B . n 
B 1 6   HIS 6   8   ?   ?   ?   B . n 
B 1 7   TRP 7   9   9   TRP TRP B . n 
B 1 8   ARG 8   10  10  ARG ARG B . n 
B 1 9   TYR 9   11  11  TYR TYR B . n 
B 1 10  GLY 10  12  12  GLY GLY B . n 
B 1 11  GLY 11  13  13  GLY GLY B . n 
B 1 12  ASP 12  14  14  ASP ASP B . n 
B 1 13  PRO 13  15  15  PRO PRO B . n 
B 1 14  PRO 14  16  16  PRO PRO B . n 
B 1 15  TRP 15  17  17  TRP TRP B . n 
B 1 16  PRO 16  18  18  PRO PRO B . n 
B 1 17  ARG 17  19  19  ARG ARG B . n 
B 1 18  VAL 18  20  20  VAL VAL B . n 
B 1 19  SER 19  21  21  SER SER B . n 
B 1 20  PRO 20  22  22  PRO PRO B . n 
B 1 21  ALA 21  23  23  ALA ALA B . n 
B 1 22  CYS 22  24  24  CYS CYS B . n 
B 1 23  ALA 23  25  25  ALA ALA B . n 
B 1 24  GLY 24  26  26  GLY GLY B . n 
B 1 25  ARG 25  27  27  ARG ARG B . n 
B 1 26  PHE 26  28  28  PHE PHE B . n 
B 1 27  GLN 27  29  29  GLN GLN B . n 
B 1 28  SER 28  30  30  SER SER B . n 
B 1 29  PRO 29  31  31  PRO PRO B . n 
B 1 30  VAL 30  32  32  VAL VAL B . n 
B 1 31  ASP 31  33  33  ASP ASP B . n 
B 1 32  ILE 32  34  34  ILE ILE B . n 
B 1 33  ARG 33  35  35  ARG ARG B . n 
B 1 34  PRO 34  36  36  PRO PRO B . n 
B 1 35  GLN 35  37  37  GLN GLN B . n 
B 1 36  LEU 36  38  38  LEU LEU B . n 
B 1 37  ALA 37  39  39  ALA ALA B . n 
B 1 38  ALA 38  40  40  ALA ALA B . n 
B 1 39  PHE 39  41  41  PHE PHE B . n 
B 1 40  SER 40  42  42  SER SER B . n 
B 1 41  PRO 41  43  43  PRO PRO B . n 
B 1 42  ALA 42  44  44  ALA ALA B . n 
B 1 43  LEU 43  45  45  LEU LEU B . n 
B 1 44  ARG 44  46  46  ARG ARG B . n 
B 1 45  PRO 45  47  47  PRO PRO B . n 
B 1 46  LEU 46  48  48  LEU LEU B . n 
B 1 47  GLU 47  49  49  GLU GLU B . n 
B 1 48  LEU 48  50  50  LEU LEU B . n 
B 1 49  LEU 49  51  51  LEU LEU B . n 
B 1 50  GLY 50  52  52  GLY GLY B . n 
B 1 51  PHE 51  53  53  PHE PHE B . n 
B 1 52  GLN 52  54  54  GLN GLN B . n 
B 1 53  LEU 53  55  55  LEU LEU B . n 
B 1 54  PRO 54  56  56  PRO PRO B . n 
B 1 55  PRO 55  57  57  PRO PRO B . n 
B 1 56  LEU 56  58  58  LEU LEU B . n 
B 1 57  PRO 57  59  59  PRO PRO B . n 
B 1 58  GLU 58  60  60  GLU GLU B . n 
B 1 59  LEU 59  61  61  LEU LEU B . n 
B 1 60  ARG 60  62  62  ARG ARG B . n 
B 1 61  LEU 61  63  63  LEU LEU B . n 
B 1 62  ARG 62  64  64  ARG ARG B . n 
B 1 63  ASN 63  65  65  ASN ASN B . n 
B 1 64  ASN 64  66  66  ASN ASN B . n 
B 1 65  GLY 65  67  67  GLY GLY B . n 
B 1 66  HIS 66  68  68  HIS HIS B . n 
B 1 67  SER 67  69  69  SER SER B . n 
B 1 68  VAL 68  70  70  VAL VAL B . n 
B 1 69  GLN 69  71  71  GLN GLN B . n 
B 1 70  LEU 70  72  72  LEU LEU B . n 
B 1 71  THR 71  73  73  THR THR B . n 
B 1 72  LEU 72  74  74  LEU LEU B . n 
B 1 73  PRO 73  75  75  PRO PRO B . n 
B 1 74  PRO 74  76  76  PRO PRO B . n 
B 1 75  GLY 75  77  77  GLY GLY B . n 
B 1 76  LEU 76  78  78  LEU LEU B . n 
B 1 77  GLU 77  79  79  GLU GLU B . n 
B 1 78  MET 78  80  80  MET MET B . n 
B 1 79  ALA 79  81  81  ALA ALA B . n 
B 1 80  LEU 80  82  82  LEU LEU B . n 
B 1 81  GLY 81  83  83  GLY GLY B . n 
B 1 82  PRO 82  84  84  PRO PRO B . n 
B 1 83  GLY 83  85  85  GLY GLY B . n 
B 1 84  ARG 84  86  86  ARG ARG B . n 
B 1 85  GLU 85  87  87  GLU GLU B . n 
B 1 86  TYR 86  88  88  TYR TYR B . n 
B 1 87  ARG 87  89  89  ARG ARG B . n 
B 1 88  ALA 88  90  90  ALA ALA B . n 
B 1 89  LEU 89  91  91  LEU LEU B . n 
B 1 90  GLN 90  92  92  GLN GLN B . n 
B 1 91  LEU 91  93  93  LEU LEU B . n 
B 1 92  HIS 92  94  94  HIS HIS B . n 
B 1 93  LEU 93  95  95  LEU LEU B . n 
B 1 94  HIS 94  96  96  HIS HIS B . n 
B 1 95  TRP 95  97  97  TRP TRP B . n 
B 1 96  GLY 96  98  98  GLY GLY B . n 
B 1 97  ALA 97  99  99  ALA ALA B . n 
B 1 98  ALA 98  100 100 ALA ALA B . n 
B 1 99  GLY 99  101 101 GLY GLY B . n 
B 1 100 ARG 100 102 102 ARG ARG B . n 
B 1 101 PRO 101 103 103 PRO PRO B . n 
B 1 102 GLY 102 104 104 GLY GLY B . n 
B 1 103 SER 103 105 105 SER SER B . n 
B 1 104 GLU 104 106 106 GLU GLU B . n 
B 1 105 HIS 105 107 107 HIS HIS B . n 
B 1 106 THR 106 108 108 THR THR B . n 
B 1 107 VAL 107 109 109 VAL VAL B . n 
B 1 108 GLU 108 110 110 GLU GLU B . n 
B 1 109 GLY 109 111 111 GLY GLY B . n 
B 1 110 HIS 110 112 112 HIS HIS B . n 
B 1 111 ARG 111 113 113 ARG ARG B . n 
B 1 112 PHE 112 114 114 PHE PHE B . n 
B 1 113 PRO 113 115 115 PRO PRO B . n 
B 1 114 ALA 114 116 116 ALA ALA B . n 
B 1 115 GLU 115 117 117 GLU GLU B . n 
B 1 116 ILE 116 118 118 ILE ILE B . n 
B 1 117 HIS 117 119 119 HIS HIS B . n 
B 1 118 VAL 118 120 120 VAL VAL B . n 
B 1 119 VAL 119 121 121 VAL VAL B . n 
B 1 120 HIS 120 122 122 HIS HIS B . n 
B 1 121 LEU 121 123 123 LEU LEU B . n 
B 1 122 SER 122 124 124 SER SER B . n 
B 1 123 THR 123 125 125 THR THR B . n 
B 1 124 ALA 124 126 126 ALA ALA B . n 
B 1 125 PHE 125 127 127 PHE PHE B . n 
B 1 126 ALA 126 128 128 ALA ALA B . n 
B 1 127 ARG 127 129 129 ARG ARG B . n 
B 1 128 VAL 128 130 130 VAL VAL B . n 
B 1 129 ASP 129 131 131 ASP ASP B . n 
B 1 130 GLU 130 132 132 GLU GLU B . n 
B 1 131 ALA 131 133 133 ALA ALA B . n 
B 1 132 LEU 132 134 134 LEU LEU B . n 
B 1 133 GLY 133 135 135 GLY GLY B . n 
B 1 134 ARG 134 136 136 ARG ARG B . n 
B 1 135 PRO 135 137 137 PRO PRO B . n 
B 1 136 GLY 136 138 138 GLY GLY B . n 
B 1 137 GLY 137 139 139 GLY GLY B . n 
B 1 138 LEU 138 140 140 LEU LEU B . n 
B 1 139 ALA 139 141 141 ALA ALA B . n 
B 1 140 VAL 140 142 142 VAL VAL B . n 
B 1 141 LEU 141 143 143 LEU LEU B . n 
B 1 142 ALA 142 144 144 ALA ALA B . n 
B 1 143 ALA 143 145 145 ALA ALA B . n 
B 1 144 PHE 144 146 146 PHE PHE B . n 
B 1 145 LEU 145 147 147 LEU LEU B . n 
B 1 146 GLU 146 148 148 GLU GLU B . n 
B 1 147 GLU 147 149 149 GLU GLU B . n 
B 1 148 GLY 148 150 150 GLY GLY B . n 
B 1 149 PRO 149 151 151 PRO PRO B . n 
B 1 150 GLU 150 152 152 GLU GLU B . n 
B 1 151 GLU 151 153 153 GLU GLU B . n 
B 1 152 ASN 152 154 154 ASN ASN B . n 
B 1 153 SER 153 155 155 SER SER B . n 
B 1 154 ALA 154 156 156 ALA ALA B . n 
B 1 155 TYR 155 157 157 TYR TYR B . n 
B 1 156 GLU 156 158 158 GLU GLU B . n 
B 1 157 GLN 157 159 159 GLN GLN B . n 
B 1 158 LEU 158 160 160 LEU LEU B . n 
B 1 159 LEU 159 161 161 LEU LEU B . n 
B 1 160 SER 160 162 162 SER SER B . n 
B 1 161 ARG 161 163 163 ARG ARG B . n 
B 1 162 LEU 162 164 164 LEU LEU B . n 
B 1 163 GLU 163 165 165 GLU GLU B . n 
B 1 164 GLU 164 166 166 GLU GLU B . n 
B 1 165 ILE 165 167 167 ILE ILE B . n 
B 1 166 ALA 166 168 168 ALA ALA B . n 
B 1 167 GLU 167 169 169 GLU GLU B . n 
B 1 168 GLU 168 170 170 GLU GLU B . n 
B 1 169 GLY 169 171 171 GLY GLY B . n 
B 1 170 SER 170 172 172 SER SER B . n 
B 1 171 GLU 171 173 173 GLU GLU B . n 
B 1 172 THR 172 174 174 THR THR B . n 
B 1 173 GLN 173 175 175 GLN GLN B . n 
B 1 174 VAL 174 176 176 VAL VAL B . n 
B 1 175 PRO 175 177 177 PRO PRO B . n 
B 1 176 GLY 176 178 178 GLY GLY B . n 
B 1 177 LEU 177 179 179 LEU LEU B . n 
B 1 178 ASP 178 180 180 ASP ASP B . n 
B 1 179 ILE 179 181 181 ILE ILE B . n 
B 1 180 SER 180 182 182 SER SER B . n 
B 1 181 ALA 181 183 183 ALA ALA B . n 
B 1 182 LEU 182 184 184 LEU LEU B . n 
B 1 183 LEU 183 185 185 LEU LEU B . n 
B 1 184 PRO 184 186 186 PRO PRO B . n 
B 1 185 SER 185 187 187 SER SER B . n 
B 1 186 ASP 186 188 188 ASP ASP B . n 
B 1 187 PHE 187 189 189 PHE PHE B . n 
B 1 188 SER 188 190 190 SER SER B . n 
B 1 189 ARG 189 191 191 ARG ARG B . n 
B 1 190 TYR 190 192 192 TYR TYR B . n 
B 1 191 PHE 191 193 193 PHE PHE B . n 
B 1 192 GLN 192 194 194 GLN GLN B . n 
B 1 193 TYR 193 195 195 TYR TYR B . n 
B 1 194 GLU 194 196 196 GLU GLU B . n 
B 1 195 GLY 195 197 197 GLY GLY B . n 
B 1 196 SER 196 198 198 SER SER B . n 
B 1 197 LEU 197 199 199 LEU LEU B . n 
B 1 198 THR 198 200 200 THR THR B . n 
B 1 199 THR 199 201 201 THR THR B . n 
B 1 200 PRO 200 202 202 PRO PRO B . n 
B 1 201 PRO 201 203 203 PRO PRO B . n 
B 1 202 CYS 202 204 204 CYS CYS B . n 
B 1 203 ALA 203 205 205 ALA ALA B . n 
B 1 204 GLN 204 206 206 GLN GLN B . n 
B 1 205 GLY 205 207 207 GLY GLY B . n 
B 1 206 VAL 206 208 208 VAL VAL B . n 
B 1 207 ILE 207 209 209 ILE ILE B . n 
B 1 208 TRP 208 210 210 TRP TRP B . n 
B 1 209 THR 209 211 211 THR THR B . n 
B 1 210 VAL 210 212 212 VAL VAL B . n 
B 1 211 PHE 211 213 213 PHE PHE B . n 
B 1 212 ASN 212 214 214 ASN ASN B . n 
B 1 213 GLN 213 215 215 GLN GLN B . n 
B 1 214 THR 214 216 216 THR THR B . n 
B 1 215 VAL 215 217 217 VAL VAL B . n 
B 1 216 MET 216 218 218 MET MET B . n 
B 1 217 LEU 217 219 219 LEU LEU B . n 
B 1 218 SER 218 220 220 SER SER B . n 
B 1 219 ALA 219 221 221 ALA ALA B . n 
B 1 220 LYS 220 222 222 LYS LYS B . n 
B 1 221 GLN 221 223 223 GLN GLN B . n 
B 1 222 LEU 222 224 224 LEU LEU B . n 
B 1 223 HIS 223 225 225 HIS HIS B . n 
B 1 224 THR 224 226 226 THR THR B . n 
B 1 225 LEU 225 227 227 LEU LEU B . n 
B 1 226 SER 226 228 228 SER SER B . n 
B 1 227 ASP 227 229 229 ASP ASP B . n 
B 1 228 THR 228 230 230 THR THR B . n 
B 1 229 LEU 229 231 231 LEU LEU B . n 
B 1 230 TRP 230 232 232 TRP TRP B . n 
B 1 231 GLY 231 233 233 GLY GLY B . n 
B 1 232 PRO 232 234 234 PRO PRO B . n 
B 1 233 GLY 233 235 235 GLY GLY B . n 
B 1 234 ASP 234 236 236 ASP ASP B . n 
B 1 235 SER 235 237 237 SER SER B . n 
B 1 236 ARG 236 238 238 ARG ARG B . n 
B 1 237 LEU 237 239 239 LEU LEU B . n 
B 1 238 GLN 238 240 240 GLN GLN B . n 
B 1 239 LEU 239 241 241 LEU LEU B . n 
B 1 240 ASN 240 242 242 ASN ASN B . n 
B 1 241 PHE 241 243 243 PHE PHE B . n 
B 1 242 ARG 242 244 244 ARG ARG B . n 
B 1 243 ALA 243 245 245 ALA ALA B . n 
B 1 244 THR 244 246 246 THR THR B . n 
B 1 245 GLN 245 247 247 GLN GLN B . n 
B 1 246 PRO 246 248 248 PRO PRO B . n 
B 1 247 LEU 247 249 249 LEU LEU B . n 
B 1 248 ASN 248 250 250 ASN ASN B . n 
B 1 249 GLY 249 251 251 GLY GLY B . n 
B 1 250 ARG 250 252 252 ARG ARG B . n 
B 1 251 VAL 251 253 253 VAL VAL B . n 
B 1 252 ILE 252 254 254 ILE ILE B . n 
B 1 253 GLU 253 255 255 GLU GLU B . n 
B 1 254 ALA 254 256 256 ALA ALA B . n 
B 1 255 SER 255 257 257 SER SER B . n 
B 1 256 PHE 256 258 258 PHE PHE B . n 
B 1 257 PRO 257 259 259 PRO PRO B . n 
C 1 1   GLY 1   3   ?   ?   ?   C . n 
C 1 2   PRO 2   4   ?   ?   ?   C . n 
C 1 3   ASP 3   5   ?   ?   ?   C . n 
C 1 4   GLN 4   6   ?   ?   ?   C . n 
C 1 5   SER 5   7   ?   ?   ?   C . n 
C 1 6   HIS 6   8   ?   ?   ?   C . n 
C 1 7   TRP 7   9   9   TRP TRP C . n 
C 1 8   ARG 8   10  10  ARG ARG C . n 
C 1 9   TYR 9   11  11  TYR TYR C . n 
C 1 10  GLY 10  12  12  GLY GLY C . n 
C 1 11  GLY 11  13  13  GLY GLY C . n 
C 1 12  ASP 12  14  14  ASP ASP C . n 
C 1 13  PRO 13  15  15  PRO PRO C . n 
C 1 14  PRO 14  16  16  PRO PRO C . n 
C 1 15  TRP 15  17  17  TRP TRP C . n 
C 1 16  PRO 16  18  18  PRO PRO C . n 
C 1 17  ARG 17  19  19  ARG ARG C . n 
C 1 18  VAL 18  20  20  VAL VAL C . n 
C 1 19  SER 19  21  21  SER SER C . n 
C 1 20  PRO 20  22  22  PRO PRO C . n 
C 1 21  ALA 21  23  23  ALA ALA C . n 
C 1 22  CYS 22  24  24  CYS CYS C . n 
C 1 23  ALA 23  25  25  ALA ALA C . n 
C 1 24  GLY 24  26  26  GLY GLY C . n 
C 1 25  ARG 25  27  27  ARG ARG C . n 
C 1 26  PHE 26  28  28  PHE PHE C . n 
C 1 27  GLN 27  29  29  GLN GLN C . n 
C 1 28  SER 28  30  30  SER SER C . n 
C 1 29  PRO 29  31  31  PRO PRO C . n 
C 1 30  VAL 30  32  32  VAL VAL C . n 
C 1 31  ASP 31  33  33  ASP ASP C . n 
C 1 32  ILE 32  34  34  ILE ILE C . n 
C 1 33  ARG 33  35  35  ARG ARG C . n 
C 1 34  PRO 34  36  36  PRO PRO C . n 
C 1 35  GLN 35  37  37  GLN GLN C . n 
C 1 36  LEU 36  38  38  LEU LEU C . n 
C 1 37  ALA 37  39  39  ALA ALA C . n 
C 1 38  ALA 38  40  40  ALA ALA C . n 
C 1 39  PHE 39  41  41  PHE PHE C . n 
C 1 40  SER 40  42  42  SER SER C . n 
C 1 41  PRO 41  43  43  PRO PRO C . n 
C 1 42  ALA 42  44  44  ALA ALA C . n 
C 1 43  LEU 43  45  45  LEU LEU C . n 
C 1 44  ARG 44  46  46  ARG ARG C . n 
C 1 45  PRO 45  47  47  PRO PRO C . n 
C 1 46  LEU 46  48  48  LEU LEU C . n 
C 1 47  GLU 47  49  49  GLU GLU C . n 
C 1 48  LEU 48  50  50  LEU LEU C . n 
C 1 49  LEU 49  51  51  LEU LEU C . n 
C 1 50  GLY 50  52  52  GLY GLY C . n 
C 1 51  PHE 51  53  53  PHE PHE C . n 
C 1 52  GLN 52  54  54  GLN GLN C . n 
C 1 53  LEU 53  55  55  LEU LEU C . n 
C 1 54  PRO 54  56  56  PRO PRO C . n 
C 1 55  PRO 55  57  57  PRO PRO C . n 
C 1 56  LEU 56  58  58  LEU LEU C . n 
C 1 57  PRO 57  59  59  PRO PRO C . n 
C 1 58  GLU 58  60  60  GLU GLU C . n 
C 1 59  LEU 59  61  61  LEU LEU C . n 
C 1 60  ARG 60  62  62  ARG ARG C . n 
C 1 61  LEU 61  63  63  LEU LEU C . n 
C 1 62  ARG 62  64  64  ARG ARG C . n 
C 1 63  ASN 63  65  65  ASN ASN C . n 
C 1 64  ASN 64  66  66  ASN ASN C . n 
C 1 65  GLY 65  67  67  GLY GLY C . n 
C 1 66  HIS 66  68  68  HIS HIS C . n 
C 1 67  SER 67  69  69  SER SER C . n 
C 1 68  VAL 68  70  70  VAL VAL C . n 
C 1 69  GLN 69  71  71  GLN GLN C . n 
C 1 70  LEU 70  72  72  LEU LEU C . n 
C 1 71  THR 71  73  73  THR THR C . n 
C 1 72  LEU 72  74  74  LEU LEU C . n 
C 1 73  PRO 73  75  75  PRO PRO C . n 
C 1 74  PRO 74  76  76  PRO PRO C . n 
C 1 75  GLY 75  77  77  GLY GLY C . n 
C 1 76  LEU 76  78  78  LEU LEU C . n 
C 1 77  GLU 77  79  79  GLU GLU C . n 
C 1 78  MET 78  80  80  MET MET C . n 
C 1 79  ALA 79  81  81  ALA ALA C . n 
C 1 80  LEU 80  82  82  LEU LEU C . n 
C 1 81  GLY 81  83  83  GLY GLY C . n 
C 1 82  PRO 82  84  84  PRO PRO C . n 
C 1 83  GLY 83  85  85  GLY GLY C . n 
C 1 84  ARG 84  86  86  ARG ARG C . n 
C 1 85  GLU 85  87  87  GLU GLU C . n 
C 1 86  TYR 86  88  88  TYR TYR C . n 
C 1 87  ARG 87  89  89  ARG ARG C . n 
C 1 88  ALA 88  90  90  ALA ALA C . n 
C 1 89  LEU 89  91  91  LEU LEU C . n 
C 1 90  GLN 90  92  92  GLN GLN C . n 
C 1 91  LEU 91  93  93  LEU LEU C . n 
C 1 92  HIS 92  94  94  HIS HIS C . n 
C 1 93  LEU 93  95  95  LEU LEU C . n 
C 1 94  HIS 94  96  96  HIS HIS C . n 
C 1 95  TRP 95  97  97  TRP TRP C . n 
C 1 96  GLY 96  98  98  GLY GLY C . n 
C 1 97  ALA 97  99  99  ALA ALA C . n 
C 1 98  ALA 98  100 100 ALA ALA C . n 
C 1 99  GLY 99  101 101 GLY GLY C . n 
C 1 100 ARG 100 102 102 ARG ARG C . n 
C 1 101 PRO 101 103 103 PRO PRO C . n 
C 1 102 GLY 102 104 104 GLY GLY C . n 
C 1 103 SER 103 105 105 SER SER C . n 
C 1 104 GLU 104 106 106 GLU GLU C . n 
C 1 105 HIS 105 107 107 HIS HIS C . n 
C 1 106 THR 106 108 108 THR THR C . n 
C 1 107 VAL 107 109 109 VAL VAL C . n 
C 1 108 GLU 108 110 110 GLU GLU C . n 
C 1 109 GLY 109 111 111 GLY GLY C . n 
C 1 110 HIS 110 112 112 HIS HIS C . n 
C 1 111 ARG 111 113 113 ARG ARG C . n 
C 1 112 PHE 112 114 114 PHE PHE C . n 
C 1 113 PRO 113 115 115 PRO PRO C . n 
C 1 114 ALA 114 116 116 ALA ALA C . n 
C 1 115 GLU 115 117 117 GLU GLU C . n 
C 1 116 ILE 116 118 118 ILE ILE C . n 
C 1 117 HIS 117 119 119 HIS HIS C . n 
C 1 118 VAL 118 120 120 VAL VAL C . n 
C 1 119 VAL 119 121 121 VAL VAL C . n 
C 1 120 HIS 120 122 122 HIS HIS C . n 
C 1 121 LEU 121 123 123 LEU LEU C . n 
C 1 122 SER 122 124 124 SER SER C . n 
C 1 123 THR 123 125 125 THR THR C . n 
C 1 124 ALA 124 126 126 ALA ALA C . n 
C 1 125 PHE 125 127 127 PHE PHE C . n 
C 1 126 ALA 126 128 128 ALA ALA C . n 
C 1 127 ARG 127 129 129 ARG ARG C . n 
C 1 128 VAL 128 130 130 VAL VAL C . n 
C 1 129 ASP 129 131 131 ASP ASP C . n 
C 1 130 GLU 130 132 132 GLU GLU C . n 
C 1 131 ALA 131 133 133 ALA ALA C . n 
C 1 132 LEU 132 134 134 LEU LEU C . n 
C 1 133 GLY 133 135 135 GLY GLY C . n 
C 1 134 ARG 134 136 136 ARG ARG C . n 
C 1 135 PRO 135 137 137 PRO PRO C . n 
C 1 136 GLY 136 138 138 GLY GLY C . n 
C 1 137 GLY 137 139 139 GLY GLY C . n 
C 1 138 LEU 138 140 140 LEU LEU C . n 
C 1 139 ALA 139 141 141 ALA ALA C . n 
C 1 140 VAL 140 142 142 VAL VAL C . n 
C 1 141 LEU 141 143 143 LEU LEU C . n 
C 1 142 ALA 142 144 144 ALA ALA C . n 
C 1 143 ALA 143 145 145 ALA ALA C . n 
C 1 144 PHE 144 146 146 PHE PHE C . n 
C 1 145 LEU 145 147 147 LEU LEU C . n 
C 1 146 GLU 146 148 148 GLU GLU C . n 
C 1 147 GLU 147 149 149 GLU GLU C . n 
C 1 148 GLY 148 150 150 GLY GLY C . n 
C 1 149 PRO 149 151 151 PRO PRO C . n 
C 1 150 GLU 150 152 152 GLU GLU C . n 
C 1 151 GLU 151 153 153 GLU GLU C . n 
C 1 152 ASN 152 154 154 ASN ASN C . n 
C 1 153 SER 153 155 155 SER SER C . n 
C 1 154 ALA 154 156 156 ALA ALA C . n 
C 1 155 TYR 155 157 157 TYR TYR C . n 
C 1 156 GLU 156 158 158 GLU GLU C . n 
C 1 157 GLN 157 159 159 GLN GLN C . n 
C 1 158 LEU 158 160 160 LEU LEU C . n 
C 1 159 LEU 159 161 161 LEU LEU C . n 
C 1 160 SER 160 162 162 SER SER C . n 
C 1 161 ARG 161 163 163 ARG ARG C . n 
C 1 162 LEU 162 164 164 LEU LEU C . n 
C 1 163 GLU 163 165 165 GLU GLU C . n 
C 1 164 GLU 164 166 166 GLU GLU C . n 
C 1 165 ILE 165 167 167 ILE ILE C . n 
C 1 166 ALA 166 168 168 ALA ALA C . n 
C 1 167 GLU 167 169 169 GLU GLU C . n 
C 1 168 GLU 168 170 170 GLU GLU C . n 
C 1 169 GLY 169 171 171 GLY GLY C . n 
C 1 170 SER 170 172 172 SER SER C . n 
C 1 171 GLU 171 173 173 GLU GLU C . n 
C 1 172 THR 172 174 174 THR THR C . n 
C 1 173 GLN 173 175 175 GLN GLN C . n 
C 1 174 VAL 174 176 176 VAL VAL C . n 
C 1 175 PRO 175 177 177 PRO PRO C . n 
C 1 176 GLY 176 178 178 GLY GLY C . n 
C 1 177 LEU 177 179 179 LEU LEU C . n 
C 1 178 ASP 178 180 180 ASP ASP C . n 
C 1 179 ILE 179 181 181 ILE ILE C . n 
C 1 180 SER 180 182 182 SER SER C . n 
C 1 181 ALA 181 183 183 ALA ALA C . n 
C 1 182 LEU 182 184 184 LEU LEU C . n 
C 1 183 LEU 183 185 185 LEU LEU C . n 
C 1 184 PRO 184 186 186 PRO PRO C . n 
C 1 185 SER 185 187 187 SER SER C . n 
C 1 186 ASP 186 188 188 ASP ASP C . n 
C 1 187 PHE 187 189 189 PHE PHE C . n 
C 1 188 SER 188 190 190 SER SER C . n 
C 1 189 ARG 189 191 191 ARG ARG C . n 
C 1 190 TYR 190 192 192 TYR TYR C . n 
C 1 191 PHE 191 193 193 PHE PHE C . n 
C 1 192 GLN 192 194 194 GLN GLN C . n 
C 1 193 TYR 193 195 195 TYR TYR C . n 
C 1 194 GLU 194 196 196 GLU GLU C . n 
C 1 195 GLY 195 197 197 GLY GLY C . n 
C 1 196 SER 196 198 198 SER SER C . n 
C 1 197 LEU 197 199 199 LEU LEU C . n 
C 1 198 THR 198 200 200 THR THR C . n 
C 1 199 THR 199 201 201 THR THR C . n 
C 1 200 PRO 200 202 202 PRO PRO C . n 
C 1 201 PRO 201 203 203 PRO PRO C . n 
C 1 202 CYS 202 204 204 CYS CYS C . n 
C 1 203 ALA 203 205 205 ALA ALA C . n 
C 1 204 GLN 204 206 206 GLN GLN C . n 
C 1 205 GLY 205 207 207 GLY GLY C . n 
C 1 206 VAL 206 208 208 VAL VAL C . n 
C 1 207 ILE 207 209 209 ILE ILE C . n 
C 1 208 TRP 208 210 210 TRP TRP C . n 
C 1 209 THR 209 211 211 THR THR C . n 
C 1 210 VAL 210 212 212 VAL VAL C . n 
C 1 211 PHE 211 213 213 PHE PHE C . n 
C 1 212 ASN 212 214 214 ASN ASN C . n 
C 1 213 GLN 213 215 215 GLN GLN C . n 
C 1 214 THR 214 216 216 THR THR C . n 
C 1 215 VAL 215 217 217 VAL VAL C . n 
C 1 216 MET 216 218 218 MET MET C . n 
C 1 217 LEU 217 219 219 LEU LEU C . n 
C 1 218 SER 218 220 220 SER SER C . n 
C 1 219 ALA 219 221 221 ALA ALA C . n 
C 1 220 LYS 220 222 222 LYS LYS C . n 
C 1 221 GLN 221 223 223 GLN GLN C . n 
C 1 222 LEU 222 224 224 LEU LEU C . n 
C 1 223 HIS 223 225 225 HIS HIS C . n 
C 1 224 THR 224 226 226 THR THR C . n 
C 1 225 LEU 225 227 227 LEU LEU C . n 
C 1 226 SER 226 228 228 SER SER C . n 
C 1 227 ASP 227 229 229 ASP ASP C . n 
C 1 228 THR 228 230 230 THR THR C . n 
C 1 229 LEU 229 231 231 LEU LEU C . n 
C 1 230 TRP 230 232 232 TRP TRP C . n 
C 1 231 GLY 231 233 233 GLY GLY C . n 
C 1 232 PRO 232 234 234 PRO PRO C . n 
C 1 233 GLY 233 235 235 GLY GLY C . n 
C 1 234 ASP 234 236 236 ASP ASP C . n 
C 1 235 SER 235 237 237 SER SER C . n 
C 1 236 ARG 236 238 238 ARG ARG C . n 
C 1 237 LEU 237 239 239 LEU LEU C . n 
C 1 238 GLN 238 240 240 GLN GLN C . n 
C 1 239 LEU 239 241 241 LEU LEU C . n 
C 1 240 ASN 240 242 242 ASN ASN C . n 
C 1 241 PHE 241 243 243 PHE PHE C . n 
C 1 242 ARG 242 244 244 ARG ARG C . n 
C 1 243 ALA 243 245 245 ALA ALA C . n 
C 1 244 THR 244 246 246 THR THR C . n 
C 1 245 GLN 245 247 247 GLN GLN C . n 
C 1 246 PRO 246 248 248 PRO PRO C . n 
C 1 247 LEU 247 249 249 LEU LEU C . n 
C 1 248 ASN 248 250 250 ASN ASN C . n 
C 1 249 GLY 249 251 251 GLY GLY C . n 
C 1 250 ARG 250 252 252 ARG ARG C . n 
C 1 251 VAL 251 253 253 VAL VAL C . n 
C 1 252 ILE 252 254 254 ILE ILE C . n 
C 1 253 GLU 253 255 255 GLU GLU C . n 
C 1 254 ALA 254 256 256 ALA ALA C . n 
C 1 255 SER 255 257 257 SER SER C . n 
C 1 256 PHE 256 258 258 PHE PHE C . n 
C 1 257 PRO 257 259 259 PRO PRO C . n 
D 1 1   GLY 1   3   ?   ?   ?   D . n 
D 1 2   PRO 2   4   ?   ?   ?   D . n 
D 1 3   ASP 3   5   ?   ?   ?   D . n 
D 1 4   GLN 4   6   ?   ?   ?   D . n 
D 1 5   SER 5   7   ?   ?   ?   D . n 
D 1 6   HIS 6   8   ?   ?   ?   D . n 
D 1 7   TRP 7   9   9   TRP TRP D . n 
D 1 8   ARG 8   10  10  ARG ARG D . n 
D 1 9   TYR 9   11  11  TYR TYR D . n 
D 1 10  GLY 10  12  12  GLY GLY D . n 
D 1 11  GLY 11  13  13  GLY GLY D . n 
D 1 12  ASP 12  14  14  ASP ASP D . n 
D 1 13  PRO 13  15  15  PRO PRO D . n 
D 1 14  PRO 14  16  16  PRO PRO D . n 
D 1 15  TRP 15  17  17  TRP TRP D . n 
D 1 16  PRO 16  18  18  PRO PRO D . n 
D 1 17  ARG 17  19  19  ARG ARG D . n 
D 1 18  VAL 18  20  20  VAL VAL D . n 
D 1 19  SER 19  21  21  SER SER D . n 
D 1 20  PRO 20  22  22  PRO PRO D . n 
D 1 21  ALA 21  23  23  ALA ALA D . n 
D 1 22  CYS 22  24  24  CYS CYS D . n 
D 1 23  ALA 23  25  25  ALA ALA D . n 
D 1 24  GLY 24  26  26  GLY GLY D . n 
D 1 25  ARG 25  27  27  ARG ARG D . n 
D 1 26  PHE 26  28  28  PHE PHE D . n 
D 1 27  GLN 27  29  29  GLN GLN D . n 
D 1 28  SER 28  30  30  SER SER D . n 
D 1 29  PRO 29  31  31  PRO PRO D . n 
D 1 30  VAL 30  32  32  VAL VAL D . n 
D 1 31  ASP 31  33  33  ASP ASP D . n 
D 1 32  ILE 32  34  34  ILE ILE D . n 
D 1 33  ARG 33  35  35  ARG ARG D . n 
D 1 34  PRO 34  36  36  PRO PRO D . n 
D 1 35  GLN 35  37  37  GLN GLN D . n 
D 1 36  LEU 36  38  38  LEU LEU D . n 
D 1 37  ALA 37  39  39  ALA ALA D . n 
D 1 38  ALA 38  40  40  ALA ALA D . n 
D 1 39  PHE 39  41  41  PHE PHE D . n 
D 1 40  SER 40  42  42  SER SER D . n 
D 1 41  PRO 41  43  43  PRO PRO D . n 
D 1 42  ALA 42  44  44  ALA ALA D . n 
D 1 43  LEU 43  45  45  LEU LEU D . n 
D 1 44  ARG 44  46  46  ARG ARG D . n 
D 1 45  PRO 45  47  47  PRO PRO D . n 
D 1 46  LEU 46  48  48  LEU LEU D . n 
D 1 47  GLU 47  49  49  GLU GLU D . n 
D 1 48  LEU 48  50  50  LEU LEU D . n 
D 1 49  LEU 49  51  51  LEU LEU D . n 
D 1 50  GLY 50  52  52  GLY GLY D . n 
D 1 51  PHE 51  53  53  PHE PHE D . n 
D 1 52  GLN 52  54  54  GLN GLN D . n 
D 1 53  LEU 53  55  55  LEU LEU D . n 
D 1 54  PRO 54  56  56  PRO PRO D . n 
D 1 55  PRO 55  57  57  PRO PRO D . n 
D 1 56  LEU 56  58  58  LEU LEU D . n 
D 1 57  PRO 57  59  59  PRO PRO D . n 
D 1 58  GLU 58  60  60  GLU GLU D . n 
D 1 59  LEU 59  61  61  LEU LEU D . n 
D 1 60  ARG 60  62  62  ARG ARG D . n 
D 1 61  LEU 61  63  63  LEU LEU D . n 
D 1 62  ARG 62  64  64  ARG ARG D . n 
D 1 63  ASN 63  65  65  ASN ASN D . n 
D 1 64  ASN 64  66  66  ASN ASN D . n 
D 1 65  GLY 65  67  67  GLY GLY D . n 
D 1 66  HIS 66  68  68  HIS HIS D . n 
D 1 67  SER 67  69  69  SER SER D . n 
D 1 68  VAL 68  70  70  VAL VAL D . n 
D 1 69  GLN 69  71  71  GLN GLN D . n 
D 1 70  LEU 70  72  72  LEU LEU D . n 
D 1 71  THR 71  73  73  THR THR D . n 
D 1 72  LEU 72  74  74  LEU LEU D . n 
D 1 73  PRO 73  75  75  PRO PRO D . n 
D 1 74  PRO 74  76  76  PRO PRO D . n 
D 1 75  GLY 75  77  77  GLY GLY D . n 
D 1 76  LEU 76  78  78  LEU LEU D . n 
D 1 77  GLU 77  79  79  GLU GLU D . n 
D 1 78  MET 78  80  80  MET MET D . n 
D 1 79  ALA 79  81  81  ALA ALA D . n 
D 1 80  LEU 80  82  82  LEU LEU D . n 
D 1 81  GLY 81  83  83  GLY GLY D . n 
D 1 82  PRO 82  84  84  PRO PRO D . n 
D 1 83  GLY 83  85  85  GLY GLY D . n 
D 1 84  ARG 84  86  86  ARG ARG D . n 
D 1 85  GLU 85  87  87  GLU GLU D . n 
D 1 86  TYR 86  88  88  TYR TYR D . n 
D 1 87  ARG 87  89  89  ARG ARG D . n 
D 1 88  ALA 88  90  90  ALA ALA D . n 
D 1 89  LEU 89  91  91  LEU LEU D . n 
D 1 90  GLN 90  92  92  GLN GLN D . n 
D 1 91  LEU 91  93  93  LEU LEU D . n 
D 1 92  HIS 92  94  94  HIS HIS D . n 
D 1 93  LEU 93  95  95  LEU LEU D . n 
D 1 94  HIS 94  96  96  HIS HIS D . n 
D 1 95  TRP 95  97  97  TRP TRP D . n 
D 1 96  GLY 96  98  98  GLY GLY D . n 
D 1 97  ALA 97  99  99  ALA ALA D . n 
D 1 98  ALA 98  100 100 ALA ALA D . n 
D 1 99  GLY 99  101 101 GLY GLY D . n 
D 1 100 ARG 100 102 102 ARG ARG D . n 
D 1 101 PRO 101 103 103 PRO PRO D . n 
D 1 102 GLY 102 104 104 GLY GLY D . n 
D 1 103 SER 103 105 105 SER SER D . n 
D 1 104 GLU 104 106 106 GLU GLU D . n 
D 1 105 HIS 105 107 107 HIS HIS D . n 
D 1 106 THR 106 108 108 THR THR D . n 
D 1 107 VAL 107 109 109 VAL VAL D . n 
D 1 108 GLU 108 110 110 GLU GLU D . n 
D 1 109 GLY 109 111 111 GLY GLY D . n 
D 1 110 HIS 110 112 112 HIS HIS D . n 
D 1 111 ARG 111 113 113 ARG ARG D . n 
D 1 112 PHE 112 114 114 PHE PHE D . n 
D 1 113 PRO 113 115 115 PRO PRO D . n 
D 1 114 ALA 114 116 116 ALA ALA D . n 
D 1 115 GLU 115 117 117 GLU GLU D . n 
D 1 116 ILE 116 118 118 ILE ILE D . n 
D 1 117 HIS 117 119 119 HIS HIS D . n 
D 1 118 VAL 118 120 120 VAL VAL D . n 
D 1 119 VAL 119 121 121 VAL VAL D . n 
D 1 120 HIS 120 122 122 HIS HIS D . n 
D 1 121 LEU 121 123 123 LEU LEU D . n 
D 1 122 SER 122 124 124 SER SER D . n 
D 1 123 THR 123 125 125 THR THR D . n 
D 1 124 ALA 124 126 126 ALA ALA D . n 
D 1 125 PHE 125 127 127 PHE PHE D . n 
D 1 126 ALA 126 128 128 ALA ALA D . n 
D 1 127 ARG 127 129 129 ARG ARG D . n 
D 1 128 VAL 128 130 130 VAL VAL D . n 
D 1 129 ASP 129 131 131 ASP ASP D . n 
D 1 130 GLU 130 132 132 GLU GLU D . n 
D 1 131 ALA 131 133 133 ALA ALA D . n 
D 1 132 LEU 132 134 134 LEU LEU D . n 
D 1 133 GLY 133 135 135 GLY GLY D . n 
D 1 134 ARG 134 136 136 ARG ARG D . n 
D 1 135 PRO 135 137 137 PRO PRO D . n 
D 1 136 GLY 136 138 138 GLY GLY D . n 
D 1 137 GLY 137 139 139 GLY GLY D . n 
D 1 138 LEU 138 140 140 LEU LEU D . n 
D 1 139 ALA 139 141 141 ALA ALA D . n 
D 1 140 VAL 140 142 142 VAL VAL D . n 
D 1 141 LEU 141 143 143 LEU LEU D . n 
D 1 142 ALA 142 144 144 ALA ALA D . n 
D 1 143 ALA 143 145 145 ALA ALA D . n 
D 1 144 PHE 144 146 146 PHE PHE D . n 
D 1 145 LEU 145 147 147 LEU LEU D . n 
D 1 146 GLU 146 148 148 GLU GLU D . n 
D 1 147 GLU 147 149 149 GLU GLU D . n 
D 1 148 GLY 148 150 150 GLY GLY D . n 
D 1 149 PRO 149 151 151 PRO PRO D . n 
D 1 150 GLU 150 152 152 GLU GLU D . n 
D 1 151 GLU 151 153 153 GLU GLU D . n 
D 1 152 ASN 152 154 154 ASN ASN D . n 
D 1 153 SER 153 155 155 SER SER D . n 
D 1 154 ALA 154 156 156 ALA ALA D . n 
D 1 155 TYR 155 157 157 TYR TYR D . n 
D 1 156 GLU 156 158 158 GLU GLU D . n 
D 1 157 GLN 157 159 159 GLN GLN D . n 
D 1 158 LEU 158 160 160 LEU LEU D . n 
D 1 159 LEU 159 161 161 LEU LEU D . n 
D 1 160 SER 160 162 162 SER SER D . n 
D 1 161 ARG 161 163 163 ARG ARG D . n 
D 1 162 LEU 162 164 164 LEU LEU D . n 
D 1 163 GLU 163 165 165 GLU GLU D . n 
D 1 164 GLU 164 166 166 GLU GLU D . n 
D 1 165 ILE 165 167 167 ILE ILE D . n 
D 1 166 ALA 166 168 168 ALA ALA D . n 
D 1 167 GLU 167 169 169 GLU GLU D . n 
D 1 168 GLU 168 170 170 GLU GLU D . n 
D 1 169 GLY 169 171 171 GLY GLY D . n 
D 1 170 SER 170 172 172 SER SER D . n 
D 1 171 GLU 171 173 173 GLU GLU D . n 
D 1 172 THR 172 174 174 THR THR D . n 
D 1 173 GLN 173 175 175 GLN GLN D . n 
D 1 174 VAL 174 176 176 VAL VAL D . n 
D 1 175 PRO 175 177 177 PRO PRO D . n 
D 1 176 GLY 176 178 178 GLY GLY D . n 
D 1 177 LEU 177 179 179 LEU LEU D . n 
D 1 178 ASP 178 180 180 ASP ASP D . n 
D 1 179 ILE 179 181 181 ILE ILE D . n 
D 1 180 SER 180 182 182 SER SER D . n 
D 1 181 ALA 181 183 183 ALA ALA D . n 
D 1 182 LEU 182 184 184 LEU LEU D . n 
D 1 183 LEU 183 185 185 LEU LEU D . n 
D 1 184 PRO 184 186 186 PRO PRO D . n 
D 1 185 SER 185 187 187 SER SER D . n 
D 1 186 ASP 186 188 188 ASP ASP D . n 
D 1 187 PHE 187 189 189 PHE PHE D . n 
D 1 188 SER 188 190 190 SER SER D . n 
D 1 189 ARG 189 191 191 ARG ARG D . n 
D 1 190 TYR 190 192 192 TYR TYR D . n 
D 1 191 PHE 191 193 193 PHE PHE D . n 
D 1 192 GLN 192 194 194 GLN GLN D . n 
D 1 193 TYR 193 195 195 TYR TYR D . n 
D 1 194 GLU 194 196 196 GLU GLU D . n 
D 1 195 GLY 195 197 197 GLY GLY D . n 
D 1 196 SER 196 198 198 SER SER D . n 
D 1 197 LEU 197 199 199 LEU LEU D . n 
D 1 198 THR 198 200 200 THR THR D . n 
D 1 199 THR 199 201 201 THR THR D . n 
D 1 200 PRO 200 202 202 PRO PRO D . n 
D 1 201 PRO 201 203 203 PRO PRO D . n 
D 1 202 CYS 202 204 204 CYS CYS D . n 
D 1 203 ALA 203 205 205 ALA ALA D . n 
D 1 204 GLN 204 206 206 GLN GLN D . n 
D 1 205 GLY 205 207 207 GLY GLY D . n 
D 1 206 VAL 206 208 208 VAL VAL D . n 
D 1 207 ILE 207 209 209 ILE ILE D . n 
D 1 208 TRP 208 210 210 TRP TRP D . n 
D 1 209 THR 209 211 211 THR THR D . n 
D 1 210 VAL 210 212 212 VAL VAL D . n 
D 1 211 PHE 211 213 213 PHE PHE D . n 
D 1 212 ASN 212 214 214 ASN ASN D . n 
D 1 213 GLN 213 215 215 GLN GLN D . n 
D 1 214 THR 214 216 216 THR THR D . n 
D 1 215 VAL 215 217 217 VAL VAL D . n 
D 1 216 MET 216 218 218 MET MET D . n 
D 1 217 LEU 217 219 219 LEU LEU D . n 
D 1 218 SER 218 220 220 SER SER D . n 
D 1 219 ALA 219 221 221 ALA ALA D . n 
D 1 220 LYS 220 222 222 LYS LYS D . n 
D 1 221 GLN 221 223 223 GLN GLN D . n 
D 1 222 LEU 222 224 224 LEU LEU D . n 
D 1 223 HIS 223 225 225 HIS HIS D . n 
D 1 224 THR 224 226 226 THR THR D . n 
D 1 225 LEU 225 227 227 LEU LEU D . n 
D 1 226 SER 226 228 228 SER SER D . n 
D 1 227 ASP 227 229 229 ASP ASP D . n 
D 1 228 THR 228 230 230 THR THR D . n 
D 1 229 LEU 229 231 231 LEU LEU D . n 
D 1 230 TRP 230 232 232 TRP TRP D . n 
D 1 231 GLY 231 233 233 GLY GLY D . n 
D 1 232 PRO 232 234 234 PRO PRO D . n 
D 1 233 GLY 233 235 235 GLY GLY D . n 
D 1 234 ASP 234 236 236 ASP ASP D . n 
D 1 235 SER 235 237 237 SER SER D . n 
D 1 236 ARG 236 238 238 ARG ARG D . n 
D 1 237 LEU 237 239 239 LEU LEU D . n 
D 1 238 GLN 238 240 240 GLN GLN D . n 
D 1 239 LEU 239 241 241 LEU LEU D . n 
D 1 240 ASN 240 242 242 ASN ASN D . n 
D 1 241 PHE 241 243 243 PHE PHE D . n 
D 1 242 ARG 242 244 244 ARG ARG D . n 
D 1 243 ALA 243 245 245 ALA ALA D . n 
D 1 244 THR 244 246 246 THR THR D . n 
D 1 245 GLN 245 247 247 GLN GLN D . n 
D 1 246 PRO 246 248 248 PRO PRO D . n 
D 1 247 LEU 247 249 249 LEU LEU D . n 
D 1 248 ASN 248 250 250 ASN ASN D . n 
D 1 249 GLY 249 251 251 GLY GLY D . n 
D 1 250 ARG 250 252 252 ARG ARG D . n 
D 1 251 VAL 251 253 253 VAL VAL D . n 
D 1 252 ILE 252 254 254 ILE ILE D . n 
D 1 253 GLU 253 255 255 GLU GLU D . n 
D 1 254 ALA 254 256 256 ALA ALA D . n 
D 1 255 SER 255 257 257 SER SER D . n 
D 1 256 PHE 256 258 258 PHE PHE D . n 
D 1 257 PRO 257 259 259 PRO PRO D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 ZN  1   264  264  ZN  ZN  A . 
F 3 9FK 1   269  269  9FK 9FK A . 
G 4 GOL 1   273  273  GOL GOL A . 
H 5 ACY 1   1260 1260 ACY ACY A . 
I 5 ACY 1   1261 1261 ACY ACY A . 
J 2 ZN  1   264  264  ZN  ZN  B . 
K 3 9FK 1   268  268  9FK 9FK B . 
L 4 GOL 1   272  272  GOL GOL B . 
M 5 ACY 1   1260 1260 ACY ACY B . 
N 2 ZN  1   264  264  ZN  ZN  C . 
O 3 9FK 1   267  267  9FK 9FK C . 
P 4 GOL 1   271  271  GOL GOL C . 
Q 5 ACY 1   1260 1260 ACY ACY C . 
R 5 ACY 1   1261 1261 ACY ACY C . 
S 5 ACY 1   1262 1262 ACY ACY C . 
T 2 ZN  1   264  264  ZN  ZN  D . 
U 3 9FK 1   266  266  9FK 9FK D . 
V 4 GOL 1   271  271  GOL GOL D . 
W 6 HOH 1   2001 2001 HOH HOH A . 
W 6 HOH 2   2002 2002 HOH HOH A . 
W 6 HOH 3   2003 2003 HOH HOH A . 
W 6 HOH 4   2004 2004 HOH HOH A . 
W 6 HOH 5   2005 2005 HOH HOH A . 
W 6 HOH 6   2006 2006 HOH HOH A . 
W 6 HOH 7   2007 2007 HOH HOH A . 
W 6 HOH 8   2008 2008 HOH HOH A . 
W 6 HOH 9   2009 2009 HOH HOH A . 
W 6 HOH 10  2010 2010 HOH HOH A . 
W 6 HOH 11  2011 2011 HOH HOH A . 
W 6 HOH 12  2012 2012 HOH HOH A . 
W 6 HOH 13  2013 2013 HOH HOH A . 
W 6 HOH 14  2014 2014 HOH HOH A . 
W 6 HOH 15  2015 2015 HOH HOH A . 
W 6 HOH 16  2016 2016 HOH HOH A . 
W 6 HOH 17  2017 2017 HOH HOH A . 
W 6 HOH 18  2018 2018 HOH HOH A . 
W 6 HOH 19  2019 2019 HOH HOH A . 
W 6 HOH 20  2020 2020 HOH HOH A . 
W 6 HOH 21  2021 2021 HOH HOH A . 
W 6 HOH 22  2022 2022 HOH HOH A . 
W 6 HOH 23  2023 2023 HOH HOH A . 
W 6 HOH 24  2024 2024 HOH HOH A . 
W 6 HOH 25  2025 2025 HOH HOH A . 
W 6 HOH 26  2026 2026 HOH HOH A . 
W 6 HOH 27  2027 2027 HOH HOH A . 
W 6 HOH 28  2028 2028 HOH HOH A . 
W 6 HOH 29  2029 2029 HOH HOH A . 
W 6 HOH 30  2030 2030 HOH HOH A . 
W 6 HOH 31  2031 2031 HOH HOH A . 
W 6 HOH 32  2032 2032 HOH HOH A . 
W 6 HOH 33  2033 2033 HOH HOH A . 
W 6 HOH 34  2034 2034 HOH HOH A . 
W 6 HOH 35  2035 2035 HOH HOH A . 
W 6 HOH 36  2036 2036 HOH HOH A . 
W 6 HOH 37  2037 2037 HOH HOH A . 
W 6 HOH 38  2038 2038 HOH HOH A . 
W 6 HOH 39  2039 2039 HOH HOH A . 
W 6 HOH 40  2040 2040 HOH HOH A . 
W 6 HOH 41  2041 2041 HOH HOH A . 
W 6 HOH 42  2042 2042 HOH HOH A . 
W 6 HOH 43  2043 2043 HOH HOH A . 
W 6 HOH 44  2044 2044 HOH HOH A . 
W 6 HOH 45  2045 2045 HOH HOH A . 
W 6 HOH 46  2046 2046 HOH HOH A . 
W 6 HOH 47  2047 2047 HOH HOH A . 
W 6 HOH 48  2048 2048 HOH HOH A . 
W 6 HOH 49  2049 2049 HOH HOH A . 
W 6 HOH 50  2050 2050 HOH HOH A . 
W 6 HOH 51  2051 2051 HOH HOH A . 
W 6 HOH 52  2052 2052 HOH HOH A . 
W 6 HOH 53  2053 2053 HOH HOH A . 
W 6 HOH 54  2054 2054 HOH HOH A . 
W 6 HOH 55  2055 2055 HOH HOH A . 
W 6 HOH 56  2056 2056 HOH HOH A . 
W 6 HOH 57  2057 2057 HOH HOH A . 
W 6 HOH 58  2058 2058 HOH HOH A . 
W 6 HOH 59  2059 2059 HOH HOH A . 
W 6 HOH 60  2060 2060 HOH HOH A . 
W 6 HOH 61  2061 2061 HOH HOH A . 
W 6 HOH 62  2062 2062 HOH HOH A . 
W 6 HOH 63  2063 2063 HOH HOH A . 
W 6 HOH 64  2064 2064 HOH HOH A . 
W 6 HOH 65  2065 2065 HOH HOH A . 
W 6 HOH 66  2066 2066 HOH HOH A . 
W 6 HOH 67  2067 2067 HOH HOH A . 
W 6 HOH 68  2068 2068 HOH HOH A . 
W 6 HOH 69  2069 2069 HOH HOH A . 
W 6 HOH 70  2070 2070 HOH HOH A . 
W 6 HOH 71  2071 2071 HOH HOH A . 
W 6 HOH 72  2072 2072 HOH HOH A . 
W 6 HOH 73  2073 2073 HOH HOH A . 
W 6 HOH 74  2074 2074 HOH HOH A . 
W 6 HOH 75  2075 2075 HOH HOH A . 
W 6 HOH 76  2076 2076 HOH HOH A . 
W 6 HOH 77  2077 2077 HOH HOH A . 
W 6 HOH 78  2078 2078 HOH HOH A . 
W 6 HOH 79  2079 2079 HOH HOH A . 
W 6 HOH 80  2080 2080 HOH HOH A . 
W 6 HOH 81  2081 2081 HOH HOH A . 
W 6 HOH 82  2082 2082 HOH HOH A . 
W 6 HOH 83  2083 2083 HOH HOH A . 
W 6 HOH 84  2084 2084 HOH HOH A . 
W 6 HOH 85  2085 2085 HOH HOH A . 
W 6 HOH 86  2086 2086 HOH HOH A . 
W 6 HOH 87  2087 2087 HOH HOH A . 
W 6 HOH 88  2088 2088 HOH HOH A . 
W 6 HOH 89  2089 2089 HOH HOH A . 
W 6 HOH 90  2090 2090 HOH HOH A . 
W 6 HOH 91  2091 2091 HOH HOH A . 
W 6 HOH 92  2092 2092 HOH HOH A . 
W 6 HOH 93  2093 2093 HOH HOH A . 
W 6 HOH 94  2094 2094 HOH HOH A . 
W 6 HOH 95  2095 2095 HOH HOH A . 
W 6 HOH 96  2096 2096 HOH HOH A . 
W 6 HOH 97  2097 2097 HOH HOH A . 
W 6 HOH 98  2098 2098 HOH HOH A . 
W 6 HOH 99  2099 2099 HOH HOH A . 
W 6 HOH 100 2100 2100 HOH HOH A . 
W 6 HOH 101 2101 2101 HOH HOH A . 
W 6 HOH 102 2102 2102 HOH HOH A . 
W 6 HOH 103 2103 2103 HOH HOH A . 
W 6 HOH 104 2104 2104 HOH HOH A . 
W 6 HOH 105 2105 2105 HOH HOH A . 
W 6 HOH 106 2106 2106 HOH HOH A . 
W 6 HOH 107 2107 2107 HOH HOH A . 
W 6 HOH 108 2108 2108 HOH HOH A . 
W 6 HOH 109 2109 2109 HOH HOH A . 
W 6 HOH 110 2110 2110 HOH HOH A . 
W 6 HOH 111 2111 2111 HOH HOH A . 
W 6 HOH 112 2112 2112 HOH HOH A . 
W 6 HOH 113 2113 2113 HOH HOH A . 
W 6 HOH 114 2114 2114 HOH HOH A . 
W 6 HOH 115 2115 2115 HOH HOH A . 
W 6 HOH 116 2116 2116 HOH HOH A . 
W 6 HOH 117 2117 2117 HOH HOH A . 
W 6 HOH 118 2118 2118 HOH HOH A . 
W 6 HOH 119 2119 2119 HOH HOH A . 
W 6 HOH 120 2120 2120 HOH HOH A . 
W 6 HOH 121 2121 2121 HOH HOH A . 
W 6 HOH 122 2122 2122 HOH HOH A . 
W 6 HOH 123 2123 2123 HOH HOH A . 
W 6 HOH 124 2124 2124 HOH HOH A . 
W 6 HOH 125 2125 2125 HOH HOH A . 
W 6 HOH 126 2126 2126 HOH HOH A . 
W 6 HOH 127 2127 2127 HOH HOH A . 
W 6 HOH 128 2128 2128 HOH HOH A . 
W 6 HOH 129 2129 2129 HOH HOH A . 
W 6 HOH 130 2130 2130 HOH HOH A . 
W 6 HOH 131 2131 2131 HOH HOH A . 
W 6 HOH 132 2132 2132 HOH HOH A . 
W 6 HOH 133 2133 2133 HOH HOH A . 
W 6 HOH 134 2134 2134 HOH HOH A . 
W 6 HOH 135 2135 2135 HOH HOH A . 
W 6 HOH 136 2136 2136 HOH HOH A . 
W 6 HOH 137 2137 2137 HOH HOH A . 
W 6 HOH 138 2138 2138 HOH HOH A . 
W 6 HOH 139 2139 2139 HOH HOH A . 
W 6 HOH 140 2140 2140 HOH HOH A . 
W 6 HOH 141 2141 2141 HOH HOH A . 
W 6 HOH 142 2142 2142 HOH HOH A . 
W 6 HOH 143 2143 2143 HOH HOH A . 
W 6 HOH 144 2144 2144 HOH HOH A . 
W 6 HOH 145 2145 2145 HOH HOH A . 
W 6 HOH 146 2146 2146 HOH HOH A . 
W 6 HOH 147 2147 2147 HOH HOH A . 
W 6 HOH 148 2148 2148 HOH HOH A . 
W 6 HOH 149 2149 2149 HOH HOH A . 
W 6 HOH 150 2150 2150 HOH HOH A . 
W 6 HOH 151 2151 2151 HOH HOH A . 
W 6 HOH 152 2152 2152 HOH HOH A . 
W 6 HOH 153 2153 2153 HOH HOH A . 
W 6 HOH 154 2154 2154 HOH HOH A . 
W 6 HOH 155 2155 2155 HOH HOH A . 
W 6 HOH 156 2156 2156 HOH HOH A . 
W 6 HOH 157 2157 2157 HOH HOH A . 
W 6 HOH 158 2158 2158 HOH HOH A . 
W 6 HOH 159 2159 2159 HOH HOH A . 
W 6 HOH 160 2160 2160 HOH HOH A . 
W 6 HOH 161 2161 2161 HOH HOH A . 
W 6 HOH 162 2162 2162 HOH HOH A . 
W 6 HOH 163 2163 2163 HOH HOH A . 
W 6 HOH 164 2164 2164 HOH HOH A . 
W 6 HOH 165 2165 2165 HOH HOH A . 
W 6 HOH 166 2166 2166 HOH HOH A . 
W 6 HOH 167 2167 2167 HOH HOH A . 
W 6 HOH 168 2168 2168 HOH HOH A . 
W 6 HOH 169 2169 2169 HOH HOH A . 
W 6 HOH 170 2170 2170 HOH HOH A . 
W 6 HOH 171 2171 2171 HOH HOH A . 
W 6 HOH 172 2172 2172 HOH HOH A . 
W 6 HOH 173 2173 2173 HOH HOH A . 
W 6 HOH 174 2174 2174 HOH HOH A . 
W 6 HOH 175 2175 2175 HOH HOH A . 
W 6 HOH 176 2176 2176 HOH HOH A . 
W 6 HOH 177 2177 2177 HOH HOH A . 
W 6 HOH 178 2178 2178 HOH HOH A . 
W 6 HOH 179 2179 2179 HOH HOH A . 
W 6 HOH 180 2180 2180 HOH HOH A . 
W 6 HOH 181 2181 2181 HOH HOH A . 
W 6 HOH 182 2182 2182 HOH HOH A . 
W 6 HOH 183 2183 2183 HOH HOH A . 
W 6 HOH 184 2184 2184 HOH HOH A . 
W 6 HOH 185 2185 2185 HOH HOH A . 
W 6 HOH 186 2186 2186 HOH HOH A . 
W 6 HOH 187 2187 2187 HOH HOH A . 
W 6 HOH 188 2188 2188 HOH HOH A . 
W 6 HOH 189 2189 2189 HOH HOH A . 
W 6 HOH 190 2190 2190 HOH HOH A . 
W 6 HOH 191 2191 2191 HOH HOH A . 
W 6 HOH 192 2192 2192 HOH HOH A . 
W 6 HOH 193 2193 2193 HOH HOH A . 
W 6 HOH 194 2194 2194 HOH HOH A . 
W 6 HOH 195 2195 2195 HOH HOH A . 
W 6 HOH 196 2196 2196 HOH HOH A . 
W 6 HOH 197 2197 2197 HOH HOH A . 
W 6 HOH 198 2198 2198 HOH HOH A . 
W 6 HOH 199 2199 2199 HOH HOH A . 
W 6 HOH 200 2200 2200 HOH HOH A . 
W 6 HOH 201 2201 2201 HOH HOH A . 
W 6 HOH 202 2202 2202 HOH HOH A . 
W 6 HOH 203 2203 2203 HOH HOH A . 
W 6 HOH 204 2204 2204 HOH HOH A . 
W 6 HOH 205 2205 2205 HOH HOH A . 
W 6 HOH 206 2206 2206 HOH HOH A . 
W 6 HOH 207 2207 2207 HOH HOH A . 
W 6 HOH 208 2208 2208 HOH HOH A . 
W 6 HOH 209 2209 2209 HOH HOH A . 
W 6 HOH 210 2210 2210 HOH HOH A . 
W 6 HOH 211 2211 2211 HOH HOH A . 
W 6 HOH 212 2212 2212 HOH HOH A . 
W 6 HOH 213 2213 2213 HOH HOH A . 
W 6 HOH 214 2214 2214 HOH HOH A . 
W 6 HOH 215 2215 2215 HOH HOH A . 
W 6 HOH 216 2216 2216 HOH HOH A . 
W 6 HOH 217 2217 2217 HOH HOH A . 
W 6 HOH 218 2218 2218 HOH HOH A . 
W 6 HOH 219 2219 2219 HOH HOH A . 
W 6 HOH 220 2220 2220 HOH HOH A . 
W 6 HOH 221 2221 2221 HOH HOH A . 
W 6 HOH 222 2222 2222 HOH HOH A . 
W 6 HOH 223 2223 2223 HOH HOH A . 
W 6 HOH 224 2224 2224 HOH HOH A . 
W 6 HOH 225 2225 2225 HOH HOH A . 
W 6 HOH 226 2226 2226 HOH HOH A . 
W 6 HOH 227 2227 2227 HOH HOH A . 
W 6 HOH 228 2228 2228 HOH HOH A . 
W 6 HOH 229 2229 2229 HOH HOH A . 
W 6 HOH 230 2230 2230 HOH HOH A . 
W 6 HOH 231 2231 2231 HOH HOH A . 
W 6 HOH 232 2232 2232 HOH HOH A . 
W 6 HOH 233 2233 2233 HOH HOH A . 
W 6 HOH 234 2234 2234 HOH HOH A . 
W 6 HOH 235 2235 2235 HOH HOH A . 
W 6 HOH 236 2236 2236 HOH HOH A . 
W 6 HOH 237 2237 2237 HOH HOH A . 
W 6 HOH 238 2238 2238 HOH HOH A . 
W 6 HOH 239 2239 2239 HOH HOH A . 
W 6 HOH 240 2240 2240 HOH HOH A . 
W 6 HOH 241 2241 2241 HOH HOH A . 
W 6 HOH 242 2242 2242 HOH HOH A . 
W 6 HOH 243 2243 2243 HOH HOH A . 
W 6 HOH 244 2244 2244 HOH HOH A . 
W 6 HOH 245 2245 2245 HOH HOH A . 
W 6 HOH 246 2246 2246 HOH HOH A . 
W 6 HOH 247 2247 2247 HOH HOH A . 
W 6 HOH 248 2248 2248 HOH HOH A . 
W 6 HOH 249 2249 2249 HOH HOH A . 
W 6 HOH 250 2250 2250 HOH HOH A . 
W 6 HOH 251 2251 2251 HOH HOH A . 
W 6 HOH 252 2252 2252 HOH HOH A . 
W 6 HOH 253 2253 2253 HOH HOH A . 
W 6 HOH 254 2254 2254 HOH HOH A . 
W 6 HOH 255 2255 2255 HOH HOH A . 
W 6 HOH 256 2256 2256 HOH HOH A . 
W 6 HOH 257 2257 2257 HOH HOH A . 
W 6 HOH 258 2258 2258 HOH HOH A . 
W 6 HOH 259 2259 2259 HOH HOH A . 
W 6 HOH 260 2260 2260 HOH HOH A . 
W 6 HOH 261 2261 2261 HOH HOH A . 
W 6 HOH 262 2262 2262 HOH HOH A . 
W 6 HOH 263 2263 2263 HOH HOH A . 
W 6 HOH 264 2264 2264 HOH HOH A . 
W 6 HOH 265 2265 2265 HOH HOH A . 
W 6 HOH 266 2266 2266 HOH HOH A . 
W 6 HOH 267 2267 2267 HOH HOH A . 
W 6 HOH 268 2268 2268 HOH HOH A . 
W 6 HOH 269 2269 2269 HOH HOH A . 
W 6 HOH 270 2270 2270 HOH HOH A . 
W 6 HOH 271 2271 2271 HOH HOH A . 
W 6 HOH 272 2272 2272 HOH HOH A . 
W 6 HOH 273 2273 2273 HOH HOH A . 
W 6 HOH 274 2274 2274 HOH HOH A . 
W 6 HOH 275 2275 2275 HOH HOH A . 
W 6 HOH 276 2276 2276 HOH HOH A . 
W 6 HOH 277 2277 2277 HOH HOH A . 
W 6 HOH 278 2278 2278 HOH HOH A . 
W 6 HOH 279 2279 2279 HOH HOH A . 
W 6 HOH 280 2280 2280 HOH HOH A . 
W 6 HOH 281 2281 2281 HOH HOH A . 
W 6 HOH 282 2282 2282 HOH HOH A . 
W 6 HOH 283 2283 2283 HOH HOH A . 
W 6 HOH 284 2284 2284 HOH HOH A . 
W 6 HOH 285 2285 2285 HOH HOH A . 
W 6 HOH 286 2286 2286 HOH HOH A . 
W 6 HOH 287 2287 2287 HOH HOH A . 
W 6 HOH 288 2288 2288 HOH HOH A . 
W 6 HOH 289 2289 2289 HOH HOH A . 
W 6 HOH 290 2290 2290 HOH HOH A . 
W 6 HOH 291 2291 2291 HOH HOH A . 
W 6 HOH 292 2292 2292 HOH HOH A . 
W 6 HOH 293 2293 2293 HOH HOH A . 
W 6 HOH 294 2294 2294 HOH HOH A . 
W 6 HOH 295 2295 2295 HOH HOH A . 
W 6 HOH 296 2296 2296 HOH HOH A . 
W 6 HOH 297 2297 2297 HOH HOH A . 
W 6 HOH 298 2298 2298 HOH HOH A . 
W 6 HOH 299 2299 2299 HOH HOH A . 
W 6 HOH 300 2300 2300 HOH HOH A . 
W 6 HOH 301 2301 2301 HOH HOH A . 
W 6 HOH 302 2302 2302 HOH HOH A . 
W 6 HOH 303 2303 2303 HOH HOH A . 
W 6 HOH 304 2304 2304 HOH HOH A . 
W 6 HOH 305 2305 2305 HOH HOH A . 
W 6 HOH 306 2306 2306 HOH HOH A . 
W 6 HOH 307 2307 2307 HOH HOH A . 
W 6 HOH 308 2308 2308 HOH HOH A . 
W 6 HOH 309 2309 2309 HOH HOH A . 
W 6 HOH 310 2310 2310 HOH HOH A . 
W 6 HOH 311 2311 2311 HOH HOH A . 
W 6 HOH 312 2312 2312 HOH HOH A . 
W 6 HOH 313 2313 2313 HOH HOH A . 
W 6 HOH 314 2314 2314 HOH HOH A . 
W 6 HOH 315 2315 2315 HOH HOH A . 
W 6 HOH 316 2316 2316 HOH HOH A . 
W 6 HOH 317 2317 2317 HOH HOH A . 
W 6 HOH 318 2318 2318 HOH HOH A . 
W 6 HOH 319 2319 2319 HOH HOH A . 
W 6 HOH 320 2320 2320 HOH HOH A . 
W 6 HOH 321 2321 2321 HOH HOH A . 
W 6 HOH 322 2322 2322 HOH HOH A . 
W 6 HOH 323 2323 2323 HOH HOH A . 
W 6 HOH 324 2324 2324 HOH HOH A . 
W 6 HOH 325 2325 2325 HOH HOH A . 
W 6 HOH 326 2326 2326 HOH HOH A . 
W 6 HOH 327 2327 2327 HOH HOH A . 
W 6 HOH 328 2328 2328 HOH HOH A . 
W 6 HOH 329 2329 2329 HOH HOH A . 
W 6 HOH 330 2330 2330 HOH HOH A . 
W 6 HOH 331 2331 2331 HOH HOH A . 
W 6 HOH 332 2332 2332 HOH HOH A . 
W 6 HOH 333 2333 2333 HOH HOH A . 
W 6 HOH 334 2334 2334 HOH HOH A . 
W 6 HOH 335 2335 2335 HOH HOH A . 
W 6 HOH 336 2336 2336 HOH HOH A . 
W 6 HOH 337 2337 2337 HOH HOH A . 
W 6 HOH 338 2338 2338 HOH HOH A . 
W 6 HOH 339 2339 2339 HOH HOH A . 
W 6 HOH 340 2340 2340 HOH HOH A . 
W 6 HOH 341 2341 2341 HOH HOH A . 
W 6 HOH 342 2342 2342 HOH HOH A . 
W 6 HOH 343 2343 2343 HOH HOH A . 
W 6 HOH 344 2344 2344 HOH HOH A . 
W 6 HOH 345 2345 2345 HOH HOH A . 
W 6 HOH 346 2346 2346 HOH HOH A . 
W 6 HOH 347 2347 2347 HOH HOH A . 
W 6 HOH 348 2348 2348 HOH HOH A . 
W 6 HOH 349 2349 2349 HOH HOH A . 
W 6 HOH 350 2350 2350 HOH HOH A . 
W 6 HOH 351 2351 2351 HOH HOH A . 
W 6 HOH 352 2352 2352 HOH HOH A . 
X 6 HOH 1   2001 2001 HOH HOH B . 
X 6 HOH 2   2002 2002 HOH HOH B . 
X 6 HOH 3   2003 2003 HOH HOH B . 
X 6 HOH 4   2004 2004 HOH HOH B . 
X 6 HOH 5   2005 2005 HOH HOH B . 
X 6 HOH 6   2006 2006 HOH HOH B . 
X 6 HOH 7   2007 2007 HOH HOH B . 
X 6 HOH 8   2008 2008 HOH HOH B . 
X 6 HOH 9   2009 2009 HOH HOH B . 
X 6 HOH 10  2010 2010 HOH HOH B . 
X 6 HOH 11  2011 2011 HOH HOH B . 
X 6 HOH 12  2012 2012 HOH HOH B . 
X 6 HOH 13  2013 2013 HOH HOH B . 
X 6 HOH 14  2014 2014 HOH HOH B . 
X 6 HOH 15  2015 2015 HOH HOH B . 
X 6 HOH 16  2016 2016 HOH HOH B . 
X 6 HOH 17  2017 2017 HOH HOH B . 
X 6 HOH 18  2018 2018 HOH HOH B . 
X 6 HOH 19  2019 2019 HOH HOH B . 
X 6 HOH 20  2020 2020 HOH HOH B . 
X 6 HOH 21  2021 2021 HOH HOH B . 
X 6 HOH 22  2022 2022 HOH HOH B . 
X 6 HOH 23  2023 2023 HOH HOH B . 
X 6 HOH 24  2024 2024 HOH HOH B . 
X 6 HOH 25  2025 2025 HOH HOH B . 
X 6 HOH 26  2026 2026 HOH HOH B . 
X 6 HOH 27  2027 2027 HOH HOH B . 
X 6 HOH 28  2028 2028 HOH HOH B . 
X 6 HOH 29  2029 2029 HOH HOH B . 
X 6 HOH 30  2030 2030 HOH HOH B . 
X 6 HOH 31  2031 2031 HOH HOH B . 
X 6 HOH 32  2032 2032 HOH HOH B . 
X 6 HOH 33  2033 2033 HOH HOH B . 
X 6 HOH 34  2034 2034 HOH HOH B . 
X 6 HOH 35  2035 2035 HOH HOH B . 
X 6 HOH 36  2036 2036 HOH HOH B . 
X 6 HOH 37  2037 2037 HOH HOH B . 
X 6 HOH 38  2038 2038 HOH HOH B . 
X 6 HOH 39  2039 2039 HOH HOH B . 
X 6 HOH 40  2040 2040 HOH HOH B . 
X 6 HOH 41  2041 2041 HOH HOH B . 
X 6 HOH 42  2042 2042 HOH HOH B . 
X 6 HOH 43  2043 2043 HOH HOH B . 
X 6 HOH 44  2044 2044 HOH HOH B . 
X 6 HOH 45  2045 2045 HOH HOH B . 
X 6 HOH 46  2046 2046 HOH HOH B . 
X 6 HOH 47  2047 2047 HOH HOH B . 
X 6 HOH 48  2048 2048 HOH HOH B . 
X 6 HOH 49  2049 2049 HOH HOH B . 
X 6 HOH 50  2050 2050 HOH HOH B . 
X 6 HOH 51  2051 2051 HOH HOH B . 
X 6 HOH 52  2052 2052 HOH HOH B . 
X 6 HOH 53  2053 2053 HOH HOH B . 
X 6 HOH 54  2054 2054 HOH HOH B . 
X 6 HOH 55  2055 2055 HOH HOH B . 
X 6 HOH 56  2056 2056 HOH HOH B . 
X 6 HOH 57  2057 2057 HOH HOH B . 
X 6 HOH 58  2058 2058 HOH HOH B . 
X 6 HOH 59  2059 2059 HOH HOH B . 
X 6 HOH 60  2060 2060 HOH HOH B . 
X 6 HOH 61  2061 2061 HOH HOH B . 
X 6 HOH 62  2062 2062 HOH HOH B . 
X 6 HOH 63  2063 2063 HOH HOH B . 
X 6 HOH 64  2064 2064 HOH HOH B . 
X 6 HOH 65  2065 2065 HOH HOH B . 
X 6 HOH 66  2066 2066 HOH HOH B . 
X 6 HOH 67  2067 2067 HOH HOH B . 
X 6 HOH 68  2068 2068 HOH HOH B . 
X 6 HOH 69  2069 2069 HOH HOH B . 
X 6 HOH 70  2070 2070 HOH HOH B . 
X 6 HOH 71  2071 2071 HOH HOH B . 
X 6 HOH 72  2072 2072 HOH HOH B . 
X 6 HOH 73  2073 2073 HOH HOH B . 
X 6 HOH 74  2074 2074 HOH HOH B . 
X 6 HOH 75  2075 2075 HOH HOH B . 
X 6 HOH 76  2076 2076 HOH HOH B . 
X 6 HOH 77  2077 2077 HOH HOH B . 
X 6 HOH 78  2078 2078 HOH HOH B . 
X 6 HOH 79  2079 2079 HOH HOH B . 
X 6 HOH 80  2080 2080 HOH HOH B . 
X 6 HOH 81  2081 2081 HOH HOH B . 
X 6 HOH 82  2082 2082 HOH HOH B . 
X 6 HOH 83  2083 2083 HOH HOH B . 
X 6 HOH 84  2084 2084 HOH HOH B . 
X 6 HOH 85  2085 2085 HOH HOH B . 
X 6 HOH 86  2086 2086 HOH HOH B . 
X 6 HOH 87  2087 2087 HOH HOH B . 
X 6 HOH 88  2088 2088 HOH HOH B . 
X 6 HOH 89  2089 2089 HOH HOH B . 
X 6 HOH 90  2090 2090 HOH HOH B . 
X 6 HOH 91  2091 2091 HOH HOH B . 
X 6 HOH 92  2092 2092 HOH HOH B . 
X 6 HOH 93  2093 2093 HOH HOH B . 
X 6 HOH 94  2094 2094 HOH HOH B . 
X 6 HOH 95  2095 2095 HOH HOH B . 
X 6 HOH 96  2096 2096 HOH HOH B . 
X 6 HOH 97  2097 2097 HOH HOH B . 
X 6 HOH 98  2098 2098 HOH HOH B . 
X 6 HOH 99  2099 2099 HOH HOH B . 
X 6 HOH 100 2100 2100 HOH HOH B . 
X 6 HOH 101 2101 2101 HOH HOH B . 
X 6 HOH 102 2102 2102 HOH HOH B . 
X 6 HOH 103 2103 2103 HOH HOH B . 
X 6 HOH 104 2104 2104 HOH HOH B . 
X 6 HOH 105 2105 2105 HOH HOH B . 
X 6 HOH 106 2106 2106 HOH HOH B . 
X 6 HOH 107 2107 2107 HOH HOH B . 
X 6 HOH 108 2108 2108 HOH HOH B . 
X 6 HOH 109 2109 2109 HOH HOH B . 
X 6 HOH 110 2110 2110 HOH HOH B . 
X 6 HOH 111 2111 2111 HOH HOH B . 
X 6 HOH 112 2112 2112 HOH HOH B . 
X 6 HOH 113 2113 2113 HOH HOH B . 
X 6 HOH 114 2114 2114 HOH HOH B . 
X 6 HOH 115 2115 2115 HOH HOH B . 
X 6 HOH 116 2116 2116 HOH HOH B . 
X 6 HOH 117 2117 2117 HOH HOH B . 
X 6 HOH 118 2118 2118 HOH HOH B . 
X 6 HOH 119 2119 2119 HOH HOH B . 
X 6 HOH 120 2120 2120 HOH HOH B . 
X 6 HOH 121 2121 2121 HOH HOH B . 
X 6 HOH 122 2122 2122 HOH HOH B . 
X 6 HOH 123 2123 2123 HOH HOH B . 
X 6 HOH 124 2124 2124 HOH HOH B . 
X 6 HOH 125 2125 2125 HOH HOH B . 
X 6 HOH 126 2126 2126 HOH HOH B . 
X 6 HOH 127 2127 2127 HOH HOH B . 
X 6 HOH 128 2128 2128 HOH HOH B . 
X 6 HOH 129 2129 2129 HOH HOH B . 
X 6 HOH 130 2130 2130 HOH HOH B . 
X 6 HOH 131 2131 2131 HOH HOH B . 
X 6 HOH 132 2132 2132 HOH HOH B . 
X 6 HOH 133 2133 2133 HOH HOH B . 
X 6 HOH 134 2134 2134 HOH HOH B . 
X 6 HOH 135 2135 2135 HOH HOH B . 
X 6 HOH 136 2136 2136 HOH HOH B . 
X 6 HOH 137 2137 2137 HOH HOH B . 
X 6 HOH 138 2138 2138 HOH HOH B . 
X 6 HOH 139 2139 2139 HOH HOH B . 
X 6 HOH 140 2140 2140 HOH HOH B . 
X 6 HOH 141 2141 2141 HOH HOH B . 
X 6 HOH 142 2142 2142 HOH HOH B . 
X 6 HOH 143 2143 2143 HOH HOH B . 
X 6 HOH 144 2144 2144 HOH HOH B . 
X 6 HOH 145 2145 2145 HOH HOH B . 
X 6 HOH 146 2146 2146 HOH HOH B . 
X 6 HOH 147 2147 2147 HOH HOH B . 
X 6 HOH 148 2148 2148 HOH HOH B . 
X 6 HOH 149 2149 2149 HOH HOH B . 
X 6 HOH 150 2150 2150 HOH HOH B . 
X 6 HOH 151 2151 2151 HOH HOH B . 
X 6 HOH 152 2152 2152 HOH HOH B . 
X 6 HOH 153 2153 2153 HOH HOH B . 
X 6 HOH 154 2154 2154 HOH HOH B . 
X 6 HOH 155 2155 2155 HOH HOH B . 
X 6 HOH 156 2156 2156 HOH HOH B . 
X 6 HOH 157 2157 2157 HOH HOH B . 
X 6 HOH 158 2158 2158 HOH HOH B . 
X 6 HOH 159 2159 2159 HOH HOH B . 
X 6 HOH 160 2160 2160 HOH HOH B . 
X 6 HOH 161 2161 2161 HOH HOH B . 
X 6 HOH 162 2162 2162 HOH HOH B . 
X 6 HOH 163 2163 2163 HOH HOH B . 
X 6 HOH 164 2164 2164 HOH HOH B . 
X 6 HOH 165 2165 2165 HOH HOH B . 
X 6 HOH 166 2166 2166 HOH HOH B . 
X 6 HOH 167 2167 2167 HOH HOH B . 
X 6 HOH 168 2168 2168 HOH HOH B . 
X 6 HOH 169 2169 2169 HOH HOH B . 
X 6 HOH 170 2170 2170 HOH HOH B . 
X 6 HOH 171 2171 2171 HOH HOH B . 
X 6 HOH 172 2172 2172 HOH HOH B . 
X 6 HOH 173 2173 2173 HOH HOH B . 
X 6 HOH 174 2174 2174 HOH HOH B . 
X 6 HOH 175 2175 2175 HOH HOH B . 
X 6 HOH 176 2176 2176 HOH HOH B . 
X 6 HOH 177 2177 2177 HOH HOH B . 
X 6 HOH 178 2178 2178 HOH HOH B . 
X 6 HOH 179 2179 2179 HOH HOH B . 
X 6 HOH 180 2180 2180 HOH HOH B . 
X 6 HOH 181 2181 2181 HOH HOH B . 
X 6 HOH 182 2182 2182 HOH HOH B . 
X 6 HOH 183 2183 2183 HOH HOH B . 
X 6 HOH 184 2184 2184 HOH HOH B . 
X 6 HOH 185 2185 2185 HOH HOH B . 
X 6 HOH 186 2186 2186 HOH HOH B . 
X 6 HOH 187 2187 2187 HOH HOH B . 
X 6 HOH 188 2188 2188 HOH HOH B . 
X 6 HOH 189 2189 2189 HOH HOH B . 
X 6 HOH 190 2190 2190 HOH HOH B . 
X 6 HOH 191 2191 2191 HOH HOH B . 
X 6 HOH 192 2192 2192 HOH HOH B . 
X 6 HOH 193 2193 2193 HOH HOH B . 
X 6 HOH 194 2194 2194 HOH HOH B . 
X 6 HOH 195 2195 2195 HOH HOH B . 
X 6 HOH 196 2196 2196 HOH HOH B . 
X 6 HOH 197 2197 2197 HOH HOH B . 
X 6 HOH 198 2198 2198 HOH HOH B . 
X 6 HOH 199 2199 2199 HOH HOH B . 
X 6 HOH 200 2200 2200 HOH HOH B . 
X 6 HOH 201 2201 2201 HOH HOH B . 
X 6 HOH 202 2202 2202 HOH HOH B . 
X 6 HOH 203 2203 2203 HOH HOH B . 
X 6 HOH 204 2204 2204 HOH HOH B . 
X 6 HOH 205 2205 2205 HOH HOH B . 
X 6 HOH 206 2206 2206 HOH HOH B . 
X 6 HOH 207 2207 2207 HOH HOH B . 
X 6 HOH 208 2208 2208 HOH HOH B . 
X 6 HOH 209 2209 2209 HOH HOH B . 
X 6 HOH 210 2210 2210 HOH HOH B . 
X 6 HOH 211 2211 2211 HOH HOH B . 
X 6 HOH 212 2212 2212 HOH HOH B . 
X 6 HOH 213 2213 2213 HOH HOH B . 
X 6 HOH 214 2214 2214 HOH HOH B . 
X 6 HOH 215 2215 2215 HOH HOH B . 
X 6 HOH 216 2216 2216 HOH HOH B . 
X 6 HOH 217 2217 2217 HOH HOH B . 
X 6 HOH 218 2218 2218 HOH HOH B . 
X 6 HOH 219 2219 2219 HOH HOH B . 
X 6 HOH 220 2220 2220 HOH HOH B . 
X 6 HOH 221 2221 2221 HOH HOH B . 
X 6 HOH 222 2222 2222 HOH HOH B . 
X 6 HOH 223 2223 2223 HOH HOH B . 
X 6 HOH 224 2224 2224 HOH HOH B . 
X 6 HOH 225 2225 2225 HOH HOH B . 
X 6 HOH 226 2226 2226 HOH HOH B . 
X 6 HOH 227 2227 2227 HOH HOH B . 
X 6 HOH 228 2228 2228 HOH HOH B . 
X 6 HOH 229 2229 2229 HOH HOH B . 
X 6 HOH 230 2230 2230 HOH HOH B . 
X 6 HOH 231 2231 2231 HOH HOH B . 
X 6 HOH 232 2232 2232 HOH HOH B . 
X 6 HOH 233 2233 2233 HOH HOH B . 
X 6 HOH 234 2234 2234 HOH HOH B . 
X 6 HOH 235 2235 2235 HOH HOH B . 
X 6 HOH 236 2236 2236 HOH HOH B . 
X 6 HOH 237 2237 2237 HOH HOH B . 
X 6 HOH 238 2238 2238 HOH HOH B . 
X 6 HOH 239 2239 2239 HOH HOH B . 
X 6 HOH 240 2240 2240 HOH HOH B . 
X 6 HOH 241 2241 2241 HOH HOH B . 
X 6 HOH 242 2242 2242 HOH HOH B . 
X 6 HOH 243 2243 2243 HOH HOH B . 
X 6 HOH 244 2244 2244 HOH HOH B . 
X 6 HOH 245 2245 2245 HOH HOH B . 
X 6 HOH 246 2246 2246 HOH HOH B . 
X 6 HOH 247 2247 2247 HOH HOH B . 
X 6 HOH 248 2248 2248 HOH HOH B . 
X 6 HOH 249 2249 2249 HOH HOH B . 
X 6 HOH 250 2250 2250 HOH HOH B . 
X 6 HOH 251 2251 2251 HOH HOH B . 
X 6 HOH 252 2252 2252 HOH HOH B . 
X 6 HOH 253 2253 2253 HOH HOH B . 
X 6 HOH 254 2254 2254 HOH HOH B . 
X 6 HOH 255 2255 2255 HOH HOH B . 
X 6 HOH 256 2256 2256 HOH HOH B . 
X 6 HOH 257 2257 2257 HOH HOH B . 
X 6 HOH 258 2258 2258 HOH HOH B . 
X 6 HOH 259 2259 2259 HOH HOH B . 
X 6 HOH 260 2260 2260 HOH HOH B . 
X 6 HOH 261 2261 2261 HOH HOH B . 
X 6 HOH 262 2262 2262 HOH HOH B . 
X 6 HOH 263 2263 2263 HOH HOH B . 
X 6 HOH 264 2264 2264 HOH HOH B . 
X 6 HOH 265 2265 2265 HOH HOH B . 
X 6 HOH 266 2266 2266 HOH HOH B . 
X 6 HOH 267 2267 2267 HOH HOH B . 
X 6 HOH 268 2268 2268 HOH HOH B . 
X 6 HOH 269 2269 2269 HOH HOH B . 
X 6 HOH 270 2270 2270 HOH HOH B . 
X 6 HOH 271 2271 2271 HOH HOH B . 
X 6 HOH 272 2272 2272 HOH HOH B . 
X 6 HOH 273 2273 2273 HOH HOH B . 
X 6 HOH 274 2274 2274 HOH HOH B . 
X 6 HOH 275 2275 2275 HOH HOH B . 
X 6 HOH 276 2276 2276 HOH HOH B . 
X 6 HOH 277 2277 2277 HOH HOH B . 
X 6 HOH 278 2278 2278 HOH HOH B . 
X 6 HOH 279 2279 2279 HOH HOH B . 
X 6 HOH 280 2280 2280 HOH HOH B . 
Y 6 HOH 1   2001 2001 HOH HOH C . 
Y 6 HOH 2   2002 2002 HOH HOH C . 
Y 6 HOH 3   2003 2003 HOH HOH C . 
Y 6 HOH 4   2004 2004 HOH HOH C . 
Y 6 HOH 5   2005 2005 HOH HOH C . 
Y 6 HOH 6   2006 2006 HOH HOH C . 
Y 6 HOH 7   2007 2007 HOH HOH C . 
Y 6 HOH 8   2008 2008 HOH HOH C . 
Y 6 HOH 9   2009 2009 HOH HOH C . 
Y 6 HOH 10  2010 2010 HOH HOH C . 
Y 6 HOH 11  2011 2011 HOH HOH C . 
Y 6 HOH 12  2012 2012 HOH HOH C . 
Y 6 HOH 13  2013 2013 HOH HOH C . 
Y 6 HOH 14  2014 2014 HOH HOH C . 
Y 6 HOH 15  2015 2015 HOH HOH C . 
Y 6 HOH 16  2016 2016 HOH HOH C . 
Y 6 HOH 17  2017 2017 HOH HOH C . 
Y 6 HOH 18  2018 2018 HOH HOH C . 
Y 6 HOH 19  2019 2019 HOH HOH C . 
Y 6 HOH 20  2020 2020 HOH HOH C . 
Y 6 HOH 21  2021 2021 HOH HOH C . 
Y 6 HOH 22  2022 2022 HOH HOH C . 
Y 6 HOH 23  2023 2023 HOH HOH C . 
Y 6 HOH 24  2024 2024 HOH HOH C . 
Y 6 HOH 25  2025 2025 HOH HOH C . 
Y 6 HOH 26  2026 2026 HOH HOH C . 
Y 6 HOH 27  2027 2027 HOH HOH C . 
Y 6 HOH 28  2028 2028 HOH HOH C . 
Y 6 HOH 29  2029 2029 HOH HOH C . 
Y 6 HOH 30  2030 2030 HOH HOH C . 
Y 6 HOH 31  2031 2031 HOH HOH C . 
Y 6 HOH 32  2032 2032 HOH HOH C . 
Y 6 HOH 33  2033 2033 HOH HOH C . 
Y 6 HOH 34  2034 2034 HOH HOH C . 
Y 6 HOH 35  2035 2035 HOH HOH C . 
Y 6 HOH 36  2036 2036 HOH HOH C . 
Y 6 HOH 37  2037 2037 HOH HOH C . 
Y 6 HOH 38  2038 2038 HOH HOH C . 
Y 6 HOH 39  2039 2039 HOH HOH C . 
Y 6 HOH 40  2040 2040 HOH HOH C . 
Y 6 HOH 41  2041 2041 HOH HOH C . 
Y 6 HOH 42  2042 2042 HOH HOH C . 
Y 6 HOH 43  2043 2043 HOH HOH C . 
Y 6 HOH 44  2044 2044 HOH HOH C . 
Y 6 HOH 45  2045 2045 HOH HOH C . 
Y 6 HOH 46  2046 2046 HOH HOH C . 
Y 6 HOH 47  2047 2047 HOH HOH C . 
Y 6 HOH 48  2048 2048 HOH HOH C . 
Y 6 HOH 49  2049 2049 HOH HOH C . 
Y 6 HOH 50  2050 2050 HOH HOH C . 
Y 6 HOH 51  2051 2051 HOH HOH C . 
Y 6 HOH 52  2052 2052 HOH HOH C . 
Y 6 HOH 53  2053 2053 HOH HOH C . 
Y 6 HOH 54  2054 2054 HOH HOH C . 
Y 6 HOH 55  2055 2055 HOH HOH C . 
Y 6 HOH 56  2056 2056 HOH HOH C . 
Y 6 HOH 57  2057 2057 HOH HOH C . 
Y 6 HOH 58  2058 2058 HOH HOH C . 
Y 6 HOH 59  2059 2059 HOH HOH C . 
Y 6 HOH 60  2060 2060 HOH HOH C . 
Y 6 HOH 61  2061 2061 HOH HOH C . 
Y 6 HOH 62  2062 2062 HOH HOH C . 
Y 6 HOH 63  2063 2063 HOH HOH C . 
Y 6 HOH 64  2064 2064 HOH HOH C . 
Y 6 HOH 65  2065 2065 HOH HOH C . 
Y 6 HOH 66  2066 2066 HOH HOH C . 
Y 6 HOH 67  2067 2067 HOH HOH C . 
Y 6 HOH 68  2068 2068 HOH HOH C . 
Y 6 HOH 69  2069 2069 HOH HOH C . 
Y 6 HOH 70  2070 2070 HOH HOH C . 
Y 6 HOH 71  2071 2071 HOH HOH C . 
Y 6 HOH 72  2072 2072 HOH HOH C . 
Y 6 HOH 73  2073 2073 HOH HOH C . 
Y 6 HOH 74  2074 2074 HOH HOH C . 
Y 6 HOH 75  2075 2075 HOH HOH C . 
Y 6 HOH 76  2076 2076 HOH HOH C . 
Y 6 HOH 77  2077 2077 HOH HOH C . 
Y 6 HOH 78  2078 2078 HOH HOH C . 
Y 6 HOH 79  2079 2079 HOH HOH C . 
Y 6 HOH 80  2080 2080 HOH HOH C . 
Y 6 HOH 81  2081 2081 HOH HOH C . 
Y 6 HOH 82  2082 2082 HOH HOH C . 
Y 6 HOH 83  2083 2083 HOH HOH C . 
Y 6 HOH 84  2084 2084 HOH HOH C . 
Y 6 HOH 85  2085 2085 HOH HOH C . 
Y 6 HOH 86  2086 2086 HOH HOH C . 
Y 6 HOH 87  2087 2087 HOH HOH C . 
Y 6 HOH 88  2088 2088 HOH HOH C . 
Y 6 HOH 89  2089 2089 HOH HOH C . 
Y 6 HOH 90  2090 2090 HOH HOH C . 
Y 6 HOH 91  2091 2091 HOH HOH C . 
Y 6 HOH 92  2092 2092 HOH HOH C . 
Y 6 HOH 93  2093 2093 HOH HOH C . 
Y 6 HOH 94  2094 2094 HOH HOH C . 
Y 6 HOH 95  2095 2095 HOH HOH C . 
Y 6 HOH 96  2096 2096 HOH HOH C . 
Y 6 HOH 97  2097 2097 HOH HOH C . 
Y 6 HOH 98  2098 2098 HOH HOH C . 
Y 6 HOH 99  2099 2099 HOH HOH C . 
Y 6 HOH 100 2100 2100 HOH HOH C . 
Y 6 HOH 101 2101 2101 HOH HOH C . 
Y 6 HOH 102 2102 2102 HOH HOH C . 
Y 6 HOH 103 2103 2103 HOH HOH C . 
Y 6 HOH 104 2104 2104 HOH HOH C . 
Y 6 HOH 105 2105 2105 HOH HOH C . 
Y 6 HOH 106 2106 2106 HOH HOH C . 
Y 6 HOH 107 2107 2107 HOH HOH C . 
Y 6 HOH 108 2108 2108 HOH HOH C . 
Y 6 HOH 109 2109 2109 HOH HOH C . 
Y 6 HOH 110 2110 2110 HOH HOH C . 
Y 6 HOH 111 2111 2111 HOH HOH C . 
Y 6 HOH 112 2112 2112 HOH HOH C . 
Y 6 HOH 113 2113 2113 HOH HOH C . 
Y 6 HOH 114 2114 2114 HOH HOH C . 
Y 6 HOH 115 2115 2115 HOH HOH C . 
Y 6 HOH 116 2116 2116 HOH HOH C . 
Y 6 HOH 117 2117 2117 HOH HOH C . 
Y 6 HOH 118 2118 2118 HOH HOH C . 
Y 6 HOH 119 2119 2119 HOH HOH C . 
Y 6 HOH 120 2120 2120 HOH HOH C . 
Y 6 HOH 121 2121 2121 HOH HOH C . 
Y 6 HOH 122 2122 2122 HOH HOH C . 
Y 6 HOH 123 2123 2123 HOH HOH C . 
Y 6 HOH 124 2124 2124 HOH HOH C . 
Y 6 HOH 125 2125 2125 HOH HOH C . 
Y 6 HOH 126 2126 2126 HOH HOH C . 
Y 6 HOH 127 2127 2127 HOH HOH C . 
Y 6 HOH 128 2128 2128 HOH HOH C . 
Y 6 HOH 129 2129 2129 HOH HOH C . 
Y 6 HOH 130 2130 2130 HOH HOH C . 
Y 6 HOH 131 2131 2131 HOH HOH C . 
Y 6 HOH 132 2132 2132 HOH HOH C . 
Y 6 HOH 133 2133 2133 HOH HOH C . 
Y 6 HOH 134 2134 2134 HOH HOH C . 
Y 6 HOH 135 2135 2135 HOH HOH C . 
Y 6 HOH 136 2136 2136 HOH HOH C . 
Y 6 HOH 137 2137 2137 HOH HOH C . 
Y 6 HOH 138 2138 2138 HOH HOH C . 
Y 6 HOH 139 2139 2139 HOH HOH C . 
Y 6 HOH 140 2140 2140 HOH HOH C . 
Y 6 HOH 141 2141 2141 HOH HOH C . 
Y 6 HOH 142 2142 2142 HOH HOH C . 
Y 6 HOH 143 2143 2143 HOH HOH C . 
Y 6 HOH 144 2144 2144 HOH HOH C . 
Y 6 HOH 145 2145 2145 HOH HOH C . 
Y 6 HOH 146 2146 2146 HOH HOH C . 
Y 6 HOH 147 2147 2147 HOH HOH C . 
Y 6 HOH 148 2148 2148 HOH HOH C . 
Y 6 HOH 149 2149 2149 HOH HOH C . 
Y 6 HOH 150 2150 2150 HOH HOH C . 
Y 6 HOH 151 2151 2151 HOH HOH C . 
Y 6 HOH 152 2152 2152 HOH HOH C . 
Y 6 HOH 153 2153 2153 HOH HOH C . 
Y 6 HOH 154 2154 2154 HOH HOH C . 
Y 6 HOH 155 2155 2155 HOH HOH C . 
Y 6 HOH 156 2156 2156 HOH HOH C . 
Y 6 HOH 157 2157 2157 HOH HOH C . 
Y 6 HOH 158 2158 2158 HOH HOH C . 
Y 6 HOH 159 2159 2159 HOH HOH C . 
Y 6 HOH 160 2160 2160 HOH HOH C . 
Y 6 HOH 161 2161 2161 HOH HOH C . 
Y 6 HOH 162 2162 2162 HOH HOH C . 
Y 6 HOH 163 2163 2163 HOH HOH C . 
Y 6 HOH 164 2164 2164 HOH HOH C . 
Y 6 HOH 165 2165 2165 HOH HOH C . 
Y 6 HOH 166 2166 2166 HOH HOH C . 
Y 6 HOH 167 2167 2167 HOH HOH C . 
Y 6 HOH 168 2168 2168 HOH HOH C . 
Y 6 HOH 169 2169 2169 HOH HOH C . 
Y 6 HOH 170 2170 2170 HOH HOH C . 
Y 6 HOH 171 2171 2171 HOH HOH C . 
Y 6 HOH 172 2172 2172 HOH HOH C . 
Y 6 HOH 173 2173 2173 HOH HOH C . 
Y 6 HOH 174 2174 2174 HOH HOH C . 
Y 6 HOH 175 2175 2175 HOH HOH C . 
Y 6 HOH 176 2176 2176 HOH HOH C . 
Y 6 HOH 177 2177 2177 HOH HOH C . 
Y 6 HOH 178 2178 2178 HOH HOH C . 
Y 6 HOH 179 2179 2179 HOH HOH C . 
Y 6 HOH 180 2180 2180 HOH HOH C . 
Y 6 HOH 181 2181 2181 HOH HOH C . 
Y 6 HOH 182 2182 2182 HOH HOH C . 
Y 6 HOH 183 2183 2183 HOH HOH C . 
Y 6 HOH 184 2184 2184 HOH HOH C . 
Y 6 HOH 185 2185 2185 HOH HOH C . 
Y 6 HOH 186 2186 2186 HOH HOH C . 
Y 6 HOH 187 2187 2187 HOH HOH C . 
Y 6 HOH 188 2188 2188 HOH HOH C . 
Y 6 HOH 189 2189 2189 HOH HOH C . 
Y 6 HOH 190 2190 2190 HOH HOH C . 
Y 6 HOH 191 2191 2191 HOH HOH C . 
Y 6 HOH 192 2192 2192 HOH HOH C . 
Y 6 HOH 193 2193 2193 HOH HOH C . 
Y 6 HOH 194 2194 2194 HOH HOH C . 
Y 6 HOH 195 2195 2195 HOH HOH C . 
Y 6 HOH 196 2196 2196 HOH HOH C . 
Y 6 HOH 197 2197 2197 HOH HOH C . 
Y 6 HOH 198 2198 2198 HOH HOH C . 
Y 6 HOH 199 2199 2199 HOH HOH C . 
Y 6 HOH 200 2200 2200 HOH HOH C . 
Y 6 HOH 201 2201 2201 HOH HOH C . 
Y 6 HOH 202 2202 2202 HOH HOH C . 
Y 6 HOH 203 2203 2203 HOH HOH C . 
Y 6 HOH 204 2204 2204 HOH HOH C . 
Y 6 HOH 205 2205 2205 HOH HOH C . 
Y 6 HOH 206 2206 2206 HOH HOH C . 
Y 6 HOH 207 2207 2207 HOH HOH C . 
Y 6 HOH 208 2208 2208 HOH HOH C . 
Y 6 HOH 209 2209 2209 HOH HOH C . 
Y 6 HOH 210 2210 2210 HOH HOH C . 
Y 6 HOH 211 2211 2211 HOH HOH C . 
Y 6 HOH 212 2212 2212 HOH HOH C . 
Y 6 HOH 213 2213 2213 HOH HOH C . 
Y 6 HOH 214 2214 2214 HOH HOH C . 
Y 6 HOH 215 2215 2215 HOH HOH C . 
Y 6 HOH 216 2216 2216 HOH HOH C . 
Y 6 HOH 217 2217 2217 HOH HOH C . 
Y 6 HOH 218 2218 2218 HOH HOH C . 
Y 6 HOH 219 2219 2219 HOH HOH C . 
Y 6 HOH 220 2220 2220 HOH HOH C . 
Y 6 HOH 221 2221 2221 HOH HOH C . 
Y 6 HOH 222 2222 2222 HOH HOH C . 
Y 6 HOH 223 2223 2223 HOH HOH C . 
Y 6 HOH 224 2224 2224 HOH HOH C . 
Y 6 HOH 225 2225 2225 HOH HOH C . 
Y 6 HOH 226 2226 2226 HOH HOH C . 
Z 6 HOH 1   2001 2001 HOH HOH D . 
Z 6 HOH 2   2002 2002 HOH HOH D . 
Z 6 HOH 3   2003 2003 HOH HOH D . 
Z 6 HOH 4   2004 2004 HOH HOH D . 
Z 6 HOH 5   2005 2005 HOH HOH D . 
Z 6 HOH 6   2006 2006 HOH HOH D . 
Z 6 HOH 7   2007 2007 HOH HOH D . 
Z 6 HOH 8   2008 2008 HOH HOH D . 
Z 6 HOH 9   2009 2009 HOH HOH D . 
Z 6 HOH 10  2010 2010 HOH HOH D . 
Z 6 HOH 11  2011 2011 HOH HOH D . 
Z 6 HOH 12  2012 2012 HOH HOH D . 
Z 6 HOH 13  2013 2013 HOH HOH D . 
Z 6 HOH 14  2014 2014 HOH HOH D . 
Z 6 HOH 15  2015 2015 HOH HOH D . 
Z 6 HOH 16  2016 2016 HOH HOH D . 
Z 6 HOH 17  2017 2017 HOH HOH D . 
Z 6 HOH 18  2018 2018 HOH HOH D . 
Z 6 HOH 19  2019 2019 HOH HOH D . 
Z 6 HOH 20  2020 2020 HOH HOH D . 
Z 6 HOH 21  2021 2021 HOH HOH D . 
Z 6 HOH 22  2022 2022 HOH HOH D . 
Z 6 HOH 23  2023 2023 HOH HOH D . 
Z 6 HOH 24  2024 2024 HOH HOH D . 
Z 6 HOH 25  2025 2025 HOH HOH D . 
Z 6 HOH 26  2026 2026 HOH HOH D . 
Z 6 HOH 27  2027 2027 HOH HOH D . 
Z 6 HOH 28  2028 2028 HOH HOH D . 
Z 6 HOH 29  2029 2029 HOH HOH D . 
Z 6 HOH 30  2030 2030 HOH HOH D . 
Z 6 HOH 31  2031 2031 HOH HOH D . 
Z 6 HOH 32  2032 2032 HOH HOH D . 
Z 6 HOH 33  2033 2033 HOH HOH D . 
Z 6 HOH 34  2034 2034 HOH HOH D . 
Z 6 HOH 35  2035 2035 HOH HOH D . 
Z 6 HOH 36  2036 2036 HOH HOH D . 
Z 6 HOH 37  2037 2037 HOH HOH D . 
Z 6 HOH 38  2038 2038 HOH HOH D . 
Z 6 HOH 39  2039 2039 HOH HOH D . 
Z 6 HOH 40  2040 2040 HOH HOH D . 
Z 6 HOH 41  2041 2041 HOH HOH D . 
Z 6 HOH 42  2042 2042 HOH HOH D . 
Z 6 HOH 43  2043 2043 HOH HOH D . 
Z 6 HOH 44  2044 2044 HOH HOH D . 
Z 6 HOH 45  2045 2045 HOH HOH D . 
Z 6 HOH 46  2046 2046 HOH HOH D . 
Z 6 HOH 47  2047 2047 HOH HOH D . 
Z 6 HOH 48  2048 2048 HOH HOH D . 
Z 6 HOH 49  2049 2049 HOH HOH D . 
Z 6 HOH 50  2050 2050 HOH HOH D . 
Z 6 HOH 51  2051 2051 HOH HOH D . 
Z 6 HOH 52  2052 2052 HOH HOH D . 
Z 6 HOH 53  2053 2053 HOH HOH D . 
Z 6 HOH 54  2054 2054 HOH HOH D . 
Z 6 HOH 55  2055 2055 HOH HOH D . 
Z 6 HOH 56  2056 2056 HOH HOH D . 
Z 6 HOH 57  2057 2057 HOH HOH D . 
Z 6 HOH 58  2058 2058 HOH HOH D . 
Z 6 HOH 59  2059 2059 HOH HOH D . 
Z 6 HOH 60  2060 2060 HOH HOH D . 
Z 6 HOH 61  2061 2061 HOH HOH D . 
Z 6 HOH 62  2062 2062 HOH HOH D . 
Z 6 HOH 63  2063 2063 HOH HOH D . 
Z 6 HOH 64  2064 2064 HOH HOH D . 
Z 6 HOH 65  2065 2065 HOH HOH D . 
Z 6 HOH 66  2066 2066 HOH HOH D . 
Z 6 HOH 67  2067 2067 HOH HOH D . 
Z 6 HOH 68  2068 2068 HOH HOH D . 
Z 6 HOH 69  2069 2069 HOH HOH D . 
Z 6 HOH 70  2070 2070 HOH HOH D . 
Z 6 HOH 71  2071 2071 HOH HOH D . 
Z 6 HOH 72  2072 2072 HOH HOH D . 
Z 6 HOH 73  2073 2073 HOH HOH D . 
Z 6 HOH 74  2074 2074 HOH HOH D . 
Z 6 HOH 75  2075 2075 HOH HOH D . 
Z 6 HOH 76  2076 2076 HOH HOH D . 
Z 6 HOH 77  2077 2077 HOH HOH D . 
Z 6 HOH 78  2078 2078 HOH HOH D . 
Z 6 HOH 79  2079 2079 HOH HOH D . 
Z 6 HOH 80  2080 2080 HOH HOH D . 
Z 6 HOH 81  2081 2081 HOH HOH D . 
Z 6 HOH 82  2082 2082 HOH HOH D . 
Z 6 HOH 83  2083 2083 HOH HOH D . 
Z 6 HOH 84  2084 2084 HOH HOH D . 
Z 6 HOH 85  2085 2085 HOH HOH D . 
Z 6 HOH 86  2086 2086 HOH HOH D . 
Z 6 HOH 87  2087 2087 HOH HOH D . 
Z 6 HOH 88  2088 2088 HOH HOH D . 
Z 6 HOH 89  2089 2089 HOH HOH D . 
Z 6 HOH 90  2090 2090 HOH HOH D . 
Z 6 HOH 91  2091 2091 HOH HOH D . 
Z 6 HOH 92  2092 2092 HOH HOH D . 
Z 6 HOH 93  2093 2093 HOH HOH D . 
Z 6 HOH 94  2094 2094 HOH HOH D . 
Z 6 HOH 95  2095 2095 HOH HOH D . 
Z 6 HOH 96  2096 2096 HOH HOH D . 
Z 6 HOH 97  2097 2097 HOH HOH D . 
Z 6 HOH 98  2098 2098 HOH HOH D . 
Z 6 HOH 99  2099 2099 HOH HOH D . 
Z 6 HOH 100 2100 2100 HOH HOH D . 
Z 6 HOH 101 2101 2101 HOH HOH D . 
Z 6 HOH 102 2102 2102 HOH HOH D . 
Z 6 HOH 103 2103 2103 HOH HOH D . 
Z 6 HOH 104 2104 2104 HOH HOH D . 
Z 6 HOH 105 2105 2105 HOH HOH D . 
Z 6 HOH 106 2106 2106 HOH HOH D . 
Z 6 HOH 107 2107 2107 HOH HOH D . 
Z 6 HOH 108 2108 2108 HOH HOH D . 
Z 6 HOH 109 2109 2109 HOH HOH D . 
Z 6 HOH 110 2110 2110 HOH HOH D . 
Z 6 HOH 111 2111 2111 HOH HOH D . 
Z 6 HOH 112 2112 2112 HOH HOH D . 
Z 6 HOH 113 2113 2113 HOH HOH D . 
Z 6 HOH 114 2114 2114 HOH HOH D . 
Z 6 HOH 115 2115 2115 HOH HOH D . 
Z 6 HOH 116 2116 2116 HOH HOH D . 
Z 6 HOH 117 2117 2117 HOH HOH D . 
Z 6 HOH 118 2118 2118 HOH HOH D . 
Z 6 HOH 119 2119 2119 HOH HOH D . 
Z 6 HOH 120 2120 2120 HOH HOH D . 
Z 6 HOH 121 2121 2121 HOH HOH D . 
Z 6 HOH 122 2122 2122 HOH HOH D . 
Z 6 HOH 123 2123 2123 HOH HOH D . 
Z 6 HOH 124 2124 2124 HOH HOH D . 
Z 6 HOH 125 2125 2125 HOH HOH D . 
Z 6 HOH 126 2126 2126 HOH HOH D . 
Z 6 HOH 127 2127 2127 HOH HOH D . 
Z 6 HOH 128 2128 2128 HOH HOH D . 
Z 6 HOH 129 2129 2129 HOH HOH D . 
Z 6 HOH 130 2130 2130 HOH HOH D . 
Z 6 HOH 131 2131 2131 HOH HOH D . 
Z 6 HOH 132 2132 2132 HOH HOH D . 
Z 6 HOH 133 2133 2133 HOH HOH D . 
Z 6 HOH 134 2134 2134 HOH HOH D . 
Z 6 HOH 135 2135 2135 HOH HOH D . 
Z 6 HOH 136 2136 2136 HOH HOH D . 
Z 6 HOH 137 2137 2137 HOH HOH D . 
Z 6 HOH 138 2138 2138 HOH HOH D . 
Z 6 HOH 139 2139 2139 HOH HOH D . 
Z 6 HOH 140 2140 2140 HOH HOH D . 
Z 6 HOH 141 2141 2141 HOH HOH D . 
Z 6 HOH 142 2142 2142 HOH HOH D . 
Z 6 HOH 143 2143 2143 HOH HOH D . 
Z 6 HOH 144 2144 2144 HOH HOH D . 
Z 6 HOH 145 2145 2145 HOH HOH D . 
Z 6 HOH 146 2146 2146 HOH HOH D . 
Z 6 HOH 147 2147 2147 HOH HOH D . 
Z 6 HOH 148 2148 2148 HOH HOH D . 
Z 6 HOH 149 2149 2149 HOH HOH D . 
Z 6 HOH 150 2150 2150 HOH HOH D . 
Z 6 HOH 151 2151 2151 HOH HOH D . 
Z 6 HOH 152 2152 2152 HOH HOH D . 
Z 6 HOH 153 2153 2153 HOH HOH D . 
Z 6 HOH 154 2154 2154 HOH HOH D . 
Z 6 HOH 155 2155 2155 HOH HOH D . 
Z 6 HOH 156 2156 2156 HOH HOH D . 
Z 6 HOH 157 2157 2157 HOH HOH D . 
Z 6 HOH 158 2158 2158 HOH HOH D . 
Z 6 HOH 159 2159 2159 HOH HOH D . 
Z 6 HOH 160 2160 2160 HOH HOH D . 
Z 6 HOH 161 2161 2161 HOH HOH D . 
Z 6 HOH 162 2162 2162 HOH HOH D . 
Z 6 HOH 163 2163 2163 HOH HOH D . 
Z 6 HOH 164 2164 2164 HOH HOH D . 
Z 6 HOH 165 2165 2165 HOH HOH D . 
Z 6 HOH 166 2166 2166 HOH HOH D . 
Z 6 HOH 167 2167 2167 HOH HOH D . 
Z 6 HOH 168 2168 2168 HOH HOH D . 
Z 6 HOH 169 2169 2169 HOH HOH D . 
Z 6 HOH 170 2170 2170 HOH HOH D . 
Z 6 HOH 171 2171 2171 HOH HOH D . 
Z 6 HOH 172 2172 2172 HOH HOH D . 
Z 6 HOH 173 2173 2173 HOH HOH D . 
Z 6 HOH 174 2174 2174 HOH HOH D . 
Z 6 HOH 175 2175 2175 HOH HOH D . 
Z 6 HOH 176 2176 2176 HOH HOH D . 
Z 6 HOH 177 2177 2177 HOH HOH D . 
Z 6 HOH 178 2178 2178 HOH HOH D . 
Z 6 HOH 179 2179 2179 HOH HOH D . 
Z 6 HOH 180 2180 2180 HOH HOH D . 
Z 6 HOH 181 2181 2181 HOH HOH D . 
Z 6 HOH 182 2182 2182 HOH HOH D . 
Z 6 HOH 183 2183 2183 HOH HOH D . 
Z 6 HOH 184 2184 2184 HOH HOH D . 
Z 6 HOH 185 2185 2185 HOH HOH D . 
Z 6 HOH 186 2186 2186 HOH HOH D . 
Z 6 HOH 187 2187 2187 HOH HOH D . 
Z 6 HOH 188 2188 2188 HOH HOH D . 
Z 6 HOH 189 2189 2189 HOH HOH D . 
Z 6 HOH 190 2190 2190 HOH HOH D . 
Z 6 HOH 191 2191 2191 HOH HOH D . 
Z 6 HOH 192 2192 2192 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
3 author_and_software_defined_assembly PISA monomeric 1 
4 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,E,F,G,H,I,W   
2 1 B,J,K,L,M,X     
3 1 C,N,O,P,Q,R,S,Y 
4 1 D,T,U,V,Z       
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 92  ? A HIS 94  ? 1_555 ZN ? E ZN . ? A ZN 264 ? 1_555 NE2 ? A HIS 94  ? A HIS 96  ? 1_555 103.3 ? 
2  NE2 ? A HIS 92  ? A HIS 94  ? 1_555 ZN ? E ZN . ? A ZN 264 ? 1_555 ND1 ? A HIS 117 ? A HIS 119 ? 1_555 110.8 ? 
3  NE2 ? A HIS 94  ? A HIS 96  ? 1_555 ZN ? E ZN . ? A ZN 264 ? 1_555 ND1 ? A HIS 117 ? A HIS 119 ? 1_555 99.2  ? 
4  NE2 ? A HIS 92  ? A HIS 94  ? 1_555 ZN ? E ZN . ? A ZN 264 ? 1_555 N24 ? F 9FK .   ? A 9FK 269 ? 1_555 112.2 ? 
5  NE2 ? A HIS 94  ? A HIS 96  ? 1_555 ZN ? E ZN . ? A ZN 264 ? 1_555 N24 ? F 9FK .   ? A 9FK 269 ? 1_555 113.0 ? 
6  ND1 ? A HIS 117 ? A HIS 119 ? 1_555 ZN ? E ZN . ? A ZN 264 ? 1_555 N24 ? F 9FK .   ? A 9FK 269 ? 1_555 116.8 ? 
7  NE2 ? B HIS 92  ? B HIS 94  ? 1_555 ZN ? J ZN . ? B ZN 264 ? 1_555 N24 ? K 9FK .   ? B 9FK 268 ? 1_555 108.7 ? 
8  NE2 ? B HIS 92  ? B HIS 94  ? 1_555 ZN ? J ZN . ? B ZN 264 ? 1_555 NE2 ? B HIS 94  ? B HIS 96  ? 1_555 103.3 ? 
9  N24 ? K 9FK .   ? B 9FK 268 ? 1_555 ZN ? J ZN . ? B ZN 264 ? 1_555 NE2 ? B HIS 94  ? B HIS 96  ? 1_555 106.2 ? 
10 NE2 ? B HIS 92  ? B HIS 94  ? 1_555 ZN ? J ZN . ? B ZN 264 ? 1_555 ND1 ? B HIS 117 ? B HIS 119 ? 1_555 117.0 ? 
11 N24 ? K 9FK .   ? B 9FK 268 ? 1_555 ZN ? J ZN . ? B ZN 264 ? 1_555 ND1 ? B HIS 117 ? B HIS 119 ? 1_555 117.6 ? 
12 NE2 ? B HIS 94  ? B HIS 96  ? 1_555 ZN ? J ZN . ? B ZN 264 ? 1_555 ND1 ? B HIS 117 ? B HIS 119 ? 1_555 102.2 ? 
13 NE2 ? C HIS 92  ? C HIS 94  ? 1_555 ZN ? N ZN . ? C ZN 264 ? 1_555 NE2 ? C HIS 94  ? C HIS 96  ? 1_555 108.6 ? 
14 NE2 ? C HIS 92  ? C HIS 94  ? 1_555 ZN ? N ZN . ? C ZN 264 ? 1_555 ND1 ? C HIS 117 ? C HIS 119 ? 1_555 108.9 ? 
15 NE2 ? C HIS 94  ? C HIS 96  ? 1_555 ZN ? N ZN . ? C ZN 264 ? 1_555 ND1 ? C HIS 117 ? C HIS 119 ? 1_555 101.3 ? 
16 NE2 ? C HIS 92  ? C HIS 94  ? 1_555 ZN ? N ZN . ? C ZN 264 ? 1_555 N24 ? O 9FK .   ? C 9FK 267 ? 1_555 106.6 ? 
17 NE2 ? C HIS 94  ? C HIS 96  ? 1_555 ZN ? N ZN . ? C ZN 264 ? 1_555 N24 ? O 9FK .   ? C 9FK 267 ? 1_555 111.4 ? 
18 ND1 ? C HIS 117 ? C HIS 119 ? 1_555 ZN ? N ZN . ? C ZN 264 ? 1_555 N24 ? O 9FK .   ? C 9FK 267 ? 1_555 119.6 ? 
19 NE2 ? D HIS 94  ? D HIS 96  ? 1_555 ZN ? T ZN . ? D ZN 264 ? 1_555 N24 ? U 9FK .   ? D 9FK 266 ? 1_555 104.7 ? 
20 NE2 ? D HIS 94  ? D HIS 96  ? 1_555 ZN ? T ZN . ? D ZN 264 ? 1_555 S21 ? U 9FK .   ? D 9FK 266 ? 1_555 135.8 ? 
21 N24 ? U 9FK .   ? D 9FK 266 ? 1_555 ZN ? T ZN . ? D ZN 264 ? 1_555 S21 ? U 9FK .   ? D 9FK 266 ? 1_555 31.1  ? 
22 NE2 ? D HIS 94  ? D HIS 96  ? 1_555 ZN ? T ZN . ? D ZN 264 ? 1_555 ND1 ? D HIS 117 ? D HIS 119 ? 1_555 101.1 ? 
23 N24 ? U 9FK .   ? D 9FK 266 ? 1_555 ZN ? T ZN . ? D ZN 264 ? 1_555 ND1 ? D HIS 117 ? D HIS 119 ? 1_555 120.2 ? 
24 S21 ? U 9FK .   ? D 9FK 266 ? 1_555 ZN ? T ZN . ? D ZN 264 ? 1_555 ND1 ? D HIS 117 ? D HIS 119 ? 1_555 104.1 ? 
25 NE2 ? D HIS 94  ? D HIS 96  ? 1_555 ZN ? T ZN . ? D ZN 264 ? 1_555 NE2 ? D HIS 92  ? D HIS 94  ? 1_555 108.8 ? 
26 N24 ? U 9FK .   ? D 9FK 266 ? 1_555 ZN ? T ZN . ? D ZN 264 ? 1_555 NE2 ? D HIS 92  ? D HIS 94  ? 1_555 107.5 ? 
27 S21 ? U 9FK .   ? D 9FK 266 ? 1_555 ZN ? T ZN . ? D ZN 264 ? 1_555 NE2 ? D HIS 92  ? D HIS 94  ? 1_555 93.7  ? 
28 ND1 ? D HIS 117 ? D HIS 119 ? 1_555 ZN ? T ZN . ? D ZN 264 ? 1_555 NE2 ? D HIS 92  ? D HIS 94  ? 1_555 113.5 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-11-11 
2 'Structure model' 1 1 2015-12-09 
3 'Structure model' 1 2 2018-01-17 
4 'Structure model' 1 3 2019-01-30 
5 'Structure model' 1 4 2019-02-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'      
2 3 'Structure model' 'Data collection'          
3 4 'Structure model' 'Data collection'          
4 4 'Structure model' 'Experimental preparation' 
5 5 'Structure model' 'Data collection'          
6 5 'Structure model' 'Experimental preparation' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' diffrn_source      
2 4 'Structure model' exptl_crystal_grow 
3 5 'Structure model' exptl_crystal_grow 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 
2 4 'Structure model' '_exptl_crystal_grow.method'           
3 5 'Structure model' '_exptl_crystal_grow.temp'             
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
REFMAC refinement       5.8.0103 ? 1 ? ? ? ? 
MOSFLM 'data reduction' .        ? 2 ? ? ? ? 
SCALA  'data scaling'   .        ? 3 ? ? ? ? 
MOLREP phasing          .        ? 4 ? ? ? ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    2206 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    2207 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.41 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     2061 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     2061 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   3_555 
_pdbx_validate_symm_contact.dist              0.75 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA B 100 ? ? -35.71  92.86  
2 1 GLU B 110 ? ? 39.23   42.42  
3 1 ALA D 100 ? ? -39.32  110.11 
4 1 GLU D 110 ? ? 38.40   41.37  
5 1 ASP D 236 ? ? -102.85 57.99  
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 2123 ? 5.85 . 
2 1 O ? A HOH 2138 ? 6.60 . 
3 1 O ? C HOH 2017 ? 6.58 . 
4 1 O ? D HOH 2013 ? 5.91 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 165 ? CG  ? A GLU 163 CG  
2  1 Y 1 A GLU 165 ? CD  ? A GLU 163 CD  
3  1 Y 1 A GLU 165 ? OE1 ? A GLU 163 OE1 
4  1 Y 1 A GLU 165 ? OE2 ? A GLU 163 OE2 
5  1 Y 1 A ASP 236 ? CG  ? A ASP 234 CG  
6  1 Y 1 A ASP 236 ? OD1 ? A ASP 234 OD1 
7  1 Y 1 A ASP 236 ? OD2 ? A ASP 234 OD2 
8  1 Y 1 B ARG 10  ? CG  ? B ARG 8   CG  
9  1 Y 1 B ARG 10  ? CD  ? B ARG 8   CD  
10 1 Y 1 B ARG 10  ? NE  ? B ARG 8   NE  
11 1 Y 1 B ARG 10  ? CZ  ? B ARG 8   CZ  
12 1 Y 1 B ARG 10  ? NH1 ? B ARG 8   NH1 
13 1 Y 1 B ARG 10  ? NH2 ? B ARG 8   NH2 
14 1 Y 1 B GLU 169 ? CG  ? B GLU 167 CG  
15 1 Y 1 B GLU 169 ? CD  ? B GLU 167 CD  
16 1 Y 1 B GLU 169 ? OE1 ? B GLU 167 OE1 
17 1 Y 1 B GLU 169 ? OE2 ? B GLU 167 OE2 
18 1 Y 1 B LYS 222 ? CG  ? B LYS 220 CG  
19 1 Y 1 B LYS 222 ? CD  ? B LYS 220 CD  
20 1 Y 1 B LYS 222 ? CE  ? B LYS 220 CE  
21 1 Y 1 B LYS 222 ? NZ  ? B LYS 220 NZ  
22 1 Y 1 B ASP 236 ? CG  ? B ASP 234 CG  
23 1 Y 1 B ASP 236 ? OD1 ? B ASP 234 OD1 
24 1 Y 1 B ASP 236 ? OD2 ? B ASP 234 OD2 
25 1 Y 1 C GLN 37  ? CG  ? C GLN 35  CG  
26 1 Y 1 C GLN 37  ? CD  ? C GLN 35  CD  
27 1 Y 1 C GLN 37  ? OE1 ? C GLN 35  OE1 
28 1 Y 1 C GLN 37  ? NE2 ? C GLN 35  NE2 
29 1 Y 1 C GLU 152 ? CG  ? C GLU 150 CG  
30 1 Y 1 C GLU 152 ? CD  ? C GLU 150 CD  
31 1 Y 1 C GLU 152 ? OE1 ? C GLU 150 OE1 
32 1 Y 1 C GLU 152 ? OE2 ? C GLU 150 OE2 
33 1 Y 1 C ASP 236 ? CG  ? C ASP 234 CG  
34 1 Y 1 C ASP 236 ? OD1 ? C ASP 234 OD1 
35 1 Y 1 C ASP 236 ? OD2 ? C ASP 234 OD2 
36 1 Y 1 D ARG 10  ? CG  ? D ARG 8   CG  
37 1 Y 1 D ARG 10  ? CD  ? D ARG 8   CD  
38 1 Y 1 D ARG 10  ? NE  ? D ARG 8   NE  
39 1 Y 1 D ARG 10  ? CZ  ? D ARG 8   CZ  
40 1 Y 1 D ARG 10  ? NH1 ? D ARG 8   NH1 
41 1 Y 1 D ARG 10  ? NH2 ? D ARG 8   NH2 
42 1 Y 1 D ARG 19  ? CG  ? D ARG 17  CG  
43 1 Y 1 D ARG 19  ? CD  ? D ARG 17  CD  
44 1 Y 1 D ARG 19  ? NE  ? D ARG 17  NE  
45 1 Y 1 D ARG 19  ? CZ  ? D ARG 17  CZ  
46 1 Y 1 D ARG 19  ? NH1 ? D ARG 17  NH1 
47 1 Y 1 D ARG 19  ? NH2 ? D ARG 17  NH2 
48 1 Y 1 D GLU 169 ? CG  ? D GLU 167 CG  
49 1 Y 1 D GLU 169 ? CD  ? D GLU 167 CD  
50 1 Y 1 D GLU 169 ? OE1 ? D GLU 167 OE1 
51 1 Y 1 D GLU 169 ? OE2 ? D GLU 167 OE2 
52 1 Y 1 D ASP 236 ? CG  ? D ASP 234 CG  
53 1 Y 1 D ASP 236 ? OD1 ? D ASP 234 OD1 
54 1 Y 1 D ASP 236 ? OD2 ? D ASP 234 OD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 3 ? A GLY 1 
2  1 Y 1 A PRO 4 ? A PRO 2 
3  1 Y 1 A ASP 5 ? A ASP 3 
4  1 Y 1 A GLN 6 ? A GLN 4 
5  1 Y 1 A SER 7 ? A SER 5 
6  1 Y 1 A HIS 8 ? A HIS 6 
7  1 Y 1 B GLY 3 ? B GLY 1 
8  1 Y 1 B PRO 4 ? B PRO 2 
9  1 Y 1 B ASP 5 ? B ASP 3 
10 1 Y 1 B GLN 6 ? B GLN 4 
11 1 Y 1 B SER 7 ? B SER 5 
12 1 Y 1 B HIS 8 ? B HIS 6 
13 1 Y 1 C GLY 3 ? C GLY 1 
14 1 Y 1 C PRO 4 ? C PRO 2 
15 1 Y 1 C ASP 5 ? C ASP 3 
16 1 Y 1 C GLN 6 ? C GLN 4 
17 1 Y 1 C SER 7 ? C SER 5 
18 1 Y 1 C HIS 8 ? C HIS 6 
19 1 Y 1 D GLY 3 ? D GLY 1 
20 1 Y 1 D PRO 4 ? D PRO 2 
21 1 Y 1 D ASP 5 ? D ASP 3 
22 1 Y 1 D GLN 6 ? D GLN 4 
23 1 Y 1 D SER 7 ? D SER 5 
24 1 Y 1 D HIS 8 ? D HIS 6 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'                                                        ZN  
3 '5-(1-naphthalen-1-yl-1,2,3-triazol-4-yl)thiophene-2-sulfonamide' 9FK 
4 GLYCEROL                                                          GOL 
5 'ACETIC ACID'                                                     ACY 
6 water                                                             HOH 
#