data_5FLM
# 
_entry.id   5FLM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.318 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5FLM         
PDBE  EBI-65382    
WWPDB D_1290065382 
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.db_id          EMD-3218 
_pdbx_database_related.content_type   'associated EM volume' 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        5FLM 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2015-10-26 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bernecky, C.'   1 
'Herzog, F.'     2 
'Baumeister, W.' 3 
'Plitzko, J.M.'  4 
'Cramer, P.'     5 
# 
_citation.id                        primary 
_citation.title                     'Structure of Transcribing Mammalian RNA Polymerase II' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            529 
_citation.page_first                551 
_citation.page_last                 ? 
_citation.year                      2016 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26789250 
_citation.pdbx_database_id_DOI      10.1038/NATURE16482 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bernecky, C.'   1 ? 
primary 'Herzog, F.'     2 ? 
primary 'Baumeister, W.' 3 ? 
primary 'Plitzko, J.M.'  4 ? 
primary 'Cramer, P.'     5 ? 
# 
_cell.entry_id           5FLM 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5FLM 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-DIRECTED RNA POLYMERASE'                                217436.062 1 2.7.7.6 ? ? ? 
2  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB2'                134041.422 1 2.7.7.6 ? ? ? 
3  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB3'                31466.098  1 ?       ? ? ? 
4  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB4'                16347.255  1 ?       ? ? ? 
5  polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC1' 24514.219  1 ?       ? ? ? 
6  polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC2' 14491.026  1 ?       ? ? ? 
7  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB7'                19314.283  1 ?       ? ? ? 
8  polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC3' 17162.273  1 ?       ? ? ? 
9  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB9'                14507.205  1 ?       ? ? ? 
10 polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC5' 7655.123   1 ?       ? ? ? 
11 polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB11'               13310.284  1 ?       ? ? ? 
12 polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC4' 7018.244   1 ?       ? ? ? 
13 polymer     syn 'DNA, DNA-RNA ELONGATION SCAFFOLD'                           12085.806  1 ?       ? ? ? 
14 polymer     syn 'RNA, DNA-RNA ELONGATION SCAFFOLD'                           6414.902   1 ?       ? ? ? 
15 polymer     syn 'DNA, DNA-RNA ELONGATION SCAFFOLD'                           11942.696  1 ?       ? ? ? 
16 non-polymer syn 'ZINC ION'                                                   65.409     8 ?       ? ? ? 
17 non-polymer syn 'MAGNESIUM ION'                                              24.305     1 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
2  
;DNA-DIRECTED RNA POLYMERASE II 140 KDA POLYPEPTIDE, DNA-DIRECTED RNA POLYMERASE II SUBUNIT B, RNA POLYMERASE II SUBUNIT 2, RNA POLYMERASE II SUBUNIT B2
;
3  'RNA POLYMERASE II SUBUNIT B3, DNA-DIRECTED RNA POLYMERASE II SUBUNIT C' 
4  'RNA POLYMERASE II SUBUNIT B4, DNA-DIRECTED RNA POLYMERASE II SUBUNIT D, RNA POLYMERASE II 16 KDA SUBUNIT, RPB16' 
5  'RNA POLYMERASES I, II, AND III SUBUNIT ABC1, DNA-DIRECTED RNA POLYMERASE II SUBUNIT E, RPB5 HOMOLOG' 
6  'RNA POLYMERASES I, II, AND III SUBUNIT ABC2, DNA-DIRECTED RNA POLYMERASE II SUBUNIT F, RPB6 HOMOLOG' 
7  'RNA POLYMERASE II SUBUNIT B7, DNA-DIRECTED RNA POLYMERASE II SUBUNIT G' 
8  
;RNA POLYMERASES I, II, AND III SUBUNIT ABC3, DNA-DIRECTED RNA POLYMERASE II SUBUNIT H, DNA-DIRECTED RNA POLYMERASES I, AND III 17.1 KDA POLYPEPTIDE, RPB17, RPB8 HOMOLOG, HRPB8
;
9  'RNA POLYMERASE II SUBUNIT B9, DNA-DIRECTED RNA POLYMERASE II SUBUNIT I' 
10 'RNA POLYMERASES I, II, AND III SUBUNIT ABC5, DNA-DIRECTED RNA POLYMERASE III SUBUNIT L' 
11 'RNA POLYMERASE II SUBUNIT B11, DNA-DIRECTED RNA POLYMERASE II SUBUNIT J' 
12 'RNA POLYMERASES I, II, AND III SUBUNIT ABC4, DNA-DIRECTED RNA POLYMERASE II SUBUNIT K' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'        no no 
;MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTE
CPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEM
DNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDN
ELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNID
RLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEV
MNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGIL
CKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPF
GFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVR
NSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLL
FNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLG
VPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMD
DDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSN
DIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPW
NQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAY
EPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSP
SYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYT
PTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDDEN
;
;MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTE
CPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEM
DNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDN
ELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNID
RLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEV
MNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGIL
CKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPF
GFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVR
NSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLL
FNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLG
VPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMD
DDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSN
DIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPW
NQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAY
EPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSP
SYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYT
PTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDDEN
;
A ? 
2  'polypeptide(L)'        no no 
;MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEE
PPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTY
CLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNF
IGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLL
AFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAA
IADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHI
DQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSA
VDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDEL
EGTNRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQ
IFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCN
LCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV
;
;MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEE
PPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTY
CLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNF
IGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLL
AFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAA
IADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHI
DQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSA
VDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDEL
EGTNRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQ
IFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCN
LCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV
;
B ? 
3  'polypeptide(L)'        no no 
;MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGLIPLTSDDIVD
KLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPNDYVEQDDILIVKLRKGQELR
LRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN
;
;MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGLIPLTSDDIVD
KLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPNDYVEQDDILIVKLRKGQELR
LRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN
;
C ? 
4  'polypeptide(L)'        no no 
;MAAGGSDPRSGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETI
ASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
;
;MAAGGSDPRSGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETI
ASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
;
D ? 
5  'polypeptide(L)'        no no 
;MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDGLDQTLEEFKAQFGGKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEP
KVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELL
ARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ
;
;MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDGLDQTLEEFKAQFGGKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEP
KVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELL
ARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ
;
E ? 
6  'polypeptide(L)'        no no 
;MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVM
VELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
;
;MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVM
VELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
;
F ? 
7  'polypeptide(L)'        no no 
;MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPF
KGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAI
GSLMDDYLGLVS
;
;MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPF
KGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAI
GSLMDDYLGLVS
;
G ? 
8  'polypeptide(L)'        no no 
;MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDD
RPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
;
;MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDD
RPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
;
H ? 
9  'polypeptide(L)'        no no 
;MEPDGTYEPGIVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEVDELTQIIADVSQDPTLPR
TEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE
;
;MEPDGTYEPGIVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEVDELTQIIADVSQDPTLPR
TEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE
;
I ? 
10 'polypeptide(L)'        no no MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK 
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK J ? 
11 'polypeptide(L)'        no no 
;MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPD
YSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
;
;MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPD
YSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
;
K ? 
12 'polypeptide(L)'        no no MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR 
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR L ? 
13 polydeoxyribonucleotide no no 
;(DG)(DG)(DC)(DA)(DG)(DT)(DA)(DC)(DT)(DA)(DG)(DT)(DA)(DA)(DA)(DC)(DT)(DA)(DG)(DT)
(DA)(DT)(DT)(DG)(DA)(DA)(DA)(DG)(DT)(DA)(DC)(DT)(DT)(DG)(DA)(DG)(DC)(DT)(DT)
;
GGCAGTACTAGTAAACTAGTATTGAAAGTACTTGAGCTT N ? 
14 polyribonucleotide      no no UAUAUGCAUAAAGACCAGGC UAUAUGCAUAAAGACCAGGC P ? 
15 polydeoxyribonucleotide no no 
;(DA)(DA)(DG)(DC)(DT)(DC)(DA)(DA)(DG)(DT)(DA)(DC)(DT)(DT)(DA)(DA)(DG)(DC)(DC)(DT)
(DG)(DG)(DT)(DC)(DA)(DT)(DT)(DA)(DC)(DT)(DA)(DG)(DT)(DA)(DC)(DT)(DG)(DC)(DC)
;
AAGCTCAAGTACTTAAGCCTGGTCATTACTAGTACTGCC T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    HIS n 
1  3    GLY n 
1  4    GLY n 
1  5    GLY n 
1  6    PRO n 
1  7    PRO n 
1  8    SER n 
1  9    GLY n 
1  10   ASP n 
1  11   SER n 
1  12   ALA n 
1  13   CYS n 
1  14   PRO n 
1  15   LEU n 
1  16   ARG n 
1  17   THR n 
1  18   ILE n 
1  19   LYS n 
1  20   ARG n 
1  21   VAL n 
1  22   GLN n 
1  23   PHE n 
1  24   GLY n 
1  25   VAL n 
1  26   LEU n 
1  27   SER n 
1  28   PRO n 
1  29   ASP n 
1  30   GLU n 
1  31   LEU n 
1  32   LYS n 
1  33   ARG n 
1  34   MET n 
1  35   SER n 
1  36   VAL n 
1  37   THR n 
1  38   GLU n 
1  39   GLY n 
1  40   GLY n 
1  41   ILE n 
1  42   LYS n 
1  43   TYR n 
1  44   PRO n 
1  45   GLU n 
1  46   THR n 
1  47   THR n 
1  48   GLU n 
1  49   GLY n 
1  50   GLY n 
1  51   ARG n 
1  52   PRO n 
1  53   LYS n 
1  54   LEU n 
1  55   GLY n 
1  56   GLY n 
1  57   LEU n 
1  58   MET n 
1  59   ASP n 
1  60   PRO n 
1  61   ARG n 
1  62   GLN n 
1  63   GLY n 
1  64   VAL n 
1  65   ILE n 
1  66   GLU n 
1  67   ARG n 
1  68   THR n 
1  69   GLY n 
1  70   ARG n 
1  71   CYS n 
1  72   GLN n 
1  73   THR n 
1  74   CYS n 
1  75   ALA n 
1  76   GLY n 
1  77   ASN n 
1  78   MET n 
1  79   THR n 
1  80   GLU n 
1  81   CYS n 
1  82   PRO n 
1  83   GLY n 
1  84   HIS n 
1  85   PHE n 
1  86   GLY n 
1  87   HIS n 
1  88   ILE n 
1  89   GLU n 
1  90   LEU n 
1  91   ALA n 
1  92   LYS n 
1  93   PRO n 
1  94   VAL n 
1  95   PHE n 
1  96   HIS n 
1  97   VAL n 
1  98   GLY n 
1  99   PHE n 
1  100  LEU n 
1  101  VAL n 
1  102  LYS n 
1  103  THR n 
1  104  MET n 
1  105  LYS n 
1  106  VAL n 
1  107  LEU n 
1  108  ARG n 
1  109  CYS n 
1  110  VAL n 
1  111  CYS n 
1  112  PHE n 
1  113  PHE n 
1  114  CYS n 
1  115  SER n 
1  116  LYS n 
1  117  LEU n 
1  118  LEU n 
1  119  VAL n 
1  120  ASP n 
1  121  SER n 
1  122  ASN n 
1  123  ASN n 
1  124  PRO n 
1  125  LYS n 
1  126  ILE n 
1  127  LYS n 
1  128  ASP n 
1  129  ILE n 
1  130  LEU n 
1  131  ALA n 
1  132  LYS n 
1  133  SER n 
1  134  LYS n 
1  135  GLY n 
1  136  GLN n 
1  137  PRO n 
1  138  LYS n 
1  139  LYS n 
1  140  ARG n 
1  141  LEU n 
1  142  THR n 
1  143  HIS n 
1  144  VAL n 
1  145  TYR n 
1  146  ASP n 
1  147  LEU n 
1  148  CYS n 
1  149  LYS n 
1  150  GLY n 
1  151  LYS n 
1  152  ASN n 
1  153  ILE n 
1  154  CYS n 
1  155  GLU n 
1  156  GLY n 
1  157  GLY n 
1  158  GLU n 
1  159  GLU n 
1  160  MET n 
1  161  ASP n 
1  162  ASN n 
1  163  LYS n 
1  164  PHE n 
1  165  GLY n 
1  166  VAL n 
1  167  GLU n 
1  168  GLN n 
1  169  PRO n 
1  170  GLU n 
1  171  GLY n 
1  172  ASP n 
1  173  GLU n 
1  174  ASP n 
1  175  LEU n 
1  176  THR n 
1  177  LYS n 
1  178  GLU n 
1  179  LYS n 
1  180  GLY n 
1  181  HIS n 
1  182  GLY n 
1  183  GLY n 
1  184  CYS n 
1  185  GLY n 
1  186  ARG n 
1  187  TYR n 
1  188  GLN n 
1  189  PRO n 
1  190  ARG n 
1  191  ILE n 
1  192  ARG n 
1  193  ARG n 
1  194  SER n 
1  195  GLY n 
1  196  LEU n 
1  197  GLU n 
1  198  LEU n 
1  199  TYR n 
1  200  ALA n 
1  201  GLU n 
1  202  TRP n 
1  203  LYS n 
1  204  HIS n 
1  205  VAL n 
1  206  ASN n 
1  207  GLU n 
1  208  ASP n 
1  209  SER n 
1  210  GLN n 
1  211  GLU n 
1  212  LYS n 
1  213  LYS n 
1  214  ILE n 
1  215  LEU n 
1  216  LEU n 
1  217  SER n 
1  218  PRO n 
1  219  GLU n 
1  220  ARG n 
1  221  VAL n 
1  222  HIS n 
1  223  GLU n 
1  224  ILE n 
1  225  PHE n 
1  226  LYS n 
1  227  ARG n 
1  228  ILE n 
1  229  SER n 
1  230  ASP n 
1  231  GLU n 
1  232  GLU n 
1  233  CYS n 
1  234  PHE n 
1  235  VAL n 
1  236  LEU n 
1  237  GLY n 
1  238  MET n 
1  239  GLU n 
1  240  PRO n 
1  241  ARG n 
1  242  TYR n 
1  243  ALA n 
1  244  ARG n 
1  245  PRO n 
1  246  GLU n 
1  247  TRP n 
1  248  MET n 
1  249  ILE n 
1  250  VAL n 
1  251  THR n 
1  252  VAL n 
1  253  LEU n 
1  254  PRO n 
1  255  VAL n 
1  256  PRO n 
1  257  PRO n 
1  258  LEU n 
1  259  SER n 
1  260  VAL n 
1  261  ARG n 
1  262  PRO n 
1  263  ALA n 
1  264  VAL n 
1  265  VAL n 
1  266  MET n 
1  267  GLN n 
1  268  GLY n 
1  269  SER n 
1  270  ALA n 
1  271  ARG n 
1  272  ASN n 
1  273  GLN n 
1  274  ASP n 
1  275  ASP n 
1  276  LEU n 
1  277  THR n 
1  278  HIS n 
1  279  LYS n 
1  280  LEU n 
1  281  ALA n 
1  282  ASP n 
1  283  ILE n 
1  284  VAL n 
1  285  LYS n 
1  286  ILE n 
1  287  ASN n 
1  288  ASN n 
1  289  GLN n 
1  290  LEU n 
1  291  ARG n 
1  292  ARG n 
1  293  ASN n 
1  294  GLU n 
1  295  GLN n 
1  296  ASN n 
1  297  GLY n 
1  298  ALA n 
1  299  ALA n 
1  300  ALA n 
1  301  HIS n 
1  302  VAL n 
1  303  ILE n 
1  304  ALA n 
1  305  GLU n 
1  306  ASP n 
1  307  VAL n 
1  308  LYS n 
1  309  LEU n 
1  310  LEU n 
1  311  GLN n 
1  312  PHE n 
1  313  HIS n 
1  314  VAL n 
1  315  ALA n 
1  316  THR n 
1  317  MET n 
1  318  VAL n 
1  319  ASP n 
1  320  ASN n 
1  321  GLU n 
1  322  LEU n 
1  323  PRO n 
1  324  GLY n 
1  325  LEU n 
1  326  PRO n 
1  327  ARG n 
1  328  ALA n 
1  329  MET n 
1  330  GLN n 
1  331  LYS n 
1  332  SER n 
1  333  GLY n 
1  334  ARG n 
1  335  PRO n 
1  336  LEU n 
1  337  LYS n 
1  338  SER n 
1  339  LEU n 
1  340  LYS n 
1  341  GLN n 
1  342  ARG n 
1  343  LEU n 
1  344  LYS n 
1  345  GLY n 
1  346  LYS n 
1  347  GLU n 
1  348  GLY n 
1  349  ARG n 
1  350  VAL n 
1  351  ARG n 
1  352  GLY n 
1  353  ASN n 
1  354  LEU n 
1  355  MET n 
1  356  GLY n 
1  357  LYS n 
1  358  ARG n 
1  359  VAL n 
1  360  ASP n 
1  361  PHE n 
1  362  SER n 
1  363  ALA n 
1  364  ARG n 
1  365  THR n 
1  366  VAL n 
1  367  ILE n 
1  368  THR n 
1  369  PRO n 
1  370  ASP n 
1  371  PRO n 
1  372  ASN n 
1  373  LEU n 
1  374  SER n 
1  375  ILE n 
1  376  ASP n 
1  377  GLN n 
1  378  VAL n 
1  379  GLY n 
1  380  VAL n 
1  381  PRO n 
1  382  ARG n 
1  383  SER n 
1  384  ILE n 
1  385  ALA n 
1  386  ALA n 
1  387  ASN n 
1  388  MET n 
1  389  THR n 
1  390  PHE n 
1  391  ALA n 
1  392  GLU n 
1  393  ILE n 
1  394  VAL n 
1  395  THR n 
1  396  PRO n 
1  397  PHE n 
1  398  ASN n 
1  399  ILE n 
1  400  ASP n 
1  401  ARG n 
1  402  LEU n 
1  403  GLN n 
1  404  GLU n 
1  405  LEU n 
1  406  VAL n 
1  407  ARG n 
1  408  ARG n 
1  409  GLY n 
1  410  ASN n 
1  411  SER n 
1  412  GLN n 
1  413  TYR n 
1  414  PRO n 
1  415  GLY n 
1  416  ALA n 
1  417  LYS n 
1  418  TYR n 
1  419  ILE n 
1  420  ILE n 
1  421  ARG n 
1  422  ASP n 
1  423  ASN n 
1  424  GLY n 
1  425  ASP n 
1  426  ARG n 
1  427  ILE n 
1  428  ASP n 
1  429  LEU n 
1  430  ARG n 
1  431  PHE n 
1  432  HIS n 
1  433  PRO n 
1  434  LYS n 
1  435  PRO n 
1  436  SER n 
1  437  ASP n 
1  438  LEU n 
1  439  HIS n 
1  440  LEU n 
1  441  GLN n 
1  442  THR n 
1  443  GLY n 
1  444  TYR n 
1  445  LYS n 
1  446  VAL n 
1  447  GLU n 
1  448  ARG n 
1  449  HIS n 
1  450  MET n 
1  451  CYS n 
1  452  ASP n 
1  453  GLY n 
1  454  ASP n 
1  455  ILE n 
1  456  VAL n 
1  457  ILE n 
1  458  PHE n 
1  459  ASN n 
1  460  ARG n 
1  461  GLN n 
1  462  PRO n 
1  463  THR n 
1  464  LEU n 
1  465  HIS n 
1  466  LYS n 
1  467  MET n 
1  468  SER n 
1  469  MET n 
1  470  MET n 
1  471  GLY n 
1  472  HIS n 
1  473  ARG n 
1  474  VAL n 
1  475  ARG n 
1  476  ILE n 
1  477  LEU n 
1  478  PRO n 
1  479  TRP n 
1  480  SER n 
1  481  THR n 
1  482  PHE n 
1  483  ARG n 
1  484  LEU n 
1  485  ASN n 
1  486  LEU n 
1  487  SER n 
1  488  VAL n 
1  489  THR n 
1  490  THR n 
1  491  PRO n 
1  492  TYR n 
1  493  ASN n 
1  494  ALA n 
1  495  ASP n 
1  496  PHE n 
1  497  ASP n 
1  498  GLY n 
1  499  ASP n 
1  500  GLU n 
1  501  MET n 
1  502  ASN n 
1  503  LEU n 
1  504  HIS n 
1  505  LEU n 
1  506  PRO n 
1  507  GLN n 
1  508  SER n 
1  509  LEU n 
1  510  GLU n 
1  511  THR n 
1  512  ARG n 
1  513  ALA n 
1  514  GLU n 
1  515  ILE n 
1  516  GLN n 
1  517  GLU n 
1  518  LEU n 
1  519  ALA n 
1  520  MET n 
1  521  VAL n 
1  522  PRO n 
1  523  ARG n 
1  524  MET n 
1  525  ILE n 
1  526  VAL n 
1  527  THR n 
1  528  PRO n 
1  529  GLN n 
1  530  SER n 
1  531  ASN n 
1  532  ARG n 
1  533  PRO n 
1  534  VAL n 
1  535  MET n 
1  536  GLY n 
1  537  ILE n 
1  538  VAL n 
1  539  GLN n 
1  540  ASP n 
1  541  THR n 
1  542  LEU n 
1  543  THR n 
1  544  ALA n 
1  545  VAL n 
1  546  ARG n 
1  547  LYS n 
1  548  PHE n 
1  549  THR n 
1  550  LYS n 
1  551  ARG n 
1  552  ASP n 
1  553  VAL n 
1  554  PHE n 
1  555  LEU n 
1  556  GLU n 
1  557  ARG n 
1  558  GLY n 
1  559  GLU n 
1  560  VAL n 
1  561  MET n 
1  562  ASN n 
1  563  LEU n 
1  564  LEU n 
1  565  MET n 
1  566  PHE n 
1  567  LEU n 
1  568  SER n 
1  569  THR n 
1  570  TRP n 
1  571  ASP n 
1  572  GLY n 
1  573  LYS n 
1  574  VAL n 
1  575  PRO n 
1  576  GLN n 
1  577  PRO n 
1  578  ALA n 
1  579  ILE n 
1  580  LEU n 
1  581  LYS n 
1  582  PRO n 
1  583  ARG n 
1  584  PRO n 
1  585  LEU n 
1  586  TRP n 
1  587  THR n 
1  588  GLY n 
1  589  LYS n 
1  590  GLN n 
1  591  ILE n 
1  592  PHE n 
1  593  SER n 
1  594  LEU n 
1  595  ILE n 
1  596  ILE n 
1  597  PRO n 
1  598  GLY n 
1  599  HIS n 
1  600  ILE n 
1  601  ASN n 
1  602  CYS n 
1  603  ILE n 
1  604  ARG n 
1  605  THR n 
1  606  HIS n 
1  607  SER n 
1  608  THR n 
1  609  HIS n 
1  610  PRO n 
1  611  ASP n 
1  612  ASP n 
1  613  GLU n 
1  614  ASP n 
1  615  SER n 
1  616  GLY n 
1  617  PRO n 
1  618  TYR n 
1  619  LYS n 
1  620  HIS n 
1  621  ILE n 
1  622  SER n 
1  623  PRO n 
1  624  GLY n 
1  625  ASP n 
1  626  THR n 
1  627  LYS n 
1  628  VAL n 
1  629  VAL n 
1  630  VAL n 
1  631  GLU n 
1  632  ASN n 
1  633  GLY n 
1  634  GLU n 
1  635  LEU n 
1  636  ILE n 
1  637  MET n 
1  638  GLY n 
1  639  ILE n 
1  640  LEU n 
1  641  CYS n 
1  642  LYS n 
1  643  LYS n 
1  644  SER n 
1  645  LEU n 
1  646  GLY n 
1  647  THR n 
1  648  SER n 
1  649  ALA n 
1  650  GLY n 
1  651  SER n 
1  652  LEU n 
1  653  VAL n 
1  654  HIS n 
1  655  ILE n 
1  656  SER n 
1  657  TYR n 
1  658  LEU n 
1  659  GLU n 
1  660  MET n 
1  661  GLY n 
1  662  HIS n 
1  663  ASP n 
1  664  ILE n 
1  665  THR n 
1  666  ARG n 
1  667  LEU n 
1  668  PHE n 
1  669  TYR n 
1  670  SER n 
1  671  ASN n 
1  672  ILE n 
1  673  GLN n 
1  674  THR n 
1  675  VAL n 
1  676  ILE n 
1  677  ASN n 
1  678  ASN n 
1  679  TRP n 
1  680  LEU n 
1  681  LEU n 
1  682  ILE n 
1  683  GLU n 
1  684  GLY n 
1  685  HIS n 
1  686  THR n 
1  687  ILE n 
1  688  GLY n 
1  689  ILE n 
1  690  GLY n 
1  691  ASP n 
1  692  SER n 
1  693  ILE n 
1  694  ALA n 
1  695  ASP n 
1  696  SER n 
1  697  LYS n 
1  698  THR n 
1  699  TYR n 
1  700  GLN n 
1  701  ASP n 
1  702  ILE n 
1  703  GLN n 
1  704  ASN n 
1  705  THR n 
1  706  ILE n 
1  707  LYS n 
1  708  LYS n 
1  709  ALA n 
1  710  LYS n 
1  711  GLN n 
1  712  ASP n 
1  713  VAL n 
1  714  ILE n 
1  715  GLU n 
1  716  VAL n 
1  717  ILE n 
1  718  GLU n 
1  719  LYS n 
1  720  ALA n 
1  721  HIS n 
1  722  ASN n 
1  723  ASN n 
1  724  GLU n 
1  725  LEU n 
1  726  GLU n 
1  727  PRO n 
1  728  THR n 
1  729  PRO n 
1  730  GLY n 
1  731  ASN n 
1  732  THR n 
1  733  LEU n 
1  734  ARG n 
1  735  GLN n 
1  736  THR n 
1  737  PHE n 
1  738  GLU n 
1  739  ASN n 
1  740  GLN n 
1  741  VAL n 
1  742  ASN n 
1  743  ARG n 
1  744  ILE n 
1  745  LEU n 
1  746  ASN n 
1  747  ASP n 
1  748  ALA n 
1  749  ARG n 
1  750  ASP n 
1  751  LYS n 
1  752  THR n 
1  753  GLY n 
1  754  SER n 
1  755  SER n 
1  756  ALA n 
1  757  GLN n 
1  758  LYS n 
1  759  SER n 
1  760  LEU n 
1  761  SER n 
1  762  GLU n 
1  763  TYR n 
1  764  ASN n 
1  765  ASN n 
1  766  PHE n 
1  767  LYS n 
1  768  SER n 
1  769  MET n 
1  770  VAL n 
1  771  VAL n 
1  772  SER n 
1  773  GLY n 
1  774  ALA n 
1  775  LYS n 
1  776  GLY n 
1  777  SER n 
1  778  LYS n 
1  779  ILE n 
1  780  ASN n 
1  781  ILE n 
1  782  SER n 
1  783  GLN n 
1  784  VAL n 
1  785  ILE n 
1  786  ALA n 
1  787  VAL n 
1  788  VAL n 
1  789  GLY n 
1  790  GLN n 
1  791  GLN n 
1  792  ASN n 
1  793  VAL n 
1  794  GLU n 
1  795  GLY n 
1  796  LYS n 
1  797  ARG n 
1  798  ILE n 
1  799  PRO n 
1  800  PHE n 
1  801  GLY n 
1  802  PHE n 
1  803  LYS n 
1  804  HIS n 
1  805  ARG n 
1  806  THR n 
1  807  LEU n 
1  808  PRO n 
1  809  HIS n 
1  810  PHE n 
1  811  ILE n 
1  812  LYS n 
1  813  ASP n 
1  814  ASP n 
1  815  TYR n 
1  816  GLY n 
1  817  PRO n 
1  818  GLU n 
1  819  SER n 
1  820  ARG n 
1  821  GLY n 
1  822  PHE n 
1  823  VAL n 
1  824  GLU n 
1  825  ASN n 
1  826  SER n 
1  827  TYR n 
1  828  LEU n 
1  829  ALA n 
1  830  GLY n 
1  831  LEU n 
1  832  THR n 
1  833  PRO n 
1  834  THR n 
1  835  GLU n 
1  836  PHE n 
1  837  PHE n 
1  838  PHE n 
1  839  HIS n 
1  840  ALA n 
1  841  MET n 
1  842  GLY n 
1  843  GLY n 
1  844  ARG n 
1  845  GLU n 
1  846  GLY n 
1  847  LEU n 
1  848  ILE n 
1  849  ASP n 
1  850  THR n 
1  851  ALA n 
1  852  VAL n 
1  853  LYS n 
1  854  THR n 
1  855  ALA n 
1  856  GLU n 
1  857  THR n 
1  858  GLY n 
1  859  TYR n 
1  860  ILE n 
1  861  GLN n 
1  862  ARG n 
1  863  ARG n 
1  864  LEU n 
1  865  ILE n 
1  866  LYS n 
1  867  SER n 
1  868  MET n 
1  869  GLU n 
1  870  SER n 
1  871  VAL n 
1  872  MET n 
1  873  VAL n 
1  874  LYS n 
1  875  TYR n 
1  876  ASP n 
1  877  ALA n 
1  878  THR n 
1  879  VAL n 
1  880  ARG n 
1  881  ASN n 
1  882  SER n 
1  883  ILE n 
1  884  ASN n 
1  885  GLN n 
1  886  VAL n 
1  887  VAL n 
1  888  GLN n 
1  889  LEU n 
1  890  ARG n 
1  891  TYR n 
1  892  GLY n 
1  893  GLU n 
1  894  ASP n 
1  895  GLY n 
1  896  LEU n 
1  897  ALA n 
1  898  GLY n 
1  899  GLU n 
1  900  SER n 
1  901  VAL n 
1  902  GLU n 
1  903  PHE n 
1  904  GLN n 
1  905  ASN n 
1  906  LEU n 
1  907  ALA n 
1  908  THR n 
1  909  LEU n 
1  910  LYS n 
1  911  PRO n 
1  912  SER n 
1  913  ASN n 
1  914  LYS n 
1  915  ALA n 
1  916  PHE n 
1  917  GLU n 
1  918  LYS n 
1  919  LYS n 
1  920  PHE n 
1  921  ARG n 
1  922  PHE n 
1  923  ASP n 
1  924  TYR n 
1  925  THR n 
1  926  ASN n 
1  927  GLU n 
1  928  ARG n 
1  929  ALA n 
1  930  LEU n 
1  931  ARG n 
1  932  ARG n 
1  933  THR n 
1  934  LEU n 
1  935  GLN n 
1  936  GLU n 
1  937  ASP n 
1  938  LEU n 
1  939  VAL n 
1  940  LYS n 
1  941  ASP n 
1  942  VAL n 
1  943  LEU n 
1  944  SER n 
1  945  ASN n 
1  946  ALA n 
1  947  HIS n 
1  948  ILE n 
1  949  GLN n 
1  950  ASN n 
1  951  GLU n 
1  952  LEU n 
1  953  GLU n 
1  954  ARG n 
1  955  GLU n 
1  956  PHE n 
1  957  GLU n 
1  958  ARG n 
1  959  MET n 
1  960  ARG n 
1  961  GLU n 
1  962  ASP n 
1  963  ARG n 
1  964  GLU n 
1  965  VAL n 
1  966  LEU n 
1  967  ARG n 
1  968  VAL n 
1  969  ILE n 
1  970  PHE n 
1  971  PRO n 
1  972  THR n 
1  973  GLY n 
1  974  ASP n 
1  975  SER n 
1  976  LYS n 
1  977  VAL n 
1  978  VAL n 
1  979  LEU n 
1  980  PRO n 
1  981  CYS n 
1  982  ASN n 
1  983  LEU n 
1  984  LEU n 
1  985  ARG n 
1  986  MET n 
1  987  ILE n 
1  988  TRP n 
1  989  ASN n 
1  990  ALA n 
1  991  GLN n 
1  992  LYS n 
1  993  ILE n 
1  994  PHE n 
1  995  HIS n 
1  996  ILE n 
1  997  ASN n 
1  998  PRO n 
1  999  ARG n 
1  1000 LEU n 
1  1001 PRO n 
1  1002 SER n 
1  1003 ASP n 
1  1004 LEU n 
1  1005 HIS n 
1  1006 PRO n 
1  1007 ILE n 
1  1008 LYS n 
1  1009 VAL n 
1  1010 VAL n 
1  1011 GLU n 
1  1012 GLY n 
1  1013 VAL n 
1  1014 LYS n 
1  1015 GLU n 
1  1016 LEU n 
1  1017 SER n 
1  1018 LYS n 
1  1019 LYS n 
1  1020 LEU n 
1  1021 VAL n 
1  1022 ILE n 
1  1023 VAL n 
1  1024 ASN n 
1  1025 GLY n 
1  1026 ASP n 
1  1027 ASP n 
1  1028 PRO n 
1  1029 LEU n 
1  1030 SER n 
1  1031 ARG n 
1  1032 GLN n 
1  1033 ALA n 
1  1034 GLN n 
1  1035 GLU n 
1  1036 ASN n 
1  1037 ALA n 
1  1038 THR n 
1  1039 LEU n 
1  1040 LEU n 
1  1041 PHE n 
1  1042 ASN n 
1  1043 ILE n 
1  1044 HIS n 
1  1045 LEU n 
1  1046 ARG n 
1  1047 SER n 
1  1048 THR n 
1  1049 LEU n 
1  1050 CYS n 
1  1051 SER n 
1  1052 ARG n 
1  1053 ARG n 
1  1054 MET n 
1  1055 ALA n 
1  1056 GLU n 
1  1057 GLU n 
1  1058 PHE n 
1  1059 ARG n 
1  1060 LEU n 
1  1061 SER n 
1  1062 GLY n 
1  1063 GLU n 
1  1064 ALA n 
1  1065 PHE n 
1  1066 ASP n 
1  1067 TRP n 
1  1068 LEU n 
1  1069 LEU n 
1  1070 GLY n 
1  1071 GLU n 
1  1072 ILE n 
1  1073 GLU n 
1  1074 SER n 
1  1075 LYS n 
1  1076 PHE n 
1  1077 ASN n 
1  1078 GLN n 
1  1079 ALA n 
1  1080 ILE n 
1  1081 ALA n 
1  1082 HIS n 
1  1083 PRO n 
1  1084 GLY n 
1  1085 GLU n 
1  1086 MET n 
1  1087 VAL n 
1  1088 GLY n 
1  1089 ALA n 
1  1090 LEU n 
1  1091 ALA n 
1  1092 ALA n 
1  1093 GLN n 
1  1094 SER n 
1  1095 LEU n 
1  1096 GLY n 
1  1097 GLU n 
1  1098 PRO n 
1  1099 ALA n 
1  1100 THR n 
1  1101 GLN n 
1  1102 MET n 
1  1103 THR n 
1  1104 LEU n 
1  1105 ASN n 
1  1106 THR n 
1  1107 PHE n 
1  1108 HIS n 
1  1109 TYR n 
1  1110 ALA n 
1  1111 GLY n 
1  1112 VAL n 
1  1113 SER n 
1  1114 ALA n 
1  1115 LYS n 
1  1116 ASN n 
1  1117 VAL n 
1  1118 THR n 
1  1119 LEU n 
1  1120 GLY n 
1  1121 VAL n 
1  1122 PRO n 
1  1123 ARG n 
1  1124 LEU n 
1  1125 LYS n 
1  1126 GLU n 
1  1127 LEU n 
1  1128 ILE n 
1  1129 ASN n 
1  1130 ILE n 
1  1131 SER n 
1  1132 LYS n 
1  1133 LYS n 
1  1134 PRO n 
1  1135 LYS n 
1  1136 THR n 
1  1137 PRO n 
1  1138 SER n 
1  1139 LEU n 
1  1140 THR n 
1  1141 VAL n 
1  1142 PHE n 
1  1143 LEU n 
1  1144 LEU n 
1  1145 GLY n 
1  1146 GLN n 
1  1147 SER n 
1  1148 ALA n 
1  1149 ARG n 
1  1150 ASP n 
1  1151 ALA n 
1  1152 GLU n 
1  1153 ARG n 
1  1154 ALA n 
1  1155 LYS n 
1  1156 ASP n 
1  1157 ILE n 
1  1158 LEU n 
1  1159 CYS n 
1  1160 ARG n 
1  1161 LEU n 
1  1162 GLU n 
1  1163 HIS n 
1  1164 THR n 
1  1165 THR n 
1  1166 LEU n 
1  1167 ARG n 
1  1168 LYS n 
1  1169 VAL n 
1  1170 THR n 
1  1171 ALA n 
1  1172 ASN n 
1  1173 THR n 
1  1174 ALA n 
1  1175 ILE n 
1  1176 TYR n 
1  1177 TYR n 
1  1178 ASP n 
1  1179 PRO n 
1  1180 ASN n 
1  1181 PRO n 
1  1182 GLN n 
1  1183 SER n 
1  1184 THR n 
1  1185 VAL n 
1  1186 VAL n 
1  1187 ALA n 
1  1188 GLU n 
1  1189 ASP n 
1  1190 GLN n 
1  1191 GLU n 
1  1192 TRP n 
1  1193 VAL n 
1  1194 ASN n 
1  1195 VAL n 
1  1196 TYR n 
1  1197 TYR n 
1  1198 GLU n 
1  1199 MET n 
1  1200 PRO n 
1  1201 ASP n 
1  1202 PHE n 
1  1203 ASP n 
1  1204 VAL n 
1  1205 ALA n 
1  1206 ARG n 
1  1207 ILE n 
1  1208 SER n 
1  1209 PRO n 
1  1210 TRP n 
1  1211 LEU n 
1  1212 LEU n 
1  1213 ARG n 
1  1214 VAL n 
1  1215 GLU n 
1  1216 LEU n 
1  1217 ASP n 
1  1218 ARG n 
1  1219 LYS n 
1  1220 HIS n 
1  1221 MET n 
1  1222 THR n 
1  1223 ASP n 
1  1224 ARG n 
1  1225 LYS n 
1  1226 LEU n 
1  1227 THR n 
1  1228 MET n 
1  1229 GLU n 
1  1230 GLN n 
1  1231 ILE n 
1  1232 ALA n 
1  1233 GLU n 
1  1234 LYS n 
1  1235 ILE n 
1  1236 ASN n 
1  1237 ALA n 
1  1238 GLY n 
1  1239 PHE n 
1  1240 GLY n 
1  1241 ASP n 
1  1242 ASP n 
1  1243 LEU n 
1  1244 ASN n 
1  1245 CYS n 
1  1246 ILE n 
1  1247 PHE n 
1  1248 ASN n 
1  1249 ASP n 
1  1250 ASP n 
1  1251 ASN n 
1  1252 ALA n 
1  1253 GLU n 
1  1254 LYS n 
1  1255 LEU n 
1  1256 VAL n 
1  1257 LEU n 
1  1258 ARG n 
1  1259 ILE n 
1  1260 ARG n 
1  1261 ILE n 
1  1262 MET n 
1  1263 ASN n 
1  1264 SER n 
1  1265 ASP n 
1  1266 GLU n 
1  1267 ASN n 
1  1268 LYS n 
1  1269 MET n 
1  1270 GLN n 
1  1271 GLU n 
1  1272 GLU n 
1  1273 GLU n 
1  1274 GLU n 
1  1275 VAL n 
1  1276 VAL n 
1  1277 ASP n 
1  1278 LYS n 
1  1279 MET n 
1  1280 ASP n 
1  1281 ASP n 
1  1282 ASP n 
1  1283 VAL n 
1  1284 PHE n 
1  1285 LEU n 
1  1286 ARG n 
1  1287 CYS n 
1  1288 ILE n 
1  1289 GLU n 
1  1290 SER n 
1  1291 ASN n 
1  1292 MET n 
1  1293 LEU n 
1  1294 THR n 
1  1295 ASP n 
1  1296 MET n 
1  1297 THR n 
1  1298 LEU n 
1  1299 GLN n 
1  1300 GLY n 
1  1301 ILE n 
1  1302 GLU n 
1  1303 GLN n 
1  1304 ILE n 
1  1305 SER n 
1  1306 LYS n 
1  1307 VAL n 
1  1308 TYR n 
1  1309 MET n 
1  1310 HIS n 
1  1311 LEU n 
1  1312 PRO n 
1  1313 GLN n 
1  1314 THR n 
1  1315 ASP n 
1  1316 ASN n 
1  1317 LYS n 
1  1318 LYS n 
1  1319 LYS n 
1  1320 ILE n 
1  1321 ILE n 
1  1322 ILE n 
1  1323 THR n 
1  1324 GLU n 
1  1325 ASP n 
1  1326 GLY n 
1  1327 GLU n 
1  1328 PHE n 
1  1329 LYS n 
1  1330 ALA n 
1  1331 LEU n 
1  1332 GLN n 
1  1333 GLU n 
1  1334 TRP n 
1  1335 ILE n 
1  1336 LEU n 
1  1337 GLU n 
1  1338 THR n 
1  1339 ASP n 
1  1340 GLY n 
1  1341 VAL n 
1  1342 SER n 
1  1343 LEU n 
1  1344 MET n 
1  1345 ARG n 
1  1346 VAL n 
1  1347 LEU n 
1  1348 SER n 
1  1349 GLU n 
1  1350 LYS n 
1  1351 ASP n 
1  1352 VAL n 
1  1353 ASP n 
1  1354 PRO n 
1  1355 VAL n 
1  1356 ARG n 
1  1357 THR n 
1  1358 THR n 
1  1359 SER n 
1  1360 ASN n 
1  1361 ASP n 
1  1362 ILE n 
1  1363 VAL n 
1  1364 GLU n 
1  1365 ILE n 
1  1366 PHE n 
1  1367 THR n 
1  1368 VAL n 
1  1369 LEU n 
1  1370 GLY n 
1  1371 ILE n 
1  1372 GLU n 
1  1373 ALA n 
1  1374 VAL n 
1  1375 ARG n 
1  1376 LYS n 
1  1377 ALA n 
1  1378 LEU n 
1  1379 GLU n 
1  1380 ARG n 
1  1381 GLU n 
1  1382 LEU n 
1  1383 TYR n 
1  1384 HIS n 
1  1385 VAL n 
1  1386 ILE n 
1  1387 SER n 
1  1388 PHE n 
1  1389 ASP n 
1  1390 GLY n 
1  1391 SER n 
1  1392 TYR n 
1  1393 VAL n 
1  1394 ASN n 
1  1395 TYR n 
1  1396 ARG n 
1  1397 HIS n 
1  1398 LEU n 
1  1399 ALA n 
1  1400 LEU n 
1  1401 LEU n 
1  1402 CYS n 
1  1403 ASP n 
1  1404 THR n 
1  1405 MET n 
1  1406 THR n 
1  1407 CYS n 
1  1408 ARG n 
1  1409 GLY n 
1  1410 HIS n 
1  1411 LEU n 
1  1412 MET n 
1  1413 ALA n 
1  1414 ILE n 
1  1415 THR n 
1  1416 ARG n 
1  1417 HIS n 
1  1418 GLY n 
1  1419 VAL n 
1  1420 ASN n 
1  1421 ARG n 
1  1422 GLN n 
1  1423 ASP n 
1  1424 THR n 
1  1425 GLY n 
1  1426 PRO n 
1  1427 LEU n 
1  1428 MET n 
1  1429 LYS n 
1  1430 CYS n 
1  1431 SER n 
1  1432 PHE n 
1  1433 GLU n 
1  1434 GLU n 
1  1435 THR n 
1  1436 VAL n 
1  1437 ASP n 
1  1438 VAL n 
1  1439 LEU n 
1  1440 MET n 
1  1441 GLU n 
1  1442 ALA n 
1  1443 ALA n 
1  1444 ALA n 
1  1445 HIS n 
1  1446 GLY n 
1  1447 GLU n 
1  1448 SER n 
1  1449 ASP n 
1  1450 PRO n 
1  1451 MET n 
1  1452 LYS n 
1  1453 GLY n 
1  1454 VAL n 
1  1455 SER n 
1  1456 GLU n 
1  1457 ASN n 
1  1458 ILE n 
1  1459 MET n 
1  1460 LEU n 
1  1461 GLY n 
1  1462 GLN n 
1  1463 LEU n 
1  1464 ALA n 
1  1465 PRO n 
1  1466 ALA n 
1  1467 GLY n 
1  1468 THR n 
1  1469 GLY n 
1  1470 CYS n 
1  1471 PHE n 
1  1472 ASP n 
1  1473 LEU n 
1  1474 LEU n 
1  1475 LEU n 
1  1476 ASP n 
1  1477 ALA n 
1  1478 GLU n 
1  1479 LYS n 
1  1480 CYS n 
1  1481 LYS n 
1  1482 TYR n 
1  1483 GLY n 
1  1484 MET n 
1  1485 GLU n 
1  1486 ILE n 
1  1487 PRO n 
1  1488 THR n 
1  1489 ASN n 
1  1490 ILE n 
1  1491 PRO n 
1  1492 GLY n 
1  1493 LEU n 
1  1494 GLY n 
1  1495 ALA n 
1  1496 ALA n 
1  1497 GLY n 
1  1498 PRO n 
1  1499 THR n 
1  1500 GLY n 
1  1501 MET n 
1  1502 PHE n 
1  1503 PHE n 
1  1504 GLY n 
1  1505 SER n 
1  1506 ALA n 
1  1507 PRO n 
1  1508 SER n 
1  1509 PRO n 
1  1510 MET n 
1  1511 GLY n 
1  1512 GLY n 
1  1513 ILE n 
1  1514 SER n 
1  1515 PRO n 
1  1516 ALA n 
1  1517 MET n 
1  1518 THR n 
1  1519 PRO n 
1  1520 TRP n 
1  1521 ASN n 
1  1522 GLN n 
1  1523 GLY n 
1  1524 ALA n 
1  1525 THR n 
1  1526 PRO n 
1  1527 ALA n 
1  1528 TYR n 
1  1529 GLY n 
1  1530 ALA n 
1  1531 TRP n 
1  1532 SER n 
1  1533 PRO n 
1  1534 SER n 
1  1535 VAL n 
1  1536 GLY n 
1  1537 SER n 
1  1538 GLY n 
1  1539 MET n 
1  1540 THR n 
1  1541 PRO n 
1  1542 GLY n 
1  1543 ALA n 
1  1544 ALA n 
1  1545 GLY n 
1  1546 PHE n 
1  1547 SER n 
1  1548 PRO n 
1  1549 SER n 
1  1550 ALA n 
1  1551 ALA n 
1  1552 SER n 
1  1553 ASP n 
1  1554 ALA n 
1  1555 SER n 
1  1556 GLY n 
1  1557 PHE n 
1  1558 SER n 
1  1559 PRO n 
1  1560 GLY n 
1  1561 TYR n 
1  1562 SER n 
1  1563 PRO n 
1  1564 ALA n 
1  1565 TRP n 
1  1566 SER n 
1  1567 PRO n 
1  1568 THR n 
1  1569 PRO n 
1  1570 GLY n 
1  1571 SER n 
1  1572 PRO n 
1  1573 GLY n 
1  1574 SER n 
1  1575 PRO n 
1  1576 GLY n 
1  1577 PRO n 
1  1578 SER n 
1  1579 SER n 
1  1580 PRO n 
1  1581 TYR n 
1  1582 ILE n 
1  1583 PRO n 
1  1584 SER n 
1  1585 PRO n 
1  1586 GLY n 
1  1587 GLY n 
1  1588 ALA n 
1  1589 MET n 
1  1590 SER n 
1  1591 PRO n 
1  1592 SER n 
1  1593 TYR n 
1  1594 SER n 
1  1595 PRO n 
1  1596 THR n 
1  1597 SER n 
1  1598 PRO n 
1  1599 ALA n 
1  1600 TYR n 
1  1601 GLU n 
1  1602 PRO n 
1  1603 ARG n 
1  1604 SER n 
1  1605 PRO n 
1  1606 GLY n 
1  1607 GLY n 
1  1608 TYR n 
1  1609 THR n 
1  1610 PRO n 
1  1611 GLN n 
1  1612 SER n 
1  1613 PRO n 
1  1614 SER n 
1  1615 TYR n 
1  1616 SER n 
1  1617 PRO n 
1  1618 THR n 
1  1619 SER n 
1  1620 PRO n 
1  1621 SER n 
1  1622 TYR n 
1  1623 SER n 
1  1624 PRO n 
1  1625 THR n 
1  1626 SER n 
1  1627 PRO n 
1  1628 SER n 
1  1629 TYR n 
1  1630 SER n 
1  1631 PRO n 
1  1632 THR n 
1  1633 SER n 
1  1634 PRO n 
1  1635 ASN n 
1  1636 TYR n 
1  1637 SER n 
1  1638 PRO n 
1  1639 THR n 
1  1640 SER n 
1  1641 PRO n 
1  1642 SER n 
1  1643 TYR n 
1  1644 SER n 
1  1645 PRO n 
1  1646 THR n 
1  1647 SER n 
1  1648 PRO n 
1  1649 SER n 
1  1650 TYR n 
1  1651 SER n 
1  1652 PRO n 
1  1653 THR n 
1  1654 SER n 
1  1655 PRO n 
1  1656 SER n 
1  1657 TYR n 
1  1658 SER n 
1  1659 PRO n 
1  1660 THR n 
1  1661 SER n 
1  1662 PRO n 
1  1663 SER n 
1  1664 TYR n 
1  1665 SER n 
1  1666 PRO n 
1  1667 THR n 
1  1668 SER n 
1  1669 PRO n 
1  1670 SER n 
1  1671 TYR n 
1  1672 SER n 
1  1673 PRO n 
1  1674 THR n 
1  1675 SER n 
1  1676 PRO n 
1  1677 SER n 
1  1678 TYR n 
1  1679 SER n 
1  1680 PRO n 
1  1681 THR n 
1  1682 SER n 
1  1683 PRO n 
1  1684 SER n 
1  1685 TYR n 
1  1686 SER n 
1  1687 PRO n 
1  1688 THR n 
1  1689 SER n 
1  1690 PRO n 
1  1691 SER n 
1  1692 TYR n 
1  1693 SER n 
1  1694 PRO n 
1  1695 THR n 
1  1696 SER n 
1  1697 PRO n 
1  1698 SER n 
1  1699 TYR n 
1  1700 SER n 
1  1701 PRO n 
1  1702 THR n 
1  1703 SER n 
1  1704 PRO n 
1  1705 SER n 
1  1706 TYR n 
1  1707 SER n 
1  1708 PRO n 
1  1709 THR n 
1  1710 SER n 
1  1711 PRO n 
1  1712 SER n 
1  1713 TYR n 
1  1714 SER n 
1  1715 PRO n 
1  1716 THR n 
1  1717 SER n 
1  1718 PRO n 
1  1719 SER n 
1  1720 TYR n 
1  1721 SER n 
1  1722 PRO n 
1  1723 THR n 
1  1724 SER n 
1  1725 PRO n 
1  1726 SER n 
1  1727 TYR n 
1  1728 SER n 
1  1729 PRO n 
1  1730 THR n 
1  1731 SER n 
1  1732 PRO n 
1  1733 SER n 
1  1734 TYR n 
1  1735 SER n 
1  1736 PRO n 
1  1737 THR n 
1  1738 SER n 
1  1739 PRO n 
1  1740 SER n 
1  1741 TYR n 
1  1742 SER n 
1  1743 PRO n 
1  1744 THR n 
1  1745 SER n 
1  1746 PRO n 
1  1747 ASN n 
1  1748 TYR n 
1  1749 SER n 
1  1750 PRO n 
1  1751 THR n 
1  1752 SER n 
1  1753 PRO n 
1  1754 ASN n 
1  1755 TYR n 
1  1756 THR n 
1  1757 PRO n 
1  1758 THR n 
1  1759 SER n 
1  1760 PRO n 
1  1761 SER n 
1  1762 TYR n 
1  1763 SER n 
1  1764 PRO n 
1  1765 THR n 
1  1766 SER n 
1  1767 PRO n 
1  1768 SER n 
1  1769 TYR n 
1  1770 SER n 
1  1771 PRO n 
1  1772 THR n 
1  1773 SER n 
1  1774 PRO n 
1  1775 ASN n 
1  1776 TYR n 
1  1777 THR n 
1  1778 PRO n 
1  1779 THR n 
1  1780 SER n 
1  1781 PRO n 
1  1782 ASN n 
1  1783 TYR n 
1  1784 SER n 
1  1785 PRO n 
1  1786 THR n 
1  1787 SER n 
1  1788 PRO n 
1  1789 SER n 
1  1790 TYR n 
1  1791 SER n 
1  1792 PRO n 
1  1793 THR n 
1  1794 SER n 
1  1795 PRO n 
1  1796 SER n 
1  1797 TYR n 
1  1798 SER n 
1  1799 PRO n 
1  1800 THR n 
1  1801 SER n 
1  1802 PRO n 
1  1803 SER n 
1  1804 TYR n 
1  1805 SER n 
1  1806 PRO n 
1  1807 SER n 
1  1808 SER n 
1  1809 PRO n 
1  1810 ARG n 
1  1811 TYR n 
1  1812 THR n 
1  1813 PRO n 
1  1814 GLN n 
1  1815 SER n 
1  1816 PRO n 
1  1817 THR n 
1  1818 TYR n 
1  1819 THR n 
1  1820 PRO n 
1  1821 SER n 
1  1822 SER n 
1  1823 PRO n 
1  1824 SER n 
1  1825 TYR n 
1  1826 SER n 
1  1827 PRO n 
1  1828 SER n 
1  1829 SER n 
1  1830 PRO n 
1  1831 SER n 
1  1832 TYR n 
1  1833 SER n 
1  1834 PRO n 
1  1835 THR n 
1  1836 SER n 
1  1837 PRO n 
1  1838 LYS n 
1  1839 TYR n 
1  1840 THR n 
1  1841 PRO n 
1  1842 THR n 
1  1843 SER n 
1  1844 PRO n 
1  1845 SER n 
1  1846 TYR n 
1  1847 SER n 
1  1848 PRO n 
1  1849 SER n 
1  1850 SER n 
1  1851 PRO n 
1  1852 GLU n 
1  1853 TYR n 
1  1854 THR n 
1  1855 PRO n 
1  1856 THR n 
1  1857 SER n 
1  1858 PRO n 
1  1859 LYS n 
1  1860 TYR n 
1  1861 SER n 
1  1862 PRO n 
1  1863 THR n 
1  1864 SER n 
1  1865 PRO n 
1  1866 LYS n 
1  1867 TYR n 
1  1868 SER n 
1  1869 PRO n 
1  1870 THR n 
1  1871 SER n 
1  1872 PRO n 
1  1873 LYS n 
1  1874 TYR n 
1  1875 SER n 
1  1876 PRO n 
1  1877 THR n 
1  1878 SER n 
1  1879 PRO n 
1  1880 THR n 
1  1881 TYR n 
1  1882 SER n 
1  1883 PRO n 
1  1884 THR n 
1  1885 THR n 
1  1886 PRO n 
1  1887 LYS n 
1  1888 TYR n 
1  1889 SER n 
1  1890 PRO n 
1  1891 THR n 
1  1892 SER n 
1  1893 PRO n 
1  1894 THR n 
1  1895 TYR n 
1  1896 SER n 
1  1897 PRO n 
1  1898 THR n 
1  1899 SER n 
1  1900 PRO n 
1  1901 VAL n 
1  1902 TYR n 
1  1903 THR n 
1  1904 PRO n 
1  1905 THR n 
1  1906 SER n 
1  1907 PRO n 
1  1908 LYS n 
1  1909 TYR n 
1  1910 SER n 
1  1911 PRO n 
1  1912 THR n 
1  1913 SER n 
1  1914 PRO n 
1  1915 THR n 
1  1916 TYR n 
1  1917 SER n 
1  1918 PRO n 
1  1919 THR n 
1  1920 SER n 
1  1921 PRO n 
1  1922 LYS n 
1  1923 TYR n 
1  1924 SER n 
1  1925 PRO n 
1  1926 THR n 
1  1927 SER n 
1  1928 PRO n 
1  1929 THR n 
1  1930 TYR n 
1  1931 SER n 
1  1932 PRO n 
1  1933 THR n 
1  1934 SER n 
1  1935 PRO n 
1  1936 LYS n 
1  1937 GLY n 
1  1938 SER n 
1  1939 THR n 
1  1940 TYR n 
1  1941 SER n 
1  1942 PRO n 
1  1943 THR n 
1  1944 SER n 
1  1945 PRO n 
1  1946 GLY n 
1  1947 TYR n 
1  1948 SER n 
1  1949 PRO n 
1  1950 THR n 
1  1951 SER n 
1  1952 PRO n 
1  1953 THR n 
1  1954 TYR n 
1  1955 SER n 
1  1956 LEU n 
1  1957 THR n 
1  1958 SER n 
1  1959 PRO n 
1  1960 ALA n 
1  1961 ILE n 
1  1962 SER n 
1  1963 PRO n 
1  1964 ASP n 
1  1965 ASP n 
1  1966 SER n 
1  1967 ASP n 
1  1968 ASP n 
1  1969 GLU n 
1  1970 ASN n 
2  1    MET n 
2  2    TYR n 
2  3    ASP n 
2  4    ALA n 
2  5    ASP n 
2  6    GLU n 
2  7    ASP n 
2  8    MET n 
2  9    GLN n 
2  10   TYR n 
2  11   ASP n 
2  12   GLU n 
2  13   ASP n 
2  14   ASP n 
2  15   ASP n 
2  16   GLU n 
2  17   ILE n 
2  18   THR n 
2  19   PRO n 
2  20   ASP n 
2  21   LEU n 
2  22   TRP n 
2  23   GLN n 
2  24   GLU n 
2  25   ALA n 
2  26   CYS n 
2  27   TRP n 
2  28   ILE n 
2  29   VAL n 
2  30   ILE n 
2  31   SER n 
2  32   SER n 
2  33   TYR n 
2  34   PHE n 
2  35   ASP n 
2  36   GLU n 
2  37   LYS n 
2  38   GLY n 
2  39   LEU n 
2  40   VAL n 
2  41   ARG n 
2  42   GLN n 
2  43   GLN n 
2  44   LEU n 
2  45   ASP n 
2  46   SER n 
2  47   PHE n 
2  48   ASP n 
2  49   GLU n 
2  50   PHE n 
2  51   ILE n 
2  52   GLN n 
2  53   MET n 
2  54   SER n 
2  55   VAL n 
2  56   GLN n 
2  57   ARG n 
2  58   ILE n 
2  59   VAL n 
2  60   GLU n 
2  61   ASP n 
2  62   ALA n 
2  63   PRO n 
2  64   PRO n 
2  65   ILE n 
2  66   ASP n 
2  67   LEU n 
2  68   GLN n 
2  69   ALA n 
2  70   GLU n 
2  71   ALA n 
2  72   GLN n 
2  73   HIS n 
2  74   ALA n 
2  75   SER n 
2  76   GLY n 
2  77   GLU n 
2  78   VAL n 
2  79   GLU n 
2  80   GLU n 
2  81   PRO n 
2  82   PRO n 
2  83   ARG n 
2  84   TYR n 
2  85   LEU n 
2  86   LEU n 
2  87   LYS n 
2  88   PHE n 
2  89   GLU n 
2  90   GLN n 
2  91   ILE n 
2  92   TYR n 
2  93   LEU n 
2  94   SER n 
2  95   LYS n 
2  96   PRO n 
2  97   THR n 
2  98   HIS n 
2  99   TRP n 
2  100  GLU n 
2  101  ARG n 
2  102  ASP n 
2  103  GLY n 
2  104  ALA n 
2  105  PRO n 
2  106  SER n 
2  107  PRO n 
2  108  MET n 
2  109  MET n 
2  110  PRO n 
2  111  ASN n 
2  112  GLU n 
2  113  ALA n 
2  114  ARG n 
2  115  LEU n 
2  116  ARG n 
2  117  ASN n 
2  118  LEU n 
2  119  THR n 
2  120  TYR n 
2  121  SER n 
2  122  ALA n 
2  123  PRO n 
2  124  LEU n 
2  125  TYR n 
2  126  VAL n 
2  127  ASP n 
2  128  ILE n 
2  129  THR n 
2  130  LYS n 
2  131  THR n 
2  132  VAL n 
2  133  ILE n 
2  134  LYS n 
2  135  GLU n 
2  136  GLY n 
2  137  GLU n 
2  138  GLU n 
2  139  GLN n 
2  140  LEU n 
2  141  GLN n 
2  142  THR n 
2  143  GLN n 
2  144  HIS n 
2  145  GLN n 
2  146  LYS n 
2  147  THR n 
2  148  PHE n 
2  149  ILE n 
2  150  GLY n 
2  151  LYS n 
2  152  ILE n 
2  153  PRO n 
2  154  ILE n 
2  155  MET n 
2  156  LEU n 
2  157  ARG n 
2  158  SER n 
2  159  THR n 
2  160  TYR n 
2  161  CYS n 
2  162  LEU n 
2  163  LEU n 
2  164  ASN n 
2  165  GLY n 
2  166  LEU n 
2  167  THR n 
2  168  ASP n 
2  169  ARG n 
2  170  ASP n 
2  171  LEU n 
2  172  CYS n 
2  173  GLU n 
2  174  LEU n 
2  175  ASN n 
2  176  GLU n 
2  177  CYS n 
2  178  PRO n 
2  179  LEU n 
2  180  ASP n 
2  181  PRO n 
2  182  GLY n 
2  183  GLY n 
2  184  TYR n 
2  185  PHE n 
2  186  ILE n 
2  187  ILE n 
2  188  ASN n 
2  189  GLY n 
2  190  SER n 
2  191  GLU n 
2  192  LYS n 
2  193  VAL n 
2  194  LEU n 
2  195  ILE n 
2  196  ALA n 
2  197  GLN n 
2  198  GLU n 
2  199  LYS n 
2  200  MET n 
2  201  ALA n 
2  202  THR n 
2  203  ASN n 
2  204  THR n 
2  205  VAL n 
2  206  TYR n 
2  207  VAL n 
2  208  PHE n 
2  209  ALA n 
2  210  LYS n 
2  211  LYS n 
2  212  ASP n 
2  213  SER n 
2  214  LYS n 
2  215  TYR n 
2  216  ALA n 
2  217  TYR n 
2  218  THR n 
2  219  GLY n 
2  220  GLU n 
2  221  CYS n 
2  222  ARG n 
2  223  SER n 
2  224  CYS n 
2  225  LEU n 
2  226  GLU n 
2  227  ASN n 
2  228  SER n 
2  229  SER n 
2  230  ARG n 
2  231  PRO n 
2  232  THR n 
2  233  SER n 
2  234  THR n 
2  235  ILE n 
2  236  TRP n 
2  237  VAL n 
2  238  SER n 
2  239  MET n 
2  240  LEU n 
2  241  ALA n 
2  242  ARG n 
2  243  GLY n 
2  244  GLY n 
2  245  GLN n 
2  246  GLY n 
2  247  ALA n 
2  248  LYS n 
2  249  LYS n 
2  250  SER n 
2  251  ALA n 
2  252  ILE n 
2  253  GLY n 
2  254  GLN n 
2  255  ARG n 
2  256  ILE n 
2  257  VAL n 
2  258  ALA n 
2  259  THR n 
2  260  LEU n 
2  261  PRO n 
2  262  TYR n 
2  263  ILE n 
2  264  LYS n 
2  265  GLN n 
2  266  GLU n 
2  267  VAL n 
2  268  PRO n 
2  269  ILE n 
2  270  ILE n 
2  271  ILE n 
2  272  VAL n 
2  273  PHE n 
2  274  ARG n 
2  275  ALA n 
2  276  LEU n 
2  277  GLY n 
2  278  PHE n 
2  279  VAL n 
2  280  SER n 
2  281  ASP n 
2  282  ARG n 
2  283  ASP n 
2  284  ILE n 
2  285  LEU n 
2  286  GLU n 
2  287  HIS n 
2  288  ILE n 
2  289  ILE n 
2  290  TYR n 
2  291  ASP n 
2  292  PHE n 
2  293  GLU n 
2  294  ASP n 
2  295  PRO n 
2  296  GLU n 
2  297  MET n 
2  298  MET n 
2  299  GLU n 
2  300  MET n 
2  301  VAL n 
2  302  LYS n 
2  303  PRO n 
2  304  SER n 
2  305  LEU n 
2  306  ASP n 
2  307  GLU n 
2  308  ALA n 
2  309  PHE n 
2  310  VAL n 
2  311  ILE n 
2  312  GLN n 
2  313  GLU n 
2  314  GLN n 
2  315  ASN n 
2  316  VAL n 
2  317  ALA n 
2  318  LEU n 
2  319  ASN n 
2  320  PHE n 
2  321  ILE n 
2  322  GLY n 
2  323  SER n 
2  324  ARG n 
2  325  GLY n 
2  326  ALA n 
2  327  LYS n 
2  328  PRO n 
2  329  GLY n 
2  330  VAL n 
2  331  THR n 
2  332  LYS n 
2  333  GLU n 
2  334  LYS n 
2  335  ARG n 
2  336  ILE n 
2  337  LYS n 
2  338  TYR n 
2  339  ALA n 
2  340  LYS n 
2  341  GLU n 
2  342  VAL n 
2  343  LEU n 
2  344  GLN n 
2  345  LYS n 
2  346  GLU n 
2  347  MET n 
2  348  LEU n 
2  349  PRO n 
2  350  HIS n 
2  351  VAL n 
2  352  GLY n 
2  353  VAL n 
2  354  SER n 
2  355  ASP n 
2  356  PHE n 
2  357  CYS n 
2  358  GLU n 
2  359  THR n 
2  360  LYS n 
2  361  LYS n 
2  362  ALA n 
2  363  TYR n 
2  364  PHE n 
2  365  LEU n 
2  366  GLY n 
2  367  TYR n 
2  368  MET n 
2  369  VAL n 
2  370  HIS n 
2  371  ARG n 
2  372  LEU n 
2  373  LEU n 
2  374  LEU n 
2  375  ALA n 
2  376  ALA n 
2  377  LEU n 
2  378  GLY n 
2  379  ARG n 
2  380  ARG n 
2  381  GLU n 
2  382  LEU n 
2  383  ASP n 
2  384  ASP n 
2  385  ARG n 
2  386  ASP n 
2  387  HIS n 
2  388  TYR n 
2  389  GLY n 
2  390  ASN n 
2  391  LYS n 
2  392  ARG n 
2  393  LEU n 
2  394  ASP n 
2  395  LEU n 
2  396  ALA n 
2  397  GLY n 
2  398  PRO n 
2  399  LEU n 
2  400  LEU n 
2  401  ALA n 
2  402  PHE n 
2  403  LEU n 
2  404  PHE n 
2  405  ARG n 
2  406  GLY n 
2  407  MET n 
2  408  PHE n 
2  409  LYS n 
2  410  ASN n 
2  411  LEU n 
2  412  LEU n 
2  413  LYS n 
2  414  GLU n 
2  415  VAL n 
2  416  ARG n 
2  417  ILE n 
2  418  TYR n 
2  419  ALA n 
2  420  GLN n 
2  421  LYS n 
2  422  PHE n 
2  423  ILE n 
2  424  ASP n 
2  425  ARG n 
2  426  GLY n 
2  427  LYS n 
2  428  ASP n 
2  429  PHE n 
2  430  ASN n 
2  431  LEU n 
2  432  GLU n 
2  433  LEU n 
2  434  ALA n 
2  435  ILE n 
2  436  LYS n 
2  437  THR n 
2  438  ARG n 
2  439  ILE n 
2  440  ILE n 
2  441  SER n 
2  442  ASP n 
2  443  GLY n 
2  444  LEU n 
2  445  LYS n 
2  446  TYR n 
2  447  SER n 
2  448  LEU n 
2  449  ALA n 
2  450  THR n 
2  451  GLY n 
2  452  ASN n 
2  453  TRP n 
2  454  GLY n 
2  455  ASP n 
2  456  GLN n 
2  457  LYS n 
2  458  LYS n 
2  459  ALA n 
2  460  HIS n 
2  461  GLN n 
2  462  ALA n 
2  463  ARG n 
2  464  ALA n 
2  465  GLY n 
2  466  VAL n 
2  467  SER n 
2  468  GLN n 
2  469  VAL n 
2  470  LEU n 
2  471  ASN n 
2  472  ARG n 
2  473  LEU n 
2  474  THR n 
2  475  PHE n 
2  476  ALA n 
2  477  SER n 
2  478  THR n 
2  479  LEU n 
2  480  SER n 
2  481  HIS n 
2  482  LEU n 
2  483  ARG n 
2  484  ARG n 
2  485  LEU n 
2  486  ASN n 
2  487  SER n 
2  488  PRO n 
2  489  ILE n 
2  490  GLY n 
2  491  ARG n 
2  492  ASP n 
2  493  GLY n 
2  494  LYS n 
2  495  LEU n 
2  496  ALA n 
2  497  LYS n 
2  498  PRO n 
2  499  ARG n 
2  500  GLN n 
2  501  LEU n 
2  502  HIS n 
2  503  ASN n 
2  504  THR n 
2  505  LEU n 
2  506  TRP n 
2  507  GLY n 
2  508  MET n 
2  509  VAL n 
2  510  CYS n 
2  511  PRO n 
2  512  ALA n 
2  513  GLU n 
2  514  THR n 
2  515  PRO n 
2  516  GLU n 
2  517  GLY n 
2  518  HIS n 
2  519  ALA n 
2  520  VAL n 
2  521  GLY n 
2  522  LEU n 
2  523  VAL n 
2  524  LYS n 
2  525  ASN n 
2  526  LEU n 
2  527  ALA n 
2  528  LEU n 
2  529  MET n 
2  530  ALA n 
2  531  TYR n 
2  532  ILE n 
2  533  SER n 
2  534  VAL n 
2  535  GLY n 
2  536  SER n 
2  537  GLN n 
2  538  PRO n 
2  539  SER n 
2  540  PRO n 
2  541  ILE n 
2  542  LEU n 
2  543  GLU n 
2  544  PHE n 
2  545  LEU n 
2  546  GLU n 
2  547  GLU n 
2  548  TRP n 
2  549  SER n 
2  550  MET n 
2  551  GLU n 
2  552  ASN n 
2  553  LEU n 
2  554  GLU n 
2  555  GLU n 
2  556  ILE n 
2  557  SER n 
2  558  PRO n 
2  559  ALA n 
2  560  ALA n 
2  561  ILE n 
2  562  ALA n 
2  563  ASP n 
2  564  ALA n 
2  565  THR n 
2  566  LYS n 
2  567  ILE n 
2  568  PHE n 
2  569  VAL n 
2  570  ASN n 
2  571  GLY n 
2  572  CYS n 
2  573  TRP n 
2  574  VAL n 
2  575  GLY n 
2  576  ILE n 
2  577  HIS n 
2  578  LYS n 
2  579  ASP n 
2  580  PRO n 
2  581  GLU n 
2  582  GLN n 
2  583  LEU n 
2  584  MET n 
2  585  ASN n 
2  586  THR n 
2  587  LEU n 
2  588  ARG n 
2  589  LYS n 
2  590  LEU n 
2  591  ARG n 
2  592  ARG n 
2  593  GLN n 
2  594  MET n 
2  595  ASP n 
2  596  ILE n 
2  597  ILE n 
2  598  VAL n 
2  599  SER n 
2  600  GLU n 
2  601  VAL n 
2  602  SER n 
2  603  MET n 
2  604  ILE n 
2  605  ARG n 
2  606  ASP n 
2  607  ILE n 
2  608  ARG n 
2  609  GLU n 
2  610  ARG n 
2  611  GLU n 
2  612  ILE n 
2  613  ARG n 
2  614  ILE n 
2  615  TYR n 
2  616  THR n 
2  617  ASP n 
2  618  ALA n 
2  619  GLY n 
2  620  ARG n 
2  621  ILE n 
2  622  CYS n 
2  623  ARG n 
2  624  PRO n 
2  625  LEU n 
2  626  LEU n 
2  627  ILE n 
2  628  VAL n 
2  629  GLU n 
2  630  LYS n 
2  631  GLN n 
2  632  LYS n 
2  633  LEU n 
2  634  LEU n 
2  635  LEU n 
2  636  LYS n 
2  637  LYS n 
2  638  ARG n 
2  639  HIS n 
2  640  ILE n 
2  641  ASP n 
2  642  GLN n 
2  643  LEU n 
2  644  LYS n 
2  645  GLU n 
2  646  ARG n 
2  647  GLU n 
2  648  TYR n 
2  649  ASN n 
2  650  ASN n 
2  651  TYR n 
2  652  SER n 
2  653  TRP n 
2  654  GLN n 
2  655  ASP n 
2  656  LEU n 
2  657  VAL n 
2  658  ALA n 
2  659  SER n 
2  660  GLY n 
2  661  VAL n 
2  662  VAL n 
2  663  GLU n 
2  664  TYR n 
2  665  ILE n 
2  666  ASP n 
2  667  THR n 
2  668  LEU n 
2  669  GLU n 
2  670  GLU n 
2  671  GLU n 
2  672  THR n 
2  673  VAL n 
2  674  MET n 
2  675  LEU n 
2  676  ALA n 
2  677  MET n 
2  678  THR n 
2  679  PRO n 
2  680  ASP n 
2  681  ASP n 
2  682  LEU n 
2  683  GLN n 
2  684  GLU n 
2  685  LYS n 
2  686  GLU n 
2  687  VAL n 
2  688  ALA n 
2  689  TYR n 
2  690  CYS n 
2  691  SER n 
2  692  THR n 
2  693  TYR n 
2  694  THR n 
2  695  HIS n 
2  696  CYS n 
2  697  GLU n 
2  698  ILE n 
2  699  HIS n 
2  700  PRO n 
2  701  SER n 
2  702  MET n 
2  703  ILE n 
2  704  LEU n 
2  705  GLY n 
2  706  VAL n 
2  707  CYS n 
2  708  ALA n 
2  709  SER n 
2  710  ILE n 
2  711  ILE n 
2  712  PRO n 
2  713  PHE n 
2  714  PRO n 
2  715  ASP n 
2  716  HIS n 
2  717  ASN n 
2  718  GLN n 
2  719  SER n 
2  720  PRO n 
2  721  ARG n 
2  722  ASN n 
2  723  THR n 
2  724  TYR n 
2  725  GLN n 
2  726  SER n 
2  727  ALA n 
2  728  MET n 
2  729  GLY n 
2  730  LYS n 
2  731  GLN n 
2  732  ALA n 
2  733  MET n 
2  734  GLY n 
2  735  VAL n 
2  736  TYR n 
2  737  ILE n 
2  738  THR n 
2  739  ASN n 
2  740  PHE n 
2  741  HIS n 
2  742  VAL n 
2  743  ARG n 
2  744  MET n 
2  745  ASP n 
2  746  THR n 
2  747  LEU n 
2  748  ALA n 
2  749  HIS n 
2  750  VAL n 
2  751  LEU n 
2  752  TYR n 
2  753  TYR n 
2  754  PRO n 
2  755  GLN n 
2  756  LYS n 
2  757  PRO n 
2  758  LEU n 
2  759  VAL n 
2  760  THR n 
2  761  THR n 
2  762  ARG n 
2  763  SER n 
2  764  MET n 
2  765  GLU n 
2  766  TYR n 
2  767  LEU n 
2  768  ARG n 
2  769  PHE n 
2  770  ARG n 
2  771  GLU n 
2  772  LEU n 
2  773  PRO n 
2  774  ALA n 
2  775  GLY n 
2  776  ILE n 
2  777  ASN n 
2  778  SER n 
2  779  ILE n 
2  780  VAL n 
2  781  ALA n 
2  782  ILE n 
2  783  ALA n 
2  784  SER n 
2  785  TYR n 
2  786  THR n 
2  787  GLY n 
2  788  TYR n 
2  789  ASN n 
2  790  GLN n 
2  791  GLU n 
2  792  ASP n 
2  793  SER n 
2  794  VAL n 
2  795  ILE n 
2  796  MET n 
2  797  ASN n 
2  798  ARG n 
2  799  SER n 
2  800  ALA n 
2  801  VAL n 
2  802  ASP n 
2  803  ARG n 
2  804  GLY n 
2  805  PHE n 
2  806  PHE n 
2  807  ARG n 
2  808  SER n 
2  809  VAL n 
2  810  PHE n 
2  811  TYR n 
2  812  ARG n 
2  813  SER n 
2  814  TYR n 
2  815  LYS n 
2  816  GLU n 
2  817  GLN n 
2  818  GLU n 
2  819  SER n 
2  820  LYS n 
2  821  LYS n 
2  822  GLY n 
2  823  PHE n 
2  824  ASP n 
2  825  GLN n 
2  826  GLU n 
2  827  GLU n 
2  828  VAL n 
2  829  PHE n 
2  830  GLU n 
2  831  LYS n 
2  832  PRO n 
2  833  THR n 
2  834  ARG n 
2  835  GLU n 
2  836  THR n 
2  837  CYS n 
2  838  GLN n 
2  839  GLY n 
2  840  MET n 
2  841  ARG n 
2  842  HIS n 
2  843  ALA n 
2  844  ILE n 
2  845  TYR n 
2  846  ASP n 
2  847  LYS n 
2  848  LEU n 
2  849  ASP n 
2  850  ASP n 
2  851  ASP n 
2  852  GLY n 
2  853  LEU n 
2  854  ILE n 
2  855  ALA n 
2  856  PRO n 
2  857  GLY n 
2  858  VAL n 
2  859  ARG n 
2  860  VAL n 
2  861  SER n 
2  862  GLY n 
2  863  ASP n 
2  864  ASP n 
2  865  VAL n 
2  866  ILE n 
2  867  ILE n 
2  868  GLY n 
2  869  LYS n 
2  870  THR n 
2  871  VAL n 
2  872  THR n 
2  873  LEU n 
2  874  PRO n 
2  875  GLU n 
2  876  ASN n 
2  877  GLU n 
2  878  ASP n 
2  879  GLU n 
2  880  LEU n 
2  881  GLU n 
2  882  GLY n 
2  883  THR n 
2  884  ASN n 
2  885  ARG n 
2  886  ARG n 
2  887  TYR n 
2  888  THR n 
2  889  LYS n 
2  890  ARG n 
2  891  ASP n 
2  892  CYS n 
2  893  SER n 
2  894  THR n 
2  895  PHE n 
2  896  LEU n 
2  897  ARG n 
2  898  THR n 
2  899  SER n 
2  900  GLU n 
2  901  THR n 
2  902  GLY n 
2  903  ILE n 
2  904  VAL n 
2  905  ASP n 
2  906  GLN n 
2  907  VAL n 
2  908  MET n 
2  909  VAL n 
2  910  THR n 
2  911  LEU n 
2  912  ASN n 
2  913  GLN n 
2  914  GLU n 
2  915  GLY n 
2  916  TYR n 
2  917  LYS n 
2  918  PHE n 
2  919  CYS n 
2  920  LYS n 
2  921  ILE n 
2  922  ARG n 
2  923  VAL n 
2  924  ARG n 
2  925  SER n 
2  926  VAL n 
2  927  ARG n 
2  928  ILE n 
2  929  PRO n 
2  930  GLN n 
2  931  ILE n 
2  932  GLY n 
2  933  ASP n 
2  934  LYS n 
2  935  PHE n 
2  936  ALA n 
2  937  SER n 
2  938  ARG n 
2  939  HIS n 
2  940  GLY n 
2  941  GLN n 
2  942  LYS n 
2  943  GLY n 
2  944  THR n 
2  945  CYS n 
2  946  GLY n 
2  947  ILE n 
2  948  GLN n 
2  949  TYR n 
2  950  ARG n 
2  951  GLN n 
2  952  GLU n 
2  953  ASP n 
2  954  MET n 
2  955  PRO n 
2  956  PHE n 
2  957  THR n 
2  958  CYS n 
2  959  GLU n 
2  960  GLY n 
2  961  ILE n 
2  962  THR n 
2  963  PRO n 
2  964  ASP n 
2  965  ILE n 
2  966  ILE n 
2  967  ILE n 
2  968  ASN n 
2  969  PRO n 
2  970  HIS n 
2  971  ALA n 
2  972  ILE n 
2  973  PRO n 
2  974  SER n 
2  975  ARG n 
2  976  MET n 
2  977  THR n 
2  978  ILE n 
2  979  GLY n 
2  980  HIS n 
2  981  LEU n 
2  982  ILE n 
2  983  GLU n 
2  984  CYS n 
2  985  LEU n 
2  986  GLN n 
2  987  GLY n 
2  988  LYS n 
2  989  VAL n 
2  990  SER n 
2  991  ALA n 
2  992  ASN n 
2  993  LYS n 
2  994  GLY n 
2  995  GLU n 
2  996  ILE n 
2  997  GLY n 
2  998  ASP n 
2  999  ALA n 
2  1000 THR n 
2  1001 PRO n 
2  1002 PHE n 
2  1003 ASN n 
2  1004 ASP n 
2  1005 ALA n 
2  1006 VAL n 
2  1007 ASN n 
2  1008 VAL n 
2  1009 GLN n 
2  1010 LYS n 
2  1011 ILE n 
2  1012 SER n 
2  1013 ASN n 
2  1014 LEU n 
2  1015 LEU n 
2  1016 SER n 
2  1017 ASP n 
2  1018 TYR n 
2  1019 GLY n 
2  1020 TYR n 
2  1021 HIS n 
2  1022 LEU n 
2  1023 ARG n 
2  1024 GLY n 
2  1025 ASN n 
2  1026 GLU n 
2  1027 VAL n 
2  1028 LEU n 
2  1029 TYR n 
2  1030 ASN n 
2  1031 GLY n 
2  1032 PHE n 
2  1033 THR n 
2  1034 GLY n 
2  1035 ARG n 
2  1036 LYS n 
2  1037 ILE n 
2  1038 THR n 
2  1039 SER n 
2  1040 GLN n 
2  1041 ILE n 
2  1042 PHE n 
2  1043 ILE n 
2  1044 GLY n 
2  1045 PRO n 
2  1046 THR n 
2  1047 TYR n 
2  1048 TYR n 
2  1049 GLN n 
2  1050 ARG n 
2  1051 LEU n 
2  1052 LYS n 
2  1053 HIS n 
2  1054 MET n 
2  1055 VAL n 
2  1056 ASP n 
2  1057 ASP n 
2  1058 LYS n 
2  1059 ILE n 
2  1060 HIS n 
2  1061 SER n 
2  1062 ARG n 
2  1063 ALA n 
2  1064 ARG n 
2  1065 GLY n 
2  1066 PRO n 
2  1067 ILE n 
2  1068 GLN n 
2  1069 ILE n 
2  1070 LEU n 
2  1071 ASN n 
2  1072 ARG n 
2  1073 GLN n 
2  1074 PRO n 
2  1075 MET n 
2  1076 GLU n 
2  1077 GLY n 
2  1078 ARG n 
2  1079 SER n 
2  1080 ARG n 
2  1081 ASP n 
2  1082 GLY n 
2  1083 GLY n 
2  1084 LEU n 
2  1085 ARG n 
2  1086 PHE n 
2  1087 GLY n 
2  1088 GLU n 
2  1089 MET n 
2  1090 GLU n 
2  1091 ARG n 
2  1092 ASP n 
2  1093 CYS n 
2  1094 GLN n 
2  1095 ILE n 
2  1096 ALA n 
2  1097 HIS n 
2  1098 GLY n 
2  1099 ALA n 
2  1100 ALA n 
2  1101 GLN n 
2  1102 PHE n 
2  1103 LEU n 
2  1104 ARG n 
2  1105 GLU n 
2  1106 ARG n 
2  1107 LEU n 
2  1108 PHE n 
2  1109 GLU n 
2  1110 ALA n 
2  1111 SER n 
2  1112 ASP n 
2  1113 PRO n 
2  1114 TYR n 
2  1115 GLN n 
2  1116 VAL n 
2  1117 HIS n 
2  1118 VAL n 
2  1119 CYS n 
2  1120 ASN n 
2  1121 LEU n 
2  1122 CYS n 
2  1123 GLY n 
2  1124 ILE n 
2  1125 MET n 
2  1126 ALA n 
2  1127 ILE n 
2  1128 ALA n 
2  1129 ASN n 
2  1130 THR n 
2  1131 ARG n 
2  1132 THR n 
2  1133 HIS n 
2  1134 THR n 
2  1135 TYR n 
2  1136 GLU n 
2  1137 CYS n 
2  1138 ARG n 
2  1139 GLY n 
2  1140 CYS n 
2  1141 ARG n 
2  1142 ASN n 
2  1143 LYS n 
2  1144 THR n 
2  1145 GLN n 
2  1146 ILE n 
2  1147 SER n 
2  1148 LEU n 
2  1149 VAL n 
2  1150 ARG n 
2  1151 MET n 
2  1152 PRO n 
2  1153 TYR n 
2  1154 ALA n 
2  1155 CYS n 
2  1156 LYS n 
2  1157 LEU n 
2  1158 LEU n 
2  1159 PHE n 
2  1160 GLN n 
2  1161 GLU n 
2  1162 LEU n 
2  1163 MET n 
2  1164 SER n 
2  1165 MET n 
2  1166 SER n 
2  1167 ILE n 
2  1168 ALA n 
2  1169 PRO n 
2  1170 ARG n 
2  1171 MET n 
2  1172 MET n 
2  1173 SER n 
2  1174 VAL n 
3  1    MET n 
3  2    PRO n 
3  3    TYR n 
3  4    ALA n 
3  5    ASN n 
3  6    GLN n 
3  7    PRO n 
3  8    THR n 
3  9    VAL n 
3  10   ARG n 
3  11   ILE n 
3  12   THR n 
3  13   GLU n 
3  14   LEU n 
3  15   THR n 
3  16   ASP n 
3  17   GLU n 
3  18   ASN n 
3  19   VAL n 
3  20   LYS n 
3  21   PHE n 
3  22   ILE n 
3  23   ILE n 
3  24   GLU n 
3  25   ASN n 
3  26   THR n 
3  27   ASP n 
3  28   LEU n 
3  29   ALA n 
3  30   VAL n 
3  31   ALA n 
3  32   ASN n 
3  33   SER n 
3  34   ILE n 
3  35   ARG n 
3  36   ARG n 
3  37   VAL n 
3  38   PHE n 
3  39   ILE n 
3  40   ALA n 
3  41   GLU n 
3  42   VAL n 
3  43   PRO n 
3  44   ILE n 
3  45   ILE n 
3  46   ALA n 
3  47   ILE n 
3  48   ASP n 
3  49   TRP n 
3  50   VAL n 
3  51   GLN n 
3  52   ILE n 
3  53   ASP n 
3  54   ALA n 
3  55   ASN n 
3  56   SER n 
3  57   SER n 
3  58   VAL n 
3  59   LEU n 
3  60   HIS n 
3  61   ASP n 
3  62   GLU n 
3  63   PHE n 
3  64   ILE n 
3  65   ALA n 
3  66   HIS n 
3  67   ARG n 
3  68   LEU n 
3  69   GLY n 
3  70   LEU n 
3  71   ILE n 
3  72   PRO n 
3  73   LEU n 
3  74   THR n 
3  75   SER n 
3  76   ASP n 
3  77   ASP n 
3  78   ILE n 
3  79   VAL n 
3  80   ASP n 
3  81   LYS n 
3  82   LEU n 
3  83   GLN n 
3  84   TYR n 
3  85   SER n 
3  86   ARG n 
3  87   ASP n 
3  88   CYS n 
3  89   THR n 
3  90   CYS n 
3  91   GLU n 
3  92   GLU n 
3  93   PHE n 
3  94   CYS n 
3  95   PRO n 
3  96   GLU n 
3  97   CYS n 
3  98   SER n 
3  99   VAL n 
3  100  GLU n 
3  101  PHE n 
3  102  THR n 
3  103  LEU n 
3  104  ASP n 
3  105  VAL n 
3  106  ARG n 
3  107  CYS n 
3  108  ASN n 
3  109  GLU n 
3  110  ASP n 
3  111  GLN n 
3  112  THR n 
3  113  ARG n 
3  114  HIS n 
3  115  VAL n 
3  116  THR n 
3  117  SER n 
3  118  ARG n 
3  119  ASP n 
3  120  LEU n 
3  121  ILE n 
3  122  SER n 
3  123  ASN n 
3  124  SER n 
3  125  PRO n 
3  126  ARG n 
3  127  VAL n 
3  128  ILE n 
3  129  PRO n 
3  130  VAL n 
3  131  THR n 
3  132  SER n 
3  133  ARG n 
3  134  ASN n 
3  135  ARG n 
3  136  ASP n 
3  137  ASN n 
3  138  ASP n 
3  139  PRO n 
3  140  ASN n 
3  141  ASP n 
3  142  TYR n 
3  143  VAL n 
3  144  GLU n 
3  145  GLN n 
3  146  ASP n 
3  147  ASP n 
3  148  ILE n 
3  149  LEU n 
3  150  ILE n 
3  151  VAL n 
3  152  LYS n 
3  153  LEU n 
3  154  ARG n 
3  155  LYS n 
3  156  GLY n 
3  157  GLN n 
3  158  GLU n 
3  159  LEU n 
3  160  ARG n 
3  161  LEU n 
3  162  ARG n 
3  163  ALA n 
3  164  TYR n 
3  165  ALA n 
3  166  LYS n 
3  167  LYS n 
3  168  GLY n 
3  169  PHE n 
3  170  GLY n 
3  171  LYS n 
3  172  GLU n 
3  173  HIS n 
3  174  ALA n 
3  175  LYS n 
3  176  TRP n 
3  177  ASN n 
3  178  PRO n 
3  179  THR n 
3  180  ALA n 
3  181  GLY n 
3  182  VAL n 
3  183  ALA n 
3  184  PHE n 
3  185  GLU n 
3  186  TYR n 
3  187  ASP n 
3  188  PRO n 
3  189  ASP n 
3  190  ASN n 
3  191  ALA n 
3  192  LEU n 
3  193  ARG n 
3  194  HIS n 
3  195  THR n 
3  196  VAL n 
3  197  TYR n 
3  198  PRO n 
3  199  LYS n 
3  200  PRO n 
3  201  GLU n 
3  202  GLU n 
3  203  TRP n 
3  204  PRO n 
3  205  LYS n 
3  206  SER n 
3  207  GLU n 
3  208  TYR n 
3  209  SER n 
3  210  GLU n 
3  211  LEU n 
3  212  ASP n 
3  213  GLU n 
3  214  ASP n 
3  215  GLU n 
3  216  SER n 
3  217  GLN n 
3  218  ALA n 
3  219  PRO n 
3  220  TYR n 
3  221  ASP n 
3  222  PRO n 
3  223  ASN n 
3  224  GLY n 
3  225  LYS n 
3  226  PRO n 
3  227  GLU n 
3  228  ARG n 
3  229  PHE n 
3  230  TYR n 
3  231  TYR n 
3  232  ASN n 
3  233  VAL n 
3  234  GLU n 
3  235  SER n 
3  236  CYS n 
3  237  GLY n 
3  238  SER n 
3  239  LEU n 
3  240  ARG n 
3  241  PRO n 
3  242  GLU n 
3  243  THR n 
3  244  ILE n 
3  245  VAL n 
3  246  LEU n 
3  247  SER n 
3  248  ALA n 
3  249  LEU n 
3  250  SER n 
3  251  GLY n 
3  252  LEU n 
3  253  LYS n 
3  254  LYS n 
3  255  LYS n 
3  256  LEU n 
3  257  SER n 
3  258  ASP n 
3  259  LEU n 
3  260  GLN n 
3  261  THR n 
3  262  GLN n 
3  263  LEU n 
3  264  SER n 
3  265  HIS n 
3  266  GLU n 
3  267  ILE n 
3  268  GLN n 
3  269  SER n 
3  270  ASP n 
3  271  VAL n 
3  272  LEU n 
3  273  THR n 
3  274  ILE n 
3  275  ASN n 
4  1    MET n 
4  2    ALA n 
4  3    ALA n 
4  4    GLY n 
4  5    GLY n 
4  6    SER n 
4  7    ASP n 
4  8    PRO n 
4  9    ARG n 
4  10   SER n 
4  11   GLY n 
4  12   ASP n 
4  13   VAL n 
4  14   GLU n 
4  15   GLU n 
4  16   ASP n 
4  17   ALA n 
4  18   SER n 
4  19   GLN n 
4  20   LEU n 
4  21   ILE n 
4  22   PHE n 
4  23   PRO n 
4  24   LYS n 
4  25   GLU n 
4  26   PHE n 
4  27   GLU n 
4  28   THR n 
4  29   ALA n 
4  30   GLU n 
4  31   THR n 
4  32   LEU n 
4  33   LEU n 
4  34   ASN n 
4  35   SER n 
4  36   GLU n 
4  37   VAL n 
4  38   HIS n 
4  39   MET n 
4  40   LEU n 
4  41   LEU n 
4  42   GLU n 
4  43   HIS n 
4  44   ARG n 
4  45   LYS n 
4  46   GLN n 
4  47   GLN n 
4  48   ASN n 
4  49   GLU n 
4  50   SER n 
4  51   ALA n 
4  52   GLU n 
4  53   ASP n 
4  54   GLU n 
4  55   GLN n 
4  56   GLU n 
4  57   LEU n 
4  58   SER n 
4  59   GLU n 
4  60   VAL n 
4  61   PHE n 
4  62   MET n 
4  63   LYS n 
4  64   THR n 
4  65   LEU n 
4  66   ASN n 
4  67   TYR n 
4  68   THR n 
4  69   ALA n 
4  70   ARG n 
4  71   PHE n 
4  72   SER n 
4  73   ARG n 
4  74   PHE n 
4  75   LYS n 
4  76   ASN n 
4  77   ARG n 
4  78   GLU n 
4  79   THR n 
4  80   ILE n 
4  81   ALA n 
4  82   SER n 
4  83   VAL n 
4  84   ARG n 
4  85   SER n 
4  86   LEU n 
4  87   LEU n 
4  88   LEU n 
4  89   GLN n 
4  90   LYS n 
4  91   LYS n 
4  92   LEU n 
4  93   HIS n 
4  94   LYS n 
4  95   PHE n 
4  96   GLU n 
4  97   LEU n 
4  98   ALA n 
4  99   CYS n 
4  100  LEU n 
4  101  ALA n 
4  102  ASN n 
4  103  LEU n 
4  104  CYS n 
4  105  PRO n 
4  106  GLU n 
4  107  THR n 
4  108  ALA n 
4  109  GLU n 
4  110  GLU n 
4  111  SER n 
4  112  LYS n 
4  113  ALA n 
4  114  LEU n 
4  115  ILE n 
4  116  PRO n 
4  117  SER n 
4  118  LEU n 
4  119  GLU n 
4  120  GLY n 
4  121  ARG n 
4  122  PHE n 
4  123  GLU n 
4  124  ASP n 
4  125  GLU n 
4  126  GLU n 
4  127  LEU n 
4  128  GLN n 
4  129  GLN n 
4  130  ILE n 
4  131  LEU n 
4  132  ASP n 
4  133  ASP n 
4  134  ILE n 
4  135  GLN n 
4  136  THR n 
4  137  LYS n 
4  138  ARG n 
4  139  SER n 
4  140  PHE n 
4  141  GLN n 
4  142  TYR n 
5  1    MET n 
5  2    ASP n 
5  3    ASP n 
5  4    GLU n 
5  5    GLU n 
5  6    GLU n 
5  7    THR n 
5  8    TYR n 
5  9    ARG n 
5  10   LEU n 
5  11   TRP n 
5  12   LYS n 
5  13   ILE n 
5  14   ARG n 
5  15   LYS n 
5  16   THR n 
5  17   ILE n 
5  18   MET n 
5  19   GLN n 
5  20   LEU n 
5  21   CYS n 
5  22   HIS n 
5  23   ASP n 
5  24   ARG n 
5  25   GLY n 
5  26   TYR n 
5  27   LEU n 
5  28   VAL n 
5  29   THR n 
5  30   GLN n 
5  31   ASP n 
5  32   GLY n 
5  33   LEU n 
5  34   ASP n 
5  35   GLN n 
5  36   THR n 
5  37   LEU n 
5  38   GLU n 
5  39   GLU n 
5  40   PHE n 
5  41   LYS n 
5  42   ALA n 
5  43   GLN n 
5  44   PHE n 
5  45   GLY n 
5  46   GLY n 
5  47   LYS n 
5  48   PRO n 
5  49   SER n 
5  50   GLU n 
5  51   GLY n 
5  52   ARG n 
5  53   PRO n 
5  54   ARG n 
5  55   ARG n 
5  56   THR n 
5  57   ASP n 
5  58   LEU n 
5  59   THR n 
5  60   VAL n 
5  61   LEU n 
5  62   VAL n 
5  63   ALA n 
5  64   HIS n 
5  65   ASN n 
5  66   ASP n 
5  67   ASP n 
5  68   PRO n 
5  69   THR n 
5  70   ASP n 
5  71   GLN n 
5  72   MET n 
5  73   PHE n 
5  74   VAL n 
5  75   PHE n 
5  76   PHE n 
5  77   PRO n 
5  78   GLU n 
5  79   GLU n 
5  80   PRO n 
5  81   LYS n 
5  82   VAL n 
5  83   GLY n 
5  84   ILE n 
5  85   LYS n 
5  86   THR n 
5  87   ILE n 
5  88   LYS n 
5  89   VAL n 
5  90   TYR n 
5  91   CYS n 
5  92   GLN n 
5  93   ARG n 
5  94   MET n 
5  95   GLN n 
5  96   GLU n 
5  97   GLU n 
5  98   ASN n 
5  99   ILE n 
5  100  THR n 
5  101  ARG n 
5  102  ALA n 
5  103  LEU n 
5  104  ILE n 
5  105  VAL n 
5  106  VAL n 
5  107  GLN n 
5  108  GLN n 
5  109  GLY n 
5  110  MET n 
5  111  THR n 
5  112  PRO n 
5  113  SER n 
5  114  ALA n 
5  115  LYS n 
5  116  GLN n 
5  117  SER n 
5  118  LEU n 
5  119  VAL n 
5  120  ASP n 
5  121  MET n 
5  122  ALA n 
5  123  PRO n 
5  124  LYS n 
5  125  TYR n 
5  126  ILE n 
5  127  LEU n 
5  128  GLU n 
5  129  GLN n 
5  130  PHE n 
5  131  LEU n 
5  132  GLN n 
5  133  GLN n 
5  134  GLU n 
5  135  LEU n 
5  136  LEU n 
5  137  ILE n 
5  138  ASN n 
5  139  ILE n 
5  140  THR n 
5  141  GLU n 
5  142  HIS n 
5  143  GLU n 
5  144  LEU n 
5  145  VAL n 
5  146  PRO n 
5  147  GLU n 
5  148  HIS n 
5  149  VAL n 
5  150  VAL n 
5  151  MET n 
5  152  THR n 
5  153  LYS n 
5  154  GLU n 
5  155  GLU n 
5  156  VAL n 
5  157  THR n 
5  158  GLU n 
5  159  LEU n 
5  160  LEU n 
5  161  ALA n 
5  162  ARG n 
5  163  TYR n 
5  164  LYS n 
5  165  LEU n 
5  166  ARG n 
5  167  GLU n 
5  168  ASN n 
5  169  GLN n 
5  170  LEU n 
5  171  PRO n 
5  172  ARG n 
5  173  ILE n 
5  174  GLN n 
5  175  ALA n 
5  176  GLY n 
5  177  ASP n 
5  178  PRO n 
5  179  VAL n 
5  180  ALA n 
5  181  ARG n 
5  182  TYR n 
5  183  PHE n 
5  184  GLY n 
5  185  ILE n 
5  186  LYS n 
5  187  ARG n 
5  188  GLY n 
5  189  GLN n 
5  190  VAL n 
5  191  VAL n 
5  192  LYS n 
5  193  ILE n 
5  194  ILE n 
5  195  ARG n 
5  196  PRO n 
5  197  SER n 
5  198  GLU n 
5  199  THR n 
5  200  ALA n 
5  201  GLY n 
5  202  ARG n 
5  203  TYR n 
5  204  ILE n 
5  205  THR n 
5  206  TYR n 
5  207  ARG n 
5  208  LEU n 
5  209  VAL n 
5  210  GLN n 
6  1    MET n 
6  2    SER n 
6  3    ASP n 
6  4    ASN n 
6  5    GLU n 
6  6    ASP n 
6  7    ASN n 
6  8    PHE n 
6  9    ASP n 
6  10   GLY n 
6  11   ASP n 
6  12   ASP n 
6  13   PHE n 
6  14   ASP n 
6  15   ASP n 
6  16   VAL n 
6  17   GLU n 
6  18   GLU n 
6  19   ASP n 
6  20   GLU n 
6  21   GLY n 
6  22   LEU n 
6  23   ASP n 
6  24   ASP n 
6  25   LEU n 
6  26   GLU n 
6  27   ASN n 
6  28   ALA n 
6  29   GLU n 
6  30   GLU n 
6  31   GLU n 
6  32   GLY n 
6  33   GLN n 
6  34   GLU n 
6  35   ASN n 
6  36   VAL n 
6  37   GLU n 
6  38   ILE n 
6  39   LEU n 
6  40   PRO n 
6  41   SER n 
6  42   GLY n 
6  43   GLU n 
6  44   ARG n 
6  45   PRO n 
6  46   GLN n 
6  47   ALA n 
6  48   ASN n 
6  49   GLN n 
6  50   LYS n 
6  51   ARG n 
6  52   ILE n 
6  53   THR n 
6  54   THR n 
6  55   PRO n 
6  56   TYR n 
6  57   MET n 
6  58   THR n 
6  59   LYS n 
6  60   TYR n 
6  61   GLU n 
6  62   ARG n 
6  63   ALA n 
6  64   ARG n 
6  65   VAL n 
6  66   LEU n 
6  67   GLY n 
6  68   THR n 
6  69   ARG n 
6  70   ALA n 
6  71   LEU n 
6  72   GLN n 
6  73   ILE n 
6  74   ALA n 
6  75   MET n 
6  76   CYS n 
6  77   ALA n 
6  78   PRO n 
6  79   VAL n 
6  80   MET n 
6  81   VAL n 
6  82   GLU n 
6  83   LEU n 
6  84   GLU n 
6  85   GLY n 
6  86   GLU n 
6  87   THR n 
6  88   ASP n 
6  89   PRO n 
6  90   LEU n 
6  91   LEU n 
6  92   ILE n 
6  93   ALA n 
6  94   MET n 
6  95   LYS n 
6  96   GLU n 
6  97   LEU n 
6  98   LYS n 
6  99   ALA n 
6  100  ARG n 
6  101  LYS n 
6  102  ILE n 
6  103  PRO n 
6  104  ILE n 
6  105  ILE n 
6  106  ILE n 
6  107  ARG n 
6  108  ARG n 
6  109  TYR n 
6  110  LEU n 
6  111  PRO n 
6  112  ASP n 
6  113  GLY n 
6  114  SER n 
6  115  TYR n 
6  116  GLU n 
6  117  ASP n 
6  118  TRP n 
6  119  GLY n 
6  120  VAL n 
6  121  ASP n 
6  122  GLU n 
6  123  LEU n 
6  124  ILE n 
6  125  ILE n 
6  126  THR n 
6  127  ASP n 
7  1    MET n 
7  2    PHE n 
7  3    TYR n 
7  4    HIS n 
7  5    ILE n 
7  6    SER n 
7  7    LEU n 
7  8    GLU n 
7  9    HIS n 
7  10   GLU n 
7  11   ILE n 
7  12   LEU n 
7  13   LEU n 
7  14   HIS n 
7  15   PRO n 
7  16   ARG n 
7  17   TYR n 
7  18   PHE n 
7  19   GLY n 
7  20   PRO n 
7  21   ASN n 
7  22   LEU n 
7  23   LEU n 
7  24   ASN n 
7  25   THR n 
7  26   VAL n 
7  27   LYS n 
7  28   GLN n 
7  29   LYS n 
7  30   LEU n 
7  31   PHE n 
7  32   THR n 
7  33   GLU n 
7  34   VAL n 
7  35   GLU n 
7  36   GLY n 
7  37   THR n 
7  38   CYS n 
7  39   THR n 
7  40   GLY n 
7  41   LYS n 
7  42   TYR n 
7  43   GLY n 
7  44   PHE n 
7  45   VAL n 
7  46   ILE n 
7  47   ALA n 
7  48   VAL n 
7  49   THR n 
7  50   THR n 
7  51   ILE n 
7  52   ASP n 
7  53   ASN n 
7  54   ILE n 
7  55   GLY n 
7  56   ALA n 
7  57   GLY n 
7  58   VAL n 
7  59   ILE n 
7  60   GLN n 
7  61   PRO n 
7  62   GLY n 
7  63   ARG n 
7  64   GLY n 
7  65   PHE n 
7  66   VAL n 
7  67   LEU n 
7  68   TYR n 
7  69   PRO n 
7  70   VAL n 
7  71   LYS n 
7  72   TYR n 
7  73   LYS n 
7  74   ALA n 
7  75   ILE n 
7  76   VAL n 
7  77   PHE n 
7  78   ARG n 
7  79   PRO n 
7  80   PHE n 
7  81   LYS n 
7  82   GLY n 
7  83   GLU n 
7  84   VAL n 
7  85   VAL n 
7  86   ASP n 
7  87   ALA n 
7  88   VAL n 
7  89   VAL n 
7  90   THR n 
7  91   GLN n 
7  92   VAL n 
7  93   ASN n 
7  94   LYS n 
7  95   VAL n 
7  96   GLY n 
7  97   LEU n 
7  98   PHE n 
7  99   THR n 
7  100  GLU n 
7  101  ILE n 
7  102  GLY n 
7  103  PRO n 
7  104  MET n 
7  105  SER n 
7  106  CYS n 
7  107  PHE n 
7  108  ILE n 
7  109  SER n 
7  110  ARG n 
7  111  HIS n 
7  112  SER n 
7  113  ILE n 
7  114  PRO n 
7  115  SER n 
7  116  GLU n 
7  117  MET n 
7  118  GLU n 
7  119  PHE n 
7  120  ASP n 
7  121  PRO n 
7  122  ASN n 
7  123  SER n 
7  124  ASN n 
7  125  PRO n 
7  126  PRO n 
7  127  CYS n 
7  128  TYR n 
7  129  LYS n 
7  130  THR n 
7  131  MET n 
7  132  ASP n 
7  133  GLU n 
7  134  ASP n 
7  135  ILE n 
7  136  VAL n 
7  137  ILE n 
7  138  GLN n 
7  139  GLN n 
7  140  ASP n 
7  141  ASP n 
7  142  GLU n 
7  143  ILE n 
7  144  ARG n 
7  145  LEU n 
7  146  LYS n 
7  147  ILE n 
7  148  VAL n 
7  149  GLY n 
7  150  THR n 
7  151  ARG n 
7  152  VAL n 
7  153  ASP n 
7  154  LYS n 
7  155  ASN n 
7  156  ASP n 
7  157  ILE n 
7  158  PHE n 
7  159  ALA n 
7  160  ILE n 
7  161  GLY n 
7  162  SER n 
7  163  LEU n 
7  164  MET n 
7  165  ASP n 
7  166  ASP n 
7  167  TYR n 
7  168  LEU n 
7  169  GLY n 
7  170  LEU n 
7  171  VAL n 
7  172  SER n 
8  1    MET n 
8  2    ALA n 
8  3    GLY n 
8  4    ILE n 
8  5    LEU n 
8  6    PHE n 
8  7    GLU n 
8  8    ASP n 
8  9    ILE n 
8  10   PHE n 
8  11   ASP n 
8  12   VAL n 
8  13   LYS n 
8  14   ASP n 
8  15   ILE n 
8  16   ASP n 
8  17   PRO n 
8  18   GLU n 
8  19   GLY n 
8  20   LYS n 
8  21   LYS n 
8  22   PHE n 
8  23   ASP n 
8  24   ARG n 
8  25   VAL n 
8  26   SER n 
8  27   ARG n 
8  28   LEU n 
8  29   HIS n 
8  30   CYS n 
8  31   GLU n 
8  32   SER n 
8  33   GLU n 
8  34   SER n 
8  35   PHE n 
8  36   LYS n 
8  37   MET n 
8  38   ASP n 
8  39   LEU n 
8  40   ILE n 
8  41   LEU n 
8  42   ASP n 
8  43   VAL n 
8  44   ASN n 
8  45   ILE n 
8  46   GLN n 
8  47   ILE n 
8  48   TYR n 
8  49   PRO n 
8  50   VAL n 
8  51   ASP n 
8  52   LEU n 
8  53   GLY n 
8  54   ASP n 
8  55   LYS n 
8  56   PHE n 
8  57   ARG n 
8  58   LEU n 
8  59   VAL n 
8  60   ILE n 
8  61   ALA n 
8  62   SER n 
8  63   THR n 
8  64   LEU n 
8  65   TYR n 
8  66   GLU n 
8  67   ASP n 
8  68   GLY n 
8  69   THR n 
8  70   LEU n 
8  71   ASP n 
8  72   ASP n 
8  73   GLY n 
8  74   GLU n 
8  75   TYR n 
8  76   ASN n 
8  77   PRO n 
8  78   THR n 
8  79   ASP n 
8  80   ASP n 
8  81   ARG n 
8  82   PRO n 
8  83   SER n 
8  84   ARG n 
8  85   ALA n 
8  86   ASP n 
8  87   GLN n 
8  88   PHE n 
8  89   GLU n 
8  90   TYR n 
8  91   VAL n 
8  92   MET n 
8  93   TYR n 
8  94   GLY n 
8  95   LYS n 
8  96   VAL n 
8  97   TYR n 
8  98   ARG n 
8  99   ILE n 
8  100  GLU n 
8  101  GLY n 
8  102  ASP n 
8  103  GLU n 
8  104  THR n 
8  105  SER n 
8  106  THR n 
8  107  GLU n 
8  108  ALA n 
8  109  ALA n 
8  110  THR n 
8  111  ARG n 
8  112  LEU n 
8  113  SER n 
8  114  ALA n 
8  115  TYR n 
8  116  VAL n 
8  117  SER n 
8  118  TYR n 
8  119  GLY n 
8  120  GLY n 
8  121  LEU n 
8  122  LEU n 
8  123  MET n 
8  124  ARG n 
8  125  LEU n 
8  126  GLN n 
8  127  GLY n 
8  128  ASP n 
8  129  ALA n 
8  130  ASN n 
8  131  ASN n 
8  132  LEU n 
8  133  HIS n 
8  134  GLY n 
8  135  PHE n 
8  136  GLU n 
8  137  VAL n 
8  138  ASP n 
8  139  SER n 
8  140  ARG n 
8  141  VAL n 
8  142  TYR n 
8  143  LEU n 
8  144  LEU n 
8  145  MET n 
8  146  LYS n 
8  147  LYS n 
8  148  LEU n 
8  149  ALA n 
8  150  PHE n 
9  1    MET n 
9  2    GLU n 
9  3    PRO n 
9  4    ASP n 
9  5    GLY n 
9  6    THR n 
9  7    TYR n 
9  8    GLU n 
9  9    PRO n 
9  10   GLY n 
9  11   ILE n 
9  12   VAL n 
9  13   GLY n 
9  14   ILE n 
9  15   ARG n 
9  16   PHE n 
9  17   CYS n 
9  18   GLN n 
9  19   GLU n 
9  20   CYS n 
9  21   ASN n 
9  22   ASN n 
9  23   MET n 
9  24   LEU n 
9  25   TYR n 
9  26   PRO n 
9  27   LYS n 
9  28   GLU n 
9  29   ASP n 
9  30   LYS n 
9  31   GLU n 
9  32   ASN n 
9  33   ARG n 
9  34   ILE n 
9  35   LEU n 
9  36   LEU n 
9  37   TYR n 
9  38   ALA n 
9  39   CYS n 
9  40   ARG n 
9  41   ASN n 
9  42   CYS n 
9  43   ASP n 
9  44   TYR n 
9  45   GLN n 
9  46   GLN n 
9  47   GLU n 
9  48   ALA n 
9  49   ASP n 
9  50   ASN n 
9  51   SER n 
9  52   CYS n 
9  53   ILE n 
9  54   TYR n 
9  55   VAL n 
9  56   ASN n 
9  57   LYS n 
9  58   ILE n 
9  59   THR n 
9  60   HIS n 
9  61   GLU n 
9  62   VAL n 
9  63   ASP n 
9  64   GLU n 
9  65   LEU n 
9  66   THR n 
9  67   GLN n 
9  68   ILE n 
9  69   ILE n 
9  70   ALA n 
9  71   ASP n 
9  72   VAL n 
9  73   SER n 
9  74   GLN n 
9  75   ASP n 
9  76   PRO n 
9  77   THR n 
9  78   LEU n 
9  79   PRO n 
9  80   ARG n 
9  81   THR n 
9  82   GLU n 
9  83   ASP n 
9  84   HIS n 
9  85   PRO n 
9  86   CYS n 
9  87   GLN n 
9  88   LYS n 
9  89   CYS n 
9  90   GLY n 
9  91   HIS n 
9  92   LYS n 
9  93   GLU n 
9  94   ALA n 
9  95   VAL n 
9  96   PHE n 
9  97   PHE n 
9  98   GLN n 
9  99   SER n 
9  100  HIS n 
9  101  SER n 
9  102  ALA n 
9  103  ARG n 
9  104  ALA n 
9  105  GLU n 
9  106  ASP n 
9  107  ALA n 
9  108  MET n 
9  109  ARG n 
9  110  LEU n 
9  111  TYR n 
9  112  TYR n 
9  113  VAL n 
9  114  CYS n 
9  115  THR n 
9  116  ALA n 
9  117  PRO n 
9  118  HIS n 
9  119  CYS n 
9  120  GLY n 
9  121  HIS n 
9  122  ARG n 
9  123  TRP n 
9  124  THR n 
9  125  GLU n 
10 1    MET n 
10 2    ILE n 
10 3    ILE n 
10 4    PRO n 
10 5    VAL n 
10 6    ARG n 
10 7    CYS n 
10 8    PHE n 
10 9    THR n 
10 10   CYS n 
10 11   GLY n 
10 12   LYS n 
10 13   ILE n 
10 14   VAL n 
10 15   GLY n 
10 16   ASN n 
10 17   LYS n 
10 18   TRP n 
10 19   GLU n 
10 20   ALA n 
10 21   TYR n 
10 22   LEU n 
10 23   GLY n 
10 24   LEU n 
10 25   LEU n 
10 26   GLN n 
10 27   ALA n 
10 28   GLU n 
10 29   TYR n 
10 30   THR n 
10 31   GLU n 
10 32   GLY n 
10 33   ASP n 
10 34   ALA n 
10 35   LEU n 
10 36   ASP n 
10 37   ALA n 
10 38   LEU n 
10 39   GLY n 
10 40   LEU n 
10 41   LYS n 
10 42   ARG n 
10 43   TYR n 
10 44   CYS n 
10 45   CYS n 
10 46   ARG n 
10 47   ARG n 
10 48   MET n 
10 49   LEU n 
10 50   LEU n 
10 51   ALA n 
10 52   HIS n 
10 53   VAL n 
10 54   ASP n 
10 55   LEU n 
10 56   ILE n 
10 57   GLU n 
10 58   LYS n 
10 59   LEU n 
10 60   LEU n 
10 61   ASN n 
10 62   TYR n 
10 63   ALA n 
10 64   PRO n 
10 65   LEU n 
10 66   GLU n 
10 67   LYS n 
11 1    MET n 
11 2    ASN n 
11 3    ALA n 
11 4    PRO n 
11 5    PRO n 
11 6    ALA n 
11 7    PHE n 
11 8    GLU n 
11 9    SER n 
11 10   PHE n 
11 11   LEU n 
11 12   LEU n 
11 13   PHE n 
11 14   GLU n 
11 15   GLY n 
11 16   GLU n 
11 17   LYS n 
11 18   LYS n 
11 19   ILE n 
11 20   THR n 
11 21   ILE n 
11 22   ASN n 
11 23   LYS n 
11 24   ASP n 
11 25   THR n 
11 26   LYS n 
11 27   VAL n 
11 28   PRO n 
11 29   ASN n 
11 30   ALA n 
11 31   CYS n 
11 32   LEU n 
11 33   PHE n 
11 34   THR n 
11 35   ILE n 
11 36   ASN n 
11 37   LYS n 
11 38   GLU n 
11 39   ASP n 
11 40   HIS n 
11 41   THR n 
11 42   LEU n 
11 43   GLY n 
11 44   ASN n 
11 45   ILE n 
11 46   ILE n 
11 47   LYS n 
11 48   SER n 
11 49   GLN n 
11 50   LEU n 
11 51   LEU n 
11 52   LYS n 
11 53   ASP n 
11 54   PRO n 
11 55   GLN n 
11 56   VAL n 
11 57   LEU n 
11 58   PHE n 
11 59   ALA n 
11 60   GLY n 
11 61   TYR n 
11 62   LYS n 
11 63   VAL n 
11 64   PRO n 
11 65   HIS n 
11 66   PRO n 
11 67   LEU n 
11 68   GLU n 
11 69   HIS n 
11 70   LYS n 
11 71   ILE n 
11 72   ILE n 
11 73   ILE n 
11 74   ARG n 
11 75   VAL n 
11 76   GLN n 
11 77   THR n 
11 78   THR n 
11 79   PRO n 
11 80   ASP n 
11 81   TYR n 
11 82   SER n 
11 83   PRO n 
11 84   GLN n 
11 85   GLU n 
11 86   ALA n 
11 87   PHE n 
11 88   THR n 
11 89   ASN n 
11 90   ALA n 
11 91   ILE n 
11 92   THR n 
11 93   ASP n 
11 94   LEU n 
11 95   ILE n 
11 96   SER n 
11 97   GLU n 
11 98   LEU n 
11 99   SER n 
11 100  LEU n 
11 101  LEU n 
11 102  GLU n 
11 103  GLU n 
11 104  ARG n 
11 105  PHE n 
11 106  ARG n 
11 107  VAL n 
11 108  ALA n 
11 109  ILE n 
11 110  LYS n 
11 111  ASP n 
11 112  LYS n 
11 113  GLN n 
11 114  GLU n 
11 115  GLY n 
11 116  ILE n 
11 117  GLU n 
12 1    MET n 
12 2    ASP n 
12 3    THR n 
12 4    GLN n 
12 5    LYS n 
12 6    ASP n 
12 7    VAL n 
12 8    GLN n 
12 9    PRO n 
12 10   PRO n 
12 11   LYS n 
12 12   GLN n 
12 13   GLN n 
12 14   PRO n 
12 15   MET n 
12 16   ILE n 
12 17   TYR n 
12 18   ILE n 
12 19   CYS n 
12 20   GLY n 
12 21   GLU n 
12 22   CYS n 
12 23   HIS n 
12 24   THR n 
12 25   GLU n 
12 26   ASN n 
12 27   GLU n 
12 28   ILE n 
12 29   LYS n 
12 30   SER n 
12 31   ARG n 
12 32   ASP n 
12 33   PRO n 
12 34   ILE n 
12 35   ARG n 
12 36   CYS n 
12 37   ARG n 
12 38   GLU n 
12 39   CYS n 
12 40   GLY n 
12 41   TYR n 
12 42   ARG n 
12 43   ILE n 
12 44   MET n 
12 45   TYR n 
12 46   LYS n 
12 47   LYS n 
12 48   ARG n 
12 49   THR n 
12 50   LYS n 
12 51   ARG n 
12 52   LEU n 
12 53   VAL n 
12 54   VAL n 
12 55   PHE n 
12 56   ASP n 
12 57   ALA n 
12 58   ARG n 
13 1    DG  n 
13 2    DG  n 
13 3    DC  n 
13 4    DA  n 
13 5    DG  n 
13 6    DT  n 
13 7    DA  n 
13 8    DC  n 
13 9    DT  n 
13 10   DA  n 
13 11   DG  n 
13 12   DT  n 
13 13   DA  n 
13 14   DA  n 
13 15   DA  n 
13 16   DC  n 
13 17   DT  n 
13 18   DA  n 
13 19   DG  n 
13 20   DT  n 
13 21   DA  n 
13 22   DT  n 
13 23   DT  n 
13 24   DG  n 
13 25   DA  n 
13 26   DA  n 
13 27   DA  n 
13 28   DG  n 
13 29   DT  n 
13 30   DA  n 
13 31   DC  n 
13 32   DT  n 
13 33   DT  n 
13 34   DG  n 
13 35   DA  n 
13 36   DG  n 
13 37   DC  n 
13 38   DT  n 
13 39   DT  n 
14 1    U   n 
14 2    A   n 
14 3    U   n 
14 4    A   n 
14 5    U   n 
14 6    G   n 
14 7    C   n 
14 8    A   n 
14 9    U   n 
14 10   A   n 
14 11   A   n 
14 12   A   n 
14 13   G   n 
14 14   A   n 
14 15   C   n 
14 16   C   n 
14 17   A   n 
14 18   G   n 
14 19   G   n 
14 20   C   n 
15 1    DA  n 
15 2    DA  n 
15 3    DG  n 
15 4    DC  n 
15 5    DT  n 
15 6    DC  n 
15 7    DA  n 
15 8    DA  n 
15 9    DG  n 
15 10   DT  n 
15 11   DA  n 
15 12   DC  n 
15 13   DT  n 
15 14   DT  n 
15 15   DA  n 
15 16   DA  n 
15 17   DG  n 
15 18   DC  n 
15 19   DC  n 
15 20   DT  n 
15 21   DG  n 
15 22   DG  n 
15 23   DT  n 
15 24   DC  n 
15 25   DA  n 
15 26   DT  n 
15 27   DT  n 
15 28   DA  n 
15 29   DC  n 
15 30   DT  n 
15 31   DA  n 
15 32   DG  n 
15 33   DT  n 
15 34   DA  n 
15 35   DC  n 
15 36   DT  n 
15 37   DG  n 
15 38   DC  n 
15 39   DC  n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? BOVINE 'BOS TAURUS' 9913 ? ? ? THYMUS ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? BOVINE 'BOS TAURUS' 9913 ? ? ? THYMUS ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? BOVINE 'BOS TAURUS' 9913 ? ? ? THYMUS ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? BOVINE 'BOS TAURUS' 9913 ? ? ? THYMUS ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? BOVINE 'BOS TAURUS' 9913 ? ? ? THYMUS ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? BOVINE 'BOS TAURUS' 9913 ? ? ? THYMUS ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? BOVINE 'BOS TAURUS' 9913 ? ? ? THYMUS ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? BOVINE 'BOS TAURUS' 9913 ? ? ? THYMUS ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? BOVINE 'BOS TAURUS' 9913 ? ? ? THYMUS ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? BOVINE 'BOS TAURUS' 9913 ? ? ? THYMUS ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? BOVINE 'BOS TAURUS' 9913 ? ? ? THYMUS ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? BOVINE 'BOS TAURUS' 9913 ? ? ? THYMUS ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
13 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
14 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
15 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1  PDB 5FLM         1  ? ? 5FLM   ? 
2  UNP A5PJW8_BOVIN 2  ? ? A5PJW8 ? 
3  UNP RPB3_BOVIN   3  ? ? Q3T0Q3 ? 
4  UNP Q1JQ91_BOVIN 4  ? ? Q1JQ91 ? 
5  UNP RPAB1_BOVIN  5  ? ? Q2T9T3 ? 
6  PDB 5FLM         6  ? ? 5FLM   ? 
7  UNP RPB7_BOVIN   7  ? ? Q5E9B8 ? 
8  UNP F2Z4H3_BOVIN 8  ? ? F2Z4H3 ? 
9  UNP RPB9_BOVIN   9  ? ? Q32P73 ? 
10 UNP RPAB5_BOVIN  10 ? ? Q32P78 ? 
11 UNP RPB11_BOVIN  11 ? ? Q32P79 ? 
12 UNP RPAB4_BOVIN  12 ? ? Q3ZBC0 ? 
13 PDB 5FLM         13 ? ? 5FLM   ? 
14 PDB 5FLM         14 ? ? 5FLM   ? 
15 PDB 5FLM         15 ? ? 5FLM   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  5FLM A 1 ? 1970 ? 5FLM   1 ? 1970 ? 1 1970 
2  2  5FLM B 1 ? 1174 ? A5PJW8 1 ? 1174 ? 1 1174 
3  3  5FLM C 1 ? 275  ? Q3T0Q3 1 ? 275  ? 1 275  
4  4  5FLM D 1 ? 142  ? Q1JQ91 1 ? 142  ? 1 142  
5  5  5FLM E 1 ? 210  ? Q2T9T3 1 ? 210  ? 1 210  
6  6  5FLM F 1 ? 127  ? 5FLM   1 ? 127  ? 1 127  
7  7  5FLM G 1 ? 172  ? Q5E9B8 1 ? 172  ? 1 172  
8  8  5FLM H 1 ? 150  ? F2Z4H3 1 ? 150  ? 1 150  
9  9  5FLM I 1 ? 125  ? Q32P73 1 ? 125  ? 1 125  
10 10 5FLM J 1 ? 67   ? Q32P78 1 ? 67   ? 1 67   
11 11 5FLM K 1 ? 117  ? Q32P79 1 ? 117  ? 1 117  
12 12 5FLM L 1 ? 58   ? Q3ZBC0 1 ? 58   ? 1 58   
13 13 5FLM N 1 ? 39   ? 5FLM   1 ? 39   ? 1 39   
14 14 5FLM P 1 ? 20   ? 5FLM   1 ? 20   ? 1 20   
15 15 5FLM T 1 ? 39   ? 5FLM   1 ? 39   ? 1 39   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"          ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"           ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.entry_id          5FLM 
_exptl.method            'ELECTRON MICROSCOPY' 
_exptl.crystals_number   ? 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 5FLM 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            3.40 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        31058 
_refine_hist.pdbx_number_atoms_nucleic_acid   1645 
_refine_hist.pdbx_number_atoms_ligand         9 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               32712 
_refine_hist.d_res_high                       3.40 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  5FLM 
_struct.title                     'Structure of transcribing mammalian RNA polymerase II' 
_struct.pdbx_descriptor           
;DNA-DIRECTED RNA POLYMERASE (E.C.2.7.7.6), DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB2 (E.C.2.7.7.6), DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB3, DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB4, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC1, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC2, DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB7, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC3, DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB9, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC5, DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB11, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC4
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        5FLM 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'TRANSCRIPTION, ELONGATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 8  ? 
I N N 9  ? 
J N N 10 ? 
K N N 11 ? 
L N N 12 ? 
M N N 13 ? 
N N N 14 ? 
O N N 15 ? 
P N N 16 ? 
Q N N 16 ? 
R N N 17 ? 
S N N 16 ? 
T N N 16 ? 
U N N 16 ? 
V N N 16 ? 
W N N 16 ? 
X N N 16 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   SER A 27   ? SER A 35   ? SER A 27   SER A 35   1 ? 9  
HELX_P HELX_P2   2   PHE A 99   ? VAL A 110  ? PHE A 99   VAL A 110  1 ? 12 
HELX_P HELX_P3   3   ASN A 123  ? SER A 133  ? ASN A 123  SER A 133  1 ? 11 
HELX_P HELX_P4   4   GLN A 136  ? LYS A 149  ? GLN A 136  LYS A 149  1 ? 14 
HELX_P HELX_P5   5   SER A 217  ? ARG A 227  ? SER A 217  ARG A 227  1 ? 11 
HELX_P HELX_P6   6   SER A 229  ? LEU A 236  ? SER A 229  LEU A 236  1 ? 8  
HELX_P HELX_P7   7   ARG A 244  ? TRP A 247  ? ARG A 244  TRP A 247  5 ? 4  
HELX_P HELX_P8   8   ASP A 274  ? GLY A 297  ? ASP A 274  GLY A 297  1 ? 24 
HELX_P HELX_P9   9   ALA A 300  ? ASP A 319  ? ALA A 300  ASP A 319  1 ? 20 
HELX_P HELX_P10  10  SER A 338  ? LYS A 344  ? SER A 338  LYS A 344  1 ? 7  
HELX_P HELX_P11  11  GLY A 348  ? LEU A 354  ? GLY A 348  LEU A 354  1 ? 7  
HELX_P HELX_P12  12  SER A 383  ? MET A 388  ? SER A 383  MET A 388  1 ? 6  
HELX_P HELX_P13  13  ASN A 398  ? GLY A 409  ? ASN A 398  GLY A 409  1 ? 12 
HELX_P HELX_P14  14  PRO A 435  ? HIS A 439  ? PRO A 435  HIS A 439  5 ? 5  
HELX_P HELX_P15  15  HIS A 465  ? MET A 467  ? HIS A 465  MET A 467  5 ? 3  
HELX_P HELX_P16  16  ASN A 485  ? SER A 487  ? ASN A 485  SER A 487  5 ? 3  
HELX_P HELX_P17  17  VAL A 488  ? ASN A 493  ? VAL A 488  ASN A 493  1 ? 6  
HELX_P HELX_P18  18  SER A 508  ? LEU A 518  ? SER A 508  LEU A 518  1 ? 11 
HELX_P HELX_P19  19  VAL A 521  ? ILE A 525  ? VAL A 521  ILE A 525  5 ? 5  
HELX_P HELX_P20  20  GLN A 539  ? LYS A 550  ? GLN A 539  LYS A 550  1 ? 12 
HELX_P HELX_P21  21  GLU A 556  ? PHE A 566  ? GLU A 556  PHE A 566  1 ? 11 
HELX_P HELX_P22  22  GLY A 588  ? ILE A 596  ? GLY A 588  ILE A 596  1 ? 9  
HELX_P HELX_P23  23  SER A 651  ? MET A 660  ? SER A 651  MET A 660  1 ? 10 
HELX_P HELX_P24  24  GLY A 661  ? GLY A 684  ? GLY A 661  GLY A 684  1 ? 24 
HELX_P HELX_P25  25  GLY A 688  ? ILE A 693  ? GLY A 688  ILE A 693  1 ? 6  
HELX_P HELX_P26  26  ASP A 695  ? ASN A 722  ? ASP A 695  ASN A 722  1 ? 28 
HELX_P HELX_P27  27  THR A 732  ? SER A 759  ? THR A 732  SER A 759  1 ? 28 
HELX_P HELX_P28  28  ASN A 764  ? SER A 772  ? ASN A 764  SER A 772  1 ? 9  
HELX_P HELX_P29  29  SER A 777  ? ALA A 786  ? SER A 777  ALA A 786  1 ? 10 
HELX_P HELX_P30  30  THR A 832  ? GLU A 869  ? THR A 832  GLU A 869  1 ? 38 
HELX_P HELX_P31  31  SER A 912  ? ARG A 921  ? SER A 912  ARG A 921  1 ? 10 
HELX_P HELX_P32  32  GLU A 927  ? LEU A 934  ? GLU A 927  LEU A 934  1 ? 8  
HELX_P HELX_P33  33  GLN A 935  ? ASN A 945  ? GLN A 935  ASN A 945  1 ? 11 
HELX_P HELX_P34  34  ASN A 945  ? PHE A 970  ? ASN A 945  PHE A 970  1 ? 26 
HELX_P HELX_P35  35  PRO A 971  ? ASP A 974  ? PRO A 971  ASP A 974  5 ? 4  
HELX_P HELX_P36  36  ASN A 982  ? PHE A 994  ? ASN A 982  PHE A 994  1 ? 13 
HELX_P HELX_P37  37  HIS A 1005 ? LYS A 1018 ? HIS A 1005 LYS A 1018 1 ? 14 
HELX_P HELX_P38  38  ASP A 1027 ? LEU A 1049 ? ASP A 1027 LEU A 1049 1 ? 23 
HELX_P HELX_P39  39  CYS A 1050 ? GLU A 1057 ? CYS A 1050 GLU A 1057 1 ? 8  
HELX_P HELX_P40  40  SER A 1061 ? ILE A 1080 ? SER A 1061 ILE A 1080 1 ? 20 
HELX_P HELX_P41  41  MET A 1086 ? GLU A 1097 ? MET A 1086 GLU A 1097 1 ? 12 
HELX_P HELX_P42  42  PRO A 1098 ? MET A 1102 ? PRO A 1098 MET A 1102 5 ? 5  
HELX_P HELX_P43  43  GLY A 1120 ? ILE A 1130 ? GLY A 1120 ILE A 1130 1 ? 11 
HELX_P HELX_P44  44  GLY A 1145 ? ASP A 1150 ? GLY A 1145 ASP A 1150 1 ? 6  
HELX_P HELX_P45  45  ASP A 1150 ? LEU A 1161 ? ASP A 1150 LEU A 1161 1 ? 12 
HELX_P HELX_P46  46  ASP A 1189 ? MET A 1199 ? ASP A 1189 MET A 1199 1 ? 11 
HELX_P HELX_P47  47  ASP A 1217 ? ARG A 1224 ? ASP A 1217 ARG A 1224 1 ? 8  
HELX_P HELX_P48  48  THR A 1227 ? GLY A 1240 ? THR A 1227 GLY A 1240 1 ? 14 
HELX_P HELX_P49  49  MET A 1262 ? ASN A 1267 ? MET A 1262 ASN A 1267 1 ? 6  
HELX_P HELX_P50  50  ASP A 1281 ? MET A 1296 ? ASP A 1281 MET A 1296 1 ? 16 
HELX_P HELX_P51  51  SER A 1342 ? GLU A 1349 ? SER A 1342 GLU A 1349 1 ? 8  
HELX_P HELX_P52  52  ILE A 1362 ? GLY A 1370 ? ILE A 1362 GLY A 1370 1 ? 9  
HELX_P HELX_P53  53  GLY A 1370 ? ASP A 1389 ? GLY A 1370 ASP A 1389 1 ? 20 
HELX_P HELX_P54  54  ASN A 1394 ? CYS A 1407 ? ASN A 1394 CYS A 1407 1 ? 14 
HELX_P HELX_P55  55  THR A 1415 ? GLN A 1422 ? THR A 1415 GLN A 1422 1 ? 8  
HELX_P HELX_P56  56  GLY A 1425 ? SER A 1431 ? GLY A 1425 SER A 1431 1 ? 7  
HELX_P HELX_P57  57  THR A 1435 ? HIS A 1445 ? THR A 1435 HIS A 1445 1 ? 11 
HELX_P HELX_P58  58  GLY A 1453 ? LEU A 1460 ? GLY A 1453 LEU A 1460 1 ? 8  
HELX_P HELX_P59  59  GLU A 1478 ? TYR A 1482 ? GLU A 1478 TYR A 1482 5 ? 5  
HELX_P HELX_P60  60  LEU B 21   ? LYS B 37   ? LEU B 21   LYS B 37   1 ? 17 
HELX_P HELX_P61  61  VAL B 40   ? MET B 53   ? VAL B 40   MET B 53   1 ? 14 
HELX_P HELX_P62  62  MET B 53   ? ASP B 61   ? MET B 53   ASP B 61   1 ? 9  
HELX_P HELX_P63  63  MET B 109  ? ARG B 116  ? MET B 109  ARG B 116  1 ? 8  
HELX_P HELX_P64  64  THR B 167  ? LEU B 174  ? THR B 167  LEU B 174  1 ? 8  
HELX_P HELX_P65  65  GLY B 246  ? GLY B 253  ? GLY B 246  GLY B 253  1 ? 8  
HELX_P HELX_P66  66  ILE B 269  ? LEU B 276  ? ILE B 269  LEU B 276  1 ? 8  
HELX_P HELX_P67  67  SER B 280  ? ILE B 289  ? SER B 280  ILE B 289  1 ? 10 
HELX_P HELX_P68  68  ASP B 294  ? ALA B 308  ? ASP B 294  ALA B 308  1 ? 15 
HELX_P HELX_P69  69  GLU B 313  ? SER B 323  ? GLU B 313  SER B 323  1 ? 11 
HELX_P HELX_P70  70  THR B 331  ? LYS B 345  ? THR B 331  LYS B 345  1 ? 15 
HELX_P HELX_P71  71  PHE B 356  ? LEU B 377  ? PHE B 356  LEU B 377  1 ? 22 
HELX_P HELX_P72  72  LEU B 395  ? ASP B 424  ? LEU B 395  ASP B 424  1 ? 30 
HELX_P HELX_P73  73  THR B 437  ? THR B 450  ? THR B 437  THR B 450  1 ? 14 
HELX_P HELX_P74  74  THR B 474  ? ARG B 483  ? THR B 474  ARG B 483  1 ? 10 
HELX_P HELX_P75  75  HIS B 502  ? TRP B 506  ? HIS B 502  TRP B 506  5 ? 5  
HELX_P HELX_P76  76  PRO B 538  ? TRP B 548  ? PRO B 538  TRP B 548  1 ? 11 
HELX_P HELX_P77  77  ASP B 579  ? GLN B 593  ? ASP B 579  GLN B 593  1 ? 15 
HELX_P HELX_P78  78  LYS B 636  ? GLU B 645  ? LYS B 636  GLU B 645  1 ? 10 
HELX_P HELX_P79  79  SER B 652  ? ALA B 658  ? SER B 652  ALA B 658  1 ? 7  
HELX_P HELX_P80  80  THR B 667  ? GLU B 671  ? THR B 667  GLU B 671  1 ? 5  
HELX_P HELX_P81  81  THR B 678  ? GLN B 683  ? THR B 678  GLN B 683  1 ? 6  
HELX_P HELX_P82  82  HIS B 699  ? LEU B 704  ? HIS B 699  LEU B 704  5 ? 6  
HELX_P HELX_P83  83  VAL B 706  ? ILE B 711  ? VAL B 706  ILE B 711  5 ? 6  
HELX_P HELX_P84  84  PHE B 713  ? HIS B 716  ? PHE B 713  HIS B 716  5 ? 4  
HELX_P HELX_P85  85  GLN B 718  ? GLY B 729  ? GLN B 718  GLY B 729  1 ? 12 
HELX_P HELX_P86  86  THR B 761  ? ARG B 768  ? THR B 761  ARG B 768  5 ? 8  
HELX_P HELX_P87  87  ARG B 798  ? ASP B 802  ? ARG B 798  ASP B 802  1 ? 5  
HELX_P HELX_P88  88  HIS B 970  ? MET B 976  ? HIS B 970  MET B 976  1 ? 7  
HELX_P HELX_P89  89  ILE B 978  ? GLY B 994  ? ILE B 978  GLY B 994  1 ? 17 
HELX_P HELX_P90  90  ASN B 1007 ? SER B 1016 ? ASN B 1007 SER B 1016 1 ? 10 
HELX_P HELX_P91  91  ASP B 1017 ? GLY B 1019 ? ASP B 1017 GLY B 1019 5 ? 3  
HELX_P HELX_P92  92  MET B 1054 ? ILE B 1059 ? MET B 1054 ILE B 1059 1 ? 6  
HELX_P HELX_P93  93  GLY B 1087 ? GLY B 1098 ? GLY B 1087 GLY B 1098 1 ? 12 
HELX_P HELX_P94  94  ALA B 1099 ? PHE B 1108 ? ALA B 1099 PHE B 1108 1 ? 10 
HELX_P HELX_P95  95  PRO B 1152 ? SER B 1164 ? PRO B 1152 SER B 1164 1 ? 13 
HELX_P HELX_P96  96  ASP C 27   ? PHE C 38   ? ASP C 27   PHE C 38   1 ? 12 
HELX_P HELX_P97  97  HIS C 60   ? LEU C 70   ? HIS C 60   LEU C 70   1 ? 11 
HELX_P HELX_P98  98  ARG C 118  ? LEU C 120  ? ARG C 118  LEU C 120  5 ? 3  
HELX_P HELX_P99  99  HIS C 173  ? ASN C 177  ? HIS C 173  ASN C 177  5 ? 5  
HELX_P HELX_P100 100 LYS C 199  ? TRP C 203  ? LYS C 199  TRP C 203  5 ? 5  
HELX_P HELX_P101 101 ARG C 240  ? VAL C 271  ? ARG C 240  VAL C 271  1 ? 32 
HELX_P HELX_P102 102 LEU D 33   ? SER D 50   ? LEU D 33   SER D 50   1 ? 18 
HELX_P HELX_P103 103 SER D 58   ? PHE D 71   ? SER D 58   PHE D 71   1 ? 14 
HELX_P HELX_P104 104 ASN D 76   ? LYS D 90   ? ASN D 76   LYS D 90   1 ? 15 
HELX_P HELX_P105 105 HIS D 93   ? CYS D 104  ? HIS D 93   CYS D 104  1 ? 12 
HELX_P HELX_P106 106 THR D 107  ? ILE D 115  ? THR D 107  ILE D 115  1 ? 9  
HELX_P HELX_P107 107 PRO D 116  ? GLU D 119  ? PRO D 116  GLU D 119  5 ? 4  
HELX_P HELX_P108 108 GLU D 123  ? ARG D 138  ? GLU D 123  ARG D 138  1 ? 16 
HELX_P HELX_P109 109 ASP E 2    ? ARG E 24   ? ASP E 2    ARG E 24   1 ? 23 
HELX_P HELX_P110 110 THR E 29   ? ASP E 34   ? THR E 29   ASP E 34   1 ? 6  
HELX_P HELX_P111 111 THR E 36   ? GLY E 45   ? THR E 36   GLY E 45   1 ? 10 
HELX_P HELX_P112 112 GLY E 83   ? ASN E 98   ? GLY E 83   ASN E 98   1 ? 16 
HELX_P HELX_P113 113 THR E 111  ? MET E 121  ? THR E 111  MET E 121  1 ? 11 
HELX_P HELX_P114 114 GLN E 133  ? LEU E 136  ? GLN E 133  LEU E 136  5 ? 4  
HELX_P HELX_P115 115 ASN E 138  ? HIS E 142  ? ASN E 138  HIS E 142  5 ? 5  
HELX_P HELX_P116 116 THR E 152  ? TYR E 163  ? THR E 152  TYR E 163  1 ? 12 
HELX_P HELX_P117 117 ARG E 166  ? LEU E 170  ? ARG E 166  LEU E 170  5 ? 5  
HELX_P HELX_P118 118 ASP E 177  ? GLY E 184  ? ASP E 177  GLY E 184  1 ? 8  
HELX_P HELX_P119 119 THR F 58   ? MET F 75   ? THR F 58   MET F 75   1 ? 18 
HELX_P HELX_P120 120 ASP F 88   ? ARG F 100  ? ASP F 88   ARG F 100  1 ? 13 
HELX_P HELX_P121 121 HIS G 14   ? PHE G 18   ? HIS G 14   PHE G 18   5 ? 5  
HELX_P HELX_P122 122 ASN G 21   ? GLU G 35   ? ASN G 21   GLU G 35   1 ? 15 
HELX_P HELX_P123 123 ALA H 129  ? HIS H 133  ? ALA H 129  HIS H 133  1 ? 5  
HELX_P HELX_P124 124 ASP I 63   ? GLN I 67   ? ASP I 63   GLN I 67   5 ? 5  
HELX_P HELX_P125 125 ILE I 69   ? ASP I 75   ? ILE I 69   ASP I 75   5 ? 7  
HELX_P HELX_P126 126 LYS J 17   ? GLU J 28   ? LYS J 17   GLU J 28   1 ? 12 
HELX_P HELX_P127 127 THR J 30   ? LEU J 38   ? THR J 30   LEU J 38   1 ? 9  
HELX_P HELX_P128 128 ARG J 42   ? ALA J 51   ? ARG J 42   ALA J 51   1 ? 10 
HELX_P HELX_P129 129 LEU J 55   ? LEU J 60   ? LEU J 55   LEU J 60   1 ? 6  
HELX_P HELX_P130 130 ASP K 39   ? LEU K 51   ? ASP K 39   LEU K 51   1 ? 13 
HELX_P HELX_P131 131 SER K 82   ? GLN K 113  ? SER K 82   GLN K 113  1 ? 32 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? P ZN .  ZN ? ? ? 1_555 A CYS 71   SG    ? ? A ZN 2488 A CYS 71   1_555 ? ? ? ? ? ? ?                       
2.806 ? 
metalc2  metalc ? ? P ZN .  ZN ? ? ? 1_555 A CYS 74   SG    ? ? A ZN 2488 A CYS 74   1_555 ? ? ? ? ? ? ?                       
2.436 ? 
metalc3  metalc ? ? P ZN .  ZN ? ? ? 1_555 A CYS 81   SG    ? ? A ZN 2488 A CYS 81   1_555 ? ? ? ? ? ? ?                       
2.488 ? 
metalc4  metalc ? ? P ZN .  ZN ? ? ? 1_555 A HIS 84   NE2   ? ? A ZN 2488 A HIS 84   1_555 ? ? ? ? ? ? ?                       
2.169 ? 
metalc5  metalc ? ? Q ZN .  ZN ? ? ? 1_555 A CYS 111  SG    ? ? A ZN 2489 A CYS 111  1_555 ? ? ? ? ? ? ?                       
2.442 ? 
metalc6  metalc ? ? Q ZN .  ZN ? ? ? 1_555 A CYS 114  SG    ? ? A ZN 2489 A CYS 114  1_555 ? ? ? ? ? ? ?                       
2.656 ? 
metalc7  metalc ? ? Q ZN .  ZN ? ? ? 1_555 A CYS 184  SG    ? ? A ZN 2489 A CYS 184  1_555 ? ? ? ? ? ? ?                       
2.703 ? 
metalc8  metalc ? ? R MG .  MG ? ? ? 1_555 A ASP 495  OD1   ? ? A MG 2490 A ASP 495  1_555 ? ? ? ? ? ? ?                       
2.275 ? 
metalc9  metalc ? ? R MG .  MG ? ? ? 1_555 A ASP 499  OD1   ? ? A MG 2490 A ASP 499  1_555 ? ? ? ? ? ? ?                       
2.325 ? 
metalc10 metalc ? ? R MG .  MG ? ? ? 1_555 A ASP 499  OD2   ? ? A MG 2490 A ASP 499  1_555 ? ? ? ? ? ? ?                       
2.168 ? 
metalc11 metalc ? ? R MG .  MG ? ? ? 1_555 N C   20   "O3'" ? ? A MG 2490 P C   20   1_555 ? ? ? ? ? ? ?                       
2.127 ? 
metalc12 metalc ? ? S ZN .  ZN ? ? ? 1_555 B CYS 1137 SG    ? ? B ZN 2175 B CYS 1137 1_555 ? ? ? ? ? ? ?                       
2.444 ? 
metalc13 metalc ? ? S ZN .  ZN ? ? ? 1_555 B CYS 1119 SG    ? ? B ZN 2175 B CYS 1119 1_555 ? ? ? ? ? ? ?                       
2.556 ? 
metalc14 metalc ? ? S ZN .  ZN ? ? ? 1_555 B CYS 1122 SG    ? ? B ZN 2175 B CYS 1122 1_555 ? ? ? ? ? ? ?                       
2.456 ? 
metalc15 metalc ? ? S ZN .  ZN ? ? ? 1_555 B CYS 1140 SG    ? ? B ZN 2175 B CYS 1140 1_555 ? ? ? ? ? ? ?                       
2.445 ? 
metalc16 metalc ? ? T ZN .  ZN ? ? ? 1_555 C CYS 88   SG    ? ? C ZN 1272 C CYS 88   1_555 ? ? ? ? ? ? ?                       
2.405 ? 
metalc17 metalc ? ? T ZN .  ZN ? ? ? 1_555 C CYS 94   SG    ? ? C ZN 1272 C CYS 94   1_555 ? ? ? ? ? ? ?                       
2.215 ? 
metalc18 metalc ? ? T ZN .  ZN ? ? ? 1_555 C CYS 90   SG    ? ? C ZN 1272 C CYS 90   1_555 ? ? ? ? ? ? ?                       
2.324 ? 
metalc19 metalc ? ? T ZN .  ZN ? ? ? 1_555 C CYS 97   SG    ? ? C ZN 1272 C CYS 97   1_555 ? ? ? ? ? ? ?                       
2.532 ? 
metalc20 metalc ? ? U ZN .  ZN ? ? ? 1_555 I CYS 39   SG    ? ? I ZN 1126 I CYS 39   1_555 ? ? ? ? ? ? ?                       
2.549 ? 
metalc21 metalc ? ? U ZN .  ZN ? ? ? 1_555 I CYS 17   SG    ? ? I ZN 1126 I CYS 17   1_555 ? ? ? ? ? ? ?                       
2.471 ? 
metalc22 metalc ? ? U ZN .  ZN ? ? ? 1_555 I CYS 42   SG    ? ? I ZN 1126 I CYS 42   1_555 ? ? ? ? ? ? ?                       
2.419 ? 
metalc23 metalc ? ? U ZN .  ZN ? ? ? 1_555 I CYS 20   SG    ? ? I ZN 1126 I CYS 20   1_555 ? ? ? ? ? ? ?                       
2.456 ? 
metalc24 metalc ? ? V ZN .  ZN ? ? ? 1_555 I CYS 89   SG    ? ? I ZN 1127 I CYS 89   1_555 ? ? ? ? ? ? ?                       
2.325 ? 
metalc25 metalc ? ? V ZN .  ZN ? ? ? 1_555 I CYS 114  SG    ? ? I ZN 1127 I CYS 114  1_555 ? ? ? ? ? ? ?                       
2.338 ? 
metalc26 metalc ? ? V ZN .  ZN ? ? ? 1_555 I CYS 119  SG    ? ? I ZN 1127 I CYS 119  1_555 ? ? ? ? ? ? ?                       
2.345 ? 
metalc27 metalc ? ? V ZN .  ZN ? ? ? 1_555 I CYS 86   SG    ? ? I ZN 1127 I CYS 86   1_555 ? ? ? ? ? ? ?                       
2.314 ? 
metalc28 metalc ? ? W ZN .  ZN ? ? ? 1_555 J CYS 7    SG    ? ? J ZN 1068 J CYS 7    1_555 ? ? ? ? ? ? ?                       
2.792 ? 
metalc29 metalc ? ? W ZN .  ZN ? ? ? 1_555 J CYS 10   SG    ? ? J ZN 1068 J CYS 10   1_555 ? ? ? ? ? ? ?                       
2.416 ? 
metalc30 metalc ? ? W ZN .  ZN ? ? ? 1_555 J CYS 44   SG    ? ? J ZN 1068 J CYS 44   1_555 ? ? ? ? ? ? ?                       
2.624 ? 
metalc31 metalc ? ? W ZN .  ZN ? ? ? 1_555 J CYS 45   SG    ? ? J ZN 1068 J CYS 45   1_555 ? ? ? ? ? ? ?                       
2.590 ? 
metalc32 metalc ? ? X ZN .  ZN ? ? ? 1_555 L CYS 39   SG    ? ? L ZN 1059 L CYS 39   1_555 ? ? ? ? ? ? ?                       
2.347 ? 
metalc33 metalc ? ? X ZN .  ZN ? ? ? 1_555 L CYS 19   SG    ? ? L ZN 1059 L CYS 19   1_555 ? ? ? ? ? ? ?                       
2.315 ? 
metalc34 metalc ? ? X ZN .  ZN ? ? ? 1_555 L CYS 36   SG    ? ? L ZN 1059 L CYS 36   1_555 ? ? ? ? ? ? ?                       
2.374 ? 
metalc35 metalc ? ? X ZN .  ZN ? ? ? 1_555 L CYS 22   SG    ? ? L ZN 1059 L CYS 22   1_555 ? ? ? ? ? ? ?                       
2.373 ? 
hydrog1  hydrog ? ? M DG 1  N1 ? ? ? 1_555 O DC  39   N3    ? ? N DG 1    T DC  39   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog2  hydrog ? ? M DG 1  N2 ? ? ? 1_555 O DC  39   O2    ? ? N DG 1    T DC  39   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog3  hydrog ? ? M DG 1  O6 ? ? ? 1_555 O DC  39   N4    ? ? N DG 1    T DC  39   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog4  hydrog ? ? M DG 2  N1 ? ? ? 1_555 O DC  38   N3    ? ? N DG 2    T DC  38   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog5  hydrog ? ? M DG 2  N2 ? ? ? 1_555 O DC  38   O2    ? ? N DG 2    T DC  38   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog6  hydrog ? ? M DG 2  O6 ? ? ? 1_555 O DC  38   N4    ? ? N DG 2    T DC  38   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog7  hydrog ? ? M DC 3  N3 ? ? ? 1_555 O DG  37   N1    ? ? N DC 3    T DG  37   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog8  hydrog ? ? M DC 3  N4 ? ? ? 1_555 O DG  37   O6    ? ? N DC 3    T DG  37   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog9  hydrog ? ? M DC 3  O2 ? ? ? 1_555 O DG  37   N2    ? ? N DC 3    T DG  37   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog10 hydrog ? ? M DA 4  N1 ? ? ? 1_555 O DT  36   N3    ? ? N DA 4    T DT  36   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog11 hydrog ? ? M DA 4  N6 ? ? ? 1_555 O DT  36   O4    ? ? N DA 4    T DT  36   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog12 hydrog ? ? M DG 5  N1 ? ? ? 1_555 O DC  35   N3    ? ? N DG 5    T DC  35   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog13 hydrog ? ? M DG 5  N2 ? ? ? 1_555 O DC  35   O2    ? ? N DG 5    T DC  35   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog14 hydrog ? ? M DG 5  O6 ? ? ? 1_555 O DC  35   N4    ? ? N DG 5    T DC  35   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog15 hydrog ? ? M DT 6  N3 ? ? ? 1_555 O DA  34   N1    ? ? N DT 6    T DA  34   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog16 hydrog ? ? M DT 6  O4 ? ? ? 1_555 O DA  34   N6    ? ? N DT 6    T DA  34   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog17 hydrog ? ? M DA 7  N1 ? ? ? 1_555 O DT  33   N3    ? ? N DA 7    T DT  33   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog18 hydrog ? ? M DA 7  N6 ? ? ? 1_555 O DT  33   O4    ? ? N DA 7    T DT  33   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog19 hydrog ? ? M DC 8  N3 ? ? ? 1_555 O DG  32   N1    ? ? N DC 8    T DG  32   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog20 hydrog ? ? M DC 8  N4 ? ? ? 1_555 O DG  32   O6    ? ? N DC 8    T DG  32   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog21 hydrog ? ? M DC 8  O2 ? ? ? 1_555 O DG  32   N2    ? ? N DC 8    T DG  32   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog22 hydrog ? ? M DT 9  N3 ? ? ? 1_555 O DA  31   N1    ? ? N DT 9    T DA  31   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog23 hydrog ? ? M DT 9  O4 ? ? ? 1_555 O DA  31   N6    ? ? N DT 9    T DA  31   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog24 hydrog ? ? M DA 10 N1 ? ? ? 1_555 O DT  30   N3    ? ? N DA 10   T DT  30   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog25 hydrog ? ? M DA 10 N6 ? ? ? 1_555 O DT  30   O4    ? ? N DA 10   T DT  30   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog26 hydrog ? ? M DG 11 N1 ? ? ? 1_555 O DC  29   N3    ? ? N DG 11   T DC  29   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog27 hydrog ? ? M DG 11 N2 ? ? ? 1_555 O DC  29   O2    ? ? N DG 11   T DC  29   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog28 hydrog ? ? M DG 11 O6 ? ? ? 1_555 O DC  29   N4    ? ? N DG 11   T DC  29   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog29 hydrog ? ? M DT 12 N3 ? ? ? 1_555 O DA  28   N1    ? ? N DT 12   T DA  28   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog30 hydrog ? ? M DT 12 O4 ? ? ? 1_555 O DA  28   N6    ? ? N DT 12   T DA  28   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog31 hydrog ? ? M DA 13 N1 ? ? ? 1_555 O DT  27   N3    ? ? N DA 13   T DT  27   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog32 hydrog ? ? M DA 13 N6 ? ? ? 1_555 O DT  27   O2    ? ? N DA 13   T DT  27   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog33 hydrog ? ? M DA 26 N6 ? ? ? 1_555 O DT  14   O4    ? ? N DA 26   T DT  14   1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog34 hydrog ? ? M DA 27 N1 ? ? ? 1_555 O DT  13   N3    ? ? N DA 27   T DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog35 hydrog ? ? M DA 27 N6 ? ? ? 1_555 O DT  13   O4    ? ? N DA 27   T DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog36 hydrog ? ? M DG 28 N1 ? ? ? 1_555 O DC  12   N3    ? ? N DG 28   T DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog37 hydrog ? ? M DG 28 N2 ? ? ? 1_555 O DC  12   O2    ? ? N DG 28   T DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog38 hydrog ? ? M DG 28 O6 ? ? ? 1_555 O DC  12   N4    ? ? N DG 28   T DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog39 hydrog ? ? M DT 29 N3 ? ? ? 1_555 O DA  11   N1    ? ? N DT 29   T DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog40 hydrog ? ? M DT 29 O4 ? ? ? 1_555 O DA  11   N6    ? ? N DT 29   T DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog41 hydrog ? ? M DA 30 N1 ? ? ? 1_555 O DT  10   N3    ? ? N DA 30   T DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog42 hydrog ? ? M DA 30 N6 ? ? ? 1_555 O DT  10   O4    ? ? N DA 30   T DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog43 hydrog ? ? M DC 31 N3 ? ? ? 1_555 O DG  9    N1    ? ? N DC 31   T DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog44 hydrog ? ? M DC 31 N4 ? ? ? 1_555 O DG  9    O6    ? ? N DC 31   T DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog45 hydrog ? ? M DC 31 O2 ? ? ? 1_555 O DG  9    N2    ? ? N DC 31   T DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog46 hydrog ? ? M DT 32 N3 ? ? ? 1_555 O DA  8    N1    ? ? N DT 32   T DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog47 hydrog ? ? M DT 32 O4 ? ? ? 1_555 O DA  8    N6    ? ? N DT 32   T DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog48 hydrog ? ? M DT 33 N3 ? ? ? 1_555 O DA  7    N1    ? ? N DT 33   T DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog49 hydrog ? ? M DT 33 O4 ? ? ? 1_555 O DA  7    N6    ? ? N DT 33   T DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog50 hydrog ? ? M DG 34 N1 ? ? ? 1_555 O DC  6    N3    ? ? N DG 34   T DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog51 hydrog ? ? M DG 34 N2 ? ? ? 1_555 O DC  6    O2    ? ? N DG 34   T DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog52 hydrog ? ? M DG 34 O6 ? ? ? 1_555 O DC  6    N4    ? ? N DG 34   T DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog53 hydrog ? ? M DA 35 N1 ? ? ? 1_555 O DT  5    N3    ? ? N DA 35   T DT  5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog54 hydrog ? ? M DA 35 N6 ? ? ? 1_555 O DT  5    O4    ? ? N DA 35   T DT  5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog55 hydrog ? ? M DG 36 N1 ? ? ? 1_555 O DC  4    N3    ? ? N DG 36   T DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog56 hydrog ? ? M DG 36 N2 ? ? ? 1_555 O DC  4    O2    ? ? N DG 36   T DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog57 hydrog ? ? M DG 36 O6 ? ? ? 1_555 O DC  4    N4    ? ? N DG 36   T DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog58 hydrog ? ? M DC 37 N3 ? ? ? 1_555 O DG  3    N1    ? ? N DC 37   T DG  3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog59 hydrog ? ? M DC 37 N4 ? ? ? 1_555 O DG  3    O6    ? ? N DC 37   T DG  3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog60 hydrog ? ? M DC 37 O2 ? ? ? 1_555 O DG  3    N2    ? ? N DC 37   T DG  3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog61 hydrog ? ? M DT 38 N3 ? ? ? 1_555 O DA  2    N1    ? ? N DT 38   T DA  2    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog62 hydrog ? ? M DT 38 O4 ? ? ? 1_555 O DA  2    N6    ? ? N DT 38   T DA  2    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog63 hydrog ? ? M DT 39 N3 ? ? ? 1_555 O DA  1    N1    ? ? N DT 39   T DA  1    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog64 hydrog ? ? M DT 39 O4 ? ? ? 1_555 O DA  1    N6    ? ? N DT 39   T DA  1    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog65 hydrog ? ? N A  11 N1 ? ? ? 1_555 O DT  26   N3    ? ? P A  11   T DT  26   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog66 hydrog ? ? N A  11 N6 ? ? ? 1_555 O DT  26   O2    ? ? P A  11   T DT  26   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog67 hydrog ? ? N A  12 N6 ? ? ? 1_555 O DA  25   N1    ? ? P A  12   T DA  25   1_555 ? ? ? ? ? ? 'A-DA MISPAIR'          ? ? 
hydrog68 hydrog ? ? N G  13 N1 ? ? ? 1_555 O DC  24   N3    ? ? P G  13   T DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog69 hydrog ? ? N G  13 N2 ? ? ? 1_555 O DC  24   O2    ? ? P G  13   T DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog70 hydrog ? ? N G  13 O6 ? ? ? 1_555 O DC  24   N4    ? ? P G  13   T DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog71 hydrog ? ? N A  14 N1 ? ? ? 1_555 O DT  23   N3    ? ? P A  14   T DT  23   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog72 hydrog ? ? N A  14 N6 ? ? ? 1_555 O DT  23   O4    ? ? P A  14   T DT  23   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog73 hydrog ? ? N C  15 N3 ? ? ? 1_555 O DG  22   N1    ? ? P C  15   T DG  22   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog74 hydrog ? ? N C  15 N4 ? ? ? 1_555 O DG  22   O6    ? ? P C  15   T DG  22   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog75 hydrog ? ? N C  15 O2 ? ? ? 1_555 O DG  22   N2    ? ? P C  15   T DG  22   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog76 hydrog ? ? N C  16 N3 ? ? ? 1_555 O DG  21   N1    ? ? P C  16   T DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog77 hydrog ? ? N C  16 N4 ? ? ? 1_555 O DG  21   O6    ? ? P C  16   T DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog78 hydrog ? ? N C  16 O2 ? ? ? 1_555 O DG  21   N2    ? ? P C  16   T DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog79 hydrog ? ? N A  17 N1 ? ? ? 1_555 O DT  20   N3    ? ? P A  17   T DT  20   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog80 hydrog ? ? N A  17 N6 ? ? ? 1_555 O DT  20   O4    ? ? P A  17   T DT  20   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog81 hydrog ? ? N G  18 N1 ? ? ? 1_555 O DC  19   N3    ? ? P G  18   T DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog82 hydrog ? ? N G  18 N2 ? ? ? 1_555 O DC  19   O2    ? ? P G  18   T DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog83 hydrog ? ? N G  18 O6 ? ? ? 1_555 O DC  19   N4    ? ? P G  18   T DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog84 hydrog ? ? N G  19 N2 ? ? ? 1_555 O DC  18   O2    ? ? P G  19   T DC  18   1_555 ? ? ? ? ? ? 'G-DC PAIR'             ? ? 
hydrog85 hydrog ? ? N C  20 N3 ? ? ? 1_555 O DG  17   N1    ? ? P C  20   T DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog86 hydrog ? ? N C  20 N4 ? ? ? 1_555 O DG  17   O6    ? ? P C  20   T DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog87 hydrog ? ? N C  20 O2 ? ? ? 1_555 O DG  17   N2    ? ? P C  20   T DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLN 461 A . ? GLN 461 A PRO 462 A ? PRO 462 A 1 -5.16 
2 LYS 581 A . ? LYS 581 A PRO 582 A ? PRO 582 A 1 1.78  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 2  ? 
AC ? 3  ? 
AD ? 2  ? 
AE ? 2  ? 
AF ? 2  ? 
AG ? 7  ? 
AH ? 4  ? 
AI ? 2  ? 
AJ ? 10 ? 
AK ? 2  ? 
AL ? 2  ? 
AM ? 2  ? 
AN ? 3  ? 
AO ? 2  ? 
AP ? 4  ? 
AQ ? 5  ? 
AR ? 2  ? 
DA ? 7  ? 
DB ? 5  ? 
BA ? 4  ? 
BB ? 2  ? 
BC ? 3  ? 
BD ? 4  ? 
BE ? 5  ? 
BF ? 2  ? 
BG ? 2  ? 
BH ? 2  ? 
BI ? 4  ? 
BJ ? 4  ? 
BK ? 4  ? 
BL ? 7  ? 
BM ? 5  ? 
BN ? 2  ? 
BO ? 15 ? 
BP ? 3  ? 
BQ ? 2  ? 
BR ? 2  ? 
BS ? 2  ? 
CA ? 4  ? 
CB ? 5  ? 
CC ? 2  ? 
EA ? 4  ? 
EB ? 2  ? 
EC ? 4  ? 
GA ? 12 ? 
GB ? 3  ? 
IA ? 3  ? 
IB ? 4  ? 
KA ? 4  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AG 4 5 ? parallel      
AG 5 6 ? anti-parallel 
AG 6 7 ? parallel      
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AJ 4 5 ? anti-parallel 
AJ 5 6 ? anti-parallel 
AJ 6 7 ? anti-parallel 
AJ 7 8 ? anti-parallel 
AJ 8 9 ? anti-parallel 
AK 1 2 ? anti-parallel 
AL 1 2 ? anti-parallel 
AM 1 2 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AO 1 2 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AP 3 4 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AQ 3 4 ? anti-parallel 
AQ 4 5 ? anti-parallel 
AR 1 2 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
DA 3 4 ? anti-parallel 
DA 4 5 ? anti-parallel 
DA 5 6 ? anti-parallel 
DA 6 7 ? anti-parallel 
DB 1 2 ? anti-parallel 
DB 2 3 ? anti-parallel 
DB 3 4 ? parallel      
DB 4 5 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BB 1 2 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? parallel      
BD 3 4 ? anti-parallel 
BE 1 2 ? anti-parallel 
BE 2 3 ? anti-parallel 
BE 3 4 ? anti-parallel 
BE 4 5 ? anti-parallel 
BF 1 2 ? parallel      
BG 1 2 ? anti-parallel 
BH 1 2 ? anti-parallel 
BI 1 2 ? parallel      
BI 2 3 ? anti-parallel 
BI 3 4 ? anti-parallel 
BJ 1 2 ? parallel      
BJ 2 3 ? anti-parallel 
BJ 3 4 ? anti-parallel 
BK 1 2 ? anti-parallel 
BK 2 3 ? parallel      
BK 3 4 ? anti-parallel 
BL 1 2 ? anti-parallel 
BL 2 3 ? anti-parallel 
BL 3 4 ? anti-parallel 
BL 4 5 ? anti-parallel 
BL 5 6 ? anti-parallel 
BL 6 7 ? anti-parallel 
BM 1 2 ? anti-parallel 
BM 2 3 ? anti-parallel 
BM 3 4 ? anti-parallel 
BM 4 5 ? anti-parallel 
BN 1 2 ? parallel      
BO 1 2 ? anti-parallel 
BO 2 3 ? anti-parallel 
BO 4 5 ? parallel      
BO 5 6 ? anti-parallel 
BO 6 7 ? anti-parallel 
BO 7 8 ? anti-parallel 
BP 1 2 ? anti-parallel 
BP 2 3 ? anti-parallel 
BQ 1 2 ? anti-parallel 
BR 1 2 ? anti-parallel 
BS 1 2 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CB 3 4 ? anti-parallel 
CB 4 5 ? anti-parallel 
CC 1 2 ? anti-parallel 
EA 1 2 ? anti-parallel 
EA 2 3 ? parallel      
EA 3 4 ? parallel      
EB 1 2 ? parallel      
EC 1 2 ? anti-parallel 
EC 2 3 ? anti-parallel 
EC 3 4 ? parallel      
GA 1 2 ? anti-parallel 
GA 6 7 ? anti-parallel 
GB 1 2 ? anti-parallel 
GB 2 3 ? anti-parallel 
IA 1 2 ? anti-parallel 
IA 2 3 ? anti-parallel 
IB 1 2 ? anti-parallel 
IB 2 3 ? anti-parallel 
IB 3 4 ? anti-parallel 
KA 1 2 ? anti-parallel 
KA 2 3 ? anti-parallel 
KA 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  SER A 1448 ? ASP A 1449 ? SER A 1448 ASP A 1449 
AA 2  ARG A 20   ? GLN A 22   ? ARG A 20   GLN A 22   
AA 3  ARG B 1170 ? MET B 1172 ? ARG B 1170 MET B 1172 
AB 1  GLY A 86   ? PHE A 95   ? GLY A 86   PHE A 95   
AB 2  ILE A 249  ? VAL A 255  ? ILE A 249  VAL A 255  
AC 1  ARG A 190  ? SER A 194  ? ARG A 190  SER A 194  
AC 2  GLU A 197  ? GLU A 201  ? GLU A 197  GLU A 201  
AC 3  LYS A 213  ? LEU A 216  ? LYS A 213  LEU A 216  
AD 1  VAL A 264  ? MET A 266  ? VAL A 264  MET A 266  
AD 2  ALA A 270  ? ASN A 272  ? ALA A 270  ASN A 272  
AE 1  MET A 329  ? LYS A 331  ? MET A 329  LYS A 331  
AE 2  ARG A 334  ? PRO A 335  ? ARG A 334  PRO A 335  
AF 1  LYS A 357  ? ARG A 358  ? LYS A 357  ARG A 358  
AF 2  ARG B 1085 ? PHE B 1086 ? ARG B 1085 PHE B 1086 
AG 1  SER A 362  ? PRO A 369  ? SER A 362  PRO A 369  
AG 2  GLU A 500  ? HIS A 504  ? GLU A 500  HIS A 504  
AG 3  ILE A 455  ? ASN A 459  ? ILE A 455  ASN A 459  
AG 4  MET A 469  ? ILE A 476  ? MET A 469  ILE A 476  
AG 5  GLN A 377  ? VAL A 380  ? GLN A 377  VAL A 380  
AG 6  PHE A 482  ? LEU A 484  ? PHE A 482  LEU A 484  
AG 7  SER A 362  ? PRO A 369  ? SER A 362  PRO A 369  
AH 1  THR A 389  ? ILE A 393  ? THR A 389  ILE A 393  
AH 2  LYS A 445  ? HIS A 449  ? LYS A 445  HIS A 449  
AH 3  ALA A 416  ? ILE A 420  ? ALA A 416  ILE A 420  
AH 4  ARG A 426  ? ASP A 428  ? ARG A 426  ASP A 428  
AI 1  PHE A 554  ? LEU A 555  ? PHE A 554  LEU A 555  
AI 2  TRP A 586  ? THR A 587  ? TRP A 586  THR A 587  
AJ 1  ILE A 579  ? LYS A 581  ? ILE A 579  LYS A 581  
AJ 2  TYR H 90   ? GLY H 101  ? TYR H 90   GLY H 101  
AJ 3  ARG H 111  ? TYR H 118  ? ARG H 111  TYR H 118  
AJ 4  LEU H 121  ? ASP H 128  ? LEU H 121  ASP H 128  
AJ 5  LEU H 39   ? ASN H 44   ? LEU H 39   ASN H 44   
AJ 6  VAL H 25   ? SER H 32   ? VAL H 25   SER H 32   
AJ 7  ILE H 4    ? ASP H 14   ? ILE H 4    ASP H 14   
AJ 8  LYS H 55   ? ALA H 61   ? LYS H 55   ALA H 61   
AJ 9  SER H 139  ? LYS H 147  ? SER H 139  LYS H 147  
AJ 10 ILE A 579  ? LYS A 581  ? ILE A 579  LYS A 581  
AK 1  VAL A 628  ? GLU A 631  ? VAL A 628  GLU A 631  
AK 2  GLU A 634  ? GLY A 638  ? GLU A 634  GLY A 638  
AL 1  GLY A 789  ? GLN A 790  ? GLY A 789  GLN A 790  
AL 2  PHE A 822  ? VAL A 823  ? PHE A 822  VAL A 823  
AM 1  ASN A 792  ? VAL A 793  ? ASN A 792  VAL A 793  
AM 2  LYS A 796  ? ARG A 797  ? LYS A 796  ARG A 797  
AN 1  MET A 872  ? VAL A 873  ? MET A 872  VAL A 873  
AN 2  VAL A 879  ? ARG A 880  ? VAL A 879  ARG A 880  
AN 3  VAL A 886  ? GLN A 888  ? VAL A 886  GLN A 888  
AO 1  GLU A 902  ? ASN A 905  ? GLU A 902  ASN A 905  
AO 2  LYS A 976  ? LEU A 979  ? LYS A 976  LEU A 979  
AP 1  LYS A 1306 ? HIS A 1310 ? LYS A 1306 HIS A 1310 
AP 2  ILE A 1335 ? ASP A 1339 ? ILE A 1335 ASP A 1339 
AP 3  SER A 1138 ? VAL A 1141 ? SER A 1138 VAL A 1141 
AP 4  THR A 1358 ? SER A 1359 ? THR A 1358 SER A 1359 
AQ 1  LEU A 1243 ? PHE A 1247 ? LEU A 1243 PHE A 1247 
AQ 2  LEU A 1255 ? ILE A 1261 ? LEU A 1255 ILE A 1261 
AQ 3  TRP A 1210 ? LEU A 1216 ? TRP A 1210 LEU A 1216 
AQ 4  THR A 1170 ? TYR A 1177 ? THR A 1170 TYR A 1177 
AQ 5  CYS I 52   ? LYS I 57   ? CYS I 52   LYS I 57   
AR 1  LYS A 1319 ? ILE A 1322 ? LYS A 1319 ILE A 1322 
AR 2  PHE A 1328 ? LEU A 1331 ? PHE A 1328 LEU A 1331 
DA 1  GLU D 30   ? THR D 31   ? GLU D 30   THR D 31   
DA 2  PHE G 2    ? LEU G 13   ? PHE G 2    LEU G 13   
DA 3  VAL G 66   ? PHE G 77   ? VAL G 66   PHE G 77   
DA 4  GLY G 57   ? ILE G 59   ? GLY G 57   ILE G 59   
DA 5  PHE A 1471 ? LEU A 1475 ? PHE A 1471 LEU A 1475 
DA 6  ILE F 104  ? TYR F 109  ? ILE F 104  TYR F 109  
DA 7  TYR F 115  ? GLY F 119  ? TYR F 115  GLY F 119  
DB 1  GLU D 30   ? THR D 31   ? GLU D 30   THR D 31   
DB 2  PHE G 2    ? LEU G 13   ? PHE G 2    LEU G 13   
DB 3  VAL G 66   ? PHE G 77   ? VAL G 66   PHE G 77   
DB 4  GLY G 43   ? ILE G 54   ? GLY G 43   ILE G 54   
DB 5  CYS G 38   ? THR G 39   ? CYS G 38   THR G 39   
BA 1  ILE B 65   ? LEU B 67   ? ILE B 65   LEU B 67   
BA 2  ARG B 83   ? LEU B 93   ? ARG B 83   LEU B 93   
BA 3  SER B 121  ? ILE B 133  ? SER B 121  ILE B 133  
BA 4  GLN B 139  ? PRO B 153  ? GLN B 139  PRO B 153  
BB 1  THR B 97   ? TRP B 99   ? THR B 97   TRP B 99   
BB 2  PRO B 105  ? PRO B 107  ? PRO B 105  PRO B 107  
BC 1  PHE B 185  ? ILE B 187  ? PHE B 185  ILE B 187  
BC 2  SER B 190  ? VAL B 193  ? SER B 190  VAL B 193  
BC 3  GLN B 468  ? VAL B 469  ? GLN B 468  VAL B 469  
BD 1  LYS B 391  ? ASP B 394  ? LYS B 391  ASP B 394  
BD 2  ALA B 196  ? MET B 200  ? ALA B 196  MET B 200  
BD 3  ARG B 484  ? ASN B 486  ? ARG B 484  ASN B 486  
BD 4  VAL B 523  ? ASN B 525  ? VAL B 523  ASN B 525  
BE 1  VAL B 205  ? PHE B 208  ? VAL B 205  PHE B 208  
BE 2  TYR B 215  ? LEU B 225  ? TYR B 215  LEU B 225  
BE 3  SER B 229  ? LEU B 240  ? SER B 229  LEU B 240  
BE 4  ILE B 256  ? THR B 259  ? ILE B 256  THR B 259  
BE 5  VAL B 267  ? PRO B 268  ? VAL B 267  PRO B 268  
BF 1  TYR B 531  ? ILE B 532  ? TYR B 531  ILE B 532  
BF 2  ILE B 621  ? GLU B 629  ? ILE B 621  GLU B 629  
BG 1  LYS B 632  ? LEU B 633  ? LYS B 632  LEU B 633  
BG 2  ILE B 621  ? GLU B 629  ? ILE B 621  GLU B 629  
BH 1  VAL B 662  ? ASP B 666  ? VAL B 662  ASP B 666  
BH 2  ILE B 621  ? GLU B 629  ? ILE B 621  GLU B 629  
BI 1  LEU B 675  ? ALA B 676  ? LEU B 675  ALA B 676  
BI 2  HIS B 695  ? CYS B 696  ? HIS B 695  CYS B 696  
BI 3  ILE B 621  ? GLU B 629  ? ILE B 621  GLU B 629  
BI 4  LYS B 632  ? LEU B 633  ? LYS B 632  LEU B 633  
BJ 1  LEU B 675  ? ALA B 676  ? LEU B 675  ALA B 676  
BJ 2  HIS B 695  ? CYS B 696  ? HIS B 695  CYS B 696  
BJ 3  ILE B 621  ? GLU B 629  ? ILE B 621  GLU B 629  
BJ 4  VAL B 662  ? ASP B 666  ? VAL B 662  ASP B 666  
BK 1  CYS B 572  ? HIS B 577  ? CYS B 572  HIS B 577  
BK 2  THR B 565  ? VAL B 569  ? THR B 565  VAL B 569  
BK 3  ILE B 612  ? TYR B 615  ? ILE B 612  TYR B 615  
BK 4  SER B 602  ? ARG B 605  ? SER B 602  ARG B 605  
BL 1  ALA B 748  ? LEU B 751  ? ALA B 748  LEU B 751  
BL 2  SER B 808  ? GLN B 817  ? SER B 808  GLN B 817  
BL 3  LYS B 917  ? ARG B 927  ? LYS B 917  ARG B 927  
BL 4  GLY B 902  ? LEU B 911  ? GLY B 902  LEU B 911  
BL 5  MET L 44   ? TYR L 45   ? MET L 44   TYR L 45   
BL 6  ILE L 16   ? CYS L 19   ? ILE L 16   CYS L 19   
BL 7  ASN L 26   ? GLU L 27   ? ASN L 26   GLU L 27   
BM 1  ALA B 748  ? LEU B 751  ? ALA B 748  LEU B 751  
BM 2  SER B 808  ? GLN B 817  ? SER B 808  GLN B 817  
BM 3  LYS B 917  ? ARG B 927  ? LYS B 917  ARG B 927  
BM 4  GLY B 902  ? LEU B 911  ? GLY B 902  LEU B 911  
BM 5  ARG B 859  ? VAL B 860  ? ARG B 859  VAL B 860  
BN 1  VAL B 759  ? THR B 760  ? VAL B 759  THR B 760  
BN 2  GLY B 997  ? ASP B 998  ? GLY B 997  ASP B 998  
BO 1  ILE B 776  ? ILE B 782  ? ILE B 776  ILE B 782  
BO 2  ILE B 1041 ? ARG B 1050 ? ILE B 1041 ARG B 1050 
BO 3  ASN B 1025 ? GLU B 1026 ? ASN B 1025 GLU B 1026 
BO 4  VAL B 794  ? ASN B 797  ? VAL B 794  ASN B 797  
BO 5  LYS B 942  ? TYR B 949  ? LYS B 942  TYR B 949  
BO 6  LYS B 934  ? SER B 937  ? LYS B 934  SER B 937  
BO 7  ILE B 965  ? ILE B 967  ? ILE B 965  ILE B 967  
BO 8  ILE B 776  ? ILE B 782  ? ILE B 776  ILE B 782  
BP 1  GLU B 827  ? PHE B 829  ? GLU B 827  PHE B 829  
BP 2  LYS B 869  ? THR B 872  ? LYS B 869  THR B 872  
BP 3  LYS B 889  ? ASP B 891  ? LYS B 889  ASP B 891  
BQ 1  VAL B 865  ? ILE B 867  ? VAL B 865  ILE B 867  
BQ 2  THR B 894  ? PHE B 895  ? THR B 894  PHE B 895  
BR 1  GLN B 1115 ? CYS B 1119 ? GLN B 1115 CYS B 1119 
BR 2  ILE B 1146 ? ARG B 1150 ? ILE B 1146 ARG B 1150 
BS 1  ILE B 1127 ? ALA B 1128 ? ILE B 1127 ALA B 1128 
BS 2  TYR B 1135 ? GLU B 1136 ? TYR B 1135 GLU B 1136 
CA 1  THR C 8    ? LEU C 14   ? THR C 8    LEU C 14   
CA 2  ASN C 18   ? GLU C 24   ? ASN C 18   GLU C 24   
CA 3  PHE C 229  ? GLU C 234  ? PHE C 229  GLU C 234  
CA 4  ALA C 183  ? GLU C 185  ? ALA C 183  GLU C 185  
CB 1  ILE C 121  ? SER C 122  ? ILE C 121  SER C 122  
CB 2  VAL C 99   ? ARG C 106  ? VAL C 99   ARG C 106  
CB 3  GLU C 158  ? GLY C 168  ? GLU C 158  GLY C 168  
CB 4  ILE C 44   ? ASN C 55   ? ILE C 44   ASN C 55   
CB 5  VAL L 54   ? ASP L 56   ? VAL L 54   ASP L 56   
CC 1  ARG C 113  ? THR C 116  ? ARG C 113  THR C 116  
CC 2  LEU C 149  ? LEU C 153  ? LEU C 149  LEU C 153  
EA 1  VAL E 60   ? LEU E 61   ? VAL E 60   LEU E 61   
EA 2  PHE E 73   ? PHE E 75   ? PHE E 73   PHE E 75   
EA 3  ARG E 101  ? VAL E 106  ? ARG E 101  VAL E 106  
EA 4  ILE E 126  ? LEU E 131  ? ILE E 126  LEU E 131  
EB 1  LYS E 81   ? VAL E 82   ? LYS E 81   VAL E 82   
EB 2  GLY E 109  ? MET E 110  ? GLY E 109  MET E 110  
EC 1  GLU E 147  ? VAL E 150  ? GLU E 147  VAL E 150  
EC 2  VAL E 190  ? ARG E 195  ? VAL E 190  ARG E 195  
EC 3  TYR E 203  ? VAL E 209  ? TYR E 203  VAL E 209  
EC 4  ARG E 172  ? ILE E 173  ? ARG E 172  ILE E 173  
GA 1  VAL G 84   ? VAL G 92   ? VAL G 84   VAL G 92   
GA 2  GLU G 142  ? ASP G 153  ? GLU G 142  ASP G 153  
GA 3  GLY G 96   ? ILE G 101  ? GLY G 96   ILE G 101  
GA 4  MET G 104  ? SER G 109  ? MET G 104  SER G 109  
GA 5  ASP G 156  ? SER G 162  ? ASP G 156  SER G 162  
GA 6  GLY G 169  ? LEU G 170  ? GLY G 169  LEU G 170  
GA 7  GLU G 142  ? ASP G 153  ? GLU G 142  ASP G 153  
GB 1  GLU G 118  ? ASP G 120  ? GLU G 118  ASP G 120  
GB 2  CYS G 127  ? LYS G 129  ? CYS G 127  LYS G 129  
GB 3  VAL G 136  ? ILE G 137  ? VAL G 136  ILE G 137  
IA 1  TYR I 25   ? GLU I 28   ? TYR I 25   GLU I 28   
IA 2  LEU I 35   ? ALA I 38   ? LEU I 35   ALA I 38   
IA 3  GLN I 45   ? GLU I 47   ? GLN I 45   GLU I 47   
IB 1  ARG I 80   ? THR I 81   ? ARG I 80   THR I 81   
IB 2  ALA I 94   ? PHE I 97   ? ALA I 94   PHE I 97   
IB 3  TYR I 111  ? CYS I 114  ? TYR I 111  CYS I 114  
IB 4  ARG I 122  ? THR I 124  ? ARG I 122  THR I 124  
KA 1  ILE K 19   ? LYS K 23   ? ILE K 19   LYS K 23   
KA 2  ALA K 30   ? ASN K 36   ? ALA K 30   ASN K 36   
KA 3  LYS K 70   ? THR K 77   ? LYS K 70   THR K 77   
KA 4  VAL K 56   ? LYS K 62   ? VAL K 56   LYS K 62   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ASP A 1449 ? N ASP A 1449 O VAL A 21   ? O VAL A 21   
AA 2 3 N GLN A 22   ? N GLN A 22   O ARG B 1170 ? O ARG B 1170 
AB 1 2 N VAL A 94   ? N VAL A 94   O VAL A 250  ? O VAL A 250  
AC 1 2 N SER A 194  ? N SER A 194  O GLU A 197  ? O GLU A 197  
AC 2 3 N ALA A 200  ? N ALA A 200  O ILE A 214  ? O ILE A 214  
AD 1 2 N MET A 266  ? N MET A 266  O ALA A 270  ? O ALA A 270  
AE 1 2 N GLN A 330  ? N GLN A 330  O ARG A 334  ? O ARG A 334  
AF 1 2 N LYS A 357  ? N LYS A 357  O PHE B 1086 ? O PHE B 1086 
AG 1 2 N THR A 365  ? N THR A 365  O MET A 501  ? O MET A 501  
AG 2 3 N HIS A 504  ? N HIS A 504  O ILE A 457  ? O ILE A 457  
AG 3 4 N PHE A 458  ? N PHE A 458  O MET A 470  ? O MET A 470  
AG 4 5 N ARG A 475  ? N ARG A 475  O VAL A 378  ? O VAL A 378  
AG 5 6 N GLY A 379  ? N GLY A 379  O ARG A 483  ? O ARG A 483  
AG 6 7 N PHE A 482  ? N PHE A 482  O VAL A 366  ? O VAL A 366  
AH 1 2 N GLU A 392  ? N GLU A 392  O VAL A 446  ? O VAL A 446  
AH 2 3 O GLU A 447  ? O GLU A 447  N LYS A 417  ? N LYS A 417  
AH 3 4 N ILE A 419  ? N ILE A 419  O ILE A 427  ? O ILE A 427  
AI 1 2 N LEU A 555  ? N LEU A 555  O TRP A 586  ? O TRP A 586  
AJ 1 2 N LEU A 580  ? N LEU A 580  O VAL H 91   ? O VAL H 91   
AJ 2 3 N GLU H 100  ? N GLU H 100  O SER H 113  ? O SER H 113  
AJ 3 4 N TYR H 118  ? N TYR H 118  O LEU H 121  ? O LEU H 121  
AJ 4 5 N ARG H 124  ? N ARG H 124  O ILE H 40   ? O ILE H 40   
AJ 5 6 N VAL H 43   ? N VAL H 43   O SER H 26   ? O SER H 26   
AJ 6 7 N GLU H 31   ? N GLU H 31   O ASP H 11   ? O ASP H 11   
AJ 7 8 N PHE H 10   ? N PHE H 10   O PHE H 56   ? O PHE H 56   
AJ 8 9 N ALA H 61   ? N ALA H 61   O TYR H 142  ? O TYR H 142  
AK 1 2 N GLU A 631  ? N GLU A 631  O GLU A 634  ? O GLU A 634  
AL 1 2 N GLY A 789  ? N GLY A 789  O VAL A 823  ? O VAL A 823  
AM 1 2 N VAL A 793  ? N VAL A 793  O LYS A 796  ? O LYS A 796  
AN 1 2 N MET A 872  ? N MET A 872  O ARG A 880  ? O ARG A 880  
AN 2 3 O VAL A 879  ? O VAL A 879  N VAL A 887  ? N VAL A 887  
AO 1 2 N GLN A 904  ? N GLN A 904  O VAL A 977  ? O VAL A 977  
AP 1 2 N HIS A 1310 ? N HIS A 1310 O ILE A 1335 ? O ILE A 1335 
AP 2 3 N THR A 1338 ? N THR A 1338 O LEU A 1139 ? O LEU A 1139 
AP 3 4 N THR A 1140 ? N THR A 1140 O THR A 1358 ? O THR A 1358 
AQ 1 2 N ILE A 1246 ? N ILE A 1246 O ARG A 1258 ? O ARG A 1258 
AQ 2 3 N ILE A 1261 ? N ILE A 1261 O TRP A 1210 ? O TRP A 1210 
AQ 3 4 O GLU A 1215 ? O GLU A 1215 N ALA A 1171 ? N ALA A 1171 
AQ 4 5 O ILE A 1175 ? O ILE A 1175 N ILE I 53   ? N ILE I 53   
AR 1 2 N ILE A 1321 ? N ILE A 1321 O LYS A 1329 ? O LYS A 1329 
DA 1 2 N GLU D 30   ? N GLU D 30   O HIS G 4    ? O HIS G 4    
DA 2 3 N LEU G 13   ? N LEU G 13   O VAL G 66   ? O VAL G 66   
DA 3 4 N LEU G 67   ? N LEU G 67   O VAL G 58   ? O VAL G 58   
DA 4 5 N ILE G 59   ? N ILE G 59   O LEU A 1473 ? O LEU A 1473 
DA 5 6 N LEU A 1474 ? N LEU A 1474 O ILE F 105  ? O ILE F 105  
DA 6 7 N ARG F 108  ? N ARG F 108  O GLU F 116  ? O GLU F 116  
DB 1 2 N GLU D 30   ? N GLU D 30   O HIS G 4    ? O HIS G 4    
DB 2 3 N LEU G 13   ? N LEU G 13   O VAL G 66   ? O VAL G 66   
DB 3 4 N PHE G 77   ? N PHE G 77   O PHE G 44   ? O PHE G 44   
DB 4 5 N GLY G 43   ? N GLY G 43   O THR G 39   ? O THR G 39   
BA 1 2 N LEU B 67   ? N LEU B 67   O TYR B 84   ? O TYR B 84   
BA 2 3 N TYR B 92   ? N TYR B 92   O TYR B 125  ? O TYR B 125  
BA 3 4 N VAL B 132  ? N VAL B 132  O LEU B 140  ? O LEU B 140  
BB 1 2 N HIS B 98   ? N HIS B 98   O SER B 106  ? O SER B 106  
BC 1 2 N ILE B 187  ? N ILE B 187  O SER B 190  ? O SER B 190  
BC 2 3 N VAL B 193  ? N VAL B 193  O GLN B 468  ? O GLN B 468  
BD 1 2 N ASP B 394  ? N ASP B 394  O GLN B 197  ? O GLN B 197  
BD 2 3 N ALA B 196  ? N ALA B 196  O ARG B 484  ? O ARG B 484  
BD 3 4 N LEU B 485  ? N LEU B 485  O LYS B 524  ? O LYS B 524  
BE 1 2 N PHE B 208  ? N PHE B 208  O THR B 218  ? O THR B 218  
BE 2 3 N LEU B 225  ? N LEU B 225  O SER B 229  ? O SER B 229  
BE 3 4 N SER B 238  ? N SER B 238  O VAL B 257  ? O VAL B 257  
BE 4 5 N ALA B 258  ? N ALA B 258  O VAL B 267  ? O VAL B 267  
BF 1 2 N TYR B 531  ? N TYR B 531  O CYS B 622  ? O CYS B 622  
BG 1 2 N LYS B 632  ? N LYS B 632  O GLU B 629  ? O GLU B 629  
BH 1 2 N ILE B 665  ? N ILE B 665  O ARG B 623  ? O ARG B 623  
BI 1 2 N ALA B 676  ? N ALA B 676  O HIS B 695  ? O HIS B 695  
BI 2 3 N CYS B 696  ? N CYS B 696  O LEU B 626  ? O LEU B 626  
BI 3 4 N GLU B 629  ? N GLU B 629  O LYS B 632  ? O LYS B 632  
BJ 1 2 N ALA B 676  ? N ALA B 676  O HIS B 695  ? O HIS B 695  
BJ 2 3 N CYS B 696  ? N CYS B 696  O LEU B 626  ? O LEU B 626  
BJ 3 4 N LEU B 625  ? N LEU B 625  O GLU B 663  ? O GLU B 663  
BK 1 2 N HIS B 577  ? N HIS B 577  O THR B 565  ? O THR B 565  
BK 2 3 N PHE B 568  ? N PHE B 568  O ILE B 612  ? O ILE B 612  
BK 3 4 N TYR B 615  ? N TYR B 615  O SER B 602  ? O SER B 602  
BL 1 2 N VAL B 750  ? N VAL B 750  O VAL B 809  ? O VAL B 809  
BL 2 3 N GLU B 816  ? N GLU B 816  O CYS B 919  ? O CYS B 919  
BL 3 4 N ARG B 924  ? N ARG B 924  O ILE B 903  ? O ILE B 903  
BL 4 5 N VAL B 909  ? N VAL B 909  O MET L 44   ? O MET L 44   
BL 5 6 N TYR L 45   ? N TYR L 45   O ILE L 18   ? O ILE L 18   
BL 6 7 N TYR L 17   ? N TYR L 17   O ASN L 26   ? O ASN L 26   
BM 1 2 N VAL B 750  ? N VAL B 750  O VAL B 809  ? O VAL B 809  
BM 2 3 N GLU B 816  ? N GLU B 816  O CYS B 919  ? O CYS B 919  
BM 3 4 N ARG B 924  ? N ARG B 924  O ILE B 903  ? O ILE B 903  
BM 4 5 N GLY B 902  ? N GLY B 902  O VAL B 860  ? O VAL B 860  
BN 1 2 N THR B 760  ? N THR B 760  O GLY B 997  ? O GLY B 997  
BO 1 2 N ILE B 782  ? N ILE B 782  O PHE B 1042 ? O PHE B 1042 
BO 2 3 N ILE B 1041 ? N ILE B 1041 O GLU B 1026 ? O GLU B 1026 
BO 4 5 N VAL B 794  ? N VAL B 794  O THR B 944  ? O THR B 944  
BO 5 6 N GLY B 943  ? N GLY B 943  O PHE B 935  ? O PHE B 935  
BO 6 7 N ILE B 795  ? N ILE B 795  O ILE B 966  ? O ILE B 966  
BO 7 8 N TYR B 1048 ? N TYR B 1048 O ILE B 776  ? O ILE B 776  
BP 1 2 N VAL B 828  ? N VAL B 828  O THR B 870  ? O THR B 870  
BP 2 3 N VAL B 871  ? N VAL B 871  O ARG B 890  ? O ARG B 890  
BQ 1 2 N ILE B 866  ? N ILE B 866  O THR B 894  ? O THR B 894  
BR 1 2 N VAL B 1118 ? N VAL B 1118 O SER B 1147 ? O SER B 1147 
BS 1 2 N ILE B 1127 ? N ILE B 1127 O GLU B 1136 ? O GLU B 1136 
CA 1 2 N THR C 12   ? N THR C 12   O LYS C 20   ? O LYS C 20   
CA 2 3 N ILE C 23   ? N ILE C 23   O PHE C 229  ? O PHE C 229  
CA 3 4 N ASN C 232  ? N ASN C 232  O ALA C 183  ? O ALA C 183  
CB 1 2 N ILE C 121  ? N ILE C 121  O THR C 102  ? O THR C 102  
CB 2 3 N VAL C 105  ? N VAL C 105  O LEU C 159  ? O LEU C 159  
CB 3 4 N GLY C 168  ? N GLY C 168  O ILE C 44   ? O ILE C 44   
CB 4 5 N VAL C 50   ? N VAL C 50   O PHE L 55   ? O PHE L 55   
CC 1 2 O VAL C 115  ? O VAL C 115  N ILE C 150  ? N ILE C 150  
EA 1 2 N VAL E 60   ? N VAL E 60   O VAL E 74   ? O VAL E 74   
EA 2 3 N PHE E 75   ? N PHE E 75   O LEU E 103  ? O LEU E 103  
EA 3 4 N ALA E 102  ? N ALA E 102  O ILE E 126  ? O ILE E 126  
EB 1 2 N VAL E 82   ? N VAL E 82   O GLY E 109  ? O GLY E 109  
EC 1 2 N VAL E 149  ? N VAL E 149  O LYS E 192  ? O LYS E 192  
EC 2 3 N ARG E 195  ? N ARG E 195  O TYR E 203  ? O TYR E 203  
EC 3 4 O LEU E 208  ? O LEU E 208  N ILE E 173  ? N ILE E 173  
GA 1 2 N ALA G 87   ? N ALA G 87   O ILE G 143  ? O ILE G 143  
GA 6 7 N GLY G 169  ? N GLY G 169  O ARG G 144  ? O ARG G 144  
GB 1 2 N ASP G 120  ? N ASP G 120  O CYS G 127  ? O CYS G 127  
GB 2 3 N TYR G 128  ? N TYR G 128  O ILE G 137  ? O ILE G 137  
IA 1 2 N LYS I 27   ? N LYS I 27   O LEU I 36   ? O LEU I 36   
IA 2 3 N TYR I 37   ? N TYR I 37   O GLN I 46   ? O GLN I 46   
IB 1 2 N THR I 81   ? N THR I 81   O ALA I 94   ? O ALA I 94   
IB 2 3 N PHE I 97   ? N PHE I 97   O TYR I 111  ? O TYR I 111  
IB 3 4 N TYR I 112  ? N TYR I 112  O TRP I 123  ? O TRP I 123  
KA 1 2 N ASN K 22   ? N ASN K 22   O LEU K 32   ? O LEU K 32   
KA 2 3 N ILE K 35   ? N ILE K 35   O ILE K 71   ? O ILE K 71   
KA 3 4 O GLN K 76   ? O GLN K 76   N LEU K 57   ? N LEU K 57   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 2488' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 2489' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 2490' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 2175' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN C 1272' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN I 1126' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN I 1127' 
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN J 1068' 
AC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN L 1059' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 CYS A 71   ? CYS A 71   . ? 1_555 ? 
2  AC1 5 THR A 73   ? THR A 73   . ? 1_555 ? 
3  AC1 5 CYS A 74   ? CYS A 74   . ? 1_555 ? 
4  AC1 5 CYS A 81   ? CYS A 81   . ? 1_555 ? 
5  AC1 5 HIS A 84   ? HIS A 84   . ? 1_555 ? 
6  AC2 5 CYS A 111  ? CYS A 111  . ? 1_555 ? 
7  AC2 5 CYS A 114  ? CYS A 114  . ? 1_555 ? 
8  AC2 5 CYS A 154  ? CYS A 154  . ? 1_555 ? 
9  AC2 5 GLY A 183  ? GLY A 183  . ? 1_555 ? 
10 AC2 5 CYS A 184  ? CYS A 184  . ? 1_555 ? 
11 AC3 4 ASP A 495  ? ASP A 495  . ? 1_555 ? 
12 AC3 4 ASP A 497  ? ASP A 497  . ? 1_555 ? 
13 AC3 4 ASP A 499  ? ASP A 499  . ? 1_555 ? 
14 AC3 4 C   N 20   ? C   P 20   . ? 1_555 ? 
15 AC4 4 CYS B 1119 ? CYS B 1119 . ? 1_555 ? 
16 AC4 4 CYS B 1122 ? CYS B 1122 . ? 1_555 ? 
17 AC4 4 CYS B 1137 ? CYS B 1137 . ? 1_555 ? 
18 AC4 4 CYS B 1140 ? CYS B 1140 . ? 1_555 ? 
19 AC5 4 CYS C 88   ? CYS C 88   . ? 1_555 ? 
20 AC5 4 CYS C 90   ? CYS C 90   . ? 1_555 ? 
21 AC5 4 CYS C 94   ? CYS C 94   . ? 1_555 ? 
22 AC5 4 CYS C 97   ? CYS C 97   . ? 1_555 ? 
23 AC6 4 CYS I 17   ? CYS I 17   . ? 1_555 ? 
24 AC6 4 CYS I 20   ? CYS I 20   . ? 1_555 ? 
25 AC6 4 CYS I 39   ? CYS I 39   . ? 1_555 ? 
26 AC6 4 CYS I 42   ? CYS I 42   . ? 1_555 ? 
27 AC7 4 CYS I 86   ? CYS I 86   . ? 1_555 ? 
28 AC7 4 CYS I 89   ? CYS I 89   . ? 1_555 ? 
29 AC7 4 CYS I 114  ? CYS I 114  . ? 1_555 ? 
30 AC7 4 CYS I 119  ? CYS I 119  . ? 1_555 ? 
31 AC8 4 CYS J 7    ? CYS J 7    . ? 1_555 ? 
32 AC8 4 CYS J 10   ? CYS J 10   . ? 1_555 ? 
33 AC8 4 CYS J 44   ? CYS J 44   . ? 1_555 ? 
34 AC8 4 CYS J 45   ? CYS J 45   . ? 1_555 ? 
35 AC9 5 CYS L 19   ? CYS L 19   . ? 1_555 ? 
36 AC9 5 CYS L 22   ? CYS L 22   . ? 1_555 ? 
37 AC9 5 THR L 24   ? THR L 24   . ? 1_555 ? 
38 AC9 5 CYS L 36   ? CYS L 36   . ? 1_555 ? 
39 AC9 5 CYS L 39   ? CYS L 39   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          5FLM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5FLM 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A 1  11   ? 109.244 146.146 176.453 1.00 147.33 ? 11   SER A N     1 
ATOM   2     C  CA    . SER A 1  11   ? 110.212 146.876 175.643 1.00 147.33 ? 11   SER A CA    1 
ATOM   3     C  C     . SER A 1  11   ? 110.452 148.270 176.210 1.00 147.33 ? 11   SER A C     1 
ATOM   4     O  O     . SER A 1  11   ? 110.787 149.200 175.478 1.00 147.33 ? 11   SER A O     1 
ATOM   5     C  CB    . SER A 1  11   ? 109.734 146.971 174.193 1.00 150.47 ? 11   SER A CB    1 
ATOM   6     O  OG    . SER A 1  11   ? 110.654 147.702 173.402 1.00 150.47 ? 11   SER A OG    1 
ATOM   7     N  N     . ALA A 1  12   ? 110.280 148.404 177.524 1.00 144.76 ? 12   ALA A N     1 
ATOM   8     C  CA    . ALA A 1  12   ? 110.456 149.674 178.214 1.00 144.76 ? 12   ALA A CA    1 
ATOM   9     C  C     . ALA A 1  12   ? 111.916 150.026 178.465 1.00 144.76 ? 12   ALA A C     1 
ATOM   10    O  O     . ALA A 1  12   ? 112.193 151.120 178.968 1.00 144.76 ? 12   ALA A O     1 
ATOM   11    C  CB    . ALA A 1  12   ? 109.700 149.661 179.546 1.00 140.00 ? 12   ALA A CB    1 
ATOM   12    N  N     . CYS A 1  13   ? 112.843 149.129 178.147 1.00 141.08 ? 13   CYS A N     1 
ATOM   13    C  CA    . CYS A 1  13   ? 114.252 149.406 178.378 1.00 141.08 ? 13   CYS A CA    1 
ATOM   14    C  C     . CYS A 1  13   ? 114.714 150.560 177.490 1.00 141.08 ? 13   CYS A C     1 
ATOM   15    O  O     . CYS A 1  13   ? 114.273 150.675 176.340 1.00 141.08 ? 13   CYS A O     1 
ATOM   16    C  CB    . CYS A 1  13   ? 115.094 148.163 178.090 1.00 139.00 ? 13   CYS A CB    1 
ATOM   17    S  SG    . CYS A 1  13   ? 114.759 146.770 179.180 1.00 139.00 ? 13   CYS A SG    1 
ATOM   18    N  N     . PRO A 1  14   ? 115.591 151.430 177.984 1.00 134.01 ? 14   PRO A N     1 
ATOM   19    C  CA    . PRO A 1  14   ? 116.119 152.498 177.131 1.00 134.01 ? 14   PRO A CA    1 
ATOM   20    C  C     . PRO A 1  14   ? 117.027 151.941 176.048 1.00 134.01 ? 14   PRO A C     1 
ATOM   21    O  O     . PRO A 1  14   ? 117.875 151.080 176.294 1.00 134.01 ? 14   PRO A O     1 
ATOM   22    C  CB    . PRO A 1  14   ? 116.897 153.382 178.112 1.00 134.87 ? 14   PRO A CB    1 
ATOM   23    C  CG    . PRO A 1  14   ? 117.291 152.453 179.210 1.00 134.87 ? 14   PRO A CG    1 
ATOM   24    C  CD    . PRO A 1  14   ? 116.150 151.480 179.346 1.00 134.87 ? 14   PRO A CD    1 
ATOM   25    N  N     . LEU A 1  15   ? 116.837 152.446 174.833 1.00 129.34 ? 15   LEU A N     1 
ATOM   26    C  CA    . LEU A 1  15   ? 117.637 151.994 173.706 1.00 129.34 ? 15   LEU A CA    1 
ATOM   27    C  C     . LEU A 1  15   ? 119.074 152.479 173.847 1.00 129.34 ? 15   LEU A C     1 
ATOM   28    O  O     . LEU A 1  15   ? 119.330 153.671 174.037 1.00 129.34 ? 15   LEU A O     1 
ATOM   29    C  CB    . LEU A 1  15   ? 117.039 152.494 172.393 1.00 127.55 ? 15   LEU A CB    1 
ATOM   30    C  CG    . LEU A 1  15   ? 117.819 152.125 171.130 1.00 127.55 ? 15   LEU A CG    1 
ATOM   31    C  CD1   . LEU A 1  15   ? 117.861 150.619 170.955 1.00 127.55 ? 15   LEU A CD1   1 
ATOM   32    C  CD2   . LEU A 1  15   ? 117.218 152.789 169.904 1.00 127.55 ? 15   LEU A CD2   1 
ATOM   33    N  N     . ARG A 1  16   ? 120.016 151.543 173.758 1.00 124.90 ? 16   ARG A N     1 
ATOM   34    C  CA    . ARG A 1  16   ? 121.430 151.855 173.890 1.00 124.90 ? 16   ARG A CA    1 
ATOM   35    C  C     . ARG A 1  16   ? 122.176 151.363 172.659 1.00 124.90 ? 16   ARG A C     1 
ATOM   36    O  O     . ARG A 1  16   ? 121.747 150.434 171.970 1.00 124.90 ? 16   ARG A O     1 
ATOM   37    C  CB    . ARG A 1  16   ? 122.030 151.234 175.158 1.00 128.83 ? 16   ARG A CB    1 
ATOM   38    C  CG    . ARG A 1  16   ? 121.448 151.764 176.459 1.00 128.83 ? 16   ARG A CG    1 
ATOM   39    C  CD    . ARG A 1  16   ? 121.850 153.205 176.718 1.00 128.83 ? 16   ARG A CD    1 
ATOM   40    N  NE    . ARG A 1  16   ? 121.310 153.697 177.983 1.00 128.83 ? 16   ARG A NE    1 
ATOM   41    C  CZ    . ARG A 1  16   ? 121.891 153.509 179.164 1.00 128.83 ? 16   ARG A CZ    1 
ATOM   42    N  NH1   . ARG A 1  16   ? 123.031 152.836 179.242 1.00 128.83 ? 16   ARG A NH1   1 
ATOM   43    N  NH2   . ARG A 1  16   ? 121.333 153.989 180.267 1.00 128.83 ? 16   ARG A NH2   1 
ATOM   44    N  N     . THR A 1  17   ? 123.306 152.006 172.390 1.00 123.57 ? 17   THR A N     1 
ATOM   45    C  CA    . THR A 1  17   ? 124.220 151.613 171.331 1.00 123.57 ? 17   THR A CA    1 
ATOM   46    C  C     . THR A 1  17   ? 125.437 150.953 171.961 1.00 123.57 ? 17   THR A C     1 
ATOM   47    O  O     . THR A 1  17   ? 125.825 151.287 173.083 1.00 123.57 ? 17   THR A O     1 
ATOM   48    C  CB    . THR A 1  17   ? 124.658 152.816 170.484 1.00 122.81 ? 17   THR A CB    1 
ATOM   49    O  OG1   . THR A 1  17   ? 125.307 153.780 171.322 1.00 122.81 ? 17   THR A OG1   1 
ATOM   50    C  CG2   . THR A 1  17   ? 123.458 153.467 169.818 1.00 122.81 ? 17   THR A CG2   1 
ATOM   51    N  N     . ILE A 1  18   ? 126.043 150.018 171.238 1.00 122.38 ? 18   ILE A N     1 
ATOM   52    C  CA    . ILE A 1  18   ? 127.188 149.283 171.758 1.00 122.38 ? 18   ILE A CA    1 
ATOM   53    C  C     . ILE A 1  18   ? 128.414 150.158 171.536 1.00 122.38 ? 18   ILE A C     1 
ATOM   54    O  O     . ILE A 1  18   ? 128.815 150.404 170.396 1.00 122.38 ? 18   ILE A O     1 
ATOM   55    C  CB    . ILE A 1  18   ? 127.348 147.928 171.062 1.00 126.42 ? 18   ILE A CB    1 
ATOM   56    C  CG1   . ILE A 1  18   ? 126.123 147.054 171.301 1.00 126.42 ? 18   ILE A CG1   1 
ATOM   57    C  CG2   . ILE A 1  18   ? 128.584 147.216 171.567 1.00 126.42 ? 18   ILE A CG2   1 
ATOM   58    C  CD1   . ILE A 1  18   ? 126.082 145.835 170.412 1.00 126.42 ? 18   ILE A CD1   1 
ATOM   59    N  N     . LYS A 1  19   ? 129.013 150.629 172.628 1.00 126.71 ? 19   LYS A N     1 
ATOM   60    C  CA    . LYS A 1  19   ? 130.203 151.460 172.549 1.00 126.71 ? 19   LYS A CA    1 
ATOM   61    C  C     . LYS A 1  19   ? 131.497 150.676 172.712 1.00 126.71 ? 19   LYS A C     1 
ATOM   62    O  O     . LYS A 1  19   ? 132.571 151.224 172.440 1.00 126.71 ? 19   LYS A O     1 
ATOM   63    C  CB    . LYS A 1  19   ? 130.135 152.567 173.604 1.00 128.42 ? 19   LYS A CB    1 
ATOM   64    C  CG    . LYS A 1  19   ? 129.000 153.545 173.362 1.00 128.42 ? 19   LYS A CG    1 
ATOM   65    C  CD    . LYS A 1  19   ? 128.966 154.650 174.399 1.00 128.42 ? 19   LYS A CD    1 
ATOM   66    C  CE    . LYS A 1  19   ? 127.896 155.676 174.058 1.00 128.42 ? 19   LYS A CE    1 
ATOM   67    N  NZ    . LYS A 1  19   ? 126.516 155.167 174.302 1.00 128.42 ? 19   LYS A NZ    1 
ATOM   68    N  N     . ARG A 1  20   ? 131.426 149.422 173.149 1.00 128.49 ? 20   ARG A N     1 
ATOM   69    C  CA    . ARG A 1  20   ? 132.618 148.601 173.296 1.00 128.49 ? 20   ARG A CA    1 
ATOM   70    C  C     . ARG A 1  20   ? 132.184 147.144 173.350 1.00 128.49 ? 20   ARG A C     1 
ATOM   71    O  O     . ARG A 1  20   ? 131.038 146.833 173.683 1.00 128.49 ? 20   ARG A O     1 
ATOM   72    C  CB    . ARG A 1  20   ? 133.410 149.012 174.545 1.00 135.01 ? 20   ARG A CB    1 
ATOM   73    C  CG    . ARG A 1  20   ? 134.729 148.297 174.754 1.00 135.01 ? 20   ARG A CG    1 
ATOM   74    C  CD    . ARG A 1  20   ? 135.510 148.933 175.892 1.00 135.01 ? 20   ARG A CD    1 
ATOM   75    N  NE    . ARG A 1  20   ? 134.841 148.789 177.179 1.00 135.01 ? 20   ARG A NE    1 
ATOM   76    C  CZ    . ARG A 1  20   ? 134.971 147.735 177.977 1.00 135.01 ? 20   ARG A CZ    1 
ATOM   77    N  NH1   . ARG A 1  20   ? 135.753 146.723 177.626 1.00 135.01 ? 20   ARG A NH1   1 
ATOM   78    N  NH2   . ARG A 1  20   ? 134.323 147.696 179.132 1.00 135.01 ? 20   ARG A NH2   1 
ATOM   79    N  N     . VAL A 1  21   ? 133.115 146.252 173.021 1.00 129.25 ? 21   VAL A N     1 
ATOM   80    C  CA    . VAL A 1  21   ? 132.893 144.812 173.097 1.00 129.25 ? 21   VAL A CA    1 
ATOM   81    C  C     . VAL A 1  21   ? 134.080 144.202 173.827 1.00 129.25 ? 21   VAL A C     1 
ATOM   82    O  O     . VAL A 1  21   ? 135.214 144.272 173.339 1.00 129.25 ? 21   VAL A O     1 
ATOM   83    C  CB    . VAL A 1  21   ? 132.725 144.176 171.707 1.00 126.14 ? 21   VAL A CB    1 
ATOM   84    C  CG1   . VAL A 1  21   ? 132.611 142.667 171.828 1.00 126.14 ? 21   VAL A CG1   1 
ATOM   85    C  CG2   . VAL A 1  21   ? 131.506 144.747 171.002 1.00 126.14 ? 21   VAL A CG2   1 
ATOM   86    N  N     . GLN A 1  22   ? 133.823 143.598 174.985 1.00 131.61 ? 22   GLN A N     1 
ATOM   87    C  CA    . GLN A 1  22   ? 134.869 143.048 175.843 1.00 131.61 ? 22   GLN A CA    1 
ATOM   88    C  C     . GLN A 1  22   ? 134.837 141.526 175.759 1.00 131.61 ? 22   GLN A C     1 
ATOM   89    O  O     . GLN A 1  22   ? 133.895 140.893 176.243 1.00 131.61 ? 22   GLN A O     1 
ATOM   90    C  CB    . GLN A 1  22   ? 134.682 143.513 177.285 1.00 137.57 ? 22   GLN A CB    1 
ATOM   91    C  CG    . GLN A 1  22   ? 135.787 143.073 178.217 1.00 137.57 ? 22   GLN A CG    1 
ATOM   92    C  CD    . GLN A 1  22   ? 137.119 143.706 177.880 1.00 137.57 ? 22   GLN A CD    1 
ATOM   93    O  OE1   . GLN A 1  22   ? 137.262 144.928 177.911 1.00 137.57 ? 22   GLN A OE1   1 
ATOM   94    N  NE2   . GLN A 1  22   ? 138.103 142.878 177.550 1.00 137.57 ? 22   GLN A NE2   1 
ATOM   95    N  N     . PHE A 1  23   ? 135.866 140.943 175.156 1.00 131.03 ? 23   PHE A N     1 
ATOM   96    C  CA    . PHE A 1  23   ? 135.965 139.496 175.066 1.00 131.03 ? 23   PHE A CA    1 
ATOM   97    C  C     . PHE A 1  23   ? 136.510 138.898 176.361 1.00 131.03 ? 23   PHE A C     1 
ATOM   98    O  O     . PHE A 1  23   ? 137.191 139.559 177.148 1.00 131.03 ? 23   PHE A O     1 
ATOM   99    C  CB    . PHE A 1  23   ? 136.837 139.094 173.880 1.00 129.33 ? 23   PHE A CB    1 
ATOM   100   C  CG    . PHE A 1  23   ? 136.207 139.381 172.552 1.00 129.33 ? 23   PHE A CG    1 
ATOM   101   C  CD1   . PHE A 1  23   ? 135.345 138.465 171.976 1.00 129.33 ? 23   PHE A CD1   1 
ATOM   102   C  CD2   . PHE A 1  23   ? 136.450 140.571 171.889 1.00 129.33 ? 23   PHE A CD2   1 
ATOM   103   C  CE1   . PHE A 1  23   ? 134.755 138.719 170.759 1.00 129.33 ? 23   PHE A CE1   1 
ATOM   104   C  CE2   . PHE A 1  23   ? 135.858 140.831 170.668 1.00 129.33 ? 23   PHE A CE2   1 
ATOM   105   C  CZ    . PHE A 1  23   ? 135.011 139.903 170.104 1.00 129.33 ? 23   PHE A CZ    1 
ATOM   106   N  N     . GLY A 1  24   ? 136.185 137.631 176.578 1.00 131.09 ? 24   GLY A N     1 
ATOM   107   C  CA    . GLY A 1  24   ? 136.649 136.927 177.758 1.00 131.09 ? 24   GLY A CA    1 
ATOM   108   C  C     . GLY A 1  24   ? 136.118 135.511 177.753 1.00 131.09 ? 24   GLY A C     1 
ATOM   109   O  O     . GLY A 1  24   ? 135.164 135.183 177.039 1.00 131.09 ? 24   GLY A O     1 
ATOM   110   N  N     . VAL A 1  25   ? 136.757 134.675 178.561 1.00 133.04 ? 25   VAL A N     1 
ATOM   111   C  CA    . VAL A 1  25   ? 136.375 133.273 178.682 1.00 133.04 ? 25   VAL A CA    1 
ATOM   112   C  C     . VAL A 1  25   ? 135.275 133.161 179.727 1.00 133.04 ? 25   VAL A C     1 
ATOM   113   O  O     . VAL A 1  25   ? 135.327 133.810 180.777 1.00 133.04 ? 25   VAL A O     1 
ATOM   114   C  CB    . VAL A 1  25   ? 137.590 132.401 179.051 1.00 132.78 ? 25   VAL A CB    1 
ATOM   115   C  CG1   . VAL A 1  25   ? 137.184 130.939 179.170 1.00 132.78 ? 25   VAL A CG1   1 
ATOM   116   C  CG2   . VAL A 1  25   ? 138.700 132.572 178.029 1.00 132.78 ? 25   VAL A CG2   1 
ATOM   117   N  N     . LEU A 1  26   ? 134.269 132.340 179.441 1.00 135.85 ? 26   LEU A N     1 
ATOM   118   C  CA    . LEU A 1  26   ? 133.155 132.148 180.361 1.00 135.85 ? 26   LEU A CA    1 
ATOM   119   C  C     . LEU A 1  26   ? 133.580 131.263 181.526 1.00 135.85 ? 26   LEU A C     1 
ATOM   120   O  O     . LEU A 1  26   ? 134.035 130.132 181.324 1.00 135.85 ? 26   LEU A O     1 
ATOM   121   C  CB    . LEU A 1  26   ? 131.957 131.543 179.634 1.00 134.26 ? 26   LEU A CB    1 
ATOM   122   C  CG    . LEU A 1  26   ? 131.232 132.473 178.664 1.00 134.26 ? 26   LEU A CG    1 
ATOM   123   C  CD1   . LEU A 1  26   ? 130.201 131.715 177.848 1.00 134.26 ? 26   LEU A CD1   1 
ATOM   124   C  CD2   . LEU A 1  26   ? 130.568 133.581 179.460 1.00 134.26 ? 26   LEU A CD2   1 
ATOM   125   N  N     . SER A 1  27   ? 133.428 131.780 182.739 1.00 135.31 ? 27   SER A N     1 
ATOM   126   C  CA    . SER A 1  27   ? 133.651 130.966 183.923 1.00 135.31 ? 27   SER A CA    1 
ATOM   127   C  C     . SER A 1  27   ? 132.573 129.892 184.013 1.00 135.31 ? 27   SER A C     1 
ATOM   128   O  O     . SER A 1  27   ? 131.411 130.148 183.670 1.00 135.31 ? 27   SER A O     1 
ATOM   129   C  CB    . SER A 1  27   ? 133.631 131.836 185.181 1.00 136.68 ? 27   SER A CB    1 
ATOM   130   O  OG    . SER A 1  27   ? 133.780 131.051 186.351 1.00 136.68 ? 27   SER A OG    1 
ATOM   131   N  N     . PRO A 1  28   ? 132.911 128.680 184.462 1.00 136.06 ? 28   PRO A N     1 
ATOM   132   C  CA    . PRO A 1  28   ? 131.873 127.646 184.581 1.00 136.06 ? 28   PRO A CA    1 
ATOM   133   C  C     . PRO A 1  28   ? 130.794 128.004 185.586 1.00 136.06 ? 28   PRO A C     1 
ATOM   134   O  O     . PRO A 1  28   ? 129.684 127.465 185.516 1.00 136.06 ? 28   PRO A O     1 
ATOM   135   C  CB    . PRO A 1  28   ? 132.672 126.406 185.002 1.00 133.72 ? 28   PRO A CB    1 
ATOM   136   C  CG    . PRO A 1  28   ? 133.873 126.954 185.688 1.00 133.72 ? 28   PRO A CG    1 
ATOM   137   C  CD    . PRO A 1  28   ? 134.222 128.203 184.933 1.00 133.72 ? 28   PRO A CD    1 
ATOM   138   N  N     . ASP A 1  29   ? 131.090 128.915 186.516 1.00 137.02 ? 29   ASP A N     1 
ATOM   139   C  CA    . ASP A 1  29   ? 130.080 129.343 187.477 1.00 137.02 ? 29   ASP A CA    1 
ATOM   140   C  C     . ASP A 1  29   ? 129.069 130.283 186.832 1.00 137.02 ? 29   ASP A C     1 
ATOM   141   O  O     . ASP A 1  29   ? 127.867 130.197 187.106 1.00 137.02 ? 29   ASP A O     1 
ATOM   142   C  CB    . ASP A 1  29   ? 130.751 130.005 188.679 1.00 143.02 ? 29   ASP A CB    1 
ATOM   143   C  CG    . ASP A 1  29   ? 131.513 129.015 189.533 1.00 143.02 ? 29   ASP A CG    1 
ATOM   144   O  OD1   . ASP A 1  29   ? 131.280 127.799 189.376 1.00 143.02 ? 29   ASP A OD1   1 
ATOM   145   O  OD2   . ASP A 1  29   ? 132.344 129.449 190.358 1.00 143.02 ? 29   ASP A OD2   1 
ATOM   146   N  N     . GLU A 1  30   ? 129.536 131.191 185.970 1.00 135.80 ? 30   GLU A N     1 
ATOM   147   C  CA    . GLU A 1  30   ? 128.606 132.016 185.208 1.00 135.80 ? 30   GLU A CA    1 
ATOM   148   C  C     . GLU A 1  30   ? 127.881 131.188 184.156 1.00 135.80 ? 30   GLU A C     1 
ATOM   149   O  O     . GLU A 1  30   ? 126.778 131.548 183.730 1.00 135.80 ? 30   GLU A O     1 
ATOM   150   C  CB    . GLU A 1  30   ? 129.345 133.192 184.564 1.00 144.58 ? 30   GLU A CB    1 
ATOM   151   C  CG    . GLU A 1  30   ? 128.441 134.191 183.848 1.00 144.58 ? 30   GLU A CG    1 
ATOM   152   C  CD    . GLU A 1  30   ? 129.205 135.376 183.290 1.00 144.58 ? 30   GLU A CD    1 
ATOM   153   O  OE1   . GLU A 1  30   ? 130.444 135.403 183.431 1.00 144.58 ? 30   GLU A OE1   1 
ATOM   154   O  OE2   . GLU A 1  30   ? 128.566 136.281 182.711 1.00 144.58 ? 30   GLU A OE2   1 
ATOM   155   N  N     . LEU A 1  31   ? 128.479 130.072 183.733 1.00 132.54 ? 31   LEU A N     1 
ATOM   156   C  CA    . LEU A 1  31   ? 127.773 129.129 182.871 1.00 132.54 ? 31   LEU A CA    1 
ATOM   157   C  C     . LEU A 1  31   ? 126.657 128.426 183.632 1.00 132.54 ? 31   LEU A C     1 
ATOM   158   O  O     . LEU A 1  31   ? 125.577 128.177 183.086 1.00 132.54 ? 31   LEU A O     1 
ATOM   159   C  CB    . LEU A 1  31   ? 128.752 128.107 182.293 1.00 133.10 ? 31   LEU A CB    1 
ATOM   160   C  CG    . LEU A 1  31   ? 129.776 128.624 181.285 1.00 133.10 ? 31   LEU A CG    1 
ATOM   161   C  CD1   . LEU A 1  31   ? 130.787 127.544 180.944 1.00 133.10 ? 31   LEU A CD1   1 
ATOM   162   C  CD2   . LEU A 1  31   ? 129.064 129.101 180.032 1.00 133.10 ? 31   LEU A CD2   1 
ATOM   163   N  N     . LYS A 1  32   ? 126.903 128.091 184.902 1.00 131.52 ? 32   LYS A N     1 
ATOM   164   C  CA    . LYS A 1  32   ? 125.865 127.455 185.706 1.00 131.52 ? 32   LYS A CA    1 
ATOM   165   C  C     . LYS A 1  32   ? 124.753 128.436 186.052 1.00 131.52 ? 32   LYS A C     1 
ATOM   166   O  O     . LYS A 1  32   ? 123.572 128.072 186.052 1.00 131.52 ? 32   LYS A O     1 
ATOM   167   C  CB    . LYS A 1  32   ? 126.472 126.862 186.976 1.00 133.45 ? 32   LYS A CB    1 
ATOM   168   C  CG    . LYS A 1  32   ? 127.378 125.673 186.725 1.00 133.45 ? 32   LYS A CG    1 
ATOM   169   C  CD    . LYS A 1  32   ? 128.026 125.192 188.009 1.00 133.45 ? 32   LYS A CD    1 
ATOM   170   C  CE    . LYS A 1  32   ? 128.909 123.986 187.754 1.00 133.45 ? 32   LYS A CE    1 
ATOM   171   N  NZ    . LYS A 1  32   ? 129.611 123.533 188.986 1.00 133.45 ? 32   LYS A NZ    1 
ATOM   172   N  N     . ARG A 1  33   ? 125.110 129.687 186.351 1.00 133.58 ? 33   ARG A N     1 
ATOM   173   C  CA    . ARG A 1  33   ? 124.091 130.679 186.681 1.00 133.58 ? 33   ARG A CA    1 
ATOM   174   C  C     . ARG A 1  33   ? 123.293 131.084 185.449 1.00 133.58 ? 33   ARG A C     1 
ATOM   175   O  O     . ARG A 1  33   ? 122.074 131.279 185.527 1.00 133.58 ? 33   ARG A O     1 
ATOM   176   C  CB    . ARG A 1  33   ? 124.734 131.912 187.312 1.00 138.65 ? 33   ARG A CB    1 
ATOM   177   C  CG    . ARG A 1  33   ? 125.374 131.694 188.669 1.00 138.65 ? 33   ARG A CG    1 
ATOM   178   C  CD    . ARG A 1  33   ? 125.946 133.004 189.192 1.00 138.65 ? 33   ARG A CD    1 
ATOM   179   N  NE    . ARG A 1  33   ? 126.562 132.874 190.508 1.00 138.65 ? 33   ARG A NE    1 
ATOM   180   C  CZ    . ARG A 1  33   ? 127.824 132.509 190.708 1.00 138.65 ? 33   ARG A CZ    1 
ATOM   181   N  NH1   . ARG A 1  33   ? 128.607 132.243 189.673 1.00 138.65 ? 33   ARG A NH1   1 
ATOM   182   N  NH2   . ARG A 1  33   ? 128.305 132.417 191.940 1.00 138.65 ? 33   ARG A NH2   1 
ATOM   183   N  N     . MET A 1  34   ? 123.963 131.215 184.304 1.00 133.19 ? 34   MET A N     1 
ATOM   184   C  CA    . MET A 1  34   ? 123.311 131.755 183.116 1.00 133.19 ? 34   MET A CA    1 
ATOM   185   C  C     . MET A 1  34   ? 122.415 130.716 182.453 1.00 133.19 ? 34   MET A C     1 
ATOM   186   O  O     . MET A 1  34   ? 121.378 131.057 181.872 1.00 133.19 ? 34   MET A O     1 
ATOM   187   C  CB    . MET A 1  34   ? 124.368 132.260 182.136 1.00 142.64 ? 34   MET A CB    1 
ATOM   188   C  CG    . MET A 1  34   ? 123.811 132.912 180.889 1.00 142.64 ? 34   MET A CG    1 
ATOM   189   S  SD    . MET A 1  34   ? 125.143 133.588 179.890 1.00 142.64 ? 34   MET A SD    1 
ATOM   190   C  CE    . MET A 1  34   ? 125.574 135.001 180.898 1.00 142.64 ? 34   MET A CE    1 
ATOM   191   N  N     . SER A 1  35   ? 122.802 129.446 182.526 1.00 132.72 ? 35   SER A N     1 
ATOM   192   C  CA    . SER A 1  35   ? 122.040 128.388 181.877 1.00 132.72 ? 35   SER A CA    1 
ATOM   193   C  C     . SER A 1  35   ? 120.646 128.274 182.479 1.00 132.72 ? 35   SER A C     1 
ATOM   194   O  O     . SER A 1  35   ? 120.477 128.317 183.701 1.00 132.72 ? 35   SER A O     1 
ATOM   195   C  CB    . SER A 1  35   ? 122.779 127.059 182.005 1.00 131.44 ? 35   SER A CB    1 
ATOM   196   O  OG    . SER A 1  35   ? 122.021 126.001 181.452 1.00 131.44 ? 35   SER A OG    1 
ATOM   197   N  N     . VAL A 1  36   ? 119.642 128.129 181.611 1.00 132.77 ? 36   VAL A N     1 
ATOM   198   C  CA    . VAL A 1  36   ? 118.271 127.995 182.089 1.00 132.77 ? 36   VAL A CA    1 
ATOM   199   C  C     . VAL A 1  36   ? 117.999 126.577 182.570 1.00 132.77 ? 36   VAL A C     1 
ATOM   200   O  O     . VAL A 1  36   ? 117.191 126.371 183.483 1.00 132.77 ? 36   VAL A O     1 
ATOM   201   C  CB    . VAL A 1  36   ? 117.278 128.420 180.992 1.00 132.54 ? 36   VAL A CB    1 
ATOM   202   C  CG1   . VAL A 1  36   ? 117.429 129.900 180.695 1.00 132.54 ? 36   VAL A CG1   1 
ATOM   203   C  CG2   . VAL A 1  36   ? 117.492 127.601 179.732 1.00 132.54 ? 36   VAL A CG2   1 
ATOM   204   N  N     . THR A 1  37   ? 118.657 125.584 181.981 1.00 136.25 ? 37   THR A N     1 
ATOM   205   C  CA    . THR A 1  37   ? 118.465 124.211 182.417 1.00 136.25 ? 37   THR A CA    1 
ATOM   206   C  C     . THR A 1  37   ? 119.325 123.915 183.641 1.00 136.25 ? 37   THR A C     1 
ATOM   207   O  O     . THR A 1  37   ? 120.459 124.385 183.765 1.00 136.25 ? 37   THR A O     1 
ATOM   208   C  CB    . THR A 1  37   ? 118.783 123.231 181.284 1.00 133.70 ? 37   THR A CB    1 
ATOM   209   O  OG1   . THR A 1  37   ? 118.472 121.896 181.703 1.00 133.70 ? 37   THR A OG1   1 
ATOM   210   C  CG2   . THR A 1  37   ? 120.247 123.308 180.881 1.00 133.70 ? 37   THR A CG2   1 
ATOM   211   N  N     . GLU A 1  38   ? 118.760 123.142 184.562 1.00 136.01 ? 38   GLU A N     1 
ATOM   212   C  CA    . GLU A 1  38   ? 119.415 122.815 185.817 1.00 136.01 ? 38   GLU A CA    1 
ATOM   213   C  C     . GLU A 1  38   ? 119.800 121.343 185.828 1.00 136.01 ? 38   GLU A C     1 
ATOM   214   O  O     . GLU A 1  38   ? 119.049 120.483 185.357 1.00 136.01 ? 38   GLU A O     1 
ATOM   215   C  CB    . GLU A 1  38   ? 118.512 123.139 187.011 1.00 143.86 ? 38   GLU A CB    1 
ATOM   216   C  CG    . GLU A 1  38   ? 118.237 124.625 187.173 1.00 143.86 ? 38   GLU A CG    1 
ATOM   217   C  CD    . GLU A 1  38   ? 117.280 124.927 188.308 1.00 143.86 ? 38   GLU A CD    1 
ATOM   218   O  OE1   . GLU A 1  38   ? 116.681 123.977 188.853 1.00 143.86 ? 38   GLU A OE1   1 
ATOM   219   O  OE2   . GLU A 1  38   ? 117.124 126.117 188.654 1.00 143.86 ? 38   GLU A OE2   1 
ATOM   220   N  N     . GLY A 1  39   ? 120.983 121.062 186.370 1.00 136.90 ? 39   GLY A N     1 
ATOM   221   C  CA    . GLY A 1  39   ? 121.522 119.720 186.325 1.00 136.90 ? 39   GLY A CA    1 
ATOM   222   C  C     . GLY A 1  39   ? 122.148 119.337 185.006 1.00 136.90 ? 39   GLY A C     1 
ATOM   223   O  O     . GLY A 1  39   ? 122.681 118.230 184.888 1.00 136.90 ? 39   GLY A O     1 
ATOM   224   N  N     . GLY A 1  40   ? 122.107 120.219 184.011 1.00 135.13 ? 40   GLY A N     1 
ATOM   225   C  CA    . GLY A 1  40   ? 122.666 119.919 182.713 1.00 135.13 ? 40   GLY A CA    1 
ATOM   226   C  C     . GLY A 1  40   ? 121.669 119.202 181.818 1.00 135.13 ? 40   GLY A C     1 
ATOM   227   O  O     . GLY A 1  40   ? 120.476 119.104 182.105 1.00 135.13 ? 40   GLY A O     1 
ATOM   228   N  N     . ILE A 1  41   ? 122.190 118.697 180.705 1.00 137.16 ? 41   ILE A N     1 
ATOM   229   C  CA    . ILE A 1  41   ? 121.419 117.857 179.798 1.00 137.16 ? 41   ILE A CA    1 
ATOM   230   C  C     . ILE A 1  41   ? 121.848 116.420 180.058 1.00 137.16 ? 41   ILE A C     1 
ATOM   231   O  O     . ILE A 1  41   ? 122.933 115.998 179.644 1.00 137.16 ? 41   ILE A O     1 
ATOM   232   C  CB    . ILE A 1  41   ? 121.642 118.252 178.333 1.00 137.52 ? 41   ILE A CB    1 
ATOM   233   C  CG1   . ILE A 1  41   ? 121.307 119.729 178.121 1.00 137.52 ? 41   ILE A CG1   1 
ATOM   234   C  CG2   . ILE A 1  41   ? 120.809 117.376 177.415 1.00 137.52 ? 41   ILE A CG2   1 
ATOM   235   C  CD1   . ILE A 1  41   ? 119.886 120.093 178.475 1.00 137.52 ? 41   ILE A CD1   1 
ATOM   236   N  N     . LYS A 1  42   ? 120.992 115.667 180.743 1.00 140.30 ? 42   LYS A N     1 
ATOM   237   C  CA    . LYS A 1  42   ? 121.299 114.295 181.126 1.00 140.30 ? 42   LYS A CA    1 
ATOM   238   C  C     . LYS A 1  42   ? 120.988 113.279 180.036 1.00 140.30 ? 42   LYS A C     1 
ATOM   239   O  O     . LYS A 1  42   ? 121.707 112.280 179.908 1.00 140.30 ? 42   LYS A O     1 
ATOM   240   C  CB    . LYS A 1  42   ? 120.537 113.929 182.401 1.00 137.87 ? 42   LYS A CB    1 
ATOM   241   C  CG    . LYS A 1  42   ? 120.975 114.723 183.621 1.00 137.87 ? 42   LYS A CG    1 
ATOM   242   C  CD    . LYS A 1  42   ? 120.127 114.393 184.836 1.00 137.87 ? 42   LYS A CD    1 
ATOM   243   C  CE    . LYS A 1  42   ? 120.586 115.178 186.054 1.00 137.87 ? 42   LYS A CE    1 
ATOM   244   N  NZ    . LYS A 1  42   ? 119.732 114.919 187.246 1.00 137.87 ? 42   LYS A NZ    1 
ATOM   245   N  N     . TYR A 1  43   ? 119.933 113.503 179.257 1.00 144.91 ? 43   TYR A N     1 
ATOM   246   C  CA    . TYR A 1  43   ? 119.351 112.470 178.412 1.00 144.91 ? 43   TYR A CA    1 
ATOM   247   C  C     . TYR A 1  43   ? 119.631 112.744 176.941 1.00 144.91 ? 43   TYR A C     1 
ATOM   248   O  O     . TYR A 1  43   ? 119.245 113.808 176.429 1.00 144.91 ? 43   TYR A O     1 
ATOM   249   C  CB    . TYR A 1  43   ? 117.843 112.389 178.666 1.00 147.96 ? 43   TYR A CB    1 
ATOM   250   C  CG    . TYR A 1  43   ? 117.511 111.986 180.084 1.00 147.96 ? 43   TYR A CG    1 
ATOM   251   C  CD1   . TYR A 1  43   ? 118.193 110.951 180.708 1.00 147.96 ? 43   TYR A CD1   1 
ATOM   252   C  CD2   . TYR A 1  43   ? 116.539 112.662 180.810 1.00 147.96 ? 43   TYR A CD2   1 
ATOM   253   C  CE1   . TYR A 1  43   ? 117.899 110.582 182.006 1.00 147.96 ? 43   TYR A CE1   1 
ATOM   254   C  CE2   . TYR A 1  43   ? 116.240 112.302 182.110 1.00 147.96 ? 43   TYR A CE2   1 
ATOM   255   C  CZ    . TYR A 1  43   ? 116.923 111.263 182.703 1.00 147.96 ? 43   TYR A CZ    1 
ATOM   256   O  OH    . TYR A 1  43   ? 116.629 110.902 183.997 1.00 147.96 ? 43   TYR A OH    1 
ATOM   257   N  N     . PRO A 1  44   ? 120.295 111.832 176.230 1.00 149.19 ? 44   PRO A N     1 
ATOM   258   C  CA    . PRO A 1  44   ? 120.524 112.045 174.792 1.00 149.19 ? 44   PRO A CA    1 
ATOM   259   C  C     . PRO A 1  44   ? 119.253 112.022 173.966 1.00 149.19 ? 44   PRO A C     1 
ATOM   260   O  O     . PRO A 1  44   ? 119.268 112.495 172.822 1.00 149.19 ? 44   PRO A O     1 
ATOM   261   C  CB    . PRO A 1  44   ? 121.451 110.880 174.406 1.00 144.51 ? 44   PRO A CB    1 
ATOM   262   C  CG    . PRO A 1  44   ? 122.091 110.464 175.689 1.00 144.51 ? 44   PRO A CG    1 
ATOM   263   C  CD    . PRO A 1  44   ? 121.036 110.665 176.737 1.00 144.51 ? 44   PRO A CD    1 
ATOM   264   N  N     . GLU A 1  45   ? 118.159 111.484 174.501 1.00 155.06 ? 45   GLU A N     1 
ATOM   265   C  CA    . GLU A 1  45   ? 116.927 111.353 173.735 1.00 155.06 ? 45   GLU A CA    1 
ATOM   266   C  C     . GLU A 1  45   ? 116.326 112.723 173.453 1.00 155.06 ? 45   GLU A C     1 
ATOM   267   O  O     . GLU A 1  45   ? 116.134 113.529 174.369 1.00 155.06 ? 45   GLU A O     1 
ATOM   268   C  CB    . GLU A 1  45   ? 115.924 110.484 174.496 1.00 157.95 ? 45   GLU A CB    1 
ATOM   269   C  CG    . GLU A 1  45   ? 116.359 109.047 174.714 1.00 157.95 ? 45   GLU A CG    1 
ATOM   270   C  CD    . GLU A 1  45   ? 117.225 108.877 175.947 1.00 157.95 ? 45   GLU A CD    1 
ATOM   271   O  OE1   . GLU A 1  45   ? 117.543 109.894 176.598 1.00 157.95 ? 45   GLU A OE1   1 
ATOM   272   O  OE2   . GLU A 1  45   ? 117.583 107.725 176.270 1.00 157.95 ? 45   GLU A OE2   1 
ATOM   273   N  N     . THR A 1  46   ? 116.028 112.984 172.181 1.00 157.35 ? 46   THR A N     1 
ATOM   274   C  CA    . THR A 1  46   ? 115.336 114.217 171.823 1.00 157.35 ? 46   THR A CA    1 
ATOM   275   C  C     . THR A 1  46   ? 113.890 114.184 172.302 1.00 157.35 ? 46   THR A C     1 
ATOM   276   O  O     . THR A 1  46   ? 113.433 115.089 173.010 1.00 157.35 ? 46   THR A O     1 
ATOM   277   C  CB    . THR A 1  46   ? 115.396 114.433 170.311 1.00 158.49 ? 46   THR A CB    1 
ATOM   278   O  OG1   . THR A 1  46   ? 116.760 114.587 169.898 1.00 158.49 ? 46   THR A OG1   1 
ATOM   279   C  CG2   . THR A 1  46   ? 114.604 115.670 169.920 1.00 158.49 ? 46   THR A CG2   1 
ATOM   280   N  N     . THR A 1  47   ? 113.157 113.138 171.928 1.00 163.66 ? 47   THR A N     1 
ATOM   281   C  CA    . THR A 1  47   ? 111.774 112.958 172.343 1.00 163.66 ? 47   THR A CA    1 
ATOM   282   C  C     . THR A 1  47   ? 111.549 111.504 172.730 1.00 163.66 ? 47   THR A C     1 
ATOM   283   O  O     . THR A 1  47   ? 112.227 110.596 172.243 1.00 163.66 ? 47   THR A O     1 
ATOM   284   C  CB    . THR A 1  47   ? 110.780 113.354 171.238 1.00 160.95 ? 47   THR A CB    1 
ATOM   285   O  OG1   . THR A 1  47   ? 111.040 112.583 170.059 1.00 160.95 ? 47   THR A OG1   1 
ATOM   286   C  CG2   . THR A 1  47   ? 110.888 114.839 170.914 1.00 160.95 ? 47   THR A CG2   1 
ATOM   287   N  N     . GLU A 1  48   ? 110.580 111.294 173.620 1.00 167.35 ? 48   GLU A N     1 
ATOM   288   C  CA    . GLU A 1  48   ? 110.178 109.950 174.016 1.00 167.35 ? 48   GLU A CA    1 
ATOM   289   C  C     . GLU A 1  48   ? 108.671 109.781 173.873 1.00 167.35 ? 48   GLU A C     1 
ATOM   290   O  O     . GLU A 1  48   ? 108.204 108.965 173.072 1.00 167.35 ? 48   GLU A O     1 
ATOM   291   C  CB    . GLU A 1  48   ? 110.620 109.650 175.450 1.00 168.95 ? 48   GLU A CB    1 
ATOM   292   C  CG    . GLU A 1  48   ? 112.126 109.537 175.622 1.00 168.95 ? 48   GLU A CG    1 
ATOM   293   C  CD    . GLU A 1  48   ? 112.530 109.258 177.055 1.00 168.95 ? 48   GLU A CD    1 
ATOM   294   O  OE1   . GLU A 1  48   ? 111.659 109.338 177.946 1.00 168.95 ? 48   GLU A OE1   1 
ATOM   295   O  OE2   . GLU A 1  48   ? 113.719 108.957 177.291 1.00 168.95 ? 48   GLU A OE2   1 
ATOM   296   N  N     . GLY A 1  49   ? 107.906 110.545 174.647 1.00 164.74 ? 49   GLY A N     1 
ATOM   297   C  CA    . GLY A 1  49   ? 106.459 110.469 174.598 1.00 164.74 ? 49   GLY A CA    1 
ATOM   298   C  C     . GLY A 1  49   ? 105.848 111.304 173.492 1.00 164.74 ? 49   GLY A C     1 
ATOM   299   O  O     . GLY A 1  49   ? 104.654 111.618 173.529 1.00 164.74 ? 49   GLY A O     1 
ATOM   300   N  N     . GLY A 1  50   ? 106.659 111.679 172.505 1.00 162.52 ? 50   GLY A N     1 
ATOM   301   C  CA    . GLY A 1  50   ? 106.205 112.516 171.416 1.00 162.52 ? 50   GLY A CA    1 
ATOM   302   C  C     . GLY A 1  50   ? 106.380 114.000 171.640 1.00 162.52 ? 50   GLY A C     1 
ATOM   303   O  O     . GLY A 1  50   ? 106.039 114.790 170.750 1.00 162.52 ? 50   GLY A O     1 
ATOM   304   N  N     . ARG A 1  51   ? 106.898 114.405 172.793 1.00 157.34 ? 51   ARG A N     1 
ATOM   305   C  CA    . ARG A 1  51   ? 107.125 115.793 173.148 1.00 157.34 ? 51   ARG A CA    1 
ATOM   306   C  C     . ARG A 1  51   ? 108.582 115.992 173.535 1.00 157.34 ? 51   ARG A C     1 
ATOM   307   O  O     . ARG A 1  51   ? 109.269 115.034 173.911 1.00 157.34 ? 51   ARG A O     1 
ATOM   308   C  CB    . ARG A 1  51   ? 106.223 116.212 174.319 1.00 163.94 ? 51   ARG A CB    1 
ATOM   309   C  CG    . ARG A 1  51   ? 104.740 116.198 174.009 1.00 163.94 ? 51   ARG A CG    1 
ATOM   310   C  CD    . ARG A 1  51   ? 103.934 116.640 175.219 1.00 163.94 ? 51   ARG A CD    1 
ATOM   311   N  NE    . ARG A 1  51   ? 102.496 116.593 174.974 1.00 163.94 ? 51   ARG A NE    1 
ATOM   312   C  CZ    . ARG A 1  51   ? 101.574 116.832 175.902 1.00 163.94 ? 51   ARG A CZ    1 
ATOM   313   N  NH1   . ARG A 1  51   ? 101.941 117.133 177.140 1.00 163.94 ? 51   ARG A NH1   1 
ATOM   314   N  NH2   . ARG A 1  51   ? 100.287 116.768 175.593 1.00 163.94 ? 51   ARG A NH2   1 
ATOM   315   N  N     . PRO A 1  52   ? 109.095 117.218 173.440 1.00 150.45 ? 52   PRO A N     1 
ATOM   316   C  CA    . PRO A 1  52   ? 110.437 117.486 173.969 1.00 150.45 ? 52   PRO A CA    1 
ATOM   317   C  C     . PRO A 1  52   ? 110.470 117.245 175.468 1.00 150.45 ? 52   PRO A C     1 
ATOM   318   O  O     . PRO A 1  52   ? 109.638 117.758 176.219 1.00 150.45 ? 52   PRO A O     1 
ATOM   319   C  CB    . PRO A 1  52   ? 110.657 118.968 173.635 1.00 151.50 ? 52   PRO A CB    1 
ATOM   320   C  CG    . PRO A 1  52   ? 109.756 119.224 172.475 1.00 151.50 ? 52   PRO A CG    1 
ATOM   321   C  CD    . PRO A 1  52   ? 108.545 118.374 172.713 1.00 151.50 ? 52   PRO A CD    1 
ATOM   322   N  N     . LYS A 1  53   ? 111.443 116.453 175.903 1.00 144.13 ? 53   LYS A N     1 
ATOM   323   C  CA    . LYS A 1  53   ? 111.539 116.048 177.295 1.00 144.13 ? 53   LYS A CA    1 
ATOM   324   C  C     . LYS A 1  53   ? 112.418 117.030 178.053 1.00 144.13 ? 53   LYS A C     1 
ATOM   325   O  O     . LYS A 1  53   ? 113.485 117.424 177.570 1.00 144.13 ? 53   LYS A O     1 
ATOM   326   C  CB    . LYS A 1  53   ? 112.078 114.617 177.422 1.00 148.93 ? 53   LYS A CB    1 
ATOM   327   C  CG    . LYS A 1  53   ? 113.477 114.398 176.871 1.00 148.93 ? 53   LYS A CG    1 
ATOM   328   C  CD    . LYS A 1  53   ? 113.887 112.944 177.022 1.00 148.93 ? 53   LYS A CD    1 
ATOM   329   C  CE    . LYS A 1  53   ? 113.998 112.562 178.488 1.00 148.93 ? 53   LYS A CE    1 
ATOM   330   N  NZ    . LYS A 1  53   ? 114.414 111.145 178.679 1.00 148.93 ? 53   LYS A NZ    1 
ATOM   331   N  N     . LEU A 1  54   ? 111.952 117.446 179.228 1.00 138.04 ? 54   LEU A N     1 
ATOM   332   C  CA    . LEU A 1  54   ? 112.702 118.410 180.020 1.00 138.04 ? 54   LEU A CA    1 
ATOM   333   C  C     . LEU A 1  54   ? 114.018 117.798 180.479 1.00 138.04 ? 54   LEU A C     1 
ATOM   334   O  O     . LEU A 1  54   ? 114.045 116.734 181.104 1.00 138.04 ? 54   LEU A O     1 
ATOM   335   C  CB    . LEU A 1  54   ? 111.878 118.869 181.226 1.00 136.25 ? 54   LEU A CB    1 
ATOM   336   C  CG    . LEU A 1  54   ? 110.858 119.991 181.005 1.00 136.25 ? 54   LEU A CG    1 
ATOM   337   C  CD1   . LEU A 1  54   ? 109.719 119.551 180.089 1.00 136.25 ? 54   LEU A CD1   1 
ATOM   338   C  CD2   . LEU A 1  54   ? 110.314 120.487 182.334 1.00 136.25 ? 54   LEU A CD2   1 
ATOM   339   N  N     . GLY A 1  55   ? 115.115 118.484 180.168 1.00 137.84 ? 55   GLY A N     1 
ATOM   340   C  CA    . GLY A 1  55   ? 116.441 117.959 180.395 1.00 137.84 ? 55   GLY A CA    1 
ATOM   341   C  C     . GLY A 1  55   ? 117.063 117.266 179.202 1.00 137.84 ? 55   GLY A C     1 
ATOM   342   O  O     . GLY A 1  55   ? 118.152 116.695 179.337 1.00 137.84 ? 55   GLY A O     1 
ATOM   343   N  N     . GLY A 1  56   ? 116.409 117.290 178.038 1.00 139.80 ? 56   GLY A N     1 
ATOM   344   C  CA    . GLY A 1  56   ? 116.966 116.654 176.865 1.00 139.80 ? 56   GLY A CA    1 
ATOM   345   C  C     . GLY A 1  56   ? 117.647 117.638 175.930 1.00 139.80 ? 56   GLY A C     1 
ATOM   346   O  O     . GLY A 1  56   ? 117.771 118.828 176.215 1.00 139.80 ? 56   GLY A O     1 
ATOM   347   N  N     . LEU A 1  57   ? 118.097 117.118 174.784 1.00 139.18 ? 57   LEU A N     1 
ATOM   348   C  CA    . LEU A 1  57   ? 118.792 117.961 173.816 1.00 139.18 ? 57   LEU A CA    1 
ATOM   349   C  C     . LEU A 1  57   ? 117.869 119.030 173.248 1.00 139.18 ? 57   LEU A C     1 
ATOM   350   O  O     . LEU A 1  57   ? 118.241 120.208 173.184 1.00 139.18 ? 57   LEU A O     1 
ATOM   351   C  CB    . LEU A 1  57   ? 119.377 117.109 172.694 1.00 140.49 ? 57   LEU A CB    1 
ATOM   352   C  CG    . LEU A 1  57   ? 120.499 116.165 173.110 1.00 140.49 ? 57   LEU A CG    1 
ATOM   353   C  CD1   . LEU A 1  57   ? 120.881 115.304 171.931 1.00 140.49 ? 57   LEU A CD1   1 
ATOM   354   C  CD2   . LEU A 1  57   ? 121.700 116.946 173.627 1.00 140.49 ? 57   LEU A CD2   1 
ATOM   355   N  N     . MET A 1  58   ? 116.666 118.644 172.824 1.00 138.37 ? 58   MET A N     1 
ATOM   356   C  CA    . MET A 1  58   ? 115.653 119.630 172.455 1.00 138.37 ? 58   MET A CA    1 
ATOM   357   C  C     . MET A 1  58   ? 114.765 119.908 173.668 1.00 138.37 ? 58   MET A C     1 
ATOM   358   O  O     . MET A 1  58   ? 113.940 119.099 174.089 1.00 138.37 ? 58   MET A O     1 
ATOM   359   C  CB    . MET A 1  58   ? 114.851 119.149 171.251 1.00 148.26 ? 58   MET A CB    1 
ATOM   360   C  CG    . MET A 1  58   ? 113.754 120.108 170.814 1.00 148.26 ? 58   MET A CG    1 
ATOM   361   S  SD    . MET A 1  58   ? 112.938 119.636 169.274 1.00 148.26 ? 58   MET A SD    1 
ATOM   362   C  CE    . MET A 1  58   ? 111.983 118.220 169.802 1.00 148.26 ? 58   MET A CE    1 
ATOM   363   N  N     . ASP A 1  59   ? 114.965 121.091 174.226 1.00 135.05 ? 59   ASP A N     1 
ATOM   364   C  CA    . ASP A 1  59   ? 114.457 121.381 175.555 1.00 135.05 ? 59   ASP A CA    1 
ATOM   365   C  C     . ASP A 1  59   ? 113.475 122.547 175.483 1.00 135.05 ? 59   ASP A C     1 
ATOM   366   O  O     . ASP A 1  59   ? 113.862 123.650 175.074 1.00 135.05 ? 59   ASP A O     1 
ATOM   367   C  CB    . ASP A 1  59   ? 115.628 121.696 176.485 1.00 135.42 ? 59   ASP A CB    1 
ATOM   368   C  CG    . ASP A 1  59   ? 115.242 121.689 177.947 1.00 135.42 ? 59   ASP A CG    1 
ATOM   369   O  OD1   . ASP A 1  59   ? 114.077 121.385 178.264 1.00 135.42 ? 59   ASP A OD1   1 
ATOM   370   O  OD2   . ASP A 1  59   ? 116.123 121.969 178.787 1.00 135.42 ? 59   ASP A OD2   1 
ATOM   371   N  N     . PRO A 1  60   ? 112.203 122.346 175.843 1.00 131.78 ? 60   PRO A N     1 
ATOM   372   C  CA    . PRO A 1  60   ? 111.229 123.442 175.698 1.00 131.78 ? 60   PRO A CA    1 
ATOM   373   C  C     . PRO A 1  60   ? 111.581 124.683 176.499 1.00 131.78 ? 60   PRO A C     1 
ATOM   374   O  O     . PRO A 1  60   ? 111.205 125.792 176.100 1.00 131.78 ? 60   PRO A O     1 
ATOM   375   C  CB    . PRO A 1  60   ? 109.919 122.801 176.175 1.00 133.14 ? 60   PRO A CB    1 
ATOM   376   C  CG    . PRO A 1  60   ? 110.352 121.695 177.081 1.00 133.14 ? 60   PRO A CG    1 
ATOM   377   C  CD    . PRO A 1  60   ? 111.595 121.149 176.447 1.00 133.14 ? 60   PRO A CD    1 
ATOM   378   N  N     . ARG A 1  61   ? 112.292 124.537 177.619 1.00 130.62 ? 61   ARG A N     1 
ATOM   379   C  CA    . ARG A 1  61   ? 112.747 125.718 178.345 1.00 130.62 ? 61   ARG A CA    1 
ATOM   380   C  C     . ARG A 1  61   ? 113.850 126.431 177.577 1.00 130.62 ? 61   ARG A C     1 
ATOM   381   O  O     . ARG A 1  61   ? 114.051 127.640 177.737 1.00 130.62 ? 61   ARG A O     1 
ATOM   382   C  CB    . ARG A 1  61   ? 113.248 125.341 179.740 1.00 134.13 ? 61   ARG A CB    1 
ATOM   383   C  CG    . ARG A 1  61   ? 114.520 124.505 179.737 1.00 134.13 ? 61   ARG A CG    1 
ATOM   384   C  CD    . ARG A 1  61   ? 115.057 124.281 181.144 1.00 134.13 ? 61   ARG A CD    1 
ATOM   385   N  NE    . ARG A 1  61   ? 114.174 123.468 181.976 1.00 134.13 ? 61   ARG A NE    1 
ATOM   386   C  CZ    . ARG A 1  61   ? 114.213 122.140 182.034 1.00 134.13 ? 61   ARG A CZ    1 
ATOM   387   N  NH1   . ARG A 1  61   ? 115.093 121.468 181.307 1.00 134.13 ? 61   ARG A NH1   1 
ATOM   388   N  NH2   . ARG A 1  61   ? 113.374 121.484 182.825 1.00 134.13 ? 61   ARG A NH2   1 
ATOM   389   N  N     . GLN A 1  62   ? 114.575 125.691 176.736 1.00 132.72 ? 62   GLN A N     1 
ATOM   390   C  CA    . GLN A 1  62   ? 115.777 126.229 176.111 1.00 132.72 ? 62   GLN A CA    1 
ATOM   391   C  C     . GLN A 1  62   ? 115.444 127.110 174.913 1.00 132.72 ? 62   GLN A C     1 
ATOM   392   O  O     . GLN A 1  62   ? 116.121 128.113 174.664 1.00 132.72 ? 62   GLN A O     1 
ATOM   393   C  CB    . GLN A 1  62   ? 116.699 125.078 175.706 1.00 132.14 ? 62   GLN A CB    1 
ATOM   394   C  CG    . GLN A 1  62   ? 118.046 125.507 175.182 1.00 132.14 ? 62   GLN A CG    1 
ATOM   395   C  CD    . GLN A 1  62   ? 118.997 124.347 174.989 1.00 132.14 ? 62   GLN A CD    1 
ATOM   396   O  OE1   . GLN A 1  62   ? 118.679 123.209 175.329 1.00 132.14 ? 62   GLN A OE1   1 
ATOM   397   N  NE2   . GLN A 1  62   ? 120.175 124.629 174.447 1.00 132.14 ? 62   GLN A NE2   1 
ATOM   398   N  N     . GLY A 1  63   ? 114.406 126.758 174.162 1.00 138.30 ? 63   GLY A N     1 
ATOM   399   C  CA    . GLY A 1  63   ? 114.076 127.508 172.963 1.00 138.30 ? 63   GLY A CA    1 
ATOM   400   C  C     . GLY A 1  63   ? 112.623 127.324 172.592 1.00 138.30 ? 63   GLY A C     1 
ATOM   401   O  O     . GLY A 1  63   ? 111.840 126.711 173.323 1.00 138.30 ? 63   GLY A O     1 
ATOM   402   N  N     . VAL A 1  64   ? 112.273 127.874 171.433 1.00 143.85 ? 64   VAL A N     1 
ATOM   403   C  CA    . VAL A 1  64   ? 110.903 127.825 170.938 1.00 143.85 ? 64   VAL A CA    1 
ATOM   404   C  C     . VAL A 1  64   ? 110.797 126.768 169.848 1.00 143.85 ? 64   VAL A C     1 
ATOM   405   O  O     . VAL A 1  64   ? 111.718 126.571 169.047 1.00 143.85 ? 64   VAL A O     1 
ATOM   406   C  CB    . VAL A 1  64   ? 110.468 129.214 170.432 1.00 146.17 ? 64   VAL A CB    1 
ATOM   407   C  CG1   . VAL A 1  64   ? 109.060 129.170 169.868 1.00 146.17 ? 64   VAL A CG1   1 
ATOM   408   C  CG2   . VAL A 1  64   ? 110.556 130.218 171.557 1.00 146.17 ? 64   VAL A CG2   1 
ATOM   409   N  N     . ILE A 1  65   ? 109.660 126.073 169.821 1.00 154.72 ? 65   ILE A N     1 
ATOM   410   C  CA    . ILE A 1  65   ? 109.434 124.951 168.923 1.00 154.72 ? 65   ILE A CA    1 
ATOM   411   C  C     . ILE A 1  65   ? 108.062 125.128 168.283 1.00 154.72 ? 65   ILE A C     1 
ATOM   412   O  O     . ILE A 1  65   ? 107.190 125.818 168.817 1.00 154.72 ? 65   ILE A O     1 
ATOM   413   C  CB    . ILE A 1  65   ? 109.529 123.605 169.680 1.00 149.16 ? 65   ILE A CB    1 
ATOM   414   C  CG1   . ILE A 1  65   ? 110.892 123.483 170.353 1.00 149.16 ? 65   ILE A CG1   1 
ATOM   415   C  CG2   . ILE A 1  65   ? 109.364 122.422 168.745 1.00 149.16 ? 65   ILE A CG2   1 
ATOM   416   C  CD1   . ILE A 1  65   ? 110.977 122.357 171.336 1.00 149.16 ? 65   ILE A CD1   1 
ATOM   417   N  N     . GLU A 1  66   ? 107.891 124.521 167.107 1.00 165.73 ? 66   GLU A N     1 
ATOM   418   C  CA    . GLU A 1  66   ? 106.648 124.376 166.355 1.00 165.73 ? 66   GLU A CA    1 
ATOM   419   C  C     . GLU A 1  66   ? 106.274 125.645 165.590 1.00 165.73 ? 66   GLU A C     1 
ATOM   420   O  O     . GLU A 1  66   ? 105.331 125.604 164.797 1.00 165.73 ? 66   GLU A O     1 
ATOM   421   C  CB    . GLU A 1  66   ? 105.451 123.968 167.237 1.00 169.00 ? 66   GLU A CB    1 
ATOM   422   C  CG    . GLU A 1  66   ? 105.588 122.612 167.903 1.00 169.00 ? 66   GLU A CG    1 
ATOM   423   C  CD    . GLU A 1  66   ? 104.453 122.330 168.869 1.00 169.00 ? 66   GLU A CD    1 
ATOM   424   O  OE1   . GLU A 1  66   ? 103.663 123.259 169.145 1.00 169.00 ? 66   GLU A OE1   1 
ATOM   425   O  OE2   . GLU A 1  66   ? 104.354 121.186 169.360 1.00 169.00 ? 66   GLU A OE2   1 
ATOM   426   N  N     . ARG A 1  67   ? 106.937 126.778 165.842 1.00 169.63 ? 67   ARG A N     1 
ATOM   427   C  CA    . ARG A 1  67   ? 106.700 128.066 165.191 1.00 169.63 ? 67   ARG A CA    1 
ATOM   428   C  C     . ARG A 1  67   ? 105.404 128.695 165.694 1.00 169.63 ? 67   ARG A C     1 
ATOM   429   O  O     . ARG A 1  67   ? 105.204 129.908 165.574 1.00 169.63 ? 67   ARG A O     1 
ATOM   430   C  CB    . ARG A 1  67   ? 106.680 127.911 163.663 1.00 204.69 ? 67   ARG A CB    1 
ATOM   431   C  CG    . ARG A 1  67   ? 106.481 129.198 162.883 1.00 204.69 ? 67   ARG A CG    1 
ATOM   432   C  CD    . ARG A 1  67   ? 106.460 128.923 161.390 1.00 204.69 ? 67   ARG A CD    1 
ATOM   433   N  NE    . ARG A 1  67   ? 105.336 128.066 161.025 1.00 204.69 ? 67   ARG A NE    1 
ATOM   434   C  CZ    . ARG A 1  67   ? 104.098 128.504 160.814 1.00 204.69 ? 67   ARG A CZ    1 
ATOM   435   N  NH1   . ARG A 1  67   ? 103.820 129.795 160.930 1.00 204.69 ? 67   ARG A NH1   1 
ATOM   436   N  NH2   . ARG A 1  67   ? 103.138 127.650 160.487 1.00 204.69 ? 67   ARG A NH2   1 
ATOM   437   N  N     . THR A 1  68   ? 104.528 127.884 166.281 1.00 161.72 ? 68   THR A N     1 
ATOM   438   C  CA    . THR A 1  68   ? 103.384 128.372 167.035 1.00 161.72 ? 68   THR A CA    1 
ATOM   439   C  C     . THR A 1  68   ? 103.623 128.338 168.536 1.00 161.72 ? 68   THR A C     1 
ATOM   440   O  O     . THR A 1  68   ? 102.759 128.781 169.300 1.00 161.72 ? 68   THR A O     1 
ATOM   441   C  CB    . THR A 1  68   ? 102.137 127.552 166.696 1.00 162.56 ? 68   THR A CB    1 
ATOM   442   O  OG1   . THR A 1  68   ? 102.372 126.174 167.011 1.00 162.56 ? 68   THR A OG1   1 
ATOM   443   C  CG2   . THR A 1  68   ? 101.809 127.679 165.219 1.00 162.56 ? 68   THR A CG2   1 
ATOM   444   N  N     . GLY A 1  69   ? 104.774 127.832 168.971 1.00 155.03 ? 69   GLY A N     1 
ATOM   445   C  CA    . GLY A 1  69   ? 104.987 127.549 170.372 1.00 155.03 ? 69   GLY A CA    1 
ATOM   446   C  C     . GLY A 1  69   ? 105.529 128.724 171.153 1.00 155.03 ? 69   GLY A C     1 
ATOM   447   O  O     . GLY A 1  69   ? 105.949 129.744 170.606 1.00 155.03 ? 69   GLY A O     1 
ATOM   448   N  N     . ARG A 1  70   ? 105.510 128.559 172.474 1.00 147.19 ? 70   ARG A N     1 
ATOM   449   C  CA    . ARG A 1  70   ? 105.991 129.566 173.410 1.00 147.19 ? 70   ARG A CA    1 
ATOM   450   C  C     . ARG A 1  70   ? 106.882 128.873 174.428 1.00 147.19 ? 70   ARG A C     1 
ATOM   451   O  O     . ARG A 1  70   ? 106.430 127.963 175.130 1.00 147.19 ? 70   ARG A O     1 
ATOM   452   C  CB    . ARG A 1  70   ? 104.823 130.275 174.103 1.00 149.77 ? 70   ARG A CB    1 
ATOM   453   C  CG    . ARG A 1  70   ? 103.881 130.993 173.146 1.00 149.77 ? 70   ARG A CG    1 
ATOM   454   C  CD    . ARG A 1  70   ? 104.552 132.185 172.487 1.00 149.77 ? 70   ARG A CD    1 
ATOM   455   N  NE    . ARG A 1  70   ? 103.668 132.848 171.532 1.00 149.77 ? 70   ARG A NE    1 
ATOM   456   C  CZ    . ARG A 1  70   ? 102.751 133.753 171.858 1.00 149.77 ? 70   ARG A CZ    1 
ATOM   457   N  NH1   . ARG A 1  70   ? 102.581 134.102 173.125 1.00 149.77 ? 70   ARG A NH1   1 
ATOM   458   N  NH2   . ARG A 1  70   ? 101.998 134.302 170.916 1.00 149.77 ? 70   ARG A NH2   1 
ATOM   459   N  N     . CYS A 1  71   ? 108.141 129.294 174.505 1.00 139.88 ? 71   CYS A N     1 
ATOM   460   C  CA    . CYS A 1  71   ? 109.072 128.681 175.438 1.00 139.88 ? 71   CYS A CA    1 
ATOM   461   C  C     . CYS A 1  71   ? 108.676 129.001 176.876 1.00 139.88 ? 71   CYS A C     1 
ATOM   462   O  O     . CYS A 1  71   ? 107.893 129.913 177.150 1.00 139.88 ? 71   CYS A O     1 
ATOM   463   C  CB    . CYS A 1  71   ? 110.500 129.149 175.163 1.00 141.57 ? 71   CYS A CB    1 
ATOM   464   S  SG    . CYS A 1  71   ? 110.697 130.932 175.165 1.00 141.57 ? 71   CYS A SG    1 
ATOM   465   N  N     . GLN A 1  72   ? 109.211 128.208 177.804 1.00 133.90 ? 72   GLN A N     1 
ATOM   466   C  CA    . GLN A 1  72   ? 108.817 128.336 179.201 1.00 133.90 ? 72   GLN A CA    1 
ATOM   467   C  C     . GLN A 1  72   ? 109.553 129.461 179.919 1.00 133.90 ? 72   GLN A C     1 
ATOM   468   O  O     . GLN A 1  72   ? 109.146 129.844 181.020 1.00 133.90 ? 72   GLN A O     1 
ATOM   469   C  CB    . GLN A 1  72   ? 109.046 127.006 179.916 1.00 133.36 ? 72   GLN A CB    1 
ATOM   470   C  CG    . GLN A 1  72   ? 108.175 125.885 179.373 1.00 133.36 ? 72   GLN A CG    1 
ATOM   471   C  CD    . GLN A 1  72   ? 108.471 124.544 180.009 1.00 133.36 ? 72   GLN A CD    1 
ATOM   472   O  OE1   . GLN A 1  72   ? 109.567 124.312 180.520 1.00 133.36 ? 72   GLN A OE1   1 
ATOM   473   N  NE2   . GLN A 1  72   ? 107.493 123.647 179.976 1.00 133.36 ? 72   GLN A NE2   1 
ATOM   474   N  N     . THR A 1  73   ? 110.624 129.994 179.328 1.00 134.04 ? 73   THR A N     1 
ATOM   475   C  CA    . THR A 1  73   ? 111.384 131.066 179.959 1.00 134.04 ? 73   THR A CA    1 
ATOM   476   C  C     . THR A 1  73   ? 110.931 132.459 179.534 1.00 134.04 ? 73   THR A C     1 
ATOM   477   O  O     . THR A 1  73   ? 111.367 133.444 180.140 1.00 134.04 ? 73   THR A O     1 
ATOM   478   C  CB    . THR A 1  73   ? 112.871 130.894 179.654 1.00 132.30 ? 73   THR A CB    1 
ATOM   479   O  OG1   . THR A 1  73   ? 113.058 130.840 178.236 1.00 132.30 ? 73   THR A OG1   1 
ATOM   480   C  CG2   . THR A 1  73   ? 113.397 129.611 180.277 1.00 132.30 ? 73   THR A CG2   1 
ATOM   481   N  N     . CYS A 1  74   ? 110.055 132.561 178.531 1.00 136.59 ? 74   CYS A N     1 
ATOM   482   C  CA    . CYS A 1  74   ? 109.570 133.841 178.020 1.00 136.59 ? 74   CYS A CA    1 
ATOM   483   C  C     . CYS A 1  74   ? 108.545 133.603 176.918 1.00 136.59 ? 74   CYS A C     1 
ATOM   484   O  O     . CYS A 1  74   ? 108.288 132.455 176.549 1.00 136.59 ? 74   CYS A O     1 
ATOM   485   C  CB    . CYS A 1  74   ? 110.720 134.709 177.495 1.00 137.29 ? 74   CYS A CB    1 
ATOM   486   S  SG    . CYS A 1  74   ? 111.763 133.956 176.229 1.00 137.29 ? 74   CYS A SG    1 
ATOM   487   N  N     . ALA A 1  75   ? 107.954 134.665 176.378 1.00 139.25 ? 75   ALA A N     1 
ATOM   488   C  CA    . ALA A 1  75   ? 106.966 134.519 175.315 1.00 139.25 ? 75   ALA A CA    1 
ATOM   489   C  C     . ALA A 1  75   ? 107.713 134.543 173.989 1.00 139.25 ? 75   ALA A C     1 
ATOM   490   O  O     . ALA A 1  75   ? 108.207 135.592 173.562 1.00 139.25 ? 75   ALA A O     1 
ATOM   491   C  CB    . ALA A 1  75   ? 105.919 135.627 175.387 1.00 138.62 ? 75   ALA A CB    1 
ATOM   492   N  N     . GLY A 1  76   ? 107.786 133.387 173.337 1.00 140.68 ? 76   GLY A N     1 
ATOM   493   C  CA    . GLY A 1  76   ? 108.691 133.208 172.222 1.00 140.68 ? 76   GLY A CA    1 
ATOM   494   C  C     . GLY A 1  76   ? 108.302 133.821 170.896 1.00 140.68 ? 76   GLY A C     1 
ATOM   495   O  O     . GLY A 1  76   ? 109.100 134.547 170.296 1.00 140.68 ? 76   GLY A O     1 
ATOM   496   N  N     . ASN A 1  77   ? 107.094 133.511 170.415 1.00 143.43 ? 77   ASN A N     1 
ATOM   497   C  CA    . ASN A 1  77   ? 106.627 133.933 169.096 1.00 143.43 ? 77   ASN A CA    1 
ATOM   498   C  C     . ASN A 1  77   ? 107.473 133.300 167.990 1.00 143.43 ? 77   ASN A C     1 
ATOM   499   O  O     . ASN A 1  77   ? 107.203 133.509 166.803 1.00 143.43 ? 77   ASN A O     1 
ATOM   500   C  CB    . ASN A 1  77   ? 106.625 135.462 168.976 1.00 146.97 ? 77   ASN A CB    1 
ATOM   501   C  CG    . ASN A 1  77   ? 105.870 135.953 167.756 1.00 146.97 ? 77   ASN A CG    1 
ATOM   502   O  OD1   . ASN A 1  77   ? 104.916 135.320 167.307 1.00 146.97 ? 77   ASN A OD1   1 
ATOM   503   N  ND2   . ASN A 1  77   ? 106.299 137.085 167.210 1.00 146.97 ? 77   ASN A ND2   1 
ATOM   504   N  N     . MET A 1  78   ? 108.508 132.544 168.380 1.00 140.46 ? 78   MET A N     1 
ATOM   505   C  CA    . MET A 1  78   ? 109.525 131.967 167.500 1.00 140.46 ? 78   MET A CA    1 
ATOM   506   C  C     . MET A 1  78   ? 110.428 133.056 166.926 1.00 140.46 ? 78   MET A C     1 
ATOM   507   O  O     . MET A 1  78   ? 111.487 132.764 166.361 1.00 140.46 ? 78   MET A O     1 
ATOM   508   C  CB    . MET A 1  78   ? 108.880 131.117 166.392 1.00 151.72 ? 78   MET A CB    1 
ATOM   509   C  CG    . MET A 1  78   ? 109.860 130.477 165.411 1.00 151.72 ? 78   MET A CG    1 
ATOM   510   S  SD    . MET A 1  78   ? 111.065 129.370 166.173 1.00 151.72 ? 78   MET A SD    1 
ATOM   511   C  CE    . MET A 1  78   ? 110.053 127.943 166.551 1.00 151.72 ? 78   MET A CE    1 
ATOM   512   N  N     . THR A 1  79   ? 110.046 134.319 167.108 1.00 139.31 ? 79   THR A N     1 
ATOM   513   C  CA    . THR A 1  79   ? 110.832 135.454 166.637 1.00 139.31 ? 79   THR A CA    1 
ATOM   514   C  C     . THR A 1  79   ? 111.544 136.168 167.782 1.00 139.31 ? 79   THR A C     1 
ATOM   515   O  O     . THR A 1  79   ? 112.777 136.202 167.826 1.00 139.31 ? 79   THR A O     1 
ATOM   516   C  CB    . THR A 1  79   ? 109.938 136.440 165.874 1.00 139.79 ? 79   THR A CB    1 
ATOM   517   O  OG1   . THR A 1  79   ? 108.898 136.912 166.740 1.00 139.79 ? 79   THR A OG1   1 
ATOM   518   C  CG2   . THR A 1  79   ? 109.316 135.765 164.663 1.00 139.79 ? 79   THR A CG2   1 
ATOM   519   N  N     . GLU A 1  80   ? 110.781 136.739 168.716 1.00 141.30 ? 80   GLU A N     1 
ATOM   520   C  CA    . GLU A 1  80   ? 111.365 137.593 169.745 1.00 141.30 ? 80   GLU A CA    1 
ATOM   521   C  C     . GLU A 1  80   ? 112.254 136.798 170.697 1.00 141.30 ? 80   GLU A C     1 
ATOM   522   O  O     . GLU A 1  80   ? 113.122 137.363 171.372 1.00 141.30 ? 80   GLU A O     1 
ATOM   523   C  CB    . GLU A 1  80   ? 110.255 138.321 170.509 1.00 151.72 ? 80   GLU A CB    1 
ATOM   524   C  CG    . GLU A 1  80   ? 110.745 139.307 171.571 1.00 151.72 ? 80   GLU A CG    1 
ATOM   525   C  CD    . GLU A 1  80   ? 111.513 140.487 170.992 1.00 151.72 ? 80   GLU A CD    1 
ATOM   526   O  OE1   . GLU A 1  80   ? 111.451 140.709 169.764 1.00 151.72 ? 80   GLU A OE1   1 
ATOM   527   O  OE2   . GLU A 1  80   ? 112.185 141.194 171.771 1.00 151.72 ? 80   GLU A OE2   1 
ATOM   528   N  N     . CYS A 1  81   ? 112.068 135.487 170.755 1.00 136.15 ? 81   CYS A N     1 
ATOM   529   C  CA    . CYS A 1  81   ? 112.895 134.676 171.638 1.00 136.15 ? 81   CYS A CA    1 
ATOM   530   C  C     . CYS A 1  81   ? 114.244 134.400 170.990 1.00 136.15 ? 81   CYS A C     1 
ATOM   531   O  O     . CYS A 1  81   ? 114.302 133.688 169.975 1.00 136.15 ? 81   CYS A O     1 
ATOM   532   C  CB    . CYS A 1  81   ? 112.205 133.361 171.977 1.00 138.71 ? 81   CYS A CB    1 
ATOM   533   S  SG    . CYS A 1  81   ? 113.157 132.309 173.096 1.00 138.71 ? 81   CYS A SG    1 
ATOM   534   N  N     . PRO A 1  82   ? 115.344 134.933 171.527 1.00 129.54 ? 82   PRO A N     1 
ATOM   535   C  CA    . PRO A 1  82   ? 116.662 134.627 170.956 1.00 129.54 ? 82   PRO A CA    1 
ATOM   536   C  C     . PRO A 1  82   ? 117.112 133.204 171.216 1.00 129.54 ? 82   PRO A C     1 
ATOM   537   O  O     . PRO A 1  82   ? 118.018 132.722 170.526 1.00 129.54 ? 82   PRO A O     1 
ATOM   538   C  CB    . PRO A 1  82   ? 117.585 135.634 171.650 1.00 128.09 ? 82   PRO A CB    1 
ATOM   539   C  CG    . PRO A 1  82   ? 116.932 135.874 172.966 1.00 128.09 ? 82   PRO A CG    1 
ATOM   540   C  CD    . PRO A 1  82   ? 115.446 135.784 172.727 1.00 128.09 ? 82   PRO A CD    1 
ATOM   541   N  N     . GLY A 1  83   ? 116.510 132.520 172.178 1.00 128.45 ? 83   GLY A N     1 
ATOM   542   C  CA    . GLY A 1  83   ? 117.013 131.248 172.653 1.00 128.45 ? 83   GLY A CA    1 
ATOM   543   C  C     . GLY A 1  83   ? 117.762 131.416 173.957 1.00 128.45 ? 83   GLY A C     1 
ATOM   544   O  O     . GLY A 1  83   ? 118.036 132.525 174.425 1.00 128.45 ? 83   GLY A O     1 
ATOM   545   N  N     . HIS A 1  84   ? 118.100 130.279 174.556 1.00 127.75 ? 84   HIS A N     1 
ATOM   546   C  CA    . HIS A 1  84   ? 118.758 130.289 175.851 1.00 127.75 ? 84   HIS A CA    1 
ATOM   547   C  C     . HIS A 1  84   ? 119.784 129.170 175.896 1.00 127.75 ? 84   HIS A C     1 
ATOM   548   O  O     . HIS A 1  84   ? 119.577 128.093 175.335 1.00 127.75 ? 84   HIS A O     1 
ATOM   549   C  CB    . HIS A 1  84   ? 117.740 130.145 176.983 1.00 127.05 ? 84   HIS A CB    1 
ATOM   550   C  CG    . HIS A 1  84   ? 116.713 131.232 177.001 1.00 127.05 ? 84   HIS A CG    1 
ATOM   551   N  ND1   . HIS A 1  84   ? 116.998 132.518 177.404 1.00 127.05 ? 84   HIS A ND1   1 
ATOM   552   C  CD2   . HIS A 1  84   ? 115.413 131.235 176.626 1.00 127.05 ? 84   HIS A CD2   1 
ATOM   553   C  CE1   . HIS A 1  84   ? 115.911 133.261 177.301 1.00 127.05 ? 84   HIS A CE1   1 
ATOM   554   N  NE2   . HIS A 1  84   ? 114.934 132.506 176.831 1.00 127.05 ? 84   HIS A NE2   1 
ATOM   555   N  N     . PHE A 1  85   ? 120.901 129.448 176.552 1.00 126.94 ? 85   PHE A N     1 
ATOM   556   C  CA    . PHE A 1  85   ? 121.989 128.494 176.656 1.00 126.94 ? 85   PHE A CA    1 
ATOM   557   C  C     . PHE A 1  85   ? 121.665 127.374 177.639 1.00 126.94 ? 85   PHE A C     1 
ATOM   558   O  O     . PHE A 1  85   ? 120.724 127.445 178.435 1.00 126.94 ? 85   PHE A O     1 
ATOM   559   C  CB    . PHE A 1  85   ? 123.286 129.188 177.058 1.00 128.42 ? 85   PHE A CB    1 
ATOM   560   C  CG    . PHE A 1  85   ? 123.847 130.073 175.987 1.00 128.42 ? 85   PHE A CG    1 
ATOM   561   C  CD1   . PHE A 1  85   ? 124.629 129.541 174.977 1.00 128.42 ? 85   PHE A CD1   1 
ATOM   562   C  CD2   . PHE A 1  85   ? 123.582 131.430 175.978 1.00 128.42 ? 85   PHE A CD2   1 
ATOM   563   C  CE1   . PHE A 1  85   ? 125.142 130.345 173.985 1.00 128.42 ? 85   PHE A CE1   1 
ATOM   564   C  CE2   . PHE A 1  85   ? 124.091 132.240 174.987 1.00 128.42 ? 85   PHE A CE2   1 
ATOM   565   C  CZ    . PHE A 1  85   ? 124.871 131.696 173.990 1.00 128.42 ? 85   PHE A CZ    1 
ATOM   566   N  N     . GLY A 1  86   ? 122.474 126.320 177.554 1.00 128.98 ? 86   GLY A N     1 
ATOM   567   C  CA    . GLY A 1  86   ? 122.373 125.171 178.428 1.00 128.98 ? 86   GLY A CA    1 
ATOM   568   C  C     . GLY A 1  86   ? 123.773 124.660 178.691 1.00 128.98 ? 86   GLY A C     1 
ATOM   569   O  O     . GLY A 1  86   ? 124.746 125.250 178.226 1.00 128.98 ? 86   GLY A O     1 
ATOM   570   N  N     . HIS A 1  87   ? 123.876 123.612 179.501 1.00 129.43 ? 87   HIS A N     1 
ATOM   571   C  CA    . HIS A 1  87   ? 125.210 123.107 179.782 1.00 129.43 ? 87   HIS A CA    1 
ATOM   572   C  C     . HIS A 1  87   ? 125.184 121.602 179.978 1.00 129.43 ? 87   HIS A C     1 
ATOM   573   O  O     . HIS A 1  87   ? 124.137 120.995 180.211 1.00 129.43 ? 87   HIS A O     1 
ATOM   574   C  CB    . HIS A 1  87   ? 125.828 123.789 181.009 1.00 130.60 ? 87   HIS A CB    1 
ATOM   575   C  CG    . HIS A 1  87   ? 125.110 123.512 182.291 1.00 130.60 ? 87   HIS A CG    1 
ATOM   576   N  ND1   . HIS A 1  87   ? 123.908 124.102 182.615 1.00 130.60 ? 87   HIS A ND1   1 
ATOM   577   C  CD2   . HIS A 1  87   ? 125.434 122.720 183.340 1.00 130.60 ? 87   HIS A CD2   1 
ATOM   578   C  CE1   . HIS A 1  87   ? 123.519 123.680 183.805 1.00 130.60 ? 87   HIS A CE1   1 
ATOM   579   N  NE2   . HIS A 1  87   ? 124.427 122.839 184.265 1.00 130.60 ? 87   HIS A NE2   1 
ATOM   580   N  N     . ILE A 1  88   ? 126.368 121.012 179.847 1.00 130.67 ? 88   ILE A N     1 
ATOM   581   C  CA    . ILE A 1  88   ? 126.636 119.621 180.174 1.00 130.67 ? 88   ILE A CA    1 
ATOM   582   C  C     . ILE A 1  88   ? 127.766 119.622 181.190 1.00 130.67 ? 88   ILE A C     1 
ATOM   583   O  O     . ILE A 1  88   ? 128.795 120.272 180.971 1.00 130.67 ? 88   ILE A O     1 
ATOM   584   C  CB    . ILE A 1  88   ? 127.037 118.807 178.929 1.00 130.30 ? 88   ILE A CB    1 
ATOM   585   C  CG1   . ILE A 1  88   ? 125.904 118.792 177.906 1.00 130.30 ? 88   ILE A CG1   1 
ATOM   586   C  CG2   . ILE A 1  88   ? 127.405 117.389 179.317 1.00 130.30 ? 88   ILE A CG2   1 
ATOM   587   C  CD1   . ILE A 1  88   ? 126.327 118.259 176.556 1.00 130.30 ? 88   ILE A CD1   1 
ATOM   588   N  N     . GLU A 1  89   ? 127.583 118.908 182.295 1.00 134.38 ? 89   GLU A N     1 
ATOM   589   C  CA    . GLU A 1  89   ? 128.621 118.817 183.315 1.00 134.38 ? 89   GLU A CA    1 
ATOM   590   C  C     . GLU A 1  89   ? 129.474 117.595 183.006 1.00 134.38 ? 89   GLU A C     1 
ATOM   591   O  O     . GLU A 1  89   ? 129.021 116.455 183.155 1.00 134.38 ? 89   GLU A O     1 
ATOM   592   C  CB    . GLU A 1  89   ? 128.015 118.732 184.713 1.00 137.95 ? 89   GLU A CB    1 
ATOM   593   C  CG    . GLU A 1  89   ? 127.290 119.989 185.162 1.00 137.95 ? 89   GLU A CG    1 
ATOM   594   C  CD    . GLU A 1  89   ? 126.699 119.849 186.552 1.00 137.95 ? 89   GLU A CD    1 
ATOM   595   O  OE1   . GLU A 1  89   ? 126.701 118.721 187.088 1.00 137.95 ? 89   GLU A OE1   1 
ATOM   596   O  OE2   . GLU A 1  89   ? 126.236 120.866 187.111 1.00 137.95 ? 89   GLU A OE2   1 
ATOM   597   N  N     . LEU A 1  90   ? 130.712 117.834 182.583 1.00 136.70 ? 90   LEU A N     1 
ATOM   598   C  CA    . LEU A 1  90   ? 131.608 116.739 182.247 1.00 136.70 ? 90   LEU A CA    1 
ATOM   599   C  C     . LEU A 1  90   ? 132.145 116.107 183.522 1.00 136.70 ? 90   LEU A C     1 
ATOM   600   O  O     . LEU A 1  90   ? 132.600 116.808 184.431 1.00 136.70 ? 90   LEU A O     1 
ATOM   601   C  CB    . LEU A 1  90   ? 132.754 117.235 181.368 1.00 133.43 ? 90   LEU A CB    1 
ATOM   602   C  CG    . LEU A 1  90   ? 132.373 117.744 179.976 1.00 133.43 ? 90   LEU A CG    1 
ATOM   603   C  CD1   . LEU A 1  90   ? 133.590 118.302 179.257 1.00 133.43 ? 90   LEU A CD1   1 
ATOM   604   C  CD2   . LEU A 1  90   ? 131.722 116.644 179.155 1.00 133.43 ? 90   LEU A CD2   1 
ATOM   605   N  N     . ALA A 1  91   ? 132.073 114.776 183.592 1.00 141.66 ? 91   ALA A N     1 
ATOM   606   C  CA    . ALA A 1  91   ? 132.563 114.068 184.769 1.00 141.66 ? 91   ALA A CA    1 
ATOM   607   C  C     . ALA A 1  91   ? 134.024 114.395 185.037 1.00 141.66 ? 91   ALA A C     1 
ATOM   608   O  O     . ALA A 1  91   ? 134.418 114.624 186.186 1.00 141.66 ? 91   ALA A O     1 
ATOM   609   C  CB    . ALA A 1  91   ? 132.373 112.564 184.586 1.00 142.97 ? 91   ALA A CB    1 
ATOM   610   N  N     . LYS A 1  92   ? 134.836 114.442 183.985 1.00 144.17 ? 92   LYS A N     1 
ATOM   611   C  CA    . LYS A 1  92   ? 136.237 114.796 184.082 1.00 144.17 ? 92   LYS A CA    1 
ATOM   612   C  C     . LYS A 1  92   ? 136.525 115.921 183.097 1.00 144.17 ? 92   LYS A C     1 
ATOM   613   O  O     . LYS A 1  92   ? 135.975 115.930 181.990 1.00 144.17 ? 92   LYS A O     1 
ATOM   614   C  CB    . LYS A 1  92   ? 137.119 113.577 183.779 1.00 148.58 ? 92   LYS A CB    1 
ATOM   615   C  CG    . LYS A 1  92   ? 136.927 112.441 184.775 1.00 148.58 ? 92   LYS A CG    1 
ATOM   616   C  CD    . LYS A 1  92   ? 137.727 111.202 184.405 1.00 148.58 ? 92   LYS A CD    1 
ATOM   617   C  CE    . LYS A 1  92   ? 139.215 111.383 184.631 1.00 148.58 ? 92   LYS A CE    1 
ATOM   618   N  NZ    . LYS A 1  92   ? 139.531 111.457 186.080 1.00 148.58 ? 92   LYS A NZ    1 
ATOM   619   N  N     . PRO A 1  93   ? 137.360 116.889 183.472 1.00 139.31 ? 93   PRO A N     1 
ATOM   620   C  CA    . PRO A 1  93   ? 137.656 118.002 182.564 1.00 139.31 ? 93   PRO A CA    1 
ATOM   621   C  C     . PRO A 1  93   ? 138.283 117.521 181.263 1.00 139.31 ? 93   PRO A C     1 
ATOM   622   O  O     . PRO A 1  93   ? 138.829 116.420 181.171 1.00 139.31 ? 93   PRO A O     1 
ATOM   623   C  CB    . PRO A 1  93   ? 138.631 118.866 183.371 1.00 137.61 ? 93   PRO A CB    1 
ATOM   624   C  CG    . PRO A 1  93   ? 138.278 118.577 184.790 1.00 137.61 ? 93   PRO A CG    1 
ATOM   625   C  CD    . PRO A 1  93   ? 137.910 117.119 184.819 1.00 137.61 ? 93   PRO A CD    1 
ATOM   626   N  N     . VAL A 1  94   ? 138.176 118.364 180.239 1.00 135.65 ? 94   VAL A N     1 
ATOM   627   C  CA    . VAL A 1  94   ? 138.665 118.062 178.897 1.00 135.65 ? 94   VAL A CA    1 
ATOM   628   C  C     . VAL A 1  94   ? 139.316 119.315 178.324 1.00 135.65 ? 94   VAL A C     1 
ATOM   629   O  O     . VAL A 1  94   ? 138.829 120.431 178.535 1.00 135.65 ? 94   VAL A O     1 
ATOM   630   C  CB    . VAL A 1  94   ? 137.526 117.561 177.979 1.00 135.90 ? 94   VAL A CB    1 
ATOM   631   C  CG1   . VAL A 1  94   ? 138.000 117.429 176.543 1.00 135.90 ? 94   VAL A CG1   1 
ATOM   632   C  CG2   . VAL A 1  94   ? 136.982 116.228 178.473 1.00 135.90 ? 94   VAL A CG2   1 
ATOM   633   N  N     . PHE A 1  95   ? 140.424 119.131 177.608 1.00 137.72 ? 95   PHE A N     1 
ATOM   634   C  CA    . PHE A 1  95   ? 141.084 120.245 176.941 1.00 137.72 ? 95   PHE A CA    1 
ATOM   635   C  C     . PHE A 1  95   ? 140.156 120.912 175.933 1.00 137.72 ? 95   PHE A C     1 
ATOM   636   O  O     . PHE A 1  95   ? 139.374 120.257 175.241 1.00 137.72 ? 95   PHE A O     1 
ATOM   637   C  CB    . PHE A 1  95   ? 142.348 119.769 176.224 1.00 140.25 ? 95   PHE A CB    1 
ATOM   638   C  CG    . PHE A 1  95   ? 143.456 119.366 177.146 1.00 140.25 ? 95   PHE A CG    1 
ATOM   639   C  CD1   . PHE A 1  95   ? 143.515 119.858 178.437 1.00 140.25 ? 95   PHE A CD1   1 
ATOM   640   C  CD2   . PHE A 1  95   ? 144.438 118.489 176.724 1.00 140.25 ? 95   PHE A CD2   1 
ATOM   641   C  CE1   . PHE A 1  95   ? 144.536 119.491 179.285 1.00 140.25 ? 95   PHE A CE1   1 
ATOM   642   C  CE2   . PHE A 1  95   ? 145.460 118.115 177.569 1.00 140.25 ? 95   PHE A CE2   1 
ATOM   643   C  CZ    . PHE A 1  95   ? 145.507 118.616 178.852 1.00 140.25 ? 95   PHE A CZ    1 
ATOM   644   N  N     . HIS A 1  96   ? 140.259 122.234 175.850 1.00 137.20 ? 96   HIS A N     1 
ATOM   645   C  CA    . HIS A 1  96   ? 139.607 123.010 174.804 1.00 137.20 ? 96   HIS A CA    1 
ATOM   646   C  C     . HIS A 1  96   ? 140.617 123.149 173.671 1.00 137.20 ? 96   HIS A C     1 
ATOM   647   O  O     . HIS A 1  96   ? 141.704 123.700 173.868 1.00 137.20 ? 96   HIS A O     1 
ATOM   648   C  CB    . HIS A 1  96   ? 139.160 124.373 175.325 1.00 137.18 ? 96   HIS A CB    1 
ATOM   649   C  CG    . HIS A 1  96   ? 138.226 125.093 174.406 1.00 137.18 ? 96   HIS A CG    1 
ATOM   650   N  ND1   . HIS A 1  96   ? 138.657 125.786 173.295 1.00 137.18 ? 96   HIS A ND1   1 
ATOM   651   C  CD2   . HIS A 1  96   ? 136.880 125.232 174.437 1.00 137.18 ? 96   HIS A CD2   1 
ATOM   652   C  CE1   . HIS A 1  96   ? 137.615 126.315 172.679 1.00 137.18 ? 96   HIS A CE1   1 
ATOM   653   N  NE2   . HIS A 1  96   ? 136.525 125.995 173.352 1.00 137.18 ? 96   HIS A NE2   1 
ATOM   654   N  N     . VAL A 1  97   ? 140.261 122.644 172.489 1.00 138.80 ? 97   VAL A N     1 
ATOM   655   C  CA    . VAL A 1  97   ? 141.256 122.462 171.435 1.00 138.80 ? 97   VAL A CA    1 
ATOM   656   C  C     . VAL A 1  97   ? 141.801 123.797 170.942 1.00 138.80 ? 97   VAL A C     1 
ATOM   657   O  O     . VAL A 1  97   ? 142.965 123.886 170.528 1.00 138.80 ? 97   VAL A O     1 
ATOM   658   C  CB    . VAL A 1  97   ? 140.659 121.627 170.285 1.00 142.91 ? 97   VAL A CB    1 
ATOM   659   C  CG1   . VAL A 1  97   ? 139.498 122.360 169.633 1.00 142.91 ? 97   VAL A CG1   1 
ATOM   660   C  CG2   . VAL A 1  97   ? 141.729 121.286 169.273 1.00 142.91 ? 97   VAL A CG2   1 
ATOM   661   N  N     . GLY A 1  98   ? 140.989 124.855 170.988 1.00 138.07 ? 98   GLY A N     1 
ATOM   662   C  CA    . GLY A 1  98   ? 141.471 126.158 170.557 1.00 138.07 ? 98   GLY A CA    1 
ATOM   663   C  C     . GLY A 1  98   ? 142.434 126.778 171.553 1.00 138.07 ? 98   GLY A C     1 
ATOM   664   O  O     . GLY A 1  98   ? 143.506 127.263 171.180 1.00 138.07 ? 98   GLY A O     1 
ATOM   665   N  N     . PHE A 1  99   ? 142.067 126.759 172.837 1.00 137.93 ? 99   PHE A N     1 
ATOM   666   C  CA    . PHE A 1  99   ? 142.904 127.280 173.914 1.00 137.93 ? 99   PHE A CA    1 
ATOM   667   C  C     . PHE A 1  99   ? 144.116 126.405 174.208 1.00 137.93 ? 99   PHE A C     1 
ATOM   668   O  O     . PHE A 1  99   ? 144.925 126.771 175.067 1.00 137.93 ? 99   PHE A O     1 
ATOM   669   C  CB    . PHE A 1  99   ? 142.069 127.448 175.186 1.00 135.63 ? 99   PHE A CB    1 
ATOM   670   C  CG    . PHE A 1  99   ? 141.054 128.553 175.107 1.00 135.63 ? 99   PHE A CG    1 
ATOM   671   C  CD1   . PHE A 1  99   ? 141.223 129.602 174.222 1.00 135.63 ? 99   PHE A CD1   1 
ATOM   672   C  CD2   . PHE A 1  99   ? 139.919 128.531 175.904 1.00 135.63 ? 99   PHE A CD2   1 
ATOM   673   C  CE1   . PHE A 1  99   ? 140.295 130.620 174.146 1.00 135.63 ? 99   PHE A CE1   1 
ATOM   674   C  CE2   . PHE A 1  99   ? 138.982 129.546 175.831 1.00 135.63 ? 99   PHE A CE2   1 
ATOM   675   C  CZ    . PHE A 1  99   ? 139.172 130.594 174.953 1.00 135.63 ? 99   PHE A CZ    1 
ATOM   676   N  N     . LEU A 1  100  ? 144.247 125.263 173.529 1.00 141.34 ? 100  LEU A N     1 
ATOM   677   C  CA    . LEU A 1  100  ? 145.279 124.284 173.861 1.00 141.34 ? 100  LEU A CA    1 
ATOM   678   C  C     . LEU A 1  100  ? 146.680 124.886 173.792 1.00 141.34 ? 100  LEU A C     1 
ATOM   679   O  O     . LEU A 1  100  ? 147.524 124.627 174.659 1.00 141.34 ? 100  LEU A O     1 
ATOM   680   C  CB    . LEU A 1  100  ? 145.146 123.084 172.923 1.00 138.41 ? 100  LEU A CB    1 
ATOM   681   C  CG    . LEU A 1  100  ? 146.111 121.908 173.035 1.00 138.41 ? 100  LEU A CG    1 
ATOM   682   C  CD1   . LEU A 1  100  ? 146.003 121.256 174.398 1.00 138.41 ? 100  LEU A CD1   1 
ATOM   683   C  CD2   . LEU A 1  100  ? 145.794 120.904 171.947 1.00 138.41 ? 100  LEU A CD2   1 
ATOM   684   N  N     . VAL A 1  101  ? 146.944 125.702 172.769 1.00 142.99 ? 101  VAL A N     1 
ATOM   685   C  CA    . VAL A 1  101  ? 148.264 126.316 172.628 1.00 142.99 ? 101  VAL A CA    1 
ATOM   686   C  C     . VAL A 1  101  ? 148.539 127.258 173.795 1.00 142.99 ? 101  VAL A C     1 
ATOM   687   O  O     . VAL A 1  101  ? 149.632 127.254 174.377 1.00 142.99 ? 101  VAL A O     1 
ATOM   688   C  CB    . VAL A 1  101  ? 148.375 127.043 171.276 1.00 142.34 ? 101  VAL A CB    1 
ATOM   689   C  CG1   . VAL A 1  101  ? 149.705 127.766 171.174 1.00 142.34 ? 101  VAL A CG1   1 
ATOM   690   C  CG2   . VAL A 1  101  ? 148.205 126.057 170.131 1.00 142.34 ? 101  VAL A CG2   1 
ATOM   691   N  N     . LYS A 1  102  ? 147.551 128.082 174.152 1.00 144.00 ? 102  LYS A N     1 
ATOM   692   C  CA    . LYS A 1  102  ? 147.694 128.951 175.316 1.00 144.00 ? 102  LYS A CA    1 
ATOM   693   C  C     . LYS A 1  102  ? 147.945 128.137 176.577 1.00 144.00 ? 102  LYS A C     1 
ATOM   694   O  O     . LYS A 1  102  ? 148.767 128.516 177.420 1.00 144.00 ? 102  LYS A O     1 
ATOM   695   C  CB    . LYS A 1  102  ? 146.447 129.818 175.481 1.00 148.06 ? 102  LYS A CB    1 
ATOM   696   C  CG    . LYS A 1  102  ? 146.129 130.679 174.276 1.00 148.06 ? 102  LYS A CG    1 
ATOM   697   C  CD    . LYS A 1  102  ? 147.294 131.584 173.937 1.00 148.06 ? 102  LYS A CD    1 
ATOM   698   C  CE    . LYS A 1  102  ? 147.424 132.715 174.938 1.00 148.06 ? 102  LYS A CE    1 
ATOM   699   N  NZ    . LYS A 1  102  ? 148.489 133.667 174.528 1.00 148.06 ? 102  LYS A NZ    1 
ATOM   700   N  N     . THR A 1  103  ? 147.247 127.008 176.719 1.00 144.30 ? 103  THR A N     1 
ATOM   701   C  CA    . THR A 1  103  ? 147.492 126.120 177.850 1.00 144.30 ? 103  THR A CA    1 
ATOM   702   C  C     . THR A 1  103  ? 148.947 125.669 177.883 1.00 144.30 ? 103  THR A C     1 
ATOM   703   O  O     . THR A 1  103  ? 149.592 125.694 178.936 1.00 144.30 ? 103  THR A O     1 
ATOM   704   C  CB    . THR A 1  103  ? 146.554 124.914 177.786 1.00 143.59 ? 103  THR A CB    1 
ATOM   705   O  OG1   . THR A 1  103  ? 145.194 125.360 177.864 1.00 143.59 ? 103  THR A OG1   1 
ATOM   706   C  CG2   . THR A 1  103  ? 146.835 123.955 178.932 1.00 143.59 ? 103  THR A CG2   1 
ATOM   707   N  N     . MET A 1  104  ? 149.490 125.275 176.728 1.00 143.61 ? 104  MET A N     1 
ATOM   708   C  CA    . MET A 1  104  ? 150.876 124.816 176.686 1.00 143.61 ? 104  MET A CA    1 
ATOM   709   C  C     . MET A 1  104  ? 151.844 125.933 177.061 1.00 143.61 ? 104  MET A C     1 
ATOM   710   O  O     . MET A 1  104  ? 152.776 125.721 177.845 1.00 143.61 ? 104  MET A O     1 
ATOM   711   C  CB    . MET A 1  104  ? 151.210 124.264 175.302 1.00 150.06 ? 104  MET A CB    1 
ATOM   712   C  CG    . MET A 1  104  ? 150.506 122.968 174.968 1.00 150.06 ? 104  MET A CG    1 
ATOM   713   S  SD    . MET A 1  104  ? 150.942 122.389 173.321 1.00 150.06 ? 104  MET A SD    1 
ATOM   714   C  CE    . MET A 1  104  ? 152.645 121.902 173.583 1.00 150.06 ? 104  MET A CE    1 
ATOM   715   N  N     . LYS A 1  105  ? 151.643 127.131 176.505 1.00 144.74 ? 105  LYS A N     1 
ATOM   716   C  CA    . LYS A 1  105  ? 152.531 128.245 176.832 1.00 144.74 ? 105  LYS A CA    1 
ATOM   717   C  C     . LYS A 1  105  ? 152.489 128.560 178.322 1.00 144.74 ? 105  LYS A C     1 
ATOM   718   O  O     . LYS A 1  105  ? 153.534 128.707 178.967 1.00 144.74 ? 105  LYS A O     1 
ATOM   719   C  CB    . LYS A 1  105  ? 152.162 129.485 176.018 1.00 146.70 ? 105  LYS A CB    1 
ATOM   720   C  CG    . LYS A 1  105  ? 152.467 129.396 174.537 1.00 146.70 ? 105  LYS A CG    1 
ATOM   721   C  CD    . LYS A 1  105  ? 152.039 130.675 173.834 1.00 146.70 ? 105  LYS A CD    1 
ATOM   722   C  CE    . LYS A 1  105  ? 152.382 130.645 172.356 1.00 146.70 ? 105  LYS A CE    1 
ATOM   723   N  NZ    . LYS A 1  105  ? 151.924 131.875 171.651 1.00 146.70 ? 105  LYS A NZ    1 
ATOM   724   N  N     . VAL A 1  106  ? 151.285 128.665 178.888 1.00 143.48 ? 106  VAL A N     1 
ATOM   725   C  CA    . VAL A 1  106  ? 151.162 129.000 180.304 1.00 143.48 ? 106  VAL A CA    1 
ATOM   726   C  C     . VAL A 1  106  ? 151.778 127.904 181.166 1.00 143.48 ? 106  VAL A C     1 
ATOM   727   O  O     . VAL A 1  106  ? 152.374 128.181 182.214 1.00 143.48 ? 106  VAL A O     1 
ATOM   728   C  CB    . VAL A 1  106  ? 149.688 129.257 180.664 1.00 140.85 ? 106  VAL A CB    1 
ATOM   729   C  CG1   . VAL A 1  106  ? 149.530 129.508 182.156 1.00 140.85 ? 106  VAL A CG1   1 
ATOM   730   C  CG2   . VAL A 1  106  ? 149.159 130.438 179.872 1.00 140.85 ? 106  VAL A CG2   1 
ATOM   731   N  N     . LEU A 1  107  ? 151.664 126.646 180.733 1.00 144.79 ? 107  LEU A N     1 
ATOM   732   C  CA    . LEU A 1  107  ? 152.317 125.558 181.456 1.00 144.79 ? 107  LEU A CA    1 
ATOM   733   C  C     . LEU A 1  107  ? 153.834 125.697 181.410 1.00 144.79 ? 107  LEU A C     1 
ATOM   734   O  O     . LEU A 1  107  ? 154.521 125.453 182.408 1.00 144.79 ? 107  LEU A O     1 
ATOM   735   C  CB    . LEU A 1  107  ? 151.887 124.205 180.888 1.00 141.03 ? 107  LEU A CB    1 
ATOM   736   C  CG    . LEU A 1  107  ? 150.461 123.712 181.131 1.00 141.03 ? 107  LEU A CG    1 
ATOM   737   C  CD1   . LEU A 1  107  ? 150.205 122.444 180.336 1.00 141.03 ? 107  LEU A CD1   1 
ATOM   738   C  CD2   . LEU A 1  107  ? 150.223 123.468 182.612 1.00 141.03 ? 107  LEU A CD2   1 
ATOM   739   N  N     . ARG A 1  108  ? 154.380 126.078 180.253 1.00 148.93 ? 108  ARG A N     1 
ATOM   740   C  CA    . ARG A 1  108  ? 155.821 126.278 180.155 1.00 148.93 ? 108  ARG A CA    1 
ATOM   741   C  C     . ARG A 1  108  ? 156.293 127.525 180.889 1.00 148.93 ? 108  ARG A C     1 
ATOM   742   O  O     . ARG A 1  108  ? 157.492 127.643 181.165 1.00 148.93 ? 108  ARG A O     1 
ATOM   743   C  CB    . ARG A 1  108  ? 156.250 126.352 178.690 1.00 155.92 ? 108  ARG A CB    1 
ATOM   744   C  CG    . ARG A 1  108  ? 156.094 125.049 177.928 1.00 155.92 ? 108  ARG A CG    1 
ATOM   745   C  CD    . ARG A 1  108  ? 156.599 125.192 176.505 1.00 155.92 ? 108  ARG A CD    1 
ATOM   746   N  NE    . ARG A 1  108  ? 156.425 123.963 175.737 1.00 155.92 ? 108  ARG A NE    1 
ATOM   747   C  CZ    . ARG A 1  108  ? 156.691 123.851 174.441 1.00 155.92 ? 108  ARG A CZ    1 
ATOM   748   N  NH1   . ARG A 1  108  ? 157.147 124.895 173.763 1.00 155.92 ? 108  ARG A NH1   1 
ATOM   749   N  NH2   . ARG A 1  108  ? 156.503 122.694 173.821 1.00 155.92 ? 108  ARG A NH2   1 
ATOM   750   N  N     . CYS A 1  109  ? 155.395 128.457 181.200 1.00 150.68 ? 109  CYS A N     1 
ATOM   751   C  CA    . CYS A 1  109  ? 155.744 129.653 181.952 1.00 150.68 ? 109  CYS A CA    1 
ATOM   752   C  C     . CYS A 1  109  ? 155.517 129.503 183.450 1.00 150.68 ? 109  CYS A C     1 
ATOM   753   O  O     . CYS A 1  109  ? 155.865 130.413 184.208 1.00 150.68 ? 109  CYS A O     1 
ATOM   754   C  CB    . CYS A 1  109  ? 154.942 130.851 181.435 1.00 159.77 ? 109  CYS A CB    1 
ATOM   755   S  SG    . CYS A 1  109  ? 155.274 131.293 179.719 1.00 159.77 ? 109  CYS A SG    1 
ATOM   756   N  N     . VAL A 1  110  ? 154.951 128.384 183.895 1.00 148.94 ? 110  VAL A N     1 
ATOM   757   C  CA    . VAL A 1  110  ? 154.558 128.201 185.287 1.00 148.94 ? 110  VAL A CA    1 
ATOM   758   C  C     . VAL A 1  110  ? 155.142 126.893 185.802 1.00 148.94 ? 110  VAL A C     1 
ATOM   759   O  O     . VAL A 1  110  ? 155.122 125.872 185.107 1.00 148.94 ? 110  VAL A O     1 
ATOM   760   C  CB    . VAL A 1  110  ? 153.022 128.225 185.443 1.00 149.37 ? 110  VAL A CB    1 
ATOM   761   C  CG1   . VAL A 1  110  ? 152.620 127.856 186.852 1.00 149.37 ? 110  VAL A CG1   1 
ATOM   762   C  CG2   . VAL A 1  110  ? 152.477 129.600 185.092 1.00 149.37 ? 110  VAL A CG2   1 
ATOM   763   N  N     . CYS A 1  111  ? 155.663 126.929 187.026 1.00 151.58 ? 111  CYS A N     1 
ATOM   764   C  CA    . CYS A 1  111  ? 156.262 125.756 187.647 1.00 151.58 ? 111  CYS A CA    1 
ATOM   765   C  C     . CYS A 1  111  ? 155.191 124.767 188.090 1.00 151.58 ? 111  CYS A C     1 
ATOM   766   O  O     . CYS A 1  111  ? 154.125 125.161 188.570 1.00 151.58 ? 111  CYS A O     1 
ATOM   767   C  CB    . CYS A 1  111  ? 157.109 126.181 188.846 1.00 164.45 ? 111  CYS A CB    1 
ATOM   768   S  SG    . CYS A 1  111  ? 157.960 124.839 189.694 1.00 164.45 ? 111  CYS A SG    1 
ATOM   769   N  N     . PHE A 1  112  ? 155.481 123.476 187.929 1.00 152.21 ? 112  PHE A N     1 
ATOM   770   C  CA    . PHE A 1  112  ? 154.563 122.439 188.382 1.00 152.21 ? 112  PHE A CA    1 
ATOM   771   C  C     . PHE A 1  112  ? 154.583 122.311 189.899 1.00 152.21 ? 112  PHE A C     1 
ATOM   772   O  O     . PHE A 1  112  ? 155.615 122.503 190.548 1.00 152.21 ? 112  PHE A O     1 
ATOM   773   C  CB    . PHE A 1  112  ? 154.907 121.086 187.764 1.00 148.22 ? 112  PHE A CB    1 
ATOM   774   C  CG    . PHE A 1  112  ? 154.624 120.992 186.298 1.00 148.22 ? 112  PHE A CG    1 
ATOM   775   C  CD1   . PHE A 1  112  ? 153.835 121.937 185.665 1.00 148.22 ? 112  PHE A CD1   1 
ATOM   776   C  CD2   . PHE A 1  112  ? 155.103 119.920 185.564 1.00 148.22 ? 112  PHE A CD2   1 
ATOM   777   C  CE1   . PHE A 1  112  ? 153.565 121.835 184.315 1.00 148.22 ? 112  PHE A CE1   1 
ATOM   778   C  CE2   . PHE A 1  112  ? 154.837 119.809 184.217 1.00 148.22 ? 112  PHE A CE2   1 
ATOM   779   C  CZ    . PHE A 1  112  ? 154.063 120.763 183.594 1.00 148.22 ? 112  PHE A CZ    1 
ATOM   780   N  N     . PHE A 1  113  ? 153.406 122.008 190.462 1.00 155.76 ? 113  PHE A N     1 
ATOM   781   C  CA    . PHE A 1  113  ? 153.205 121.773 191.900 1.00 155.76 ? 113  PHE A CA    1 
ATOM   782   C  C     . PHE A 1  113  ? 153.853 122.868 192.746 1.00 155.76 ? 113  PHE A C     1 
ATOM   783   O  O     . PHE A 1  113  ? 154.224 122.655 193.903 1.00 155.76 ? 113  PHE A O     1 
ATOM   784   C  CB    . PHE A 1  113  ? 153.670 120.370 192.330 1.00 156.95 ? 113  PHE A CB    1 
ATOM   785   C  CG    . PHE A 1  113  ? 155.085 120.024 191.941 1.00 156.95 ? 113  PHE A CG    1 
ATOM   786   C  CD1   . PHE A 1  113  ? 156.151 120.379 192.748 1.00 156.95 ? 113  PHE A CD1   1 
ATOM   787   C  CD2   . PHE A 1  113  ? 155.342 119.301 190.785 1.00 156.95 ? 113  PHE A CD2   1 
ATOM   788   C  CE1   . PHE A 1  113  ? 157.448 120.053 192.393 1.00 156.95 ? 113  PHE A CE1   1 
ATOM   789   C  CE2   . PHE A 1  113  ? 156.636 118.973 190.425 1.00 156.95 ? 113  PHE A CE2   1 
ATOM   790   C  CZ    . PHE A 1  113  ? 157.690 119.346 191.232 1.00 156.95 ? 113  PHE A CZ    1 
ATOM   791   N  N     . CYS A 1  114  ? 153.979 124.052 192.154 1.00 156.03 ? 114  CYS A N     1 
ATOM   792   C  CA    . CYS A 1  114  ? 154.403 125.278 192.813 1.00 156.03 ? 114  CYS A CA    1 
ATOM   793   C  C     . CYS A 1  114  ? 153.428 126.365 192.394 1.00 156.03 ? 114  CYS A C     1 
ATOM   794   O  O     . CYS A 1  114  ? 152.763 126.984 193.232 1.00 156.03 ? 114  CYS A O     1 
ATOM   795   C  CB    . CYS A 1  114  ? 155.840 125.642 192.442 1.00 163.67 ? 114  CYS A CB    1 
ATOM   796   S  SG    . CYS A 1  114  ? 156.483 127.114 193.274 1.00 163.67 ? 114  CYS A SG    1 
ATOM   797   N  N     . SER A 1  115  ? 153.382 126.605 191.083 1.00 156.16 ? 115  SER A N     1 
ATOM   798   C  CA    . SER A 1  115  ? 152.481 127.476 190.334 1.00 156.16 ? 115  SER A CA    1 
ATOM   799   C  C     . SER A 1  115  ? 152.985 128.910 190.281 1.00 156.16 ? 115  SER A C     1 
ATOM   800   O  O     . SER A 1  115  ? 152.377 129.733 189.586 1.00 156.16 ? 115  SER A O     1 
ATOM   801   C  CB    . SER A 1  115  ? 151.043 127.470 190.869 1.00 151.90 ? 115  SER A CB    1 
ATOM   802   O  OG    . SER A 1  115  ? 150.218 128.346 190.125 1.00 151.90 ? 115  SER A OG    1 
ATOM   803   N  N     . LYS A 1  116  ? 154.065 129.243 190.977 1.00 155.46 ? 116  LYS A N     1 
ATOM   804   C  CA    . LYS A 1  116  ? 154.681 130.544 190.793 1.00 155.46 ? 116  LYS A CA    1 
ATOM   805   C  C     . LYS A 1  116  ? 155.435 130.582 189.467 1.00 155.46 ? 116  LYS A C     1 
ATOM   806   O  O     . LYS A 1  116  ? 155.815 129.549 188.908 1.00 155.46 ? 116  LYS A O     1 
ATOM   807   C  CB    . LYS A 1  116  ? 155.623 130.860 191.954 1.00 153.26 ? 116  LYS A CB    1 
ATOM   808   C  CG    . LYS A 1  116  ? 154.917 131.022 193.288 1.00 153.26 ? 116  LYS A CG    1 
ATOM   809   C  CD    . LYS A 1  116  ? 155.907 131.258 194.414 1.00 153.26 ? 116  LYS A CD    1 
ATOM   810   C  CE    . LYS A 1  116  ? 155.197 131.447 195.744 1.00 153.26 ? 116  LYS A CE    1 
ATOM   811   N  NZ    . LYS A 1  116  ? 156.160 131.623 196.868 1.00 153.26 ? 116  LYS A NZ    1 
ATOM   812   N  N     . LEU A 1  117  ? 155.638 131.794 188.958 1.00 159.36 ? 117  LEU A N     1 
ATOM   813   C  CA    . LEU A 1  117  ? 156.361 131.961 187.705 1.00 159.36 ? 117  LEU A CA    1 
ATOM   814   C  C     . LEU A 1  117  ? 157.782 131.425 187.832 1.00 159.36 ? 117  LEU A C     1 
ATOM   815   O  O     . LEU A 1  117  ? 158.419 131.529 188.884 1.00 159.36 ? 117  LEU A O     1 
ATOM   816   C  CB    . LEU A 1  117  ? 156.393 133.434 187.296 1.00 157.97 ? 117  LEU A CB    1 
ATOM   817   C  CG    . LEU A 1  117  ? 155.058 134.097 186.952 1.00 157.97 ? 117  LEU A CG    1 
ATOM   818   C  CD1   . LEU A 1  117  ? 155.254 135.581 186.698 1.00 157.97 ? 117  LEU A CD1   1 
ATOM   819   C  CD2   . LEU A 1  117  ? 154.418 133.429 185.746 1.00 157.97 ? 117  LEU A CD2   1 
ATOM   820   N  N     . LEU A 1  118  ? 158.278 130.837 186.742 1.00 165.03 ? 118  LEU A N     1 
ATOM   821   C  CA    . LEU A 1  118  ? 159.649 130.341 186.720 1.00 165.03 ? 118  LEU A CA    1 
ATOM   822   C  C     . LEU A 1  118  ? 160.676 131.450 186.884 1.00 165.03 ? 118  LEU A C     1 
ATOM   823   O  O     . LEU A 1  118  ? 161.658 131.258 187.608 1.00 165.03 ? 118  LEU A O     1 
ATOM   824   C  CB    . LEU A 1  118  ? 159.914 129.578 185.423 1.00 160.01 ? 118  LEU A CB    1 
ATOM   825   C  CG    . LEU A 1  118  ? 159.125 128.280 185.258 1.00 160.01 ? 118  LEU A CG    1 
ATOM   826   C  CD1   . LEU A 1  118  ? 159.363 127.663 183.891 1.00 160.01 ? 118  LEU A CD1   1 
ATOM   827   C  CD2   . LEU A 1  118  ? 159.497 127.305 186.358 1.00 160.01 ? 118  LEU A CD2   1 
ATOM   828   N  N     . VAL A 1  119  ? 160.477 132.596 186.238 1.00 174.51 ? 119  VAL A N     1 
ATOM   829   C  CA    . VAL A 1  119  ? 161.325 133.765 186.425 1.00 174.51 ? 119  VAL A CA    1 
ATOM   830   C  C     . VAL A 1  119  ? 160.559 134.753 187.292 1.00 174.51 ? 119  VAL A C     1 
ATOM   831   O  O     . VAL A 1  119  ? 159.399 135.066 187.002 1.00 174.51 ? 119  VAL A O     1 
ATOM   832   C  CB    . VAL A 1  119  ? 161.727 134.407 185.084 1.00 175.69 ? 119  VAL A CB    1 
ATOM   833   C  CG1   . VAL A 1  119  ? 162.608 135.621 185.322 1.00 175.69 ? 119  VAL A CG1   1 
ATOM   834   C  CG2   . VAL A 1  119  ? 162.429 133.390 184.199 1.00 175.69 ? 119  VAL A CG2   1 
ATOM   835   N  N     . ASP A 1  120  ? 161.201 135.232 188.354 1.00 183.77 ? 120  ASP A N     1 
ATOM   836   C  CA    . ASP A 1  120  ? 160.514 136.045 189.350 1.00 183.77 ? 120  ASP A CA    1 
ATOM   837   C  C     . ASP A 1  120  ? 160.044 137.364 188.752 1.00 183.77 ? 120  ASP A C     1 
ATOM   838   O  O     . ASP A 1  120  ? 160.743 137.976 187.938 1.00 183.77 ? 120  ASP A O     1 
ATOM   839   C  CB    . ASP A 1  120  ? 161.434 136.308 190.538 1.00 188.49 ? 120  ASP A CB    1 
ATOM   840   C  CG    . ASP A 1  120  ? 161.702 135.061 191.350 1.00 188.49 ? 120  ASP A CG    1 
ATOM   841   O  OD1   . ASP A 1  120  ? 160.947 134.077 191.202 1.00 188.49 ? 120  ASP A OD1   1 
ATOM   842   O  OD2   . ASP A 1  120  ? 162.673 135.062 192.134 1.00 188.49 ? 120  ASP A OD2   1 
ATOM   843   N  N     . SER A 1  121  ? 158.857 137.808 189.172 1.00 187.45 ? 121  SER A N     1 
ATOM   844   C  CA    . SER A 1  121  ? 158.326 139.084 188.705 1.00 187.45 ? 121  SER A CA    1 
ATOM   845   C  C     . SER A 1  121  ? 159.115 140.268 189.245 1.00 187.45 ? 121  SER A C     1 
ATOM   846   O  O     . SER A 1  121  ? 158.909 141.398 188.788 1.00 187.45 ? 121  SER A O     1 
ATOM   847   C  CB    . SER A 1  121  ? 156.854 139.211 189.100 1.00 184.06 ? 121  SER A CB    1 
ATOM   848   O  OG    . SER A 1  121  ? 156.323 140.460 188.693 1.00 184.06 ? 121  SER A OG    1 
ATOM   849   N  N     . ASN A 1  122  ? 160.010 140.038 190.208 1.00 188.88 ? 122  ASN A N     1 
ATOM   850   C  CA    . ASN A 1  122  ? 160.849 141.107 190.734 1.00 188.88 ? 122  ASN A CA    1 
ATOM   851   C  C     . ASN A 1  122  ? 161.987 141.467 189.787 1.00 188.88 ? 122  ASN A C     1 
ATOM   852   O  O     . ASN A 1  122  ? 162.624 142.510 189.969 1.00 188.88 ? 122  ASN A O     1 
ATOM   853   C  CB    . ASN A 1  122  ? 161.413 140.700 192.097 1.00 190.64 ? 122  ASN A CB    1 
ATOM   854   C  CG    . ASN A 1  122  ? 162.115 141.841 192.805 1.00 190.64 ? 122  ASN A CG    1 
ATOM   855   O  OD1   . ASN A 1  122  ? 161.765 143.007 192.630 1.00 190.64 ? 122  ASN A OD1   1 
ATOM   856   N  ND2   . ASN A 1  122  ? 163.119 141.508 193.609 1.00 190.64 ? 122  ASN A ND2   1 
ATOM   857   N  N     . ASN A 1  123  ? 162.250 140.636 188.787 1.00 187.37 ? 123  ASN A N     1 
ATOM   858   C  CA    . ASN A 1  123  ? 163.378 140.841 187.889 1.00 187.37 ? 123  ASN A CA    1 
ATOM   859   C  C     . ASN A 1  123  ? 163.235 142.170 187.157 1.00 187.37 ? 123  ASN A C     1 
ATOM   860   O  O     . ASN A 1  123  ? 162.188 142.418 186.537 1.00 187.37 ? 123  ASN A O     1 
ATOM   861   C  CB    . ASN A 1  123  ? 163.460 139.685 186.891 1.00 185.92 ? 123  ASN A CB    1 
ATOM   862   C  CG    . ASN A 1  123  ? 164.752 139.684 186.084 1.00 185.92 ? 123  ASN A CG    1 
ATOM   863   O  OD1   . ASN A 1  123  ? 165.439 140.699 185.974 1.00 185.92 ? 123  ASN A OD1   1 
ATOM   864   N  ND2   . ASN A 1  123  ? 165.084 138.533 185.513 1.00 185.92 ? 123  ASN A ND2   1 
ATOM   865   N  N     . PRO A 1  124  ? 164.235 143.056 187.213 1.00 185.64 ? 124  PRO A N     1 
ATOM   866   C  CA    . PRO A 1  124  ? 164.168 144.288 186.411 1.00 185.64 ? 124  PRO A CA    1 
ATOM   867   C  C     . PRO A 1  124  ? 164.008 144.033 184.923 1.00 185.64 ? 124  PRO A C     1 
ATOM   868   O  O     . PRO A 1  124  ? 163.580 144.935 184.191 1.00 185.64 ? 124  PRO A O     1 
ATOM   869   C  CB    . PRO A 1  124  ? 165.502 144.978 186.729 1.00 184.18 ? 124  PRO A CB    1 
ATOM   870   C  CG    . PRO A 1  124  ? 165.854 144.484 188.092 1.00 184.18 ? 124  PRO A CG    1 
ATOM   871   C  CD    . PRO A 1  124  ? 165.379 143.058 188.141 1.00 184.18 ? 124  PRO A CD    1 
ATOM   872   N  N     . LYS A 1  125  ? 164.350 142.833 184.449 1.00 184.81 ? 125  LYS A N     1 
ATOM   873   C  CA    . LYS A 1  125  ? 164.024 142.455 183.078 1.00 184.81 ? 125  LYS A CA    1 
ATOM   874   C  C     . LYS A 1  125  ? 162.515 142.399 182.877 1.00 184.81 ? 125  LYS A C     1 
ATOM   875   O  O     . LYS A 1  125  ? 161.983 142.954 181.908 1.00 184.81 ? 125  LYS A O     1 
ATOM   876   C  CB    . LYS A 1  125  ? 164.662 141.106 182.742 1.00 179.50 ? 125  LYS A CB    1 
ATOM   877   C  CG    . LYS A 1  125  ? 166.176 141.141 182.629 1.00 179.50 ? 125  LYS A CG    1 
ATOM   878   C  CD    . LYS A 1  125  ? 166.734 139.765 182.306 1.00 179.50 ? 125  LYS A CD    1 
ATOM   879   C  CE    . LYS A 1  125  ? 166.311 139.311 180.919 1.00 179.50 ? 125  LYS A CE    1 
ATOM   880   N  NZ    . LYS A 1  125  ? 166.888 140.167 179.847 1.00 179.50 ? 125  LYS A NZ    1 
ATOM   881   N  N     . ILE A 1  126  ? 161.806 141.738 183.794 1.00 184.32 ? 126  ILE A N     1 
ATOM   882   C  CA    . ILE A 1  126  ? 160.355 141.624 183.671 1.00 184.32 ? 126  ILE A CA    1 
ATOM   883   C  C     . ILE A 1  126  ? 159.687 142.954 184.000 1.00 184.32 ? 126  ILE A C     1 
ATOM   884   O  O     . ILE A 1  126  ? 158.625 143.282 183.461 1.00 184.32 ? 126  ILE A O     1 
ATOM   885   C  CB    . ILE A 1  126  ? 159.828 140.478 184.554 1.00 184.66 ? 126  ILE A CB    1 
ATOM   886   C  CG1   . ILE A 1  126  ? 160.316 139.136 184.007 1.00 184.66 ? 126  ILE A CG1   1 
ATOM   887   C  CG2   . ILE A 1  126  ? 158.308 140.485 184.626 1.00 184.66 ? 126  ILE A CG2   1 
ATOM   888   C  CD1   . ILE A 1  126  ? 159.966 137.962 184.878 1.00 184.66 ? 126  ILE A CD1   1 
ATOM   889   N  N     . LYS A 1  127  ? 160.300 143.748 184.881 1.00 183.56 ? 127  LYS A N     1 
ATOM   890   C  CA    . LYS A 1  127  ? 159.797 145.101 185.097 1.00 183.56 ? 127  LYS A CA    1 
ATOM   891   C  C     . LYS A 1  127  ? 159.942 145.942 183.835 1.00 183.56 ? 127  LYS A C     1 
ATOM   892   O  O     . LYS A 1  127  ? 159.084 146.781 183.532 1.00 183.56 ? 127  LYS A O     1 
ATOM   893   C  CB    . LYS A 1  127  ? 160.520 145.759 186.273 1.00 182.90 ? 127  LYS A CB    1 
ATOM   894   C  CG    . LYS A 1  127  ? 160.203 145.135 187.623 1.00 182.90 ? 127  LYS A CG    1 
ATOM   895   C  CD    . LYS A 1  127  ? 160.975 145.815 188.740 1.00 182.90 ? 127  LYS A CD    1 
ATOM   896   C  CE    . LYS A 1  127  ? 160.626 145.222 190.095 1.00 182.90 ? 127  LYS A CE    1 
ATOM   897   N  NZ    . LYS A 1  127  ? 161.396 145.866 191.194 1.00 182.90 ? 127  LYS A NZ    1 
ATOM   898   N  N     . ASP A 1  128  ? 161.019 145.720 183.078 1.00 184.95 ? 128  ASP A N     1 
ATOM   899   C  CA    . ASP A 1  128  ? 161.186 146.404 181.800 1.00 184.95 ? 128  ASP A CA    1 
ATOM   900   C  C     . ASP A 1  128  ? 160.154 145.927 180.784 1.00 184.95 ? 128  ASP A C     1 
ATOM   901   O  O     . ASP A 1  128  ? 159.594 146.728 180.026 1.00 184.95 ? 128  ASP A O     1 
ATOM   902   C  CB    . ASP A 1  128  ? 162.604 146.179 181.274 1.00 185.26 ? 128  ASP A CB    1 
ATOM   903   C  CG    . ASP A 1  128  ? 162.848 146.862 179.945 1.00 185.26 ? 128  ASP A CG    1 
ATOM   904   O  OD1   . ASP A 1  128  ? 162.856 148.110 179.911 1.00 185.26 ? 128  ASP A OD1   1 
ATOM   905   O  OD2   . ASP A 1  128  ? 163.029 146.151 178.934 1.00 185.26 ? 128  ASP A OD2   1 
ATOM   906   N  N     . ILE A 1  129  ? 159.888 144.618 180.758 1.00 181.16 ? 129  ILE A N     1 
ATOM   907   C  CA    . ILE A 1  129  ? 158.917 144.071 179.813 1.00 181.16 ? 129  ILE A CA    1 
ATOM   908   C  C     . ILE A 1  129  ? 157.505 144.526 180.160 1.00 181.16 ? 129  ILE A C     1 
ATOM   909   O  O     . ILE A 1  129  ? 156.663 144.698 179.271 1.00 181.16 ? 129  ILE A O     1 
ATOM   910   C  CB    . ILE A 1  129  ? 159.034 142.534 179.773 1.00 178.32 ? 129  ILE A CB    1 
ATOM   911   C  CG1   . ILE A 1  129  ? 160.392 142.124 179.199 1.00 178.32 ? 129  ILE A CG1   1 
ATOM   912   C  CG2   . ILE A 1  129  ? 157.914 141.915 178.954 1.00 178.32 ? 129  ILE A CG2   1 
ATOM   913   C  CD1   . ILE A 1  129  ? 160.679 140.647 179.313 1.00 178.32 ? 129  ILE A CD1   1 
ATOM   914   N  N     . LEU A 1  130  ? 157.222 144.738 181.446 1.00 178.33 ? 130  LEU A N     1 
ATOM   915   C  CA    . LEU A 1  130  ? 155.913 145.250 181.839 1.00 178.33 ? 130  LEU A CA    1 
ATOM   916   C  C     . LEU A 1  130  ? 155.813 146.748 181.584 1.00 178.33 ? 130  LEU A C     1 
ATOM   917   O  O     . LEU A 1  130  ? 154.724 147.266 181.312 1.00 178.33 ? 130  LEU A O     1 
ATOM   918   C  CB    . LEU A 1  130  ? 155.641 144.939 183.311 1.00 176.71 ? 130  LEU A CB    1 
ATOM   919   C  CG    . LEU A 1  130  ? 155.501 143.470 183.721 1.00 176.71 ? 130  LEU A CG    1 
ATOM   920   C  CD1   . LEU A 1  130  ? 155.355 143.352 185.231 1.00 176.71 ? 130  LEU A CD1   1 
ATOM   921   C  CD2   . LEU A 1  130  ? 154.330 142.812 183.010 1.00 176.71 ? 130  LEU A CD2   1 
ATOM   922   N  N     . ALA A 1  131  ? 156.938 147.462 181.672 1.00 177.47 ? 131  ALA A N     1 
ATOM   923   C  CA    . ALA A 1  131  ? 156.928 148.897 181.405 1.00 177.47 ? 131  ALA A CA    1 
ATOM   924   C  C     . ALA A 1  131  ? 156.725 149.176 179.920 1.00 177.47 ? 131  ALA A C     1 
ATOM   925   O  O     . ALA A 1  131  ? 155.884 149.997 179.536 1.00 177.47 ? 131  ALA A O     1 
ATOM   926   C  CB    . ALA A 1  131  ? 158.227 149.529 181.906 1.00 176.45 ? 131  ALA A CB    1 
ATOM   927   N  N     . LYS A 1  132  ? 157.489 148.491 179.065 1.00 176.41 ? 132  LYS A N     1 
ATOM   928   C  CA    . LYS A 1  132  ? 157.378 148.720 177.627 1.00 176.41 ? 132  LYS A CA    1 
ATOM   929   C  C     . LYS A 1  132  ? 156.149 148.030 177.046 1.00 176.41 ? 132  LYS A C     1 
ATOM   930   O  O     . LYS A 1  132  ? 155.449 148.602 176.202 1.00 176.41 ? 132  LYS A O     1 
ATOM   931   C  CB    . LYS A 1  132  ? 158.640 148.232 176.918 1.00 169.34 ? 132  LYS A CB    1 
ATOM   932   C  CG    . LYS A 1  132  ? 159.896 149.010 177.259 1.00 169.34 ? 132  LYS A CG    1 
ATOM   933   C  CD    . LYS A 1  132  ? 161.105 148.401 176.571 1.00 169.34 ? 132  LYS A CD    1 
ATOM   934   C  CE    . LYS A 1  132  ? 162.372 149.182 176.871 1.00 169.34 ? 132  LYS A CE    1 
ATOM   935   N  NZ    . LYS A 1  132  ? 163.567 148.549 176.246 1.00 169.34 ? 132  LYS A NZ    1 
ATOM   936   N  N     . SER A 1  133  ? 155.870 146.808 177.490 1.00 175.01 ? 133  SER A N     1 
ATOM   937   C  CA    . SER A 1  133  ? 154.789 145.991 176.953 1.00 175.01 ? 133  SER A CA    1 
ATOM   938   C  C     . SER A 1  133  ? 153.440 146.292 177.592 1.00 175.01 ? 133  SER A C     1 
ATOM   939   O  O     . SER A 1  133  ? 152.470 145.582 177.307 1.00 175.01 ? 133  SER A O     1 
ATOM   940   C  CB    . SER A 1  133  ? 155.121 144.506 177.119 1.00 177.61 ? 133  SER A CB    1 
ATOM   941   O  OG    . SER A 1  133  ? 156.258 144.151 176.350 1.00 177.61 ? 133  SER A OG    1 
ATOM   942   N  N     . LYS A 1  134  ? 153.366 147.293 178.467 1.00 170.18 ? 134  LYS A N     1 
ATOM   943   C  CA    . LYS A 1  134  ? 152.095 147.708 179.046 1.00 170.18 ? 134  LYS A CA    1 
ATOM   944   C  C     . LYS A 1  134  ? 151.097 148.041 177.944 1.00 170.18 ? 134  LYS A C     1 
ATOM   945   O  O     . LYS A 1  134  ? 151.388 148.846 177.053 1.00 170.18 ? 134  LYS A O     1 
ATOM   946   C  CB    . LYS A 1  134  ? 152.307 148.921 179.949 1.00 166.76 ? 134  LYS A CB    1 
ATOM   947   C  CG    . LYS A 1  134  ? 151.053 149.404 180.658 1.00 166.76 ? 134  LYS A CG    1 
ATOM   948   C  CD    . LYS A 1  134  ? 151.325 150.670 181.459 1.00 166.76 ? 134  LYS A CD    1 
ATOM   949   C  CE    . LYS A 1  134  ? 152.280 150.415 182.614 1.00 166.76 ? 134  LYS A CE    1 
ATOM   950   N  NZ    . LYS A 1  134  ? 151.700 149.497 183.632 1.00 166.76 ? 134  LYS A NZ    1 
ATOM   951   N  N     . GLY A 1  135  ? 149.920 147.425 178.008 1.00 169.11 ? 135  GLY A N     1 
ATOM   952   C  CA    . GLY A 1  135  ? 148.897 147.626 177.005 1.00 169.11 ? 135  GLY A CA    1 
ATOM   953   C  C     . GLY A 1  135  ? 148.854 146.583 175.910 1.00 169.11 ? 135  GLY A C     1 
ATOM   954   O  O     . GLY A 1  135  ? 147.905 146.588 175.114 1.00 169.11 ? 135  GLY A O     1 
ATOM   955   N  N     . GLN A 1  136  ? 149.840 145.685 175.841 1.00 168.96 ? 136  GLN A N     1 
ATOM   956   C  CA    . GLN A 1  136  ? 149.892 144.618 174.845 1.00 168.96 ? 136  GLN A CA    1 
ATOM   957   C  C     . GLN A 1  136  ? 149.883 143.292 175.599 1.00 168.96 ? 136  GLN A C     1 
ATOM   958   O  O     . GLN A 1  136  ? 150.946 142.722 175.886 1.00 168.96 ? 136  GLN A O     1 
ATOM   959   C  CB    . GLN A 1  136  ? 151.122 144.734 173.946 1.00 171.88 ? 136  GLN A CB    1 
ATOM   960   C  CG    . GLN A 1  136  ? 151.157 145.981 173.079 1.00 171.88 ? 136  GLN A CG    1 
ATOM   961   C  CD    . GLN A 1  136  ? 151.759 147.175 173.792 1.00 171.88 ? 136  GLN A CD    1 
ATOM   962   O  OE1   . GLN A 1  136  ? 152.179 147.077 174.942 1.00 171.88 ? 136  GLN A OE1   1 
ATOM   963   N  NE2   . GLN A 1  136  ? 151.803 148.312 173.108 1.00 171.88 ? 136  GLN A NE2   1 
ATOM   964   N  N     . PRO A 1  137  ? 148.701 142.773 175.929 1.00 165.41 ? 137  PRO A N     1 
ATOM   965   C  CA    . PRO A 1  137  ? 148.646 141.559 176.760 1.00 165.41 ? 137  PRO A CA    1 
ATOM   966   C  C     . PRO A 1  137  ? 149.208 140.322 176.079 1.00 165.41 ? 137  PRO A C     1 
ATOM   967   O  O     . PRO A 1  137  ? 149.713 139.427 176.768 1.00 165.41 ? 137  PRO A O     1 
ATOM   968   C  CB    . PRO A 1  137  ? 147.148 141.418 177.059 1.00 161.48 ? 137  PRO A CB    1 
ATOM   969   C  CG    . PRO A 1  137  ? 146.474 142.100 175.921 1.00 161.48 ? 137  PRO A CG    1 
ATOM   970   C  CD    . PRO A 1  137  ? 147.359 143.258 175.565 1.00 161.48 ? 137  PRO A CD    1 
ATOM   971   N  N     . LYS A 1  138  ? 149.138 140.237 174.750 1.00 164.37 ? 138  LYS A N     1 
ATOM   972   C  CA    . LYS A 1  138  ? 149.714 139.095 174.048 1.00 164.37 ? 138  LYS A CA    1 
ATOM   973   C  C     . LYS A 1  138  ? 151.231 139.206 173.955 1.00 164.37 ? 138  LYS A C     1 
ATOM   974   O  O     . LYS A 1  138  ? 151.955 138.233 174.206 1.00 164.37 ? 138  LYS A O     1 
ATOM   975   C  CB    . LYS A 1  138  ? 149.105 138.980 172.650 1.00 159.10 ? 138  LYS A CB    1 
ATOM   976   C  CG    . LYS A 1  138  ? 149.626 137.804 171.845 1.00 159.10 ? 138  LYS A CG    1 
ATOM   977   C  CD    . LYS A 1  138  ? 148.905 137.675 170.516 1.00 159.10 ? 138  LYS A CD    1 
ATOM   978   C  CE    . LYS A 1  138  ? 149.453 136.507 169.712 1.00 159.10 ? 138  LYS A CE    1 
ATOM   979   N  NZ    . LYS A 1  138  ? 150.830 136.771 169.211 1.00 159.10 ? 138  LYS A NZ    1 
ATOM   980   N  N     . LYS A 1  139  ? 151.723 140.393 173.592 1.00 168.15 ? 139  LYS A N     1 
ATOM   981   C  CA    . LYS A 1  139  ? 153.156 140.582 173.397 1.00 168.15 ? 139  LYS A CA    1 
ATOM   982   C  C     . LYS A 1  139  ? 153.925 140.286 174.678 1.00 168.15 ? 139  LYS A C     1 
ATOM   983   O  O     . LYS A 1  139  ? 154.964 139.615 174.652 1.00 168.15 ? 139  LYS A O     1 
ATOM   984   C  CB    . LYS A 1  139  ? 153.427 142.006 172.913 1.00 169.15 ? 139  LYS A CB    1 
ATOM   985   C  CG    . LYS A 1  139  ? 154.872 142.274 172.544 1.00 169.15 ? 139  LYS A CG    1 
ATOM   986   C  CD    . LYS A 1  139  ? 155.093 143.739 172.211 1.00 169.15 ? 139  LYS A CD    1 
ATOM   987   C  CE    . LYS A 1  139  ? 154.378 144.125 170.929 1.00 169.15 ? 139  LYS A CE    1 
ATOM   988   N  NZ    . LYS A 1  139  ? 154.572 145.564 170.603 1.00 169.15 ? 139  LYS A NZ    1 
ATOM   989   N  N     . ARG A 1  140  ? 153.417 140.767 175.817 1.00 168.17 ? 140  ARG A N     1 
ATOM   990   C  CA    . ARG A 1  140  ? 154.078 140.484 177.085 1.00 168.17 ? 140  ARG A CA    1 
ATOM   991   C  C     . ARG A 1  140  ? 154.080 138.989 177.381 1.00 168.17 ? 140  ARG A C     1 
ATOM   992   O  O     . ARG A 1  140  ? 155.022 138.477 177.994 1.00 168.17 ? 140  ARG A O     1 
ATOM   993   C  CB    . ARG A 1  140  ? 153.416 141.263 178.224 1.00 165.57 ? 140  ARG A CB    1 
ATOM   994   C  CG    . ARG A 1  140  ? 152.022 140.791 178.584 1.00 165.57 ? 140  ARG A CG    1 
ATOM   995   C  CD    . ARG A 1  140  ? 151.528 141.415 179.880 1.00 165.57 ? 140  ARG A CD    1 
ATOM   996   N  NE    . ARG A 1  140  ? 151.347 142.860 179.790 1.00 165.57 ? 140  ARG A NE    1 
ATOM   997   C  CZ    . ARG A 1  140  ? 151.182 143.652 180.844 1.00 165.57 ? 140  ARG A CZ    1 
ATOM   998   N  NH1   . ARG A 1  140  ? 151.169 143.137 182.065 1.00 165.57 ? 140  ARG A NH1   1 
ATOM   999   N  NH2   . ARG A 1  140  ? 151.023 144.957 180.678 1.00 165.57 ? 140  ARG A NH2   1 
ATOM   1000  N  N     . LEU A 1  141  ? 153.040 138.270 176.945 1.00 168.53 ? 141  LEU A N     1 
ATOM   1001  C  CA    . LEU A 1  141  ? 153.043 136.818 177.099 1.00 168.53 ? 141  LEU A CA    1 
ATOM   1002  C  C     . LEU A 1  141  ? 154.137 136.187 176.253 1.00 168.53 ? 141  LEU A C     1 
ATOM   1003  O  O     . LEU A 1  141  ? 154.800 135.238 176.690 1.00 168.53 ? 141  LEU A O     1 
ATOM   1004  C  CB    . LEU A 1  141  ? 151.675 136.236 176.733 1.00 159.81 ? 141  LEU A CB    1 
ATOM   1005  C  CG    . LEU A 1  141  ? 151.447 134.735 176.972 1.00 159.81 ? 141  LEU A CG    1 
ATOM   1006  C  CD1   . LEU A 1  141  ? 150.001 134.452 177.335 1.00 159.81 ? 141  LEU A CD1   1 
ATOM   1007  C  CD2   . LEU A 1  141  ? 151.838 133.899 175.760 1.00 159.81 ? 141  LEU A CD2   1 
ATOM   1008  N  N     . THR A 1  142  ? 154.339 136.695 175.035 1.00 170.94 ? 142  THR A N     1 
ATOM   1009  C  CA    . THR A 1  142  ? 155.407 136.165 174.192 1.00 170.94 ? 142  THR A CA    1 
ATOM   1010  C  C     . THR A 1  142  ? 156.776 136.417 174.818 1.00 170.94 ? 142  THR A C     1 
ATOM   1011  O  O     . THR A 1  142  ? 157.641 135.531 174.826 1.00 170.94 ? 142  THR A O     1 
ATOM   1012  C  CB    . THR A 1  142  ? 155.330 136.776 172.792 1.00 169.11 ? 142  THR A CB    1 
ATOM   1013  O  OG1   . THR A 1  142  ? 155.441 138.202 172.881 1.00 169.11 ? 142  THR A OG1   1 
ATOM   1014  C  CG2   . THR A 1  142  ? 154.012 136.412 172.121 1.00 169.11 ? 142  THR A CG2   1 
ATOM   1015  N  N     . HIS A 1  143  ? 156.986 137.617 175.363 1.00 171.05 ? 143  HIS A N     1 
ATOM   1016  C  CA    . HIS A 1  143  ? 158.280 137.936 175.962 1.00 171.05 ? 143  HIS A CA    1 
ATOM   1017  C  C     . HIS A 1  143  ? 158.529 137.112 177.223 1.00 171.05 ? 143  HIS A C     1 
ATOM   1018  O  O     . HIS A 1  143  ? 159.577 136.470 177.360 1.00 171.05 ? 143  HIS A O     1 
ATOM   1019  C  CB    . HIS A 1  143  ? 158.376 139.433 176.262 1.00 172.04 ? 143  HIS A CB    1 
ATOM   1020  C  CG    . HIS A 1  143  ? 158.360 140.296 175.040 1.00 172.04 ? 143  HIS A CG    1 
ATOM   1021  N  ND1   . HIS A 1  143  ? 159.380 140.288 174.112 1.00 172.04 ? 143  HIS A ND1   1 
ATOM   1022  C  CD2   . HIS A 1  143  ? 157.464 141.212 174.604 1.00 172.04 ? 143  HIS A CD2   1 
ATOM   1023  C  CE1   . HIS A 1  143  ? 159.104 141.148 173.149 1.00 172.04 ? 143  HIS A CE1   1 
ATOM   1024  N  NE2   . HIS A 1  143  ? 157.947 141.724 173.424 1.00 172.04 ? 143  HIS A NE2   1 
ATOM   1025  N  N     . VAL A 1  144  ? 157.573 137.112 178.158 1.00 170.23 ? 144  VAL A N     1 
ATOM   1026  C  CA    . VAL A 1  144  ? 157.782 136.366 179.398 1.00 170.23 ? 144  VAL A CA    1 
ATOM   1027  C  C     . VAL A 1  144  ? 157.795 134.870 179.126 1.00 170.23 ? 144  VAL A C     1 
ATOM   1028  O  O     . VAL A 1  144  ? 158.251 134.083 179.962 1.00 170.23 ? 144  VAL A O     1 
ATOM   1029  C  CB    . VAL A 1  144  ? 156.721 136.727 180.460 1.00 168.08 ? 144  VAL A CB    1 
ATOM   1030  C  CG1   . VAL A 1  144  ? 156.738 138.221 180.758 1.00 168.08 ? 144  VAL A CG1   1 
ATOM   1031  C  CG2   . VAL A 1  144  ? 155.341 136.238 180.047 1.00 168.08 ? 144  VAL A CG2   1 
ATOM   1032  N  N     . TYR A 1  145  ? 157.285 134.448 177.966 1.00 168.96 ? 145  TYR A N     1 
ATOM   1033  C  CA    . TYR A 1  145  ? 157.466 133.063 177.551 1.00 168.96 ? 145  TYR A CA    1 
ATOM   1034  C  C     . TYR A 1  145  ? 158.895 132.824 177.086 1.00 168.96 ? 145  TYR A C     1 
ATOM   1035  O  O     . TYR A 1  145  ? 159.502 131.797 177.416 1.00 168.96 ? 145  TYR A O     1 
ATOM   1036  C  CB    . TYR A 1  145  ? 156.470 132.707 176.447 1.00 162.40 ? 145  TYR A CB    1 
ATOM   1037  C  CG    . TYR A 1  145  ? 156.660 131.323 175.866 1.00 162.40 ? 145  TYR A CG    1 
ATOM   1038  C  CD1   . TYR A 1  145  ? 156.234 130.195 176.554 1.00 162.40 ? 145  TYR A CD1   1 
ATOM   1039  C  CD2   . TYR A 1  145  ? 157.257 131.146 174.625 1.00 162.40 ? 145  TYR A CD2   1 
ATOM   1040  C  CE1   . TYR A 1  145  ? 156.404 128.929 176.026 1.00 162.40 ? 145  TYR A CE1   1 
ATOM   1041  C  CE2   . TYR A 1  145  ? 157.431 129.885 174.088 1.00 162.40 ? 145  TYR A CE2   1 
ATOM   1042  C  CZ    . TYR A 1  145  ? 157.002 128.780 174.792 1.00 162.40 ? 145  TYR A CZ    1 
ATOM   1043  O  OH    . TYR A 1  145  ? 157.173 127.523 174.260 1.00 162.40 ? 145  TYR A OH    1 
ATOM   1044  N  N     . ASP A 1  146  ? 159.453 133.770 176.324 1.00 171.72 ? 146  ASP A N     1 
ATOM   1045  C  CA    . ASP A 1  146  ? 160.854 133.669 175.928 1.00 171.72 ? 146  ASP A CA    1 
ATOM   1046  C  C     . ASP A 1  146  ? 161.779 133.660 177.139 1.00 171.72 ? 146  ASP A C     1 
ATOM   1047  O  O     . ASP A 1  146  ? 162.830 133.010 177.111 1.00 171.72 ? 146  ASP A O     1 
ATOM   1048  C  CB    . ASP A 1  146  ? 161.219 134.822 174.993 1.00 178.61 ? 146  ASP A CB    1 
ATOM   1049  C  CG    . ASP A 1  146  ? 160.543 134.714 173.641 1.00 178.61 ? 146  ASP A CG    1 
ATOM   1050  O  OD1   . ASP A 1  146  ? 160.058 133.615 173.302 1.00 178.61 ? 146  ASP A OD1   1 
ATOM   1051  O  OD2   . ASP A 1  146  ? 160.491 135.731 172.918 1.00 178.61 ? 146  ASP A OD2   1 
ATOM   1052  N  N     . LEU A 1  147  ? 161.415 134.378 178.203 1.00 171.42 ? 147  LEU A N     1 
ATOM   1053  C  CA    . LEU A 1  147  ? 162.230 134.378 179.414 1.00 171.42 ? 147  LEU A CA    1 
ATOM   1054  C  C     . LEU A 1  147  ? 162.010 133.118 180.243 1.00 171.42 ? 147  LEU A C     1 
ATOM   1055  O  O     . LEU A 1  147  ? 162.972 132.492 180.699 1.00 171.42 ? 147  LEU A O     1 
ATOM   1056  C  CB    . LEU A 1  147  ? 161.934 135.623 180.254 1.00 171.43 ? 147  LEU A CB    1 
ATOM   1057  C  CG    . LEU A 1  147  ? 162.726 136.899 179.959 1.00 171.43 ? 147  LEU A CG    1 
ATOM   1058  C  CD1   . LEU A 1  147  ? 162.416 137.451 178.578 1.00 171.43 ? 147  LEU A CD1   1 
ATOM   1059  C  CD2   . LEU A 1  147  ? 162.456 137.946 181.030 1.00 171.43 ? 147  LEU A CD2   1 
ATOM   1060  N  N     . CYS A 1  148  ? 160.749 132.731 180.451 1.00 171.85 ? 148  CYS A N     1 
ATOM   1061  C  CA    . CYS A 1  148  ? 160.462 131.624 181.357 1.00 171.85 ? 148  CYS A CA    1 
ATOM   1062  C  C     . CYS A 1  148  ? 160.757 130.271 180.722 1.00 171.85 ? 148  CYS A C     1 
ATOM   1063  O  O     . CYS A 1  148  ? 160.792 129.258 181.429 1.00 171.85 ? 148  CYS A O     1 
ATOM   1064  C  CB    . CYS A 1  148  ? 159.010 131.685 181.829 1.00 173.11 ? 148  CYS A CB    1 
ATOM   1065  S  SG    . CYS A 1  148  ? 158.629 133.097 182.895 1.00 173.11 ? 148  CYS A SG    1 
ATOM   1066  N  N     . LYS A 1  149  ? 160.966 130.223 179.405 1.00 170.67 ? 149  LYS A N     1 
ATOM   1067  C  CA    . LYS A 1  149  ? 161.374 128.962 178.797 1.00 170.67 ? 149  LYS A CA    1 
ATOM   1068  C  C     . LYS A 1  149  ? 162.838 128.633 179.059 1.00 170.67 ? 149  LYS A C     1 
ATOM   1069  O  O     . LYS A 1  149  ? 163.251 127.494 178.817 1.00 170.67 ? 149  LYS A O     1 
ATOM   1070  C  CB    . LYS A 1  149  ? 161.125 128.985 177.287 1.00 170.69 ? 149  LYS A CB    1 
ATOM   1071  C  CG    . LYS A 1  149  ? 161.972 129.992 176.530 1.00 170.69 ? 149  LYS A CG    1 
ATOM   1072  C  CD    . LYS A 1  149  ? 161.680 129.949 175.039 1.00 170.69 ? 149  LYS A CD    1 
ATOM   1073  C  CE    . LYS A 1  149  ? 162.119 128.628 174.430 1.00 170.69 ? 149  LYS A CE    1 
ATOM   1074  N  NZ    . LYS A 1  149  ? 161.843 128.568 172.968 1.00 170.69 ? 149  LYS A NZ    1 
ATOM   1075  N  N     . GLY A 1  150  ? 163.624 129.593 179.547 1.00 171.78 ? 150  GLY A N     1 
ATOM   1076  C  CA    . GLY A 1  150  ? 165.043 129.397 179.765 1.00 171.78 ? 150  GLY A CA    1 
ATOM   1077  C  C     . GLY A 1  150  ? 165.439 128.856 181.118 1.00 171.78 ? 150  GLY A C     1 
ATOM   1078  O  O     . GLY A 1  150  ? 166.611 128.525 181.320 1.00 171.78 ? 150  GLY A O     1 
ATOM   1079  N  N     . LYS A 1  151  ? 164.500 128.752 182.055 1.00 171.52 ? 151  LYS A N     1 
ATOM   1080  C  CA    . LYS A 1  151  ? 164.776 128.220 183.385 1.00 171.52 ? 151  LYS A CA    1 
ATOM   1081  C  C     . LYS A 1  151  ? 164.275 126.782 183.444 1.00 171.52 ? 151  LYS A C     1 
ATOM   1082  O  O     . LYS A 1  151  ? 163.064 126.538 183.452 1.00 171.52 ? 151  LYS A O     1 
ATOM   1083  C  CB    . LYS A 1  151  ? 164.115 129.074 184.464 1.00 172.40 ? 151  LYS A CB    1 
ATOM   1084  C  CG    . LYS A 1  151  ? 164.630 130.499 184.537 1.00 172.40 ? 151  LYS A CG    1 
ATOM   1085  C  CD    . LYS A 1  151  ? 166.075 130.540 185.006 1.00 172.40 ? 151  LYS A CD    1 
ATOM   1086  C  CE    . LYS A 1  151  ? 166.588 131.969 185.096 1.00 172.40 ? 151  LYS A CE    1 
ATOM   1087  N  NZ    . LYS A 1  151  ? 165.857 132.752 186.129 1.00 172.40 ? 151  LYS A NZ    1 
ATOM   1088  N  N     . ASN A 1  152  ? 165.209 125.833 183.488 1.00 167.09 ? 152  ASN A N     1 
ATOM   1089  C  CA    . ASN A 1  152  ? 164.857 124.426 183.607 1.00 167.09 ? 152  ASN A CA    1 
ATOM   1090  C  C     . ASN A 1  152  ? 164.562 124.006 185.037 1.00 167.09 ? 152  ASN A C     1 
ATOM   1091  O  O     . ASN A 1  152  ? 163.899 122.983 185.243 1.00 167.09 ? 152  ASN A O     1 
ATOM   1092  C  CB    . ASN A 1  152  ? 165.984 123.549 183.052 1.00 168.18 ? 152  ASN A CB    1 
ATOM   1093  C  CG    . ASN A 1  152  ? 166.116 123.655 181.548 1.00 168.18 ? 152  ASN A CG    1 
ATOM   1094  O  OD1   . ASN A 1  152  ? 165.166 124.014 180.853 1.00 168.18 ? 152  ASN A OD1   1 
ATOM   1095  N  ND2   . ASN A 1  152  ? 167.299 123.337 181.035 1.00 168.18 ? 152  ASN A ND2   1 
ATOM   1096  N  N     . ILE A 1  153  ? 165.041 124.757 186.026 1.00 169.52 ? 153  ILE A N     1 
ATOM   1097  C  CA    . ILE A 1  153  ? 164.865 124.405 187.430 1.00 169.52 ? 153  ILE A CA    1 
ATOM   1098  C  C     . ILE A 1  153  ? 164.419 125.646 188.188 1.00 169.52 ? 153  ILE A C     1 
ATOM   1099  O  O     . ILE A 1  153  ? 165.165 126.628 188.270 1.00 169.52 ? 153  ILE A O     1 
ATOM   1100  C  CB    . ILE A 1  153  ? 166.156 123.840 188.050 1.00 167.75 ? 153  ILE A CB    1 
ATOM   1101  C  CG1   . ILE A 1  153  ? 166.529 122.505 187.402 1.00 167.75 ? 153  ILE A CG1   1 
ATOM   1102  C  CG2   . ILE A 1  153  ? 166.005 123.673 189.551 1.00 167.75 ? 153  ILE A CG2   1 
ATOM   1103  C  CD1   . ILE A 1  153  ? 167.900 122.002 187.796 1.00 167.75 ? 153  ILE A CD1   1 
ATOM   1104  N  N     . CYS A 1  154  ? 163.208 125.609 188.737 1.00 173.13 ? 154  CYS A N     1 
ATOM   1105  C  CA    . CYS A 1  154  ? 162.815 126.598 189.725 1.00 173.13 ? 154  CYS A CA    1 
ATOM   1106  C  C     . CYS A 1  154  ? 163.457 126.257 191.064 1.00 173.13 ? 154  CYS A C     1 
ATOM   1107  O  O     . CYS A 1  154  ? 163.821 125.109 191.328 1.00 173.13 ? 154  CYS A O     1 
ATOM   1108  C  CB    . CYS A 1  154  ? 161.294 126.655 189.862 1.00 174.69 ? 154  CYS A CB    1 
ATOM   1109  S  SG    . CYS A 1  154  ? 160.694 127.902 191.027 1.00 174.69 ? 154  CYS A SG    1 
ATOM   1110  N  N     . GLU A 1  155  ? 163.610 127.268 191.912 1.00 175.39 ? 155  GLU A N     1 
ATOM   1111  C  CA    . GLU A 1  155  ? 164.268 127.061 193.199 1.00 175.39 ? 155  GLU A CA    1 
ATOM   1112  C  C     . GLU A 1  155  ? 163.538 127.765 194.338 1.00 175.39 ? 155  GLU A C     1 
ATOM   1113  O  O     . GLU A 1  155  ? 163.777 127.479 195.511 1.00 175.39 ? 155  GLU A O     1 
ATOM   1114  C  CB    . GLU A 1  155  ? 165.722 127.537 193.135 1.00 180.08 ? 155  GLU A CB    1 
ATOM   1115  C  CG    . GLU A 1  155  ? 166.602 126.713 192.205 1.00 180.08 ? 155  GLU A CG    1 
ATOM   1116  C  CD    . GLU A 1  155  ? 168.016 127.248 192.109 1.00 180.08 ? 155  GLU A CD    1 
ATOM   1117  O  OE1   . GLU A 1  155  ? 168.271 128.354 192.627 1.00 180.08 ? 155  GLU A OE1   1 
ATOM   1118  O  OE2   . GLU A 1  155  ? 168.872 126.563 191.511 1.00 180.08 ? 155  GLU A OE2   1 
ATOM   1119  N  N     . HIS A 1  181  ? 162.038 135.248 196.017 1.00 182.70 ? 181  HIS A N     1 
ATOM   1120  C  CA    . HIS A 1  181  ? 161.932 134.040 195.209 1.00 182.70 ? 181  HIS A CA    1 
ATOM   1121  C  C     . HIS A 1  181  ? 161.146 132.974 195.965 1.00 182.70 ? 181  HIS A C     1 
ATOM   1122  O  O     . HIS A 1  181  ? 161.095 132.986 197.194 1.00 182.70 ? 181  HIS A O     1 
ATOM   1123  C  CB    . HIS A 1  181  ? 163.322 133.521 194.836 1.00 182.55 ? 181  HIS A CB    1 
ATOM   1124  C  CG    . HIS A 1  181  ? 163.303 132.358 193.895 1.00 182.55 ? 181  HIS A CG    1 
ATOM   1125  N  ND1   . HIS A 1  181  ? 162.758 132.434 192.631 1.00 182.55 ? 181  HIS A ND1   1 
ATOM   1126  C  CD2   . HIS A 1  181  ? 163.771 131.094 194.027 1.00 182.55 ? 181  HIS A CD2   1 
ATOM   1127  C  CE1   . HIS A 1  181  ? 162.887 131.266 192.027 1.00 182.55 ? 181  HIS A CE1   1 
ATOM   1128  N  NE2   . HIS A 1  181  ? 163.498 130.436 192.853 1.00 182.55 ? 181  HIS A NE2   1 
ATOM   1129  N  N     . GLY A 1  182  ? 160.531 132.056 195.228 1.00 179.18 ? 182  GLY A N     1 
ATOM   1130  C  CA    . GLY A 1  182  ? 159.744 131.008 195.837 1.00 179.18 ? 182  GLY A CA    1 
ATOM   1131  C  C     . GLY A 1  182  ? 160.566 129.768 196.137 1.00 179.18 ? 182  GLY A C     1 
ATOM   1132  O  O     . GLY A 1  182  ? 161.795 129.747 196.061 1.00 179.18 ? 182  GLY A O     1 
ATOM   1133  N  N     . GLY A 1  183  ? 159.853 128.708 196.490 1.00 175.27 ? 183  GLY A N     1 
ATOM   1134  C  CA    . GLY A 1  183  ? 160.447 127.419 196.783 1.00 175.27 ? 183  GLY A CA    1 
ATOM   1135  C  C     . GLY A 1  183  ? 160.455 126.511 195.574 1.00 175.27 ? 183  GLY A C     1 
ATOM   1136  O  O     . GLY A 1  183  ? 160.604 126.957 194.433 1.00 175.27 ? 183  GLY A O     1 
ATOM   1137  N  N     . CYS A 1  184  ? 160.294 125.211 195.832 1.00 172.19 ? 184  CYS A N     1 
ATOM   1138  C  CA    . CYS A 1  184  ? 160.189 124.193 194.786 1.00 172.19 ? 184  CYS A CA    1 
ATOM   1139  C  C     . CYS A 1  184  ? 161.455 124.160 193.923 1.00 172.19 ? 184  CYS A C     1 
ATOM   1140  O  O     . CYS A 1  184  ? 161.481 124.591 192.769 1.00 172.19 ? 184  CYS A O     1 
ATOM   1141  C  CB    . CYS A 1  184  ? 158.937 124.423 193.931 1.00 171.81 ? 184  CYS A CB    1 
ATOM   1142  S  SG    . CYS A 1  184  ? 158.665 123.179 192.653 1.00 171.81 ? 184  CYS A SG    1 
ATOM   1143  N  N     . GLY A 1  185  ? 162.515 123.627 194.530 1.00 169.44 ? 185  GLY A N     1 
ATOM   1144  C  CA    . GLY A 1  185  ? 163.816 123.503 193.909 1.00 169.44 ? 185  GLY A CA    1 
ATOM   1145  C  C     . GLY A 1  185  ? 163.972 122.381 192.905 1.00 169.44 ? 185  GLY A C     1 
ATOM   1146  O  O     . GLY A 1  185  ? 165.102 122.056 192.534 1.00 169.44 ? 185  GLY A O     1 
ATOM   1147  N  N     . ARG A 1  186  ? 162.877 121.780 192.443 1.00 166.59 ? 186  ARG A N     1 
ATOM   1148  C  CA    . ARG A 1  186  ? 162.950 120.607 191.587 1.00 166.59 ? 186  ARG A CA    1 
ATOM   1149  C  C     . ARG A 1  186  ? 163.084 121.009 190.117 1.00 166.59 ? 186  ARG A C     1 
ATOM   1150  O  O     . ARG A 1  186  ? 163.121 122.190 189.763 1.00 166.59 ? 186  ARG A O     1 
ATOM   1151  C  CB    . ARG A 1  186  ? 161.720 119.723 191.787 1.00 163.95 ? 186  ARG A CB    1 
ATOM   1152  C  CG    . ARG A 1  186  ? 161.566 119.133 193.179 1.00 163.95 ? 186  ARG A CG    1 
ATOM   1153  C  CD    . ARG A 1  186  ? 160.300 118.301 193.249 1.00 163.95 ? 186  ARG A CD    1 
ATOM   1154  N  NE    . ARG A 1  186  ? 160.005 117.823 194.595 1.00 163.95 ? 186  ARG A NE    1 
ATOM   1155  C  CZ    . ARG A 1  186  ? 158.893 117.172 194.916 1.00 163.95 ? 186  ARG A CZ    1 
ATOM   1156  N  NH1   . ARG A 1  186  ? 157.983 116.925 193.985 1.00 163.95 ? 186  ARG A NH1   1 
ATOM   1157  N  NH2   . ARG A 1  186  ? 158.687 116.770 196.164 1.00 163.95 ? 186  ARG A NH2   1 
ATOM   1158  N  N     . TYR A 1  187  ? 163.154 119.999 189.251 1.00 161.47 ? 187  TYR A N     1 
ATOM   1159  C  CA    . TYR A 1  187  ? 163.260 120.194 187.812 1.00 161.47 ? 187  TYR A CA    1 
ATOM   1160  C  C     . TYR A 1  187  ? 161.920 120.610 187.209 1.00 161.47 ? 187  TYR A C     1 
ATOM   1161  O  O     . TYR A 1  187  ? 160.853 120.438 187.806 1.00 161.47 ? 187  TYR A O     1 
ATOM   1162  C  CB    . TYR A 1  187  ? 163.741 118.915 187.129 1.00 164.64 ? 187  TYR A CB    1 
ATOM   1163  C  CG    . TYR A 1  187  ? 165.127 118.465 187.529 1.00 164.64 ? 187  TYR A CG    1 
ATOM   1164  C  CD1   . TYR A 1  187  ? 166.251 118.924 186.855 1.00 164.64 ? 187  TYR A CD1   1 
ATOM   1165  C  CD2   . TYR A 1  187  ? 165.311 117.573 188.576 1.00 164.64 ? 187  TYR A CD2   1 
ATOM   1166  C  CE1   . TYR A 1  187  ? 167.521 118.509 187.216 1.00 164.64 ? 187  TYR A CE1   1 
ATOM   1167  C  CE2   . TYR A 1  187  ? 166.576 117.153 188.945 1.00 164.64 ? 187  TYR A CE2   1 
ATOM   1168  C  CZ    . TYR A 1  187  ? 167.678 117.625 188.262 1.00 164.64 ? 187  TYR A CZ    1 
ATOM   1169  O  OH    . TYR A 1  187  ? 168.940 117.211 188.624 1.00 164.64 ? 187  TYR A OH    1 
ATOM   1170  N  N     . GLN A 1  188  ? 161.993 121.174 186.008 1.00 158.58 ? 188  GLN A N     1 
ATOM   1171  C  CA    . GLN A 1  188  ? 160.811 121.485 185.203 1.00 158.58 ? 188  GLN A CA    1 
ATOM   1172  C  C     . GLN A 1  188  ? 160.827 120.659 183.926 1.00 158.58 ? 188  GLN A C     1 
ATOM   1173  O  O     . GLN A 1  188  ? 161.706 120.866 183.067 1.00 158.58 ? 188  GLN A O     1 
ATOM   1174  C  CB    . GLN A 1  188  ? 160.750 122.976 184.881 1.00 158.86 ? 188  GLN A CB    1 
ATOM   1175  C  CG    . GLN A 1  188  ? 160.539 123.827 186.109 1.00 158.86 ? 188  GLN A CG    1 
ATOM   1176  C  CD    . GLN A 1  188  ? 159.279 123.437 186.845 1.00 158.86 ? 188  GLN A CD    1 
ATOM   1177  O  OE1   . GLN A 1  188  ? 158.246 123.170 186.231 1.00 158.86 ? 188  GLN A OE1   1 
ATOM   1178  N  NE2   . GLN A 1  188  ? 159.362 123.373 188.166 1.00 158.86 ? 188  GLN A NE2   1 
ATOM   1179  N  N     . PRO A 1  189  ? 159.895 119.727 183.752 1.00 156.09 ? 189  PRO A N     1 
ATOM   1180  C  CA    . PRO A 1  189  ? 159.927 118.850 182.578 1.00 156.09 ? 189  PRO A CA    1 
ATOM   1181  C  C     . PRO A 1  189  ? 159.473 119.566 181.317 1.00 156.09 ? 189  PRO A C     1 
ATOM   1182  O  O     . PRO A 1  189  ? 158.866 120.639 181.354 1.00 156.09 ? 189  PRO A O     1 
ATOM   1183  C  CB    . PRO A 1  189  ? 158.950 117.733 182.951 1.00 153.82 ? 189  PRO A CB    1 
ATOM   1184  C  CG    . PRO A 1  189  ? 157.973 118.403 183.840 1.00 153.82 ? 189  PRO A CG    1 
ATOM   1185  C  CD    . PRO A 1  189  ? 158.760 119.415 184.637 1.00 153.82 ? 189  PRO A CD    1 
ATOM   1186  N  N     . ARG A 1  190  ? 159.785 118.945 180.184 1.00 157.12 ? 190  ARG A N     1 
ATOM   1187  C  CA    . ARG A 1  190  ? 159.300 119.431 178.901 1.00 157.12 ? 190  ARG A CA    1 
ATOM   1188  C  C     . ARG A 1  190  ? 157.921 118.854 178.602 1.00 157.12 ? 190  ARG A C     1 
ATOM   1189  O  O     . ARG A 1  190  ? 157.627 117.696 178.909 1.00 157.12 ? 190  ARG A O     1 
ATOM   1190  C  CB    . ARG A 1  190  ? 160.275 119.057 177.784 1.00 159.28 ? 190  ARG A CB    1 
ATOM   1191  C  CG    . ARG A 1  190  ? 159.848 119.525 176.400 1.00 159.28 ? 190  ARG A CG    1 
ATOM   1192  C  CD    . ARG A 1  190  ? 160.816 119.040 175.337 1.00 159.28 ? 190  ARG A CD    1 
ATOM   1193  N  NE    . ARG A 1  190  ? 160.837 117.582 175.267 1.00 159.28 ? 190  ARG A NE    1 
ATOM   1194  C  CZ    . ARG A 1  190  ? 161.789 116.878 174.665 1.00 159.28 ? 190  ARG A CZ    1 
ATOM   1195  N  NH1   . ARG A 1  190  ? 162.800 117.501 174.077 1.00 159.28 ? 190  ARG A NH1   1 
ATOM   1196  N  NH2   . ARG A 1  190  ? 161.732 115.554 174.653 1.00 159.28 ? 190  ARG A NH2   1 
ATOM   1197  N  N     . ILE A 1  191  ? 157.070 119.674 177.994 1.00 153.01 ? 191  ILE A N     1 
ATOM   1198  C  CA    . ILE A 1  191  ? 155.703 119.289 177.667 1.00 153.01 ? 191  ILE A CA    1 
ATOM   1199  C  C     . ILE A 1  191  ? 155.595 119.142 176.157 1.00 153.01 ? 191  ILE A C     1 
ATOM   1200  O  O     . ILE A 1  191  ? 155.711 120.130 175.421 1.00 153.01 ? 191  ILE A O     1 
ATOM   1201  C  CB    . ILE A 1  191  ? 154.683 120.307 178.190 1.00 150.45 ? 191  ILE A CB    1 
ATOM   1202  C  CG1   . ILE A 1  191  ? 154.712 120.337 179.714 1.00 150.45 ? 191  ILE A CG1   1 
ATOM   1203  C  CG2   . ILE A 1  191  ? 153.286 119.964 177.700 1.00 150.45 ? 191  ILE A CG2   1 
ATOM   1204  C  CD1   . ILE A 1  191  ? 153.926 121.466 180.290 1.00 150.45 ? 191  ILE A CD1   1 
ATOM   1205  N  N     . ARG A 1  192  ? 155.371 117.915 175.701 1.00 156.39 ? 192  ARG A N     1 
ATOM   1206  C  CA    . ARG A 1  192  ? 155.209 117.614 174.288 1.00 156.39 ? 192  ARG A CA    1 
ATOM   1207  C  C     . ARG A 1  192  ? 153.742 117.338 173.986 1.00 156.39 ? 192  ARG A C     1 
ATOM   1208  O  O     . ARG A 1  192  ? 153.038 116.717 174.782 1.00 156.39 ? 192  ARG A O     1 
ATOM   1209  C  CB    . ARG A 1  192  ? 156.059 116.405 173.883 1.00 159.99 ? 192  ARG A CB    1 
ATOM   1210  C  CG    . ARG A 1  192  ? 155.931 116.014 172.420 1.00 159.99 ? 192  ARG A CG    1 
ATOM   1211  C  CD    . ARG A 1  192  ? 156.733 114.763 172.114 1.00 159.99 ? 192  ARG A CD    1 
ATOM   1212  N  NE    . ARG A 1  192  ? 158.168 114.990 172.246 1.00 159.99 ? 192  ARG A NE    1 
ATOM   1213  C  CZ    . ARG A 1  192  ? 159.088 114.041 172.110 1.00 159.99 ? 192  ARG A CZ    1 
ATOM   1214  N  NH1   . ARG A 1  192  ? 158.724 112.795 171.841 1.00 159.99 ? 192  ARG A NH1   1 
ATOM   1215  N  NH2   . ARG A 1  192  ? 160.373 114.339 172.245 1.00 159.99 ? 192  ARG A NH2   1 
ATOM   1216  N  N     . ARG A 1  193  ? 153.282 117.800 172.828 1.00 153.04 ? 193  ARG A N     1 
ATOM   1217  C  CA    . ARG A 1  193  ? 151.898 117.603 172.412 1.00 153.04 ? 193  ARG A CA    1 
ATOM   1218  C  C     . ARG A 1  193  ? 151.855 116.603 171.268 1.00 153.04 ? 193  ARG A C     1 
ATOM   1219  O  O     . ARG A 1  193  ? 152.413 116.858 170.195 1.00 153.04 ? 193  ARG A O     1 
ATOM   1220  C  CB    . ARG A 1  193  ? 151.252 118.922 171.989 1.00 152.82 ? 193  ARG A CB    1 
ATOM   1221  C  CG    . ARG A 1  193  ? 149.797 118.775 171.578 1.00 152.82 ? 193  ARG A CG    1 
ATOM   1222  C  CD    . ARG A 1  193  ? 149.183 120.115 171.226 1.00 152.82 ? 193  ARG A CD    1 
ATOM   1223  N  NE    . ARG A 1  193  ? 149.795 120.708 170.042 1.00 152.82 ? 193  ARG A NE    1 
ATOM   1224  C  CZ    . ARG A 1  193  ? 149.432 120.429 168.795 1.00 152.82 ? 193  ARG A CZ    1 
ATOM   1225  N  NH1   . ARG A 1  193  ? 148.455 119.563 168.562 1.00 152.82 ? 193  ARG A NH1   1 
ATOM   1226  N  NH2   . ARG A 1  193  ? 150.045 121.019 167.778 1.00 152.82 ? 193  ARG A NH2   1 
ATOM   1227  N  N     . SER A 1  194  ? 151.193 115.471 171.496 1.00 155.13 ? 194  SER A N     1 
ATOM   1228  C  CA    . SER A 1  194  ? 150.944 114.476 170.458 1.00 155.13 ? 194  SER A CA    1 
ATOM   1229  C  C     . SER A 1  194  ? 149.437 114.370 170.277 1.00 155.13 ? 194  SER A C     1 
ATOM   1230  O  O     . SER A 1  194  ? 148.736 113.867 171.161 1.00 155.13 ? 194  SER A O     1 
ATOM   1231  C  CB    . SER A 1  194  ? 151.554 113.126 170.829 1.00 153.32 ? 194  SER A CB    1 
ATOM   1232  O  OG    . SER A 1  194  ? 151.269 112.151 169.841 1.00 153.32 ? 194  SER A OG    1 
ATOM   1233  N  N     . GLY A 1  195  ? 148.944 114.827 169.132 1.00 154.32 ? 195  GLY A N     1 
ATOM   1234  C  CA    . GLY A 1  195  ? 147.506 114.908 168.944 1.00 154.32 ? 195  GLY A CA    1 
ATOM   1235  C  C     . GLY A 1  195  ? 146.909 115.859 169.962 1.00 154.32 ? 195  GLY A C     1 
ATOM   1236  O  O     . GLY A 1  195  ? 147.312 117.023 170.073 1.00 154.32 ? 195  GLY A O     1 
ATOM   1237  N  N     . LEU A 1  196  ? 145.934 115.368 170.721 1.00 153.75 ? 196  LEU A N     1 
ATOM   1238  C  CA    . LEU A 1  196  ? 145.329 116.119 171.812 1.00 153.75 ? 196  LEU A CA    1 
ATOM   1239  C  C     . LEU A 1  196  ? 145.953 115.794 173.164 1.00 153.75 ? 196  LEU A C     1 
ATOM   1240  O  O     . LEU A 1  196  ? 145.493 116.313 174.187 1.00 153.75 ? 196  LEU A O     1 
ATOM   1241  C  CB    . LEU A 1  196  ? 143.822 115.858 171.853 1.00 148.53 ? 196  LEU A CB    1 
ATOM   1242  C  CG    . LEU A 1  196  ? 143.040 116.335 170.628 1.00 148.53 ? 196  LEU A CG    1 
ATOM   1243  C  CD1   . LEU A 1  196  ? 141.596 115.877 170.705 1.00 148.53 ? 196  LEU A CD1   1 
ATOM   1244  C  CD2   . LEU A 1  196  ? 143.120 117.849 170.496 1.00 148.53 ? 196  LEU A CD2   1 
ATOM   1245  N  N     . GLU A 1  197  ? 146.979 114.950 173.194 1.00 155.97 ? 197  GLU A N     1 
ATOM   1246  C  CA    . GLU A 1  197  ? 147.607 114.514 174.431 1.00 155.97 ? 197  GLU A CA    1 
ATOM   1247  C  C     . GLU A 1  197  ? 148.806 115.390 174.772 1.00 155.97 ? 197  GLU A C     1 
ATOM   1248  O  O     . GLU A 1  197  ? 149.568 115.804 173.894 1.00 155.97 ? 197  GLU A O     1 
ATOM   1249  C  CB    . GLU A 1  197  ? 148.059 113.056 174.328 1.00 163.97 ? 197  GLU A CB    1 
ATOM   1250  C  CG    . GLU A 1  197  ? 146.934 112.048 174.187 1.00 163.97 ? 197  GLU A CG    1 
ATOM   1251  C  CD    . GLU A 1  197  ? 147.449 110.631 174.026 1.00 163.97 ? 197  GLU A CD    1 
ATOM   1252  O  OE1   . GLU A 1  197  ? 148.672 110.461 173.843 1.00 163.97 ? 197  GLU A OE1   1 
ATOM   1253  O  OE2   . GLU A 1  197  ? 146.633 109.688 174.082 1.00 163.97 ? 197  GLU A OE2   1 
ATOM   1254  N  N     . LEU A 1  198  ? 148.970 115.660 176.066 1.00 153.01 ? 198  LEU A N     1 
ATOM   1255  C  CA    . LEU A 1  198  ? 150.129 116.369 176.585 1.00 153.01 ? 198  LEU A CA    1 
ATOM   1256  C  C     . LEU A 1  198  ? 151.002 115.414 177.390 1.00 153.01 ? 198  LEU A C     1 
ATOM   1257  O  O     . LEU A 1  198  ? 150.506 114.504 178.061 1.00 153.01 ? 198  LEU A O     1 
ATOM   1258  C  CB    . LEU A 1  198  ? 149.722 117.564 177.461 1.00 147.56 ? 198  LEU A CB    1 
ATOM   1259  C  CG    . LEU A 1  198  ? 149.012 118.732 176.775 1.00 147.56 ? 198  LEU A CG    1 
ATOM   1260  C  CD1   . LEU A 1  198  ? 148.622 119.791 177.794 1.00 147.56 ? 198  LEU A CD1   1 
ATOM   1261  C  CD2   . LEU A 1  198  ? 149.886 119.327 175.685 1.00 147.56 ? 198  LEU A CD2   1 
ATOM   1262  N  N     . TYR A 1  199  ? 152.313 115.640 177.318 1.00 155.98 ? 199  TYR A N     1 
ATOM   1263  C  CA    . TYR A 1  199  ? 153.310 114.793 177.952 1.00 155.98 ? 199  TYR A CA    1 
ATOM   1264  C  C     . TYR A 1  199  ? 154.310 115.664 178.694 1.00 155.98 ? 199  TYR A C     1 
ATOM   1265  O  O     . TYR A 1  199  ? 154.573 116.802 178.292 1.00 155.98 ? 199  TYR A O     1 
ATOM   1266  C  CB    . TYR A 1  199  ? 154.070 113.938 176.927 1.00 156.30 ? 199  TYR A CB    1 
ATOM   1267  C  CG    . TYR A 1  199  ? 153.227 112.970 176.132 1.00 156.30 ? 199  TYR A CG    1 
ATOM   1268  C  CD1   . TYR A 1  199  ? 152.194 112.260 176.726 1.00 156.30 ? 199  TYR A CD1   1 
ATOM   1269  C  CD2   . TYR A 1  199  ? 153.481 112.753 174.785 1.00 156.30 ? 199  TYR A CD2   1 
ATOM   1270  C  CE1   . TYR A 1  199  ? 151.429 111.372 175.995 1.00 156.30 ? 199  TYR A CE1   1 
ATOM   1271  C  CE2   . TYR A 1  199  ? 152.725 111.869 174.048 1.00 156.30 ? 199  TYR A CE2   1 
ATOM   1272  C  CZ    . TYR A 1  199  ? 151.701 111.180 174.656 1.00 156.30 ? 199  TYR A CZ    1 
ATOM   1273  O  OH    . TYR A 1  199  ? 150.946 110.296 173.923 1.00 156.30 ? 199  TYR A OH    1 
ATOM   1274  N  N     . ALA A 1  200  ? 154.878 115.114 179.764 1.00 156.29 ? 200  ALA A N     1 
ATOM   1275  C  CA    . ALA A 1  200  ? 155.950 115.750 180.515 1.00 156.29 ? 200  ALA A CA    1 
ATOM   1276  C  C     . ALA A 1  200  ? 157.128 114.791 180.610 1.00 156.29 ? 200  ALA A C     1 
ATOM   1277  O  O     . ALA A 1  200  ? 156.950 113.601 180.888 1.00 156.29 ? 200  ALA A O     1 
ATOM   1278  C  CB    . ALA A 1  200  ? 155.484 116.158 181.918 1.00 154.62 ? 200  ALA A CB    1 
ATOM   1279  N  N     . GLU A 1  201  ? 158.333 115.310 180.374 1.00 157.67 ? 201  GLU A N     1 
ATOM   1280  C  CA    . GLU A 1  201  ? 159.535 114.490 180.352 1.00 157.67 ? 201  GLU A CA    1 
ATOM   1281  C  C     . GLU A 1  201  ? 160.658 115.182 181.106 1.00 157.67 ? 201  GLU A C     1 
ATOM   1282  O  O     . GLU A 1  201  ? 160.931 116.366 180.884 1.00 157.67 ? 201  GLU A O     1 
ATOM   1283  C  CB    . GLU A 1  201  ? 159.991 114.196 178.917 1.00 162.84 ? 201  GLU A CB    1 
ATOM   1284  C  CG    . GLU A 1  201  ? 159.035 113.332 178.120 1.00 162.84 ? 201  GLU A CG    1 
ATOM   1285  C  CD    . GLU A 1  201  ? 159.507 113.107 176.697 1.00 162.84 ? 201  GLU A CD    1 
ATOM   1286  O  OE1   . GLU A 1  201  ? 160.488 113.761 176.284 1.00 162.84 ? 201  GLU A OE1   1 
ATOM   1287  O  OE2   . GLU A 1  201  ? 158.896 112.275 175.993 1.00 162.84 ? 201  GLU A OE2   1 
ATOM   1288  N  N     . TRP A 1  202  ? 161.309 114.432 181.988 1.00 150.31 ? 202  TRP A N     1 
ATOM   1289  C  CA    . TRP A 1  202  ? 162.504 114.901 182.676 1.00 150.31 ? 202  TRP A CA    1 
ATOM   1290  C  C     . TRP A 1  202  ? 163.755 114.297 182.043 1.00 150.31 ? 202  TRP A C     1 
ATOM   1291  O  O     . TRP A 1  202  ? 164.483 114.971 181.315 1.00 150.31 ? 202  TRP A O     1 
ATOM   1292  C  CB    . TRP A 1  202  ? 162.447 114.548 184.162 1.00 153.99 ? 202  TRP A CB    1 
ATOM   1293  C  CG    . TRP A 1  202  ? 161.449 115.344 184.941 1.00 153.99 ? 202  TRP A CG    1 
ATOM   1294  C  CD1   . TRP A 1  202  ? 161.665 116.530 185.578 1.00 153.99 ? 202  TRP A CD1   1 
ATOM   1295  C  CD2   . TRP A 1  202  ? 160.073 115.017 185.159 1.00 153.99 ? 202  TRP A CD2   1 
ATOM   1296  N  NE1   . TRP A 1  202  ? 160.510 116.957 186.188 1.00 153.99 ? 202  TRP A NE1   1 
ATOM   1297  C  CE2   . TRP A 1  202  ? 159.517 116.045 185.944 1.00 153.99 ? 202  TRP A CE2   1 
ATOM   1298  C  CE3   . TRP A 1  202  ? 159.258 113.952 184.768 1.00 153.99 ? 202  TRP A CE3   1 
ATOM   1299  C  CZ2   . TRP A 1  202  ? 158.184 116.039 186.345 1.00 153.99 ? 202  TRP A CZ2   1 
ATOM   1300  C  CZ3   . TRP A 1  202  ? 157.935 113.948 185.167 1.00 153.99 ? 202  TRP A CZ3   1 
ATOM   1301  C  CH2   . TRP A 1  202  ? 157.411 114.984 185.946 1.00 153.99 ? 202  TRP A CH2   1 
ATOM   1302  N  N     . LYS A 1  212  ? 160.846 109.484 183.168 1.00 154.92 ? 212  LYS A N     1 
ATOM   1303  C  CA    . LYS A 1  212  ? 159.422 109.652 183.433 1.00 154.92 ? 212  LYS A CA    1 
ATOM   1304  C  C     . LYS A 1  212  ? 158.677 110.238 182.239 1.00 154.92 ? 212  LYS A C     1 
ATOM   1305  O  O     . LYS A 1  212  ? 158.662 111.453 182.043 1.00 154.92 ? 212  LYS A O     1 
ATOM   1306  C  CB    . LYS A 1  212  ? 159.200 110.550 184.652 1.00 147.68 ? 212  LYS A CB    1 
ATOM   1307  C  CG    . LYS A 1  212  ? 159.625 109.963 185.986 1.00 147.68 ? 212  LYS A CG    1 
ATOM   1308  C  CD    . LYS A 1  212  ? 159.348 110.957 187.108 1.00 147.68 ? 212  LYS A CD    1 
ATOM   1309  C  CE    . LYS A 1  212  ? 159.746 110.412 188.470 1.00 147.68 ? 212  LYS A CE    1 
ATOM   1310  N  NZ    . LYS A 1  212  ? 158.935 109.223 188.851 1.00 147.68 ? 212  LYS A NZ    1 
ATOM   1311  N  N     . LYS A 1  213  ? 158.058 109.370 181.444 1.00 157.50 ? 213  LYS A N     1 
ATOM   1312  C  CA    . LYS A 1  213  ? 157.117 109.785 180.409 1.00 157.50 ? 213  LYS A CA    1 
ATOM   1313  C  C     . LYS A 1  213  ? 155.714 109.544 180.949 1.00 157.50 ? 213  LYS A C     1 
ATOM   1314  O  O     . LYS A 1  213  ? 155.282 108.395 181.084 1.00 157.50 ? 213  LYS A O     1 
ATOM   1315  C  CB    . LYS A 1  213  ? 157.349 109.020 179.108 1.00 160.42 ? 213  LYS A CB    1 
ATOM   1316  C  CG    . LYS A 1  213  ? 158.608 109.419 178.361 1.00 160.42 ? 213  LYS A CG    1 
ATOM   1317  C  CD    . LYS A 1  213  ? 158.759 108.605 177.087 1.00 160.42 ? 213  LYS A CD    1 
ATOM   1318  C  CE    . LYS A 1  213  ? 157.650 108.916 176.093 1.00 160.42 ? 213  LYS A CE    1 
ATOM   1319  N  NZ    . LYS A 1  213  ? 157.708 110.313 175.586 1.00 160.42 ? 213  LYS A NZ    1 
ATOM   1320  N  N     . ILE A 1  214  ? 155.004 110.626 181.251 1.00 153.79 ? 214  ILE A N     1 
ATOM   1321  C  CA    . ILE A 1  214  ? 153.720 110.559 181.934 1.00 153.79 ? 214  ILE A CA    1 
ATOM   1322  C  C     . ILE A 1  214  ? 152.635 111.089 181.011 1.00 153.79 ? 214  ILE A C     1 
ATOM   1323  O  O     . ILE A 1  214  ? 152.894 111.936 180.149 1.00 153.79 ? 214  ILE A O     1 
ATOM   1324  C  CB    . ILE A 1  214  ? 153.738 111.352 183.258 1.00 151.58 ? 214  ILE A CB    1 
ATOM   1325  C  CG1   . ILE A 1  214  ? 154.053 112.825 182.993 1.00 151.58 ? 214  ILE A CG1   1 
ATOM   1326  C  CG2   . ILE A 1  214  ? 154.744 110.753 184.226 1.00 151.58 ? 214  ILE A CG2   1 
ATOM   1327  C  CD1   . ILE A 1  214  ? 153.909 113.708 184.212 1.00 151.58 ? 214  ILE A CD1   1 
ATOM   1328  N  N     . LEU A 1  215  ? 151.419 110.585 181.196 1.00 150.47 ? 215  LEU A N     1 
ATOM   1329  C  CA    . LEU A 1  215  ? 150.260 111.151 180.522 1.00 150.47 ? 215  LEU A CA    1 
ATOM   1330  C  C     . LEU A 1  215  ? 149.757 112.329 181.341 1.00 150.47 ? 215  LEU A C     1 
ATOM   1331  O  O     . LEU A 1  215  ? 149.340 112.157 182.492 1.00 150.47 ? 215  LEU A O     1 
ATOM   1332  C  CB    . LEU A 1  215  ? 149.164 110.098 180.375 1.00 149.27 ? 215  LEU A CB    1 
ATOM   1333  C  CG    . LEU A 1  215  ? 149.425 108.843 179.541 1.00 149.27 ? 215  LEU A CG    1 
ATOM   1334  C  CD1   . LEU A 1  215  ? 148.270 107.864 179.694 1.00 149.27 ? 215  LEU A CD1   1 
ATOM   1335  C  CD2   . LEU A 1  215  ? 149.630 109.197 178.079 1.00 149.27 ? 215  LEU A CD2   1 
ATOM   1336  N  N     . LEU A 1  216  ? 149.792 113.525 180.764 1.00 146.11 ? 216  LEU A N     1 
ATOM   1337  C  CA    . LEU A 1  216  ? 149.371 114.716 181.486 1.00 146.11 ? 216  LEU A CA    1 
ATOM   1338  C  C     . LEU A 1  216  ? 147.863 114.855 181.342 1.00 146.11 ? 216  LEU A C     1 
ATOM   1339  O  O     . LEU A 1  216  ? 147.353 115.071 180.236 1.00 146.11 ? 216  LEU A O     1 
ATOM   1340  C  CB    . LEU A 1  216  ? 150.091 115.958 180.964 1.00 144.07 ? 216  LEU A CB    1 
ATOM   1341  C  CG    . LEU A 1  216  ? 149.719 117.279 181.640 1.00 144.07 ? 216  LEU A CG    1 
ATOM   1342  C  CD1   . LEU A 1  216  ? 150.065 117.233 183.117 1.00 144.07 ? 216  LEU A CD1   1 
ATOM   1343  C  CD2   . LEU A 1  216  ? 150.420 118.445 180.966 1.00 144.07 ? 216  LEU A CD2   1 
ATOM   1344  N  N     . SER A 1  217  ? 147.163 114.737 182.445 1.00 144.07 ? 217  SER A N     1 
ATOM   1345  C  CA    . SER A 1  217  ? 145.713 114.765 182.459 1.00 144.07 ? 217  SER A CA    1 
ATOM   1346  C  C     . SER A 1  217  ? 145.205 116.190 182.646 1.00 144.07 ? 217  SER A C     1 
ATOM   1347  O  O     . SER A 1  217  ? 145.837 116.996 183.336 1.00 144.07 ? 217  SER A O     1 
ATOM   1348  C  CB    . SER A 1  217  ? 145.171 113.877 183.577 1.00 145.48 ? 217  SER A CB    1 
ATOM   1349  O  OG    . SER A 1  217  ? 145.571 114.350 184.851 1.00 145.48 ? 217  SER A OG    1 
ATOM   1350  N  N     . PRO A 1  218  ? 144.066 116.515 182.035 1.00 139.56 ? 218  PRO A N     1 
ATOM   1351  C  CA    . PRO A 1  218  ? 143.481 117.849 182.251 1.00 139.56 ? 218  PRO A CA    1 
ATOM   1352  C  C     . PRO A 1  218  ? 143.139 118.134 183.702 1.00 139.56 ? 218  PRO A C     1 
ATOM   1353  O  O     . PRO A 1  218  ? 143.070 119.309 184.088 1.00 139.56 ? 218  PRO A O     1 
ATOM   1354  C  CB    . PRO A 1  218  ? 142.231 117.825 181.358 1.00 136.97 ? 218  PRO A CB    1 
ATOM   1355  C  CG    . PRO A 1  218  ? 141.923 116.371 181.178 1.00 136.97 ? 218  PRO A CG    1 
ATOM   1356  C  CD    . PRO A 1  218  ? 143.251 115.696 181.123 1.00 136.97 ? 218  PRO A CD    1 
ATOM   1357  N  N     . GLU A 1  219  ? 142.931 117.103 184.522 1.00 140.83 ? 219  GLU A N     1 
ATOM   1358  C  CA    . GLU A 1  219  ? 142.732 117.326 185.950 1.00 140.83 ? 219  GLU A CA    1 
ATOM   1359  C  C     . GLU A 1  219  ? 143.973 117.947 186.580 1.00 140.83 ? 219  GLU A C     1 
ATOM   1360  O  O     . GLU A 1  219  ? 143.878 118.913 187.347 1.00 140.83 ? 219  GLU A O     1 
ATOM   1361  C  CB    . GLU A 1  219  ? 142.379 116.014 186.651 1.00 152.19 ? 219  GLU A CB    1 
ATOM   1362  C  CG    . GLU A 1  219  ? 141.026 115.438 186.282 1.00 152.19 ? 219  GLU A CG    1 
ATOM   1363  C  CD    . GLU A 1  219  ? 140.747 114.129 186.997 1.00 152.19 ? 219  GLU A CD    1 
ATOM   1364  O  OE1   . GLU A 1  219  ? 141.685 113.574 187.607 1.00 152.19 ? 219  GLU A OE1   1 
ATOM   1365  O  OE2   . GLU A 1  219  ? 139.588 113.662 186.960 1.00 152.19 ? 219  GLU A OE2   1 
ATOM   1366  N  N     . ARG A 1  220  ? 145.151 117.405 186.261 1.00 140.28 ? 220  ARG A N     1 
ATOM   1367  C  CA    . ARG A 1  220  ? 146.396 117.965 186.779 1.00 140.28 ? 220  ARG A CA    1 
ATOM   1368  C  C     . ARG A 1  220  ? 146.569 119.414 186.346 1.00 140.28 ? 220  ARG A C     1 
ATOM   1369  O  O     . ARG A 1  220  ? 146.925 120.279 187.153 1.00 140.28 ? 220  ARG A O     1 
ATOM   1370  C  CB    . ARG A 1  220  ? 147.588 117.128 186.313 1.00 148.38 ? 220  ARG A CB    1 
ATOM   1371  C  CG    . ARG A 1  220  ? 147.664 115.730 186.901 1.00 148.38 ? 220  ARG A CG    1 
ATOM   1372  C  CD    . ARG A 1  220  ? 148.930 115.032 186.428 1.00 148.38 ? 220  ARG A CD    1 
ATOM   1373  N  NE    . ARG A 1  220  ? 149.048 113.667 186.932 1.00 148.38 ? 220  ARG A NE    1 
ATOM   1374  C  CZ    . ARG A 1  220  ? 150.023 112.831 186.589 1.00 148.38 ? 220  ARG A CZ    1 
ATOM   1375  N  NH1   . ARG A 1  220  ? 150.965 113.222 185.742 1.00 148.38 ? 220  ARG A NH1   1 
ATOM   1376  N  NH2   . ARG A 1  220  ? 150.059 111.604 187.092 1.00 148.38 ? 220  ARG A NH2   1 
ATOM   1377  N  N     . VAL A 1  221  ? 146.313 119.697 185.067 1.00 139.11 ? 221  VAL A N     1 
ATOM   1378  C  CA    . VAL A 1  221  ? 146.512 121.046 184.547 1.00 139.11 ? 221  VAL A CA    1 
ATOM   1379  C  C     . VAL A 1  221  ? 145.526 122.012 185.195 1.00 139.11 ? 221  VAL A C     1 
ATOM   1380  O  O     . VAL A 1  221  ? 145.850 123.179 185.450 1.00 139.11 ? 221  VAL A O     1 
ATOM   1381  C  CB    . VAL A 1  221  ? 146.390 121.043 183.012 1.00 138.47 ? 221  VAL A CB    1 
ATOM   1382  C  CG1   . VAL A 1  221  ? 146.638 122.425 182.446 1.00 138.47 ? 221  VAL A CG1   1 
ATOM   1383  C  CG2   . VAL A 1  221  ? 147.347 120.031 182.402 1.00 138.47 ? 221  VAL A CG2   1 
ATOM   1384  N  N     . HIS A 1  222  ? 144.314 121.536 185.486 1.00 138.11 ? 222  HIS A N     1 
ATOM   1385  C  CA    . HIS A 1  222  ? 143.334 122.363 186.184 1.00 138.11 ? 222  HIS A CA    1 
ATOM   1386  C  C     . HIS A 1  222  ? 143.789 122.656 187.610 1.00 138.11 ? 222  HIS A C     1 
ATOM   1387  O  O     . HIS A 1  222  ? 143.715 123.800 188.079 1.00 138.11 ? 222  HIS A O     1 
ATOM   1388  C  CB    . HIS A 1  222  ? 141.973 121.663 186.170 1.00 136.34 ? 222  HIS A CB    1 
ATOM   1389  C  CG    . HIS A 1  222  ? 140.867 122.464 186.779 1.00 136.34 ? 222  HIS A CG    1 
ATOM   1390  N  ND1   . HIS A 1  222  ? 140.482 123.694 186.291 1.00 136.34 ? 222  HIS A ND1   1 
ATOM   1391  C  CD2   . HIS A 1  222  ? 140.045 122.201 187.822 1.00 136.34 ? 222  HIS A CD2   1 
ATOM   1392  C  CE1   . HIS A 1  222  ? 139.481 124.160 187.016 1.00 136.34 ? 222  HIS A CE1   1 
ATOM   1393  N  NE2   . HIS A 1  222  ? 139.196 123.273 187.951 1.00 136.34 ? 222  HIS A NE2   1 
ATOM   1394  N  N     . GLU A 1  223  ? 144.280 121.627 188.309 1.00 139.68 ? 223  GLU A N     1 
ATOM   1395  C  CA    . GLU A 1  223  ? 144.825 121.821 189.650 1.00 139.68 ? 223  GLU A CA    1 
ATOM   1396  C  C     . GLU A 1  223  ? 145.988 122.805 189.637 1.00 139.68 ? 223  GLU A C     1 
ATOM   1397  O  O     . GLU A 1  223  ? 146.186 123.560 190.596 1.00 139.68 ? 223  GLU A O     1 
ATOM   1398  C  CB    . GLU A 1  223  ? 145.275 120.478 190.228 1.00 146.20 ? 223  GLU A CB    1 
ATOM   1399  C  CG    . GLU A 1  223  ? 144.148 119.486 190.467 1.00 146.20 ? 223  GLU A CG    1 
ATOM   1400  C  CD    . GLU A 1  223  ? 144.656 118.128 190.915 1.00 146.20 ? 223  GLU A CD    1 
ATOM   1401  O  OE1   . GLU A 1  223  ? 145.885 117.907 190.871 1.00 146.20 ? 223  GLU A OE1   1 
ATOM   1402  O  OE2   . GLU A 1  223  ? 143.826 117.279 191.303 1.00 146.20 ? 223  GLU A OE2   1 
ATOM   1403  N  N     . ILE A 1  224  ? 146.771 122.808 188.557 1.00 136.73 ? 224  ILE A N     1 
ATOM   1404  C  CA    . ILE A 1  224  ? 147.888 123.743 188.444 1.00 136.73 ? 224  ILE A CA    1 
ATOM   1405  C  C     . ILE A 1  224  ? 147.370 125.162 188.248 1.00 136.73 ? 224  ILE A C     1 
ATOM   1406  O  O     . ILE A 1  224  ? 147.796 126.101 188.930 1.00 136.73 ? 224  ILE A O     1 
ATOM   1407  C  CB    . ILE A 1  224  ? 148.830 123.326 187.300 1.00 136.80 ? 224  ILE A CB    1 
ATOM   1408  C  CG1   . ILE A 1  224  ? 149.531 122.011 187.637 1.00 136.80 ? 224  ILE A CG1   1 
ATOM   1409  C  CG2   . ILE A 1  224  ? 149.853 124.416 187.020 1.00 136.80 ? 224  ILE A CG2   1 
ATOM   1410  C  CD1   . ILE A 1  224  ? 150.284 121.410 186.475 1.00 136.80 ? 224  ILE A CD1   1 
ATOM   1411  N  N     . PHE A 1  225  ? 146.432 125.336 187.313 1.00 135.80 ? 225  PHE A N     1 
ATOM   1412  C  CA    . PHE A 1  225  ? 145.925 126.672 187.021 1.00 135.80 ? 225  PHE A CA    1 
ATOM   1413  C  C     . PHE A 1  225  ? 145.096 127.248 188.159 1.00 135.80 ? 225  PHE A C     1 
ATOM   1414  O  O     . PHE A 1  225  ? 144.877 128.464 188.190 1.00 135.80 ? 225  PHE A O     1 
ATOM   1415  C  CB    . PHE A 1  225  ? 145.094 126.665 185.738 1.00 134.87 ? 225  PHE A CB    1 
ATOM   1416  C  CG    . PHE A 1  225  ? 145.891 126.398 184.494 1.00 134.87 ? 225  PHE A CG    1 
ATOM   1417  C  CD1   . PHE A 1  225  ? 147.267 126.539 184.490 1.00 134.87 ? 225  PHE A CD1   1 
ATOM   1418  C  CD2   . PHE A 1  225  ? 145.258 126.033 183.319 1.00 134.87 ? 225  PHE A CD2   1 
ATOM   1419  C  CE1   . PHE A 1  225  ? 147.997 126.301 183.343 1.00 134.87 ? 225  PHE A CE1   1 
ATOM   1420  C  CE2   . PHE A 1  225  ? 145.982 125.799 182.168 1.00 134.87 ? 225  PHE A CE2   1 
ATOM   1421  C  CZ    . PHE A 1  225  ? 147.354 125.931 182.181 1.00 134.87 ? 225  PHE A CZ    1 
ATOM   1422  N  N     . LYS A 1  226  ? 144.621 126.416 189.090 1.00 136.84 ? 226  LYS A N     1 
ATOM   1423  C  CA    . LYS A 1  226  ? 143.918 126.958 190.248 1.00 136.84 ? 226  LYS A CA    1 
ATOM   1424  C  C     . LYS A 1  226  ? 144.810 127.870 191.082 1.00 136.84 ? 226  LYS A C     1 
ATOM   1425  O  O     . LYS A 1  226  ? 144.329 128.858 191.648 1.00 136.84 ? 226  LYS A O     1 
ATOM   1426  C  CB    . LYS A 1  226  ? 143.378 125.833 191.130 1.00 139.56 ? 226  LYS A CB    1 
ATOM   1427  C  CG    . LYS A 1  226  ? 142.228 125.041 190.548 1.00 139.56 ? 226  LYS A CG    1 
ATOM   1428  C  CD    . LYS A 1  226  ? 141.827 123.930 191.506 1.00 139.56 ? 226  LYS A CD    1 
ATOM   1429  C  CE    . LYS A 1  226  ? 140.641 123.138 190.990 1.00 139.56 ? 226  LYS A CE    1 
ATOM   1430  N  NZ    . LYS A 1  226  ? 140.281 122.023 191.910 1.00 139.56 ? 226  LYS A NZ    1 
ATOM   1431  N  N     . ARG A 1  227  ? 146.104 127.563 191.167 1.00 141.05 ? 227  ARG A N     1 
ATOM   1432  C  CA    . ARG A 1  227  ? 146.986 128.199 192.135 1.00 141.05 ? 227  ARG A CA    1 
ATOM   1433  C  C     . ARG A 1  227  ? 147.621 129.496 191.643 1.00 141.05 ? 227  ARG A C     1 
ATOM   1434  O  O     . ARG A 1  227  ? 148.221 130.209 192.455 1.00 141.05 ? 227  ARG A O     1 
ATOM   1435  C  CB    . ARG A 1  227  ? 148.116 127.245 192.529 1.00 145.99 ? 227  ARG A CB    1 
ATOM   1436  C  CG    . ARG A 1  227  ? 147.721 125.961 193.223 1.00 145.99 ? 227  ARG A CG    1 
ATOM   1437  C  CD    . ARG A 1  227  ? 148.989 125.178 193.531 1.00 145.99 ? 227  ARG A CD    1 
ATOM   1438  N  NE    . ARG A 1  227  ? 148.740 123.870 194.127 1.00 145.99 ? 227  ARG A NE    1 
ATOM   1439  C  CZ    . ARG A 1  227  ? 149.693 122.979 194.379 1.00 145.99 ? 227  ARG A CZ    1 
ATOM   1440  N  NH1   . ARG A 1  227  ? 150.956 123.258 194.086 1.00 145.99 ? 227  ARG A NH1   1 
ATOM   1441  N  NH2   . ARG A 1  227  ? 149.387 121.808 194.922 1.00 145.99 ? 227  ARG A NH2   1 
ATOM   1442  N  N     . ILE A 1  228  ? 147.522 129.815 190.351 1.00 144.68 ? 228  ILE A N     1 
ATOM   1443  C  CA    . ILE A 1  228  ? 148.266 130.946 189.802 1.00 144.68 ? 228  ILE A CA    1 
ATOM   1444  C  C     . ILE A 1  228  ? 147.777 132.240 190.437 1.00 144.68 ? 228  ILE A C     1 
ATOM   1445  O  O     . ILE A 1  228  ? 146.577 132.543 190.428 1.00 144.68 ? 228  ILE A O     1 
ATOM   1446  C  CB    . ILE A 1  228  ? 148.136 130.990 188.273 1.00 145.03 ? 228  ILE A CB    1 
ATOM   1447  C  CG1   . ILE A 1  228  ? 148.816 129.773 187.645 1.00 145.03 ? 228  ILE A CG1   1 
ATOM   1448  C  CG2   . ILE A 1  228  ? 148.744 132.268 187.722 1.00 145.03 ? 228  ILE A CG2   1 
ATOM   1449  C  CD1   . ILE A 1  228  ? 148.566 129.625 186.164 1.00 145.03 ? 228  ILE A CD1   1 
ATOM   1450  N  N     . SER A 1  229  ? 148.710 133.008 190.992 1.00 151.92 ? 229  SER A N     1 
ATOM   1451  C  CA    . SER A 1  229  ? 148.367 134.248 191.673 1.00 151.92 ? 229  SER A CA    1 
ATOM   1452  C  C     . SER A 1  229  ? 147.889 135.298 190.677 1.00 151.92 ? 229  SER A C     1 
ATOM   1453  O  O     . SER A 1  229  ? 148.167 135.224 189.477 1.00 151.92 ? 229  SER A O     1 
ATOM   1454  C  CB    . SER A 1  229  ? 149.567 134.778 192.455 1.00 153.44 ? 229  SER A CB    1 
ATOM   1455  O  OG    . SER A 1  229  ? 149.262 136.010 193.083 1.00 153.44 ? 229  SER A OG    1 
ATOM   1456  N  N     . ASP A 1  230  ? 147.155 136.286 191.194 1.00 153.65 ? 230  ASP A N     1 
ATOM   1457  C  CA    . ASP A 1  230  ? 146.629 137.347 190.340 1.00 153.65 ? 230  ASP A CA    1 
ATOM   1458  C  C     . ASP A 1  230  ? 147.760 138.145 189.702 1.00 153.65 ? 230  ASP A C     1 
ATOM   1459  O  O     . ASP A 1  230  ? 147.702 138.493 188.516 1.00 153.65 ? 230  ASP A O     1 
ATOM   1460  C  CB    . ASP A 1  230  ? 145.706 138.257 191.149 1.00 153.02 ? 230  ASP A CB    1 
ATOM   1461  C  CG    . ASP A 1  230  ? 144.434 137.556 191.581 1.00 153.02 ? 230  ASP A CG    1 
ATOM   1462  O  OD1   . ASP A 1  230  ? 144.140 136.472 191.035 1.00 153.02 ? 230  ASP A OD1   1 
ATOM   1463  O  OD2   . ASP A 1  230  ? 143.727 138.088 192.461 1.00 153.02 ? 230  ASP A OD2   1 
ATOM   1464  N  N     . GLU A 1  231  ? 148.803 138.442 190.481 1.00 155.77 ? 231  GLU A N     1 
ATOM   1465  C  CA    . GLU A 1  231  ? 149.990 139.079 189.920 1.00 155.77 ? 231  GLU A CA    1 
ATOM   1466  C  C     . GLU A 1  231  ? 150.598 138.217 188.823 1.00 155.77 ? 231  GLU A C     1 
ATOM   1467  O  O     . GLU A 1  231  ? 151.025 138.723 187.780 1.00 155.77 ? 231  GLU A O     1 
ATOM   1468  C  CB    . GLU A 1  231  ? 151.020 139.336 191.020 1.00 158.49 ? 231  GLU A CB    1 
ATOM   1469  C  CG    . GLU A 1  231  ? 150.599 140.344 192.073 1.00 158.49 ? 231  GLU A CG    1 
ATOM   1470  C  CD    . GLU A 1  231  ? 151.642 140.506 193.163 1.00 158.49 ? 231  GLU A CD    1 
ATOM   1471  O  OE1   . GLU A 1  231  ? 152.600 139.705 193.193 1.00 158.49 ? 231  GLU A OE1   1 
ATOM   1472  O  OE2   . GLU A 1  231  ? 151.506 141.433 193.988 1.00 158.49 ? 231  GLU A OE2   1 
ATOM   1473  N  N     . GLU A 1  232  ? 150.628 136.902 189.038 1.00 156.75 ? 232  GLU A N     1 
ATOM   1474  C  CA    . GLU A 1  232  ? 151.339 136.017 188.123 1.00 156.75 ? 232  GLU A CA    1 
ATOM   1475  C  C     . GLU A 1  232  ? 150.534 135.768 186.853 1.00 156.75 ? 232  GLU A C     1 
ATOM   1476  O  O     . GLU A 1  232  ? 151.105 135.533 185.783 1.00 156.75 ? 232  GLU A O     1 
ATOM   1477  C  CB    . GLU A 1  232  ? 151.679 134.708 188.833 1.00 158.59 ? 232  GLU A CB    1 
ATOM   1478  C  CG    . GLU A 1  232  ? 152.690 134.896 189.952 1.00 158.59 ? 232  GLU A CG    1 
ATOM   1479  C  CD    . GLU A 1  232  ? 152.958 133.625 190.726 1.00 158.59 ? 232  GLU A CD    1 
ATOM   1480  O  OE1   . GLU A 1  232  ? 152.218 132.640 190.529 1.00 158.59 ? 232  GLU A OE1   1 
ATOM   1481  O  OE2   . GLU A 1  232  ? 153.912 133.614 191.532 1.00 158.59 ? 232  GLU A OE2   1 
ATOM   1482  N  N     . CYS A 1  233  ? 149.203 135.813 186.946 1.00 155.75 ? 233  CYS A N     1 
ATOM   1483  C  CA    . CYS A 1  233  ? 148.412 135.727 185.723 1.00 155.75 ? 233  CYS A CA    1 
ATOM   1484  C  C     . CYS A 1  233  ? 148.359 137.071 185.013 1.00 155.75 ? 233  CYS A C     1 
ATOM   1485  O  O     . CYS A 1  233  ? 148.112 137.124 183.803 1.00 155.75 ? 233  CYS A O     1 
ATOM   1486  C  CB    . CYS A 1  233  ? 146.997 135.226 186.019 1.00 152.81 ? 233  CYS A CB    1 
ATOM   1487  S  SG    . CYS A 1  233  ? 146.024 136.264 187.119 1.00 152.81 ? 233  CYS A SG    1 
ATOM   1488  N  N     . PHE A 1  234  ? 148.599 138.164 185.742 1.00 154.22 ? 234  PHE A N     1 
ATOM   1489  C  CA    . PHE A 1  234  ? 148.681 139.468 185.093 1.00 154.22 ? 234  PHE A CA    1 
ATOM   1490  C  C     . PHE A 1  234  ? 150.003 139.629 184.352 1.00 154.22 ? 234  PHE A C     1 
ATOM   1491  O  O     . PHE A 1  234  ? 150.054 140.259 183.289 1.00 154.22 ? 234  PHE A O     1 
ATOM   1492  C  CB    . PHE A 1  234  ? 148.500 140.584 186.121 1.00 152.78 ? 234  PHE A CB    1 
ATOM   1493  C  CG    . PHE A 1  234  ? 148.616 141.965 185.542 1.00 152.78 ? 234  PHE A CG    1 
ATOM   1494  C  CD1   . PHE A 1  234  ? 147.550 142.539 184.870 1.00 152.78 ? 234  PHE A CD1   1 
ATOM   1495  C  CD2   . PHE A 1  234  ? 149.789 142.690 185.671 1.00 152.78 ? 234  PHE A CD2   1 
ATOM   1496  C  CE1   . PHE A 1  234  ? 147.653 143.810 184.335 1.00 152.78 ? 234  PHE A CE1   1 
ATOM   1497  C  CE2   . PHE A 1  234  ? 149.898 143.961 185.139 1.00 152.78 ? 234  PHE A CE2   1 
ATOM   1498  C  CZ    . PHE A 1  234  ? 148.829 144.522 184.470 1.00 152.78 ? 234  PHE A CZ    1 
ATOM   1499  N  N     . VAL A 1  235  ? 151.086 139.071 184.901 1.00 155.37 ? 235  VAL A N     1 
ATOM   1500  C  CA    . VAL A 1  235  ? 152.369 139.089 184.203 1.00 155.37 ? 235  VAL A CA    1 
ATOM   1501  C  C     . VAL A 1  235  ? 152.303 138.225 182.952 1.00 155.37 ? 235  VAL A C     1 
ATOM   1502  O  O     . VAL A 1  235  ? 153.018 138.476 181.973 1.00 155.37 ? 235  VAL A O     1 
ATOM   1503  C  CB    . VAL A 1  235  ? 153.500 138.645 185.156 1.00 158.67 ? 235  VAL A CB    1 
ATOM   1504  C  CG1   . VAL A 1  235  ? 154.828 138.531 184.420 1.00 158.67 ? 235  VAL A CG1   1 
ATOM   1505  C  CG2   . VAL A 1  235  ? 153.630 139.625 186.308 1.00 158.67 ? 235  VAL A CG2   1 
ATOM   1506  N  N     . LEU A 1  236  ? 151.423 137.225 182.941 1.00 155.05 ? 236  LEU A N     1 
ATOM   1507  C  CA    . LEU A 1  236  ? 151.224 136.401 181.757 1.00 155.05 ? 236  LEU A CA    1 
ATOM   1508  C  C     . LEU A 1  236  ? 150.321 137.061 180.724 1.00 155.05 ? 236  LEU A C     1 
ATOM   1509  O  O     . LEU A 1  236  ? 150.111 136.483 179.654 1.00 155.05 ? 236  LEU A O     1 
ATOM   1510  C  CB    . LEU A 1  236  ? 150.642 135.038 182.145 1.00 151.22 ? 236  LEU A CB    1 
ATOM   1511  C  CG    . LEU A 1  236  ? 151.534 134.092 182.950 1.00 151.22 ? 236  LEU A CG    1 
ATOM   1512  C  CD1   . LEU A 1  236  ? 150.763 132.848 183.359 1.00 151.22 ? 236  LEU A CD1   1 
ATOM   1513  C  CD2   . LEU A 1  236  ? 152.771 133.717 182.151 1.00 151.22 ? 236  LEU A CD2   1 
ATOM   1514  N  N     . GLY A 1  237  ? 149.786 138.245 181.010 1.00 155.79 ? 237  GLY A N     1 
ATOM   1515  C  CA    . GLY A 1  237  ? 148.995 138.975 180.044 1.00 155.79 ? 237  GLY A CA    1 
ATOM   1516  C  C     . GLY A 1  237  ? 147.508 138.709 180.079 1.00 155.79 ? 237  GLY A C     1 
ATOM   1517  O  O     . GLY A 1  237  ? 146.759 139.391 179.370 1.00 155.79 ? 237  GLY A O     1 
ATOM   1518  N  N     . MET A 1  238  ? 147.050 137.749 180.872 1.00 150.98 ? 238  MET A N     1 
ATOM   1519  C  CA    . MET A 1  238  ? 145.633 137.423 180.968 1.00 150.98 ? 238  MET A CA    1 
ATOM   1520  C  C     . MET A 1  238  ? 145.060 138.134 182.188 1.00 150.98 ? 238  MET A C     1 
ATOM   1521  O  O     . MET A 1  238  ? 145.431 137.826 183.325 1.00 150.98 ? 238  MET A O     1 
ATOM   1522  C  CB    . MET A 1  238  ? 145.437 135.913 181.056 1.00 150.98 ? 238  MET A CB    1 
ATOM   1523  C  CG    . MET A 1  238  ? 145.867 135.183 179.800 1.00 150.98 ? 238  MET A CG    1 
ATOM   1524  S  SD    . MET A 1  238  ? 145.625 133.409 179.923 1.00 150.98 ? 238  MET A SD    1 
ATOM   1525  C  CE    . MET A 1  238  ? 146.966 133.005 181.032 1.00 150.98 ? 238  MET A CE    1 
ATOM   1526  N  N     . GLU A 1  239  ? 144.162 139.084 181.948 1.00 147.74 ? 239  GLU A N     1 
ATOM   1527  C  CA    . GLU A 1  239  ? 143.600 139.868 183.038 1.00 147.74 ? 239  GLU A CA    1 
ATOM   1528  C  C     . GLU A 1  239  ? 142.825 138.958 183.987 1.00 147.74 ? 239  GLU A C     1 
ATOM   1529  O  O     . GLU A 1  239  ? 142.118 138.049 183.537 1.00 147.74 ? 239  GLU A O     1 
ATOM   1530  C  CB    . GLU A 1  239  ? 142.693 140.970 182.491 1.00 156.10 ? 239  GLU A CB    1 
ATOM   1531  C  CG    . GLU A 1  239  ? 143.445 142.028 181.699 1.00 156.10 ? 239  GLU A CG    1 
ATOM   1532  C  CD    . GLU A 1  239  ? 142.538 143.102 181.136 1.00 156.10 ? 239  GLU A CD    1 
ATOM   1533  O  OE1   . GLU A 1  239  ? 141.303 142.941 181.212 1.00 156.10 ? 239  GLU A OE1   1 
ATOM   1534  O  OE2   . GLU A 1  239  ? 143.061 144.110 180.618 1.00 156.10 ? 239  GLU A OE2   1 
ATOM   1535  N  N     . PRO A 1  240  ? 142.929 139.175 185.302 1.00 144.44 ? 240  PRO A N     1 
ATOM   1536  C  CA    . PRO A 1  240  ? 142.412 138.169 186.245 1.00 144.44 ? 240  PRO A CA    1 
ATOM   1537  C  C     . PRO A 1  240  ? 140.908 137.957 186.175 1.00 144.44 ? 240  PRO A C     1 
ATOM   1538  O  O     . PRO A 1  240  ? 140.456 136.808 186.230 1.00 144.44 ? 240  PRO A O     1 
ATOM   1539  C  CB    . PRO A 1  240  ? 142.851 138.722 187.609 1.00 146.23 ? 240  PRO A CB    1 
ATOM   1540  C  CG    . PRO A 1  240  ? 142.967 140.196 187.392 1.00 146.23 ? 240  PRO A CG    1 
ATOM   1541  C  CD    . PRO A 1  240  ? 143.487 140.350 185.992 1.00 146.23 ? 240  PRO A CD    1 
ATOM   1542  N  N     . ARG A 1  241  ? 140.115 139.024 186.063 1.00 142.99 ? 241  ARG A N     1 
ATOM   1543  C  CA    . ARG A 1  241  ? 138.667 138.864 186.159 1.00 142.99 ? 241  ARG A CA    1 
ATOM   1544  C  C     . ARG A 1  241  ? 138.041 138.379 184.856 1.00 142.99 ? 241  ARG A C     1 
ATOM   1545  O  O     . ARG A 1  241  ? 137.056 137.633 184.895 1.00 142.99 ? 241  ARG A O     1 
ATOM   1546  C  CB    . ARG A 1  241  ? 138.021 140.175 186.623 1.00 144.47 ? 241  ARG A CB    1 
ATOM   1547  C  CG    . ARG A 1  241  ? 138.241 141.373 185.708 1.00 144.47 ? 241  ARG A CG    1 
ATOM   1548  C  CD    . ARG A 1  241  ? 137.703 142.655 186.338 1.00 144.47 ? 241  ARG A CD    1 
ATOM   1549  N  NE    . ARG A 1  241  ? 136.254 142.650 186.501 1.00 144.47 ? 241  ARG A NE    1 
ATOM   1550  C  CZ    . ARG A 1  241  ? 135.393 143.074 185.584 1.00 144.47 ? 241  ARG A CZ    1 
ATOM   1551  N  NH1   . ARG A 1  241  ? 135.836 143.555 184.432 1.00 144.47 ? 241  ARG A NH1   1 
ATOM   1552  N  NH2   . ARG A 1  241  ? 134.090 143.032 185.824 1.00 144.47 ? 241  ARG A NH2   1 
ATOM   1553  N  N     . TYR A 1  242  ? 138.580 138.774 183.700 1.00 139.54 ? 242  TYR A N     1 
ATOM   1554  C  CA    . TYR A 1  242  ? 138.003 138.310 182.443 1.00 139.54 ? 242  TYR A CA    1 
ATOM   1555  C  C     . TYR A 1  242  ? 138.398 136.872 182.121 1.00 139.54 ? 242  TYR A C     1 
ATOM   1556  O  O     . TYR A 1  242  ? 137.535 136.060 181.773 1.00 139.54 ? 242  TYR A O     1 
ATOM   1557  C  CB    . TYR A 1  242  ? 138.404 139.239 181.297 1.00 142.75 ? 242  TYR A CB    1 
ATOM   1558  C  CG    . TYR A 1  242  ? 137.754 140.599 181.361 1.00 142.75 ? 242  TYR A CG    1 
ATOM   1559  C  CD1   . TYR A 1  242  ? 136.425 140.732 181.736 1.00 142.75 ? 242  TYR A CD1   1 
ATOM   1560  C  CD2   . TYR A 1  242  ? 138.464 141.750 181.046 1.00 142.75 ? 242  TYR A CD2   1 
ATOM   1561  C  CE1   . TYR A 1  242  ? 135.820 141.970 181.791 1.00 142.75 ? 242  TYR A CE1   1 
ATOM   1562  C  CE2   . TYR A 1  242  ? 137.868 142.995 181.103 1.00 142.75 ? 242  TYR A CE2   1 
ATOM   1563  C  CZ    . TYR A 1  242  ? 136.544 143.099 181.476 1.00 142.75 ? 242  TYR A CZ    1 
ATOM   1564  O  OH    . TYR A 1  242  ? 135.934 144.332 181.538 1.00 142.75 ? 242  TYR A OH    1 
ATOM   1565  N  N     . ALA A 1  243  ? 139.685 136.537 182.217 1.00 141.26 ? 243  ALA A N     1 
ATOM   1566  C  CA    . ALA A 1  243  ? 140.163 135.216 181.830 1.00 141.26 ? 243  ALA A CA    1 
ATOM   1567  C  C     . ALA A 1  243  ? 141.227 134.728 182.802 1.00 141.26 ? 243  ALA A C     1 
ATOM   1568  O  O     . ALA A 1  243  ? 142.220 135.420 183.039 1.00 141.26 ? 243  ALA A O     1 
ATOM   1569  C  CB    . ALA A 1  243  ? 140.727 135.231 180.407 1.00 141.44 ? 243  ALA A CB    1 
ATOM   1570  N  N     . ARG A 1  244  ? 141.021 133.528 183.343 1.00 137.32 ? 244  ARG A N     1 
ATOM   1571  C  CA    . ARG A 1  244  ? 141.978 132.851 184.198 1.00 137.32 ? 244  ARG A CA    1 
ATOM   1572  C  C     . ARG A 1  244  ? 142.297 131.489 183.588 1.00 137.32 ? 244  ARG A C     1 
ATOM   1573  O  O     . ARG A 1  244  ? 141.392 130.834 183.057 1.00 137.32 ? 244  ARG A O     1 
ATOM   1574  C  CB    . ARG A 1  244  ? 141.398 132.682 185.621 1.00 141.14 ? 244  ARG A CB    1 
ATOM   1575  C  CG    . ARG A 1  244  ? 142.360 132.156 186.681 1.00 141.14 ? 244  ARG A CG    1 
ATOM   1576  C  CD    . ARG A 1  244  ? 143.523 133.100 186.964 1.00 141.14 ? 244  ARG A CD    1 
ATOM   1577  N  NE    . ARG A 1  244  ? 143.099 134.370 187.538 1.00 141.14 ? 244  ARG A NE    1 
ATOM   1578  C  CZ    . ARG A 1  244  ? 142.922 134.562 188.840 1.00 141.14 ? 244  ARG A CZ    1 
ATOM   1579  N  NH1   . ARG A 1  244  ? 143.131 133.565 189.690 1.00 141.14 ? 244  ARG A NH1   1 
ATOM   1580  N  NH2   . ARG A 1  244  ? 142.538 135.747 189.295 1.00 141.14 ? 244  ARG A NH2   1 
ATOM   1581  N  N     . PRO A 1  245  ? 143.561 131.045 183.629 1.00 135.72 ? 245  PRO A N     1 
ATOM   1582  C  CA    . PRO A 1  245  ? 143.962 129.857 182.851 1.00 135.72 ? 245  PRO A CA    1 
ATOM   1583  C  C     . PRO A 1  245  ? 143.064 128.631 182.970 1.00 135.72 ? 245  PRO A C     1 
ATOM   1584  O  O     . PRO A 1  245  ? 142.832 127.969 181.950 1.00 135.72 ? 245  PRO A O     1 
ATOM   1585  C  CB    . PRO A 1  245  ? 145.364 129.572 183.393 1.00 136.39 ? 245  PRO A CB    1 
ATOM   1586  C  CG    . PRO A 1  245  ? 145.896 130.905 183.736 1.00 136.39 ? 245  PRO A CG    1 
ATOM   1587  C  CD    . PRO A 1  245  ? 144.734 131.770 184.151 1.00 136.39 ? 245  PRO A CD    1 
ATOM   1588  N  N     . GLU A 1  246  ? 142.562 128.292 184.163 1.00 135.66 ? 246  GLU A N     1 
ATOM   1589  C  CA    . GLU A 1  246  ? 141.784 127.060 184.281 1.00 135.66 ? 246  GLU A CA    1 
ATOM   1590  C  C     . GLU A 1  246  ? 140.484 127.140 183.495 1.00 135.66 ? 246  GLU A C     1 
ATOM   1591  O  O     . GLU A 1  246  ? 139.893 126.104 183.166 1.00 135.66 ? 246  GLU A O     1 
ATOM   1592  C  CB    . GLU A 1  246  ? 141.485 126.735 185.746 1.00 137.32 ? 246  GLU A CB    1 
ATOM   1593  C  CG    . GLU A 1  246  ? 140.454 127.632 186.401 1.00 137.32 ? 246  GLU A CG    1 
ATOM   1594  C  CD    . GLU A 1  246  ? 141.054 128.913 186.919 1.00 137.32 ? 246  GLU A CD    1 
ATOM   1595  O  OE1   . GLU A 1  246  ? 142.276 129.096 186.747 1.00 137.32 ? 246  GLU A OE1   1 
ATOM   1596  O  OE2   . GLU A 1  246  ? 140.308 129.733 187.493 1.00 137.32 ? 246  GLU A OE2   1 
ATOM   1597  N  N     . TRP A 1  247  ? 140.028 128.352 183.177 1.00 133.12 ? 247  TRP A N     1 
ATOM   1598  C  CA    . TRP A 1  247  ? 138.829 128.505 182.365 1.00 133.12 ? 247  TRP A CA    1 
ATOM   1599  C  C     . TRP A 1  247  ? 139.054 128.052 180.931 1.00 133.12 ? 247  TRP A C     1 
ATOM   1600  O  O     . TRP A 1  247  ? 138.083 127.875 180.188 1.00 133.12 ? 247  TRP A O     1 
ATOM   1601  C  CB    . TRP A 1  247  ? 138.364 129.960 182.396 1.00 134.66 ? 247  TRP A CB    1 
ATOM   1602  C  CG    . TRP A 1  247  ? 137.946 130.408 183.756 1.00 134.66 ? 247  TRP A CG    1 
ATOM   1603  C  CD1   . TRP A 1  247  ? 137.848 129.638 184.877 1.00 134.66 ? 247  TRP A CD1   1 
ATOM   1604  C  CD2   . TRP A 1  247  ? 137.585 131.736 184.149 1.00 134.66 ? 247  TRP A CD2   1 
ATOM   1605  N  NE1   . TRP A 1  247  ? 137.441 130.401 185.942 1.00 134.66 ? 247  TRP A NE1   1 
ATOM   1606  C  CE2   . TRP A 1  247  ? 137.272 131.693 185.521 1.00 134.66 ? 247  TRP A CE2   1 
ATOM   1607  C  CE3   . TRP A 1  247  ? 137.492 132.956 183.475 1.00 134.66 ? 247  TRP A CE3   1 
ATOM   1608  C  CZ2   . TRP A 1  247  ? 136.872 132.820 186.230 1.00 134.66 ? 247  TRP A CZ2   1 
ATOM   1609  C  CZ3   . TRP A 1  247  ? 137.094 134.075 184.182 1.00 134.66 ? 247  TRP A CZ3   1 
ATOM   1610  C  CH2   . TRP A 1  247  ? 136.790 133.999 185.545 1.00 134.66 ? 247  TRP A CH2   1 
ATOM   1611  N  N     . MET A 1  248  ? 140.311 127.865 180.526 1.00 134.20 ? 248  MET A N     1 
ATOM   1612  C  CA    . MET A 1  248  ? 140.605 127.294 179.219 1.00 134.20 ? 248  MET A CA    1 
ATOM   1613  C  C     . MET A 1  248  ? 140.447 125.781 179.198 1.00 134.20 ? 248  MET A C     1 
ATOM   1614  O  O     . MET A 1  248  ? 140.536 125.180 178.122 1.00 134.20 ? 248  MET A O     1 
ATOM   1615  C  CB    . MET A 1  248  ? 142.022 127.667 178.786 1.00 140.40 ? 248  MET A CB    1 
ATOM   1616  C  CG    . MET A 1  248  ? 142.230 129.154 178.548 1.00 140.40 ? 248  MET A CG    1 
ATOM   1617  S  SD    . MET A 1  248  ? 143.874 129.527 177.914 1.00 140.40 ? 248  MET A SD    1 
ATOM   1618  C  CE    . MET A 1  248  ? 144.868 129.261 179.377 1.00 140.40 ? 248  MET A CE    1 
ATOM   1619  N  N     . ILE A 1  249  ? 140.226 125.157 180.350 1.00 134.99 ? 249  ILE A N     1 
ATOM   1620  C  CA    . ILE A 1  249  ? 139.993 123.721 180.430 1.00 134.99 ? 249  ILE A CA    1 
ATOM   1621  C  C     . ILE A 1  249  ? 138.494 123.491 180.561 1.00 134.99 ? 249  ILE A C     1 
ATOM   1622  O  O     . ILE A 1  249  ? 137.870 123.942 181.528 1.00 134.99 ? 249  ILE A O     1 
ATOM   1623  C  CB    . ILE A 1  249  ? 140.752 123.102 181.610 1.00 135.61 ? 249  ILE A CB    1 
ATOM   1624  C  CG1   . ILE A 1  249  ? 142.257 123.209 181.375 1.00 135.61 ? 249  ILE A CG1   1 
ATOM   1625  C  CG2   . ILE A 1  249  ? 140.341 121.655 181.810 1.00 135.61 ? 249  ILE A CG2   1 
ATOM   1626  C  CD1   . ILE A 1  249  ? 143.078 122.852 182.578 1.00 135.61 ? 249  ILE A CD1   1 
ATOM   1627  N  N     . VAL A 1  250  ? 137.915 122.794 179.584 1.00 136.06 ? 250  VAL A N     1 
ATOM   1628  C  CA    . VAL A 1  250  ? 136.470 122.612 179.548 1.00 136.06 ? 250  VAL A CA    1 
ATOM   1629  C  C     . VAL A 1  250  ? 136.033 121.729 180.707 1.00 136.06 ? 250  VAL A C     1 
ATOM   1630  O  O     . VAL A 1  250  ? 136.538 120.614 180.889 1.00 136.06 ? 250  VAL A O     1 
ATOM   1631  C  CB    . VAL A 1  250  ? 136.033 122.016 178.203 1.00 134.07 ? 250  VAL A CB    1 
ATOM   1632  C  CG1   . VAL A 1  250  ? 134.544 121.723 178.217 1.00 134.07 ? 250  VAL A CG1   1 
ATOM   1633  C  CG2   . VAL A 1  250  ? 136.374 122.965 177.076 1.00 134.07 ? 250  VAL A CG2   1 
ATOM   1634  N  N     . THR A 1  251  ? 135.086 122.230 181.496 1.00 134.72 ? 251  THR A N     1 
ATOM   1635  C  CA    . THR A 1  251  ? 134.467 121.466 182.569 1.00 134.72 ? 251  THR A CA    1 
ATOM   1636  C  C     . THR A 1  251  ? 132.958 121.483 182.369 1.00 134.72 ? 251  THR A C     1 
ATOM   1637  O  O     . THR A 1  251  ? 132.334 120.437 182.165 1.00 134.72 ? 251  THR A O     1 
ATOM   1638  C  CB    . THR A 1  251  ? 134.844 122.037 183.937 1.00 135.55 ? 251  THR A CB    1 
ATOM   1639  O  OG1   . THR A 1  251  ? 136.265 121.971 184.109 1.00 135.55 ? 251  THR A OG1   1 
ATOM   1640  C  CG2   . THR A 1  251  ? 134.173 121.248 185.044 1.00 135.55 ? 251  THR A CG2   1 
ATOM   1641  N  N     . VAL A 1  252  ? 132.369 122.671 182.429 1.00 131.20 ? 252  VAL A N     1 
ATOM   1642  C  CA    . VAL A 1  252  ? 130.963 122.881 182.116 1.00 131.20 ? 252  VAL A CA    1 
ATOM   1643  C  C     . VAL A 1  252  ? 130.888 123.315 180.658 1.00 131.20 ? 252  VAL A C     1 
ATOM   1644  O  O     . VAL A 1  252  ? 131.370 124.394 180.299 1.00 131.20 ? 252  VAL A O     1 
ATOM   1645  C  CB    . VAL A 1  252  ? 130.331 123.920 183.049 1.00 130.17 ? 252  VAL A CB    1 
ATOM   1646  C  CG1   . VAL A 1  252  ? 128.898 124.184 182.650 1.00 130.17 ? 252  VAL A CG1   1 
ATOM   1647  C  CG2   . VAL A 1  252  ? 130.410 123.448 184.489 1.00 130.17 ? 252  VAL A CG2   1 
ATOM   1648  N  N     . LEU A 1  253  ? 130.286 122.474 179.806 1.00 129.15 ? 253  LEU A N     1 
ATOM   1649  C  CA    . LEU A 1  253  ? 130.311 122.712 178.363 1.00 129.15 ? 253  LEU A CA    1 
ATOM   1650  C  C     . LEU A 1  253  ? 128.998 123.325 177.904 1.00 129.15 ? 253  LEU A C     1 
ATOM   1651  O  O     . LEU A 1  253  ? 127.928 122.780 178.202 1.00 129.15 ? 253  LEU A O     1 
ATOM   1652  C  CB    . LEU A 1  253  ? 130.562 121.406 177.618 1.00 129.79 ? 253  LEU A CB    1 
ATOM   1653  C  CG    . LEU A 1  253  ? 130.588 121.478 176.092 1.00 129.79 ? 253  LEU A CG    1 
ATOM   1654  C  CD1   . LEU A 1  253  ? 131.740 122.348 175.622 1.00 129.79 ? 253  LEU A CD1   1 
ATOM   1655  C  CD2   . LEU A 1  253  ? 130.690 120.086 175.494 1.00 129.79 ? 253  LEU A CD2   1 
ATOM   1656  N  N     . PRO A 1  254  ? 129.030 124.444 177.186 1.00 128.68 ? 254  PRO A N     1 
ATOM   1657  C  CA    . PRO A 1  254  ? 127.786 125.081 176.750 1.00 128.68 ? 254  PRO A CA    1 
ATOM   1658  C  C     . PRO A 1  254  ? 127.066 124.298 175.663 1.00 128.68 ? 254  PRO A C     1 
ATOM   1659  O  O     . PRO A 1  254  ? 127.677 123.659 174.805 1.00 128.68 ? 254  PRO A O     1 
ATOM   1660  C  CB    . PRO A 1  254  ? 128.258 126.441 176.215 1.00 128.75 ? 254  PRO A CB    1 
ATOM   1661  C  CG    . PRO A 1  254  ? 129.555 126.684 176.907 1.00 128.75 ? 254  PRO A CG    1 
ATOM   1662  C  CD    . PRO A 1  254  ? 130.191 125.329 176.991 1.00 128.75 ? 254  PRO A CD    1 
ATOM   1663  N  N     . VAL A 1  255  ? 125.741 124.360 175.722 1.00 128.68 ? 255  VAL A N     1 
ATOM   1664  C  CA    . VAL A 1  255  ? 124.837 123.819 174.717 1.00 128.68 ? 255  VAL A CA    1 
ATOM   1665  C  C     . VAL A 1  255  ? 124.080 124.991 174.102 1.00 128.68 ? 255  VAL A C     1 
ATOM   1666  O  O     . VAL A 1  255  ? 123.316 125.664 174.803 1.00 128.68 ? 255  VAL A O     1 
ATOM   1667  C  CB    . VAL A 1  255  ? 123.859 122.788 175.306 1.00 127.45 ? 255  VAL A CB    1 
ATOM   1668  C  CG1   . VAL A 1  255  ? 122.824 122.384 174.270 1.00 127.45 ? 255  VAL A CG1   1 
ATOM   1669  C  CG2   . VAL A 1  255  ? 124.614 121.570 175.805 1.00 127.45 ? 255  VAL A CG2   1 
ATOM   1670  N  N     . PRO A 1  256  ? 124.259 125.277 172.816 1.00 127.95 ? 256  PRO A N     1 
ATOM   1671  C  CA    . PRO A 1  256  ? 123.623 126.450 172.210 1.00 127.95 ? 256  PRO A CA    1 
ATOM   1672  C  C     . PRO A 1  256  ? 122.134 126.233 172.013 1.00 127.95 ? 256  PRO A C     1 
ATOM   1673  O  O     . PRO A 1  256  ? 121.661 125.088 171.978 1.00 127.95 ? 256  PRO A O     1 
ATOM   1674  C  CB    . PRO A 1  256  ? 124.352 126.588 170.865 1.00 125.54 ? 256  PRO A CB    1 
ATOM   1675  C  CG    . PRO A 1  256  ? 124.793 125.206 170.546 1.00 125.54 ? 256  PRO A CG    1 
ATOM   1676  C  CD    . PRO A 1  256  ? 125.129 124.565 171.864 1.00 125.54 ? 256  PRO A CD    1 
ATOM   1677  N  N     . PRO A 1  257  ? 121.363 127.310 171.884 1.00 129.79 ? 257  PRO A N     1 
ATOM   1678  C  CA    . PRO A 1  257  ? 119.905 127.182 171.780 1.00 129.79 ? 257  PRO A CA    1 
ATOM   1679  C  C     . PRO A 1  257  ? 119.477 126.497 170.491 1.00 129.79 ? 257  PRO A C     1 
ATOM   1680  O  O     . PRO A 1  257  ? 120.246 126.331 169.542 1.00 129.79 ? 257  PRO A O     1 
ATOM   1681  C  CB    . PRO A 1  257  ? 119.421 128.633 171.816 1.00 126.14 ? 257  PRO A CB    1 
ATOM   1682  C  CG    . PRO A 1  257  ? 120.509 129.375 172.510 1.00 126.14 ? 257  PRO A CG    1 
ATOM   1683  C  CD    . PRO A 1  257  ? 121.775 128.712 172.062 1.00 126.14 ? 257  PRO A CD    1 
ATOM   1684  N  N     . LEU A 1  258  ? 118.205 126.089 170.481 1.00 133.33 ? 258  LEU A N     1 
ATOM   1685  C  CA    . LEU A 1  258  ? 117.597 125.535 169.275 1.00 133.33 ? 258  LEU A CA    1 
ATOM   1686  C  C     . LEU A 1  258  ? 117.650 126.515 168.112 1.00 133.33 ? 258  LEU A C     1 
ATOM   1687  O  O     . LEU A 1  258  ? 117.601 126.102 166.949 1.00 133.33 ? 258  LEU A O     1 
ATOM   1688  C  CB    . LEU A 1  258  ? 116.146 125.143 169.557 1.00 136.35 ? 258  LEU A CB    1 
ATOM   1689  C  CG    . LEU A 1  258  ? 115.898 124.030 170.573 1.00 136.35 ? 258  LEU A CG    1 
ATOM   1690  C  CD1   . LEU A 1  258  ? 114.412 123.899 170.835 1.00 136.35 ? 258  LEU A CD1   1 
ATOM   1691  C  CD2   . LEU A 1  258  ? 116.470 122.710 170.090 1.00 136.35 ? 258  LEU A CD2   1 
ATOM   1692  N  N     . SER A 1  259  ? 117.729 127.815 168.402 1.00 131.47 ? 259  SER A N     1 
ATOM   1693  C  CA    . SER A 1  259  ? 117.831 128.806 167.336 1.00 131.47 ? 259  SER A CA    1 
ATOM   1694  C  C     . SER A 1  259  ? 119.163 128.693 166.605 1.00 131.47 ? 259  SER A C     1 
ATOM   1695  O  O     . SER A 1  259  ? 119.234 128.910 165.390 1.00 131.47 ? 259  SER A O     1 
ATOM   1696  C  CB    . SER A 1  259  ? 117.653 130.211 167.910 1.00 130.90 ? 259  SER A CB    1 
ATOM   1697  O  OG    . SER A 1  259  ? 116.360 130.375 168.464 1.00 130.90 ? 259  SER A OG    1 
ATOM   1698  N  N     . VAL A 1  260  ? 120.232 128.356 167.330 1.00 131.44 ? 260  VAL A N     1 
ATOM   1699  C  CA    . VAL A 1  260  ? 121.539 128.200 166.701 1.00 131.44 ? 260  VAL A CA    1 
ATOM   1700  C  C     . VAL A 1  260  ? 121.602 126.902 165.908 1.00 131.44 ? 260  VAL A C     1 
ATOM   1701  O  O     . VAL A 1  260  ? 122.259 126.835 164.863 1.00 131.44 ? 260  VAL A O     1 
ATOM   1702  C  CB    . VAL A 1  260  ? 122.649 128.269 167.766 1.00 130.54 ? 260  VAL A CB    1 
ATOM   1703  C  CG1   . VAL A 1  260  ? 124.013 128.029 167.145 1.00 130.54 ? 260  VAL A CG1   1 
ATOM   1704  C  CG2   . VAL A 1  260  ? 122.613 129.605 168.482 1.00 130.54 ? 260  VAL A CG2   1 
ATOM   1705  N  N     . ARG A 1  261  ? 120.911 125.864 166.370 1.00 135.48 ? 261  ARG A N     1 
ATOM   1706  C  CA    . ARG A 1  261  ? 120.901 124.556 165.713 1.00 135.48 ? 261  ARG A CA    1 
ATOM   1707  C  C     . ARG A 1  261  ? 119.467 124.108 165.430 1.00 135.48 ? 261  ARG A C     1 
ATOM   1708  O  O     . ARG A 1  261  ? 118.961 123.161 166.040 1.00 135.48 ? 261  ARG A O     1 
ATOM   1709  C  CB    . ARG A 1  261  ? 121.650 123.535 166.569 1.00 134.99 ? 261  ARG A CB    1 
ATOM   1710  C  CG    . ARG A 1  261  ? 121.133 123.417 167.998 1.00 134.99 ? 261  ARG A CG    1 
ATOM   1711  C  CD    . ARG A 1  261  ? 121.876 122.373 168.801 1.00 134.99 ? 261  ARG A CD    1 
ATOM   1712  N  NE    . ARG A 1  261  ? 121.344 122.284 170.157 1.00 134.99 ? 261  ARG A NE    1 
ATOM   1713  C  CZ    . ARG A 1  261  ? 120.300 121.538 170.501 1.00 134.99 ? 261  ARG A CZ    1 
ATOM   1714  N  NH1   . ARG A 1  261  ? 119.668 120.815 169.586 1.00 134.99 ? 261  ARG A NH1   1 
ATOM   1715  N  NH2   . ARG A 1  261  ? 119.883 121.519 171.759 1.00 134.99 ? 261  ARG A NH2   1 
ATOM   1716  N  N     . PRO A 1  262  ? 118.779 124.767 164.495 1.00 144.92 ? 262  PRO A N     1 
ATOM   1717  C  CA    . PRO A 1  262  ? 117.391 124.386 164.214 1.00 144.92 ? 262  PRO A CA    1 
ATOM   1718  C  C     . PRO A 1  262  ? 117.301 122.985 163.632 1.00 144.92 ? 262  PRO A C     1 
ATOM   1719  O  O     . PRO A 1  262  ? 118.228 122.493 162.985 1.00 144.92 ? 262  PRO A O     1 
ATOM   1720  C  CB    . PRO A 1  262  ? 116.934 125.434 163.193 1.00 137.13 ? 262  PRO A CB    1 
ATOM   1721  C  CG    . PRO A 1  262  ? 117.831 126.588 163.416 1.00 137.13 ? 262  PRO A CG    1 
ATOM   1722  C  CD    . PRO A 1  262  ? 119.162 125.975 163.745 1.00 137.13 ? 262  PRO A CD    1 
ATOM   1723  N  N     . ALA A 1  263  ? 116.159 122.349 163.871 1.00 165.10 ? 263  ALA A N     1 
ATOM   1724  C  CA    . ALA A 1  263  ? 115.886 121.044 163.297 1.00 165.10 ? 263  ALA A CA    1 
ATOM   1725  C  C     . ALA A 1  263  ? 115.486 121.199 161.832 1.00 165.10 ? 263  ALA A C     1 
ATOM   1726  O  O     . ALA A 1  263  ? 115.358 122.306 161.303 1.00 165.10 ? 263  ALA A O     1 
ATOM   1727  C  CB    . ALA A 1  263  ? 114.794 120.336 164.097 1.00 165.06 ? 263  ALA A CB    1 
ATOM   1728  N  N     . VAL A 1  264  ? 115.269 120.068 161.168 1.00 185.23 ? 264  VAL A N     1 
ATOM   1729  C  CA    . VAL A 1  264  ? 114.873 120.046 159.765 1.00 185.23 ? 264  VAL A CA    1 
ATOM   1730  C  C     . VAL A 1  264  ? 113.524 119.351 159.673 1.00 185.23 ? 264  VAL A C     1 
ATOM   1731  O  O     . VAL A 1  264  ? 113.417 118.155 159.970 1.00 185.23 ? 264  VAL A O     1 
ATOM   1732  C  CB    . VAL A 1  264  ? 115.912 119.339 158.879 1.00 188.56 ? 264  VAL A CB    1 
ATOM   1733  C  CG1   . VAL A 1  264  ? 115.400 119.223 157.456 1.00 188.56 ? 264  VAL A CG1   1 
ATOM   1734  C  CG2   . VAL A 1  264  ? 117.237 120.087 158.915 1.00 188.56 ? 264  VAL A CG2   1 
ATOM   1735  N  N     . VAL A 1  265  ? 112.500 120.091 159.259 1.00 199.80 ? 265  VAL A N     1 
ATOM   1736  C  CA    . VAL A 1  265  ? 111.139 119.576 159.174 1.00 199.80 ? 265  VAL A CA    1 
ATOM   1737  C  C     . VAL A 1  265  ? 110.914 119.028 157.775 1.00 199.80 ? 265  VAL A C     1 
ATOM   1738  O  O     . VAL A 1  265  ? 110.880 119.784 156.796 1.00 199.80 ? 265  VAL A O     1 
ATOM   1739  C  CB    . VAL A 1  265  ? 110.109 120.671 159.510 1.00 191.89 ? 265  VAL A CB    1 
ATOM   1740  C  CG1   . VAL A 1  265  ? 108.692 120.140 159.348 1.00 191.89 ? 265  VAL A CG1   1 
ATOM   1741  C  CG2   . VAL A 1  265  ? 110.337 121.198 160.918 1.00 191.89 ? 265  VAL A CG2   1 
ATOM   1742  N  N     . MET A 1  266  ? 110.764 117.710 157.677 1.00 208.40 ? 266  MET A N     1 
ATOM   1743  C  CA    . MET A 1  266  ? 110.552 117.053 156.391 1.00 208.40 ? 266  MET A CA    1 
ATOM   1744  C  C     . MET A 1  266  ? 109.092 116.637 156.303 1.00 208.40 ? 266  MET A C     1 
ATOM   1745  O  O     . MET A 1  266  ? 108.677 115.694 156.984 1.00 208.40 ? 266  MET A O     1 
ATOM   1746  C  CB    . MET A 1  266  ? 111.470 115.840 156.231 1.00 205.62 ? 266  MET A CB    1 
ATOM   1747  C  CG    . MET A 1  266  ? 112.950 116.174 156.170 1.00 205.62 ? 266  MET A CG    1 
ATOM   1748  S  SD    . MET A 1  266  ? 113.349 117.239 154.773 1.00 205.62 ? 266  MET A SD    1 
ATOM   1749  C  CE    . MET A 1  266  ? 112.977 116.145 153.404 1.00 205.62 ? 266  MET A CE    1 
ATOM   1750  N  N     . GLN A 1  267  ? 108.316 117.353 155.486 1.00 209.70 ? 267  GLN A N     1 
ATOM   1751  C  CA    . GLN A 1  267  ? 106.961 116.949 155.122 1.00 209.70 ? 267  GLN A CA    1 
ATOM   1752  C  C     . GLN A 1  267  ? 106.015 116.921 156.319 1.00 209.70 ? 267  GLN A C     1 
ATOM   1753  O  O     . GLN A 1  267  ? 104.817 116.668 156.160 1.00 209.70 ? 267  GLN A O     1 
ATOM   1754  C  CB    . GLN A 1  267  ? 106.986 115.581 154.433 1.00 207.11 ? 267  GLN A CB    1 
ATOM   1755  C  CG    . GLN A 1  267  ? 107.716 115.585 153.100 1.00 207.11 ? 267  GLN A CG    1 
ATOM   1756  C  CD    . GLN A 1  267  ? 107.808 114.207 152.479 1.00 207.11 ? 267  GLN A CD    1 
ATOM   1757  O  OE1   . GLN A 1  267  ? 107.744 113.194 153.174 1.00 207.11 ? 267  GLN A OE1   1 
ATOM   1758  N  NE2   . GLN A 1  267  ? 107.962 114.163 151.160 1.00 207.11 ? 267  GLN A NE2   1 
ATOM   1759  N  N     . GLY A 1  268  ? 106.539 117.170 157.519 1.00 210.91 ? 268  GLY A N     1 
ATOM   1760  C  CA    . GLY A 1  268  ? 105.788 116.986 158.739 1.00 210.91 ? 268  GLY A CA    1 
ATOM   1761  C  C     . GLY A 1  268  ? 105.823 115.578 159.291 1.00 210.91 ? 268  GLY A C     1 
ATOM   1762  O  O     . GLY A 1  268  ? 105.342 115.356 160.409 1.00 210.91 ? 268  GLY A O     1 
ATOM   1763  N  N     . SER A 1  269  ? 106.375 114.621 158.541 1.00 210.94 ? 269  SER A N     1 
ATOM   1764  C  CA    . SER A 1  269  ? 106.447 113.246 159.026 1.00 210.94 ? 269  SER A CA    1 
ATOM   1765  C  C     . SER A 1  269  ? 107.493 113.099 160.124 1.00 210.94 ? 269  SER A C     1 
ATOM   1766  O  O     . SER A 1  269  ? 107.213 112.516 161.179 1.00 210.94 ? 269  SER A O     1 
ATOM   1767  C  CB    . SER A 1  269  ? 106.750 112.298 157.866 1.00 208.27 ? 269  SER A CB    1 
ATOM   1768  O  OG    . SER A 1  269  ? 108.020 112.570 157.300 1.00 208.27 ? 269  SER A OG    1 
ATOM   1769  N  N     . ALA A 1  270  ? 108.700 113.614 159.899 1.00 201.30 ? 270  ALA A N     1 
ATOM   1770  C  CA    . ALA A 1  270  ? 109.783 113.498 160.864 1.00 201.30 ? 270  ALA A CA    1 
ATOM   1771  C  C     . ALA A 1  270  ? 110.609 114.775 160.861 1.00 201.30 ? 270  ALA A C     1 
ATOM   1772  O  O     . ALA A 1  270  ? 110.574 115.563 159.912 1.00 201.30 ? 270  ALA A O     1 
ATOM   1773  C  CB    . ALA A 1  270  ? 110.682 112.292 160.565 1.00 198.42 ? 270  ALA A CB    1 
ATOM   1774  N  N     . ARG A 1  271  ? 111.362 114.967 161.940 1.00 185.61 ? 271  ARG A N     1 
ATOM   1775  C  CA    . ARG A 1  271  ? 112.237 116.119 162.106 1.00 185.61 ? 271  ARG A CA    1 
ATOM   1776  C  C     . ARG A 1  271  ? 113.680 115.643 162.136 1.00 185.61 ? 271  ARG A C     1 
ATOM   1777  O  O     . ARG A 1  271  ? 114.072 114.900 163.041 1.00 185.61 ? 271  ARG A O     1 
ATOM   1778  C  CB    . ARG A 1  271  ? 111.912 116.884 163.396 1.00 177.20 ? 271  ARG A CB    1 
ATOM   1779  C  CG    . ARG A 1  271  ? 110.552 117.565 163.417 1.00 177.20 ? 271  ARG A CG    1 
ATOM   1780  C  CD    . ARG A 1  271  ? 110.274 118.179 164.784 1.00 177.20 ? 271  ARG A CD    1 
ATOM   1781  N  NE    . ARG A 1  271  ? 111.169 119.290 165.104 1.00 177.20 ? 271  ARG A NE    1 
ATOM   1782  C  CZ    . ARG A 1  271  ? 110.925 120.561 164.800 1.00 177.20 ? 271  ARG A CZ    1 
ATOM   1783  N  NH1   . ARG A 1  271  ? 109.803 120.894 164.178 1.00 177.20 ? 271  ARG A NH1   1 
ATOM   1784  N  NH2   . ARG A 1  271  ? 111.798 121.504 165.133 1.00 177.20 ? 271  ARG A NH2   1 
ATOM   1785  N  N     . ASN A 1  272  ? 114.467 116.068 161.151 1.00 179.01 ? 272  ASN A N     1 
ATOM   1786  C  CA    . ASN A 1  272  ? 115.896 115.812 161.171 1.00 179.01 ? 272  ASN A CA    1 
ATOM   1787  C  C     . ASN A 1  272  ? 116.569 116.804 162.116 1.00 179.01 ? 272  ASN A C     1 
ATOM   1788  O  O     . ASN A 1  272  ? 115.923 117.676 162.700 1.00 179.01 ? 272  ASN A O     1 
ATOM   1789  C  CB    . ASN A 1  272  ? 116.477 115.884 159.761 1.00 186.46 ? 272  ASN A CB    1 
ATOM   1790  C  CG    . ASN A 1  272  ? 116.033 114.727 158.891 1.00 186.46 ? 272  ASN A CG    1 
ATOM   1791  O  OD1   . ASN A 1  272  ? 115.664 113.665 159.392 1.00 186.46 ? 272  ASN A OD1   1 
ATOM   1792  N  ND2   . ASN A 1  272  ? 116.069 114.925 157.578 1.00 186.46 ? 272  ASN A ND2   1 
ATOM   1793  N  N     . GLN A 1  273  ? 117.885 116.680 162.276 1.00 165.20 ? 273  GLN A N     1 
ATOM   1794  C  CA    . GLN A 1  273  ? 118.588 117.459 163.284 1.00 165.20 ? 273  GLN A CA    1 
ATOM   1795  C  C     . GLN A 1  273  ? 119.926 117.949 162.752 1.00 165.20 ? 273  GLN A C     1 
ATOM   1796  O  O     . GLN A 1  273  ? 120.522 117.329 161.867 1.00 165.20 ? 273  GLN A O     1 
ATOM   1797  C  CB    . GLN A 1  273  ? 118.794 116.639 164.562 1.00 162.93 ? 273  GLN A CB    1 
ATOM   1798  C  CG    . GLN A 1  273  ? 117.496 116.298 165.272 1.00 162.93 ? 273  GLN A CG    1 
ATOM   1799  C  CD    . GLN A 1  273  ? 117.703 115.423 166.485 1.00 162.93 ? 273  GLN A CD    1 
ATOM   1800  O  OE1   . GLN A 1  273  ? 118.704 114.715 166.591 1.00 162.93 ? 273  GLN A OE1   1 
ATOM   1801  N  NE2   . GLN A 1  273  ? 116.752 115.460 167.408 1.00 162.93 ? 273  GLN A NE2   1 
ATOM   1802  N  N     . ASP A 1  274  ? 120.386 119.067 163.306 1.00 157.42 ? 274  ASP A N     1 
ATOM   1803  C  CA    . ASP A 1  274  ? 121.626 119.694 162.883 1.00 157.42 ? 274  ASP A CA    1 
ATOM   1804  C  C     . ASP A 1  274  ? 122.828 118.895 163.386 1.00 157.42 ? 274  ASP A C     1 
ATOM   1805  O  O     . ASP A 1  274  ? 122.717 118.053 164.283 1.00 157.42 ? 274  ASP A O     1 
ATOM   1806  C  CB    . ASP A 1  274  ? 121.683 121.136 163.391 1.00 156.83 ? 274  ASP A CB    1 
ATOM   1807  C  CG    . ASP A 1  274  ? 122.829 121.927 162.791 1.00 156.83 ? 274  ASP A CG    1 
ATOM   1808  O  OD1   . ASP A 1  274  ? 123.522 121.392 161.900 1.00 156.83 ? 274  ASP A OD1   1 
ATOM   1809  O  OD2   . ASP A 1  274  ? 123.038 123.083 163.213 1.00 156.83 ? 274  ASP A OD2   1 
ATOM   1810  N  N     . ASP A 1  275  ? 123.984 119.153 162.769 1.00 155.88 ? 275  ASP A N     1 
ATOM   1811  C  CA    . ASP A 1  275  ? 125.222 118.470 163.138 1.00 155.88 ? 275  ASP A CA    1 
ATOM   1812  C  C     . ASP A 1  275  ? 125.483 118.564 164.640 1.00 155.88 ? 275  ASP A C     1 
ATOM   1813  O  O     . ASP A 1  275  ? 125.851 117.572 165.288 1.00 155.88 ? 275  ASP A O     1 
ATOM   1814  C  CB    . ASP A 1  275  ? 126.388 119.072 162.354 1.00 167.56 ? 275  ASP A CB    1 
ATOM   1815  C  CG    . ASP A 1  275  ? 126.246 118.880 160.856 1.00 167.56 ? 275  ASP A CG    1 
ATOM   1816  O  OD1   . ASP A 1  275  ? 125.419 118.046 160.433 1.00 167.56 ? 275  ASP A OD1   1 
ATOM   1817  O  OD2   . ASP A 1  275  ? 126.957 119.573 160.098 1.00 167.56 ? 275  ASP A OD2   1 
ATOM   1818  N  N     . LEU A 1  276  ? 125.295 119.760 165.208 1.00 148.70 ? 276  LEU A N     1 
ATOM   1819  C  CA    . LEU A 1  276  ? 125.422 119.930 166.651 1.00 148.70 ? 276  LEU A CA    1 
ATOM   1820  C  C     . LEU A 1  276  ? 124.572 118.922 167.408 1.00 148.70 ? 276  LEU A C     1 
ATOM   1821  O  O     . LEU A 1  276  ? 125.107 118.107 168.158 1.00 148.70 ? 276  LEU A O     1 
ATOM   1822  C  CB    . LEU A 1  276  ? 125.053 121.355 167.071 1.00 141.60 ? 276  LEU A CB    1 
ATOM   1823  C  CG    . LEU A 1  276  ? 126.027 122.468 166.689 1.00 141.60 ? 276  LEU A CG    1 
ATOM   1824  C  CD1   . LEU A 1  276  ? 125.489 123.817 167.129 1.00 141.60 ? 276  LEU A CD1   1 
ATOM   1825  C  CD2   . LEU A 1  276  ? 127.398 122.198 167.302 1.00 141.60 ? 276  LEU A CD2   1 
ATOM   1826  N  N     . THR A 1  277  ? 123.251 118.954 167.213 1.00 147.54 ? 277  THR A N     1 
ATOM   1827  C  CA    . THR A 1  277  ? 122.343 118.149 168.029 1.00 147.54 ? 277  THR A CA    1 
ATOM   1828  C  C     . THR A 1  277  ? 122.824 116.706 168.159 1.00 147.54 ? 277  THR A C     1 
ATOM   1829  O  O     . THR A 1  277  ? 122.821 116.133 169.256 1.00 147.54 ? 277  THR A O     1 
ATOM   1830  C  CB    . THR A 1  277  ? 120.938 118.193 167.431 1.00 151.37 ? 277  THR A CB    1 
ATOM   1831  O  OG1   . THR A 1  277  ? 120.478 119.549 167.392 1.00 151.37 ? 277  THR A OG1   1 
ATOM   1832  C  CG2   . THR A 1  277  ? 119.981 117.375 168.274 1.00 151.37 ? 277  THR A CG2   1 
ATOM   1833  N  N     . HIS A 1  278  ? 123.279 116.114 167.054 1.00 146.90 ? 278  HIS A N     1 
ATOM   1834  C  CA    . HIS A 1  278  ? 123.809 114.756 167.118 1.00 146.90 ? 278  HIS A CA    1 
ATOM   1835  C  C     . HIS A 1  278  ? 125.160 114.719 167.826 1.00 146.90 ? 278  HIS A C     1 
ATOM   1836  O  O     . HIS A 1  278  ? 125.465 113.758 168.546 1.00 146.90 ? 278  HIS A O     1 
ATOM   1837  C  CB    . HIS A 1  278  ? 123.923 114.171 165.710 1.00 156.57 ? 278  HIS A CB    1 
ATOM   1838  C  CG    . HIS A 1  278  ? 122.620 114.099 164.974 1.00 156.57 ? 278  HIS A CG    1 
ATOM   1839  N  ND1   . HIS A 1  278  ? 121.600 113.250 165.345 1.00 156.57 ? 278  HIS A ND1   1 
ATOM   1840  C  CD2   . HIS A 1  278  ? 122.179 114.759 163.877 1.00 156.57 ? 278  HIS A CD2   1 
ATOM   1841  C  CE1   . HIS A 1  278  ? 120.584 113.396 164.513 1.00 156.57 ? 278  HIS A CE1   1 
ATOM   1842  N  NE2   . HIS A 1  278  ? 120.910 114.305 163.613 1.00 156.57 ? 278  HIS A NE2   1 
ATOM   1843  N  N     . LYS A 1  279  ? 125.984 115.751 167.640 1.00 142.66 ? 279  LYS A N     1 
ATOM   1844  C  CA    . LYS A 1  279  ? 127.286 115.758 168.300 1.00 142.66 ? 279  LYS A CA    1 
ATOM   1845  C  C     . LYS A 1  279  ? 127.125 115.836 169.816 1.00 142.66 ? 279  LYS A C     1 
ATOM   1846  O  O     . LYS A 1  279  ? 127.711 115.044 170.564 1.00 142.66 ? 279  LYS A O     1 
ATOM   1847  C  CB    . LYS A 1  279  ? 128.122 116.924 167.779 1.00 144.14 ? 279  LYS A CB    1 
ATOM   1848  C  CG    . LYS A 1  279  ? 129.552 116.914 168.253 1.00 144.14 ? 279  LYS A CG    1 
ATOM   1849  C  CD    . LYS A 1  279  ? 130.261 115.693 167.697 1.00 144.14 ? 279  LYS A CD    1 
ATOM   1850  C  CE    . LYS A 1  279  ? 131.751 115.728 167.973 1.00 144.14 ? 279  LYS A CE    1 
ATOM   1851  N  NZ    . LYS A 1  279  ? 132.412 114.453 167.578 1.00 144.14 ? 279  LYS A NZ    1 
ATOM   1852  N  N     . LEU A 1  280  ? 126.324 116.797 170.281 1.00 139.30 ? 280  LEU A N     1 
ATOM   1853  C  CA    . LEU A 1  280  ? 125.946 116.886 171.684 1.00 139.30 ? 280  LEU A CA    1 
ATOM   1854  C  C     . LEU A 1  280  ? 125.293 115.598 172.162 1.00 139.30 ? 280  LEU A C     1 
ATOM   1855  O  O     . LEU A 1  280  ? 125.434 115.220 173.329 1.00 139.30 ? 280  LEU A O     1 
ATOM   1856  C  CB    . LEU A 1  280  ? 124.997 118.067 171.885 1.00 134.03 ? 280  LEU A CB    1 
ATOM   1857  C  CG    . LEU A 1  280  ? 125.543 119.458 171.558 1.00 134.03 ? 280  LEU A CG    1 
ATOM   1858  C  CD1   . LEU A 1  280  ? 124.440 120.497 171.640 1.00 134.03 ? 280  LEU A CD1   1 
ATOM   1859  C  CD2   . LEU A 1  280  ? 126.689 119.819 172.485 1.00 134.03 ? 280  LEU A CD2   1 
ATOM   1860  N  N     . ALA A 1  281  ? 124.559 114.916 171.278 1.00 142.18 ? 281  ALA A N     1 
ATOM   1861  C  CA    . ALA A 1  281  ? 124.024 113.604 171.629 1.00 142.18 ? 281  ALA A CA    1 
ATOM   1862  C  C     . ALA A 1  281  ? 125.147 112.644 171.997 1.00 142.18 ? 281  ALA A C     1 
ATOM   1863  O  O     . ALA A 1  281  ? 125.093 111.971 173.034 1.00 142.18 ? 281  ALA A O     1 
ATOM   1864  C  CB    . ALA A 1  281  ? 123.189 113.046 170.475 1.00 143.18 ? 281  ALA A CB    1 
ATOM   1865  N  N     . ASP A 1  282  ? 126.187 112.583 171.161 1.00 141.26 ? 282  ASP A N     1 
ATOM   1866  C  CA    . ASP A 1  282  ? 127.338 111.740 171.471 1.00 141.26 ? 282  ASP A CA    1 
ATOM   1867  C  C     . ASP A 1  282  ? 127.978 112.149 172.795 1.00 141.26 ? 282  ASP A C     1 
ATOM   1868  O  O     . ASP A 1  282  ? 128.278 111.300 173.647 1.00 141.26 ? 282  ASP A O     1 
ATOM   1869  C  CB    . ASP A 1  282  ? 128.357 111.817 170.334 1.00 146.96 ? 282  ASP A CB    1 
ATOM   1870  C  CG    . ASP A 1  282  ? 127.848 111.188 169.055 1.00 146.96 ? 282  ASP A CG    1 
ATOM   1871  O  OD1   . ASP A 1  282  ? 126.855 110.433 169.116 1.00 146.96 ? 282  ASP A OD1   1 
ATOM   1872  O  OD2   . ASP A 1  282  ? 128.438 111.450 167.986 1.00 146.96 ? 282  ASP A OD2   1 
ATOM   1873  N  N     . ILE A 1  283  ? 128.182 113.457 172.986 1.00 138.87 ? 283  ILE A N     1 
ATOM   1874  C  CA    . ILE A 1  283  ? 128.823 113.951 174.203 1.00 138.87 ? 283  ILE A CA    1 
ATOM   1875  C  C     . ILE A 1  283  ? 128.025 113.548 175.436 1.00 138.87 ? 283  ILE A C     1 
ATOM   1876  O  O     . ILE A 1  283  ? 128.597 113.186 176.471 1.00 138.87 ? 283  ILE A O     1 
ATOM   1877  C  CB    . ILE A 1  283  ? 129.011 115.478 174.121 1.00 137.05 ? 283  ILE A CB    1 
ATOM   1878  C  CG1   . ILE A 1  283  ? 130.006 115.833 173.015 1.00 137.05 ? 283  ILE A CG1   1 
ATOM   1879  C  CG2   . ILE A 1  283  ? 129.476 116.038 175.458 1.00 137.05 ? 283  ILE A CG2   1 
ATOM   1880  C  CD1   . ILE A 1  283  ? 130.068 117.310 172.707 1.00 137.05 ? 283  ILE A CD1   1 
ATOM   1881  N  N     . VAL A 1  284  ? 126.694 113.592 175.346 1.00 138.73 ? 284  VAL A N     1 
ATOM   1882  C  CA    . VAL A 1  284  ? 125.865 113.217 176.488 1.00 138.73 ? 284  VAL A CA    1 
ATOM   1883  C  C     . VAL A 1  284  ? 125.914 111.711 176.714 1.00 138.73 ? 284  VAL A C     1 
ATOM   1884  O  O     . VAL A 1  284  ? 125.929 111.244 177.860 1.00 138.73 ? 284  VAL A O     1 
ATOM   1885  C  CB    . VAL A 1  284  ? 124.421 113.719 176.296 1.00 138.30 ? 284  VAL A CB    1 
ATOM   1886  C  CG1   . VAL A 1  284  ? 123.538 113.221 177.417 1.00 138.30 ? 284  VAL A CG1   1 
ATOM   1887  C  CG2   . VAL A 1  284  ? 124.388 115.231 176.262 1.00 138.30 ? 284  VAL A CG2   1 
ATOM   1888  N  N     . LYS A 1  285  ? 125.944 110.926 175.634 1.00 138.98 ? 285  LYS A N     1 
ATOM   1889  C  CA    . LYS A 1  285  ? 126.048 109.476 175.773 1.00 138.98 ? 285  LYS A CA    1 
ATOM   1890  C  C     . LYS A 1  285  ? 127.315 109.087 176.526 1.00 138.98 ? 285  LYS A C     1 
ATOM   1891  O  O     . LYS A 1  285  ? 127.264 108.435 177.578 1.00 138.98 ? 285  LYS A O     1 
ATOM   1892  C  CB    . LYS A 1  285  ? 126.028 108.808 174.396 1.00 144.07 ? 285  LYS A CB    1 
ATOM   1893  C  CG    . LYS A 1  285  ? 124.717 108.912 173.645 1.00 144.07 ? 285  LYS A CG    1 
ATOM   1894  C  CD    . LYS A 1  285  ? 124.851 108.293 172.263 1.00 144.07 ? 285  LYS A CD    1 
ATOM   1895  C  CE    . LYS A 1  285  ? 123.551 108.373 171.483 1.00 144.07 ? 285  LYS A CE    1 
ATOM   1896  N  NZ    . LYS A 1  285  ? 123.701 107.827 170.104 1.00 144.07 ? 285  LYS A NZ    1 
ATOM   1897  N  N     . ILE A 1  286  ? 128.470 109.497 176.001 1.00 137.79 ? 286  ILE A N     1 
ATOM   1898  C  CA    . ILE A 1  286  ? 129.732 109.069 176.596 1.00 137.79 ? 286  ILE A CA    1 
ATOM   1899  C  C     . ILE A 1  286  ? 129.954 109.752 177.941 1.00 137.79 ? 286  ILE A C     1 
ATOM   1900  O  O     . ILE A 1  286  ? 130.605 109.197 178.835 1.00 137.79 ? 286  ILE A O     1 
ATOM   1901  C  CB    . ILE A 1  286  ? 130.883 109.316 175.606 1.00 138.81 ? 286  ILE A CB    1 
ATOM   1902  C  CG1   . ILE A 1  286  ? 130.706 108.396 174.398 1.00 138.81 ? 286  ILE A CG1   1 
ATOM   1903  C  CG2   . ILE A 1  286  ? 132.237 109.081 176.254 1.00 138.81 ? 286  ILE A CG2   1 
ATOM   1904  C  CD1   . ILE A 1  286  ? 131.632 108.694 173.269 1.00 138.81 ? 286  ILE A CD1   1 
ATOM   1905  N  N     . ASN A 1  287  ? 129.396 110.950 178.122 1.00 140.15 ? 287  ASN A N     1 
ATOM   1906  C  CA    . ASN A 1  287  ? 129.445 111.589 179.434 1.00 140.15 ? 287  ASN A CA    1 
ATOM   1907  C  C     . ASN A 1  287  ? 128.694 110.761 180.467 1.00 140.15 ? 287  ASN A C     1 
ATOM   1908  O  O     . ASN A 1  287  ? 129.180 110.551 181.584 1.00 140.15 ? 287  ASN A O     1 
ATOM   1909  C  CB    . ASN A 1  287  ? 128.867 113.001 179.362 1.00 135.90 ? 287  ASN A CB    1 
ATOM   1910  C  CG    . ASN A 1  287  ? 129.107 113.790 180.633 1.00 135.90 ? 287  ASN A CG    1 
ATOM   1911  O  OD1   . ASN A 1  287  ? 130.116 113.603 181.312 1.00 135.90 ? 287  ASN A OD1   1 
ATOM   1912  N  ND2   . ASN A 1  287  ? 128.171 114.667 180.970 1.00 135.90 ? 287  ASN A ND2   1 
ATOM   1913  N  N     . ASN A 1  288  ? 127.500 110.279 180.110 1.00 141.26 ? 288  ASN A N     1 
ATOM   1914  C  CA    . ASN A 1  288  ? 126.735 109.450 181.036 1.00 141.26 ? 288  ASN A CA    1 
ATOM   1915  C  C     . ASN A 1  288  ? 127.457 108.139 181.321 1.00 141.26 ? 288  ASN A C     1 
ATOM   1916  O  O     . ASN A 1  288  ? 127.511 107.690 182.475 1.00 141.26 ? 288  ASN A O     1 
ATOM   1917  C  CB    . ASN A 1  288  ? 125.338 109.188 180.475 1.00 143.15 ? 288  ASN A CB    1 
ATOM   1918  C  CG    . ASN A 1  288  ? 124.468 110.429 180.480 1.00 143.15 ? 288  ASN A CG    1 
ATOM   1919  O  OD1   . ASN A 1  288  ? 124.689 111.354 181.262 1.00 143.15 ? 288  ASN A OD1   1 
ATOM   1920  N  ND2   . ASN A 1  288  ? 123.475 110.458 179.600 1.00 143.15 ? 288  ASN A ND2   1 
ATOM   1921  N  N     . GLN A 1  289  ? 128.019 107.510 180.283 1.00 141.33 ? 289  GLN A N     1 
ATOM   1922  C  CA    . GLN A 1  289  ? 128.814 106.305 180.505 1.00 141.33 ? 289  GLN A CA    1 
ATOM   1923  C  C     . GLN A 1  289  ? 129.963 106.576 181.466 1.00 141.33 ? 289  GLN A C     1 
ATOM   1924  O  O     . GLN A 1  289  ? 130.275 105.744 182.326 1.00 141.33 ? 289  GLN A O     1 
ATOM   1925  C  CB    . GLN A 1  289  ? 129.352 105.766 179.180 1.00 143.53 ? 289  GLN A CB    1 
ATOM   1926  C  CG    . GLN A 1  289  ? 128.295 105.222 178.236 1.00 143.53 ? 289  GLN A CG    1 
ATOM   1927  C  CD    . GLN A 1  289  ? 128.890 104.716 176.936 1.00 143.53 ? 289  GLN A CD    1 
ATOM   1928  O  OE1   . GLN A 1  289  ? 129.973 105.140 176.529 1.00 143.53 ? 289  GLN A OE1   1 
ATOM   1929  N  NE2   . GLN A 1  289  ? 128.188 103.800 176.280 1.00 143.53 ? 289  GLN A NE2   1 
ATOM   1930  N  N     . LEU A 1  290  ? 130.599 107.742 181.342 1.00 142.75 ? 290  LEU A N     1 
ATOM   1931  C  CA    . LEU A 1  290  ? 131.718 108.064 182.219 1.00 142.75 ? 290  LEU A CA    1 
ATOM   1932  C  C     . LEU A 1  290  ? 131.242 108.313 183.645 1.00 142.75 ? 290  LEU A C     1 
ATOM   1933  O  O     . LEU A 1  290  ? 131.933 107.957 184.606 1.00 142.75 ? 290  LEU A O     1 
ATOM   1934  C  CB    . LEU A 1  290  ? 132.477 109.275 181.674 1.00 140.77 ? 290  LEU A CB    1 
ATOM   1935  C  CG    . LEU A 1  290  ? 133.697 109.737 182.469 1.00 140.77 ? 290  LEU A CG    1 
ATOM   1936  C  CD1   . LEU A 1  290  ? 134.743 108.636 182.504 1.00 140.77 ? 290  LEU A CD1   1 
ATOM   1937  C  CD2   . LEU A 1  290  ? 134.280 111.007 181.871 1.00 140.77 ? 290  LEU A CD2   1 
ATOM   1938  N  N     . ARG A 1  291  ? 130.064 108.921 183.805 1.00 144.52 ? 291  ARG A N     1 
ATOM   1939  C  CA    . ARG A 1  291  ? 129.473 109.072 185.132 1.00 144.52 ? 291  ARG A CA    1 
ATOM   1940  C  C     . ARG A 1  291  ? 129.260 107.711 185.784 1.00 144.52 ? 291  ARG A C     1 
ATOM   1941  O  O     . ARG A 1  291  ? 129.711 107.462 186.912 1.00 144.52 ? 291  ARG A O     1 
ATOM   1942  C  CB    . ARG A 1  291  ? 128.146 109.830 185.035 1.00 140.14 ? 291  ARG A CB    1 
ATOM   1943  C  CG    . ARG A 1  291  ? 128.240 111.254 184.510 1.00 140.14 ? 291  ARG A CG    1 
ATOM   1944  C  CD    . ARG A 1  291  ? 128.975 112.168 185.469 1.00 140.14 ? 291  ARG A CD    1 
ATOM   1945  N  NE    . ARG A 1  291  ? 128.293 112.273 186.753 1.00 140.14 ? 291  ARG A NE    1 
ATOM   1946  C  CZ    . ARG A 1  291  ? 127.269 113.086 186.992 1.00 140.14 ? 291  ARG A CZ    1 
ATOM   1947  N  NH1   . ARG A 1  291  ? 126.798 113.869 186.030 1.00 140.14 ? 291  ARG A NH1   1 
ATOM   1948  N  NH2   . ARG A 1  291  ? 126.711 113.113 188.195 1.00 140.14 ? 291  ARG A NH2   1 
ATOM   1949  N  N     . ARG A 1  292  ? 128.565 106.814 185.077 1.00 147.06 ? 292  ARG A N     1 
ATOM   1950  C  CA    . ARG A 1  292  ? 128.317 105.477 185.607 1.00 147.06 ? 292  ARG A CA    1 
ATOM   1951  C  C     . ARG A 1  292  ? 129.619 104.779 185.973 1.00 147.06 ? 292  ARG A C     1 
ATOM   1952  O  O     . ARG A 1  292  ? 129.767 104.261 187.085 1.00 147.06 ? 292  ARG A O     1 
ATOM   1953  C  CB    . ARG A 1  292  ? 127.539 104.640 184.593 1.00 149.76 ? 292  ARG A CB    1 
ATOM   1954  C  CG    . ARG A 1  292  ? 126.119 105.099 184.341 1.00 149.76 ? 292  ARG A CG    1 
ATOM   1955  C  CD    . ARG A 1  292  ? 125.433 104.150 183.378 1.00 149.76 ? 292  ARG A CD    1 
ATOM   1956  N  NE    . ARG A 1  292  ? 124.065 104.556 183.079 1.00 149.76 ? 292  ARG A NE    1 
ATOM   1957  C  CZ    . ARG A 1  292  ? 123.282 103.940 182.199 1.00 149.76 ? 292  ARG A CZ    1 
ATOM   1958  N  NH1   . ARG A 1  292  ? 123.733 102.887 181.532 1.00 149.76 ? 292  ARG A NH1   1 
ATOM   1959  N  NH2   . ARG A 1  292  ? 122.048 104.376 181.989 1.00 149.76 ? 292  ARG A NH2   1 
ATOM   1960  N  N     . ASN A 1  293  ? 130.581 104.760 185.050 1.00 147.86 ? 293  ASN A N     1 
ATOM   1961  C  CA    . ASN A 1  293  ? 131.838 104.071 185.316 1.00 147.86 ? 293  ASN A CA    1 
ATOM   1962  C  C     . ASN A 1  293  ? 132.683 104.786 186.363 1.00 147.86 ? 293  ASN A C     1 
ATOM   1963  O  O     . ASN A 1  293  ? 133.668 104.213 186.839 1.00 147.86 ? 293  ASN A O     1 
ATOM   1964  C  CB    . ASN A 1  293  ? 132.622 103.894 184.017 1.00 144.96 ? 293  ASN A CB    1 
ATOM   1965  C  CG    . ASN A 1  293  ? 132.004 102.854 183.105 1.00 144.96 ? 293  ASN A CG    1 
ATOM   1966  O  OD1   . ASN A 1  293  ? 131.271 101.976 183.558 1.00 144.96 ? 293  ASN A OD1   1 
ATOM   1967  N  ND2   . ASN A 1  293  ? 132.299 102.945 181.814 1.00 144.96 ? 293  ASN A ND2   1 
ATOM   1968  N  N     . GLU A 1  294  ? 132.335 106.024 186.726 1.00 150.27 ? 294  GLU A N     1 
ATOM   1969  C  CA    . GLU A 1  294  ? 132.923 106.622 187.921 1.00 150.27 ? 294  GLU A CA    1 
ATOM   1970  C  C     . GLU A 1  294  ? 132.233 106.118 189.181 1.00 150.27 ? 294  GLU A C     1 
ATOM   1971  O  O     . GLU A 1  294  ? 132.874 105.970 190.228 1.00 150.27 ? 294  GLU A O     1 
ATOM   1972  C  CB    . GLU A 1  294  ? 132.858 108.147 187.861 1.00 153.31 ? 294  GLU A CB    1 
ATOM   1973  C  CG    . GLU A 1  294  ? 133.830 108.788 186.895 1.00 153.31 ? 294  GLU A CG    1 
ATOM   1974  C  CD    . GLU A 1  294  ? 133.702 110.296 186.876 1.00 153.31 ? 294  GLU A CD    1 
ATOM   1975  O  OE1   . GLU A 1  294  ? 132.727 110.818 187.457 1.00 153.31 ? 294  GLU A OE1   1 
ATOM   1976  O  OE2   . GLU A 1  294  ? 134.579 110.960 186.289 1.00 153.31 ? 294  GLU A OE2   1 
ATOM   1977  N  N     . GLN A 1  295  ? 130.925 105.858 189.106 1.00 150.15 ? 295  GLN A N     1 
ATOM   1978  C  CA    . GLN A 1  295  ? 130.237 105.298 190.266 1.00 150.15 ? 295  GLN A CA    1 
ATOM   1979  C  C     . GLN A 1  295  ? 130.685 103.865 190.535 1.00 150.15 ? 295  GLN A C     1 
ATOM   1980  O  O     . GLN A 1  295  ? 130.966 103.500 191.682 1.00 150.15 ? 295  GLN A O     1 
ATOM   1981  C  CB    . GLN A 1  295  ? 128.723 105.374 190.069 1.00 152.06 ? 295  GLN A CB    1 
ATOM   1982  C  CG    . GLN A 1  295  ? 128.187 106.797 190.062 1.00 152.06 ? 295  GLN A CG    1 
ATOM   1983  C  CD    . GLN A 1  295  ? 126.692 106.859 189.822 1.00 152.06 ? 295  GLN A CD    1 
ATOM   1984  O  OE1   . GLN A 1  295  ? 126.107 105.949 189.237 1.00 152.06 ? 295  GLN A OE1   1 
ATOM   1985  N  NE2   . GLN A 1  295  ? 126.065 107.940 190.274 1.00 152.06 ? 295  GLN A NE2   1 
ATOM   1986  N  N     . ASN A 1  296  ? 130.765 103.041 189.489 1.00 151.04 ? 296  ASN A N     1 
ATOM   1987  C  CA    . ASN A 1  296  ? 131.301 101.691 189.633 1.00 151.04 ? 296  ASN A CA    1 
ATOM   1988  C  C     . ASN A 1  296  ? 132.798 101.714 189.914 1.00 151.04 ? 296  ASN A C     1 
ATOM   1989  O  O     . ASN A 1  296  ? 133.273 101.035 190.832 1.00 151.04 ? 296  ASN A O     1 
ATOM   1990  C  CB    . ASN A 1  296  ? 131.022 100.874 188.370 1.00 148.13 ? 296  ASN A CB    1 
ATOM   1991  C  CG    . ASN A 1  296  ? 129.554 100.556 188.190 1.00 148.13 ? 296  ASN A CG    1 
ATOM   1992  O  OD1   . ASN A 1  296  ? 128.790 100.529 189.154 1.00 148.13 ? 296  ASN A OD1   1 
ATOM   1993  N  ND2   . ASN A 1  296  ? 129.150 100.309 186.949 1.00 148.13 ? 296  ASN A ND2   1 
ATOM   1994  N  N     . GLY A 1  297  ? 133.552 102.488 189.134 1.00 155.05 ? 297  GLY A N     1 
ATOM   1995  C  CA    . GLY A 1  297  ? 134.994 102.525 189.211 1.00 155.05 ? 297  GLY A CA    1 
ATOM   1996  C  C     . GLY A 1  297  ? 135.701 101.715 188.145 1.00 155.05 ? 297  GLY A C     1 
ATOM   1997  O  O     . GLY A 1  297  ? 136.855 102.019 187.820 1.00 155.05 ? 297  GLY A O     1 
ATOM   1998  N  N     . ALA A 1  298  ? 135.034 100.701 187.591 1.00 157.01 ? 298  ALA A N     1 
ATOM   1999  C  CA    . ALA A 1  298  ? 135.522 99.887  186.482 1.00 157.01 ? 298  ALA A CA    1 
ATOM   2000  C  C     . ALA A 1  298  ? 136.934 99.359  186.710 1.00 157.01 ? 298  ALA A C     1 
ATOM   2001  O  O     . ALA A 1  298  ? 137.301 99.010  187.836 1.00 157.01 ? 298  ALA A O     1 
ATOM   2002  C  CB    . ALA A 1  298  ? 135.472 100.689 185.179 1.00 154.11 ? 298  ALA A CB    1 
ATOM   2003  N  N     . ALA A 1  299  ? 137.731 99.305  185.643 1.00 158.74 ? 299  ALA A N     1 
ATOM   2004  C  CA    . ALA A 1  299  ? 139.125 98.890  185.715 1.00 158.74 ? 299  ALA A CA    1 
ATOM   2005  C  C     . ALA A 1  299  ? 140.097 100.064 185.714 1.00 158.74 ? 299  ALA A C     1 
ATOM   2006  O  O     . ALA A 1  299  ? 141.310 99.845  185.790 1.00 158.74 ? 299  ALA A O     1 
ATOM   2007  C  CB    . ALA A 1  299  ? 139.448 97.942  184.558 1.00 155.35 ? 299  ALA A CB    1 
ATOM   2008  N  N     . ALA A 1  300  ? 139.585 101.289 185.585 1.00 157.02 ? 300  ALA A N     1 
ATOM   2009  C  CA    . ALA A 1  300  ? 140.311 102.552 185.713 1.00 157.02 ? 300  ALA A CA    1 
ATOM   2010  C  C     . ALA A 1  300  ? 141.192 102.892 184.513 1.00 157.02 ? 300  ALA A C     1 
ATOM   2011  O  O     . ALA A 1  300  ? 141.565 104.057 184.344 1.00 157.02 ? 300  ALA A O     1 
ATOM   2012  C  CB    . ALA A 1  300  ? 141.157 102.559 186.992 1.00 155.98 ? 300  ALA A CB    1 
ATOM   2013  N  N     . HIS A 1  301  ? 141.539 101.914 183.671 1.00 155.69 ? 301  HIS A N     1 
ATOM   2014  C  CA    . HIS A 1  301  ? 142.068 102.280 182.360 1.00 155.69 ? 301  HIS A CA    1 
ATOM   2015  C  C     . HIS A 1  301  ? 140.947 102.526 181.356 1.00 155.69 ? 301  HIS A C     1 
ATOM   2016  O  O     . HIS A 1  301  ? 141.089 103.360 180.452 1.00 155.69 ? 301  HIS A O     1 
ATOM   2017  C  CB    . HIS A 1  301  ? 143.047 101.227 181.830 1.00 153.60 ? 301  HIS A CB    1 
ATOM   2018  C  CG    . HIS A 1  301  ? 142.451 99.868  181.630 1.00 153.60 ? 301  HIS A CG    1 
ATOM   2019  N  ND1   . HIS A 1  301  ? 142.253 98.980  182.666 1.00 153.60 ? 301  HIS A ND1   1 
ATOM   2020  C  CD2   . HIS A 1  301  ? 142.029 99.238  180.508 1.00 153.60 ? 301  HIS A CD2   1 
ATOM   2021  C  CE1   . HIS A 1  301  ? 141.731 97.863  182.190 1.00 153.60 ? 301  HIS A CE1   1 
ATOM   2022  N  NE2   . HIS A 1  301  ? 141.581 97.995  180.884 1.00 153.60 ? 301  HIS A NE2   1 
ATOM   2023  N  N     . VAL A 1  302  ? 139.835 101.800 181.500 1.00 153.02 ? 302  VAL A N     1 
ATOM   2024  C  CA    . VAL A 1  302  ? 138.656 102.054 180.678 1.00 153.02 ? 302  VAL A CA    1 
ATOM   2025  C  C     . VAL A 1  302  ? 138.203 103.497 180.846 1.00 153.02 ? 302  VAL A C     1 
ATOM   2026  O  O     . VAL A 1  302  ? 137.722 104.132 179.898 1.00 153.02 ? 302  VAL A O     1 
ATOM   2027  C  CB    . VAL A 1  302  ? 137.533 101.061 181.037 1.00 148.08 ? 302  VAL A CB    1 
ATOM   2028  C  CG1   . VAL A 1  302  ? 136.280 101.344 180.221 1.00 148.08 ? 302  VAL A CG1   1 
ATOM   2029  C  CG2   . VAL A 1  302  ? 138.002 99.628  180.838 1.00 148.08 ? 302  VAL A CG2   1 
ATOM   2030  N  N     . ILE A 1  303  ? 138.359 104.039 182.057 1.00 151.45 ? 303  ILE A N     1 
ATOM   2031  C  CA    . ILE A 1  303  ? 138.082 105.455 182.282 1.00 151.45 ? 303  ILE A CA    1 
ATOM   2032  C  C     . ILE A 1  303  ? 138.955 106.307 181.372 1.00 151.45 ? 303  ILE A C     1 
ATOM   2033  O  O     . ILE A 1  303  ? 138.482 107.254 180.737 1.00 151.45 ? 303  ILE A O     1 
ATOM   2034  C  CB    . ILE A 1  303  ? 138.293 105.819 183.762 1.00 148.68 ? 303  ILE A CB    1 
ATOM   2035  C  CG1   . ILE A 1  303  ? 137.416 104.945 184.655 1.00 148.68 ? 303  ILE A CG1   1 
ATOM   2036  C  CG2   . ILE A 1  303  ? 137.981 107.287 183.997 1.00 148.68 ? 303  ILE A CG2   1 
ATOM   2037  C  CD1   . ILE A 1  303  ? 135.946 105.072 184.357 1.00 148.68 ? 303  ILE A CD1   1 
ATOM   2038  N  N     . ALA A 1  304  ? 140.244 105.971 181.289 1.00 153.14 ? 304  ALA A N     1 
ATOM   2039  C  CA    . ALA A 1  304  ? 141.144 106.711 180.411 1.00 153.14 ? 304  ALA A CA    1 
ATOM   2040  C  C     . ALA A 1  304  ? 140.703 106.609 178.957 1.00 153.14 ? 304  ALA A C     1 
ATOM   2041  O  O     . ALA A 1  304  ? 140.756 107.596 178.215 1.00 153.14 ? 304  ALA A O     1 
ATOM   2042  C  CB    . ALA A 1  304  ? 142.577 106.206 180.576 1.00 151.60 ? 304  ALA A CB    1 
ATOM   2043  N  N     . GLU A 1  305  ? 140.256 105.423 178.533 1.00 152.16 ? 305  GLU A N     1 
ATOM   2044  C  CA    . GLU A 1  305  ? 139.740 105.270 177.175 1.00 152.16 ? 305  GLU A CA    1 
ATOM   2045  C  C     . GLU A 1  305  ? 138.553 106.195 176.930 1.00 152.16 ? 305  GLU A C     1 
ATOM   2046  O  O     . GLU A 1  305  ? 138.492 106.893 175.910 1.00 152.16 ? 305  GLU A O     1 
ATOM   2047  C  CB    . GLU A 1  305  ? 139.344 103.814 176.925 1.00 153.94 ? 305  GLU A CB    1 
ATOM   2048  C  CG    . GLU A 1  305  ? 138.811 103.552 175.524 1.00 153.94 ? 305  GLU A CG    1 
ATOM   2049  C  CD    . GLU A 1  305  ? 138.429 102.100 175.303 1.00 153.94 ? 305  GLU A CD    1 
ATOM   2050  O  OE1   . GLU A 1  305  ? 138.546 101.301 176.256 1.00 153.94 ? 305  GLU A OE1   1 
ATOM   2051  O  OE2   . GLU A 1  305  ? 138.009 101.759 174.177 1.00 153.94 ? 305  GLU A OE2   1 
ATOM   2052  N  N     . ASP A 1  306  ? 137.600 106.219 177.866 1.00 150.44 ? 306  ASP A N     1 
ATOM   2053  C  CA    . ASP A 1  306  ? 136.406 107.036 177.684 1.00 150.44 ? 306  ASP A CA    1 
ATOM   2054  C  C     . ASP A 1  306  ? 136.717 108.524 177.770 1.00 150.44 ? 306  ASP A C     1 
ATOM   2055  O  O     . ASP A 1  306  ? 135.977 109.343 177.216 1.00 150.44 ? 306  ASP A O     1 
ATOM   2056  C  CB    . ASP A 1  306  ? 135.347 106.651 178.718 1.00 156.08 ? 306  ASP A CB    1 
ATOM   2057  C  CG    . ASP A 1  306  ? 134.753 105.280 178.459 1.00 156.08 ? 306  ASP A CG    1 
ATOM   2058  O  OD1   . ASP A 1  306  ? 134.910 104.766 177.332 1.00 156.08 ? 306  ASP A OD1   1 
ATOM   2059  O  OD2   . ASP A 1  306  ? 134.134 104.715 179.385 1.00 156.08 ? 306  ASP A OD2   1 
ATOM   2060  N  N     . VAL A 1  307  ? 137.792 108.896 178.468 1.00 148.23 ? 307  VAL A N     1 
ATOM   2061  C  CA    . VAL A 1  307  ? 138.193 110.299 178.519 1.00 148.23 ? 307  VAL A CA    1 
ATOM   2062  C  C     . VAL A 1  307  ? 138.949 110.680 177.252 1.00 148.23 ? 307  VAL A C     1 
ATOM   2063  O  O     . VAL A 1  307  ? 138.975 111.851 176.856 1.00 148.23 ? 307  VAL A O     1 
ATOM   2064  C  CB    . VAL A 1  307  ? 139.015 110.573 179.793 1.00 147.97 ? 307  VAL A CB    1 
ATOM   2065  C  CG1   . VAL A 1  307  ? 139.527 112.008 179.824 1.00 147.97 ? 307  VAL A CG1   1 
ATOM   2066  C  CG2   . VAL A 1  307  ? 138.172 110.304 181.020 1.00 147.97 ? 307  VAL A CG2   1 
ATOM   2067  N  N     . LYS A 1  308  ? 139.571 109.703 176.592 1.00 145.96 ? 308  LYS A N     1 
ATOM   2068  C  CA    . LYS A 1  308  ? 140.219 109.984 175.314 1.00 145.96 ? 308  LYS A CA    1 
ATOM   2069  C  C     . LYS A 1  308  ? 139.188 110.119 174.199 1.00 145.96 ? 308  LYS A C     1 
ATOM   2070  O  O     . LYS A 1  308  ? 139.295 111.003 173.339 1.00 145.96 ? 308  LYS A O     1 
ATOM   2071  C  CB    . LYS A 1  308  ? 141.239 108.893 174.987 1.00 151.79 ? 308  LYS A CB    1 
ATOM   2072  C  CG    . LYS A 1  308  ? 142.449 108.895 175.906 1.00 151.79 ? 308  LYS A CG    1 
ATOM   2073  C  CD    . LYS A 1  308  ? 143.454 107.829 175.511 1.00 151.79 ? 308  LYS A CD    1 
ATOM   2074  C  CE    . LYS A 1  308  ? 144.711 107.934 176.357 1.00 151.79 ? 308  LYS A CE    1 
ATOM   2075  N  NZ    . LYS A 1  308  ? 144.487 107.449 177.746 1.00 151.79 ? 308  LYS A NZ    1 
ATOM   2076  N  N     . LEU A 1  309  ? 138.173 109.253 174.199 1.00 141.95 ? 309  LEU A N     1 
ATOM   2077  C  CA    . LEU A 1  309  ? 137.116 109.375 173.200 1.00 141.95 ? 309  LEU A CA    1 
ATOM   2078  C  C     . LEU A 1  309  ? 136.236 110.589 173.482 1.00 141.95 ? 309  LEU A C     1 
ATOM   2079  O  O     . LEU A 1  309  ? 135.835 111.305 172.554 1.00 141.95 ? 309  LEU A O     1 
ATOM   2080  C  CB    . LEU A 1  309  ? 136.293 108.087 173.159 1.00 138.70 ? 309  LEU A CB    1 
ATOM   2081  C  CG    . LEU A 1  309  ? 135.129 107.994 172.175 1.00 138.70 ? 309  LEU A CG    1 
ATOM   2082  C  CD1   . LEU A 1  309  ? 135.631 108.158 170.754 1.00 138.70 ? 309  LEU A CD1   1 
ATOM   2083  C  CD2   . LEU A 1  309  ? 134.429 106.656 172.332 1.00 138.70 ? 309  LEU A CD2   1 
ATOM   2084  N  N     . LEU A 1  310  ? 135.937 110.842 174.759 1.00 139.56 ? 310  LEU A N     1 
ATOM   2085  C  CA    . LEU A 1  310  ? 135.261 112.077 175.143 1.00 139.56 ? 310  LEU A CA    1 
ATOM   2086  C  C     . LEU A 1  310  ? 136.074 113.294 174.722 1.00 139.56 ? 310  LEU A C     1 
ATOM   2087  O  O     . LEU A 1  310  ? 135.520 114.296 174.258 1.00 139.56 ? 310  LEU A O     1 
ATOM   2088  C  CB    . LEU A 1  310  ? 135.018 112.088 176.652 1.00 134.33 ? 310  LEU A CB    1 
ATOM   2089  C  CG    . LEU A 1  310  ? 134.401 113.353 177.251 1.00 134.33 ? 310  LEU A CG    1 
ATOM   2090  C  CD1   . LEU A 1  310  ? 133.001 113.573 176.715 1.00 134.33 ? 310  LEU A CD1   1 
ATOM   2091  C  CD2   . LEU A 1  310  ? 134.394 113.281 178.769 1.00 134.33 ? 310  LEU A CD2   1 
ATOM   2092  N  N     . GLN A 1  311  ? 137.395 113.224 174.892 1.00 141.92 ? 311  GLN A N     1 
ATOM   2093  C  CA    . GLN A 1  311  ? 138.286 114.249 174.359 1.00 141.92 ? 311  GLN A CA    1 
ATOM   2094  C  C     . GLN A 1  311  ? 138.078 114.418 172.861 1.00 141.92 ? 311  GLN A C     1 
ATOM   2095  O  O     . GLN A 1  311  ? 138.044 115.540 172.344 1.00 141.92 ? 311  GLN A O     1 
ATOM   2096  C  CB    . GLN A 1  311  ? 139.739 113.875 174.658 1.00 139.83 ? 311  GLN A CB    1 
ATOM   2097  C  CG    . GLN A 1  311  ? 140.777 114.858 174.143 1.00 139.83 ? 311  GLN A CG    1 
ATOM   2098  C  CD    . GLN A 1  311  ? 140.725 116.194 174.844 1.00 139.83 ? 311  GLN A CD    1 
ATOM   2099  O  OE1   . GLN A 1  311  ? 140.911 116.277 176.057 1.00 139.83 ? 311  GLN A OE1   1 
ATOM   2100  N  NE2   . GLN A 1  311  ? 140.475 117.253 174.084 1.00 139.83 ? 311  GLN A NE2   1 
ATOM   2101  N  N     . PHE A 1  312  ? 137.930 113.299 172.150 1.00 142.92 ? 312  PHE A N     1 
ATOM   2102  C  CA    . PHE A 1  312  ? 137.742 113.356 170.705 1.00 142.92 ? 312  PHE A CA    1 
ATOM   2103  C  C     . PHE A 1  312  ? 136.447 114.068 170.336 1.00 142.92 ? 312  PHE A C     1 
ATOM   2104  O  O     . PHE A 1  312  ? 136.418 114.863 169.391 1.00 142.92 ? 312  PHE A O     1 
ATOM   2105  C  CB    . PHE A 1  312  ? 137.762 111.946 170.120 1.00 147.25 ? 312  PHE A CB    1 
ATOM   2106  C  CG    . PHE A 1  312  ? 137.457 111.898 168.655 1.00 147.25 ? 312  PHE A CG    1 
ATOM   2107  C  CD1   . PHE A 1  312  ? 138.437 112.184 167.724 1.00 147.25 ? 312  PHE A CD1   1 
ATOM   2108  C  CD2   . PHE A 1  312  ? 136.189 111.569 168.208 1.00 147.25 ? 312  PHE A CD2   1 
ATOM   2109  C  CE1   . PHE A 1  312  ? 138.159 112.141 166.375 1.00 147.25 ? 312  PHE A CE1   1 
ATOM   2110  C  CE2   . PHE A 1  312  ? 135.905 111.526 166.858 1.00 147.25 ? 312  PHE A CE2   1 
ATOM   2111  C  CZ    . PHE A 1  312  ? 136.891 111.812 165.940 1.00 147.25 ? 312  PHE A CZ    1 
ATOM   2112  N  N     . HIS A 1  313  ? 135.361 113.796 171.063 1.00 141.86 ? 313  HIS A N     1 
ATOM   2113  C  CA    . HIS A 1  313  ? 134.087 114.427 170.726 1.00 141.86 ? 313  HIS A CA    1 
ATOM   2114  C  C     . HIS A 1  313  ? 134.067 115.899 171.124 1.00 141.86 ? 313  HIS A C     1 
ATOM   2115  O  O     . HIS A 1  313  ? 133.694 116.763 170.320 1.00 141.86 ? 313  HIS A O     1 
ATOM   2116  C  CB    . HIS A 1  313  ? 132.935 113.669 171.384 1.00 141.20 ? 313  HIS A CB    1 
ATOM   2117  C  CG    . HIS A 1  313  ? 132.753 112.282 170.854 1.00 141.20 ? 313  HIS A CG    1 
ATOM   2118  N  ND1   . HIS A 1  313  ? 132.239 112.029 169.601 1.00 141.20 ? 313  HIS A ND1   1 
ATOM   2119  C  CD2   . HIS A 1  313  ? 133.039 111.075 171.394 1.00 141.20 ? 313  HIS A CD2   1 
ATOM   2120  C  CE1   . HIS A 1  313  ? 132.202 110.724 169.398 1.00 141.20 ? 313  HIS A CE1   1 
ATOM   2121  N  NE2   . HIS A 1  313  ? 132.682 110.123 170.470 1.00 141.20 ? 313  HIS A NE2   1 
ATOM   2122  N  N     . VAL A 1  314  ? 134.470 116.204 172.359 1.00 141.99 ? 314  VAL A N     1 
ATOM   2123  C  CA    . VAL A 1  314  ? 134.440 117.585 172.835 1.00 141.99 ? 314  VAL A CA    1 
ATOM   2124  C  C     . VAL A 1  314  ? 135.359 118.459 171.991 1.00 141.99 ? 314  VAL A C     1 
ATOM   2125  O  O     . VAL A 1  314  ? 134.990 119.567 171.583 1.00 141.99 ? 314  VAL A O     1 
ATOM   2126  C  CB    . VAL A 1  314  ? 134.814 117.650 174.327 1.00 140.22 ? 314  VAL A CB    1 
ATOM   2127  C  CG1   . VAL A 1  314  ? 134.910 119.095 174.788 1.00 140.22 ? 314  VAL A CG1   1 
ATOM   2128  C  CG2   . VAL A 1  314  ? 133.790 116.897 175.165 1.00 140.22 ? 314  VAL A CG2   1 
ATOM   2129  N  N     . ALA A 1  315  ? 136.569 117.973 171.709 1.00 144.16 ? 315  ALA A N     1 
ATOM   2130  C  CA    . ALA A 1  315  ? 137.497 118.763 170.908 1.00 144.16 ? 315  ALA A CA    1 
ATOM   2131  C  C     . ALA A 1  315  ? 137.131 118.732 169.431 1.00 144.16 ? 315  ALA A C     1 
ATOM   2132  O  O     . ALA A 1  315  ? 137.544 119.614 168.670 1.00 144.16 ? 315  ALA A O     1 
ATOM   2133  C  CB    . ALA A 1  315  ? 138.926 118.265 171.112 1.00 143.66 ? 315  ALA A CB    1 
ATOM   2134  N  N     . THR A 1  316  ? 136.359 117.730 169.005 1.00 145.60 ? 316  THR A N     1 
ATOM   2135  C  CA    . THR A 1  316  ? 135.983 117.640 167.597 1.00 145.60 ? 316  THR A CA    1 
ATOM   2136  C  C     . THR A 1  316  ? 134.841 118.591 167.261 1.00 145.60 ? 316  THR A C     1 
ATOM   2137  O  O     . THR A 1  316  ? 134.825 119.186 166.176 1.00 145.60 ? 316  THR A O     1 
ATOM   2138  C  CB    . THR A 1  316  ? 135.608 116.203 167.238 1.00 148.74 ? 316  THR A CB    1 
ATOM   2139  O  OG1   . THR A 1  316  ? 136.756 115.358 167.377 1.00 148.74 ? 316  THR A OG1   1 
ATOM   2140  C  CG2   . THR A 1  316  ? 135.120 116.129 165.811 1.00 148.74 ? 316  THR A CG2   1 
ATOM   2141  N  N     . MET A 1  317  ? 133.878 118.750 168.173 1.00 145.37 ? 317  MET A N     1 
ATOM   2142  C  CA    . MET A 1  317  ? 132.773 119.670 167.916 1.00 145.37 ? 317  MET A CA    1 
ATOM   2143  C  C     . MET A 1  317  ? 133.281 121.079 167.631 1.00 145.37 ? 317  MET A C     1 
ATOM   2144  O  O     . MET A 1  317  ? 132.701 121.805 166.815 1.00 145.37 ? 317  MET A O     1 
ATOM   2145  C  CB    . MET A 1  317  ? 131.810 119.682 169.103 1.00 144.80 ? 317  MET A CB    1 
ATOM   2146  C  CG    . MET A 1  317  ? 130.654 120.655 168.946 1.00 144.80 ? 317  MET A CG    1 
ATOM   2147  S  SD    . MET A 1  317  ? 129.513 120.640 170.339 1.00 144.80 ? 317  MET A SD    1 
ATOM   2148  C  CE    . MET A 1  317  ? 130.500 121.457 171.589 1.00 144.80 ? 317  MET A CE    1 
ATOM   2149  N  N     . VAL A 1  318  ? 134.369 121.479 168.290 1.00 146.97 ? 318  VAL A N     1 
ATOM   2150  C  CA    . VAL A 1  318  ? 134.941 122.800 168.051 1.00 146.97 ? 318  VAL A CA    1 
ATOM   2151  C  C     . VAL A 1  318  ? 135.671 122.832 166.713 1.00 146.97 ? 318  VAL A C     1 
ATOM   2152  O  O     . VAL A 1  318  ? 135.465 123.738 165.897 1.00 146.97 ? 318  VAL A O     1 
ATOM   2153  C  CB    . VAL A 1  318  ? 135.869 123.199 169.211 1.00 144.07 ? 318  VAL A CB    1 
ATOM   2154  C  CG1   . VAL A 1  318  ? 136.528 124.541 168.929 1.00 144.07 ? 318  VAL A CG1   1 
ATOM   2155  C  CG2   . VAL A 1  318  ? 135.098 123.236 170.522 1.00 144.07 ? 318  VAL A CG2   1 
ATOM   2156  N  N     . ASP A 1  319  ? 136.539 121.851 166.466 1.00 156.31 ? 319  ASP A N     1 
ATOM   2157  C  CA    . ASP A 1  319  ? 137.338 121.802 165.246 1.00 156.31 ? 319  ASP A CA    1 
ATOM   2158  C  C     . ASP A 1  319  ? 137.277 120.398 164.664 1.00 156.31 ? 319  ASP A C     1 
ATOM   2159  O  O     . ASP A 1  319  ? 137.749 119.443 165.289 1.00 156.31 ? 319  ASP A O     1 
ATOM   2160  C  CB    . ASP A 1  319  ? 138.789 122.204 165.525 1.00 163.25 ? 319  ASP A CB    1 
ATOM   2161  C  CG    . ASP A 1  319  ? 139.627 122.311 164.259 1.00 163.25 ? 319  ASP A CG    1 
ATOM   2162  O  OD1   . ASP A 1  319  ? 139.098 122.061 163.156 1.00 163.25 ? 319  ASP A OD1   1 
ATOM   2163  O  OD2   . ASP A 1  319  ? 140.820 122.661 164.367 1.00 163.25 ? 319  ASP A OD2   1 
ATOM   2164  N  N     . ASN A 1  320  ? 136.700 120.275 163.472 1.00 163.89 ? 320  ASN A N     1 
ATOM   2165  C  CA    . ASN A 1  320  ? 136.698 119.019 162.738 1.00 163.89 ? 320  ASN A CA    1 
ATOM   2166  C  C     . ASN A 1  320  ? 137.847 118.911 161.743 1.00 163.89 ? 320  ASN A C     1 
ATOM   2167  O  O     . ASN A 1  320  ? 138.067 117.830 161.190 1.00 163.89 ? 320  ASN A O     1 
ATOM   2168  C  CB    . ASN A 1  320  ? 135.360 118.842 162.011 1.00 171.02 ? 320  ASN A CB    1 
ATOM   2169  C  CG    . ASN A 1  320  ? 135.158 117.435 161.489 1.00 171.02 ? 320  ASN A CG    1 
ATOM   2170  O  OD1   . ASN A 1  320  ? 135.656 116.468 162.062 1.00 171.02 ? 320  ASN A OD1   1 
ATOM   2171  N  ND2   . ASN A 1  320  ? 134.413 117.314 160.396 1.00 171.02 ? 320  ASN A ND2   1 
ATOM   2172  N  N     . GLU A 1  321  ? 138.585 119.993 161.503 1.00 168.75 ? 321  GLU A N     1 
ATOM   2173  C  CA    . GLU A 1  321  ? 139.650 120.014 160.508 1.00 168.75 ? 321  GLU A CA    1 
ATOM   2174  C  C     . GLU A 1  321  ? 141.034 119.735 161.083 1.00 168.75 ? 321  GLU A C     1 
ATOM   2175  O  O     . GLU A 1  321  ? 142.023 119.873 160.357 1.00 168.75 ? 321  GLU A O     1 
ATOM   2176  C  CB    . GLU A 1  321  ? 139.659 121.357 159.768 1.00 170.60 ? 321  GLU A CB    1 
ATOM   2177  C  CG    . GLU A 1  321  ? 138.464 121.550 158.849 1.00 170.60 ? 321  GLU A CG    1 
ATOM   2178  C  CD    . GLU A 1  321  ? 138.464 122.897 158.157 1.00 170.60 ? 321  GLU A CD    1 
ATOM   2179  O  OE1   . GLU A 1  321  ? 139.285 123.758 158.534 1.00 170.60 ? 321  GLU A OE1   1 
ATOM   2180  O  OE2   . GLU A 1  321  ? 137.646 123.093 157.232 1.00 170.60 ? 321  GLU A OE2   1 
ATOM   2181  N  N     . LEU A 1  322  ? 141.129 119.377 162.361 1.00 171.14 ? 322  LEU A N     1 
ATOM   2182  C  CA    . LEU A 1  322  ? 142.418 119.130 162.992 1.00 171.14 ? 322  LEU A CA    1 
ATOM   2183  C  C     . LEU A 1  322  ? 143.235 118.122 162.185 1.00 171.14 ? 322  LEU A C     1 
ATOM   2184  O  O     . LEU A 1  322  ? 142.713 117.062 161.814 1.00 171.14 ? 322  LEU A O     1 
ATOM   2185  C  CB    . LEU A 1  322  ? 142.222 118.609 164.415 1.00 163.46 ? 322  LEU A CB    1 
ATOM   2186  C  CG    . LEU A 1  322  ? 141.683 119.574 165.464 1.00 163.46 ? 322  LEU A CG    1 
ATOM   2187  C  CD1   . LEU A 1  322  ? 141.338 118.809 166.722 1.00 163.46 ? 322  LEU A CD1   1 
ATOM   2188  C  CD2   . LEU A 1  322  ? 142.735 120.627 165.762 1.00 163.46 ? 322  LEU A CD2   1 
ATOM   2189  N  N     . PRO A 1  323  ? 144.501 118.411 161.895 1.00 174.51 ? 323  PRO A N     1 
ATOM   2190  C  CA    . PRO A 1  323  ? 145.352 117.414 161.240 1.00 174.51 ? 323  PRO A CA    1 
ATOM   2191  C  C     . PRO A 1  323  ? 145.803 116.348 162.223 1.00 174.51 ? 323  PRO A C     1 
ATOM   2192  O  O     . PRO A 1  323  ? 145.878 116.574 163.433 1.00 174.51 ? 323  PRO A O     1 
ATOM   2193  C  CB    . PRO A 1  323  ? 146.538 118.241 160.734 1.00 177.70 ? 323  PRO A CB    1 
ATOM   2194  C  CG    . PRO A 1  323  ? 146.620 119.375 161.698 1.00 177.70 ? 323  PRO A CG    1 
ATOM   2195  C  CD    . PRO A 1  323  ? 145.202 119.692 162.096 1.00 177.70 ? 323  PRO A CD    1 
ATOM   2196  N  N     . GLY A 1  324  ? 146.106 115.169 161.685 1.00 172.50 ? 324  GLY A N     1 
ATOM   2197  C  CA    . GLY A 1  324  ? 146.571 114.074 162.510 1.00 172.50 ? 324  GLY A CA    1 
ATOM   2198  C  C     . GLY A 1  324  ? 145.495 113.317 163.254 1.00 172.50 ? 324  GLY A C     1 
ATOM   2199  O  O     . GLY A 1  324  ? 145.800 112.301 163.885 1.00 172.50 ? 324  GLY A O     1 
ATOM   2200  N  N     . LEU A 1  325  ? 144.244 113.776 163.205 1.00 172.68 ? 325  LEU A N     1 
ATOM   2201  C  CA    . LEU A 1  325  ? 143.151 113.089 163.868 1.00 172.68 ? 325  LEU A CA    1 
ATOM   2202  C  C     . LEU A 1  325  ? 142.090 112.680 162.854 1.00 172.68 ? 325  LEU A C     1 
ATOM   2203  O  O     . LEU A 1  325  ? 141.849 113.408 161.884 1.00 172.68 ? 325  LEU A O     1 
ATOM   2204  C  CB    . LEU A 1  325  ? 142.508 113.979 164.943 1.00 167.60 ? 325  LEU A CB    1 
ATOM   2205  C  CG    . LEU A 1  325  ? 143.377 114.374 166.137 1.00 167.60 ? 325  LEU A CG    1 
ATOM   2206  C  CD1   . LEU A 1  325  ? 142.631 115.347 167.033 1.00 167.60 ? 325  LEU A CD1   1 
ATOM   2207  C  CD2   . LEU A 1  325  ? 143.806 113.142 166.916 1.00 167.60 ? 325  LEU A CD2   1 
ATOM   2208  N  N     . PRO A 1  326  ? 141.447 111.530 163.041 1.00 174.01 ? 326  PRO A N     1 
ATOM   2209  C  CA    . PRO A 1  326  ? 140.339 111.160 162.152 1.00 174.01 ? 326  PRO A CA    1 
ATOM   2210  C  C     . PRO A 1  326  ? 139.174 112.121 162.334 1.00 174.01 ? 326  PRO A C     1 
ATOM   2211  O  O     . PRO A 1  326  ? 138.778 112.438 163.456 1.00 174.01 ? 326  PRO A O     1 
ATOM   2212  C  CB    . PRO A 1  326  ? 139.988 109.737 162.598 1.00 171.53 ? 326  PRO A CB    1 
ATOM   2213  C  CG    . PRO A 1  326  ? 140.427 109.679 164.025 1.00 171.53 ? 326  PRO A CG    1 
ATOM   2214  C  CD    . PRO A 1  326  ? 141.674 110.520 164.089 1.00 171.53 ? 326  PRO A CD    1 
ATOM   2215  N  N     . ARG A 1  327  ? 138.632 112.593 161.218 1.00 180.41 ? 327  ARG A N     1 
ATOM   2216  C  CA    . ARG A 1  327  ? 137.633 113.653 161.224 1.00 180.41 ? 327  ARG A CA    1 
ATOM   2217  C  C     . ARG A 1  327  ? 136.244 113.040 161.358 1.00 180.41 ? 327  ARG A C     1 
ATOM   2218  O  O     . ARG A 1  327  ? 135.881 112.143 160.591 1.00 180.41 ? 327  ARG A O     1 
ATOM   2219  C  CB    . ARG A 1  327  ? 137.760 114.499 159.955 1.00 176.08 ? 327  ARG A CB    1 
ATOM   2220  C  CG    . ARG A 1  327  ? 139.107 115.216 159.900 1.00 176.08 ? 327  ARG A CG    1 
ATOM   2221  C  CD    . ARG A 1  327  ? 139.298 116.113 158.691 1.00 176.08 ? 327  ARG A CD    1 
ATOM   2222  N  NE    . ARG A 1  327  ? 140.623 116.732 158.723 1.00 176.08 ? 327  ARG A NE    1 
ATOM   2223  C  CZ    . ARG A 1  327  ? 141.125 117.493 157.756 1.00 176.08 ? 327  ARG A CZ    1 
ATOM   2224  N  NH1   . ARG A 1  327  ? 140.413 117.740 156.665 1.00 176.08 ? 327  ARG A NH1   1 
ATOM   2225  N  NH2   . ARG A 1  327  ? 142.341 118.011 157.880 1.00 176.08 ? 327  ARG A NH2   1 
ATOM   2226  N  N     . ALA A 1  328  ? 135.481 113.517 162.343 1.00 184.82 ? 328  ALA A N     1 
ATOM   2227  C  CA    . ALA A 1  328  ? 134.245 112.848 162.730 1.00 184.82 ? 328  ALA A CA    1 
ATOM   2228  C  C     . ALA A 1  328  ? 133.272 112.810 161.566 1.00 184.82 ? 328  ALA A C     1 
ATOM   2229  O  O     . ALA A 1  328  ? 133.090 113.803 160.856 1.00 184.82 ? 328  ALA A O     1 
ATOM   2230  C  CB    . ALA A 1  328  ? 133.601 113.541 163.926 1.00 173.73 ? 328  ALA A CB    1 
ATOM   2231  N  N     . MET A 1  329  ? 132.643 111.657 161.381 1.00 200.60 ? 329  MET A N     1 
ATOM   2232  C  CA    . MET A 1  329  ? 131.736 111.407 160.273 1.00 200.60 ? 329  MET A CA    1 
ATOM   2233  C  C     . MET A 1  329  ? 130.360 111.132 160.854 1.00 200.60 ? 329  MET A C     1 
ATOM   2234  O  O     . MET A 1  329  ? 130.174 110.122 161.538 1.00 200.60 ? 329  MET A O     1 
ATOM   2235  C  CB    . MET A 1  329  ? 132.205 110.198 159.468 1.00 202.26 ? 329  MET A CB    1 
ATOM   2236  C  CG    . MET A 1  329  ? 133.646 110.269 159.030 1.00 202.26 ? 329  MET A CG    1 
ATOM   2237  S  SD    . MET A 1  329  ? 134.001 111.748 158.069 1.00 202.26 ? 329  MET A SD    1 
ATOM   2238  C  CE    . MET A 1  329  ? 133.029 111.448 156.576 1.00 202.26 ? 329  MET A CE    1 
ATOM   2239  N  N     . GLN A 1  330  ? 129.396 112.015 160.594 1.00 209.53 ? 330  GLN A N     1 
ATOM   2240  C  CA    . GLN A 1  330  ? 128.068 111.790 161.156 1.00 209.53 ? 330  GLN A CA    1 
ATOM   2241  C  C     . GLN A 1  330  ? 127.423 110.549 160.547 1.00 209.53 ? 330  GLN A C     1 
ATOM   2242  O  O     . GLN A 1  330  ? 127.122 109.579 161.254 1.00 209.53 ? 330  GLN A O     1 
ATOM   2243  C  CB    . GLN A 1  330  ? 127.171 113.020 160.966 1.00 202.28 ? 330  GLN A CB    1 
ATOM   2244  C  CG    . GLN A 1  330  ? 126.885 113.416 159.517 1.00 202.28 ? 330  GLN A CG    1 
ATOM   2245  C  CD    . GLN A 1  330  ? 125.767 114.432 159.388 1.00 202.28 ? 330  GLN A CD    1 
ATOM   2246  O  OE1   . GLN A 1  330  ? 125.469 115.180 160.319 1.00 202.28 ? 330  GLN A OE1   1 
ATOM   2247  N  NE2   . GLN A 1  330  ? 125.102 114.423 158.237 1.00 202.28 ? 330  GLN A NE2   1 
ATOM   2248  N  N     . LYS A 1  331  ? 127.292 110.534 159.220 1.00 219.58 ? 331  LYS A N     1 
ATOM   2249  C  CA    . LYS A 1  331  ? 126.480 109.617 158.427 1.00 219.58 ? 331  LYS A CA    1 
ATOM   2250  C  C     . LYS A 1  331  ? 126.754 109.928 156.964 1.00 219.58 ? 331  LYS A C     1 
ATOM   2251  O  O     . LYS A 1  331  ? 127.311 110.987 156.652 1.00 219.58 ? 331  LYS A O     1 
ATOM   2252  C  CB    . LYS A 1  331  ? 124.976 109.773 158.708 1.00 219.78 ? 331  LYS A CB    1 
ATOM   2253  C  CG    . LYS A 1  331  ? 124.476 109.295 160.066 1.00 219.78 ? 331  LYS A CG    1 
ATOM   2254  C  CD    . LYS A 1  331  ? 123.031 109.685 160.297 1.00 219.78 ? 331  LYS A CD    1 
ATOM   2255  C  CE    . LYS A 1  331  ? 122.544 109.206 161.656 1.00 219.78 ? 331  LYS A CE    1 
ATOM   2256  N  NZ    . LYS A 1  331  ? 121.163 109.676 161.965 1.00 219.78 ? 331  LYS A NZ    1 
ATOM   2257  N  N     . SER A 1  332  ? 126.386 109.009 156.069 1.00 232.92 ? 332  SER A N     1 
ATOM   2258  C  CA    . SER A 1  332  ? 126.441 109.240 154.624 1.00 232.92 ? 332  SER A CA    1 
ATOM   2259  C  C     . SER A 1  332  ? 127.843 109.601 154.149 1.00 232.92 ? 332  SER A C     1 
ATOM   2260  O  O     . SER A 1  332  ? 128.013 110.214 153.095 1.00 232.92 ? 332  SER A O     1 
ATOM   2261  C  CB    . SER A 1  332  ? 125.446 110.324 154.198 1.00 232.57 ? 332  SER A CB    1 
ATOM   2262  O  OG    . SER A 1  332  ? 125.765 111.588 154.759 1.00 232.57 ? 332  SER A OG    1 
ATOM   2263  N  N     . GLY A 1  333  ? 128.862 109.216 154.914 1.00 220.08 ? 333  GLY A N     1 
ATOM   2264  C  CA    . GLY A 1  333  ? 130.218 109.628 154.594 1.00 220.08 ? 333  GLY A CA    1 
ATOM   2265  C  C     . GLY A 1  333  ? 130.434 111.124 154.513 1.00 220.08 ? 333  GLY A C     1 
ATOM   2266  O  O     . GLY A 1  333  ? 131.325 111.572 153.786 1.00 220.08 ? 333  GLY A O     1 
ATOM   2267  N  N     . ARG A 1  334  ? 129.634 111.918 155.227 1.00 205.96 ? 334  ARG A N     1 
ATOM   2268  C  CA    . ARG A 1  334  ? 129.810 113.363 155.232 1.00 205.96 ? 334  ARG A CA    1 
ATOM   2269  C  C     . ARG A 1  334  ? 130.415 113.803 156.555 1.00 205.96 ? 334  ARG A C     1 
ATOM   2270  O  O     . ARG A 1  334  ? 129.869 113.469 157.616 1.00 205.96 ? 334  ARG A O     1 
ATOM   2271  C  CB    . ARG A 1  334  ? 128.472 114.088 155.003 1.00 202.81 ? 334  ARG A CB    1 
ATOM   2272  C  CG    . ARG A 1  334  ? 128.626 115.599 154.833 1.00 202.81 ? 334  ARG A CG    1 
ATOM   2273  C  CD    . ARG A 1  334  ? 127.302 116.297 154.540 1.00 202.81 ? 334  ARG A CD    1 
ATOM   2274  N  NE    . ARG A 1  334  ? 126.386 116.308 155.685 1.00 202.81 ? 334  ARG A NE    1 
ATOM   2275  C  CZ    . ARG A 1  334  ? 126.385 117.238 156.639 1.00 202.81 ? 334  ARG A CZ    1 
ATOM   2276  N  NH1   . ARG A 1  334  ? 127.248 118.244 156.590 1.00 202.81 ? 334  ARG A NH1   1 
ATOM   2277  N  NH2   . ARG A 1  334  ? 125.510 117.172 157.636 1.00 202.81 ? 334  ARG A NH2   1 
ATOM   2278  N  N     . PRO A 1  335  ? 131.534 114.525 156.542 1.00 191.15 ? 335  PRO A N     1 
ATOM   2279  C  CA    . PRO A 1  335  ? 132.105 115.016 157.799 1.00 191.15 ? 335  PRO A CA    1 
ATOM   2280  C  C     . PRO A 1  335  ? 131.223 116.080 158.429 1.00 191.15 ? 335  PRO A C     1 
ATOM   2281  O  O     . PRO A 1  335  ? 130.456 116.770 157.753 1.00 191.15 ? 335  PRO A O     1 
ATOM   2282  C  CB    . PRO A 1  335  ? 133.458 115.598 157.373 1.00 192.87 ? 335  PRO A CB    1 
ATOM   2283  C  CG    . PRO A 1  335  ? 133.262 115.984 155.950 1.00 192.87 ? 335  PRO A CG    1 
ATOM   2284  C  CD    . PRO A 1  335  ? 132.298 114.982 155.369 1.00 192.87 ? 335  PRO A CD    1 
ATOM   2285  N  N     . LEU A 1  336  ? 131.341 116.203 159.748 1.00 174.17 ? 336  LEU A N     1 
ATOM   2286  C  CA    . LEU A 1  336  ? 130.571 117.187 160.492 1.00 174.17 ? 336  LEU A CA    1 
ATOM   2287  C  C     . LEU A 1  336  ? 131.006 118.604 160.139 1.00 174.17 ? 336  LEU A C     1 
ATOM   2288  O  O     . LEU A 1  336  ? 132.096 118.843 159.612 1.00 174.17 ? 336  LEU A O     1 
ATOM   2289  C  CB    . LEU A 1  336  ? 130.726 116.971 161.997 1.00 172.86 ? 336  LEU A CB    1 
ATOM   2290  C  CG    . LEU A 1  336  ? 130.078 115.748 162.636 1.00 172.86 ? 336  LEU A CG    1 
ATOM   2291  C  CD1   . LEU A 1  336  ? 130.509 115.637 164.083 1.00 172.86 ? 336  LEU A CD1   1 
ATOM   2292  C  CD2   . LEU A 1  336  ? 128.573 115.886 162.550 1.00 172.86 ? 336  LEU A CD2   1 
ATOM   2293  N  N     . LYS A 1  337  ? 130.123 119.553 160.435 1.00 161.54 ? 337  LYS A N     1 
ATOM   2294  C  CA    . LYS A 1  337  ? 130.441 120.972 160.351 1.00 161.54 ? 337  LYS A CA    1 
ATOM   2295  C  C     . LYS A 1  337  ? 130.708 121.472 161.766 1.00 161.54 ? 337  LYS A C     1 
ATOM   2296  O  O     . LYS A 1  337  ? 129.781 121.610 162.569 1.00 161.54 ? 337  LYS A O     1 
ATOM   2297  C  CB    . LYS A 1  337  ? 129.305 121.752 159.694 1.00 158.60 ? 337  LYS A CB    1 
ATOM   2298  C  CG    . LYS A 1  337  ? 129.578 123.239 159.560 1.00 158.60 ? 337  LYS A CG    1 
ATOM   2299  C  CD    . LYS A 1  337  ? 128.402 123.967 158.931 1.00 158.60 ? 337  LYS A CD    1 
ATOM   2300  C  CE    . LYS A 1  337  ? 128.218 123.581 157.475 1.00 158.60 ? 337  LYS A CE    1 
ATOM   2301  N  NZ    . LYS A 1  337  ? 129.367 124.022 156.638 1.00 158.60 ? 337  LYS A NZ    1 
ATOM   2302  N  N     . SER A 1  338  ? 131.975 121.737 162.066 1.00 151.88 ? 338  SER A N     1 
ATOM   2303  C  CA    . SER A 1  338  ? 132.366 122.261 163.362 1.00 151.88 ? 338  SER A CA    1 
ATOM   2304  C  C     . SER A 1  338  ? 132.067 123.754 163.447 1.00 151.88 ? 338  SER A C     1 
ATOM   2305  O  O     . SER A 1  338  ? 131.898 124.440 162.435 1.00 151.88 ? 338  SER A O     1 
ATOM   2306  C  CB    . SER A 1  338  ? 133.849 122.006 163.624 1.00 155.17 ? 338  SER A CB    1 
ATOM   2307  O  OG    . SER A 1  338  ? 134.656 122.698 162.689 1.00 155.17 ? 338  SER A OG    1 
ATOM   2308  N  N     . LEU A 1  339  ? 131.982 124.250 164.684 1.00 143.15 ? 339  LEU A N     1 
ATOM   2309  C  CA    . LEU A 1  339  ? 131.741 125.672 164.904 1.00 143.15 ? 339  LEU A CA    1 
ATOM   2310  C  C     . LEU A 1  339  ? 132.788 126.528 164.201 1.00 143.15 ? 339  LEU A C     1 
ATOM   2311  O  O     . LEU A 1  339  ? 132.473 127.601 163.669 1.00 143.15 ? 339  LEU A O     1 
ATOM   2312  C  CB    . LEU A 1  339  ? 131.722 125.968 166.403 1.00 134.84 ? 339  LEU A CB    1 
ATOM   2313  C  CG    . LEU A 1  339  ? 130.612 125.263 167.185 1.00 134.84 ? 339  LEU A CG    1 
ATOM   2314  C  CD1   . LEU A 1  339  ? 130.769 125.504 168.674 1.00 134.84 ? 339  LEU A CD1   1 
ATOM   2315  C  CD2   . LEU A 1  339  ? 129.239 125.706 166.708 1.00 134.84 ? 339  LEU A CD2   1 
ATOM   2316  N  N     . LYS A 1  340  ? 134.041 126.065 164.180 1.00 146.48 ? 340  LYS A N     1 
ATOM   2317  C  CA    . LYS A 1  340  ? 135.067 126.769 163.419 1.00 146.48 ? 340  LYS A CA    1 
ATOM   2318  C  C     . LYS A 1  340  ? 134.709 126.802 161.940 1.00 146.48 ? 340  LYS A C     1 
ATOM   2319  O  O     . LYS A 1  340  ? 134.737 127.862 161.307 1.00 146.48 ? 340  LYS A O     1 
ATOM   2320  C  CB    . LYS A 1  340  ? 136.434 126.115 163.618 1.00 150.96 ? 340  LYS A CB    1 
ATOM   2321  C  CG    . LYS A 1  340  ? 137.551 126.883 162.923 1.00 150.96 ? 340  LYS A CG    1 
ATOM   2322  C  CD    . LYS A 1  340  ? 138.903 126.208 163.050 1.00 150.96 ? 340  LYS A CD    1 
ATOM   2323  C  CE    . LYS A 1  340  ? 139.027 125.064 162.059 1.00 150.96 ? 340  LYS A CE    1 
ATOM   2324  N  NZ    . LYS A 1  340  ? 140.369 124.427 162.110 1.00 150.96 ? 340  LYS A NZ    1 
ATOM   2325  N  N     . GLN A 1  341  ? 134.357 125.643 161.373 1.00 146.58 ? 341  GLN A N     1 
ATOM   2326  C  CA    . GLN A 1  341  ? 133.914 125.606 159.982 1.00 146.58 ? 341  GLN A CA    1 
ATOM   2327  C  C     . GLN A 1  341  ? 132.695 126.489 159.755 1.00 146.58 ? 341  GLN A C     1 
ATOM   2328  O  O     . GLN A 1  341  ? 132.508 127.012 158.652 1.00 146.58 ? 341  GLN A O     1 
ATOM   2329  C  CB    . GLN A 1  341  ? 133.607 124.170 159.554 1.00 160.07 ? 341  GLN A CB    1 
ATOM   2330  C  CG    . GLN A 1  341  ? 134.822 123.263 159.423 1.00 160.07 ? 341  GLN A CG    1 
ATOM   2331  C  CD    . GLN A 1  341  ? 134.440 121.847 159.036 1.00 160.07 ? 341  GLN A CD    1 
ATOM   2332  O  OE1   . GLN A 1  341  ? 133.330 121.399 159.308 1.00 160.07 ? 341  GLN A OE1   1 
ATOM   2333  N  NE2   . GLN A 1  341  ? 135.353 121.140 158.384 1.00 160.07 ? 341  GLN A NE2   1 
ATOM   2334  N  N     . ARG A 1  342  ? 131.855 126.669 160.776 1.00 140.21 ? 342  ARG A N     1 
ATOM   2335  C  CA    . ARG A 1  342  ? 130.736 127.592 160.629 1.00 140.21 ? 342  ARG A CA    1 
ATOM   2336  C  C     . ARG A 1  342  ? 131.204 129.039 160.563 1.00 140.21 ? 342  ARG A C     1 
ATOM   2337  O  O     . ARG A 1  342  ? 130.651 129.829 159.791 1.00 140.21 ? 342  ARG A O     1 
ATOM   2338  C  CB    . ARG A 1  342  ? 129.734 127.434 161.773 1.00 144.26 ? 342  ARG A CB    1 
ATOM   2339  C  CG    . ARG A 1  342  ? 128.927 126.151 161.762 1.00 144.26 ? 342  ARG A CG    1 
ATOM   2340  C  CD    . ARG A 1  342  ? 127.821 126.213 162.809 1.00 144.26 ? 342  ARG A CD    1 
ATOM   2341  N  NE    . ARG A 1  342  ? 126.996 125.009 162.828 1.00 144.26 ? 342  ARG A NE    1 
ATOM   2342  C  CZ    . ARG A 1  342  ? 125.991 124.809 163.674 1.00 144.26 ? 342  ARG A CZ    1 
ATOM   2343  N  NH1   . ARG A 1  342  ? 125.678 125.739 164.566 1.00 144.26 ? 342  ARG A NH1   1 
ATOM   2344  N  NH2   . ARG A 1  342  ? 125.295 123.683 163.626 1.00 144.26 ? 342  ARG A NH2   1 
ATOM   2345  N  N     . LEU A 1  343  ? 132.202 129.409 161.362 1.00 140.14 ? 343  LEU A N     1 
ATOM   2346  C  CA    . LEU A 1  343  ? 132.594 130.804 161.510 1.00 140.14 ? 343  LEU A CA    1 
ATOM   2347  C  C     . LEU A 1  343  ? 133.782 131.220 160.649 1.00 140.14 ? 343  LEU A C     1 
ATOM   2348  O  O     . LEU A 1  343  ? 134.209 132.374 160.740 1.00 140.14 ? 343  LEU A O     1 
ATOM   2349  C  CB    . LEU A 1  343  ? 132.909 131.103 162.977 1.00 138.10 ? 343  LEU A CB    1 
ATOM   2350  C  CG    . LEU A 1  343  ? 131.735 130.969 163.942 1.00 138.10 ? 343  LEU A CG    1 
ATOM   2351  C  CD1   . LEU A 1  343  ? 132.189 131.207 165.368 1.00 138.10 ? 343  LEU A CD1   1 
ATOM   2352  C  CD2   . LEU A 1  343  ? 130.630 131.928 163.560 1.00 138.10 ? 343  LEU A CD2   1 
ATOM   2353  N  N     . LYS A 1  344  ? 134.328 130.331 159.819 1.00 139.86 ? 344  LYS A N     1 
ATOM   2354  C  CA    . LYS A 1  344  ? 135.625 130.618 159.212 1.00 139.86 ? 344  LYS A CA    1 
ATOM   2355  C  C     . LYS A 1  344  ? 135.555 131.077 157.759 1.00 139.86 ? 344  LYS A C     1 
ATOM   2356  O  O     . LYS A 1  344  ? 135.683 132.271 157.474 1.00 139.86 ? 344  LYS A O     1 
ATOM   2357  C  CB    . LYS A 1  344  ? 136.519 129.381 159.304 1.00 145.63 ? 344  LYS A CB    1 
ATOM   2358  C  CG    . LYS A 1  344  ? 137.914 129.562 158.746 1.00 145.63 ? 344  LYS A CG    1 
ATOM   2359  C  CD    . LYS A 1  344  ? 138.696 128.267 158.861 1.00 145.63 ? 344  LYS A CD    1 
ATOM   2360  C  CE    . LYS A 1  344  ? 138.074 127.182 157.994 1.00 145.63 ? 344  LYS A CE    1 
ATOM   2361  N  NZ    . LYS A 1  344  ? 138.118 127.528 156.545 1.00 145.63 ? 344  LYS A NZ    1 
ATOM   2362  N  N     . GLY A 1  345  ? 135.342 130.148 156.838 1.00 134.70 ? 345  GLY A N     1 
ATOM   2363  C  CA    . GLY A 1  345  ? 135.559 130.434 155.432 1.00 134.70 ? 345  GLY A CA    1 
ATOM   2364  C  C     . GLY A 1  345  ? 134.523 131.377 154.854 1.00 134.70 ? 345  GLY A C     1 
ATOM   2365  O  O     . GLY A 1  345  ? 133.601 131.845 155.522 1.00 134.70 ? 345  GLY A O     1 
ATOM   2366  N  N     . LYS A 1  346  ? 134.701 131.671 153.566 1.00 132.92 ? 346  LYS A N     1 
ATOM   2367  C  CA    . LYS A 1  346  ? 133.702 132.430 152.828 1.00 132.92 ? 346  LYS A CA    1 
ATOM   2368  C  C     . LYS A 1  346  ? 132.374 131.691 152.870 1.00 132.92 ? 346  LYS A C     1 
ATOM   2369  O  O     . LYS A 1  346  ? 132.329 130.469 152.700 1.00 132.92 ? 346  LYS A O     1 
ATOM   2370  C  CB    . LYS A 1  346  ? 134.153 132.643 151.381 1.00 130.94 ? 346  LYS A CB    1 
ATOM   2371  C  CG    . LYS A 1  346  ? 133.173 133.455 150.548 1.00 130.94 ? 346  LYS A CG    1 
ATOM   2372  C  CD    . LYS A 1  346  ? 133.660 133.637 149.122 1.00 130.94 ? 346  LYS A CD    1 
ATOM   2373  C  CE    . LYS A 1  346  ? 133.465 132.369 148.312 1.00 130.94 ? 346  LYS A CE    1 
ATOM   2374  N  NZ    . LYS A 1  346  ? 133.903 132.544 146.901 1.00 130.94 ? 346  LYS A NZ    1 
ATOM   2375  N  N     . GLU A 1  347  ? 131.301 132.442 153.117 1.00 134.43 ? 347  GLU A N     1 
ATOM   2376  C  CA    . GLU A 1  347  ? 129.938 131.992 153.398 1.00 134.43 ? 347  GLU A CA    1 
ATOM   2377  C  C     . GLU A 1  347  ? 129.810 131.566 154.857 1.00 134.43 ? 347  GLU A C     1 
ATOM   2378  O  O     . GLU A 1  347  ? 128.704 131.219 155.289 1.00 134.43 ? 347  GLU A O     1 
ATOM   2379  C  CB    . GLU A 1  347  ? 129.462 130.859 152.474 1.00 143.72 ? 347  GLU A CB    1 
ATOM   2380  C  CG    . GLU A 1  347  ? 129.356 131.287 151.018 1.00 143.72 ? 347  GLU A CG    1 
ATOM   2381  C  CD    . GLU A 1  347  ? 129.029 130.139 150.085 1.00 143.72 ? 347  GLU A CD    1 
ATOM   2382  O  OE1   . GLU A 1  347  ? 129.076 128.974 150.531 1.00 143.72 ? 347  GLU A OE1   1 
ATOM   2383  O  OE2   . GLU A 1  347  ? 128.727 130.403 148.903 1.00 143.72 ? 347  GLU A OE2   1 
ATOM   2384  N  N     . GLY A 1  348  ? 130.896 131.570 155.626 1.00 129.12 ? 348  GLY A N     1 
ATOM   2385  C  CA    . GLY A 1  348  ? 130.774 131.497 157.067 1.00 129.12 ? 348  GLY A CA    1 
ATOM   2386  C  C     . GLY A 1  348  ? 130.216 132.784 157.643 1.00 129.12 ? 348  GLY A C     1 
ATOM   2387  O  O     . GLY A 1  348  ? 130.255 133.840 157.016 1.00 129.12 ? 348  GLY A O     1 
ATOM   2388  N  N     . ARG A 1  349  ? 129.711 132.687 158.877 1.00 124.69 ? 349  ARG A N     1 
ATOM   2389  C  CA    . ARG A 1  349  ? 128.910 133.765 159.457 1.00 124.69 ? 349  ARG A CA    1 
ATOM   2390  C  C     . ARG A 1  349  ? 129.598 135.121 159.335 1.00 124.69 ? 349  ARG A C     1 
ATOM   2391  O  O     . ARG A 1  349  ? 128.981 136.101 158.899 1.00 124.69 ? 349  ARG A O     1 
ATOM   2392  C  CB    . ARG A 1  349  ? 128.606 133.456 160.922 1.00 127.70 ? 349  ARG A CB    1 
ATOM   2393  C  CG    . ARG A 1  349  ? 127.947 132.109 161.125 1.00 127.70 ? 349  ARG A CG    1 
ATOM   2394  C  CD    . ARG A 1  349  ? 126.534 132.080 160.584 1.00 127.70 ? 349  ARG A CD    1 
ATOM   2395  N  NE    . ARG A 1  349  ? 125.931 130.759 160.748 1.00 127.70 ? 349  ARG A NE    1 
ATOM   2396  C  CZ    . ARG A 1  349  ? 125.966 129.799 159.827 1.00 127.70 ? 349  ARG A CZ    1 
ATOM   2397  N  NH1   . ARG A 1  349  ? 126.571 130.010 158.666 1.00 127.70 ? 349  ARG A NH1   1 
ATOM   2398  N  NH2   . ARG A 1  349  ? 125.394 128.626 160.066 1.00 127.70 ? 349  ARG A NH2   1 
ATOM   2399  N  N     . VAL A 1  350  ? 130.877 135.192 159.702 1.00 120.94 ? 350  VAL A N     1 
ATOM   2400  C  CA    . VAL A 1  350  ? 131.644 136.433 159.666 1.00 120.94 ? 350  VAL A CA    1 
ATOM   2401  C  C     . VAL A 1  350  ? 131.671 137.012 158.257 1.00 120.94 ? 350  VAL A C     1 
ATOM   2402  O  O     . VAL A 1  350  ? 131.114 138.085 158.006 1.00 120.94 ? 350  VAL A O     1 
ATOM   2403  C  CB    . VAL A 1  350  ? 133.071 136.211 160.194 1.00 123.88 ? 350  VAL A CB    1 
ATOM   2404  C  CG1   . VAL A 1  350  ? 133.875 137.492 160.087 1.00 123.88 ? 350  VAL A CG1   1 
ATOM   2405  C  CG2   . VAL A 1  350  ? 133.029 135.716 161.627 1.00 123.88 ? 350  VAL A CG2   1 
ATOM   2406  N  N     . ARG A 1  351  ? 132.321 136.309 157.325 1.00 122.04 ? 351  ARG A N     1 
ATOM   2407  C  CA    . ARG A 1  351  ? 132.444 136.834 155.969 1.00 122.04 ? 351  ARG A CA    1 
ATOM   2408  C  C     . ARG A 1  351  ? 131.137 136.698 155.197 1.00 122.04 ? 351  ARG A C     1 
ATOM   2409  O  O     . ARG A 1  351  ? 130.746 137.611 154.463 1.00 122.04 ? 351  ARG A O     1 
ATOM   2410  C  CB    . ARG A 1  351  ? 133.582 136.128 155.227 1.00 130.94 ? 351  ARG A CB    1 
ATOM   2411  C  CG    . ARG A 1  351  ? 133.796 136.635 153.806 1.00 130.94 ? 351  ARG A CG    1 
ATOM   2412  C  CD    . ARG A 1  351  ? 134.932 135.915 153.086 1.00 130.94 ? 351  ARG A CD    1 
ATOM   2413  N  NE    . ARG A 1  351  ? 136.235 136.174 153.691 1.00 130.94 ? 351  ARG A NE    1 
ATOM   2414  C  CZ    . ARG A 1  351  ? 137.374 135.640 153.261 1.00 130.94 ? 351  ARG A CZ    1 
ATOM   2415  N  NH1   . ARG A 1  351  ? 137.370 134.823 152.216 1.00 130.94 ? 351  ARG A NH1   1 
ATOM   2416  N  NH2   . ARG A 1  351  ? 138.516 135.929 153.869 1.00 130.94 ? 351  ARG A NH2   1 
ATOM   2417  N  N     . GLY A 1  352  ? 130.453 135.569 155.343 1.00 121.52 ? 352  GLY A N     1 
ATOM   2418  C  CA    . GLY A 1  352  ? 129.246 135.307 154.585 1.00 121.52 ? 352  GLY A CA    1 
ATOM   2419  C  C     . GLY A 1  352  ? 127.981 136.027 155.011 1.00 121.52 ? 352  GLY A C     1 
ATOM   2420  O  O     . GLY A 1  352  ? 127.284 136.570 154.153 1.00 121.52 ? 352  GLY A O     1 
ATOM   2421  N  N     . ASN A 1  353  ? 127.628 135.995 156.299 1.00 117.75 ? 353  ASN A N     1 
ATOM   2422  C  CA    . ASN A 1  353  ? 126.363 136.566 156.753 1.00 117.75 ? 353  ASN A CA    1 
ATOM   2423  C  C     . ASN A 1  353  ? 126.481 137.947 157.391 1.00 117.75 ? 353  ASN A C     1 
ATOM   2424  O  O     . ASN A 1  353  ? 125.449 138.538 157.726 1.00 117.75 ? 353  ASN A O     1 
ATOM   2425  C  CB    . ASN A 1  353  ? 125.672 135.619 157.737 1.00 121.27 ? 353  ASN A CB    1 
ATOM   2426  C  CG    . ASN A 1  353  ? 125.235 134.326 157.089 1.00 121.27 ? 353  ASN A CG    1 
ATOM   2427  O  OD1   . ASN A 1  353  ? 125.464 133.242 157.624 1.00 121.27 ? 353  ASN A OD1   1 
ATOM   2428  N  ND2   . ASN A 1  353  ? 124.606 134.432 155.926 1.00 121.27 ? 353  ASN A ND2   1 
ATOM   2429  N  N     . LEU A 1  354  ? 127.690 138.481 157.567 1.00 118.16 ? 354  LEU A N     1 
ATOM   2430  C  CA    . LEU A 1  354  ? 127.865 139.755 158.261 1.00 118.16 ? 354  LEU A CA    1 
ATOM   2431  C  C     . LEU A 1  354  ? 128.462 140.833 157.370 1.00 118.16 ? 354  LEU A C     1 
ATOM   2432  O  O     . LEU A 1  354  ? 127.783 141.824 157.081 1.00 118.16 ? 354  LEU A O     1 
ATOM   2433  C  CB    . LEU A 1  354  ? 128.723 139.567 159.517 1.00 118.74 ? 354  LEU A CB    1 
ATOM   2434  C  CG    . LEU A 1  354  ? 128.067 138.802 160.658 1.00 118.74 ? 354  LEU A CG    1 
ATOM   2435  C  CD1   . LEU A 1  354  ? 129.069 138.577 161.762 1.00 118.74 ? 354  LEU A CD1   1 
ATOM   2436  C  CD2   . LEU A 1  354  ? 126.878 139.592 161.168 1.00 118.74 ? 354  LEU A CD2   1 
ATOM   2437  N  N     . MET A 1  355  ? 129.719 140.688 156.941 1.00 120.07 ? 355  MET A N     1 
ATOM   2438  C  CA    . MET A 1  355  ? 130.336 141.696 156.087 1.00 120.07 ? 355  MET A CA    1 
ATOM   2439  C  C     . MET A 1  355  ? 129.538 141.932 154.813 1.00 120.07 ? 355  MET A C     1 
ATOM   2440  O  O     . MET A 1  355  ? 129.537 143.053 154.297 1.00 120.07 ? 355  MET A O     1 
ATOM   2441  C  CB    . MET A 1  355  ? 131.764 141.284 155.738 1.00 128.26 ? 355  MET A CB    1 
ATOM   2442  C  CG    . MET A 1  355  ? 132.650 141.070 156.951 1.00 128.26 ? 355  MET A CG    1 
ATOM   2443  S  SD    . MET A 1  355  ? 132.758 142.483 158.070 1.00 128.26 ? 355  MET A SD    1 
ATOM   2444  C  CE    . MET A 1  355  ? 133.626 143.693 157.061 1.00 128.26 ? 355  MET A CE    1 
ATOM   2445  N  N     . GLY A 1  356  ? 128.837 140.919 154.321 1.00 117.23 ? 356  GLY A N     1 
ATOM   2446  C  CA    . GLY A 1  356  ? 127.921 141.089 153.210 1.00 117.23 ? 356  GLY A CA    1 
ATOM   2447  C  C     . GLY A 1  356  ? 126.772 140.123 153.389 1.00 117.23 ? 356  GLY A C     1 
ATOM   2448  O  O     . GLY A 1  356  ? 126.873 139.145 154.132 1.00 117.23 ? 356  GLY A O     1 
ATOM   2449  N  N     . LYS A 1  357  ? 125.659 140.424 152.726 1.00 114.32 ? 357  LYS A N     1 
ATOM   2450  C  CA    . LYS A 1  357  ? 124.464 139.622 152.941 1.00 114.32 ? 357  LYS A CA    1 
ATOM   2451  C  C     . LYS A 1  357  ? 123.495 139.804 151.784 1.00 114.32 ? 357  LYS A C     1 
ATOM   2452  O  O     . LYS A 1  357  ? 123.588 140.761 151.011 1.00 114.32 ? 357  LYS A O     1 
ATOM   2453  C  CB    . LYS A 1  357  ? 123.802 139.985 154.271 1.00 112.64 ? 357  LYS A CB    1 
ATOM   2454  C  CG    . LYS A 1  357  ? 123.417 141.444 154.378 1.00 112.64 ? 357  LYS A CG    1 
ATOM   2455  C  CD    . LYS A 1  357  ? 122.883 141.761 155.758 1.00 112.64 ? 357  LYS A CD    1 
ATOM   2456  C  CE    . LYS A 1  357  ? 123.972 141.620 156.807 1.00 112.64 ? 357  LYS A CE    1 
ATOM   2457  N  NZ    . LYS A 1  357  ? 123.471 141.933 158.173 1.00 112.64 ? 357  LYS A NZ    1 
ATOM   2458  N  N     . ARG A 1  358  ? 122.563 138.862 151.677 1.00 111.69 ? 358  ARG A N     1 
ATOM   2459  C  CA    . ARG A 1  358  ? 121.478 138.939 150.710 1.00 111.69 ? 358  ARG A CA    1 
ATOM   2460  C  C     . ARG A 1  358  ? 120.425 139.907 151.234 1.00 111.69 ? 358  ARG A C     1 
ATOM   2461  O  O     . ARG A 1  358  ? 120.034 139.833 152.403 1.00 111.69 ? 358  ARG A O     1 
ATOM   2462  C  CB    . ARG A 1  358  ? 120.882 137.552 150.474 1.00 120.64 ? 358  ARG A CB    1 
ATOM   2463  C  CG    . ARG A 1  358  ? 121.843 136.603 149.775 1.00 120.64 ? 358  ARG A CG    1 
ATOM   2464  C  CD    . ARG A 1  358  ? 121.193 135.279 149.435 1.00 120.64 ? 358  ARG A CD    1 
ATOM   2465  N  NE    . ARG A 1  358  ? 120.813 134.549 150.641 1.00 120.64 ? 358  ARG A NE    1 
ATOM   2466  C  CZ    . ARG A 1  358  ? 121.634 133.759 151.326 1.00 120.64 ? 358  ARG A CZ    1 
ATOM   2467  N  NH1   . ARG A 1  358  ? 122.889 133.597 150.927 1.00 120.64 ? 358  ARG A NH1   1 
ATOM   2468  N  NH2   . ARG A 1  358  ? 121.202 133.132 152.412 1.00 120.64 ? 358  ARG A NH2   1 
ATOM   2469  N  N     . VAL A 1  359  ? 119.969 140.815 150.370 1.00 109.04 ? 359  VAL A N     1 
ATOM   2470  C  CA    . VAL A 1  359  ? 119.199 141.977 150.790 1.00 109.04 ? 359  VAL A CA    1 
ATOM   2471  C  C     . VAL A 1  359  ? 117.889 142.031 150.013 1.00 109.04 ? 359  VAL A C     1 
ATOM   2472  O  O     . VAL A 1  359  ? 117.708 141.357 148.998 1.00 109.04 ? 359  VAL A O     1 
ATOM   2473  C  CB    . VAL A 1  359  ? 119.986 143.290 150.605 1.00 110.35 ? 359  VAL A CB    1 
ATOM   2474  C  CG1   . VAL A 1  359  ? 121.254 143.267 151.441 1.00 110.35 ? 359  VAL A CG1   1 
ATOM   2475  C  CG2   . VAL A 1  359  ? 120.309 143.513 149.140 1.00 110.35 ? 359  VAL A CG2   1 
ATOM   2476  N  N     . ASP A 1  360  ? 116.969 142.852 150.514 1.00 110.35 ? 360  ASP A N     1 
ATOM   2477  C  CA    . ASP A 1  360  ? 115.674 143.056 149.890 1.00 110.35 ? 360  ASP A CA    1 
ATOM   2478  C  C     . ASP A 1  360  ? 115.699 144.288 148.989 1.00 110.35 ? 360  ASP A C     1 
ATOM   2479  O  O     . ASP A 1  360  ? 116.689 145.020 148.912 1.00 110.35 ? 360  ASP A O     1 
ATOM   2480  C  CB    . ASP A 1  360  ? 114.587 143.197 150.954 1.00 122.68 ? 360  ASP A CB    1 
ATOM   2481  C  CG    . ASP A 1  360  ? 114.263 141.889 151.634 1.00 122.68 ? 360  ASP A CG    1 
ATOM   2482  O  OD1   . ASP A 1  360  ? 114.598 140.830 151.066 1.00 122.68 ? 360  ASP A OD1   1 
ATOM   2483  O  OD2   . ASP A 1  360  ? 113.679 141.917 152.737 1.00 122.68 ? 360  ASP A OD2   1 
ATOM   2484  N  N     . PHE A 1  361  ? 114.572 144.530 148.320 1.00 106.49 ? 361  PHE A N     1 
ATOM   2485  C  CA    . PHE A 1  361  ? 114.401 145.656 147.403 1.00 106.49 ? 361  PHE A CA    1 
ATOM   2486  C  C     . PHE A 1  361  ? 115.563 145.754 146.419 1.00 106.49 ? 361  PHE A C     1 
ATOM   2487  O  O     . PHE A 1  361  ? 116.156 146.814 146.215 1.00 106.49 ? 361  PHE A O     1 
ATOM   2488  C  CB    . PHE A 1  361  ? 114.211 146.962 148.170 1.00 114.25 ? 361  PHE A CB    1 
ATOM   2489  C  CG    . PHE A 1  361  ? 112.976 146.980 149.015 1.00 114.25 ? 361  PHE A CG    1 
ATOM   2490  C  CD1   . PHE A 1  361  ? 111.735 147.196 148.441 1.00 114.25 ? 361  PHE A CD1   1 
ATOM   2491  C  CD2   . PHE A 1  361  ? 113.052 146.793 150.382 1.00 114.25 ? 361  PHE A CD2   1 
ATOM   2492  C  CE1   . PHE A 1  361  ? 110.595 147.215 149.212 1.00 114.25 ? 361  PHE A CE1   1 
ATOM   2493  C  CE2   . PHE A 1  361  ? 111.913 146.814 151.160 1.00 114.25 ? 361  PHE A CE2   1 
ATOM   2494  C  CZ    . PHE A 1  361  ? 110.684 147.026 150.573 1.00 114.25 ? 361  PHE A CZ    1 
ATOM   2495  N  N     . SER A 1  362  ? 115.887 144.619 145.805 1.00 102.02 ? 362  SER A N     1 
ATOM   2496  C  CA    . SER A 1  362  ? 116.923 144.543 144.791 1.00 102.02 ? 362  SER A CA    1 
ATOM   2497  C  C     . SER A 1  362  ? 116.458 143.627 143.668 1.00 102.02 ? 362  SER A C     1 
ATOM   2498  O  O     . SER A 1  362  ? 115.959 142.525 143.911 1.00 102.02 ? 362  SER A O     1 
ATOM   2499  C  CB    . SER A 1  362  ? 118.242 144.030 145.376 1.00 106.07 ? 362  SER A CB    1 
ATOM   2500  O  OG    . SER A 1  362  ? 118.102 142.708 145.860 1.00 106.07 ? 362  SER A OG    1 
ATOM   2501  N  N     . ALA A 1  363  ? 116.628 144.096 142.434 1.00 96.69  ? 363  ALA A N     1 
ATOM   2502  C  CA    . ALA A 1  363  ? 116.159 143.375 141.260 1.00 96.69  ? 363  ALA A CA    1 
ATOM   2503  C  C     . ALA A 1  363  ? 117.284 143.248 140.249 1.00 96.69  ? 363  ALA A C     1 
ATOM   2504  O  O     . ALA A 1  363  ? 117.881 144.252 139.852 1.00 96.69  ? 363  ALA A O     1 
ATOM   2505  C  CB    . ALA A 1  363  ? 114.962 144.084 140.624 1.00 100.13 ? 363  ALA A CB    1 
ATOM   2506  N  N     . ARG A 1  364  ? 117.562 142.018 139.829 1.00 98.62  ? 364  ARG A N     1 
ATOM   2507  C  CA    . ARG A 1  364  ? 118.588 141.730 138.840 1.00 98.62  ? 364  ARG A CA    1 
ATOM   2508  C  C     . ARG A 1  364  ? 117.931 141.370 137.518 1.00 98.62  ? 364  ARG A C     1 
ATOM   2509  O  O     . ARG A 1  364  ? 116.921 140.660 137.493 1.00 98.62  ? 364  ARG A O     1 
ATOM   2510  C  CB    . ARG A 1  364  ? 119.481 140.576 139.293 1.00 101.97 ? 364  ARG A CB    1 
ATOM   2511  C  CG    . ARG A 1  364  ? 120.653 140.284 138.383 1.00 101.97 ? 364  ARG A CG    1 
ATOM   2512  C  CD    . ARG A 1  364  ? 121.471 139.132 138.935 1.00 101.97 ? 364  ARG A CD    1 
ATOM   2513  N  NE    . ARG A 1  364  ? 122.607 138.798 138.084 1.00 101.97 ? 364  ARG A NE    1 
ATOM   2514  C  CZ    . ARG A 1  364  ? 123.794 139.386 138.166 1.00 101.97 ? 364  ARG A CZ    1 
ATOM   2515  N  NH1   . ARG A 1  364  ? 124.003 140.334 139.068 1.00 101.97 ? 364  ARG A NH1   1 
ATOM   2516  N  NH2   . ARG A 1  364  ? 124.776 139.023 137.355 1.00 101.97 ? 364  ARG A NH2   1 
ATOM   2517  N  N     . THR A 1  365  ? 118.508 141.852 136.425 1.00 98.98  ? 365  THR A N     1 
ATOM   2518  C  CA    . THR A 1  365  ? 118.051 141.489 135.088 1.00 98.98  ? 365  THR A CA    1 
ATOM   2519  C  C     . THR A 1  365  ? 119.129 141.894 134.089 1.00 98.98  ? 365  THR A C     1 
ATOM   2520  O  O     . THR A 1  365  ? 120.181 142.432 134.456 1.00 98.98  ? 365  THR A O     1 
ATOM   2521  C  CB    . THR A 1  365  ? 116.707 142.134 134.748 1.00 96.89  ? 365  THR A CB    1 
ATOM   2522  O  OG1   . THR A 1  365  ? 116.218 141.597 133.515 1.00 96.89  ? 365  THR A OG1   1 
ATOM   2523  C  CG2   . THR A 1  365  ? 116.862 143.621 134.593 1.00 96.89  ? 365  THR A CG2   1 
ATOM   2524  N  N     . VAL A 1  366  ? 118.856 141.612 132.817 1.00 98.64  ? 366  VAL A N     1 
ATOM   2525  C  CA    . VAL A 1  366  ? 119.748 141.927 131.709 1.00 98.64  ? 366  VAL A CA    1 
ATOM   2526  C  C     . VAL A 1  366  ? 119.577 143.395 131.344 1.00 98.64  ? 366  VAL A C     1 
ATOM   2527  O  O     . VAL A 1  366  ? 118.500 143.975 131.524 1.00 98.64  ? 366  VAL A O     1 
ATOM   2528  C  CB    . VAL A 1  366  ? 119.464 141.001 130.509 1.00 97.59  ? 366  VAL A CB    1 
ATOM   2529  C  CG1   . VAL A 1  366  ? 120.349 141.342 129.319 1.00 97.59  ? 366  VAL A CG1   1 
ATOM   2530  C  CG2   . VAL A 1  366  ? 119.666 139.556 130.912 1.00 97.59  ? 366  VAL A CG2   1 
ATOM   2531  N  N     . ILE A 1  367  ? 120.649 144.002 130.844 1.00 95.89  ? 367  ILE A N     1 
ATOM   2532  C  CA    . ILE A 1  367  ? 120.651 145.393 130.413 1.00 95.89  ? 367  ILE A CA    1 
ATOM   2533  C  C     . ILE A 1  367  ? 120.676 145.452 128.892 1.00 95.89  ? 367  ILE A C     1 
ATOM   2534  O  O     . ILE A 1  367  ? 121.297 144.615 128.225 1.00 95.89  ? 367  ILE A O     1 
ATOM   2535  C  CB    . ILE A 1  367  ? 121.848 146.159 131.013 1.00 93.59  ? 367  ILE A CB    1 
ATOM   2536  C  CG1   . ILE A 1  367  ? 123.155 145.458 130.657 1.00 93.59  ? 367  ILE A CG1   1 
ATOM   2537  C  CG2   . ILE A 1  367  ? 121.706 146.301 132.521 1.00 93.59  ? 367  ILE A CG2   1 
ATOM   2538  C  CD1   . ILE A 1  367  ? 124.370 146.237 131.054 1.00 93.59  ? 367  ILE A CD1   1 
ATOM   2539  N  N     . THR A 1  368  ? 119.982 146.449 128.341 1.00 96.81  ? 368  THR A N     1 
ATOM   2540  C  CA    . THR A 1  368  ? 119.963 146.728 126.914 1.00 96.81  ? 368  THR A CA    1 
ATOM   2541  C  C     . THR A 1  368  ? 120.168 148.218 126.681 1.00 96.81  ? 368  THR A C     1 
ATOM   2542  O  O     . THR A 1  368  ? 119.639 149.042 127.436 1.00 96.81  ? 368  THR A O     1 
ATOM   2543  C  CB    . THR A 1  368  ? 118.641 146.279 126.263 1.00 102.43 ? 368  THR A CB    1 
ATOM   2544  O  OG1   . THR A 1  368  ? 117.535 146.904 126.928 1.00 102.43 ? 368  THR A OG1   1 
ATOM   2545  C  CG2   . THR A 1  368  ? 118.485 144.775 126.329 1.00 102.43 ? 368  THR A CG2   1 
ATOM   2546  N  N     . PRO A 1  369  ? 120.922 148.597 125.650 1.00 94.20  ? 369  PRO A N     1 
ATOM   2547  C  CA    . PRO A 1  369  ? 121.237 150.019 125.446 1.00 94.20  ? 369  PRO A CA    1 
ATOM   2548  C  C     . PRO A 1  369  ? 120.011 150.813 125.023 1.00 94.20  ? 369  PRO A C     1 
ATOM   2549  O  O     . PRO A 1  369  ? 119.290 150.426 124.102 1.00 94.20  ? 369  PRO A O     1 
ATOM   2550  C  CB    . PRO A 1  369  ? 122.288 149.985 124.331 1.00 95.19  ? 369  PRO A CB    1 
ATOM   2551  C  CG    . PRO A 1  369  ? 121.975 148.756 123.572 1.00 95.19  ? 369  PRO A CG    1 
ATOM   2552  C  CD    . PRO A 1  369  ? 121.466 147.755 124.574 1.00 95.19  ? 369  PRO A CD    1 
ATOM   2553  N  N     . ASP A 1  370  ? 119.769 151.922 125.715 1.00 97.07  ? 370  ASP A N     1 
ATOM   2554  C  CA    . ASP A 1  370  ? 118.849 152.952 125.233 1.00 97.07  ? 370  ASP A CA    1 
ATOM   2555  C  C     . ASP A 1  370  ? 119.605 154.268 125.115 1.00 97.07  ? 370  ASP A C     1 
ATOM   2556  O  O     . ASP A 1  370  ? 119.957 154.867 126.148 1.00 97.07  ? 370  ASP A O     1 
ATOM   2557  C  CB    . ASP A 1  370  ? 117.655 153.102 126.173 1.00 101.59 ? 370  ASP A CB    1 
ATOM   2558  C  CG    . ASP A 1  370  ? 116.588 154.021 125.616 1.00 101.59 ? 370  ASP A CG    1 
ATOM   2559  O  OD1   . ASP A 1  370  ? 115.915 153.626 124.642 1.00 101.59 ? 370  ASP A OD1   1 
ATOM   2560  O  OD2   . ASP A 1  370  ? 116.429 155.143 126.139 1.00 101.59 ? 370  ASP A OD2   1 
ATOM   2561  N  N     . PRO A 1  371  ? 119.888 154.763 123.905 1.00 97.03  ? 371  PRO A N     1 
ATOM   2562  C  CA    . PRO A 1  371  ? 120.542 156.076 123.797 1.00 97.03  ? 371  PRO A CA    1 
ATOM   2563  C  C     . PRO A 1  371  ? 119.637 157.248 124.141 1.00 97.03  ? 371  PRO A C     1 
ATOM   2564  O  O     . PRO A 1  371  ? 120.152 158.338 124.420 1.00 97.03  ? 371  PRO A O     1 
ATOM   2565  C  CB    . PRO A 1  371  ? 120.983 156.125 122.329 1.00 92.10  ? 371  PRO A CB    1 
ATOM   2566  C  CG    . PRO A 1  371  ? 120.023 155.239 121.631 1.00 92.10  ? 371  PRO A CG    1 
ATOM   2567  C  CD    . PRO A 1  371  ? 119.725 154.122 122.592 1.00 92.10  ? 371  PRO A CD    1 
ATOM   2568  N  N     . ASN A 1  372  ? 118.316 157.068 124.134 1.00 96.47  ? 372  ASN A N     1 
ATOM   2569  C  CA    . ASN A 1  372  ? 117.405 158.195 124.296 1.00 96.47  ? 372  ASN A CA    1 
ATOM   2570  C  C     . ASN A 1  372  ? 117.237 158.651 125.740 1.00 96.47  ? 372  ASN A C     1 
ATOM   2571  O  O     . ASN A 1  372  ? 116.623 159.699 125.968 1.00 96.47  ? 372  ASN A O     1 
ATOM   2572  C  CB    . ASN A 1  372  ? 116.037 157.860 123.706 1.00 98.96  ? 372  ASN A CB    1 
ATOM   2573  C  CG    . ASN A 1  372  ? 116.029 157.918 122.198 1.00 98.96  ? 372  ASN A CG    1 
ATOM   2574  O  OD1   . ASN A 1  372  ? 115.946 158.997 121.612 1.00 98.96  ? 372  ASN A OD1   1 
ATOM   2575  N  ND2   . ASN A 1  372  ? 116.142 156.763 121.558 1.00 98.96  ? 372  ASN A ND2   1 
ATOM   2576  N  N     . LEU A 1  373  ? 117.750 157.906 126.713 1.00 95.32  ? 373  LEU A N     1 
ATOM   2577  C  CA    . LEU A 1  373  ? 117.707 158.377 128.088 1.00 95.32  ? 373  LEU A CA    1 
ATOM   2578  C  C     . LEU A 1  373  ? 118.785 159.435 128.320 1.00 95.32  ? 373  LEU A C     1 
ATOM   2579  O  O     . LEU A 1  373  ? 119.586 159.755 127.439 1.00 95.32  ? 373  LEU A O     1 
ATOM   2580  C  CB    . LEU A 1  373  ? 117.892 157.217 129.065 1.00 93.13  ? 373  LEU A CB    1 
ATOM   2581  C  CG    . LEU A 1  373  ? 116.785 156.167 129.125 1.00 93.13  ? 373  LEU A CG    1 
ATOM   2582  C  CD1   . LEU A 1  373  ? 117.204 155.041 130.037 1.00 93.13  ? 373  LEU A CD1   1 
ATOM   2583  C  CD2   . LEU A 1  373  ? 115.478 156.779 129.599 1.00 93.13  ? 373  LEU A CD2   1 
ATOM   2584  N  N     . SER A 1  374  ? 118.801 159.981 129.532 1.00 98.36  ? 374  SER A N     1 
ATOM   2585  C  CA    . SER A 1  374  ? 119.873 160.873 129.948 1.00 98.36  ? 374  SER A CA    1 
ATOM   2586  C  C     . SER A 1  374  ? 120.994 160.027 130.544 1.00 98.36  ? 374  SER A C     1 
ATOM   2587  O  O     . SER A 1  374  ? 120.954 158.795 130.513 1.00 98.36  ? 374  SER A O     1 
ATOM   2588  C  CB    . SER A 1  374  ? 119.351 161.919 130.928 1.00 98.96  ? 374  SER A CB    1 
ATOM   2589  O  OG    . SER A 1  374  ? 118.388 162.757 130.317 1.00 98.96  ? 374  SER A OG    1 
ATOM   2590  N  N     . ILE A 1  375  ? 122.014 160.678 131.100 1.00 96.76  ? 375  ILE A N     1 
ATOM   2591  C  CA    . ILE A 1  375  ? 123.101 159.940 131.738 1.00 96.76  ? 375  ILE A CA    1 
ATOM   2592  C  C     . ILE A 1  375  ? 122.587 159.205 132.968 1.00 96.76  ? 375  ILE A C     1 
ATOM   2593  O  O     . ILE A 1  375  ? 122.794 157.996 133.129 1.00 96.76  ? 375  ILE A O     1 
ATOM   2594  C  CB    . ILE A 1  375  ? 124.249 160.886 132.122 1.00 97.72  ? 375  ILE A CB    1 
ATOM   2595  C  CG1   . ILE A 1  375  ? 124.836 161.579 130.906 1.00 97.72  ? 375  ILE A CG1   1 
ATOM   2596  C  CG2   . ILE A 1  375  ? 125.348 160.116 132.804 1.00 97.72  ? 375  ILE A CG2   1 
ATOM   2597  C  CD1   . ILE A 1  375  ? 125.808 162.630 131.314 1.00 97.72  ? 375  ILE A CD1   1 
ATOM   2598  N  N     . ASP A 1  376  ? 121.919 159.934 133.859 1.00 99.94  ? 376  ASP A N     1 
ATOM   2599  C  CA    . ASP A 1  376  ? 121.522 159.407 135.155 1.00 99.94  ? 376  ASP A CA    1 
ATOM   2600  C  C     . ASP A 1  376  ? 120.181 158.691 135.137 1.00 99.94  ? 376  ASP A C     1 
ATOM   2601  O  O     . ASP A 1  376  ? 119.711 158.281 136.201 1.00 99.94  ? 376  ASP A O     1 
ATOM   2602  C  CB    . ASP A 1  376  ? 121.479 160.535 136.190 1.00 105.26 ? 376  ASP A CB    1 
ATOM   2603  C  CG    . ASP A 1  376  ? 120.525 161.648 135.803 1.00 105.26 ? 376  ASP A CG    1 
ATOM   2604  O  OD1   . ASP A 1  376  ? 120.003 161.621 134.668 1.00 105.26 ? 376  ASP A OD1   1 
ATOM   2605  O  OD2   . ASP A 1  376  ? 120.301 162.555 136.632 1.00 105.26 ? 376  ASP A OD2   1 
ATOM   2606  N  N     . GLN A 1  377  ? 119.536 158.549 133.984 1.00 95.31  ? 377  GLN A N     1 
ATOM   2607  C  CA    . GLN A 1  377  ? 118.304 157.786 134.011 1.00 95.31  ? 377  GLN A CA    1 
ATOM   2608  C  C     . GLN A 1  377  ? 118.584 156.308 133.769 1.00 95.31  ? 377  GLN A C     1 
ATOM   2609  O  O     . GLN A 1  377  ? 119.705 155.898 133.460 1.00 95.31  ? 377  GLN A O     1 
ATOM   2610  C  CB    . GLN A 1  377  ? 117.311 158.316 132.981 1.00 91.66  ? 377  GLN A CB    1 
ATOM   2611  C  CG    . GLN A 1  377  ? 116.762 159.684 133.312 1.00 91.66  ? 377  GLN A CG    1 
ATOM   2612  C  CD    . GLN A 1  377  ? 115.823 160.203 132.247 1.00 91.66  ? 377  GLN A CD    1 
ATOM   2613  O  OE1   . GLN A 1  377  ? 115.896 159.797 131.088 1.00 91.66  ? 377  GLN A OE1   1 
ATOM   2614  N  NE2   . GLN A 1  377  ? 114.931 161.105 132.634 1.00 91.66  ? 377  GLN A NE2   1 
ATOM   2615  N  N     . VAL A 1  378  ? 117.537 155.502 133.915 1.00 92.27  ? 378  VAL A N     1 
ATOM   2616  C  CA    . VAL A 1  378  ? 117.616 154.078 133.624 1.00 92.27  ? 378  VAL A CA    1 
ATOM   2617  C  C     . VAL A 1  378  ? 116.225 153.593 133.241 1.00 92.27  ? 378  VAL A C     1 
ATOM   2618  O  O     . VAL A 1  378  ? 115.222 154.022 133.818 1.00 92.27  ? 378  VAL A O     1 
ATOM   2619  C  CB    . VAL A 1  378  ? 118.203 153.292 134.822 1.00 91.55  ? 378  VAL A CB    1 
ATOM   2620  C  CG1   . VAL A 1  378  ? 117.318 153.425 136.048 1.00 91.55  ? 378  VAL A CG1   1 
ATOM   2621  C  CG2   . VAL A 1  378  ? 118.408 151.833 134.456 1.00 91.55  ? 378  VAL A CG2   1 
ATOM   2622  N  N     . GLY A 1  379  ? 116.167 152.715 132.241 1.00 94.12  ? 379  GLY A N     1 
ATOM   2623  C  CA    . GLY A 1  379  ? 114.925 152.028 131.926 1.00 94.12  ? 379  GLY A CA    1 
ATOM   2624  C  C     . GLY A 1  379  ? 114.645 150.947 132.948 1.00 94.12  ? 379  GLY A C     1 
ATOM   2625  O  O     . GLY A 1  379  ? 115.509 150.115 133.239 1.00 94.12  ? 379  GLY A O     1 
ATOM   2626  N  N     . VAL A 1  380  ? 113.441 150.960 133.507 1.00 93.30  ? 380  VAL A N     1 
ATOM   2627  C  CA    . VAL A 1  380  ? 112.994 149.947 134.453 1.00 93.30  ? 380  VAL A CA    1 
ATOM   2628  C  C     . VAL A 1  380  ? 111.765 149.246 133.883 1.00 93.30  ? 380  VAL A C     1 
ATOM   2629  O  O     . VAL A 1  380  ? 110.745 149.897 133.640 1.00 93.30  ? 380  VAL A O     1 
ATOM   2630  C  CB    . VAL A 1  380  ? 112.690 150.542 135.836 1.00 94.05  ? 380  VAL A CB    1 
ATOM   2631  C  CG1   . VAL A 1  380  ? 112.075 149.486 136.723 1.00 94.05  ? 380  VAL A CG1   1 
ATOM   2632  C  CG2   . VAL A 1  380  ? 113.963 151.071 136.460 1.00 94.05  ? 380  VAL A CG2   1 
ATOM   2633  N  N     . PRO A 1  381  ? 111.806 147.934 133.650 1.00 97.91  ? 381  PRO A N     1 
ATOM   2634  C  CA    . PRO A 1  381  ? 110.594 147.227 133.219 1.00 97.91  ? 381  PRO A CA    1 
ATOM   2635  C  C     . PRO A 1  381  ? 109.478 147.335 134.250 1.00 97.91  ? 381  PRO A C     1 
ATOM   2636  O  O     . PRO A 1  381  ? 109.712 147.628 135.422 1.00 97.91  ? 381  PRO A O     1 
ATOM   2637  C  CB    . PRO A 1  381  ? 111.069 145.779 133.053 1.00 94.78  ? 381  PRO A CB    1 
ATOM   2638  C  CG    . PRO A 1  381  ? 112.278 145.678 133.901 1.00 94.78  ? 381  PRO A CG    1 
ATOM   2639  C  CD    . PRO A 1  381  ? 112.946 147.018 133.806 1.00 94.78  ? 381  PRO A CD    1 
ATOM   2640  N  N     . ARG A 1  382  ? 108.246 147.077 133.798 1.00 103.42 ? 382  ARG A N     1 
ATOM   2641  C  CA    . ARG A 1  382  ? 107.083 147.349 134.640 1.00 103.42 ? 382  ARG A CA    1 
ATOM   2642  C  C     . ARG A 1  382  ? 106.869 146.267 135.694 1.00 103.42 ? 382  ARG A C     1 
ATOM   2643  O  O     . ARG A 1  382  ? 106.154 146.491 136.675 1.00 103.42 ? 382  ARG A O     1 
ATOM   2644  C  CB    . ARG A 1  382  ? 105.830 147.516 133.777 1.00 106.46 ? 382  ARG A CB    1 
ATOM   2645  C  CG    . ARG A 1  382  ? 105.837 148.771 132.916 1.00 106.46 ? 382  ARG A CG    1 
ATOM   2646  C  CD    . ARG A 1  382  ? 104.529 148.963 132.165 1.00 106.46 ? 382  ARG A CD    1 
ATOM   2647  N  NE    . ARG A 1  382  ? 104.554 150.165 131.336 1.00 106.46 ? 382  ARG A NE    1 
ATOM   2648  C  CZ    . ARG A 1  382  ? 103.573 150.527 130.515 1.00 106.46 ? 382  ARG A CZ    1 
ATOM   2649  N  NH1   . ARG A 1  382  ? 102.483 149.781 130.415 1.00 106.46 ? 382  ARG A NH1   1 
ATOM   2650  N  NH2   . ARG A 1  382  ? 103.680 151.637 129.797 1.00 106.46 ? 382  ARG A NH2   1 
ATOM   2651  N  N     . SER A 1  383  ? 107.467 145.086 135.513 1.00 105.58 ? 383  SER A N     1 
ATOM   2652  C  CA    . SER A 1  383  ? 107.349 144.048 136.534 1.00 105.58 ? 383  SER A CA    1 
ATOM   2653  C  C     . SER A 1  383  ? 108.266 144.344 137.718 1.00 105.58 ? 383  SER A C     1 
ATOM   2654  O  O     . SER A 1  383  ? 107.844 144.290 138.881 1.00 105.58 ? 383  SER A O     1 
ATOM   2655  C  CB    . SER A 1  383  ? 107.669 142.681 135.933 1.00 110.54 ? 383  SER A CB    1 
ATOM   2656  O  OG    . SER A 1  383  ? 109.010 142.627 135.480 1.00 110.54 ? 383  SER A OG    1 
ATOM   2657  N  N     . ILE A 1  384  ? 109.533 144.662 137.434 1.00 104.89 ? 384  ILE A N     1 
ATOM   2658  C  CA    . ILE A 1  384  ? 110.463 145.079 138.481 1.00 104.89 ? 384  ILE A CA    1 
ATOM   2659  C  C     . ILE A 1  384  ? 109.939 146.322 139.187 1.00 104.89 ? 384  ILE A C     1 
ATOM   2660  O  O     . ILE A 1  384  ? 110.068 146.467 140.407 1.00 104.89 ? 384  ILE A O     1 
ATOM   2661  C  CB    . ILE A 1  384  ? 111.866 145.304 137.882 1.00 100.53 ? 384  ILE A CB    1 
ATOM   2662  C  CG1   . ILE A 1  384  ? 112.519 143.963 137.534 1.00 100.53 ? 384  ILE A CG1   1 
ATOM   2663  C  CG2   . ILE A 1  384  ? 112.734 146.141 138.802 1.00 100.53 ? 384  ILE A CG2   1 
ATOM   2664  C  CD1   . ILE A 1  384  ? 113.826 144.097 136.776 1.00 100.53 ? 384  ILE A CD1   1 
ATOM   2665  N  N     . ALA A 1  385  ? 109.321 147.232 138.429 1.00 108.15 ? 385  ALA A N     1 
ATOM   2666  C  CA    . ALA A 1  385  ? 108.692 148.399 139.036 1.00 108.15 ? 385  ALA A CA    1 
ATOM   2667  C  C     . ALA A 1  385  ? 107.396 148.031 139.747 1.00 108.15 ? 385  ALA A C     1 
ATOM   2668  O  O     . ALA A 1  385  ? 106.906 148.802 140.578 1.00 108.15 ? 385  ALA A O     1 
ATOM   2669  C  CB    . ALA A 1  385  ? 108.441 149.467 137.971 1.00 108.85 ? 385  ALA A CB    1 
ATOM   2670  N  N     . ALA A 1  386  ? 106.830 146.860 139.449 1.00 112.64 ? 386  ALA A N     1 
ATOM   2671  C  CA    . ALA A 1  386  ? 105.615 146.423 140.130 1.00 112.64 ? 386  ALA A CA    1 
ATOM   2672  C  C     . ALA A 1  386  ? 105.921 145.834 141.502 1.00 112.64 ? 386  ALA A C     1 
ATOM   2673  O  O     . ALA A 1  386  ? 105.233 146.138 142.480 1.00 112.64 ? 386  ALA A O     1 
ATOM   2674  C  CB    . ALA A 1  386  ? 104.861 145.409 139.268 1.00 111.84 ? 386  ALA A CB    1 
ATOM   2675  N  N     . ASN A 1  387  ? 106.952 144.995 141.602 1.00 113.23 ? 387  ASN A N     1 
ATOM   2676  C  CA    . ASN A 1  387  ? 107.254 144.374 142.889 1.00 113.23 ? 387  ASN A CA    1 
ATOM   2677  C  C     . ASN A 1  387  ? 107.950 145.347 143.835 1.00 113.23 ? 387  ASN A C     1 
ATOM   2678  O  O     . ASN A 1  387  ? 107.594 145.441 145.015 1.00 113.23 ? 387  ASN A O     1 
ATOM   2679  C  CB    . ASN A 1  387  ? 108.101 143.121 142.678 1.00 113.44 ? 387  ASN A CB    1 
ATOM   2680  C  CG    . ASN A 1  387  ? 107.300 141.977 142.105 1.00 113.44 ? 387  ASN A CG    1 
ATOM   2681  O  OD1   . ASN A 1  387  ? 106.080 141.924 142.253 1.00 113.44 ? 387  ASN A OD1   1 
ATOM   2682  N  ND2   . ASN A 1  387  ? 107.983 141.044 141.457 1.00 113.44 ? 387  ASN A ND2   1 
ATOM   2683  N  N     . MET A 1  388  ? 108.947 146.076 143.342 1.00 112.81 ? 388  MET A N     1 
ATOM   2684  C  CA    . MET A 1  388  ? 109.738 146.934 144.216 1.00 112.81 ? 388  MET A CA    1 
ATOM   2685  C  C     . MET A 1  388  ? 108.917 148.135 144.669 1.00 112.81 ? 388  MET A C     1 
ATOM   2686  O  O     . MET A 1  388  ? 108.297 148.822 143.853 1.00 112.81 ? 388  MET A O     1 
ATOM   2687  C  CB    . MET A 1  388  ? 111.002 147.389 143.493 1.00 116.18 ? 388  MET A CB    1 
ATOM   2688  C  CG    . MET A 1  388  ? 111.919 146.240 143.123 1.00 116.18 ? 388  MET A CG    1 
ATOM   2689  S  SD    . MET A 1  388  ? 113.378 146.776 142.223 1.00 116.18 ? 388  MET A SD    1 
ATOM   2690  C  CE    . MET A 1  388  ? 114.319 147.514 143.544 1.00 116.18 ? 388  MET A CE    1 
ATOM   2691  N  N     . THR A 1  389  ? 108.917 148.389 145.976 1.00 118.51 ? 389  THR A N     1 
ATOM   2692  C  CA    . THR A 1  389  ? 108.099 149.435 146.569 1.00 118.51 ? 389  THR A CA    1 
ATOM   2693  C  C     . THR A 1  389  ? 108.965 150.397 147.368 1.00 118.51 ? 389  THR A C     1 
ATOM   2694  O  O     . THR A 1  389  ? 110.075 150.067 147.791 1.00 118.51 ? 389  THR A O     1 
ATOM   2695  C  CB    . THR A 1  389  ? 107.013 148.851 147.479 1.00 124.03 ? 389  THR A CB    1 
ATOM   2696  O  OG1   . THR A 1  389  ? 107.617 148.032 148.488 1.00 124.03 ? 389  THR A OG1   1 
ATOM   2697  C  CG2   . THR A 1  389  ? 106.036 148.031 146.671 1.00 124.03 ? 389  THR A CG2   1 
ATOM   2698  N  N     . PHE A 1  390  ? 108.431 151.598 147.575 1.00 126.01 ? 390  PHE A N     1 
ATOM   2699  C  CA    . PHE A 1  390  ? 109.063 152.609 148.411 1.00 126.01 ? 390  PHE A CA    1 
ATOM   2700  C  C     . PHE A 1  390  ? 108.091 152.957 149.525 1.00 126.01 ? 390  PHE A C     1 
ATOM   2701  O  O     . PHE A 1  390  ? 106.924 153.269 149.258 1.00 126.01 ? 390  PHE A O     1 
ATOM   2702  C  CB    . PHE A 1  390  ? 109.434 153.853 147.596 1.00 125.33 ? 390  PHE A CB    1 
ATOM   2703  C  CG    . PHE A 1  390  ? 110.118 154.927 148.396 1.00 125.33 ? 390  PHE A CG    1 
ATOM   2704  C  CD1   . PHE A 1  390  ? 111.469 154.832 148.684 1.00 125.33 ? 390  PHE A CD1   1 
ATOM   2705  C  CD2   . PHE A 1  390  ? 109.420 156.036 148.845 1.00 125.33 ? 390  PHE A CD2   1 
ATOM   2706  C  CE1   . PHE A 1  390  ? 112.109 155.813 149.412 1.00 125.33 ? 390  PHE A CE1   1 
ATOM   2707  C  CE2   . PHE A 1  390  ? 110.058 157.021 149.578 1.00 125.33 ? 390  PHE A CE2   1 
ATOM   2708  C  CZ    . PHE A 1  390  ? 111.405 156.908 149.860 1.00 125.33 ? 390  PHE A CZ    1 
ATOM   2709  N  N     . ALA A 1  391  ? 108.560 152.871 150.767 1.00 132.99 ? 391  ALA A N     1 
ATOM   2710  C  CA    . ALA A 1  391  ? 107.741 153.225 151.913 1.00 132.99 ? 391  ALA A CA    1 
ATOM   2711  C  C     . ALA A 1  391  ? 107.628 154.743 152.032 1.00 132.99 ? 391  ALA A C     1 
ATOM   2712  O  O     . ALA A 1  391  ? 108.604 155.482 151.886 1.00 132.99 ? 391  ALA A O     1 
ATOM   2713  C  CB    . ALA A 1  391  ? 108.324 152.629 153.194 1.00 130.96 ? 391  ALA A CB    1 
ATOM   2714  N  N     . GLU A 1  392  ? 106.411 155.203 152.311 1.00 143.96 ? 392  GLU A N     1 
ATOM   2715  C  CA    . GLU A 1  392  ? 106.093 156.621 152.238 1.00 143.96 ? 392  GLU A CA    1 
ATOM   2716  C  C     . GLU A 1  392  ? 105.352 157.037 153.500 1.00 143.96 ? 392  GLU A C     1 
ATOM   2717  O  O     . GLU A 1  392  ? 104.669 156.232 154.133 1.00 143.96 ? 392  GLU A O     1 
ATOM   2718  C  CB    . GLU A 1  392  ? 105.263 156.915 150.983 1.00 144.48 ? 392  GLU A CB    1 
ATOM   2719  C  CG    . GLU A 1  392  ? 104.919 158.367 150.750 1.00 144.48 ? 392  GLU A CG    1 
ATOM   2720  C  CD    . GLU A 1  392  ? 104.186 158.566 149.445 1.00 144.48 ? 392  GLU A CD    1 
ATOM   2721  O  OE1   . GLU A 1  392  ? 103.974 157.563 148.729 1.00 144.48 ? 392  GLU A OE1   1 
ATOM   2722  O  OE2   . GLU A 1  392  ? 103.813 159.716 149.135 1.00 144.48 ? 392  GLU A OE2   1 
ATOM   2723  N  N     . ILE A 1  393  ? 105.502 158.306 153.870 1.00 144.28 ? 393  ILE A N     1 
ATOM   2724  C  CA    . ILE A 1  393  ? 104.811 158.884 155.016 1.00 144.28 ? 393  ILE A CA    1 
ATOM   2725  C  C     . ILE A 1  393  ? 103.714 159.799 154.492 1.00 144.28 ? 393  ILE A C     1 
ATOM   2726  O  O     . ILE A 1  393  ? 103.938 160.568 153.551 1.00 144.28 ? 393  ILE A O     1 
ATOM   2727  C  CB    . ILE A 1  393  ? 105.782 159.645 155.935 1.00 144.91 ? 393  ILE A CB    1 
ATOM   2728  C  CG1   . ILE A 1  393  ? 106.813 158.686 156.528 1.00 144.91 ? 393  ILE A CG1   1 
ATOM   2729  C  CG2   . ILE A 1  393  ? 105.025 160.333 157.052 1.00 144.91 ? 393  ILE A CG2   1 
ATOM   2730  C  CD1   . ILE A 1  393  ? 107.942 159.376 157.260 1.00 144.91 ? 393  ILE A CD1   1 
ATOM   2731  N  N     . VAL A 1  394  ? 102.528 159.707 155.090 1.00 149.49 ? 394  VAL A N     1 
ATOM   2732  C  CA    . VAL A 1  394  ? 101.390 160.509 154.653 1.00 149.49 ? 394  VAL A CA    1 
ATOM   2733  C  C     . VAL A 1  394  ? 101.434 161.860 155.355 1.00 149.49 ? 394  VAL A C     1 
ATOM   2734  O  O     . VAL A 1  394  ? 101.611 161.933 156.577 1.00 149.49 ? 394  VAL A O     1 
ATOM   2735  C  CB    . VAL A 1  394  ? 100.067 159.779 154.937 1.00 146.69 ? 394  VAL A CB    1 
ATOM   2736  C  CG1   . VAL A 1  394  ? 98.887  160.638 154.512 1.00 146.69 ? 394  VAL A CG1   1 
ATOM   2737  C  CG2   . VAL A 1  394  ? 100.039 158.434 154.235 1.00 146.69 ? 394  VAL A CG2   1 
ATOM   2738  N  N     . THR A 1  395  ? 101.274 162.932 154.583 1.00 151.93 ? 395  THR A N     1 
ATOM   2739  C  CA    . THR A 1  395  ? 101.248 164.290 155.107 1.00 151.93 ? 395  THR A CA    1 
ATOM   2740  C  C     . THR A 1  395  ? 99.967  164.968 154.628 1.00 151.93 ? 395  THR A C     1 
ATOM   2741  O  O     . THR A 1  395  ? 99.205  164.360 153.863 1.00 151.93 ? 395  THR A O     1 
ATOM   2742  C  CB    . THR A 1  395  ? 102.488 165.064 154.647 1.00 150.92 ? 395  THR A CB    1 
ATOM   2743  O  OG1   . THR A 1  395  ? 102.552 165.072 153.214 1.00 150.92 ? 395  THR A OG1   1 
ATOM   2744  C  CG2   . THR A 1  395  ? 103.747 164.436 155.201 1.00 150.92 ? 395  THR A CG2   1 
ATOM   2745  N  N     . PRO A 1  396  ? 99.675  166.206 155.041 1.00 151.21 ? 396  PRO A N     1 
ATOM   2746  C  CA    . PRO A 1  396  ? 98.536  166.913 154.433 1.00 151.21 ? 396  PRO A CA    1 
ATOM   2747  C  C     . PRO A 1  396  ? 98.737  167.231 152.960 1.00 151.21 ? 396  PRO A C     1 
ATOM   2748  O  O     . PRO A 1  396  ? 97.758  167.520 152.260 1.00 151.21 ? 396  PRO A O     1 
ATOM   2749  C  CB    . PRO A 1  396  ? 98.422  168.186 155.284 1.00 150.17 ? 396  PRO A CB    1 
ATOM   2750  C  CG    . PRO A 1  396  ? 99.780  168.363 155.887 1.00 150.17 ? 396  PRO A CG    1 
ATOM   2751  C  CD    . PRO A 1  396  ? 100.217 166.963 156.185 1.00 150.17 ? 396  PRO A CD    1 
ATOM   2752  N  N     . PHE A 1  397  ? 99.976  167.189 152.467 1.00 152.18 ? 397  PHE A N     1 
ATOM   2753  C  CA    . PHE A 1  397  ? 100.224 167.467 151.056 1.00 152.18 ? 397  PHE A CA    1 
ATOM   2754  C  C     . PHE A 1  397  ? 99.822  166.290 150.174 1.00 152.18 ? 397  PHE A C     1 
ATOM   2755  O  O     . PHE A 1  397  ? 99.101  166.458 149.184 1.00 152.18 ? 397  PHE A O     1 
ATOM   2756  C  CB    . PHE A 1  397  ? 101.700 167.805 150.845 1.00 155.28 ? 397  PHE A CB    1 
ATOM   2757  C  CG    . PHE A 1  397  ? 102.148 169.043 151.562 1.00 155.28 ? 397  PHE A CG    1 
ATOM   2758  C  CD1   . PHE A 1  397  ? 101.959 170.291 150.996 1.00 155.28 ? 397  PHE A CD1   1 
ATOM   2759  C  CD2   . PHE A 1  397  ? 102.764 168.959 152.799 1.00 155.28 ? 397  PHE A CD2   1 
ATOM   2760  C  CE1   . PHE A 1  397  ? 102.373 171.434 151.651 1.00 155.28 ? 397  PHE A CE1   1 
ATOM   2761  C  CE2   . PHE A 1  397  ? 103.180 170.100 153.460 1.00 155.28 ? 397  PHE A CE2   1 
ATOM   2762  C  CZ    . PHE A 1  397  ? 102.983 171.338 152.884 1.00 155.28 ? 397  PHE A CZ    1 
ATOM   2763  N  N     . ASN A 1  398  ? 100.285 165.086 150.517 1.00 150.94 ? 398  ASN A N     1 
ATOM   2764  C  CA    . ASN A 1  398  ? 100.172 163.936 149.629 1.00 150.94 ? 398  ASN A CA    1 
ATOM   2765  C  C     . ASN A 1  398  ? 98.985  163.028 149.929 1.00 150.94 ? 398  ASN A C     1 
ATOM   2766  O  O     . ASN A 1  398  ? 98.840  162.000 149.260 1.00 150.94 ? 398  ASN A O     1 
ATOM   2767  C  CB    . ASN A 1  398  ? 101.470 163.120 149.670 1.00 149.67 ? 398  ASN A CB    1 
ATOM   2768  C  CG    . ASN A 1  398  ? 101.822 162.634 151.069 1.00 149.67 ? 398  ASN A CG    1 
ATOM   2769  O  OD1   . ASN A 1  398  ? 100.949 162.362 151.892 1.00 149.67 ? 398  ASN A OD1   1 
ATOM   2770  N  ND2   . ASN A 1  398  ? 103.117 162.519 151.338 1.00 149.67 ? 398  ASN A ND2   1 
ATOM   2771  N  N     . ILE A 1  399  ? 98.142  163.366 150.908 1.00 152.45 ? 399  ILE A N     1 
ATOM   2772  C  CA    . ILE A 1  399  ? 97.092  162.434 151.316 1.00 152.45 ? 399  ILE A CA    1 
ATOM   2773  C  C     . ILE A 1  399  ? 96.095  162.198 150.186 1.00 152.45 ? 399  ILE A C     1 
ATOM   2774  O  O     . ILE A 1  399  ? 95.539  161.100 150.062 1.00 152.45 ? 399  ILE A O     1 
ATOM   2775  C  CB    . ILE A 1  399  ? 96.398  162.933 152.600 1.00 148.41 ? 399  ILE A CB    1 
ATOM   2776  C  CG1   . ILE A 1  399  ? 95.413  161.882 153.115 1.00 148.41 ? 399  ILE A CG1   1 
ATOM   2777  C  CG2   . ILE A 1  399  ? 95.701  164.265 152.366 1.00 148.41 ? 399  ILE A CG2   1 
ATOM   2778  C  CD1   . ILE A 1  399  ? 94.906  162.150 154.510 1.00 148.41 ? 399  ILE A CD1   1 
ATOM   2779  N  N     . ASP A 1  400  ? 95.869  163.200 149.335 1.00 155.23 ? 400  ASP A N     1 
ATOM   2780  C  CA    . ASP A 1  400  ? 94.982  163.014 148.190 1.00 155.23 ? 400  ASP A CA    1 
ATOM   2781  C  C     . ASP A 1  400  ? 95.578  162.015 147.204 1.00 155.23 ? 400  ASP A C     1 
ATOM   2782  O  O     . ASP A 1  400  ? 94.934  161.028 146.821 1.00 155.23 ? 400  ASP A O     1 
ATOM   2783  C  CB    . ASP A 1  400  ? 94.730  164.359 147.507 1.00 162.81 ? 400  ASP A CB    1 
ATOM   2784  C  CG    . ASP A 1  400  ? 93.919  165.309 148.367 1.00 162.81 ? 400  ASP A CG    1 
ATOM   2785  O  OD1   . ASP A 1  400  ? 93.279  164.844 149.333 1.00 162.81 ? 400  ASP A OD1   1 
ATOM   2786  O  OD2   . ASP A 1  400  ? 93.929  166.525 148.080 1.00 162.81 ? 400  ASP A OD2   1 
ATOM   2787  N  N     . ARG A 1  401  ? 96.821  162.264 146.786 1.00 153.43 ? 401  ARG A N     1 
ATOM   2788  C  CA    . ARG A 1  401  ? 97.505  161.369 145.860 1.00 153.43 ? 401  ARG A CA    1 
ATOM   2789  C  C     . ARG A 1  401  ? 97.602  159.957 146.421 1.00 153.43 ? 401  ARG A C     1 
ATOM   2790  O  O     . ARG A 1  401  ? 97.444  158.974 145.687 1.00 153.43 ? 401  ARG A O     1 
ATOM   2791  C  CB    . ARG A 1  401  ? 98.894  161.929 145.550 1.00 148.22 ? 401  ARG A CB    1 
ATOM   2792  C  CG    . ARG A 1  401  ? 99.738  161.083 144.622 1.00 148.22 ? 401  ARG A CG    1 
ATOM   2793  C  CD    . ARG A 1  401  ? 101.064 161.770 144.331 1.00 148.22 ? 401  ARG A CD    1 
ATOM   2794  N  NE    . ARG A 1  401  ? 101.866 161.951 145.539 1.00 148.22 ? 401  ARG A NE    1 
ATOM   2795  C  CZ    . ARG A 1  401  ? 102.665 161.022 146.055 1.00 148.22 ? 401  ARG A CZ    1 
ATOM   2796  N  NH1   . ARG A 1  401  ? 102.776 159.838 145.471 1.00 148.22 ? 401  ARG A NH1   1 
ATOM   2797  N  NH2   . ARG A 1  401  ? 103.355 161.279 147.158 1.00 148.22 ? 401  ARG A NH2   1 
ATOM   2798  N  N     . LEU A 1  402  ? 97.848  159.834 147.727 1.00 152.67 ? 402  LEU A N     1 
ATOM   2799  C  CA    . LEU A 1  402  ? 98.004  158.509 148.315 1.00 152.67 ? 402  LEU A CA    1 
ATOM   2800  C  C     . LEU A 1  402  ? 96.663  157.807 148.472 1.00 152.67 ? 402  LEU A C     1 
ATOM   2801  O  O     . LEU A 1  402  ? 96.601  156.575 148.450 1.00 152.67 ? 402  LEU A O     1 
ATOM   2802  C  CB    . LEU A 1  402  ? 98.737  158.606 149.650 1.00 147.91 ? 402  LEU A CB    1 
ATOM   2803  C  CG    . LEU A 1  402  ? 100.183 159.064 149.465 1.00 147.91 ? 402  LEU A CG    1 
ATOM   2804  C  CD1   . LEU A 1  402  ? 100.917 159.196 150.792 1.00 147.91 ? 402  LEU A CD1   1 
ATOM   2805  C  CD2   . LEU A 1  402  ? 100.899 158.111 148.527 1.00 147.91 ? 402  LEU A CD2   1 
ATOM   2806  N  N     . GLN A 1  403  ? 95.575  158.563 148.628 1.00 154.25 ? 403  GLN A N     1 
ATOM   2807  C  CA    . GLN A 1  403  ? 94.263  157.928 148.561 1.00 154.25 ? 403  GLN A CA    1 
ATOM   2808  C  C     . GLN A 1  403  ? 93.932  157.500 147.138 1.00 154.25 ? 403  GLN A C     1 
ATOM   2809  O  O     . GLN A 1  403  ? 93.187  156.533 146.941 1.00 154.25 ? 403  GLN A O     1 
ATOM   2810  C  CB    . GLN A 1  403  ? 93.184  158.856 149.116 1.00 158.92 ? 403  GLN A CB    1 
ATOM   2811  C  CG    . GLN A 1  403  ? 93.254  159.040 150.623 1.00 158.92 ? 403  GLN A CG    1 
ATOM   2812  C  CD    . GLN A 1  403  ? 92.211  160.006 151.143 1.00 158.92 ? 403  GLN A CD    1 
ATOM   2813  O  OE1   . GLN A 1  403  ? 91.732  160.873 150.413 1.00 158.92 ? 403  GLN A OE1   1 
ATOM   2814  N  NE2   . GLN A 1  403  ? 91.849  159.859 152.413 1.00 158.92 ? 403  GLN A NE2   1 
ATOM   2815  N  N     . GLU A 1  404  ? 94.481  158.194 146.138 1.00 155.34 ? 404  GLU A N     1 
ATOM   2816  C  CA    . GLU A 1  404  ? 94.351  157.720 144.764 1.00 155.34 ? 404  GLU A CA    1 
ATOM   2817  C  C     . GLU A 1  404  ? 95.091  156.400 144.572 1.00 155.34 ? 404  GLU A C     1 
ATOM   2818  O  O     . GLU A 1  404  ? 94.522  155.421 144.073 1.00 155.34 ? 404  GLU A O     1 
ATOM   2819  C  CB    . GLU A 1  404  ? 94.870  158.778 143.791 1.00 159.52 ? 404  GLU A CB    1 
ATOM   2820  C  CG    . GLU A 1  404  ? 94.055  160.058 143.770 1.00 159.52 ? 404  GLU A CG    1 
ATOM   2821  C  CD    . GLU A 1  404  ? 94.631  161.097 142.829 1.00 159.52 ? 404  GLU A CD    1 
ATOM   2822  O  OE1   . GLU A 1  404  ? 95.756  160.890 142.327 1.00 159.52 ? 404  GLU A OE1   1 
ATOM   2823  O  OE2   . GLU A 1  404  ? 93.960  162.122 142.591 1.00 159.52 ? 404  GLU A OE2   1 
ATOM   2824  N  N     . LEU A 1  405  ? 96.367  156.356 144.971 1.00 154.88 ? 405  LEU A N     1 
ATOM   2825  C  CA    . LEU A 1  405  ? 97.155  155.135 144.819 1.00 154.88 ? 405  LEU A CA    1 
ATOM   2826  C  C     . LEU A 1  405  ? 96.531  153.974 145.584 1.00 154.88 ? 405  LEU A C     1 
ATOM   2827  O  O     . LEU A 1  405  ? 96.380  152.871 145.049 1.00 154.88 ? 405  LEU A O     1 
ATOM   2828  C  CB    . LEU A 1  405  ? 98.592  155.372 145.289 1.00 149.89 ? 405  LEU A CB    1 
ATOM   2829  C  CG    . LEU A 1  405  ? 99.442  156.396 144.532 1.00 149.89 ? 405  LEU A CG    1 
ATOM   2830  C  CD1   . LEU A 1  405  ? 100.795 156.559 145.204 1.00 149.89 ? 405  LEU A CD1   1 
ATOM   2831  C  CD2   . LEU A 1  405  ? 99.611  156.009 143.075 1.00 149.89 ? 405  LEU A CD2   1 
ATOM   2832  N  N     . VAL A 1  406  ? 96.164  154.209 146.847 1.00 155.73 ? 406  VAL A N     1 
ATOM   2833  C  CA    . VAL A 1  406  ? 95.525  153.167 147.649 1.00 155.73 ? 406  VAL A CA    1 
ATOM   2834  C  C     . VAL A 1  406  ? 94.204  152.742 147.020 1.00 155.73 ? 406  VAL A C     1 
ATOM   2835  O  O     . VAL A 1  406  ? 93.824  151.565 147.074 1.00 155.73 ? 406  VAL A O     1 
ATOM   2836  C  CB    . VAL A 1  406  ? 95.341  153.647 149.102 1.00 159.04 ? 406  VAL A CB    1 
ATOM   2837  C  CG1   . VAL A 1  406  ? 94.484  152.671 149.885 1.00 159.04 ? 406  VAL A CG1   1 
ATOM   2838  C  CG2   . VAL A 1  406  ? 96.694  153.792 149.779 1.00 159.04 ? 406  VAL A CG2   1 
ATOM   2839  N  N     . ARG A 1  407  ? 93.490  153.684 146.399 1.00 157.75 ? 407  ARG A N     1 
ATOM   2840  C  CA    . ARG A 1  407  ? 92.275  153.318 145.677 1.00 157.75 ? 407  ARG A CA    1 
ATOM   2841  C  C     . ARG A 1  407  ? 92.590  152.370 144.527 1.00 157.75 ? 407  ARG A C     1 
ATOM   2842  O  O     . ARG A 1  407  ? 91.844  151.418 144.270 1.00 157.75 ? 407  ARG A O     1 
ATOM   2843  C  CB    . ARG A 1  407  ? 91.558  154.566 145.160 1.00 161.23 ? 407  ARG A CB    1 
ATOM   2844  C  CG    . ARG A 1  407  ? 90.278  154.250 144.394 1.00 161.23 ? 407  ARG A CG    1 
ATOM   2845  C  CD    . ARG A 1  407  ? 89.479  155.501 144.076 1.00 161.23 ? 407  ARG A CD    1 
ATOM   2846  N  NE    . ARG A 1  407  ? 88.953  156.137 145.280 1.00 161.23 ? 407  ARG A NE    1 
ATOM   2847  C  CZ    . ARG A 1  407  ? 89.447  157.248 145.814 1.00 161.23 ? 407  ARG A CZ    1 
ATOM   2848  N  NH1   . ARG A 1  407  ? 90.486  157.851 145.250 1.00 161.23 ? 407  ARG A NH1   1 
ATOM   2849  N  NH2   . ARG A 1  407  ? 88.905  157.758 146.912 1.00 161.23 ? 407  ARG A NH2   1 
ATOM   2850  N  N     . ARG A 1  408  ? 93.699  152.612 143.823 1.00 155.87 ? 408  ARG A N     1 
ATOM   2851  C  CA    . ARG A 1  408  ? 94.073  151.715 142.733 1.00 155.87 ? 408  ARG A CA    1 
ATOM   2852  C  C     . ARG A 1  408  ? 94.516  150.351 143.249 1.00 155.87 ? 408  ARG A C     1 
ATOM   2853  O  O     . ARG A 1  408  ? 93.997  149.324 142.798 1.00 155.87 ? 408  ARG A O     1 
ATOM   2854  C  CB    . ARG A 1  408  ? 95.170  152.347 141.877 1.00 154.38 ? 408  ARG A CB    1 
ATOM   2855  C  CG    . ARG A 1  408  ? 94.710  153.573 141.107 1.00 154.38 ? 408  ARG A CG    1 
ATOM   2856  C  CD    . ARG A 1  408  ? 95.797  154.105 140.192 1.00 154.38 ? 408  ARG A CD    1 
ATOM   2857  N  NE    . ARG A 1  408  ? 95.366  155.306 139.484 1.00 154.38 ? 408  ARG A NE    1 
ATOM   2858  C  CZ    . ARG A 1  408  ? 96.147  156.023 138.683 1.00 154.38 ? 408  ARG A CZ    1 
ATOM   2859  N  NH1   . ARG A 1  408  ? 97.403  155.662 138.484 1.00 154.38 ? 408  ARG A NH1   1 
ATOM   2860  N  NH2   . ARG A 1  408  ? 95.671  157.102 138.079 1.00 154.38 ? 408  ARG A NH2   1 
ATOM   2861  N  N     . GLY A 1  409  ? 95.461  150.314 144.185 1.00 153.36 ? 409  GLY A N     1 
ATOM   2862  C  CA    . GLY A 1  409  ? 95.849  149.044 144.766 1.00 153.36 ? 409  GLY A CA    1 
ATOM   2863  C  C     . GLY A 1  409  ? 96.935  148.332 143.971 1.00 153.36 ? 409  GLY A C     1 
ATOM   2864  O  O     . GLY A 1  409  ? 97.677  148.927 143.186 1.00 153.36 ? 409  GLY A O     1 
ATOM   2865  N  N     . ASN A 1  410  ? 97.013  147.021 144.189 1.00 155.09 ? 410  ASN A N     1 
ATOM   2866  C  CA    . ASN A 1  410  ? 98.036  146.200 143.557 1.00 155.09 ? 410  ASN A CA    1 
ATOM   2867  C  C     . ASN A 1  410  ? 97.577  145.589 142.237 1.00 155.09 ? 410  ASN A C     1 
ATOM   2868  O  O     . ASN A 1  410  ? 98.366  144.897 141.585 1.00 155.09 ? 410  ASN A O     1 
ATOM   2869  C  CB    . ASN A 1  410  ? 98.479  145.089 144.518 1.00 153.15 ? 410  ASN A CB    1 
ATOM   2870  C  CG    . ASN A 1  410  ? 99.789  144.440 144.106 1.00 153.15 ? 410  ASN A CG    1 
ATOM   2871  O  OD1   . ASN A 1  410  ? 100.647 145.076 143.493 1.00 153.15 ? 410  ASN A OD1   1 
ATOM   2872  N  ND2   . ASN A 1  410  ? 99.951  143.169 144.451 1.00 153.15 ? 410  ASN A ND2   1 
ATOM   2873  N  N     . SER A 1  411  ? 96.331  145.829 141.824 1.00 152.38 ? 411  SER A N     1 
ATOM   2874  C  CA    . SER A 1  411  ? 95.859  145.302 140.547 1.00 152.38 ? 411  SER A CA    1 
ATOM   2875  C  C     . SER A 1  411  ? 96.293  146.203 139.398 1.00 152.38 ? 411  SER A C     1 
ATOM   2876  O  O     . SER A 1  411  ? 97.171  145.842 138.605 1.00 152.38 ? 411  SER A O     1 
ATOM   2877  C  CB    . SER A 1  411  ? 94.338  145.150 140.572 1.00 149.90 ? 411  SER A CB    1 
ATOM   2878  O  OG    . SER A 1  411  ? 93.931  144.190 141.530 1.00 149.90 ? 411  SER A OG    1 
ATOM   2879  N  N     . GLN A 1  412  ? 95.683  147.379 139.287 1.00 150.72 ? 412  GLN A N     1 
ATOM   2880  C  CA    . GLN A 1  412  ? 96.213  148.404 138.404 1.00 150.72 ? 412  GLN A CA    1 
ATOM   2881  C  C     . GLN A 1  412  ? 97.570  148.865 138.930 1.00 150.72 ? 412  GLN A C     1 
ATOM   2882  O  O     . GLN A 1  412  ? 97.771  149.014 140.140 1.00 150.72 ? 412  GLN A O     1 
ATOM   2883  C  CB    . GLN A 1  412  ? 95.240  149.579 138.297 1.00 153.95 ? 412  GLN A CB    1 
ATOM   2884  C  CG    . GLN A 1  412  ? 93.910  149.215 137.647 1.00 153.95 ? 412  GLN A CG    1 
ATOM   2885  C  CD    . GLN A 1  412  ? 92.925  150.368 137.626 1.00 153.95 ? 412  GLN A CD    1 
ATOM   2886  O  OE1   . GLN A 1  412  ? 93.012  151.290 138.438 1.00 153.95 ? 412  GLN A OE1   1 
ATOM   2887  N  NE2   . GLN A 1  412  ? 91.975  150.319 136.699 1.00 153.95 ? 412  GLN A NE2   1 
ATOM   2888  N  N     . TYR A 1  413  ? 98.514  149.078 138.003 1.00 144.57 ? 413  TYR A N     1 
ATOM   2889  C  CA    . TYR A 1  413  ? 99.914  149.238 138.399 1.00 144.57 ? 413  TYR A CA    1 
ATOM   2890  C  C     . TYR A 1  413  ? 100.149 150.366 139.397 1.00 144.57 ? 413  TYR A C     1 
ATOM   2891  O  O     . TYR A 1  413  ? 100.652 150.091 140.498 1.00 144.57 ? 413  TYR A O     1 
ATOM   2892  C  CB    . TYR A 1  413  ? 100.812 149.399 137.169 1.00 134.23 ? 413  TYR A CB    1 
ATOM   2893  C  CG    . TYR A 1  413  ? 102.191 149.871 137.577 1.00 134.23 ? 413  TYR A CG    1 
ATOM   2894  C  CD1   . TYR A 1  413  ? 103.075 149.019 138.227 1.00 134.23 ? 413  TYR A CD1   1 
ATOM   2895  C  CD2   . TYR A 1  413  ? 102.597 151.177 137.340 1.00 134.23 ? 413  TYR A CD2   1 
ATOM   2896  C  CE1   . TYR A 1  413  ? 104.327 149.451 138.619 1.00 134.23 ? 413  TYR A CE1   1 
ATOM   2897  C  CE2   . TYR A 1  413  ? 103.841 151.617 137.729 1.00 134.23 ? 413  TYR A CE2   1 
ATOM   2898  C  CZ    . TYR A 1  413  ? 104.701 150.754 138.364 1.00 134.23 ? 413  TYR A CZ    1 
ATOM   2899  O  OH    . TYR A 1  413  ? 105.938 151.212 138.742 1.00 134.23 ? 413  TYR A OH    1 
ATOM   2900  N  N     . PRO A 1  414  ? 99.809  151.635 139.107 1.00 147.99 ? 414  PRO A N     1 
ATOM   2901  C  CA    . PRO A 1  414  ? 100.260 152.714 139.998 1.00 147.99 ? 414  PRO A CA    1 
ATOM   2902  C  C     . PRO A 1  414  ? 99.529  152.709 141.331 1.00 147.99 ? 414  PRO A C     1 
ATOM   2903  O  O     . PRO A 1  414  ? 98.536  153.419 141.505 1.00 147.99 ? 414  PRO A O     1 
ATOM   2904  C  CB    . PRO A 1  414  ? 99.951  153.983 139.197 1.00 142.86 ? 414  PRO A CB    1 
ATOM   2905  C  CG    . PRO A 1  414  ? 99.828  153.524 137.780 1.00 142.86 ? 414  PRO A CG    1 
ATOM   2906  C  CD    . PRO A 1  414  ? 99.162  152.189 137.906 1.00 142.86 ? 414  PRO A CD    1 
ATOM   2907  N  N     . GLY A 1  415  ? 100.014 151.912 142.281 1.00 146.02 ? 415  GLY A N     1 
ATOM   2908  C  CA    . GLY A 1  415  ? 99.271  151.654 143.499 1.00 146.02 ? 415  GLY A CA    1 
ATOM   2909  C  C     . GLY A 1  415  ? 100.136 151.288 144.688 1.00 146.02 ? 415  GLY A C     1 
ATOM   2910  O  O     . GLY A 1  415  ? 101.355 151.476 144.659 1.00 146.02 ? 415  GLY A O     1 
ATOM   2911  N  N     . ALA A 1  416  ? 99.509  150.822 145.764 1.00 149.29 ? 416  ALA A N     1 
ATOM   2912  C  CA    . ALA A 1  416  ? 100.216 150.447 146.979 1.00 149.29 ? 416  ALA A CA    1 
ATOM   2913  C  C     . ALA A 1  416  ? 99.999  148.971 147.275 1.00 149.29 ? 416  ALA A C     1 
ATOM   2914  O  O     . ALA A 1  416  ? 98.879  148.467 147.161 1.00 149.29 ? 416  ALA A O     1 
ATOM   2915  C  CB    . ALA A 1  416  ? 99.750  151.283 148.171 1.00 149.49 ? 416  ALA A CB    1 
ATOM   2916  N  N     . LYS A 1  417  ? 101.078 148.279 147.648 1.00 153.83 ? 417  LYS A N     1 
ATOM   2917  C  CA    . LYS A 1  417  ? 100.941 146.903 148.113 1.00 153.83 ? 417  LYS A CA    1 
ATOM   2918  C  C     . LYS A 1  417  ? 100.508 146.845 149.575 1.00 153.83 ? 417  LYS A C     1 
ATOM   2919  O  O     . LYS A 1  417  ? 99.649  146.036 149.940 1.00 153.83 ? 417  LYS A O     1 
ATOM   2920  C  CB    . LYS A 1  417  ? 102.248 146.132 147.910 1.00 147.88 ? 417  LYS A CB    1 
ATOM   2921  C  CG    . LYS A 1  417  ? 102.538 145.756 146.464 1.00 147.88 ? 417  LYS A CG    1 
ATOM   2922  C  CD    . LYS A 1  417  ? 103.975 145.290 146.291 1.00 147.88 ? 417  LYS A CD    1 
ATOM   2923  C  CE    . LYS A 1  417  ? 104.276 144.078 147.155 1.00 147.88 ? 417  LYS A CE    1 
ATOM   2924  N  NZ    . LYS A 1  417  ? 105.690 143.631 147.030 1.00 147.88 ? 417  LYS A NZ    1 
ATOM   2925  N  N     . TYR A 1  418  ? 101.085 147.693 150.426 1.00 155.87 ? 418  TYR A N     1 
ATOM   2926  C  CA    . TYR A 1  418  ? 100.788 147.665 151.851 1.00 155.87 ? 418  TYR A CA    1 
ATOM   2927  C  C     . TYR A 1  418  ? 100.571 149.068 152.399 1.00 155.87 ? 418  TYR A C     1 
ATOM   2928  O  O     . TYR A 1  418  ? 101.151 150.048 151.915 1.00 155.87 ? 418  TYR A O     1 
ATOM   2929  C  CB    . TYR A 1  418  ? 101.907 147.004 152.668 1.00 168.68 ? 418  TYR A CB    1 
ATOM   2930  C  CG    . TYR A 1  418  ? 102.120 145.531 152.412 1.00 168.68 ? 418  TYR A CG    1 
ATOM   2931  C  CD1   . TYR A 1  418  ? 101.323 144.578 153.031 1.00 168.68 ? 418  TYR A CD1   1 
ATOM   2932  C  CD2   . TYR A 1  418  ? 103.153 145.091 151.598 1.00 168.68 ? 418  TYR A CD2   1 
ATOM   2933  C  CE1   . TYR A 1  418  ? 101.526 143.232 152.819 1.00 168.68 ? 418  TYR A CE1   1 
ATOM   2934  C  CE2   . TYR A 1  418  ? 103.365 143.746 151.381 1.00 168.68 ? 418  TYR A CE2   1 
ATOM   2935  C  CZ    . TYR A 1  418  ? 102.548 142.821 151.994 1.00 168.68 ? 418  TYR A CZ    1 
ATOM   2936  O  OH    . TYR A 1  418  ? 102.753 141.478 151.780 1.00 168.68 ? 418  TYR A OH    1 
ATOM   2937  N  N     . ILE A 1  419  ? 99.740  149.139 153.437 1.00 160.38 ? 419  ILE A N     1 
ATOM   2938  C  CA    . ILE A 1  419  ? 99.570  150.329 154.261 1.00 160.38 ? 419  ILE A CA    1 
ATOM   2939  C  C     . ILE A 1  419  ? 100.078 149.999 155.657 1.00 160.38 ? 419  ILE A C     1 
ATOM   2940  O  O     . ILE A 1  419  ? 99.788  148.925 156.192 1.00 160.38 ? 419  ILE A O     1 
ATOM   2941  C  CB    . ILE A 1  419  ? 98.098  150.789 154.315 1.00 158.54 ? 419  ILE A CB    1 
ATOM   2942  C  CG1   . ILE A 1  419  ? 97.606  151.200 152.928 1.00 158.54 ? 419  ILE A CG1   1 
ATOM   2943  C  CG2   . ILE A 1  419  ? 97.937  151.946 155.284 1.00 158.54 ? 419  ILE A CG2   1 
ATOM   2944  C  CD1   . ILE A 1  419  ? 96.116  151.431 152.860 1.00 158.54 ? 419  ILE A CD1   1 
ATOM   2945  N  N     . ILE A 1  420  ? 100.840 150.916 156.245 1.00 158.98 ? 420  ILE A N     1 
ATOM   2946  C  CA    . ILE A 1  420  ? 101.458 150.710 157.549 1.00 158.98 ? 420  ILE A CA    1 
ATOM   2947  C  C     . ILE A 1  420  ? 100.849 151.704 158.526 1.00 158.98 ? 420  ILE A C     1 
ATOM   2948  O  O     . ILE A 1  420  ? 100.988 152.919 158.345 1.00 158.98 ? 420  ILE A O     1 
ATOM   2949  C  CB    . ILE A 1  420  ? 102.985 150.879 157.498 1.00 157.96 ? 420  ILE A CB    1 
ATOM   2950  C  CG1   . ILE A 1  420  ? 103.620 149.790 156.634 1.00 157.96 ? 420  ILE A CG1   1 
ATOM   2951  C  CG2   . ILE A 1  420  ? 103.575 150.859 158.899 1.00 157.96 ? 420  ILE A CG2   1 
ATOM   2952  C  CD1   . ILE A 1  420  ? 105.084 150.024 156.361 1.00 157.96 ? 420  ILE A CD1   1 
ATOM   2953  N  N     . ARG A 1  421  ? 100.179 151.192 159.558 1.00 165.89 ? 421  ARG A N     1 
ATOM   2954  C  CA    . ARG A 1  421  ? 99.659  152.052 160.607 1.00 165.89 ? 421  ARG A CA    1 
ATOM   2955  C  C     . ARG A 1  421  ? 100.788 152.480 161.543 1.00 165.89 ? 421  ARG A C     1 
ATOM   2956  O  O     . ARG A 1  421  ? 101.946 152.080 161.393 1.00 165.89 ? 421  ARG A O     1 
ATOM   2957  C  CB    . ARG A 1  421  ? 98.537  151.353 161.375 1.00 166.32 ? 421  ARG A CB    1 
ATOM   2958  C  CG    . ARG A 1  421  ? 97.230  151.228 160.600 1.00 166.32 ? 421  ARG A CG    1 
ATOM   2959  C  CD    . ARG A 1  421  ? 96.062  150.890 161.523 1.00 166.32 ? 421  ARG A CD    1 
ATOM   2960  N  NE    . ARG A 1  421  ? 96.159  149.556 162.109 1.00 166.32 ? 421  ARG A NE    1 
ATOM   2961  C  CZ    . ARG A 1  421  ? 95.631  148.464 161.566 1.00 166.32 ? 421  ARG A CZ    1 
ATOM   2962  N  NH1   . ARG A 1  421  ? 94.954  148.551 160.430 1.00 166.32 ? 421  ARG A NH1   1 
ATOM   2963  N  NH2   . ARG A 1  421  ? 95.765  147.288 162.165 1.00 166.32 ? 421  ARG A NH2   1 
ATOM   2964  N  N     . ASP A 1  422  ? 100.446 153.309 162.531 1.00 168.25 ? 422  ASP A N     1 
ATOM   2965  C  CA    . ASP A 1  422  ? 101.443 153.796 163.475 1.00 168.25 ? 422  ASP A CA    1 
ATOM   2966  C  C     . ASP A 1  422  ? 101.861 152.741 164.489 1.00 168.25 ? 422  ASP A C     1 
ATOM   2967  O  O     . ASP A 1  422  ? 102.835 152.959 165.216 1.00 168.25 ? 422  ASP A O     1 
ATOM   2968  C  CB    . ASP A 1  422  ? 100.918 155.035 164.201 1.00 160.97 ? 422  ASP A CB    1 
ATOM   2969  C  CG    . ASP A 1  422  ? 100.814 156.238 163.289 1.00 160.97 ? 422  ASP A CG    1 
ATOM   2970  O  OD1   . ASP A 1  422  ? 101.421 156.207 162.199 1.00 160.97 ? 422  ASP A OD1   1 
ATOM   2971  O  OD2   . ASP A 1  422  ? 100.126 157.214 163.658 1.00 160.97 ? 422  ASP A OD2   1 
ATOM   2972  N  N     . ASN A 1  423  ? 101.155 151.617 164.555 1.00 172.45 ? 423  ASN A N     1 
ATOM   2973  C  CA    . ASN A 1  423  ? 101.530 150.506 165.417 1.00 172.45 ? 423  ASN A CA    1 
ATOM   2974  C  C     . ASN A 1  423  ? 102.512 149.554 164.749 1.00 172.45 ? 423  ASN A C     1 
ATOM   2975  O  O     . ASN A 1  423  ? 102.891 148.549 165.358 1.00 172.45 ? 423  ASN A O     1 
ATOM   2976  C  CB    . ASN A 1  423  ? 100.283 149.726 165.844 1.00 175.77 ? 423  ASN A CB    1 
ATOM   2977  C  CG    . ASN A 1  423  ? 99.376  150.527 166.752 1.00 175.77 ? 423  ASN A CG    1 
ATOM   2978  O  OD1   . ASN A 1  423  ? 99.813  151.466 167.417 1.00 175.77 ? 423  ASN A OD1   1 
ATOM   2979  N  ND2   . ASN A 1  423  ? 98.101  150.158 166.787 1.00 175.77 ? 423  ASN A ND2   1 
ATOM   2980  N  N     . GLY A 1  424  ? 102.927 149.843 163.517 1.00 171.61 ? 424  GLY A N     1 
ATOM   2981  C  CA    . GLY A 1  424  ? 103.658 148.882 162.725 1.00 171.61 ? 424  GLY A CA    1 
ATOM   2982  C  C     . GLY A 1  424  ? 102.802 147.798 162.114 1.00 171.61 ? 424  GLY A C     1 
ATOM   2983  O  O     . GLY A 1  424  ? 103.330 146.950 161.385 1.00 171.61 ? 424  GLY A O     1 
ATOM   2984  N  N     . ASP A 1  425  ? 101.499 147.799 162.388 1.00 173.25 ? 425  ASP A N     1 
ATOM   2985  C  CA    . ASP A 1  425  ? 100.599 146.801 161.830 1.00 173.25 ? 425  ASP A CA    1 
ATOM   2986  C  C     . ASP A 1  425  ? 100.553 146.931 160.314 1.00 173.25 ? 425  ASP A C     1 
ATOM   2987  O  O     . ASP A 1  425  ? 100.373 148.028 159.777 1.00 173.25 ? 425  ASP A O     1 
ATOM   2988  C  CB    . ASP A 1  425  ? 99.201  146.963 162.422 1.00 175.92 ? 425  ASP A CB    1 
ATOM   2989  C  CG    . ASP A 1  425  ? 99.145  146.598 163.893 1.00 175.92 ? 425  ASP A CG    1 
ATOM   2990  O  OD1   . ASP A 1  425  ? 100.084 145.933 164.378 1.00 175.92 ? 425  ASP A OD1   1 
ATOM   2991  O  OD2   . ASP A 1  425  ? 98.164  146.978 164.564 1.00 175.92 ? 425  ASP A OD2   1 
ATOM   2992  N  N     . ARG A 1  426  ? 100.709 145.806 159.625 1.00 173.83 ? 426  ARG A N     1 
ATOM   2993  C  CA    . ARG A 1  426  ? 100.857 145.783 158.177 1.00 173.83 ? 426  ARG A CA    1 
ATOM   2994  C  C     . ARG A 1  426  ? 99.544  145.360 157.529 1.00 173.83 ? 426  ARG A C     1 
ATOM   2995  O  O     . ARG A 1  426  ? 98.988  144.310 157.866 1.00 173.83 ? 426  ARG A O     1 
ATOM   2996  C  CB    . ARG A 1  426  ? 101.991 144.837 157.782 1.00 178.05 ? 426  ARG A CB    1 
ATOM   2997  C  CG    . ARG A 1  426  ? 102.309 144.798 156.306 1.00 178.05 ? 426  ARG A CG    1 
ATOM   2998  C  CD    . ARG A 1  426  ? 103.440 143.823 156.041 1.00 178.05 ? 426  ARG A CD    1 
ATOM   2999  N  NE    . ARG A 1  426  ? 103.063 142.460 156.401 1.00 178.05 ? 426  ARG A NE    1 
ATOM   3000  C  CZ    . ARG A 1  426  ? 103.927 141.470 156.595 1.00 178.05 ? 426  ARG A CZ    1 
ATOM   3001  N  NH1   . ARG A 1  426  ? 105.229 141.689 156.468 1.00 178.05 ? 426  ARG A NH1   1 
ATOM   3002  N  NH2   . ARG A 1  426  ? 103.489 140.262 156.921 1.00 178.05 ? 426  ARG A NH2   1 
ATOM   3003  N  N     . ILE A 1  427  ? 99.056  146.180 156.601 1.00 171.70 ? 427  ILE A N     1 
ATOM   3004  C  CA    . ILE A 1  427  ? 97.779  145.970 155.928 1.00 171.70 ? 427  ILE A CA    1 
ATOM   3005  C  C     . ILE A 1  427  ? 98.058  145.659 154.464 1.00 171.70 ? 427  ILE A C     1 
ATOM   3006  O  O     . ILE A 1  427  ? 98.801  146.391 153.799 1.00 171.70 ? 427  ILE A O     1 
ATOM   3007  C  CB    . ILE A 1  427  ? 96.858  147.197 156.065 1.00 169.36 ? 427  ILE A CB    1 
ATOM   3008  C  CG1   . ILE A 1  427  ? 96.486  147.419 157.530 1.00 169.36 ? 427  ILE A CG1   1 
ATOM   3009  C  CG2   . ILE A 1  427  ? 95.605  147.025 155.226 1.00 169.36 ? 427  ILE A CG2   1 
ATOM   3010  C  CD1   . ILE A 1  427  ? 97.332  148.457 158.217 1.00 169.36 ? 427  ILE A CD1   1 
ATOM   3011  N  N     . ASP A 1  428  ? 97.449  144.583 153.965 1.00 174.70 ? 428  ASP A N     1 
ATOM   3012  C  CA    . ASP A 1  428  ? 97.749  144.027 152.652 1.00 174.70 ? 428  ASP A CA    1 
ATOM   3013  C  C     . ASP A 1  428  ? 96.557  144.215 151.722 1.00 174.70 ? 428  ASP A C     1 
ATOM   3014  O  O     . ASP A 1  428  ? 95.426  143.870 152.079 1.00 174.70 ? 428  ASP A O     1 
ATOM   3015  C  CB    . ASP A 1  428  ? 98.095  142.542 152.769 1.00 180.12 ? 428  ASP A CB    1 
ATOM   3016  C  CG    . ASP A 1  428  ? 98.590  141.952 151.466 1.00 180.12 ? 428  ASP A CG    1 
ATOM   3017  O  OD1   . ASP A 1  428  ? 98.749  142.707 150.484 1.00 180.12 ? 428  ASP A OD1   1 
ATOM   3018  O  OD2   . ASP A 1  428  ? 98.834  140.727 151.429 1.00 180.12 ? 428  ASP A OD2   1 
ATOM   3019  N  N     . LEU A 1  429  ? 96.816  144.758 150.532 1.00 174.44 ? 429  LEU A N     1 
ATOM   3020  C  CA    . LEU A 1  429  ? 95.777  145.021 149.543 1.00 174.44 ? 429  LEU A CA    1 
ATOM   3021  C  C     . LEU A 1  429  ? 95.658  143.945 148.468 1.00 174.44 ? 429  LEU A C     1 
ATOM   3022  O  O     . LEU A 1  429  ? 94.764  144.043 147.621 1.00 174.44 ? 429  LEU A O     1 
ATOM   3023  C  CB    . LEU A 1  429  ? 96.022  146.377 148.872 1.00 166.38 ? 429  LEU A CB    1 
ATOM   3024  C  CG    . LEU A 1  429  ? 95.918  147.611 149.768 1.00 166.38 ? 429  LEU A CG    1 
ATOM   3025  C  CD1   . LEU A 1  429  ? 96.299  148.866 149.004 1.00 166.38 ? 429  LEU A CD1   1 
ATOM   3026  C  CD2   . LEU A 1  429  ? 94.521  147.739 150.344 1.00 166.38 ? 429  LEU A CD2   1 
ATOM   3027  N  N     . ARG A 1  430  ? 96.523  142.926 148.469 1.00 179.00 ? 430  ARG A N     1 
ATOM   3028  C  CA    . ARG A 1  430  ? 96.481  141.952 147.381 1.00 179.00 ? 430  ARG A CA    1 
ATOM   3029  C  C     . ARG A 1  430  ? 95.413  140.893 147.618 1.00 179.00 ? 430  ARG A C     1 
ATOM   3030  O  O     . ARG A 1  430  ? 94.990  140.210 146.678 1.00 179.00 ? 430  ARG A O     1 
ATOM   3031  C  CB    . ARG A 1  430  ? 97.845  141.291 147.190 1.00 178.20 ? 430  ARG A CB    1 
ATOM   3032  C  CG    . ARG A 1  430  ? 98.282  140.397 148.328 1.00 178.20 ? 430  ARG A CG    1 
ATOM   3033  C  CD    . ARG A 1  430  ? 99.634  139.785 148.023 1.00 178.20 ? 430  ARG A CD    1 
ATOM   3034  N  NE    . ARG A 1  430  ? 100.670 140.808 147.940 1.00 178.20 ? 430  ARG A NE    1 
ATOM   3035  C  CZ    . ARG A 1  430  ? 101.354 141.256 148.985 1.00 178.20 ? 430  ARG A CZ    1 
ATOM   3036  N  NH1   . ARG A 1  430  ? 101.121 140.761 150.192 1.00 178.20 ? 430  ARG A NH1   1 
ATOM   3037  N  NH2   . ARG A 1  430  ? 102.276 142.191 148.824 1.00 178.20 ? 430  ARG A NH2   1 
ATOM   3038  N  N     . PHE A 1  431  ? 94.969  140.731 148.863 1.00 187.57 ? 431  PHE A N     1 
ATOM   3039  C  CA    . PHE A 1  431  ? 93.901  139.792 149.193 1.00 187.57 ? 431  PHE A CA    1 
ATOM   3040  C  C     . PHE A 1  431  ? 92.618  140.595 149.355 1.00 187.57 ? 431  PHE A C     1 
ATOM   3041  O  O     . PHE A 1  431  ? 92.445  141.306 150.349 1.00 187.57 ? 431  PHE A O     1 
ATOM   3042  C  CB    . PHE A 1  431  ? 94.215  139.016 150.469 1.00 192.11 ? 431  PHE A CB    1 
ATOM   3043  C  CG    . PHE A 1  431  ? 95.426  138.133 150.374 1.00 192.11 ? 431  PHE A CG    1 
ATOM   3044  C  CD1   . PHE A 1  431  ? 95.338  136.872 149.809 1.00 192.11 ? 431  PHE A CD1   1 
ATOM   3045  C  CD2   . PHE A 1  431  ? 96.645  138.553 150.879 1.00 192.11 ? 431  PHE A CD2   1 
ATOM   3046  C  CE1   . PHE A 1  431  ? 96.449  136.053 149.731 1.00 192.11 ? 431  PHE A CE1   1 
ATOM   3047  C  CE2   . PHE A 1  431  ? 97.759  137.740 150.805 1.00 192.11 ? 431  PHE A CE2   1 
ATOM   3048  C  CZ    . PHE A 1  431  ? 97.661  136.488 150.230 1.00 192.11 ? 431  PHE A CZ    1 
ATOM   3049  N  N     . HIS A 1  432  ? 91.717  140.481 148.372 1.00 191.17 ? 432  HIS A N     1 
ATOM   3050  C  CA    . HIS A 1  432  ? 90.362  141.020 148.449 1.00 191.17 ? 432  HIS A CA    1 
ATOM   3051  C  C     . HIS A 1  432  ? 90.384  142.550 148.471 1.00 191.17 ? 432  HIS A C     1 
ATOM   3052  O  O     . HIS A 1  432  ? 91.451  143.150 148.658 1.00 191.17 ? 432  HIS A O     1 
ATOM   3053  C  CB    . HIS A 1  432  ? 89.650  140.425 149.668 1.00 190.56 ? 432  HIS A CB    1 
ATOM   3054  C  CG    . HIS A 1  432  ? 89.548  138.931 149.624 1.00 190.56 ? 432  HIS A CG    1 
ATOM   3055  N  ND1   . HIS A 1  432  ? 88.739  138.267 148.727 1.00 190.56 ? 432  HIS A ND1   1 
ATOM   3056  C  CD2   . HIS A 1  432  ? 90.167  137.972 150.353 1.00 190.56 ? 432  HIS A CD2   1 
ATOM   3057  C  CE1   . HIS A 1  432  ? 88.857  136.964 148.911 1.00 190.56 ? 432  HIS A CE1   1 
ATOM   3058  N  NE2   . HIS A 1  432  ? 89.717  136.758 149.892 1.00 190.56 ? 432  HIS A NE2   1 
ATOM   3059  N  N     . PRO A 1  433  ? 89.248  143.223 148.247 1.00 196.13 ? 433  PRO A N     1 
ATOM   3060  C  CA    . PRO A 1  433  ? 89.295  144.693 148.154 1.00 196.13 ? 433  PRO A CA    1 
ATOM   3061  C  C     . PRO A 1  433  ? 89.742  145.385 149.432 1.00 196.13 ? 433  PRO A C     1 
ATOM   3062  O  O     . PRO A 1  433  ? 90.311  146.481 149.358 1.00 196.13 ? 433  PRO A O     1 
ATOM   3063  C  CB    . PRO A 1  433  ? 87.852  145.061 147.778 1.00 195.25 ? 433  PRO A CB    1 
ATOM   3064  C  CG    . PRO A 1  433  ? 87.031  143.910 148.264 1.00 195.25 ? 433  PRO A CG    1 
ATOM   3065  C  CD    . PRO A 1  433  ? 87.889  142.713 147.991 1.00 195.25 ? 433  PRO A CD    1 
ATOM   3066  N  N     . LYS A 1  434  ? 89.506  144.779 150.601 1.00 196.28 ? 434  LYS A N     1 
ATOM   3067  C  CA    . LYS A 1  434  ? 89.874  145.357 151.892 1.00 196.28 ? 434  LYS A CA    1 
ATOM   3068  C  C     . LYS A 1  434  ? 89.264  146.746 152.050 1.00 196.28 ? 434  LYS A C     1 
ATOM   3069  O  O     . LYS A 1  434  ? 89.995  147.744 152.071 1.00 196.28 ? 434  LYS A O     1 
ATOM   3070  C  CB    . LYS A 1  434  ? 91.398  145.428 152.040 1.00 190.46 ? 434  LYS A CB    1 
ATOM   3071  C  CG    . LYS A 1  434  ? 92.108  144.091 151.909 1.00 190.46 ? 434  LYS A CG    1 
ATOM   3072  C  CD    . LYS A 1  434  ? 91.631  143.093 152.951 1.00 190.46 ? 434  LYS A CD    1 
ATOM   3073  C  CE    . LYS A 1  434  ? 92.176  143.432 154.327 1.00 190.46 ? 434  LYS A CE    1 
ATOM   3074  N  NZ    . LYS A 1  434  ? 91.829  142.394 155.336 1.00 190.46 ? 434  LYS A NZ    1 
ATOM   3075  N  N     . PRO A 1  435  ? 87.936  146.852 152.161 1.00 191.31 ? 435  PRO A N     1 
ATOM   3076  C  CA    . PRO A 1  435  ? 87.313  148.188 152.161 1.00 191.31 ? 435  PRO A CA    1 
ATOM   3077  C  C     . PRO A 1  435  ? 87.558  148.990 153.429 1.00 191.31 ? 435  PRO A C     1 
ATOM   3078  O  O     . PRO A 1  435  ? 87.547  150.227 153.384 1.00 191.31 ? 435  PRO A O     1 
ATOM   3079  C  CB    . PRO A 1  435  ? 85.825  147.868 151.973 1.00 192.40 ? 435  PRO A CB    1 
ATOM   3080  C  CG    . PRO A 1  435  ? 85.663  146.521 152.594 1.00 192.40 ? 435  PRO A CG    1 
ATOM   3081  C  CD    . PRO A 1  435  ? 86.945  145.774 152.324 1.00 192.40 ? 435  PRO A CD    1 
ATOM   3082  N  N     . SER A 1  436  ? 87.779  148.324 154.563 1.00 185.53 ? 436  SER A N     1 
ATOM   3083  C  CA    . SER A 1  436  ? 87.787  149.030 155.842 1.00 185.53 ? 436  SER A CA    1 
ATOM   3084  C  C     . SER A 1  436  ? 89.071  149.828 156.042 1.00 185.53 ? 436  SER A C     1 
ATOM   3085  O  O     . SER A 1  436  ? 89.051  150.905 156.649 1.00 185.53 ? 436  SER A O     1 
ATOM   3086  C  CB    . SER A 1  436  ? 87.594  148.036 156.987 1.00 183.87 ? 436  SER A CB    1 
ATOM   3087  O  OG    . SER A 1  436  ? 88.671  147.117 157.048 1.00 183.87 ? 436  SER A OG    1 
ATOM   3088  N  N     . ASP A 1  437  ? 90.195  149.319 155.543 1.00 182.16 ? 437  ASP A N     1 
ATOM   3089  C  CA    . ASP A 1  437  ? 91.497  149.909 155.833 1.00 182.16 ? 437  ASP A CA    1 
ATOM   3090  C  C     . ASP A 1  437  ? 91.951  150.926 154.793 1.00 182.16 ? 437  ASP A C     1 
ATOM   3091  O  O     . ASP A 1  437  ? 93.083  151.412 154.886 1.00 182.16 ? 437  ASP A O     1 
ATOM   3092  C  CB    . ASP A 1  437  ? 92.549  148.806 155.967 1.00 185.77 ? 437  ASP A CB    1 
ATOM   3093  C  CG    . ASP A 1  437  ? 92.351  147.961 157.213 1.00 185.77 ? 437  ASP A CG    1 
ATOM   3094  O  OD1   . ASP A 1  437  ? 91.609  148.399 158.117 1.00 185.77 ? 437  ASP A OD1   1 
ATOM   3095  O  OD2   . ASP A 1  437  ? 92.936  146.860 157.288 1.00 185.77 ? 437  ASP A OD2   1 
ATOM   3096  N  N     . LEU A 1  438  ? 91.109  151.261 153.813 1.00 176.76 ? 438  LEU A N     1 
ATOM   3097  C  CA    . LEU A 1  438  ? 91.538  152.166 152.751 1.00 176.76 ? 438  LEU A CA    1 
ATOM   3098  C  C     . LEU A 1  438  ? 91.705  153.594 153.260 1.00 176.76 ? 438  LEU A C     1 
ATOM   3099  O  O     . LEU A 1  438  ? 92.269  154.445 152.563 1.00 176.76 ? 438  LEU A O     1 
ATOM   3100  C  CB    . LEU A 1  438  ? 90.541  152.129 151.594 1.00 180.49 ? 438  LEU A CB    1 
ATOM   3101  C  CG    . LEU A 1  438  ? 90.374  150.793 150.869 1.00 180.49 ? 438  LEU A CG    1 
ATOM   3102  C  CD1   . LEU A 1  438  ? 89.286  150.891 149.809 1.00 180.49 ? 438  LEU A CD1   1 
ATOM   3103  C  CD2   . LEU A 1  438  ? 91.687  150.334 150.258 1.00 180.49 ? 438  LEU A CD2   1 
ATOM   3104  N  N     . HIS A 1  439  ? 91.218  153.880 154.465 1.00 170.70 ? 439  HIS A N     1 
ATOM   3105  C  CA    . HIS A 1  439  ? 91.316  155.232 155.000 1.00 170.70 ? 439  HIS A CA    1 
ATOM   3106  C  C     . HIS A 1  439  ? 92.760  155.561 155.357 1.00 170.70 ? 439  HIS A C     1 
ATOM   3107  O  O     . HIS A 1  439  ? 93.505  154.710 155.851 1.00 170.70 ? 439  HIS A O     1 
ATOM   3108  C  CB    . HIS A 1  439  ? 90.424  155.384 156.233 1.00 173.90 ? 439  HIS A CB    1 
ATOM   3109  C  CG    . HIS A 1  439  ? 90.806  154.488 157.369 1.00 173.90 ? 439  HIS A CG    1 
ATOM   3110  N  ND1   . HIS A 1  439  ? 90.520  153.140 157.383 1.00 173.90 ? 439  HIS A ND1   1 
ATOM   3111  C  CD2   . HIS A 1  439  ? 91.458  154.746 158.527 1.00 173.90 ? 439  HIS A CD2   1 
ATOM   3112  C  CE1   . HIS A 1  439  ? 90.977  152.607 158.502 1.00 173.90 ? 439  HIS A CE1   1 
ATOM   3113  N  NE2   . HIS A 1  439  ? 91.550  153.560 159.214 1.00 173.90 ? 439  HIS A NE2   1 
ATOM   3114  N  N     . LEU A 1  440  ? 93.153  156.806 155.105 1.00 158.48 ? 440  LEU A N     1 
ATOM   3115  C  CA    . LEU A 1  440  ? 94.503  157.272 155.375 1.00 158.48 ? 440  LEU A CA    1 
ATOM   3116  C  C     . LEU A 1  440  ? 94.477  158.556 156.193 1.00 158.48 ? 440  LEU A C     1 
ATOM   3117  O  O     . LEU A 1  440  ? 93.581  159.393 156.046 1.00 158.48 ? 440  LEU A O     1 
ATOM   3118  C  CB    . LEU A 1  440  ? 95.278  157.516 154.075 1.00 155.92 ? 440  LEU A CB    1 
ATOM   3119  C  CG    . LEU A 1  440  ? 95.589  156.305 153.196 1.00 155.92 ? 440  LEU A CG    1 
ATOM   3120  C  CD1   . LEU A 1  440  ? 96.244  156.750 151.901 1.00 155.92 ? 440  LEU A CD1   1 
ATOM   3121  C  CD2   . LEU A 1  440  ? 96.476  155.316 153.936 1.00 155.92 ? 440  LEU A CD2   1 
ATOM   3122  N  N     . GLN A 1  441  ? 95.478  158.702 157.056 1.00 153.72 ? 441  GLN A N     1 
ATOM   3123  C  CA    . GLN A 1  441  ? 95.671  159.923 157.824 1.00 153.72 ? 441  GLN A CA    1 
ATOM   3124  C  C     . GLN A 1  441  ? 97.159  160.072 158.098 1.00 153.72 ? 441  GLN A C     1 
ATOM   3125  O  O     . GLN A 1  441  ? 97.934  159.125 157.936 1.00 153.72 ? 441  GLN A O     1 
ATOM   3126  C  CB    . GLN A 1  441  ? 94.861  159.915 159.126 1.00 154.12 ? 441  GLN A CB    1 
ATOM   3127  C  CG    . GLN A 1  441  ? 95.264  158.846 160.124 1.00 154.12 ? 441  GLN A CG    1 
ATOM   3128  C  CD    . GLN A 1  441  ? 94.405  158.868 161.375 1.00 154.12 ? 441  GLN A CD    1 
ATOM   3129  O  OE1   . GLN A 1  441  ? 93.306  159.420 161.376 1.00 154.12 ? 441  GLN A OE1   1 
ATOM   3130  N  NE2   . GLN A 1  441  ? 94.904  158.263 162.448 1.00 154.12 ? 441  GLN A NE2   1 
ATOM   3131  N  N     . THR A 1  442  ? 97.547  161.281 158.499 1.00 152.96 ? 442  THR A N     1 
ATOM   3132  C  CA    . THR A 1  442  ? 98.959  161.603 158.660 1.00 152.96 ? 442  THR A CA    1 
ATOM   3133  C  C     . THR A 1  442  ? 99.631  160.653 159.644 1.00 152.96 ? 442  THR A C     1 
ATOM   3134  O  O     . THR A 1  442  ? 99.071  160.306 160.687 1.00 152.96 ? 442  THR A O     1 
ATOM   3135  C  CB    . THR A 1  442  ? 99.122  163.049 159.132 1.00 149.59 ? 442  THR A CB    1 
ATOM   3136  O  OG1   . THR A 1  442  ? 98.444  163.228 160.380 1.00 149.59 ? 442  THR A OG1   1 
ATOM   3137  C  CG2   . THR A 1  442  ? 98.547  164.008 158.104 1.00 149.59 ? 442  THR A CG2   1 
ATOM   3138  N  N     . GLY A 1  443  ? 100.848 160.235 159.300 1.00 151.75 ? 443  GLY A N     1 
ATOM   3139  C  CA    . GLY A 1  443  ? 101.608 159.292 160.083 1.00 151.75 ? 443  GLY A CA    1 
ATOM   3140  C  C     . GLY A 1  443  ? 101.648 157.885 159.521 1.00 151.75 ? 443  GLY A C     1 
ATOM   3141  O  O     . GLY A 1  443  ? 102.581 157.138 159.835 1.00 151.75 ? 443  GLY A O     1 
ATOM   3142  N  N     . TYR A 1  444  ? 100.678 157.508 158.691 1.00 152.19 ? 444  TYR A N     1 
ATOM   3143  C  CA    . TYR A 1  444  ? 100.733 156.201 158.055 1.00 152.19 ? 444  TYR A CA    1 
ATOM   3144  C  C     . TYR A 1  444  ? 101.855 156.157 157.024 1.00 152.19 ? 444  TYR A C     1 
ATOM   3145  O  O     . TYR A 1  444  ? 102.265 157.178 156.464 1.00 152.19 ? 444  TYR A O     1 
ATOM   3146  C  CB    . TYR A 1  444  ? 99.412  155.855 157.369 1.00 155.35 ? 444  TYR A CB    1 
ATOM   3147  C  CG    . TYR A 1  444  ? 98.239  155.658 158.296 1.00 155.35 ? 444  TYR A CG    1 
ATOM   3148  C  CD1   . TYR A 1  444  ? 98.409  155.101 159.554 1.00 155.35 ? 444  TYR A CD1   1 
ATOM   3149  C  CD2   . TYR A 1  444  ? 96.952  155.983 157.893 1.00 155.35 ? 444  TYR A CD2   1 
ATOM   3150  C  CE1   . TYR A 1  444  ? 97.334  154.905 160.400 1.00 155.35 ? 444  TYR A CE1   1 
ATOM   3151  C  CE2   . TYR A 1  444  ? 95.872  155.788 158.727 1.00 155.35 ? 444  TYR A CE2   1 
ATOM   3152  C  CZ    . TYR A 1  444  ? 96.068  155.250 159.981 1.00 155.35 ? 444  TYR A CZ    1 
ATOM   3153  O  OH    . TYR A 1  444  ? 94.994  155.054 160.819 1.00 155.35 ? 444  TYR A OH    1 
ATOM   3154  N  N     . LYS A 1  445  ? 102.346 154.949 156.764 1.00 149.68 ? 445  LYS A N     1 
ATOM   3155  C  CA    . LYS A 1  445  ? 103.342 154.730 155.722 1.00 149.68 ? 445  LYS A CA    1 
ATOM   3156  C  C     . LYS A 1  445  ? 102.695 153.919 154.609 1.00 149.68 ? 445  LYS A C     1 
ATOM   3157  O  O     . LYS A 1  445  ? 102.484 152.712 154.756 1.00 149.68 ? 445  LYS A O     1 
ATOM   3158  C  CB    . LYS A 1  445  ? 104.579 154.019 156.271 1.00 149.74 ? 445  LYS A CB    1 
ATOM   3159  C  CG    . LYS A 1  445  ? 105.420 154.870 157.204 1.00 149.74 ? 445  LYS A CG    1 
ATOM   3160  C  CD    . LYS A 1  445  ? 106.489 154.038 157.886 1.00 149.74 ? 445  LYS A CD    1 
ATOM   3161  C  CE    . LYS A 1  445  ? 107.460 153.466 156.865 1.00 149.74 ? 445  LYS A CE    1 
ATOM   3162  N  NZ    . LYS A 1  445  ? 108.515 152.626 157.495 1.00 149.74 ? 445  LYS A NZ    1 
ATOM   3163  N  N     . VAL A 1  446  ? 102.409 154.574 153.490 1.00 141.95 ? 446  VAL A N     1 
ATOM   3164  C  CA    . VAL A 1  446  ? 101.899 153.911 152.298 1.00 141.95 ? 446  VAL A CA    1 
ATOM   3165  C  C     . VAL A 1  446  ? 103.090 153.421 151.497 1.00 141.95 ? 446  VAL A C     1 
ATOM   3166  O  O     . VAL A 1  446  ? 103.954 154.216 151.107 1.00 141.95 ? 446  VAL A O     1 
ATOM   3167  C  CB    . VAL A 1  446  ? 101.027 154.857 151.456 1.00 143.93 ? 446  VAL A CB    1 
ATOM   3168  C  CG1   . VAL A 1  446  ? 100.626 154.181 150.157 1.00 143.93 ? 446  VAL A CG1   1 
ATOM   3169  C  CG2   . VAL A 1  446  ? 99.799  155.284 152.236 1.00 143.93 ? 446  VAL A CG2   1 
ATOM   3170  N  N     . GLU A 1  447  ? 103.148 152.117 151.251 1.00 138.24 ? 447  GLU A N     1 
ATOM   3171  C  CA    . GLU A 1  447  ? 104.232 151.554 150.459 1.00 138.24 ? 447  GLU A CA    1 
ATOM   3172  C  C     . GLU A 1  447  ? 103.769 151.521 149.011 1.00 138.24 ? 447  GLU A C     1 
ATOM   3173  O  O     . GLU A 1  447  ? 102.916 150.707 148.647 1.00 138.24 ? 447  GLU A O     1 
ATOM   3174  C  CB    . GLU A 1  447  ? 104.598 150.160 150.954 1.00 149.32 ? 447  GLU A CB    1 
ATOM   3175  C  CG    . GLU A 1  447  ? 105.212 150.127 152.334 1.00 149.32 ? 447  GLU A CG    1 
ATOM   3176  C  CD    . GLU A 1  447  ? 105.477 148.714 152.794 1.00 149.32 ? 447  GLU A CD    1 
ATOM   3177  O  OE1   . GLU A 1  447  ? 104.993 147.777 152.126 1.00 149.32 ? 447  GLU A OE1   1 
ATOM   3178  O  OE2   . GLU A 1  447  ? 106.178 148.531 153.810 1.00 149.32 ? 447  GLU A OE2   1 
ATOM   3179  N  N     . ARG A 1  448  ? 104.341 152.386 148.181 1.00 128.52 ? 448  ARG A N     1 
ATOM   3180  C  CA    . ARG A 1  448  ? 103.853 152.527 146.819 1.00 128.52 ? 448  ARG A CA    1 
ATOM   3181  C  C     . ARG A 1  448  ? 104.785 151.822 145.845 1.00 128.52 ? 448  ARG A C     1 
ATOM   3182  O  O     . ARG A 1  448  ? 105.880 151.383 146.195 1.00 128.52 ? 448  ARG A O     1 
ATOM   3183  C  CB    . ARG A 1  448  ? 103.726 154.005 146.441 1.00 129.53 ? 448  ARG A CB    1 
ATOM   3184  C  CG    . ARG A 1  448  ? 105.062 154.719 146.294 1.00 129.53 ? 448  ARG A CG    1 
ATOM   3185  C  CD    . ARG A 1  448  ? 104.877 156.191 145.943 1.00 129.53 ? 448  ARG A CD    1 
ATOM   3186  N  NE    . ARG A 1  448  ? 106.151 156.851 145.665 1.00 129.53 ? 448  ARG A NE    1 
ATOM   3187  C  CZ    . ARG A 1  448  ? 106.941 157.388 146.589 1.00 129.53 ? 448  ARG A CZ    1 
ATOM   3188  N  NH1   . ARG A 1  448  ? 106.588 157.358 147.865 1.00 129.53 ? 448  ARG A NH1   1 
ATOM   3189  N  NH2   . ARG A 1  448  ? 108.082 157.962 146.234 1.00 129.53 ? 448  ARG A NH2   1 
ATOM   3190  N  N     . HIS A 1  449  ? 104.354 151.762 144.592 1.00 125.76 ? 449  HIS A N     1 
ATOM   3191  C  CA    . HIS A 1  449  ? 105.198 151.202 143.552 1.00 125.76 ? 449  HIS A CA    1 
ATOM   3192  C  C     . HIS A 1  449  ? 106.185 152.247 143.050 1.00 125.76 ? 449  HIS A C     1 
ATOM   3193  O  O     . HIS A 1  449  ? 105.922 153.453 143.085 1.00 125.76 ? 449  HIS A O     1 
ATOM   3194  C  CB    . HIS A 1  449  ? 104.355 150.662 142.398 1.00 133.61 ? 449  HIS A CB    1 
ATOM   3195  C  CG    . HIS A 1  449  ? 103.457 149.527 142.784 1.00 133.61 ? 449  HIS A CG    1 
ATOM   3196  N  ND1   . HIS A 1  449  ? 103.936 148.289 143.152 1.00 133.61 ? 449  HIS A ND1   1 
ATOM   3197  C  CD2   . HIS A 1  449  ? 102.109 149.438 142.840 1.00 133.61 ? 449  HIS A CD2   1 
ATOM   3198  C  CE1   . HIS A 1  449  ? 102.920 147.490 143.431 1.00 133.61 ? 449  HIS A CE1   1 
ATOM   3199  N  NE2   . HIS A 1  449  ? 101.800 148.163 143.244 1.00 133.61 ? 449  HIS A NE2   1 
ATOM   3200  N  N     . MET A 1  450  ? 107.337 151.770 142.588 1.00 118.41 ? 450  MET A N     1 
ATOM   3201  C  CA    . MET A 1  450  ? 108.376 152.662 142.095 1.00 118.41 ? 450  MET A CA    1 
ATOM   3202  C  C     . MET A 1  450  ? 107.916 153.361 140.820 1.00 118.41 ? 450  MET A C     1 
ATOM   3203  O  O     . MET A 1  450  ? 107.474 152.713 139.867 1.00 118.41 ? 450  MET A O     1 
ATOM   3204  C  CB    . MET A 1  450  ? 109.660 151.872 141.861 1.00 115.00 ? 450  MET A CB    1 
ATOM   3205  C  CG    . MET A 1  450  ? 110.786 152.645 141.212 1.00 115.00 ? 450  MET A CG    1 
ATOM   3206  S  SD    . MET A 1  450  ? 112.306 151.680 141.246 1.00 115.00 ? 450  MET A SD    1 
ATOM   3207  C  CE    . MET A 1  450  ? 111.873 150.325 140.166 1.00 115.00 ? 450  MET A CE    1 
ATOM   3208  N  N     . CYS A 1  451  ? 108.019 154.688 140.810 1.00 115.52 ? 451  CYS A N     1 
ATOM   3209  C  CA    . CYS A 1  451  ? 107.493 155.526 139.743 1.00 115.52 ? 451  CYS A CA    1 
ATOM   3210  C  C     . CYS A 1  451  ? 108.600 156.389 139.155 1.00 115.52 ? 451  CYS A C     1 
ATOM   3211  O  O     . CYS A 1  451  ? 109.692 156.504 139.717 1.00 115.52 ? 451  CYS A O     1 
ATOM   3212  C  CB    . CYS A 1  451  ? 106.354 156.422 140.247 1.00 127.95 ? 451  CYS A CB    1 
ATOM   3213  S  SG    . CYS A 1  451  ? 104.876 155.532 140.779 1.00 127.95 ? 451  CYS A SG    1 
ATOM   3214  N  N     . ASP A 1  452  ? 108.304 156.981 137.997 1.00 110.07 ? 452  ASP A N     1 
ATOM   3215  C  CA    . ASP A 1  452  ? 109.265 157.833 137.307 1.00 110.07 ? 452  ASP A CA    1 
ATOM   3216  C  C     . ASP A 1  452  ? 109.771 158.936 138.227 1.00 110.07 ? 452  ASP A C     1 
ATOM   3217  O  O     . ASP A 1  452  ? 108.987 159.654 138.853 1.00 110.07 ? 452  ASP A O     1 
ATOM   3218  C  CB    . ASP A 1  452  ? 108.621 158.449 136.063 1.00 107.60 ? 452  ASP A CB    1 
ATOM   3219  C  CG    . ASP A 1  452  ? 108.298 157.419 135.000 1.00 107.60 ? 452  ASP A CG    1 
ATOM   3220  O  OD1   . ASP A 1  452  ? 108.830 156.292 135.079 1.00 107.60 ? 452  ASP A OD1   1 
ATOM   3221  O  OD2   . ASP A 1  452  ? 107.510 157.738 134.085 1.00 107.60 ? 452  ASP A OD2   1 
ATOM   3222  N  N     . GLY A 1  453  ? 111.094 159.069 138.303 1.00 106.13 ? 453  GLY A N     1 
ATOM   3223  C  CA    . GLY A 1  453  ? 111.732 160.055 139.148 1.00 106.13 ? 453  GLY A CA    1 
ATOM   3224  C  C     . GLY A 1  453  ? 112.397 159.502 140.391 1.00 106.13 ? 453  GLY A C     1 
ATOM   3225  O  O     . GLY A 1  453  ? 113.182 160.220 141.021 1.00 106.13 ? 453  GLY A O     1 
ATOM   3226  N  N     . ASP A 1  454  ? 112.113 158.257 140.763 1.00 105.43 ? 454  ASP A N     1 
ATOM   3227  C  CA    . ASP A 1  454  ? 112.725 157.676 141.946 1.00 105.43 ? 454  ASP A CA    1 
ATOM   3228  C  C     . ASP A 1  454  ? 114.221 157.457 141.730 1.00 105.43 ? 454  ASP A C     1 
ATOM   3229  O  O     . ASP A 1  454  ? 114.709 157.358 140.603 1.00 105.43 ? 454  ASP A O     1 
ATOM   3230  C  CB    . ASP A 1  454  ? 112.046 156.358 142.311 1.00 113.37 ? 454  ASP A CB    1 
ATOM   3231  C  CG    . ASP A 1  454  ? 110.652 156.557 142.876 1.00 113.37 ? 454  ASP A CG    1 
ATOM   3232  O  OD1   . ASP A 1  454  ? 110.333 157.693 143.285 1.00 113.37 ? 454  ASP A OD1   1 
ATOM   3233  O  OD2   . ASP A 1  454  ? 109.877 155.580 142.910 1.00 113.37 ? 454  ASP A OD2   1 
ATOM   3234  N  N     . ILE A 1  455  ? 114.950 157.386 142.839 1.00 100.60 ? 455  ILE A N     1 
ATOM   3235  C  CA    . ILE A 1  455  ? 116.400 157.231 142.830 1.00 100.60 ? 455  ILE A CA    1 
ATOM   3236  C  C     . ILE A 1  455  ? 116.737 155.801 143.220 1.00 100.60 ? 455  ILE A C     1 
ATOM   3237  O  O     . ILE A 1  455  ? 116.185 155.265 144.187 1.00 100.60 ? 455  ILE A O     1 
ATOM   3238  C  CB    . ILE A 1  455  ? 117.079 158.237 143.779 1.00 104.43 ? 455  ILE A CB    1 
ATOM   3239  C  CG1   . ILE A 1  455  ? 116.850 159.665 143.283 1.00 104.43 ? 455  ILE A CG1   1 
ATOM   3240  C  CG2   . ILE A 1  455  ? 118.561 157.941 143.899 1.00 104.43 ? 455  ILE A CG2   1 
ATOM   3241  C  CD1   . ILE A 1  455  ? 117.254 160.725 144.274 1.00 104.43 ? 455  ILE A CD1   1 
ATOM   3242  N  N     . VAL A 1  456  ? 117.635 155.181 142.458 1.00 97.35  ? 456  VAL A N     1 
ATOM   3243  C  CA    . VAL A 1  456  ? 118.064 153.808 142.699 1.00 97.35  ? 456  VAL A CA    1 
ATOM   3244  C  C     . VAL A 1  456  ? 119.573 153.724 142.513 1.00 97.35  ? 456  VAL A C     1 
ATOM   3245  O  O     . VAL A 1  456  ? 120.122 154.262 141.546 1.00 97.35  ? 456  VAL A O     1 
ATOM   3246  C  CB    . VAL A 1  456  ? 117.340 152.808 141.768 1.00 96.18  ? 456  VAL A CB    1 
ATOM   3247  C  CG1   . VAL A 1  456  ? 115.872 152.705 142.124 1.00 96.18  ? 456  VAL A CG1   1 
ATOM   3248  C  CG2   . VAL A 1  456  ? 117.481 153.224 140.316 1.00 96.18  ? 456  VAL A CG2   1 
ATOM   3249  N  N     . ILE A 1  457  ? 120.252 153.066 143.460 1.00 94.54  ? 457  ILE A N     1 
ATOM   3250  C  CA    . ILE A 1  457  ? 121.651 152.697 143.278 1.00 94.54  ? 457  ILE A CA    1 
ATOM   3251  C  C     . ILE A 1  457  ? 121.686 151.458 142.399 1.00 94.54  ? 457  ILE A C     1 
ATOM   3252  O  O     . ILE A 1  457  ? 120.761 150.642 142.399 1.00 94.54  ? 457  ILE A O     1 
ATOM   3253  C  CB    . ILE A 1  457  ? 122.376 152.495 144.627 1.00 100.03 ? 457  ILE A CB    1 
ATOM   3254  C  CG1   . ILE A 1  457  ? 122.628 153.856 145.275 1.00 100.03 ? 457  ILE A CG1   1 
ATOM   3255  C  CG2   . ILE A 1  457  ? 123.684 151.732 144.476 1.00 100.03 ? 457  ILE A CG2   1 
ATOM   3256  C  CD1   . ILE A 1  457  ? 123.293 153.782 146.612 1.00 100.03 ? 457  ILE A CD1   1 
ATOM   3257  N  N     . PHE A 1  458  ? 122.745 151.335 141.609 1.00 96.43  ? 458  PHE A N     1 
ATOM   3258  C  CA    . PHE A 1  458  ? 122.759 150.442 140.465 1.00 96.43  ? 458  PHE A CA    1 
ATOM   3259  C  C     . PHE A 1  458  ? 124.148 149.829 140.374 1.00 96.43  ? 458  PHE A C     1 
ATOM   3260  O  O     . PHE A 1  458  ? 125.138 150.535 140.574 1.00 96.43  ? 458  PHE A O     1 
ATOM   3261  C  CB    . PHE A 1  458  ? 122.380 151.242 139.216 1.00 97.72  ? 458  PHE A CB    1 
ATOM   3262  C  CG    . PHE A 1  458  ? 122.264 150.432 137.978 1.00 97.72  ? 458  PHE A CG    1 
ATOM   3263  C  CD1   . PHE A 1  458  ? 121.151 149.650 137.749 1.00 97.72  ? 458  PHE A CD1   1 
ATOM   3264  C  CD2   . PHE A 1  458  ? 123.244 150.495 137.009 1.00 97.72  ? 458  PHE A CD2   1 
ATOM   3265  C  CE1   . PHE A 1  458  ? 121.037 148.916 136.591 1.00 97.72  ? 458  PHE A CE1   1 
ATOM   3266  C  CE2   . PHE A 1  458  ? 123.132 149.771 135.856 1.00 97.72  ? 458  PHE A CE2   1 
ATOM   3267  C  CZ    . PHE A 1  458  ? 122.030 148.973 135.643 1.00 97.72  ? 458  PHE A CZ    1 
ATOM   3268  N  N     . ASN A 1  459  ? 124.231 148.529 140.093 1.00 101.51 ? 459  ASN A N     1 
ATOM   3269  C  CA    . ASN A 1  459  ? 125.471 147.805 140.344 1.00 101.51 ? 459  ASN A CA    1 
ATOM   3270  C  C     . ASN A 1  459  ? 125.741 146.760 139.268 1.00 101.51 ? 459  ASN A C     1 
ATOM   3271  O  O     . ASN A 1  459  ? 124.818 146.200 138.678 1.00 101.51 ? 459  ASN A O     1 
ATOM   3272  C  CB    . ASN A 1  459  ? 125.401 147.139 141.724 1.00 106.28 ? 459  ASN A CB    1 
ATOM   3273  C  CG    . ASN A 1  459  ? 126.704 146.508 142.149 1.00 106.28 ? 459  ASN A CG    1 
ATOM   3274  O  OD1   . ASN A 1  459  ? 127.567 146.199 141.334 1.00 106.28 ? 459  ASN A OD1   1 
ATOM   3275  N  ND2   . ASN A 1  459  ? 126.850 146.310 143.446 1.00 106.28 ? 459  ASN A ND2   1 
ATOM   3276  N  N     . ARG A 1  460  ? 127.029 146.494 139.034 1.00 105.60 ? 460  ARG A N     1 
ATOM   3277  C  CA    . ARG A 1  460  ? 127.482 145.345 138.250 1.00 105.60 ? 460  ARG A CA    1 
ATOM   3278  C  C     . ARG A 1  460  ? 128.638 144.689 138.987 1.00 105.60 ? 460  ARG A C     1 
ATOM   3279  O  O     . ARG A 1  460  ? 129.583 145.376 139.385 1.00 105.60 ? 460  ARG A O     1 
ATOM   3280  C  CB    . ARG A 1  460  ? 127.939 145.743 136.843 1.00 103.95 ? 460  ARG A CB    1 
ATOM   3281  C  CG    . ARG A 1  460  ? 128.420 144.540 136.029 1.00 103.95 ? 460  ARG A CG    1 
ATOM   3282  C  CD    . ARG A 1  460  ? 128.999 144.928 134.680 1.00 103.95 ? 460  ARG A CD    1 
ATOM   3283  N  NE    . ARG A 1  460  ? 129.420 143.763 133.904 1.00 103.95 ? 460  ARG A NE    1 
ATOM   3284  C  CZ    . ARG A 1  460  ? 130.610 143.177 134.005 1.00 103.95 ? 460  ARG A CZ    1 
ATOM   3285  N  NH1   . ARG A 1  460  ? 131.514 143.639 134.858 1.00 103.95 ? 460  ARG A NH1   1 
ATOM   3286  N  NH2   . ARG A 1  460  ? 130.897 142.123 133.255 1.00 103.95 ? 460  ARG A NH2   1 
ATOM   3287  N  N     . GLN A 1  461  ? 128.574 143.371 139.162 1.00 110.00 ? 461  GLN A N     1 
ATOM   3288  C  CA    . GLN A 1  461  ? 129.697 142.628 139.737 1.00 110.00 ? 461  GLN A CA    1 
ATOM   3289  C  C     . GLN A 1  461  ? 130.726 142.208 138.694 1.00 110.00 ? 461  GLN A C     1 
ATOM   3290  O  O     . GLN A 1  461  ? 130.367 141.850 137.573 1.00 110.00 ? 461  GLN A O     1 
ATOM   3291  C  CB    . GLN A 1  461  ? 129.212 141.385 140.483 1.00 113.46 ? 461  GLN A CB    1 
ATOM   3292  C  CG    . GLN A 1  461  ? 128.512 141.674 141.785 1.00 113.46 ? 461  GLN A CG    1 
ATOM   3293  C  CD    . GLN A 1  461  ? 127.051 141.978 141.606 1.00 113.46 ? 461  GLN A CD    1 
ATOM   3294  O  OE1   . GLN A 1  461  ? 126.527 141.940 140.493 1.00 113.46 ? 461  GLN A OE1   1 
ATOM   3295  N  NE2   . GLN A 1  461  ? 126.381 142.294 142.705 1.00 113.46 ? 461  GLN A NE2   1 
ATOM   3296  N  N     . PRO A 1  462  ? 132.017 142.252 139.063 1.00 113.00 ? 462  PRO A N     1 
ATOM   3297  C  CA    . PRO A 1  462  ? 132.505 142.772 140.345 1.00 113.00 ? 462  PRO A CA    1 
ATOM   3298  C  C     . PRO A 1  462  ? 132.569 144.293 140.356 1.00 113.00 ? 462  PRO A C     1 
ATOM   3299  O  O     . PRO A 1  462  ? 132.640 144.897 139.285 1.00 113.00 ? 462  PRO A O     1 
ATOM   3300  C  CB    . PRO A 1  462  ? 133.905 142.174 140.452 1.00 115.24 ? 462  PRO A CB    1 
ATOM   3301  C  CG    . PRO A 1  462  ? 134.349 142.062 139.042 1.00 115.24 ? 462  PRO A CG    1 
ATOM   3302  C  CD    . PRO A 1  462  ? 133.122 141.758 138.221 1.00 115.24 ? 462  PRO A CD    1 
ATOM   3303  N  N     . THR A 1  463  ? 132.546 144.908 141.536 1.00 112.58 ? 463  THR A N     1 
ATOM   3304  C  CA    . THR A 1  463  ? 132.759 146.346 141.644 1.00 112.58 ? 463  THR A CA    1 
ATOM   3305  C  C     . THR A 1  463  ? 134.236 146.571 141.936 1.00 112.58 ? 463  THR A C     1 
ATOM   3306  O  O     . THR A 1  463  ? 134.708 146.299 143.044 1.00 112.58 ? 463  THR A O     1 
ATOM   3307  C  CB    . THR A 1  463  ? 131.883 146.954 142.736 1.00 115.44 ? 463  THR A CB    1 
ATOM   3308  O  OG1   . THR A 1  463  ? 132.224 146.382 144.002 1.00 115.44 ? 463  THR A OG1   1 
ATOM   3309  C  CG2   . THR A 1  463  ? 130.424 146.678 142.454 1.00 115.44 ? 463  THR A CG2   1 
ATOM   3310  N  N     . LEU A 1  464  ? 134.967 147.063 140.937 1.00 110.65 ? 464  LEU A N     1 
ATOM   3311  C  CA    . LEU A 1  464  ? 136.396 147.289 141.096 1.00 110.65 ? 464  LEU A CA    1 
ATOM   3312  C  C     . LEU A 1  464  ? 136.697 148.629 141.752 1.00 110.65 ? 464  LEU A C     1 
ATOM   3313  O  O     . LEU A 1  464  ? 137.577 148.708 142.616 1.00 110.65 ? 464  LEU A O     1 
ATOM   3314  C  CB    . LEU A 1  464  ? 137.088 147.181 139.739 1.00 110.69 ? 464  LEU A CB    1 
ATOM   3315  C  CG    . LEU A 1  464  ? 136.961 145.791 139.111 1.00 110.69 ? 464  LEU A CG    1 
ATOM   3316  C  CD1   . LEU A 1  464  ? 137.577 145.745 137.721 1.00 110.69 ? 464  LEU A CD1   1 
ATOM   3317  C  CD2   . LEU A 1  464  ? 137.575 144.726 140.014 1.00 110.69 ? 464  LEU A CD2   1 
ATOM   3318  N  N     . HIS A 1  465  ? 135.980 149.680 141.366 1.00 107.80 ? 465  HIS A N     1 
ATOM   3319  C  CA    . HIS A 1  465  ? 136.164 151.007 141.936 1.00 107.80 ? 465  HIS A CA    1 
ATOM   3320  C  C     . HIS A 1  465  ? 134.783 151.585 142.223 1.00 107.80 ? 465  HIS A C     1 
ATOM   3321  O  O     . HIS A 1  465  ? 133.760 150.964 141.925 1.00 107.80 ? 465  HIS A O     1 
ATOM   3322  C  CB    . HIS A 1  465  ? 136.994 151.888 140.998 1.00 109.68 ? 465  HIS A CB    1 
ATOM   3323  C  CG    . HIS A 1  465  ? 136.418 152.021 139.622 1.00 109.68 ? 465  HIS A CG    1 
ATOM   3324  N  ND1   . HIS A 1  465  ? 136.409 150.982 138.717 1.00 109.68 ? 465  HIS A ND1   1 
ATOM   3325  C  CD2   . HIS A 1  465  ? 135.868 153.080 138.985 1.00 109.68 ? 465  HIS A CD2   1 
ATOM   3326  C  CE1   . HIS A 1  465  ? 135.852 151.389 137.590 1.00 109.68 ? 465  HIS A CE1   1 
ATOM   3327  N  NE2   . HIS A 1  465  ? 135.516 152.659 137.726 1.00 109.68 ? 465  HIS A NE2   1 
ATOM   3328  N  N     . LYS A 1  466  ? 134.755 152.787 142.807 1.00 107.60 ? 466  LYS A N     1 
ATOM   3329  C  CA    . LYS A 1  466  ? 133.481 153.314 143.286 1.00 107.60 ? 466  LYS A CA    1 
ATOM   3330  C  C     . LYS A 1  466  ? 132.588 153.807 142.158 1.00 107.60 ? 466  LYS A C     1 
ATOM   3331  O  O     . LYS A 1  466  ? 131.393 154.024 142.385 1.00 107.60 ? 466  LYS A O     1 
ATOM   3332  C  CB    . LYS A 1  466  ? 133.693 154.448 144.291 1.00 106.66 ? 466  LYS A CB    1 
ATOM   3333  C  CG    . LYS A 1  466  ? 134.280 155.723 143.722 1.00 106.66 ? 466  LYS A CG    1 
ATOM   3334  C  CD    . LYS A 1  466  ? 134.395 156.771 144.815 1.00 106.66 ? 466  LYS A CD    1 
ATOM   3335  C  CE    . LYS A 1  466  ? 134.970 158.070 144.295 1.00 106.66 ? 466  LYS A CE    1 
ATOM   3336  N  NZ    . LYS A 1  466  ? 135.066 159.086 145.378 1.00 106.66 ? 466  LYS A NZ    1 
ATOM   3337  N  N     . MET A 1  467  ? 133.130 153.989 140.954 1.00 106.58 ? 467  MET A N     1 
ATOM   3338  C  CA    . MET A 1  467  ? 132.296 154.388 139.829 1.00 106.58 ? 467  MET A CA    1 
ATOM   3339  C  C     . MET A 1  467  ? 131.413 153.250 139.340 1.00 106.58 ? 467  MET A C     1 
ATOM   3340  O  O     . MET A 1  467  ? 130.528 153.488 138.513 1.00 106.58 ? 467  MET A O     1 
ATOM   3341  C  CB    . MET A 1  467  ? 133.172 154.904 138.689 1.00 110.27 ? 467  MET A CB    1 
ATOM   3342  C  CG    . MET A 1  467  ? 134.077 156.047 139.107 1.00 110.27 ? 467  MET A CG    1 
ATOM   3343  S  SD    . MET A 1  467  ? 133.166 157.507 139.624 1.00 110.27 ? 467  MET A SD    1 
ATOM   3344  C  CE    . MET A 1  467  ? 134.503 158.552 140.179 1.00 110.27 ? 467  MET A CE    1 
ATOM   3345  N  N     . SER A 1  468  ? 131.633 152.031 139.831 1.00 105.03 ? 468  SER A N     1 
ATOM   3346  C  CA    . SER A 1  468  ? 130.811 150.883 139.476 1.00 105.03 ? 468  SER A CA    1 
ATOM   3347  C  C     . SER A 1  468  ? 129.514 150.821 140.267 1.00 105.03 ? 468  SER A C     1 
ATOM   3348  O  O     . SER A 1  468  ? 128.695 149.933 140.011 1.00 105.03 ? 468  SER A O     1 
ATOM   3349  C  CB    . SER A 1  468  ? 131.598 149.586 139.682 1.00 107.13 ? 468  SER A CB    1 
ATOM   3350  O  OG    . SER A 1  468  ? 132.706 149.516 138.805 1.00 107.13 ? 468  SER A OG    1 
ATOM   3351  N  N     . MET A 1  469  ? 129.317 151.716 141.228 1.00 103.70 ? 469  MET A N     1 
ATOM   3352  C  CA    . MET A 1  469  ? 128.035 151.872 141.902 1.00 103.70 ? 469  MET A CA    1 
ATOM   3353  C  C     . MET A 1  469  ? 127.657 153.343 141.841 1.00 103.70 ? 469  MET A C     1 
ATOM   3354  O  O     . MET A 1  469  ? 128.322 154.183 142.453 1.00 103.70 ? 469  MET A O     1 
ATOM   3355  C  CB    . MET A 1  469  ? 128.099 151.383 143.351 1.00 112.89 ? 469  MET A CB    1 
ATOM   3356  C  CG    . MET A 1  469  ? 128.346 149.888 143.480 1.00 112.89 ? 469  MET A CG    1 
ATOM   3357  S  SD    . MET A 1  469  ? 128.404 149.311 145.186 1.00 112.89 ? 469  MET A SD    1 
ATOM   3358  C  CE    . MET A 1  469  ? 126.677 149.434 145.642 1.00 112.89 ? 469  MET A CE    1 
ATOM   3359  N  N     . MET A 1  470  ? 126.593 153.655 141.102 1.00 100.71 ? 470  MET A N     1 
ATOM   3360  C  CA    . MET A 1  470  ? 126.173 155.034 140.892 1.00 100.71 ? 470  MET A CA    1 
ATOM   3361  C  C     . MET A 1  470  ? 124.657 155.103 140.956 1.00 100.71 ? 470  MET A C     1 
ATOM   3362  O  O     . MET A 1  470  ? 123.972 154.266 140.363 1.00 100.71 ? 470  MET A O     1 
ATOM   3363  C  CB    . MET A 1  470  ? 126.662 155.569 139.541 1.00 107.13 ? 470  MET A CB    1 
ATOM   3364  C  CG    . MET A 1  470  ? 128.167 155.687 139.401 1.00 107.13 ? 470  MET A CG    1 
ATOM   3365  S  SD    . MET A 1  470  ? 128.639 156.490 137.859 1.00 107.13 ? 470  MET A SD    1 
ATOM   3366  C  CE    . MET A 1  470  ? 128.284 155.192 136.682 1.00 107.13 ? 470  MET A CE    1 
ATOM   3367  N  N     . GLY A 1  471  ? 124.137 156.096 141.672 1.00 99.87  ? 471  GLY A N     1 
ATOM   3368  C  CA    . GLY A 1  471  ? 122.694 156.253 141.768 1.00 99.87  ? 471  GLY A CA    1 
ATOM   3369  C  C     . GLY A 1  471  ? 122.127 156.860 140.497 1.00 99.87  ? 471  GLY A C     1 
ATOM   3370  O  O     . GLY A 1  471  ? 122.731 157.755 139.897 1.00 99.87  ? 471  GLY A O     1 
ATOM   3371  N  N     . HIS A 1  472  ? 120.962 156.377 140.084 1.00 98.19  ? 472  HIS A N     1 
ATOM   3372  C  CA    . HIS A 1  472  ? 120.307 156.796 138.858 1.00 98.19  ? 472  HIS A CA    1 
ATOM   3373  C  C     . HIS A 1  472  ? 118.925 157.367 139.156 1.00 98.19  ? 472  HIS A C     1 
ATOM   3374  O  O     . HIS A 1  472  ? 118.516 157.514 140.309 1.00 98.19  ? 472  HIS A O     1 
ATOM   3375  C  CB    . HIS A 1  472  ? 120.217 155.638 137.863 1.00 97.04  ? 472  HIS A CB    1 
ATOM   3376  C  CG    . HIS A 1  472  ? 121.539 155.205 137.309 1.00 97.04  ? 472  HIS A CG    1 
ATOM   3377  N  ND1   . HIS A 1  472  ? 122.247 155.963 136.402 1.00 97.04  ? 472  HIS A ND1   1 
ATOM   3378  C  CD2   . HIS A 1  472  ? 122.277 154.094 137.528 1.00 97.04  ? 472  HIS A CD2   1 
ATOM   3379  C  CE1   . HIS A 1  472  ? 123.366 155.335 136.086 1.00 97.04  ? 472  HIS A CE1   1 
ATOM   3380  N  NE2   . HIS A 1  472  ? 123.409 154.199 136.758 1.00 97.04  ? 472  HIS A NE2   1 
ATOM   3381  N  N     . ARG A 1  473  ? 118.207 157.695 138.084 1.00 97.87  ? 473  ARG A N     1 
ATOM   3382  C  CA    . ARG A 1  473  ? 116.884 158.297 138.163 1.00 97.87  ? 473  ARG A CA    1 
ATOM   3383  C  C     . ARG A 1  473  ? 115.922 157.467 137.324 1.00 97.87  ? 473  ARG A C     1 
ATOM   3384  O  O     . ARG A 1  473  ? 116.053 157.412 136.099 1.00 97.87  ? 473  ARG A O     1 
ATOM   3385  C  CB    . ARG A 1  473  ? 116.935 159.751 137.681 1.00 103.07 ? 473  ARG A CB    1 
ATOM   3386  C  CG    . ARG A 1  473  ? 115.623 160.501 137.730 1.00 103.07 ? 473  ARG A CG    1 
ATOM   3387  C  CD    . ARG A 1  473  ? 115.831 161.944 137.298 1.00 103.07 ? 473  ARG A CD    1 
ATOM   3388  N  NE    . ARG A 1  473  ? 116.287 162.052 135.916 1.00 103.07 ? 473  ARG A NE    1 
ATOM   3389  C  CZ    . ARG A 1  473  ? 116.890 163.125 135.412 1.00 103.07 ? 473  ARG A CZ    1 
ATOM   3390  N  NH1   . ARG A 1  473  ? 117.124 164.178 136.183 1.00 103.07 ? 473  ARG A NH1   1 
ATOM   3391  N  NH2   . ARG A 1  473  ? 117.271 163.141 134.143 1.00 103.07 ? 473  ARG A NH2   1 
ATOM   3392  N  N     . VAL A 1  474  ? 114.952 156.835 137.986 1.00 96.99  ? 474  VAL A N     1 
ATOM   3393  C  CA    . VAL A 1  474  ? 114.141 155.799 137.355 1.00 96.99  ? 474  VAL A CA    1 
ATOM   3394  C  C     . VAL A 1  474  ? 113.271 156.381 136.247 1.00 96.99  ? 474  VAL A C     1 
ATOM   3395  O  O     . VAL A 1  474  ? 112.713 157.481 136.376 1.00 96.99  ? 474  VAL A O     1 
ATOM   3396  C  CB    . VAL A 1  474  ? 113.278 155.092 138.414 1.00 99.09  ? 474  VAL A CB    1 
ATOM   3397  C  CG1   . VAL A 1  474  ? 112.356 154.078 137.768 1.00 99.09  ? 474  VAL A CG1   1 
ATOM   3398  C  CG2   . VAL A 1  474  ? 114.153 154.419 139.452 1.00 99.09  ? 474  VAL A CG2   1 
ATOM   3399  N  N     . ARG A 1  475  ? 113.157 155.640 135.142 1.00 95.99  ? 475  ARG A N     1 
ATOM   3400  C  CA    . ARG A 1  475  ? 112.132 155.864 134.130 1.00 95.99  ? 475  ARG A CA    1 
ATOM   3401  C  C     . ARG A 1  475  ? 111.606 154.510 133.676 1.00 95.99  ? 475  ARG A C     1 
ATOM   3402  O  O     . ARG A 1  475  ? 112.388 153.622 133.327 1.00 95.99  ? 475  ARG A O     1 
ATOM   3403  C  CB    . ARG A 1  475  ? 112.668 156.673 132.944 1.00 97.58  ? 475  ARG A CB    1 
ATOM   3404  C  CG    . ARG A 1  475  ? 111.618 156.978 131.889 1.00 97.58  ? 475  ARG A CG    1 
ATOM   3405  C  CD    . ARG A 1  475  ? 112.144 157.931 130.834 1.00 97.58  ? 475  ARG A CD    1 
ATOM   3406  N  NE    . ARG A 1  475  ? 111.146 158.219 129.809 1.00 97.58  ? 475  ARG A NE    1 
ATOM   3407  C  CZ    . ARG A 1  475  ? 110.988 157.527 128.686 1.00 97.58  ? 475  ARG A CZ    1 
ATOM   3408  N  NH1   . ARG A 1  475  ? 111.777 156.499 128.414 1.00 97.58  ? 475  ARG A NH1   1 
ATOM   3409  N  NH2   . ARG A 1  475  ? 110.047 157.878 127.823 1.00 97.58  ? 475  ARG A NH2   1 
ATOM   3410  N  N     . ILE A 1  476  ? 110.288 154.354 133.696 1.00 94.29  ? 476  ILE A N     1 
ATOM   3411  C  CA    . ILE A 1  476  ? 109.657 153.063 133.449 1.00 94.29  ? 476  ILE A CA    1 
ATOM   3412  C  C     . ILE A 1  476  ? 109.463 152.865 131.953 1.00 94.29  ? 476  ILE A C     1 
ATOM   3413  O  O     . ILE A 1  476  ? 108.967 153.753 131.250 1.00 94.29  ? 476  ILE A O     1 
ATOM   3414  C  CB    . ILE A 1  476  ? 108.323 152.973 134.209 1.00 97.59  ? 476  ILE A CB    1 
ATOM   3415  C  CG1   . ILE A 1  476  ? 108.580 152.985 135.716 1.00 97.59  ? 476  ILE A CG1   1 
ATOM   3416  C  CG2   . ILE A 1  476  ? 107.567 151.728 133.807 1.00 97.59  ? 476  ILE A CG2   1 
ATOM   3417  C  CD1   . ILE A 1  476  ? 107.339 153.157 136.548 1.00 97.59  ? 476  ILE A CD1   1 
ATOM   3418  N  N     . LEU A 1  477  ? 109.856 151.698 131.460 1.00 95.93  ? 477  LEU A N     1 
ATOM   3419  C  CA    . LEU A 1  477  ? 109.798 151.362 130.047 1.00 95.93  ? 477  LEU A CA    1 
ATOM   3420  C  C     . LEU A 1  477  ? 109.217 149.971 129.867 1.00 95.93  ? 477  LEU A C     1 
ATOM   3421  O  O     . LEU A 1  477  ? 109.183 149.177 130.814 1.00 95.93  ? 477  LEU A O     1 
ATOM   3422  C  CB    . LEU A 1  477  ? 111.184 151.417 129.390 1.00 94.86  ? 477  LEU A CB    1 
ATOM   3423  C  CG    . LEU A 1  477  ? 111.783 152.795 129.163 1.00 94.86  ? 477  LEU A CG    1 
ATOM   3424  C  CD1   . LEU A 1  477  ? 113.196 152.710 128.628 1.00 94.86  ? 477  LEU A CD1   1 
ATOM   3425  C  CD2   . LEU A 1  477  ? 110.900 153.487 128.166 1.00 94.86  ? 477  LEU A CD2   1 
ATOM   3426  N  N     . PRO A 1  478  ? 108.751 149.643 128.659 1.00 96.78  ? 478  PRO A N     1 
ATOM   3427  C  CA    . PRO A 1  478  ? 108.266 148.281 128.401 1.00 96.78  ? 478  PRO A CA    1 
ATOM   3428  C  C     . PRO A 1  478  ? 109.349 147.213 128.371 1.00 96.78  ? 478  PRO A C     1 
ATOM   3429  O  O     . PRO A 1  478  ? 110.532 147.458 128.622 1.00 96.78  ? 478  PRO A O     1 
ATOM   3430  C  CB    . PRO A 1  478  ? 107.597 148.410 127.026 1.00 95.50  ? 478  PRO A CB    1 
ATOM   3431  C  CG    . PRO A 1  478  ? 107.222 149.836 126.923 1.00 95.50  ? 478  PRO A CG    1 
ATOM   3432  C  CD    . PRO A 1  478  ? 108.341 150.572 127.591 1.00 95.50  ? 478  PRO A CD    1 
ATOM   3433  N  N     . TRP A 1  479  ? 108.904 146.007 128.037 1.00 101.66 ? 479  TRP A N     1 
ATOM   3434  C  CA    . TRP A 1  479  ? 109.627 144.734 127.920 1.00 101.66 ? 479  TRP A CA    1 
ATOM   3435  C  C     . TRP A 1  479  ? 110.373 144.432 129.226 1.00 101.66 ? 479  TRP A C     1 
ATOM   3436  O  O     . TRP A 1  479  ? 109.994 144.919 130.297 1.00 101.66 ? 479  TRP A O     1 
ATOM   3437  C  CB    . TRP A 1  479  ? 110.509 144.784 126.684 1.00 101.45 ? 479  TRP A CB    1 
ATOM   3438  C  CG    . TRP A 1  479  ? 109.731 144.892 125.402 1.00 101.45 ? 479  TRP A CG    1 
ATOM   3439  C  CD1   . TRP A 1  479  ? 109.409 146.038 124.734 1.00 101.45 ? 479  TRP A CD1   1 
ATOM   3440  C  CD2   . TRP A 1  479  ? 109.180 143.815 124.637 1.00 101.45 ? 479  TRP A CD2   1 
ATOM   3441  N  NE1   . TRP A 1  479  ? 108.690 145.742 123.604 1.00 101.45 ? 479  TRP A NE1   1 
ATOM   3442  C  CE2   . TRP A 1  479  ? 108.535 144.383 123.521 1.00 101.45 ? 479  TRP A CE2   1 
ATOM   3443  C  CE3   . TRP A 1  479  ? 109.168 142.427 124.788 1.00 101.45 ? 479  TRP A CE3   1 
ATOM   3444  C  CZ2   . TRP A 1  479  ? 107.888 143.612 122.563 1.00 101.45 ? 479  TRP A CZ2   1 
ATOM   3445  C  CZ3   . TRP A 1  479  ? 108.525 141.664 123.835 1.00 101.45 ? 479  TRP A CZ3   1 
ATOM   3446  C  CH2   . TRP A 1  479  ? 107.893 142.257 122.738 1.00 101.45 ? 479  TRP A CH2   1 
ATOM   3447  N  N     . SER A 1  480  ? 111.466 143.672 129.141 1.00 96.80  ? 480  SER A N     1 
ATOM   3448  C  CA    . SER A 1  480  ? 112.020 143.008 130.315 1.00 96.80  ? 480  SER A CA    1 
ATOM   3449  C  C     . SER A 1  480  ? 113.323 143.574 130.865 1.00 96.80  ? 480  SER A C     1 
ATOM   3450  O  O     . SER A 1  480  ? 113.772 143.103 131.915 1.00 96.80  ? 480  SER A O     1 
ATOM   3451  C  CB    . SER A 1  480  ? 112.229 141.519 130.014 1.00 104.47 ? 480  SER A CB    1 
ATOM   3452  O  OG    . SER A 1  480  ? 110.993 140.877 129.762 1.00 104.47 ? 480  SER A OG    1 
ATOM   3453  N  N     . THR A 1  481  ? 113.954 144.546 130.213 1.00 93.88  ? 481  THR A N     1 
ATOM   3454  C  CA    . THR A 1  481  ? 115.366 144.800 130.467 1.00 93.88  ? 481  THR A CA    1 
ATOM   3455  C  C     . THR A 1  481  ? 115.608 146.200 131.010 1.00 93.88  ? 481  THR A C     1 
ATOM   3456  O  O     . THR A 1  481  ? 114.875 147.143 130.702 1.00 93.88  ? 481  THR A O     1 
ATOM   3457  C  CB    . THR A 1  481  ? 116.205 144.618 129.198 1.00 96.85  ? 481  THR A CB    1 
ATOM   3458  O  OG1   . THR A 1  481  ? 115.744 145.522 128.187 1.00 96.85  ? 481  THR A OG1   1 
ATOM   3459  C  CG2   . THR A 1  481  ? 116.095 143.198 128.683 1.00 96.85  ? 481  THR A CG2   1 
ATOM   3460  N  N     . PHE A 1  482  ? 116.655 146.314 131.828 1.00 94.63  ? 482  PHE A N     1 
ATOM   3461  C  CA    . PHE A 1  482  ? 117.196 147.615 132.189 1.00 94.63  ? 482  PHE A CA    1 
ATOM   3462  C  C     . PHE A 1  482  ? 117.763 148.301 130.954 1.00 94.63  ? 482  PHE A C     1 
ATOM   3463  O  O     . PHE A 1  482  ? 118.263 147.654 130.031 1.00 94.63  ? 482  PHE A O     1 
ATOM   3464  C  CB    . PHE A 1  482  ? 118.296 147.477 133.242 1.00 92.48  ? 482  PHE A CB    1 
ATOM   3465  C  CG    . PHE A 1  482  ? 117.810 147.025 134.586 1.00 92.48  ? 482  PHE A CG    1 
ATOM   3466  C  CD1   . PHE A 1  482  ? 116.484 147.171 134.952 1.00 92.48  ? 482  PHE A CD1   1 
ATOM   3467  C  CD2   . PHE A 1  482  ? 118.688 146.459 135.489 1.00 92.48  ? 482  PHE A CD2   1 
ATOM   3468  C  CE1   . PHE A 1  482  ? 116.050 146.759 136.194 1.00 92.48  ? 482  PHE A CE1   1 
ATOM   3469  C  CE2   . PHE A 1  482  ? 118.256 146.042 136.729 1.00 92.48  ? 482  PHE A CE2   1 
ATOM   3470  C  CZ    . PHE A 1  482  ? 116.937 146.191 137.080 1.00 92.48  ? 482  PHE A CZ    1 
ATOM   3471  N  N     . ARG A 1  483  ? 117.685 149.628 130.940 1.00 91.60  ? 483  ARG A N     1 
ATOM   3472  C  CA    . ARG A 1  483  ? 118.176 150.407 129.815 1.00 91.60  ? 483  ARG A CA    1 
ATOM   3473  C  C     . ARG A 1  483  ? 118.862 151.652 130.348 1.00 91.60  ? 483  ARG A C     1 
ATOM   3474  O  O     . ARG A 1  483  ? 118.333 152.323 131.234 1.00 91.60  ? 483  ARG A O     1 
ATOM   3475  C  CB    . ARG A 1  483  ? 117.039 150.789 128.866 1.00 94.73  ? 483  ARG A CB    1 
ATOM   3476  C  CG    . ARG A 1  483  ? 116.353 149.586 128.259 1.00 94.73  ? 483  ARG A CG    1 
ATOM   3477  C  CD    . ARG A 1  483  ? 115.177 149.954 127.392 1.00 94.73  ? 483  ARG A CD    1 
ATOM   3478  N  NE    . ARG A 1  483  ? 114.466 148.755 126.957 1.00 94.73  ? 483  ARG A NE    1 
ATOM   3479  C  CZ    . ARG A 1  483  ? 113.547 148.138 127.693 1.00 94.73  ? 483  ARG A CZ    1 
ATOM   3480  N  NH1   . ARG A 1  483  ? 113.233 148.612 128.890 1.00 94.73  ? 483  ARG A NH1   1 
ATOM   3481  N  NH2   . ARG A 1  483  ? 112.943 147.049 127.235 1.00 94.73  ? 483  ARG A NH2   1 
ATOM   3482  N  N     . LEU A 1  484  ? 120.038 151.955 129.808 1.00 96.00  ? 484  LEU A N     1 
ATOM   3483  C  CA    . LEU A 1  484  ? 120.829 153.073 130.301 1.00 96.00  ? 484  LEU A CA    1 
ATOM   3484  C  C     . LEU A 1  484  ? 121.623 153.668 129.150 1.00 96.00  ? 484  LEU A C     1 
ATOM   3485  O  O     . LEU A 1  484  ? 121.919 152.992 128.162 1.00 96.00  ? 484  LEU A O     1 
ATOM   3486  C  CB    . LEU A 1  484  ? 121.741 152.631 131.453 1.00 94.54  ? 484  LEU A CB    1 
ATOM   3487  C  CG    . LEU A 1  484  ? 122.672 151.429 131.245 1.00 94.54  ? 484  LEU A CG    1 
ATOM   3488  C  CD1   . LEU A 1  484  ? 123.949 151.766 130.497 1.00 94.54  ? 484  LEU A CD1   1 
ATOM   3489  C  CD2   . LEU A 1  484  ? 123.003 150.797 132.581 1.00 94.54  ? 484  LEU A CD2   1 
ATOM   3490  N  N     . ASN A 1  485  ? 121.960 154.949 129.286 1.00 98.67  ? 485  ASN A N     1 
ATOM   3491  C  CA    . ASN A 1  485  ? 122.695 155.626 128.228 1.00 98.67  ? 485  ASN A CA    1 
ATOM   3492  C  C     . ASN A 1  485  ? 124.116 155.083 128.148 1.00 98.67  ? 485  ASN A C     1 
ATOM   3493  O  O     . ASN A 1  485  ? 124.684 154.607 129.134 1.00 98.67  ? 485  ASN A O     1 
ATOM   3494  C  CB    . ASN A 1  485  ? 122.713 157.136 128.457 1.00 101.39 ? 485  ASN A CB    1 
ATOM   3495  C  CG    . ASN A 1  485  ? 123.230 157.904 127.252 1.00 101.39 ? 485  ASN A CG    1 
ATOM   3496  O  OD1   . ASN A 1  485  ? 123.902 157.346 126.385 1.00 101.39 ? 485  ASN A OD1   1 
ATOM   3497  N  ND2   . ASN A 1  485  ? 122.917 159.191 127.193 1.00 101.39 ? 485  ASN A ND2   1 
ATOM   3498  N  N     . LEU A 1  486  ? 124.693 155.170 126.953 1.00 100.57 ? 486  LEU A N     1 
ATOM   3499  C  CA    . LEU A 1  486  ? 125.894 154.407 126.653 1.00 100.57 ? 486  LEU A CA    1 
ATOM   3500  C  C     . LEU A 1  486  ? 127.179 155.119 127.049 1.00 100.57 ? 486  LEU A C     1 
ATOM   3501  O  O     . LEU A 1  486  ? 128.233 154.475 127.098 1.00 100.57 ? 486  LEU A O     1 
ATOM   3502  C  CB    . LEU A 1  486  ? 125.892 154.045 125.173 1.00 98.79  ? 486  LEU A CB    1 
ATOM   3503  C  CG    . LEU A 1  486  ? 124.643 153.181 125.013 1.00 98.79  ? 486  LEU A CG    1 
ATOM   3504  C  CD1   . LEU A 1  486  ? 124.396 152.751 123.591 1.00 98.79  ? 486  LEU A CD1   1 
ATOM   3505  C  CD2   . LEU A 1  486  ? 124.756 151.990 125.934 1.00 98.79  ? 486  LEU A CD2   1 
ATOM   3506  N  N     . SER A 1  487  ? 127.121 156.415 127.360 1.00 101.87 ? 487  SER A N     1 
ATOM   3507  C  CA    . SER A 1  487  ? 128.265 157.051 128.000 1.00 101.87 ? 487  SER A CA    1 
ATOM   3508  C  C     . SER A 1  487  ? 128.513 156.476 129.387 1.00 101.87 ? 487  SER A C     1 
ATOM   3509  O  O     . SER A 1  487  ? 129.639 156.555 129.889 1.00 101.87 ? 487  SER A O     1 
ATOM   3510  C  CB    . SER A 1  487  ? 128.056 158.563 128.080 1.00 101.78 ? 487  SER A CB    1 
ATOM   3511  O  OG    . SER A 1  487  ? 127.972 159.135 126.786 1.00 101.78 ? 487  SER A OG    1 
ATOM   3512  N  N     . VAL A 1  488  ? 127.487 155.879 130.005 1.00 98.31  ? 488  VAL A N     1 
ATOM   3513  C  CA    . VAL A 1  488  ? 127.646 155.174 131.275 1.00 98.31  ? 488  VAL A CA    1 
ATOM   3514  C  C     . VAL A 1  488  ? 128.178 153.768 131.057 1.00 98.31  ? 488  VAL A C     1 
ATOM   3515  O  O     . VAL A 1  488  ? 128.379 153.020 132.023 1.00 98.31  ? 488  VAL A O     1 
ATOM   3516  C  CB    . VAL A 1  488  ? 126.283 155.185 132.000 1.00 100.64 ? 488  VAL A CB    1 
ATOM   3517  C  CG1   . VAL A 1  488  ? 126.387 154.660 133.421 1.00 100.64 ? 488  VAL A CG1   1 
ATOM   3518  C  CG2   . VAL A 1  488  ? 125.686 156.575 131.971 1.00 100.64 ? 488  VAL A CG2   1 
ATOM   3519  N  N     . THR A 1  489  ? 128.415 153.386 129.802 1.00 99.69  ? 489  THR A N     1 
ATOM   3520  C  CA    . THR A 1  489  ? 128.980 152.077 129.494 1.00 99.69  ? 489  THR A CA    1 
ATOM   3521  C  C     . THR A 1  489  ? 130.357 151.897 130.127 1.00 99.69  ? 489  THR A C     1 
ATOM   3522  O  O     . THR A 1  489  ? 130.602 150.920 130.844 1.00 99.69  ? 489  THR A O     1 
ATOM   3523  C  CB    . THR A 1  489  ? 129.051 151.903 127.975 1.00 104.06 ? 489  THR A CB    1 
ATOM   3524  O  OG1   . THR A 1  489  ? 127.727 151.813 127.432 1.00 104.06 ? 489  THR A OG1   1 
ATOM   3525  C  CG2   . THR A 1  489  ? 129.846 150.679 127.608 1.00 104.06 ? 489  THR A CG2   1 
ATOM   3526  N  N     . THR A 1  490  ? 131.271 152.835 129.872 1.00 98.09  ? 490  THR A N     1 
ATOM   3527  C  CA    . THR A 1  490  ? 132.653 152.667 130.321 1.00 98.09  ? 490  THR A CA    1 
ATOM   3528  C  C     . THR A 1  490  ? 132.833 152.547 131.835 1.00 98.09  ? 490  THR A C     1 
ATOM   3529  O  O     . THR A 1  490  ? 133.724 151.788 132.252 1.00 98.09  ? 490  THR A O     1 
ATOM   3530  C  CB    . THR A 1  490  ? 133.524 153.803 129.762 1.00 102.15 ? 490  THR A CB    1 
ATOM   3531  O  OG1   . THR A 1  490  ? 132.963 155.074 130.110 1.00 102.15 ? 490  THR A OG1   1 
ATOM   3532  C  CG2   . THR A 1  490  ? 133.633 153.698 128.254 1.00 102.15 ? 490  THR A CG2   1 
ATOM   3533  N  N     . PRO A 1  491  ? 132.084 153.251 132.698 1.00 97.53  ? 491  PRO A N     1 
ATOM   3534  C  CA    . PRO A 1  491  ? 132.283 153.033 134.146 1.00 97.53  ? 491  PRO A CA    1 
ATOM   3535  C  C     . PRO A 1  491  ? 132.087 151.590 134.585 1.00 97.53  ? 491  PRO A C     1 
ATOM   3536  O  O     . PRO A 1  491  ? 132.892 151.070 135.367 1.00 97.53  ? 491  PRO A O     1 
ATOM   3537  C  CB    . PRO A 1  491  ? 131.243 153.967 134.779 1.00 96.38  ? 491  PRO A CB    1 
ATOM   3538  C  CG    . PRO A 1  491  ? 131.065 155.041 133.796 1.00 96.38  ? 491  PRO A CG    1 
ATOM   3539  C  CD    . PRO A 1  491  ? 131.171 154.383 132.455 1.00 96.38  ? 491  PRO A CD    1 
ATOM   3540  N  N     . TYR A 1  492  ? 131.040 150.921 134.098 1.00 97.31  ? 492  TYR A N     1 
ATOM   3541  C  CA    . TYR A 1  492  ? 130.727 149.588 134.602 1.00 97.31  ? 492  TYR A CA    1 
ATOM   3542  C  C     . TYR A 1  492  ? 131.478 148.493 133.856 1.00 97.31  ? 492  TYR A C     1 
ATOM   3543  O  O     . TYR A 1  492  ? 131.352 147.317 134.213 1.00 97.31  ? 492  TYR A O     1 
ATOM   3544  C  CB    . TYR A 1  492  ? 129.227 149.317 134.507 1.00 98.39  ? 492  TYR A CB    1 
ATOM   3545  C  CG    . TYR A 1  492  ? 128.353 150.206 135.352 1.00 98.39  ? 492  TYR A CG    1 
ATOM   3546  C  CD1   . TYR A 1  492  ? 128.131 149.922 136.690 1.00 98.39  ? 492  TYR A CD1   1 
ATOM   3547  C  CD2   . TYR A 1  492  ? 127.712 151.306 134.803 1.00 98.39  ? 492  TYR A CD2   1 
ATOM   3548  C  CE1   . TYR A 1  492  ? 127.320 150.723 137.462 1.00 98.39  ? 492  TYR A CE1   1 
ATOM   3549  C  CE2   . TYR A 1  492  ? 126.901 152.109 135.568 1.00 98.39  ? 492  TYR A CE2   1 
ATOM   3550  C  CZ    . TYR A 1  492  ? 126.709 151.816 136.895 1.00 98.39  ? 492  TYR A CZ    1 
ATOM   3551  O  OH    . TYR A 1  492  ? 125.898 152.617 137.661 1.00 98.39  ? 492  TYR A OH    1 
ATOM   3552  N  N     . ASN A 1  493  ? 132.231 148.845 132.813 1.00 98.67  ? 493  ASN A N     1 
ATOM   3553  C  CA    . ASN A 1  493  ? 132.921 147.939 131.888 1.00 98.67  ? 493  ASN A CA    1 
ATOM   3554  C  C     . ASN A 1  493  ? 131.927 147.207 130.993 1.00 98.67  ? 493  ASN A C     1 
ATOM   3555  O  O     . ASN A 1  493  ? 132.350 146.381 130.178 1.00 98.67  ? 493  ASN A O     1 
ATOM   3556  C  CB    . ASN A 1  493  ? 133.827 146.907 132.583 1.00 101.78 ? 493  ASN A CB    1 
ATOM   3557  C  CG    . ASN A 1  493  ? 134.996 147.545 133.297 1.00 101.78 ? 493  ASN A CG    1 
ATOM   3558  O  OD1   . ASN A 1  493  ? 135.263 147.250 134.462 1.00 101.78 ? 493  ASN A OD1   1 
ATOM   3559  N  ND2   . ASN A 1  493  ? 135.707 148.422 132.601 1.00 101.78 ? 493  ASN A ND2   1 
ATOM   3560  N  N     . ALA A 1  494  ? 130.630 147.457 131.140 1.00 99.74  ? 494  ALA A N     1 
ATOM   3561  C  CA    . ALA A 1  494  ? 129.612 146.663 130.470 1.00 99.74  ? 494  ALA A CA    1 
ATOM   3562  C  C     . ALA A 1  494  ? 129.691 146.762 128.951 1.00 99.74  ? 494  ALA A C     1 
ATOM   3563  O  O     . ALA A 1  494  ? 130.044 147.795 128.383 1.00 99.74  ? 494  ALA A O     1 
ATOM   3564  C  CB    . ALA A 1  494  ? 128.223 147.100 130.918 1.00 98.31  ? 494  ALA A CB    1 
ATOM   3565  N  N     . ASP A 1  495  ? 129.372 145.647 128.305 1.00 102.11 ? 495  ASP A N     1 
ATOM   3566  C  CA    . ASP A 1  495  ? 128.911 145.590 126.928 1.00 102.11 ? 495  ASP A CA    1 
ATOM   3567  C  C     . ASP A 1  495  ? 127.566 144.886 126.961 1.00 102.11 ? 495  ASP A C     1 
ATOM   3568  O  O     . ASP A 1  495  ? 127.207 144.288 127.975 1.00 102.11 ? 495  ASP A O     1 
ATOM   3569  C  CB    . ASP A 1  495  ? 129.887 144.837 126.020 1.00 108.98 ? 495  ASP A CB    1 
ATOM   3570  C  CG    . ASP A 1  495  ? 130.179 143.433 126.514 1.00 108.98 ? 495  ASP A CG    1 
ATOM   3571  O  OD1   . ASP A 1  495  ? 129.771 143.097 127.646 1.00 108.98 ? 495  ASP A OD1   1 
ATOM   3572  O  OD2   . ASP A 1  495  ? 130.814 142.662 125.766 1.00 108.98 ? 495  ASP A OD2   1 
ATOM   3573  N  N     . PHE A 1  496  ? 126.795 144.964 125.881 1.00 98.87  ? 496  PHE A N     1 
ATOM   3574  C  CA    . PHE A 1  496  ? 125.523 144.252 125.940 1.00 98.87  ? 496  PHE A CA    1 
ATOM   3575  C  C     . PHE A 1  496  ? 125.654 142.949 125.156 1.00 98.87  ? 496  PHE A C     1 
ATOM   3576  O  O     . PHE A 1  496  ? 125.454 142.872 123.943 1.00 98.87  ? 496  PHE A O     1 
ATOM   3577  C  CB    . PHE A 1  496  ? 124.405 145.133 125.408 1.00 97.64  ? 496  PHE A CB    1 
ATOM   3578  C  CG    . PHE A 1  496  ? 124.278 146.431 126.133 1.00 97.64  ? 496  PHE A CG    1 
ATOM   3579  C  CD1   . PHE A 1  496  ? 123.533 146.534 127.293 1.00 97.64  ? 496  PHE A CD1   1 
ATOM   3580  C  CD2   . PHE A 1  496  ? 124.939 147.546 125.667 1.00 97.64  ? 496  PHE A CD2   1 
ATOM   3581  C  CE1   . PHE A 1  496  ? 123.434 147.741 127.957 1.00 97.64  ? 496  PHE A CE1   1 
ATOM   3582  C  CE2   . PHE A 1  496  ? 124.849 148.739 126.327 1.00 97.64  ? 496  PHE A CE2   1 
ATOM   3583  C  CZ    . PHE A 1  496  ? 124.094 148.844 127.470 1.00 97.64  ? 496  PHE A CZ    1 
ATOM   3584  N  N     . ASP A 1  497  ? 126.004 141.906 125.900 1.00 102.69 ? 497  ASP A N     1 
ATOM   3585  C  CA    . ASP A 1  497  ? 125.679 140.524 125.598 1.00 102.69 ? 497  ASP A CA    1 
ATOM   3586  C  C     . ASP A 1  497  ? 125.451 139.801 126.926 1.00 102.69 ? 497  ASP A C     1 
ATOM   3587  O  O     . ASP A 1  497  ? 126.378 139.571 127.704 1.00 102.69 ? 497  ASP A O     1 
ATOM   3588  C  CB    . ASP A 1  497  ? 126.785 139.889 124.746 1.00 104.44 ? 497  ASP A CB    1 
ATOM   3589  C  CG    . ASP A 1  497  ? 128.171 140.149 125.306 1.00 104.44 ? 497  ASP A CG    1 
ATOM   3590  O  OD1   . ASP A 1  497  ? 128.279 140.937 126.264 1.00 104.44 ? 497  ASP A OD1   1 
ATOM   3591  O  OD2   . ASP A 1  497  ? 129.158 139.590 124.781 1.00 104.44 ? 497  ASP A OD2   1 
ATOM   3592  N  N     . GLY A 1  498  ? 124.210 139.411 127.180 1.00 105.84 ? 498  GLY A N     1 
ATOM   3593  C  CA    . GLY A 1  498  ? 123.883 138.677 128.380 1.00 105.84 ? 498  GLY A CA    1 
ATOM   3594  C  C     . GLY A 1  498  ? 124.325 139.296 129.692 1.00 105.84 ? 498  GLY A C     1 
ATOM   3595  O  O     . GLY A 1  498  ? 124.407 138.571 130.691 1.00 105.84 ? 498  GLY A O     1 
ATOM   3596  N  N     . ASP A 1  499  ? 124.623 140.594 129.735 1.00 102.94 ? 499  ASP A N     1 
ATOM   3597  C  CA    . ASP A 1  499  ? 125.057 141.192 130.992 1.00 102.94 ? 499  ASP A CA    1 
ATOM   3598  C  C     . ASP A 1  499  ? 123.871 141.556 131.874 1.00 102.94 ? 499  ASP A C     1 
ATOM   3599  O  O     . ASP A 1  499  ? 122.868 142.104 131.415 1.00 102.94 ? 499  ASP A O     1 
ATOM   3600  C  CB    . ASP A 1  499  ? 125.916 142.436 130.761 1.00 109.78 ? 499  ASP A CB    1 
ATOM   3601  C  CG    . ASP A 1  499  ? 127.348 142.098 130.401 1.00 109.78 ? 499  ASP A CG    1 
ATOM   3602  O  OD1   . ASP A 1  499  ? 127.722 140.923 130.530 1.00 109.78 ? 499  ASP A OD1   1 
ATOM   3603  O  OD2   . ASP A 1  499  ? 128.119 143.011 130.042 1.00 109.78 ? 499  ASP A OD2   1 
ATOM   3604  N  N     . GLU A 1  500  ? 124.006 141.250 133.160 1.00 100.59 ? 500  GLU A N     1 
ATOM   3605  C  CA    . GLU A 1  500  ? 122.990 141.556 134.153 1.00 100.59 ? 500  GLU A CA    1 
ATOM   3606  C  C     . GLU A 1  500  ? 123.560 142.550 135.151 1.00 100.59 ? 500  GLU A C     1 
ATOM   3607  O  O     . GLU A 1  500  ? 124.773 142.619 135.364 1.00 100.59 ? 500  GLU A O     1 
ATOM   3608  C  CB    . GLU A 1  500  ? 122.520 140.297 134.890 1.00 109.41 ? 500  GLU A CB    1 
ATOM   3609  C  CG    . GLU A 1  500  ? 121.904 139.243 133.994 1.00 109.41 ? 500  GLU A CG    1 
ATOM   3610  C  CD    . GLU A 1  500  ? 122.947 138.344 133.364 1.00 109.41 ? 500  GLU A CD    1 
ATOM   3611  O  OE1   . GLU A 1  500  ? 124.152 138.571 133.598 1.00 109.41 ? 500  GLU A OE1   1 
ATOM   3612  O  OE2   . GLU A 1  500  ? 122.564 137.411 132.630 1.00 109.41 ? 500  GLU A OE2   1 
ATOM   3613  N  N     . MET A 1  501  ? 122.669 143.326 135.765 1.00 98.72  ? 501  MET A N     1 
ATOM   3614  C  CA    . MET A 1  501  ? 123.080 144.310 136.757 1.00 98.72  ? 501  MET A CA    1 
ATOM   3615  C  C     . MET A 1  501  ? 122.040 144.421 137.860 1.00 98.72  ? 501  MET A C     1 
ATOM   3616  O  O     . MET A 1  501  ? 120.837 144.447 137.590 1.00 98.72  ? 501  MET A O     1 
ATOM   3617  C  CB    . MET A 1  501  ? 123.316 145.681 136.115 1.00 101.33 ? 501  MET A CB    1 
ATOM   3618  C  CG    . MET A 1  501  ? 124.602 145.760 135.316 1.00 101.33 ? 501  MET A CG    1 
ATOM   3619  S  SD    . MET A 1  501  ? 124.840 147.371 134.568 1.00 101.33 ? 501  MET A SD    1 
ATOM   3620  C  CE    . MET A 1  501  ? 126.438 147.134 133.817 1.00 101.33 ? 501  MET A CE    1 
ATOM   3621  N  N     . ASN A 1  502  ? 122.515 144.511 139.101 1.00 96.50  ? 502  ASN A N     1 
ATOM   3622  C  CA    . ASN A 1  502  ? 121.643 144.582 140.264 1.00 96.50  ? 502  ASN A CA    1 
ATOM   3623  C  C     . ASN A 1  502  ? 121.080 145.984 140.444 1.00 96.50  ? 502  ASN A C     1 
ATOM   3624  O  O     . ASN A 1  502  ? 121.730 146.987 140.132 1.00 96.50  ? 502  ASN A O     1 
ATOM   3625  C  CB    . ASN A 1  502  ? 122.386 144.165 141.533 1.00 103.70 ? 502  ASN A CB    1 
ATOM   3626  C  CG    . ASN A 1  502  ? 122.717 142.692 141.552 1.00 103.70 ? 502  ASN A CG    1 
ATOM   3627  O  OD1   . ASN A 1  502  ? 122.135 141.908 140.806 1.00 103.70 ? 502  ASN A OD1   1 
ATOM   3628  N  ND2   . ASN A 1  502  ? 123.628 142.300 142.428 1.00 103.70 ? 502  ASN A ND2   1 
ATOM   3629  N  N     . LEU A 1  503  ? 119.860 146.038 140.975 1.00 96.72  ? 503  LEU A N     1 
ATOM   3630  C  CA    . LEU A 1  503  ? 119.133 147.282 141.197 1.00 96.72  ? 503  LEU A CA    1 
ATOM   3631  C  C     . LEU A 1  503  ? 118.768 147.363 142.671 1.00 96.72  ? 503  LEU A C     1 
ATOM   3632  O  O     . LEU A 1  503  ? 118.009 146.526 143.169 1.00 96.72  ? 503  LEU A O     1 
ATOM   3633  C  CB    . LEU A 1  503  ? 117.873 147.342 140.330 1.00 96.26  ? 503  LEU A CB    1 
ATOM   3634  C  CG    . LEU A 1  503  ? 117.045 148.624 140.402 1.00 96.26  ? 503  LEU A CG    1 
ATOM   3635  C  CD1   . LEU A 1  503  ? 117.840 149.765 139.801 1.00 96.26  ? 503  LEU A CD1   1 
ATOM   3636  C  CD2   . LEU A 1  503  ? 115.701 148.477 139.707 1.00 96.26  ? 503  LEU A CD2   1 
ATOM   3637  N  N     . HIS A 1  504  ? 119.304 148.363 143.362 1.00 97.71  ? 504  HIS A N     1 
ATOM   3638  C  CA    . HIS A 1  504  ? 119.088 148.554 144.788 1.00 97.71  ? 504  HIS A CA    1 
ATOM   3639  C  C     . HIS A 1  504  ? 118.274 149.819 145.013 1.00 97.71  ? 504  HIS A C     1 
ATOM   3640  O  O     . HIS A 1  504  ? 118.619 150.888 144.502 1.00 97.71  ? 504  HIS A O     1 
ATOM   3641  C  CB    . HIS A 1  504  ? 120.420 148.642 145.536 1.00 99.18  ? 504  HIS A CB    1 
ATOM   3642  C  CG    . HIS A 1  504  ? 121.286 147.433 145.372 1.00 99.18  ? 504  HIS A CG    1 
ATOM   3643  N  ND1   . HIS A 1  504  ? 120.992 146.224 145.962 1.00 99.18  ? 504  HIS A ND1   1 
ATOM   3644  C  CD2   . HIS A 1  504  ? 122.431 147.242 144.674 1.00 99.18  ? 504  HIS A CD2   1 
ATOM   3645  C  CE1   . HIS A 1  504  ? 121.922 145.342 145.644 1.00 99.18  ? 504  HIS A CE1   1 
ATOM   3646  N  NE2   . HIS A 1  504  ? 122.806 145.934 144.861 1.00 99.18  ? 504  HIS A NE2   1 
ATOM   3647  N  N     . LEU A 1  505  ? 117.197 149.693 145.784 1.00 104.77 ? 505  LEU A N     1 
ATOM   3648  C  CA    . LEU A 1  505  ? 116.229 150.768 145.969 1.00 104.77 ? 505  LEU A CA    1 
ATOM   3649  C  C     . LEU A 1  505  ? 116.282 151.290 147.400 1.00 104.77 ? 505  LEU A C     1 
ATOM   3650  O  O     . LEU A 1  505  ? 115.951 150.543 148.337 1.00 104.77 ? 505  LEU A O     1 
ATOM   3651  C  CB    . LEU A 1  505  ? 114.823 150.276 145.634 1.00 105.84 ? 505  LEU A CB    1 
ATOM   3652  C  CG    . LEU A 1  505  ? 113.636 151.211 145.860 1.00 105.84 ? 505  LEU A CG    1 
ATOM   3653  C  CD1   . LEU A 1  505  ? 113.763 152.455 145.012 1.00 105.84 ? 505  LEU A CD1   1 
ATOM   3654  C  CD2   . LEU A 1  505  ? 112.348 150.482 145.538 1.00 105.84 ? 505  LEU A CD2   1 
ATOM   3655  N  N     . PRO A 1  506  ? 116.680 152.541 147.626 1.00 109.25 ? 506  PRO A N     1 
ATOM   3656  C  CA    . PRO A 1  506  ? 116.631 153.094 148.983 1.00 109.25 ? 506  PRO A CA    1 
ATOM   3657  C  C     . PRO A 1  506  ? 115.196 153.275 149.454 1.00 109.25 ? 506  PRO A C     1 
ATOM   3658  O  O     . PRO A 1  506  ? 114.340 153.774 148.722 1.00 109.25 ? 506  PRO A O     1 
ATOM   3659  C  CB    . PRO A 1  506  ? 117.347 154.438 148.834 1.00 105.11 ? 506  PRO A CB    1 
ATOM   3660  C  CG    . PRO A 1  506  ? 117.146 154.804 147.400 1.00 105.11 ? 506  PRO A CG    1 
ATOM   3661  C  CD    . PRO A 1  506  ? 117.227 153.505 146.657 1.00 105.11 ? 506  PRO A CD    1 
ATOM   3662  N  N     . GLN A 1  507  ? 114.940 152.857 150.692 1.00 116.83 ? 507  GLN A N     1 
ATOM   3663  C  CA    . GLN A 1  507  ? 113.597 152.865 151.257 1.00 116.83 ? 507  GLN A CA    1 
ATOM   3664  C  C     . GLN A 1  507  ? 113.311 154.065 152.149 1.00 116.83 ? 507  GLN A C     1 
ATOM   3665  O  O     . GLN A 1  507  ? 112.209 154.155 152.698 1.00 116.83 ? 507  GLN A O     1 
ATOM   3666  C  CB    . GLN A 1  507  ? 113.357 151.573 152.042 1.00 117.60 ? 507  GLN A CB    1 
ATOM   3667  C  CG    . GLN A 1  507  ? 113.378 150.342 151.166 1.00 117.60 ? 507  GLN A CG    1 
ATOM   3668  C  CD    . GLN A 1  507  ? 112.336 150.406 150.071 1.00 117.60 ? 507  GLN A CD    1 
ATOM   3669  O  OE1   . GLN A 1  507  ? 111.197 150.805 150.306 1.00 117.60 ? 507  GLN A OE1   1 
ATOM   3670  N  NE2   . GLN A 1  507  ? 112.734 150.050 148.858 1.00 117.60 ? 507  GLN A NE2   1 
ATOM   3671  N  N     . SER A 1  508  ? 114.257 154.984 152.315 1.00 122.56 ? 508  SER A N     1 
ATOM   3672  C  CA    . SER A 1  508  ? 114.064 156.136 153.184 1.00 122.56 ? 508  SER A CA    1 
ATOM   3673  C  C     . SER A 1  508  ? 114.384 157.418 152.431 1.00 122.56 ? 508  SER A C     1 
ATOM   3674  O  O     . SER A 1  508  ? 115.178 157.412 151.487 1.00 122.56 ? 508  SER A O     1 
ATOM   3675  C  CB    . SER A 1  508  ? 114.936 156.035 154.440 1.00 123.22 ? 508  SER A CB    1 
ATOM   3676  O  OG    . SER A 1  508  ? 114.785 157.182 155.257 1.00 123.22 ? 508  SER A OG    1 
ATOM   3677  N  N     . LEU A 1  509  ? 113.757 158.517 152.854 1.00 124.18 ? 509  LEU A N     1 
ATOM   3678  C  CA    . LEU A 1  509  ? 114.046 159.813 152.248 1.00 124.18 ? 509  LEU A CA    1 
ATOM   3679  C  C     . LEU A 1  509  ? 115.420 160.317 152.666 1.00 124.18 ? 509  LEU A C     1 
ATOM   3680  O  O     . LEU A 1  509  ? 116.057 161.090 151.940 1.00 124.18 ? 509  LEU A O     1 
ATOM   3681  C  CB    . LEU A 1  509  ? 112.960 160.816 152.631 1.00 128.81 ? 509  LEU A CB    1 
ATOM   3682  C  CG    . LEU A 1  509  ? 111.567 160.480 152.097 1.00 128.81 ? 509  LEU A CG    1 
ATOM   3683  C  CD1   . LEU A 1  509  ? 110.533 161.413 152.683 1.00 128.81 ? 509  LEU A CD1   1 
ATOM   3684  C  CD2   . LEU A 1  509  ? 111.547 160.551 150.578 1.00 128.81 ? 509  LEU A CD2   1 
ATOM   3685  N  N     . GLU A 1  510  ? 115.893 159.885 153.834 1.00 124.38 ? 510  GLU A N     1 
ATOM   3686  C  CA    . GLU A 1  510  ? 117.201 160.305 154.322 1.00 124.38 ? 510  GLU A CA    1 
ATOM   3687  C  C     . GLU A 1  510  ? 118.313 159.685 153.483 1.00 124.38 ? 510  GLU A C     1 
ATOM   3688  O  O     . GLU A 1  510  ? 119.209 160.381 152.987 1.00 124.38 ? 510  GLU A O     1 
ATOM   3689  C  CB    . GLU A 1  510  ? 117.332 159.915 155.796 1.00 143.22 ? 510  GLU A CB    1 
ATOM   3690  C  CG    . GLU A 1  510  ? 118.552 160.453 156.505 1.00 143.22 ? 510  GLU A CG    1 
ATOM   3691  C  CD    . GLU A 1  510  ? 118.583 160.055 157.970 1.00 143.22 ? 510  GLU A CD    1 
ATOM   3692  O  OE1   . GLU A 1  510  ? 117.694 159.287 158.398 1.00 143.22 ? 510  GLU A OE1   1 
ATOM   3693  O  OE2   . GLU A 1  510  ? 119.487 160.518 158.697 1.00 143.22 ? 510  GLU A OE2   1 
ATOM   3694  N  N     . THR A 1  511  ? 118.257 158.364 153.302 1.00 117.43 ? 511  THR A N     1 
ATOM   3695  C  CA    . THR A 1  511  ? 119.218 157.694 152.434 1.00 117.43 ? 511  THR A CA    1 
ATOM   3696  C  C     . THR A 1  511  ? 119.036 158.096 150.975 1.00 117.43 ? 511  THR A C     1 
ATOM   3697  O  O     . THR A 1  511  ? 120.013 158.131 150.217 1.00 117.43 ? 511  THR A O     1 
ATOM   3698  C  CB    . THR A 1  511  ? 119.101 156.179 152.595 1.00 117.76 ? 511  THR A CB    1 
ATOM   3699  O  OG1   . THR A 1  511  ? 120.105 155.537 151.804 1.00 117.76 ? 511  THR A OG1   1 
ATOM   3700  C  CG2   . THR A 1  511  ? 117.737 155.691 152.162 1.00 117.76 ? 511  THR A CG2   1 
ATOM   3701  N  N     . ARG A 1  512  ? 117.806 158.411 150.563 1.00 114.00 ? 512  ARG A N     1 
ATOM   3702  C  CA    . ARG A 1  512  ? 117.591 158.906 149.208 1.00 114.00 ? 512  ARG A CA    1 
ATOM   3703  C  C     . ARG A 1  512  ? 118.280 160.248 149.011 1.00 114.00 ? 512  ARG A C     1 
ATOM   3704  O  O     . ARG A 1  512  ? 118.847 160.517 147.944 1.00 114.00 ? 512  ARG A O     1 
ATOM   3705  C  CB    . ARG A 1  512  ? 116.093 159.014 148.927 1.00 113.57 ? 512  ARG A CB    1 
ATOM   3706  C  CG    . ARG A 1  512  ? 115.732 159.495 147.538 1.00 113.57 ? 512  ARG A CG    1 
ATOM   3707  C  CD    . ARG A 1  512  ? 114.224 159.500 147.362 1.00 113.57 ? 512  ARG A CD    1 
ATOM   3708  N  NE    . ARG A 1  512  ? 113.819 159.955 146.037 1.00 113.57 ? 512  ARG A NE    1 
ATOM   3709  C  CZ    . ARG A 1  512  ? 112.572 159.901 145.583 1.00 113.57 ? 512  ARG A CZ    1 
ATOM   3710  N  NH1   . ARG A 1  512  ? 111.607 159.409 146.348 1.00 113.57 ? 512  ARG A NH1   1 
ATOM   3711  N  NH2   . ARG A 1  512  ? 112.287 160.338 144.364 1.00 113.57 ? 512  ARG A NH2   1 
ATOM   3712  N  N     . ALA A 1  513  ? 118.258 161.097 150.040 1.00 116.07 ? 513  ALA A N     1 
ATOM   3713  C  CA    . ALA A 1  513  ? 118.971 162.366 149.968 1.00 116.07 ? 513  ALA A CA    1 
ATOM   3714  C  C     . ALA A 1  513  ? 120.477 162.145 149.947 1.00 116.07 ? 513  ALA A C     1 
ATOM   3715  O  O     . ALA A 1  513  ? 121.204 162.832 149.220 1.00 116.07 ? 513  ALA A O     1 
ATOM   3716  C  CB    . ALA A 1  513  ? 118.571 163.262 151.139 1.00 121.02 ? 513  ALA A CB    1 
ATOM   3717  N  N     . GLU A 1  514  ? 120.969 161.187 150.740 1.00 112.28 ? 514  GLU A N     1 
ATOM   3718  C  CA    . GLU A 1  514  ? 122.392 160.857 150.689 1.00 112.28 ? 514  GLU A CA    1 
ATOM   3719  C  C     . GLU A 1  514  ? 122.814 160.444 149.286 1.00 112.28 ? 514  GLU A C     1 
ATOM   3720  O  O     . GLU A 1  514  ? 123.805 160.950 148.747 1.00 112.28 ? 514  GLU A O     1 
ATOM   3721  C  CB    . GLU A 1  514  ? 122.730 159.741 151.675 1.00 124.85 ? 514  GLU A CB    1 
ATOM   3722  C  CG    . GLU A 1  514  ? 122.702 160.140 153.124 1.00 124.85 ? 514  GLU A CG    1 
ATOM   3723  C  CD    . GLU A 1  514  ? 123.062 158.985 154.027 1.00 124.85 ? 514  GLU A CD    1 
ATOM   3724  O  OE1   . GLU A 1  514  ? 123.082 157.833 153.541 1.00 124.85 ? 514  GLU A OE1   1 
ATOM   3725  O  OE2   . GLU A 1  514  ? 123.357 159.233 155.210 1.00 124.85 ? 514  GLU A OE2   1 
ATOM   3726  N  N     . ILE A 1  515  ? 122.077 159.510 148.687 1.00 107.66 ? 515  ILE A N     1 
ATOM   3727  C  CA    . ILE A 1  515  ? 122.414 159.040 147.347 1.00 107.66 ? 515  ILE A CA    1 
ATOM   3728  C  C     . ILE A 1  515  ? 122.326 160.183 146.349 1.00 107.66 ? 515  ILE A C     1 
ATOM   3729  O  O     . ILE A 1  515  ? 123.138 160.288 145.423 1.00 107.66 ? 515  ILE A O     1 
ATOM   3730  C  CB    . ILE A 1  515  ? 121.490 157.876 146.951 1.00 106.77 ? 515  ILE A CB    1 
ATOM   3731  C  CG1   . ILE A 1  515  ? 121.657 156.714 147.924 1.00 106.77 ? 515  ILE A CG1   1 
ATOM   3732  C  CG2   . ILE A 1  515  ? 121.791 157.409 145.541 1.00 106.77 ? 515  ILE A CG2   1 
ATOM   3733  C  CD1   . ILE A 1  515  ? 120.590 155.674 147.773 1.00 106.77 ? 515  ILE A CD1   1 
ATOM   3734  N  N     . GLN A 1  516  ? 121.347 161.068 146.533 1.00 110.44 ? 516  GLN A N     1 
ATOM   3735  C  CA    . GLN A 1  516  ? 121.144 162.140 145.570 1.00 110.44 ? 516  GLN A CA    1 
ATOM   3736  C  C     . GLN A 1  516  ? 122.249 163.185 145.646 1.00 110.44 ? 516  GLN A C     1 
ATOM   3737  O  O     . GLN A 1  516  ? 122.608 163.781 144.625 1.00 110.44 ? 516  GLN A O     1 
ATOM   3738  C  CB    . GLN A 1  516  ? 119.778 162.784 145.790 1.00 113.56 ? 516  GLN A CB    1 
ATOM   3739  C  CG    . GLN A 1  516  ? 119.366 163.754 144.703 1.00 113.56 ? 516  GLN A CG    1 
ATOM   3740  C  CD    . GLN A 1  516  ? 117.931 164.201 144.860 1.00 113.56 ? 516  GLN A CD    1 
ATOM   3741  O  OE1   . GLN A 1  516  ? 117.217 163.722 145.741 1.00 113.56 ? 516  GLN A OE1   1 
ATOM   3742  N  NE2   . GLN A 1  516  ? 117.495 165.116 144.004 1.00 113.56 ? 516  GLN A NE2   1 
ATOM   3743  N  N     . GLU A 1  517  ? 122.780 163.440 146.836 1.00 111.94 ? 517  GLU A N     1 
ATOM   3744  C  CA    . GLU A 1  517  ? 123.806 164.455 147.018 1.00 111.94 ? 517  GLU A CA    1 
ATOM   3745  C  C     . GLU A 1  517  ? 125.217 163.881 147.096 1.00 111.94 ? 517  GLU A C     1 
ATOM   3746  O  O     . GLU A 1  517  ? 126.166 164.639 147.321 1.00 111.94 ? 517  GLU A O     1 
ATOM   3747  C  CB    . GLU A 1  517  ? 123.467 165.281 148.256 1.00 130.56 ? 517  GLU A CB    1 
ATOM   3748  C  CG    . GLU A 1  517  ? 122.104 165.924 148.065 1.00 130.56 ? 517  GLU A CG    1 
ATOM   3749  C  CD    . GLU A 1  517  ? 121.611 166.705 149.250 1.00 130.56 ? 517  GLU A CD    1 
ATOM   3750  O  OE1   . GLU A 1  517  ? 122.278 166.705 150.305 1.00 130.56 ? 517  GLU A OE1   1 
ATOM   3751  O  OE2   . GLU A 1  517  ? 120.523 167.299 149.122 1.00 130.56 ? 517  GLU A OE2   1 
ATOM   3752  N  N     . LEU A 1  518  ? 125.374 162.567 146.926 1.00 106.49 ? 518  LEU A N     1 
ATOM   3753  C  CA    . LEU A 1  518  ? 126.683 161.919 146.927 1.00 106.49 ? 518  LEU A CA    1 
ATOM   3754  C  C     . LEU A 1  518  ? 126.896 161.043 145.700 1.00 106.49 ? 518  LEU A C     1 
ATOM   3755  O  O     . LEU A 1  518  ? 127.808 161.307 144.911 1.00 106.49 ? 518  LEU A O     1 
ATOM   3756  C  CB    . LEU A 1  518  ? 126.868 161.088 148.204 1.00 106.22 ? 518  LEU A CB    1 
ATOM   3757  C  CG    . LEU A 1  518  ? 126.955 161.835 149.536 1.00 106.22 ? 518  LEU A CG    1 
ATOM   3758  C  CD1   . LEU A 1  518  ? 127.013 160.847 150.687 1.00 106.22 ? 518  LEU A CD1   1 
ATOM   3759  C  CD2   . LEU A 1  518  ? 128.162 162.758 149.559 1.00 106.22 ? 518  LEU A CD2   1 
ATOM   3760  N  N     . ALA A 1  519  ? 126.089 159.999 145.521 1.00 106.80 ? 519  ALA A N     1 
ATOM   3761  C  CA    . ALA A 1  519  ? 126.371 158.936 144.566 1.00 106.80 ? 519  ALA A CA    1 
ATOM   3762  C  C     . ALA A 1  519  ? 125.751 159.147 143.191 1.00 106.80 ? 519  ALA A C     1 
ATOM   3763  O  O     . ALA A 1  519  ? 125.850 158.249 142.350 1.00 106.80 ? 519  ALA A O     1 
ATOM   3764  C  CB    . ALA A 1  519  ? 125.898 157.592 145.127 1.00 103.03 ? 519  ALA A CB    1 
ATOM   3765  N  N     . MET A 1  520  ? 125.109 160.285 142.935 1.00 106.69 ? 520  MET A N     1 
ATOM   3766  C  CA    . MET A 1  520  ? 124.517 160.500 141.621 1.00 106.69 ? 520  MET A CA    1 
ATOM   3767  C  C     . MET A 1  520  ? 125.586 160.510 140.537 1.00 106.69 ? 520  MET A C     1 
ATOM   3768  O  O     . MET A 1  520  ? 126.751 160.839 140.778 1.00 106.69 ? 520  MET A O     1 
ATOM   3769  C  CB    . MET A 1  520  ? 123.727 161.805 141.583 1.00 106.14 ? 520  MET A CB    1 
ATOM   3770  C  CG    . MET A 1  520  ? 122.447 161.750 142.372 1.00 106.14 ? 520  MET A CG    1 
ATOM   3771  S  SD    . MET A 1  520  ? 121.299 160.499 141.773 1.00 106.14 ? 520  MET A SD    1 
ATOM   3772  C  CE    . MET A 1  520  ? 120.836 161.204 140.196 1.00 106.14 ? 520  MET A CE    1 
ATOM   3773  N  N     . VAL A 1  521  ? 125.171 160.132 139.327 1.00 103.29 ? 521  VAL A N     1 
ATOM   3774  C  CA    . VAL A 1  521  ? 126.123 159.982 138.227 1.00 103.29 ? 521  VAL A CA    1 
ATOM   3775  C  C     . VAL A 1  521  ? 126.737 161.311 137.798 1.00 103.29 ? 521  VAL A C     1 
ATOM   3776  O  O     . VAL A 1  521  ? 127.964 161.365 137.617 1.00 103.29 ? 521  VAL A O     1 
ATOM   3777  C  CB    . VAL A 1  521  ? 125.461 159.236 137.056 1.00 99.71  ? 521  VAL A CB    1 
ATOM   3778  C  CG1   . VAL A 1  521  ? 126.455 159.031 135.941 1.00 99.71  ? 521  VAL A CG1   1 
ATOM   3779  C  CG2   . VAL A 1  521  ? 124.913 157.914 137.520 1.00 99.71  ? 521  VAL A CG2   1 
ATOM   3780  N  N     . PRO A 1  522  ? 125.974 162.396 137.602 1.00 106.85 ? 522  PRO A N     1 
ATOM   3781  C  CA    . PRO A 1  522  ? 126.611 163.655 137.178 1.00 106.85 ? 522  PRO A CA    1 
ATOM   3782  C  C     . PRO A 1  522  ? 127.669 164.169 138.138 1.00 106.85 ? 522  PRO A C     1 
ATOM   3783  O  O     . PRO A 1  522  ? 128.566 164.900 137.703 1.00 106.85 ? 522  PRO A O     1 
ATOM   3784  C  CB    . PRO A 1  522  ? 125.428 164.629 137.072 1.00 104.26 ? 522  PRO A CB    1 
ATOM   3785  C  CG    . PRO A 1  522  ? 124.385 164.050 137.945 1.00 104.26 ? 522  PRO A CG    1 
ATOM   3786  C  CD    . PRO A 1  522  ? 124.518 162.572 137.741 1.00 104.26 ? 522  PRO A CD    1 
ATOM   3787  N  N     . ARG A 1  523  ? 127.603 163.810 139.422 1.00 109.05 ? 523  ARG A N     1 
ATOM   3788  C  CA    . ARG A 1  523  ? 128.625 164.238 140.370 1.00 109.05 ? 523  ARG A CA    1 
ATOM   3789  C  C     . ARG A 1  523  ? 129.900 163.414 140.251 1.00 109.05 ? 523  ARG A C     1 
ATOM   3790  O  O     . ARG A 1  523  ? 130.978 163.890 140.622 1.00 109.05 ? 523  ARG A O     1 
ATOM   3791  C  CB    . ARG A 1  523  ? 128.089 164.144 141.799 1.00 113.81 ? 523  ARG A CB    1 
ATOM   3792  C  CG    . ARG A 1  523  ? 126.930 165.074 142.089 1.00 113.81 ? 523  ARG A CG    1 
ATOM   3793  C  CD    . ARG A 1  523  ? 126.487 164.974 143.538 1.00 113.81 ? 523  ARG A CD    1 
ATOM   3794  N  NE    . ARG A 1  523  ? 125.354 165.851 143.816 1.00 113.81 ? 523  ARG A NE    1 
ATOM   3795  C  CZ    . ARG A 1  523  ? 125.465 167.138 144.128 1.00 113.81 ? 523  ARG A CZ    1 
ATOM   3796  N  NH1   . ARG A 1  523  ? 126.662 167.702 144.206 1.00 113.81 ? 523  ARG A NH1   1 
ATOM   3797  N  NH2   . ARG A 1  523  ? 124.379 167.863 144.364 1.00 113.81 ? 523  ARG A NH2   1 
ATOM   3798  N  N     . MET A 1  524  ? 129.794 162.191 139.743 1.00 107.83 ? 524  MET A N     1 
ATOM   3799  C  CA    . MET A 1  524  ? 130.884 161.227 139.721 1.00 107.83 ? 524  MET A CA    1 
ATOM   3800  C  C     . MET A 1  524  ? 131.670 161.232 138.415 1.00 107.83 ? 524  MET A C     1 
ATOM   3801  O  O     . MET A 1  524  ? 132.493 160.335 138.204 1.00 107.83 ? 524  MET A O     1 
ATOM   3802  C  CB    . MET A 1  524  ? 130.337 159.829 140.009 1.00 109.70 ? 524  MET A CB    1 
ATOM   3803  C  CG    . MET A 1  524  ? 129.781 159.700 141.417 1.00 109.70 ? 524  MET A CG    1 
ATOM   3804  S  SD    . MET A 1  524  ? 129.041 158.102 141.773 1.00 109.70 ? 524  MET A SD    1 
ATOM   3805  C  CE    . MET A 1  524  ? 130.502 157.077 141.790 1.00 109.70 ? 524  MET A CE    1 
ATOM   3806  N  N     . ILE A 1  525  ? 131.412 162.197 137.527 1.00 107.03 ? 525  ILE A N     1 
ATOM   3807  C  CA    . ILE A 1  525  ? 132.029 162.206 136.198 1.00 107.03 ? 525  ILE A CA    1 
ATOM   3808  C  C     . ILE A 1  525  ? 133.548 162.108 136.300 1.00 107.03 ? 525  ILE A C     1 
ATOM   3809  O  O     . ILE A 1  525  ? 134.170 161.199 135.739 1.00 107.03 ? 525  ILE A O     1 
ATOM   3810  C  CB    . ILE A 1  525  ? 131.609 163.465 135.421 1.00 104.64 ? 525  ILE A CB    1 
ATOM   3811  C  CG1   . ILE A 1  525  ? 130.116 163.427 135.100 1.00 104.64 ? 525  ILE A CG1   1 
ATOM   3812  C  CG2   . ILE A 1  525  ? 132.434 163.610 134.157 1.00 104.64 ? 525  ILE A CG2   1 
ATOM   3813  C  CD1   . ILE A 1  525  ? 129.588 164.722 134.534 1.00 104.64 ? 525  ILE A CD1   1 
ATOM   3814  N  N     . VAL A 1  526  ? 134.167 163.042 137.012 1.00 108.18 ? 526  VAL A N     1 
ATOM   3815  C  CA    . VAL A 1  526  ? 135.621 163.046 137.144 1.00 108.18 ? 526  VAL A CA    1 
ATOM   3816  C  C     . VAL A 1  526  ? 136.025 162.092 138.256 1.00 108.18 ? 526  VAL A C     1 
ATOM   3817  O  O     . VAL A 1  526  ? 135.504 162.165 139.375 1.00 108.18 ? 526  VAL A O     1 
ATOM   3818  C  CB    . VAL A 1  526  ? 136.144 164.465 137.410 1.00 106.15 ? 526  VAL A CB    1 
ATOM   3819  C  CG1   . VAL A 1  526  ? 137.631 164.430 137.721 1.00 106.15 ? 526  VAL A CG1   1 
ATOM   3820  C  CG2   . VAL A 1  526  ? 135.890 165.340 136.204 1.00 106.15 ? 526  VAL A CG2   1 
ATOM   3821  N  N     . THR A 1  527  ? 136.958 161.193 137.952 1.00 108.14 ? 527  THR A N     1 
ATOM   3822  C  CA    . THR A 1  527  ? 137.373 160.244 138.973 1.00 108.14 ? 527  THR A CA    1 
ATOM   3823  C  C     . THR A 1  527  ? 138.460 160.849 139.844 1.00 108.14 ? 527  THR A C     1 
ATOM   3824  O  O     . THR A 1  527  ? 139.310 161.594 139.338 1.00 108.14 ? 527  THR A O     1 
ATOM   3825  C  CB    . THR A 1  527  ? 137.872 158.943 138.343 1.00 108.00 ? 527  THR A CB    1 
ATOM   3826  O  OG1   . THR A 1  527  ? 138.142 157.982 139.369 1.00 108.00 ? 527  THR A OG1   1 
ATOM   3827  C  CG2   . THR A 1  527  ? 139.127 159.163 137.516 1.00 108.00 ? 527  THR A CG2   1 
ATOM   3828  N  N     . PRO A 1  528  ? 138.438 160.603 141.157 1.00 106.82 ? 528  PRO A N     1 
ATOM   3829  C  CA    . PRO A 1  528  ? 139.584 160.986 141.990 1.00 106.82 ? 528  PRO A CA    1 
ATOM   3830  C  C     . PRO A 1  528  ? 140.807 160.131 141.747 1.00 106.82 ? 528  PRO A C     1 
ATOM   3831  O  O     . PRO A 1  528  ? 141.916 160.558 142.090 1.00 106.82 ? 528  PRO A O     1 
ATOM   3832  C  CB    . PRO A 1  528  ? 139.053 160.810 143.415 1.00 105.89 ? 528  PRO A CB    1 
ATOM   3833  C  CG    . PRO A 1  528  ? 137.997 159.778 143.290 1.00 105.89 ? 528  PRO A CG    1 
ATOM   3834  C  CD    . PRO A 1  528  ? 137.359 159.990 141.948 1.00 105.89 ? 528  PRO A CD    1 
ATOM   3835  N  N     . GLN A 1  529  ? 140.638 158.932 141.183 1.00 108.00 ? 529  GLN A N     1 
ATOM   3836  C  CA    . GLN A 1  529  ? 141.782 158.078 140.878 1.00 108.00 ? 529  GLN A CA    1 
ATOM   3837  C  C     . GLN A 1  529  ? 142.775 158.783 139.966 1.00 108.00 ? 529  GLN A C     1 
ATOM   3838  O  O     . GLN A 1  529  ? 143.859 159.181 140.400 1.00 108.00 ? 529  GLN A O     1 
ATOM   3839  C  CB    . GLN A 1  529  ? 141.306 156.783 140.226 1.00 114.66 ? 529  GLN A CB    1 
ATOM   3840  C  CG    . GLN A 1  529  ? 142.432 155.847 139.830 1.00 114.66 ? 529  GLN A CG    1 
ATOM   3841  C  CD    . GLN A 1  529  ? 141.930 154.553 139.229 1.00 114.66 ? 529  GLN A CD    1 
ATOM   3842  O  OE1   . GLN A 1  529  ? 140.730 154.278 139.232 1.00 114.66 ? 529  GLN A OE1   1 
ATOM   3843  N  NE2   . GLN A 1  529  ? 142.843 153.762 138.687 1.00 114.66 ? 529  GLN A NE2   1 
ATOM   3844  N  N     . SER A 1  530  ? 142.421 158.943 138.694 1.00 108.95 ? 530  SER A N     1 
ATOM   3845  C  CA    . SER A 1  530  ? 143.321 159.514 137.705 1.00 108.95 ? 530  SER A CA    1 
ATOM   3846  C  C     . SER A 1  530  ? 143.098 160.998 137.453 1.00 108.95 ? 530  SER A C     1 
ATOM   3847  O  O     . SER A 1  530  ? 143.700 161.536 136.521 1.00 108.95 ? 530  SER A O     1 
ATOM   3848  C  CB    . SER A 1  530  ? 143.205 158.755 136.377 1.00 111.19 ? 530  SER A CB    1 
ATOM   3849  O  OG    . SER A 1  530  ? 141.911 158.905 135.825 1.00 111.19 ? 530  SER A OG    1 
ATOM   3850  N  N     . ASN A 1  531  ? 142.222 161.652 138.221 1.00 107.20 ? 531  ASN A N     1 
ATOM   3851  C  CA    . ASN A 1  531  ? 141.770 163.033 137.990 1.00 107.20 ? 531  ASN A CA    1 
ATOM   3852  C  C     . ASN A 1  531  ? 141.416 163.267 136.520 1.00 107.20 ? 531  ASN A C     1 
ATOM   3853  O  O     . ASN A 1  531  ? 141.676 164.328 135.946 1.00 107.20 ? 531  ASN A O     1 
ATOM   3854  C  CB    . ASN A 1  531  ? 142.769 164.070 138.539 1.00 108.04 ? 531  ASN A CB    1 
ATOM   3855  C  CG    . ASN A 1  531  ? 144.119 164.082 137.831 1.00 108.04 ? 531  ASN A CG    1 
ATOM   3856  O  OD1   . ASN A 1  531  ? 144.214 164.027 136.609 1.00 108.04 ? 531  ASN A OD1   1 
ATOM   3857  N  ND2   . ASN A 1  531  ? 145.183 164.155 138.623 1.00 108.04 ? 531  ASN A ND2   1 
ATOM   3858  N  N     . ARG A 1  532  ? 140.774 162.270 135.927 1.00 105.48 ? 532  ARG A N     1 
ATOM   3859  C  CA    . ARG A 1  532  ? 140.243 162.284 134.575 1.00 105.48 ? 532  ARG A CA    1 
ATOM   3860  C  C     . ARG A 1  532  ? 138.742 162.068 134.641 1.00 105.48 ? 532  ARG A C     1 
ATOM   3861  O  O     . ARG A 1  532  ? 138.224 161.559 135.641 1.00 105.48 ? 532  ARG A O     1 
ATOM   3862  C  CB    . ARG A 1  532  ? 140.875 161.183 133.710 1.00 105.93 ? 532  ARG A CB    1 
ATOM   3863  C  CG    . ARG A 1  532  ? 142.353 161.342 133.433 1.00 105.93 ? 532  ARG A CG    1 
ATOM   3864  C  CD    . ARG A 1  532  ? 142.847 160.226 132.520 1.00 105.93 ? 532  ARG A CD    1 
ATOM   3865  N  NE    . ARG A 1  532  ? 142.735 158.909 133.142 1.00 105.93 ? 532  ARG A NE    1 
ATOM   3866  C  CZ    . ARG A 1  532  ? 141.773 158.031 132.876 1.00 105.93 ? 532  ARG A CZ    1 
ATOM   3867  N  NH1   . ARG A 1  532  ? 140.828 158.325 131.994 1.00 105.93 ? 532  ARG A NH1   1 
ATOM   3868  N  NH2   . ARG A 1  532  ? 141.753 156.860 133.496 1.00 105.93 ? 532  ARG A NH2   1 
ATOM   3869  N  N     . PRO A 1  533  ? 138.008 162.454 133.601 1.00 104.25 ? 533  PRO A N     1 
ATOM   3870  C  CA    . PRO A 1  533  ? 136.594 162.070 133.532 1.00 104.25 ? 533  PRO A CA    1 
ATOM   3871  C  C     . PRO A 1  533  ? 136.449 160.585 133.242 1.00 104.25 ? 533  PRO A C     1 
ATOM   3872  O  O     . PRO A 1  533  ? 137.190 160.014 132.439 1.00 104.25 ? 533  PRO A O     1 
ATOM   3873  C  CB    . PRO A 1  533  ? 136.053 162.925 132.377 1.00 104.33 ? 533  PRO A CB    1 
ATOM   3874  C  CG    . PRO A 1  533  ? 137.242 163.186 131.528 1.00 104.33 ? 533  PRO A CG    1 
ATOM   3875  C  CD    . PRO A 1  533  ? 138.391 163.336 132.484 1.00 104.33 ? 533  PRO A CD    1 
ATOM   3876  N  N     . VAL A 1  534  ? 135.488 159.953 133.916 1.00 104.29 ? 534  VAL A N     1 
ATOM   3877  C  CA    . VAL A 1  534  ? 135.251 158.531 133.699 1.00 104.29 ? 534  VAL A CA    1 
ATOM   3878  C  C     . VAL A 1  534  ? 134.494 158.309 132.400 1.00 104.29 ? 534  VAL A C     1 
ATOM   3879  O  O     . VAL A 1  534  ? 134.856 157.446 131.591 1.00 104.29 ? 534  VAL A O     1 
ATOM   3880  C  CB    . VAL A 1  534  ? 134.490 157.921 134.892 1.00 102.61 ? 534  VAL A CB    1 
ATOM   3881  C  CG1   . VAL A 1  534  ? 134.230 156.444 134.651 1.00 102.61 ? 534  VAL A CG1   1 
ATOM   3882  C  CG2   . VAL A 1  534  ? 135.252 158.124 136.170 1.00 102.61 ? 534  VAL A CG2   1 
ATOM   3883  N  N     . MET A 1  535  ? 133.447 159.093 132.175 1.00 104.20 ? 535  MET A N     1 
ATOM   3884  C  CA    . MET A 1  535  ? 132.561 158.902 131.039 1.00 104.20 ? 535  MET A CA    1 
ATOM   3885  C  C     . MET A 1  535  ? 133.007 159.766 129.869 1.00 104.20 ? 535  MET A C     1 
ATOM   3886  O  O     . MET A 1  535  ? 133.430 160.912 130.056 1.00 104.20 ? 535  MET A O     1 
ATOM   3887  C  CB    . MET A 1  535  ? 131.121 159.239 131.425 1.00 107.60 ? 535  MET A CB    1 
ATOM   3888  C  CG    . MET A 1  535  ? 130.531 158.303 132.453 1.00 107.60 ? 535  MET A CG    1 
ATOM   3889  S  SD    . MET A 1  535  ? 128.827 158.727 132.837 1.00 107.60 ? 535  MET A SD    1 
ATOM   3890  C  CE    . MET A 1  535  ? 129.090 160.202 133.810 1.00 107.60 ? 535  MET A CE    1 
ATOM   3891  N  N     . GLY A 1  536  ? 132.910 159.211 128.664 1.00 98.27  ? 536  GLY A N     1 
ATOM   3892  C  CA    . GLY A 1  536  ? 133.224 159.942 127.455 1.00 98.27  ? 536  GLY A CA    1 
ATOM   3893  C  C     . GLY A 1  536  ? 132.392 159.406 126.313 1.00 98.27  ? 536  GLY A C     1 
ATOM   3894  O  O     . GLY A 1  536  ? 131.661 158.425 126.455 1.00 98.27  ? 536  GLY A O     1 
ATOM   3895  N  N     . ILE A 1  537  ? 132.509 160.072 125.168 1.00 97.02  ? 537  ILE A N     1 
ATOM   3896  C  CA    . ILE A 1  537  ? 131.762 159.654 123.990 1.00 97.02  ? 537  ILE A CA    1 
ATOM   3897  C  C     . ILE A 1  537  ? 132.386 158.385 123.425 1.00 97.02  ? 537  ILE A C     1 
ATOM   3898  O  O     . ILE A 1  537  ? 133.583 158.346 123.110 1.00 97.02  ? 537  ILE A O     1 
ATOM   3899  C  CB    . ILE A 1  537  ? 131.729 160.785 122.954 1.00 95.73  ? 537  ILE A CB    1 
ATOM   3900  C  CG1   . ILE A 1  537  ? 131.138 162.052 123.575 1.00 95.73  ? 537  ILE A CG1   1 
ATOM   3901  C  CG2   . ILE A 1  537  ? 130.911 160.379 121.765 1.00 95.73  ? 537  ILE A CG2   1 
ATOM   3902  C  CD1   . ILE A 1  537  ? 129.726 161.882 124.101 1.00 95.73  ? 537  ILE A CD1   1 
ATOM   3903  N  N     . VAL A 1  538  ? 131.573 157.336 123.291 1.00 96.67  ? 538  VAL A N     1 
ATOM   3904  C  CA    . VAL A 1  538  ? 132.060 155.992 123.003 1.00 96.67  ? 538  VAL A CA    1 
ATOM   3905  C  C     . VAL A 1  538  ? 131.199 155.367 121.909 1.00 96.67  ? 538  VAL A C     1 
ATOM   3906  O  O     . VAL A 1  538  ? 130.023 155.707 121.749 1.00 96.67  ? 538  VAL A O     1 
ATOM   3907  C  CB    . VAL A 1  538  ? 132.062 155.124 124.290 1.00 97.22  ? 538  VAL A CB    1 
ATOM   3908  C  CG1   . VAL A 1  538  ? 132.482 153.688 124.010 1.00 97.22  ? 538  VAL A CG1   1 
ATOM   3909  C  CG2   . VAL A 1  538  ? 132.976 155.733 125.339 1.00 97.22  ? 538  VAL A CG2   1 
ATOM   3910  N  N     . GLN A 1  539  ? 131.803 154.450 121.153 1.00 92.99  ? 539  GLN A N     1 
ATOM   3911  C  CA    . GLN A 1  539  ? 131.149 153.663 120.093 1.00 92.99  ? 539  GLN A CA    1 
ATOM   3912  C  C     . GLN A 1  539  ? 130.692 154.610 118.986 1.00 92.99  ? 539  GLN A C     1 
ATOM   3913  O  O     . GLN A 1  539  ? 131.498 155.442 118.541 1.00 92.99  ? 539  GLN A O     1 
ATOM   3914  C  CB    . GLN A 1  539  ? 130.055 152.797 120.706 1.00 100.32 ? 539  GLN A CB    1 
ATOM   3915  C  CG    . GLN A 1  539  ? 130.575 151.713 121.622 1.00 100.32 ? 539  GLN A CG    1 
ATOM   3916  C  CD    . GLN A 1  539  ? 131.457 150.727 120.891 1.00 100.32 ? 539  GLN A CD    1 
ATOM   3917  O  OE1   . GLN A 1  539  ? 132.683 150.792 120.979 1.00 100.32 ? 539  GLN A OE1   1 
ATOM   3918  N  NE2   . GLN A 1  539  ? 130.840 149.814 120.151 1.00 100.32 ? 539  GLN A NE2   1 
ATOM   3919  N  N     . ASP A 1  540  ? 129.445 154.518 118.515 1.00 93.56  ? 540  ASP A N     1 
ATOM   3920  C  CA    . ASP A 1  540  ? 129.032 155.224 117.306 1.00 93.56  ? 540  ASP A CA    1 
ATOM   3921  C  C     . ASP A 1  540  ? 129.214 156.728 117.446 1.00 93.56  ? 540  ASP A C     1 
ATOM   3922  O  O     . ASP A 1  540  ? 129.786 157.378 116.566 1.00 93.56  ? 540  ASP A O     1 
ATOM   3923  C  CB    . ASP A 1  540  ? 127.572 154.908 116.985 1.00 105.29 ? 540  ASP A CB    1 
ATOM   3924  C  CG    . ASP A 1  540  ? 127.366 153.482 116.540 1.00 105.29 ? 540  ASP A CG    1 
ATOM   3925  O  OD1   . ASP A 1  540  ? 128.356 152.824 116.166 1.00 105.29 ? 540  ASP A OD1   1 
ATOM   3926  O  OD2   . ASP A 1  540  ? 126.207 153.018 116.562 1.00 105.29 ? 540  ASP A OD2   1 
ATOM   3927  N  N     . THR A 1  541  ? 128.725 157.296 118.551 1.00 94.04  ? 541  THR A N     1 
ATOM   3928  C  CA    . THR A 1  541  ? 128.631 158.747 118.666 1.00 94.04  ? 541  THR A CA    1 
ATOM   3929  C  C     . THR A 1  541  ? 129.988 159.421 118.506 1.00 94.04  ? 541  THR A C     1 
ATOM   3930  O  O     . THR A 1  541  ? 130.062 160.545 118.011 1.00 94.04  ? 541  THR A O     1 
ATOM   3931  C  CB    . THR A 1  541  ? 127.993 159.130 120.005 1.00 92.36  ? 541  THR A CB    1 
ATOM   3932  O  OG1   . THR A 1  541  ? 126.714 158.495 120.121 1.00 92.36  ? 541  THR A OG1   1 
ATOM   3933  C  CG2   . THR A 1  541  ? 127.787 160.636 120.096 1.00 92.36  ? 541  THR A CG2   1 
ATOM   3934  N  N     . LEU A 1  542  ? 131.074 158.738 118.875 1.00 93.09  ? 542  LEU A N     1 
ATOM   3935  C  CA    . LEU A 1  542  ? 132.401 159.331 118.726 1.00 93.09  ? 542  LEU A CA    1 
ATOM   3936  C  C     . LEU A 1  542  ? 132.839 159.342 117.265 1.00 93.09  ? 542  LEU A C     1 
ATOM   3937  O  O     . LEU A 1  542  ? 133.360 160.350 116.767 1.00 93.09  ? 542  LEU A O     1 
ATOM   3938  C  CB    . LEU A 1  542  ? 133.405 158.579 119.601 1.00 95.91  ? 542  LEU A CB    1 
ATOM   3939  C  CG    . LEU A 1  542  ? 134.860 159.043 119.565 1.00 95.91  ? 542  LEU A CG    1 
ATOM   3940  C  CD1   . LEU A 1  542  ? 134.963 160.481 120.020 1.00 95.91  ? 542  LEU A CD1   1 
ATOM   3941  C  CD2   . LEU A 1  542  ? 135.719 158.159 120.447 1.00 95.91  ? 542  LEU A CD2   1 
ATOM   3942  N  N     . THR A 1  543  ? 132.627 158.229 116.558 1.00 88.95  ? 543  THR A N     1 
ATOM   3943  C  CA    . THR A 1  543  ? 132.909 158.186 115.125 1.00 88.95  ? 543  THR A CA    1 
ATOM   3944  C  C     . THR A 1  543  ? 132.079 159.221 114.373 1.00 88.95  ? 543  THR A C     1 
ATOM   3945  O  O     . THR A 1  543  ? 132.592 159.944 113.511 1.00 88.95  ? 543  THR A O     1 
ATOM   3946  C  CB    . THR A 1  543  ? 132.637 156.781 114.584 1.00 91.12  ? 543  THR A CB    1 
ATOM   3947  O  OG1   . THR A 1  543  ? 133.528 155.847 115.205 1.00 91.12  ? 543  THR A OG1   1 
ATOM   3948  C  CG2   . THR A 1  543  ? 132.831 156.735 113.081 1.00 91.12  ? 543  THR A CG2   1 
ATOM   3949  N  N     . ALA A 1  544  ? 130.790 159.313 114.703 1.00 92.11  ? 544  ALA A N     1 
ATOM   3950  C  CA    . ALA A 1  544  ? 129.917 160.273 114.041 1.00 92.11  ? 544  ALA A CA    1 
ATOM   3951  C  C     . ALA A 1  544  ? 130.242 161.703 114.447 1.00 92.11  ? 544  ALA A C     1 
ATOM   3952  O  O     . ALA A 1  544  ? 129.902 162.642 113.721 1.00 92.11  ? 544  ALA A O     1 
ATOM   3953  C  CB    . ALA A 1  544  ? 128.457 159.953 114.350 1.00 90.36  ? 544  ALA A CB    1 
ATOM   3954  N  N     . VAL A 1  545  ? 130.879 161.894 115.605 1.00 91.82  ? 545  VAL A N     1 
ATOM   3955  C  CA    . VAL A 1  545  ? 131.406 163.213 115.945 1.00 91.82  ? 545  VAL A CA    1 
ATOM   3956  C  C     . VAL A 1  545  ? 132.578 163.559 115.041 1.00 91.82  ? 545  VAL A C     1 
ATOM   3957  O  O     . VAL A 1  545  ? 132.667 164.673 114.514 1.00 91.82  ? 545  VAL A O     1 
ATOM   3958  C  CB    . VAL A 1  545  ? 131.807 163.287 117.428 1.00 91.62  ? 545  VAL A CB    1 
ATOM   3959  C  CG1   . VAL A 1  545  ? 132.666 164.497 117.653 1.00 91.62  ? 545  VAL A CG1   1 
ATOM   3960  C  CG2   . VAL A 1  545  ? 130.587 163.425 118.296 1.00 91.62  ? 545  VAL A CG2   1 
ATOM   3961  N  N     . ARG A 1  546  ? 133.506 162.618 114.863 1.00 91.69  ? 546  ARG A N     1 
ATOM   3962  C  CA    . ARG A 1  546  ? 134.618 162.862 113.951 1.00 91.69  ? 546  ARG A CA    1 
ATOM   3963  C  C     . ARG A 1  546  ? 134.119 163.195 112.551 1.00 91.69  ? 546  ARG A C     1 
ATOM   3964  O  O     . ARG A 1  546  ? 134.375 164.290 112.040 1.00 91.69  ? 546  ARG A O     1 
ATOM   3965  C  CB    . ARG A 1  546  ? 135.564 161.669 113.876 1.00 100.01 ? 546  ARG A CB    1 
ATOM   3966  C  CG    . ARG A 1  546  ? 136.714 161.952 112.935 1.00 100.01 ? 546  ARG A CG    1 
ATOM   3967  C  CD    . ARG A 1  546  ? 137.681 160.805 112.791 1.00 100.01 ? 546  ARG A CD    1 
ATOM   3968  N  NE    . ARG A 1  546  ? 138.760 161.173 111.882 1.00 100.01 ? 546  ARG A NE    1 
ATOM   3969  C  CZ    . ARG A 1  546  ? 138.688 161.064 110.561 1.00 100.01 ? 546  ARG A CZ    1 
ATOM   3970  N  NH1   . ARG A 1  546  ? 137.587 160.593 109.993 1.00 100.01 ? 546  ARG A NH1   1 
ATOM   3971  N  NH2   . ARG A 1  546  ? 139.716 161.428 109.807 1.00 100.01 ? 546  ARG A NH2   1 
ATOM   3972  N  N     . LYS A 1  547  ? 133.425 162.243 111.919 1.00 89.36  ? 547  LYS A N     1 
ATOM   3973  C  CA    . LYS A 1  547  ? 132.908 162.462 110.572 1.00 89.36  ? 547  LYS A CA    1 
ATOM   3974  C  C     . LYS A 1  547  ? 132.003 163.683 110.500 1.00 89.36  ? 547  LYS A C     1 
ATOM   3975  O  O     . LYS A 1  547  ? 131.954 164.359 109.469 1.00 89.36  ? 547  LYS A O     1 
ATOM   3976  C  CB    . LYS A 1  547  ? 132.148 161.228 110.090 1.00 93.89  ? 547  LYS A CB    1 
ATOM   3977  C  CG    . LYS A 1  547  ? 133.017 160.012 109.852 1.00 93.89  ? 547  LYS A CG    1 
ATOM   3978  C  CD    . LYS A 1  547  ? 132.168 158.766 109.696 1.00 93.89  ? 547  LYS A CD    1 
ATOM   3979  C  CE    . LYS A 1  547  ? 131.240 158.885 108.500 1.00 93.89  ? 547  LYS A CE    1 
ATOM   3980  N  NZ    . LYS A 1  547  ? 130.392 157.676 108.322 1.00 93.89  ? 547  LYS A NZ    1 
ATOM   3981  N  N     . PHE A 1  548  ? 131.289 163.983 111.584 1.00 88.23  ? 548  PHE A N     1 
ATOM   3982  C  CA    . PHE A 1  548  ? 130.361 165.107 111.613 1.00 88.23  ? 548  PHE A CA    1 
ATOM   3983  C  C     . PHE A 1  548  ? 131.062 166.451 111.760 1.00 88.23  ? 548  PHE A C     1 
ATOM   3984  O  O     . PHE A 1  548  ? 130.493 167.477 111.373 1.00 88.23  ? 548  PHE A O     1 
ATOM   3985  C  CB    . PHE A 1  548  ? 129.360 164.913 112.755 1.00 85.04  ? 548  PHE A CB    1 
ATOM   3986  C  CG    . PHE A 1  548  ? 128.389 166.044 112.915 1.00 85.04  ? 548  PHE A CG    1 
ATOM   3987  C  CD1   . PHE A 1  548  ? 127.300 166.160 112.075 1.00 85.04  ? 548  PHE A CD1   1 
ATOM   3988  C  CD2   . PHE A 1  548  ? 128.554 166.980 113.917 1.00 85.04  ? 548  PHE A CD2   1 
ATOM   3989  C  CE1   . PHE A 1  548  ? 126.402 167.199 112.219 1.00 85.04  ? 548  PHE A CE1   1 
ATOM   3990  C  CE2   . PHE A 1  548  ? 127.658 168.019 114.068 1.00 85.04  ? 548  PHE A CE2   1 
ATOM   3991  C  CZ    . PHE A 1  548  ? 126.581 168.127 113.218 1.00 85.04  ? 548  PHE A CZ    1 
ATOM   3992  N  N     . THR A 1  549  ? 132.279 166.469 112.296 1.00 92.15  ? 549  THR A N     1 
ATOM   3993  C  CA    . THR A 1  549  ? 132.988 167.702 112.604 1.00 92.15  ? 549  THR A CA    1 
ATOM   3994  C  C     . THR A 1  549  ? 133.927 168.129 111.478 1.00 92.15  ? 549  THR A C     1 
ATOM   3995  O  O     . THR A 1  549  ? 134.521 169.208 111.553 1.00 92.15  ? 549  THR A O     1 
ATOM   3996  C  CB    . THR A 1  549  ? 133.756 167.525 113.924 1.00 95.46  ? 549  THR A CB    1 
ATOM   3997  O  OG1   . THR A 1  549  ? 132.862 166.997 114.909 1.00 95.46  ? 549  THR A OG1   1 
ATOM   3998  C  CG2   . THR A 1  549  ? 134.264 168.852 114.462 1.00 95.46  ? 549  THR A CG2   1 
ATOM   3999  N  N     . LYS A 1  550  ? 134.052 167.329 110.423 1.00 99.54  ? 550  LYS A N     1 
ATOM   4000  C  CA    . LYS A 1  550  ? 134.901 167.714 109.306 1.00 99.54  ? 550  LYS A CA    1 
ATOM   4001  C  C     . LYS A 1  550  ? 134.354 168.966 108.629 1.00 99.54  ? 550  LYS A C     1 
ATOM   4002  O  O     . LYS A 1  550  ? 133.166 169.285 108.717 1.00 99.54  ? 550  LYS A O     1 
ATOM   4003  C  CB    . LYS A 1  550  ? 135.004 166.586 108.281 1.00 94.71  ? 550  LYS A CB    1 
ATOM   4004  C  CG    . LYS A 1  550  ? 135.724 165.342 108.759 1.00 94.71  ? 550  LYS A CG    1 
ATOM   4005  C  CD    . LYS A 1  550  ? 135.702 164.279 107.672 1.00 94.71  ? 550  LYS A CD    1 
ATOM   4006  C  CE    . LYS A 1  550  ? 136.454 163.027 108.089 1.00 94.71  ? 550  LYS A CE    1 
ATOM   4007  N  NZ    . LYS A 1  550  ? 136.384 161.959 107.050 1.00 94.71  ? 550  LYS A NZ    1 
ATOM   4008  N  N     . ARG A 1  551  ? 135.249 169.686 107.947 1.00 107.21 ? 551  ARG A N     1 
ATOM   4009  C  CA    . ARG A 1  551  ? 134.823 170.851 107.177 1.00 107.21 ? 551  ARG A CA    1 
ATOM   4010  C  C     . ARG A 1  551  ? 133.797 170.464 106.123 1.00 107.21 ? 551  ARG A C     1 
ATOM   4011  O  O     . ARG A 1  551  ? 132.867 171.228 105.840 1.00 107.21 ? 551  ARG A O     1 
ATOM   4012  C  CB    . ARG A 1  551  ? 136.020 171.512 106.500 1.00 117.83 ? 551  ARG A CB    1 
ATOM   4013  C  CG    . ARG A 1  551  ? 137.056 172.101 107.422 1.00 117.83 ? 551  ARG A CG    1 
ATOM   4014  C  CD    . ARG A 1  551  ? 138.147 172.760 106.598 1.00 117.83 ? 551  ARG A CD    1 
ATOM   4015  N  NE    . ARG A 1  551  ? 139.265 173.232 107.405 1.00 117.83 ? 551  ARG A NE    1 
ATOM   4016  C  CZ    . ARG A 1  551  ? 140.381 173.740 106.893 1.00 117.83 ? 551  ARG A CZ    1 
ATOM   4017  N  NH1   . ARG A 1  551  ? 140.516 173.843 105.579 1.00 117.83 ? 551  ARG A NH1   1 
ATOM   4018  N  NH2   . ARG A 1  551  ? 141.359 174.145 107.690 1.00 117.83 ? 551  ARG A NH2   1 
ATOM   4019  N  N     . ASP A 1  552  ? 133.955 169.279 105.529 1.00 110.38 ? 552  ASP A N     1 
ATOM   4020  C  CA    . ASP A 1  552  ? 133.126 168.878 104.400 1.00 110.38 ? 552  ASP A CA    1 
ATOM   4021  C  C     . ASP A 1  552  ? 131.653 168.772 104.756 1.00 110.38 ? 552  ASP A C     1 
ATOM   4022  O  O     . ASP A 1  552  ? 130.809 168.852 103.859 1.00 110.38 ? 552  ASP A O     1 
ATOM   4023  C  CB    . ASP A 1  552  ? 133.613 167.543 103.841 1.00 121.71 ? 552  ASP A CB    1 
ATOM   4024  C  CG    . ASP A 1  552  ? 134.931 167.666 103.122 1.00 121.71 ? 552  ASP A CG    1 
ATOM   4025  O  OD1   . ASP A 1  552  ? 135.318 168.804 102.792 1.00 121.71 ? 552  ASP A OD1   1 
ATOM   4026  O  OD2   . ASP A 1  552  ? 135.576 166.627 102.878 1.00 121.71 ? 552  ASP A OD2   1 
ATOM   4027  N  N     . VAL A 1  553  ? 131.314 168.600 106.034 1.00 103.32 ? 553  VAL A N     1 
ATOM   4028  C  CA    . VAL A 1  553  ? 129.915 168.400 106.377 1.00 103.32 ? 553  VAL A CA    1 
ATOM   4029  C  C     . VAL A 1  553  ? 129.167 169.713 106.244 1.00 103.32 ? 553  VAL A C     1 
ATOM   4030  O  O     . VAL A 1  553  ? 129.459 170.695 106.937 1.00 103.32 ? 553  VAL A O     1 
ATOM   4031  C  CB    . VAL A 1  553  ? 129.783 167.823 107.792 1.00 101.93 ? 553  VAL A CB    1 
ATOM   4032  C  CG1   . VAL A 1  553  ? 128.324 167.751 108.191 1.00 101.93 ? 553  VAL A CG1   1 
ATOM   4033  C  CG2   . VAL A 1  553  ? 130.410 166.454 107.844 1.00 101.93 ? 553  VAL A CG2   1 
ATOM   4034  N  N     . PHE A 1  554  ? 128.181 169.725 105.355 1.00 98.49  ? 554  PHE A N     1 
ATOM   4035  C  CA    . PHE A 1  554  ? 127.285 170.852 105.180 1.00 98.49  ? 554  PHE A CA    1 
ATOM   4036  C  C     . PHE A 1  554  ? 125.865 170.335 105.324 1.00 98.49  ? 554  PHE A C     1 
ATOM   4037  O  O     . PHE A 1  554  ? 125.573 169.186 104.985 1.00 98.49  ? 554  PHE A O     1 
ATOM   4038  C  CB    . PHE A 1  554  ? 127.468 171.531 103.822 1.00 105.15 ? 554  PHE A CB    1 
ATOM   4039  C  CG    . PHE A 1  554  ? 128.795 172.210 103.645 1.00 105.15 ? 554  PHE A CG    1 
ATOM   4040  C  CD1   . PHE A 1  554  ? 129.012 173.475 104.162 1.00 105.15 ? 554  PHE A CD1   1 
ATOM   4041  C  CD2   . PHE A 1  554  ? 129.811 171.603 102.930 1.00 105.15 ? 554  PHE A CD2   1 
ATOM   4042  C  CE1   . PHE A 1  554  ? 130.226 174.107 103.994 1.00 105.15 ? 554  PHE A CE1   1 
ATOM   4043  C  CE2   . PHE A 1  554  ? 131.028 172.232 102.757 1.00 105.15 ? 554  PHE A CE2   1 
ATOM   4044  C  CZ    . PHE A 1  554  ? 131.235 173.485 103.290 1.00 105.15 ? 554  PHE A CZ    1 
ATOM   4045  N  N     . LEU A 1  555  ? 124.984 171.189 105.830 1.00 98.31  ? 555  LEU A N     1 
ATOM   4046  C  CA    . LEU A 1  555  ? 123.635 170.772 106.173 1.00 98.31  ? 555  LEU A CA    1 
ATOM   4047  C  C     . LEU A 1  555  ? 122.635 171.747 105.579 1.00 98.31  ? 555  LEU A C     1 
ATOM   4048  O  O     . LEU A 1  555  ? 122.759 172.961 105.766 1.00 98.31  ? 555  LEU A O     1 
ATOM   4049  C  CB    . LEU A 1  555  ? 123.462 170.692 107.689 1.00 92.19  ? 555  LEU A CB    1 
ATOM   4050  C  CG    . LEU A 1  555  ? 124.362 169.675 108.389 1.00 92.19  ? 555  LEU A CG    1 
ATOM   4051  C  CD1   . LEU A 1  555  ? 124.179 169.751 109.884 1.00 92.19  ? 555  LEU A CD1   1 
ATOM   4052  C  CD2   . LEU A 1  555  ? 124.089 168.272 107.884 1.00 92.19  ? 555  LEU A CD2   1 
ATOM   4053  N  N     . GLU A 1  556  ? 121.647 171.214 104.870 1.00 103.17 ? 556  GLU A N     1 
ATOM   4054  C  CA    . GLU A 1  556  ? 120.563 172.033 104.351 1.00 103.17 ? 556  GLU A CA    1 
ATOM   4055  C  C     . GLU A 1  556  ? 119.617 172.378 105.500 1.00 103.17 ? 556  GLU A C     1 
ATOM   4056  O  O     . GLU A 1  556  ? 119.874 172.065 106.666 1.00 103.17 ? 556  GLU A O     1 
ATOM   4057  C  CB    . GLU A 1  556  ? 119.865 171.321 103.195 1.00 118.79 ? 556  GLU A CB    1 
ATOM   4058  C  CG    . GLU A 1  556  ? 119.232 169.991 103.555 1.00 118.79 ? 556  GLU A CG    1 
ATOM   4059  C  CD    . GLU A 1  556  ? 118.664 169.280 102.343 1.00 118.79 ? 556  GLU A CD    1 
ATOM   4060  O  OE1   . GLU A 1  556  ? 118.475 169.943 101.301 1.00 118.79 ? 556  GLU A OE1   1 
ATOM   4061  O  OE2   . GLU A 1  556  ? 118.408 168.060 102.427 1.00 118.79 ? 556  GLU A OE2   1 
ATOM   4062  N  N     . ARG A 1  557  ? 118.498 173.023 105.177 1.00 99.13  ? 557  ARG A N     1 
ATOM   4063  C  CA    . ARG A 1  557  ? 117.688 173.678 106.199 1.00 99.13  ? 557  ARG A CA    1 
ATOM   4064  C  C     . ARG A 1  557  ? 116.979 172.666 107.097 1.00 99.13  ? 557  ARG A C     1 
ATOM   4065  O  O     . ARG A 1  557  ? 117.072 172.745 108.328 1.00 99.13  ? 557  ARG A O     1 
ATOM   4066  C  CB    . ARG A 1  557  ? 116.695 174.619 105.514 1.00 102.85 ? 557  ARG A CB    1 
ATOM   4067  C  CG    . ARG A 1  557  ? 115.831 175.455 106.429 1.00 102.85 ? 557  ARG A CG    1 
ATOM   4068  C  CD    . ARG A 1  557  ? 115.030 176.455 105.605 1.00 102.85 ? 557  ARG A CD    1 
ATOM   4069  N  NE    . ARG A 1  557  ? 114.163 177.293 106.424 1.00 102.85 ? 557  ARG A NE    1 
ATOM   4070  C  CZ    . ARG A 1  557  ? 112.903 176.998 106.720 1.00 102.85 ? 557  ARG A CZ    1 
ATOM   4071  N  NH1   . ARG A 1  557  ? 112.353 175.890 106.248 1.00 102.85 ? 557  ARG A NH1   1 
ATOM   4072  N  NH2   . ARG A 1  557  ? 112.187 177.820 107.474 1.00 102.85 ? 557  ARG A NH2   1 
ATOM   4073  N  N     . GLY A 1  558  ? 116.285 171.693 106.500 1.00 100.12 ? 558  GLY A N     1 
ATOM   4074  C  CA    . GLY A 1  558  ? 115.481 170.775 107.295 1.00 100.12 ? 558  GLY A CA    1 
ATOM   4075  C  C     . GLY A 1  558  ? 116.306 169.887 108.208 1.00 100.12 ? 558  GLY A C     1 
ATOM   4076  O  O     . GLY A 1  558  ? 115.909 169.605 109.344 1.00 100.12 ? 558  GLY A O     1 
ATOM   4077  N  N     . GLU A 1  559  ? 117.458 169.420 107.722 1.00 100.49 ? 559  GLU A N     1 
ATOM   4078  C  CA    . GLU A 1  559  ? 118.348 168.620 108.556 1.00 100.49 ? 559  GLU A CA    1 
ATOM   4079  C  C     . GLU A 1  559  ? 118.756 169.395 109.802 1.00 100.49 ? 559  GLU A C     1 
ATOM   4080  O  O     . GLU A 1  559  ? 118.768 168.855 110.917 1.00 100.49 ? 559  GLU A O     1 
ATOM   4081  C  CB    . GLU A 1  559  ? 119.578 168.207 107.748 1.00 114.27 ? 559  GLU A CB    1 
ATOM   4082  C  CG    . GLU A 1  559  ? 119.256 167.344 106.539 1.00 114.27 ? 559  GLU A CG    1 
ATOM   4083  C  CD    . GLU A 1  559  ? 120.476 167.049 105.685 1.00 114.27 ? 559  GLU A CD    1 
ATOM   4084  O  OE1   . GLU A 1  559  ? 121.545 167.640 105.941 1.00 114.27 ? 559  GLU A OE1   1 
ATOM   4085  O  OE2   . GLU A 1  559  ? 120.364 166.229 104.751 1.00 114.27 ? 559  GLU A OE2   1 
ATOM   4086  N  N     . VAL A 1  560  ? 119.082 170.677 109.626 1.00 96.84  ? 560  VAL A N     1 
ATOM   4087  C  CA    . VAL A 1  560  ? 119.384 171.537 110.763 1.00 96.84  ? 560  VAL A CA    1 
ATOM   4088  C  C     . VAL A 1  560  ? 118.161 171.680 111.655 1.00 96.84  ? 560  VAL A C     1 
ATOM   4089  O  O     . VAL A 1  560  ? 118.278 171.782 112.880 1.00 96.84  ? 560  VAL A O     1 
ATOM   4090  C  CB    . VAL A 1  560  ? 119.896 172.905 110.274 1.00 96.57  ? 560  VAL A CB    1 
ATOM   4091  C  CG1   . VAL A 1  560  ? 120.138 173.846 111.440 1.00 96.57  ? 560  VAL A CG1   1 
ATOM   4092  C  CG2   . VAL A 1  560  ? 121.156 172.728 109.470 1.00 96.57  ? 560  VAL A CG2   1 
ATOM   4093  N  N     . MET A 1  561  ? 116.967 171.678 111.059 1.00 95.14  ? 561  MET A N     1 
ATOM   4094  C  CA    . MET A 1  561  ? 115.754 171.760 111.865 1.00 95.14  ? 561  MET A CA    1 
ATOM   4095  C  C     . MET A 1  561  ? 115.629 170.558 112.793 1.00 95.14  ? 561  MET A C     1 
ATOM   4096  O  O     . MET A 1  561  ? 115.272 170.703 113.968 1.00 95.14  ? 561  MET A O     1 
ATOM   4097  C  CB    . MET A 1  561  ? 114.524 171.872 110.965 1.00 100.82 ? 561  MET A CB    1 
ATOM   4098  C  CG    . MET A 1  561  ? 114.525 173.095 110.072 1.00 100.82 ? 561  MET A CG    1 
ATOM   4099  S  SD    . MET A 1  561  ? 114.573 174.630 111.006 1.00 100.82 ? 561  MET A SD    1 
ATOM   4100  C  CE    . MET A 1  561  ? 114.543 175.837 109.689 1.00 100.82 ? 561  MET A CE    1 
ATOM   4101  N  N     . ASN A 1  562  ? 115.929 169.361 112.285 1.00 91.76  ? 562  ASN A N     1 
ATOM   4102  C  CA    . ASN A 1  562  ? 115.869 168.170 113.128 1.00 91.76  ? 562  ASN A CA    1 
ATOM   4103  C  C     . ASN A 1  562  ? 116.951 168.203 114.203 1.00 91.76  ? 562  ASN A C     1 
ATOM   4104  O  O     . ASN A 1  562  ? 116.675 167.995 115.395 1.00 91.76  ? 562  ASN A O     1 
ATOM   4105  C  CB    . ASN A 1  562  ? 116.007 166.915 112.266 1.00 99.96  ? 562  ASN A CB    1 
ATOM   4106  C  CG    . ASN A 1  562  ? 114.810 166.694 111.365 1.00 99.96  ? 562  ASN A CG    1 
ATOM   4107  O  OD1   . ASN A 1  562  ? 113.710 167.165 111.649 1.00 99.96  ? 562  ASN A OD1   1 
ATOM   4108  N  ND2   . ASN A 1  562  ? 115.021 165.979 110.265 1.00 99.96  ? 562  ASN A ND2   1 
ATOM   4109  N  N     . LEU A 1  563  ? 118.195 168.474 113.796 1.00 89.54  ? 563  LEU A N     1 
ATOM   4110  C  CA    . LEU A 1  563  ? 119.300 168.445 114.748 1.00 89.54  ? 563  LEU A CA    1 
ATOM   4111  C  C     . LEU A 1  563  ? 119.105 169.469 115.857 1.00 89.54  ? 563  LEU A C     1 
ATOM   4112  O  O     . LEU A 1  563  ? 119.437 169.208 117.019 1.00 89.54  ? 563  LEU A O     1 
ATOM   4113  C  CB    . LEU A 1  563  ? 120.623 168.678 114.023 1.00 88.17  ? 563  LEU A CB    1 
ATOM   4114  C  CG    . LEU A 1  563  ? 120.955 167.587 113.007 1.00 88.17  ? 563  LEU A CG    1 
ATOM   4115  C  CD1   . LEU A 1  563  ? 122.289 167.847 112.329 1.00 88.17  ? 563  LEU A CD1   1 
ATOM   4116  C  CD2   . LEU A 1  563  ? 120.922 166.224 113.663 1.00 88.17  ? 563  LEU A CD2   1 
ATOM   4117  N  N     . LEU A 1  564  ? 118.563 170.640 115.520 1.00 90.58  ? 564  LEU A N     1 
ATOM   4118  C  CA    . LEU A 1  564  ? 118.215 171.609 116.552 1.00 90.58  ? 564  LEU A CA    1 
ATOM   4119  C  C     . LEU A 1  564  ? 117.014 171.136 117.357 1.00 90.58  ? 564  LEU A C     1 
ATOM   4120  O  O     . LEU A 1  564  ? 116.874 171.478 118.537 1.00 90.58  ? 564  LEU A O     1 
ATOM   4121  C  CB    . LEU A 1  564  ? 117.934 172.972 115.925 1.00 90.82  ? 564  LEU A CB    1 
ATOM   4122  C  CG    . LEU A 1  564  ? 119.117 173.649 115.240 1.00 90.82  ? 564  LEU A CG    1 
ATOM   4123  C  CD1   . LEU A 1  564  ? 118.688 174.949 114.586 1.00 90.82  ? 564  LEU A CD1   1 
ATOM   4124  C  CD2   . LEU A 1  564  ? 120.232 173.883 116.233 1.00 90.82  ? 564  LEU A CD2   1 
ATOM   4125  N  N     . MET A 1  565  ? 116.133 170.348 116.737 1.00 90.65  ? 565  MET A N     1 
ATOM   4126  C  CA    . MET A 1  565  ? 114.978 169.838 117.465 1.00 90.65  ? 565  MET A CA    1 
ATOM   4127  C  C     . MET A 1  565  ? 115.397 168.855 118.549 1.00 90.65  ? 565  MET A C     1 
ATOM   4128  O  O     . MET A 1  565  ? 114.692 168.700 119.554 1.00 90.65  ? 565  MET A O     1 
ATOM   4129  C  CB    . MET A 1  565  ? 113.988 169.187 116.501 1.00 98.89  ? 565  MET A CB    1 
ATOM   4130  C  CG    . MET A 1  565  ? 112.739 168.659 117.171 1.00 98.89  ? 565  MET A CG    1 
ATOM   4131  S  SD    . MET A 1  565  ? 111.748 169.987 117.871 1.00 98.89  ? 565  MET A SD    1 
ATOM   4132  C  CE    . MET A 1  565  ? 110.423 169.041 118.608 1.00 98.89  ? 565  MET A CE    1 
ATOM   4133  N  N     . PHE A 1  566  ? 116.544 168.197 118.385 1.00 90.80  ? 566  PHE A N     1 
ATOM   4134  C  CA    . PHE A 1  566  ? 117.013 167.278 119.418 1.00 90.80  ? 566  PHE A CA    1 
ATOM   4135  C  C     . PHE A 1  566  ? 117.945 167.913 120.447 1.00 90.80  ? 566  PHE A C     1 
ATOM   4136  O  O     . PHE A 1  566  ? 118.482 167.189 121.291 1.00 90.80  ? 566  PHE A O     1 
ATOM   4137  C  CB    . PHE A 1  566  ? 117.702 166.063 118.793 1.00 89.68  ? 566  PHE A CB    1 
ATOM   4138  C  CG    . PHE A 1  566  ? 116.768 165.156 118.053 1.00 89.68  ? 566  PHE A CG    1 
ATOM   4139  C  CD1   . PHE A 1  566  ? 115.932 164.302 118.746 1.00 89.68  ? 566  PHE A CD1   1 
ATOM   4140  C  CD2   . PHE A 1  566  ? 116.747 165.130 116.672 1.00 89.68  ? 566  PHE A CD2   1 
ATOM   4141  C  CE1   . PHE A 1  566  ? 115.071 163.455 118.078 1.00 89.68  ? 566  PHE A CE1   1 
ATOM   4142  C  CE2   . PHE A 1  566  ? 115.890 164.284 115.996 1.00 89.68  ? 566  PHE A CE2   1 
ATOM   4143  C  CZ    . PHE A 1  566  ? 115.051 163.444 116.701 1.00 89.68  ? 566  PHE A CZ    1 
ATOM   4144  N  N     . LEU A 1  567  ? 118.167 169.227 120.403 1.00 93.03  ? 567  LEU A N     1 
ATOM   4145  C  CA    . LEU A 1  567  ? 118.920 169.889 121.464 1.00 93.03  ? 567  LEU A CA    1 
ATOM   4146  C  C     . LEU A 1  567  ? 117.992 170.306 122.602 1.00 93.03  ? 567  LEU A C     1 
ATOM   4147  O  O     . LEU A 1  567  ? 117.031 171.053 122.394 1.00 93.03  ? 567  LEU A O     1 
ATOM   4148  C  CB    . LEU A 1  567  ? 119.666 171.107 120.921 1.00 91.38  ? 567  LEU A CB    1 
ATOM   4149  C  CG    . LEU A 1  567  ? 120.892 170.895 120.033 1.00 91.38  ? 567  LEU A CG    1 
ATOM   4150  C  CD1   . LEU A 1  567  ? 121.364 172.219 119.473 1.00 91.38  ? 567  LEU A CD1   1 
ATOM   4151  C  CD2   . LEU A 1  567  ? 122.002 170.248 120.839 1.00 91.38  ? 567  LEU A CD2   1 
ATOM   4152  N  N     . SER A 1  568  ? 118.277 169.812 123.809 1.00 97.78  ? 568  SER A N     1 
ATOM   4153  C  CA    . SER A 1  568  ? 117.434 170.112 124.963 1.00 97.78  ? 568  SER A CA    1 
ATOM   4154  C  C     . SER A 1  568  ? 117.761 171.471 125.572 1.00 97.78  ? 568  SER A C     1 
ATOM   4155  O  O     . SER A 1  568  ? 116.874 172.142 126.111 1.00 97.78  ? 568  SER A O     1 
ATOM   4156  C  CB    . SER A 1  568  ? 117.575 169.011 126.016 1.00 99.71  ? 568  SER A CB    1 
ATOM   4157  O  OG    . SER A 1  568  ? 118.902 168.936 126.505 1.00 99.71  ? 568  SER A OG    1 
ATOM   4158  N  N     . THR A 1  569  ? 119.020 171.889 125.504 1.00 97.68  ? 569  THR A N     1 
ATOM   4159  C  CA    . THR A 1  569  ? 119.463 173.136 126.110 1.00 97.68  ? 569  THR A CA    1 
ATOM   4160  C  C     . THR A 1  569  ? 119.401 174.312 125.151 1.00 97.68  ? 569  THR A C     1 
ATOM   4161  O  O     . THR A 1  569  ? 119.818 175.415 125.518 1.00 97.68  ? 569  THR A O     1 
ATOM   4162  C  CB    . THR A 1  569  ? 120.894 172.994 126.629 1.00 99.21  ? 569  THR A CB    1 
ATOM   4163  O  OG1   . THR A 1  569  ? 121.770 172.675 125.541 1.00 99.21  ? 569  THR A OG1   1 
ATOM   4164  C  CG2   . THR A 1  569  ? 120.965 171.890 127.652 1.00 99.21  ? 569  THR A CG2   1 
ATOM   4165  N  N     . TRP A 1  570  ? 118.885 174.105 123.945 1.00 98.03  ? 570  TRP A N     1 
ATOM   4166  C  CA    . TRP A 1  570  ? 118.998 175.110 122.901 1.00 98.03  ? 570  TRP A CA    1 
ATOM   4167  C  C     . TRP A 1  570  ? 118.024 176.258 123.135 1.00 98.03  ? 570  TRP A C     1 
ATOM   4168  O  O     . TRP A 1  570  ? 116.895 176.062 123.593 1.00 98.03  ? 570  TRP A O     1 
ATOM   4169  C  CB    . TRP A 1  570  ? 118.786 174.448 121.540 1.00 94.68  ? 570  TRP A CB    1 
ATOM   4170  C  CG    . TRP A 1  570  ? 118.879 175.344 120.354 1.00 94.68  ? 570  TRP A CG    1 
ATOM   4171  C  CD1   . TRP A 1  570  ? 120.001 175.951 119.868 1.00 94.68  ? 570  TRP A CD1   1 
ATOM   4172  C  CD2   . TRP A 1  570  ? 117.842 175.604 119.409 1.00 94.68  ? 570  TRP A CD2   1 
ATOM   4173  N  NE1   . TRP A 1  570  ? 119.700 176.649 118.723 1.00 94.68  ? 570  TRP A NE1   1 
ATOM   4174  C  CE2   . TRP A 1  570  ? 118.380 176.442 118.415 1.00 94.68  ? 570  TRP A CE2   1 
ATOM   4175  C  CE3   . TRP A 1  570  ? 116.496 175.244 119.331 1.00 94.68  ? 570  TRP A CE3   1 
ATOM   4176  C  CZ2   . TRP A 1  570  ? 117.620 176.921 117.354 1.00 94.68  ? 570  TRP A CZ2   1 
ATOM   4177  C  CZ3   . TRP A 1  570  ? 115.742 175.724 118.283 1.00 94.68  ? 570  TRP A CZ3   1 
ATOM   4178  C  CH2   . TRP A 1  570  ? 116.305 176.551 117.307 1.00 94.68  ? 570  TRP A CH2   1 
ATOM   4179  N  N     . ASP A 1  571  ? 118.485 177.470 122.822 1.00 101.98 ? 571  ASP A N     1 
ATOM   4180  C  CA    . ASP A 1  571  ? 117.739 178.689 123.110 1.00 101.98 ? 571  ASP A CA    1 
ATOM   4181  C  C     . ASP A 1  571  ? 116.474 178.838 122.267 1.00 101.98 ? 571  ASP A C     1 
ATOM   4182  O  O     . ASP A 1  571  ? 115.554 179.547 122.684 1.00 101.98 ? 571  ASP A O     1 
ATOM   4183  C  CB    . ASP A 1  571  ? 118.642 179.900 122.882 1.00 108.84 ? 571  ASP A CB    1 
ATOM   4184  C  CG    . ASP A 1  571  ? 119.822 179.937 123.836 1.00 108.84 ? 571  ASP A CG    1 
ATOM   4185  O  OD1   . ASP A 1  571  ? 119.804 179.212 124.852 1.00 108.84 ? 571  ASP A OD1   1 
ATOM   4186  O  OD2   . ASP A 1  571  ? 120.778 180.692 123.554 1.00 108.84 ? 571  ASP A OD2   1 
ATOM   4187  N  N     . GLY A 1  572  ? 116.405 178.212 121.094 1.00 101.57 ? 572  GLY A N     1 
ATOM   4188  C  CA    . GLY A 1  572  ? 115.325 178.486 120.166 1.00 101.57 ? 572  GLY A CA    1 
ATOM   4189  C  C     . GLY A 1  572  ? 115.640 179.526 119.113 1.00 101.57 ? 572  GLY A C     1 
ATOM   4190  O  O     . GLY A 1  572  ? 114.722 179.996 118.431 1.00 101.57 ? 572  GLY A O     1 
ATOM   4191  N  N     . LYS A 1  573  ? 116.908 179.895 118.959 1.00 100.37 ? 573  LYS A N     1 
ATOM   4192  C  CA    . LYS A 1  573  ? 117.352 180.888 117.988 1.00 100.37 ? 573  LYS A CA    1 
ATOM   4193  C  C     . LYS A 1  573  ? 118.206 180.175 116.945 1.00 100.37 ? 573  LYS A C     1 
ATOM   4194  O  O     . LYS A 1  573  ? 119.311 179.716 117.252 1.00 100.37 ? 573  LYS A O     1 
ATOM   4195  C  CB    . LYS A 1  573  ? 118.135 181.998 118.685 1.00 107.95 ? 573  LYS A CB    1 
ATOM   4196  C  CG    . LYS A 1  573  ? 117.292 182.820 119.641 1.00 107.95 ? 573  LYS A CG    1 
ATOM   4197  C  CD    . LYS A 1  573  ? 118.117 183.890 120.329 1.00 107.95 ? 573  LYS A CD    1 
ATOM   4198  C  CE    . LYS A 1  573  ? 118.493 185.004 119.374 1.00 107.95 ? 573  LYS A CE    1 
ATOM   4199  N  NZ    . LYS A 1  573  ? 117.304 185.801 118.967 1.00 107.95 ? 573  LYS A NZ    1 
ATOM   4200  N  N     . VAL A 1  574  ? 117.699 180.080 115.720 1.00 98.14  ? 574  VAL A N     1 
ATOM   4201  C  CA    . VAL A 1  574  ? 118.419 179.397 114.647 1.00 98.14  ? 574  VAL A CA    1 
ATOM   4202  C  C     . VAL A 1  574  ? 119.650 180.219 114.280 1.00 98.14  ? 574  VAL A C     1 
ATOM   4203  O  O     . VAL A 1  574  ? 119.525 181.414 113.973 1.00 98.14  ? 574  VAL A O     1 
ATOM   4204  C  CB    . VAL A 1  574  ? 117.516 179.162 113.425 1.00 95.70  ? 574  VAL A CB    1 
ATOM   4205  C  CG1   . VAL A 1  574  ? 118.301 178.514 112.284 1.00 95.70  ? 574  VAL A CG1   1 
ATOM   4206  C  CG2   . VAL A 1  574  ? 116.343 178.288 113.807 1.00 95.70  ? 574  VAL A CG2   1 
ATOM   4207  N  N     . PRO A 1  575  ? 120.847 179.636 114.303 1.00 96.31  ? 575  PRO A N     1 
ATOM   4208  C  CA    . PRO A 1  575  ? 122.044 180.403 113.947 1.00 96.31  ? 575  PRO A CA    1 
ATOM   4209  C  C     . PRO A 1  575  ? 122.070 180.736 112.466 1.00 96.31  ? 575  PRO A C     1 
ATOM   4210  O  O     . PRO A 1  575  ? 121.443 180.068 111.640 1.00 96.31  ? 575  PRO A O     1 
ATOM   4211  C  CB    . PRO A 1  575  ? 123.191 179.460 114.322 1.00 93.33  ? 575  PRO A CB    1 
ATOM   4212  C  CG    . PRO A 1  575  ? 122.596 178.099 114.187 1.00 93.33  ? 575  PRO A CG    1 
ATOM   4213  C  CD    . PRO A 1  575  ? 121.164 178.237 114.632 1.00 93.33  ? 575  PRO A CD    1 
ATOM   4214  N  N     . GLN A 1  576  ? 122.811 181.782 112.135 1.00 100.69 ? 576  GLN A N     1 
ATOM   4215  C  CA    . GLN A 1  576  ? 122.923 182.198 110.746 1.00 100.69 ? 576  GLN A CA    1 
ATOM   4216  C  C     . GLN A 1  576  ? 123.968 181.335 110.043 1.00 100.69 ? 576  GLN A C     1 
ATOM   4217  O  O     . GLN A 1  576  ? 125.089 181.207 110.539 1.00 100.69 ? 576  GLN A O     1 
ATOM   4218  C  CB    . GLN A 1  576  ? 123.288 183.675 110.662 1.00 108.10 ? 576  GLN A CB    1 
ATOM   4219  C  CG    . GLN A 1  576  ? 123.206 184.271 109.272 1.00 108.10 ? 576  GLN A CG    1 
ATOM   4220  C  CD    . GLN A 1  576  ? 123.341 185.776 109.286 1.00 108.10 ? 576  GLN A CD    1 
ATOM   4221  O  OE1   . GLN A 1  576  ? 123.428 186.391 110.347 1.00 108.10 ? 576  GLN A OE1   1 
ATOM   4222  N  NE2   . GLN A 1  576  ? 123.345 186.382 108.104 1.00 108.10 ? 576  GLN A NE2   1 
ATOM   4223  N  N     . PRO A 1  577  ? 123.636 180.730 108.903 1.00 98.58  ? 577  PRO A N     1 
ATOM   4224  C  CA    . PRO A 1  577  ? 124.490 179.676 108.345 1.00 98.58  ? 577  PRO A CA    1 
ATOM   4225  C  C     . PRO A 1  577  ? 125.837 180.205 107.880 1.00 98.58  ? 577  PRO A C     1 
ATOM   4226  O  O     . PRO A 1  577  ? 126.047 181.408 107.712 1.00 98.58  ? 577  PRO A O     1 
ATOM   4227  C  CB    . PRO A 1  577  ? 123.667 179.149 107.167 1.00 100.16 ? 577  PRO A CB    1 
ATOM   4228  C  CG    . PRO A 1  577  ? 122.824 180.307 106.764 1.00 100.16 ? 577  PRO A CG    1 
ATOM   4229  C  CD    . PRO A 1  577  ? 122.482 181.019 108.039 1.00 100.16 ? 577  PRO A CD    1 
ATOM   4230  N  N     . ALA A 1  578  ? 126.763 179.265 107.680 1.00 100.67 ? 578  ALA A N     1 
ATOM   4231  C  CA    . ALA A 1  578  ? 128.089 179.617 107.183 1.00 100.67 ? 578  ALA A CA    1 
ATOM   4232  C  C     . ALA A 1  578  ? 128.011 180.194 105.777 1.00 100.67 ? 578  ALA A C     1 
ATOM   4233  O  O     . ALA A 1  578  ? 128.643 181.211 105.478 1.00 100.67 ? 578  ALA A O     1 
ATOM   4234  C  CB    . ALA A 1  578  ? 129.003 178.392 107.211 1.00 100.54 ? 578  ALA A CB    1 
ATOM   4235  N  N     . ILE A 1  579  ? 127.236 179.562 104.900 1.00 98.97  ? 579  ILE A N     1 
ATOM   4236  C  CA    . ILE A 1  579  ? 127.064 180.012 103.522 1.00 98.97  ? 579  ILE A CA    1 
ATOM   4237  C  C     . ILE A 1  579  ? 125.648 180.547 103.370 1.00 98.97  ? 579  ILE A C     1 
ATOM   4238  O  O     . ILE A 1  579  ? 124.676 179.785 103.447 1.00 98.97  ? 579  ILE A O     1 
ATOM   4239  C  CB    . ILE A 1  579  ? 127.332 178.885 102.515 1.00 101.13 ? 579  ILE A CB    1 
ATOM   4240  C  CG1   . ILE A 1  579  ? 128.790 178.438 102.588 1.00 101.13 ? 579  ILE A CG1   1 
ATOM   4241  C  CG2   . ILE A 1  579  ? 126.993 179.343 101.109 1.00 101.13 ? 579  ILE A CG2   1 
ATOM   4242  C  CD1   . ILE A 1  579  ? 129.081 177.197 101.784 1.00 101.13 ? 579  ILE A CD1   1 
ATOM   4243  N  N     . LEU A 1  580  ? 125.529 181.859 103.167 1.00 101.12 ? 580  LEU A N     1 
ATOM   4244  C  CA    . LEU A 1  580  ? 124.217 182.473 102.999 1.00 101.12 ? 580  LEU A CA    1 
ATOM   4245  C  C     . LEU A 1  580  ? 123.693 182.327 101.575 1.00 101.12 ? 580  LEU A C     1 
ATOM   4246  O  O     . LEU A 1  580  ? 122.485 182.160 101.370 1.00 101.12 ? 580  LEU A O     1 
ATOM   4247  C  CB    . LEU A 1  580  ? 124.281 183.949 103.387 1.00 104.55 ? 580  LEU A CB    1 
ATOM   4248  C  CG    . LEU A 1  580  ? 124.528 184.251 104.860 1.00 104.55 ? 580  LEU A CG    1 
ATOM   4249  C  CD1   . LEU A 1  580  ? 124.778 185.728 105.054 1.00 104.55 ? 580  LEU A CD1   1 
ATOM   4250  C  CD2   . LEU A 1  580  ? 123.324 183.809 105.668 1.00 104.55 ? 580  LEU A CD2   1 
ATOM   4251  N  N     . LYS A 1  581  ? 124.577 182.385 100.586 1.00 103.36 ? 581  LYS A N     1 
ATOM   4252  C  CA    . LYS A 1  581  ? 124.171 182.427 99.188  1.00 103.36 ? 581  LYS A CA    1 
ATOM   4253  C  C     . LYS A 1  581  ? 125.127 181.562 98.367  1.00 103.36 ? 581  LYS A C     1 
ATOM   4254  O  O     . LYS A 1  581  ? 126.316 181.501 98.677  1.00 103.36 ? 581  LYS A O     1 
ATOM   4255  C  CB    . LYS A 1  581  ? 124.161 183.884 98.697  1.00 109.48 ? 581  LYS A CB    1 
ATOM   4256  C  CG    . LYS A 1  581  ? 123.635 184.104 97.293  1.00 109.48 ? 581  LYS A CG    1 
ATOM   4257  C  CD    . LYS A 1  581  ? 123.598 185.571 96.907  1.00 109.48 ? 581  LYS A CD    1 
ATOM   4258  C  CE    . LYS A 1  581  ? 123.061 185.737 95.492  1.00 109.48 ? 581  LYS A CE    1 
ATOM   4259  N  NZ    . LYS A 1  581  ? 123.008 187.163 95.072  1.00 109.48 ? 581  LYS A NZ    1 
ATOM   4260  N  N     . PRO A 1  582  ? 124.628 180.882 97.318  1.00 105.24 ? 582  PRO A N     1 
ATOM   4261  C  CA    . PRO A 1  582  ? 123.276 180.818 96.741  1.00 105.24 ? 582  PRO A CA    1 
ATOM   4262  C  C     . PRO A 1  582  ? 122.223 180.097 97.583  1.00 105.24 ? 582  PRO A C     1 
ATOM   4263  O  O     . PRO A 1  582  ? 121.043 180.426 97.467  1.00 105.24 ? 582  PRO A O     1 
ATOM   4264  C  CB    . PRO A 1  582  ? 123.503 180.068 95.425  1.00 106.00 ? 582  PRO A CB    1 
ATOM   4265  C  CG    . PRO A 1  582  ? 124.699 179.241 95.676  1.00 106.00 ? 582  PRO A CG    1 
ATOM   4266  C  CD    . PRO A 1  582  ? 125.583 180.085 96.536  1.00 106.00 ? 582  PRO A CD    1 
ATOM   4267  N  N     . ARG A 1  583  ? 122.633 179.137 98.408  1.00 101.41 ? 583  ARG A N     1 
ATOM   4268  C  CA    . ARG A 1  583  ? 121.689 178.408 99.237  1.00 101.41 ? 583  ARG A CA    1 
ATOM   4269  C  C     . ARG A 1  583  ? 122.215 178.282 100.660 1.00 101.41 ? 583  ARG A C     1 
ATOM   4270  O  O     . ARG A 1  583  ? 123.417 178.071 100.865 1.00 101.41 ? 583  ARG A O     1 
ATOM   4271  C  CB    . ARG A 1  583  ? 121.415 177.015 98.645  1.00 105.60 ? 583  ARG A CB    1 
ATOM   4272  C  CG    . ARG A 1  583  ? 122.670 176.185 98.425  1.00 105.60 ? 583  ARG A CG    1 
ATOM   4273  C  CD    . ARG A 1  583  ? 122.352 174.808 97.869  1.00 105.60 ? 583  ARG A CD    1 
ATOM   4274  N  NE    . ARG A 1  583  ? 121.592 174.001 98.818  1.00 105.60 ? 583  ARG A NE    1 
ATOM   4275  C  CZ    . ARG A 1  583  ? 121.104 172.796 98.546  1.00 105.60 ? 583  ARG A CZ    1 
ATOM   4276  N  NH1   . ARG A 1  583  ? 121.295 172.261 97.348  1.00 105.60 ? 583  ARG A NH1   1 
ATOM   4277  N  NH2   . ARG A 1  583  ? 120.420 172.127 99.465  1.00 105.60 ? 583  ARG A NH2   1 
ATOM   4278  N  N     . PRO A 1  584  ? 121.345 178.426 101.660 1.00 99.84  ? 584  PRO A N     1 
ATOM   4279  C  CA    . PRO A 1  584  ? 121.801 178.393 103.057 1.00 99.84  ? 584  PRO A CA    1 
ATOM   4280  C  C     . PRO A 1  584  ? 122.353 177.027 103.436 1.00 99.84  ? 584  PRO A C     1 
ATOM   4281  O  O     . PRO A 1  584  ? 121.675 176.008 103.291 1.00 99.84  ? 584  PRO A O     1 
ATOM   4282  C  CB    . PRO A 1  584  ? 120.530 178.721 103.849 1.00 98.27  ? 584  PRO A CB    1 
ATOM   4283  C  CG    . PRO A 1  584  ? 119.669 179.467 102.876 1.00 98.27  ? 584  PRO A CG    1 
ATOM   4284  C  CD    . PRO A 1  584  ? 119.929 178.811 101.555 1.00 98.27  ? 584  PRO A CD    1 
ATOM   4285  N  N     . LEU A 1  585  ? 123.576 177.017 103.966 1.00 98.82  ? 585  LEU A N     1 
ATOM   4286  C  CA    . LEU A 1  585  ? 124.212 175.796 104.446 1.00 98.82  ? 585  LEU A CA    1 
ATOM   4287  C  C     . LEU A 1  585  ? 124.860 176.037 105.800 1.00 98.82  ? 585  LEU A C     1 
ATOM   4288  O  O     . LEU A 1  585  ? 125.788 176.843 105.917 1.00 98.82  ? 585  LEU A O     1 
ATOM   4289  C  CB    . LEU A 1  585  ? 125.265 175.280 103.457 1.00 100.70 ? 585  LEU A CB    1 
ATOM   4290  C  CG    . LEU A 1  585  ? 124.845 174.241 102.411 1.00 100.70 ? 585  LEU A CG    1 
ATOM   4291  C  CD1   . LEU A 1  585  ? 123.830 174.774 101.433 1.00 100.70 ? 585  LEU A CD1   1 
ATOM   4292  C  CD2   . LEU A 1  585  ? 126.063 173.744 101.667 1.00 100.70 ? 585  LEU A CD2   1 
ATOM   4293  N  N     . TRP A 1  586  ? 124.364 175.343 106.816 1.00 93.88  ? 586  TRP A N     1 
ATOM   4294  C  CA    . TRP A 1  586  ? 125.042 175.232 108.097 1.00 93.88  ? 586  TRP A CA    1 
ATOM   4295  C  C     . TRP A 1  586  ? 126.162 174.207 107.993 1.00 93.88  ? 586  TRP A C     1 
ATOM   4296  O  O     . TRP A 1  586  ? 126.160 173.348 107.107 1.00 93.88  ? 586  TRP A O     1 
ATOM   4297  C  CB    . TRP A 1  586  ? 124.054 174.828 109.189 1.00 95.48  ? 586  TRP A CB    1 
ATOM   4298  C  CG    . TRP A 1  586  ? 123.080 175.904 109.534 1.00 95.48  ? 586  TRP A CG    1 
ATOM   4299  C  CD1   . TRP A 1  586  ? 123.177 176.802 110.556 1.00 95.48  ? 586  TRP A CD1   1 
ATOM   4300  C  CD2   . TRP A 1  586  ? 121.883 176.235 108.822 1.00 95.48  ? 586  TRP A CD2   1 
ATOM   4301  N  NE1   . TRP A 1  586  ? 122.097 177.649 110.544 1.00 95.48  ? 586  TRP A NE1   1 
ATOM   4302  C  CE2   . TRP A 1  586  ? 121.291 177.324 109.485 1.00 95.48  ? 586  TRP A CE2   1 
ATOM   4303  C  CE3   . TRP A 1  586  ? 121.249 175.707 107.695 1.00 95.48  ? 586  TRP A CE3   1 
ATOM   4304  C  CZ2   . TRP A 1  586  ? 120.096 177.894 109.059 1.00 95.48  ? 586  TRP A CZ2   1 
ATOM   4305  C  CZ3   . TRP A 1  586  ? 120.064 176.275 107.274 1.00 95.48  ? 586  TRP A CZ3   1 
ATOM   4306  C  CH2   . TRP A 1  586  ? 119.500 177.356 107.954 1.00 95.48  ? 586  TRP A CH2   1 
ATOM   4307  N  N     . THR A 1  587  ? 127.129 174.307 108.897 1.00 93.65  ? 587  THR A N     1 
ATOM   4308  C  CA    . THR A 1  587  ? 128.274 173.408 108.905 1.00 93.65  ? 587  THR A CA    1 
ATOM   4309  C  C     . THR A 1  587  ? 128.285 172.628 110.216 1.00 93.65  ? 587  THR A C     1 
ATOM   4310  O  O     . THR A 1  587  ? 127.734 173.084 111.221 1.00 93.65  ? 587  THR A O     1 
ATOM   4311  C  CB    . THR A 1  587  ? 129.575 174.196 108.729 1.00 97.96  ? 587  THR A CB    1 
ATOM   4312  O  OG1   . THR A 1  587  ? 129.466 175.039 107.576 1.00 97.96  ? 587  THR A OG1   1 
ATOM   4313  C  CG2   . THR A 1  587  ? 130.751 173.256 108.504 1.00 97.96  ? 587  THR A CG2   1 
ATOM   4314  N  N     . GLY A 1  588  ? 128.899 171.441 110.195 1.00 93.74  ? 588  GLY A N     1 
ATOM   4315  C  CA    . GLY A 1  588  ? 128.905 170.593 111.379 1.00 93.74  ? 588  GLY A CA    1 
ATOM   4316  C  C     . GLY A 1  588  ? 129.485 171.274 112.603 1.00 93.74  ? 588  GLY A C     1 
ATOM   4317  O  O     . GLY A 1  588  ? 128.956 171.140 113.709 1.00 93.74  ? 588  GLY A O     1 
ATOM   4318  N  N     . LYS A 1  589  ? 130.583 172.011 112.424 1.00 93.10  ? 589  LYS A N     1 
ATOM   4319  C  CA    . LYS A 1  589  ? 131.163 172.747 113.541 1.00 93.10  ? 589  LYS A CA    1 
ATOM   4320  C  C     . LYS A 1  589  ? 130.233 173.857 114.010 1.00 93.10  ? 589  LYS A C     1 
ATOM   4321  O  O     . LYS A 1  589  ? 130.254 174.243 115.185 1.00 93.10  ? 589  LYS A O     1 
ATOM   4322  C  CB    . LYS A 1  589  ? 132.517 173.330 113.141 1.00 99.93  ? 589  LYS A CB    1 
ATOM   4323  C  CG    . LYS A 1  589  ? 133.586 172.303 112.838 1.00 99.93  ? 589  LYS A CG    1 
ATOM   4324  C  CD    . LYS A 1  589  ? 134.856 172.975 112.363 1.00 99.93  ? 589  LYS A CD    1 
ATOM   4325  C  CE    . LYS A 1  589  ? 135.947 171.968 112.081 1.00 99.93  ? 589  LYS A CE    1 
ATOM   4326  N  NZ    . LYS A 1  589  ? 137.162 172.641 111.558 1.00 99.93  ? 589  LYS A NZ    1 
ATOM   4327  N  N     . GLN A 1  590  ? 129.406 174.379 113.103 1.00 92.82  ? 590  GLN A N     1 
ATOM   4328  C  CA    . GLN A 1  590  ? 128.545 175.503 113.450 1.00 92.82  ? 590  GLN A CA    1 
ATOM   4329  C  C     . GLN A 1  590  ? 127.390 175.060 114.340 1.00 92.82  ? 590  GLN A C     1 
ATOM   4330  O  O     . GLN A 1  590  ? 126.982 175.791 115.249 1.00 92.82  ? 590  GLN A O     1 
ATOM   4331  C  CB    . GLN A 1  590  ? 128.026 176.171 112.178 1.00 97.47  ? 590  GLN A CB    1 
ATOM   4332  C  CG    . GLN A 1  590  ? 127.256 177.454 112.413 1.00 97.47  ? 590  GLN A CG    1 
ATOM   4333  C  CD    . GLN A 1  590  ? 126.941 178.174 111.123 1.00 97.47  ? 590  GLN A CD    1 
ATOM   4334  O  OE1   . GLN A 1  590  ? 127.363 177.751 110.049 1.00 97.47  ? 590  GLN A OE1   1 
ATOM   4335  N  NE2   . GLN A 1  590  ? 126.205 179.272 111.220 1.00 97.47  ? 590  GLN A NE2   1 
ATOM   4336  N  N     . ILE A 1  591  ? 126.844 173.870 114.090 1.00 92.42  ? 591  ILE A N     1 
ATOM   4337  C  CA    . ILE A 1  591  ? 125.804 173.338 114.964 1.00 92.42  ? 591  ILE A CA    1 
ATOM   4338  C  C     . ILE A 1  591  ? 126.411 172.739 116.224 1.00 92.42  ? 591  ILE A C     1 
ATOM   4339  O  O     . ILE A 1  591  ? 125.874 172.907 117.325 1.00 92.42  ? 591  ILE A O     1 
ATOM   4340  C  CB    . ILE A 1  591  ? 124.932 172.316 114.212 1.00 89.72  ? 591  ILE A CB    1 
ATOM   4341  C  CG1   . ILE A 1  591  ? 124.039 173.035 113.205 1.00 89.72  ? 591  ILE A CG1   1 
ATOM   4342  C  CG2   . ILE A 1  591  ? 124.104 171.481 115.180 1.00 89.72  ? 591  ILE A CG2   1 
ATOM   4343  C  CD1   . ILE A 1  591  ? 123.262 172.108 112.332 1.00 89.72  ? 591  ILE A CD1   1 
ATOM   4344  N  N     . PHE A 1  592  ? 127.539 172.037 116.092 1.00 91.74  ? 592  PHE A N     1 
ATOM   4345  C  CA    . PHE A 1  592  ? 128.180 171.487 117.282 1.00 91.74  ? 592  PHE A CA    1 
ATOM   4346  C  C     . PHE A 1  592  ? 128.599 172.590 118.243 1.00 91.74  ? 592  PHE A C     1 
ATOM   4347  O  O     . PHE A 1  592  ? 128.649 172.369 119.457 1.00 91.74  ? 592  PHE A O     1 
ATOM   4348  C  CB    . PHE A 1  592  ? 129.391 170.633 116.910 1.00 94.76  ? 592  PHE A CB    1 
ATOM   4349  C  CG    . PHE A 1  592  ? 130.064 170.019 118.099 1.00 94.76  ? 592  PHE A CG    1 
ATOM   4350  C  CD1   . PHE A 1  592  ? 129.570 168.856 118.659 1.00 94.76  ? 592  PHE A CD1   1 
ATOM   4351  C  CD2   . PHE A 1  592  ? 131.165 170.621 118.682 1.00 94.76  ? 592  PHE A CD2   1 
ATOM   4352  C  CE1   . PHE A 1  592  ? 130.170 168.294 119.765 1.00 94.76  ? 592  PHE A CE1   1 
ATOM   4353  C  CE2   . PHE A 1  592  ? 131.766 170.065 119.792 1.00 94.76  ? 592  PHE A CE2   1 
ATOM   4354  C  CZ    . PHE A 1  592  ? 131.266 168.899 120.333 1.00 94.76  ? 592  PHE A CZ    1 
ATOM   4355  N  N     . SER A 1  593  ? 128.899 173.782 117.723 1.00 92.78  ? 593  SER A N     1 
ATOM   4356  C  CA    . SER A 1  593  ? 129.173 174.922 118.590 1.00 92.78  ? 593  SER A CA    1 
ATOM   4357  C  C     . SER A 1  593  ? 127.970 175.291 119.447 1.00 92.78  ? 593  SER A C     1 
ATOM   4358  O  O     . SER A 1  593  ? 128.135 175.955 120.475 1.00 92.78  ? 593  SER A O     1 
ATOM   4359  C  CB    . SER A 1  593  ? 129.601 176.128 117.750 1.00 99.25  ? 593  SER A CB    1 
ATOM   4360  O  OG    . SER A 1  593  ? 130.817 175.873 117.071 1.00 99.25  ? 593  SER A OG    1 
ATOM   4361  N  N     . LEU A 1  594  ? 126.764 174.882 119.043 1.00 89.88  ? 594  LEU A N     1 
ATOM   4362  C  CA    . LEU A 1  594  ? 125.583 175.119 119.866 1.00 89.88  ? 594  LEU A CA    1 
ATOM   4363  C  C     . LEU A 1  594  ? 125.475 174.105 120.995 1.00 89.88  ? 594  LEU A C     1 
ATOM   4364  O  O     . LEU A 1  594  ? 124.737 174.330 121.960 1.00 89.88  ? 594  LEU A O     1 
ATOM   4365  C  CB    . LEU A 1  594  ? 124.324 175.077 119.002 1.00 87.74  ? 594  LEU A CB    1 
ATOM   4366  C  CG    . LEU A 1  594  ? 124.227 176.164 117.935 1.00 87.74  ? 594  LEU A CG    1 
ATOM   4367  C  CD1   . LEU A 1  594  ? 123.028 175.925 117.046 1.00 87.74  ? 594  LEU A CD1   1 
ATOM   4368  C  CD2   . LEU A 1  594  ? 124.148 177.532 118.587 1.00 87.74  ? 594  LEU A CD2   1 
ATOM   4369  N  N     . ILE A 1  595  ? 126.192 172.985 120.891 1.00 92.66  ? 595  ILE A N     1 
ATOM   4370  C  CA    . ILE A 1  595  ? 126.162 171.983 121.952 1.00 92.66  ? 595  ILE A CA    1 
ATOM   4371  C  C     . ILE A 1  595  ? 127.018 172.433 123.127 1.00 92.66  ? 595  ILE A C     1 
ATOM   4372  O  O     . ILE A 1  595  ? 126.616 172.318 124.291 1.00 92.66  ? 595  ILE A O     1 
ATOM   4373  C  CB    . ILE A 1  595  ? 126.627 170.619 121.415 1.00 88.77  ? 595  ILE A CB    1 
ATOM   4374  C  CG1   . ILE A 1  595  ? 125.670 170.112 120.341 1.00 88.77  ? 595  ILE A CG1   1 
ATOM   4375  C  CG2   . ILE A 1  595  ? 126.725 169.618 122.549 1.00 88.77  ? 595  ILE A CG2   1 
ATOM   4376  C  CD1   . ILE A 1  595  ? 126.184 168.903 119.610 1.00 88.77  ? 595  ILE A CD1   1 
ATOM   4377  N  N     . ILE A 1  596  ? 128.213 172.941 122.838 1.00 94.12  ? 596  ILE A N     1 
ATOM   4378  C  CA    . ILE A 1  596  ? 129.185 173.310 123.865 1.00 94.12  ? 596  ILE A CA    1 
ATOM   4379  C  C     . ILE A 1  596  ? 128.572 174.367 124.770 1.00 94.12  ? 596  ILE A C     1 
ATOM   4380  O  O     . ILE A 1  596  ? 128.263 175.479 124.319 1.00 94.12  ? 596  ILE A O     1 
ATOM   4381  C  CB    . ILE A 1  596  ? 130.495 173.802 123.235 1.00 93.10  ? 596  ILE A CB    1 
ATOM   4382  C  CG1   . ILE A 1  596  ? 131.149 172.662 122.453 1.00 93.10  ? 596  ILE A CG1   1 
ATOM   4383  C  CG2   . ILE A 1  596  ? 131.435 174.322 124.303 1.00 93.10  ? 596  ILE A CG2   1 
ATOM   4384  C  CD1   . ILE A 1  596  ? 132.315 173.091 121.607 1.00 93.10  ? 596  ILE A CD1   1 
ATOM   4385  N  N     . PRO A 1  597  ? 128.379 174.067 126.049 1.00 102.31 ? 597  PRO A N     1 
ATOM   4386  C  CA    . PRO A 1  597  ? 127.621 174.962 126.923 1.00 102.31 ? 597  PRO A CA    1 
ATOM   4387  C  C     . PRO A 1  597  ? 128.429 176.162 127.385 1.00 102.31 ? 597  PRO A C     1 
ATOM   4388  O  O     . PRO A 1  597  ? 129.659 176.173 127.351 1.00 102.31 ? 597  PRO A O     1 
ATOM   4389  C  CB    . PRO A 1  597  ? 127.266 174.062 128.108 1.00 99.83  ? 597  PRO A CB    1 
ATOM   4390  C  CG    . PRO A 1  597  ? 128.390 173.092 128.175 1.00 99.83  ? 597  PRO A CG    1 
ATOM   4391  C  CD    . PRO A 1  597  ? 128.822 172.850 126.755 1.00 99.83  ? 597  PRO A CD    1 
ATOM   4392  N  N     . GLY A 1  598  ? 127.692 177.173 127.842 1.00 106.19 ? 598  GLY A N     1 
ATOM   4393  C  CA    . GLY A 1  598  ? 128.303 178.370 128.394 1.00 106.19 ? 598  GLY A CA    1 
ATOM   4394  C  C     . GLY A 1  598  ? 129.349 178.940 127.474 1.00 106.19 ? 598  GLY A C     1 
ATOM   4395  O  O     . GLY A 1  598  ? 129.176 178.988 126.252 1.00 106.19 ? 598  GLY A O     1 
ATOM   4396  N  N     . HIS A 1  599  ? 130.444 179.399 128.067 1.00 103.65 ? 599  HIS A N     1 
ATOM   4397  C  CA    . HIS A 1  599  ? 131.629 179.802 127.327 1.00 103.65 ? 599  HIS A CA    1 
ATOM   4398  C  C     . HIS A 1  599  ? 132.775 178.942 127.841 1.00 103.65 ? 599  HIS A C     1 
ATOM   4399  O  O     . HIS A 1  599  ? 133.252 179.137 128.966 1.00 103.65 ? 599  HIS A O     1 
ATOM   4400  C  CB    . HIS A 1  599  ? 131.903 181.289 127.514 1.00 108.05 ? 599  HIS A CB    1 
ATOM   4401  C  CG    . HIS A 1  599  ? 130.718 182.160 127.223 1.00 108.05 ? 599  HIS A CG    1 
ATOM   4402  N  ND1   . HIS A 1  599  ? 130.188 182.302 125.958 1.00 108.05 ? 599  HIS A ND1   1 
ATOM   4403  C  CD2   . HIS A 1  599  ? 129.967 182.944 128.032 1.00 108.05 ? 599  HIS A CD2   1 
ATOM   4404  C  CE1   . HIS A 1  599  ? 129.159 183.130 126.002 1.00 108.05 ? 599  HIS A CE1   1 
ATOM   4405  N  NE2   . HIS A 1  599  ? 129.005 183.535 127.249 1.00 108.05 ? 599  HIS A NE2   1 
ATOM   4406  N  N     . ILE A 1  600  ? 133.231 178.009 127.013 1.00 104.36 ? 600  ILE A N     1 
ATOM   4407  C  CA    . ILE A 1  600  ? 134.252 177.043 127.398 1.00 104.36 ? 600  ILE A CA    1 
ATOM   4408  C  C     . ILE A 1  600  ? 135.476 177.274 126.526 1.00 104.36 ? 600  ILE A C     1 
ATOM   4409  O  O     . ILE A 1  600  ? 135.350 177.617 125.347 1.00 104.36 ? 600  ILE A O     1 
ATOM   4410  C  CB    . ILE A 1  600  ? 133.729 175.592 127.278 1.00 104.74 ? 600  ILE A CB    1 
ATOM   4411  C  CG1   . ILE A 1  600  ? 132.629 175.353 128.322 1.00 104.74 ? 600  ILE A CG1   1 
ATOM   4412  C  CG2   . ILE A 1  600  ? 134.870 174.574 127.360 1.00 104.74 ? 600  ILE A CG2   1 
ATOM   4413  C  CD1   . ILE A 1  600  ? 131.957 174.009 128.253 1.00 104.74 ? 600  ILE A CD1   1 
ATOM   4414  N  N     . ASN A 1  601  ? 136.664 177.119 127.110 1.00 105.28 ? 601  ASN A N     1 
ATOM   4415  C  CA    . ASN A 1  601  ? 137.911 177.391 126.404 1.00 105.28 ? 601  ASN A CA    1 
ATOM   4416  C  C     . ASN A 1  601  ? 138.813 176.169 126.460 1.00 105.28 ? 601  ASN A C     1 
ATOM   4417  O  O     . ASN A 1  601  ? 139.189 175.714 127.545 1.00 105.28 ? 601  ASN A O     1 
ATOM   4418  C  CB    . ASN A 1  601  ? 138.613 178.613 126.995 1.00 102.99 ? 601  ASN A CB    1 
ATOM   4419  C  CG    . ASN A 1  601  ? 137.841 179.889 126.768 1.00 102.99 ? 601  ASN A CG    1 
ATOM   4420  O  OD1   . ASN A 1  601  ? 137.084 180.014 125.811 1.00 102.99 ? 601  ASN A OD1   1 
ATOM   4421  N  ND2   . ASN A 1  601  ? 138.001 180.836 127.684 1.00 102.99 ? 601  ASN A ND2   1 
ATOM   4422  N  N     . CYS A 1  602  ? 139.174 175.657 125.290 1.00 103.10 ? 602  CYS A N     1 
ATOM   4423  C  CA    . CYS A 1  602  ? 139.961 174.441 125.191 1.00 103.10 ? 602  CYS A CA    1 
ATOM   4424  C  C     . CYS A 1  602  ? 140.812 174.498 123.930 1.00 103.10 ? 602  CYS A C     1 
ATOM   4425  O  O     . CYS A 1  602  ? 140.433 175.130 122.941 1.00 103.10 ? 602  CYS A O     1 
ATOM   4426  C  CB    . CYS A 1  602  ? 139.051 173.208 125.177 1.00 111.18 ? 602  CYS A CB    1 
ATOM   4427  S  SG    . CYS A 1  602  ? 139.923 171.657 124.998 1.00 111.18 ? 602  CYS A SG    1 
ATOM   4428  N  N     . ILE A 1  603  ? 141.982 173.862 123.990 1.00 105.16 ? 603  ILE A N     1 
ATOM   4429  C  CA    . ILE A 1  603  ? 142.833 173.648 122.822 1.00 105.16 ? 603  ILE A CA    1 
ATOM   4430  C  C     . ILE A 1  603  ? 143.349 172.216 122.876 1.00 105.16 ? 603  ILE A C     1 
ATOM   4431  O  O     . ILE A 1  603  ? 144.068 171.855 123.813 1.00 105.16 ? 603  ILE A O     1 
ATOM   4432  C  CB    . ILE A 1  603  ? 144.013 174.635 122.765 1.00 103.82 ? 603  ILE A CB    1 
ATOM   4433  C  CG1   . ILE A 1  603  ? 143.516 176.062 122.547 1.00 103.82 ? 603  ILE A CG1   1 
ATOM   4434  C  CG2   . ILE A 1  603  ? 144.974 174.241 121.659 1.00 103.82 ? 603  ILE A CG2   1 
ATOM   4435  C  CD1   . ILE A 1  603  ? 144.598 177.102 122.688 1.00 103.82 ? 603  ILE A CD1   1 
ATOM   4436  N  N     . ARG A 1  604  ? 143.006 171.406 121.874 1.00 109.22 ? 604  ARG A N     1 
ATOM   4437  C  CA    . ARG A 1  604  ? 143.518 170.045 121.747 1.00 109.22 ? 604  ARG A CA    1 
ATOM   4438  C  C     . ARG A 1  604  ? 143.948 169.800 120.305 1.00 109.22 ? 604  ARG A C     1 
ATOM   4439  O  O     . ARG A 1  604  ? 143.713 170.620 119.416 1.00 109.22 ? 604  ARG A O     1 
ATOM   4440  C  CB    . ARG A 1  604  ? 142.487 168.993 122.188 1.00 111.13 ? 604  ARG A CB    1 
ATOM   4441  C  CG    . ARG A 1  604  ? 142.046 169.107 123.640 1.00 111.13 ? 604  ARG A CG    1 
ATOM   4442  C  CD    . ARG A 1  604  ? 143.228 169.001 124.591 1.00 111.13 ? 604  ARG A CD    1 
ATOM   4443  N  NE    . ARG A 1  604  ? 143.936 167.732 124.482 1.00 111.13 ? 604  ARG A NE    1 
ATOM   4444  C  CZ    . ARG A 1  604  ? 143.598 166.632 125.144 1.00 111.13 ? 604  ARG A CZ    1 
ATOM   4445  N  NH1   . ARG A 1  604  ? 142.564 166.650 125.974 1.00 111.13 ? 604  ARG A NH1   1 
ATOM   4446  N  NH2   . ARG A 1  604  ? 144.303 165.520 124.990 1.00 111.13 ? 604  ARG A NH2   1 
ATOM   4447  N  N     . THR A 1  605  ? 144.617 168.672 120.080 1.00 114.34 ? 605  THR A N     1 
ATOM   4448  C  CA    . THR A 1  605  ? 145.122 168.303 118.763 1.00 114.34 ? 605  THR A CA    1 
ATOM   4449  C  C     . THR A 1  605  ? 144.533 166.964 118.344 1.00 114.34 ? 605  THR A C     1 
ATOM   4450  O  O     . THR A 1  605  ? 144.466 166.031 119.150 1.00 114.34 ? 605  THR A O     1 
ATOM   4451  C  CB    . THR A 1  605  ? 146.652 168.230 118.752 1.00 119.46 ? 605  THR A CB    1 
ATOM   4452  O  OG1   . THR A 1  605  ? 147.095 167.278 119.727 1.00 119.46 ? 605  THR A OG1   1 
ATOM   4453  C  CG2   . THR A 1  605  ? 147.251 169.587 119.071 1.00 119.46 ? 605  THR A CG2   1 
ATOM   4454  N  N     . HIS A 1  606  ? 144.107 166.877 117.086 1.00 121.92 ? 606  HIS A N     1 
ATOM   4455  C  CA    . HIS A 1  606  ? 143.577 165.636 116.545 1.00 121.92 ? 606  HIS A CA    1 
ATOM   4456  C  C     . HIS A 1  606  ? 144.694 164.605 116.401 1.00 121.92 ? 606  HIS A C     1 
ATOM   4457  O  O     . HIS A 1  606  ? 145.883 164.933 116.397 1.00 121.92 ? 606  HIS A O     1 
ATOM   4458  C  CB    . HIS A 1  606  ? 142.900 165.893 115.199 1.00 119.42 ? 606  HIS A CB    1 
ATOM   4459  C  CG    . HIS A 1  606  ? 142.220 164.694 114.618 1.00 119.42 ? 606  HIS A CG    1 
ATOM   4460  N  ND1   . HIS A 1  606  ? 141.185 164.044 115.254 1.00 119.42 ? 606  HIS A ND1   1 
ATOM   4461  C  CD2   . HIS A 1  606  ? 142.415 164.037 113.451 1.00 119.42 ? 606  HIS A CD2   1 
ATOM   4462  C  CE1   . HIS A 1  606  ? 140.777 163.033 114.508 1.00 119.42 ? 606  HIS A CE1   1 
ATOM   4463  N  NE2   . HIS A 1  606  ? 141.507 163.007 113.408 1.00 119.42 ? 606  HIS A NE2   1 
ATOM   4464  N  N     . SER A 1  607  ? 144.293 163.336 116.299 1.00 127.72 ? 607  SER A N     1 
ATOM   4465  C  CA    . SER A 1  607  ? 145.256 162.237 116.288 1.00 127.72 ? 607  SER A CA    1 
ATOM   4466  C  C     . SER A 1  607  ? 146.198 162.331 115.094 1.00 127.72 ? 607  SER A C     1 
ATOM   4467  O  O     . SER A 1  607  ? 147.419 162.198 115.236 1.00 127.72 ? 607  SER A O     1 
ATOM   4468  C  CB    . SER A 1  607  ? 144.516 160.898 116.285 1.00 125.32 ? 607  SER A CB    1 
ATOM   4469  O  OG    . SER A 1  607  ? 143.755 160.737 115.101 1.00 125.32 ? 607  SER A OG    1 
ATOM   4470  N  N     . THR A 1  608  ? 145.647 162.557 113.902 1.00 132.63 ? 608  THR A N     1 
ATOM   4471  C  CA    . THR A 1  608  ? 146.458 162.610 112.690 1.00 132.63 ? 608  THR A CA    1 
ATOM   4472  C  C     . THR A 1  608  ? 147.296 163.875 112.578 1.00 132.63 ? 608  THR A C     1 
ATOM   4473  O  O     . THR A 1  608  ? 148.058 163.991 111.612 1.00 132.63 ? 608  THR A O     1 
ATOM   4474  C  CB    . THR A 1  608  ? 145.575 162.479 111.448 1.00 128.22 ? 608  THR A CB    1 
ATOM   4475  O  OG1   . THR A 1  608  ? 144.596 163.525 111.440 1.00 128.22 ? 608  THR A OG1   1 
ATOM   4476  C  CG2   . THR A 1  608  ? 144.879 161.132 111.432 1.00 128.22 ? 608  THR A CG2   1 
ATOM   4477  N  N     . HIS A 1  609  ? 147.165 164.819 113.504 1.00 138.11 ? 609  HIS A N     1 
ATOM   4478  C  CA    . HIS A 1  609  ? 147.936 166.055 113.456 1.00 138.11 ? 609  HIS A CA    1 
ATOM   4479  C  C     . HIS A 1  609  ? 149.429 165.760 113.413 1.00 138.11 ? 609  HIS A C     1 
ATOM   4480  O  O     . HIS A 1  609  ? 149.961 165.156 114.357 1.00 138.11 ? 609  HIS A O     1 
ATOM   4481  C  CB    . HIS A 1  609  ? 147.622 166.926 114.668 1.00 139.33 ? 609  HIS A CB    1 
ATOM   4482  C  CG    . HIS A 1  609  ? 148.425 168.188 114.732 1.00 139.33 ? 609  HIS A CG    1 
ATOM   4483  N  ND1   . HIS A 1  609  ? 148.369 169.158 113.756 1.00 139.33 ? 609  HIS A ND1   1 
ATOM   4484  C  CD2   . HIS A 1  609  ? 149.302 168.638 115.659 1.00 139.33 ? 609  HIS A CD2   1 
ATOM   4485  C  CE1   . HIS A 1  609  ? 149.177 170.152 114.077 1.00 139.33 ? 609  HIS A CE1   1 
ATOM   4486  N  NE2   . HIS A 1  609  ? 149.756 169.861 115.228 1.00 139.33 ? 609  HIS A NE2   1 
ATOM   4487  N  N     . PRO A 1  610  ? 150.135 166.160 112.360 1.00 144.62 ? 610  PRO A N     1 
ATOM   4488  C  CA    . PRO A 1  610  ? 151.588 165.965 112.337 1.00 144.62 ? 610  PRO A CA    1 
ATOM   4489  C  C     . PRO A 1  610  ? 152.293 166.999 113.196 1.00 144.62 ? 610  PRO A C     1 
ATOM   4490  O  O     . PRO A 1  610  ? 151.650 167.894 113.752 1.00 144.62 ? 610  PRO A O     1 
ATOM   4491  C  CB    . PRO A 1  610  ? 151.936 166.124 110.853 1.00 142.22 ? 610  PRO A CB    1 
ATOM   4492  C  CG    . PRO A 1  610  ? 150.894 167.057 110.337 1.00 142.22 ? 610  PRO A CG    1 
ATOM   4493  C  CD    . PRO A 1  610  ? 149.634 166.754 111.109 1.00 142.22 ? 610  PRO A CD    1 
ATOM   4494  N  N     . ASP A 1  611  ? 153.612 166.891 113.310 1.00 149.36 ? 611  ASP A N     1 
ATOM   4495  C  CA    . ASP A 1  611  ? 154.409 167.864 114.041 1.00 149.36 ? 611  ASP A CA    1 
ATOM   4496  C  C     . ASP A 1  611  ? 155.020 168.922 113.133 1.00 149.36 ? 611  ASP A C     1 
ATOM   4497  O  O     . ASP A 1  611  ? 155.752 169.790 113.620 1.00 149.36 ? 611  ASP A O     1 
ATOM   4498  C  CB    . ASP A 1  611  ? 155.507 167.151 114.838 1.00 158.19 ? 611  ASP A CB    1 
ATOM   4499  C  CG    . ASP A 1  611  ? 154.950 166.337 115.992 1.00 158.19 ? 611  ASP A CG    1 
ATOM   4500  O  OD1   . ASP A 1  611  ? 153.779 166.562 116.368 1.00 158.19 ? 611  ASP A OD1   1 
ATOM   4501  O  OD2   . ASP A 1  611  ? 155.678 165.474 116.523 1.00 158.19 ? 611  ASP A OD2   1 
ATOM   4502  N  N     . ASP A 1  612  ? 154.738 168.870 111.830 1.00 149.55 ? 612  ASP A N     1 
ATOM   4503  C  CA    . ASP A 1  612  ? 155.282 169.854 110.900 1.00 149.55 ? 612  ASP A CA    1 
ATOM   4504  C  C     . ASP A 1  612  ? 154.500 171.162 110.938 1.00 149.55 ? 612  ASP A C     1 
ATOM   4505  O  O     . ASP A 1  612  ? 155.091 172.241 110.814 1.00 149.55 ? 612  ASP A O     1 
ATOM   4506  C  CB    . ASP A 1  612  ? 155.292 169.285 109.480 1.00 154.53 ? 612  ASP A CB    1 
ATOM   4507  C  CG    . ASP A 1  612  ? 156.313 168.183 109.303 1.00 154.53 ? 612  ASP A CG    1 
ATOM   4508  O  OD1   . ASP A 1  612  ? 157.213 168.062 110.161 1.00 154.53 ? 612  ASP A OD1   1 
ATOM   4509  O  OD2   . ASP A 1  612  ? 156.216 167.436 108.307 1.00 154.53 ? 612  ASP A OD2   1 
ATOM   4510  N  N     . GLU A 1  613  ? 153.176 171.088 111.100 1.00 147.04 ? 613  GLU A N     1 
ATOM   4511  C  CA    . GLU A 1  613  ? 152.349 172.290 111.046 1.00 147.04 ? 613  GLU A CA    1 
ATOM   4512  C  C     . GLU A 1  613  ? 152.678 173.276 112.157 1.00 147.04 ? 613  GLU A C     1 
ATOM   4513  O  O     . GLU A 1  613  ? 152.368 174.464 112.027 1.00 147.04 ? 613  GLU A O     1 
ATOM   4514  C  CB    . GLU A 1  613  ? 150.867 171.920 111.108 1.00 144.59 ? 613  GLU A CB    1 
ATOM   4515  C  CG    . GLU A 1  613  ? 150.362 171.151 109.900 1.00 144.59 ? 613  GLU A CG    1 
ATOM   4516  C  CD    . GLU A 1  613  ? 148.895 170.791 110.016 1.00 144.59 ? 613  GLU A CD    1 
ATOM   4517  O  OE1   . GLU A 1  613  ? 148.318 170.990 111.106 1.00 144.59 ? 613  GLU A OE1   1 
ATOM   4518  O  OE2   . GLU A 1  613  ? 148.317 170.312 109.017 1.00 144.59 ? 613  GLU A OE2   1 
ATOM   4519  N  N     . ASP A 1  614  ? 153.295 172.815 113.246 1.00 146.20 ? 614  ASP A N     1 
ATOM   4520  C  CA    . ASP A 1  614  ? 153.680 173.728 114.316 1.00 146.20 ? 614  ASP A CA    1 
ATOM   4521  C  C     . ASP A 1  614  ? 154.950 174.496 113.974 1.00 146.20 ? 614  ASP A C     1 
ATOM   4522  O  O     . ASP A 1  614  ? 155.144 175.617 114.456 1.00 146.20 ? 614  ASP A O     1 
ATOM   4523  C  CB    . ASP A 1  614  ? 153.872 172.954 115.620 1.00 152.07 ? 614  ASP A CB    1 
ATOM   4524  C  CG    . ASP A 1  614  ? 152.573 172.392 116.164 1.00 152.07 ? 614  ASP A CG    1 
ATOM   4525  O  OD1   . ASP A 1  614  ? 151.496 172.846 115.725 1.00 152.07 ? 614  ASP A OD1   1 
ATOM   4526  O  OD2   . ASP A 1  614  ? 152.631 171.496 117.033 1.00 152.07 ? 614  ASP A OD2   1 
ATOM   4527  N  N     . SER A 1  615  ? 155.824 173.911 113.152 1.00 144.82 ? 615  SER A N     1 
ATOM   4528  C  CA    . SER A 1  615  ? 157.142 174.494 112.917 1.00 144.82 ? 615  SER A CA    1 
ATOM   4529  C  C     . SER A 1  615  ? 157.060 175.756 112.065 1.00 144.82 ? 615  SER A C     1 
ATOM   4530  O  O     . SER A 1  615  ? 157.520 176.829 112.474 1.00 144.82 ? 615  SER A O     1 
ATOM   4531  C  CB    . SER A 1  615  ? 158.051 173.459 112.251 1.00 146.25 ? 615  SER A CB    1 
ATOM   4532  O  OG    . SER A 1  615  ? 157.562 173.096 110.973 1.00 146.25 ? 615  SER A OG    1 
ATOM   4533  N  N     . GLY A 1  616  ? 156.472 175.648 110.877 1.00 137.85 ? 616  GLY A N     1 
ATOM   4534  C  CA    . GLY A 1  616  ? 156.495 176.724 109.915 1.00 137.85 ? 616  GLY A CA    1 
ATOM   4535  C  C     . GLY A 1  616  ? 155.185 177.474 109.798 1.00 137.85 ? 616  GLY A C     1 
ATOM   4536  O  O     . GLY A 1  616  ? 154.418 177.599 110.759 1.00 137.85 ? 616  GLY A O     1 
ATOM   4537  N  N     . PRO A 1  617  ? 154.911 177.996 108.606 1.00 132.21 ? 617  PRO A N     1 
ATOM   4538  C  CA    . PRO A 1  617  ? 153.623 178.649 108.353 1.00 132.21 ? 617  PRO A CA    1 
ATOM   4539  C  C     . PRO A 1  617  ? 152.482 177.651 108.454 1.00 132.21 ? 617  PRO A C     1 
ATOM   4540  O  O     . PRO A 1  617  ? 152.681 176.435 108.510 1.00 132.21 ? 617  PRO A O     1 
ATOM   4541  C  CB    . PRO A 1  617  ? 153.776 179.199 106.932 1.00 128.86 ? 617  PRO A CB    1 
ATOM   4542  C  CG    . PRO A 1  617  ? 154.790 178.306 106.300 1.00 128.86 ? 617  PRO A CG    1 
ATOM   4543  C  CD    . PRO A 1  617  ? 155.756 177.960 107.401 1.00 128.86 ? 617  PRO A CD    1 
ATOM   4544  N  N     . TYR A 1  618  ? 151.264 178.195 108.509 1.00 129.20 ? 618  TYR A N     1 
ATOM   4545  C  CA    . TYR A 1  618  ? 150.039 177.425 108.710 1.00 129.20 ? 618  TYR A CA    1 
ATOM   4546  C  C     . TYR A 1  618  ? 149.979 176.803 110.100 1.00 129.20 ? 618  TYR A C     1 
ATOM   4547  O  O     . TYR A 1  618  ? 149.468 175.694 110.269 1.00 129.20 ? 618  TYR A O     1 
ATOM   4548  C  CB    . TYR A 1  618  ? 149.863 176.340 107.641 1.00 131.97 ? 618  TYR A CB    1 
ATOM   4549  C  CG    . TYR A 1  618  ? 149.749 176.887 106.243 1.00 131.97 ? 618  TYR A CG    1 
ATOM   4550  C  CD1   . TYR A 1  618  ? 149.017 178.035 105.991 1.00 131.97 ? 618  TYR A CD1   1 
ATOM   4551  C  CD2   . TYR A 1  618  ? 150.379 176.262 105.177 1.00 131.97 ? 618  TYR A CD2   1 
ATOM   4552  C  CE1   . TYR A 1  618  ? 148.910 178.544 104.719 1.00 131.97 ? 618  TYR A CE1   1 
ATOM   4553  C  CE2   . TYR A 1  618  ? 150.278 176.764 103.897 1.00 131.97 ? 618  TYR A CE2   1 
ATOM   4554  C  CZ    . TYR A 1  618  ? 149.541 177.907 103.674 1.00 131.97 ? 618  TYR A CZ    1 
ATOM   4555  O  OH    . TYR A 1  618  ? 149.437 178.415 102.401 1.00 131.97 ? 618  TYR A OH    1 
ATOM   4556  N  N     . LYS A 1  619  ? 150.510 177.505 111.103 1.00 125.31 ? 619  LYS A N     1 
ATOM   4557  C  CA    . LYS A 1  619  ? 150.314 177.076 112.482 1.00 125.31 ? 619  LYS A CA    1 
ATOM   4558  C  C     . LYS A 1  619  ? 148.835 177.071 112.836 1.00 125.31 ? 619  LYS A C     1 
ATOM   4559  O  O     . LYS A 1  619  ? 148.303 176.074 113.335 1.00 125.31 ? 619  LYS A O     1 
ATOM   4560  C  CB    . LYS A 1  619  ? 151.087 177.988 113.436 1.00 131.62 ? 619  LYS A CB    1 
ATOM   4561  C  CG    . LYS A 1  619  ? 152.592 177.829 113.384 1.00 131.62 ? 619  LYS A CG    1 
ATOM   4562  C  CD    . LYS A 1  619  ? 153.269 178.771 114.366 1.00 131.62 ? 619  LYS A CD    1 
ATOM   4563  C  CE    . LYS A 1  619  ? 152.970 178.385 115.808 1.00 131.62 ? 619  LYS A CE    1 
ATOM   4564  N  NZ    . LYS A 1  619  ? 153.559 177.068 116.183 1.00 131.62 ? 619  LYS A NZ    1 
ATOM   4565  N  N     . HIS A 1  620  ? 148.156 178.190 112.592 1.00 120.21 ? 620  HIS A N     1 
ATOM   4566  C  CA    . HIS A 1  620  ? 146.748 178.329 112.929 1.00 120.21 ? 620  HIS A CA    1 
ATOM   4567  C  C     . HIS A 1  620  ? 145.807 177.941 111.796 1.00 120.21 ? 620  HIS A C     1 
ATOM   4568  O  O     . HIS A 1  620  ? 144.607 177.783 112.042 1.00 120.21 ? 620  HIS A O     1 
ATOM   4569  C  CB    . HIS A 1  620  ? 146.465 179.769 113.357 1.00 113.19 ? 620  HIS A CB    1 
ATOM   4570  C  CG    . HIS A 1  620  ? 147.323 180.232 114.491 1.00 113.19 ? 620  HIS A CG    1 
ATOM   4571  N  ND1   . HIS A 1  620  ? 147.191 179.742 115.772 1.00 113.19 ? 620  HIS A ND1   1 
ATOM   4572  C  CD2   . HIS A 1  620  ? 148.336 181.129 114.534 1.00 113.19 ? 620  HIS A CD2   1 
ATOM   4573  C  CE1   . HIS A 1  620  ? 148.081 180.323 116.557 1.00 113.19 ? 620  HIS A CE1   1 
ATOM   4574  N  NE2   . HIS A 1  620  ? 148.788 181.169 115.830 1.00 113.19 ? 620  HIS A NE2   1 
ATOM   4575  N  N     . ILE A 1  621  ? 146.304 177.796 110.571 1.00 121.85 ? 621  ILE A N     1 
ATOM   4576  C  CA    . ILE A 1  621  ? 145.456 177.339 109.475 1.00 121.85 ? 621  ILE A CA    1 
ATOM   4577  C  C     . ILE A 1  621  ? 145.326 175.820 109.454 1.00 121.85 ? 621  ILE A C     1 
ATOM   4578  O  O     . ILE A 1  621  ? 144.224 175.297 109.277 1.00 121.85 ? 621  ILE A O     1 
ATOM   4579  C  CB    . ILE A 1  621  ? 145.968 177.888 108.130 1.00 121.55 ? 621  ILE A CB    1 
ATOM   4580  C  CG1   . ILE A 1  621  ? 145.696 179.388 108.035 1.00 121.55 ? 621  ILE A CG1   1 
ATOM   4581  C  CG2   . ILE A 1  621  ? 145.305 177.182 106.984 1.00 121.55 ? 621  ILE A CG2   1 
ATOM   4582  C  CD1   . ILE A 1  621  ? 146.267 180.017 106.795 1.00 121.55 ? 621  ILE A CD1   1 
ATOM   4583  N  N     . SER A 1  622  ? 146.429 175.090 109.662 1.00 125.37 ? 622  SER A N     1 
ATOM   4584  C  CA    . SER A 1  622  ? 146.413 173.630 109.751 1.00 125.37 ? 622  SER A CA    1 
ATOM   4585  C  C     . SER A 1  622  ? 145.731 173.004 108.539 1.00 125.37 ? 622  SER A C     1 
ATOM   4586  O  O     . SER A 1  622  ? 144.561 172.609 108.633 1.00 125.37 ? 622  SER A O     1 
ATOM   4587  C  CB    . SER A 1  622  ? 145.712 173.169 111.032 1.00 125.52 ? 622  SER A CB    1 
ATOM   4588  O  OG    . SER A 1  622  ? 144.338 173.502 111.006 1.00 125.52 ? 622  SER A OG    1 
ATOM   4589  N  N     . PRO A 1  623  ? 146.414 172.924 107.396 1.00 126.44 ? 623  PRO A N     1 
ATOM   4590  C  CA    . PRO A 1  623  ? 145.751 172.488 106.153 1.00 126.44 ? 623  PRO A CA    1 
ATOM   4591  C  C     . PRO A 1  623  ? 144.889 171.244 106.296 1.00 126.44 ? 623  PRO A C     1 
ATOM   4592  O  O     . PRO A 1  623  ? 143.912 171.094 105.553 1.00 126.44 ? 623  PRO A O     1 
ATOM   4593  C  CB    . PRO A 1  623  ? 146.934 172.239 105.208 1.00 129.30 ? 623  PRO A CB    1 
ATOM   4594  C  CG    . PRO A 1  623  ? 148.003 173.143 105.710 1.00 129.30 ? 623  PRO A CG    1 
ATOM   4595  C  CD    . PRO A 1  623  ? 147.859 173.144 107.203 1.00 129.30 ? 623  PRO A CD    1 
ATOM   4596  N  N     . GLY A 1  624  ? 145.215 170.345 107.222 1.00 125.68 ? 624  GLY A N     1 
ATOM   4597  C  CA    . GLY A 1  624  ? 144.377 169.193 107.462 1.00 125.68 ? 624  GLY A CA    1 
ATOM   4598  C  C     . GLY A 1  624  ? 143.182 169.424 108.357 1.00 125.68 ? 624  GLY A C     1 
ATOM   4599  O  O     . GLY A 1  624  ? 142.584 168.450 108.823 1.00 125.68 ? 624  GLY A O     1 
ATOM   4600  N  N     . ASP A 1  625  ? 142.824 170.681 108.637 1.00 123.10 ? 625  ASP A N     1 
ATOM   4601  C  CA    . ASP A 1  625  ? 141.716 171.080 109.508 1.00 123.10 ? 625  ASP A CA    1 
ATOM   4602  C  C     . ASP A 1  625  ? 141.980 170.694 110.958 1.00 123.10 ? 625  ASP A C     1 
ATOM   4603  O  O     . ASP A 1  625  ? 141.153 170.979 111.827 1.00 123.10 ? 625  ASP A O     1 
ATOM   4604  C  CB    . ASP A 1  625  ? 140.360 170.515 109.048 1.00 122.48 ? 625  ASP A CB    1 
ATOM   4605  C  CG    . ASP A 1  625  ? 139.192 171.041 109.870 1.00 122.48 ? 625  ASP A CG    1 
ATOM   4606  O  OD1   . ASP A 1  625  ? 138.990 172.273 109.892 1.00 122.48 ? 625  ASP A OD1   1 
ATOM   4607  O  OD2   . ASP A 1  625  ? 138.476 170.228 110.488 1.00 122.48 ? 625  ASP A OD2   1 
ATOM   4608  N  N     . THR A 1  626  ? 143.119 170.074 111.247 1.00 119.08 ? 626  THR A N     1 
ATOM   4609  C  CA    . THR A 1  626  ? 143.418 169.473 112.539 1.00 119.08 ? 626  THR A CA    1 
ATOM   4610  C  C     . THR A 1  626  ? 143.731 170.502 113.622 1.00 119.08 ? 626  THR A C     1 
ATOM   4611  O  O     . THR A 1  626  ? 143.455 171.695 113.456 1.00 119.08 ? 626  THR A O     1 
ATOM   4612  C  CB    . THR A 1  626  ? 144.576 168.489 112.392 1.00 123.30 ? 626  THR A CB    1 
ATOM   4613  O  OG1   . THR A 1  626  ? 144.831 167.866 113.655 1.00 123.30 ? 626  THR A OG1   1 
ATOM   4614  C  CG2   . THR A 1  626  ? 145.819 169.200 111.895 1.00 123.30 ? 626  THR A CG2   1 
ATOM   4615  N  N     . LYS A 1  627  ? 144.301 170.028 114.735 1.00 114.59 ? 627  LYS A N     1 
ATOM   4616  C  CA    . LYS A 1  627  ? 144.300 170.663 116.051 1.00 114.59 ? 627  LYS A CA    1 
ATOM   4617  C  C     . LYS A 1  627  ? 142.851 170.805 116.518 1.00 114.59 ? 627  LYS A C     1 
ATOM   4618  O  O     . LYS A 1  627  ? 141.994 170.056 116.045 1.00 114.59 ? 627  LYS A O     1 
ATOM   4619  C  CB    . LYS A 1  627  ? 145.019 172.020 115.957 1.00 113.48 ? 627  LYS A CB    1 
ATOM   4620  C  CG    . LYS A 1  627  ? 145.310 172.795 117.238 1.00 113.48 ? 627  LYS A CG    1 
ATOM   4621  C  CD    . LYS A 1  627  ? 145.923 174.138 116.873 1.00 113.48 ? 627  LYS A CD    1 
ATOM   4622  C  CE    . LYS A 1  627  ? 146.143 175.028 118.081 1.00 113.48 ? 627  LYS A CE    1 
ATOM   4623  N  NZ    . LYS A 1  627  ? 146.697 176.352 117.675 1.00 113.48 ? 627  LYS A NZ    1 
ATOM   4624  N  N     . VAL A 1  628  ? 142.567 171.772 117.395 1.00 107.53 ? 628  VAL A N     1 
ATOM   4625  C  CA    . VAL A 1  628  ? 141.220 172.147 117.832 1.00 107.53 ? 628  VAL A CA    1 
ATOM   4626  C  C     . VAL A 1  628  ? 141.349 173.556 118.392 1.00 107.53 ? 628  VAL A C     1 
ATOM   4627  O  O     . VAL A 1  628  ? 142.410 173.939 118.888 1.00 107.53 ? 628  VAL A O     1 
ATOM   4628  C  CB    . VAL A 1  628  ? 140.640 171.174 118.902 1.00 105.00 ? 628  VAL A CB    1 
ATOM   4629  C  CG1   . VAL A 1  628  ? 139.371 171.730 119.523 1.00 105.00 ? 628  VAL A CG1   1 
ATOM   4630  C  CG2   . VAL A 1  628  ? 140.308 169.802 118.344 1.00 105.00 ? 628  VAL A CG2   1 
ATOM   4631  N  N     . VAL A 1  629  ? 140.260 174.321 118.340 1.00 102.94 ? 629  VAL A N     1 
ATOM   4632  C  CA    . VAL A 1  629  ? 140.127 175.558 119.105 1.00 102.94 ? 629  VAL A CA    1 
ATOM   4633  C  C     . VAL A 1  629  ? 138.680 175.670 119.560 1.00 102.94 ? 629  VAL A C     1 
ATOM   4634  O  O     . VAL A 1  629  ? 137.760 175.464 118.762 1.00 102.94 ? 629  VAL A O     1 
ATOM   4635  C  CB    . VAL A 1  629  ? 140.519 176.809 118.293 1.00 104.71 ? 629  VAL A CB    1 
ATOM   4636  C  CG1   . VAL A 1  629  ? 140.212 178.064 119.083 1.00 104.71 ? 629  VAL A CG1   1 
ATOM   4637  C  CG2   . VAL A 1  629  ? 141.989 176.793 117.920 1.00 104.71 ? 629  VAL A CG2   1 
ATOM   4638  N  N     . VAL A 1  630  ? 138.472 175.990 120.834 1.00 102.59 ? 630  VAL A N     1 
ATOM   4639  C  CA    . VAL A 1  630  ? 137.151 176.326 121.350 1.00 102.59 ? 630  VAL A CA    1 
ATOM   4640  C  C     . VAL A 1  630  ? 137.277 177.634 122.114 1.00 102.59 ? 630  VAL A C     1 
ATOM   4641  O  O     . VAL A 1  630  ? 137.923 177.677 123.167 1.00 102.59 ? 630  VAL A O     1 
ATOM   4642  C  CB    . VAL A 1  630  ? 136.572 175.223 122.253 1.00 99.58  ? 630  VAL A CB    1 
ATOM   4643  C  CG1   . VAL A 1  630  ? 135.232 175.654 122.825 1.00 99.58  ? 630  VAL A CG1   1 
ATOM   4644  C  CG2   . VAL A 1  630  ? 136.427 173.921 121.483 1.00 99.58  ? 630  VAL A CG2   1 
ATOM   4645  N  N     . GLU A 1  631  ? 136.658 178.691 121.596 1.00 103.48 ? 631  GLU A N     1 
ATOM   4646  C  CA    . GLU A 1  631  ? 136.699 180.000 122.227 1.00 103.48 ? 631  GLU A CA    1 
ATOM   4647  C  C     . GLU A 1  631  ? 135.290 180.484 122.532 1.00 103.48 ? 631  GLU A C     1 
ATOM   4648  O  O     . GLU A 1  631  ? 134.395 180.414 121.684 1.00 103.48 ? 631  GLU A O     1 
ATOM   4649  C  CB    . GLU A 1  631  ? 137.401 181.041 121.347 1.00 112.32 ? 631  GLU A CB    1 
ATOM   4650  C  CG    . GLU A 1  631  ? 138.877 180.800 121.113 1.00 112.32 ? 631  GLU A CG    1 
ATOM   4651  C  CD    . GLU A 1  631  ? 139.517 181.904 120.290 1.00 112.32 ? 631  GLU A CD    1 
ATOM   4652  O  OE1   . GLU A 1  631  ? 138.780 182.769 119.772 1.00 112.32 ? 631  GLU A OE1   1 
ATOM   4653  O  OE2   . GLU A 1  631  ? 140.760 181.914 120.169 1.00 112.32 ? 631  GLU A OE2   1 
ATOM   4654  N  N     . ASN A 1  632  ? 135.107 180.972 123.760 1.00 105.01 ? 632  ASN A N     1 
ATOM   4655  C  CA    . ASN A 1  632  ? 133.880 181.657 124.167 1.00 105.01 ? 632  ASN A CA    1 
ATOM   4656  C  C     . ASN A 1  632  ? 132.664 180.750 123.988 1.00 105.01 ? 632  ASN A C     1 
ATOM   4657  O  O     . ASN A 1  632  ? 131.561 181.209 123.679 1.00 105.01 ? 632  ASN A O     1 
ATOM   4658  C  CB    . ASN A 1  632  ? 133.715 182.965 123.389 1.00 107.61 ? 632  ASN A CB    1 
ATOM   4659  C  CG    . ASN A 1  632  ? 132.724 183.919 124.030 1.00 107.61 ? 632  ASN A CG    1 
ATOM   4660  O  OD1   . ASN A 1  632  ? 131.923 183.536 124.879 1.00 107.61 ? 632  ASN A OD1   1 
ATOM   4661  N  ND2   . ASN A 1  632  ? 132.774 185.179 123.612 1.00 107.61 ? 632  ASN A ND2   1 
ATOM   4662  N  N     . GLY A 1  633  ? 132.869 179.449 124.160 1.00 102.71 ? 633  GLY A N     1 
ATOM   4663  C  CA    . GLY A 1  633  ? 131.803 178.483 123.960 1.00 102.71 ? 633  GLY A CA    1 
ATOM   4664  C  C     . GLY A 1  633  ? 131.473 178.222 122.507 1.00 102.71 ? 633  GLY A C     1 
ATOM   4665  O  O     . GLY A 1  633  ? 130.298 178.034 122.168 1.00 102.71 ? 633  GLY A O     1 
ATOM   4666  N  N     . GLU A 1  634  ? 132.481 178.196 121.639 1.00 103.32 ? 634  GLU A N     1 
ATOM   4667  C  CA    . GLU A 1  634  ? 132.273 178.069 120.204 1.00 103.32 ? 634  GLU A CA    1 
ATOM   4668  C  C     . GLU A 1  634  ? 133.431 177.287 119.605 1.00 103.32 ? 634  GLU A C     1 
ATOM   4669  O  O     . GLU A 1  634  ? 134.581 177.484 119.999 1.00 103.32 ? 634  GLU A O     1 
ATOM   4670  C  CB    . GLU A 1  634  ? 132.166 179.450 119.553 1.00 112.83 ? 634  GLU A CB    1 
ATOM   4671  C  CG    . GLU A 1  634  ? 131.903 179.451 118.063 1.00 112.83 ? 634  GLU A CG    1 
ATOM   4672  C  CD    . GLU A 1  634  ? 131.794 180.858 117.514 1.00 112.83 ? 634  GLU A CD    1 
ATOM   4673  O  OE1   . GLU A 1  634  ? 131.961 181.812 118.302 1.00 112.83 ? 634  GLU A OE1   1 
ATOM   4674  O  OE2   . GLU A 1  634  ? 131.542 181.013 116.302 1.00 112.83 ? 634  GLU A OE2   1 
ATOM   4675  N  N     . LEU A 1  635  ? 133.128 176.412 118.650 1.00 100.69 ? 635  LEU A N     1 
ATOM   4676  C  CA    . LEU A 1  635  ? 134.152 175.594 118.008 1.00 100.69 ? 635  LEU A CA    1 
ATOM   4677  C  C     . LEU A 1  635  ? 134.610 176.301 116.738 1.00 100.69 ? 635  LEU A C     1 
ATOM   4678  O  O     . LEU A 1  635  ? 133.865 176.381 115.757 1.00 100.69 ? 635  LEU A O     1 
ATOM   4679  C  CB    . LEU A 1  635  ? 133.618 174.200 117.697 1.00 95.03  ? 635  LEU A CB    1 
ATOM   4680  C  CG    . LEU A 1  635  ? 134.578 173.248 116.983 1.00 95.03  ? 635  LEU A CG    1 
ATOM   4681  C  CD1   . LEU A 1  635  ? 135.790 172.962 117.840 1.00 95.03  ? 635  LEU A CD1   1 
ATOM   4682  C  CD2   . LEU A 1  635  ? 133.872 171.957 116.620 1.00 95.03  ? 635  LEU A CD2   1 
ATOM   4683  N  N     . ILE A 1  636  ? 135.838 176.814 116.760 1.00 101.41 ? 636  ILE A N     1 
ATOM   4684  C  CA    . ILE A 1  636  ? 136.373 177.520 115.602 1.00 101.41 ? 636  ILE A CA    1 
ATOM   4685  C  C     . ILE A 1  636  ? 136.892 176.542 114.558 1.00 101.41 ? 636  ILE A C     1 
ATOM   4686  O  O     . ILE A 1  636  ? 136.571 176.652 113.369 1.00 101.41 ? 636  ILE A O     1 
ATOM   4687  C  CB    . ILE A 1  636  ? 137.466 178.506 116.050 1.00 101.34 ? 636  ILE A CB    1 
ATOM   4688  C  CG1   . ILE A 1  636  ? 136.845 179.622 116.887 1.00 101.34 ? 636  ILE A CG1   1 
ATOM   4689  C  CG2   . ILE A 1  636  ? 138.210 179.061 114.851 1.00 101.34 ? 636  ILE A CG2   1 
ATOM   4690  C  CD1   . ILE A 1  636  ? 137.848 180.497 117.570 1.00 101.34 ? 636  ILE A CD1   1 
ATOM   4691  N  N     . MET A 1  637  ? 137.691 175.568 114.985 1.00 104.74 ? 637  MET A N     1 
ATOM   4692  C  CA    . MET A 1  637  ? 138.390 174.686 114.062 1.00 104.74 ? 637  MET A CA    1 
ATOM   4693  C  C     . MET A 1  637  ? 138.795 173.414 114.792 1.00 104.74 ? 637  MET A C     1 
ATOM   4694  O  O     . MET A 1  637  ? 138.823 173.365 116.023 1.00 104.74 ? 637  MET A O     1 
ATOM   4695  C  CB    . MET A 1  637  ? 139.609 175.390 113.459 1.00 111.74 ? 637  MET A CB    1 
ATOM   4696  C  CG    . MET A 1  637  ? 140.618 175.846 114.499 1.00 111.74 ? 637  MET A CG    1 
ATOM   4697  S  SD    . MET A 1  637  ? 142.091 176.595 113.784 1.00 111.74 ? 637  MET A SD    1 
ATOM   4698  C  CE    . MET A 1  637  ? 142.994 175.137 113.287 1.00 111.74 ? 637  MET A CE    1 
ATOM   4699  N  N     . GLY A 1  638  ? 139.104 172.387 114.015 1.00 107.29 ? 638  GLY A N     1 
ATOM   4700  C  CA    . GLY A 1  638  ? 139.612 171.135 114.537 1.00 107.29 ? 638  GLY A CA    1 
ATOM   4701  C  C     . GLY A 1  638  ? 138.579 170.020 114.489 1.00 107.29 ? 638  GLY A C     1 
ATOM   4702  O  O     . GLY A 1  638  ? 137.369 170.236 114.545 1.00 107.29 ? 638  GLY A O     1 
ATOM   4703  N  N     . ILE A 1  639  ? 139.101 168.799 114.394 1.00 105.85 ? 639  ILE A N     1 
ATOM   4704  C  CA    . ILE A 1  639  ? 138.293 167.588 114.324 1.00 105.85 ? 639  ILE A CA    1 
ATOM   4705  C  C     . ILE A 1  639  ? 138.381 166.882 115.668 1.00 105.85 ? 639  ILE A C     1 
ATOM   4706  O  O     . ILE A 1  639  ? 139.481 166.671 116.192 1.00 105.85 ? 639  ILE A O     1 
ATOM   4707  C  CB    . ILE A 1  639  ? 138.748 166.651 113.194 1.00 105.24 ? 639  ILE A CB    1 
ATOM   4708  C  CG1   . ILE A 1  639  ? 138.512 167.295 111.830 1.00 105.24 ? 639  ILE A CG1   1 
ATOM   4709  C  CG2   . ILE A 1  639  ? 138.013 165.331 113.276 1.00 105.24 ? 639  ILE A CG2   1 
ATOM   4710  C  CD1   . ILE A 1  639  ? 139.119 166.514 110.687 1.00 105.24 ? 639  ILE A CD1   1 
ATOM   4711  N  N     . LEU A 1  640  ? 137.230 166.520 116.222 1.00 105.12 ? 640  LEU A N     1 
ATOM   4712  C  CA    . LEU A 1  640  ? 137.187 165.859 117.514 1.00 105.12 ? 640  LEU A CA    1 
ATOM   4713  C  C     . LEU A 1  640  ? 137.487 164.370 117.365 1.00 105.12 ? 640  LEU A C     1 
ATOM   4714  O  O     . LEU A 1  640  ? 137.284 163.767 116.307 1.00 105.12 ? 640  LEU A O     1 
ATOM   4715  C  CB    . LEU A 1  640  ? 135.823 166.061 118.160 1.00 98.00  ? 640  LEU A CB    1 
ATOM   4716  C  CG    . LEU A 1  640  ? 135.422 167.525 118.338 1.00 98.00  ? 640  LEU A CG    1 
ATOM   4717  C  CD1   . LEU A 1  640  ? 134.036 167.602 118.911 1.00 98.00  ? 640  LEU A CD1   1 
ATOM   4718  C  CD2   . LEU A 1  640  ? 136.409 168.291 119.199 1.00 98.00  ? 640  LEU A CD2   1 
ATOM   4719  N  N     . CYS A 1  641  ? 137.977 163.778 118.442 1.00 105.38 ? 641  CYS A N     1 
ATOM   4720  C  CA    . CYS A 1  641  ? 138.344 162.365 118.468 1.00 105.38 ? 641  CYS A CA    1 
ATOM   4721  C  C     . CYS A 1  641  ? 138.413 161.940 119.929 1.00 105.38 ? 641  CYS A C     1 
ATOM   4722  O  O     . CYS A 1  641  ? 137.971 162.671 120.824 1.00 105.38 ? 641  CYS A O     1 
ATOM   4723  C  CB    . CYS A 1  641  ? 139.659 162.112 117.727 1.00 109.26 ? 641  CYS A CB    1 
ATOM   4724  S  SG    . CYS A 1  641  ? 141.066 163.070 118.329 1.00 109.26 ? 641  CYS A SG    1 
ATOM   4725  N  N     . LYS A 1  642  ? 138.950 160.741 120.170 1.00 106.75 ? 642  LYS A N     1 
ATOM   4726  C  CA    . LYS A 1  642  ? 139.157 160.271 121.536 1.00 106.75 ? 642  LYS A CA    1 
ATOM   4727  C  C     . LYS A 1  642  ? 140.000 161.247 122.347 1.00 106.75 ? 642  LYS A C     1 
ATOM   4728  O  O     . LYS A 1  642  ? 139.902 161.283 123.579 1.00 106.75 ? 642  LYS A O     1 
ATOM   4729  C  CB    . LYS A 1  642  ? 139.820 158.892 121.513 1.00 104.37 ? 642  LYS A CB    1 
ATOM   4730  C  CG    . LYS A 1  642  ? 140.018 158.257 122.879 1.00 104.37 ? 642  LYS A CG    1 
ATOM   4731  C  CD    . LYS A 1  642  ? 140.679 156.894 122.765 1.00 104.37 ? 642  LYS A CD    1 
ATOM   4732  C  CE    . LYS A 1  642  ? 140.909 156.275 124.133 1.00 104.37 ? 642  LYS A CE    1 
ATOM   4733  N  NZ    . LYS A 1  642  ? 141.568 154.942 124.038 1.00 104.37 ? 642  LYS A NZ    1 
ATOM   4734  N  N     . LYS A 1  643  ? 140.824 162.054 121.676 1.00 108.48 ? 643  LYS A N     1 
ATOM   4735  C  CA    . LYS A 1  643  ? 141.670 163.020 122.364 1.00 108.48 ? 643  LYS A CA    1 
ATOM   4736  C  C     . LYS A 1  643  ? 140.937 164.307 122.715 1.00 108.48 ? 643  LYS A C     1 
ATOM   4737  O  O     . LYS A 1  643  ? 141.538 165.188 123.338 1.00 108.48 ? 643  LYS A O     1 
ATOM   4738  C  CB    . LYS A 1  643  ? 142.893 163.355 121.506 1.00 115.56 ? 643  LYS A CB    1 
ATOM   4739  C  CG    . LYS A 1  643  ? 143.878 162.211 121.304 1.00 115.56 ? 643  LYS A CG    1 
ATOM   4740  C  CD    . LYS A 1  643  ? 145.091 162.681 120.508 1.00 115.56 ? 643  LYS A CD    1 
ATOM   4741  C  CE    . LYS A 1  643  ? 146.160 161.604 120.402 1.00 115.56 ? 643  LYS A CE    1 
ATOM   4742  N  NZ    . LYS A 1  643  ? 145.788 160.532 119.440 1.00 115.56 ? 643  LYS A NZ    1 
ATOM   4743  N  N     . SER A 1  644  ? 139.662 164.438 122.338 1.00 104.58 ? 644  SER A N     1 
ATOM   4744  C  CA    . SER A 1  644  ? 138.915 165.672 122.566 1.00 104.58 ? 644  SER A CA    1 
ATOM   4745  C  C     . SER A 1  644  ? 137.658 165.415 123.388 1.00 104.58 ? 644  SER A C     1 
ATOM   4746  O  O     . SER A 1  644  ? 137.603 165.835 124.546 1.00 104.58 ? 644  SER A O     1 
ATOM   4747  C  CB    . SER A 1  644  ? 138.589 166.336 121.228 1.00 106.35 ? 644  SER A CB    1 
ATOM   4748  O  OG    . SER A 1  644  ? 139.772 166.751 120.569 1.00 106.35 ? 644  SER A OG    1 
ATOM   4749  N  N     . LEU A 1  645  ? 136.640 164.751 122.835 1.00 103.36 ? 645  LEU A N     1 
ATOM   4750  C  CA    . LEU A 1  645  ? 135.454 164.451 123.630 1.00 103.36 ? 645  LEU A CA    1 
ATOM   4751  C  C     . LEU A 1  645  ? 135.649 163.241 124.533 1.00 103.36 ? 645  LEU A C     1 
ATOM   4752  O  O     . LEU A 1  645  ? 134.946 163.109 125.540 1.00 103.36 ? 645  LEU A O     1 
ATOM   4753  C  CB    . LEU A 1  645  ? 134.239 164.211 122.735 1.00 103.54 ? 645  LEU A CB    1 
ATOM   4754  C  CG    . LEU A 1  645  ? 133.702 165.381 121.919 1.00 103.54 ? 645  LEU A CG    1 
ATOM   4755  C  CD1   . LEU A 1  645  ? 132.491 164.922 121.134 1.00 103.54 ? 645  LEU A CD1   1 
ATOM   4756  C  CD2   . LEU A 1  645  ? 133.364 166.560 122.813 1.00 103.54 ? 645  LEU A CD2   1 
ATOM   4757  N  N     . GLY A 1  646  ? 136.585 162.361 124.202 1.00 107.31 ? 646  GLY A N     1 
ATOM   4758  C  CA    . GLY A 1  646  ? 136.784 161.153 124.970 1.00 107.31 ? 646  GLY A CA    1 
ATOM   4759  C  C     . GLY A 1  646  ? 137.355 161.438 126.346 1.00 107.31 ? 646  GLY A C     1 
ATOM   4760  O  O     . GLY A 1  646  ? 137.516 162.580 126.779 1.00 107.31 ? 646  GLY A O     1 
ATOM   4761  N  N     . THR A 1  647  ? 137.680 160.357 127.046 1.00 108.25 ? 647  THR A N     1 
ATOM   4762  C  CA    . THR A 1  647  ? 138.146 160.452 128.423 1.00 108.25 ? 647  THR A CA    1 
ATOM   4763  C  C     . THR A 1  647  ? 139.669 160.552 128.436 1.00 108.25 ? 647  THR A C     1 
ATOM   4764  O  O     . THR A 1  647  ? 140.377 159.588 128.128 1.00 108.25 ? 647  THR A O     1 
ATOM   4765  C  CB    . THR A 1  647  ? 137.634 159.266 129.242 1.00 105.85 ? 647  THR A CB    1 
ATOM   4766  O  OG1   . THR A 1  647  ? 138.163 159.326 130.572 1.00 105.85 ? 647  THR A OG1   1 
ATOM   4767  C  CG2   . THR A 1  647  ? 137.953 157.920 128.580 1.00 105.85 ? 647  THR A CG2   1 
ATOM   4768  N  N     . SER A 1  648  ? 140.164 161.738 128.782 1.00 110.39 ? 648  SER A N     1 
ATOM   4769  C  CA    . SER A 1  648  ? 141.587 162.002 128.926 1.00 110.39 ? 648  SER A CA    1 
ATOM   4770  C  C     . SER A 1  648  ? 141.736 163.255 129.772 1.00 110.39 ? 648  SER A C     1 
ATOM   4771  O  O     . SER A 1  648  ? 140.781 164.013 129.960 1.00 110.39 ? 648  SER A O     1 
ATOM   4772  C  CB    . SER A 1  648  ? 142.279 162.168 127.570 1.00 113.55 ? 648  SER A CB    1 
ATOM   4773  O  OG    . SER A 1  648  ? 141.781 163.294 126.872 1.00 113.55 ? 648  SER A OG    1 
ATOM   4774  N  N     . ALA A 1  649  ? 142.943 163.457 130.292 1.00 112.95 ? 649  ALA A N     1 
ATOM   4775  C  CA    . ALA A 1  649  ? 143.206 164.623 131.123 1.00 112.95 ? 649  ALA A CA    1 
ATOM   4776  C  C     . ALA A 1  649  ? 143.026 165.907 130.324 1.00 112.95 ? 649  ALA A C     1 
ATOM   4777  O  O     . ALA A 1  649  ? 143.621 166.080 129.257 1.00 112.95 ? 649  ALA A O     1 
ATOM   4778  C  CB    . ALA A 1  649  ? 144.620 164.551 131.694 1.00 112.40 ? 649  ALA A CB    1 
ATOM   4779  N  N     . GLY A 1  650  ? 142.199 166.808 130.847 1.00 113.37 ? 650  GLY A N     1 
ATOM   4780  C  CA    . GLY A 1  650  ? 142.016 168.106 130.221 1.00 113.37 ? 650  GLY A CA    1 
ATOM   4781  C  C     . GLY A 1  650  ? 141.198 168.084 128.950 1.00 113.37 ? 650  GLY A C     1 
ATOM   4782  O  O     . GLY A 1  650  ? 141.262 169.035 128.164 1.00 113.37 ? 650  GLY A O     1 
ATOM   4783  N  N     . SER A 1  651  ? 140.427 167.025 128.726 1.00 110.99 ? 651  SER A N     1 
ATOM   4784  C  CA    . SER A 1  651  ? 139.569 166.956 127.555 1.00 110.99 ? 651  SER A CA    1 
ATOM   4785  C  C     . SER A 1  651  ? 138.431 167.967 127.665 1.00 110.99 ? 651  SER A C     1 
ATOM   4786  O  O     . SER A 1  651  ? 138.125 168.483 128.744 1.00 110.99 ? 651  SER A O     1 
ATOM   4787  C  CB    . SER A 1  651  ? 139.010 165.546 127.377 1.00 114.33 ? 651  SER A CB    1 
ATOM   4788  O  OG    . SER A 1  651  ? 140.043 164.625 127.076 1.00 114.33 ? 651  SER A OG    1 
ATOM   4789  N  N     . LEU A 1  652  ? 137.818 168.263 126.514 1.00 107.46 ? 652  LEU A N     1 
ATOM   4790  C  CA    . LEU A 1  652  ? 136.750 169.260 126.456 1.00 107.46 ? 652  LEU A CA    1 
ATOM   4791  C  C     . LEU A 1  652  ? 135.661 168.984 127.487 1.00 107.46 ? 652  LEU A C     1 
ATOM   4792  O  O     . LEU A 1  652  ? 135.085 169.917 128.060 1.00 107.46 ? 652  LEU A O     1 
ATOM   4793  C  CB    . LEU A 1  652  ? 136.156 169.299 125.047 1.00 100.70 ? 652  LEU A CB    1 
ATOM   4794  C  CG    . LEU A 1  652  ? 134.966 170.234 124.815 1.00 100.70 ? 652  LEU A CG    1 
ATOM   4795  C  CD1   . LEU A 1  652  ? 135.372 171.677 125.035 1.00 100.70 ? 652  LEU A CD1   1 
ATOM   4796  C  CD2   . LEU A 1  652  ? 134.398 170.046 123.420 1.00 100.70 ? 652  LEU A CD2   1 
ATOM   4797  N  N     . VAL A 1  653  ? 135.373 167.709 127.742 1.00 104.31 ? 653  VAL A N     1 
ATOM   4798  C  CA    . VAL A 1  653  ? 134.344 167.358 128.717 1.00 104.31 ? 653  VAL A CA    1 
ATOM   4799  C  C     . VAL A 1  653  ? 134.820 167.673 130.130 1.00 104.31 ? 653  VAL A C     1 
ATOM   4800  O  O     . VAL A 1  653  ? 134.072 168.218 130.950 1.00 104.31 ? 653  VAL A O     1 
ATOM   4801  C  CB    . VAL A 1  653  ? 133.957 165.877 128.577 1.00 102.52 ? 653  VAL A CB    1 
ATOM   4802  C  CG1   . VAL A 1  653  ? 132.914 165.523 129.602 1.00 102.52 ? 653  VAL A CG1   1 
ATOM   4803  C  CG2   . VAL A 1  653  ? 133.470 165.578 127.168 1.00 102.52 ? 653  VAL A CG2   1 
ATOM   4804  N  N     . HIS A 1  654  ? 136.071 167.320 130.436 1.00 104.45 ? 654  HIS A N     1 
ATOM   4805  C  CA    . HIS A 1  654  ? 136.652 167.629 131.739 1.00 104.45 ? 654  HIS A CA    1 
ATOM   4806  C  C     . HIS A 1  654  ? 136.649 169.132 131.994 1.00 104.45 ? 654  HIS A C     1 
ATOM   4807  O  O     . HIS A 1  654  ? 136.255 169.598 133.072 1.00 104.45 ? 654  HIS A O     1 
ATOM   4808  C  CB    . HIS A 1  654  ? 138.076 167.067 131.800 1.00 104.38 ? 654  HIS A CB    1 
ATOM   4809  C  CG    . HIS A 1  654  ? 138.750 167.246 133.123 1.00 104.38 ? 654  HIS A CG    1 
ATOM   4810  N  ND1   . HIS A 1  654  ? 140.116 167.143 133.278 1.00 104.38 ? 654  HIS A ND1   1 
ATOM   4811  C  CD2   . HIS A 1  654  ? 138.249 167.501 134.354 1.00 104.38 ? 654  HIS A CD2   1 
ATOM   4812  C  CE1   . HIS A 1  654  ? 140.427 167.338 134.547 1.00 104.38 ? 654  HIS A CE1   1 
ATOM   4813  N  NE2   . HIS A 1  654  ? 139.313 167.556 135.221 1.00 104.38 ? 654  HIS A NE2   1 
ATOM   4814  N  N     . ILE A 1  655  ? 137.081 169.907 130.995 1.00 105.59 ? 655  ILE A N     1 
ATOM   4815  C  CA    . ILE A 1  655  ? 137.068 171.362 131.108 1.00 105.59 ? 655  ILE A CA    1 
ATOM   4816  C  C     . ILE A 1  655  ? 135.646 171.866 131.310 1.00 105.59 ? 655  ILE A C     1 
ATOM   4817  O  O     . ILE A 1  655  ? 135.407 172.808 132.076 1.00 105.59 ? 655  ILE A O     1 
ATOM   4818  C  CB    . ILE A 1  655  ? 137.726 171.995 129.867 1.00 107.58 ? 655  ILE A CB    1 
ATOM   4819  C  CG1   . ILE A 1  655  ? 139.202 171.609 129.803 1.00 107.58 ? 655  ILE A CG1   1 
ATOM   4820  C  CG2   . ILE A 1  655  ? 137.572 173.507 129.881 1.00 107.58 ? 655  ILE A CG2   1 
ATOM   4821  C  CD1   . ILE A 1  655  ? 139.871 171.999 128.517 1.00 107.58 ? 655  ILE A CD1   1 
ATOM   4822  N  N     . SER A 1  656  ? 134.678 171.238 130.638 1.00 107.72 ? 656  SER A N     1 
ATOM   4823  C  CA    . SER A 1  656  ? 133.281 171.601 130.850 1.00 107.72 ? 656  SER A CA    1 
ATOM   4824  C  C     . SER A 1  656  ? 132.849 171.315 132.281 1.00 107.72 ? 656  SER A C     1 
ATOM   4825  O  O     . SER A 1  656  ? 132.016 172.037 132.842 1.00 107.72 ? 656  SER A O     1 
ATOM   4826  C  CB    . SER A 1  656  ? 132.386 170.849 129.866 1.00 109.34 ? 656  SER A CB    1 
ATOM   4827  O  OG    . SER A 1  656  ? 131.023 171.171 130.074 1.00 109.34 ? 656  SER A OG    1 
ATOM   4828  N  N     . TYR A 1  657  ? 133.398 170.260 132.888 1.00 109.38 ? 657  TYR A N     1 
ATOM   4829  C  CA    . TYR A 1  657  ? 133.026 169.915 134.256 1.00 109.38 ? 657  TYR A CA    1 
ATOM   4830  C  C     . TYR A 1  657  ? 133.582 170.934 135.242 1.00 109.38 ? 657  TYR A C     1 
ATOM   4831  O  O     . TYR A 1  657  ? 132.842 171.499 136.056 1.00 109.38 ? 657  TYR A O     1 
ATOM   4832  C  CB    . TYR A 1  657  ? 133.525 168.511 134.604 1.00 110.16 ? 657  TYR A CB    1 
ATOM   4833  C  CG    . TYR A 1  657  ? 133.224 168.095 136.029 1.00 110.16 ? 657  TYR A CG    1 
ATOM   4834  C  CD1   . TYR A 1  657  ? 131.973 167.607 136.381 1.00 110.16 ? 657  TYR A CD1   1 
ATOM   4835  C  CD2   . TYR A 1  657  ? 134.185 168.209 137.025 1.00 110.16 ? 657  TYR A CD2   1 
ATOM   4836  C  CE1   . TYR A 1  657  ? 131.692 167.233 137.679 1.00 110.16 ? 657  TYR A CE1   1 
ATOM   4837  C  CE2   . TYR A 1  657  ? 133.914 167.838 138.325 1.00 110.16 ? 657  TYR A CE2   1 
ATOM   4838  C  CZ    . TYR A 1  657  ? 132.665 167.351 138.647 1.00 110.16 ? 657  TYR A CZ    1 
ATOM   4839  O  OH    . TYR A 1  657  ? 132.390 166.981 139.944 1.00 110.16 ? 657  TYR A OH    1 
ATOM   4840  N  N     . LEU A 1  658  ? 134.892 171.186 135.180 1.00 109.85 ? 658  LEU A N     1 
ATOM   4841  C  CA    . LEU A 1  658  ? 135.503 172.060 136.177 1.00 109.85 ? 658  LEU A CA    1 
ATOM   4842  C  C     . LEU A 1  658  ? 135.099 173.514 135.972 1.00 109.85 ? 658  LEU A C     1 
ATOM   4843  O  O     . LEU A 1  658  ? 134.897 174.250 136.944 1.00 109.85 ? 658  LEU A O     1 
ATOM   4844  C  CB    . LEU A 1  658  ? 137.023 171.917 136.152 1.00 106.65 ? 658  LEU A CB    1 
ATOM   4845  C  CG    . LEU A 1  658  ? 137.588 170.567 136.592 1.00 106.65 ? 658  LEU A CG    1 
ATOM   4846  C  CD1   . LEU A 1  658  ? 139.099 170.559 136.472 1.00 106.65 ? 658  LEU A CD1   1 
ATOM   4847  C  CD2   . LEU A 1  658  ? 137.162 170.243 138.014 1.00 106.65 ? 658  LEU A CD2   1 
ATOM   4848  N  N     . GLU A 1  659  ? 134.974 173.948 134.718 1.00 113.00 ? 659  GLU A N     1 
ATOM   4849  C  CA    . GLU A 1  659  ? 134.687 175.354 134.454 1.00 113.00 ? 659  GLU A CA    1 
ATOM   4850  C  C     . GLU A 1  659  ? 133.218 175.686 134.698 1.00 113.00 ? 659  GLU A C     1 
ATOM   4851  O  O     . GLU A 1  659  ? 132.901 176.692 135.340 1.00 113.00 ? 659  GLU A O     1 
ATOM   4852  C  CB    . GLU A 1  659  ? 135.091 175.712 133.025 1.00 117.36 ? 659  GLU A CB    1 
ATOM   4853  C  CG    . GLU A 1  659  ? 134.915 177.183 132.695 1.00 117.36 ? 659  GLU A CG    1 
ATOM   4854  C  CD    . GLU A 1  659  ? 135.390 177.533 131.302 1.00 117.36 ? 659  GLU A CD    1 
ATOM   4855  O  OE1   . GLU A 1  659  ? 135.821 176.617 130.570 1.00 117.36 ? 659  GLU A OE1   1 
ATOM   4856  O  OE2   . GLU A 1  659  ? 135.339 178.726 130.939 1.00 117.36 ? 659  GLU A OE2   1 
ATOM   4857  N  N     . MET A 1  660  ? 132.308 174.854 134.195 1.00 114.51 ? 660  MET A N     1 
ATOM   4858  C  CA    . MET A 1  660  ? 130.870 175.134 134.303 1.00 114.51 ? 660  MET A CA    1 
ATOM   4859  C  C     . MET A 1  660  ? 130.269 174.434 135.518 1.00 114.51 ? 660  MET A C     1 
ATOM   4860  O  O     . MET A 1  660  ? 129.847 175.085 136.477 1.00 114.51 ? 660  MET A O     1 
ATOM   4861  C  CB    . MET A 1  660  ? 130.155 174.720 133.015 1.00 119.70 ? 660  MET A CB    1 
ATOM   4862  C  CG    . MET A 1  660  ? 130.564 175.522 131.793 1.00 119.70 ? 660  MET A CG    1 
ATOM   4863  S  SD    . MET A 1  660  ? 130.211 177.280 131.965 1.00 119.70 ? 660  MET A SD    1 
ATOM   4864  C  CE    . MET A 1  660  ? 128.421 177.258 131.994 1.00 119.70 ? 660  MET A CE    1 
ATOM   4865  N  N     . GLY A 1  661  ? 130.220 173.112 135.481 1.00 111.07 ? 661  GLY A N     1 
ATOM   4866  C  CA    . GLY A 1  661  ? 129.630 172.346 136.560 1.00 111.07 ? 661  GLY A CA    1 
ATOM   4867  C  C     . GLY A 1  661  ? 129.150 171.006 136.060 1.00 111.07 ? 661  GLY A C     1 
ATOM   4868  O  O     . GLY A 1  661  ? 129.245 170.683 134.878 1.00 111.07 ? 661  GLY A O     1 
ATOM   4869  N  N     . HIS A 1  662  ? 128.622 170.216 136.996 1.00 108.41 ? 662  HIS A N     1 
ATOM   4870  C  CA    . HIS A 1  662  ? 128.147 168.880 136.647 1.00 108.41 ? 662  HIS A CA    1 
ATOM   4871  C  C     . HIS A 1  662  ? 126.780 168.939 135.976 1.00 108.41 ? 662  HIS A C     1 
ATOM   4872  O  O     . HIS A 1  662  ? 126.511 168.200 135.018 1.00 108.41 ? 662  HIS A O     1 
ATOM   4873  C  CB    . HIS A 1  662  ? 128.096 168.003 137.897 1.00 109.81 ? 662  HIS A CB    1 
ATOM   4874  C  CG    . HIS A 1  662  ? 127.178 168.517 138.960 1.00 109.81 ? 662  HIS A CG    1 
ATOM   4875  N  ND1   . HIS A 1  662  ? 127.498 169.586 139.769 1.00 109.81 ? 662  HIS A ND1   1 
ATOM   4876  C  CD2   . HIS A 1  662  ? 125.946 168.111 139.345 1.00 109.81 ? 662  HIS A CD2   1 
ATOM   4877  C  CE1   . HIS A 1  662  ? 126.504 169.815 140.607 1.00 109.81 ? 662  HIS A CE1   1 
ATOM   4878  N  NE2   . HIS A 1  662  ? 125.549 168.934 140.371 1.00 109.81 ? 662  HIS A NE2   1 
ATOM   4879  N  N     . ASP A 1  663  ? 125.906 169.822 136.468 1.00 105.62 ? 663  ASP A N     1 
ATOM   4880  C  CA    . ASP A 1  663  ? 124.544 169.923 135.953 1.00 105.62 ? 663  ASP A CA    1 
ATOM   4881  C  C     . ASP A 1  663  ? 124.538 170.133 134.445 1.00 105.62 ? 663  ASP A C     1 
ATOM   4882  O  O     . ASP A 1  663  ? 123.855 169.414 133.706 1.00 105.62 ? 663  ASP A O     1 
ATOM   4883  C  CB    . ASP A 1  663  ? 123.816 171.070 136.655 1.00 114.27 ? 663  ASP A CB    1 
ATOM   4884  C  CG    . ASP A 1  663  ? 122.353 171.164 136.265 1.00 114.27 ? 663  ASP A CG    1 
ATOM   4885  O  OD1   . ASP A 1  663  ? 121.858 170.269 135.547 1.00 114.27 ? 663  ASP A OD1   1 
ATOM   4886  O  OD2   . ASP A 1  663  ? 121.694 172.143 136.675 1.00 114.27 ? 663  ASP A OD2   1 
ATOM   4887  N  N     . ILE A 1  664  ? 125.302 171.112 133.969 1.00 102.13 ? 664  ILE A N     1 
ATOM   4888  C  CA    . ILE A 1  664  ? 125.274 171.441 132.551 1.00 102.13 ? 664  ILE A CA    1 
ATOM   4889  C  C     . ILE A 1  664  ? 126.114 170.451 131.752 1.00 102.13 ? 664  ILE A C     1 
ATOM   4890  O  O     . ILE A 1  664  ? 125.848 170.201 130.571 1.00 102.13 ? 664  ILE A O     1 
ATOM   4891  C  CB    . ILE A 1  664  ? 125.738 172.892 132.354 1.00 102.70 ? 664  ILE A CB    1 
ATOM   4892  C  CG1   . ILE A 1  664  ? 124.903 173.828 133.221 1.00 102.70 ? 664  ILE A CG1   1 
ATOM   4893  C  CG2   . ILE A 1  664  ? 125.536 173.310 130.929 1.00 102.70 ? 664  ILE A CG2   1 
ATOM   4894  C  CD1   . ILE A 1  664  ? 125.440 175.235 133.290 1.00 102.70 ? 664  ILE A CD1   1 
ATOM   4895  N  N     . THR A 1  665  ? 127.129 169.858 132.388 1.00 99.60  ? 665  THR A N     1 
ATOM   4896  C  CA    . THR A 1  665  ? 127.949 168.854 131.715 1.00 99.60  ? 665  THR A CA    1 
ATOM   4897  C  C     . THR A 1  665  ? 127.126 167.625 131.344 1.00 99.60  ? 665  THR A C     1 
ATOM   4898  O  O     . THR A 1  665  ? 127.294 167.056 130.254 1.00 99.60  ? 665  THR A O     1 
ATOM   4899  C  CB    . THR A 1  665  ? 129.128 168.460 132.607 1.00 102.30 ? 665  THR A CB    1 
ATOM   4900  O  OG1   . THR A 1  665  ? 129.907 169.623 132.912 1.00 102.30 ? 665  THR A OG1   1 
ATOM   4901  C  CG2   . THR A 1  665  ? 130.013 167.444 131.910 1.00 102.30 ? 665  THR A CG2   1 
ATOM   4902  N  N     . ARG A 1  666  ? 126.230 167.198 132.240 1.00 99.55  ? 666  ARG A N     1 
ATOM   4903  C  CA    . ARG A 1  666  ? 125.322 166.099 131.923 1.00 99.55  ? 666  ARG A CA    1 
ATOM   4904  C  C     . ARG A 1  666  ? 124.569 166.373 130.625 1.00 99.55  ? 666  ARG A C     1 
ATOM   4905  O  O     . ARG A 1  666  ? 124.515 165.531 129.717 1.00 99.55  ? 666  ARG A O     1 
ATOM   4906  C  CB    . ARG A 1  666  ? 124.337 165.884 133.076 1.00 101.16 ? 666  ARG A CB    1 
ATOM   4907  C  CG    . ARG A 1  666  ? 123.396 164.706 132.876 1.00 101.16 ? 666  ARG A CG    1 
ATOM   4908  C  CD    . ARG A 1  666  ? 122.396 164.565 134.014 1.00 101.16 ? 666  ARG A CD    1 
ATOM   4909  N  NE    . ARG A 1  666  ? 121.446 165.672 134.049 1.00 101.16 ? 666  ARG A NE    1 
ATOM   4910  C  CZ    . ARG A 1  666  ? 121.484 166.665 134.931 1.00 101.16 ? 666  ARG A CZ    1 
ATOM   4911  N  NH1   . ARG A 1  666  ? 122.426 166.693 135.863 1.00 101.16 ? 666  ARG A NH1   1 
ATOM   4912  N  NH2   . ARG A 1  666  ? 120.575 167.629 134.884 1.00 101.16 ? 666  ARG A NH2   1 
ATOM   4913  N  N     . LEU A 1  667  ? 123.994 167.571 130.522 1.00 98.51  ? 667  LEU A N     1 
ATOM   4914  C  CA    . LEU A 1  667  ? 123.271 167.958 129.319 1.00 98.51  ? 667  LEU A CA    1 
ATOM   4915  C  C     . LEU A 1  667  ? 124.197 168.041 128.113 1.00 98.51  ? 667  LEU A C     1 
ATOM   4916  O  O     . LEU A 1  667  ? 123.758 167.838 126.977 1.00 98.51  ? 667  LEU A O     1 
ATOM   4917  C  CB    . LEU A 1  667  ? 122.572 169.294 129.559 1.00 97.98  ? 667  LEU A CB    1 
ATOM   4918  C  CG    . LEU A 1  667  ? 121.545 169.246 130.694 1.00 97.98  ? 667  LEU A CG    1 
ATOM   4919  C  CD1   . LEU A 1  667  ? 121.012 170.630 131.020 1.00 97.98  ? 667  LEU A CD1   1 
ATOM   4920  C  CD2   . LEU A 1  667  ? 120.408 168.296 130.349 1.00 97.98  ? 667  LEU A CD2   1 
ATOM   4921  N  N     . PHE A 1  668  ? 125.476 168.345 128.338 1.00 94.59  ? 668  PHE A N     1 
ATOM   4922  C  CA    . PHE A 1  668  ? 126.455 168.314 127.254 1.00 94.59  ? 668  PHE A CA    1 
ATOM   4923  C  C     . PHE A 1  668  ? 126.572 166.910 126.667 1.00 94.59  ? 668  PHE A C     1 
ATOM   4924  O  O     . PHE A 1  668  ? 126.406 166.713 125.451 1.00 94.59  ? 668  PHE A O     1 
ATOM   4925  C  CB    . PHE A 1  668  ? 127.796 168.827 127.784 1.00 94.07  ? 668  PHE A CB    1 
ATOM   4926  C  CG    . PHE A 1  668  ? 128.930 168.748 126.806 1.00 94.07  ? 668  PHE A CG    1 
ATOM   4927  C  CD1   . PHE A 1  668  ? 129.032 169.649 125.765 1.00 94.07  ? 668  PHE A CD1   1 
ATOM   4928  C  CD2   . PHE A 1  668  ? 129.935 167.815 126.973 1.00 94.07  ? 668  PHE A CD2   1 
ATOM   4929  C  CE1   . PHE A 1  668  ? 130.088 169.594 124.882 1.00 94.07  ? 668  PHE A CE1   1 
ATOM   4930  C  CE2   . PHE A 1  668  ? 130.996 167.757 126.095 1.00 94.07  ? 668  PHE A CE2   1 
ATOM   4931  C  CZ    . PHE A 1  668  ? 131.073 168.650 125.049 1.00 94.07  ? 668  PHE A CZ    1 
ATOM   4932  N  N     . TYR A 1  669  ? 126.819 165.913 127.527 1.00 94.34  ? 669  TYR A N     1 
ATOM   4933  C  CA    . TYR A 1  669  ? 126.807 164.521 127.081 1.00 94.34  ? 669  TYR A CA    1 
ATOM   4934  C  C     . TYR A 1  669  ? 125.528 164.190 126.323 1.00 94.34  ? 669  TYR A C     1 
ATOM   4935  O  O     . TYR A 1  669  ? 125.566 163.759 125.163 1.00 94.34  ? 669  TYR A O     1 
ATOM   4936  C  CB    . TYR A 1  669  ? 126.916 163.571 128.272 1.00 98.56  ? 669  TYR A CB    1 
ATOM   4937  C  CG    . TYR A 1  669  ? 128.239 163.444 128.985 1.00 98.56  ? 669  TYR A CG    1 
ATOM   4938  C  CD1   . TYR A 1  669  ? 129.163 162.484 128.598 1.00 98.56  ? 669  TYR A CD1   1 
ATOM   4939  C  CD2   . TYR A 1  669  ? 128.540 164.239 130.081 1.00 98.56  ? 669  TYR A CD2   1 
ATOM   4940  C  CE1   . TYR A 1  669  ? 130.357 162.336 129.263 1.00 98.56  ? 669  TYR A CE1   1 
ATOM   4941  C  CE2   . TYR A 1  669  ? 129.734 164.100 130.753 1.00 98.56  ? 669  TYR A CE2   1 
ATOM   4942  C  CZ    . TYR A 1  669  ? 130.640 163.147 130.338 1.00 98.56  ? 669  TYR A CZ    1 
ATOM   4943  O  OH    . TYR A 1  669  ? 131.836 162.996 130.998 1.00 98.56  ? 669  TYR A OH    1 
ATOM   4944  N  N     . SER A 1  670  ? 124.381 164.385 126.979 1.00 93.04  ? 670  SER A N     1 
ATOM   4945  C  CA    . SER A 1  670  ? 123.110 163.931 126.417 1.00 93.04  ? 670  SER A CA    1 
ATOM   4946  C  C     . SER A 1  670  ? 122.841 164.571 125.062 1.00 93.04  ? 670  SER A C     1 
ATOM   4947  O  O     . SER A 1  670  ? 122.428 163.898 124.108 1.00 93.04  ? 670  SER A O     1 
ATOM   4948  C  CB    . SER A 1  670  ? 121.973 164.235 127.392 1.00 95.42  ? 670  SER A CB    1 
ATOM   4949  O  OG    . SER A 1  670  ? 122.127 163.512 128.599 1.00 95.42  ? 670  SER A OG    1 
ATOM   4950  N  N     . ASN A 1  671  ? 123.078 165.879 124.961 1.00 89.03  ? 671  ASN A N     1 
ATOM   4951  C  CA    . ASN A 1  671  ? 122.872 166.577 123.699 1.00 89.03  ? 671  ASN A CA    1 
ATOM   4952  C  C     . ASN A 1  671  ? 123.755 165.997 122.602 1.00 89.03  ? 671  ASN A C     1 
ATOM   4953  O  O     . ASN A 1  671  ? 123.265 165.679 121.508 1.00 89.03  ? 671  ASN A O     1 
ATOM   4954  C  CB    . ASN A 1  671  ? 123.129 168.072 123.879 1.00 93.78  ? 671  ASN A CB    1 
ATOM   4955  C  CG    . ASN A 1  671  ? 122.066 168.742 124.718 1.00 93.78  ? 671  ASN A CG    1 
ATOM   4956  O  OD1   . ASN A 1  671  ? 120.944 168.249 124.826 1.00 93.78  ? 671  ASN A OD1   1 
ATOM   4957  N  ND2   . ASN A 1  671  ? 122.411 169.873 125.318 1.00 93.78  ? 671  ASN A ND2   1 
ATOM   4958  N  N     . ILE A 1  672  ? 125.057 165.831 122.880 1.00 88.87  ? 672  ILE A N     1 
ATOM   4959  C  CA    . ILE A 1  672  ? 125.952 165.214 121.894 1.00 88.87  ? 672  ILE A CA    1 
ATOM   4960  C  C     . ILE A 1  672  ? 125.376 163.891 121.407 1.00 88.87  ? 672  ILE A C     1 
ATOM   4961  O  O     . ILE A 1  672  ? 125.181 163.675 120.201 1.00 88.87  ? 672  ILE A O     1 
ATOM   4962  C  CB    . ILE A 1  672  ? 127.359 165.008 122.480 1.00 88.24  ? 672  ILE A CB    1 
ATOM   4963  C  CG1   . ILE A 1  672  ? 128.052 166.344 122.708 1.00 88.24  ? 672  ILE A CG1   1 
ATOM   4964  C  CG2   . ILE A 1  672  ? 128.199 164.145 121.552 1.00 88.24  ? 672  ILE A CG2   1 
ATOM   4965  C  CD1   . ILE A 1  672  ? 129.347 166.217 123.448 1.00 88.24  ? 672  ILE A CD1   1 
ATOM   4966  N  N     . GLN A 1  673  ? 125.083 162.995 122.353 1.00 89.97  ? 673  GLN A N     1 
ATOM   4967  C  CA    . GLN A 1  673  ? 124.505 161.687 122.069 1.00 89.97  ? 673  GLN A CA    1 
ATOM   4968  C  C     . GLN A 1  673  ? 123.337 161.793 121.098 1.00 89.97  ? 673  GLN A C     1 
ATOM   4969  O  O     . GLN A 1  673  ? 123.414 161.301 119.964 1.00 89.97  ? 673  GLN A O     1 
ATOM   4970  C  CB    . GLN A 1  673  ? 124.037 161.025 123.368 1.00 95.79  ? 673  GLN A CB    1 
ATOM   4971  C  CG    . GLN A 1  673  ? 125.140 160.696 124.368 1.00 95.79  ? 673  GLN A CG    1 
ATOM   4972  C  CD    . GLN A 1  673  ? 126.047 159.576 123.903 1.00 95.79  ? 673  GLN A CD    1 
ATOM   4973  O  OE1   . GLN A 1  673  ? 127.146 159.818 123.404 1.00 95.79  ? 673  GLN A OE1   1 
ATOM   4974  N  NE2   . GLN A 1  673  ? 125.596 158.340 124.076 1.00 95.79  ? 673  GLN A NE2   1 
ATOM   4975  N  N     . THR A 1  674  ? 122.261 162.450 121.534 1.00 90.45  ? 674  THR A N     1 
ATOM   4976  C  CA    . THR A 1  674  ? 121.032 162.510 120.753 1.00 90.45  ? 674  THR A CA    1 
ATOM   4977  C  C     . THR A 1  674  ? 121.251 163.101 119.366 1.00 90.45  ? 674  THR A C     1 
ATOM   4978  O  O     . THR A 1  674  ? 120.929 162.459 118.357 1.00 90.45  ? 674  THR A O     1 
ATOM   4979  C  CB    . THR A 1  674  ? 119.967 163.320 121.495 1.00 89.96  ? 674  THR A CB    1 
ATOM   4980  O  OG1   . THR A 1  674  ? 120.448 164.650 121.718 1.00 89.96  ? 674  THR A OG1   1 
ATOM   4981  C  CG2   . THR A 1  674  ? 119.651 162.679 122.831 1.00 89.96  ? 674  THR A CG2   1 
ATOM   4982  N  N     . VAL A 1  675  ? 121.806 164.315 119.296 1.00 87.82  ? 675  VAL A N     1 
ATOM   4983  C  CA    . VAL A 1  675  ? 121.827 165.017 118.014 1.00 87.82  ? 675  VAL A CA    1 
ATOM   4984  C  C     . VAL A 1  675  ? 122.748 164.311 117.028 1.00 87.82  ? 675  VAL A C     1 
ATOM   4985  O  O     . VAL A 1  675  ? 122.460 164.248 115.827 1.00 87.82  ? 675  VAL A O     1 
ATOM   4986  C  CB    . VAL A 1  675  ? 122.219 166.497 118.198 1.00 87.06  ? 675  VAL A CB    1 
ATOM   4987  C  CG1   . VAL A 1  675  ? 121.253 167.189 119.140 1.00 87.06  ? 675  VAL A CG1   1 
ATOM   4988  C  CG2   . VAL A 1  675  ? 123.648 166.645 118.663 1.00 87.06  ? 675  VAL A CG2   1 
ATOM   4989  N  N     . ILE A 1  676  ? 123.863 163.758 117.510 1.00 87.78  ? 676  ILE A N     1 
ATOM   4990  C  CA    . ILE A 1  676  ? 124.811 163.181 116.565 1.00 87.78  ? 676  ILE A CA    1 
ATOM   4991  C  C     . ILE A 1  676  ? 124.470 161.734 116.218 1.00 87.78  ? 676  ILE A C     1 
ATOM   4992  O  O     . ILE A 1  676  ? 124.909 161.234 115.175 1.00 87.78  ? 676  ILE A O     1 
ATOM   4993  C  CB    . ILE A 1  676  ? 126.223 163.393 117.132 1.00 88.90  ? 676  ILE A CB    1 
ATOM   4994  C  CG1   . ILE A 1  676  ? 126.485 164.898 117.187 1.00 88.90  ? 676  ILE A CG1   1 
ATOM   4995  C  CG2   . ILE A 1  676  ? 127.275 162.742 116.266 1.00 88.90  ? 676  ILE A CG2   1 
ATOM   4996  C  CD1   . ILE A 1  676  ? 127.693 165.302 117.959 1.00 88.90  ? 676  ILE A CD1   1 
ATOM   4997  N  N     . ASN A 1  677  ? 123.643 161.061 117.023 1.00 88.81  ? 677  ASN A N     1 
ATOM   4998  C  CA    . ASN A 1  677  ? 123.018 159.830 116.545 1.00 88.81  ? 677  ASN A CA    1 
ATOM   4999  C  C     . ASN A 1  677  ? 121.991 160.138 115.463 1.00 88.81  ? 677  ASN A C     1 
ATOM   5000  O  O     . ASN A 1  677  ? 122.043 159.582 114.355 1.00 88.81  ? 677  ASN A O     1 
ATOM   5001  C  CB    . ASN A 1  677  ? 122.358 159.081 117.703 1.00 93.79  ? 677  ASN A CB    1 
ATOM   5002  C  CG    . ASN A 1  677  ? 123.361 158.430 118.624 1.00 93.79  ? 677  ASN A CG    1 
ATOM   5003  O  OD1   . ASN A 1  677  ? 124.486 158.136 118.225 1.00 93.79  ? 677  ASN A OD1   1 
ATOM   5004  N  ND2   . ASN A 1  677  ? 122.959 158.196 119.867 1.00 93.79  ? 677  ASN A ND2   1 
ATOM   5005  N  N     . ASN A 1  678  ? 121.060 161.047 115.761 1.00 87.63  ? 678  ASN A N     1 
ATOM   5006  C  CA    . ASN A 1  678  ? 119.976 161.329 114.828 1.00 87.63  ? 678  ASN A CA    1 
ATOM   5007  C  C     . ASN A 1  678  ? 120.486 161.971 113.545 1.00 87.63  ? 678  ASN A C     1 
ATOM   5008  O  O     . ASN A 1  678  ? 119.801 161.921 112.517 1.00 87.63  ? 678  ASN A O     1 
ATOM   5009  C  CB    . ASN A 1  678  ? 118.937 162.204 115.516 1.00 90.04  ? 678  ASN A CB    1 
ATOM   5010  C  CG    . ASN A 1  678  ? 118.206 161.462 116.611 1.00 90.04  ? 678  ASN A CG    1 
ATOM   5011  O  OD1   . ASN A 1  678  ? 118.014 160.248 116.538 1.00 90.04  ? 678  ASN A OD1   1 
ATOM   5012  N  ND2   . ASN A 1  678  ? 117.856 162.175 117.666 1.00 90.04  ? 678  ASN A ND2   1 
ATOM   5013  N  N     . TRP A 1  679  ? 121.676 162.576 113.576 1.00 86.56  ? 679  TRP A N     1 
ATOM   5014  C  CA    . TRP A 1  679  ? 122.352 162.893 112.324 1.00 86.56  ? 679  TRP A CA    1 
ATOM   5015  C  C     . TRP A 1  679  ? 123.054 161.678 111.743 1.00 86.56  ? 679  TRP A C     1 
ATOM   5016  O  O     . TRP A 1  679  ? 123.108 161.531 110.518 1.00 86.56  ? 679  TRP A O     1 
ATOM   5017  C  CB    . TRP A 1  679  ? 123.371 164.015 112.514 1.00 87.85  ? 679  TRP A CB    1 
ATOM   5018  C  CG    . TRP A 1  679  ? 124.094 164.354 111.250 1.00 87.85  ? 679  TRP A CG    1 
ATOM   5019  C  CD1   . TRP A 1  679  ? 123.692 165.230 110.286 1.00 87.85  ? 679  TRP A CD1   1 
ATOM   5020  C  CD2   . TRP A 1  679  ? 125.343 163.813 110.809 1.00 87.85  ? 679  TRP A CD2   1 
ATOM   5021  N  NE1   . TRP A 1  679  ? 124.619 165.275 109.274 1.00 87.85  ? 679  TRP A NE1   1 
ATOM   5022  C  CE2   . TRP A 1  679  ? 125.644 164.416 109.572 1.00 87.85  ? 679  TRP A CE2   1 
ATOM   5023  C  CE3   . TRP A 1  679  ? 126.242 162.884 111.345 1.00 87.85  ? 679  TRP A CE3   1 
ATOM   5024  C  CZ2   . TRP A 1  679  ? 126.805 164.114 108.856 1.00 87.85  ? 679  TRP A CZ2   1 
ATOM   5025  C  CZ3   . TRP A 1  679  ? 127.394 162.588 110.636 1.00 87.85  ? 679  TRP A CZ3   1 
ATOM   5026  C  CH2   . TRP A 1  679  ? 127.661 163.196 109.400 1.00 87.85  ? 679  TRP A CH2   1 
ATOM   5027  N  N     . LEU A 1  680  ? 123.596 160.804 112.597 1.00 88.60  ? 680  LEU A N     1 
ATOM   5028  C  CA    . LEU A 1  680  ? 124.282 159.614 112.103 1.00 88.60  ? 680  LEU A CA    1 
ATOM   5029  C  C     . LEU A 1  680  ? 123.357 158.741 111.264 1.00 88.60  ? 680  LEU A C     1 
ATOM   5030  O  O     . LEU A 1  680  ? 123.832 157.965 110.429 1.00 88.60  ? 680  LEU A O     1 
ATOM   5031  C  CB    . LEU A 1  680  ? 124.867 158.816 113.271 1.00 90.89  ? 680  LEU A CB    1 
ATOM   5032  C  CG    . LEU A 1  680  ? 125.592 157.511 112.941 1.00 90.89  ? 680  LEU A CG    1 
ATOM   5033  C  CD1   . LEU A 1  680  ? 126.781 157.778 112.038 1.00 90.89  ? 680  LEU A CD1   1 
ATOM   5034  C  CD2   . LEU A 1  680  ? 126.036 156.803 114.211 1.00 90.89  ? 680  LEU A CD2   1 
ATOM   5035  N  N     . LEU A 1  681  ? 122.040 158.858 111.458 1.00 90.56  ? 681  LEU A N     1 
ATOM   5036  C  CA    . LEU A 1  681  ? 121.110 158.174 110.560 1.00 90.56  ? 681  LEU A CA    1 
ATOM   5037  C  C     . LEU A 1  681  ? 121.344 158.571 109.105 1.00 90.56  ? 681  LEU A C     1 
ATOM   5038  O  O     . LEU A 1  681  ? 121.194 157.750 108.194 1.00 90.56  ? 681  LEU A O     1 
ATOM   5039  C  CB    . LEU A 1  681  ? 119.660 158.472 110.946 1.00 91.54  ? 681  LEU A CB    1 
ATOM   5040  C  CG    . LEU A 1  681  ? 118.952 157.675 112.042 1.00 91.54  ? 681  LEU A CG    1 
ATOM   5041  C  CD1   . LEU A 1  681  ? 119.500 158.001 113.417 1.00 91.54  ? 681  LEU A CD1   1 
ATOM   5042  C  CD2   . LEU A 1  681  ? 117.454 157.915 111.995 1.00 91.54  ? 681  LEU A CD2   1 
ATOM   5043  N  N     . ILE A 1  682  ? 121.725 159.827 108.867 1.00 89.78  ? 682  ILE A N     1 
ATOM   5044  C  CA    . ILE A 1  682  ? 121.719 160.356 107.503 1.00 89.78  ? 682  ILE A CA    1 
ATOM   5045  C  C     . ILE A 1  682  ? 122.855 159.756 106.677 1.00 89.78  ? 682  ILE A C     1 
ATOM   5046  O  O     . ILE A 1  682  ? 122.626 159.200 105.597 1.00 89.78  ? 682  ILE A O     1 
ATOM   5047  C  CB    . ILE A 1  682  ? 121.770 161.894 107.519 1.00 89.70  ? 682  ILE A CB    1 
ATOM   5048  C  CG1   . ILE A 1  682  ? 120.457 162.449 108.066 1.00 89.70  ? 682  ILE A CG1   1 
ATOM   5049  C  CG2   . ILE A 1  682  ? 121.997 162.430 106.135 1.00 89.70  ? 682  ILE A CG2   1 
ATOM   5050  C  CD1   . ILE A 1  682  ? 120.469 163.941 108.309 1.00 89.70  ? 682  ILE A CD1   1 
ATOM   5051  N  N     . GLU A 1  683  ? 124.096 159.865 107.161 1.00 91.67  ? 683  GLU A N     1 
ATOM   5052  C  CA    . GLU A 1  683  ? 125.200 159.260 106.414 1.00 91.67  ? 683  GLU A CA    1 
ATOM   5053  C  C     . GLU A 1  683  ? 125.319 157.765 106.685 1.00 91.67  ? 683  GLU A C     1 
ATOM   5054  O  O     . GLU A 1  683  ? 125.619 156.986 105.771 1.00 91.67  ? 683  GLU A O     1 
ATOM   5055  C  CB    . GLU A 1  683  ? 126.533 159.947 106.723 1.00 99.28  ? 683  GLU A CB    1 
ATOM   5056  C  CG    . GLU A 1  683  ? 126.713 161.327 106.120 1.00 99.28  ? 683  GLU A CG    1 
ATOM   5057  C  CD    . GLU A 1  683  ? 128.134 161.842 106.290 1.00 99.28  ? 683  GLU A CD    1 
ATOM   5058  O  OE1   . GLU A 1  683  ? 128.898 161.206 107.045 1.00 99.28  ? 683  GLU A OE1   1 
ATOM   5059  O  OE2   . GLU A 1  683  ? 128.494 162.847 105.645 1.00 99.28  ? 683  GLU A OE2   1 
ATOM   5060  N  N     . GLY A 1  684  ? 125.115 157.344 107.925 1.00 89.53  ? 684  GLY A N     1 
ATOM   5061  C  CA    . GLY A 1  684  ? 125.255 155.941 108.252 1.00 89.53  ? 684  GLY A CA    1 
ATOM   5062  C  C     . GLY A 1  684  ? 126.708 155.524 108.331 1.00 89.53  ? 684  GLY A C     1 
ATOM   5063  O  O     . GLY A 1  684  ? 127.594 156.238 107.853 1.00 89.53  ? 684  GLY A O     1 
ATOM   5064  N  N     . HIS A 1  685  ? 126.965 154.371 108.940 1.00 92.66  ? 685  HIS A N     1 
ATOM   5065  C  CA    . HIS A 1  685  ? 128.320 153.869 109.091 1.00 92.66  ? 685  HIS A CA    1 
ATOM   5066  C  C     . HIS A 1  685  ? 128.287 152.368 108.865 1.00 92.66  ? 685  HIS A C     1 
ATOM   5067  O  O     . HIS A 1  685  ? 127.282 151.717 109.146 1.00 92.66  ? 685  HIS A O     1 
ATOM   5068  C  CB    . HIS A 1  685  ? 128.885 154.201 110.476 1.00 97.21  ? 685  HIS A CB    1 
ATOM   5069  C  CG    . HIS A 1  685  ? 130.334 153.875 110.628 1.00 97.21  ? 685  HIS A CG    1 
ATOM   5070  N  ND1   . HIS A 1  685  ? 131.310 154.469 109.858 1.00 97.21  ? 685  HIS A ND1   1 
ATOM   5071  C  CD2   . HIS A 1  685  ? 130.978 153.021 111.457 1.00 97.21  ? 685  HIS A CD2   1 
ATOM   5072  C  CE1   . HIS A 1  685  ? 132.492 153.995 110.204 1.00 97.21  ? 685  HIS A CE1   1 
ATOM   5073  N  NE2   . HIS A 1  685  ? 132.318 153.115 111.172 1.00 97.21  ? 685  HIS A NE2   1 
ATOM   5074  N  N     . THR A 1  686  ? 129.379 151.823 108.338 1.00 95.43  ? 686  THR A N     1 
ATOM   5075  C  CA    . THR A 1  686  ? 129.401 150.409 107.994 1.00 95.43  ? 686  THR A CA    1 
ATOM   5076  C  C     . THR A 1  686  ? 130.839 149.921 107.925 1.00 95.43  ? 686  THR A C     1 
ATOM   5077  O  O     . THR A 1  686  ? 131.784 150.707 107.873 1.00 95.43  ? 686  THR A O     1 
ATOM   5078  C  CB    . THR A 1  686  ? 128.689 150.150 106.663 1.00 91.91  ? 686  THR A CB    1 
ATOM   5079  O  OG1   . THR A 1  686  ? 128.602 148.740 106.431 1.00 91.91  ? 686  THR A OG1   1 
ATOM   5080  C  CG2   . THR A 1  686  ? 129.453 150.801 105.524 1.00 91.91  ? 686  THR A CG2   1 
ATOM   5081  N  N     . ILE A 1  687  ? 130.987 148.601 107.949 1.00 98.41  ? 687  ILE A N     1 
ATOM   5082  C  CA    . ILE A 1  687  ? 132.211 147.928 107.539 1.00 98.41  ? 687  ILE A CA    1 
ATOM   5083  C  C     . ILE A 1  687  ? 131.847 146.872 106.509 1.00 98.41  ? 687  ILE A C     1 
ATOM   5084  O  O     . ILE A 1  687  ? 130.866 146.138 106.677 1.00 98.41  ? 687  ILE A O     1 
ATOM   5085  C  CB    . ILE A 1  687  ? 132.972 147.299 108.725 1.00 98.34  ? 687  ILE A CB    1 
ATOM   5086  C  CG1   . ILE A 1  687  ? 133.680 148.377 109.542 1.00 98.34  ? 687  ILE A CG1   1 
ATOM   5087  C  CG2   . ILE A 1  687  ? 133.955 146.246 108.247 1.00 98.34  ? 687  ILE A CG2   1 
ATOM   5088  C  CD1   . ILE A 1  687  ? 134.377 147.828 110.761 1.00 98.34  ? 687  ILE A CD1   1 
ATOM   5089  N  N     . GLY A 1  688  ? 132.640 146.797 105.447 1.00 102.39 ? 688  GLY A N     1 
ATOM   5090  C  CA    . GLY A 1  688  ? 132.420 145.814 104.406 1.00 102.39 ? 688  GLY A CA    1 
ATOM   5091  C  C     . GLY A 1  688  ? 133.758 145.382 103.854 1.00 102.39 ? 688  GLY A C     1 
ATOM   5092  O  O     . GLY A 1  688  ? 134.793 145.996 104.131 1.00 102.39 ? 688  GLY A O     1 
ATOM   5093  N  N     . ILE A 1  689  ? 133.728 144.306 103.067 1.00 103.15 ? 689  ILE A N     1 
ATOM   5094  C  CA    . ILE A 1  689  ? 134.968 143.718 102.568 1.00 103.15 ? 689  ILE A CA    1 
ATOM   5095  C  C     . ILE A 1  689  ? 135.754 144.725 101.740 1.00 103.15 ? 689  ILE A C     1 
ATOM   5096  O  O     . ILE A 1  689  ? 136.992 144.710 101.741 1.00 103.15 ? 689  ILE A O     1 
ATOM   5097  C  CB    . ILE A 1  689  ? 134.651 142.437 101.776 1.00 96.11  ? 689  ILE A CB    1 
ATOM   5098  C  CG1   . ILE A 1  689  ? 134.050 141.392 102.714 1.00 96.11  ? 689  ILE A CG1   1 
ATOM   5099  C  CG2   . ILE A 1  689  ? 135.895 141.880 101.125 1.00 96.11  ? 689  ILE A CG2   1 
ATOM   5100  C  CD1   . ILE A 1  689  ? 133.503 140.189 102.007 1.00 96.11  ? 689  ILE A CD1   1 
ATOM   5101  N  N     . GLY A 1  690  ? 135.061 145.635 101.053 1.00 107.32 ? 690  GLY A N     1 
ATOM   5102  C  CA    . GLY A 1  690  ? 135.751 146.677 100.312 1.00 107.32 ? 690  GLY A CA    1 
ATOM   5103  C  C     . GLY A 1  690  ? 136.592 147.579 101.190 1.00 107.32 ? 690  GLY A C     1 
ATOM   5104  O  O     . GLY A 1  690  ? 137.516 148.238 100.707 1.00 107.32 ? 690  GLY A O     1 
ATOM   5105  N  N     . ASP A 1  691  ? 136.286 147.623 102.487 1.00 113.35 ? 691  ASP A N     1 
ATOM   5106  C  CA    . ASP A 1  691  ? 137.088 148.403 103.418 1.00 113.35 ? 691  ASP A CA    1 
ATOM   5107  C  C     . ASP A 1  691  ? 138.352 147.669 103.843 1.00 113.35 ? 691  ASP A C     1 
ATOM   5108  O  O     . ASP A 1  691  ? 139.307 148.314 104.290 1.00 113.35 ? 691  ASP A O     1 
ATOM   5109  C  CB    . ASP A 1  691  ? 136.248 148.759 104.644 1.00 115.77 ? 691  ASP A CB    1 
ATOM   5110  C  CG    . ASP A 1  691  ? 135.105 149.700 104.313 1.00 115.77 ? 691  ASP A CG    1 
ATOM   5111  O  OD1   . ASP A 1  691  ? 135.137 150.324 103.231 1.00 115.77 ? 691  ASP A OD1   1 
ATOM   5112  O  OD2   . ASP A 1  691  ? 134.168 149.809 105.129 1.00 115.77 ? 691  ASP A OD2   1 
ATOM   5113  N  N     . SER A 1  692  ? 138.386 146.345 103.711 1.00 111.16 ? 692  SER A N     1 
ATOM   5114  C  CA    . SER A 1  692  ? 139.529 145.546 104.131 1.00 111.16 ? 692  SER A CA    1 
ATOM   5115  C  C     . SER A 1  692  ? 140.495 145.233 102.996 1.00 111.16 ? 692  SER A C     1 
ATOM   5116  O  O     . SER A 1  692  ? 141.521 144.591 103.237 1.00 111.16 ? 692  SER A O     1 
ATOM   5117  C  CB    . SER A 1  692  ? 139.047 144.239 104.767 1.00 108.92 ? 692  SER A CB    1 
ATOM   5118  O  OG    . SER A 1  692  ? 138.343 143.447 103.827 1.00 108.92 ? 692  SER A OG    1 
ATOM   5119  N  N     . ILE A 1  693  ? 140.202 145.671 101.776 1.00 113.95 ? 693  ILE A N     1 
ATOM   5120  C  CA    . ILE A 1  693  ? 140.994 145.334 100.599 1.00 113.95 ? 693  ILE A CA    1 
ATOM   5121  C  C     . ILE A 1  693  ? 141.872 146.524 100.236 1.00 113.95 ? 693  ILE A C     1 
ATOM   5122  O  O     . ILE A 1  693  ? 141.425 147.676 100.277 1.00 113.95 ? 693  ILE A O     1 
ATOM   5123  C  CB    . ILE A 1  693  ? 140.087 144.924 99.422  1.00 109.27 ? 693  ILE A CB    1 
ATOM   5124  C  CG1   . ILE A 1  693  ? 139.371 143.613 99.745  1.00 109.27 ? 693  ILE A CG1   1 
ATOM   5125  C  CG2   . ILE A 1  693  ? 140.880 144.795 98.132  1.00 109.27 ? 693  ILE A CG2   1 
ATOM   5126  C  CD1   . ILE A 1  693  ? 138.317 143.230 98.741  1.00 109.27 ? 693  ILE A CD1   1 
ATOM   5127  N  N     . ALA A 1  694  ? 143.126 146.242 99.897  1.00 122.25 ? 694  ALA A N     1 
ATOM   5128  C  CA    . ALA A 1  694  ? 144.088 147.245 99.467  1.00 122.25 ? 694  ALA A CA    1 
ATOM   5129  C  C     . ALA A 1  694  ? 144.189 147.242 97.944  1.00 122.25 ? 694  ALA A C     1 
ATOM   5130  O  O     . ALA A 1  694  ? 143.488 146.502 97.249  1.00 122.25 ? 694  ALA A O     1 
ATOM   5131  C  CB    . ALA A 1  694  ? 145.451 146.995 100.113 1.00 123.69 ? 694  ALA A CB    1 
ATOM   5132  N  N     . ASP A 1  695  ? 145.073 148.089 97.425  1.00 130.31 ? 695  ASP A N     1 
ATOM   5133  C  CA    . ASP A 1  695  ? 145.287 148.151 95.987  1.00 130.31 ? 695  ASP A CA    1 
ATOM   5134  C  C     . ASP A 1  695  ? 146.016 146.905 95.500  1.00 130.31 ? 695  ASP A C     1 
ATOM   5135  O  O     . ASP A 1  695  ? 146.666 146.195 96.271  1.00 130.31 ? 695  ASP A O     1 
ATOM   5136  C  CB    . ASP A 1  695  ? 146.086 149.402 95.620  1.00 140.57 ? 695  ASP A CB    1 
ATOM   5137  C  CG    . ASP A 1  695  ? 145.293 150.677 95.814  1.00 140.57 ? 695  ASP A CG    1 
ATOM   5138  O  OD1   . ASP A 1  695  ? 144.052 150.597 95.927  1.00 140.57 ? 695  ASP A OD1   1 
ATOM   5139  O  OD2   . ASP A 1  695  ? 145.911 151.762 95.854  1.00 140.57 ? 695  ASP A OD2   1 
ATOM   5140  N  N     . SER A 1  696  ? 145.902 146.639 94.196  1.00 128.20 ? 696  SER A N     1 
ATOM   5141  C  CA    . SER A 1  696  ? 146.636 145.524 93.608  1.00 128.20 ? 696  SER A CA    1 
ATOM   5142  C  C     . SER A 1  696  ? 148.136 145.791 93.591  1.00 128.20 ? 696  SER A C     1 
ATOM   5143  O  O     . SER A 1  696  ? 148.932 144.859 93.425  1.00 128.20 ? 696  SER A O     1 
ATOM   5144  C  CB    . SER A 1  696  ? 146.125 145.244 92.195  1.00 130.87 ? 696  SER A CB    1 
ATOM   5145  O  OG    . SER A 1  696  ? 146.354 146.353 91.344  1.00 130.87 ? 696  SER A OG    1 
ATOM   5146  N  N     . LYS A 1  697  ? 148.539 147.053 93.752  1.00 126.99 ? 697  LYS A N     1 
ATOM   5147  C  CA    . LYS A 1  697  ? 149.957 147.375 93.891  1.00 126.99 ? 697  LYS A CA    1 
ATOM   5148  C  C     . LYS A 1  697  ? 150.446 147.103 95.309  1.00 126.99 ? 697  LYS A C     1 
ATOM   5149  O  O     . LYS A 1  697  ? 151.555 146.585 95.509  1.00 126.99 ? 697  LYS A O     1 
ATOM   5150  C  CB    . LYS A 1  697  ? 150.192 148.838 93.519  1.00 124.89 ? 697  LYS A CB    1 
ATOM   5151  C  CG    . LYS A 1  697  ? 151.643 149.276 93.544  1.00 124.89 ? 697  LYS A CG    1 
ATOM   5152  C  CD    . LYS A 1  697  ? 151.759 150.776 93.335  1.00 124.89 ? 697  LYS A CD    1 
ATOM   5153  C  CE    . LYS A 1  697  ? 151.325 151.176 91.934  1.00 124.89 ? 697  LYS A CE    1 
ATOM   5154  N  NZ    . LYS A 1  697  ? 151.408 152.649 91.730  1.00 124.89 ? 697  LYS A NZ    1 
ATOM   5155  N  N     . THR A 1  698  ? 149.626 147.445 96.307  1.00 125.14 ? 698  THR A N     1 
ATOM   5156  C  CA    . THR A 1  698  ? 150.041 147.314 97.699  1.00 125.14 ? 698  THR A CA    1 
ATOM   5157  C  C     . THR A 1  698  ? 150.313 145.859 98.060  1.00 125.14 ? 698  THR A C     1 
ATOM   5158  O  O     . THR A 1  698  ? 151.186 145.570 98.885  1.00 125.14 ? 698  THR A O     1 
ATOM   5159  C  CB    . THR A 1  698  ? 148.972 147.911 98.617  1.00 126.04 ? 698  THR A CB    1 
ATOM   5160  O  OG1   . THR A 1  698  ? 148.765 149.286 98.273  1.00 126.04 ? 698  THR A OG1   1 
ATOM   5161  C  CG2   . THR A 1  698  ? 149.406 147.832 100.072 1.00 126.04 ? 698  THR A CG2   1 
ATOM   5162  N  N     . TYR A 1  699  ? 149.589 144.927 97.439  1.00 124.96 ? 699  TYR A N     1 
ATOM   5163  C  CA    . TYR A 1  699  ? 149.824 143.512 97.708  1.00 124.96 ? 699  TYR A CA    1 
ATOM   5164  C  C     . TYR A 1  699  ? 151.211 143.088 97.244  1.00 124.96 ? 699  TYR A C     1 
ATOM   5165  O  O     . TYR A 1  699  ? 151.923 142.363 97.951  1.00 124.96 ? 699  TYR A O     1 
ATOM   5166  C  CB    . TYR A 1  699  ? 148.740 142.668 97.040  1.00 126.05 ? 699  TYR A CB    1 
ATOM   5167  C  CG    . TYR A 1  699  ? 147.367 142.882 97.629  1.00 126.05 ? 699  TYR A CG    1 
ATOM   5168  C  CD1   . TYR A 1  699  ? 147.197 143.011 99.001  1.00 126.05 ? 699  TYR A CD1   1 
ATOM   5169  C  CD2   . TYR A 1  699  ? 146.241 142.955 96.820  1.00 126.05 ? 699  TYR A CD2   1 
ATOM   5170  C  CE1   . TYR A 1  699  ? 145.947 143.206 99.550  1.00 126.05 ? 699  TYR A CE1   1 
ATOM   5171  C  CE2   . TYR A 1  699  ? 144.986 143.150 97.360  1.00 126.05 ? 699  TYR A CE2   1 
ATOM   5172  C  CZ    . TYR A 1  699  ? 144.846 143.274 98.725  1.00 126.05 ? 699  TYR A CZ    1 
ATOM   5173  O  OH    . TYR A 1  699  ? 143.599 143.469 99.269  1.00 126.05 ? 699  TYR A OH    1 
ATOM   5174  N  N     . GLN A 1  700  ? 151.618 143.537 96.054  1.00 124.47 ? 700  GLN A N     1 
ATOM   5175  C  CA    . GLN A 1  700  ? 152.959 143.220 95.576  1.00 124.47 ? 700  GLN A CA    1 
ATOM   5176  C  C     . GLN A 1  700  ? 154.018 143.912 96.425  1.00 124.47 ? 700  GLN A C     1 
ATOM   5177  O  O     . GLN A 1  700  ? 155.092 143.350 96.667  1.00 124.47 ? 700  GLN A O     1 
ATOM   5178  C  CB    . GLN A 1  700  ? 153.102 143.606 94.104  1.00 130.00 ? 700  GLN A CB    1 
ATOM   5179  C  CG    . GLN A 1  700  ? 154.417 143.168 93.478  1.00 130.00 ? 700  GLN A CG    1 
ATOM   5180  C  CD    . GLN A 1  700  ? 154.459 143.396 91.978  1.00 130.00 ? 700  GLN A CD    1 
ATOM   5181  O  OE1   . GLN A 1  700  ? 153.467 143.798 91.370  1.00 130.00 ? 700  GLN A OE1   1 
ATOM   5182  N  NE2   . GLN A 1  700  ? 155.613 143.138 91.373  1.00 130.00 ? 700  GLN A NE2   1 
ATOM   5183  N  N     . ASP A 1  701  ? 153.731 145.130 96.892  1.00 123.09 ? 701  ASP A N     1 
ATOM   5184  C  CA    . ASP A 1  701  ? 154.640 145.793 97.825  1.00 123.09 ? 701  ASP A CA    1 
ATOM   5185  C  C     . ASP A 1  701  ? 154.847 144.948 99.079  1.00 123.09 ? 701  ASP A C     1 
ATOM   5186  O  O     . ASP A 1  701  ? 155.985 144.640 99.463  1.00 123.09 ? 701  ASP A O     1 
ATOM   5187  C  CB    . ASP A 1  701  ? 154.087 147.170 98.196  1.00 129.60 ? 701  ASP A CB    1 
ATOM   5188  C  CG    . ASP A 1  701  ? 154.092 148.136 97.029  1.00 129.60 ? 701  ASP A CG    1 
ATOM   5189  O  OD1   . ASP A 1  701  ? 154.804 147.873 96.037  1.00 129.60 ? 701  ASP A OD1   1 
ATOM   5190  O  OD2   . ASP A 1  701  ? 153.377 149.157 97.102  1.00 129.60 ? 701  ASP A OD2   1 
ATOM   5191  N  N     . ILE A 1  702  ? 153.744 144.552 99.719  1.00 120.41 ? 702  ILE A N     1 
ATOM   5192  C  CA    . ILE A 1  702  ? 153.813 143.812 100.976 1.00 120.41 ? 702  ILE A CA    1 
ATOM   5193  C  C     . ILE A 1  702  ? 154.532 142.485 100.778 1.00 120.41 ? 702  ILE A C     1 
ATOM   5194  O  O     . ILE A 1  702  ? 155.425 142.123 101.552 1.00 120.41 ? 702  ILE A O     1 
ATOM   5195  C  CB    . ILE A 1  702  ? 152.399 143.604 101.546 1.00 117.93 ? 702  ILE A CB    1 
ATOM   5196  C  CG1   . ILE A 1  702  ? 151.778 144.946 101.936 1.00 117.93 ? 702  ILE A CG1   1 
ATOM   5197  C  CG2   . ILE A 1  702  ? 152.434 142.665 102.739 1.00 117.93 ? 702  ILE A CG2   1 
ATOM   5198  C  CD1   . ILE A 1  702  ? 150.306 144.862 102.248 1.00 117.93 ? 702  ILE A CD1   1 
ATOM   5199  N  N     . GLN A 1  703  ? 154.158 141.741 99.735  1.00 120.27 ? 703  GLN A N     1 
ATOM   5200  C  CA    . GLN A 1  703  ? 154.774 140.436 99.511  1.00 120.27 ? 703  GLN A CA    1 
ATOM   5201  C  C     . GLN A 1  703  ? 156.255 140.571 99.176  1.00 120.27 ? 703  GLN A C     1 
ATOM   5202  O  O     . GLN A 1  703  ? 157.068 139.724 99.570  1.00 120.27 ? 703  GLN A O     1 
ATOM   5203  C  CB    . GLN A 1  703  ? 154.027 139.688 98.409  1.00 127.54 ? 703  GLN A CB    1 
ATOM   5204  C  CG    . GLN A 1  703  ? 152.612 139.298 98.805  1.00 127.54 ? 703  GLN A CG    1 
ATOM   5205  C  CD    . GLN A 1  703  ? 151.852 138.629 97.682  1.00 127.54 ? 703  GLN A CD    1 
ATOM   5206  O  OE1   . GLN A 1  703  ? 152.159 138.824 96.506  1.00 127.54 ? 703  GLN A OE1   1 
ATOM   5207  N  NE2   . GLN A 1  703  ? 150.848 137.836 98.038  1.00 127.54 ? 703  GLN A NE2   1 
ATOM   5208  N  N     . ASN A 1  704  ? 156.628 141.632 98.456  1.00 118.55 ? 704  ASN A N     1 
ATOM   5209  C  CA    . ASN A 1  704  ? 158.045 141.908 98.239  1.00 118.55 ? 704  ASN A CA    1 
ATOM   5210  C  C     . ASN A 1  704  ? 158.770 142.108 99.563  1.00 118.55 ? 704  ASN A C     1 
ATOM   5211  O  O     . ASN A 1  704  ? 159.838 141.527 99.794  1.00 118.55 ? 704  ASN A O     1 
ATOM   5212  C  CB    . ASN A 1  704  ? 158.216 143.134 97.342  1.00 117.53 ? 704  ASN A CB    1 
ATOM   5213  C  CG    . ASN A 1  704  ? 157.885 142.849 95.893  1.00 117.53 ? 704  ASN A CG    1 
ATOM   5214  O  OD1   . ASN A 1  704  ? 157.967 141.709 95.436  1.00 117.53 ? 704  ASN A OD1   1 
ATOM   5215  N  ND2   . ASN A 1  704  ? 157.503 143.888 95.160  1.00 117.53 ? 704  ASN A ND2   1 
ATOM   5216  N  N     . THR A 1  705  ? 158.196 142.923 100.454 1.00 118.41 ? 705  THR A N     1 
ATOM   5217  C  CA    . THR A 1  705  ? 158.818 143.147 101.757 1.00 118.41 ? 705  THR A CA    1 
ATOM   5218  C  C     . THR A 1  705  ? 158.952 141.842 102.536 1.00 118.41 ? 705  THR A C     1 
ATOM   5219  O  O     . THR A 1  705  ? 159.979 141.584 103.178 1.00 118.41 ? 705  THR A O     1 
ATOM   5220  C  CB    . THR A 1  705  ? 158.008 144.170 102.554 1.00 118.67 ? 705  THR A CB    1 
ATOM   5221  O  OG1   . THR A 1  705  ? 157.928 145.395 101.816 1.00 118.67 ? 705  THR A OG1   1 
ATOM   5222  C  CG2   . THR A 1  705  ? 158.671 144.444 103.894 1.00 118.67 ? 705  THR A CG2   1 
ATOM   5223  N  N     . ILE A 1  706  ? 157.919 140.998 102.478 1.00 118.34 ? 706  ILE A N     1 
ATOM   5224  C  CA    . ILE A 1  706  ? 157.940 139.728 103.201 1.00 118.34 ? 706  ILE A CA    1 
ATOM   5225  C  C     . ILE A 1  706  ? 159.066 138.842 102.687 1.00 118.34 ? 706  ILE A C     1 
ATOM   5226  O  O     . ILE A 1  706  ? 159.882 138.331 103.463 1.00 118.34 ? 706  ILE A O     1 
ATOM   5227  C  CB    . ILE A 1  706  ? 156.581 139.019 103.091 1.00 117.31 ? 706  ILE A CB    1 
ATOM   5228  C  CG1   . ILE A 1  706  ? 155.497 139.813 103.815 1.00 117.31 ? 706  ILE A CG1   1 
ATOM   5229  C  CG2   . ILE A 1  706  ? 156.675 137.611 103.649 1.00 117.31 ? 706  ILE A CG2   1 
ATOM   5230  C  CD1   . ILE A 1  706  ? 154.107 139.300 103.546 1.00 117.31 ? 706  ILE A CD1   1 
ATOM   5231  N  N     . LYS A 1  707  ? 159.121 138.637 101.368 1.00 118.53 ? 707  LYS A N     1 
ATOM   5232  C  CA    . LYS A 1  707  ? 160.155 137.771 100.808 1.00 118.53 ? 707  LYS A CA    1 
ATOM   5233  C  C     . LYS A 1  707  ? 161.548 138.319 101.094 1.00 118.53 ? 707  LYS A C     1 
ATOM   5234  O  O     . LYS A 1  707  ? 162.487 137.552 101.341 1.00 118.53 ? 707  LYS A O     1 
ATOM   5235  C  CB    . LYS A 1  707  ? 159.934 137.593 99.307  1.00 116.48 ? 707  LYS A CB    1 
ATOM   5236  C  CG    . LYS A 1  707  ? 158.665 136.828 98.978  1.00 116.48 ? 707  LYS A CG    1 
ATOM   5237  C  CD    . LYS A 1  707  ? 158.425 136.745 97.483  1.00 116.48 ? 707  LYS A CD    1 
ATOM   5238  C  CE    . LYS A 1  707  ? 157.156 135.964 97.183  1.00 116.48 ? 707  LYS A CE    1 
ATOM   5239  N  NZ    . LYS A 1  707  ? 156.851 135.912 95.728  1.00 116.48 ? 707  LYS A NZ    1 
ATOM   5240  N  N     . LYS A 1  708  ? 161.697 139.646 101.068 1.00 120.86 ? 708  LYS A N     1 
ATOM   5241  C  CA    . LYS A 1  708  ? 162.941 140.265 101.516 1.00 120.86 ? 708  LYS A CA    1 
ATOM   5242  C  C     . LYS A 1  708  ? 163.289 139.832 102.936 1.00 120.86 ? 708  LYS A C     1 
ATOM   5243  O  O     . LYS A 1  708  ? 164.409 139.379 103.206 1.00 120.86 ? 708  LYS A O     1 
ATOM   5244  C  CB    . LYS A 1  708  ? 162.820 141.787 101.439 1.00 123.24 ? 708  LYS A CB    1 
ATOM   5245  C  CG    . LYS A 1  708  ? 164.047 142.539 101.926 1.00 123.24 ? 708  LYS A CG    1 
ATOM   5246  C  CD    . LYS A 1  708  ? 163.824 144.043 101.871 1.00 123.24 ? 708  LYS A CD    1 
ATOM   5247  C  CE    . LYS A 1  708  ? 164.939 144.799 102.576 1.00 123.24 ? 708  LYS A CE    1 
ATOM   5248  N  NZ    . LYS A 1  708  ? 166.260 144.591 101.926 1.00 123.24 ? 708  LYS A NZ    1 
ATOM   5249  N  N     . ALA A 1  709  ? 162.330 139.956 103.856 1.00 118.61 ? 709  ALA A N     1 
ATOM   5250  C  CA    . ALA A 1  709  ? 162.587 139.637 105.256 1.00 118.61 ? 709  ALA A CA    1 
ATOM   5251  C  C     . ALA A 1  709  ? 162.972 138.173 105.432 1.00 118.61 ? 709  ALA A C     1 
ATOM   5252  O  O     . ALA A 1  709  ? 163.944 137.851 106.124 1.00 118.61 ? 709  ALA A O     1 
ATOM   5253  C  CB    . ALA A 1  709  ? 161.360 139.975 106.099 1.00 118.90 ? 709  ALA A CB    1 
ATOM   5254  N  N     . LYS A 1  710  ? 162.211 137.268 104.813 1.00 118.52 ? 710  LYS A N     1 
ATOM   5255  C  CA    . LYS A 1  710  ? 162.490 135.844 104.964 1.00 118.52 ? 710  LYS A CA    1 
ATOM   5256  C  C     . LYS A 1  710  ? 163.836 135.475 104.352 1.00 118.52 ? 710  LYS A C     1 
ATOM   5257  O  O     . LYS A 1  710  ? 164.550 134.612 104.876 1.00 118.52 ? 710  LYS A O     1 
ATOM   5258  C  CB    . LYS A 1  710  ? 161.362 135.022 104.339 1.00 113.27 ? 710  LYS A CB    1 
ATOM   5259  C  CG    . LYS A 1  710  ? 160.041 135.146 105.085 1.00 113.27 ? 710  LYS A CG    1 
ATOM   5260  C  CD    . LYS A 1  710  ? 158.876 134.609 104.274 1.00 113.27 ? 710  LYS A CD    1 
ATOM   5261  C  CE    . LYS A 1  710  ? 159.034 133.126 103.995 1.00 113.27 ? 710  LYS A CE    1 
ATOM   5262  N  NZ    . LYS A 1  710  ? 157.890 132.585 103.211 1.00 113.27 ? 710  LYS A NZ    1 
ATOM   5263  N  N     . GLN A 1  711  ? 164.209 136.131 103.249 1.00 121.55 ? 711  GLN A N     1 
ATOM   5264  C  CA    . GLN A 1  711  ? 165.535 135.900 102.685 1.00 121.55 ? 711  GLN A CA    1 
ATOM   5265  C  C     . GLN A 1  711  ? 166.626 136.377 103.637 1.00 121.55 ? 711  GLN A C     1 
ATOM   5266  O  O     . GLN A 1  711  ? 167.667 135.722 103.780 1.00 121.55 ? 711  GLN A O     1 
ATOM   5267  C  CB    . GLN A 1  711  ? 165.659 136.592 101.329 1.00 129.54 ? 711  GLN A CB    1 
ATOM   5268  C  CG    . GLN A 1  711  ? 166.958 136.289 100.602 1.00 129.54 ? 711  GLN A CG    1 
ATOM   5269  C  CD    . GLN A 1  711  ? 166.988 136.862 99.200  1.00 129.54 ? 711  GLN A CD    1 
ATOM   5270  O  OE1   . GLN A 1  711  ? 165.999 137.418 98.722  1.00 129.54 ? 711  GLN A OE1   1 
ATOM   5271  N  NE2   . GLN A 1  711  ? 168.127 136.729 98.532  1.00 129.54 ? 711  GLN A NE2   1 
ATOM   5272  N  N     . ASP A 1  712  ? 166.405 137.514 104.304 1.00 121.83 ? 712  ASP A N     1 
ATOM   5273  C  CA    . ASP A 1  712  ? 167.368 137.971 105.303 1.00 121.83 ? 712  ASP A CA    1 
ATOM   5274  C  C     . ASP A 1  712  ? 167.482 136.976 106.452 1.00 121.83 ? 712  ASP A C     1 
ATOM   5275  O  O     . ASP A 1  712  ? 168.586 136.704 106.942 1.00 121.83 ? 712  ASP A O     1 
ATOM   5276  C  CB    . ASP A 1  712  ? 166.973 139.351 105.826 1.00 128.78 ? 712  ASP A CB    1 
ATOM   5277  C  CG    . ASP A 1  712  ? 167.183 140.446 104.800 1.00 128.78 ? 712  ASP A CG    1 
ATOM   5278  O  OD1   . ASP A 1  712  ? 167.914 140.209 103.815 1.00 128.78 ? 712  ASP A OD1   1 
ATOM   5279  O  OD2   . ASP A 1  712  ? 166.619 141.545 104.978 1.00 128.78 ? 712  ASP A OD2   1 
ATOM   5280  N  N     . VAL A 1  713  ? 166.349 136.422 106.895 1.00 120.00 ? 713  VAL A N     1 
ATOM   5281  C  CA    . VAL A 1  713  ? 166.375 135.418 107.956 1.00 120.00 ? 713  VAL A CA    1 
ATOM   5282  C  C     . VAL A 1  713  ? 167.173 134.200 107.513 1.00 120.00 ? 713  VAL A C     1 
ATOM   5283  O  O     . VAL A 1  713  ? 167.959 133.639 108.287 1.00 120.00 ? 713  VAL A O     1 
ATOM   5284  C  CB    . VAL A 1  713  ? 164.940 135.036 108.367 1.00 115.69 ? 713  VAL A CB    1 
ATOM   5285  C  CG1   . VAL A 1  713  ? 164.962 133.918 109.394 1.00 115.69 ? 713  VAL A CG1   1 
ATOM   5286  C  CG2   . VAL A 1  713  ? 164.206 136.247 108.915 1.00 115.69 ? 713  VAL A CG2   1 
ATOM   5287  N  N     . ILE A 1  714  ? 166.994 133.778 106.259 1.00 119.60 ? 714  ILE A N     1 
ATOM   5288  C  CA    . ILE A 1  714  ? 167.787 132.671 105.731 1.00 119.60 ? 714  ILE A CA    1 
ATOM   5289  C  C     . ILE A 1  714  ? 169.272 133.015 105.762 1.00 119.60 ? 714  ILE A C     1 
ATOM   5290  O  O     . ILE A 1  714  ? 170.111 132.170 106.100 1.00 119.60 ? 714  ILE A O     1 
ATOM   5291  C  CB    . ILE A 1  714  ? 167.314 132.303 104.313 1.00 117.71 ? 714  ILE A CB    1 
ATOM   5292  C  CG1   . ILE A 1  714  ? 165.901 131.723 104.362 1.00 117.71 ? 714  ILE A CG1   1 
ATOM   5293  C  CG2   . ILE A 1  714  ? 168.274 131.319 103.665 1.00 117.71 ? 714  ILE A CG2   1 
ATOM   5294  C  CD1   . ILE A 1  714  ? 165.270 131.543 103.005 1.00 117.71 ? 714  ILE A CD1   1 
ATOM   5295  N  N     . GLU A 1  715  ? 169.620 134.260 105.424 1.00 120.92 ? 715  GLU A N     1 
ATOM   5296  C  CA    . GLU A 1  715  ? 171.021 134.671 105.478 1.00 120.92 ? 715  GLU A CA    1 
ATOM   5297  C  C     . GLU A 1  715  ? 171.574 134.571 106.896 1.00 120.92 ? 715  GLU A C     1 
ATOM   5298  O  O     . GLU A 1  715  ? 172.689 134.080 107.105 1.00 120.92 ? 715  GLU A O     1 
ATOM   5299  C  CB    . GLU A 1  715  ? 171.183 136.094 104.941 1.00 128.12 ? 715  GLU A CB    1 
ATOM   5300  C  CG    . GLU A 1  715  ? 170.916 136.241 103.456 1.00 128.12 ? 715  GLU A CG    1 
ATOM   5301  C  CD    . GLU A 1  715  ? 171.070 137.673 102.980 1.00 128.12 ? 715  GLU A CD    1 
ATOM   5302  O  OE1   . GLU A 1  715  ? 171.203 138.576 103.834 1.00 128.12 ? 715  GLU A OE1   1 
ATOM   5303  O  OE2   . GLU A 1  715  ? 171.060 137.895 101.751 1.00 128.12 ? 715  GLU A OE2   1 
ATOM   5304  N  N     . VAL A 1  716  ? 170.805 135.033 107.885 1.00 121.81 ? 716  VAL A N     1 
ATOM   5305  C  CA    . VAL A 1  716  ? 171.287 135.013 109.266 1.00 121.81 ? 716  VAL A CA    1 
ATOM   5306  C  C     . VAL A 1  716  ? 171.443 133.580 109.760 1.00 121.81 ? 716  VAL A C     1 
ATOM   5307  O  O     . VAL A 1  716  ? 172.435 133.232 110.414 1.00 121.81 ? 716  VAL A O     1 
ATOM   5308  C  CB    . VAL A 1  716  ? 170.347 135.824 110.175 1.00 115.98 ? 716  VAL A CB    1 
ATOM   5309  C  CG1   . VAL A 1  716  ? 170.759 135.676 111.631 1.00 115.98 ? 716  VAL A CG1   1 
ATOM   5310  C  CG2   . VAL A 1  716  ? 170.364 137.281 109.765 1.00 115.98 ? 716  VAL A CG2   1 
ATOM   5311  N  N     . ILE A 1  717  ? 170.464 132.726 109.459 1.00 123.81 ? 717  ILE A N     1 
ATOM   5312  C  CA    . ILE A 1  717  ? 170.538 131.335 109.901 1.00 123.81 ? 717  ILE A CA    1 
ATOM   5313  C  C     . ILE A 1  717  ? 171.732 130.641 109.256 1.00 123.81 ? 717  ILE A C     1 
ATOM   5314  O  O     . ILE A 1  717  ? 172.478 129.905 109.916 1.00 123.81 ? 717  ILE A O     1 
ATOM   5315  C  CB    . ILE A 1  717  ? 169.218 130.605 109.597 1.00 121.65 ? 717  ILE A CB    1 
ATOM   5316  C  CG1   . ILE A 1  717  ? 168.076 131.216 110.407 1.00 121.65 ? 717  ILE A CG1   1 
ATOM   5317  C  CG2   . ILE A 1  717  ? 169.332 129.139 109.936 1.00 121.65 ? 717  ILE A CG2   1 
ATOM   5318  C  CD1   . ILE A 1  717  ? 166.712 130.707 110.011 1.00 121.65 ? 717  ILE A CD1   1 
ATOM   5319  N  N     . GLU A 1  718  ? 171.949 130.887 107.961 1.00 124.16 ? 718  GLU A N     1 
ATOM   5320  C  CA    . GLU A 1  718  ? 173.092 130.285 107.283 1.00 124.16 ? 718  GLU A CA    1 
ATOM   5321  C  C     . GLU A 1  718  ? 174.408 130.877 107.777 1.00 124.16 ? 718  GLU A C     1 
ATOM   5322  O  O     . GLU A 1  718  ? 175.469 130.262 107.619 1.00 124.16 ? 718  GLU A O     1 
ATOM   5323  C  CB    . GLU A 1  718  ? 172.954 130.442 105.768 1.00 128.53 ? 718  GLU A CB    1 
ATOM   5324  C  CG    . GLU A 1  718  ? 171.825 129.609 105.178 1.00 128.53 ? 718  GLU A CG    1 
ATOM   5325  C  CD    . GLU A 1  718  ? 171.679 129.789 103.681 1.00 128.53 ? 718  GLU A CD    1 
ATOM   5326  O  OE1   . GLU A 1  718  ? 172.336 130.691 103.122 1.00 128.53 ? 718  GLU A OE1   1 
ATOM   5327  O  OE2   . GLU A 1  718  ? 170.907 129.026 103.063 1.00 128.53 ? 718  GLU A OE2   1 
ATOM   5328  N  N     . LYS A 1  719  ? 174.365 132.072 108.374 1.00 124.17 ? 719  LYS A N     1 
ATOM   5329  C  CA    . LYS A 1  719  ? 175.530 132.550 109.112 1.00 124.17 ? 719  LYS A CA    1 
ATOM   5330  C  C     . LYS A 1  719  ? 175.738 131.735 110.380 1.00 124.17 ? 719  LYS A C     1 
ATOM   5331  O  O     . LYS A 1  719  ? 176.870 131.363 110.713 1.00 124.17 ? 719  LYS A O     1 
ATOM   5332  C  CB    . LYS A 1  719  ? 175.385 134.029 109.469 1.00 122.71 ? 719  LYS A CB    1 
ATOM   5333  C  CG    . LYS A 1  719  ? 175.457 135.005 108.313 1.00 122.71 ? 719  LYS A CG    1 
ATOM   5334  C  CD    . LYS A 1  719  ? 175.256 136.419 108.837 1.00 122.71 ? 719  LYS A CD    1 
ATOM   5335  C  CE    . LYS A 1  719  ? 175.349 137.459 107.738 1.00 122.71 ? 719  LYS A CE    1 
ATOM   5336  N  NZ    . LYS A 1  719  ? 175.106 138.827 108.274 1.00 122.71 ? 719  LYS A NZ    1 
ATOM   5337  N  N     . ALA A 1  720  ? 174.652 131.449 111.103 1.00 123.67 ? 720  ALA A N     1 
ATOM   5338  C  CA    . ALA A 1  720  ? 174.773 130.748 112.376 1.00 123.67 ? 720  ALA A CA    1 
ATOM   5339  C  C     . ALA A 1  720  ? 175.201 129.297 112.191 1.00 123.67 ? 720  ALA A C     1 
ATOM   5340  O  O     . ALA A 1  720  ? 175.797 128.710 113.100 1.00 123.67 ? 720  ALA A O     1 
ATOM   5341  C  CB    . ALA A 1  720  ? 173.454 130.824 113.144 1.00 126.34 ? 720  ALA A CB    1 
ATOM   5342  N  N     . HIS A 1  721  ? 174.901 128.696 111.035 1.00 125.10 ? 721  HIS A N     1 
ATOM   5343  C  CA    . HIS A 1  721  ? 175.359 127.331 110.792 1.00 125.10 ? 721  HIS A CA    1 
ATOM   5344  C  C     . HIS A 1  721  ? 176.874 127.251 110.666 1.00 125.10 ? 721  HIS A C     1 
ATOM   5345  O  O     . HIS A 1  721  ? 177.474 126.246 111.062 1.00 125.10 ? 721  HIS A O     1 
ATOM   5346  C  CB    . HIS A 1  721  ? 174.704 126.750 109.540 1.00 128.51 ? 721  HIS A CB    1 
ATOM   5347  C  CG    . HIS A 1  721  ? 173.229 126.535 109.669 1.00 128.51 ? 721  HIS A CG    1 
ATOM   5348  N  ND1   . HIS A 1  721  ? 172.687 125.669 110.594 1.00 128.51 ? 721  HIS A ND1   1 
ATOM   5349  C  CD2   . HIS A 1  721  ? 172.185 127.027 108.960 1.00 128.51 ? 721  HIS A CD2   1 
ATOM   5350  C  CE1   . HIS A 1  721  ? 171.373 125.659 110.470 1.00 128.51 ? 721  HIS A CE1   1 
ATOM   5351  N  NE2   . HIS A 1  721  ? 171.042 126.473 109.484 1.00 128.51 ? 721  HIS A NE2   1 
ATOM   5352  N  N     . ASN A 1  722  ? 177.509 128.286 110.123 1.00 123.93 ? 722  ASN A N     1 
ATOM   5353  C  CA    . ASN A 1  722  ? 178.954 128.312 109.945 1.00 123.93 ? 722  ASN A CA    1 
ATOM   5354  C  C     . ASN A 1  722  ? 179.688 128.903 111.140 1.00 123.93 ? 722  ASN A C     1 
ATOM   5355  O  O     . ASN A 1  722  ? 180.906 129.097 111.064 1.00 123.93 ? 722  ASN A O     1 
ATOM   5356  C  CB    . ASN A 1  722  ? 179.320 129.087 108.677 1.00 125.15 ? 722  ASN A CB    1 
ATOM   5357  C  CG    . ASN A 1  722  ? 178.960 128.336 107.410 1.00 125.15 ? 722  ASN A CG    1 
ATOM   5358  O  OD1   . ASN A 1  722  ? 178.832 127.112 107.414 1.00 125.15 ? 722  ASN A OD1   1 
ATOM   5359  N  ND2   . ASN A 1  722  ? 178.804 129.069 106.314 1.00 125.15 ? 722  ASN A ND2   1 
ATOM   5360  N  N     . ASN A 1  723  ? 178.975 129.212 112.225 1.00 129.40 ? 723  ASN A N     1 
ATOM   5361  C  CA    . ASN A 1  723  ? 179.498 129.752 113.479 1.00 129.40 ? 723  ASN A CA    1 
ATOM   5362  C  C     . ASN A 1  723  ? 179.911 131.215 113.354 1.00 129.40 ? 723  ASN A C     1 
ATOM   5363  O  O     . ASN A 1  723  ? 180.338 131.812 114.349 1.00 129.40 ? 723  ASN A O     1 
ATOM   5364  C  CB    . ASN A 1  723  ? 180.678 128.927 114.024 1.00 133.61 ? 723  ASN A CB    1 
ATOM   5365  C  CG    . ASN A 1  723  ? 180.992 129.237 115.476 1.00 133.61 ? 723  ASN A CG    1 
ATOM   5366  O  OD1   . ASN A 1  723  ? 180.105 129.593 116.251 1.00 133.61 ? 723  ASN A OD1   1 
ATOM   5367  N  ND2   . ASN A 1  723  ? 182.260 129.105 115.850 1.00 133.61 ? 723  ASN A ND2   1 
ATOM   5368  N  N     . GLU A 1  724  ? 179.791 131.816 112.166 1.00 132.01 ? 724  GLU A N     1 
ATOM   5369  C  CA    . GLU A 1  724  ? 180.235 133.191 111.958 1.00 132.01 ? 724  GLU A CA    1 
ATOM   5370  C  C     . GLU A 1  724  ? 179.481 134.198 112.820 1.00 132.01 ? 724  GLU A C     1 
ATOM   5371  O  O     . GLU A 1  724  ? 179.908 135.354 112.914 1.00 132.01 ? 724  GLU A O     1 
ATOM   5372  C  CB    . GLU A 1  724  ? 180.092 133.573 110.484 1.00 134.56 ? 724  GLU A CB    1 
ATOM   5373  C  CG    . GLU A 1  724  ? 181.008 132.807 109.545 1.00 134.56 ? 724  GLU A CG    1 
ATOM   5374  C  CD    . GLU A 1  724  ? 180.799 133.193 108.094 1.00 134.56 ? 724  GLU A CD    1 
ATOM   5375  O  OE1   . GLU A 1  724  ? 179.823 133.916 107.806 1.00 134.56 ? 724  GLU A OE1   1 
ATOM   5376  O  OE2   . GLU A 1  724  ? 181.611 132.777 107.242 1.00 134.56 ? 724  GLU A OE2   1 
ATOM   5377  N  N     . LEU A 1  725  ? 178.372 133.801 113.437 1.00 137.01 ? 725  LEU A N     1 
ATOM   5378  C  CA    . LEU A 1  725  ? 177.643 134.719 114.301 1.00 137.01 ? 725  LEU A CA    1 
ATOM   5379  C  C     . LEU A 1  725  ? 178.374 134.876 115.628 1.00 137.01 ? 725  LEU A C     1 
ATOM   5380  O  O     . LEU A 1  725  ? 178.599 133.896 116.345 1.00 137.01 ? 725  LEU A O     1 
ATOM   5381  C  CB    . LEU A 1  725  ? 176.220 134.212 114.527 1.00 136.67 ? 725  LEU A CB    1 
ATOM   5382  C  CG    . LEU A 1  725  ? 175.360 135.041 115.481 1.00 136.67 ? 725  LEU A CG    1 
ATOM   5383  C  CD1   . LEU A 1  725  ? 175.205 136.453 114.953 1.00 136.67 ? 725  LEU A CD1   1 
ATOM   5384  C  CD2   . LEU A 1  725  ? 173.999 134.397 115.676 1.00 136.67 ? 725  LEU A CD2   1 
ATOM   5385  N  N     . GLU A 1  726  ? 178.740 136.117 115.953 1.00 147.66 ? 726  GLU A N     1 
ATOM   5386  C  CA    . GLU A 1  726  ? 179.486 136.418 117.168 1.00 147.66 ? 726  GLU A CA    1 
ATOM   5387  C  C     . GLU A 1  726  ? 178.529 136.780 118.287 1.00 147.66 ? 726  GLU A C     1 
ATOM   5388  O  O     . GLU A 1  726  ? 177.685 137.670 118.106 1.00 147.66 ? 726  GLU A O     1 
ATOM   5389  C  CB    . GLU A 1  726  ? 180.459 137.568 116.926 1.00 158.90 ? 726  GLU A CB    1 
ATOM   5390  C  CG    . GLU A 1  726  ? 181.569 137.239 115.942 1.00 158.90 ? 726  GLU A CG    1 
ATOM   5391  C  CD    . GLU A 1  726  ? 182.471 138.424 115.661 1.00 158.90 ? 726  GLU A CD    1 
ATOM   5392  O  OE1   . GLU A 1  726  ? 182.133 139.547 116.092 1.00 158.90 ? 726  GLU A OE1   1 
ATOM   5393  O  OE2   . GLU A 1  726  ? 183.518 138.233 115.007 1.00 158.90 ? 726  GLU A OE2   1 
ATOM   5394  N  N     . PRO A 1  727  ? 178.620 136.124 119.442 1.00 150.74 ? 727  PRO A N     1 
ATOM   5395  C  CA    . PRO A 1  727  ? 177.684 136.419 120.532 1.00 150.74 ? 727  PRO A CA    1 
ATOM   5396  C  C     . PRO A 1  727  ? 177.842 137.846 121.036 1.00 150.74 ? 727  PRO A C     1 
ATOM   5397  O  O     . PRO A 1  727  ? 178.950 138.306 121.321 1.00 150.74 ? 727  PRO A O     1 
ATOM   5398  C  CB    . PRO A 1  727  ? 178.058 135.390 121.605 1.00 147.68 ? 727  PRO A CB    1 
ATOM   5399  C  CG    . PRO A 1  727  ? 179.492 135.081 121.335 1.00 147.68 ? 727  PRO A CG    1 
ATOM   5400  C  CD    . PRO A 1  727  ? 179.633 135.130 119.838 1.00 147.68 ? 727  PRO A CD    1 
ATOM   5401  N  N     . THR A 1  728  ? 176.718 138.544 121.133 1.00 156.32 ? 728  THR A N     1 
ATOM   5402  C  CA    . THR A 1  728  ? 176.711 139.872 121.725 1.00 156.32 ? 728  THR A CA    1 
ATOM   5403  C  C     . THR A 1  728  ? 176.990 139.750 123.222 1.00 156.32 ? 728  THR A C     1 
ATOM   5404  O  O     . THR A 1  728  ? 176.432 138.866 123.883 1.00 156.32 ? 728  THR A O     1 
ATOM   5405  C  CB    . THR A 1  728  ? 175.358 140.549 121.477 1.00 157.86 ? 728  THR A CB    1 
ATOM   5406  O  OG1   . THR A 1  728  ? 175.135 140.666 120.067 1.00 157.86 ? 728  THR A OG1   1 
ATOM   5407  C  CG2   . THR A 1  728  ? 175.297 141.935 122.107 1.00 157.86 ? 728  THR A CG2   1 
ATOM   5408  N  N     . PRO A 1  729  ? 177.861 140.593 123.783 1.00 158.02 ? 729  PRO A N     1 
ATOM   5409  C  CA    . PRO A 1  729  ? 178.198 140.464 125.205 1.00 158.02 ? 729  PRO A CA    1 
ATOM   5410  C  C     . PRO A 1  729  ? 176.958 140.502 126.089 1.00 158.02 ? 729  PRO A C     1 
ATOM   5411  O  O     . PRO A 1  729  ? 176.102 141.379 125.961 1.00 158.02 ? 729  PRO A O     1 
ATOM   5412  C  CB    . PRO A 1  729  ? 179.118 141.664 125.458 1.00 155.81 ? 729  PRO A CB    1 
ATOM   5413  C  CG    . PRO A 1  729  ? 178.797 142.630 124.354 1.00 155.81 ? 729  PRO A CG    1 
ATOM   5414  C  CD    . PRO A 1  729  ? 178.539 141.747 123.171 1.00 155.81 ? 729  PRO A CD    1 
ATOM   5415  N  N     . GLY A 1  730  ? 176.869 139.524 126.990 1.00 156.40 ? 730  GLY A N     1 
ATOM   5416  C  CA    . GLY A 1  730  ? 175.697 139.345 127.819 1.00 156.40 ? 730  GLY A CA    1 
ATOM   5417  C  C     . GLY A 1  730  ? 174.636 138.437 127.240 1.00 156.40 ? 730  GLY A C     1 
ATOM   5418  O  O     . GLY A 1  730  ? 173.556 138.320 127.830 1.00 156.40 ? 730  GLY A O     1 
ATOM   5419  N  N     . ASN A 1  731  ? 174.908 137.781 126.112 1.00 153.84 ? 731  ASN A N     1 
ATOM   5420  C  CA    . ASN A 1  731  ? 173.920 136.962 125.423 1.00 153.84 ? 731  ASN A CA    1 
ATOM   5421  C  C     . ASN A 1  731  ? 174.533 135.639 124.993 1.00 153.84 ? 731  ASN A C     1 
ATOM   5422  O  O     . ASN A 1  731  ? 175.658 135.607 124.483 1.00 153.84 ? 731  ASN A O     1 
ATOM   5423  C  CB    . ASN A 1  731  ? 173.356 137.691 124.198 1.00 156.85 ? 731  ASN A CB    1 
ATOM   5424  C  CG    . ASN A 1  731  ? 172.448 138.846 124.570 1.00 156.85 ? 731  ASN A CG    1 
ATOM   5425  O  OD1   . ASN A 1  731  ? 171.860 138.865 125.650 1.00 156.85 ? 731  ASN A OD1   1 
ATOM   5426  N  ND2   . ASN A 1  731  ? 172.330 139.817 123.673 1.00 156.85 ? 731  ASN A ND2   1 
ATOM   5427  N  N     . THR A 1  732  ? 173.789 134.555 125.195 1.00 147.46 ? 732  THR A N     1 
ATOM   5428  C  CA    . THR A 1  732  ? 174.147 133.274 124.607 1.00 147.46 ? 732  THR A CA    1 
ATOM   5429  C  C     . THR A 1  732  ? 173.893 133.327 123.102 1.00 147.46 ? 732  THR A C     1 
ATOM   5430  O  O     . THR A 1  732  ? 173.112 134.150 122.617 1.00 147.46 ? 732  THR A O     1 
ATOM   5431  C  CB    . THR A 1  732  ? 173.329 132.154 125.264 1.00 147.57 ? 732  THR A CB    1 
ATOM   5432  O  OG1   . THR A 1  732  ? 173.516 132.207 126.683 1.00 147.57 ? 732  THR A OG1   1 
ATOM   5433  C  CG2   . THR A 1  732  ? 173.769 130.778 124.780 1.00 147.57 ? 732  THR A CG2   1 
ATOM   5434  N  N     . LEU A 1  733  ? 174.580 132.457 122.354 1.00 143.11 ? 733  LEU A N     1 
ATOM   5435  C  CA    . LEU A 1  733  ? 174.413 132.429 120.902 1.00 143.11 ? 733  LEU A CA    1 
ATOM   5436  C  C     . LEU A 1  733  ? 172.947 132.266 120.514 1.00 143.11 ? 733  LEU A C     1 
ATOM   5437  O  O     . LEU A 1  733  ? 172.486 132.856 119.528 1.00 143.11 ? 733  LEU A O     1 
ATOM   5438  C  CB    . LEU A 1  733  ? 175.255 131.305 120.300 1.00 141.79 ? 733  LEU A CB    1 
ATOM   5439  C  CG    . LEU A 1  733  ? 175.195 131.103 118.786 1.00 141.79 ? 733  LEU A CG    1 
ATOM   5440  C  CD1   . LEU A 1  733  ? 175.774 132.310 118.075 1.00 141.79 ? 733  LEU A CD1   1 
ATOM   5441  C  CD2   . LEU A 1  733  ? 175.921 129.835 118.378 1.00 141.79 ? 733  LEU A CD2   1 
ATOM   5442  N  N     . ARG A 1  734  ? 172.196 131.477 121.285 1.00 142.61 ? 734  ARG A N     1 
ATOM   5443  C  CA    . ARG A 1  734  ? 170.759 131.379 121.054 1.00 142.61 ? 734  ARG A CA    1 
ATOM   5444  C  C     . ARG A 1  734  ? 170.067 132.706 121.336 1.00 142.61 ? 734  ARG A C     1 
ATOM   5445  O  O     . ARG A 1  734  ? 169.136 133.093 120.620 1.00 142.61 ? 734  ARG A O     1 
ATOM   5446  C  CB    . ARG A 1  734  ? 170.158 130.269 121.917 1.00 141.56 ? 734  ARG A CB    1 
ATOM   5447  C  CG    . ARG A 1  734  ? 170.690 128.883 121.606 1.00 141.56 ? 734  ARG A CG    1 
ATOM   5448  C  CD    . ARG A 1  734  ? 170.266 128.437 120.218 1.00 141.56 ? 734  ARG A CD    1 
ATOM   5449  N  NE    . ARG A 1  734  ? 170.772 127.108 119.888 1.00 141.56 ? 734  ARG A NE    1 
ATOM   5450  C  CZ    . ARG A 1  734  ? 170.155 125.975 120.205 1.00 141.56 ? 734  ARG A CZ    1 
ATOM   5451  N  NH1   . ARG A 1  734  ? 169.004 126.005 120.862 1.00 141.56 ? 734  ARG A NH1   1 
ATOM   5452  N  NH2   . ARG A 1  734  ? 170.688 124.810 119.863 1.00 141.56 ? 734  ARG A NH2   1 
ATOM   5453  N  N     . GLN A 1  735  ? 170.513 133.421 122.369 1.00 142.46 ? 735  GLN A N     1 
ATOM   5454  C  CA    . GLN A 1  735  ? 169.880 134.687 122.724 1.00 142.46 ? 735  GLN A CA    1 
ATOM   5455  C  C     . GLN A 1  735  ? 170.131 135.746 121.656 1.00 142.46 ? 735  GLN A C     1 
ATOM   5456  O  O     . GLN A 1  735  ? 169.205 136.445 121.231 1.00 142.46 ? 735  GLN A O     1 
ATOM   5457  C  CB    . GLN A 1  735  ? 170.375 135.157 124.094 1.00 150.50 ? 735  GLN A CB    1 
ATOM   5458  C  CG    . GLN A 1  735  ? 169.904 134.287 125.250 1.00 150.50 ? 735  GLN A CG    1 
ATOM   5459  C  CD    . GLN A 1  735  ? 170.438 134.750 126.592 1.00 150.50 ? 735  GLN A CD    1 
ATOM   5460  O  OE1   . GLN A 1  735  ? 171.480 135.398 126.670 1.00 150.50 ? 735  GLN A OE1   1 
ATOM   5461  N  NE2   . GLN A 1  735  ? 169.720 134.421 127.659 1.00 150.50 ? 735  GLN A NE2   1 
ATOM   5462  N  N     . THR A 1  736  ? 171.381 135.879 121.205 1.00 139.78 ? 736  THR A N     1 
ATOM   5463  C  CA    . THR A 1  736  ? 171.674 136.856 120.159 1.00 139.78 ? 736  THR A CA    1 
ATOM   5464  C  C     . THR A 1  736  ? 171.059 136.451 118.823 1.00 139.78 ? 736  THR A C     1 
ATOM   5465  O  O     . THR A 1  736  ? 170.663 137.317 118.034 1.00 139.78 ? 736  THR A O     1 
ATOM   5466  C  CB    . THR A 1  736  ? 173.187 137.059 120.023 1.00 143.25 ? 736  THR A CB    1 
ATOM   5467  O  OG1   . THR A 1  736  ? 173.449 138.110 119.084 1.00 143.25 ? 736  THR A OG1   1 
ATOM   5468  C  CG2   . THR A 1  736  ? 173.877 135.789 119.556 1.00 143.25 ? 736  THR A CG2   1 
ATOM   5469  N  N     . PHE A 1  737  ? 170.951 135.147 118.562 1.00 134.16 ? 737  PHE A N     1 
ATOM   5470  C  CA    . PHE A 1  737  ? 170.297 134.676 117.345 1.00 134.16 ? 737  PHE A CA    1 
ATOM   5471  C  C     . PHE A 1  737  ? 168.819 135.051 117.340 1.00 134.16 ? 737  PHE A C     1 
ATOM   5472  O  O     . PHE A 1  737  ? 168.325 135.691 116.401 1.00 134.16 ? 737  PHE A O     1 
ATOM   5473  C  CB    . PHE A 1  737  ? 170.484 133.162 117.220 1.00 130.87 ? 737  PHE A CB    1 
ATOM   5474  C  CG    . PHE A 1  737  ? 169.783 132.556 116.040 1.00 130.87 ? 737  PHE A CG    1 
ATOM   5475  C  CD1   . PHE A 1  737  ? 170.338 132.628 114.776 1.00 130.87 ? 737  PHE A CD1   1 
ATOM   5476  C  CD2   . PHE A 1  737  ? 168.574 131.903 116.198 1.00 130.87 ? 737  PHE A CD2   1 
ATOM   5477  C  CE1   . PHE A 1  737  ? 169.694 132.068 113.690 1.00 130.87 ? 737  PHE A CE1   1 
ATOM   5478  C  CE2   . PHE A 1  737  ? 167.927 131.341 115.115 1.00 130.87 ? 737  PHE A CE2   1 
ATOM   5479  C  CZ    . PHE A 1  737  ? 168.488 131.424 113.862 1.00 130.87 ? 737  PHE A CZ    1 
ATOM   5480  N  N     . GLU A 1  738  ? 168.096 134.660 118.394 1.00 135.17 ? 738  GLU A N     1 
ATOM   5481  C  CA    . GLU A 1  738  ? 166.688 135.020 118.507 1.00 135.17 ? 738  GLU A CA    1 
ATOM   5482  C  C     . GLU A 1  738  ? 166.494 136.530 118.505 1.00 135.17 ? 738  GLU A C     1 
ATOM   5483  O  O     . GLU A 1  738  ? 165.502 137.029 117.963 1.00 135.17 ? 738  GLU A O     1 
ATOM   5484  C  CB    . GLU A 1  738  ? 166.090 134.412 119.778 1.00 136.88 ? 738  GLU A CB    1 
ATOM   5485  C  CG    . GLU A 1  738  ? 166.070 132.892 119.795 1.00 136.88 ? 738  GLU A CG    1 
ATOM   5486  C  CD    . GLU A 1  738  ? 165.276 132.304 118.647 1.00 136.88 ? 738  GLU A CD    1 
ATOM   5487  O  OE1   . GLU A 1  738  ? 164.216 132.868 118.310 1.00 136.88 ? 738  GLU A OE1   1 
ATOM   5488  O  OE2   . GLU A 1  738  ? 165.712 131.279 118.081 1.00 136.88 ? 738  GLU A OE2   1 
ATOM   5489  N  N     . ASN A 1  739  ? 167.431 137.271 119.100 1.00 135.60 ? 739  ASN A N     1 
ATOM   5490  C  CA    . ASN A 1  739  ? 167.357 138.727 119.068 1.00 135.60 ? 739  ASN A CA    1 
ATOM   5491  C  C     . ASN A 1  739  ? 167.414 139.245 117.637 1.00 135.60 ? 739  ASN A C     1 
ATOM   5492  O  O     . ASN A 1  739  ? 166.556 140.026 117.215 1.00 135.60 ? 739  ASN A O     1 
ATOM   5493  C  CB    . ASN A 1  739  ? 168.478 139.334 119.914 1.00 143.04 ? 739  ASN A CB    1 
ATOM   5494  C  CG    . ASN A 1  739  ? 168.231 139.189 121.403 1.00 143.04 ? 739  ASN A CG    1 
ATOM   5495  O  OD1   . ASN A 1  739  ? 167.090 139.054 121.846 1.00 143.04 ? 739  ASN A OD1   1 
ATOM   5496  N  ND2   . ASN A 1  739  ? 169.303 139.212 122.186 1.00 143.04 ? 739  ASN A ND2   1 
ATOM   5497  N  N     . GLN A 1  740  ? 168.417 138.809 116.868 1.00 134.05 ? 740  GLN A N     1 
ATOM   5498  C  CA    . GLN A 1  740  ? 168.537 139.266 115.485 1.00 134.05 ? 740  GLN A CA    1 
ATOM   5499  C  C     . GLN A 1  740  ? 167.291 138.921 114.676 1.00 134.05 ? 740  GLN A C     1 
ATOM   5500  O  O     . GLN A 1  740  ? 166.734 139.776 113.972 1.00 134.05 ? 740  GLN A O     1 
ATOM   5501  C  CB    . GLN A 1  740  ? 169.780 138.664 114.829 1.00 134.91 ? 740  GLN A CB    1 
ATOM   5502  C  CG    . GLN A 1  740  ? 171.095 139.173 115.385 1.00 134.91 ? 740  GLN A CG    1 
ATOM   5503  C  CD    . GLN A 1  740  ? 172.290 138.541 114.703 1.00 134.91 ? 740  GLN A CD    1 
ATOM   5504  O  OE1   . GLN A 1  740  ? 172.199 137.442 114.155 1.00 134.91 ? 740  GLN A OE1   1 
ATOM   5505  N  NE2   . GLN A 1  740  ? 173.419 139.239 114.723 1.00 134.91 ? 740  GLN A NE2   1 
ATOM   5506  N  N     . VAL A 1  741  ? 166.837 137.668 114.765 1.00 130.15 ? 741  VAL A N     1 
ATOM   5507  C  CA    . VAL A 1  741  ? 165.681 137.249 113.974 1.00 130.15 ? 741  VAL A CA    1 
ATOM   5508  C  C     . VAL A 1  741  ? 164.451 138.065 114.356 1.00 130.15 ? 741  VAL A C     1 
ATOM   5509  O  O     . VAL A 1  741  ? 163.668 138.483 113.493 1.00 130.15 ? 741  VAL A O     1 
ATOM   5510  C  CB    . VAL A 1  741  ? 165.431 135.740 114.134 1.00 124.34 ? 741  VAL A CB    1 
ATOM   5511  C  CG1   . VAL A 1  741  ? 164.203 135.330 113.343 1.00 124.34 ? 741  VAL A CG1   1 
ATOM   5512  C  CG2   . VAL A 1  741  ? 166.647 134.950 113.685 1.00 124.34 ? 741  VAL A CG2   1 
ATOM   5513  N  N     . ASN A 1  742  ? 164.268 138.315 115.656 1.00 132.58 ? 742  ASN A N     1 
ATOM   5514  C  CA    . ASN A 1  742  ? 163.151 139.147 116.094 1.00 132.58 ? 742  ASN A CA    1 
ATOM   5515  C  C     . ASN A 1  742  ? 163.266 140.564 115.545 1.00 132.58 ? 742  ASN A C     1 
ATOM   5516  O  O     . ASN A 1  742  ? 162.258 141.172 115.163 1.00 132.58 ? 742  ASN A O     1 
ATOM   5517  C  CB    . ASN A 1  742  ? 163.072 139.165 117.619 1.00 135.13 ? 742  ASN A CB    1 
ATOM   5518  C  CG    . ASN A 1  742  ? 162.585 137.850 118.189 1.00 135.13 ? 742  ASN A CG    1 
ATOM   5519  O  OD1   . ASN A 1  742  ? 161.899 137.085 117.513 1.00 135.13 ? 742  ASN A OD1   1 
ATOM   5520  N  ND2   . ASN A 1  742  ? 162.940 137.577 119.439 1.00 135.13 ? 742  ASN A ND2   1 
ATOM   5521  N  N     . ARG A 1  743  ? 164.485 141.110 115.502 1.00 133.69 ? 743  ARG A N     1 
ATOM   5522  C  CA    . ARG A 1  743  ? 164.700 142.412 114.878 1.00 133.69 ? 743  ARG A CA    1 
ATOM   5523  C  C     . ARG A 1  743  ? 164.195 142.408 113.441 1.00 133.69 ? 743  ARG A C     1 
ATOM   5524  O  O     . ARG A 1  743  ? 163.401 143.269 113.039 1.00 133.69 ? 743  ARG A O     1 
ATOM   5525  C  CB    . ARG A 1  743  ? 166.186 142.780 114.908 1.00 145.34 ? 743  ARG A CB    1 
ATOM   5526  C  CG    . ARG A 1  743  ? 166.817 142.916 116.284 1.00 145.34 ? 743  ARG A CG    1 
ATOM   5527  C  CD    . ARG A 1  743  ? 166.353 144.149 117.033 1.00 145.34 ? 743  ARG A CD    1 
ATOM   5528  N  NE    . ARG A 1  743  ? 167.007 144.250 118.335 1.00 145.34 ? 743  ARG A NE    1 
ATOM   5529  C  CZ    . ARG A 1  743  ? 168.213 144.774 118.525 1.00 145.34 ? 743  ARG A CZ    1 
ATOM   5530  N  NH1   . ARG A 1  743  ? 168.906 145.240 117.495 1.00 145.34 ? 743  ARG A NH1   1 
ATOM   5531  N  NH2   . ARG A 1  743  ? 168.733 144.826 119.744 1.00 145.34 ? 743  ARG A NH2   1 
ATOM   5532  N  N     . ILE A 1  744  ? 164.643 141.426 112.653 1.00 129.68 ? 744  ILE A N     1 
ATOM   5533  C  CA    . ILE A 1  744  ? 164.298 141.387 111.233 1.00 129.68 ? 744  ILE A CA    1 
ATOM   5534  C  C     . ILE A 1  744  ? 162.791 141.251 111.048 1.00 129.68 ? 744  ILE A C     1 
ATOM   5535  O  O     . ILE A 1  744  ? 162.168 142.001 110.285 1.00 129.68 ? 744  ILE A O     1 
ATOM   5536  C  CB    . ILE A 1  744  ? 165.054 140.247 110.529 1.00 124.41 ? 744  ILE A CB    1 
ATOM   5537  C  CG1   . ILE A 1  744  ? 166.559 140.514 110.545 1.00 124.41 ? 744  ILE A CG1   1 
ATOM   5538  C  CG2   . ILE A 1  744  ? 164.559 140.077 109.104 1.00 124.41 ? 744  ILE A CG2   1 
ATOM   5539  C  CD1   . ILE A 1  744  ? 167.381 139.347 110.060 1.00 124.41 ? 744  ILE A CD1   1 
ATOM   5540  N  N     . LEU A 1  745  ? 162.180 140.296 111.754 1.00 128.48 ? 745  LEU A N     1 
ATOM   5541  C  CA    . LEU A 1  745  ? 160.759 140.024 111.557 1.00 128.48 ? 745  LEU A CA    1 
ATOM   5542  C  C     . LEU A 1  745  ? 159.899 141.200 112.009 1.00 128.48 ? 745  LEU A C     1 
ATOM   5543  O  O     . LEU A 1  745  ? 158.931 141.571 111.333 1.00 128.48 ? 745  LEU A O     1 
ATOM   5544  C  CB    . LEU A 1  745  ? 160.362 138.748 112.298 1.00 121.42 ? 745  LEU A CB    1 
ATOM   5545  C  CG    . LEU A 1  745  ? 161.000 137.451 111.803 1.00 121.42 ? 745  LEU A CG    1 
ATOM   5546  C  CD1   . LEU A 1  745  ? 160.613 136.289 112.699 1.00 121.42 ? 745  LEU A CD1   1 
ATOM   5547  C  CD2   . LEU A 1  745  ? 160.622 137.167 110.357 1.00 121.42 ? 745  LEU A CD2   1 
ATOM   5548  N  N     . ASN A 1  746  ? 160.231 141.796 113.157 1.00 131.61 ? 746  ASN A N     1 
ATOM   5549  C  CA    . ASN A 1  746  ? 159.472 142.955 113.619 1.00 131.61 ? 746  ASN A CA    1 
ATOM   5550  C  C     . ASN A 1  746  ? 159.617 144.128 112.659 1.00 131.61 ? 746  ASN A C     1 
ATOM   5551  O  O     . ASN A 1  746  ? 158.648 144.856 112.409 1.00 131.61 ? 746  ASN A O     1 
ATOM   5552  C  CB    . ASN A 1  746  ? 159.910 143.351 115.027 1.00 131.80 ? 746  ASN A CB    1 
ATOM   5553  C  CG    . ASN A 1  746  ? 159.410 142.386 116.082 1.00 131.80 ? 746  ASN A CG    1 
ATOM   5554  O  OD1   . ASN A 1  746  ? 158.422 141.683 115.873 1.00 131.80 ? 746  ASN A OD1   1 
ATOM   5555  N  ND2   . ASN A 1  746  ? 160.083 142.354 117.225 1.00 131.80 ? 746  ASN A ND2   1 
ATOM   5556  N  N     . ASP A 1  747  ? 160.818 144.327 112.106 1.00 133.92 ? 747  ASP A N     1 
ATOM   5557  C  CA    . ASP A 1  747  ? 160.988 145.335 111.063 1.00 133.92 ? 747  ASP A CA    1 
ATOM   5558  C  C     . ASP A 1  747  ? 160.071 145.049 109.880 1.00 133.92 ? 747  ASP A C     1 
ATOM   5559  O  O     . ASP A 1  747  ? 159.423 145.957 109.344 1.00 133.92 ? 747  ASP A O     1 
ATOM   5560  C  CB    . ASP A 1  747  ? 162.447 145.384 110.613 1.00 141.29 ? 747  ASP A CB    1 
ATOM   5561  C  CG    . ASP A 1  747  ? 163.364 145.973 111.666 1.00 141.29 ? 747  ASP A CG    1 
ATOM   5562  O  OD1   . ASP A 1  747  ? 162.856 146.618 112.606 1.00 141.29 ? 747  ASP A OD1   1 
ATOM   5563  O  OD2   . ASP A 1  747  ? 164.595 145.793 111.552 1.00 141.29 ? 747  ASP A OD2   1 
ATOM   5564  N  N     . ALA A 1  748  ? 160.004 143.782 109.462 1.00 130.82 ? 748  ALA A N     1 
ATOM   5565  C  CA    . ALA A 1  748  ? 159.121 143.393 108.368 1.00 130.82 ? 748  ALA A CA    1 
ATOM   5566  C  C     . ALA A 1  748  ? 157.675 143.772 108.663 1.00 130.82 ? 748  ALA A C     1 
ATOM   5567  O  O     . ALA A 1  748  ? 157.076 144.592 107.958 1.00 130.82 ? 748  ALA A O     1 
ATOM   5568  C  CB    . ALA A 1  748  ? 159.238 141.892 108.110 1.00 131.08 ? 748  ALA A CB    1 
ATOM   5569  N  N     . ARG A 1  749  ? 157.097 143.175 109.709 1.00 130.75 ? 749  ARG A N     1 
ATOM   5570  C  CA    . ARG A 1  749  ? 155.681 143.383 109.996 1.00 130.75 ? 749  ARG A CA    1 
ATOM   5571  C  C     . ARG A 1  749  ? 155.357 144.851 110.256 1.00 130.75 ? 749  ARG A C     1 
ATOM   5572  O  O     . ARG A 1  749  ? 154.267 145.315 109.899 1.00 130.75 ? 749  ARG A O     1 
ATOM   5573  C  CB    . ARG A 1  749  ? 155.260 142.517 111.182 1.00 133.20 ? 749  ARG A CB    1 
ATOM   5574  C  CG    . ARG A 1  749  ? 156.004 142.822 112.467 1.00 133.20 ? 749  ARG A CG    1 
ATOM   5575  C  CD    . ARG A 1  749  ? 155.591 141.881 113.581 1.00 133.20 ? 749  ARG A CD    1 
ATOM   5576  N  NE    . ARG A 1  749  ? 154.180 142.024 113.924 1.00 133.20 ? 749  ARG A NE    1 
ATOM   5577  C  CZ    . ARG A 1  749  ? 153.704 142.931 114.771 1.00 133.20 ? 749  ARG A CZ    1 
ATOM   5578  N  NH1   . ARG A 1  749  ? 154.526 143.787 115.362 1.00 133.20 ? 749  ARG A NH1   1 
ATOM   5579  N  NH2   . ARG A 1  749  ? 152.405 142.981 115.024 1.00 133.20 ? 749  ARG A NH2   1 
ATOM   5580  N  N     . ASP A 1  750  ? 156.285 145.600 110.858 1.00 130.83 ? 750  ASP A N     1 
ATOM   5581  C  CA    . ASP A 1  750  ? 156.051 147.026 111.066 1.00 130.83 ? 750  ASP A CA    1 
ATOM   5582  C  C     . ASP A 1  750  ? 156.012 147.774 109.739 1.00 130.83 ? 750  ASP A C     1 
ATOM   5583  O  O     . ASP A 1  750  ? 155.118 148.598 109.504 1.00 130.83 ? 750  ASP A O     1 
ATOM   5584  C  CB    . ASP A 1  750  ? 157.125 147.611 111.982 1.00 137.32 ? 750  ASP A CB    1 
ATOM   5585  C  CG    . ASP A 1  750  ? 156.965 147.171 113.422 1.00 137.32 ? 750  ASP A CG    1 
ATOM   5586  O  OD1   . ASP A 1  750  ? 155.869 146.693 113.780 1.00 137.32 ? 750  ASP A OD1   1 
ATOM   5587  O  OD2   . ASP A 1  750  ? 157.937 147.303 114.196 1.00 137.32 ? 750  ASP A OD2   1 
ATOM   5588  N  N     . LYS A 1  751  ? 156.973 147.495 108.856 1.00 129.17 ? 751  LYS A N     1 
ATOM   5589  C  CA    . LYS A 1  751  ? 157.018 148.177 107.566 1.00 129.17 ? 751  LYS A CA    1 
ATOM   5590  C  C     . LYS A 1  751  ? 155.776 147.868 106.737 1.00 129.17 ? 751  LYS A C     1 
ATOM   5591  O  O     . LYS A 1  751  ? 155.150 148.773 106.172 1.00 129.17 ? 751  LYS A O     1 
ATOM   5592  C  CB    . LYS A 1  751  ? 158.286 147.777 106.813 1.00 127.25 ? 751  LYS A CB    1 
ATOM   5593  C  CG    . LYS A 1  751  ? 158.470 148.480 105.483 1.00 127.25 ? 751  LYS A CG    1 
ATOM   5594  C  CD    . LYS A 1  751  ? 159.774 148.062 104.827 1.00 127.25 ? 751  LYS A CD    1 
ATOM   5595  C  CE    . LYS A 1  751  ? 159.962 148.750 103.487 1.00 127.25 ? 751  LYS A CE    1 
ATOM   5596  N  NZ    . LYS A 1  751  ? 161.241 148.355 102.835 1.00 127.25 ? 751  LYS A NZ    1 
ATOM   5597  N  N     . THR A 1  752  ? 155.404 146.587 106.656 1.00 129.02 ? 752  THR A N     1 
ATOM   5598  C  CA    . THR A 1  752  ? 154.202 146.207 105.919 1.00 129.02 ? 752  THR A CA    1 
ATOM   5599  C  C     . THR A 1  752  ? 152.963 146.840 106.535 1.00 129.02 ? 752  THR A C     1 
ATOM   5600  O  O     . THR A 1  752  ? 152.037 147.246 105.823 1.00 129.02 ? 752  THR A O     1 
ATOM   5601  C  CB    . THR A 1  752  ? 154.065 144.685 105.884 1.00 127.15 ? 752  THR A CB    1 
ATOM   5602  O  OG1   . THR A 1  752  ? 153.986 144.182 107.222 1.00 127.15 ? 752  THR A OG1   1 
ATOM   5603  C  CG2   . THR A 1  752  ? 155.259 144.058 105.184 1.00 127.15 ? 752  THR A CG2   1 
ATOM   5604  N  N     . GLY A 1  753  ? 152.931 146.932 107.866 1.00 130.52 ? 753  GLY A N     1 
ATOM   5605  C  CA    . GLY A 1  753  ? 151.840 147.637 108.518 1.00 130.52 ? 753  GLY A CA    1 
ATOM   5606  C  C     . GLY A 1  753  ? 151.732 149.076 108.060 1.00 130.52 ? 753  GLY A C     1 
ATOM   5607  O  O     . GLY A 1  753  ? 150.675 149.519 107.607 1.00 130.52 ? 753  GLY A O     1 
ATOM   5608  N  N     . SER A 1  754  ? 152.838 149.821 108.151 1.00 129.66 ? 754  SER A N     1 
ATOM   5609  C  CA    . SER A 1  754  ? 152.834 151.215 107.714 1.00 129.66 ? 754  SER A CA    1 
ATOM   5610  C  C     . SER A 1  754  ? 152.423 151.341 106.253 1.00 129.66 ? 754  SER A C     1 
ATOM   5611  O  O     . SER A 1  754  ? 151.745 152.303 105.872 1.00 129.66 ? 754  SER A O     1 
ATOM   5612  C  CB    . SER A 1  754  ? 154.212 151.837 107.937 1.00 131.80 ? 754  SER A CB    1 
ATOM   5613  O  OG    . SER A 1  754  ? 155.191 151.197 107.137 1.00 131.80 ? 754  SER A OG    1 
ATOM   5614  N  N     . SER A 1  755  ? 152.819 150.377 105.419 1.00 129.14 ? 755  SER A N     1 
ATOM   5615  C  CA    . SER A 1  755  ? 152.402 150.394 104.019 1.00 129.14 ? 755  SER A CA    1 
ATOM   5616  C  C     . SER A 1  755  ? 150.890 150.250 103.897 1.00 129.14 ? 755  SER A C     1 
ATOM   5617  O  O     . SER A 1  755  ? 150.234 151.021 103.184 1.00 129.14 ? 755  SER A O     1 
ATOM   5618  C  CB    . SER A 1  755  ? 153.110 149.281 103.248 1.00 128.41 ? 755  SER A CB    1 
ATOM   5619  O  OG    . SER A 1  755  ? 152.682 149.242 101.898 1.00 128.41 ? 755  SER A OG    1 
ATOM   5620  N  N     . ALA A 1  756  ? 150.318 149.263 104.591 1.00 126.61 ? 756  ALA A N     1 
ATOM   5621  C  CA    . ALA A 1  756  ? 148.872 149.068 104.550 1.00 126.61 ? 756  ALA A CA    1 
ATOM   5622  C  C     . ALA A 1  756  ? 148.140 150.290 105.088 1.00 126.61 ? 756  ALA A C     1 
ATOM   5623  O  O     . ALA A 1  756  ? 147.007 150.578 104.686 1.00 126.61 ? 756  ALA A O     1 
ATOM   5624  C  CB    . ALA A 1  756  ? 148.490 147.820 105.344 1.00 123.45 ? 756  ALA A CB    1 
ATOM   5625  N  N     . GLN A 1  757  ? 148.777 151.024 105.999 1.00 126.78 ? 757  GLN A N     1 
ATOM   5626  C  CA    . GLN A 1  757  ? 148.152 152.218 106.554 1.00 126.78 ? 757  GLN A CA    1 
ATOM   5627  C  C     . GLN A 1  757  ? 148.296 153.399 105.604 1.00 126.78 ? 757  GLN A C     1 
ATOM   5628  O  O     . GLN A 1  757  ? 147.527 154.364 105.673 1.00 126.78 ? 757  GLN A O     1 
ATOM   5629  C  CB    . GLN A 1  757  ? 148.773 152.524 107.913 1.00 126.60 ? 757  GLN A CB    1 
ATOM   5630  C  CG    . GLN A 1  757  ? 148.616 151.372 108.887 1.00 126.60 ? 757  GLN A CG    1 
ATOM   5631  C  CD    . GLN A 1  757  ? 149.397 151.572 110.167 1.00 126.60 ? 757  GLN A CD    1 
ATOM   5632  O  OE1   . GLN A 1  757  ? 150.298 152.408 110.234 1.00 126.60 ? 757  GLN A OE1   1 
ATOM   5633  N  NE2   . GLN A 1  757  ? 149.094 150.765 111.174 1.00 126.60 ? 757  GLN A NE2   1 
ATOM   5634  N  N     . LYS A 1  758  ? 149.283 153.340 104.705 1.00 129.20 ? 758  LYS A N     1 
ATOM   5635  C  CA    . LYS A 1  758  ? 149.379 154.328 103.638 1.00 129.20 ? 758  LYS A CA    1 
ATOM   5636  C  C     . LYS A 1  758  ? 148.472 153.991 102.462 1.00 129.20 ? 758  LYS A C     1 
ATOM   5637  O  O     . LYS A 1  758  ? 148.190 154.873 101.644 1.00 129.20 ? 758  LYS A O     1 
ATOM   5638  C  CB    . LYS A 1  758  ? 150.822 154.454 103.146 1.00 131.65 ? 758  LYS A CB    1 
ATOM   5639  C  CG    . LYS A 1  758  ? 151.784 155.066 104.148 1.00 131.65 ? 758  LYS A CG    1 
ATOM   5640  C  CD    . LYS A 1  758  ? 153.195 155.087 103.588 1.00 131.65 ? 758  LYS A CD    1 
ATOM   5641  C  CE    . LYS A 1  758  ? 154.172 155.733 104.553 1.00 131.65 ? 758  LYS A CE    1 
ATOM   5642  N  NZ    . LYS A 1  758  ? 155.562 155.700 104.019 1.00 131.65 ? 758  LYS A NZ    1 
ATOM   5643  N  N     . SER A 1  759  ? 148.007 152.749 102.362 1.00 129.26 ? 759  SER A N     1 
ATOM   5644  C  CA    . SER A 1  759  ? 147.126 152.340 101.275 1.00 129.26 ? 759  SER A CA    1 
ATOM   5645  C  C     . SER A 1  759  ? 145.659 152.653 101.539 1.00 129.26 ? 759  SER A C     1 
ATOM   5646  O  O     . SER A 1  759  ? 144.825 152.429 100.655 1.00 129.26 ? 759  SER A O     1 
ATOM   5647  C  CB    . SER A 1  759  ? 147.284 150.840 101.007 1.00 131.90 ? 759  SER A CB    1 
ATOM   5648  O  OG    . SER A 1  759  ? 146.397 150.411 99.989  1.00 131.90 ? 759  SER A OG    1 
ATOM   5649  N  N     . LEU A 1  760  ? 145.323 153.166 102.718 1.00 126.41 ? 760  LEU A N     1 
ATOM   5650  C  CA    . LEU A 1  760  ? 143.936 153.396 103.095 1.00 126.41 ? 760  LEU A CA    1 
ATOM   5651  C  C     . LEU A 1  760  ? 143.405 154.665 102.442 1.00 126.41 ? 760  LEU A C     1 
ATOM   5652  O  O     . LEU A 1  760  ? 144.047 155.719 102.502 1.00 126.41 ? 760  LEU A O     1 
ATOM   5653  C  CB    . LEU A 1  760  ? 143.803 153.495 104.614 1.00 123.01 ? 760  LEU A CB    1 
ATOM   5654  C  CG    . LEU A 1  760  ? 144.131 152.226 105.399 1.00 123.01 ? 760  LEU A CG    1 
ATOM   5655  C  CD1   . LEU A 1  760  ? 144.064 152.483 106.895 1.00 123.01 ? 760  LEU A CD1   1 
ATOM   5656  C  CD2   . LEU A 1  760  ? 143.189 151.109 105.004 1.00 123.01 ? 760  LEU A CD2   1 
ATOM   5657  N  N     . SER A 1  761  ? 142.236 154.556 101.819 1.00 125.68 ? 761  SER A N     1 
ATOM   5658  C  CA    . SER A 1  761  ? 141.547 155.720 101.290 1.00 125.68 ? 761  SER A CA    1 
ATOM   5659  C  C     . SER A 1  761  ? 140.893 156.509 102.422 1.00 125.68 ? 761  SER A C     1 
ATOM   5660  O  O     . SER A 1  761  ? 140.659 155.995 103.518 1.00 125.68 ? 761  SER A O     1 
ATOM   5661  C  CB    . SER A 1  761  ? 140.491 155.299 100.270 1.00 126.86 ? 761  SER A CB    1 
ATOM   5662  O  OG    . SER A 1  761  ? 141.088 154.683 99.142  1.00 126.86 ? 761  SER A OG    1 
ATOM   5663  N  N     . GLU A 1  762  ? 140.602 157.783 102.145 1.00 124.12 ? 762  GLU A N     1 
ATOM   5664  C  CA    . GLU A 1  762  ? 139.878 158.596 103.117 1.00 124.12 ? 762  GLU A CA    1 
ATOM   5665  C  C     . GLU A 1  762  ? 138.476 158.054 103.367 1.00 124.12 ? 762  GLU A C     1 
ATOM   5666  O  O     . GLU A 1  762  ? 137.894 158.308 104.428 1.00 124.12 ? 762  GLU A O     1 
ATOM   5667  C  CB    . GLU A 1  762  ? 139.805 160.049 102.644 1.00 138.69 ? 762  GLU A CB    1 
ATOM   5668  C  CG    . GLU A 1  762  ? 141.144 160.764 102.599 1.00 138.69 ? 762  GLU A CG    1 
ATOM   5669  C  CD    . GLU A 1  762  ? 141.026 162.184 102.078 1.00 138.69 ? 762  GLU A CD    1 
ATOM   5670  O  OE1   . GLU A 1  762  ? 139.942 162.545 101.574 1.00 138.69 ? 762  GLU A OE1   1 
ATOM   5671  O  OE2   . GLU A 1  762  ? 142.015 162.941 102.175 1.00 138.69 ? 762  GLU A OE2   1 
ATOM   5672  N  N     . TYR A 1  763  ? 137.918 157.314 102.405 1.00 119.00 ? 763  TYR A N     1 
ATOM   5673  C  CA    . TYR A 1  763  ? 136.586 156.744 102.556 1.00 119.00 ? 763  TYR A CA    1 
ATOM   5674  C  C     . TYR A 1  763  ? 136.581 155.440 103.342 1.00 119.00 ? 763  TYR A C     1 
ATOM   5675  O  O     . TYR A 1  763  ? 135.512 155.007 103.783 1.00 119.00 ? 763  TYR A O     1 
ATOM   5676  C  CB    . TYR A 1  763  ? 135.957 156.496 101.182 1.00 122.04 ? 763  TYR A CB    1 
ATOM   5677  C  CG    . TYR A 1  763  ? 135.675 157.746 100.381 1.00 122.04 ? 763  TYR A CG    1 
ATOM   5678  C  CD1   . TYR A 1  763  ? 134.475 158.428 100.526 1.00 122.04 ? 763  TYR A CD1   1 
ATOM   5679  C  CD2   . TYR A 1  763  ? 136.599 158.232 99.466  1.00 122.04 ? 763  TYR A CD2   1 
ATOM   5680  C  CE1   . TYR A 1  763  ? 134.206 159.562 99.792  1.00 122.04 ? 763  TYR A CE1   1 
ATOM   5681  C  CE2   . TYR A 1  763  ? 136.339 159.369 98.726  1.00 122.04 ? 763  TYR A CE2   1 
ATOM   5682  C  CZ    . TYR A 1  763  ? 135.140 160.029 98.894  1.00 122.04 ? 763  TYR A CZ    1 
ATOM   5683  O  OH    . TYR A 1  763  ? 134.873 161.161 98.160  1.00 122.04 ? 763  TYR A OH    1 
ATOM   5684  N  N     . ASN A 1  764  ? 137.738 154.807 103.522 1.00 115.37 ? 764  ASN A N     1 
ATOM   5685  C  CA    . ASN A 1  764  ? 137.777 153.494 104.154 1.00 115.37 ? 764  ASN A CA    1 
ATOM   5686  C  C     . ASN A 1  764  ? 137.366 153.601 105.616 1.00 115.37 ? 764  ASN A C     1 
ATOM   5687  O  O     . ASN A 1  764  ? 137.829 154.483 106.344 1.00 115.37 ? 764  ASN A O     1 
ATOM   5688  C  CB    . ASN A 1  764  ? 139.176 152.890 104.024 1.00 116.58 ? 764  ASN A CB    1 
ATOM   5689  C  CG    . ASN A 1  764  ? 139.234 151.439 104.465 1.00 116.58 ? 764  ASN A CG    1 
ATOM   5690  O  OD1   . ASN A 1  764  ? 138.417 150.977 105.261 1.00 116.58 ? 764  ASN A OD1   1 
ATOM   5691  N  ND2   . ASN A 1  764  ? 140.194 150.704 103.924 1.00 116.58 ? 764  ASN A ND2   1 
ATOM   5692  N  N     . ASN A 1  765  ? 136.492 152.687 106.041 1.00 110.49 ? 765  ASN A N     1 
ATOM   5693  C  CA    . ASN A 1  765  ? 135.850 152.808 107.345 1.00 110.49 ? 765  ASN A CA    1 
ATOM   5694  C  C     . ASN A 1  765  ? 136.736 152.337 108.492 1.00 110.49 ? 765  ASN A C     1 
ATOM   5695  O  O     . ASN A 1  765  ? 136.569 152.812 109.623 1.00 110.49 ? 765  ASN A O     1 
ATOM   5696  C  CB    . ASN A 1  765  ? 134.532 152.038 107.344 1.00 111.15 ? 765  ASN A CB    1 
ATOM   5697  C  CG    . ASN A 1  765  ? 133.490 152.673 106.440 1.00 111.15 ? 765  ASN A CG    1 
ATOM   5698  O  OD1   . ASN A 1  765  ? 132.872 153.676 106.795 1.00 111.15 ? 765  ASN A OD1   1 
ATOM   5699  N  ND2   . ASN A 1  765  ? 133.293 152.091 105.263 1.00 111.15 ? 765  ASN A ND2   1 
ATOM   5700  N  N     . PHE A 1  766  ? 137.661 151.405 108.240 1.00 108.19 ? 766  PHE A N     1 
ATOM   5701  C  CA    . PHE A 1  766  ? 138.663 151.079 109.252 1.00 108.19 ? 766  PHE A CA    1 
ATOM   5702  C  C     . PHE A 1  766  ? 139.366 152.340 109.736 1.00 108.19 ? 766  PHE A C     1 
ATOM   5703  O  O     . PHE A 1  766  ? 139.542 152.549 110.942 1.00 108.19 ? 766  PHE A O     1 
ATOM   5704  C  CB    . PHE A 1  766  ? 139.687 150.082 108.701 1.00 110.41 ? 766  PHE A CB    1 
ATOM   5705  C  CG    . PHE A 1  766  ? 139.155 148.689 108.518 1.00 110.41 ? 766  PHE A CG    1 
ATOM   5706  C  CD1   . PHE A 1  766  ? 137.995 148.285 109.154 1.00 110.41 ? 766  PHE A CD1   1 
ATOM   5707  C  CD2   . PHE A 1  766  ? 139.840 147.771 107.740 1.00 110.41 ? 766  PHE A CD2   1 
ATOM   5708  C  CE1   . PHE A 1  766  ? 137.512 146.998 108.997 1.00 110.41 ? 766  PHE A CE1   1 
ATOM   5709  C  CE2   . PHE A 1  766  ? 139.364 146.484 107.581 1.00 110.41 ? 766  PHE A CE2   1 
ATOM   5710  C  CZ    . PHE A 1  766  ? 138.199 146.097 108.211 1.00 110.41 ? 766  PHE A CZ    1 
ATOM   5711  N  N     . LYS A 1  767  ? 139.761 153.201 108.798 1.00 107.42 ? 767  LYS A N     1 
ATOM   5712  C  CA    . LYS A 1  767  ? 140.377 154.471 109.158 1.00 107.42 ? 767  LYS A CA    1 
ATOM   5713  C  C     . LYS A 1  767  ? 139.406 155.361 109.923 1.00 107.42 ? 767  LYS A C     1 
ATOM   5714  O  O     . LYS A 1  767  ? 139.817 156.095 110.830 1.00 107.42 ? 767  LYS A O     1 
ATOM   5715  C  CB    . LYS A 1  767  ? 140.876 155.168 107.892 1.00 115.96 ? 767  LYS A CB    1 
ATOM   5716  C  CG    . LYS A 1  767  ? 141.636 156.455 108.120 1.00 115.96 ? 767  LYS A CG    1 
ATOM   5717  C  CD    . LYS A 1  767  ? 142.145 157.032 106.809 1.00 115.96 ? 767  LYS A CD    1 
ATOM   5718  C  CE    . LYS A 1  767  ? 142.908 158.328 107.034 1.00 115.96 ? 767  LYS A CE    1 
ATOM   5719  N  NZ    . LYS A 1  767  ? 143.414 158.900 105.757 1.00 115.96 ? 767  LYS A NZ    1 
ATOM   5720  N  N     . SER A 1  768  ? 138.115 155.293 109.592 1.00 104.83 ? 768  SER A N     1 
ATOM   5721  C  CA    . SER A 1  768  ? 137.125 156.110 110.287 1.00 104.83 ? 768  SER A CA    1 
ATOM   5722  C  C     . SER A 1  768  ? 136.966 155.691 111.743 1.00 104.83 ? 768  SER A C     1 
ATOM   5723  O  O     . SER A 1  768  ? 136.715 156.542 112.605 1.00 104.83 ? 768  SER A O     1 
ATOM   5724  C  CB    . SER A 1  768  ? 135.779 156.038 109.568 1.00 107.98 ? 768  SER A CB    1 
ATOM   5725  O  OG    . SER A 1  768  ? 135.858 156.613 108.276 1.00 107.98 ? 768  SER A OG    1 
ATOM   5726  N  N     . MET A 1  769  ? 137.091 154.397 112.037 1.00 102.67 ? 769  MET A N     1 
ATOM   5727  C  CA    . MET A 1  769  ? 137.013 153.955 113.426 1.00 102.67 ? 769  MET A CA    1 
ATOM   5728  C  C     . MET A 1  769  ? 138.329 154.160 114.169 1.00 102.67 ? 769  MET A C     1 
ATOM   5729  O  O     . MET A 1  769  ? 138.323 154.539 115.345 1.00 102.67 ? 769  MET A O     1 
ATOM   5730  C  CB    . MET A 1  769  ? 136.594 152.487 113.495 1.00 98.30  ? 769  MET A CB    1 
ATOM   5731  C  CG    . MET A 1  769  ? 135.153 152.225 113.102 1.00 98.30  ? 769  MET A CG    1 
ATOM   5732  S  SD    . MET A 1  769  ? 134.770 150.471 113.187 1.00 98.30  ? 769  MET A SD    1 
ATOM   5733  C  CE    . MET A 1  769  ? 133.055 150.468 112.686 1.00 98.30  ? 769  MET A CE    1 
ATOM   5734  N  N     . VAL A 1  770  ? 139.462 153.921 113.506 1.00 103.30 ? 770  VAL A N     1 
ATOM   5735  C  CA    . VAL A 1  770  ? 140.742 153.926 114.209 1.00 103.30 ? 770  VAL A CA    1 
ATOM   5736  C  C     . VAL A 1  770  ? 141.222 155.352 114.456 1.00 103.30 ? 770  VAL A C     1 
ATOM   5737  O  O     . VAL A 1  770  ? 141.744 155.666 115.532 1.00 103.30 ? 770  VAL A O     1 
ATOM   5738  C  CB    . VAL A 1  770  ? 141.784 153.105 113.431 1.00 102.12 ? 770  VAL A CB    1 
ATOM   5739  C  CG1   . VAL A 1  770  ? 143.151 153.243 114.077 1.00 102.12 ? 770  VAL A CG1   1 
ATOM   5740  C  CG2   . VAL A 1  770  ? 141.370 151.647 113.390 1.00 102.12 ? 770  VAL A CG2   1 
ATOM   5741  N  N     . VAL A 1  771  ? 141.062 156.233 113.465 1.00 103.72 ? 771  VAL A N     1 
ATOM   5742  C  CA    . VAL A 1  771  ? 141.579 157.594 113.598 1.00 103.72 ? 771  VAL A CA    1 
ATOM   5743  C  C     . VAL A 1  771  ? 140.897 158.324 114.746 1.00 103.72 ? 771  VAL A C     1 
ATOM   5744  O  O     . VAL A 1  771  ? 141.548 159.037 115.521 1.00 103.72 ? 771  VAL A O     1 
ATOM   5745  C  CB    . VAL A 1  771  ? 141.431 158.356 112.271 1.00 106.81 ? 771  VAL A CB    1 
ATOM   5746  C  CG1   . VAL A 1  771  ? 141.719 159.824 112.478 1.00 106.81 ? 771  VAL A CG1   1 
ATOM   5747  C  CG2   . VAL A 1  771  ? 142.399 157.795 111.258 1.00 106.81 ? 771  VAL A CG2   1 
ATOM   5748  N  N     . SER A 1  772  ? 139.581 158.156 114.886 1.00 103.42 ? 772  SER A N     1 
ATOM   5749  C  CA    . SER A 1  772  ? 138.882 158.796 115.992 1.00 103.42 ? 772  SER A CA    1 
ATOM   5750  C  C     . SER A 1  772  ? 139.104 158.072 117.313 1.00 103.42 ? 772  SER A C     1 
ATOM   5751  O  O     . SER A 1  772  ? 138.682 158.577 118.358 1.00 103.42 ? 772  SER A O     1 
ATOM   5752  C  CB    . SER A 1  772  ? 137.382 158.873 115.701 1.00 98.14  ? 772  SER A CB    1 
ATOM   5753  O  OG    . SER A 1  772  ? 136.820 157.581 115.601 1.00 98.14  ? 772  SER A OG    1 
ATOM   5754  N  N     . GLY A 1  773  ? 139.754 156.910 117.294 1.00 105.26 ? 773  GLY A N     1 
ATOM   5755  C  CA    . GLY A 1  773  ? 139.955 156.153 118.511 1.00 105.26 ? 773  GLY A CA    1 
ATOM   5756  C  C     . GLY A 1  773  ? 138.698 155.578 119.115 1.00 105.26 ? 773  GLY A C     1 
ATOM   5757  O  O     . GLY A 1  773  ? 138.721 155.165 120.279 1.00 105.26 ? 773  GLY A O     1 
ATOM   5758  N  N     . ALA A 1  774  ? 137.596 155.544 118.363 1.00 105.98 ? 774  ALA A N     1 
ATOM   5759  C  CA    . ALA A 1  774  ? 136.353 154.992 118.888 1.00 105.98 ? 774  ALA A CA    1 
ATOM   5760  C  C     . ALA A 1  774  ? 136.520 153.522 119.246 1.00 105.98 ? 774  ALA A C     1 
ATOM   5761  O  O     . ALA A 1  774  ? 136.191 153.102 120.361 1.00 105.98 ? 774  ALA A O     1 
ATOM   5762  C  CB    . ALA A 1  774  ? 135.225 155.182 117.874 1.00 103.76 ? 774  ALA A CB    1 
ATOM   5763  N  N     . LYS A 1  775  ? 137.022 152.724 118.307 1.00 105.86 ? 775  LYS A N     1 
ATOM   5764  C  CA    . LYS A 1  775  ? 137.348 151.335 118.588 1.00 105.86 ? 775  LYS A CA    1 
ATOM   5765  C  C     . LYS A 1  775  ? 138.347 150.863 117.541 1.00 105.86 ? 775  LYS A C     1 
ATOM   5766  O  O     . LYS A 1  775  ? 138.427 151.418 116.442 1.00 105.86 ? 775  LYS A O     1 
ATOM   5767  C  CB    . LYS A 1  775  ? 136.081 150.471 118.606 1.00 103.76 ? 775  LYS A CB    1 
ATOM   5768  C  CG    . LYS A 1  775  ? 136.260 149.062 119.129 1.00 103.76 ? 775  LYS A CG    1 
ATOM   5769  C  CD    . LYS A 1  775  ? 134.909 148.385 119.261 1.00 103.76 ? 775  LYS A CD    1 
ATOM   5770  C  CE    . LYS A 1  775  ? 135.052 146.932 119.642 1.00 103.76 ? 775  LYS A CE    1 
ATOM   5771  N  NZ    . LYS A 1  775  ? 135.733 146.788 120.953 1.00 103.76 ? 775  LYS A NZ    1 
ATOM   5772  N  N     . GLY A 1  776  ? 139.102 149.827 117.889 1.00 107.74 ? 776  GLY A N     1 
ATOM   5773  C  CA    . GLY A 1  776  ? 140.146 149.338 117.014 1.00 107.74 ? 776  GLY A CA    1 
ATOM   5774  C  C     . GLY A 1  776  ? 141.410 150.172 117.104 1.00 107.74 ? 776  GLY A C     1 
ATOM   5775  O  O     . GLY A 1  776  ? 141.456 151.246 117.705 1.00 107.74 ? 776  GLY A O     1 
ATOM   5776  N  N     . SER A 1  777  ? 142.464 149.651 116.481 1.00 106.58 ? 777  SER A N     1 
ATOM   5777  C  CA    . SER A 1  777  ? 143.773 150.286 116.513 1.00 106.58 ? 777  SER A CA    1 
ATOM   5778  C  C     . SER A 1  777  ? 144.500 149.963 115.218 1.00 106.58 ? 777  SER A C     1 
ATOM   5779  O  O     . SER A 1  777  ? 144.093 149.079 114.461 1.00 106.58 ? 777  SER A O     1 
ATOM   5780  C  CB    . SER A 1  777  ? 144.592 149.835 117.725 1.00 103.26 ? 777  SER A CB    1 
ATOM   5781  O  OG    . SER A 1  777  ? 144.860 148.447 117.669 1.00 103.26 ? 777  SER A OG    1 
ATOM   5782  N  N     . LYS A 1  778  ? 145.580 150.710 114.970 1.00 107.17 ? 778  LYS A N     1 
ATOM   5783  C  CA    . LYS A 1  778  ? 146.330 150.556 113.728 1.00 107.17 ? 778  LYS A CA    1 
ATOM   5784  C  C     . LYS A 1  778  ? 146.843 149.132 113.537 1.00 107.17 ? 778  LYS A C     1 
ATOM   5785  O  O     . LYS A 1  778  ? 146.888 148.638 112.403 1.00 107.17 ? 778  LYS A O     1 
ATOM   5786  C  CB    . LYS A 1  778  ? 147.494 151.542 113.701 1.00 106.91 ? 778  LYS A CB    1 
ATOM   5787  C  CG    . LYS A 1  778  ? 147.093 153.001 113.595 1.00 106.91 ? 778  LYS A CG    1 
ATOM   5788  C  CD    . LYS A 1  778  ? 148.328 153.885 113.635 1.00 106.91 ? 778  LYS A CD    1 
ATOM   5789  C  CE    . LYS A 1  778  ? 147.974 155.353 113.494 1.00 106.91 ? 778  LYS A CE    1 
ATOM   5790  N  NZ    . LYS A 1  778  ? 149.173 156.237 113.568 1.00 106.91 ? 778  LYS A NZ    1 
ATOM   5791  N  N     . ILE A 1  779  ? 147.221 148.456 114.625 1.00 104.87 ? 779  ILE A N     1 
ATOM   5792  C  CA    . ILE A 1  779  ? 147.776 147.109 114.509 1.00 104.87 ? 779  ILE A CA    1 
ATOM   5793  C  C     . ILE A 1  779  ? 146.735 146.147 113.948 1.00 104.87 ? 779  ILE A C     1 
ATOM   5794  O  O     . ILE A 1  779  ? 147.073 145.162 113.279 1.00 104.87 ? 779  ILE A O     1 
ATOM   5795  C  CB    . ILE A 1  779  ? 148.324 146.635 115.870 1.00 106.28 ? 779  ILE A CB    1 
ATOM   5796  C  CG1   . ILE A 1  779  ? 149.175 145.377 115.695 1.00 106.28 ? 779  ILE A CG1   1 
ATOM   5797  C  CG2   . ILE A 1  779  ? 147.196 146.378 116.859 1.00 106.28 ? 779  ILE A CG2   1 
ATOM   5798  C  CD1   . ILE A 1  779  ? 150.437 145.615 114.902 1.00 106.28 ? 779  ILE A CD1   1 
ATOM   5799  N  N     . ASN A 1  780  ? 145.453 146.425 114.193 1.00 102.89 ? 780  ASN A N     1 
ATOM   5800  C  CA    . ASN A 1  780  ? 144.400 145.574 113.653 1.00 102.89 ? 780  ASN A CA    1 
ATOM   5801  C  C     . ASN A 1  780  ? 144.281 145.751 112.145 1.00 102.89 ? 780  ASN A C     1 
ATOM   5802  O  O     . ASN A 1  780  ? 144.106 144.777 111.404 1.00 102.89 ? 780  ASN A O     1 
ATOM   5803  C  CB    . ASN A 1  780  ? 143.075 145.881 114.347 1.00 105.29 ? 780  ASN A CB    1 
ATOM   5804  C  CG    . ASN A 1  780  ? 143.133 145.623 115.837 1.00 105.29 ? 780  ASN A CG    1 
ATOM   5805  O  OD1   . ASN A 1  780  ? 142.707 146.453 116.639 1.00 105.29 ? 780  ASN A OD1   1 
ATOM   5806  N  ND2   . ASN A 1  780  ? 143.683 144.477 116.217 1.00 105.29 ? 780  ASN A ND2   1 
ATOM   5807  N  N     . ILE A 1  781  ? 144.373 146.996 111.672 1.00 102.87 ? 781  ILE A N     1 
ATOM   5808  C  CA    . ILE A 1  781  ? 144.415 147.243 110.234 1.00 102.87 ? 781  ILE A CA    1 
ATOM   5809  C  C     . ILE A 1  781  ? 145.619 146.545 109.617 1.00 102.87 ? 781  ILE A C     1 
ATOM   5810  O  O     . ILE A 1  781  ? 145.536 145.977 108.520 1.00 102.87 ? 781  ILE A O     1 
ATOM   5811  C  CB    . ILE A 1  781  ? 144.435 148.757 109.955 1.00 105.58 ? 781  ILE A CB    1 
ATOM   5812  C  CG1   . ILE A 1  781  ? 143.133 149.405 110.423 1.00 105.58 ? 781  ILE A CG1   1 
ATOM   5813  C  CG2   . ILE A 1  781  ? 144.664 149.035 108.479 1.00 105.58 ? 781  ILE A CG2   1 
ATOM   5814  C  CD1   . ILE A 1  781  ? 143.171 150.911 110.376 1.00 105.58 ? 781  ILE A CD1   1 
ATOM   5815  N  N     . SER A 1  782  ? 146.753 146.564 110.321 1.00 105.52 ? 782  SER A N     1 
ATOM   5816  C  CA    . SER A 1  782  ? 147.944 145.876 109.834 1.00 105.52 ? 782  SER A CA    1 
ATOM   5817  C  C     . SER A 1  782  ? 147.701 144.378 109.693 1.00 105.52 ? 782  SER A C     1 
ATOM   5818  O  O     . SER A 1  782  ? 148.040 143.776 108.668 1.00 105.52 ? 782  SER A O     1 
ATOM   5819  C  CB    . SER A 1  782  ? 149.120 146.142 110.775 1.00 113.80 ? 782  SER A CB    1 
ATOM   5820  O  OG    . SER A 1  782  ? 150.276 145.441 110.352 1.00 113.80 ? 782  SER A OG    1 
ATOM   5821  N  N     . GLN A 1  783  ? 147.114 143.756 110.720 1.00 101.99 ? 783  GLN A N     1 
ATOM   5822  C  CA    . GLN A 1  783  ? 146.880 142.315 110.670 1.00 101.99 ? 783  GLN A CA    1 
ATOM   5823  C  C     . GLN A 1  783  ? 145.841 141.954 109.615 1.00 101.99 ? 783  GLN A C     1 
ATOM   5824  O  O     . GLN A 1  783  ? 145.904 140.871 109.020 1.00 101.99 ? 783  GLN A O     1 
ATOM   5825  C  CB    . GLN A 1  783  ? 146.448 141.800 112.043 1.00 101.77 ? 783  GLN A CB    1 
ATOM   5826  C  CG    . GLN A 1  783  ? 147.529 141.882 113.105 1.00 101.77 ? 783  GLN A CG    1 
ATOM   5827  C  CD    . GLN A 1  783  ? 147.052 141.405 114.459 1.00 101.77 ? 783  GLN A CD    1 
ATOM   5828  O  OE1   . GLN A 1  783  ? 145.858 141.427 114.750 1.00 101.77 ? 783  GLN A OE1   1 
ATOM   5829  N  NE2   . GLN A 1  783  ? 147.983 140.966 115.295 1.00 101.77 ? 783  GLN A NE2   1 
ATOM   5830  N  N     . VAL A 1  784  ? 144.875 142.840 109.371 1.00 102.01 ? 784  VAL A N     1 
ATOM   5831  C  CA    . VAL A 1  784  ? 143.843 142.549 108.380 1.00 102.01 ? 784  VAL A CA    1 
ATOM   5832  C  C     . VAL A 1  784  ? 144.404 142.654 106.967 1.00 102.01 ? 784  VAL A C     1 
ATOM   5833  O  O     . VAL A 1  784  ? 144.266 141.728 106.159 1.00 102.01 ? 784  VAL A O     1 
ATOM   5834  C  CB    . VAL A 1  784  ? 142.634 143.481 108.572 1.00 96.41  ? 784  VAL A CB    1 
ATOM   5835  C  CG1   . VAL A 1  784  ? 141.689 143.357 107.396 1.00 96.41  ? 784  VAL A CG1   1 
ATOM   5836  C  CG2   . VAL A 1  784  ? 141.908 143.140 109.856 1.00 96.41  ? 784  VAL A CG2   1 
ATOM   5837  N  N     . ILE A 1  785  ? 145.034 143.782 106.643 1.00 107.36 ? 785  ILE A N     1 
ATOM   5838  C  CA    . ILE A 1  785  ? 145.418 144.030 105.257 1.00 107.36 ? 785  ILE A CA    1 
ATOM   5839  C  C     . ILE A 1  785  ? 146.725 143.326 104.908 1.00 107.36 ? 785  ILE A C     1 
ATOM   5840  O  O     . ILE A 1  785  ? 146.843 142.703 103.847 1.00 107.36 ? 785  ILE A O     1 
ATOM   5841  C  CB    . ILE A 1  785  ? 145.505 145.543 104.992 1.00 110.82 ? 785  ILE A CB    1 
ATOM   5842  C  CG1   . ILE A 1  785  ? 144.128 146.180 105.145 1.00 110.82 ? 785  ILE A CG1   1 
ATOM   5843  C  CG2   . ILE A 1  785  ? 146.029 145.806 103.596 1.00 110.82 ? 785  ILE A CG2   1 
ATOM   5844  C  CD1   . ILE A 1  785  ? 144.161 147.680 105.108 1.00 110.82 ? 785  ILE A CD1   1 
ATOM   5845  N  N     . ALA A 1  786  ? 147.722 143.400 105.790 1.00 108.77 ? 786  ALA A N     1 
ATOM   5846  C  CA    . ALA A 1  786  ? 149.071 143.020 105.389 1.00 108.77 ? 786  ALA A CA    1 
ATOM   5847  C  C     . ALA A 1  786  ? 149.535 141.695 105.979 1.00 108.77 ? 786  ALA A C     1 
ATOM   5848  O  O     . ALA A 1  786  ? 149.547 140.673 105.287 1.00 108.77 ? 786  ALA A O     1 
ATOM   5849  C  CB    . ALA A 1  786  ? 150.055 144.123 105.780 1.00 115.50 ? 786  ALA A CB    1 
ATOM   5850  N  N     . VAL A 1  787  ? 149.919 141.700 107.252 1.00 104.80 ? 787  VAL A N     1 
ATOM   5851  C  CA    . VAL A 1  787  ? 150.577 140.560 107.880 1.00 104.80 ? 787  VAL A CA    1 
ATOM   5852  C  C     . VAL A 1  787  ? 150.055 140.413 109.300 1.00 104.80 ? 787  VAL A C     1 
ATOM   5853  O  O     . VAL A 1  787  ? 149.960 141.398 110.040 1.00 104.80 ? 787  VAL A O     1 
ATOM   5854  C  CB    . VAL A 1  787  ? 152.113 140.725 107.886 1.00 104.46 ? 787  VAL A CB    1 
ATOM   5855  C  CG1   . VAL A 1  787  ? 152.769 139.591 108.644 1.00 104.46 ? 787  VAL A CG1   1 
ATOM   5856  C  CG2   . VAL A 1  787  ? 152.661 140.796 106.473 1.00 104.46 ? 787  VAL A CG2   1 
ATOM   5857  N  N     . VAL A 1  788  ? 149.722 139.180 109.685 1.00 102.60 ? 788  VAL A N     1 
ATOM   5858  C  CA    . VAL A 1  788  ? 149.332 138.929 111.068 1.00 102.60 ? 788  VAL A CA    1 
ATOM   5859  C  C     . VAL A 1  788  ? 150.533 139.046 111.999 1.00 102.60 ? 788  VAL A C     1 
ATOM   5860  O  O     . VAL A 1  788  ? 150.436 139.658 113.069 1.00 102.60 ? 788  VAL A O     1 
ATOM   5861  C  CB    . VAL A 1  788  ? 148.655 137.556 111.194 1.00 97.05  ? 788  VAL A CB    1 
ATOM   5862  C  CG1   . VAL A 1  788  ? 148.389 137.231 112.651 1.00 97.05  ? 788  VAL A CG1   1 
ATOM   5863  C  CG2   . VAL A 1  788  ? 147.363 137.537 110.403 1.00 97.05  ? 788  VAL A CG2   1 
ATOM   5864  N  N     . GLY A 1  789  ? 151.674 138.477 111.620 1.00 106.08 ? 789  GLY A N     1 
ATOM   5865  C  CA    . GLY A 1  789  ? 152.896 138.666 112.371 1.00 106.08 ? 789  GLY A CA    1 
ATOM   5866  C  C     . GLY A 1  789  ? 153.318 137.457 113.179 1.00 106.08 ? 789  GLY A C     1 
ATOM   5867  O  O     . GLY A 1  789  ? 152.721 136.378 113.136 1.00 106.08 ? 789  GLY A O     1 
ATOM   5868  N  N     . GLN A 1  790  ? 154.396 137.660 113.932 1.00 109.16 ? 790  GLN A N     1 
ATOM   5869  C  CA    . GLN A 1  790  ? 154.959 136.603 114.760 1.00 109.16 ? 790  GLN A CA    1 
ATOM   5870  C  C     . GLN A 1  790  ? 154.005 136.229 115.887 1.00 109.16 ? 790  GLN A C     1 
ATOM   5871  O  O     . GLN A 1  790  ? 153.448 137.095 116.566 1.00 109.16 ? 790  GLN A O     1 
ATOM   5872  C  CB    . GLN A 1  790  ? 156.299 137.055 115.344 1.00 111.11 ? 790  GLN A CB    1 
ATOM   5873  C  CG    . GLN A 1  790  ? 156.999 136.012 116.198 1.00 111.11 ? 790  GLN A CG    1 
ATOM   5874  C  CD    . GLN A 1  790  ? 157.416 134.792 115.409 1.00 111.11 ? 790  GLN A CD    1 
ATOM   5875  O  OE1   . GLN A 1  790  ? 158.192 134.887 114.460 1.00 111.11 ? 790  GLN A OE1   1 
ATOM   5876  N  NE2   . GLN A 1  790  ? 156.902 133.633 115.800 1.00 111.11 ? 790  GLN A NE2   1 
ATOM   5877  N  N     . GLN A 1  791  ? 153.818 134.927 116.081 1.00 112.52 ? 791  GLN A N     1 
ATOM   5878  C  CA    . GLN A 1  791  ? 153.049 134.402 117.199 1.00 112.52 ? 791  GLN A CA    1 
ATOM   5879  C  C     . GLN A 1  791  ? 154.007 133.908 118.274 1.00 112.52 ? 791  GLN A C     1 
ATOM   5880  O  O     . GLN A 1  791  ? 155.049 133.322 117.967 1.00 112.52 ? 791  GLN A O     1 
ATOM   5881  C  CB    . GLN A 1  791  ? 152.125 133.268 116.753 1.00 108.25 ? 791  GLN A CB    1 
ATOM   5882  C  CG    . GLN A 1  791  ? 151.058 133.691 115.756 1.00 108.25 ? 791  GLN A CG    1 
ATOM   5883  C  CD    . GLN A 1  791  ? 150.090 134.704 116.332 1.00 108.25 ? 791  GLN A CD    1 
ATOM   5884  O  OE1   . GLN A 1  791  ? 150.205 135.902 116.076 1.00 108.25 ? 791  GLN A OE1   1 
ATOM   5885  N  NE2   . GLN A 1  791  ? 149.128 134.229 117.114 1.00 108.25 ? 791  GLN A NE2   1 
ATOM   5886  N  N     . ASN A 1  792  ? 153.653 134.150 119.534 1.00 115.98 ? 792  ASN A N     1 
ATOM   5887  C  CA    . ASN A 1  792  ? 154.543 133.885 120.654 1.00 115.98 ? 792  ASN A CA    1 
ATOM   5888  C  C     . ASN A 1  792  ? 153.817 133.097 121.734 1.00 115.98 ? 792  ASN A C     1 
ATOM   5889  O  O     . ASN A 1  792  ? 152.700 133.446 122.126 1.00 115.98 ? 792  ASN A O     1 
ATOM   5890  C  CB    . ASN A 1  792  ? 155.083 135.191 121.248 1.00 117.48 ? 792  ASN A CB    1 
ATOM   5891  C  CG    . ASN A 1  792  ? 156.043 135.901 120.315 1.00 117.48 ? 792  ASN A CG    1 
ATOM   5892  O  OD1   . ASN A 1  792  ? 156.659 135.279 119.451 1.00 117.48 ? 792  ASN A OD1   1 
ATOM   5893  N  ND2   . ASN A 1  792  ? 156.173 137.211 120.485 1.00 117.48 ? 792  ASN A ND2   1 
ATOM   5894  N  N     . VAL A 1  793  ? 154.464 132.039 122.216 1.00 118.68 ? 793  VAL A N     1 
ATOM   5895  C  CA    . VAL A 1  793  ? 153.992 131.264 123.359 1.00 118.68 ? 793  VAL A CA    1 
ATOM   5896  C  C     . VAL A 1  793  ? 154.955 131.501 124.514 1.00 118.68 ? 793  VAL A C     1 
ATOM   5897  O  O     . VAL A 1  793  ? 156.138 131.149 124.424 1.00 118.68 ? 793  VAL A O     1 
ATOM   5898  C  CB    . VAL A 1  793  ? 153.881 129.766 123.034 1.00 116.53 ? 793  VAL A CB    1 
ATOM   5899  C  CG1   . VAL A 1  793  ? 153.601 128.974 124.295 1.00 116.53 ? 793  VAL A CG1   1 
ATOM   5900  C  CG2   . VAL A 1  793  ? 152.775 129.533 122.025 1.00 116.53 ? 793  VAL A CG2   1 
ATOM   5901  N  N     . GLU A 1  794  ? 154.447 132.095 125.595 1.00 121.75 ? 794  GLU A N     1 
ATOM   5902  C  CA    . GLU A 1  794  ? 155.246 132.435 126.773 1.00 121.75 ? 794  GLU A CA    1 
ATOM   5903  C  C     . GLU A 1  794  ? 156.407 133.358 126.408 1.00 121.75 ? 794  GLU A C     1 
ATOM   5904  O  O     . GLU A 1  794  ? 157.561 133.134 126.779 1.00 121.75 ? 794  GLU A O     1 
ATOM   5905  C  CB    . GLU A 1  794  ? 155.743 131.176 127.486 1.00 130.01 ? 794  GLU A CB    1 
ATOM   5906  C  CG    . GLU A 1  794  ? 154.635 130.366 128.136 1.00 130.01 ? 794  GLU A CG    1 
ATOM   5907  C  CD    . GLU A 1  794  ? 155.143 129.102 128.797 1.00 130.01 ? 794  GLU A CD    1 
ATOM   5908  O  OE1   . GLU A 1  794  ? 156.323 128.753 128.590 1.00 130.01 ? 794  GLU A OE1   1 
ATOM   5909  O  OE2   . GLU A 1  794  ? 154.359 128.462 129.529 1.00 130.01 ? 794  GLU A OE2   1 
ATOM   5910  N  N     . GLY A 1  795  ? 156.085 134.413 125.662 1.00 118.66 ? 795  GLY A N     1 
ATOM   5911  C  CA    . GLY A 1  795  ? 157.055 135.448 125.356 1.00 118.66 ? 795  GLY A CA    1 
ATOM   5912  C  C     . GLY A 1  795  ? 158.180 135.026 124.443 1.00 118.66 ? 795  GLY A C     1 
ATOM   5913  O  O     . GLY A 1  795  ? 159.104 135.810 124.212 1.00 118.66 ? 795  GLY A O     1 
ATOM   5914  N  N     . LYS A 1  796  ? 158.136 133.807 123.914 1.00 114.35 ? 796  LYS A N     1 
ATOM   5915  C  CA    . LYS A 1  796  ? 159.186 133.300 123.047 1.00 114.35 ? 796  LYS A CA    1 
ATOM   5916  C  C     . LYS A 1  796  ? 158.574 132.754 121.767 1.00 114.35 ? 796  LYS A C     1 
ATOM   5917  O  O     . LYS A 1  796  ? 157.393 132.397 121.723 1.00 114.35 ? 796  LYS A O     1 
ATOM   5918  C  CB    . LYS A 1  796  ? 160.010 132.206 123.737 1.00 111.59 ? 796  LYS A CB    1 
ATOM   5919  C  CG    . LYS A 1  796  ? 160.821 132.699 124.922 1.00 111.59 ? 796  LYS A CG    1 
ATOM   5920  C  CD    . LYS A 1  796  ? 161.543 131.556 125.615 1.00 111.59 ? 796  LYS A CD    1 
ATOM   5921  C  CE    . LYS A 1  796  ? 162.366 132.055 126.791 1.00 111.59 ? 796  LYS A CE    1 
ATOM   5922  N  NZ    . LYS A 1  796  ? 163.025 130.938 127.523 1.00 111.59 ? 796  LYS A NZ    1 
ATOM   5923  N  N     . ARG A 1  797  ? 159.395 132.702 120.723 1.00 111.02 ? 797  ARG A N     1 
ATOM   5924  C  CA    . ARG A 1  797  ? 158.953 132.167 119.445 1.00 111.02 ? 797  ARG A CA    1 
ATOM   5925  C  C     . ARG A 1  797  ? 158.593 130.694 119.619 1.00 111.02 ? 797  ARG A C     1 
ATOM   5926  O  O     . ARG A 1  797  ? 159.154 130.001 120.472 1.00 111.02 ? 797  ARG A O     1 
ATOM   5927  C  CB    . ARG A 1  797  ? 160.056 132.370 118.403 1.00 114.85 ? 797  ARG A CB    1 
ATOM   5928  C  CG    . ARG A 1  797  ? 159.652 132.123 116.970 1.00 114.85 ? 797  ARG A CG    1 
ATOM   5929  C  CD    . ARG A 1  797  ? 160.810 132.410 116.025 1.00 114.85 ? 797  ARG A CD    1 
ATOM   5930  N  NE    . ARG A 1  797  ? 161.900 131.456 116.194 1.00 114.85 ? 797  ARG A NE    1 
ATOM   5931  C  CZ    . ARG A 1  797  ? 163.112 131.607 115.674 1.00 114.85 ? 797  ARG A CZ    1 
ATOM   5932  N  NH1   . ARG A 1  797  ? 163.390 132.675 114.946 1.00 114.85 ? 797  ARG A NH1   1 
ATOM   5933  N  NH2   . ARG A 1  797  ? 164.041 130.683 115.870 1.00 114.85 ? 797  ARG A NH2   1 
ATOM   5934  N  N     . ILE A 1  798  ? 157.646 130.221 118.809 1.00 108.09 ? 798  ILE A N     1 
ATOM   5935  C  CA    . ILE A 1  798  ? 156.932 128.963 119.052 1.00 108.09 ? 798  ILE A CA    1 
ATOM   5936  C  C     . ILE A 1  798  ? 157.911 127.837 119.363 1.00 108.09 ? 798  ILE A C     1 
ATOM   5937  O  O     . ILE A 1  798  ? 158.849 127.596 118.590 1.00 108.09 ? 798  ILE A O     1 
ATOM   5938  C  CB    . ILE A 1  798  ? 156.041 128.590 117.856 1.00 105.90 ? 798  ILE A CB    1 
ATOM   5939  C  CG1   . ILE A 1  798  ? 155.012 129.690 117.581 1.00 105.90 ? 798  ILE A CG1   1 
ATOM   5940  C  CG2   . ILE A 1  798  ? 155.335 127.271 118.100 1.00 105.90 ? 798  ILE A CG2   1 
ATOM   5941  C  CD1   . ILE A 1  798  ? 154.075 129.950 118.733 1.00 105.90 ? 798  ILE A CD1   1 
ATOM   5942  N  N     . PRO A 1  799  ? 157.725 127.119 120.468 1.00 103.83 ? 799  PRO A N     1 
ATOM   5943  C  CA    . PRO A 1  799  ? 158.747 126.173 120.928 1.00 103.83 ? 799  PRO A CA    1 
ATOM   5944  C  C     . PRO A 1  799  ? 158.735 124.889 120.119 1.00 103.83 ? 799  PRO A C     1 
ATOM   5945  O  O     . PRO A 1  799  ? 158.041 124.748 119.111 1.00 103.83 ? 799  PRO A O     1 
ATOM   5946  C  CB    . PRO A 1  799  ? 158.350 125.914 122.383 1.00 103.07 ? 799  PRO A CB    1 
ATOM   5947  C  CG    . PRO A 1  799  ? 156.871 126.111 122.390 1.00 103.07 ? 799  PRO A CG    1 
ATOM   5948  C  CD    . PRO A 1  799  ? 156.602 127.218 121.413 1.00 103.07 ? 799  PRO A CD    1 
ATOM   5949  N  N     . PHE A 1  800  ? 159.536 123.931 120.584 1.00 104.60 ? 800  PHE A N     1 
ATOM   5950  C  CA    . PHE A 1  800  ? 159.587 122.598 119.996 1.00 104.60 ? 800  PHE A CA    1 
ATOM   5951  C  C     . PHE A 1  800  ? 158.802 121.649 120.894 1.00 104.60 ? 800  PHE A C     1 
ATOM   5952  O  O     . PHE A 1  800  ? 159.266 121.286 121.979 1.00 104.60 ? 800  PHE A O     1 
ATOM   5953  C  CB    . PHE A 1  800  ? 161.031 122.125 119.845 1.00 105.73 ? 800  PHE A CB    1 
ATOM   5954  C  CG    . PHE A 1  800  ? 161.870 122.987 118.941 1.00 105.73 ? 800  PHE A CG    1 
ATOM   5955  C  CD1   . PHE A 1  800  ? 161.840 122.814 117.570 1.00 105.73 ? 800  PHE A CD1   1 
ATOM   5956  C  CD2   . PHE A 1  800  ? 162.703 123.958 119.465 1.00 105.73 ? 800  PHE A CD2   1 
ATOM   5957  C  CE1   . PHE A 1  800  ? 162.613 123.601 116.736 1.00 105.73 ? 800  PHE A CE1   1 
ATOM   5958  C  CE2   . PHE A 1  800  ? 163.480 124.747 118.637 1.00 105.73 ? 800  PHE A CE2   1 
ATOM   5959  C  CZ    . PHE A 1  800  ? 163.433 124.567 117.271 1.00 105.73 ? 800  PHE A CZ    1 
ATOM   5960  N  N     . GLY A 1  801  ? 157.620 121.243 120.441 1.00 107.44 ? 801  GLY A N     1 
ATOM   5961  C  CA    . GLY A 1  801  ? 156.831 120.265 121.168 1.00 107.44 ? 801  GLY A CA    1 
ATOM   5962  C  C     . GLY A 1  801  ? 157.316 118.856 120.910 1.00 107.44 ? 801  GLY A C     1 
ATOM   5963  O  O     . GLY A 1  801  ? 157.397 118.025 121.817 1.00 107.44 ? 801  GLY A O     1 
ATOM   5964  N  N     . PHE A 1  802  ? 157.641 118.593 119.652 1.00 110.03 ? 802  PHE A N     1 
ATOM   5965  C  CA    . PHE A 1  802  ? 158.178 117.314 119.214 1.00 110.03 ? 802  PHE A CA    1 
ATOM   5966  C  C     . PHE A 1  802  ? 159.672 117.292 119.504 1.00 110.03 ? 802  PHE A C     1 
ATOM   5967  O  O     . PHE A 1  802  ? 160.189 118.101 120.279 1.00 110.03 ? 802  PHE A O     1 
ATOM   5968  C  CB    . PHE A 1  802  ? 157.869 117.097 117.740 1.00 105.67 ? 802  PHE A CB    1 
ATOM   5969  C  CG    . PHE A 1  802  ? 156.410 117.047 117.443 1.00 105.67 ? 802  PHE A CG    1 
ATOM   5970  C  CD1   . PHE A 1  802  ? 155.500 116.707 118.425 1.00 105.67 ? 802  PHE A CD1   1 
ATOM   5971  C  CD2   . PHE A 1  802  ? 155.940 117.371 116.195 1.00 105.67 ? 802  PHE A CD2   1 
ATOM   5972  C  CE1   . PHE A 1  802  ? 154.152 116.671 118.151 1.00 105.67 ? 802  PHE A CE1   1 
ATOM   5973  C  CE2   . PHE A 1  802  ? 154.600 117.338 115.932 1.00 105.67 ? 802  PHE A CE2   1 
ATOM   5974  C  CZ    . PHE A 1  802  ? 153.703 116.988 116.904 1.00 105.67 ? 802  PHE A CZ    1 
ATOM   5975  N  N     . LYS A 1  803  ? 160.393 116.361 118.893 1.00 113.01 ? 803  LYS A N     1 
ATOM   5976  C  CA    . LYS A 1  803  ? 161.835 116.310 119.064 1.00 113.01 ? 803  LYS A CA    1 
ATOM   5977  C  C     . LYS A 1  803  ? 162.450 117.216 118.008 1.00 113.01 ? 803  LYS A C     1 
ATOM   5978  O  O     . LYS A 1  803  ? 162.473 116.878 116.821 1.00 113.01 ? 803  LYS A O     1 
ATOM   5979  C  CB    . LYS A 1  803  ? 162.347 114.880 118.930 1.00 119.65 ? 803  LYS A CB    1 
ATOM   5980  C  CG    . LYS A 1  803  ? 161.881 113.954 120.034 1.00 119.65 ? 803  LYS A CG    1 
ATOM   5981  C  CD    . LYS A 1  803  ? 162.314 112.522 119.770 1.00 119.65 ? 803  LYS A CD    1 
ATOM   5982  C  CE    . LYS A 1  803  ? 161.873 111.600 120.894 1.00 119.65 ? 803  LYS A CE    1 
ATOM   5983  N  NZ    . LYS A 1  803  ? 162.191 110.175 120.613 1.00 119.65 ? 803  LYS A NZ    1 
ATOM   5984  N  N     . HIS A 1  804  ? 162.954 118.364 118.456 1.00 115.85 ? 804  HIS A N     1 
ATOM   5985  C  CA    . HIS A 1  804  ? 163.676 119.333 117.638 1.00 115.85 ? 804  HIS A CA    1 
ATOM   5986  C  C     . HIS A 1  804  ? 162.925 119.732 116.368 1.00 115.85 ? 804  HIS A C     1 
ATOM   5987  O  O     . HIS A 1  804  ? 163.547 120.031 115.346 1.00 115.85 ? 804  HIS A O     1 
ATOM   5988  C  CB    . HIS A 1  804  ? 165.071 118.796 117.318 1.00 130.34 ? 804  HIS A CB    1 
ATOM   5989  C  CG    . HIS A 1  804  ? 165.898 118.551 118.542 1.00 130.34 ? 804  HIS A CG    1 
ATOM   5990  N  ND1   . HIS A 1  804  ? 166.487 119.572 119.255 1.00 130.34 ? 804  HIS A ND1   1 
ATOM   5991  C  CD2   . HIS A 1  804  ? 166.172 117.412 119.220 1.00 130.34 ? 804  HIS A CD2   1 
ATOM   5992  C  CE1   . HIS A 1  804  ? 167.128 119.068 120.293 1.00 130.34 ? 804  HIS A CE1   1 
ATOM   5993  N  NE2   . HIS A 1  804  ? 166.953 117.759 120.295 1.00 130.34 ? 804  HIS A NE2   1 
ATOM   5994  N  N     . ARG A 1  805  ? 161.593 119.746 116.413 1.00 107.45 ? 805  ARG A N     1 
ATOM   5995  C  CA    . ARG A 1  805  ? 160.792 120.354 115.360 1.00 107.45 ? 805  ARG A CA    1 
ATOM   5996  C  C     . ARG A 1  805  ? 159.434 120.724 115.937 1.00 107.45 ? 805  ARG A C     1 
ATOM   5997  O  O     . ARG A 1  805  ? 158.985 120.138 116.926 1.00 107.45 ? 805  ARG A O     1 
ATOM   5998  C  CB    . ARG A 1  805  ? 160.620 119.431 114.150 1.00 105.72 ? 805  ARG A CB    1 
ATOM   5999  C  CG    . ARG A 1  805  ? 159.911 118.134 114.442 1.00 105.72 ? 805  ARG A CG    1 
ATOM   6000  C  CD    . ARG A 1  805  ? 159.715 117.373 113.156 1.00 105.72 ? 805  ARG A CD    1 
ATOM   6001  N  NE    . ARG A 1  805  ? 158.992 116.126 113.350 1.00 105.72 ? 805  ARG A NE    1 
ATOM   6002  C  CZ    . ARG A 1  805  ? 158.736 115.265 112.374 1.00 105.72 ? 805  ARG A CZ    1 
ATOM   6003  N  NH1   . ARG A 1  805  ? 159.146 115.521 111.141 1.00 105.72 ? 805  ARG A NH1   1 
ATOM   6004  N  NH2   . ARG A 1  805  ? 158.069 114.149 112.630 1.00 105.72 ? 805  ARG A NH2   1 
ATOM   6005  N  N     . THR A 1  806  ? 158.783 121.703 115.308 1.00 100.68 ? 806  THR A N     1 
ATOM   6006  C  CA    . THR A 1  806  ? 157.549 122.246 115.863 1.00 100.68 ? 806  THR A CA    1 
ATOM   6007  C  C     . THR A 1  806  ? 156.330 121.396 115.509 1.00 100.68 ? 806  THR A C     1 
ATOM   6008  O  O     . THR A 1  806  ? 155.487 121.133 116.373 1.00 100.68 ? 806  THR A O     1 
ATOM   6009  C  CB    . THR A 1  806  ? 157.358 123.684 115.385 1.00 101.66 ? 806  THR A CB    1 
ATOM   6010  O  OG1   . THR A 1  806  ? 158.515 124.456 115.729 1.00 101.66 ? 806  THR A OG1   1 
ATOM   6011  C  CG2   . THR A 1  806  ? 156.171 124.299 116.071 1.00 101.66 ? 806  THR A CG2   1 
ATOM   6012  N  N     . LEU A 1  807  ? 156.219 120.957 114.261 1.00 102.76 ? 807  LEU A N     1 
ATOM   6013  C  CA    . LEU A 1  807  ? 155.101 120.160 113.779 1.00 102.76 ? 807  LEU A CA    1 
ATOM   6014  C  C     . LEU A 1  807  ? 155.643 119.027 112.923 1.00 102.76 ? 807  LEU A C     1 
ATOM   6015  O  O     . LEU A 1  807  ? 156.804 119.067 112.501 1.00 102.76 ? 807  LEU A O     1 
ATOM   6016  C  CB    . LEU A 1  807  ? 154.101 121.000 112.971 1.00 100.70 ? 807  LEU A CB    1 
ATOM   6017  C  CG    . LEU A 1  807  ? 153.266 122.027 113.729 1.00 100.70 ? 807  LEU A CG    1 
ATOM   6018  C  CD1   . LEU A 1  807  ? 152.360 122.769 112.767 1.00 100.70 ? 807  LEU A CD1   1 
ATOM   6019  C  CD2   . LEU A 1  807  ? 152.455 121.365 114.827 1.00 100.70 ? 807  LEU A CD2   1 
ATOM   6020  N  N     . PRO A 1  808  ? 154.832 117.994 112.654 1.00 102.19 ? 808  PRO A N     1 
ATOM   6021  C  CA    . PRO A 1  808  ? 155.368 116.849 111.903 1.00 102.19 ? 808  PRO A CA    1 
ATOM   6022  C  C     . PRO A 1  808  ? 155.782 117.220 110.497 1.00 102.19 ? 808  PRO A C     1 
ATOM   6023  O  O     . PRO A 1  808  ? 156.632 116.546 109.902 1.00 102.19 ? 808  PRO A O     1 
ATOM   6024  C  CB    . PRO A 1  808  ? 154.198 115.856 111.891 1.00 98.55  ? 808  PRO A CB    1 
ATOM   6025  C  CG    . PRO A 1  808  ? 153.311 116.285 112.994 1.00 98.55  ? 808  PRO A CG    1 
ATOM   6026  C  CD    . PRO A 1  808  ? 153.414 117.776 112.993 1.00 98.55  ? 808  PRO A CD    1 
ATOM   6027  N  N     . HIS A 1  809  ? 155.207 118.291 109.954 1.00 104.31 ? 809  HIS A N     1 
ATOM   6028  C  CA    . HIS A 1  809  ? 155.464 118.658 108.568 1.00 104.31 ? 809  HIS A CA    1 
ATOM   6029  C  C     . HIS A 1  809  ? 156.868 119.215 108.403 1.00 104.31 ? 809  HIS A C     1 
ATOM   6030  O  O     . HIS A 1  809  ? 157.553 118.918 107.417 1.00 104.31 ? 809  HIS A O     1 
ATOM   6031  C  CB    . HIS A 1  809  ? 154.425 119.683 108.124 1.00 105.24 ? 809  HIS A CB    1 
ATOM   6032  C  CG    . HIS A 1  809  ? 153.020 119.266 108.417 1.00 105.24 ? 809  HIS A CG    1 
ATOM   6033  N  ND1   . HIS A 1  809  ? 152.383 118.259 107.728 1.00 105.24 ? 809  HIS A ND1   1 
ATOM   6034  C  CD2   . HIS A 1  809  ? 152.141 119.699 109.351 1.00 105.24 ? 809  HIS A CD2   1 
ATOM   6035  C  CE1   . HIS A 1  809  ? 151.166 118.097 108.216 1.00 105.24 ? 809  HIS A CE1   1 
ATOM   6036  N  NE2   . HIS A 1  809  ? 150.992 118.962 109.198 1.00 105.24 ? 809  HIS A NE2   1 
ATOM   6037  N  N     . PHE A 1  810  ? 157.312 120.025 109.358 1.00 103.80 ? 810  PHE A N     1 
ATOM   6038  C  CA    . PHE A 1  810  ? 158.588 120.702 109.226 1.00 103.80 ? 810  PHE A CA    1 
ATOM   6039  C  C     . PHE A 1  810  ? 159.742 119.745 109.504 1.00 103.80 ? 810  PHE A C     1 
ATOM   6040  O  O     . PHE A 1  810  ? 159.603 118.733 110.196 1.00 103.80 ? 810  PHE A O     1 
ATOM   6041  C  CB    . PHE A 1  810  ? 158.656 121.904 110.165 1.00 102.08 ? 810  PHE A CB    1 
ATOM   6042  C  CG    . PHE A 1  810  ? 157.617 122.945 109.880 1.00 102.08 ? 810  PHE A CG    1 
ATOM   6043  C  CD1   . PHE A 1  810  ? 157.793 123.859 108.857 1.00 102.08 ? 810  PHE A CD1   1 
ATOM   6044  C  CD2   . PHE A 1  810  ? 156.466 123.012 110.639 1.00 102.08 ? 810  PHE A CD2   1 
ATOM   6045  C  CE1   . PHE A 1  810  ? 156.832 124.814 108.592 1.00 102.08 ? 810  PHE A CE1   1 
ATOM   6046  C  CE2   . PHE A 1  810  ? 155.504 123.968 110.383 1.00 102.08 ? 810  PHE A CE2   1 
ATOM   6047  C  CZ    . PHE A 1  810  ? 155.687 124.869 109.358 1.00 102.08 ? 810  PHE A CZ    1 
ATOM   6048  N  N     . ILE A 1  811  ? 160.894 120.088 108.945 1.00 107.69 ? 811  ILE A N     1 
ATOM   6049  C  CA    . ILE A 1  811  ? 162.082 119.263 109.082 1.00 107.69 ? 811  ILE A CA    1 
ATOM   6050  C  C     . ILE A 1  811  ? 162.816 119.636 110.366 1.00 107.69 ? 811  ILE A C     1 
ATOM   6051  O  O     . ILE A 1  811  ? 162.846 120.797 110.780 1.00 107.69 ? 811  ILE A O     1 
ATOM   6052  C  CB    . ILE A 1  811  ? 162.983 119.422 107.847 1.00 112.28 ? 811  ILE A CB    1 
ATOM   6053  C  CG1   . ILE A 1  811  ? 162.250 118.942 106.595 1.00 112.28 ? 811  ILE A CG1   1 
ATOM   6054  C  CG2   . ILE A 1  811  ? 164.242 118.625 107.988 1.00 112.28 ? 811  ILE A CG2   1 
ATOM   6055  C  CD1   . ILE A 1  811  ? 162.996 119.247 105.317 1.00 112.28 ? 811  ILE A CD1   1 
ATOM   6056  N  N     . LYS A 1  812  ? 163.392 118.626 111.017 1.00 113.49 ? 812  LYS A N     1 
ATOM   6057  C  CA    . LYS A 1  812  ? 164.074 118.840 112.287 1.00 113.49 ? 812  LYS A CA    1 
ATOM   6058  C  C     . LYS A 1  812  ? 165.153 119.911 112.166 1.00 113.49 ? 812  LYS A C     1 
ATOM   6059  O  O     . LYS A 1  812  ? 165.830 120.024 111.140 1.00 113.49 ? 812  LYS A O     1 
ATOM   6060  C  CB    . LYS A 1  812  ? 164.695 117.539 112.796 1.00 115.19 ? 812  LYS A CB    1 
ATOM   6061  C  CG    . LYS A 1  812  ? 163.695 116.515 113.300 1.00 115.19 ? 812  LYS A CG    1 
ATOM   6062  C  CD    . LYS A 1  812  ? 164.403 115.267 113.800 1.00 115.19 ? 812  LYS A CD    1 
ATOM   6063  C  CE    . LYS A 1  812  ? 163.416 114.280 114.398 1.00 115.19 ? 812  LYS A CE    1 
ATOM   6064  N  NZ    . LYS A 1  812  ? 164.087 113.031 114.851 1.00 115.19 ? 812  LYS A NZ    1 
ATOM   6065  N  N     . ASP A 1  813  ? 165.296 120.704 113.229 1.00 119.26 ? 813  ASP A N     1 
ATOM   6066  C  CA    . ASP A 1  813  ? 166.271 121.795 113.296 1.00 119.26 ? 813  ASP A CA    1 
ATOM   6067  C  C     . ASP A 1  813  ? 166.013 122.842 112.213 1.00 119.26 ? 813  ASP A C     1 
ATOM   6068  O  O     . ASP A 1  813  ? 166.919 123.257 111.487 1.00 119.26 ? 813  ASP A O     1 
ATOM   6069  C  CB    . ASP A 1  813  ? 167.705 121.264 113.215 1.00 131.52 ? 813  ASP A CB    1 
ATOM   6070  C  CG    . ASP A 1  813  ? 168.128 120.528 114.470 1.00 131.52 ? 813  ASP A CG    1 
ATOM   6071  O  OD1   . ASP A 1  813  ? 167.458 120.691 115.512 1.00 131.52 ? 813  ASP A OD1   1 
ATOM   6072  O  OD2   . ASP A 1  813  ? 169.130 119.784 114.414 1.00 131.52 ? 813  ASP A OD2   1 
ATOM   6073  N  N     . ASP A 1  814  ? 164.758 123.271 112.108 1.00 117.07 ? 814  ASP A N     1 
ATOM   6074  C  CA    . ASP A 1  814  ? 164.367 124.354 111.213 1.00 117.07 ? 814  ASP A CA    1 
ATOM   6075  C  C     . ASP A 1  814  ? 164.010 125.563 112.069 1.00 117.07 ? 814  ASP A C     1 
ATOM   6076  O  O     . ASP A 1  814  ? 162.968 125.577 112.731 1.00 117.07 ? 814  ASP A O     1 
ATOM   6077  C  CB    . ASP A 1  814  ? 163.193 123.942 110.327 1.00 114.97 ? 814  ASP A CB    1 
ATOM   6078  C  CG    . ASP A 1  814  ? 162.841 124.995 109.290 1.00 114.97 ? 814  ASP A CG    1 
ATOM   6079  O  OD1   . ASP A 1  814  ? 163.555 126.016 109.196 1.00 114.97 ? 814  ASP A OD1   1 
ATOM   6080  O  OD2   . ASP A 1  814  ? 161.843 124.799 108.565 1.00 114.97 ? 814  ASP A OD2   1 
ATOM   6081  N  N     . TYR A 1  815  ? 164.875 126.572 112.051 1.00 113.63 ? 815  TYR A N     1 
ATOM   6082  C  CA    . TYR A 1  815  ? 164.647 127.824 112.756 1.00 113.63 ? 815  TYR A CA    1 
ATOM   6083  C  C     . TYR A 1  815  ? 164.079 128.908 111.854 1.00 113.63 ? 815  TYR A C     1 
ATOM   6084  O  O     . TYR A 1  815  ? 163.923 130.048 112.302 1.00 113.63 ? 815  TYR A O     1 
ATOM   6085  C  CB    . TYR A 1  815  ? 165.944 128.305 113.408 1.00 118.42 ? 815  TYR A CB    1 
ATOM   6086  C  CG    . TYR A 1  815  ? 166.409 127.410 114.529 1.00 118.42 ? 815  TYR A CG    1 
ATOM   6087  C  CD1   . TYR A 1  815  ? 167.234 126.326 114.278 1.00 118.42 ? 815  TYR A CD1   1 
ATOM   6088  C  CD2   . TYR A 1  815  ? 166.001 127.636 115.837 1.00 118.42 ? 815  TYR A CD2   1 
ATOM   6089  C  CE1   . TYR A 1  815  ? 167.650 125.501 115.296 1.00 118.42 ? 815  TYR A CE1   1 
ATOM   6090  C  CE2   . TYR A 1  815  ? 166.416 126.819 116.862 1.00 118.42 ? 815  TYR A CE2   1 
ATOM   6091  C  CZ    . TYR A 1  815  ? 167.240 125.752 116.586 1.00 118.42 ? 815  TYR A CZ    1 
ATOM   6092  O  OH    . TYR A 1  815  ? 167.657 124.929 117.604 1.00 118.42 ? 815  TYR A OH    1 
ATOM   6093  N  N     . GLY A 1  816  ? 163.771 128.581 110.602 1.00 111.83 ? 816  GLY A N     1 
ATOM   6094  C  CA    . GLY A 1  816  ? 163.269 129.546 109.656 1.00 111.83 ? 816  GLY A CA    1 
ATOM   6095  C  C     . GLY A 1  816  ? 161.978 130.190 110.115 1.00 111.83 ? 816  GLY A C     1 
ATOM   6096  O  O     . GLY A 1  816  ? 161.326 129.737 111.060 1.00 111.83 ? 816  GLY A O     1 
ATOM   6097  N  N     . PRO A 1  817  ? 161.584 131.277 109.447 1.00 107.34 ? 817  PRO A N     1 
ATOM   6098  C  CA    . PRO A 1  817  ? 160.408 132.026 109.914 1.00 107.34 ? 817  PRO A CA    1 
ATOM   6099  C  C     . PRO A 1  817  ? 159.124 131.216 109.881 1.00 107.34 ? 817  PRO A C     1 
ATOM   6100  O  O     . PRO A 1  817  ? 158.257 131.405 110.741 1.00 107.34 ? 817  PRO A O     1 
ATOM   6101  C  CB    . PRO A 1  817  ? 160.360 133.220 108.950 1.00 109.87 ? 817  PRO A CB    1 
ATOM   6102  C  CG    . PRO A 1  817  ? 161.023 132.723 107.713 1.00 109.87 ? 817  PRO A CG    1 
ATOM   6103  C  CD    . PRO A 1  817  ? 162.121 131.815 108.187 1.00 109.87 ? 817  PRO A CD    1 
ATOM   6104  N  N     . GLU A 1  818  ? 158.989 130.296 108.925 1.00 106.19 ? 818  GLU A N     1 
ATOM   6105  C  CA    . GLU A 1  818  ? 157.735 129.567 108.768 1.00 106.19 ? 818  GLU A CA    1 
ATOM   6106  C  C     . GLU A 1  818  ? 157.578 128.491 109.836 1.00 106.19 ? 818  GLU A C     1 
ATOM   6107  O  O     . GLU A 1  818  ? 156.493 128.322 110.405 1.00 106.19 ? 818  GLU A O     1 
ATOM   6108  C  CB    . GLU A 1  818  ? 157.668 128.955 107.370 1.00 117.08 ? 818  GLU A CB    1 
ATOM   6109  C  CG    . GLU A 1  818  ? 157.622 129.985 106.259 1.00 117.08 ? 818  GLU A CG    1 
ATOM   6110  C  CD    . GLU A 1  818  ? 157.631 129.356 104.882 1.00 117.08 ? 818  GLU A CD    1 
ATOM   6111  O  OE1   . GLU A 1  818  ? 157.848 128.130 104.792 1.00 117.08 ? 818  GLU A OE1   1 
ATOM   6112  O  OE2   . GLU A 1  818  ? 157.424 130.086 103.891 1.00 117.08 ? 818  GLU A OE2   1 
ATOM   6113  N  N     . SER A 1  819  ? 158.651 127.748 110.121 1.00 105.20 ? 819  SER A N     1 
ATOM   6114  C  CA    . SER A 1  819  ? 158.556 126.635 111.060 1.00 105.20 ? 819  SER A CA    1 
ATOM   6115  C  C     . SER A 1  819  ? 158.235 127.102 112.473 1.00 105.20 ? 819  SER A C     1 
ATOM   6116  O  O     . SER A 1  819  ? 157.494 126.427 113.196 1.00 105.20 ? 819  SER A O     1 
ATOM   6117  C  CB    . SER A 1  819  ? 159.857 125.835 111.058 1.00 109.61 ? 819  SER A CB    1 
ATOM   6118  O  OG    . SER A 1  819  ? 159.813 124.789 112.013 1.00 109.61 ? 819  SER A OG    1 
ATOM   6119  N  N     . ARG A 1  820  ? 158.776 128.243 112.883 1.00 103.39 ? 820  ARG A N     1 
ATOM   6120  C  CA    . ARG A 1  820  ? 158.657 128.719 114.252 1.00 103.39 ? 820  ARG A CA    1 
ATOM   6121  C  C     . ARG A 1  820  ? 157.472 129.657 114.467 1.00 103.39 ? 820  ARG A C     1 
ATOM   6122  O  O     . ARG A 1  820  ? 157.367 130.260 115.538 1.00 103.39 ? 820  ARG A O     1 
ATOM   6123  C  CB    . ARG A 1  820  ? 159.957 129.391 114.687 1.00 110.35 ? 820  ARG A CB    1 
ATOM   6124  C  CG    . ARG A 1  820  ? 161.146 128.447 114.754 1.00 110.35 ? 820  ARG A CG    1 
ATOM   6125  C  CD    . ARG A 1  820  ? 160.921 127.347 115.786 1.00 110.35 ? 820  ARG A CD    1 
ATOM   6126  N  NE    . ARG A 1  820  ? 160.754 127.871 117.139 1.00 110.35 ? 820  ARG A NE    1 
ATOM   6127  C  CZ    . ARG A 1  820  ? 161.760 128.165 117.955 1.00 110.35 ? 820  ARG A CZ    1 
ATOM   6128  N  NH1   . ARG A 1  820  ? 163.012 127.984 117.561 1.00 110.35 ? 820  ARG A NH1   1 
ATOM   6129  N  NH2   . ARG A 1  820  ? 161.515 128.635 119.170 1.00 110.35 ? 820  ARG A NH2   1 
ATOM   6130  N  N     . GLY A 1  821  ? 156.604 129.819 113.476 1.00 104.21 ? 821  GLY A N     1 
ATOM   6131  C  CA    . GLY A 1  821  ? 155.314 130.439 113.698 1.00 104.21 ? 821  GLY A CA    1 
ATOM   6132  C  C     . GLY A 1  821  ? 155.100 131.847 113.187 1.00 104.21 ? 821  GLY A C     1 
ATOM   6133  O  O     . GLY A 1  821  ? 154.078 132.450 113.530 1.00 104.21 ? 821  GLY A O     1 
ATOM   6134  N  N     . PHE A 1  822  ? 156.015 132.394 112.393 1.00 103.54 ? 822  PHE A N     1 
ATOM   6135  C  CA    . PHE A 1  822  ? 155.744 133.672 111.749 1.00 103.54 ? 822  PHE A CA    1 
ATOM   6136  C  C     . PHE A 1  822  ? 154.649 133.501 110.705 1.00 103.54 ? 822  PHE A C     1 
ATOM   6137  O  O     . PHE A 1  822  ? 154.734 132.638 109.828 1.00 103.54 ? 822  PHE A O     1 
ATOM   6138  C  CB    . PHE A 1  822  ? 157.011 134.230 111.102 1.00 105.07 ? 822  PHE A CB    1 
ATOM   6139  C  CG    . PHE A 1  822  ? 156.792 135.497 110.326 1.00 105.07 ? 822  PHE A CG    1 
ATOM   6140  C  CD1   . PHE A 1  822  ? 156.699 136.716 110.973 1.00 105.07 ? 822  PHE A CD1   1 
ATOM   6141  C  CD2   . PHE A 1  822  ? 156.692 135.471 108.945 1.00 105.07 ? 822  PHE A CD2   1 
ATOM   6142  C  CE1   . PHE A 1  822  ? 156.503 137.883 110.260 1.00 105.07 ? 822  PHE A CE1   1 
ATOM   6143  C  CE2   . PHE A 1  822  ? 156.496 136.635 108.228 1.00 105.07 ? 822  PHE A CE2   1 
ATOM   6144  C  CZ    . PHE A 1  822  ? 156.403 137.842 108.887 1.00 105.07 ? 822  PHE A CZ    1 
ATOM   6145  N  N     . VAL A 1  823  ? 153.613 134.327 110.806 1.00 103.42 ? 823  VAL A N     1 
ATOM   6146  C  CA    . VAL A 1  823  ? 152.425 134.211 109.968 1.00 103.42 ? 823  VAL A CA    1 
ATOM   6147  C  C     . VAL A 1  823  ? 152.554 135.215 108.832 1.00 103.42 ? 823  VAL A C     1 
ATOM   6148  O  O     . VAL A 1  823  ? 152.544 136.430 109.059 1.00 103.42 ? 823  VAL A O     1 
ATOM   6149  C  CB    . VAL A 1  823  ? 151.138 134.448 110.766 1.00 100.47 ? 823  VAL A CB    1 
ATOM   6150  C  CG1   . VAL A 1  823  ? 149.943 134.382 109.845 1.00 100.47 ? 823  VAL A CG1   1 
ATOM   6151  C  CG2   . VAL A 1  823  ? 151.012 133.434 111.891 1.00 100.47 ? 823  VAL A CG2   1 
ATOM   6152  N  N     . GLU A 1  824  ? 152.675 134.707 107.607 1.00 103.96 ? 824  GLU A N     1 
ATOM   6153  C  CA    . GLU A 1  824  ? 152.796 135.570 106.437 1.00 103.96 ? 824  GLU A CA    1 
ATOM   6154  C  C     . GLU A 1  824  ? 151.436 136.083 105.974 1.00 103.96 ? 824  GLU A C     1 
ATOM   6155  O  O     . GLU A 1  824  ? 151.306 137.244 105.572 1.00 103.96 ? 824  GLU A O     1 
ATOM   6156  C  CB    . GLU A 1  824  ? 153.497 134.806 105.313 1.00 115.15 ? 824  GLU A CB    1 
ATOM   6157  C  CG    . GLU A 1  824  ? 153.734 135.605 104.050 1.00 115.15 ? 824  GLU A CG    1 
ATOM   6158  C  CD    . GLU A 1  824  ? 154.472 134.803 102.997 1.00 115.15 ? 824  GLU A CD    1 
ATOM   6159  O  OE1   . GLU A 1  824  ? 154.755 133.613 103.247 1.00 115.15 ? 824  GLU A OE1   1 
ATOM   6160  O  OE2   . GLU A 1  824  ? 154.772 135.360 101.921 1.00 115.15 ? 824  GLU A OE2   1 
ATOM   6161  N  N     . ASN A 1  825  ? 150.420 135.228 106.020 1.00 101.08 ? 825  ASN A N     1 
ATOM   6162  C  CA    . ASN A 1  825  ? 149.096 135.576 105.527 1.00 101.08 ? 825  ASN A CA    1 
ATOM   6163  C  C     . ASN A 1  825  ? 148.388 136.540 106.475 1.00 101.08 ? 825  ASN A C     1 
ATOM   6164  O  O     . ASN A 1  825  ? 148.762 136.704 107.639 1.00 101.08 ? 825  ASN A O     1 
ATOM   6165  C  CB    . ASN A 1  825  ? 148.246 134.322 105.341 1.00 101.22 ? 825  ASN A CB    1 
ATOM   6166  C  CG    . ASN A 1  825  ? 148.701 133.480 104.169 1.00 101.22 ? 825  ASN A CG    1 
ATOM   6167  O  OD1   . ASN A 1  825  ? 148.420 133.799 103.015 1.00 101.22 ? 825  ASN A OD1   1 
ATOM   6168  N  ND2   . ASN A 1  825  ? 149.406 132.396 104.460 1.00 101.22 ? 825  ASN A ND2   1 
ATOM   6169  N  N     . SER A 1  826  ? 147.350 137.183 105.951 1.00 95.93  ? 826  SER A N     1 
ATOM   6170  C  CA    . SER A 1  826  ? 146.512 138.105 106.701 1.00 95.93  ? 826  SER A CA    1 
ATOM   6171  C  C     . SER A 1  826  ? 145.096 137.549 106.792 1.00 95.93  ? 826  SER A C     1 
ATOM   6172  O  O     . SER A 1  826  ? 144.700 136.690 105.999 1.00 95.93  ? 826  SER A O     1 
ATOM   6173  C  CB    . SER A 1  826  ? 146.485 139.485 106.043 1.00 97.80  ? 826  SER A CB    1 
ATOM   6174  O  OG    . SER A 1  826  ? 145.887 139.425 104.760 1.00 97.80  ? 826  SER A OG    1 
ATOM   6175  N  N     . TYR A 1  827  ? 144.340 138.034 107.784 1.00 92.00  ? 827  TYR A N     1 
ATOM   6176  C  CA    . TYR A 1  827  ? 143.003 137.498 108.031 1.00 92.00  ? 827  TYR A CA    1 
ATOM   6177  C  C     . TYR A 1  827  ? 142.107 137.611 106.803 1.00 92.00  ? 827  TYR A C     1 
ATOM   6178  O  O     . TYR A 1  827  ? 141.201 136.793 106.613 1.00 92.00  ? 827  TYR A O     1 
ATOM   6179  C  CB    . TYR A 1  827  ? 142.350 138.213 109.213 1.00 92.33  ? 827  TYR A CB    1 
ATOM   6180  C  CG    . TYR A 1  827  ? 143.019 138.002 110.548 1.00 92.33  ? 827  TYR A CG    1 
ATOM   6181  C  CD1   . TYR A 1  827  ? 143.543 136.768 110.903 1.00 92.33  ? 827  TYR A CD1   1 
ATOM   6182  C  CD2   . TYR A 1  827  ? 143.098 139.038 111.467 1.00 92.33  ? 827  TYR A CD2   1 
ATOM   6183  C  CE1   . TYR A 1  827  ? 144.146 136.580 112.132 1.00 92.33  ? 827  TYR A CE1   1 
ATOM   6184  C  CE2   . TYR A 1  827  ? 143.694 138.861 112.691 1.00 92.33  ? 827  TYR A CE2   1 
ATOM   6185  C  CZ    . TYR A 1  827  ? 144.217 137.633 113.020 1.00 92.33  ? 827  TYR A CZ    1 
ATOM   6186  O  OH    . TYR A 1  827  ? 144.809 137.472 114.249 1.00 92.33  ? 827  TYR A OH    1 
ATOM   6187  N  N     . LEU A 1  828  ? 142.331 138.625 105.965 1.00 92.00  ? 828  LEU A N     1 
ATOM   6188  C  CA    . LEU A 1  828  ? 141.523 138.768 104.759 1.00 92.00  ? 828  LEU A CA    1 
ATOM   6189  C  C     . LEU A 1  828  ? 141.797 137.629 103.789 1.00 92.00  ? 828  LEU A C     1 
ATOM   6190  O  O     . LEU A 1  828  ? 140.873 136.947 103.331 1.00 92.00  ? 828  LEU A O     1 
ATOM   6191  C  CB    . LEU A 1  828  ? 141.798 140.116 104.095 1.00 96.27  ? 828  LEU A CB    1 
ATOM   6192  C  CG    . LEU A 1  828  ? 141.061 140.356 102.774 1.00 96.27  ? 828  LEU A CG    1 
ATOM   6193  C  CD1   . LEU A 1  828  ? 139.558 140.389 102.995 1.00 96.27  ? 828  LEU A CD1   1 
ATOM   6194  C  CD2   . LEU A 1  828  ? 141.542 141.633 102.107 1.00 96.27  ? 828  LEU A CD2   1 
ATOM   6195  N  N     . ALA A 1  829  ? 143.072 137.403 103.474 1.00 91.57  ? 829  ALA A N     1 
ATOM   6196  C  CA    . ALA A 1  829  ? 143.437 136.300 102.597 1.00 91.57  ? 829  ALA A CA    1 
ATOM   6197  C  C     . ALA A 1  829  ? 143.249 134.950 103.274 1.00 91.57  ? 829  ALA A C     1 
ATOM   6198  O  O     . ALA A 1  829  ? 142.978 133.956 102.593 1.00 91.57  ? 829  ALA A O     1 
ATOM   6199  C  CB    . ALA A 1  829  ? 144.883 136.460 102.130 1.00 91.18  ? 829  ALA A CB    1 
ATOM   6200  N  N     . GLY A 1  830  ? 143.382 134.896 104.589 1.00 92.89  ? 830  GLY A N     1 
ATOM   6201  C  CA    . GLY A 1  830  ? 143.192 133.676 105.346 1.00 92.89  ? 830  GLY A CA    1 
ATOM   6202  C  C     . GLY A 1  830  ? 144.496 132.949 105.604 1.00 92.89  ? 830  GLY A C     1 
ATOM   6203  O  O     . GLY A 1  830  ? 145.428 132.972 104.793 1.00 92.89  ? 830  GLY A O     1 
ATOM   6204  N  N     . LEU A 1  831  ? 144.563 132.282 106.751 1.00 94.60  ? 831  LEU A N     1 
ATOM   6205  C  CA    . LEU A 1  831  ? 145.769 131.595 107.183 1.00 94.60  ? 831  LEU A CA    1 
ATOM   6206  C  C     . LEU A 1  831  ? 145.921 130.256 106.464 1.00 94.60  ? 831  LEU A C     1 
ATOM   6207  O  O     . LEU A 1  831  ? 144.955 129.673 105.974 1.00 94.60  ? 831  LEU A O     1 
ATOM   6208  C  CB    . LEU A 1  831  ? 145.734 131.355 108.693 1.00 92.02  ? 831  LEU A CB    1 
ATOM   6209  C  CG    . LEU A 1  831  ? 145.506 132.572 109.594 1.00 92.02  ? 831  LEU A CG    1 
ATOM   6210  C  CD1   . LEU A 1  831  ? 145.435 132.165 111.052 1.00 92.02  ? 831  LEU A CD1   1 
ATOM   6211  C  CD2   . LEU A 1  831  ? 146.546 133.644 109.402 1.00 92.02  ? 831  LEU A CD2   1 
ATOM   6212  N  N     . THR A 1  832  ? 147.161 129.770 106.415 1.00 97.33  ? 832  THR A N     1 
ATOM   6213  C  CA    . THR A 1  832  ? 147.428 128.381 106.071 1.00 97.33  ? 832  THR A CA    1 
ATOM   6214  C  C     . THR A 1  832  ? 147.166 127.511 107.295 1.00 97.33  ? 832  THR A C     1 
ATOM   6215  O  O     . THR A 1  832  ? 147.030 128.031 108.409 1.00 97.33  ? 832  THR A O     1 
ATOM   6216  C  CB    . THR A 1  832  ? 148.864 128.221 105.566 1.00 100.95 ? 832  THR A CB    1 
ATOM   6217  O  OG1   . THR A 1  832  ? 149.793 128.649 106.562 1.00 100.95 ? 832  THR A OG1   1 
ATOM   6218  C  CG2   . THR A 1  832  ? 149.072 129.053 104.300 1.00 100.95 ? 832  THR A CG2   1 
ATOM   6219  N  N     . PRO A 1  833  ? 147.093 126.182 107.137 1.00 95.24  ? 833  PRO A N     1 
ATOM   6220  C  CA    . PRO A 1  833  ? 146.777 125.334 108.301 1.00 95.24  ? 833  PRO A CA    1 
ATOM   6221  C  C     . PRO A 1  833  ? 147.785 125.424 109.438 1.00 95.24  ? 833  PRO A C     1 
ATOM   6222  O  O     . PRO A 1  833  ? 147.385 125.570 110.600 1.00 95.24  ? 833  PRO A O     1 
ATOM   6223  C  CB    . PRO A 1  833  ? 146.719 123.927 107.697 1.00 92.42  ? 833  PRO A CB    1 
ATOM   6224  C  CG    . PRO A 1  833  ? 146.353 124.140 106.273 1.00 92.42  ? 833  PRO A CG    1 
ATOM   6225  C  CD    . PRO A 1  833  ? 147.064 125.405 105.880 1.00 92.42  ? 833  PRO A CD    1 
ATOM   6226  N  N     . THR A 1  834  ? 149.084 125.340 109.142 1.00 93.93  ? 834  THR A N     1 
ATOM   6227  C  CA    . THR A 1  834  ? 150.078 125.376 110.212 1.00 93.93  ? 834  THR A CA    1 
ATOM   6228  C  C     . THR A 1  834  ? 150.096 126.741 110.887 1.00 93.93  ? 834  THR A C     1 
ATOM   6229  O  O     . THR A 1  834  ? 150.250 126.843 112.111 1.00 93.93  ? 834  THR A O     1 
ATOM   6230  C  CB    . THR A 1  834  ? 151.464 125.022 109.670 1.00 95.09  ? 834  THR A CB    1 
ATOM   6231  O  OG1   . THR A 1  834  ? 151.833 125.943 108.637 1.00 95.09  ? 834  THR A OG1   1 
ATOM   6232  C  CG2   . THR A 1  834  ? 151.472 123.612 109.108 1.00 95.09  ? 834  THR A CG2   1 
ATOM   6233  N  N     . GLU A 1  835  ? 149.934 127.804 110.100 1.00 97.12  ? 835  GLU A N     1 
ATOM   6234  C  CA    . GLU A 1  835  ? 149.819 129.142 110.667 1.00 97.12  ? 835  GLU A CA    1 
ATOM   6235  C  C     . GLU A 1  835  ? 148.537 129.283 111.477 1.00 97.12  ? 835  GLU A C     1 
ATOM   6236  O  O     . GLU A 1  835  ? 148.478 130.065 112.432 1.00 97.12  ? 835  GLU A O     1 
ATOM   6237  C  CB    . GLU A 1  835  ? 149.879 130.177 109.546 1.00 102.98 ? 835  GLU A CB    1 
ATOM   6238  C  CG    . GLU A 1  835  ? 151.222 130.227 108.830 1.00 102.98 ? 835  GLU A CG    1 
ATOM   6239  C  CD    . GLU A 1  835  ? 151.212 131.149 107.626 1.00 102.98 ? 835  GLU A CD    1 
ATOM   6240  O  OE1   . GLU A 1  835  ? 150.119 131.611 107.238 1.00 102.98 ? 835  GLU A OE1   1 
ATOM   6241  O  OE2   . GLU A 1  835  ? 152.297 131.405 107.063 1.00 102.98 ? 835  GLU A OE2   1 
ATOM   6242  N  N     . PHE A 1  836  ? 147.503 128.520 111.118 1.00 94.47  ? 836  PHE A N     1 
ATOM   6243  C  CA    . PHE A 1  836  ? 146.263 128.546 111.887 1.00 94.47  ? 836  PHE A CA    1 
ATOM   6244  C  C     . PHE A 1  836  ? 146.445 127.873 113.242 1.00 94.47  ? 836  PHE A C     1 
ATOM   6245  O  O     . PHE A 1  836  ? 145.948 128.363 114.264 1.00 94.47  ? 836  PHE A O     1 
ATOM   6246  C  CB    . PHE A 1  836  ? 145.142 127.873 111.097 1.00 93.20  ? 836  PHE A CB    1 
ATOM   6247  C  CG    . PHE A 1  836  ? 143.850 127.770 111.849 1.00 93.20  ? 836  PHE A CG    1 
ATOM   6248  C  CD1   . PHE A 1  836  ? 143.008 128.861 111.955 1.00 93.20  ? 836  PHE A CD1   1 
ATOM   6249  C  CD2   . PHE A 1  836  ? 143.474 126.581 112.445 1.00 93.20  ? 836  PHE A CD2   1 
ATOM   6250  C  CE1   . PHE A 1  836  ? 141.818 128.768 112.648 1.00 93.20  ? 836  PHE A CE1   1 
ATOM   6251  C  CE2   . PHE A 1  836  ? 142.285 126.483 113.139 1.00 93.20  ? 836  PHE A CE2   1 
ATOM   6252  C  CZ    . PHE A 1  836  ? 141.458 127.577 113.240 1.00 93.20  ? 836  PHE A CZ    1 
ATOM   6253  N  N     . PHE A 1  837  ? 147.158 126.746 113.271 1.00 94.22  ? 837  PHE A N     1 
ATOM   6254  C  CA    . PHE A 1  837  ? 147.402 126.062 114.537 1.00 94.22  ? 837  PHE A CA    1 
ATOM   6255  C  C     . PHE A 1  837  ? 148.326 126.882 115.431 1.00 94.22  ? 837  PHE A C     1 
ATOM   6256  O  O     . PHE A 1  837  ? 148.065 127.045 116.630 1.00 94.22  ? 837  PHE A O     1 
ATOM   6257  C  CB    . PHE A 1  837  ? 147.987 124.675 114.281 1.00 92.59  ? 837  PHE A CB    1 
ATOM   6258  C  CG    . PHE A 1  837  ? 148.287 123.907 115.530 1.00 92.59  ? 837  PHE A CG    1 
ATOM   6259  C  CD1   . PHE A 1  837  ? 147.270 123.289 116.233 1.00 92.59  ? 837  PHE A CD1   1 
ATOM   6260  C  CD2   . PHE A 1  837  ? 149.584 123.788 115.996 1.00 92.59  ? 837  PHE A CD2   1 
ATOM   6261  C  CE1   . PHE A 1  837  ? 147.536 122.581 117.384 1.00 92.59  ? 837  PHE A CE1   1 
ATOM   6262  C  CE2   . PHE A 1  837  ? 149.856 123.076 117.147 1.00 92.59  ? 837  PHE A CE2   1 
ATOM   6263  C  CZ    . PHE A 1  837  ? 148.830 122.473 117.840 1.00 92.59  ? 837  PHE A CZ    1 
ATOM   6264  N  N     . PHE A 1  838  ? 149.418 127.401 114.863 1.00 94.79  ? 838  PHE A N     1 
ATOM   6265  C  CA    . PHE A 1  838  ? 150.288 128.306 115.610 1.00 94.79  ? 838  PHE A CA    1 
ATOM   6266  C  C     . PHE A 1  838  ? 149.506 129.503 116.132 1.00 94.79  ? 838  PHE A C     1 
ATOM   6267  O  O     . PHE A 1  838  ? 149.746 129.988 117.244 1.00 94.79  ? 838  PHE A O     1 
ATOM   6268  C  CB    . PHE A 1  838  ? 151.444 128.774 114.726 1.00 96.80  ? 838  PHE A CB    1 
ATOM   6269  C  CG    . PHE A 1  838  ? 152.370 127.676 114.311 1.00 96.80  ? 838  PHE A CG    1 
ATOM   6270  C  CD1   . PHE A 1  838  ? 152.453 126.511 115.046 1.00 96.80  ? 838  PHE A CD1   1 
ATOM   6271  C  CD2   . PHE A 1  838  ? 153.145 127.800 113.174 1.00 96.80  ? 838  PHE A CD2   1 
ATOM   6272  C  CE1   . PHE A 1  838  ? 153.300 125.500 114.666 1.00 96.80  ? 838  PHE A CE1   1 
ATOM   6273  C  CE2   . PHE A 1  838  ? 153.995 126.787 112.788 1.00 96.80  ? 838  PHE A CE2   1 
ATOM   6274  C  CZ    . PHE A 1  838  ? 154.073 125.637 113.535 1.00 96.80  ? 838  PHE A CZ    1 
ATOM   6275  N  N     . HIS A 1  839  ? 148.559 129.991 115.331 1.00 94.79  ? 839  HIS A N     1 
ATOM   6276  C  CA    . HIS A 1  839  ? 147.722 131.106 115.755 1.00 94.79  ? 839  HIS A CA    1 
ATOM   6277  C  C     . HIS A 1  839  ? 146.852 130.722 116.945 1.00 94.79  ? 839  HIS A C     1 
ATOM   6278  O  O     . HIS A 1  839  ? 146.687 131.509 117.887 1.00 94.79  ? 839  HIS A O     1 
ATOM   6279  C  CB    . HIS A 1  839  ? 146.865 131.570 114.578 1.00 98.10  ? 839  HIS A CB    1 
ATOM   6280  C  CG    . HIS A 1  839  ? 146.010 132.758 114.882 1.00 98.10  ? 839  HIS A CG    1 
ATOM   6281  N  ND1   . HIS A 1  839  ? 146.535 133.974 115.257 1.00 98.10  ? 839  HIS A ND1   1 
ATOM   6282  C  CD2   . HIS A 1  839  ? 144.667 132.920 114.852 1.00 98.10  ? 839  HIS A CD2   1 
ATOM   6283  C  CE1   . HIS A 1  839  ? 145.551 134.833 115.454 1.00 98.10  ? 839  HIS A CE1   1 
ATOM   6284  N  NE2   . HIS A 1  839  ? 144.407 134.219 115.214 1.00 98.10  ? 839  HIS A NE2   1 
ATOM   6285  N  N     . ALA A 1  840  ? 146.288 129.511 116.920 1.00 94.57  ? 840  ALA A N     1 
ATOM   6286  C  CA    . ALA A 1  840  ? 145.505 129.032 118.056 1.00 94.57  ? 840  ALA A CA    1 
ATOM   6287  C  C     . ALA A 1  840  ? 146.365 128.935 119.309 1.00 94.57  ? 840  ALA A C     1 
ATOM   6288  O  O     . ALA A 1  840  ? 145.931 129.306 120.407 1.00 94.57  ? 840  ALA A O     1 
ATOM   6289  C  CB    . ALA A 1  840  ? 144.876 127.679 117.724 1.00 93.57  ? 840  ALA A CB    1 
ATOM   6290  N  N     . MET A 1  841  ? 147.596 128.434 119.162 1.00 96.49  ? 841  MET A N     1 
ATOM   6291  C  CA    . MET A 1  841  ? 148.541 128.451 120.275 1.00 96.49  ? 841  MET A CA    1 
ATOM   6292  C  C     . MET A 1  841  ? 148.759 129.869 120.785 1.00 96.49  ? 841  MET A C     1 
ATOM   6293  O  O     . MET A 1  841  ? 148.861 130.095 121.997 1.00 96.49  ? 841  MET A O     1 
ATOM   6294  C  CB    . MET A 1  841  ? 149.873 127.834 119.848 1.00 101.00 ? 841  MET A CB    1 
ATOM   6295  C  CG    . MET A 1  841  ? 149.823 126.345 119.570 1.00 101.00 ? 841  MET A CG    1 
ATOM   6296  S  SD    . MET A 1  841  ? 151.386 125.702 118.944 1.00 101.00 ? 841  MET A SD    1 
ATOM   6297  C  CE    . MET A 1  841  ? 152.415 125.828 120.403 1.00 101.00 ? 841  MET A CE    1 
ATOM   6298  N  N     . GLY A 1  842  ? 148.827 130.839 119.873 1.00 99.86  ? 842  GLY A N     1 
ATOM   6299  C  CA    . GLY A 1  842  ? 149.056 132.213 120.286 1.00 99.86  ? 842  GLY A CA    1 
ATOM   6300  C  C     . GLY A 1  842  ? 147.879 132.801 121.040 1.00 99.86  ? 842  GLY A C     1 
ATOM   6301  O  O     . GLY A 1  842  ? 148.050 133.643 121.925 1.00 99.86  ? 842  GLY A O     1 
ATOM   6302  N  N     . GLY A 1  843  ? 146.664 132.367 120.698 1.00 100.73 ? 843  GLY A N     1 
ATOM   6303  C  CA    . GLY A 1  843  ? 145.492 132.867 121.400 1.00 100.73 ? 843  GLY A CA    1 
ATOM   6304  C  C     . GLY A 1  843  ? 145.252 132.184 122.733 1.00 100.73 ? 843  GLY A C     1 
ATOM   6305  O  O     . GLY A 1  843  ? 144.720 132.799 123.666 1.00 100.73 ? 843  GLY A O     1 
ATOM   6306  N  N     . ARG A 1  844  ? 145.638 130.909 122.843 1.00 106.94 ? 844  ARG A N     1 
ATOM   6307  C  CA    . ARG A 1  844  ? 145.435 130.175 124.088 1.00 106.94 ? 844  ARG A CA    1 
ATOM   6308  C  C     . ARG A 1  844  ? 146.127 130.865 125.258 1.00 106.94 ? 844  ARG A C     1 
ATOM   6309  O  O     . ARG A 1  844  ? 145.585 130.914 126.368 1.00 106.94 ? 844  ARG A O     1 
ATOM   6310  C  CB    . ARG A 1  844  ? 145.936 128.740 123.935 1.00 104.63 ? 844  ARG A CB    1 
ATOM   6311  C  CG    . ARG A 1  844  ? 145.737 127.874 125.163 1.00 104.63 ? 844  ARG A CG    1 
ATOM   6312  C  CD    . ARG A 1  844  ? 144.276 127.805 125.563 1.00 104.63 ? 844  ARG A CD    1 
ATOM   6313  N  NE    . ARG A 1  844  ? 143.439 127.279 124.489 1.00 104.63 ? 844  ARG A NE    1 
ATOM   6314  C  CZ    . ARG A 1  844  ? 143.232 125.985 124.274 1.00 104.63 ? 844  ARG A CZ    1 
ATOM   6315  N  NH1   . ARG A 1  844  ? 143.803 125.082 125.059 1.00 104.63 ? 844  ARG A NH1   1 
ATOM   6316  N  NH2   . ARG A 1  844  ? 142.455 125.592 123.275 1.00 104.63 ? 844  ARG A NH2   1 
ATOM   6317  N  N     . GLU A 1  845  ? 147.323 131.410 125.026 1.00 112.31 ? 845  GLU A N     1 
ATOM   6318  C  CA    . GLU A 1  845  ? 148.021 132.136 126.081 1.00 112.31 ? 845  GLU A CA    1 
ATOM   6319  C  C     . GLU A 1  845  ? 147.228 133.361 126.521 1.00 112.31 ? 845  GLU A C     1 
ATOM   6320  O  O     . GLU A 1  845  ? 147.193 133.695 127.711 1.00 112.31 ? 845  GLU A O     1 
ATOM   6321  C  CB    . GLU A 1  845  ? 149.417 132.537 125.604 1.00 121.74 ? 845  GLU A CB    1 
ATOM   6322  C  CG    . GLU A 1  845  ? 150.254 133.254 126.653 1.00 121.74 ? 845  GLU A CG    1 
ATOM   6323  C  CD    . GLU A 1  845  ? 151.641 133.610 126.152 1.00 121.74 ? 845  GLU A CD    1 
ATOM   6324  O  OE1   . GLU A 1  845  ? 151.939 133.333 124.972 1.00 121.74 ? 845  GLU A OE1   1 
ATOM   6325  O  OE2   . GLU A 1  845  ? 152.433 134.168 126.939 1.00 121.74 ? 845  GLU A OE2   1 
ATOM   6326  N  N     . GLY A 1  846  ? 146.577 134.037 125.573 1.00 111.56 ? 846  GLY A N     1 
ATOM   6327  C  CA    . GLY A 1  846  ? 145.758 135.184 125.930 1.00 111.56 ? 846  GLY A CA    1 
ATOM   6328  C  C     . GLY A 1  846  ? 144.558 134.797 126.770 1.00 111.56 ? 846  GLY A C     1 
ATOM   6329  O  O     . GLY A 1  846  ? 144.265 135.430 127.790 1.00 111.56 ? 846  GLY A O     1 
ATOM   6330  N  N     . LEU A 1  847  ? 143.845 133.747 126.354 1.00 110.90 ? 847  LEU A N     1 
ATOM   6331  C  CA    . LEU A 1  847  ? 142.704 133.276 127.138 1.00 110.90 ? 847  LEU A CA    1 
ATOM   6332  C  C     . LEU A 1  847  ? 143.137 132.860 128.539 1.00 110.90 ? 847  LEU A C     1 
ATOM   6333  O  O     . LEU A 1  847  ? 142.466 133.173 129.531 1.00 110.90 ? 847  LEU A O     1 
ATOM   6334  C  CB    . LEU A 1  847  ? 142.013 132.111 126.427 1.00 104.79 ? 847  LEU A CB    1 
ATOM   6335  C  CG    . LEU A 1  847  ? 140.958 132.392 125.358 1.00 104.79 ? 847  LEU A CG    1 
ATOM   6336  C  CD1   . LEU A 1  847  ? 141.568 133.050 124.136 1.00 104.79 ? 847  LEU A CD1   1 
ATOM   6337  C  CD2   . LEU A 1  847  ? 140.263 131.100 124.974 1.00 104.79 ? 847  LEU A CD2   1 
ATOM   6338  N  N     . ILE A 1  848  ? 144.265 132.155 128.638 1.00 114.96 ? 848  ILE A N     1 
ATOM   6339  C  CA    . ILE A 1  848  ? 144.738 131.677 129.935 1.00 114.96 ? 848  ILE A CA    1 
ATOM   6340  C  C     . ILE A 1  848  ? 145.112 132.849 130.833 1.00 114.96 ? 848  ILE A C     1 
ATOM   6341  O  O     . ILE A 1  848  ? 144.770 132.873 132.020 1.00 114.96 ? 848  ILE A O     1 
ATOM   6342  C  CB    . ILE A 1  848  ? 145.912 130.701 129.751 1.00 111.15 ? 848  ILE A CB    1 
ATOM   6343  C  CG1   . ILE A 1  848  ? 145.417 129.410 129.105 1.00 111.15 ? 848  ILE A CG1   1 
ATOM   6344  C  CG2   . ILE A 1  848  ? 146.586 130.414 131.082 1.00 111.15 ? 848  ILE A CG2   1 
ATOM   6345  C  CD1   . ILE A 1  848  ? 146.518 128.497 128.655 1.00 111.15 ? 848  ILE A CD1   1 
ATOM   6346  N  N     . ASP A 1  849  ? 145.818 133.840 130.284 1.00 121.69 ? 849  ASP A N     1 
ATOM   6347  C  CA    . ASP A 1  849  ? 146.135 135.031 131.067 1.00 121.69 ? 849  ASP A CA    1 
ATOM   6348  C  C     . ASP A 1  849  ? 144.864 135.715 131.556 1.00 121.69 ? 849  ASP A C     1 
ATOM   6349  O  O     . ASP A 1  849  ? 144.758 136.094 132.730 1.00 121.69 ? 849  ASP A O     1 
ATOM   6350  C  CB    . ASP A 1  849  ? 146.987 135.997 130.243 1.00 128.75 ? 849  ASP A CB    1 
ATOM   6351  C  CG    . ASP A 1  849  ? 148.400 135.493 130.037 1.00 128.75 ? 849  ASP A CG    1 
ATOM   6352  O  OD1   . ASP A 1  849  ? 148.817 134.575 130.772 1.00 128.75 ? 849  ASP A OD1   1 
ATOM   6353  O  OD2   . ASP A 1  849  ? 149.095 136.018 129.141 1.00 128.75 ? 849  ASP A OD2   1 
ATOM   6354  N  N     . THR A 1  850  ? 143.879 135.863 130.665 1.00 122.21 ? 850  THR A N     1 
ATOM   6355  C  CA    . THR A 1  850  ? 142.610 136.481 131.042 1.00 122.21 ? 850  THR A CA    1 
ATOM   6356  C  C     . THR A 1  850  ? 141.949 135.738 132.197 1.00 122.21 ? 850  THR A C     1 
ATOM   6357  O  O     . THR A 1  850  ? 141.447 136.356 133.143 1.00 122.21 ? 850  THR A O     1 
ATOM   6358  C  CB    . THR A 1  850  ? 141.674 136.531 129.833 1.00 122.46 ? 850  THR A CB    1 
ATOM   6359  O  OG1   . THR A 1  850  ? 142.256 137.344 128.807 1.00 122.46 ? 850  THR A OG1   1 
ATOM   6360  C  CG2   . THR A 1  850  ? 140.316 137.100 130.226 1.00 122.46 ? 850  THR A CG2   1 
ATOM   6361  N  N     . ALA A 1  851  ? 141.947 134.404 132.143 1.00 123.05 ? 851  ALA A N     1 
ATOM   6362  C  CA    . ALA A 1  851  ? 141.271 133.634 133.183 1.00 123.05 ? 851  ALA A CA    1 
ATOM   6363  C  C     . ALA A 1  851  ? 142.045 133.662 134.497 1.00 123.05 ? 851  ALA A C     1 
ATOM   6364  O  O     . ALA A 1  851  ? 141.443 133.731 135.575 1.00 123.05 ? 851  ALA A O     1 
ATOM   6365  C  CB    . ALA A 1  851  ? 141.063 132.193 132.718 1.00 120.77 ? 851  ALA A CB    1 
ATOM   6366  N  N     . VAL A 1  852  ? 143.375 133.611 134.431 1.00 127.02 ? 852  VAL A N     1 
ATOM   6367  C  CA    . VAL A 1  852  ? 144.181 133.440 135.636 1.00 127.02 ? 852  VAL A CA    1 
ATOM   6368  C  C     . VAL A 1  852  ? 144.343 134.757 136.385 1.00 127.02 ? 852  VAL A C     1 
ATOM   6369  O  O     . VAL A 1  852  ? 144.308 134.788 137.621 1.00 127.02 ? 852  VAL A O     1 
ATOM   6370  C  CB    . VAL A 1  852  ? 145.544 132.818 135.279 1.00 127.08 ? 852  VAL A CB    1 
ATOM   6371  C  CG1   . VAL A 1  852  ? 146.455 132.783 136.495 1.00 127.08 ? 852  VAL A CG1   1 
ATOM   6372  C  CG2   . VAL A 1  852  ? 145.353 131.412 134.736 1.00 127.08 ? 852  VAL A CG2   1 
ATOM   6373  N  N     . LYS A 1  853  ? 144.517 135.868 135.659 1.00 133.36 ? 853  LYS A N     1 
ATOM   6374  C  CA    . LYS A 1  853  ? 144.871 137.118 136.329 1.00 133.36 ? 853  LYS A CA    1 
ATOM   6375  C  C     . LYS A 1  853  ? 143.761 137.613 137.249 1.00 133.36 ? 853  LYS A C     1 
ATOM   6376  O  O     . LYS A 1  853  ? 144.045 138.232 138.282 1.00 133.36 ? 853  LYS A O     1 
ATOM   6377  C  CB    . LYS A 1  853  ? 145.214 138.199 135.301 1.00 136.53 ? 853  LYS A CB    1 
ATOM   6378  C  CG    . LYS A 1  853  ? 144.050 138.641 134.429 1.00 136.53 ? 853  LYS A CG    1 
ATOM   6379  C  CD    . LYS A 1  853  ? 144.486 139.702 133.438 1.00 136.53 ? 853  LYS A CD    1 
ATOM   6380  C  CE    . LYS A 1  853  ? 143.342 140.123 132.532 1.00 136.53 ? 853  LYS A CE    1 
ATOM   6381  N  NZ    . LYS A 1  853  ? 143.773 141.143 131.536 1.00 136.53 ? 853  LYS A NZ    1 
ATOM   6382  N  N     . THR A 1  854  ? 142.499 137.331 136.908 1.00 135.07 ? 854  THR A N     1 
ATOM   6383  C  CA    . THR A 1  854  ? 141.377 137.954 137.606 1.00 135.07 ? 854  THR A CA    1 
ATOM   6384  C  C     . THR A 1  854  ? 141.369 137.609 139.091 1.00 135.07 ? 854  THR A C     1 
ATOM   6385  O  O     . THR A 1  854  ? 141.097 138.474 139.934 1.00 135.07 ? 854  THR A O     1 
ATOM   6386  C  CB    . THR A 1  854  ? 140.059 137.536 136.954 1.00 133.19 ? 854  THR A CB    1 
ATOM   6387  O  OG1   . THR A 1  854  ? 139.952 136.107 136.958 1.00 133.19 ? 854  THR A OG1   1 
ATOM   6388  C  CG2   . THR A 1  854  ? 139.985 138.045 135.523 1.00 133.19 ? 854  THR A CG2   1 
ATOM   6389  N  N     . ALA A 1  855  ? 141.668 136.355 139.433 1.00 134.18 ? 855  ALA A N     1 
ATOM   6390  C  CA    . ALA A 1  855  ? 141.623 135.934 140.830 1.00 134.18 ? 855  ALA A CA    1 
ATOM   6391  C  C     . ALA A 1  855  ? 142.692 136.643 141.653 1.00 134.18 ? 855  ALA A C     1 
ATOM   6392  O  O     . ALA A 1  855  ? 142.420 137.153 142.747 1.00 134.18 ? 855  ALA A O     1 
ATOM   6393  C  CB    . ALA A 1  855  ? 141.783 134.417 140.923 1.00 133.94 ? 855  ALA A CB    1 
ATOM   6394  N  N     . GLU A 1  856  ? 143.923 136.684 141.136 1.00 134.69 ? 856  GLU A N     1 
ATOM   6395  C  CA    . GLU A 1  856  ? 145.000 137.355 141.856 1.00 134.69 ? 856  GLU A CA    1 
ATOM   6396  C  C     . GLU A 1  856  ? 144.730 138.849 141.987 1.00 134.69 ? 856  GLU A C     1 
ATOM   6397  O  O     . GLU A 1  856  ? 144.987 139.442 143.042 1.00 134.69 ? 856  GLU A O     1 
ATOM   6398  C  CB    . GLU A 1  856  ? 146.336 137.110 141.155 1.00 141.04 ? 856  GLU A CB    1 
ATOM   6399  C  CG    . GLU A 1  856  ? 146.806 135.664 141.195 1.00 141.04 ? 856  GLU A CG    1 
ATOM   6400  C  CD    . GLU A 1  856  ? 148.117 135.458 140.462 1.00 141.04 ? 856  GLU A CD    1 
ATOM   6401  O  OE1   . GLU A 1  856  ? 148.570 136.395 139.771 1.00 141.04 ? 856  GLU A OE1   1 
ATOM   6402  O  OE2   . GLU A 1  856  ? 148.696 134.358 140.579 1.00 141.04 ? 856  GLU A OE2   1 
ATOM   6403  N  N     . THR A 1  857  ? 144.205 139.473 140.931 1.00 134.13 ? 857  THR A N     1 
ATOM   6404  C  CA    . THR A 1  857  ? 143.899 140.900 140.992 1.00 134.13 ? 857  THR A CA    1 
ATOM   6405  C  C     . THR A 1  857  ? 142.823 141.187 142.034 1.00 134.13 ? 857  THR A C     1 
ATOM   6406  O  O     . THR A 1  857  ? 142.941 142.130 142.825 1.00 134.13 ? 857  THR A O     1 
ATOM   6407  C  CB    . THR A 1  857  ? 143.466 141.408 139.618 1.00 137.53 ? 857  THR A CB    1 
ATOM   6408  O  OG1   . THR A 1  857  ? 142.319 140.672 139.173 1.00 137.53 ? 857  THR A OG1   1 
ATOM   6409  C  CG2   . THR A 1  857  ? 144.592 141.248 138.613 1.00 137.53 ? 857  THR A CG2   1 
ATOM   6410  N  N     . GLY A 1  858  ? 141.760 140.380 142.047 1.00 131.38 ? 858  GLY A N     1 
ATOM   6411  C  CA    . GLY A 1  858  ? 140.704 140.588 143.027 1.00 131.38 ? 858  GLY A CA    1 
ATOM   6412  C  C     . GLY A 1  858  ? 141.167 140.339 144.450 1.00 131.38 ? 858  GLY A C     1 
ATOM   6413  O  O     . GLY A 1  858  ? 140.748 141.032 145.382 1.00 131.38 ? 858  GLY A O     1 
ATOM   6414  N  N     . TYR A 1  859  ? 142.041 139.350 144.638 1.00 128.92 ? 859  TYR A N     1 
ATOM   6415  C  CA    . TYR A 1  859  ? 142.542 139.045 145.974 1.00 128.92 ? 859  TYR A CA    1 
ATOM   6416  C  C     . TYR A 1  859  ? 143.462 140.155 146.480 1.00 128.92 ? 859  TYR A C     1 
ATOM   6417  O  O     . TYR A 1  859  ? 143.386 140.558 147.648 1.00 128.92 ? 859  TYR A O     1 
ATOM   6418  C  CB    . TYR A 1  859  ? 143.244 137.686 145.950 1.00 135.38 ? 859  TYR A CB    1 
ATOM   6419  C  CG    . TYR A 1  859  ? 143.889 137.255 147.245 1.00 135.38 ? 859  TYR A CG    1 
ATOM   6420  C  CD1   . TYR A 1  859  ? 143.117 136.910 148.347 1.00 135.38 ? 859  TYR A CD1   1 
ATOM   6421  C  CD2   . TYR A 1  859  ? 145.266 137.120 147.344 1.00 135.38 ? 859  TYR A CD2   1 
ATOM   6422  C  CE1   . TYR A 1  859  ? 143.702 136.496 149.527 1.00 135.38 ? 859  TYR A CE1   1 
ATOM   6423  C  CE2   . TYR A 1  859  ? 145.861 136.695 148.515 1.00 135.38 ? 859  TYR A CE2   1 
ATOM   6424  C  CZ    . TYR A 1  859  ? 145.075 136.390 149.605 1.00 135.38 ? 859  TYR A CZ    1 
ATOM   6425  O  OH    . TYR A 1  859  ? 145.665 135.973 150.776 1.00 135.38 ? 859  TYR A OH    1 
ATOM   6426  N  N     . ILE A 1  860  ? 144.324 140.679 145.603 1.00 124.89 ? 860  ILE A N     1 
ATOM   6427  C  CA    . ILE A 1  860  ? 145.157 141.825 145.967 1.00 124.89 ? 860  ILE A CA    1 
ATOM   6428  C  C     . ILE A 1  860  ? 144.284 143.030 146.297 1.00 124.89 ? 860  ILE A C     1 
ATOM   6429  O  O     . ILE A 1  860  ? 144.524 143.746 147.277 1.00 124.89 ? 860  ILE A O     1 
ATOM   6430  C  CB    . ILE A 1  860  ? 146.155 142.145 144.840 1.00 124.75 ? 860  ILE A CB    1 
ATOM   6431  C  CG1   . ILE A 1  860  ? 147.179 141.021 144.691 1.00 124.75 ? 860  ILE A CG1   1 
ATOM   6432  C  CG2   . ILE A 1  860  ? 146.854 143.470 145.095 1.00 124.75 ? 860  ILE A CG2   1 
ATOM   6433  C  CD1   . ILE A 1  860  ? 148.044 141.164 143.461 1.00 124.75 ? 860  ILE A CD1   1 
ATOM   6434  N  N     . GLN A 1  861  ? 143.260 143.274 145.474 1.00 123.31 ? 861  GLN A N     1 
ATOM   6435  C  CA    . GLN A 1  861  ? 142.293 144.330 145.758 1.00 123.31 ? 861  GLN A CA    1 
ATOM   6436  C  C     . GLN A 1  861  ? 141.713 144.183 147.158 1.00 123.31 ? 861  GLN A C     1 
ATOM   6437  O  O     . GLN A 1  861  ? 141.689 145.142 147.942 1.00 123.31 ? 861  GLN A O     1 
ATOM   6438  C  CB    . GLN A 1  861  ? 141.176 144.298 144.713 1.00 124.74 ? 861  GLN A CB    1 
ATOM   6439  C  CG    . GLN A 1  861  ? 140.083 145.343 144.908 1.00 124.74 ? 861  GLN A CG    1 
ATOM   6440  C  CD    . GLN A 1  861  ? 140.542 146.757 144.620 1.00 124.74 ? 861  GLN A CD    1 
ATOM   6441  O  OE1   . GLN A 1  861  ? 140.877 147.514 145.531 1.00 124.74 ? 861  GLN A OE1   1 
ATOM   6442  N  NE2   . GLN A 1  861  ? 140.535 147.130 143.346 1.00 124.74 ? 861  GLN A NE2   1 
ATOM   6443  N  N     . ARG A 1  862  ? 141.250 142.976 147.493 1.00 124.19 ? 862  ARG A N     1 
ATOM   6444  C  CA    . ARG A 1  862  ? 140.659 142.751 148.807 1.00 124.19 ? 862  ARG A CA    1 
ATOM   6445  C  C     . ARG A 1  862  ? 141.661 143.034 149.917 1.00 124.19 ? 862  ARG A C     1 
ATOM   6446  O  O     . ARG A 1  862  ? 141.333 143.694 150.906 1.00 124.19 ? 862  ARG A O     1 
ATOM   6447  C  CB    . ARG A 1  862  ? 140.134 141.321 148.923 1.00 128.25 ? 862  ARG A CB    1 
ATOM   6448  C  CG    . ARG A 1  862  ? 139.500 141.040 150.271 1.00 128.25 ? 862  ARG A CG    1 
ATOM   6449  C  CD    . ARG A 1  862  ? 139.025 139.606 150.383 1.00 128.25 ? 862  ARG A CD    1 
ATOM   6450  N  NE    . ARG A 1  862  ? 138.375 139.361 151.665 1.00 128.25 ? 862  ARG A NE    1 
ATOM   6451  C  CZ    . ARG A 1  862  ? 139.022 139.049 152.782 1.00 128.25 ? 862  ARG A CZ    1 
ATOM   6452  N  NH1   . ARG A 1  862  ? 140.344 138.948 152.779 1.00 128.25 ? 862  ARG A NH1   1 
ATOM   6453  N  NH2   . ARG A 1  862  ? 138.347 138.847 153.905 1.00 128.25 ? 862  ARG A NH2   1 
ATOM   6454  N  N     . ARG A 1  863  ? 142.892 142.543 149.768 1.00 121.90 ? 863  ARG A N     1 
ATOM   6455  C  CA    . ARG A 1  863  ? 143.902 142.754 150.802 1.00 121.90 ? 863  ARG A CA    1 
ATOM   6456  C  C     . ARG A 1  863  ? 144.179 144.240 151.010 1.00 121.90 ? 863  ARG A C     1 
ATOM   6457  O  O     . ARG A 1  863  ? 144.267 144.714 152.151 1.00 121.90 ? 863  ARG A O     1 
ATOM   6458  C  CB    . ARG A 1  863  ? 145.177 142.000 150.431 1.00 131.85 ? 863  ARG A CB    1 
ATOM   6459  C  CG    . ARG A 1  863  ? 144.977 140.498 150.411 1.00 131.85 ? 863  ARG A CG    1 
ATOM   6460  C  CD    . ARG A 1  863  ? 146.151 139.759 149.792 1.00 131.85 ? 863  ARG A CD    1 
ATOM   6461  N  NE    . ARG A 1  863  ? 147.394 139.857 150.546 1.00 131.85 ? 863  ARG A NE    1 
ATOM   6462  C  CZ    . ARG A 1  863  ? 148.545 139.332 150.138 1.00 131.85 ? 863  ARG A CZ    1 
ATOM   6463  N  NH1   . ARG A 1  863  ? 148.601 138.671 148.988 1.00 131.85 ? 863  ARG A NH1   1 
ATOM   6464  N  NH2   . ARG A 1  863  ? 149.637 139.458 150.878 1.00 131.85 ? 863  ARG A NH2   1 
ATOM   6465  N  N     . LEU A 1  864  ? 144.306 144.993 149.915 1.00 119.65 ? 864  LEU A N     1 
ATOM   6466  C  CA    . LEU A 1  864  ? 144.516 146.435 150.023 1.00 119.65 ? 864  LEU A CA    1 
ATOM   6467  C  C     . LEU A 1  864  ? 143.362 147.104 150.759 1.00 119.65 ? 864  LEU A C     1 
ATOM   6468  O  O     . LEU A 1  864  ? 143.576 147.920 151.666 1.00 119.65 ? 864  LEU A O     1 
ATOM   6469  C  CB    . LEU A 1  864  ? 144.687 147.050 148.634 1.00 121.35 ? 864  LEU A CB    1 
ATOM   6470  C  CG    . LEU A 1  864  ? 145.924 146.657 147.827 1.00 121.35 ? 864  LEU A CG    1 
ATOM   6471  C  CD1   . LEU A 1  864  ? 145.851 147.244 146.428 1.00 121.35 ? 864  LEU A CD1   1 
ATOM   6472  C  CD2   . LEU A 1  864  ? 147.193 147.109 148.528 1.00 121.35 ? 864  LEU A CD2   1 
ATOM   6473  N  N     . ILE A 1  865  ? 142.125 146.768 150.382 1.00 118.46 ? 865  ILE A N     1 
ATOM   6474  C  CA    . ILE A 1  865  ? 140.968 147.400 151.011 1.00 118.46 ? 865  ILE A CA    1 
ATOM   6475  C  C     . ILE A 1  865  ? 140.910 147.061 152.496 1.00 118.46 ? 865  ILE A C     1 
ATOM   6476  O  O     . ILE A 1  865  ? 140.629 147.926 153.333 1.00 118.46 ? 865  ILE A O     1 
ATOM   6477  C  CB    . ILE A 1  865  ? 139.673 146.991 150.287 1.00 119.45 ? 865  ILE A CB    1 
ATOM   6478  C  CG1   . ILE A 1  865  ? 139.669 147.535 148.858 1.00 119.45 ? 865  ILE A CG1   1 
ATOM   6479  C  CG2   . ILE A 1  865  ? 138.461 147.500 151.043 1.00 119.45 ? 865  ILE A CG2   1 
ATOM   6480  C  CD1   . ILE A 1  865  ? 138.543 147.001 148.005 1.00 119.45 ? 865  ILE A CD1   1 
ATOM   6481  N  N     . LYS A 1  866  ? 141.183 145.802 152.848 1.00 119.21 ? 866  LYS A N     1 
ATOM   6482  C  CA    . LYS A 1  866  ? 141.153 145.403 154.250 1.00 119.21 ? 866  LYS A CA    1 
ATOM   6483  C  C     . LYS A 1  866  ? 142.229 146.108 155.060 1.00 119.21 ? 866  LYS A C     1 
ATOM   6484  O  O     . LYS A 1  866  ? 142.005 146.441 156.229 1.00 119.21 ? 866  LYS A O     1 
ATOM   6485  C  CB    . LYS A 1  866  ? 141.316 143.889 154.379 1.00 126.16 ? 866  LYS A CB    1 
ATOM   6486  C  CG    . LYS A 1  866  ? 140.233 143.078 153.695 1.00 126.16 ? 866  LYS A CG    1 
ATOM   6487  C  CD    . LYS A 1  866  ? 138.864 143.436 154.228 1.00 126.16 ? 866  LYS A CD    1 
ATOM   6488  C  CE    . LYS A 1  866  ? 138.676 142.891 155.628 1.00 126.16 ? 866  LYS A CE    1 
ATOM   6489  N  NZ    . LYS A 1  866  ? 137.300 143.127 156.134 1.00 126.16 ? 866  LYS A NZ    1 
ATOM   6490  N  N     . SER A 1  867  ? 143.401 146.344 154.466 1.00 117.86 ? 867  SER A N     1 
ATOM   6491  C  CA    . SER A 1  867  ? 144.465 147.010 155.212 1.00 117.86 ? 867  SER A CA    1 
ATOM   6492  C  C     . SER A 1  867  ? 144.193 148.504 155.363 1.00 117.86 ? 867  SER A C     1 
ATOM   6493  O  O     . SER A 1  867  ? 144.500 149.090 156.408 1.00 117.86 ? 867  SER A O     1 
ATOM   6494  C  CB    . SER A 1  867  ? 145.812 146.775 154.534 1.00 123.57 ? 867  SER A CB    1 
ATOM   6495  O  OG    . SER A 1  867  ? 145.843 147.351 153.243 1.00 123.57 ? 867  SER A OG    1 
ATOM   6496  N  N     . MET A 1  868  ? 143.614 149.136 154.343 1.00 117.80 ? 868  MET A N     1 
ATOM   6497  C  CA    . MET A 1  868  ? 143.405 150.579 154.350 1.00 117.80 ? 868  MET A CA    1 
ATOM   6498  C  C     . MET A 1  868  ? 142.051 151.014 154.894 1.00 117.80 ? 868  MET A C     1 
ATOM   6499  O  O     . MET A 1  868  ? 141.837 152.217 155.060 1.00 117.80 ? 868  MET A O     1 
ATOM   6500  C  CB    . MET A 1  868  ? 143.551 151.145 152.936 1.00 123.29 ? 868  MET A CB    1 
ATOM   6501  C  CG    . MET A 1  868  ? 144.943 151.161 152.351 1.00 123.29 ? 868  MET A CG    1 
ATOM   6502  S  SD    . MET A 1  868  ? 144.823 151.884 150.705 1.00 123.29 ? 868  MET A SD    1 
ATOM   6503  C  CE    . MET A 1  868  ? 146.522 151.850 150.165 1.00 123.29 ? 868  MET A CE    1 
ATOM   6504  N  N     . GLU A 1  869  ? 141.147 150.079 155.198 1.00 116.23 ? 869  GLU A N     1 
ATOM   6505  C  CA    . GLU A 1  869  ? 139.727 150.417 155.283 1.00 116.23 ? 869  GLU A CA    1 
ATOM   6506  C  C     . GLU A 1  869  ? 139.428 151.539 156.271 1.00 116.23 ? 869  GLU A C     1 
ATOM   6507  O  O     . GLU A 1  869  ? 138.485 152.309 156.062 1.00 116.23 ? 869  GLU A O     1 
ATOM   6508  C  CB    . GLU A 1  869  ? 138.906 149.177 155.647 1.00 129.55 ? 869  GLU A CB    1 
ATOM   6509  C  CG    . GLU A 1  869  ? 139.207 148.593 157.013 1.00 129.55 ? 869  GLU A CG    1 
ATOM   6510  C  CD    . GLU A 1  869  ? 138.395 147.345 157.290 1.00 129.55 ? 869  GLU A CD    1 
ATOM   6511  O  OE1   . GLU A 1  869  ? 137.392 147.123 156.581 1.00 129.55 ? 869  GLU A OE1   1 
ATOM   6512  O  OE2   . GLU A 1  869  ? 138.754 146.592 158.217 1.00 129.55 ? 869  GLU A OE2   1 
ATOM   6513  N  N     . SER A 1  870  ? 140.214 151.661 157.343 1.00 112.11 ? 870  SER A N     1 
ATOM   6514  C  CA    . SER A 1  870  ? 139.860 152.617 158.387 1.00 112.11 ? 870  SER A CA    1 
ATOM   6515  C  C     . SER A 1  870  ? 140.522 153.978 158.199 1.00 112.11 ? 870  SER A C     1 
ATOM   6516  O  O     . SER A 1  870  ? 140.227 154.909 158.955 1.00 112.11 ? 870  SER A O     1 
ATOM   6517  C  CB    . SER A 1  870  ? 140.228 152.049 159.756 1.00 117.89 ? 870  SER A CB    1 
ATOM   6518  O  OG    . SER A 1  870  ? 141.625 151.861 159.867 1.00 117.89 ? 870  SER A OG    1 
ATOM   6519  N  N     . VAL A 1  871  ? 141.406 154.122 157.209 1.00 109.37 ? 871  VAL A N     1 
ATOM   6520  C  CA    . VAL A 1  871  ? 142.105 155.387 157.016 1.00 109.37 ? 871  VAL A CA    1 
ATOM   6521  C  C     . VAL A 1  871  ? 141.125 156.438 156.508 1.00 109.37 ? 871  VAL A C     1 
ATOM   6522  O  O     . VAL A 1  871  ? 140.281 156.166 155.644 1.00 109.37 ? 871  VAL A O     1 
ATOM   6523  C  CB    . VAL A 1  871  ? 143.289 155.200 156.052 1.00 106.47 ? 871  VAL A CB    1 
ATOM   6524  C  CG1   . VAL A 1  871  ? 143.971 156.524 155.771 1.00 106.47 ? 871  VAL A CG1   1 
ATOM   6525  C  CG2   . VAL A 1  871  ? 144.284 154.200 156.625 1.00 106.47 ? 871  VAL A CG2   1 
ATOM   6526  N  N     . MET A 1  872  ? 141.227 157.649 157.056 1.00 107.07 ? 872  MET A N     1 
ATOM   6527  C  CA    . MET A 1  872  ? 140.253 158.694 156.779 1.00 107.07 ? 872  MET A CA    1 
ATOM   6528  C  C     . MET A 1  872  ? 140.923 160.049 156.995 1.00 107.07 ? 872  MET A C     1 
ATOM   6529  O  O     . MET A 1  872  ? 142.067 160.131 157.451 1.00 107.07 ? 872  MET A O     1 
ATOM   6530  C  CB    . MET A 1  872  ? 139.017 158.495 157.677 1.00 112.34 ? 872  MET A CB    1 
ATOM   6531  C  CG    . MET A 1  872  ? 137.878 159.477 157.501 1.00 112.34 ? 872  MET A CG    1 
ATOM   6532  S  SD    . MET A 1  872  ? 136.502 159.111 158.594 1.00 112.34 ? 872  MET A SD    1 
ATOM   6533  C  CE    . MET A 1  872  ? 137.195 159.564 160.188 1.00 112.34 ? 872  MET A CE    1 
ATOM   6534  N  N     . VAL A 1  873  ? 140.197 161.117 156.672 1.00 104.99 ? 873  VAL A N     1 
ATOM   6535  C  CA    . VAL A 1  873  ? 140.630 162.492 156.900 1.00 104.99 ? 873  VAL A CA    1 
ATOM   6536  C  C     . VAL A 1  873  ? 139.864 163.023 158.103 1.00 104.99 ? 873  VAL A C     1 
ATOM   6537  O  O     . VAL A 1  873  ? 138.648 163.238 158.035 1.00 104.99 ? 873  VAL A O     1 
ATOM   6538  C  CB    . VAL A 1  873  ? 140.406 163.381 155.668 1.00 103.39 ? 873  VAL A CB    1 
ATOM   6539  C  CG1   . VAL A 1  873  ? 140.638 164.836 156.019 1.00 103.39 ? 873  VAL A CG1   1 
ATOM   6540  C  CG2   . VAL A 1  873  ? 141.343 162.980 154.557 1.00 103.39 ? 873  VAL A CG2   1 
ATOM   6541  N  N     . LYS A 1  874  ? 140.573 163.232 159.208 1.00 108.05 ? 874  LYS A N     1 
ATOM   6542  C  CA    . LYS A 1  874  ? 139.969 163.813 160.395 1.00 108.05 ? 874  LYS A CA    1 
ATOM   6543  C  C     . LYS A 1  874  ? 139.709 165.301 160.177 1.00 108.05 ? 874  LYS A C     1 
ATOM   6544  O  O     . LYS A 1  874  ? 140.264 165.931 159.274 1.00 108.05 ? 874  LYS A O     1 
ATOM   6545  C  CB    . LYS A 1  874  ? 140.869 163.605 161.612 1.00 110.73 ? 874  LYS A CB    1 
ATOM   6546  C  CG    . LYS A 1  874  ? 141.182 162.152 161.917 1.00 110.73 ? 874  LYS A CG    1 
ATOM   6547  C  CD    . LYS A 1  874  ? 139.924 161.381 162.249 1.00 110.73 ? 874  LYS A CD    1 
ATOM   6548  C  CE    . LYS A 1  874  ? 140.247 159.945 162.618 1.00 110.73 ? 874  LYS A CE    1 
ATOM   6549  N  NZ    . LYS A 1  874  ? 139.013 159.182 162.948 1.00 110.73 ? 874  LYS A NZ    1 
ATOM   6550  N  N     . TYR A 1  875  ? 138.843 165.864 161.022 1.00 112.97 ? 875  TYR A N     1 
ATOM   6551  C  CA    . TYR A 1  875  ? 138.506 167.282 160.931 1.00 112.97 ? 875  TYR A CA    1 
ATOM   6552  C  C     . TYR A 1  875  ? 139.704 168.198 161.145 1.00 112.97 ? 875  TYR A C     1 
ATOM   6553  O  O     . TYR A 1  875  ? 139.593 169.402 160.886 1.00 112.97 ? 875  TYR A O     1 
ATOM   6554  C  CB    . TYR A 1  875  ? 137.402 167.622 161.930 1.00 120.16 ? 875  TYR A CB    1 
ATOM   6555  C  CG    . TYR A 1  875  ? 136.054 167.063 161.546 1.00 120.16 ? 875  TYR A CG    1 
ATOM   6556  C  CD1   . TYR A 1  875  ? 135.663 165.795 161.948 1.00 120.16 ? 875  TYR A CD1   1 
ATOM   6557  C  CD2   . TYR A 1  875  ? 135.180 167.801 160.759 1.00 120.16 ? 875  TYR A CD2   1 
ATOM   6558  C  CE1   . TYR A 1  875  ? 134.434 165.284 161.591 1.00 120.16 ? 875  TYR A CE1   1 
ATOM   6559  C  CE2   . TYR A 1  875  ? 133.950 167.301 160.399 1.00 120.16 ? 875  TYR A CE2   1 
ATOM   6560  C  CZ    . TYR A 1  875  ? 133.582 166.042 160.815 1.00 120.16 ? 875  TYR A CZ    1 
ATOM   6561  O  OH    . TYR A 1  875  ? 132.356 165.538 160.455 1.00 120.16 ? 875  TYR A OH    1 
ATOM   6562  N  N     . ASP A 1  876  ? 140.835 167.669 161.602 1.00 112.34 ? 876  ASP A N     1 
ATOM   6563  C  CA    . ASP A 1  876  ? 142.080 168.423 161.605 1.00 112.34 ? 876  ASP A CA    1 
ATOM   6564  C  C     . ASP A 1  876  ? 142.772 168.400 160.250 1.00 112.34 ? 876  ASP A C     1 
ATOM   6565  O  O     . ASP A 1  876  ? 143.842 169.001 160.109 1.00 112.34 ? 876  ASP A O     1 
ATOM   6566  C  CB    . ASP A 1  876  ? 143.032 167.870 162.670 1.00 122.49 ? 876  ASP A CB    1 
ATOM   6567  C  CG    . ASP A 1  876  ? 142.559 168.155 164.078 1.00 122.49 ? 876  ASP A CG    1 
ATOM   6568  O  OD1   . ASP A 1  876  ? 141.671 169.016 164.241 1.00 122.49 ? 876  ASP A OD1   1 
ATOM   6569  O  OD2   . ASP A 1  876  ? 143.079 167.525 165.022 1.00 122.49 ? 876  ASP A OD2   1 
ATOM   6570  N  N     . ALA A 1  877  ? 142.189 167.712 159.266 1.00 111.78 ? 877  ALA A N     1 
ATOM   6571  C  CA    . ALA A 1  877  ? 142.762 167.380 157.964 1.00 111.78 ? 877  ALA A CA    1 
ATOM   6572  C  C     . ALA A 1  877  ? 143.932 166.415 158.089 1.00 111.78 ? 877  ALA A C     1 
ATOM   6573  O  O     . ALA A 1  877  ? 144.451 165.956 157.065 1.00 111.78 ? 877  ALA A O     1 
ATOM   6574  C  CB    . ALA A 1  877  ? 143.200 168.616 157.166 1.00 112.67 ? 877  ALA A CB    1 
ATOM   6575  N  N     . THR A 1  878  ? 144.367 166.096 159.304 1.00 105.48 ? 878  THR A N     1 
ATOM   6576  C  CA    . THR A 1  878  ? 145.337 165.033 159.499 1.00 105.48 ? 878  THR A CA    1 
ATOM   6577  C  C     . THR A 1  878  ? 144.727 163.705 159.082 1.00 105.48 ? 878  THR A C     1 
ATOM   6578  O  O     . THR A 1  878  ? 143.561 163.422 159.366 1.00 105.48 ? 878  THR A O     1 
ATOM   6579  C  CB    . THR A 1  878  ? 145.776 164.970 160.960 1.00 105.83 ? 878  THR A CB    1 
ATOM   6580  O  OG1   . THR A 1  878  ? 144.633 164.733 161.789 1.00 105.83 ? 878  THR A OG1   1 
ATOM   6581  C  CG2   . THR A 1  878  ? 146.427 166.275 161.379 1.00 105.83 ? 878  THR A CG2   1 
ATOM   6582  N  N     . VAL A 1  879  ? 145.523 162.885 158.407 1.00 103.34 ? 879  VAL A N     1 
ATOM   6583  C  CA    . VAL A 1  879  ? 145.064 161.587 157.936 1.00 103.34 ? 879  VAL A CA    1 
ATOM   6584  C  C     . VAL A 1  879  ? 145.391 160.574 159.024 1.00 103.34 ? 879  VAL A C     1 
ATOM   6585  O  O     . VAL A 1  879  ? 146.560 160.261 159.264 1.00 103.34 ? 879  VAL A O     1 
ATOM   6586  C  CB    . VAL A 1  879  ? 145.716 161.211 156.603 1.00 104.05 ? 879  VAL A CB    1 
ATOM   6587  C  CG1   . VAL A 1  879  ? 145.304 159.816 156.194 1.00 104.05 ? 879  VAL A CG1   1 
ATOM   6588  C  CG2   . VAL A 1  879  ? 145.330 162.210 155.534 1.00 104.05 ? 879  VAL A CG2   1 
ATOM   6589  N  N     . ARG A 1  880  ? 144.358 160.057 159.680 1.00 105.61 ? 880  ARG A N     1 
ATOM   6590  C  CA    . ARG A 1  880  ? 144.529 159.157 160.808 1.00 105.61 ? 880  ARG A CA    1 
ATOM   6591  C  C     . ARG A 1  880  ? 143.712 157.899 160.572 1.00 105.61 ? 880  ARG A C     1 
ATOM   6592  O  O     . ARG A 1  880  ? 142.619 157.959 160.005 1.00 105.61 ? 880  ARG A O     1 
ATOM   6593  C  CB    . ARG A 1  880  ? 144.090 159.813 162.118 1.00 107.36 ? 880  ARG A CB    1 
ATOM   6594  C  CG    . ARG A 1  880  ? 144.861 161.062 162.485 1.00 107.36 ? 880  ARG A CG    1 
ATOM   6595  C  CD    . ARG A 1  880  ? 144.463 161.560 163.862 1.00 107.36 ? 880  ARG A CD    1 
ATOM   6596  N  NE    . ARG A 1  880  ? 145.105 162.824 164.198 1.00 107.36 ? 880  ARG A NE    1 
ATOM   6597  C  CZ    . ARG A 1  880  ? 144.916 163.471 165.341 1.00 107.36 ? 880  ARG A CZ    1 
ATOM   6598  N  NH1   . ARG A 1  880  ? 144.124 162.958 166.271 1.00 107.36 ? 880  ARG A NH1   1 
ATOM   6599  N  NH2   . ARG A 1  880  ? 145.531 164.623 165.563 1.00 107.36 ? 880  ARG A NH2   1 
ATOM   6600  N  N     . ASN A 1  881  ? 144.242 156.764 161.014 1.00 113.16 ? 881  ASN A N     1 
ATOM   6601  C  CA    . ASN A 1  881  ? 143.520 155.504 160.914 1.00 113.16 ? 881  ASN A CA    1 
ATOM   6602  C  C     . ASN A 1  881  ? 142.532 155.391 162.077 1.00 113.16 ? 881  ASN A C     1 
ATOM   6603  O  O     . ASN A 1  881  ? 142.275 156.357 162.800 1.00 113.16 ? 881  ASN A O     1 
ATOM   6604  C  CB    . ASN A 1  881  ? 144.501 154.336 160.829 1.00 111.91 ? 881  ASN A CB    1 
ATOM   6605  C  CG    . ASN A 1  881  ? 145.465 154.280 162.002 1.00 111.91 ? 881  ASN A CG    1 
ATOM   6606  O  OD1   . ASN A 1  881  ? 145.128 154.638 163.128 1.00 111.91 ? 881  ASN A OD1   1 
ATOM   6607  N  ND2   . ASN A 1  881  ? 146.683 153.826 161.732 1.00 111.91 ? 881  ASN A ND2   1 
ATOM   6608  N  N     . SER A 1  882  ? 141.953 154.200 162.260 1.00 117.18 ? 882  SER A N     1 
ATOM   6609  C  CA    . SER A 1  882  ? 140.882 154.026 163.240 1.00 117.18 ? 882  SER A CA    1 
ATOM   6610  C  C     . SER A 1  882  ? 141.348 154.336 164.658 1.00 117.18 ? 882  SER A C     1 
ATOM   6611  O  O     . SER A 1  882  ? 140.537 154.700 165.518 1.00 117.18 ? 882  SER A O     1 
ATOM   6612  C  CB    . SER A 1  882  ? 140.339 152.599 163.178 1.00 117.94 ? 882  SER A CB    1 
ATOM   6613  O  OG    . SER A 1  882  ? 141.336 151.661 163.548 1.00 117.94 ? 882  SER A OG    1 
ATOM   6614  N  N     . ILE A 1  883  ? 142.646 154.206 164.920 1.00 113.51 ? 883  ILE A N     1 
ATOM   6615  C  CA    . ILE A 1  883  ? 143.161 154.220 166.284 1.00 113.51 ? 883  ILE A CA    1 
ATOM   6616  C  C     . ILE A 1  883  ? 143.582 155.643 166.637 1.00 113.51 ? 883  ILE A C     1 
ATOM   6617  O  O     . ILE A 1  883  ? 144.092 155.899 167.733 1.00 113.51 ? 883  ILE A O     1 
ATOM   6618  C  CB    . ILE A 1  883  ? 144.335 153.238 166.417 1.00 115.28 ? 883  ILE A CB    1 
ATOM   6619  C  CG1   . ILE A 1  883  ? 143.946 151.893 165.824 1.00 115.28 ? 883  ILE A CG1   1 
ATOM   6620  C  CG2   . ILE A 1  883  ? 144.655 152.968 167.877 1.00 115.28 ? 883  ILE A CG2   1 
ATOM   6621  C  CD1   . ILE A 1  883  ? 145.127 150.995 165.600 1.00 115.28 ? 883  ILE A CD1   1 
ATOM   6622  N  N     . ASN A 1  884  ? 143.373 156.573 165.706 1.00 111.00 ? 884  ASN A N     1 
ATOM   6623  C  CA    . ASN A 1  884  ? 143.779 157.979 165.745 1.00 111.00 ? 884  ASN A CA    1 
ATOM   6624  C  C     . ASN A 1  884  ? 145.274 158.142 165.492 1.00 111.00 ? 884  ASN A C     1 
ATOM   6625  O  O     . ASN A 1  884  ? 145.759 159.277 165.509 1.00 111.00 ? 884  ASN A O     1 
ATOM   6626  C  CB    . ASN A 1  884  ? 143.411 158.691 167.057 1.00 116.22 ? 884  ASN A CB    1 
ATOM   6627  C  CG    . ASN A 1  884  ? 141.919 158.898 167.208 1.00 116.22 ? 884  ASN A CG    1 
ATOM   6628  O  OD1   . ASN A 1  884  ? 141.183 158.932 166.221 1.00 116.22 ? 884  ASN A OD1   1 
ATOM   6629  N  ND2   . ASN A 1  884  ? 141.463 159.032 168.445 1.00 116.22 ? 884  ASN A ND2   1 
ATOM   6630  N  N     . GLN A 1  885  ? 146.025 157.058 165.296 1.00 110.14 ? 885  GLN A N     1 
ATOM   6631  C  CA    . GLN A 1  885  ? 147.422 157.180 164.903 1.00 110.14 ? 885  GLN A CA    1 
ATOM   6632  C  C     . GLN A 1  885  ? 147.527 157.954 163.595 1.00 110.14 ? 885  GLN A C     1 
ATOM   6633  O  O     . GLN A 1  885  ? 146.720 157.772 162.681 1.00 110.14 ? 885  GLN A O     1 
ATOM   6634  C  CB    . GLN A 1  885  ? 148.055 155.797 164.755 1.00 114.46 ? 885  GLN A CB    1 
ATOM   6635  C  CG    . GLN A 1  885  ? 148.143 155.020 166.058 1.00 114.46 ? 885  GLN A CG    1 
ATOM   6636  C  CD    . GLN A 1  885  ? 148.694 153.624 165.864 1.00 114.46 ? 885  GLN A CD    1 
ATOM   6637  O  OE1   . GLN A 1  885  ? 148.629 153.067 164.769 1.00 114.46 ? 885  GLN A OE1   1 
ATOM   6638  N  NE2   . GLN A 1  885  ? 149.236 153.048 166.929 1.00 114.46 ? 885  GLN A NE2   1 
ATOM   6639  N  N     . VAL A 1  886  ? 148.534 158.816 163.506 1.00 104.69 ? 886  VAL A N     1 
ATOM   6640  C  CA    . VAL A 1  886  ? 148.629 159.786 162.422 1.00 104.69 ? 886  VAL A CA    1 
ATOM   6641  C  C     . VAL A 1  886  ? 149.431 159.164 161.287 1.00 104.69 ? 886  VAL A C     1 
ATOM   6642  O  O     . VAL A 1  886  ? 150.633 158.924 161.422 1.00 104.69 ? 886  VAL A O     1 
ATOM   6643  C  CB    . VAL A 1  886  ? 149.269 161.093 162.900 1.00 103.79 ? 886  VAL A CB    1 
ATOM   6644  C  CG1   . VAL A 1  886  ? 149.482 162.035 161.731 1.00 103.79 ? 886  VAL A CG1   1 
ATOM   6645  C  CG2   . VAL A 1  886  ? 148.399 161.742 163.955 1.00 103.79 ? 886  VAL A CG2   1 
ATOM   6646  N  N     . VAL A 1  887  ? 148.764 158.904 160.163 1.00 105.50 ? 887  VAL A N     1 
ATOM   6647  C  CA    . VAL A 1  887  ? 149.463 158.431 158.974 1.00 105.50 ? 887  VAL A CA    1 
ATOM   6648  C  C     . VAL A 1  887  ? 150.148 159.591 158.264 1.00 105.50 ? 887  VAL A C     1 
ATOM   6649  O  O     . VAL A 1  887  ? 151.323 159.506 157.888 1.00 105.50 ? 887  VAL A O     1 
ATOM   6650  C  CB    . VAL A 1  887  ? 148.487 157.696 158.038 1.00 105.13 ? 887  VAL A CB    1 
ATOM   6651  C  CG1   . VAL A 1  887  ? 149.191 157.277 156.757 1.00 105.13 ? 887  VAL A CG1   1 
ATOM   6652  C  CG2   . VAL A 1  887  ? 147.893 156.492 158.743 1.00 105.13 ? 887  VAL A CG2   1 
ATOM   6653  N  N     . GLN A 1  888  ? 149.426 160.696 158.079 1.00 105.50 ? 888  GLN A N     1 
ATOM   6654  C  CA    . GLN A 1  888  ? 149.944 161.896 157.438 1.00 105.50 ? 888  GLN A CA    1 
ATOM   6655  C  C     . GLN A 1  888  ? 149.373 163.116 158.143 1.00 105.50 ? 888  GLN A C     1 
ATOM   6656  O  O     . GLN A 1  888  ? 148.253 163.072 158.661 1.00 105.50 ? 888  GLN A O     1 
ATOM   6657  C  CB    . GLN A 1  888  ? 149.583 161.943 155.948 1.00 107.62 ? 888  GLN A CB    1 
ATOM   6658  C  CG    . GLN A 1  888  ? 150.244 160.876 155.099 1.00 107.62 ? 888  GLN A CG    1 
ATOM   6659  C  CD    . GLN A 1  888  ? 149.785 160.916 153.655 1.00 107.62 ? 888  GLN A CD    1 
ATOM   6660  O  OE1   . GLN A 1  888  ? 148.692 161.393 153.354 1.00 107.62 ? 888  GLN A OE1   1 
ATOM   6661  N  NE2   . GLN A 1  888  ? 150.621 160.418 152.753 1.00 107.62 ? 888  GLN A NE2   1 
ATOM   6662  N  N     . LEU A 1  889  ? 150.145 164.205 158.161 1.00 106.95 ? 889  LEU A N     1 
ATOM   6663  C  CA    . LEU A 1  889  ? 149.667 165.433 158.790 1.00 106.95 ? 889  LEU A CA    1 
ATOM   6664  C  C     . LEU A 1  889  ? 148.684 166.167 157.887 1.00 106.95 ? 889  LEU A C     1 
ATOM   6665  O  O     . LEU A 1  889  ? 147.743 166.805 158.372 1.00 106.95 ? 889  LEU A O     1 
ATOM   6666  C  CB    . LEU A 1  889  ? 150.844 166.336 159.151 1.00 108.91 ? 889  LEU A CB    1 
ATOM   6667  C  CG    . LEU A 1  889  ? 151.780 165.783 160.227 1.00 108.91 ? 889  LEU A CG    1 
ATOM   6668  C  CD1   . LEU A 1  889  ? 152.981 166.692 160.431 1.00 108.91 ? 889  LEU A CD1   1 
ATOM   6669  C  CD2   . LEU A 1  889  ? 151.035 165.571 161.536 1.00 108.91 ? 889  LEU A CD2   1 
ATOM   6670  N  N     . ARG A 1  890  ? 148.896 166.101 156.575 1.00 107.73 ? 890  ARG A N     1 
ATOM   6671  C  CA    . ARG A 1  890  ? 147.956 166.627 155.599 1.00 107.73 ? 890  ARG A CA    1 
ATOM   6672  C  C     . ARG A 1  890  ? 147.786 165.590 154.499 1.00 107.73 ? 890  ARG A C     1 
ATOM   6673  O  O     . ARG A 1  890  ? 148.695 164.801 154.227 1.00 107.73 ? 890  ARG A O     1 
ATOM   6674  C  CB    . ARG A 1  890  ? 148.431 167.961 155.008 1.00 111.58 ? 890  ARG A CB    1 
ATOM   6675  C  CG    . ARG A 1  890  ? 148.626 169.071 156.032 1.00 111.58 ? 890  ARG A CG    1 
ATOM   6676  C  CD    . ARG A 1  890  ? 147.321 169.476 156.702 1.00 111.58 ? 890  ARG A CD    1 
ATOM   6677  N  NE    . ARG A 1  890  ? 147.517 170.553 157.669 1.00 111.58 ? 890  ARG A NE    1 
ATOM   6678  C  CZ    . ARG A 1  890  ? 146.609 170.933 158.562 1.00 111.58 ? 890  ARG A CZ    1 
ATOM   6679  N  NH1   . ARG A 1  890  ? 145.440 170.317 158.624 1.00 111.58 ? 890  ARG A NH1   1 
ATOM   6680  N  NH2   . ARG A 1  890  ? 146.872 171.923 159.404 1.00 111.58 ? 890  ARG A NH2   1 
ATOM   6681  N  N     . TYR A 1  891  ? 146.613 165.592 153.872 1.00 109.18 ? 891  TYR A N     1 
ATOM   6682  C  CA    . TYR A 1  891  ? 146.295 164.565 152.886 1.00 109.18 ? 891  TYR A CA    1 
ATOM   6683  C  C     . TYR A 1  891  ? 147.007 164.822 151.566 1.00 109.18 ? 891  TYR A C     1 
ATOM   6684  O  O     . TYR A 1  891  ? 146.907 165.909 150.991 1.00 109.18 ? 891  TYR A O     1 
ATOM   6685  C  CB    . TYR A 1  891  ? 144.789 164.490 152.663 1.00 106.78 ? 891  TYR A CB    1 
ATOM   6686  C  CG    . TYR A 1  891  ? 144.411 163.642 151.475 1.00 106.78 ? 891  TYR A CG    1 
ATOM   6687  C  CD1   . TYR A 1  891  ? 144.585 162.267 151.494 1.00 106.78 ? 891  TYR A CD1   1 
ATOM   6688  C  CD2   . TYR A 1  891  ? 143.855 164.214 150.344 1.00 106.78 ? 891  TYR A CD2   1 
ATOM   6689  C  CE1   . TYR A 1  891  ? 144.240 161.494 150.410 1.00 106.78 ? 891  TYR A CE1   1 
ATOM   6690  C  CE2   . TYR A 1  891  ? 143.501 163.446 149.260 1.00 106.78 ? 891  TYR A CE2   1 
ATOM   6691  C  CZ    . TYR A 1  891  ? 143.697 162.087 149.299 1.00 106.78 ? 891  TYR A CZ    1 
ATOM   6692  O  OH    . TYR A 1  891  ? 143.346 161.307 148.222 1.00 106.78 ? 891  TYR A OH    1 
ATOM   6693  N  N     . GLY A 1  892  ? 147.721 163.810 151.078 1.00 111.72 ? 892  GLY A N     1 
ATOM   6694  C  CA    . GLY A 1  892  ? 148.472 163.938 149.846 1.00 111.72 ? 892  GLY A CA    1 
ATOM   6695  C  C     . GLY A 1  892  ? 149.675 164.842 150.005 1.00 111.72 ? 892  GLY A C     1 
ATOM   6696  O  O     . GLY A 1  892  ? 150.344 165.187 149.026 1.00 111.72 ? 892  GLY A O     1 
ATOM   6697  N  N     . GLU A 1  893  ? 149.916 165.256 151.252 1.00 111.68 ? 893  GLU A N     1 
ATOM   6698  C  CA    . GLU A 1  893  ? 151.046 166.069 151.692 1.00 111.68 ? 893  GLU A CA    1 
ATOM   6699  C  C     . GLU A 1  893  ? 150.896 167.531 151.282 1.00 111.68 ? 893  GLU A C     1 
ATOM   6700  O  O     . GLU A 1  893  ? 151.561 168.402 151.852 1.00 111.68 ? 893  GLU A O     1 
ATOM   6701  C  CB    . GLU A 1  893  ? 152.364 165.493 151.161 1.00 116.28 ? 893  GLU A CB    1 
ATOM   6702  C  CG    . GLU A 1  893  ? 152.721 164.129 151.734 1.00 116.28 ? 893  GLU A CG    1 
ATOM   6703  C  CD    . GLU A 1  893  ? 153.938 163.506 151.070 1.00 116.28 ? 893  GLU A CD    1 
ATOM   6704  O  OE1   . GLU A 1  893  ? 154.389 164.022 150.025 1.00 116.28 ? 893  GLU A OE1   1 
ATOM   6705  O  OE2   . GLU A 1  893  ? 154.441 162.490 151.595 1.00 116.28 ? 893  GLU A OE2   1 
ATOM   6706  N  N     . ASP A 1  894  ? 150.037 167.817 150.300 1.00 112.99 ? 894  ASP A N     1 
ATOM   6707  C  CA    . ASP A 1  894  ? 149.592 169.178 150.025 1.00 112.99 ? 894  ASP A CA    1 
ATOM   6708  C  C     . ASP A 1  894  ? 148.195 169.480 150.565 1.00 112.99 ? 894  ASP A C     1 
ATOM   6709  O  O     . ASP A 1  894  ? 147.735 170.617 150.441 1.00 112.99 ? 894  ASP A O     1 
ATOM   6710  C  CB    . ASP A 1  894  ? 149.656 169.480 148.520 1.00 117.36 ? 894  ASP A CB    1 
ATOM   6711  C  CG    . ASP A 1  894  ? 148.820 168.527 147.687 1.00 117.36 ? 894  ASP A CG    1 
ATOM   6712  O  OD1   . ASP A 1  894  ? 148.304 167.540 148.244 1.00 117.36 ? 894  ASP A OD1   1 
ATOM   6713  O  OD2   . ASP A 1  894  ? 148.686 168.769 146.468 1.00 117.36 ? 894  ASP A OD2   1 
ATOM   6714  N  N     . GLY A 1  895  ? 147.510 168.499 151.148 1.00 111.03 ? 895  GLY A N     1 
ATOM   6715  C  CA    . GLY A 1  895  ? 146.238 168.755 151.814 1.00 111.03 ? 895  GLY A CA    1 
ATOM   6716  C  C     . GLY A 1  895  ? 145.038 168.945 150.910 1.00 111.03 ? 895  GLY A C     1 
ATOM   6717  O  O     . GLY A 1  895  ? 144.007 169.451 151.367 1.00 111.03 ? 895  GLY A O     1 
ATOM   6718  N  N     . LEU A 1  896  ? 145.133 168.552 149.641 1.00 111.04 ? 896  LEU A N     1 
ATOM   6719  C  CA    . LEU A 1  896  ? 144.080 168.799 148.665 1.00 111.04 ? 896  LEU A CA    1 
ATOM   6720  C  C     . LEU A 1  896  ? 143.437 167.495 148.205 1.00 111.04 ? 896  LEU A C     1 
ATOM   6721  O  O     . LEU A 1  896  ? 144.062 166.433 148.207 1.00 111.04 ? 896  LEU A O     1 
ATOM   6722  C  CB    . LEU A 1  896  ? 144.623 169.552 147.445 1.00 111.03 ? 896  LEU A CB    1 
ATOM   6723  C  CG    . LEU A 1  896  ? 145.136 170.976 147.649 1.00 111.03 ? 896  LEU A CG    1 
ATOM   6724  C  CD1   . LEU A 1  896  ? 145.745 171.485 146.361 1.00 111.03 ? 896  LEU A CD1   1 
ATOM   6725  C  CD2   . LEU A 1  896  ? 144.034 171.912 148.123 1.00 111.03 ? 896  LEU A CD2   1 
ATOM   6726  N  N     . ALA A 1  897  ? 142.166 167.591 147.814 1.00 113.61 ? 897  ALA A N     1 
ATOM   6727  C  CA    . ALA A 1  897  ? 141.488 166.469 147.185 1.00 113.61 ? 897  ALA A CA    1 
ATOM   6728  C  C     . ALA A 1  897  ? 142.033 166.253 145.777 1.00 113.61 ? 897  ALA A C     1 
ATOM   6729  O  O     . ALA A 1  897  ? 142.602 167.155 145.158 1.00 113.61 ? 897  ALA A O     1 
ATOM   6730  C  CB    . ALA A 1  897  ? 139.978 166.703 147.141 1.00 111.85 ? 897  ALA A CB    1 
ATOM   6731  N  N     . GLY A 1  898  ? 141.848 165.033 145.266 1.00 114.58 ? 898  GLY A N     1 
ATOM   6732  C  CA    . GLY A 1  898  ? 142.518 164.645 144.037 1.00 114.58 ? 898  GLY A CA    1 
ATOM   6733  C  C     . GLY A 1  898  ? 141.707 164.808 142.770 1.00 114.58 ? 898  GLY A C     1 
ATOM   6734  O  O     . GLY A 1  898  ? 142.261 164.659 141.677 1.00 114.58 ? 898  GLY A O     1 
ATOM   6735  N  N     . GLU A 1  899  ? 140.409 165.101 142.881 1.00 116.48 ? 899  GLU A N     1 
ATOM   6736  C  CA    . GLU A 1  899  ? 139.575 165.161 141.683 1.00 116.48 ? 899  GLU A CA    1 
ATOM   6737  C  C     . GLU A 1  899  ? 139.700 166.494 140.946 1.00 116.48 ? 899  GLU A C     1 
ATOM   6738  O  O     . GLU A 1  899  ? 139.643 166.524 139.712 1.00 116.48 ? 899  GLU A O     1 
ATOM   6739  C  CB    . GLU A 1  899  ? 138.112 164.887 142.038 1.00 126.01 ? 899  GLU A CB    1 
ATOM   6740  C  CG    . GLU A 1  899  ? 137.479 165.897 142.979 1.00 126.01 ? 899  GLU A CG    1 
ATOM   6741  C  CD    . GLU A 1  899  ? 136.047 165.543 143.327 1.00 126.01 ? 899  GLU A CD    1 
ATOM   6742  O  OE1   . GLU A 1  899  ? 135.444 164.725 142.599 1.00 126.01 ? 899  GLU A OE1   1 
ATOM   6743  O  OE2   . GLU A 1  899  ? 135.522 166.082 144.324 1.00 126.01 ? 899  GLU A OE2   1 
ATOM   6744  N  N     . SER A 1  900  ? 139.875 167.602 141.671 1.00 113.17 ? 900  SER A N     1 
ATOM   6745  C  CA    . SER A 1  900  ? 139.776 168.924 141.057 1.00 113.17 ? 900  SER A CA    1 
ATOM   6746  C  C     . SER A 1  900  ? 141.089 169.419 140.460 1.00 113.17 ? 900  SER A C     1 
ATOM   6747  O  O     . SER A 1  900  ? 141.110 170.509 139.881 1.00 113.17 ? 900  SER A O     1 
ATOM   6748  C  CB    . SER A 1  900  ? 139.271 169.938 142.086 1.00 110.24 ? 900  SER A CB    1 
ATOM   6749  O  OG    . SER A 1  900  ? 137.956 169.624 142.507 1.00 110.24 ? 900  SER A OG    1 
ATOM   6750  N  N     . VAL A 1  901  ? 142.171 168.659 140.591 1.00 110.26 ? 901  VAL A N     1 
ATOM   6751  C  CA    . VAL A 1  901  ? 143.478 169.099 140.118 1.00 110.26 ? 901  VAL A CA    1 
ATOM   6752  C  C     . VAL A 1  901  ? 143.612 168.865 138.614 1.00 110.26 ? 901  VAL A C     1 
ATOM   6753  O  O     . VAL A 1  901  ? 142.945 168.009 138.026 1.00 110.26 ? 901  VAL A O     1 
ATOM   6754  C  CB    . VAL A 1  901  ? 144.589 168.382 140.899 1.00 109.96 ? 901  VAL A CB    1 
ATOM   6755  C  CG1   . VAL A 1  901  ? 144.558 168.801 142.356 1.00 109.96 ? 901  VAL A CG1   1 
ATOM   6756  C  CG2   . VAL A 1  901  ? 144.400 166.883 140.793 1.00 109.96 ? 901  VAL A CG2   1 
ATOM   6757  N  N     . GLU A 1  902  ? 144.494 169.645 137.981 1.00 112.02 ? 902  GLU A N     1 
ATOM   6758  C  CA    . GLU A 1  902  ? 144.846 169.449 136.577 1.00 112.02 ? 902  GLU A CA    1 
ATOM   6759  C  C     . GLU A 1  902  ? 146.360 169.487 136.406 1.00 112.02 ? 902  GLU A C     1 
ATOM   6760  O  O     . GLU A 1  902  ? 147.105 169.851 137.321 1.00 112.02 ? 902  GLU A O     1 
ATOM   6761  C  CB    . GLU A 1  902  ? 144.219 170.500 135.652 1.00 118.33 ? 902  GLU A CB    1 
ATOM   6762  C  CG    . GLU A 1  902  ? 142.719 170.413 135.475 1.00 118.33 ? 902  GLU A CG    1 
ATOM   6763  C  CD    . GLU A 1  902  ? 142.215 171.406 134.443 1.00 118.33 ? 902  GLU A CD    1 
ATOM   6764  O  OE1   . GLU A 1  902  ? 143.015 172.256 133.999 1.00 118.33 ? 902  GLU A OE1   1 
ATOM   6765  O  OE2   . GLU A 1  902  ? 141.027 171.331 134.065 1.00 118.33 ? 902  GLU A OE2   1 
ATOM   6766  N  N     . PHE A 1  903  ? 146.809 169.093 135.213 1.00 110.87 ? 903  PHE A N     1 
ATOM   6767  C  CA    . PHE A 1  903  ? 148.214 169.205 134.847 1.00 110.87 ? 903  PHE A CA    1 
ATOM   6768  C  C     . PHE A 1  903  ? 148.563 170.637 134.458 1.00 110.87 ? 903  PHE A C     1 
ATOM   6769  O  O     . PHE A 1  903  ? 147.771 171.348 133.835 1.00 110.87 ? 903  PHE A O     1 
ATOM   6770  C  CB    . PHE A 1  903  ? 148.552 168.276 133.680 1.00 108.83 ? 903  PHE A CB    1 
ATOM   6771  C  CG    . PHE A 1  903  ? 148.482 166.820 134.020 1.00 108.83 ? 903  PHE A CG    1 
ATOM   6772  C  CD1   . PHE A 1  903  ? 149.549 166.191 134.634 1.00 108.83 ? 903  PHE A CD1   1 
ATOM   6773  C  CD2   . PHE A 1  903  ? 147.358 166.077 133.714 1.00 108.83 ? 903  PHE A CD2   1 
ATOM   6774  C  CE1   . PHE A 1  903  ? 149.495 164.850 134.944 1.00 108.83 ? 903  PHE A CE1   1 
ATOM   6775  C  CE2   . PHE A 1  903  ? 147.298 164.733 134.023 1.00 108.83 ? 903  PHE A CE2   1 
ATOM   6776  C  CZ    . PHE A 1  903  ? 148.368 164.121 134.639 1.00 108.83 ? 903  PHE A CZ    1 
ATOM   6777  N  N     . GLN A 1  904  ? 149.773 171.052 134.825 1.00 112.39 ? 904  GLN A N     1 
ATOM   6778  C  CA    . GLN A 1  904  ? 150.247 172.401 134.553 1.00 112.39 ? 904  GLN A CA    1 
ATOM   6779  C  C     . GLN A 1  904  ? 151.736 172.353 134.248 1.00 112.39 ? 904  GLN A C     1 
ATOM   6780  O  O     . GLN A 1  904  ? 152.404 171.338 134.458 1.00 112.39 ? 904  GLN A O     1 
ATOM   6781  C  CB    . GLN A 1  904  ? 149.984 173.341 135.731 1.00 113.98 ? 904  GLN A CB    1 
ATOM   6782  C  CG    . GLN A 1  904  ? 148.525 173.541 136.061 1.00 113.98 ? 904  GLN A CG    1 
ATOM   6783  C  CD    . GLN A 1  904  ? 148.335 174.482 137.221 1.00 113.98 ? 904  GLN A CD    1 
ATOM   6784  O  OE1   . GLN A 1  904  ? 149.252 174.714 138.000 1.00 113.98 ? 904  GLN A OE1   1 
ATOM   6785  N  NE2   . GLN A 1  904  ? 147.143 175.024 137.348 1.00 113.98 ? 904  GLN A NE2   1 
ATOM   6786  N  N     . ASN A 1  905  ? 152.248 173.469 133.735 1.00 115.93 ? 905  ASN A N     1 
ATOM   6787  C  CA    . ASN A 1  905  ? 153.673 173.665 133.522 1.00 115.93 ? 905  ASN A CA    1 
ATOM   6788  C  C     . ASN A 1  905  ? 154.172 174.775 134.436 1.00 115.93 ? 905  ASN A C     1 
ATOM   6789  O  O     . ASN A 1  905  ? 153.549 175.837 134.536 1.00 115.93 ? 905  ASN A O     1 
ATOM   6790  C  CB    . ASN A 1  905  ? 153.978 174.010 132.062 1.00 121.55 ? 905  ASN A CB    1 
ATOM   6791  C  CG    . ASN A 1  905  ? 153.768 172.834 131.132 1.00 121.55 ? 905  ASN A CG    1 
ATOM   6792  O  OD1   . ASN A 1  905  ? 153.809 171.680 131.558 1.00 121.55 ? 905  ASN A OD1   1 
ATOM   6793  N  ND2   . ASN A 1  905  ? 153.546 173.118 129.855 1.00 121.55 ? 905  ASN A ND2   1 
ATOM   6794  N  N     . LEU A 1  906  ? 155.298 174.521 135.104 1.00 119.68 ? 906  LEU A N     1 
ATOM   6795  C  CA    . LEU A 1  906  ? 155.861 175.501 136.028 1.00 119.68 ? 906  LEU A CA    1 
ATOM   6796  C  C     . LEU A 1  906  ? 156.410 176.714 135.284 1.00 119.68 ? 906  LEU A C     1 
ATOM   6797  O  O     . LEU A 1  906  ? 156.161 177.858 135.681 1.00 119.68 ? 906  LEU A O     1 
ATOM   6798  C  CB    . LEU A 1  906  ? 156.952 174.846 136.877 1.00 118.85 ? 906  LEU A CB    1 
ATOM   6799  C  CG    . LEU A 1  906  ? 156.499 173.722 137.812 1.00 118.85 ? 906  LEU A CG    1 
ATOM   6800  C  CD1   . LEU A 1  906  ? 157.695 173.078 138.490 1.00 118.85 ? 906  LEU A CD1   1 
ATOM   6801  C  CD2   . LEU A 1  906  ? 155.507 174.237 138.845 1.00 118.85 ? 906  LEU A CD2   1 
ATOM   6802  N  N     . ALA A 1  907  ? 157.190 176.474 134.227 1.00 123.83 ? 907  ALA A N     1 
ATOM   6803  C  CA    . ALA A 1  907  ? 157.691 177.491 133.304 1.00 123.83 ? 907  ALA A CA    1 
ATOM   6804  C  C     . ALA A 1  907  ? 158.724 178.417 133.940 1.00 123.83 ? 907  ALA A C     1 
ATOM   6805  O  O     . ALA A 1  907  ? 159.439 179.129 133.227 1.00 123.83 ? 907  ALA A O     1 
ATOM   6806  C  CB    . ALA A 1  907  ? 156.534 178.311 132.724 1.00 123.25 ? 907  ALA A CB    1 
ATOM   6807  N  N     . THR A 1  908  ? 158.814 178.422 135.272 1.00 124.23 ? 908  THR A N     1 
ATOM   6808  C  CA    . THR A 1  908  ? 159.991 178.974 135.930 1.00 124.23 ? 908  THR A CA    1 
ATOM   6809  C  C     . THR A 1  908  ? 161.114 177.949 135.946 1.00 124.23 ? 908  THR A C     1 
ATOM   6810  O  O     . THR A 1  908  ? 162.295 178.313 135.968 1.00 124.23 ? 908  THR A O     1 
ATOM   6811  C  CB    . THR A 1  908  ? 159.641 179.434 137.349 1.00 123.37 ? 908  THR A CB    1 
ATOM   6812  O  OG1   . THR A 1  908  ? 158.637 180.452 137.280 1.00 123.37 ? 908  THR A OG1   1 
ATOM   6813  C  CG2   . THR A 1  908  ? 160.859 180.010 138.050 1.00 123.37 ? 908  THR A CG2   1 
ATOM   6814  N  N     . LEU A 1  909  ? 160.757 176.669 135.930 1.00 124.93 ? 909  LEU A N     1 
ATOM   6815  C  CA    . LEU A 1  909  ? 161.728 175.601 135.782 1.00 124.93 ? 909  LEU A CA    1 
ATOM   6816  C  C     . LEU A 1  909  ? 162.045 175.393 134.306 1.00 124.93 ? 909  LEU A C     1 
ATOM   6817  O  O     . LEU A 1  909  ? 161.149 175.385 133.457 1.00 124.93 ? 909  LEU A O     1 
ATOM   6818  C  CB    . LEU A 1  909  ? 161.188 174.307 136.388 1.00 124.22 ? 909  LEU A CB    1 
ATOM   6819  C  CG    . LEU A 1  909  ? 162.092 173.079 136.314 1.00 124.22 ? 909  LEU A CG    1 
ATOM   6820  C  CD1   . LEU A 1  909  ? 163.320 173.280 137.186 1.00 124.22 ? 909  LEU A CD1   1 
ATOM   6821  C  CD2   . LEU A 1  909  ? 161.332 171.825 136.705 1.00 124.22 ? 909  LEU A CD2   1 
ATOM   6822  N  N     . LYS A 1  910  ? 163.331 175.244 134.009 1.00 127.03 ? 910  LYS A N     1 
ATOM   6823  C  CA    . LYS A 1  910  ? 163.879 174.976 132.683 1.00 127.03 ? 910  LYS A CA    1 
ATOM   6824  C  C     . LYS A 1  910  ? 163.550 176.027 131.611 1.00 127.03 ? 910  LYS A C     1 
ATOM   6825  O  O     . LYS A 1  910  ? 163.161 175.663 130.494 1.00 127.03 ? 910  LYS A O     1 
ATOM   6826  C  CB    . LYS A 1  910  ? 163.370 173.589 132.258 1.00 127.42 ? 910  LYS A CB    1 
ATOM   6827  C  CG    . LYS A 1  910  ? 163.966 172.948 131.011 1.00 127.42 ? 910  LYS A CG    1 
ATOM   6828  C  CD    . LYS A 1  910  ? 163.297 171.606 130.764 1.00 127.42 ? 910  LYS A CD    1 
ATOM   6829  C  CE    . LYS A 1  910  ? 163.794 170.952 129.491 1.00 127.42 ? 910  LYS A CE    1 
ATOM   6830  N  NZ    . LYS A 1  910  ? 163.119 169.645 129.269 1.00 127.42 ? 910  LYS A NZ    1 
ATOM   6831  N  N     . PRO A 1  911  ? 163.653 177.327 131.891 1.00 132.09 ? 911  PRO A N     1 
ATOM   6832  C  CA    . PRO A 1  911  ? 164.246 178.245 130.917 1.00 132.09 ? 911  PRO A CA    1 
ATOM   6833  C  C     . PRO A 1  911  ? 165.759 178.283 131.079 1.00 132.09 ? 911  PRO A C     1 
ATOM   6834  O  O     . PRO A 1  911  ? 166.309 177.928 132.124 1.00 132.09 ? 911  PRO A O     1 
ATOM   6835  C  CB    . PRO A 1  911  ? 163.619 179.600 131.268 1.00 129.22 ? 911  PRO A CB    1 
ATOM   6836  C  CG    . PRO A 1  911  ? 163.331 179.501 132.691 1.00 129.22 ? 911  PRO A CG    1 
ATOM   6837  C  CD    . PRO A 1  911  ? 162.901 178.081 132.912 1.00 129.22 ? 911  PRO A CD    1 
ATOM   6838  N  N     . SER A 1  912  ? 166.433 178.727 130.025 1.00 135.64 ? 912  SER A N     1 
ATOM   6839  C  CA    . SER A 1  912  ? 167.813 179.154 130.199 1.00 135.64 ? 912  SER A CA    1 
ATOM   6840  C  C     . SER A 1  912  ? 167.832 180.429 131.031 1.00 135.64 ? 912  SER A C     1 
ATOM   6841  O  O     . SER A 1  912  ? 166.906 181.243 130.964 1.00 135.64 ? 912  SER A O     1 
ATOM   6842  C  CB    . SER A 1  912  ? 168.484 179.387 128.847 1.00 135.98 ? 912  SER A CB    1 
ATOM   6843  O  OG    . SER A 1  912  ? 167.862 180.445 128.143 1.00 135.98 ? 912  SER A OG    1 
ATOM   6844  N  N     . ASN A 1  913  ? 168.885 180.592 131.837 1.00 134.73 ? 913  ASN A N     1 
ATOM   6845  C  CA    . ASN A 1  913  ? 168.965 181.754 132.719 1.00 134.73 ? 913  ASN A CA    1 
ATOM   6846  C  C     . ASN A 1  913  ? 168.868 183.049 131.919 1.00 134.73 ? 913  ASN A C     1 
ATOM   6847  O  O     . ASN A 1  913  ? 168.233 184.017 132.356 1.00 134.73 ? 913  ASN A O     1 
ATOM   6848  C  CB    . ASN A 1  913  ? 170.265 181.703 133.525 1.00 132.31 ? 913  ASN A CB    1 
ATOM   6849  C  CG    . ASN A 1  913  ? 170.289 182.698 134.673 1.00 132.31 ? 913  ASN A CG    1 
ATOM   6850  O  OD1   . ASN A 1  913  ? 169.528 183.665 134.700 1.00 132.31 ? 913  ASN A OD1   1 
ATOM   6851  N  ND2   . ASN A 1  913  ? 171.174 182.461 135.633 1.00 132.31 ? 913  ASN A ND2   1 
ATOM   6852  N  N     . LYS A 1  914  ? 169.478 183.074 130.734 1.00 134.00 ? 914  LYS A N     1 
ATOM   6853  C  CA    . LYS A 1  914  ? 169.341 184.186 129.802 1.00 134.00 ? 914  LYS A CA    1 
ATOM   6854  C  C     . LYS A 1  914  ? 167.873 184.445 129.484 1.00 134.00 ? 914  LYS A C     1 
ATOM   6855  O  O     . LYS A 1  914  ? 167.352 185.527 129.770 1.00 134.00 ? 914  LYS A O     1 
ATOM   6856  C  CB    . LYS A 1  914  ? 170.125 183.906 128.518 1.00 135.06 ? 914  LYS A CB    1 
ATOM   6857  C  CG    . LYS A 1  914  ? 170.020 185.007 127.479 1.00 135.06 ? 914  LYS A CG    1 
ATOM   6858  C  CD    . LYS A 1  914  ? 170.579 186.317 128.009 1.00 135.06 ? 914  LYS A CD    1 
ATOM   6859  C  CE    . LYS A 1  914  ? 170.605 187.385 126.929 1.00 135.06 ? 914  LYS A CE    1 
ATOM   6860  N  NZ    . LYS A 1  914  ? 170.969 188.721 127.479 1.00 135.06 ? 914  LYS A NZ    1 
ATOM   6861  N  N     . ALA A 1  915  ? 167.204 183.458 128.879 1.00 134.48 ? 915  ALA A N     1 
ATOM   6862  C  CA    . ALA A 1  915  ? 165.786 183.606 128.566 1.00 134.48 ? 915  ALA A CA    1 
ATOM   6863  C  C     . ALA A 1  915  ? 164.948 183.814 129.822 1.00 134.48 ? 915  ALA A C     1 
ATOM   6864  O  O     . ALA A 1  915  ? 163.900 184.467 129.765 1.00 134.48 ? 915  ALA A O     1 
ATOM   6865  C  CB    . ALA A 1  915  ? 165.288 182.386 127.793 1.00 133.56 ? 915  ALA A CB    1 
ATOM   6866  N  N     . PHE A 1  916  ? 165.387 183.267 130.957 1.00 131.60 ? 916  PHE A N     1 
ATOM   6867  C  CA    . PHE A 1  916  ? 164.694 183.495 132.221 1.00 131.60 ? 916  PHE A CA    1 
ATOM   6868  C  C     . PHE A 1  916  ? 164.638 184.983 132.546 1.00 131.60 ? 916  PHE A C     1 
ATOM   6869  O  O     . PHE A 1  916  ? 163.560 185.557 132.747 1.00 131.60 ? 916  PHE A O     1 
ATOM   6870  C  CB    . PHE A 1  916  ? 165.394 182.719 133.341 1.00 129.14 ? 916  PHE A CB    1 
ATOM   6871  C  CG    . PHE A 1  916  ? 164.801 182.943 134.705 1.00 129.14 ? 916  PHE A CG    1 
ATOM   6872  C  CD1   . PHE A 1  916  ? 163.681 182.242 135.113 1.00 129.14 ? 916  PHE A CD1   1 
ATOM   6873  C  CD2   . PHE A 1  916  ? 165.370 183.849 135.583 1.00 129.14 ? 916  PHE A CD2   1 
ATOM   6874  C  CE1   . PHE A 1  916  ? 163.140 182.443 136.370 1.00 129.14 ? 916  PHE A CE1   1 
ATOM   6875  C  CE2   . PHE A 1  916  ? 164.830 184.056 136.837 1.00 129.14 ? 916  PHE A CE2   1 
ATOM   6876  C  CZ    . PHE A 1  916  ? 163.712 183.353 137.230 1.00 129.14 ? 916  PHE A CZ    1 
ATOM   6877  N  N     . GLU A 1  917  ? 165.807 185.627 132.586 1.00 132.33 ? 917  GLU A N     1 
ATOM   6878  C  CA    . GLU A 1  917  ? 165.855 187.046 132.922 1.00 132.33 ? 917  GLU A CA    1 
ATOM   6879  C  C     . GLU A 1  917  ? 165.274 187.895 131.799 1.00 132.33 ? 917  GLU A C     1 
ATOM   6880  O  O     . GLU A 1  917  ? 164.816 189.017 132.027 1.00 132.33 ? 917  GLU A O     1 
ATOM   6881  C  CB    . GLU A 1  917  ? 167.294 187.460 133.237 1.00 137.53 ? 917  GLU A CB    1 
ATOM   6882  C  CG    . GLU A 1  917  ? 167.434 188.893 133.725 1.00 137.53 ? 917  GLU A CG    1 
ATOM   6883  C  CD    . GLU A 1  917  ? 168.861 189.253 134.087 1.00 137.53 ? 917  GLU A CD    1 
ATOM   6884  O  OE1   . GLU A 1  917  ? 169.754 188.396 133.916 1.00 137.53 ? 917  GLU A OE1   1 
ATOM   6885  O  OE2   . GLU A 1  917  ? 169.088 190.392 134.546 1.00 137.53 ? 917  GLU A OE2   1 
ATOM   6886  N  N     . LYS A 1  918  ? 165.276 187.375 130.572 1.00 131.74 ? 918  LYS A N     1 
ATOM   6887  C  CA    . LYS A 1  918  ? 164.656 188.117 129.481 1.00 131.74 ? 918  LYS A CA    1 
ATOM   6888  C  C     . LYS A 1  918  ? 163.140 188.135 129.627 1.00 131.74 ? 918  LYS A C     1 
ATOM   6889  O  O     . LYS A 1  918  ? 162.487 189.139 129.320 1.00 131.74 ? 918  LYS A O     1 
ATOM   6890  C  CB    . LYS A 1  918  ? 165.061 187.516 128.134 1.00 130.63 ? 918  LYS A CB    1 
ATOM   6891  C  CG    . LYS A 1  918  ? 164.536 188.286 126.931 1.00 130.63 ? 918  LYS A CG    1 
ATOM   6892  C  CD    . LYS A 1  918  ? 164.977 187.644 125.626 1.00 130.63 ? 918  LYS A CD    1 
ATOM   6893  C  CE    . LYS A 1  918  ? 164.323 186.287 125.426 1.00 130.63 ? 918  LYS A CE    1 
ATOM   6894  N  NZ    . LYS A 1  918  ? 162.846 186.402 125.275 1.00 130.63 ? 918  LYS A NZ    1 
ATOM   6895  N  N     . LYS A 1  919  ? 162.562 187.028 130.096 1.00 131.37 ? 919  LYS A N     1 
ATOM   6896  C  CA    . LYS A 1  919  ? 161.110 186.936 130.205 1.00 131.37 ? 919  LYS A CA    1 
ATOM   6897  C  C     . LYS A 1  919  ? 160.573 187.578 131.482 1.00 131.37 ? 919  LYS A C     1 
ATOM   6898  O  O     . LYS A 1  919  ? 159.534 188.246 131.446 1.00 131.37 ? 919  LYS A O     1 
ATOM   6899  C  CB    . LYS A 1  919  ? 160.676 185.472 130.127 1.00 129.61 ? 919  LYS A CB    1 
ATOM   6900  C  CG    . LYS A 1  919  ? 160.920 184.825 128.775 1.00 129.61 ? 919  LYS A CG    1 
ATOM   6901  C  CD    . LYS A 1  919  ? 160.578 183.345 128.807 1.00 129.61 ? 919  LYS A CD    1 
ATOM   6902  C  CE    . LYS A 1  919  ? 160.812 182.696 127.454 1.00 129.61 ? 919  LYS A CE    1 
ATOM   6903  N  NZ    . LYS A 1  919  ? 160.544 181.232 127.492 1.00 129.61 ? 919  LYS A NZ    1 
ATOM   6904  N  N     . PHE A 1  920  ? 161.228 187.356 132.622 1.00 131.14 ? 920  PHE A N     1 
ATOM   6905  C  CA    . PHE A 1  920  ? 160.628 187.671 133.916 1.00 131.14 ? 920  PHE A CA    1 
ATOM   6906  C  C     . PHE A 1  920  ? 161.100 188.980 134.553 1.00 131.14 ? 920  PHE A C     1 
ATOM   6907  O  O     . PHE A 1  920  ? 160.622 189.318 135.639 1.00 131.14 ? 920  PHE A O     1 
ATOM   6908  C  CB    . PHE A 1  920  ? 160.872 186.516 134.889 1.00 127.36 ? 920  PHE A CB    1 
ATOM   6909  C  CG    . PHE A 1  920  ? 160.223 185.220 134.475 1.00 127.36 ? 920  PHE A CG    1 
ATOM   6910  C  CD1   . PHE A 1  920  ? 159.159 185.200 133.590 1.00 127.36 ? 920  PHE A CD1   1 
ATOM   6911  C  CD2   . PHE A 1  920  ? 160.689 184.020 134.971 1.00 127.36 ? 920  PHE A CD2   1 
ATOM   6912  C  CE1   . PHE A 1  920  ? 158.571 184.002 133.217 1.00 127.36 ? 920  PHE A CE1   1 
ATOM   6913  C  CE2   . PHE A 1  920  ? 160.112 182.824 134.602 1.00 127.36 ? 920  PHE A CE2   1 
ATOM   6914  C  CZ    . PHE A 1  920  ? 159.053 182.816 133.724 1.00 127.36 ? 920  PHE A CZ    1 
ATOM   6915  N  N     . ARG A 1  921  ? 162.009 189.730 133.923 1.00 136.52 ? 921  ARG A N     1 
ATOM   6916  C  CA    . ARG A 1  921  ? 162.730 190.771 134.658 1.00 136.52 ? 921  ARG A CA    1 
ATOM   6917  C  C     . ARG A 1  921  ? 161.909 192.047 134.832 1.00 136.52 ? 921  ARG A C     1 
ATOM   6918  O  O     . ARG A 1  921  ? 162.045 192.739 135.848 1.00 136.52 ? 921  ARG A O     1 
ATOM   6919  C  CB    . ARG A 1  921  ? 164.048 191.090 133.957 1.00 141.98 ? 921  ARG A CB    1 
ATOM   6920  C  CG    . ARG A 1  921  ? 164.876 192.182 134.605 1.00 141.98 ? 921  ARG A CG    1 
ATOM   6921  C  CD    . ARG A 1  921  ? 165.313 191.793 136.002 1.00 141.98 ? 921  ARG A CD    1 
ATOM   6922  N  NE    . ARG A 1  921  ? 166.135 192.830 136.619 1.00 141.98 ? 921  ARG A NE    1 
ATOM   6923  C  CZ    . ARG A 1  921  ? 165.649 193.877 137.277 1.00 141.98 ? 921  ARG A CZ    1 
ATOM   6924  N  NH1   . ARG A 1  921  ? 164.339 194.033 137.405 1.00 141.98 ? 921  ARG A NH1   1 
ATOM   6925  N  NH2   . ARG A 1  921  ? 166.474 194.770 137.806 1.00 141.98 ? 921  ARG A NH2   1 
ATOM   6926  N  N     . PHE A 1  922  ? 161.053 192.372 133.862 1.00 142.65 ? 922  PHE A N     1 
ATOM   6927  C  CA    . PHE A 1  922  ? 160.399 193.681 133.756 1.00 142.65 ? 922  PHE A CA    1 
ATOM   6928  C  C     . PHE A 1  922  ? 161.441 194.798 133.628 1.00 142.65 ? 922  PHE A C     1 
ATOM   6929  O  O     . PHE A 1  922  ? 161.760 195.519 134.575 1.00 142.65 ? 922  PHE A O     1 
ATOM   6930  C  CB    . PHE A 1  922  ? 159.443 193.959 134.925 1.00 137.98 ? 922  PHE A CB    1 
ATOM   6931  C  CG    . PHE A 1  922  ? 158.709 195.271 134.799 1.00 137.98 ? 922  PHE A CG    1 
ATOM   6932  C  CD1   . PHE A 1  922  ? 157.589 195.372 133.993 1.00 137.98 ? 922  PHE A CD1   1 
ATOM   6933  C  CD2   . PHE A 1  922  ? 159.143 196.402 135.470 1.00 137.98 ? 922  PHE A CD2   1 
ATOM   6934  C  CE1   . PHE A 1  922  ? 156.911 196.568 133.864 1.00 137.98 ? 922  PHE A CE1   1 
ATOM   6935  C  CE2   . PHE A 1  922  ? 158.470 197.604 135.342 1.00 137.98 ? 922  PHE A CE2   1 
ATOM   6936  C  CZ    . PHE A 1  922  ? 157.352 197.685 134.540 1.00 137.98 ? 922  PHE A CZ    1 
ATOM   6937  N  N     . ASP A 1  923  ? 162.009 194.885 132.428 1.00 148.87 ? 923  ASP A N     1 
ATOM   6938  C  CA    . ASP A 1  923  ? 162.908 195.987 132.117 1.00 148.87 ? 923  ASP A CA    1 
ATOM   6939  C  C     . ASP A 1  923  ? 162.090 197.246 131.860 1.00 148.87 ? 923  ASP A C     1 
ATOM   6940  O  O     . ASP A 1  923  ? 161.299 197.302 130.913 1.00 148.87 ? 923  ASP A O     1 
ATOM   6941  C  CB    . ASP A 1  923  ? 163.757 195.652 130.892 1.00 154.92 ? 923  ASP A CB    1 
ATOM   6942  C  CG    . ASP A 1  923  ? 164.801 194.594 131.174 1.00 154.92 ? 923  ASP A CG    1 
ATOM   6943  O  OD1   . ASP A 1  923  ? 165.116 194.367 132.360 1.00 154.92 ? 923  ASP A OD1   1 
ATOM   6944  O  OD2   . ASP A 1  923  ? 165.304 193.985 130.209 1.00 154.92 ? 923  ASP A OD2   1 
ATOM   6945  N  N     . TYR A 1  924  ? 162.285 198.257 132.703 1.00 150.79 ? 924  TYR A N     1 
ATOM   6946  C  CA    . TYR A 1  924  ? 161.679 199.568 132.525 1.00 150.79 ? 924  TYR A CA    1 
ATOM   6947  C  C     . TYR A 1  924  ? 162.632 200.574 131.893 1.00 150.79 ? 924  TYR A C     1 
ATOM   6948  O  O     . TYR A 1  924  ? 162.264 201.740 131.722 1.00 150.79 ? 924  TYR A O     1 
ATOM   6949  C  CB    . TYR A 1  924  ? 161.156 200.090 133.866 1.00 145.66 ? 924  TYR A CB    1 
ATOM   6950  C  CG    . TYR A 1  924  ? 162.202 200.210 134.947 1.00 145.66 ? 924  TYR A CG    1 
ATOM   6951  C  CD1   . TYR A 1  924  ? 162.954 201.366 135.087 1.00 145.66 ? 924  TYR A CD1   1 
ATOM   6952  C  CD2   . TYR A 1  924  ? 162.420 199.177 135.848 1.00 145.66 ? 924  TYR A CD2   1 
ATOM   6953  C  CE1   . TYR A 1  924  ? 163.907 201.482 136.080 1.00 145.66 ? 924  TYR A CE1   1 
ATOM   6954  C  CE2   . TYR A 1  924  ? 163.371 199.286 136.847 1.00 145.66 ? 924  TYR A CE2   1 
ATOM   6955  C  CZ    . TYR A 1  924  ? 164.115 200.439 136.956 1.00 145.66 ? 924  TYR A CZ    1 
ATOM   6956  O  OH    . TYR A 1  924  ? 165.058 200.555 137.955 1.00 145.66 ? 924  TYR A OH    1 
ATOM   6957  N  N     . THR A 1  925  ? 163.847 200.147 131.544 1.00 152.98 ? 925  THR A N     1 
ATOM   6958  C  CA    . THR A 1  925  ? 164.862 201.079 131.061 1.00 152.98 ? 925  THR A CA    1 
ATOM   6959  C  C     . THR A 1  925  ? 164.508 201.632 129.685 1.00 152.98 ? 925  THR A C     1 
ATOM   6960  O  O     . THR A 1  925  ? 164.801 202.797 129.384 1.00 152.98 ? 925  THR A O     1 
ATOM   6961  C  CB    . THR A 1  925  ? 166.225 200.383 131.022 1.00 151.86 ? 925  THR A CB    1 
ATOM   6962  O  OG1   . THR A 1  925  ? 166.567 199.924 132.336 1.00 151.86 ? 925  THR A OG1   1 
ATOM   6963  C  CG2   . THR A 1  925  ? 167.306 201.333 130.531 1.00 151.86 ? 925  THR A CG2   1 
ATOM   6964  N  N     . ASN A 1  926  ? 163.871 200.817 128.841 1.00 153.03 ? 926  ASN A N     1 
ATOM   6965  C  CA    . ASN A 1  926  ? 163.638 201.202 127.452 1.00 153.03 ? 926  ASN A CA    1 
ATOM   6966  C  C     . ASN A 1  926  ? 162.776 202.455 127.360 1.00 153.03 ? 926  ASN A C     1 
ATOM   6967  O  O     . ASN A 1  926  ? 163.096 203.390 126.616 1.00 153.03 ? 926  ASN A O     1 
ATOM   6968  C  CB    . ASN A 1  926  ? 162.979 200.049 126.697 1.00 154.06 ? 926  ASN A CB    1 
ATOM   6969  C  CG    . ASN A 1  926  ? 163.889 198.850 126.552 1.00 154.06 ? 926  ASN A CG    1 
ATOM   6970  O  OD1   . ASN A 1  926  ? 165.112 198.971 126.618 1.00 154.06 ? 926  ASN A OD1   1 
ATOM   6971  N  ND2   . ASN A 1  926  ? 163.296 197.679 126.355 1.00 154.06 ? 926  ASN A ND2   1 
ATOM   6972  N  N     . GLU A 1  927  ? 161.649 202.460 128.077 1.00 151.84 ? 927  GLU A N     1 
ATOM   6973  C  CA    . GLU A 1  927  ? 160.678 203.550 128.138 1.00 151.84 ? 927  GLU A CA    1 
ATOM   6974  C  C     . GLU A 1  927  ? 159.858 203.635 126.855 1.00 151.84 ? 927  GLU A C     1 
ATOM   6975  O  O     . GLU A 1  927  ? 158.758 204.193 126.859 1.00 151.84 ? 927  GLU A O     1 
ATOM   6976  C  CB    . GLU A 1  927  ? 161.371 204.889 128.423 1.00 156.66 ? 927  GLU A CB    1 
ATOM   6977  C  CG    . GLU A 1  927  ? 160.440 206.087 128.526 1.00 156.66 ? 927  GLU A CG    1 
ATOM   6978  C  CD    . GLU A 1  927  ? 161.179 207.374 128.824 1.00 156.66 ? 927  GLU A CD    1 
ATOM   6979  O  OE1   . GLU A 1  927  ? 162.423 207.335 128.926 1.00 156.66 ? 927  GLU A OE1   1 
ATOM   6980  O  OE2   . GLU A 1  927  ? 160.518 208.426 128.952 1.00 156.66 ? 927  GLU A OE2   1 
ATOM   6981  N  N     . ARG A 1  928  ? 160.352 203.046 125.764 1.00 152.55 ? 928  ARG A N     1 
ATOM   6982  C  CA    . ARG A 1  928  ? 159.536 202.937 124.561 1.00 152.55 ? 928  ARG A CA    1 
ATOM   6983  C  C     . ARG A 1  928  ? 158.609 201.728 124.637 1.00 152.55 ? 928  ARG A C     1 
ATOM   6984  O  O     . ARG A 1  928  ? 157.411 201.830 124.348 1.00 152.55 ? 928  ARG A O     1 
ATOM   6985  C  CB    . ARG A 1  928  ? 160.439 202.865 123.325 1.00 156.48 ? 928  ARG A CB    1 
ATOM   6986  C  CG    . ARG A 1  928  ? 161.266 204.128 123.120 1.00 156.48 ? 928  ARG A CG    1 
ATOM   6987  C  CD    . ARG A 1  928  ? 162.207 204.050 121.922 1.00 156.48 ? 928  ARG A CD    1 
ATOM   6988  N  NE    . ARG A 1  928  ? 161.505 203.967 120.645 1.00 156.48 ? 928  ARG A NE    1 
ATOM   6989  C  CZ    . ARG A 1  928  ? 161.555 202.915 119.834 1.00 156.48 ? 928  ARG A CZ    1 
ATOM   6990  N  NH1   . ARG A 1  928  ? 162.291 201.862 120.160 1.00 156.48 ? 928  ARG A NH1   1 
ATOM   6991  N  NH2   . ARG A 1  928  ? 160.886 202.924 118.689 1.00 156.48 ? 928  ARG A NH2   1 
ATOM   6992  N  N     . ALA A 1  929  ? 159.143 200.583 125.076 1.00 152.43 ? 929  ALA A N     1 
ATOM   6993  C  CA    . ALA A 1  929  ? 158.306 199.407 125.281 1.00 152.43 ? 929  ALA A CA    1 
ATOM   6994  C  C     . ALA A 1  929  ? 157.325 199.622 126.423 1.00 152.43 ? 929  ALA A C     1 
ATOM   6995  O  O     . ALA A 1  929  ? 156.277 198.970 126.472 1.00 152.43 ? 929  ALA A O     1 
ATOM   6996  C  CB    . ALA A 1  929  ? 159.178 198.180 125.551 1.00 153.65 ? 929  ALA A CB    1 
ATOM   6997  N  N     . LEU A 1  930  ? 157.647 200.522 127.351 1.00 149.88 ? 930  LEU A N     1 
ATOM   6998  C  CA    . LEU A 1  930  ? 156.692 200.871 128.395 1.00 149.88 ? 930  LEU A CA    1 
ATOM   6999  C  C     . LEU A 1  930  ? 155.540 201.688 127.826 1.00 149.88 ? 930  LEU A C     1 
ATOM   7000  O  O     . LEU A 1  930  ? 154.376 201.456 128.167 1.00 149.88 ? 930  LEU A O     1 
ATOM   7001  C  CB    . LEU A 1  930  ? 157.389 201.635 129.518 1.00 148.63 ? 930  LEU A CB    1 
ATOM   7002  C  CG    . LEU A 1  930  ? 158.453 200.913 130.339 1.00 148.63 ? 930  LEU A CG    1 
ATOM   7003  C  CD1   . LEU A 1  930  ? 159.068 201.885 131.324 1.00 148.63 ? 930  LEU A CD1   1 
ATOM   7004  C  CD2   . LEU A 1  930  ? 157.869 199.711 131.060 1.00 148.63 ? 930  LEU A CD2   1 
ATOM   7005  N  N     . ARG A 1  931  ? 155.850 202.660 126.963 1.00 148.16 ? 931  ARG A N     1 
ATOM   7006  C  CA    . ARG A 1  931  ? 154.802 203.395 126.260 1.00 148.16 ? 931  ARG A CA    1 
ATOM   7007  C  C     . ARG A 1  931  ? 153.920 202.444 125.463 1.00 148.16 ? 931  ARG A C     1 
ATOM   7008  O  O     . ARG A 1  931  ? 152.693 202.594 125.426 1.00 148.16 ? 931  ARG A O     1 
ATOM   7009  C  CB    . ARG A 1  931  ? 155.419 204.441 125.326 1.00 148.89 ? 931  ARG A CB    1 
ATOM   7010  C  CG    . ARG A 1  931  ? 156.226 205.553 125.987 1.00 148.89 ? 931  ARG A CG    1 
ATOM   7011  C  CD    . ARG A 1  931  ? 155.391 206.572 126.750 1.00 148.89 ? 931  ARG A CD    1 
ATOM   7012  N  NE    . ARG A 1  931  ? 156.257 207.610 127.309 1.00 148.89 ? 931  ARG A NE    1 
ATOM   7013  C  CZ    . ARG A 1  931  ? 155.850 208.589 128.112 1.00 148.89 ? 931  ARG A CZ    1 
ATOM   7014  N  NH1   . ARG A 1  931  ? 154.572 208.692 128.443 1.00 148.89 ? 931  ARG A NH1   1 
ATOM   7015  N  NH2   . ARG A 1  931  ? 156.720 209.480 128.567 1.00 148.89 ? 931  ARG A NH2   1 
ATOM   7016  N  N     . ARG A 1  932  ? 154.536 201.454 124.814 1.00 149.67 ? 932  ARG A N     1 
ATOM   7017  C  CA    . ARG A 1  932  ? 153.783 200.552 123.949 1.00 149.67 ? 932  ARG A CA    1 
ATOM   7018  C  C     . ARG A 1  932  ? 152.895 199.612 124.759 1.00 149.67 ? 932  ARG A C     1 
ATOM   7019  O  O     . ARG A 1  932  ? 151.681 199.535 124.535 1.00 149.67 ? 932  ARG A O     1 
ATOM   7020  C  CB    . ARG A 1  932  ? 154.743 199.757 123.063 1.00 155.95 ? 932  ARG A CB    1 
ATOM   7021  C  CG    . ARG A 1  932  ? 154.037 198.785 122.143 1.00 155.95 ? 932  ARG A CG    1 
ATOM   7022  C  CD    . ARG A 1  932  ? 153.070 199.524 121.232 1.00 155.95 ? 932  ARG A CD    1 
ATOM   7023  N  NE    . ARG A 1  932  ? 152.365 198.626 120.323 1.00 155.95 ? 932  ARG A NE    1 
ATOM   7024  C  CZ    . ARG A 1  932  ? 151.277 198.964 119.639 1.00 155.95 ? 932  ARG A CZ    1 
ATOM   7025  N  NH1   . ARG A 1  932  ? 150.767 200.181 119.762 1.00 155.95 ? 932  ARG A NH1   1 
ATOM   7026  N  NH2   . ARG A 1  932  ? 150.696 198.085 118.833 1.00 155.95 ? 932  ARG A NH2   1 
ATOM   7027  N  N     . THR A 1  933  ? 153.485 198.882 125.706 1.00 145.34 ? 933  THR A N     1 
ATOM   7028  C  CA    . THR A 1  933  ? 152.734 197.869 126.442 1.00 145.34 ? 933  THR A CA    1 
ATOM   7029  C  C     . THR A 1  933  ? 151.866 198.489 127.532 1.00 145.34 ? 933  THR A C     1 
ATOM   7030  O  O     . THR A 1  933  ? 150.698 198.120 127.692 1.00 145.34 ? 933  THR A O     1 
ATOM   7031  C  CB    . THR A 1  933  ? 153.688 196.838 127.047 1.00 147.91 ? 933  THR A CB    1 
ATOM   7032  O  OG1   . THR A 1  933  ? 154.603 197.492 127.935 1.00 147.91 ? 933  THR A OG1   1 
ATOM   7033  C  CG2   . THR A 1  933  ? 154.472 196.127 125.953 1.00 147.91 ? 933  THR A CG2   1 
ATOM   7034  N  N     . LEU A 1  934  ? 152.421 199.427 128.290 1.00 146.09 ? 934  LEU A N     1 
ATOM   7035  C  CA    . LEU A 1  934  ? 151.740 200.028 129.424 1.00 146.09 ? 934  LEU A CA    1 
ATOM   7036  C  C     . LEU A 1  934  ? 151.194 201.399 129.038 1.00 146.09 ? 934  LEU A C     1 
ATOM   7037  O  O     . LEU A 1  934  ? 151.763 202.097 128.195 1.00 146.09 ? 934  LEU A O     1 
ATOM   7038  C  CB    . LEU A 1  934  ? 152.689 200.143 130.620 1.00 145.00 ? 934  LEU A CB    1 
ATOM   7039  C  CG    . LEU A 1  934  ? 152.152 200.757 131.913 1.00 145.00 ? 934  LEU A CG    1 
ATOM   7040  C  CD1   . LEU A 1  934  ? 151.006 199.926 132.457 1.00 145.00 ? 934  LEU A CD1   1 
ATOM   7041  C  CD2   . LEU A 1  934  ? 153.257 200.877 132.948 1.00 145.00 ? 934  LEU A CD2   1 
ATOM   7042  N  N     . GLN A 1  935  ? 150.063 201.762 129.639 1.00 146.65 ? 935  GLN A N     1 
ATOM   7043  C  CA    . GLN A 1  935  ? 149.388 203.002 129.280 1.00 146.65 ? 935  GLN A CA    1 
ATOM   7044  C  C     . GLN A 1  935  ? 150.293 204.207 129.532 1.00 146.65 ? 935  GLN A C     1 
ATOM   7045  O  O     . GLN A 1  935  ? 151.133 204.206 130.436 1.00 146.65 ? 935  GLN A O     1 
ATOM   7046  C  CB    . GLN A 1  935  ? 148.083 203.143 130.064 1.00 142.92 ? 935  GLN A CB    1 
ATOM   7047  C  CG    . GLN A 1  935  ? 147.206 204.297 129.609 1.00 142.92 ? 935  GLN A CG    1 
ATOM   7048  C  CD    . GLN A 1  935  ? 145.853 204.303 130.285 1.00 142.92 ? 935  GLN A CD    1 
ATOM   7049  O  OE1   . GLN A 1  935  ? 145.532 203.406 131.063 1.00 142.92 ? 935  GLN A OE1   1 
ATOM   7050  N  NE2   . GLN A 1  935  ? 145.044 205.312 129.983 1.00 142.92 ? 935  GLN A NE2   1 
ATOM   7051  N  N     . GLU A 1  936  ? 150.108 205.244 128.708 1.00 150.45 ? 936  GLU A N     1 
ATOM   7052  C  CA    . GLU A 1  936  ? 150.991 206.407 128.732 1.00 150.45 ? 936  GLU A CA    1 
ATOM   7053  C  C     . GLU A 1  936  ? 150.963 207.127 130.076 1.00 150.45 ? 936  GLU A C     1 
ATOM   7054  O  O     . GLU A 1  936  ? 151.932 207.804 130.438 1.00 150.45 ? 936  GLU A O     1 
ATOM   7055  C  CB    . GLU A 1  936  ? 150.601 207.368 127.607 1.00 157.64 ? 936  GLU A CB    1 
ATOM   7056  C  CG    . GLU A 1  936  ? 151.485 208.597 127.484 1.00 157.64 ? 936  GLU A CG    1 
ATOM   7057  C  CD    . GLU A 1  936  ? 151.067 209.501 126.343 1.00 157.64 ? 936  GLU A CD    1 
ATOM   7058  O  OE1   . GLU A 1  936  ? 150.063 209.184 125.672 1.00 157.64 ? 936  GLU A OE1   1 
ATOM   7059  O  OE2   . GLU A 1  936  ? 151.741 210.527 126.118 1.00 157.64 ? 936  GLU A OE2   1 
ATOM   7060  N  N     . ASP A 1  937  ? 149.868 207.000 130.829 1.00 148.31 ? 937  ASP A N     1 
ATOM   7061  C  CA    . ASP A 1  937  ? 149.773 207.707 132.102 1.00 148.31 ? 937  ASP A CA    1 
ATOM   7062  C  C     . ASP A 1  937  ? 150.525 206.983 133.212 1.00 148.31 ? 937  ASP A C     1 
ATOM   7063  O  O     . ASP A 1  937  ? 150.934 207.613 134.197 1.00 148.31 ? 937  ASP A O     1 
ATOM   7064  C  CB    . ASP A 1  937  ? 148.304 207.895 132.482 1.00 152.21 ? 937  ASP A CB    1 
ATOM   7065  C  CG    . ASP A 1  937  ? 147.591 208.880 131.574 1.00 152.21 ? 937  ASP A CG    1 
ATOM   7066  O  OD1   . ASP A 1  937  ? 148.285 209.633 130.857 1.00 152.21 ? 937  ASP A OD1   1 
ATOM   7067  O  OD2   . ASP A 1  937  ? 146.343 208.908 131.576 1.00 152.21 ? 937  ASP A OD2   1 
ATOM   7068  N  N     . LEU A 1  938  ? 150.706 205.665 133.086 1.00 146.21 ? 938  LEU A N     1 
ATOM   7069  C  CA    . LEU A 1  938  ? 151.332 204.900 134.159 1.00 146.21 ? 938  LEU A CA    1 
ATOM   7070  C  C     . LEU A 1  938  ? 152.837 204.733 133.951 1.00 146.21 ? 938  LEU A C     1 
ATOM   7071  O  O     . LEU A 1  938  ? 153.541 204.263 134.851 1.00 146.21 ? 938  LEU A O     1 
ATOM   7072  C  CB    . LEU A 1  938  ? 150.653 203.530 134.281 1.00 139.91 ? 938  LEU A CB    1 
ATOM   7073  C  CG    . LEU A 1  938  ? 149.367 203.462 135.121 1.00 139.91 ? 938  LEU A CG    1 
ATOM   7074  C  CD1   . LEU A 1  938  ? 148.241 204.289 134.523 1.00 139.91 ? 938  LEU A CD1   1 
ATOM   7075  C  CD2   . LEU A 1  938  ? 148.920 202.028 135.259 1.00 139.91 ? 938  LEU A CD2   1 
ATOM   7076  N  N     . VAL A 1  939  ? 153.359 205.117 132.782 1.00 147.94 ? 939  VAL A N     1 
ATOM   7077  C  CA    . VAL A 1  939  ? 154.787 204.940 132.535 1.00 147.94 ? 939  VAL A CA    1 
ATOM   7078  C  C     . VAL A 1  939  ? 155.592 206.008 133.265 1.00 147.94 ? 939  VAL A C     1 
ATOM   7079  O  O     . VAL A 1  939  ? 156.659 205.726 133.823 1.00 147.94 ? 939  VAL A O     1 
ATOM   7080  C  CB    . VAL A 1  939  ? 155.072 204.933 131.023 1.00 147.60 ? 939  VAL A CB    1 
ATOM   7081  C  CG1   . VAL A 1  939  ? 154.584 206.210 130.386 1.00 147.60 ? 939  VAL A CG1   1 
ATOM   7082  C  CG2   . VAL A 1  939  ? 156.560 204.757 130.778 1.00 147.60 ? 939  VAL A CG2   1 
ATOM   7083  N  N     . LYS A 1  940  ? 155.097 207.247 133.277 1.00 150.73 ? 940  LYS A N     1 
ATOM   7084  C  CA    . LYS A 1  940  ? 155.716 208.277 134.101 1.00 150.73 ? 940  LYS A CA    1 
ATOM   7085  C  C     . LYS A 1  940  ? 155.681 207.881 135.570 1.00 150.73 ? 940  LYS A C     1 
ATOM   7086  O  O     . LYS A 1  940  ? 156.622 208.157 136.324 1.00 150.73 ? 940  LYS A O     1 
ATOM   7087  C  CB    . LYS A 1  940  ? 155.001 209.610 133.887 1.00 149.24 ? 940  LYS A CB    1 
ATOM   7088  C  CG    . LYS A 1  940  ? 155.160 210.185 132.492 1.00 149.24 ? 940  LYS A CG    1 
ATOM   7089  C  CD    . LYS A 1  940  ? 154.365 211.472 132.336 1.00 149.24 ? 940  LYS A CD    1 
ATOM   7090  C  CE    . LYS A 1  940  ? 154.936 212.597 133.185 1.00 149.24 ? 940  LYS A CE    1 
ATOM   7091  N  NZ    . LYS A 1  940  ? 156.290 213.007 132.726 1.00 149.24 ? 940  LYS A NZ    1 
ATOM   7092  N  N     . ASP A 1  941  ? 154.603 207.212 135.986 1.00 150.10 ? 941  ASP A N     1 
ATOM   7093  C  CA    . ASP A 1  941  ? 154.474 206.795 137.376 1.00 150.10 ? 941  ASP A CA    1 
ATOM   7094  C  C     . ASP A 1  941  ? 155.474 205.695 137.711 1.00 150.10 ? 941  ASP A C     1 
ATOM   7095  O  O     . ASP A 1  941  ? 156.068 205.697 138.795 1.00 150.10 ? 941  ASP A O     1 
ATOM   7096  C  CB    . ASP A 1  941  ? 153.041 206.329 137.641 1.00 151.84 ? 941  ASP A CB    1 
ATOM   7097  C  CG    . ASP A 1  941  ? 152.756 206.110 139.115 1.00 151.84 ? 941  ASP A CG    1 
ATOM   7098  O  OD1   . ASP A 1  941  ? 153.625 206.433 139.952 1.00 151.84 ? 941  ASP A OD1   1 
ATOM   7099  O  OD2   . ASP A 1  941  ? 151.657 205.613 139.437 1.00 151.84 ? 941  ASP A OD2   1 
ATOM   7100  N  N     . VAL A 1  942  ? 155.684 204.752 136.788 1.00 148.09 ? 942  VAL A N     1 
ATOM   7101  C  CA    . VAL A 1  942  ? 156.636 203.670 137.037 1.00 148.09 ? 942  VAL A CA    1 
ATOM   7102  C  C     . VAL A 1  942  ? 158.065 204.201 137.030 1.00 148.09 ? 942  VAL A C     1 
ATOM   7103  O  O     . VAL A 1  942  ? 158.891 203.825 137.870 1.00 148.09 ? 942  VAL A O     1 
ATOM   7104  C  CB    . VAL A 1  942  ? 156.451 202.543 136.006 1.00 142.87 ? 942  VAL A CB    1 
ATOM   7105  C  CG1   . VAL A 1  942  ? 157.555 201.507 136.146 1.00 142.87 ? 942  VAL A CG1   1 
ATOM   7106  C  CG2   . VAL A 1  942  ? 155.096 201.890 136.180 1.00 142.87 ? 942  VAL A CG2   1 
ATOM   7107  N  N     . LEU A 1  943  ? 158.376 205.090 136.084 1.00 147.88 ? 943  LEU A N     1 
ATOM   7108  C  CA    . LEU A 1  943  ? 159.755 205.545 135.933 1.00 147.88 ? 943  LEU A CA    1 
ATOM   7109  C  C     . LEU A 1  943  ? 160.144 206.565 136.994 1.00 147.88 ? 943  LEU A C     1 
ATOM   7110  O  O     . LEU A 1  943  ? 161.317 206.637 137.380 1.00 147.88 ? 943  LEU A O     1 
ATOM   7111  C  CB    . LEU A 1  943  ? 159.964 206.134 134.539 1.00 145.78 ? 943  LEU A CB    1 
ATOM   7112  C  CG    . LEU A 1  943  ? 159.874 205.145 133.380 1.00 145.78 ? 943  LEU A CG    1 
ATOM   7113  C  CD1   . LEU A 1  943  ? 159.966 205.874 132.055 1.00 145.78 ? 943  LEU A CD1   1 
ATOM   7114  C  CD2   . LEU A 1  943  ? 160.975 204.108 133.504 1.00 145.78 ? 943  LEU A CD2   1 
ATOM   7115  N  N     . SER A 1  944  ? 159.187 207.361 137.474 1.00 151.70 ? 944  SER A N     1 
ATOM   7116  C  CA    . SER A 1  944  ? 159.515 208.418 138.425 1.00 151.70 ? 944  SER A CA    1 
ATOM   7117  C  C     . SER A 1  944  ? 159.932 207.840 139.773 1.00 151.70 ? 944  SER A C     1 
ATOM   7118  O  O     . SER A 1  944  ? 160.984 208.192 140.318 1.00 151.70 ? 944  SER A O     1 
ATOM   7119  C  CB    . SER A 1  944  ? 158.324 209.365 138.585 1.00 154.17 ? 944  SER A CB    1 
ATOM   7120  O  OG    . SER A 1  944  ? 157.211 208.695 139.150 1.00 154.17 ? 944  SER A OG    1 
ATOM   7121  N  N     . ASN A 1  945  ? 159.120 206.940 140.321 1.00 151.07 ? 945  ASN A N     1 
ATOM   7122  C  CA    . ASN A 1  945  ? 159.348 206.416 141.662 1.00 151.07 ? 945  ASN A CA    1 
ATOM   7123  C  C     . ASN A 1  945  ? 160.413 205.326 141.628 1.00 151.07 ? 945  ASN A C     1 
ATOM   7124  O  O     . ASN A 1  945  ? 160.336 204.400 140.814 1.00 151.07 ? 945  ASN A O     1 
ATOM   7125  C  CB    . ASN A 1  945  ? 158.047 205.867 142.240 1.00 149.62 ? 945  ASN A CB    1 
ATOM   7126  C  CG    . ASN A 1  945  ? 157.025 206.950 142.505 1.00 149.62 ? 945  ASN A CG    1 
ATOM   7127  O  OD1   . ASN A 1  945  ? 157.374 208.116 142.684 1.00 149.62 ? 945  ASN A OD1   1 
ATOM   7128  N  ND2   . ASN A 1  945  ? 155.753 206.572 142.526 1.00 149.62 ? 945  ASN A ND2   1 
ATOM   7129  N  N     . ALA A 1  946  ? 161.410 205.440 142.510 1.00 149.23 ? 946  ALA A N     1 
ATOM   7130  C  CA    . ALA A 1  946  ? 162.369 204.356 142.691 1.00 149.23 ? 946  ALA A CA    1 
ATOM   7131  C  C     . ALA A 1  946  ? 161.863 203.308 143.672 1.00 149.23 ? 946  ALA A C     1 
ATOM   7132  O  O     . ALA A 1  946  ? 162.408 202.200 143.715 1.00 149.23 ? 946  ALA A O     1 
ATOM   7133  C  CB    . ALA A 1  946  ? 163.712 204.912 143.166 1.00 146.79 ? 946  ALA A CB    1 
ATOM   7134  N  N     . HIS A 1  947  ? 160.834 203.636 144.457 1.00 146.76 ? 947  HIS A N     1 
ATOM   7135  C  CA    . HIS A 1  947  ? 160.224 202.658 145.351 1.00 146.76 ? 947  HIS A CA    1 
ATOM   7136  C  C     . HIS A 1  947  ? 159.556 201.541 144.557 1.00 146.76 ? 947  HIS A C     1 
ATOM   7137  O  O     . HIS A 1  947  ? 159.720 200.351 144.864 1.00 146.76 ? 947  HIS A O     1 
ATOM   7138  C  CB    . HIS A 1  947  ? 159.217 203.364 146.259 1.00 148.13 ? 947  HIS A CB    1 
ATOM   7139  C  CG    . HIS A 1  947  ? 158.539 202.458 147.236 1.00 148.13 ? 947  HIS A CG    1 
ATOM   7140  N  ND1   . HIS A 1  947  ? 159.225 201.761 148.207 1.00 148.13 ? 947  HIS A ND1   1 
ATOM   7141  C  CD2   . HIS A 1  947  ? 157.232 202.140 147.396 1.00 148.13 ? 947  HIS A CD2   1 
ATOM   7142  C  CE1   . HIS A 1  947  ? 158.371 201.050 148.921 1.00 148.13 ? 947  HIS A CE1   1 
ATOM   7143  N  NE2   . HIS A 1  947  ? 157.155 201.262 148.449 1.00 148.13 ? 947  HIS A NE2   1 
ATOM   7144  N  N     . ILE A 1  948  ? 158.794 201.916 143.526 1.00 146.15 ? 948  ILE A N     1 
ATOM   7145  C  CA    . ILE A 1  948  ? 158.195 200.939 142.620 1.00 146.15 ? 948  ILE A CA    1 
ATOM   7146  C  C     . ILE A 1  948  ? 159.274 200.033 142.050 1.00 146.15 ? 948  ILE A C     1 
ATOM   7147  O  O     . ILE A 1  948  ? 159.143 198.802 142.025 1.00 146.15 ? 948  ILE A O     1 
ATOM   7148  C  CB    . ILE A 1  948  ? 157.432 201.662 141.496 1.00 144.12 ? 948  ILE A CB    1 
ATOM   7149  C  CG1   . ILE A 1  948  ? 156.368 202.583 142.087 1.00 144.12 ? 948  ILE A CG1   1 
ATOM   7150  C  CG2   . ILE A 1  948  ? 156.812 200.659 140.536 1.00 144.12 ? 948  ILE A CG2   1 
ATOM   7151  C  CD1   . ILE A 1  948  ? 155.671 203.448 141.069 1.00 144.12 ? 948  ILE A CD1   1 
ATOM   7152  N  N     . GLN A 1  949  ? 160.368 200.643 141.594 1.00 146.17 ? 949  GLN A N     1 
ATOM   7153  C  CA    . GLN A 1  949  ? 161.465 199.892 141.000 1.00 146.17 ? 949  GLN A CA    1 
ATOM   7154  C  C     . GLN A 1  949  ? 162.083 198.937 142.014 1.00 146.17 ? 949  GLN A C     1 
ATOM   7155  O  O     . GLN A 1  949  ? 162.519 197.835 141.658 1.00 146.17 ? 949  GLN A O     1 
ATOM   7156  C  CB    . GLN A 1  949  ? 162.501 200.876 140.462 1.00 145.94 ? 949  GLN A CB    1 
ATOM   7157  C  CG    . GLN A 1  949  ? 161.919 201.826 139.419 1.00 145.94 ? 949  GLN A CG    1 
ATOM   7158  C  CD    . GLN A 1  949  ? 162.873 202.937 139.019 1.00 145.94 ? 949  GLN A CD    1 
ATOM   7159  O  OE1   . GLN A 1  949  ? 163.810 203.261 139.747 1.00 145.94 ? 949  GLN A OE1   1 
ATOM   7160  N  NE2   . GLN A 1  949  ? 162.614 203.551 137.873 1.00 145.94 ? 949  GLN A NE2   1 
ATOM   7161  N  N     . ASN A 1  950  ? 162.111 199.339 143.287 1.00 145.61 ? 950  ASN A N     1 
ATOM   7162  C  CA    . ASN A 1  950  ? 162.610 198.457 144.338 1.00 145.61 ? 950  ASN A CA    1 
ATOM   7163  C  C     . ASN A 1  950  ? 161.708 197.242 144.506 1.00 145.61 ? 950  ASN A C     1 
ATOM   7164  O  O     . ASN A 1  950  ? 162.182 196.097 144.518 1.00 145.61 ? 950  ASN A O     1 
ATOM   7165  C  CB    . ASN A 1  950  ? 162.727 199.227 145.655 1.00 147.34 ? 950  ASN A CB    1 
ATOM   7166  C  CG    . ASN A 1  950  ? 163.827 200.266 145.626 1.00 147.34 ? 950  ASN A CG    1 
ATOM   7167  O  OD1   . ASN A 1  950  ? 164.781 200.156 144.857 1.00 147.34 ? 950  ASN A OD1   1 
ATOM   7168  N  ND2   . ASN A 1  950  ? 163.696 201.289 146.462 1.00 147.34 ? 950  ASN A ND2   1 
ATOM   7169  N  N     . GLU A 1  951  ? 160.397 197.473 144.639 1.00 143.44 ? 951  GLU A N     1 
ATOM   7170  C  CA    . GLU A 1  951  ? 159.454 196.362 144.750 1.00 143.44 ? 951  GLU A CA    1 
ATOM   7171  C  C     . GLU A 1  951  ? 159.598 195.402 143.576 1.00 143.44 ? 951  GLU A C     1 
ATOM   7172  O  O     . GLU A 1  951  ? 159.619 194.176 143.749 1.00 143.44 ? 951  GLU A O     1 
ATOM   7173  C  CB    . GLU A 1  951  ? 158.020 196.890 144.825 1.00 147.30 ? 951  GLU A CB    1 
ATOM   7174  C  CG    . GLU A 1  951  ? 157.695 197.677 146.080 1.00 147.30 ? 951  GLU A CG    1 
ATOM   7175  C  CD    . GLU A 1  951  ? 156.279 198.222 146.070 1.00 147.30 ? 951  GLU A CD    1 
ATOM   7176  O  OE1   . GLU A 1  951  ? 155.618 198.138 145.013 1.00 147.30 ? 951  GLU A OE1   1 
ATOM   7177  O  OE2   . GLU A 1  951  ? 155.827 198.735 147.116 1.00 147.30 ? 951  GLU A OE2   1 
ATOM   7178  N  N     . LEU A 1  952  ? 159.721 195.951 142.369 1.00 142.70 ? 952  LEU A N     1 
ATOM   7179  C  CA    . LEU A 1  952  ? 159.780 195.127 141.170 1.00 142.70 ? 952  LEU A CA    1 
ATOM   7180  C  C     . LEU A 1  952  ? 161.161 194.528 140.932 1.00 142.70 ? 952  LEU A C     1 
ATOM   7181  O  O     . LEU A 1  952  ? 161.307 193.708 140.020 1.00 142.70 ? 952  LEU A O     1 
ATOM   7182  C  CB    . LEU A 1  952  ? 159.319 195.940 139.960 1.00 138.86 ? 952  LEU A CB    1 
ATOM   7183  C  CG    . LEU A 1  952  ? 157.801 195.966 139.728 1.00 138.86 ? 952  LEU A CG    1 
ATOM   7184  C  CD1   . LEU A 1  952  ? 157.046 196.628 140.870 1.00 138.86 ? 952  LEU A CD1   1 
ATOM   7185  C  CD2   . LEU A 1  952  ? 157.462 196.657 138.423 1.00 138.86 ? 952  LEU A CD2   1 
ATOM   7186  N  N     . GLU A 1  953  ? 162.174 194.924 141.708 1.00 142.97 ? 953  GLU A N     1 
ATOM   7187  C  CA    . GLU A 1  953  ? 163.379 194.105 141.808 1.00 142.97 ? 953  GLU A CA    1 
ATOM   7188  C  C     . GLU A 1  953  ? 163.171 192.955 142.789 1.00 142.97 ? 953  GLU A C     1 
ATOM   7189  O  O     . GLU A 1  953  ? 163.599 191.820 142.534 1.00 142.97 ? 953  GLU A O     1 
ATOM   7190  C  CB    . GLU A 1  953  ? 164.577 194.954 142.240 1.00 151.81 ? 953  GLU A CB    1 
ATOM   7191  C  CG    . GLU A 1  953  ? 165.056 195.969 141.220 1.00 151.81 ? 953  GLU A CG    1 
ATOM   7192  C  CD    . GLU A 1  953  ? 166.213 196.805 141.741 1.00 151.81 ? 953  GLU A CD    1 
ATOM   7193  O  OE1   . GLU A 1  953  ? 166.505 196.732 142.954 1.00 151.81 ? 953  GLU A OE1   1 
ATOM   7194  O  OE2   . GLU A 1  953  ? 166.835 197.530 140.937 1.00 151.81 ? 953  GLU A OE2   1 
ATOM   7195  N  N     . ARG A 1  954  ? 162.512 193.236 143.917 1.00 139.89 ? 954  ARG A N     1 
ATOM   7196  C  CA    . ARG A 1  954  ? 162.277 192.201 144.919 1.00 139.89 ? 954  ARG A CA    1 
ATOM   7197  C  C     . ARG A 1  954  ? 161.457 191.050 144.350 1.00 139.89 ? 954  ARG A C     1 
ATOM   7198  O  O     . ARG A 1  954  ? 161.701 189.882 144.683 1.00 139.89 ? 954  ARG A O     1 
ATOM   7199  C  CB    . ARG A 1  954  ? 161.580 192.798 146.141 1.00 139.28 ? 954  ARG A CB    1 
ATOM   7200  C  CG    . ARG A 1  954  ? 162.435 193.773 146.927 1.00 139.28 ? 954  ARG A CG    1 
ATOM   7201  C  CD    . ARG A 1  954  ? 161.697 194.280 148.154 1.00 139.28 ? 954  ARG A CD    1 
ATOM   7202  N  NE    . ARG A 1  954  ? 162.504 195.217 148.927 1.00 139.28 ? 954  ARG A NE    1 
ATOM   7203  C  CZ    . ARG A 1  954  ? 162.068 195.874 149.996 1.00 139.28 ? 954  ARG A CZ    1 
ATOM   7204  N  NH1   . ARG A 1  954  ? 160.825 195.699 150.424 1.00 139.28 ? 954  ARG A NH1   1 
ATOM   7205  N  NH2   . ARG A 1  954  ? 162.875 196.706 150.639 1.00 139.28 ? 954  ARG A NH2   1 
ATOM   7206  N  N     . GLU A 1  955  ? 160.474 191.359 143.499 1.00 139.01 ? 955  GLU A N     1 
ATOM   7207  C  CA    . GLU A 1  955  ? 159.698 190.314 142.836 1.00 139.01 ? 955  GLU A CA    1 
ATOM   7208  C  C     . GLU A 1  955  ? 160.610 189.327 142.117 1.00 139.01 ? 955  GLU A C     1 
ATOM   7209  O  O     . GLU A 1  955  ? 160.515 188.107 142.304 1.00 139.01 ? 955  GLU A O     1 
ATOM   7210  C  CB    . GLU A 1  955  ? 158.715 190.944 141.847 1.00 141.79 ? 955  GLU A CB    1 
ATOM   7211  C  CG    . GLU A 1  955  ? 157.826 189.939 141.135 1.00 141.79 ? 955  GLU A CG    1 
ATOM   7212  C  CD    . GLU A 1  955  ? 156.898 190.589 140.126 1.00 141.79 ? 955  GLU A CD    1 
ATOM   7213  O  OE1   . GLU A 1  955  ? 157.008 191.815 139.912 1.00 141.79 ? 955  GLU A OE1   1 
ATOM   7214  O  OE2   . GLU A 1  955  ? 156.053 189.873 139.549 1.00 141.79 ? 955  GLU A OE2   1 
ATOM   7215  N  N     . PHE A 1  956  ? 161.516 189.854 141.291 1.00 136.51 ? 956  PHE A N     1 
ATOM   7216  C  CA    . PHE A 1  956  ? 162.411 188.997 140.524 1.00 136.51 ? 956  PHE A CA    1 
ATOM   7217  C  C     . PHE A 1  956  ? 163.390 188.256 141.427 1.00 136.51 ? 956  PHE A C     1 
ATOM   7218  O  O     . PHE A 1  956  ? 163.789 187.128 141.113 1.00 136.51 ? 956  PHE A O     1 
ATOM   7219  C  CB    . PHE A 1  956  ? 163.150 189.835 139.482 1.00 132.83 ? 956  PHE A CB    1 
ATOM   7220  C  CG    . PHE A 1  956  ? 164.109 189.052 138.642 1.00 132.83 ? 956  PHE A CG    1 
ATOM   7221  C  CD1   . PHE A 1  956  ? 163.650 188.256 137.609 1.00 132.83 ? 956  PHE A CD1   1 
ATOM   7222  C  CD2   . PHE A 1  956  ? 165.471 189.131 138.865 1.00 132.83 ? 956  PHE A CD2   1 
ATOM   7223  C  CE1   . PHE A 1  956  ? 164.530 187.537 136.827 1.00 132.83 ? 956  PHE A CE1   1 
ATOM   7224  C  CE2   . PHE A 1  956  ? 166.357 188.417 138.082 1.00 132.83 ? 956  PHE A CE2   1 
ATOM   7225  C  CZ    . PHE A 1  956  ? 165.885 187.618 137.063 1.00 132.83 ? 956  PHE A CZ    1 
ATOM   7226  N  N     . GLU A 1  957  ? 163.782 188.862 142.552 1.00 137.62 ? 957  GLU A N     1 
ATOM   7227  C  CA    . GLU A 1  957  ? 164.579 188.134 143.536 1.00 137.62 ? 957  GLU A CA    1 
ATOM   7228  C  C     . GLU A 1  957  ? 163.832 186.900 144.032 1.00 137.62 ? 957  GLU A C     1 
ATOM   7229  O  O     . GLU A 1  957  ? 164.363 185.779 144.022 1.00 137.62 ? 957  GLU A O     1 
ATOM   7230  C  CB    . GLU A 1  957  ? 164.929 189.051 144.706 1.00 146.88 ? 957  GLU A CB    1 
ATOM   7231  C  CG    . GLU A 1  957  ? 165.802 190.229 144.343 1.00 146.88 ? 957  GLU A CG    1 
ATOM   7232  C  CD    . GLU A 1  957  ? 166.067 191.124 145.534 1.00 146.88 ? 957  GLU A CD    1 
ATOM   7233  O  OE1   . GLU A 1  957  ? 165.453 190.892 146.599 1.00 146.88 ? 957  GLU A OE1   1 
ATOM   7234  O  OE2   . GLU A 1  957  ? 166.875 192.065 145.405 1.00 146.88 ? 957  GLU A OE2   1 
ATOM   7235  N  N     . ARG A 1  958  ? 162.583 187.094 144.469 1.00 134.99 ? 958  ARG A N     1 
ATOM   7236  C  CA    . ARG A 1  958  ? 161.776 185.974 144.941 1.00 134.99 ? 958  ARG A CA    1 
ATOM   7237  C  C     . ARG A 1  958  ? 161.620 184.913 143.861 1.00 134.99 ? 958  ARG A C     1 
ATOM   7238  O  O     . ARG A 1  958  ? 161.654 183.711 144.149 1.00 134.99 ? 958  ARG A O     1 
ATOM   7239  C  CB    . ARG A 1  958  ? 160.405 186.472 145.394 1.00 137.18 ? 958  ARG A CB    1 
ATOM   7240  C  CG    . ARG A 1  958  ? 160.439 187.389 146.602 1.00 137.18 ? 958  ARG A CG    1 
ATOM   7241  C  CD    . ARG A 1  958  ? 159.037 187.845 146.976 1.00 137.18 ? 958  ARG A CD    1 
ATOM   7242  N  NE    . ARG A 1  958  ? 159.039 188.778 148.100 1.00 137.18 ? 958  ARG A NE    1 
ATOM   7243  C  CZ    . ARG A 1  958  ? 157.966 189.433 148.531 1.00 137.18 ? 958  ARG A CZ    1 
ATOM   7244  N  NH1   . ARG A 1  958  ? 156.797 189.266 147.929 1.00 137.18 ? 958  ARG A NH1   1 
ATOM   7245  N  NH2   . ARG A 1  958  ? 158.062 190.262 149.562 1.00 137.18 ? 958  ARG A NH2   1 
ATOM   7246  N  N     . MET A 1  959  ? 161.452 185.339 142.606 1.00 133.51 ? 959  MET A N     1 
ATOM   7247  C  CA    . MET A 1  959  ? 161.326 184.367 141.526 1.00 133.51 ? 959  MET A CA    1 
ATOM   7248  C  C     . MET A 1  959  ? 162.626 183.606 141.300 1.00 133.51 ? 959  MET A C     1 
ATOM   7249  O  O     . MET A 1  959  ? 162.594 182.442 140.886 1.00 133.51 ? 959  MET A O     1 
ATOM   7250  C  CB    . MET A 1  959  ? 160.878 185.058 140.242 1.00 136.36 ? 959  MET A CB    1 
ATOM   7251  C  CG    . MET A 1  959  ? 159.475 185.624 140.320 1.00 136.36 ? 959  MET A CG    1 
ATOM   7252  S  SD    . MET A 1  959  ? 158.981 186.453 138.804 1.00 136.36 ? 959  MET A SD    1 
ATOM   7253  C  CE    . MET A 1  959  ? 158.727 185.046 137.729 1.00 136.36 ? 959  MET A CE    1 
ATOM   7254  N  N     . ARG A 1  960  ? 163.775 184.234 141.567 1.00 133.57 ? 960  ARG A N     1 
ATOM   7255  C  CA    . ARG A 1  960  ? 165.035 183.503 141.471 1.00 133.57 ? 960  ARG A CA    1 
ATOM   7256  C  C     . ARG A 1  960  ? 165.133 182.445 142.562 1.00 133.57 ? 960  ARG A C     1 
ATOM   7257  O  O     . ARG A 1  960  ? 165.472 181.284 142.291 1.00 133.57 ? 960  ARG A O     1 
ATOM   7258  C  CB    . ARG A 1  960  ? 166.229 184.456 141.548 1.00 138.60 ? 960  ARG A CB    1 
ATOM   7259  C  CG    . ARG A 1  960  ? 166.363 185.391 140.363 1.00 138.60 ? 960  ARG A CG    1 
ATOM   7260  C  CD    . ARG A 1  960  ? 167.598 186.274 140.493 1.00 138.60 ? 960  ARG A CD    1 
ATOM   7261  N  NE    . ARG A 1  960  ? 167.580 187.123 141.681 1.00 138.60 ? 960  ARG A NE    1 
ATOM   7262  C  CZ    . ARG A 1  960  ? 168.557 187.967 141.996 1.00 138.60 ? 960  ARG A CZ    1 
ATOM   7263  N  NH1   . ARG A 1  960  ? 169.615 188.073 141.206 1.00 138.60 ? 960  ARG A NH1   1 
ATOM   7264  N  NH2   . ARG A 1  960  ? 168.476 188.707 143.094 1.00 138.60 ? 960  ARG A NH2   1 
ATOM   7265  N  N     . GLU A 1  961  ? 164.844 182.829 143.811 1.00 134.51 ? 961  GLU A N     1 
ATOM   7266  C  CA    . GLU A 1  961  ? 164.870 181.851 144.896 1.00 134.51 ? 961  GLU A CA    1 
ATOM   7267  C  C     . GLU A 1  961  ? 163.928 180.688 144.605 1.00 134.51 ? 961  GLU A C     1 
ATOM   7268  O  O     . GLU A 1  961  ? 164.283 179.517 144.798 1.00 134.51 ? 961  GLU A O     1 
ATOM   7269  C  CB    . GLU A 1  961  ? 164.504 182.520 146.221 1.00 141.43 ? 961  GLU A CB    1 
ATOM   7270  C  CG    . GLU A 1  961  ? 165.523 183.530 146.715 1.00 141.43 ? 961  GLU A CG    1 
ATOM   7271  C  CD    . GLU A 1  961  ? 165.102 184.186 148.015 1.00 141.43 ? 961  GLU A CD    1 
ATOM   7272  O  OE1   . GLU A 1  961  ? 163.941 183.991 148.431 1.00 141.43 ? 961  GLU A OE1   1 
ATOM   7273  O  OE2   . GLU A 1  961  ? 165.933 184.893 148.623 1.00 141.43 ? 961  GLU A OE2   1 
ATOM   7274  N  N     . ASP A 1  962  ? 162.723 180.996 144.119 1.00 132.47 ? 962  ASP A N     1 
ATOM   7275  C  CA    . ASP A 1  962  ? 161.768 179.947 143.781 1.00 132.47 ? 962  ASP A CA    1 
ATOM   7276  C  C     . ASP A 1  962  ? 162.295 179.063 142.658 1.00 132.47 ? 962  ASP A C     1 
ATOM   7277  O  O     . ASP A 1  962  ? 162.089 177.844 142.670 1.00 132.47 ? 962  ASP A O     1 
ATOM   7278  C  CB    . ASP A 1  962  ? 160.427 180.569 143.395 1.00 133.81 ? 962  ASP A CB    1 
ATOM   7279  C  CG    . ASP A 1  962  ? 159.741 181.246 144.566 1.00 133.81 ? 962  ASP A CG    1 
ATOM   7280  O  OD1   . ASP A 1  962  ? 160.139 180.986 145.720 1.00 133.81 ? 962  ASP A OD1   1 
ATOM   7281  O  OD2   . ASP A 1  962  ? 158.804 182.040 144.334 1.00 133.81 ? 962  ASP A OD2   1 
ATOM   7282  N  N     . ARG A 1  963  ? 162.976 179.662 141.678 1.00 128.79 ? 963  ARG A N     1 
ATOM   7283  C  CA    . ARG A 1  963  ? 163.590 178.881 140.608 1.00 128.79 ? 963  ARG A CA    1 
ATOM   7284  C  C     . ARG A 1  963  ? 164.602 177.885 141.162 1.00 128.79 ? 963  ARG A C     1 
ATOM   7285  O  O     . ARG A 1  963  ? 164.605 176.708 140.776 1.00 128.79 ? 963  ARG A O     1 
ATOM   7286  C  CB    . ARG A 1  963  ? 164.251 179.825 139.604 1.00 130.20 ? 963  ARG A CB    1 
ATOM   7287  C  CG    . ARG A 1  963  ? 164.943 179.164 138.423 1.00 130.20 ? 963  ARG A CG    1 
ATOM   7288  C  CD    . ARG A 1  963  ? 165.467 180.242 137.485 1.00 130.20 ? 963  ARG A CD    1 
ATOM   7289  N  NE    . ARG A 1  963  ? 166.139 179.725 136.298 1.00 130.20 ? 963  ARG A NE    1 
ATOM   7290  C  CZ    . ARG A 1  963  ? 167.442 179.484 136.226 1.00 130.20 ? 963  ARG A CZ    1 
ATOM   7291  N  NH1   . ARG A 1  963  ? 168.219 179.720 137.274 1.00 130.20 ? 963  ARG A NH1   1 
ATOM   7292  N  NH2   . ARG A 1  963  ? 167.974 179.023 135.104 1.00 130.20 ? 963  ARG A NH2   1 
ATOM   7293  N  N     . GLU A 1  964  ? 165.461 178.336 142.079 1.00 129.55 ? 964  GLU A N     1 
ATOM   7294  C  CA    . GLU A 1  964  ? 166.430 177.429 142.686 1.00 129.55 ? 964  GLU A CA    1 
ATOM   7295  C  C     . GLU A 1  964  ? 165.730 176.322 143.469 1.00 129.55 ? 964  GLU A C     1 
ATOM   7296  O  O     . GLU A 1  964  ? 166.146 175.157 143.426 1.00 129.55 ? 964  GLU A O     1 
ATOM   7297  C  CB    . GLU A 1  964  ? 167.386 178.211 143.585 1.00 139.06 ? 964  GLU A CB    1 
ATOM   7298  C  CG    . GLU A 1  964  ? 168.255 179.209 142.837 1.00 139.06 ? 964  GLU A CG    1 
ATOM   7299  C  CD    . GLU A 1  964  ? 169.109 178.555 141.767 1.00 139.06 ? 964  GLU A CD    1 
ATOM   7300  O  OE1   . GLU A 1  964  ? 169.617 177.440 142.008 1.00 139.06 ? 964  GLU A OE1   1 
ATOM   7301  O  OE2   . GLU A 1  964  ? 169.274 179.157 140.685 1.00 139.06 ? 964  GLU A OE2   1 
ATOM   7302  N  N     . VAL A 1  965  ? 164.655 176.667 144.185 1.00 125.10 ? 965  VAL A N     1 
ATOM   7303  C  CA    . VAL A 1  965  ? 163.906 175.654 144.926 1.00 125.10 ? 965  VAL A CA    1 
ATOM   7304  C  C     . VAL A 1  965  ? 163.336 174.606 143.977 1.00 125.10 ? 965  VAL A C     1 
ATOM   7305  O  O     . VAL A 1  965  ? 163.392 173.401 144.254 1.00 125.10 ? 965  VAL A O     1 
ATOM   7306  C  CB    . VAL A 1  965  ? 162.803 176.314 145.775 1.00 122.13 ? 965  VAL A CB    1 
ATOM   7307  C  CG1   . VAL A 1  965  ? 161.933 175.257 146.433 1.00 122.13 ? 965  VAL A CG1   1 
ATOM   7308  C  CG2   . VAL A 1  965  ? 163.418 177.212 146.833 1.00 122.13 ? 965  VAL A CG2   1 
ATOM   7309  N  N     . LEU A 1  966  ? 162.784 175.042 142.841 1.00 123.57 ? 966  LEU A N     1 
ATOM   7310  C  CA    . LEU A 1  966  ? 162.276 174.095 141.851 1.00 123.57 ? 966  LEU A CA    1 
ATOM   7311  C  C     . LEU A 1  966  ? 163.392 173.192 141.346 1.00 123.57 ? 966  LEU A C     1 
ATOM   7312  O  O     . LEU A 1  966  ? 163.209 171.979 141.192 1.00 123.57 ? 966  LEU A O     1 
ATOM   7313  C  CB    . LEU A 1  966  ? 161.635 174.841 140.683 1.00 122.36 ? 966  LEU A CB    1 
ATOM   7314  C  CG    . LEU A 1  966  ? 160.414 175.704 140.977 1.00 122.36 ? 966  LEU A CG    1 
ATOM   7315  C  CD1   . LEU A 1  966  ? 159.995 176.446 139.723 1.00 122.36 ? 966  LEU A CD1   1 
ATOM   7316  C  CD2   . LEU A 1  966  ? 159.280 174.857 141.504 1.00 122.36 ? 966  LEU A CD2   1 
ATOM   7317  N  N     . ARG A 1  967  ? 164.562 173.774 141.081 1.00 123.53 ? 967  ARG A N     1 
ATOM   7318  C  CA    . ARG A 1  967  ? 165.693 172.986 140.613 1.00 123.53 ? 967  ARG A CA    1 
ATOM   7319  C  C     . ARG A 1  967  ? 166.217 172.038 141.683 1.00 123.53 ? 967  ARG A C     1 
ATOM   7320  O  O     . ARG A 1  967  ? 166.934 171.086 141.357 1.00 123.53 ? 967  ARG A O     1 
ATOM   7321  C  CB    . ARG A 1  967  ? 166.786 173.931 140.124 1.00 130.18 ? 967  ARG A CB    1 
ATOM   7322  C  CG    . ARG A 1  967  ? 166.360 174.699 138.895 1.00 130.18 ? 967  ARG A CG    1 
ATOM   7323  C  CD    . ARG A 1  967  ? 167.406 175.680 138.427 1.00 130.18 ? 967  ARG A CD    1 
ATOM   7324  N  NE    . ARG A 1  967  ? 166.974 176.340 137.203 1.00 130.18 ? 967  ARG A NE    1 
ATOM   7325  C  CZ    . ARG A 1  967  ? 167.138 175.843 135.981 1.00 130.18 ? 967  ARG A CZ    1 
ATOM   7326  N  NH1   . ARG A 1  967  ? 167.745 174.678 135.814 1.00 130.18 ? 967  ARG A NH1   1 
ATOM   7327  N  NH2   . ARG A 1  967  ? 166.704 176.516 134.925 1.00 130.18 ? 967  ARG A NH2   1 
ATOM   7328  N  N     . VAL A 1  968  ? 165.881 172.279 142.952 1.00 122.42 ? 968  VAL A N     1 
ATOM   7329  C  CA    . VAL A 1  968  ? 166.166 171.297 143.995 1.00 122.42 ? 968  VAL A CA    1 
ATOM   7330  C  C     . VAL A 1  968  ? 165.114 170.194 143.986 1.00 122.42 ? 968  VAL A C     1 
ATOM   7331  O  O     . VAL A 1  968  ? 165.428 169.009 144.150 1.00 122.42 ? 968  VAL A O     1 
ATOM   7332  C  CB    . VAL A 1  968  ? 166.251 171.983 145.370 1.00 122.93 ? 968  VAL A CB    1 
ATOM   7333  C  CG1   . VAL A 1  968  ? 166.386 170.947 146.473 1.00 122.93 ? 968  VAL A CG1   1 
ATOM   7334  C  CG2   . VAL A 1  968  ? 167.422 172.951 145.404 1.00 122.93 ? 968  VAL A CG2   1 
ATOM   7335  N  N     . ILE A 1  969  ? 163.850 170.567 143.782 1.00 121.23 ? 969  ILE A N     1 
ATOM   7336  C  CA    . ILE A 1  969  ? 162.760 169.606 143.904 1.00 121.23 ? 969  ILE A CA    1 
ATOM   7337  C  C     . ILE A 1  969  ? 162.665 168.726 142.662 1.00 121.23 ? 969  ILE A C     1 
ATOM   7338  O  O     . ILE A 1  969  ? 162.370 167.529 142.757 1.00 121.23 ? 969  ILE A O     1 
ATOM   7339  C  CB    . ILE A 1  969  ? 161.436 170.341 144.178 1.00 120.15 ? 969  ILE A CB    1 
ATOM   7340  C  CG1   . ILE A 1  969  ? 161.498 171.076 145.515 1.00 120.15 ? 969  ILE A CG1   1 
ATOM   7341  C  CG2   . ILE A 1  969  ? 160.273 169.365 144.185 1.00 120.15 ? 969  ILE A CG2   1 
ATOM   7342  C  CD1   . ILE A 1  969  ? 160.333 172.012 145.733 1.00 120.15 ? 969  ILE A CD1   1 
ATOM   7343  N  N     . PHE A 1  970  ? 162.916 169.294 141.479 1.00 124.03 ? 970  PHE A N     1 
ATOM   7344  C  CA    . PHE A 1  970  ? 162.691 168.610 140.206 1.00 124.03 ? 970  PHE A CA    1 
ATOM   7345  C  C     . PHE A 1  970  ? 163.992 168.466 139.425 1.00 124.03 ? 970  PHE A C     1 
ATOM   7346  O  O     . PHE A 1  970  ? 164.293 169.285 138.545 1.00 124.03 ? 970  PHE A O     1 
ATOM   7347  C  CB    . PHE A 1  970  ? 161.647 169.340 139.361 1.00 120.46 ? 970  PHE A CB    1 
ATOM   7348  C  CG    . PHE A 1  970  ? 160.264 169.304 139.937 1.00 120.46 ? 970  PHE A CG    1 
ATOM   7349  C  CD1   . PHE A 1  970  ? 159.448 168.207 139.735 1.00 120.46 ? 970  PHE A CD1   1 
ATOM   7350  C  CD2   . PHE A 1  970  ? 159.773 170.370 140.669 1.00 120.46 ? 970  PHE A CD2   1 
ATOM   7351  C  CE1   . PHE A 1  970  ? 158.173 168.167 140.259 1.00 120.46 ? 970  PHE A CE1   1 
ATOM   7352  C  CE2   . PHE A 1  970  ? 158.497 170.337 141.195 1.00 120.46 ? 970  PHE A CE2   1 
ATOM   7353  C  CZ    . PHE A 1  970  ? 157.697 169.234 140.990 1.00 120.46 ? 970  PHE A CZ    1 
ATOM   7354  N  N     . PRO A 1  971  ? 164.787 167.439 139.716 1.00 127.95 ? 971  PRO A N     1 
ATOM   7355  C  CA    . PRO A 1  971  ? 165.838 167.038 138.778 1.00 127.95 ? 971  PRO A CA    1 
ATOM   7356  C  C     . PRO A 1  971  ? 165.230 166.391 137.544 1.00 127.95 ? 971  PRO A C     1 
ATOM   7357  O  O     . PRO A 1  971  ? 164.051 166.033 137.516 1.00 127.95 ? 971  PRO A O     1 
ATOM   7358  C  CB    . PRO A 1  971  ? 166.676 166.040 139.583 1.00 123.36 ? 971  PRO A CB    1 
ATOM   7359  C  CG    . PRO A 1  971  ? 165.719 165.477 140.570 1.00 123.36 ? 971  PRO A CG    1 
ATOM   7360  C  CD    . PRO A 1  971  ? 164.789 166.605 140.930 1.00 123.36 ? 971  PRO A CD    1 
ATOM   7361  N  N     . THR A 1  972  ? 166.057 166.275 136.500 1.00 136.25 ? 972  THR A N     1 
ATOM   7362  C  CA    . THR A 1  972  ? 165.675 165.770 135.180 1.00 136.25 ? 972  THR A CA    1 
ATOM   7363  C  C     . THR A 1  972  ? 164.713 166.723 134.476 1.00 136.25 ? 972  THR A C     1 
ATOM   7364  O  O     . THR A 1  972  ? 164.399 166.537 133.296 1.00 136.25 ? 972  THR A O     1 
ATOM   7365  C  CB    . THR A 1  972  ? 165.056 164.365 135.252 1.00 139.68 ? 972  THR A CB    1 
ATOM   7366  O  OG1   . THR A 1  972  ? 163.834 164.404 135.999 1.00 139.68 ? 972  THR A OG1   1 
ATOM   7367  C  CG2   . THR A 1  972  ? 166.020 163.388 135.916 1.00 139.68 ? 972  THR A CG2   1 
ATOM   7368  N  N     . GLY A 1  973  ? 164.241 167.741 135.190 1.00 134.24 ? 973  GLY A N     1 
ATOM   7369  C  CA    . GLY A 1  973  ? 163.473 168.817 134.597 1.00 134.24 ? 973  GLY A CA    1 
ATOM   7370  C  C     . GLY A 1  973  ? 162.119 168.447 134.035 1.00 134.24 ? 973  GLY A C     1 
ATOM   7371  O  O     . GLY A 1  973  ? 161.770 168.874 132.930 1.00 134.24 ? 973  GLY A O     1 
ATOM   7372  N  N     . ASP A 1  974  ? 161.341 167.663 134.773 1.00 134.58 ? 974  ASP A N     1 
ATOM   7373  C  CA    . ASP A 1  974  ? 159.971 167.386 134.365 1.00 134.58 ? 974  ASP A CA    1 
ATOM   7374  C  C     . ASP A 1  974  ? 159.103 168.567 134.779 1.00 134.58 ? 974  ASP A C     1 
ATOM   7375  O  O     . ASP A 1  974  ? 158.961 168.853 135.973 1.00 134.58 ? 974  ASP A O     1 
ATOM   7376  C  CB    . ASP A 1  974  ? 159.472 166.089 134.996 1.00 140.61 ? 974  ASP A CB    1 
ATOM   7377  C  CG    . ASP A 1  974  ? 158.113 165.664 134.466 1.00 140.61 ? 974  ASP A CG    1 
ATOM   7378  O  OD1   . ASP A 1  974  ? 157.592 166.330 133.546 1.00 140.61 ? 974  ASP A OD1   1 
ATOM   7379  O  OD2   . ASP A 1  974  ? 157.568 164.660 134.969 1.00 140.61 ? 974  ASP A OD2   1 
ATOM   7380  N  N     . SER A 1  975  ? 158.520 169.248 133.796 1.00 126.33 ? 975  SER A N     1 
ATOM   7381  C  CA    . SER A 1  975  ? 157.756 170.462 134.039 1.00 126.33 ? 975  SER A CA    1 
ATOM   7382  C  C     . SER A 1  975  ? 156.258 170.219 134.133 1.00 126.33 ? 975  SER A C     1 
ATOM   7383  O  O     . SER A 1  975  ? 155.503 171.175 134.326 1.00 126.33 ? 975  SER A O     1 
ATOM   7384  C  CB    . SER A 1  975  ? 158.042 171.494 132.943 1.00 126.63 ? 975  SER A CB    1 
ATOM   7385  O  OG    . SER A 1  975  ? 157.612 171.024 131.680 1.00 126.63 ? 975  SER A OG    1 
ATOM   7386  N  N     . LYS A 1  976  ? 155.809 168.973 134.011 1.00 118.60 ? 976  LYS A N     1 
ATOM   7387  C  CA    . LYS A 1  976  ? 154.388 168.655 134.094 1.00 118.60 ? 976  LYS A CA    1 
ATOM   7388  C  C     . LYS A 1  976  ? 154.075 168.327 135.548 1.00 118.60 ? 976  LYS A C     1 
ATOM   7389  O  O     . LYS A 1  976  ? 154.495 167.288 136.065 1.00 118.60 ? 976  LYS A O     1 
ATOM   7390  C  CB    . LYS A 1  976  ? 154.041 167.495 133.165 1.00 111.72 ? 976  LYS A CB    1 
ATOM   7391  C  CG    . LYS A 1  976  ? 152.559 167.182 133.079 1.00 111.72 ? 976  LYS A CG    1 
ATOM   7392  C  CD    . LYS A 1  976  ? 152.308 165.959 132.210 1.00 111.72 ? 976  LYS A CD    1 
ATOM   7393  C  CE    . LYS A 1  976  ? 152.631 166.245 130.753 1.00 111.72 ? 976  LYS A CE    1 
ATOM   7394  N  NZ    . LYS A 1  976  ? 152.407 165.058 129.883 1.00 111.72 ? 976  LYS A NZ    1 
ATOM   7395  N  N     . VAL A 1  977  ? 153.331 169.215 136.202 1.00 113.33 ? 977  VAL A N     1 
ATOM   7396  C  CA    . VAL A 1  977  ? 153.096 169.152 137.638 1.00 113.33 ? 977  VAL A CA    1 
ATOM   7397  C  C     . VAL A 1  977  ? 151.610 169.346 137.895 1.00 113.33 ? 977  VAL A C     1 
ATOM   7398  O  O     . VAL A 1  977  ? 150.980 170.231 137.309 1.00 113.33 ? 977  VAL A O     1 
ATOM   7399  C  CB    . VAL A 1  977  ? 153.923 170.213 138.396 1.00 115.60 ? 977  VAL A CB    1 
ATOM   7400  C  CG1   . VAL A 1  977  ? 153.588 170.194 139.873 1.00 115.60 ? 977  VAL A CG1   1 
ATOM   7401  C  CG2   . VAL A 1  977  ? 155.410 169.983 138.180 1.00 115.60 ? 977  VAL A CG2   1 
ATOM   7402  N  N     . VAL A 1  978  ? 151.058 168.528 138.782 1.00 107.58 ? 978  VAL A N     1 
ATOM   7403  C  CA    . VAL A 1  978  ? 149.626 168.514 139.053 1.00 107.58 ? 978  VAL A CA    1 
ATOM   7404  C  C     . VAL A 1  978  ? 149.321 169.539 140.142 1.00 107.58 ? 978  VAL A C     1 
ATOM   7405  O  O     . VAL A 1  978  ? 149.885 169.476 141.239 1.00 107.58 ? 978  VAL A O     1 
ATOM   7406  C  CB    . VAL A 1  978  ? 149.167 167.110 139.469 1.00 108.22 ? 978  VAL A CB    1 
ATOM   7407  C  CG1   . VAL A 1  978  ? 147.710 167.124 139.813 1.00 108.22 ? 978  VAL A CG1   1 
ATOM   7408  C  CG2   . VAL A 1  978  ? 149.443 166.112 138.358 1.00 108.22 ? 978  VAL A CG2   1 
ATOM   7409  N  N     . LEU A 1  979  ? 148.425 170.476 139.844 1.00 109.28 ? 979  LEU A N     1 
ATOM   7410  C  CA    . LEU A 1  979  ? 148.088 171.565 140.752 1.00 109.28 ? 979  LEU A CA    1 
ATOM   7411  C  C     . LEU A 1  979  ? 146.591 171.845 140.697 1.00 109.28 ? 979  LEU A C     1 
ATOM   7412  O  O     . LEU A 1  979  ? 145.936 171.534 139.694 1.00 109.28 ? 979  LEU A O     1 
ATOM   7413  C  CB    . LEU A 1  979  ? 148.892 172.834 140.421 1.00 108.31 ? 979  LEU A CB    1 
ATOM   7414  C  CG    . LEU A 1  979  ? 150.393 172.717 140.714 1.00 108.31 ? 979  LEU A CG    1 
ATOM   7415  C  CD1   . LEU A 1  979  ? 151.166 173.943 140.275 1.00 108.31 ? 979  LEU A CD1   1 
ATOM   7416  C  CD2   . LEU A 1  979  ? 150.616 172.465 142.192 1.00 108.31 ? 979  LEU A CD2   1 
ATOM   7417  N  N     . PRO A 1  980  ? 146.020 172.423 141.767 1.00 114.76 ? 980  PRO A N     1 
ATOM   7418  C  CA    . PRO A 1  980  ? 144.547 172.447 141.879 1.00 114.76 ? 980  PRO A CA    1 
ATOM   7419  C  C     . PRO A 1  980  ? 143.820 173.245 140.809 1.00 114.76 ? 980  PRO A C     1 
ATOM   7420  O  O     . PRO A 1  980  ? 142.845 172.740 140.234 1.00 114.76 ? 980  PRO A O     1 
ATOM   7421  C  CB    . PRO A 1  980  ? 144.328 173.036 143.278 1.00 111.09 ? 980  PRO A CB    1 
ATOM   7422  C  CG    . PRO A 1  980  ? 145.534 173.842 143.540 1.00 111.09 ? 980  PRO A CG    1 
ATOM   7423  C  CD    . PRO A 1  980  ? 146.659 173.055 142.933 1.00 111.09 ? 980  PRO A CD    1 
ATOM   7424  N  N     . CYS A 1  981  ? 144.241 174.470 140.526 1.00 116.07 ? 981  CYS A N     1 
ATOM   7425  C  CA    . CYS A 1  981  ? 143.508 175.334 139.613 1.00 116.07 ? 981  CYS A CA    1 
ATOM   7426  C  C     . CYS A 1  981  ? 144.376 175.688 138.415 1.00 116.07 ? 981  CYS A C     1 
ATOM   7427  O  O     . CYS A 1  981  ? 145.576 175.929 138.547 1.00 116.07 ? 981  CYS A O     1 
ATOM   7428  C  CB    . CYS A 1  981  ? 143.033 176.616 140.305 1.00 122.17 ? 981  CYS A CB    1 
ATOM   7429  S  SG    . CYS A 1  981  ? 144.340 177.602 141.058 1.00 122.17 ? 981  CYS A SG    1 
ATOM   7430  N  N     . ASN A 1  982  ? 143.749 175.731 137.240 1.00 112.48 ? 982  ASN A N     1 
ATOM   7431  C  CA    . ASN A 1  982  ? 144.463 175.941 135.986 1.00 112.48 ? 982  ASN A CA    1 
ATOM   7432  C  C     . ASN A 1  982  ? 144.503 177.439 135.717 1.00 112.48 ? 982  ASN A C     1 
ATOM   7433  O  O     . ASN A 1  982  ? 143.471 178.054 135.435 1.00 112.48 ? 982  ASN A O     1 
ATOM   7434  C  CB    . ASN A 1  982  ? 143.784 175.187 134.846 1.00 113.76 ? 982  ASN A CB    1 
ATOM   7435  C  CG    . ASN A 1  982  ? 144.629 175.134 133.588 1.00 113.76 ? 982  ASN A CG    1 
ATOM   7436  O  OD1   . ASN A 1  982  ? 145.555 175.925 133.409 1.00 113.76 ? 982  ASN A OD1   1 
ATOM   7437  N  ND2   . ASN A 1  982  ? 144.314 174.193 132.707 1.00 113.76 ? 982  ASN A ND2   1 
ATOM   7438  N  N     . LEU A 1  983  ? 145.699 178.021 135.794 1.00 110.40 ? 983  LEU A N     1 
ATOM   7439  C  CA    . LEU A 1  983  ? 145.818 179.473 135.739 1.00 110.40 ? 983  LEU A CA    1 
ATOM   7440  C  C     . LEU A 1  983  ? 145.738 179.987 134.307 1.00 110.40 ? 983  LEU A C     1 
ATOM   7441  O  O     . LEU A 1  983  ? 145.269 181.107 134.071 1.00 110.40 ? 983  LEU A O     1 
ATOM   7442  C  CB    . LEU A 1  983  ? 147.119 179.906 136.409 1.00 109.63 ? 983  LEU A CB    1 
ATOM   7443  C  CG    . LEU A 1  983  ? 147.146 179.574 137.903 1.00 109.63 ? 983  LEU A CG    1 
ATOM   7444  C  CD1   . LEU A 1  983  ? 148.498 179.869 138.512 1.00 109.63 ? 983  LEU A CD1   1 
ATOM   7445  C  CD2   . LEU A 1  983  ? 146.054 180.330 138.646 1.00 109.63 ? 983  LEU A CD2   1 
ATOM   7446  N  N     . LEU A 1  984  ? 146.180 179.185 133.339 1.00 107.81 ? 984  LEU A N     1 
ATOM   7447  C  CA    . LEU A 1  984  ? 146.118 179.612 131.945 1.00 107.81 ? 984  LEU A CA    1 
ATOM   7448  C  C     . LEU A 1  984  ? 144.677 179.661 131.453 1.00 107.81 ? 984  LEU A C     1 
ATOM   7449  O  O     . LEU A 1  984  ? 144.272 180.613 130.772 1.00 107.81 ? 984  LEU A O     1 
ATOM   7450  C  CB    . LEU A 1  984  ? 146.963 178.681 131.076 1.00 101.03 ? 984  LEU A CB    1 
ATOM   7451  C  CG    . LEU A 1  984  ? 148.462 178.700 131.385 1.00 101.03 ? 984  LEU A CG    1 
ATOM   7452  C  CD1   . LEU A 1  984  ? 149.205 177.659 130.559 1.00 101.03 ? 984  LEU A CD1   1 
ATOM   7453  C  CD2   . LEU A 1  984  ? 149.048 180.087 131.164 1.00 101.03 ? 984  LEU A CD2   1 
ATOM   7454  N  N     . ARG A 1  985  ? 143.880 178.644 131.797 1.00 108.28 ? 985  ARG A N     1 
ATOM   7455  C  CA    . ARG A 1  985  ? 142.472 178.670 131.419 1.00 108.28 ? 985  ARG A CA    1 
ATOM   7456  C  C     . ARG A 1  985  ? 141.750 179.834 132.080 1.00 108.28 ? 985  ARG A C     1 
ATOM   7457  O  O     . ARG A 1  985  ? 140.846 180.424 131.486 1.00 108.28 ? 985  ARG A O     1 
ATOM   7458  C  CB    . ARG A 1  985  ? 141.776 177.358 131.780 1.00 113.19 ? 985  ARG A CB    1 
ATOM   7459  C  CG    . ARG A 1  985  ? 142.215 176.147 130.980 1.00 113.19 ? 985  ARG A CG    1 
ATOM   7460  C  CD    . ARG A 1  985  ? 141.302 174.951 131.244 1.00 113.19 ? 985  ARG A CD    1 
ATOM   7461  N  NE    . ARG A 1  985  ? 141.305 174.521 132.639 1.00 113.19 ? 985  ARG A NE    1 
ATOM   7462  C  CZ    . ARG A 1  985  ? 140.335 174.798 133.505 1.00 113.19 ? 985  ARG A CZ    1 
ATOM   7463  N  NH1   . ARG A 1  985  ? 139.284 175.506 133.118 1.00 113.19 ? 985  ARG A NH1   1 
ATOM   7464  N  NH2   . ARG A 1  985  ? 140.415 174.369 134.757 1.00 113.19 ? 985  ARG A NH2   1 
ATOM   7465  N  N     . MET A 1  986  ? 142.135 180.185 133.307 1.00 107.94 ? 986  MET A N     1 
ATOM   7466  C  CA    . MET A 1  986  ? 141.440 181.255 134.017 1.00 107.94 ? 986  MET A CA    1 
ATOM   7467  C  C     . MET A 1  986  ? 141.819 182.625 133.463 1.00 107.94 ? 986  MET A C     1 
ATOM   7468  O  O     . MET A 1  986  ? 140.960 183.503 133.309 1.00 107.94 ? 986  MET A O     1 
ATOM   7469  C  CB    . MET A 1  986  ? 141.737 181.157 135.512 1.00 117.04 ? 986  MET A CB    1 
ATOM   7470  C  CG    . MET A 1  986  ? 141.116 179.928 136.154 1.00 117.04 ? 986  MET A CG    1 
ATOM   7471  S  SD    . MET A 1  986  ? 141.626 179.665 137.857 1.00 117.04 ? 986  MET A SD    1 
ATOM   7472  C  CE    . MET A 1  986  ? 140.773 181.014 138.651 1.00 117.04 ? 986  MET A CE    1 
ATOM   7473  N  N     . ILE A 1  987  ? 143.100 182.823 133.149 1.00 108.85 ? 987  ILE A N     1 
ATOM   7474  C  CA    . ILE A 1  987  ? 143.542 184.085 132.557 1.00 108.85 ? 987  ILE A CA    1 
ATOM   7475  C  C     . ILE A 1  987  ? 142.906 184.272 131.185 1.00 108.85 ? 987  ILE A C     1 
ATOM   7476  O  O     . ILE A 1  987  ? 142.326 185.324 130.875 1.00 108.85 ? 987  ILE A O     1 
ATOM   7477  C  CB    . ILE A 1  987  ? 145.078 184.130 132.474 1.00 108.93 ? 987  ILE A CB    1 
ATOM   7478  C  CG1   . ILE A 1  987  ? 145.690 184.183 133.874 1.00 108.93 ? 987  ILE A CG1   1 
ATOM   7479  C  CG2   . ILE A 1  987  ? 145.542 185.313 131.641 1.00 108.93 ? 987  ILE A CG2   1 
ATOM   7480  C  CD1   . ILE A 1  987  ? 147.183 183.967 133.896 1.00 108.93 ? 987  ILE A CD1   1 
ATOM   7481  N  N     . TRP A 1  988  ? 142.985 183.237 130.349 1.00 106.19 ? 988  TRP A N     1 
ATOM   7482  C  CA    . TRP A 1  988  ? 142.441 183.338 129.003 1.00 106.19 ? 988  TRP A CA    1 
ATOM   7483  C  C     . TRP A 1  988  ? 140.922 183.220 128.998 1.00 106.19 ? 988  TRP A C     1 
ATOM   7484  O  O     . TRP A 1  988  ? 140.299 183.423 127.951 1.00 106.19 ? 988  TRP A O     1 
ATOM   7485  C  CB    . TRP A 1  988  ? 143.131 182.292 128.116 1.00 104.50 ? 988  TRP A CB    1 
ATOM   7486  C  CG    . TRP A 1  988  ? 142.872 182.400 126.644 1.00 104.50 ? 988  TRP A CG    1 
ATOM   7487  C  CD1   . TRP A 1  988  ? 143.295 183.407 125.824 1.00 104.50 ? 988  TRP A CD1   1 
ATOM   7488  C  CD2   . TRP A 1  988  ? 142.308 181.402 125.788 1.00 104.50 ? 988  TRP A CD2   1 
ATOM   7489  N  NE1   . TRP A 1  988  ? 142.930 183.150 124.527 1.00 104.50 ? 988  TRP A NE1   1 
ATOM   7490  C  CE2   . TRP A 1  988  ? 142.334 181.916 124.472 1.00 104.50 ? 988  TRP A CE2   1 
ATOM   7491  C  CE3   . TRP A 1  988  ? 141.746 180.150 126.003 1.00 104.50 ? 988  TRP A CE3   1 
ATOM   7492  C  CZ2   . TRP A 1  988  ? 141.815 181.213 123.377 1.00 104.50 ? 988  TRP A CZ2   1 
ATOM   7493  C  CZ3   . TRP A 1  988  ? 141.215 179.453 124.909 1.00 104.50 ? 988  TRP A CZ3   1 
ATOM   7494  C  CH2   . TRP A 1  988  ? 141.278 179.979 123.612 1.00 104.50 ? 988  TRP A CH2   1 
ATOM   7495  N  N     . ASN A 1  989  ? 140.317 182.900 130.146 1.00 107.08 ? 989  ASN A N     1 
ATOM   7496  C  CA    . ASN A 1  989  ? 138.891 183.141 130.339 1.00 107.08 ? 989  ASN A CA    1 
ATOM   7497  C  C     . ASN A 1  989  ? 138.626 184.615 130.611 1.00 107.08 ? 989  ASN A C     1 
ATOM   7498  O  O     . ASN A 1  989  ? 137.693 185.205 130.056 1.00 107.08 ? 989  ASN A O     1 
ATOM   7499  C  CB    . ASN A 1  989  ? 138.344 182.294 131.491 1.00 108.66 ? 989  ASN A CB    1 
ATOM   7500  C  CG    . ASN A 1  989  ? 138.098 180.855 131.100 1.00 108.66 ? 989  ASN A CG    1 
ATOM   7501  O  OD1   . ASN A 1  989  ? 137.912 180.545 129.926 1.00 108.66 ? 989  ASN A OD1   1 
ATOM   7502  N  ND2   . ASN A 1  989  ? 138.094 179.964 132.086 1.00 108.66 ? 989  ASN A ND2   1 
ATOM   7503  N  N     . ALA A 1  990  ? 139.430 185.223 131.488 1.00 108.65 ? 990  ALA A N     1 
ATOM   7504  C  CA    . ALA A 1  990  ? 139.243 186.636 131.804 1.00 108.65 ? 990  ALA A CA    1 
ATOM   7505  C  C     . ALA A 1  990  ? 139.352 187.501 130.555 1.00 108.65 ? 990  ALA A C     1 
ATOM   7506  O  O     . ALA A 1  990  ? 138.535 188.410 130.344 1.00 108.65 ? 990  ALA A O     1 
ATOM   7507  C  CB    . ALA A 1  990  ? 140.263 187.080 132.852 1.00 109.76 ? 990  ALA A CB    1 
ATOM   7508  N  N     . GLN A 1  991  ? 140.353 187.226 129.712 1.00 109.28 ? 991  GLN A N     1 
ATOM   7509  C  CA    . GLN A 1  991  ? 140.518 187.991 128.478 1.00 109.28 ? 991  GLN A CA    1 
ATOM   7510  C  C     . GLN A 1  991  ? 139.249 187.967 127.633 1.00 109.28 ? 991  GLN A C     1 
ATOM   7511  O  O     . GLN A 1  991  ? 138.833 188.993 127.083 1.00 109.28 ? 991  GLN A O     1 
ATOM   7512  C  CB    . GLN A 1  991  ? 141.696 187.447 127.671 1.00 115.21 ? 991  GLN A CB    1 
ATOM   7513  C  CG    . GLN A 1  991  ? 143.048 187.636 128.324 1.00 115.21 ? 991  GLN A CG    1 
ATOM   7514  C  CD    . GLN A 1  991  ? 144.165 187.039 127.500 1.00 115.21 ? 991  GLN A CD    1 
ATOM   7515  O  OE1   . GLN A 1  991  ? 143.943 186.137 126.697 1.00 115.21 ? 991  GLN A OE1   1 
ATOM   7516  N  NE2   . GLN A 1  991  ? 145.374 187.543 127.690 1.00 115.21 ? 991  GLN A NE2   1 
ATOM   7517  N  N     . LYS A 1  992  ? 138.616 186.798 127.520 1.00 107.86 ? 992  LYS A N     1 
ATOM   7518  C  CA    . LYS A 1  992  ? 137.442 186.679 126.664 1.00 107.86 ? 992  LYS A CA    1 
ATOM   7519  C  C     . LYS A 1  992  ? 136.197 187.256 127.321 1.00 107.86 ? 992  LYS A C     1 
ATOM   7520  O  O     . LYS A 1  992  ? 135.331 187.802 126.629 1.00 107.86 ? 992  LYS A O     1 
ATOM   7521  C  CB    . LYS A 1  992  ? 137.217 185.218 126.286 1.00 106.89 ? 992  LYS A CB    1 
ATOM   7522  C  CG    . LYS A 1  992  ? 138.352 184.643 125.473 1.00 106.89 ? 992  LYS A CG    1 
ATOM   7523  C  CD    . LYS A 1  992  ? 138.431 185.340 124.130 1.00 106.89 ? 992  LYS A CD    1 
ATOM   7524  C  CE    . LYS A 1  992  ? 139.571 184.797 123.301 1.00 106.89 ? 992  LYS A CE    1 
ATOM   7525  N  NZ    . LYS A 1  992  ? 139.353 183.363 123.003 1.00 106.89 ? 992  LYS A NZ    1 
ATOM   7526  N  N     . ILE A 1  993  ? 136.083 187.146 128.644 1.00 109.08 ? 993  ILE A N     1 
ATOM   7527  C  CA    . ILE A 1  993  ? 134.909 187.679 129.323 1.00 109.08 ? 993  ILE A CA    1 
ATOM   7528  C  C     . ILE A 1  993  ? 134.907 189.199 129.279 1.00 109.08 ? 993  ILE A C     1 
ATOM   7529  O  O     . ILE A 1  993  ? 133.869 189.823 129.027 1.00 109.08 ? 993  ILE A O     1 
ATOM   7530  C  CB    . ILE A 1  993  ? 134.849 187.151 130.767 1.00 108.88 ? 993  ILE A CB    1 
ATOM   7531  C  CG1   . ILE A 1  993  ? 134.627 185.640 130.770 1.00 108.88 ? 993  ILE A CG1   1 
ATOM   7532  C  CG2   . ILE A 1  993  ? 133.748 187.845 131.545 1.00 108.88 ? 993  ILE A CG2   1 
ATOM   7533  C  CD1   . ILE A 1  993  ? 134.765 185.011 132.132 1.00 108.88 ? 993  ILE A CD1   1 
ATOM   7534  N  N     . PHE A 1  994  ? 136.059 189.820 129.519 1.00 109.24 ? 994  PHE A N     1 
ATOM   7535  C  CA    . PHE A 1  994  ? 136.154 191.272 129.574 1.00 109.24 ? 994  PHE A CA    1 
ATOM   7536  C  C     . PHE A 1  994  ? 136.615 191.901 128.262 1.00 109.24 ? 994  PHE A C     1 
ATOM   7537  O  O     . PHE A 1  994  ? 136.850 193.114 128.220 1.00 109.24 ? 994  PHE A O     1 
ATOM   7538  C  CB    . PHE A 1  994  ? 137.051 191.679 130.741 1.00 112.11 ? 994  PHE A CB    1 
ATOM   7539  C  CG    . PHE A 1  994  ? 136.443 191.374 132.081 1.00 112.11 ? 994  PHE A CG    1 
ATOM   7540  C  CD1   . PHE A 1  994  ? 135.068 191.272 132.218 1.00 112.11 ? 994  PHE A CD1   1 
ATOM   7541  C  CD2   . PHE A 1  994  ? 137.233 191.147 133.186 1.00 112.11 ? 994  PHE A CD2   1 
ATOM   7542  C  CE1   . PHE A 1  994  ? 134.497 190.986 133.442 1.00 112.11 ? 994  PHE A CE1   1 
ATOM   7543  C  CE2   . PHE A 1  994  ? 136.667 190.855 134.414 1.00 112.11 ? 994  PHE A CE2   1 
ATOM   7544  C  CZ    . PHE A 1  994  ? 135.298 190.774 134.541 1.00 112.11 ? 994  PHE A CZ    1 
ATOM   7545  N  N     . HIS A 1  995  ? 136.760 191.106 127.198 1.00 112.75 ? 995  HIS A N     1 
ATOM   7546  C  CA    . HIS A 1  995  ? 136.973 191.615 125.839 1.00 112.75 ? 995  HIS A CA    1 
ATOM   7547  C  C     . HIS A 1  995  ? 138.275 192.408 125.728 1.00 112.75 ? 995  HIS A C     1 
ATOM   7548  O  O     . HIS A 1  995  ? 138.308 193.532 125.222 1.00 112.75 ? 995  HIS A O     1 
ATOM   7549  C  CB    . HIS A 1  995  ? 135.782 192.460 125.381 1.00 110.41 ? 995  HIS A CB    1 
ATOM   7550  C  CG    . HIS A 1  995  ? 134.476 191.728 125.400 1.00 110.41 ? 995  HIS A CG    1 
ATOM   7551  N  ND1   . HIS A 1  995  ? 134.179 190.711 124.519 1.00 110.41 ? 995  HIS A ND1   1 
ATOM   7552  C  CD2   . HIS A 1  995  ? 133.387 191.869 126.192 1.00 110.41 ? 995  HIS A CD2   1 
ATOM   7553  C  CE1   . HIS A 1  995  ? 132.964 190.256 124.768 1.00 110.41 ? 995  HIS A CE1   1 
ATOM   7554  N  NE2   . HIS A 1  995  ? 132.462 190.942 125.779 1.00 110.41 ? 995  HIS A NE2   1 
ATOM   7555  N  N     . ILE A 1  996  ? 139.362 191.806 126.204 1.00 117.06 ? 996  ILE A N     1 
ATOM   7556  C  CA    . ILE A 1  996  ? 140.654 192.478 126.202 1.00 117.06 ? 996  ILE A CA    1 
ATOM   7557  C  C     . ILE A 1  996  ? 141.245 192.463 124.800 1.00 117.06 ? 996  ILE A C     1 
ATOM   7558  O  O     . ILE A 1  996  ? 141.226 191.435 124.110 1.00 117.06 ? 996  ILE A O     1 
ATOM   7559  C  CB    . ILE A 1  996  ? 141.593 191.814 127.219 1.00 118.67 ? 996  ILE A CB    1 
ATOM   7560  C  CG1   . ILE A 1  996  ? 141.084 192.077 128.637 1.00 118.67 ? 996  ILE A CG1   1 
ATOM   7561  C  CG2   . ILE A 1  996  ? 143.016 192.298 127.033 1.00 118.67 ? 996  ILE A CG2   1 
ATOM   7562  C  CD1   . ILE A 1  996  ? 141.792 191.286 129.690 1.00 118.67 ? 996  ILE A CD1   1 
ATOM   7563  N  N     . ASN A 1  997  ? 141.773 193.611 124.371 1.00 123.53 ? 997  ASN A N     1 
ATOM   7564  C  CA    . ASN A 1  997  ? 142.407 193.725 123.064 1.00 123.53 ? 997  ASN A CA    1 
ATOM   7565  C  C     . ASN A 1  997  ? 143.918 193.762 123.264 1.00 123.53 ? 997  ASN A C     1 
ATOM   7566  O  O     . ASN A 1  997  ? 144.434 194.742 123.819 1.00 123.53 ? 997  ASN A O     1 
ATOM   7567  C  CB    . ASN A 1  997  ? 141.932 194.982 122.347 1.00 125.82 ? 997  ASN A CB    1 
ATOM   7568  C  CG    . ASN A 1  997  ? 142.373 195.035 120.896 1.00 125.82 ? 997  ASN A CG    1 
ATOM   7569  O  OD1   . ASN A 1  997  ? 143.308 194.346 120.489 1.00 125.82 ? 997  ASN A OD1   1 
ATOM   7570  N  ND2   . ASN A 1  997  ? 141.700 195.862 120.107 1.00 125.82 ? 997  ASN A ND2   1 
ATOM   7571  N  N     . PRO A 1  998  ? 144.659 192.736 122.838 1.00 127.23 ? 998  PRO A N     1 
ATOM   7572  C  CA    . PRO A 1  998  ? 146.121 192.755 123.016 1.00 127.23 ? 998  PRO A CA    1 
ATOM   7573  C  C     . PRO A 1  998  ? 146.829 193.811 122.182 1.00 127.23 ? 998  PRO A C     1 
ATOM   7574  O  O     . PRO A 1  998  ? 148.008 194.086 122.438 1.00 127.23 ? 998  PRO A O     1 
ATOM   7575  C  CB    . PRO A 1  998  ? 146.544 191.340 122.605 1.00 124.10 ? 998  PRO A CB    1 
ATOM   7576  C  CG    . PRO A 1  998  ? 145.483 190.904 121.650 1.00 124.10 ? 998  PRO A CG    1 
ATOM   7577  C  CD    . PRO A 1  998  ? 144.202 191.506 122.166 1.00 124.10 ? 998  PRO A CD    1 
ATOM   7578  N  N     . ARG A 1  999  ? 146.156 194.401 121.197 1.00 130.39 ? 999  ARG A N     1 
ATOM   7579  C  CA    . ARG A 1  999  ? 146.761 195.405 120.331 1.00 130.39 ? 999  ARG A CA    1 
ATOM   7580  C  C     . ARG A 1  999  ? 146.810 196.788 120.966 1.00 130.39 ? 999  ARG A C     1 
ATOM   7581  O  O     . ARG A 1  999  ? 147.319 197.720 120.337 1.00 130.39 ? 999  ARG A O     1 
ATOM   7582  C  CB    . ARG A 1  999  ? 145.988 195.487 119.012 1.00 135.36 ? 999  ARG A CB    1 
ATOM   7583  C  CG    . ARG A 1  999  ? 145.976 194.206 118.199 1.00 135.36 ? 999  ARG A CG    1 
ATOM   7584  C  CD    . ARG A 1  999  ? 147.364 193.838 117.711 1.00 135.36 ? 999  ARG A CD    1 
ATOM   7585  N  NE    . ARG A 1  999  ? 147.947 194.910 116.912 1.00 135.36 ? 999  ARG A NE    1 
ATOM   7586  C  CZ    . ARG A 1  999  ? 147.652 195.140 115.637 1.00 135.36 ? 999  ARG A CZ    1 
ATOM   7587  N  NH1   . ARG A 1  999  ? 146.766 194.379 115.010 1.00 135.36 ? 999  ARG A NH1   1 
ATOM   7588  N  NH2   . ARG A 1  999  ? 148.233 196.142 114.992 1.00 135.36 ? 999  ARG A NH2   1 
ATOM   7589  N  N     . LEU A 1  1000 ? 146.294 196.945 122.182 1.00 130.65 ? 1000 LEU A N     1 
ATOM   7590  C  CA    . LEU A 1  1000 ? 146.190 198.222 122.863 1.00 130.65 ? 1000 LEU A CA    1 
ATOM   7591  C  C     . LEU A 1  1000 ? 147.038 198.230 124.134 1.00 130.65 ? 1000 LEU A C     1 
ATOM   7592  O  O     . LEU A 1  1000 ? 147.315 197.172 124.706 1.00 130.65 ? 1000 LEU A O     1 
ATOM   7593  C  CB    . LEU A 1  1000 ? 144.730 198.519 123.226 1.00 126.66 ? 1000 LEU A CB    1 
ATOM   7594  C  CG    . LEU A 1  1000 ? 143.757 198.680 122.057 1.00 126.66 ? 1000 LEU A CG    1 
ATOM   7595  C  CD1   . LEU A 1  1000 ? 142.334 198.822 122.572 1.00 126.66 ? 1000 LEU A CD1   1 
ATOM   7596  C  CD2   . LEU A 1  1000 ? 144.143 199.874 121.199 1.00 126.66 ? 1000 LEU A CD2   1 
ATOM   7597  N  N     . PRO A 1  1001 ? 147.475 199.403 124.595 1.00 135.85 ? 1001 PRO A N     1 
ATOM   7598  C  CA    . PRO A 1  1001 ? 148.218 199.463 125.861 1.00 135.85 ? 1001 PRO A CA    1 
ATOM   7599  C  C     . PRO A 1  1001 ? 147.304 199.173 127.044 1.00 135.85 ? 1001 PRO A C     1 
ATOM   7600  O  O     . PRO A 1  1001 ? 146.149 199.605 127.077 1.00 135.85 ? 1001 PRO A O     1 
ATOM   7601  C  CB    . PRO A 1  1001 ? 148.751 200.898 125.892 1.00 134.33 ? 1001 PRO A CB    1 
ATOM   7602  C  CG    . PRO A 1  1001 ? 147.780 201.667 125.066 1.00 134.33 ? 1001 PRO A CG    1 
ATOM   7603  C  CD    . PRO A 1  1001 ? 147.360 200.731 123.964 1.00 134.33 ? 1001 PRO A CD    1 
ATOM   7604  N  N     . SER A 1  1002 ? 147.832 198.437 128.017 1.00 137.92 ? 1002 SER A N     1 
ATOM   7605  C  CA    . SER A 1  1002 ? 147.059 198.031 129.181 1.00 137.92 ? 1002 SER A CA    1 
ATOM   7606  C  C     . SER A 1  1002 ? 146.991 199.149 130.214 1.00 137.92 ? 1002 SER A C     1 
ATOM   7607  O  O     . SER A 1  1002 ? 147.916 199.951 130.359 1.00 137.92 ? 1002 SER A O     1 
ATOM   7608  C  CB    . SER A 1  1002 ? 147.666 196.780 129.815 1.00 136.50 ? 1002 SER A CB    1 
ATOM   7609  O  OG    . SER A 1  1002 ? 146.951 196.400 130.977 1.00 136.50 ? 1002 SER A OG    1 
ATOM   7610  N  N     . ASP A 1  1003 ? 145.876 199.190 130.938 1.00 138.98 ? 1003 ASP A N     1 
ATOM   7611  C  CA    . ASP A 1  1003 ? 145.666 200.159 132.006 1.00 138.98 ? 1003 ASP A CA    1 
ATOM   7612  C  C     . ASP A 1  1003 ? 146.054 199.624 133.378 1.00 138.98 ? 1003 ASP A C     1 
ATOM   7613  O  O     . ASP A 1  1003 ? 145.886 200.335 134.374 1.00 138.98 ? 1003 ASP A O     1 
ATOM   7614  C  CB    . ASP A 1  1003 ? 144.202 200.609 132.027 1.00 139.40 ? 1003 ASP A CB    1 
ATOM   7615  C  CG    . ASP A 1  1003 ? 143.239 199.456 132.246 1.00 139.40 ? 1003 ASP A CG    1 
ATOM   7616  O  OD1   . ASP A 1  1003 ? 143.684 198.289 132.227 1.00 139.40 ? 1003 ASP A OD1   1 
ATOM   7617  O  OD2   . ASP A 1  1003 ? 142.034 199.718 132.444 1.00 139.40 ? 1003 ASP A OD2   1 
ATOM   7618  N  N     . LEU A 1  1004 ? 146.562 198.398 133.453 1.00 135.52 ? 1004 LEU A N     1 
ATOM   7619  C  CA    . LEU A 1  1004 ? 146.847 197.765 134.732 1.00 135.52 ? 1004 LEU A CA    1 
ATOM   7620  C  C     . LEU A 1  1004 ? 148.151 198.286 135.318 1.00 135.52 ? 1004 LEU A C     1 
ATOM   7621  O  O     . LEU A 1  1004 ? 149.159 198.410 134.618 1.00 135.52 ? 1004 LEU A O     1 
ATOM   7622  C  CB    . LEU A 1  1004 ? 146.912 196.248 134.564 1.00 132.35 ? 1004 LEU A CB    1 
ATOM   7623  C  CG    . LEU A 1  1004 ? 147.271 195.400 135.783 1.00 132.35 ? 1004 LEU A CG    1 
ATOM   7624  C  CD1   . LEU A 1  1004 ? 146.250 195.580 136.890 1.00 132.35 ? 1004 LEU A CD1   1 
ATOM   7625  C  CD2   . LEU A 1  1004 ? 147.358 193.944 135.373 1.00 132.35 ? 1004 LEU A CD2   1 
ATOM   7626  N  N     . HIS A 1  1005 ? 148.127 198.584 136.611 1.00 134.42 ? 1005 HIS A N     1 
ATOM   7627  C  CA    . HIS A 1  1005 ? 149.300 199.114 137.293 1.00 134.42 ? 1005 HIS A CA    1 
ATOM   7628  C  C     . HIS A 1  1005 ? 150.205 197.965 137.724 1.00 134.42 ? 1005 HIS A C     1 
ATOM   7629  O  O     . HIS A 1  1005 ? 149.731 197.029 138.377 1.00 134.42 ? 1005 HIS A O     1 
ATOM   7630  C  CB    . HIS A 1  1005 ? 148.886 199.940 138.503 1.00 135.13 ? 1005 HIS A CB    1 
ATOM   7631  C  CG    . HIS A 1  1005 ? 150.014 200.683 139.148 1.00 135.13 ? 1005 HIS A CG    1 
ATOM   7632  N  ND1   . HIS A 1  1005 ? 150.751 201.637 138.480 1.00 135.13 ? 1005 HIS A ND1   1 
ATOM   7633  C  CD2   . HIS A 1  1005 ? 150.516 200.630 140.403 1.00 135.13 ? 1005 HIS A CD2   1 
ATOM   7634  C  CE1   . HIS A 1  1005 ? 151.668 202.130 139.293 1.00 135.13 ? 1005 HIS A CE1   1 
ATOM   7635  N  NE2   . HIS A 1  1005 ? 151.546 201.537 140.466 1.00 135.13 ? 1005 HIS A NE2   1 
ATOM   7636  N  N     . PRO A 1  1006 ? 151.494 197.998 137.379 1.00 130.85 ? 1006 PRO A N     1 
ATOM   7637  C  CA    . PRO A 1  1006 ? 152.343 196.819 137.625 1.00 130.85 ? 1006 PRO A CA    1 
ATOM   7638  C  C     . PRO A 1  1006 ? 152.570 196.509 139.093 1.00 130.85 ? 1006 PRO A C     1 
ATOM   7639  O  O     . PRO A 1  1006 ? 152.953 195.378 139.419 1.00 130.85 ? 1006 PRO A O     1 
ATOM   7640  C  CB    . PRO A 1  1006 ? 153.652 197.183 136.911 1.00 129.18 ? 1006 PRO A CB    1 
ATOM   7641  C  CG    . PRO A 1  1006 ? 153.669 198.668 136.899 1.00 129.18 ? 1006 PRO A CG    1 
ATOM   7642  C  CD    . PRO A 1  1006 ? 152.238 199.088 136.729 1.00 129.18 ? 1006 PRO A CD    1 
ATOM   7643  N  N     . ILE A 1  1007 ? 152.357 197.469 139.996 1.00 132.93 ? 1007 ILE A N     1 
ATOM   7644  C  CA    . ILE A 1  1007 ? 152.459 197.172 141.423 1.00 132.93 ? 1007 ILE A CA    1 
ATOM   7645  C  C     . ILE A 1  1007 ? 151.303 196.285 141.858 1.00 132.93 ? 1007 ILE A C     1 
ATOM   7646  O  O     . ILE A 1  1007 ? 151.501 195.227 142.465 1.00 132.93 ? 1007 ILE A O     1 
ATOM   7647  C  CB    . ILE A 1  1007 ? 152.491 198.465 142.253 1.00 134.78 ? 1007 ILE A CB    1 
ATOM   7648  C  CG1   . ILE A 1  1007 ? 153.765 199.252 142.000 1.00 134.78 ? 1007 ILE A CG1   1 
ATOM   7649  C  CG2   . ILE A 1  1007 ? 152.376 198.149 143.732 1.00 134.78 ? 1007 ILE A CG2   1 
ATOM   7650  C  CD1   . ILE A 1  1007 ? 153.733 200.580 142.680 1.00 134.78 ? 1007 ILE A CD1   1 
ATOM   7651  N  N     . LYS A 1  1008 ? 150.075 196.707 141.545 1.00 131.76 ? 1008 LYS A N     1 
ATOM   7652  C  CA    . LYS A 1  1008 ? 148.886 196.019 142.033 1.00 131.76 ? 1008 LYS A CA    1 
ATOM   7653  C  C     . LYS A 1  1008 ? 148.822 194.574 141.563 1.00 131.76 ? 1008 LYS A C     1 
ATOM   7654  O  O     . LYS A 1  1008 ? 148.025 193.792 142.093 1.00 131.76 ? 1008 LYS A O     1 
ATOM   7655  C  CB    . LYS A 1  1008 ? 147.639 196.787 141.599 1.00 132.84 ? 1008 LYS A CB    1 
ATOM   7656  C  CG    . LYS A 1  1008 ? 147.552 198.164 142.234 1.00 132.84 ? 1008 LYS A CG    1 
ATOM   7657  C  CD    . LYS A 1  1008 ? 146.379 198.967 141.715 1.00 132.84 ? 1008 LYS A CD    1 
ATOM   7658  C  CE    . LYS A 1  1008 ? 146.332 200.329 142.386 1.00 132.84 ? 1008 LYS A CE    1 
ATOM   7659  N  NZ    . LYS A 1  1008 ? 145.234 201.176 141.855 1.00 132.84 ? 1008 LYS A NZ    1 
ATOM   7660  N  N     . VAL A 1  1009 ? 149.640 194.205 140.578 1.00 131.81 ? 1009 VAL A N     1 
ATOM   7661  C  CA    . VAL A 1  1009 ? 149.865 192.793 140.286 1.00 131.81 ? 1009 VAL A CA    1 
ATOM   7662  C  C     . VAL A 1  1009 ? 150.587 192.131 141.454 1.00 131.81 ? 1009 VAL A C     1 
ATOM   7663  O  O     . VAL A 1  1009 ? 150.142 191.110 141.992 1.00 131.81 ? 1009 VAL A O     1 
ATOM   7664  C  CB    . VAL A 1  1009 ? 150.654 192.637 138.976 1.00 128.82 ? 1009 VAL A CB    1 
ATOM   7665  C  CG1   . VAL A 1  1009 ? 150.996 191.189 138.741 1.00 128.82 ? 1009 VAL A CG1   1 
ATOM   7666  C  CG2   . VAL A 1  1009 ? 149.862 193.191 137.808 1.00 128.82 ? 1009 VAL A CG2   1 
ATOM   7667  N  N     . VAL A 1  1010 ? 151.707 192.725 141.874 1.00 132.58 ? 1010 VAL A N     1 
ATOM   7668  C  CA    . VAL A 1  1010 ? 152.508 192.157 142.957 1.00 132.58 ? 1010 VAL A CA    1 
ATOM   7669  C  C     . VAL A 1  1010 ? 151.721 192.174 144.262 1.00 132.58 ? 1010 VAL A C     1 
ATOM   7670  O  O     . VAL A 1  1010 ? 151.656 191.173 144.984 1.00 132.58 ? 1010 VAL A O     1 
ATOM   7671  C  CB    . VAL A 1  1010 ? 153.839 192.916 143.098 1.00 132.04 ? 1010 VAL A CB    1 
ATOM   7672  C  CG1   . VAL A 1  1010 ? 154.637 192.374 144.272 1.00 132.04 ? 1010 VAL A CG1   1 
ATOM   7673  C  CG2   . VAL A 1  1010 ? 154.639 192.828 141.810 1.00 132.04 ? 1010 VAL A CG2   1 
ATOM   7674  N  N     . GLU A 1  1011 ? 151.118 193.320 144.586 1.00 131.88 ? 1011 GLU A N     1 
ATOM   7675  C  CA    . GLU A 1  1011 ? 150.309 193.416 145.797 1.00 131.88 ? 1011 GLU A CA    1 
ATOM   7676  C  C     . GLU A 1  1011 ? 149.082 192.520 145.717 1.00 131.88 ? 1011 GLU A C     1 
ATOM   7677  O  O     . GLU A 1  1011 ? 148.593 192.043 146.747 1.00 131.88 ? 1011 GLU A O     1 
ATOM   7678  C  CB    . GLU A 1  1011 ? 149.895 194.867 146.037 1.00 145.56 ? 1011 GLU A CB    1 
ATOM   7679  C  CG    . GLU A 1  1011 ? 151.055 195.797 146.356 1.00 145.56 ? 1011 GLU A CG    1 
ATOM   7680  C  CD    . GLU A 1  1011 ? 150.617 197.238 146.530 1.00 145.56 ? 1011 GLU A CD    1 
ATOM   7681  O  OE1   . GLU A 1  1011 ? 149.444 197.546 146.230 1.00 145.56 ? 1011 GLU A OE1   1 
ATOM   7682  O  OE2   . GLU A 1  1011 ? 151.447 198.065 146.964 1.00 145.56 ? 1011 GLU A OE2   1 
ATOM   7683  N  N     . GLY A 1  1012 ? 148.574 192.278 144.507 1.00 129.57 ? 1012 GLY A N     1 
ATOM   7684  C  CA    . GLY A 1  1012 ? 147.459 191.357 144.361 1.00 129.57 ? 1012 GLY A CA    1 
ATOM   7685  C  C     . GLY A 1  1012 ? 147.858 189.923 144.647 1.00 129.57 ? 1012 GLY A C     1 
ATOM   7686  O  O     . GLY A 1  1012 ? 147.101 189.163 145.256 1.00 129.57 ? 1012 GLY A O     1 
ATOM   7687  N  N     . VAL A 1  1013 ? 149.062 189.534 144.219 1.00 126.10 ? 1013 VAL A N     1 
ATOM   7688  C  CA    . VAL A 1  1013 ? 149.535 188.175 144.474 1.00 126.10 ? 1013 VAL A CA    1 
ATOM   7689  C  C     . VAL A 1  1013 ? 149.895 188.005 145.947 1.00 126.10 ? 1013 VAL A C     1 
ATOM   7690  O  O     . VAL A 1  1013 ? 149.603 186.973 146.561 1.00 126.10 ? 1013 VAL A O     1 
ATOM   7691  C  CB    . VAL A 1  1013 ? 150.723 187.839 143.555 1.00 123.03 ? 1013 VAL A CB    1 
ATOM   7692  C  CG1   . VAL A 1  1013 ? 151.287 186.468 143.890 1.00 123.03 ? 1013 VAL A CG1   1 
ATOM   7693  C  CG2   . VAL A 1  1013 ? 150.297 187.897 142.098 1.00 123.03 ? 1013 VAL A CG2   1 
ATOM   7694  N  N     . LYS A 1  1014 ? 150.532 189.020 146.537 1.00 126.89 ? 1014 LYS A N     1 
ATOM   7695  C  CA    . LYS A 1  1014 ? 150.901 188.947 147.948 1.00 126.89 ? 1014 LYS A CA    1 
ATOM   7696  C  C     . LYS A 1  1014 ? 149.666 188.903 148.839 1.00 126.89 ? 1014 LYS A C     1 
ATOM   7697  O  O     . LYS A 1  1014 ? 149.570 188.071 149.747 1.00 126.89 ? 1014 LYS A O     1 
ATOM   7698  C  CB    . LYS A 1  1014 ? 151.795 190.128 148.324 1.00 127.21 ? 1014 LYS A CB    1 
ATOM   7699  C  CG    . LYS A 1  1014 ? 153.205 190.042 147.771 1.00 127.21 ? 1014 LYS A CG    1 
ATOM   7700  C  CD    . LYS A 1  1014 ? 154.031 191.233 148.216 1.00 127.21 ? 1014 LYS A CD    1 
ATOM   7701  C  CE    . LYS A 1  1014 ? 154.224 191.224 149.723 1.00 127.21 ? 1014 LYS A CE    1 
ATOM   7702  N  NZ    . LYS A 1  1014 ? 155.020 190.055 150.183 1.00 127.21 ? 1014 LYS A NZ    1 
ATOM   7703  N  N     . GLU A 1  1015 ? 148.706 189.800 148.596 1.00 127.69 ? 1015 GLU A N     1 
ATOM   7704  C  CA    . GLU A 1  1015 ? 147.453 189.744 149.341 1.00 127.69 ? 1015 GLU A CA    1 
ATOM   7705  C  C     . GLU A 1  1015 ? 146.659 188.493 148.993 1.00 127.69 ? 1015 GLU A C     1 
ATOM   7706  O  O     . GLU A 1  1015 ? 145.775 188.085 149.756 1.00 127.69 ? 1015 GLU A O     1 
ATOM   7707  C  CB    . GLU A 1  1015 ? 146.622 190.998 149.072 1.00 141.88 ? 1015 GLU A CB    1 
ATOM   7708  C  CG    . GLU A 1  1015 ? 147.233 192.281 149.620 1.00 141.88 ? 1015 GLU A CG    1 
ATOM   7709  C  CD    . GLU A 1  1015 ? 146.418 193.511 149.264 1.00 141.88 ? 1015 GLU A CD    1 
ATOM   7710  O  OE1   . GLU A 1  1015 ? 145.491 193.391 148.436 1.00 141.88 ? 1015 GLU A OE1   1 
ATOM   7711  O  OE2   . GLU A 1  1015 ? 146.704 194.597 149.811 1.00 141.88 ? 1015 GLU A OE2   1 
ATOM   7712  N  N     . LEU A 1  1016 ? 146.960 187.868 147.853 1.00 123.58 ? 1016 LEU A N     1 
ATOM   7713  C  CA    . LEU A 1  1016 ? 146.259 186.650 147.465 1.00 123.58 ? 1016 LEU A CA    1 
ATOM   7714  C  C     . LEU A 1  1016 ? 146.753 185.446 148.255 1.00 123.58 ? 1016 LEU A C     1 
ATOM   7715  O  O     . LEU A 1  1016 ? 145.951 184.665 148.779 1.00 123.58 ? 1016 LEU A O     1 
ATOM   7716  C  CB    . LEU A 1  1016 ? 146.425 186.411 145.964 1.00 120.49 ? 1016 LEU A CB    1 
ATOM   7717  C  CG    . LEU A 1  1016 ? 145.876 185.083 145.443 1.00 120.49 ? 1016 LEU A CG    1 
ATOM   7718  C  CD1   . LEU A 1  1016 ? 144.393 185.006 145.677 1.00 120.49 ? 1016 LEU A CD1   1 
ATOM   7719  C  CD2   . LEU A 1  1016 ? 146.185 184.922 143.969 1.00 120.49 ? 1016 LEU A CD2   1 
ATOM   7720  N  N     . SER A 1  1017 ? 148.075 185.285 148.363 1.00 122.70 ? 1017 SER A N     1 
ATOM   7721  C  CA    . SER A 1  1017 ? 148.624 184.055 148.926 1.00 122.70 ? 1017 SER A CA    1 
ATOM   7722  C  C     . SER A 1  1017 ? 148.333 183.928 150.416 1.00 122.70 ? 1017 SER A C     1 
ATOM   7723  O  O     . SER A 1  1017 ? 148.497 182.845 150.988 1.00 122.70 ? 1017 SER A O     1 
ATOM   7724  C  CB    . SER A 1  1017 ? 150.129 183.988 148.670 1.00 124.80 ? 1017 SER A CB    1 
ATOM   7725  O  OG    . SER A 1  1017 ? 150.685 182.809 149.223 1.00 124.80 ? 1017 SER A OG    1 
ATOM   7726  N  N     . LYS A 1  1018 ? 147.902 185.014 151.062 1.00 122.00 ? 1018 LYS A N     1 
ATOM   7727  C  CA    . LYS A 1  1018 ? 147.508 184.923 152.464 1.00 122.00 ? 1018 LYS A CA    1 
ATOM   7728  C  C     . LYS A 1  1018 ? 146.147 184.262 152.619 1.00 122.00 ? 1018 LYS A C     1 
ATOM   7729  O  O     . LYS A 1  1018 ? 145.886 183.609 153.635 1.00 122.00 ? 1018 LYS A O     1 
ATOM   7730  C  CB    . LYS A 1  1018 ? 147.484 186.311 153.102 1.00 122.14 ? 1018 LYS A CB    1 
ATOM   7731  C  CG    . LYS A 1  1018 ? 148.836 186.975 153.226 1.00 122.14 ? 1018 LYS A CG    1 
ATOM   7732  C  CD    . LYS A 1  1018 ? 148.688 188.369 153.801 1.00 122.14 ? 1018 LYS A CD    1 
ATOM   7733  C  CE    . LYS A 1  1018 ? 150.034 189.045 153.962 1.00 122.14 ? 1018 LYS A CE    1 
ATOM   7734  N  NZ    . LYS A 1  1018 ? 149.888 190.435 154.471 1.00 122.14 ? 1018 LYS A NZ    1 
ATOM   7735  N  N     . LYS A 1  1019 ? 145.275 184.413 151.626 1.00 120.19 ? 1019 LYS A N     1 
ATOM   7736  C  CA    . LYS A 1  1019 ? 143.909 183.917 151.706 1.00 120.19 ? 1019 LYS A CA    1 
ATOM   7737  C  C     . LYS A 1  1019 ? 143.765 182.483 151.219 1.00 120.19 ? 1019 LYS A C     1 
ATOM   7738  O  O     . LYS A 1  1019 ? 142.641 181.975 151.162 1.00 120.19 ? 1019 LYS A O     1 
ATOM   7739  C  CB    . LYS A 1  1019 ? 142.972 184.830 150.912 1.00 127.16 ? 1019 LYS A CB    1 
ATOM   7740  C  CG    . LYS A 1  1019 ? 142.801 186.205 151.532 1.00 127.16 ? 1019 LYS A CG    1 
ATOM   7741  C  CD    . LYS A 1  1019 ? 141.823 187.052 150.744 1.00 127.16 ? 1019 LYS A CD    1 
ATOM   7742  C  CE    . LYS A 1  1019 ? 140.414 186.494 150.853 1.00 127.16 ? 1019 LYS A CE    1 
ATOM   7743  N  NZ    . LYS A 1  1019 ? 139.892 186.571 152.245 1.00 127.16 ? 1019 LYS A NZ    1 
ATOM   7744  N  N     . LEU A 1  1020 ? 144.863 181.826 150.858 1.00 117.58 ? 1020 LEU A N     1 
ATOM   7745  C  CA    . LEU A 1  1020 ? 144.858 180.404 150.541 1.00 117.58 ? 1020 LEU A CA    1 
ATOM   7746  C  C     . LEU A 1  1020 ? 145.436 179.689 151.756 1.00 117.58 ? 1020 LEU A C     1 
ATOM   7747  O  O     . LEU A 1  1020 ? 146.649 179.728 151.984 1.00 117.58 ? 1020 LEU A O     1 
ATOM   7748  C  CB    . LEU A 1  1020 ? 145.685 180.130 149.289 1.00 117.14 ? 1020 LEU A CB    1 
ATOM   7749  C  CG    . LEU A 1  1020 ? 145.272 180.907 148.035 1.00 117.14 ? 1020 LEU A CG    1 
ATOM   7750  C  CD1   . LEU A 1  1020 ? 146.224 180.624 146.885 1.00 117.14 ? 1020 LEU A CD1   1 
ATOM   7751  C  CD2   . LEU A 1  1020 ? 143.833 180.620 147.640 1.00 117.14 ? 1020 LEU A CD2   1 
ATOM   7752  N  N     . VAL A 1  1021 ? 144.578 179.029 152.528 1.00 115.89 ? 1021 VAL A N     1 
ATOM   7753  C  CA    . VAL A 1  1021 ? 144.945 178.539 153.852 1.00 115.89 ? 1021 VAL A CA    1 
ATOM   7754  C  C     . VAL A 1  1021 ? 144.753 177.031 153.888 1.00 115.89 ? 1021 VAL A C     1 
ATOM   7755  O  O     . VAL A 1  1021 ? 143.617 176.541 153.897 1.00 115.89 ? 1021 VAL A O     1 
ATOM   7756  C  CB    . VAL A 1  1021 ? 144.125 179.221 154.955 1.00 118.59 ? 1021 VAL A CB    1 
ATOM   7757  C  CG1   . VAL A 1  1021 ? 144.450 178.618 156.307 1.00 118.59 ? 1021 VAL A CG1   1 
ATOM   7758  C  CG2   . VAL A 1  1021 ? 144.385 180.720 154.958 1.00 118.59 ? 1021 VAL A CG2   1 
ATOM   7759  N  N     . ILE A 1  1022 ? 145.864 176.295 153.906 1.00 115.13 ? 1022 ILE A N     1 
ATOM   7760  C  CA    . ILE A 1  1022 ? 145.821 174.876 154.234 1.00 115.13 ? 1022 ILE A CA    1 
ATOM   7761  C  C     . ILE A 1  1022 ? 145.870 174.668 155.744 1.00 115.13 ? 1022 ILE A C     1 
ATOM   7762  O  O     . ILE A 1  1022 ? 145.134 173.841 156.293 1.00 115.13 ? 1022 ILE A O     1 
ATOM   7763  C  CB    . ILE A 1  1022 ? 146.960 174.137 153.513 1.00 114.26 ? 1022 ILE A CB    1 
ATOM   7764  C  CG1   . ILE A 1  1022 ? 146.753 174.212 152.001 1.00 114.26 ? 1022 ILE A CG1   1 
ATOM   7765  C  CG2   . ILE A 1  1022 ? 147.030 172.690 153.964 1.00 114.26 ? 1022 ILE A CG2   1 
ATOM   7766  C  CD1   . ILE A 1  1022 ? 147.935 173.737 151.204 1.00 114.26 ? 1022 ILE A CD1   1 
ATOM   7767  N  N     . VAL A 1  1023 ? 146.725 175.419 156.436 1.00 118.56 ? 1023 VAL A N     1 
ATOM   7768  C  CA    . VAL A 1  1023 ? 146.968 175.250 157.866 1.00 118.56 ? 1023 VAL A CA    1 
ATOM   7769  C  C     . VAL A 1  1023 ? 146.440 176.478 158.593 1.00 118.56 ? 1023 VAL A C     1 
ATOM   7770  O  O     . VAL A 1  1023 ? 146.781 177.613 158.238 1.00 118.56 ? 1023 VAL A O     1 
ATOM   7771  C  CB    . VAL A 1  1023 ? 148.461 175.043 158.165 1.00 117.55 ? 1023 VAL A CB    1 
ATOM   7772  C  CG1   . VAL A 1  1023 ? 148.700 174.979 159.668 1.00 117.55 ? 1023 VAL A CG1   1 
ATOM   7773  C  CG2   . VAL A 1  1023 ? 148.973 173.789 157.480 1.00 117.55 ? 1023 VAL A CG2   1 
ATOM   7774  N  N     . ASN A 1  1024 ? 145.624 176.253 159.624 1.00 128.40 ? 1024 ASN A N     1 
ATOM   7775  C  CA    . ASN A 1  1024 ? 145.030 177.327 160.414 1.00 128.40 ? 1024 ASN A CA    1 
ATOM   7776  C  C     . ASN A 1  1024 ? 145.772 177.433 161.743 1.00 128.40 ? 1024 ASN A C     1 
ATOM   7777  O  O     . ASN A 1  1024 ? 145.649 176.553 162.602 1.00 128.40 ? 1024 ASN A O     1 
ATOM   7778  C  CB    . ASN A 1  1024 ? 143.542 177.067 160.644 1.00 132.55 ? 1024 ASN A CB    1 
ATOM   7779  C  CG    . ASN A 1  1024 ? 142.725 177.171 159.370 1.00 132.55 ? 1024 ASN A CG    1 
ATOM   7780  O  OD1   . ASN A 1  1024 ? 142.432 178.267 158.892 1.00 132.55 ? 1024 ASN A OD1   1 
ATOM   7781  N  ND2   . ASN A 1  1024 ? 142.348 176.025 158.815 1.00 132.55 ? 1024 ASN A ND2   1 
ATOM   7782  N  N     . GLY A 1  1025 ? 146.543 178.499 161.910 1.00 132.56 ? 1025 GLY A N     1 
ATOM   7783  C  CA    . GLY A 1  1025 ? 147.170 178.770 163.192 1.00 132.56 ? 1025 GLY A CA    1 
ATOM   7784  C  C     . GLY A 1  1025 ? 148.088 179.969 163.092 1.00 132.56 ? 1025 GLY A C     1 
ATOM   7785  O  O     . GLY A 1  1025 ? 148.550 180.340 162.008 1.00 132.56 ? 1025 GLY A O     1 
ATOM   7786  N  N     . ASP A 1  1026 ? 148.350 180.565 164.253 1.00 138.20 ? 1026 ASP A N     1 
ATOM   7787  C  CA    . ASP A 1  1026 ? 149.298 181.662 164.358 1.00 138.20 ? 1026 ASP A CA    1 
ATOM   7788  C  C     . ASP A 1  1026 ? 150.672 181.189 164.818 1.00 138.20 ? 1026 ASP A C     1 
ATOM   7789  O  O     . ASP A 1  1026 ? 151.608 181.991 164.876 1.00 138.20 ? 1026 ASP A O     1 
ATOM   7790  C  CB    . ASP A 1  1026 ? 148.757 182.725 165.324 1.00 147.24 ? 1026 ASP A CB    1 
ATOM   7791  C  CG    . ASP A 1  1026 ? 149.514 184.039 165.244 1.00 147.24 ? 1026 ASP A CG    1 
ATOM   7792  O  OD1   . ASP A 1  1026 ? 150.330 184.211 164.316 1.00 147.24 ? 1026 ASP A OD1   1 
ATOM   7793  O  OD2   . ASP A 1  1026 ? 149.301 184.898 166.123 1.00 147.24 ? 1026 ASP A OD2   1 
ATOM   7794  N  N     . ASP A 1  1027 ? 150.815 179.902 165.127 1.00 135.62 ? 1027 ASP A N     1 
ATOM   7795  C  CA    . ASP A 1  1027 ? 152.075 179.385 165.629 1.00 135.62 ? 1027 ASP A CA    1 
ATOM   7796  C  C     . ASP A 1  1027 ? 153.128 179.404 164.523 1.00 135.62 ? 1027 ASP A C     1 
ATOM   7797  O  O     . ASP A 1  1027 ? 152.803 179.248 163.343 1.00 135.62 ? 1027 ASP A O     1 
ATOM   7798  C  CB    . ASP A 1  1027 ? 151.898 177.961 166.155 1.00 139.84 ? 1027 ASP A CB    1 
ATOM   7799  C  CG    . ASP A 1  1027 ? 151.079 177.905 167.432 1.00 139.84 ? 1027 ASP A CG    1 
ATOM   7800  O  OD1   . ASP A 1  1027 ? 150.909 178.964 168.071 1.00 139.84 ? 1027 ASP A OD1   1 
ATOM   7801  O  OD2   . ASP A 1  1027 ? 150.610 176.807 167.800 1.00 139.84 ? 1027 ASP A OD2   1 
ATOM   7802  N  N     . PRO A 1  1028 ? 154.400 179.608 164.877 1.00 131.27 ? 1028 PRO A N     1 
ATOM   7803  C  CA    . PRO A 1  1028 ? 155.449 179.538 163.846 1.00 131.27 ? 1028 PRO A CA    1 
ATOM   7804  C  C     . PRO A 1  1028 ? 155.540 178.171 163.196 1.00 131.27 ? 1028 PRO A C     1 
ATOM   7805  O  O     . PRO A 1  1028 ? 155.818 178.071 161.994 1.00 131.27 ? 1028 PRO A O     1 
ATOM   7806  C  CB    . PRO A 1  1028 ? 156.721 179.897 164.626 1.00 128.90 ? 1028 PRO A CB    1 
ATOM   7807  C  CG    . PRO A 1  1028 ? 156.411 179.524 166.040 1.00 128.90 ? 1028 PRO A CG    1 
ATOM   7808  C  CD    . PRO A 1  1028 ? 154.956 179.839 166.220 1.00 128.90 ? 1028 PRO A CD    1 
ATOM   7809  N  N     . LEU A 1  1029 ? 155.309 177.109 163.972 1.00 126.20 ? 1029 LEU A N     1 
ATOM   7810  C  CA    . LEU A 1  1029 ? 155.188 175.774 163.398 1.00 126.20 ? 1029 LEU A CA    1 
ATOM   7811  C  C     . LEU A 1  1029 ? 154.076 175.731 162.357 1.00 126.20 ? 1029 LEU A C     1 
ATOM   7812  O  O     . LEU A 1  1029 ? 154.213 175.081 161.312 1.00 126.20 ? 1029 LEU A O     1 
ATOM   7813  C  CB    . LEU A 1  1029 ? 154.930 174.759 164.512 1.00 122.19 ? 1029 LEU A CB    1 
ATOM   7814  C  CG    . LEU A 1  1029 ? 154.717 173.293 164.139 1.00 122.19 ? 1029 LEU A CG    1 
ATOM   7815  C  CD1   . LEU A 1  1029 ? 155.970 172.709 163.514 1.00 122.19 ? 1029 LEU A CD1   1 
ATOM   7816  C  CD2   . LEU A 1  1029 ? 154.301 172.493 165.362 1.00 122.19 ? 1029 LEU A CD2   1 
ATOM   7817  N  N     . SER A 1  1030 ? 152.973 176.435 162.618 1.00 128.31 ? 1030 SER A N     1 
ATOM   7818  C  CA    . SER A 1  1030 ? 151.882 176.497 161.651 1.00 128.31 ? 1030 SER A CA    1 
ATOM   7819  C  C     . SER A 1  1030 ? 152.282 177.318 160.431 1.00 128.31 ? 1030 SER A C     1 
ATOM   7820  O  O     . SER A 1  1030 ? 151.907 176.991 159.299 1.00 128.31 ? 1030 SER A O     1 
ATOM   7821  C  CB    . SER A 1  1030 ? 150.633 177.082 162.309 1.00 129.72 ? 1030 SER A CB    1 
ATOM   7822  O  OG    . SER A 1  1030 ? 150.168 176.251 163.357 1.00 129.72 ? 1030 SER A OG    1 
ATOM   7823  N  N     . ARG A 1  1031 ? 153.039 178.398 160.644 1.00 128.00 ? 1031 ARG A N     1 
ATOM   7824  C  CA    . ARG A 1  1031 ? 153.519 179.202 159.523 1.00 128.00 ? 1031 ARG A CA    1 
ATOM   7825  C  C     . ARG A 1  1031 ? 154.376 178.366 158.581 1.00 128.00 ? 1031 ARG A C     1 
ATOM   7826  O  O     . ARG A 1  1031 ? 154.122 178.311 157.371 1.00 128.00 ? 1031 ARG A O     1 
ATOM   7827  C  CB    . ARG A 1  1031 ? 154.313 180.408 160.029 1.00 136.88 ? 1031 ARG A CB    1 
ATOM   7828  C  CG    . ARG A 1  1031 ? 153.506 181.464 160.768 1.00 136.88 ? 1031 ARG A CG    1 
ATOM   7829  C  CD    . ARG A 1  1031 ? 154.408 182.625 161.175 1.00 136.88 ? 1031 ARG A CD    1 
ATOM   7830  N  NE    . ARG A 1  1031 ? 153.682 183.693 161.856 1.00 136.88 ? 1031 ARG A NE    1 
ATOM   7831  C  CZ    . ARG A 1  1031 ? 153.439 183.719 163.162 1.00 136.88 ? 1031 ARG A CZ    1 
ATOM   7832  N  NH1   . ARG A 1  1031 ? 153.870 182.735 163.938 1.00 136.88 ? 1031 ARG A NH1   1 
ATOM   7833  N  NH2   . ARG A 1  1031 ? 152.770 184.732 163.694 1.00 136.88 ? 1031 ARG A NH2   1 
ATOM   7834  N  N     . GLN A 1  1032 ? 155.401 177.705 159.124 1.00 126.63 ? 1032 GLN A N     1 
ATOM   7835  C  CA    . GLN A 1  1032 ? 156.258 176.868 158.292 1.00 126.63 ? 1032 GLN A CA    1 
ATOM   7836  C  C     . GLN A 1  1032 ? 155.472 175.716 157.683 1.00 126.63 ? 1032 GLN A C     1 
ATOM   7837  O  O     . GLN A 1  1032 ? 155.762 175.277 156.563 1.00 126.63 ? 1032 GLN A O     1 
ATOM   7838  C  CB    . GLN A 1  1032 ? 157.437 176.345 159.114 1.00 127.29 ? 1032 GLN A CB    1 
ATOM   7839  C  CG    . GLN A 1  1032 ? 158.449 175.548 158.311 1.00 127.29 ? 1032 GLN A CG    1 
ATOM   7840  C  CD    . GLN A 1  1032 ? 159.128 176.385 157.247 1.00 127.29 ? 1032 GLN A CD    1 
ATOM   7841  O  OE1   . GLN A 1  1032 ? 158.774 176.319 156.070 1.00 127.29 ? 1032 GLN A OE1   1 
ATOM   7842  N  NE2   . GLN A 1  1032 ? 160.105 177.185 157.656 1.00 127.29 ? 1032 GLN A NE2   1 
ATOM   7843  N  N     . ALA A 1  1033 ? 154.460 175.223 158.402 1.00 122.91 ? 1033 ALA A N     1 
ATOM   7844  C  CA    . ALA A 1  1033 ? 153.615 174.168 157.853 1.00 122.91 ? 1033 ALA A CA    1 
ATOM   7845  C  C     . ALA A 1  1033 ? 152.878 174.643 156.608 1.00 122.91 ? 1033 ALA A C     1 
ATOM   7846  O  O     . ALA A 1  1033 ? 152.819 173.926 155.600 1.00 122.91 ? 1033 ALA A O     1 
ATOM   7847  C  CB    . ALA A 1  1033 ? 152.623 173.687 158.911 1.00 123.13 ? 1033 ALA A CB    1 
ATOM   7848  N  N     . GLN A 1  1034 ? 152.321 175.857 156.650 1.00 122.67 ? 1034 GLN A N     1 
ATOM   7849  C  CA    . GLN A 1  1034 ? 151.575 176.355 155.498 1.00 122.67 ? 1034 GLN A CA    1 
ATOM   7850  C  C     . GLN A 1  1034 ? 152.505 176.732 154.353 1.00 122.67 ? 1034 GLN A C     1 
ATOM   7851  O  O     . GLN A 1  1034 ? 152.164 176.528 153.182 1.00 122.67 ? 1034 GLN A O     1 
ATOM   7852  C  CB    . GLN A 1  1034 ? 150.707 177.548 155.894 1.00 122.48 ? 1034 GLN A CB    1 
ATOM   7853  C  CG    . GLN A 1  1034 ? 149.827 178.045 154.755 1.00 122.48 ? 1034 GLN A CG    1 
ATOM   7854  C  CD    . GLN A 1  1034 ? 148.845 179.114 155.183 1.00 122.48 ? 1034 GLN A CD    1 
ATOM   7855  O  OE1   . GLN A 1  1034 ? 148.734 179.435 156.365 1.00 122.48 ? 1034 GLN A OE1   1 
ATOM   7856  N  NE2   . GLN A 1  1034 ? 148.125 179.674 154.218 1.00 122.48 ? 1034 GLN A NE2   1 
ATOM   7857  N  N     . GLU A 1  1035 ? 153.677 177.292 154.662 1.00 122.24 ? 1035 GLU A N     1 
ATOM   7858  C  CA    . GLU A 1  1035 ? 154.636 177.593 153.604 1.00 122.24 ? 1035 GLU A CA    1 
ATOM   7859  C  C     . GLU A 1  1035 ? 155.087 176.320 152.901 1.00 122.24 ? 1035 GLU A C     1 
ATOM   7860  O  O     . GLU A 1  1035 ? 155.194 176.280 151.670 1.00 122.24 ? 1035 GLU A O     1 
ATOM   7861  C  CB    . GLU A 1  1035 ? 155.839 178.352 154.164 1.00 130.13 ? 1035 GLU A CB    1 
ATOM   7862  C  CG    . GLU A 1  1035 ? 155.535 179.767 154.613 1.00 130.13 ? 1035 GLU A CG    1 
ATOM   7863  C  CD    . GLU A 1  1035 ? 156.763 180.483 155.141 1.00 130.13 ? 1035 GLU A CD    1 
ATOM   7864  O  OE1   . GLU A 1  1035 ? 157.804 179.820 155.332 1.00 130.13 ? 1035 GLU A OE1   1 
ATOM   7865  O  OE2   . GLU A 1  1035 ? 156.690 181.711 155.357 1.00 130.13 ? 1035 GLU A OE2   1 
ATOM   7866  N  N     . ASN A 1  1036 ? 155.352 175.264 153.671 1.00 120.70 ? 1036 ASN A N     1 
ATOM   7867  C  CA    . ASN A 1  1036 ? 155.780 174.007 153.068 1.00 120.70 ? 1036 ASN A CA    1 
ATOM   7868  C  C     . ASN A 1  1036 ? 154.640 173.318 152.329 1.00 120.70 ? 1036 ASN A C     1 
ATOM   7869  O  O     . ASN A 1  1036 ? 154.885 172.588 151.362 1.00 120.70 ? 1036 ASN A O     1 
ATOM   7870  C  CB    . ASN A 1  1036 ? 156.361 173.087 154.141 1.00 121.43 ? 1036 ASN A CB    1 
ATOM   7871  C  CG    . ASN A 1  1036 ? 157.691 173.584 154.671 1.00 121.43 ? 1036 ASN A CG    1 
ATOM   7872  O  OD1   . ASN A 1  1036 ? 158.408 174.313 153.988 1.00 121.43 ? 1036 ASN A OD1   1 
ATOM   7873  N  ND2   . ASN A 1  1036 ? 158.024 173.199 155.897 1.00 121.43 ? 1036 ASN A ND2   1 
ATOM   7874  N  N     . ALA A 1  1037 ? 153.396 173.543 152.753 1.00 120.56 ? 1037 ALA A N     1 
ATOM   7875  C  CA    . ALA A 1  1037 ? 152.265 172.900 152.092 1.00 120.56 ? 1037 ALA A CA    1 
ATOM   7876  C  C     . ALA A 1  1037 ? 151.920 173.596 150.779 1.00 120.56 ? 1037 ALA A C     1 
ATOM   7877  O  O     . ALA A 1  1037 ? 151.686 172.940 149.758 1.00 120.56 ? 1037 ALA A O     1 
ATOM   7878  C  CB    . ALA A 1  1037 ? 151.057 172.877 153.027 1.00 120.36 ? 1037 ALA A CB    1 
ATOM   7879  N  N     . THR A 1  1038 ? 151.880 174.927 150.787 1.00 118.14 ? 1038 THR A N     1 
ATOM   7880  C  CA    . THR A 1  1038 ? 151.466 175.715 149.634 1.00 118.14 ? 1038 THR A CA    1 
ATOM   7881  C  C     . THR A 1  1038 ? 152.657 176.181 148.793 1.00 118.14 ? 1038 THR A C     1 
ATOM   7882  O  O     . THR A 1  1038 ? 152.466 176.923 147.825 1.00 118.14 ? 1038 THR A O     1 
ATOM   7883  C  CB    . THR A 1  1038 ? 150.629 176.912 150.116 1.00 120.63 ? 1038 THR A CB    1 
ATOM   7884  O  OG1   . THR A 1  1038 ? 149.666 176.450 151.070 1.00 120.63 ? 1038 THR A OG1   1 
ATOM   7885  C  CG2   . THR A 1  1038 ? 149.836 177.541 148.969 1.00 120.63 ? 1038 THR A CG2   1 
ATOM   7886  N  N     . LEU A 1  1039 ? 153.876 175.753 149.139 1.00 115.50 ? 1039 LEU A N     1 
ATOM   7887  C  CA    . LEU A 1  1039 ? 155.093 176.232 148.484 1.00 115.50 ? 1039 LEU A CA    1 
ATOM   7888  C  C     . LEU A 1  1039 ? 155.006 176.165 146.962 1.00 115.50 ? 1039 LEU A C     1 
ATOM   7889  O  O     . LEU A 1  1039 ? 155.054 177.193 146.276 1.00 115.50 ? 1039 LEU A O     1 
ATOM   7890  C  CB    . LEU A 1  1039 ? 156.293 175.430 148.994 1.00 113.68 ? 1039 LEU A CB    1 
ATOM   7891  C  CG    . LEU A 1  1039 ? 157.683 175.783 148.468 1.00 113.68 ? 1039 LEU A CG    1 
ATOM   7892  C  CD1   . LEU A 1  1039 ? 158.681 175.668 149.587 1.00 113.68 ? 1039 LEU A CD1   1 
ATOM   7893  C  CD2   . LEU A 1  1039 ? 158.066 174.832 147.353 1.00 113.68 ? 1039 LEU A CD2   1 
ATOM   7894  N  N     . LEU A 1  1040 ? 154.894 174.951 146.418 1.00 112.98 ? 1040 LEU A N     1 
ATOM   7895  C  CA    . LEU A 1  1040 ? 154.978 174.764 144.972 1.00 112.98 ? 1040 LEU A CA    1 
ATOM   7896  C  C     . LEU A 1  1040 ? 153.896 175.544 144.234 1.00 112.98 ? 1040 LEU A C     1 
ATOM   7897  O  O     . LEU A 1  1040 ? 154.159 176.155 143.189 1.00 112.98 ? 1040 LEU A O     1 
ATOM   7898  C  CB    . LEU A 1  1040 ? 154.890 173.275 144.646 1.00 112.55 ? 1040 LEU A CB    1 
ATOM   7899  C  CG    . LEU A 1  1040 ? 154.888 172.861 143.179 1.00 112.55 ? 1040 LEU A CG    1 
ATOM   7900  C  CD1   . LEU A 1  1040 ? 156.175 173.278 142.509 1.00 112.55 ? 1040 LEU A CD1   1 
ATOM   7901  C  CD2   . LEU A 1  1040 ? 154.706 171.365 143.081 1.00 112.55 ? 1040 LEU A CD2   1 
ATOM   7902  N  N     . PHE A 1  1041 ? 152.675 175.549 144.770 1.00 112.39 ? 1041 PHE A N     1 
ATOM   7903  C  CA    . PHE A 1  1041 ? 151.590 176.279 144.125 1.00 112.39 ? 1041 PHE A CA    1 
ATOM   7904  C  C     . PHE A 1  1041 ? 151.818 177.784 144.198 1.00 112.39 ? 1041 PHE A C     1 
ATOM   7905  O  O     . PHE A 1  1041 ? 151.392 178.529 143.311 1.00 112.39 ? 1041 PHE A O     1 
ATOM   7906  C  CB    . PHE A 1  1041 ? 150.253 175.906 144.762 1.00 111.50 ? 1041 PHE A CB    1 
ATOM   7907  C  CG    . PHE A 1  1041 ? 149.089 176.674 144.211 1.00 111.50 ? 1041 PHE A CG    1 
ATOM   7908  C  CD1   . PHE A 1  1041 ? 148.531 176.328 142.995 1.00 111.50 ? 1041 PHE A CD1   1 
ATOM   7909  C  CD2   . PHE A 1  1041 ? 148.551 177.737 144.910 1.00 111.50 ? 1041 PHE A CD2   1 
ATOM   7910  C  CE1   . PHE A 1  1041 ? 147.460 177.030 142.484 1.00 111.50 ? 1041 PHE A CE1   1 
ATOM   7911  C  CE2   . PHE A 1  1041 ? 147.479 178.442 144.404 1.00 111.50 ? 1041 PHE A CE2   1 
ATOM   7912  C  CZ    . PHE A 1  1041 ? 146.936 178.090 143.190 1.00 111.50 ? 1041 PHE A CZ    1 
ATOM   7913  N  N     . ASN A 1  1042 ? 152.481 178.253 145.257 1.00 111.57 ? 1042 ASN A N     1 
ATOM   7914  C  CA    . ASN A 1  1042 ? 152.823 179.670 145.329 1.00 111.57 ? 1042 ASN A CA    1 
ATOM   7915  C  C     . ASN A 1  1042 ? 153.906 180.020 144.320 1.00 111.57 ? 1042 ASN A C     1 
ATOM   7916  O  O     . ASN A 1  1042 ? 153.906 181.121 143.755 1.00 111.57 ? 1042 ASN A O     1 
ATOM   7917  C  CB    . ASN A 1  1042 ? 153.268 180.038 146.743 1.00 114.50 ? 1042 ASN A CB    1 
ATOM   7918  C  CG    . ASN A 1  1042 ? 152.117 180.071 147.721 1.00 114.50 ? 1042 ASN A CG    1 
ATOM   7919  O  OD1   . ASN A 1  1042 ? 150.968 180.278 147.336 1.00 114.50 ? 1042 ASN A OD1   1 
ATOM   7920  N  ND2   . ASN A 1  1042 ? 152.418 179.862 148.998 1.00 114.50 ? 1042 ASN A ND2   1 
ATOM   7921  N  N     . ILE A 1  1043 ? 154.839 179.097 144.080 1.00 113.14 ? 1043 ILE A N     1 
ATOM   7922  C  CA    . ILE A 1  1043 ? 155.862 179.323 143.062 1.00 113.14 ? 1043 ILE A CA    1 
ATOM   7923  C  C     . ILE A 1  1043 ? 155.226 179.403 141.681 1.00 113.14 ? 1043 ILE A C     1 
ATOM   7924  O  O     . ILE A 1  1043 ? 155.520 180.310 140.892 1.00 113.14 ? 1043 ILE A O     1 
ATOM   7925  C  CB    . ILE A 1  1043 ? 156.933 178.219 143.120 1.00 118.69 ? 1043 ILE A CB    1 
ATOM   7926  C  CG1   . ILE A 1  1043 ? 157.735 178.310 144.419 1.00 118.69 ? 1043 ILE A CG1   1 
ATOM   7927  C  CG2   . ILE A 1  1043 ? 157.847 178.307 141.913 1.00 118.69 ? 1043 ILE A CG2   1 
ATOM   7928  C  CD1   . ILE A 1  1043 ? 158.648 177.127 144.646 1.00 118.69 ? 1043 ILE A CD1   1 
ATOM   7929  N  N     . HIS A 1  1044 ? 154.350 178.446 141.363 1.00 113.83 ? 1044 HIS A N     1 
ATOM   7930  C  CA    . HIS A 1  1044 ? 153.647 178.474 140.083 1.00 113.83 ? 1044 HIS A CA    1 
ATOM   7931  C  C     . HIS A 1  1044 ? 152.794 179.729 139.941 1.00 113.83 ? 1044 HIS A C     1 
ATOM   7932  O  O     . HIS A 1  1044 ? 152.763 180.359 138.874 1.00 113.83 ? 1044 HIS A O     1 
ATOM   7933  C  CB    . HIS A 1  1044 ? 152.774 177.230 139.949 1.00 110.22 ? 1044 HIS A CB    1 
ATOM   7934  C  CG    . HIS A 1  1044 ? 151.961 177.195 138.695 1.00 110.22 ? 1044 HIS A CG    1 
ATOM   7935  N  ND1   . HIS A 1  1044 ? 152.525 177.106 137.441 1.00 110.22 ? 1044 HIS A ND1   1 
ATOM   7936  C  CD2   . HIS A 1  1044 ? 150.623 177.258 138.503 1.00 110.22 ? 1044 HIS A CD2   1 
ATOM   7937  C  CE1   . HIS A 1  1044 ? 151.568 177.101 136.531 1.00 110.22 ? 1044 HIS A CE1   1 
ATOM   7938  N  NE2   . HIS A 1  1044 ? 150.404 177.193 137.149 1.00 110.22 ? 1044 HIS A NE2   1 
ATOM   7939  N  N     . LEU A 1  1045 ? 152.091 180.101 141.010 1.00 112.48 ? 1045 LEU A N     1 
ATOM   7940  C  CA    . LEU A 1  1045 ? 151.186 181.242 140.961 1.00 112.48 ? 1045 LEU A CA    1 
ATOM   7941  C  C     . LEU A 1  1045 ? 151.958 182.540 140.765 1.00 112.48 ? 1045 LEU A C     1 
ATOM   7942  O  O     . LEU A 1  1045 ? 151.519 183.431 140.031 1.00 112.48 ? 1045 LEU A O     1 
ATOM   7943  C  CB    . LEU A 1  1045 ? 150.357 181.286 142.243 1.00 112.11 ? 1045 LEU A CB    1 
ATOM   7944  C  CG    . LEU A 1  1045 ? 149.301 182.374 142.393 1.00 112.11 ? 1045 LEU A CG    1 
ATOM   7945  C  CD1   . LEU A 1  1045 ? 148.205 182.170 141.370 1.00 112.11 ? 1045 LEU A CD1   1 
ATOM   7946  C  CD2   . LEU A 1  1045 ? 148.732 182.348 143.796 1.00 112.11 ? 1045 LEU A CD2   1 
ATOM   7947  N  N     . ARG A 1  1046 ? 153.116 182.665 141.418 1.00 114.74 ? 1046 ARG A N     1 
ATOM   7948  C  CA    . ARG A 1  1046 ? 153.987 183.805 141.163 1.00 114.74 ? 1046 ARG A CA    1 
ATOM   7949  C  C     . ARG A 1  1046 ? 154.641 183.725 139.792 1.00 114.74 ? 1046 ARG A C     1 
ATOM   7950  O  O     . ARG A 1  1046 ? 155.077 184.752 139.264 1.00 114.74 ? 1046 ARG A O     1 
ATOM   7951  C  CB    . ARG A 1  1046 ? 155.060 183.908 142.248 1.00 113.99 ? 1046 ARG A CB    1 
ATOM   7952  C  CG    . ARG A 1  1046 ? 154.527 184.334 143.603 1.00 113.99 ? 1046 ARG A CG    1 
ATOM   7953  C  CD    . ARG A 1  1046 ? 155.654 184.684 144.560 1.00 113.99 ? 1046 ARG A CD    1 
ATOM   7954  N  NE    . ARG A 1  1046 ? 156.483 183.529 144.887 1.00 113.99 ? 1046 ARG A NE    1 
ATOM   7955  C  CZ    . ARG A 1  1046 ? 156.216 182.678 145.872 1.00 113.99 ? 1046 ARG A CZ    1 
ATOM   7956  N  NH1   . ARG A 1  1046 ? 155.138 182.853 146.625 1.00 113.99 ? 1046 ARG A NH1   1 
ATOM   7957  N  NH2   . ARG A 1  1046 ? 157.023 181.654 146.105 1.00 113.99 ? 1046 ARG A NH2   1 
ATOM   7958  N  N     . SER A 1  1047 ? 154.719 182.529 139.207 1.00 116.67 ? 1047 SER A N     1 
ATOM   7959  C  CA    . SER A 1  1047 ? 155.277 182.394 137.866 1.00 116.67 ? 1047 SER A CA    1 
ATOM   7960  C  C     . SER A 1  1047 ? 154.320 182.941 136.816 1.00 116.67 ? 1047 SER A C     1 
ATOM   7961  O  O     . SER A 1  1047 ? 154.709 183.764 135.978 1.00 116.67 ? 1047 SER A O     1 
ATOM   7962  C  CB    . SER A 1  1047 ? 155.605 180.930 137.582 1.00 119.35 ? 1047 SER A CB    1 
ATOM   7963  O  OG    . SER A 1  1047 ? 156.614 180.458 138.456 1.00 119.35 ? 1047 SER A OG    1 
ATOM   7964  N  N     . THR A 1  1048 ? 153.062 182.502 136.846 1.00 118.68 ? 1048 THR A N     1 
ATOM   7965  C  CA    . THR A 1  1048 ? 152.103 182.899 135.821 1.00 118.68 ? 1048 THR A CA    1 
ATOM   7966  C  C     . THR A 1  1048 ? 151.571 184.315 136.001 1.00 118.68 ? 1048 THR A C     1 
ATOM   7967  O  O     . THR A 1  1048 ? 151.223 184.958 135.006 1.00 118.68 ? 1048 THR A O     1 
ATOM   7968  C  CB    . THR A 1  1048 ? 150.919 181.931 135.792 1.00 118.57 ? 1048 THR A CB    1 
ATOM   7969  O  OG1   . THR A 1  1048 ? 150.262 181.951 137.062 1.00 118.57 ? 1048 THR A OG1   1 
ATOM   7970  C  CG2   . THR A 1  1048 ? 151.391 180.520 135.495 1.00 118.57 ? 1048 THR A CG2   1 
ATOM   7971  N  N     . LEU A 1  1049 ? 151.487 184.810 137.232 1.00 119.78 ? 1049 LEU A N     1 
ATOM   7972  C  CA    . LEU A 1  1049 ? 150.975 186.144 137.511 1.00 119.78 ? 1049 LEU A CA    1 
ATOM   7973  C  C     . LEU A 1  1049 ? 152.065 187.207 137.540 1.00 119.78 ? 1049 LEU A C     1 
ATOM   7974  O  O     . LEU A 1  1049 ? 151.794 188.336 137.953 1.00 119.78 ? 1049 LEU A O     1 
ATOM   7975  C  CB    . LEU A 1  1049 ? 150.191 186.159 138.824 1.00 119.61 ? 1049 LEU A CB    1 
ATOM   7976  C  CG    . LEU A 1  1049 ? 148.876 185.379 138.812 1.00 119.61 ? 1049 LEU A CG    1 
ATOM   7977  C  CD1   . LEU A 1  1049 ? 148.199 185.461 140.169 1.00 119.61 ? 1049 LEU A CD1   1 
ATOM   7978  C  CD2   . LEU A 1  1049 ? 147.963 185.897 137.716 1.00 119.61 ? 1049 LEU A CD2   1 
ATOM   7979  N  N     . CYS A 1  1050 ? 153.290 186.867 137.139 1.00 126.24 ? 1050 CYS A N     1 
ATOM   7980  C  CA    . CYS A 1  1050 ? 154.399 187.814 137.186 1.00 126.24 ? 1050 CYS A CA    1 
ATOM   7981  C  C     . CYS A 1  1050 ? 154.054 189.107 136.457 1.00 126.24 ? 1050 CYS A C     1 
ATOM   7982  O  O     . CYS A 1  1050 ? 153.295 189.110 135.485 1.00 126.24 ? 1050 CYS A O     1 
ATOM   7983  C  CB    . CYS A 1  1050 ? 155.650 187.193 136.565 1.00 130.08 ? 1050 CYS A CB    1 
ATOM   7984  S  SG    . CYS A 1  1050 ? 157.088 188.284 136.570 1.00 130.08 ? 1050 CYS A SG    1 
ATOM   7985  N  N     . SER A 1  1051 ? 154.616 190.212 136.953 1.00 127.90 ? 1051 SER A N     1 
ATOM   7986  C  CA    . SER A 1  1051 ? 154.258 191.535 136.451 1.00 127.90 ? 1051 SER A CA    1 
ATOM   7987  C  C     . SER A 1  1051 ? 154.583 191.684 134.969 1.00 127.90 ? 1051 SER A C     1 
ATOM   7988  O  O     . SER A 1  1051 ? 153.735 192.111 134.177 1.00 127.90 ? 1051 SER A O     1 
ATOM   7989  C  CB    . SER A 1  1051 ? 154.969 192.612 137.270 1.00 130.17 ? 1051 SER A CB    1 
ATOM   7990  O  OG    . SER A 1  1051 ? 156.374 192.509 137.131 1.00 130.17 ? 1051 SER A OG    1 
ATOM   7991  N  N     . ARG A 1  1052 ? 155.813 191.342 134.572 1.00 129.11 ? 1052 ARG A N     1 
ATOM   7992  C  CA    . ARG A 1  1052 ? 156.182 191.487 133.167 1.00 129.11 ? 1052 ARG A CA    1 
ATOM   7993  C  C     . ARG A 1  1052 ? 155.369 190.551 132.283 1.00 129.11 ? 1052 ARG A C     1 
ATOM   7994  O  O     . ARG A 1  1052 ? 155.113 190.860 131.115 1.00 129.11 ? 1052 ARG A O     1 
ATOM   7995  C  CB    . ARG A 1  1052 ? 157.677 191.240 132.959 1.00 137.36 ? 1052 ARG A CB    1 
ATOM   7996  C  CG    . ARG A 1  1052 ? 158.130 191.513 131.515 1.00 137.36 ? 1052 ARG A CG    1 
ATOM   7997  C  CD    . ARG A 1  1052 ? 159.622 191.294 131.310 1.00 137.36 ? 1052 ARG A CD    1 
ATOM   7998  N  NE    . ARG A 1  1052 ? 160.059 191.536 129.937 1.00 137.36 ? 1052 ARG A NE    1 
ATOM   7999  C  CZ    . ARG A 1  1052 ? 160.412 192.727 129.465 1.00 137.36 ? 1052 ARG A CZ    1 
ATOM   8000  N  NH1   . ARG A 1  1052 ? 160.380 193.787 130.257 1.00 137.36 ? 1052 ARG A NH1   1 
ATOM   8001  N  NH2   . ARG A 1  1052 ? 160.799 192.857 128.203 1.00 137.36 ? 1052 ARG A NH2   1 
ATOM   8002  N  N     . ARG A 1  1053 ? 154.951 189.401 132.816 1.00 126.44 ? 1053 ARG A N     1 
ATOM   8003  C  CA    . ARG A 1  1053 ? 154.086 188.520 132.038 1.00 126.44 ? 1053 ARG A CA    1 
ATOM   8004  C  C     . ARG A 1  1053 ? 152.698 189.125 131.870 1.00 126.44 ? 1053 ARG A C     1 
ATOM   8005  O  O     . ARG A 1  1053 ? 152.074 188.978 130.814 1.00 126.44 ? 1053 ARG A O     1 
ATOM   8006  C  CB    . ARG A 1  1053 ? 154.003 187.140 132.686 1.00 123.38 ? 1053 ARG A CB    1 
ATOM   8007  C  CG    . ARG A 1  1053 ? 153.164 186.153 131.890 1.00 123.38 ? 1053 ARG A CG    1 
ATOM   8008  C  CD    . ARG A 1  1053 ? 153.118 184.782 132.541 1.00 123.38 ? 1053 ARG A CD    1 
ATOM   8009  N  NE    . ARG A 1  1053 ? 154.409 184.104 132.491 1.00 123.38 ? 1053 ARG A NE    1 
ATOM   8010  C  CZ    . ARG A 1  1053 ? 154.816 183.359 131.468 1.00 123.38 ? 1053 ARG A CZ    1 
ATOM   8011  N  NH1   . ARG A 1  1053 ? 154.027 183.192 130.416 1.00 123.38 ? 1053 ARG A NH1   1 
ATOM   8012  N  NH2   . ARG A 1  1053 ? 156.007 182.775 131.501 1.00 123.38 ? 1053 ARG A NH2   1 
ATOM   8013  N  N     . MET A 1  1054 ? 152.198 189.807 132.903 1.00 126.93 ? 1054 MET A N     1 
ATOM   8014  C  CA    . MET A 1  1054 ? 150.965 190.574 132.755 1.00 126.93 ? 1054 MET A CA    1 
ATOM   8015  C  C     . MET A 1  1054 ? 151.117 191.644 131.680 1.00 126.93 ? 1054 MET A C     1 
ATOM   8016  O  O     . MET A 1  1054 ? 150.222 191.843 130.851 1.00 126.93 ? 1054 MET A O     1 
ATOM   8017  C  CB    . MET A 1  1054 ? 150.580 191.226 134.084 1.00 128.74 ? 1054 MET A CB    1 
ATOM   8018  C  CG    . MET A 1  1054 ? 150.187 190.291 135.215 1.00 128.74 ? 1054 MET A CG    1 
ATOM   8019  S  SD    . MET A 1  1054 ? 148.666 189.371 134.929 1.00 128.74 ? 1054 MET A SD    1 
ATOM   8020  C  CE    . MET A 1  1054 ? 149.319 187.737 134.637 1.00 128.74 ? 1054 MET A CE    1 
ATOM   8021  N  N     . ALA A 1  1055 ? 152.253 192.344 131.679 1.00 130.06 ? 1055 ALA A N     1 
ATOM   8022  C  CA    . ALA A 1  1055 ? 152.442 193.478 130.783 1.00 130.06 ? 1055 ALA A CA    1 
ATOM   8023  C  C     . ALA A 1  1055 ? 152.928 193.084 129.393 1.00 130.06 ? 1055 ALA A C     1 
ATOM   8024  O  O     . ALA A 1  1055 ? 153.036 193.960 128.528 1.00 130.06 ? 1055 ALA A O     1 
ATOM   8025  C  CB    . ALA A 1  1055 ? 153.420 194.473 131.408 1.00 129.51 ? 1055 ALA A CB    1 
ATOM   8026  N  N     . GLU A 1  1056 ? 153.232 191.809 129.151 1.00 130.25 ? 1056 GLU A N     1 
ATOM   8027  C  CA    . GLU A 1  1056 ? 153.627 191.384 127.814 1.00 130.25 ? 1056 GLU A CA    1 
ATOM   8028  C  C     . GLU A 1  1056 ? 152.517 190.603 127.127 1.00 130.25 ? 1056 GLU A C     1 
ATOM   8029  O  O     . GLU A 1  1056 ? 151.841 191.122 126.232 1.00 130.25 ? 1056 GLU A O     1 
ATOM   8030  C  CB    . GLU A 1  1056 ? 154.897 190.528 127.859 1.00 141.34 ? 1056 GLU A CB    1 
ATOM   8031  C  CG    . GLU A 1  1056 ? 156.182 191.281 128.154 1.00 141.34 ? 1056 GLU A CG    1 
ATOM   8032  C  CD    . GLU A 1  1056 ? 157.383 190.354 128.229 1.00 141.34 ? 1056 GLU A CD    1 
ATOM   8033  O  OE1   . GLU A 1  1056 ? 157.182 189.122 128.296 1.00 141.34 ? 1056 GLU A OE1   1 
ATOM   8034  O  OE2   . GLU A 1  1056 ? 158.527 190.851 128.199 1.00 141.34 ? 1056 GLU A OE2   1 
ATOM   8035  N  N     . GLU A 1  1057 ? 152.323 189.352 127.546 1.00 127.19 ? 1057 GLU A N     1 
ATOM   8036  C  CA    . GLU A 1  1057 ? 151.456 188.438 126.812 1.00 127.19 ? 1057 GLU A CA    1 
ATOM   8037  C  C     . GLU A 1  1057 ? 149.978 188.704 127.080 1.00 127.19 ? 1057 GLU A C     1 
ATOM   8038  O  O     . GLU A 1  1057 ? 149.176 188.787 126.146 1.00 127.19 ? 1057 GLU A O     1 
ATOM   8039  C  CB    . GLU A 1  1057 ? 151.805 186.993 127.180 1.00 131.17 ? 1057 GLU A CB    1 
ATOM   8040  C  CG    . GLU A 1  1057 ? 153.212 186.570 126.784 1.00 131.17 ? 1057 GLU A CG    1 
ATOM   8041  C  CD    . GLU A 1  1057 ? 153.552 185.170 127.260 1.00 131.17 ? 1057 GLU A CD    1 
ATOM   8042  O  OE1   . GLU A 1  1057 ? 152.766 184.601 128.046 1.00 131.17 ? 1057 GLU A OE1   1 
ATOM   8043  O  OE2   . GLU A 1  1057 ? 154.607 184.638 126.854 1.00 131.17 ? 1057 GLU A OE2   1 
ATOM   8044  N  N     . PHE A 1  1058 ? 149.603 188.829 128.353 1.00 123.76 ? 1058 PHE A N     1 
ATOM   8045  C  CA    . PHE A 1  1058 ? 148.202 188.660 128.729 1.00 123.76 ? 1058 PHE A CA    1 
ATOM   8046  C  C     . PHE A 1  1058 ? 147.370 189.927 128.545 1.00 123.76 ? 1058 PHE A C     1 
ATOM   8047  O  O     . PHE A 1  1058 ? 146.203 189.841 128.146 1.00 123.76 ? 1058 PHE A O     1 
ATOM   8048  C  CB    . PHE A 1  1058 ? 148.123 188.146 130.164 1.00 123.02 ? 1058 PHE A CB    1 
ATOM   8049  C  CG    . PHE A 1  1058 ? 148.733 186.784 130.338 1.00 123.02 ? 1058 PHE A CG    1 
ATOM   8050  C  CD1   . PHE A 1  1058 ? 148.902 185.949 129.247 1.00 123.02 ? 1058 PHE A CD1   1 
ATOM   8051  C  CD2   . PHE A 1  1058 ? 149.157 186.345 131.576 1.00 123.02 ? 1058 PHE A CD2   1 
ATOM   8052  C  CE1   . PHE A 1  1058 ? 149.470 184.703 129.390 1.00 123.02 ? 1058 PHE A CE1   1 
ATOM   8053  C  CE2   . PHE A 1  1058 ? 149.726 185.096 131.725 1.00 123.02 ? 1058 PHE A CE2   1 
ATOM   8054  C  CZ    . PHE A 1  1058 ? 149.882 184.275 130.631 1.00 123.02 ? 1058 PHE A CZ    1 
ATOM   8055  N  N     . ARG A 1  1059 ? 147.934 191.096 128.859 1.00 123.41 ? 1059 ARG A N     1 
ATOM   8056  C  CA    . ARG A 1  1059 ? 147.247 192.383 128.701 1.00 123.41 ? 1059 ARG A CA    1 
ATOM   8057  C  C     . ARG A 1  1059 ? 146.001 192.497 129.581 1.00 123.41 ? 1059 ARG A C     1 
ATOM   8058  O  O     . ARG A 1  1059 ? 145.056 193.209 129.234 1.00 123.41 ? 1059 ARG A O     1 
ATOM   8059  C  CB    . ARG A 1  1059 ? 146.872 192.636 127.237 1.00 131.69 ? 1059 ARG A CB    1 
ATOM   8060  C  CG    . ARG A 1  1059 ? 148.030 192.772 126.271 1.00 131.69 ? 1059 ARG A CG    1 
ATOM   8061  C  CD    . ARG A 1  1059 ? 148.656 194.142 126.401 1.00 131.69 ? 1059 ARG A CD    1 
ATOM   8062  N  NE    . ARG A 1  1059 ? 149.673 194.383 125.386 1.00 131.69 ? 1059 ARG A NE    1 
ATOM   8063  C  CZ    . ARG A 1  1059 ? 150.971 194.141 125.532 1.00 131.69 ? 1059 ARG A CZ    1 
ATOM   8064  N  NH1   . ARG A 1  1059 ? 151.447 193.636 126.661 1.00 131.69 ? 1059 ARG A NH1   1 
ATOM   8065  N  NH2   . ARG A 1  1059 ? 151.798 194.409 124.532 1.00 131.69 ? 1059 ARG A NH2   1 
ATOM   8066  N  N     . LEU A 1  1060 ? 145.980 191.818 130.727 1.00 123.69 ? 1060 LEU A N     1 
ATOM   8067  C  CA    . LEU A 1  1060 ? 144.800 191.849 131.587 1.00 123.69 ? 1060 LEU A CA    1 
ATOM   8068  C  C     . LEU A 1  1060 ? 144.568 193.244 132.160 1.00 123.69 ? 1060 LEU A C     1 
ATOM   8069  O  O     . LEU A 1  1060 ? 145.476 193.861 132.722 1.00 123.69 ? 1060 LEU A O     1 
ATOM   8070  C  CB    . LEU A 1  1060 ? 144.940 190.836 132.725 1.00 121.05 ? 1060 LEU A CB    1 
ATOM   8071  C  CG    . LEU A 1  1060 ? 144.928 189.348 132.368 1.00 121.05 ? 1060 LEU A CG    1 
ATOM   8072  C  CD1   . LEU A 1  1060 ? 145.225 188.502 133.594 1.00 121.05 ? 1060 LEU A CD1   1 
ATOM   8073  C  CD2   . LEU A 1  1060 ? 143.594 188.956 131.771 1.00 121.05 ? 1060 LEU A CD2   1 
ATOM   8074  N  N     . SER A 1  1061 ? 143.342 193.738 132.011 1.00 128.93 ? 1061 SER A N     1 
ATOM   8075  C  CA    . SER A 1  1061 ? 142.945 194.990 132.635 1.00 128.93 ? 1061 SER A CA    1 
ATOM   8076  C  C     . SER A 1  1061 ? 142.759 194.802 134.139 1.00 128.93 ? 1061 SER A C     1 
ATOM   8077  O  O     . SER A 1  1061 ? 142.630 193.682 134.641 1.00 128.93 ? 1061 SER A O     1 
ATOM   8078  C  CB    . SER A 1  1061 ? 141.660 195.525 132.006 1.00 128.25 ? 1061 SER A CB    1 
ATOM   8079  O  OG    . SER A 1  1061 ? 140.581 194.631 132.208 1.00 128.25 ? 1061 SER A OG    1 
ATOM   8080  N  N     . GLY A 1  1062 ? 142.762 195.927 134.859 1.00 129.45 ? 1062 GLY A N     1 
ATOM   8081  C  CA    . GLY A 1  1062 ? 142.684 195.876 136.314 1.00 129.45 ? 1062 GLY A CA    1 
ATOM   8082  C  C     . GLY A 1  1062 ? 141.489 195.098 136.829 1.00 129.45 ? 1062 GLY A C     1 
ATOM   8083  O  O     . GLY A 1  1062 ? 141.620 194.245 137.711 1.00 129.45 ? 1062 GLY A O     1 
ATOM   8084  N  N     . GLU A 1  1063 ? 140.301 195.388 136.290 1.00 127.13 ? 1063 GLU A N     1 
ATOM   8085  C  CA    . GLU A 1  1063 ? 139.102 194.659 136.696 1.00 127.13 ? 1063 GLU A CA    1 
ATOM   8086  C  C     . GLU A 1  1063 ? 139.244 193.170 136.395 1.00 127.13 ? 1063 GLU A C     1 
ATOM   8087  O  O     . GLU A 1  1063 ? 138.822 192.317 137.187 1.00 127.13 ? 1063 GLU A O     1 
ATOM   8088  C  CB    . GLU A 1  1063 ? 137.872 195.242 135.994 1.00 138.98 ? 1063 GLU A CB    1 
ATOM   8089  C  CG    . GLU A 1  1063 ? 137.543 196.683 136.382 1.00 138.98 ? 1063 GLU A CG    1 
ATOM   8090  C  CD    . GLU A 1  1063 ? 136.354 197.241 135.615 1.00 138.98 ? 1063 GLU A CD    1 
ATOM   8091  O  OE1   . GLU A 1  1063 ? 135.906 196.589 134.648 1.00 138.98 ? 1063 GLU A OE1   1 
ATOM   8092  O  OE2   . GLU A 1  1063 ? 135.862 198.329 135.982 1.00 138.98 ? 1063 GLU A OE2   1 
ATOM   8093  N  N     . ALA A 1  1064 ? 139.855 192.841 135.255 1.00 124.73 ? 1064 ALA A N     1 
ATOM   8094  C  CA    . ALA A 1  1064 ? 140.111 191.445 134.921 1.00 124.73 ? 1064 ALA A CA    1 
ATOM   8095  C  C     . ALA A 1  1064 ? 141.033 190.795 135.940 1.00 124.73 ? 1064 ALA A C     1 
ATOM   8096  O  O     . ALA A 1  1064 ? 140.850 189.628 136.303 1.00 124.73 ? 1064 ALA A O     1 
ATOM   8097  C  CB    . ALA A 1  1064 ? 140.707 191.346 133.519 1.00 121.48 ? 1064 ALA A CB    1 
ATOM   8098  N  N     . PHE A 1  1065 ? 142.028 191.543 136.420 1.00 125.09 ? 1065 PHE A N     1 
ATOM   8099  C  CA    . PHE A 1  1065 ? 142.967 190.997 137.391 1.00 125.09 ? 1065 PHE A CA    1 
ATOM   8100  C  C     . PHE A 1  1065 ? 142.287 190.763 138.734 1.00 125.09 ? 1065 PHE A C     1 
ATOM   8101  O  O     . PHE A 1  1065 ? 142.507 189.733 139.384 1.00 125.09 ? 1065 PHE A O     1 
ATOM   8102  C  CB    . PHE A 1  1065 ? 144.169 191.932 137.532 1.00 126.08 ? 1065 PHE A CB    1 
ATOM   8103  C  CG    . PHE A 1  1065 ? 145.179 191.466 138.532 1.00 126.08 ? 1065 PHE A CG    1 
ATOM   8104  C  CD1   . PHE A 1  1065 ? 146.046 190.435 138.222 1.00 126.08 ? 1065 PHE A CD1   1 
ATOM   8105  C  CD2   . PHE A 1  1065 ? 145.275 192.065 139.775 1.00 126.08 ? 1065 PHE A CD2   1 
ATOM   8106  C  CE1   . PHE A 1  1065 ? 146.981 189.998 139.135 1.00 126.08 ? 1065 PHE A CE1   1 
ATOM   8107  C  CE2   . PHE A 1  1065 ? 146.211 191.635 140.692 1.00 126.08 ? 1065 PHE A CE2   1 
ATOM   8108  C  CZ    . PHE A 1  1065 ? 147.064 190.599 140.372 1.00 126.08 ? 1065 PHE A CZ    1 
ATOM   8109  N  N     . ASP A 1  1066 ? 141.439 191.705 139.156 1.00 124.29 ? 1066 ASP A N     1 
ATOM   8110  C  CA    . ASP A 1  1066 ? 140.683 191.524 140.391 1.00 124.29 ? 1066 ASP A CA    1 
ATOM   8111  C  C     . ASP A 1  1066 ? 139.782 190.299 140.295 1.00 124.29 ? 1066 ASP A C     1 
ATOM   8112  O  O     . ASP A 1  1066 ? 139.777 189.441 141.188 1.00 124.29 ? 1066 ASP A O     1 
ATOM   8113  C  CB    . ASP A 1  1066 ? 139.856 192.775 140.687 1.00 133.09 ? 1066 ASP A CB    1 
ATOM   8114  C  CG    . ASP A 1  1066 ? 140.714 193.989 141.005 1.00 133.09 ? 1066 ASP A CG    1 
ATOM   8115  O  OD1   . ASP A 1  1066 ? 141.915 193.824 141.306 1.00 133.09 ? 1066 ASP A OD1   1 
ATOM   8116  O  OD2   . ASP A 1  1066 ? 140.177 195.117 140.950 1.00 133.09 ? 1066 ASP A OD2   1 
ATOM   8117  N  N     . TRP A 1  1067 ? 139.015 190.201 139.206 1.00 118.40 ? 1067 TRP A N     1 
ATOM   8118  C  CA    . TRP A 1  1067 ? 138.178 189.026 138.983 1.00 118.40 ? 1067 TRP A CA    1 
ATOM   8119  C  C     . TRP A 1  1067 ? 138.998 187.747 139.053 1.00 118.40 ? 1067 TRP A C     1 
ATOM   8120  O  O     . TRP A 1  1067 ? 138.591 186.766 139.690 1.00 118.40 ? 1067 TRP A O     1 
ATOM   8121  C  CB    . TRP A 1  1067 ? 137.483 189.149 137.630 1.00 114.69 ? 1067 TRP A CB    1 
ATOM   8122  C  CG    . TRP A 1  1067 ? 136.608 188.027 137.272 1.00 114.69 ? 1067 TRP A CG    1 
ATOM   8123  C  CD1   . TRP A 1  1067 ? 135.295 187.859 137.608 1.00 114.69 ? 1067 TRP A CD1   1 
ATOM   8124  C  CD2   . TRP A 1  1067 ? 136.949 186.928 136.439 1.00 114.69 ? 1067 TRP A CD2   1 
ATOM   8125  N  NE1   . TRP A 1  1067 ? 134.801 186.712 137.044 1.00 114.69 ? 1067 TRP A NE1   1 
ATOM   8126  C  CE2   . TRP A 1  1067 ? 135.804 186.118 136.323 1.00 114.69 ? 1067 TRP A CE2   1 
ATOM   8127  C  CE3   . TRP A 1  1067 ? 138.120 186.537 135.789 1.00 114.69 ? 1067 TRP A CE3   1 
ATOM   8128  C  CZ2   . TRP A 1  1067 ? 135.801 184.939 135.596 1.00 114.69 ? 1067 TRP A CZ2   1 
ATOM   8129  C  CZ3   . TRP A 1  1067 ? 138.115 185.381 135.055 1.00 114.69 ? 1067 TRP A CZ3   1 
ATOM   8130  C  CH2   . TRP A 1  1067 ? 136.966 184.585 134.967 1.00 114.69 ? 1067 TRP A CH2   1 
ATOM   8131  N  N     . LEU A 1  1068 ? 140.178 187.761 138.426 1.00 118.36 ? 1068 LEU A N     1 
ATOM   8132  C  CA    . LEU A 1  1068 ? 141.030 186.580 138.389 1.00 118.36 ? 1068 LEU A CA    1 
ATOM   8133  C  C     . LEU A 1  1068 ? 141.453 186.162 139.789 1.00 118.36 ? 1068 LEU A C     1 
ATOM   8134  O  O     . LEU A 1  1068 ? 141.361 184.981 140.145 1.00 118.36 ? 1068 LEU A O     1 
ATOM   8135  C  CB    . LEU A 1  1068 ? 142.247 186.854 137.509 1.00 114.33 ? 1068 LEU A CB    1 
ATOM   8136  C  CG    . LEU A 1  1068 ? 143.290 185.743 137.410 1.00 114.33 ? 1068 LEU A CG    1 
ATOM   8137  C  CD1   . LEU A 1  1068 ? 142.693 184.480 136.816 1.00 114.33 ? 1068 LEU A CD1   1 
ATOM   8138  C  CD2   . LEU A 1  1068 ? 144.484 186.199 136.591 1.00 114.33 ? 1068 LEU A CD2   1 
ATOM   8139  N  N     . LEU A 1  1069 ? 141.908 187.119 140.602 1.00 120.29 ? 1069 LEU A N     1 
ATOM   8140  C  CA    . LEU A 1  1069 ? 142.243 186.811 141.989 1.00 120.29 ? 1069 LEU A CA    1 
ATOM   8141  C  C     . LEU A 1  1069 ? 141.039 186.226 142.715 1.00 120.29 ? 1069 LEU A C     1 
ATOM   8142  O  O     . LEU A 1  1069 ? 141.158 185.244 143.462 1.00 120.29 ? 1069 LEU A O     1 
ATOM   8143  C  CB    . LEU A 1  1069 ? 142.728 188.068 142.708 1.00 122.17 ? 1069 LEU A CB    1 
ATOM   8144  C  CG    . LEU A 1  1069 ? 143.954 188.803 142.181 1.00 122.17 ? 1069 LEU A CG    1 
ATOM   8145  C  CD1   . LEU A 1  1069 ? 144.202 190.040 143.029 1.00 122.17 ? 1069 LEU A CD1   1 
ATOM   8146  C  CD2   . LEU A 1  1069 ? 145.146 187.886 142.185 1.00 122.17 ? 1069 LEU A CD2   1 
ATOM   8147  N  N     . GLY A 1  1070 ? 139.862 186.816 142.491 1.00 120.36 ? 1070 GLY A N     1 
ATOM   8148  C  CA    . GLY A 1  1070 ? 138.657 186.315 143.132 1.00 120.36 ? 1070 GLY A CA    1 
ATOM   8149  C  C     . GLY A 1  1070 ? 138.407 184.849 142.846 1.00 120.36 ? 1070 GLY A C     1 
ATOM   8150  O  O     . GLY A 1  1070 ? 138.179 184.051 143.760 1.00 120.36 ? 1070 GLY A O     1 
ATOM   8151  N  N     . GLU A 1  1071 ? 138.458 184.464 141.570 1.00 119.23 ? 1071 GLU A N     1 
ATOM   8152  C  CA    . GLU A 1  1071 ? 138.192 183.065 141.248 1.00 119.23 ? 1071 GLU A CA    1 
ATOM   8153  C  C     . GLU A 1  1071 ? 139.322 182.149 141.696 1.00 119.23 ? 1071 GLU A C     1 
ATOM   8154  O  O     . GLU A 1  1071 ? 139.086 180.976 142.002 1.00 119.23 ? 1071 GLU A O     1 
ATOM   8155  C  CB    . GLU A 1  1071 ? 137.940 182.870 139.761 1.00 125.21 ? 1071 GLU A CB    1 
ATOM   8156  C  CG    . GLU A 1  1071 ? 136.588 183.268 139.292 1.00 125.21 ? 1071 GLU A CG    1 
ATOM   8157  C  CD    . GLU A 1  1071 ? 136.369 182.831 137.863 1.00 125.21 ? 1071 GLU A CD    1 
ATOM   8158  O  OE1   . GLU A 1  1071 ? 137.360 182.500 137.178 1.00 125.21 ? 1071 GLU A OE1   1 
ATOM   8159  O  OE2   . GLU A 1  1071 ? 135.202 182.745 137.441 1.00 125.21 ? 1071 GLU A OE2   1 
ATOM   8160  N  N     . ILE A 1  1072 ? 140.563 182.641 141.704 1.00 117.40 ? 1072 ILE A N     1 
ATOM   8161  C  CA    . ILE A 1  1072 ? 141.639 181.807 142.238 1.00 117.40 ? 1072 ILE A CA    1 
ATOM   8162  C  C     . ILE A 1  1072 ? 141.348 181.449 143.691 1.00 117.40 ? 1072 ILE A C     1 
ATOM   8163  O  O     . ILE A 1  1072 ? 141.450 180.280 144.094 1.00 117.40 ? 1072 ILE A O     1 
ATOM   8164  C  CB    . ILE A 1  1072 ? 143.004 182.500 142.077 1.00 118.88 ? 1072 ILE A CB    1 
ATOM   8165  C  CG1   . ILE A 1  1072 ? 143.374 182.599 140.601 1.00 118.88 ? 1072 ILE A CG1   1 
ATOM   8166  C  CG2   . ILE A 1  1072 ? 144.080 181.736 142.829 1.00 118.88 ? 1072 ILE A CG2   1 
ATOM   8167  C  CD1   . ILE A 1  1072 ? 144.618 183.399 140.355 1.00 118.88 ? 1072 ILE A CD1   1 
ATOM   8168  N  N     . GLU A 1  1073 ? 140.947 182.443 144.492 1.00 118.63 ? 1073 GLU A N     1 
ATOM   8169  C  CA    . GLU A 1  1073 ? 140.492 182.178 145.856 1.00 118.63 ? 1073 GLU A CA    1 
ATOM   8170  C  C     . GLU A 1  1073 ? 139.363 181.152 145.878 1.00 118.63 ? 1073 GLU A C     1 
ATOM   8171  O  O     . GLU A 1  1073 ? 139.512 180.049 146.420 1.00 118.63 ? 1073 GLU A O     1 
ATOM   8172  C  CB    . GLU A 1  1073 ? 140.025 183.479 146.513 1.00 128.70 ? 1073 GLU A CB    1 
ATOM   8173  C  CG    . GLU A 1  1073 ? 141.110 184.515 146.718 1.00 128.70 ? 1073 GLU A CG    1 
ATOM   8174  C  CD    . GLU A 1  1073 ? 140.566 185.820 147.261 1.00 128.70 ? 1073 GLU A CD    1 
ATOM   8175  O  OE1   . GLU A 1  1073 ? 139.327 185.952 147.326 1.00 128.70 ? 1073 GLU A OE1   1 
ATOM   8176  O  OE2   . GLU A 1  1073 ? 141.369 186.714 147.609 1.00 128.70 ? 1073 GLU A OE2   1 
ATOM   8177  N  N     . SER A 1  1074 ? 138.218 181.513 145.287 1.00 117.20 ? 1074 SER A N     1 
ATOM   8178  C  CA    . SER A 1  1074 ? 137.013 180.696 145.420 1.00 117.20 ? 1074 SER A CA    1 
ATOM   8179  C  C     . SER A 1  1074 ? 137.221 179.272 144.921 1.00 117.20 ? 1074 SER A C     1 
ATOM   8180  O  O     . SER A 1  1074 ? 136.591 178.338 145.431 1.00 117.20 ? 1074 SER A O     1 
ATOM   8181  C  CB    . SER A 1  1074 ? 135.856 181.352 144.666 1.00 123.64 ? 1074 SER A CB    1 
ATOM   8182  O  OG    . SER A 1  1074 ? 135.538 182.614 145.226 1.00 123.64 ? 1074 SER A OG    1 
ATOM   8183  N  N     . LYS A 1  1075 ? 138.085 179.083 143.925 1.00 112.98 ? 1075 LYS A N     1 
ATOM   8184  C  CA    . LYS A 1  1075 ? 138.308 177.750 143.377 1.00 112.98 ? 1075 LYS A CA    1 
ATOM   8185  C  C     . LYS A 1  1075 ? 139.286 176.949 144.231 1.00 112.98 ? 1075 LYS A C     1 
ATOM   8186  O  O     . LYS A 1  1075 ? 139.072 175.754 144.478 1.00 112.98 ? 1075 LYS A O     1 
ATOM   8187  C  CB    . LYS A 1  1075 ? 138.803 177.855 141.935 1.00 113.77 ? 1075 LYS A CB    1 
ATOM   8188  C  CG    . LYS A 1  1075 ? 138.922 176.520 141.226 1.00 113.77 ? 1075 LYS A CG    1 
ATOM   8189  C  CD    . LYS A 1  1075 ? 139.492 176.683 139.828 1.00 113.77 ? 1075 LYS A CD    1 
ATOM   8190  C  CE    . LYS A 1  1075 ? 138.526 177.430 138.921 1.00 113.77 ? 1075 LYS A CE    1 
ATOM   8191  N  NZ    . LYS A 1  1075 ? 139.067 177.600 137.542 1.00 113.77 ? 1075 LYS A NZ    1 
ATOM   8192  N  N     . PHE A 1  1076 ? 140.369 177.586 144.691 1.00 112.81 ? 1076 PHE A N     1 
ATOM   8193  C  CA    . PHE A 1  1076 ? 141.305 176.864 145.545 1.00 112.81 ? 1076 PHE A CA    1 
ATOM   8194  C  C     . PHE A 1  1076 ? 140.638 176.435 146.843 1.00 112.81 ? 1076 PHE A C     1 
ATOM   8195  O  O     . PHE A 1  1076 ? 140.917 175.349 147.363 1.00 112.81 ? 1076 PHE A O     1 
ATOM   8196  C  CB    . PHE A 1  1076 ? 142.540 177.708 145.847 1.00 113.12 ? 1076 PHE A CB    1 
ATOM   8197  C  CG    . PHE A 1  1076 ? 143.530 177.009 146.735 1.00 113.12 ? 1076 PHE A CG    1 
ATOM   8198  C  CD1   . PHE A 1  1076 ? 144.419 176.091 146.206 1.00 113.12 ? 1076 PHE A CD1   1 
ATOM   8199  C  CD2   . PHE A 1  1076 ? 143.554 177.244 148.100 1.00 113.12 ? 1076 PHE A CD2   1 
ATOM   8200  C  CE1   . PHE A 1  1076 ? 145.324 175.435 147.013 1.00 113.12 ? 1076 PHE A CE1   1 
ATOM   8201  C  CE2   . PHE A 1  1076 ? 144.456 176.587 148.912 1.00 113.12 ? 1076 PHE A CE2   1 
ATOM   8202  C  CZ    . PHE A 1  1076 ? 145.342 175.682 148.368 1.00 113.12 ? 1076 PHE A CZ    1 
ATOM   8203  N  N     . ASN A 1  1077 ? 139.753 177.274 147.384 1.00 113.59 ? 1077 ASN A N     1 
ATOM   8204  C  CA    . ASN A 1  1077 ? 139.031 176.884 148.588 1.00 113.59 ? 1077 ASN A CA    1 
ATOM   8205  C  C     . ASN A 1  1077 ? 138.107 175.699 148.343 1.00 113.59 ? 1077 ASN A C     1 
ATOM   8206  O  O     . ASN A 1  1077 ? 137.791 174.969 149.289 1.00 113.59 ? 1077 ASN A O     1 
ATOM   8207  C  CB    . ASN A 1  1077 ? 138.242 178.070 149.138 1.00 118.33 ? 1077 ASN A CB    1 
ATOM   8208  C  CG    . ASN A 1  1077 ? 139.137 179.126 149.752 1.00 118.33 ? 1077 ASN A CG    1 
ATOM   8209  O  OD1   . ASN A 1  1077 ? 140.264 178.840 150.157 1.00 118.33 ? 1077 ASN A OD1   1 
ATOM   8210  N  ND2   . ASN A 1  1077 ? 138.639 180.353 149.831 1.00 118.33 ? 1077 ASN A ND2   1 
ATOM   8211  N  N     . GLN A 1  1078 ? 137.668 175.490 147.100 1.00 113.18 ? 1078 GLN A N     1 
ATOM   8212  C  CA    . GLN A 1  1078 ? 136.913 174.286 146.775 1.00 113.18 ? 1078 GLN A CA    1 
ATOM   8213  C  C     . GLN A 1  1078 ? 137.820 173.078 146.601 1.00 113.18 ? 1078 GLN A C     1 
ATOM   8214  O  O     . GLN A 1  1078 ? 137.408 171.953 146.905 1.00 113.18 ? 1078 GLN A O     1 
ATOM   8215  C  CB    . GLN A 1  1078 ? 136.090 174.494 145.504 1.00 117.58 ? 1078 GLN A CB    1 
ATOM   8216  C  CG    . GLN A 1  1078 ? 134.957 175.495 145.639 1.00 117.58 ? 1078 GLN A CG    1 
ATOM   8217  C  CD    . GLN A 1  1078 ? 134.197 175.679 144.339 1.00 117.58 ? 1078 GLN A CD    1 
ATOM   8218  O  OE1   . GLN A 1  1078 ? 134.727 175.430 143.257 1.00 117.58 ? 1078 GLN A OE1   1 
ATOM   8219  N  NE2   . GLN A 1  1078 ? 132.946 176.114 144.441 1.00 117.58 ? 1078 GLN A NE2   1 
ATOM   8220  N  N     . ALA A 1  1079 ? 139.045 173.285 146.113 1.00 111.57 ? 1079 ALA A N     1 
ATOM   8221  C  CA    . ALA A 1  1079 ? 139.951 172.168 145.865 1.00 111.57 ? 1079 ALA A CA    1 
ATOM   8222  C  C     . ALA A 1  1079 ? 140.377 171.441 147.136 1.00 111.57 ? 1079 ALA A C     1 
ATOM   8223  O  O     . ALA A 1  1079 ? 140.889 170.321 147.040 1.00 111.57 ? 1079 ALA A O     1 
ATOM   8224  C  CB    . ALA A 1  1079 ? 141.190 172.659 145.118 1.00 112.73 ? 1079 ALA A CB    1 
ATOM   8225  N  N     . ILE A 1  1080 ? 140.180 172.038 148.314 1.00 110.07 ? 1080 ILE A N     1 
ATOM   8226  C  CA    . ILE A 1  1080 ? 140.629 171.415 149.554 1.00 110.07 ? 1080 ILE A CA    1 
ATOM   8227  C  C     . ILE A 1  1080 ? 139.786 170.185 149.857 1.00 110.07 ? 1080 ILE A C     1 
ATOM   8228  O  O     . ILE A 1  1080 ? 138.563 170.177 149.662 1.00 110.07 ? 1080 ILE A O     1 
ATOM   8229  C  CB    . ILE A 1  1080 ? 140.576 172.430 150.708 1.00 110.53 ? 1080 ILE A CB    1 
ATOM   8230  C  CG1   . ILE A 1  1080 ? 141.582 173.554 150.467 1.00 110.53 ? 1080 ILE A CG1   1 
ATOM   8231  C  CG2   . ILE A 1  1080 ? 140.858 171.759 152.045 1.00 110.53 ? 1080 ILE A CG2   1 
ATOM   8232  C  CD1   . ILE A 1  1080 ? 141.441 174.704 151.429 1.00 110.53 ? 1080 ILE A CD1   1 
ATOM   8233  N  N     . ALA A 1  1081 ? 140.445 169.131 150.334 1.00 109.00 ? 1081 ALA A N     1 
ATOM   8234  C  CA    . ALA A 1  1081 ? 139.748 167.905 150.692 1.00 109.00 ? 1081 ALA A CA    1 
ATOM   8235  C  C     . ALA A 1  1081 ? 138.784 168.149 151.846 1.00 109.00 ? 1081 ALA A C     1 
ATOM   8236  O  O     . ALA A 1  1081 ? 138.985 169.036 152.680 1.00 109.00 ? 1081 ALA A O     1 
ATOM   8237  C  CB    . ALA A 1  1081 ? 140.749 166.813 151.066 1.00 107.43 ? 1081 ALA A CB    1 
ATOM   8238  N  N     . HIS A 1  1082 ? 137.730 167.345 151.891 1.00 107.62 ? 1082 HIS A N     1 
ATOM   8239  C  CA    . HIS A 1  1082 ? 136.690 167.495 152.902 1.00 107.62 ? 1082 HIS A CA    1 
ATOM   8240  C  C     . HIS A 1  1082 ? 136.969 166.571 154.080 1.00 107.62 ? 1082 HIS A C     1 
ATOM   8241  O  O     . HIS A 1  1082 ? 137.226 165.380 153.873 1.00 107.62 ? 1082 HIS A O     1 
ATOM   8242  C  CB    . HIS A 1  1082 ? 135.325 167.172 152.317 1.00 114.99 ? 1082 HIS A CB    1 
ATOM   8243  C  CG    . HIS A 1  1082 ? 134.965 168.009 151.131 1.00 114.99 ? 1082 HIS A CG    1 
ATOM   8244  N  ND1   . HIS A 1  1082 ? 134.683 169.354 151.227 1.00 114.99 ? 1082 HIS A ND1   1 
ATOM   8245  C  CD2   . HIS A 1  1082 ? 134.846 167.693 149.820 1.00 114.99 ? 1082 HIS A CD2   1 
ATOM   8246  C  CE1   . HIS A 1  1082 ? 134.402 169.830 150.027 1.00 114.99 ? 1082 HIS A CE1   1 
ATOM   8247  N  NE2   . HIS A 1  1082 ? 134.495 168.842 149.155 1.00 114.99 ? 1082 HIS A NE2   1 
ATOM   8248  N  N     . PRO A 1  1083 ? 136.944 167.074 155.312 1.00 107.68 ? 1083 PRO A N     1 
ATOM   8249  C  CA    . PRO A 1  1083 ? 137.052 166.182 156.473 1.00 107.68 ? 1083 PRO A CA    1 
ATOM   8250  C  C     . PRO A 1  1083 ? 135.925 165.160 156.479 1.00 107.68 ? 1083 PRO A C     1 
ATOM   8251  O  O     . PRO A 1  1083 ? 134.750 165.505 156.343 1.00 107.68 ? 1083 PRO A O     1 
ATOM   8252  C  CB    . PRO A 1  1083 ? 136.950 167.142 157.662 1.00 109.55 ? 1083 PRO A CB    1 
ATOM   8253  C  CG    . PRO A 1  1083 ? 137.447 168.441 157.130 1.00 109.55 ? 1083 PRO A CG    1 
ATOM   8254  C  CD    . PRO A 1  1083 ? 136.973 168.493 155.705 1.00 109.55 ? 1083 PRO A CD    1 
ATOM   8255  N  N     . GLY A 1  1084 ? 136.291 163.895 156.654 1.00 111.48 ? 1084 GLY A N     1 
ATOM   8256  C  CA    . GLY A 1  1084 ? 135.343 162.800 156.624 1.00 111.48 ? 1084 GLY A CA    1 
ATOM   8257  C  C     . GLY A 1  1084 ? 135.441 161.905 155.409 1.00 111.48 ? 1084 GLY A C     1 
ATOM   8258  O  O     . GLY A 1  1084 ? 134.833 160.827 155.413 1.00 111.48 ? 1084 GLY A O     1 
ATOM   8259  N  N     . GLU A 1  1085 ? 136.170 162.308 154.371 1.00 111.51 ? 1085 GLU A N     1 
ATOM   8260  C  CA    . GLU A 1  1085 ? 136.386 161.430 153.229 1.00 111.51 ? 1085 GLU A CA    1 
ATOM   8261  C  C     . GLU A 1  1085 ? 137.098 160.163 153.674 1.00 111.51 ? 1085 GLU A C     1 
ATOM   8262  O  O     . GLU A 1  1085 ? 138.003 160.205 154.509 1.00 111.51 ? 1085 GLU A O     1 
ATOM   8263  C  CB    . GLU A 1  1085 ? 137.229 162.120 152.158 1.00 118.54 ? 1085 GLU A CB    1 
ATOM   8264  C  CG    . GLU A 1  1085 ? 136.575 163.288 151.460 1.00 118.54 ? 1085 GLU A CG    1 
ATOM   8265  C  CD    . GLU A 1  1085 ? 137.511 163.945 150.465 1.00 118.54 ? 1085 GLU A CD    1 
ATOM   8266  O  OE1   . GLU A 1  1085 ? 138.710 163.596 150.456 1.00 118.54 ? 1085 GLU A OE1   1 
ATOM   8267  O  OE2   . GLU A 1  1085 ? 137.051 164.812 149.695 1.00 118.54 ? 1085 GLU A OE2   1 
ATOM   8268  N  N     . MET A 1  1086 ? 136.716 159.033 153.089 1.00 111.50 ? 1086 MET A N     1 
ATOM   8269  C  CA    . MET A 1  1086 ? 137.376 157.772 153.393 1.00 111.50 ? 1086 MET A CA    1 
ATOM   8270  C  C     . MET A 1  1086 ? 138.504 157.596 152.388 1.00 111.50 ? 1086 MET A C     1 
ATOM   8271  O  O     . MET A 1  1086 ? 138.264 157.314 151.210 1.00 111.50 ? 1086 MET A O     1 
ATOM   8272  C  CB    . MET A 1  1086 ? 136.387 156.614 153.335 1.00 114.75 ? 1086 MET A CB    1 
ATOM   8273  C  CG    . MET A 1  1086 ? 135.310 156.699 154.392 1.00 114.75 ? 1086 MET A CG    1 
ATOM   8274  S  SD    . MET A 1  1086 ? 136.028 156.713 156.040 1.00 114.75 ? 1086 MET A SD    1 
ATOM   8275  C  CE    . MET A 1  1086 ? 136.719 155.066 156.107 1.00 114.75 ? 1086 MET A CE    1 
ATOM   8276  N  N     . VAL A 1  1087 ? 139.735 157.768 152.861 1.00 106.24 ? 1087 VAL A N     1 
ATOM   8277  C  CA    . VAL A 1  1087 ? 140.891 157.743 151.975 1.00 106.24 ? 1087 VAL A CA    1 
ATOM   8278  C  C     . VAL A 1  1087 ? 141.354 156.317 151.723 1.00 106.24 ? 1087 VAL A C     1 
ATOM   8279  O  O     . VAL A 1  1087 ? 141.819 155.989 150.627 1.00 106.24 ? 1087 VAL A O     1 
ATOM   8280  C  CB    . VAL A 1  1087 ? 142.010 158.617 152.561 1.00 103.71 ? 1087 VAL A CB    1 
ATOM   8281  C  CG1   . VAL A 1  1087 ? 143.228 158.553 151.692 1.00 103.71 ? 1087 VAL A CG1   1 
ATOM   8282  C  CG2   . VAL A 1  1087 ? 141.541 160.036 152.657 1.00 103.71 ? 1087 VAL A CG2   1 
ATOM   8283  N  N     . GLY A 1  1088 ? 141.245 155.450 152.728 1.00 112.85 ? 1088 GLY A N     1 
ATOM   8284  C  CA    . GLY A 1  1088 ? 141.779 154.105 152.586 1.00 112.85 ? 1088 GLY A CA    1 
ATOM   8285  C  C     . GLY A 1  1088 ? 141.102 153.309 151.489 1.00 112.85 ? 1088 GLY A C     1 
ATOM   8286  O  O     . GLY A 1  1088 ? 141.763 152.670 150.667 1.00 112.85 ? 1088 GLY A O     1 
ATOM   8287  N  N     . ALA A 1  1089 ? 139.770 153.333 151.462 1.00 112.93 ? 1089 ALA A N     1 
ATOM   8288  C  CA    . ALA A 1  1089 ? 139.050 152.588 150.437 1.00 112.93 ? 1089 ALA A CA    1 
ATOM   8289  C  C     . ALA A 1  1089 ? 139.257 153.206 149.061 1.00 112.93 ? 1089 ALA A C     1 
ATOM   8290  O  O     . ALA A 1  1089 ? 139.395 152.488 148.064 1.00 112.93 ? 1089 ALA A O     1 
ATOM   8291  C  CB    . ALA A 1  1089 ? 137.563 152.521 150.781 1.00 115.08 ? 1089 ALA A CB    1 
ATOM   8292  N  N     . LEU A 1  1090 ? 139.298 154.537 148.988 1.00 112.30 ? 1090 LEU A N     1 
ATOM   8293  C  CA    . LEU A 1  1090 ? 139.431 155.199 147.695 1.00 112.30 ? 1090 LEU A CA    1 
ATOM   8294  C  C     . LEU A 1  1090 ? 140.820 154.983 147.105 1.00 112.30 ? 1090 LEU A C     1 
ATOM   8295  O  O     . LEU A 1  1090 ? 140.975 154.826 145.889 1.00 112.30 ? 1090 LEU A O     1 
ATOM   8296  C  CB    . LEU A 1  1090 ? 139.125 156.689 147.839 1.00 106.57 ? 1090 LEU A CB    1 
ATOM   8297  C  CG    . LEU A 1  1090 ? 139.273 157.504 146.558 1.00 106.57 ? 1090 LEU A CG    1 
ATOM   8298  C  CD1   . LEU A 1  1090 ? 138.311 156.988 145.504 1.00 106.57 ? 1090 LEU A CD1   1 
ATOM   8299  C  CD2   . LEU A 1  1090 ? 139.039 158.981 146.826 1.00 106.57 ? 1090 LEU A CD2   1 
ATOM   8300  N  N     . ALA A 1  1091 ? 141.845 154.965 147.957 1.00 110.94 ? 1091 ALA A N     1 
ATOM   8301  C  CA    . ALA A 1  1091 ? 143.201 154.719 147.480 1.00 110.94 ? 1091 ALA A CA    1 
ATOM   8302  C  C     . ALA A 1  1091 ? 143.409 153.243 147.174 1.00 110.94 ? 1091 ALA A C     1 
ATOM   8303  O  O     . ALA A 1  1091 ? 144.137 152.886 146.242 1.00 110.94 ? 1091 ALA A O     1 
ATOM   8304  C  CB    . ALA A 1  1091 ? 144.216 155.205 148.512 1.00 108.84 ? 1091 ALA A CB    1 
ATOM   8305  N  N     . ALA A 1  1092 ? 142.781 152.367 147.961 1.00 115.33 ? 1092 ALA A N     1 
ATOM   8306  C  CA    . ALA A 1  1092 ? 142.871 150.937 147.693 1.00 115.33 ? 1092 ALA A CA    1 
ATOM   8307  C  C     . ALA A 1  1092 ? 142.198 150.583 146.375 1.00 115.33 ? 1092 ALA A C     1 
ATOM   8308  O  O     . ALA A 1  1092 ? 142.660 149.695 145.649 1.00 115.33 ? 1092 ALA A O     1 
ATOM   8309  C  CB    . ALA A 1  1092 ? 142.245 150.150 148.841 1.00 114.92 ? 1092 ALA A CB    1 
ATOM   8310  N  N     . GLN A 1  1093 ? 141.099 151.268 146.050 1.00 114.92 ? 1093 GLN A N     1 
ATOM   8311  C  CA    . GLN A 1  1093 ? 140.434 151.035 144.773 1.00 114.92 ? 1093 GLN A CA    1 
ATOM   8312  C  C     . GLN A 1  1093 ? 141.168 151.729 143.635 1.00 114.92 ? 1093 GLN A C     1 
ATOM   8313  O  O     . GLN A 1  1093 ? 141.140 151.259 142.493 1.00 114.92 ? 1093 GLN A O     1 
ATOM   8314  C  CB    . GLN A 1  1093 ? 138.985 151.511 144.844 1.00 113.54 ? 1093 GLN A CB    1 
ATOM   8315  C  CG    . GLN A 1  1093 ? 138.118 150.699 145.782 1.00 113.54 ? 1093 GLN A CG    1 
ATOM   8316  C  CD    . GLN A 1  1093 ? 136.718 151.256 145.906 1.00 113.54 ? 1093 GLN A CD    1 
ATOM   8317  O  OE1   . GLN A 1  1093 ? 136.486 152.443 145.675 1.00 113.54 ? 1093 GLN A OE1   1 
ATOM   8318  N  NE2   . GLN A 1  1093 ? 135.774 150.400 146.275 1.00 113.54 ? 1093 GLN A NE2   1 
ATOM   8319  N  N     . SER A 1  1094 ? 141.823 152.855 143.926 1.00 115.35 ? 1094 SER A N     1 
ATOM   8320  C  CA    . SER A 1  1094 ? 142.573 153.556 142.890 1.00 115.35 ? 1094 SER A CA    1 
ATOM   8321  C  C     . SER A 1  1094 ? 143.819 152.778 142.493 1.00 115.35 ? 1094 SER A C     1 
ATOM   8322  O  O     . SER A 1  1094 ? 144.206 152.768 141.320 1.00 115.35 ? 1094 SER A O     1 
ATOM   8323  C  CB    . SER A 1  1094 ? 142.947 154.956 143.370 1.00 114.19 ? 1094 SER A CB    1 
ATOM   8324  O  OG    . SER A 1  1094 ? 141.789 155.740 143.596 1.00 114.19 ? 1094 SER A OG    1 
ATOM   8325  N  N     . LEU A 1  1095 ? 144.477 152.142 143.460 1.00 116.27 ? 1095 LEU A N     1 
ATOM   8326  C  CA    . LEU A 1  1095 ? 145.640 151.319 143.151 1.00 116.27 ? 1095 LEU A CA    1 
ATOM   8327  C  C     . LEU A 1  1095 ? 145.238 149.927 142.682 1.00 116.27 ? 1095 LEU A C     1 
ATOM   8328  O  O     . LEU A 1  1095 ? 145.956 149.303 141.894 1.00 116.27 ? 1095 LEU A O     1 
ATOM   8329  C  CB    . LEU A 1  1095 ? 146.551 151.222 144.373 1.00 115.47 ? 1095 LEU A CB    1 
ATOM   8330  C  CG    . LEU A 1  1095 ? 147.098 152.573 144.826 1.00 115.47 ? 1095 LEU A CG    1 
ATOM   8331  C  CD1   . LEU A 1  1095 ? 147.937 152.431 146.080 1.00 115.47 ? 1095 LEU A CD1   1 
ATOM   8332  C  CD2   . LEU A 1  1095 ? 147.889 153.222 143.710 1.00 115.47 ? 1095 LEU A CD2   1 
ATOM   8333  N  N     . GLY A 1  1096 ? 144.094 149.425 143.154 1.00 122.03 ? 1096 GLY A N     1 
ATOM   8334  C  CA    . GLY A 1  1096 ? 143.706 148.063 142.837 1.00 122.03 ? 1096 GLY A CA    1 
ATOM   8335  C  C     . GLY A 1  1096 ? 142.942 147.931 141.536 1.00 122.03 ? 1096 GLY A C     1 
ATOM   8336  O  O     . GLY A 1  1096 ? 142.918 146.852 140.938 1.00 122.03 ? 1096 GLY A O     1 
ATOM   8337  N  N     . GLU A 1  1097 ? 142.303 149.008 141.083 1.00 128.60 ? 1097 GLU A N     1 
ATOM   8338  C  CA    . GLU A 1  1097 ? 141.529 148.933 139.845 1.00 128.60 ? 1097 GLU A CA    1 
ATOM   8339  C  C     . GLU A 1  1097 ? 142.410 148.719 138.620 1.00 128.60 ? 1097 GLU A C     1 
ATOM   8340  O  O     . GLU A 1  1097 ? 142.065 147.866 137.785 1.00 128.60 ? 1097 GLU A O     1 
ATOM   8341  C  CB    . GLU A 1  1097 ? 140.646 150.180 139.714 1.00 127.41 ? 1097 GLU A CB    1 
ATOM   8342  C  CG    . GLU A 1  1097 ? 139.660 150.157 138.546 1.00 127.41 ? 1097 GLU A CG    1 
ATOM   8343  C  CD    . GLU A 1  1097 ? 140.289 150.537 137.220 1.00 127.41 ? 1097 GLU A CD    1 
ATOM   8344  O  OE1   . GLU A 1  1097 ? 141.320 151.240 137.230 1.00 127.41 ? 1097 GLU A OE1   1 
ATOM   8345  O  OE2   . GLU A 1  1097 ? 139.750 150.134 136.168 1.00 127.41 ? 1097 GLU A OE2   1 
ATOM   8346  N  N     . PRO A 1  1098 ? 143.524 149.437 138.428 1.00 134.52 ? 1098 PRO A N     1 
ATOM   8347  C  CA    . PRO A 1  1098 ? 144.394 149.126 137.282 1.00 134.52 ? 1098 PRO A CA    1 
ATOM   8348  C  C     . PRO A 1  1098 ? 145.027 147.753 137.356 1.00 134.52 ? 1098 PRO A C     1 
ATOM   8349  O  O     . PRO A 1  1098 ? 145.421 147.219 136.312 1.00 134.52 ? 1098 PRO A O     1 
ATOM   8350  C  CB    . PRO A 1  1098 ? 145.461 150.227 137.340 1.00 126.32 ? 1098 PRO A CB    1 
ATOM   8351  C  CG    . PRO A 1  1098 ? 144.807 151.336 138.049 1.00 126.32 ? 1098 PRO A CG    1 
ATOM   8352  C  CD    . PRO A 1  1098 ? 143.960 150.676 139.094 1.00 126.32 ? 1098 PRO A CD    1 
ATOM   8353  N  N     . ALA A 1  1099 ? 145.145 147.168 138.552 1.00 141.79 ? 1099 ALA A N     1 
ATOM   8354  C  CA    . ALA A 1  1099 ? 145.777 145.859 138.683 1.00 141.79 ? 1099 ALA A CA    1 
ATOM   8355  C  C     . ALA A 1  1099 ? 145.084 144.811 137.825 1.00 141.79 ? 1099 ALA A C     1 
ATOM   8356  O  O     . ALA A 1  1099 ? 145.735 143.878 137.340 1.00 141.79 ? 1099 ALA A O     1 
ATOM   8357  C  CB    . ALA A 1  1099 ? 145.792 145.425 140.148 1.00 136.11 ? 1099 ALA A CB    1 
ATOM   8358  N  N     . THR A 1  1100 ? 143.775 144.953 137.615 1.00 142.28 ? 1100 THR A N     1 
ATOM   8359  C  CA    . THR A 1  1100 ? 143.062 144.045 136.729 1.00 142.28 ? 1100 THR A CA    1 
ATOM   8360  C  C     . THR A 1  1100 ? 143.504 144.189 135.278 1.00 142.28 ? 1100 THR A C     1 
ATOM   8361  O  O     . THR A 1  1100 ? 143.383 143.230 134.509 1.00 142.28 ? 1100 THR A O     1 
ATOM   8362  C  CB    . THR A 1  1100 ? 141.554 144.278 136.840 1.00 138.69 ? 1100 THR A CB    1 
ATOM   8363  O  OG1   . THR A 1  1100 ? 141.251 145.632 136.482 1.00 138.69 ? 1100 THR A OG1   1 
ATOM   8364  C  CG2   . THR A 1  1100 ? 141.082 144.022 138.264 1.00 138.69 ? 1100 THR A CG2   1 
ATOM   8365  N  N     . GLN A 1  1101 ? 144.008 145.362 134.889 1.00 146.63 ? 1101 GLN A N     1 
ATOM   8366  C  CA    . GLN A 1  1101 ? 144.488 145.614 133.535 1.00 146.63 ? 1101 GLN A CA    1 
ATOM   8367  C  C     . GLN A 1  1101 ? 145.996 145.432 133.392 1.00 146.63 ? 1101 GLN A C     1 
ATOM   8368  O  O     . GLN A 1  1101 ? 146.543 145.712 132.320 1.00 146.63 ? 1101 GLN A O     1 
ATOM   8369  C  CB    . GLN A 1  1101 ? 144.097 147.023 133.084 1.00 136.46 ? 1101 GLN A CB    1 
ATOM   8370  C  CG    . GLN A 1  1101 ? 142.606 147.242 132.917 1.00 136.46 ? 1101 GLN A CG    1 
ATOM   8371  C  CD    . GLN A 1  1101 ? 142.278 148.651 132.468 1.00 136.46 ? 1101 GLN A CD    1 
ATOM   8372  O  OE1   . GLN A 1  1101 ? 143.060 149.579 132.677 1.00 136.46 ? 1101 GLN A OE1   1 
ATOM   8373  N  NE2   . GLN A 1  1101 ? 141.119 148.818 131.841 1.00 136.46 ? 1101 GLN A NE2   1 
ATOM   8374  N  N     . MET A 1  1102 ? 146.681 144.970 134.436 1.00 158.55 ? 1102 MET A N     1 
ATOM   8375  C  CA    . MET A 1  1102 ? 148.145 144.948 134.480 1.00 158.55 ? 1102 MET A CA    1 
ATOM   8376  C  C     . MET A 1  1102 ? 148.748 143.684 133.884 1.00 158.55 ? 1102 MET A C     1 
ATOM   8377  O  O     . MET A 1  1102 ? 149.949 143.444 134.047 1.00 158.55 ? 1102 MET A O     1 
ATOM   8378  C  CB    . MET A 1  1102 ? 148.638 145.157 135.908 1.00 152.24 ? 1102 MET A CB    1 
ATOM   8379  C  CG    . MET A 1  1102 ? 148.490 146.584 136.405 1.00 152.24 ? 1102 MET A CG    1 
ATOM   8380  S  SD    . MET A 1  1102 ? 149.111 146.801 138.081 1.00 152.24 ? 1102 MET A SD    1 
ATOM   8381  C  CE    . MET A 1  1102 ? 150.869 146.626 137.803 1.00 152.24 ? 1102 MET A CE    1 
ATOM   8382  N  N     . THR A 1  1103 ? 147.950 142.841 133.221 1.00 171.41 ? 1103 THR A N     1 
ATOM   8383  C  CA    . THR A 1  1103 ? 148.506 141.664 132.554 1.00 171.41 ? 1103 THR A CA    1 
ATOM   8384  C  C     . THR A 1  1103 ? 149.628 142.044 131.592 1.00 171.41 ? 1103 THR A C     1 
ATOM   8385  O  O     . THR A 1  1103 ? 150.452 141.197 131.225 1.00 171.41 ? 1103 THR A O     1 
ATOM   8386  C  CB    . THR A 1  1103 ? 147.405 140.912 131.806 1.00 161.26 ? 1103 THR A CB    1 
ATOM   8387  N  N     . LEU A 1  1104 ? 149.669 143.308 131.167 1.00 182.50 ? 1104 LEU A N     1 
ATOM   8388  C  CA    . LEU A 1  1104 ? 150.733 143.965 130.411 1.00 182.50 ? 1104 LEU A CA    1 
ATOM   8389  C  C     . LEU A 1  1104 ? 150.814 143.485 128.966 1.00 182.50 ? 1104 LEU A C     1 
ATOM   8390  O  O     . LEU A 1  1104 ? 151.619 144.018 128.204 1.00 182.50 ? 1104 LEU A O     1 
ATOM   8391  C  CB    . LEU A 1  1104 ? 152.119 143.824 131.067 1.00 177.17 ? 1104 LEU A CB    1 
ATOM   8392  N  N     . ASN A 1  1105 ? 150.011 142.496 128.569 1.00 190.43 ? 1105 ASN A N     1 
ATOM   8393  C  CA    . ASN A 1  1105 ? 150.002 141.980 127.199 1.00 190.43 ? 1105 ASN A CA    1 
ATOM   8394  C  C     . ASN A 1  1105 ? 151.380 141.464 126.790 1.00 190.43 ? 1105 ASN A C     1 
ATOM   8395  O  O     . ASN A 1  1105 ? 151.910 141.816 125.733 1.00 190.43 ? 1105 ASN A O     1 
ATOM   8396  C  CB    . ASN A 1  1105 ? 149.500 143.038 126.213 1.00 190.23 ? 1105 ASN A CB    1 
ATOM   8397  N  N     . THR A 1  1106 ? 151.960 140.617 127.639 1.00 193.70 ? 1106 THR A N     1 
ATOM   8398  C  CA    . THR A 1  1106 ? 153.255 139.962 127.392 1.00 193.70 ? 1106 THR A CA    1 
ATOM   8399  C  C     . THR A 1  1106 ? 154.300 141.052 127.157 1.00 193.70 ? 1106 THR A C     1 
ATOM   8400  O  O     . THR A 1  1106 ? 154.578 141.821 128.092 1.00 193.70 ? 1106 THR A O     1 
ATOM   8401  C  CB    . THR A 1  1106 ? 153.100 138.945 126.266 1.00 191.50 ? 1106 THR A CB    1 
ATOM   8402  N  N     . PHE A 1  1107 ? 154.912 141.132 125.972 1.00 198.31 ? 1107 PHE A N     1 
ATOM   8403  C  CA    . PHE A 1  1107 ? 155.938 142.102 125.567 1.00 198.31 ? 1107 PHE A CA    1 
ATOM   8404  C  C     . PHE A 1  1107 ? 157.303 141.775 126.158 1.00 198.31 ? 1107 PHE A C     1 
ATOM   8405  O  O     . PHE A 1  1107 ? 158.275 142.491 125.869 1.00 198.31 ? 1107 PHE A O     1 
ATOM   8406  C  CB    . PHE A 1  1107 ? 155.571 143.549 125.919 1.00 194.15 ? 1107 PHE A CB    1 
ATOM   8407  N  N     . HIS A 1  1108 ? 157.412 140.735 126.979 1.00 196.59 ? 1108 HIS A N     1 
ATOM   8408  C  CA    . HIS A 1  1108 ? 158.692 140.334 127.553 1.00 196.59 ? 1108 HIS A CA    1 
ATOM   8409  C  C     . HIS A 1  1108 ? 159.684 139.921 126.469 1.00 196.59 ? 1108 HIS A C     1 
ATOM   8410  O  O     . HIS A 1  1108 ? 160.895 139.903 126.693 1.00 196.59 ? 1108 HIS A O     1 
ATOM   8411  C  CB    . HIS A 1  1108 ? 158.495 139.186 128.546 1.00 192.81 ? 1108 HIS A CB    1 
ATOM   8412  N  N     . LYS A 1  1115 ? 168.227 141.781 129.620 1.00 155.98 ? 1115 LYS A N     1 
ATOM   8413  C  CA    . LYS A 1  1115 ? 167.724 141.711 130.987 1.00 155.98 ? 1115 LYS A CA    1 
ATOM   8414  C  C     . LYS A 1  1115 ? 166.204 141.821 131.021 1.00 155.98 ? 1115 LYS A C     1 
ATOM   8415  O  O     . LYS A 1  1115 ? 165.617 142.644 130.320 1.00 155.98 ? 1115 LYS A O     1 
ATOM   8416  C  CB    . LYS A 1  1115 ? 168.347 142.814 131.847 1.00 150.36 ? 1115 LYS A CB    1 
ATOM   8417  C  CG    . LYS A 1  1115 ? 167.920 142.775 133.304 1.00 150.36 ? 1115 LYS A CG    1 
ATOM   8418  C  CD    . LYS A 1  1115 ? 168.582 143.877 134.111 1.00 150.36 ? 1115 LYS A CD    1 
ATOM   8419  C  CE    . LYS A 1  1115 ? 168.122 143.841 135.559 1.00 150.36 ? 1115 LYS A CE    1 
ATOM   8420  N  NZ    . LYS A 1  1115 ? 168.743 144.922 136.366 1.00 150.36 ? 1115 LYS A NZ    1 
ATOM   8421  N  N     . ASN A 1  1116 ? 165.573 140.986 131.841 1.00 154.25 ? 1116 ASN A N     1 
ATOM   8422  C  CA    . ASN A 1  1116 ? 164.131 141.001 132.026 1.00 154.25 ? 1116 ASN A CA    1 
ATOM   8423  C  C     . ASN A 1  1116 ? 163.799 141.277 133.487 1.00 154.25 ? 1116 ASN A C     1 
ATOM   8424  O  O     . ASN A 1  1116 ? 164.599 141.016 134.390 1.00 154.25 ? 1116 ASN A O     1 
ATOM   8425  C  CB    . ASN A 1  1116 ? 163.497 139.676 131.582 1.00 157.65 ? 1116 ASN A CB    1 
ATOM   8426  C  CG    . ASN A 1  1116 ? 164.008 138.489 132.376 1.00 157.65 ? 1116 ASN A CG    1 
ATOM   8427  O  OD1   . ASN A 1  1116 ? 165.035 138.570 133.049 1.00 157.65 ? 1116 ASN A OD1   1 
ATOM   8428  N  ND2   . ASN A 1  1116 ? 163.286 137.377 132.304 1.00 157.65 ? 1116 ASN A ND2   1 
ATOM   8429  N  N     . VAL A 1  1117 ? 162.604 141.818 133.711 1.00 146.43 ? 1117 VAL A N     1 
ATOM   8430  C  CA    . VAL A 1  1117 ? 162.130 142.160 135.047 1.00 146.43 ? 1117 VAL A CA    1 
ATOM   8431  C  C     . VAL A 1  1117 ? 160.684 141.707 135.176 1.00 146.43 ? 1117 VAL A C     1 
ATOM   8432  O  O     . VAL A 1  1117 ? 159.873 141.926 134.270 1.00 146.43 ? 1117 VAL A O     1 
ATOM   8433  C  CB    . VAL A 1  1117 ? 162.250 143.674 135.330 1.00 141.42 ? 1117 VAL A CB    1 
ATOM   8434  C  CG1   . VAL A 1  1117 ? 161.645 144.017 136.684 1.00 141.42 ? 1117 VAL A CG1   1 
ATOM   8435  C  CG2   . VAL A 1  1117 ? 163.702 144.123 135.267 1.00 141.42 ? 1117 VAL A CG2   1 
ATOM   8436  N  N     . THR A 1  1118 ? 160.363 141.068 136.299 1.00 141.31 ? 1118 THR A N     1 
ATOM   8437  C  CA    . THR A 1  1118 ? 158.973 140.754 136.600 1.00 141.31 ? 1118 THR A CA    1 
ATOM   8438  C  C     . THR A 1  1118 ? 158.182 142.045 136.764 1.00 141.31 ? 1118 THR A C     1 
ATOM   8439  O  O     . THR A 1  1118 ? 158.572 142.933 137.527 1.00 141.31 ? 1118 THR A O     1 
ATOM   8440  C  CB    . THR A 1  1118 ? 158.874 139.908 137.869 1.00 142.07 ? 1118 THR A CB    1 
ATOM   8441  O  OG1   . THR A 1  1118 ? 159.445 140.624 138.971 1.00 142.07 ? 1118 THR A OG1   1 
ATOM   8442  C  CG2   . THR A 1  1118 ? 159.613 138.590 137.693 1.00 142.07 ? 1118 THR A CG2   1 
ATOM   8443  N  N     . LEU A 1  1119 ? 157.073 142.153 136.037 1.00 134.74 ? 1119 LEU A N     1 
ATOM   8444  C  CA    . LEU A 1  1119 ? 156.263 143.361 136.039 1.00 134.74 ? 1119 LEU A CA    1 
ATOM   8445  C  C     . LEU A 1  1119 ? 154.792 142.979 136.108 1.00 134.74 ? 1119 LEU A C     1 
ATOM   8446  O  O     . LEU A 1  1119 ? 154.410 141.835 135.848 1.00 134.74 ? 1119 LEU A O     1 
ATOM   8447  C  CB    . LEU A 1  1119 ? 156.545 144.223 134.801 1.00 132.80 ? 1119 LEU A CB    1 
ATOM   8448  C  CG    . LEU A 1  1119 ? 157.952 144.818 134.705 1.00 132.80 ? 1119 LEU A CG    1 
ATOM   8449  C  CD1   . LEU A 1  1119 ? 158.156 145.514 133.372 1.00 132.80 ? 1119 LEU A CD1   1 
ATOM   8450  C  CD2   . LEU A 1  1119 ? 158.198 145.782 135.854 1.00 132.80 ? 1119 LEU A CD2   1 
ATOM   8451  N  N     . GLY A 1  1120 ? 153.961 143.959 136.458 1.00 133.16 ? 1120 GLY A N     1 
ATOM   8452  C  CA    . GLY A 1  1120 ? 152.536 143.707 136.530 1.00 133.16 ? 1120 GLY A CA    1 
ATOM   8453  C  C     . GLY A 1  1120 ? 152.105 143.110 137.861 1.00 133.16 ? 1120 GLY A C     1 
ATOM   8454  O  O     . GLY A 1  1120 ? 152.613 143.456 138.933 1.00 133.16 ? 1120 GLY A O     1 
ATOM   8455  N  N     . VAL A 1  1121 ? 151.127 142.205 137.779 1.00 131.08 ? 1121 VAL A N     1 
ATOM   8456  C  CA    . VAL A 1  1121 ? 150.556 141.600 138.985 1.00 131.08 ? 1121 VAL A CA    1 
ATOM   8457  C  C     . VAL A 1  1121 ? 151.591 140.839 139.814 1.00 131.08 ? 1121 VAL A C     1 
ATOM   8458  O  O     . VAL A 1  1121 ? 151.596 140.999 141.042 1.00 131.08 ? 1121 VAL A O     1 
ATOM   8459  C  CB    . VAL A 1  1121 ? 149.341 140.734 138.616 1.00 134.69 ? 1121 VAL A CB    1 
ATOM   8460  C  CG1   . VAL A 1  1121 ? 148.795 140.022 139.845 1.00 134.69 ? 1121 VAL A CG1   1 
ATOM   8461  C  CG2   . VAL A 1  1121 ? 148.263 141.585 137.962 1.00 134.69 ? 1121 VAL A CG2   1 
ATOM   8462  N  N     . PRO A 1  1122 ? 152.461 139.997 139.236 1.00 129.73 ? 1122 PRO A N     1 
ATOM   8463  C  CA    . PRO A 1  1122 ? 153.443 139.301 140.089 1.00 129.73 ? 1122 PRO A CA    1 
ATOM   8464  C  C     . PRO A 1  1122 ? 154.393 140.236 140.820 1.00 129.73 ? 1122 PRO A C     1 
ATOM   8465  O  O     . PRO A 1  1122 ? 154.637 140.047 142.021 1.00 129.73 ? 1122 PRO A O     1 
ATOM   8466  C  CB    . PRO A 1  1122 ? 154.178 138.389 139.095 1.00 128.91 ? 1122 PRO A CB    1 
ATOM   8467  C  CG    . PRO A 1  1122 ? 153.986 139.039 137.774 1.00 128.91 ? 1122 PRO A CG    1 
ATOM   8468  C  CD    . PRO A 1  1122 ? 152.592 139.580 137.829 1.00 128.91 ? 1122 PRO A CD    1 
ATOM   8469  N  N     . ARG A 1  1123 ? 154.936 141.246 140.136 1.00 128.58 ? 1123 ARG A N     1 
ATOM   8470  C  CA    . ARG A 1  1123 ? 155.788 142.216 140.816 1.00 128.58 ? 1123 ARG A CA    1 
ATOM   8471  C  C     . ARG A 1  1123 ? 155.008 142.973 141.881 1.00 128.58 ? 1123 ARG A C     1 
ATOM   8472  O  O     . ARG A 1  1123 ? 155.548 143.303 142.944 1.00 128.58 ? 1123 ARG A O     1 
ATOM   8473  C  CB    . ARG A 1  1123 ? 156.397 143.188 139.806 1.00 128.26 ? 1123 ARG A CB    1 
ATOM   8474  C  CG    . ARG A 1  1123 ? 157.271 144.269 140.426 1.00 128.26 ? 1123 ARG A CG    1 
ATOM   8475  C  CD    . ARG A 1  1123 ? 158.441 143.677 141.195 1.00 128.26 ? 1123 ARG A CD    1 
ATOM   8476  N  NE    . ARG A 1  1123 ? 159.295 144.715 141.765 1.00 128.26 ? 1123 ARG A NE    1 
ATOM   8477  C  CZ    . ARG A 1  1123 ? 160.212 144.501 142.704 1.00 128.26 ? 1123 ARG A CZ    1 
ATOM   8478  N  NH1   . ARG A 1  1123 ? 160.400 143.282 143.188 1.00 128.26 ? 1123 ARG A NH1   1 
ATOM   8479  N  NH2   . ARG A 1  1123 ? 160.940 145.510 143.161 1.00 128.26 ? 1123 ARG A NH2   1 
ATOM   8480  N  N     . LEU A 1  1124 ? 153.728 143.245 141.618 1.00 127.55 ? 1124 LEU A N     1 
ATOM   8481  C  CA    . LEU A 1  1124 ? 152.896 143.890 142.627 1.00 127.55 ? 1124 LEU A CA    1 
ATOM   8482  C  C     . LEU A 1  1124 ? 152.716 142.986 143.839 1.00 127.55 ? 1124 LEU A C     1 
ATOM   8483  O  O     . LEU A 1  1124 ? 152.615 143.467 144.972 1.00 127.55 ? 1124 LEU A O     1 
ATOM   8484  C  CB    . LEU A 1  1124 ? 151.544 144.273 142.025 1.00 125.98 ? 1124 LEU A CB    1 
ATOM   8485  C  CG    . LEU A 1  1124 ? 150.546 144.966 142.955 1.00 125.98 ? 1124 LEU A CG    1 
ATOM   8486  C  CD1   . LEU A 1  1124 ? 151.082 146.313 143.404 1.00 125.98 ? 1124 LEU A CD1   1 
ATOM   8487  C  CD2   . LEU A 1  1124 ? 149.194 145.123 142.279 1.00 125.98 ? 1124 LEU A CD2   1 
ATOM   8488  N  N     . LYS A 1  1125 ? 152.685 141.669 143.622 1.00 130.13 ? 1125 LYS A N     1 
ATOM   8489  C  CA    . LYS A 1  1125 ? 152.646 140.736 144.743 1.00 130.13 ? 1125 LYS A CA    1 
ATOM   8490  C  C     . LYS A 1  1125 ? 153.952 140.771 145.524 1.00 130.13 ? 1125 LYS A C     1 
ATOM   8491  O  O     . LYS A 1  1125 ? 153.953 140.702 146.759 1.00 130.13 ? 1125 LYS A O     1 
ATOM   8492  C  CB    . LYS A 1  1125 ? 152.359 139.319 144.246 1.00 131.06 ? 1125 LYS A CB    1 
ATOM   8493  C  CG    . LYS A 1  1125 ? 150.951 139.104 143.740 1.00 131.06 ? 1125 LYS A CG    1 
ATOM   8494  C  CD    . LYS A 1  1125 ? 150.742 137.664 143.301 1.00 131.06 ? 1125 LYS A CD    1 
ATOM   8495  C  CE    . LYS A 1  1125 ? 150.796 136.714 144.488 1.00 131.06 ? 1125 LYS A CE    1 
ATOM   8496  N  NZ    . LYS A 1  1125 ? 149.675 136.942 145.443 1.00 131.06 ? 1125 LYS A NZ    1 
ATOM   8497  N  N     . GLU A 1  1126 ? 155.080 140.874 144.817 1.00 130.81 ? 1126 GLU A N     1 
ATOM   8498  C  CA    . GLU A 1  1126 ? 156.366 140.955 145.504 1.00 130.81 ? 1126 GLU A CA    1 
ATOM   8499  C  C     . GLU A 1  1126 ? 156.473 142.230 146.333 1.00 130.81 ? 1126 GLU A C     1 
ATOM   8500  O  O     . GLU A 1  1126 ? 157.059 142.223 147.421 1.00 130.81 ? 1126 GLU A O     1 
ATOM   8501  C  CB    . GLU A 1  1126 ? 157.510 140.874 144.495 1.00 138.73 ? 1126 GLU A CB    1 
ATOM   8502  C  CG    . GLU A 1  1126 ? 157.630 139.533 143.798 1.00 138.73 ? 1126 GLU A CG    1 
ATOM   8503  C  CD    . GLU A 1  1126 ? 158.757 139.506 142.787 1.00 138.73 ? 1126 GLU A CD    1 
ATOM   8504  O  OE1   . GLU A 1  1126 ? 159.324 140.581 142.496 1.00 138.73 ? 1126 GLU A OE1   1 
ATOM   8505  O  OE2   . GLU A 1  1126 ? 159.081 138.410 142.285 1.00 138.73 ? 1126 GLU A OE2   1 
ATOM   8506  N  N     . LEU A 1  1127 ? 155.915 143.337 145.835 1.00 129.59 ? 1127 LEU A N     1 
ATOM   8507  C  CA    . LEU A 1  1127 ? 155.989 144.595 146.573 1.00 129.59 ? 1127 LEU A CA    1 
ATOM   8508  C  C     . LEU A 1  1127 ? 155.025 144.604 147.756 1.00 129.59 ? 1127 LEU A C     1 
ATOM   8509  O  O     . LEU A 1  1127 ? 155.411 144.942 148.881 1.00 129.59 ? 1127 LEU A O     1 
ATOM   8510  C  CB    . LEU A 1  1127 ? 155.698 145.770 145.639 1.00 127.20 ? 1127 LEU A CB    1 
ATOM   8511  C  CG    . LEU A 1  1127 ? 156.683 146.010 144.493 1.00 127.20 ? 1127 LEU A CG    1 
ATOM   8512  C  CD1   . LEU A 1  1127 ? 156.186 147.132 143.601 1.00 127.20 ? 1127 LEU A CD1   1 
ATOM   8513  C  CD2   . LEU A 1  1127 ? 158.076 146.316 145.021 1.00 127.20 ? 1127 LEU A CD2   1 
ATOM   8514  N  N     . ILE A 1  1128 ? 153.764 144.237 147.519 1.00 131.46 ? 1128 ILE A N     1 
ATOM   8515  C  CA    . ILE A 1  1128 ? 152.753 144.303 148.572 1.00 131.46 ? 1128 ILE A CA    1 
ATOM   8516  C  C     . ILE A 1  1128 ? 153.035 143.272 149.659 1.00 131.46 ? 1128 ILE A C     1 
ATOM   8517  O  O     . ILE A 1  1128 ? 152.815 143.527 150.849 1.00 131.46 ? 1128 ILE A O     1 
ATOM   8518  C  CB    . ILE A 1  1128 ? 151.347 144.129 147.966 1.00 130.32 ? 1128 ILE A CB    1 
ATOM   8519  C  CG1   . ILE A 1  1128 ? 151.057 145.254 146.970 1.00 130.32 ? 1128 ILE A CG1   1 
ATOM   8520  C  CG2   . ILE A 1  1128 ? 150.285 144.095 149.049 1.00 130.32 ? 1128 ILE A CG2   1 
ATOM   8521  C  CD1   . ILE A 1  1128 ? 151.113 146.634 147.578 1.00 130.32 ? 1128 ILE A CD1   1 
ATOM   8522  N  N     . ASN A 1  1129 ? 153.539 142.097 149.274 1.00 134.03 ? 1129 ASN A N     1 
ATOM   8523  C  CA    . ASN A 1  1129 ? 153.841 141.064 150.257 1.00 134.03 ? 1129 ASN A CA    1 
ATOM   8524  C  C     . ASN A 1  1129 ? 155.126 141.330 151.027 1.00 134.03 ? 1129 ASN A C     1 
ATOM   8525  O  O     . ASN A 1  1129 ? 155.308 140.742 152.098 1.00 134.03 ? 1129 ASN A O     1 
ATOM   8526  C  CB    . ASN A 1  1129 ? 153.938 139.698 149.577 1.00 136.12 ? 1129 ASN A CB    1 
ATOM   8527  C  CG    . ASN A 1  1129 ? 152.598 139.190 149.104 1.00 136.12 ? 1129 ASN A CG    1 
ATOM   8528  O  OD1   . ASN A 1  1129 ? 151.557 139.592 149.619 1.00 136.12 ? 1129 ASN A OD1   1 
ATOM   8529  N  ND2   . ASN A 1  1129 ? 152.613 138.302 148.119 1.00 136.12 ? 1129 ASN A ND2   1 
ATOM   8530  N  N     . ILE A 1  1130 ? 156.003 142.194 150.514 1.00 135.55 ? 1130 ILE A N     1 
ATOM   8531  C  CA    . ILE A 1  1130 ? 157.339 142.404 151.065 1.00 135.55 ? 1130 ILE A CA    1 
ATOM   8532  C  C     . ILE A 1  1130 ? 157.995 141.033 151.176 1.00 135.55 ? 1130 ILE A C     1 
ATOM   8533  O  O     . ILE A 1  1130 ? 158.408 140.604 152.258 1.00 135.55 ? 1130 ILE A O     1 
ATOM   8534  C  CB    . ILE A 1  1130 ? 157.297 143.149 152.413 1.00 130.46 ? 1130 ILE A CB    1 
ATOM   8535  C  CG1   . ILE A 1  1130 ? 156.581 144.484 152.244 1.00 130.46 ? 1130 ILE A CG1   1 
ATOM   8536  C  CG2   . ILE A 1  1130 ? 158.700 143.472 152.903 1.00 130.46 ? 1130 ILE A CG2   1 
ATOM   8537  C  CD1   . ILE A 1  1130 ? 156.332 145.197 153.542 1.00 130.46 ? 1130 ILE A CD1   1 
ATOM   8538  N  N     . SER A 1  1131 ? 158.041 140.315 150.058 1.00 140.60 ? 1131 SER A N     1 
ATOM   8539  C  CA    . SER A 1  1131 ? 158.578 138.963 150.061 1.00 140.60 ? 1131 SER A CA    1 
ATOM   8540  C  C     . SER A 1  1131 ? 160.072 138.980 150.358 1.00 140.60 ? 1131 SER A C     1 
ATOM   8541  O  O     . SER A 1  1131 ? 160.791 139.906 149.972 1.00 140.60 ? 1131 SER A O     1 
ATOM   8542  C  CB    . SER A 1  1131 ? 158.310 138.289 148.716 1.00 139.87 ? 1131 SER A CB    1 
ATOM   8543  O  OG    . SER A 1  1131 ? 158.965 138.976 147.665 1.00 139.87 ? 1131 SER A OG    1 
ATOM   8544  N  N     . LYS A 1  1132 ? 160.534 137.944 151.061 1.00 145.48 ? 1132 LYS A N     1 
ATOM   8545  C  CA    . LYS A 1  1132 ? 161.951 137.834 151.392 1.00 145.48 ? 1132 LYS A CA    1 
ATOM   8546  C  C     . LYS A 1  1132 ? 162.802 137.736 150.133 1.00 145.48 ? 1132 LYS A C     1 
ATOM   8547  O  O     . LYS A 1  1132 ? 163.732 138.526 149.930 1.00 145.48 ? 1132 LYS A O     1 
ATOM   8548  C  CB    . LYS A 1  1132 ? 162.184 136.625 152.301 1.00 148.15 ? 1132 LYS A CB    1 
ATOM   8549  C  CG    . LYS A 1  1132 ? 163.647 136.366 152.623 1.00 148.15 ? 1132 LYS A CG    1 
ATOM   8550  C  CD    . LYS A 1  1132 ? 164.283 137.540 153.347 1.00 148.15 ? 1132 LYS A CD    1 
ATOM   8551  C  CE    . LYS A 1  1132 ? 165.701 137.208 153.781 1.00 148.15 ? 1132 LYS A CE    1 
ATOM   8552  N  NZ    . LYS A 1  1132 ? 166.411 138.404 154.308 1.00 148.15 ? 1132 LYS A NZ    1 
ATOM   8553  N  N     . LYS A 1  1133 ? 162.498 136.770 149.273 1.00 144.06 ? 1133 LYS A N     1 
ATOM   8554  C  CA    . LYS A 1  1133 ? 163.261 136.574 148.048 1.00 144.06 ? 1133 LYS A CA    1 
ATOM   8555  C  C     . LYS A 1  1133 ? 162.391 136.884 146.839 1.00 144.06 ? 1133 LYS A C     1 
ATOM   8556  O  O     . LYS A 1  1133 ? 161.502 136.087 146.504 1.00 144.06 ? 1133 LYS A O     1 
ATOM   8557  C  CB    . LYS A 1  1133 ? 163.783 135.138 147.970 1.00 145.78 ? 1133 LYS A CB    1 
ATOM   8558  C  CG    . LYS A 1  1133 ? 164.796 134.787 149.044 1.00 145.78 ? 1133 LYS A CG    1 
ATOM   8559  C  CD    . LYS A 1  1133 ? 165.186 133.321 148.958 1.00 145.78 ? 1133 LYS A CD    1 
ATOM   8560  C  CE    . LYS A 1  1133 ? 166.209 132.957 150.021 1.00 145.78 ? 1133 LYS A CE    1 
ATOM   8561  N  NZ    . LYS A 1  1133 ? 166.546 131.506 149.992 1.00 145.78 ? 1133 LYS A NZ    1 
ATOM   8562  N  N     . PRO A 1  1134 ? 162.597 138.010 146.161 1.00 142.37 ? 1134 PRO A N     1 
ATOM   8563  C  CA    . PRO A 1  1134 ? 161.883 138.252 144.906 1.00 142.37 ? 1134 PRO A CA    1 
ATOM   8564  C  C     . PRO A 1  1134 ? 162.416 137.361 143.796 1.00 142.37 ? 1134 PRO A C     1 
ATOM   8565  O  O     . PRO A 1  1134 ? 163.510 136.798 143.879 1.00 142.37 ? 1134 PRO A O     1 
ATOM   8566  C  CB    . PRO A 1  1134 ? 162.167 139.730 144.613 1.00 141.67 ? 1134 PRO A CB    1 
ATOM   8567  C  CG    . PRO A 1  1134 ? 162.496 140.319 145.946 1.00 141.67 ? 1134 PRO A CG    1 
ATOM   8568  C  CD    . PRO A 1  1134 ? 163.248 139.231 146.661 1.00 141.67 ? 1134 PRO A CD    1 
ATOM   8569  N  N     . LYS A 1  1135 ? 161.616 137.240 142.737 1.00 143.14 ? 1135 LYS A N     1 
ATOM   8570  C  CA    . LYS A 1  1135 ? 162.009 136.424 141.596 1.00 143.14 ? 1135 LYS A CA    1 
ATOM   8571  C  C     . LYS A 1  1135 ? 163.133 137.052 140.783 1.00 143.14 ? 1135 LYS A C     1 
ATOM   8572  O  O     . LYS A 1  1135 ? 163.969 136.321 140.243 1.00 143.14 ? 1135 LYS A O     1 
ATOM   8573  C  CB    . LYS A 1  1135 ? 160.798 136.162 140.699 1.00 143.62 ? 1135 LYS A CB    1 
ATOM   8574  C  CG    . LYS A 1  1135 ? 159.725 135.310 141.358 1.00 143.62 ? 1135 LYS A CG    1 
ATOM   8575  C  CD    . LYS A 1  1135 ? 158.502 135.165 140.471 1.00 143.62 ? 1135 LYS A CD    1 
ATOM   8576  C  CE    . LYS A 1  1135 ? 157.447 134.294 141.133 1.00 143.62 ? 1135 LYS A CE    1 
ATOM   8577  N  NZ    . LYS A 1  1135 ? 156.207 134.200 140.315 1.00 143.62 ? 1135 LYS A NZ    1 
ATOM   8578  N  N     . THR A 1  1136 ? 163.179 138.381 140.689 1.00 144.53 ? 1136 THR A N     1 
ATOM   8579  C  CA    . THR A 1  1136 ? 164.222 139.087 139.943 1.00 144.53 ? 1136 THR A CA    1 
ATOM   8580  C  C     . THR A 1  1136 ? 164.749 140.239 140.789 1.00 144.53 ? 1136 THR A C     1 
ATOM   8581  O  O     . THR A 1  1136 ? 164.323 141.391 140.642 1.00 144.53 ? 1136 THR A O     1 
ATOM   8582  C  CB    . THR A 1  1136 ? 163.689 139.586 138.598 1.00 146.42 ? 1136 THR A CB    1 
ATOM   8583  O  OG1   . THR A 1  1136 ? 163.201 138.477 137.835 1.00 146.42 ? 1136 THR A OG1   1 
ATOM   8584  C  CG2   . THR A 1  1136 ? 164.792 140.275 137.801 1.00 146.42 ? 1136 THR A CG2   1 
ATOM   8585  N  N     . PRO A 1  1137 ? 165.661 139.955 141.719 1.00 143.03 ? 1137 PRO A N     1 
ATOM   8586  C  CA    . PRO A 1  1137 ? 166.369 141.045 142.403 1.00 143.03 ? 1137 PRO A CA    1 
ATOM   8587  C  C     . PRO A 1  1137 ? 167.372 141.695 141.461 1.00 143.03 ? 1137 PRO A C     1 
ATOM   8588  O  O     . PRO A 1  1137 ? 168.077 141.010 140.718 1.00 143.03 ? 1137 PRO A O     1 
ATOM   8589  C  CB    . PRO A 1  1137 ? 167.059 140.340 143.576 1.00 140.36 ? 1137 PRO A CB    1 
ATOM   8590  C  CG    . PRO A 1  1137 ? 167.245 138.934 143.099 1.00 140.36 ? 1137 PRO A CG    1 
ATOM   8591  C  CD    . PRO A 1  1137 ? 166.056 138.630 142.228 1.00 140.36 ? 1137 PRO A CD    1 
ATOM   8592  N  N     . SER A 1  1138 ? 167.436 143.026 141.499 1.00 143.99 ? 1138 SER A N     1 
ATOM   8593  C  CA    . SER A 1  1138 ? 168.322 143.772 140.616 1.00 143.99 ? 1138 SER A CA    1 
ATOM   8594  C  C     . SER A 1  1138 ? 168.845 145.010 141.329 1.00 143.99 ? 1138 SER A C     1 
ATOM   8595  O  O     . SER A 1  1138 ? 168.130 145.631 142.121 1.00 143.99 ? 1138 SER A O     1 
ATOM   8596  C  CB    . SER A 1  1138 ? 167.615 144.184 139.320 1.00 148.89 ? 1138 SER A CB    1 
ATOM   8597  O  OG    . SER A 1  1138 ? 166.563 145.093 139.581 1.00 148.89 ? 1138 SER A OG    1 
ATOM   8598  N  N     . LEU A 1  1139 ? 170.097 145.359 141.043 1.00 140.93 ? 1139 LEU A N     1 
ATOM   8599  C  CA    . LEU A 1  1139 ? 170.768 146.504 141.649 1.00 140.93 ? 1139 LEU A CA    1 
ATOM   8600  C  C     . LEU A 1  1139 ? 171.416 147.333 140.553 1.00 140.93 ? 1139 LEU A C     1 
ATOM   8601  O  O     . LEU A 1  1139 ? 172.298 146.841 139.841 1.00 140.93 ? 1139 LEU A O     1 
ATOM   8602  C  CB    . LEU A 1  1139 ? 171.816 146.049 142.669 1.00 140.62 ? 1139 LEU A CB    1 
ATOM   8603  C  CG    . LEU A 1  1139 ? 172.762 147.116 143.220 1.00 140.62 ? 1139 LEU A CG    1 
ATOM   8604  C  CD1   . LEU A 1  1139 ? 171.996 148.205 143.936 1.00 140.62 ? 1139 LEU A CD1   1 
ATOM   8605  C  CD2   . LEU A 1  1139 ? 173.789 146.489 144.152 1.00 140.62 ? 1139 LEU A CD2   1 
ATOM   8606  N  N     . THR A 1  1140 ? 170.978 148.582 140.416 1.00 141.29 ? 1140 THR A N     1 
ATOM   8607  C  CA    . THR A 1  1140 ? 171.594 149.490 139.461 1.00 141.29 ? 1140 THR A CA    1 
ATOM   8608  C  C     . THR A 1  1140 ? 172.741 150.247 140.121 1.00 141.29 ? 1140 THR A C     1 
ATOM   8609  O  O     . THR A 1  1140 ? 172.700 150.577 141.308 1.00 141.29 ? 1140 THR A O     1 
ATOM   8610  C  CB    . THR A 1  1140 ? 170.567 150.468 138.881 1.00 140.96 ? 1140 THR A CB    1 
ATOM   8611  O  OG1   . THR A 1  1140 ? 171.166 151.217 137.817 1.00 140.96 ? 1140 THR A OG1   1 
ATOM   8612  C  CG2   . THR A 1  1140 ? 170.051 151.429 139.936 1.00 140.96 ? 1140 THR A CG2   1 
ATOM   8613  N  N     . VAL A 1  1141 ? 173.788 150.492 139.337 1.00 140.56 ? 1141 VAL A N     1 
ATOM   8614  C  CA    . VAL A 1  1141 ? 175.037 151.058 139.829 1.00 140.56 ? 1141 VAL A CA    1 
ATOM   8615  C  C     . VAL A 1  1141 ? 175.480 152.172 138.891 1.00 140.56 ? 1141 VAL A C     1 
ATOM   8616  O  O     . VAL A 1  1141 ? 175.512 151.995 137.666 1.00 140.56 ? 1141 VAL A O     1 
ATOM   8617  C  CB    . VAL A 1  1141 ? 176.133 149.980 139.953 1.00 140.53 ? 1141 VAL A CB    1 
ATOM   8618  C  CG1   . VAL A 1  1141 ? 177.455 150.611 140.344 1.00 140.53 ? 1141 VAL A CG1   1 
ATOM   8619  C  CG2   . VAL A 1  1141 ? 175.729 148.921 140.967 1.00 140.53 ? 1141 VAL A CG2   1 
ATOM   8620  N  N     . PHE A 1  1142 ? 175.828 153.316 139.477 1.00 140.09 ? 1142 PHE A N     1 
ATOM   8621  C  CA    . PHE A 1  1142 ? 176.328 154.485 138.773 1.00 140.09 ? 1142 PHE A CA    1 
ATOM   8622  C  C     . PHE A 1  1142 ? 177.771 154.743 139.187 1.00 140.09 ? 1142 PHE A C     1 
ATOM   8623  O  O     . PHE A 1  1142 ? 178.204 154.357 140.276 1.00 140.09 ? 1142 PHE A O     1 
ATOM   8624  C  CB    . PHE A 1  1142 ? 175.467 155.720 139.069 1.00 141.07 ? 1142 PHE A CB    1 
ATOM   8625  C  CG    . PHE A 1  1142 ? 174.038 155.584 138.629 1.00 141.07 ? 1142 PHE A CG    1 
ATOM   8626  C  CD1   . PHE A 1  1142 ? 173.670 155.856 137.324 1.00 141.07 ? 1142 PHE A CD1   1 
ATOM   8627  C  CD2   . PHE A 1  1142 ? 173.060 155.187 139.523 1.00 141.07 ? 1142 PHE A CD2   1 
ATOM   8628  C  CE1   . PHE A 1  1142 ? 172.355 155.733 136.919 1.00 141.07 ? 1142 PHE A CE1   1 
ATOM   8629  C  CE2   . PHE A 1  1142 ? 171.744 155.063 139.123 1.00 141.07 ? 1142 PHE A CE2   1 
ATOM   8630  C  CZ    . PHE A 1  1142 ? 171.392 155.336 137.820 1.00 141.07 ? 1142 PHE A CZ    1 
ATOM   8631  N  N     . LEU A 1  1143 ? 178.517 155.409 138.307 1.00 142.53 ? 1143 LEU A N     1 
ATOM   8632  C  CA    . LEU A 1  1143 ? 179.953 155.595 138.474 1.00 142.53 ? 1143 LEU A CA    1 
ATOM   8633  C  C     . LEU A 1  1143 ? 180.282 157.082 138.507 1.00 142.53 ? 1143 LEU A C     1 
ATOM   8634  O  O     . LEU A 1  1143 ? 179.797 157.849 137.669 1.00 142.53 ? 1143 LEU A O     1 
ATOM   8635  C  CB    . LEU A 1  1143 ? 180.715 154.896 137.347 1.00 144.86 ? 1143 LEU A CB    1 
ATOM   8636  C  CG    . LEU A 1  1143 ? 180.479 153.382 137.285 1.00 144.86 ? 1143 LEU A CG    1 
ATOM   8637  C  CD1   . LEU A 1  1143 ? 181.159 152.764 136.074 1.00 144.86 ? 1143 LEU A CD1   1 
ATOM   8638  C  CD2   . LEU A 1  1143 ? 180.929 152.695 138.564 1.00 144.86 ? 1143 LEU A CD2   1 
ATOM   8639  N  N     . LEU A 1  1144 ? 181.090 157.487 139.490 1.00 143.37 ? 1144 LEU A N     1 
ATOM   8640  C  CA    . LEU A 1  1144 ? 181.389 158.905 139.686 1.00 143.37 ? 1144 LEU A CA    1 
ATOM   8641  C  C     . LEU A 1  1144 ? 182.353 159.444 138.633 1.00 143.37 ? 1144 LEU A C     1 
ATOM   8642  O  O     . LEU A 1  1144 ? 182.047 160.414 137.930 1.00 143.37 ? 1144 LEU A O     1 
ATOM   8643  C  CB    . LEU A 1  1144 ? 181.964 159.124 141.086 1.00 144.46 ? 1144 LEU A CB    1 
ATOM   8644  C  CG    . LEU A 1  1144 ? 181.024 158.925 142.272 1.00 144.46 ? 1144 LEU A CG    1 
ATOM   8645  C  CD1   . LEU A 1  1144 ? 181.794 159.005 143.578 1.00 144.46 ? 1144 LEU A CD1   1 
ATOM   8646  C  CD2   . LEU A 1  1144 ? 179.939 159.981 142.231 1.00 144.46 ? 1144 LEU A CD2   1 
ATOM   8647  N  N     . GLY A 1  1145 ? 183.523 158.823 138.507 1.00 146.34 ? 1145 GLY A N     1 
ATOM   8648  C  CA    . GLY A 1  1145 ? 184.650 159.439 137.837 1.00 146.34 ? 1145 GLY A CA    1 
ATOM   8649  C  C     . GLY A 1  1145 ? 184.714 159.166 136.349 1.00 146.34 ? 1145 GLY A C     1 
ATOM   8650  O  O     . GLY A 1  1145 ? 183.699 158.995 135.668 1.00 146.34 ? 1145 GLY A O     1 
ATOM   8651  N  N     . GLN A 1  1146 ? 185.949 159.137 135.836 1.00 153.36 ? 1146 GLN A N     1 
ATOM   8652  C  CA    . GLN A 1  1146 ? 186.179 158.794 134.437 1.00 153.36 ? 1146 GLN A CA    1 
ATOM   8653  C  C     . GLN A 1  1146 ? 185.689 157.393 134.105 1.00 153.36 ? 1146 GLN A C     1 
ATOM   8654  O  O     . GLN A 1  1146 ? 185.584 157.047 132.924 1.00 153.36 ? 1146 GLN A O     1 
ATOM   8655  C  CB    . GLN A 1  1146 ? 187.667 158.909 134.095 1.00 157.20 ? 1146 GLN A CB    1 
ATOM   8656  C  CG    . GLN A 1  1146 ? 188.225 160.322 134.150 1.00 157.20 ? 1146 GLN A CG    1 
ATOM   8657  C  CD    . GLN A 1  1146 ? 189.711 160.372 133.842 1.00 157.20 ? 1146 GLN A CD    1 
ATOM   8658  O  OE1   . GLN A 1  1146 ? 190.426 159.384 134.014 1.00 157.20 ? 1146 GLN A OE1   1 
ATOM   8659  N  NE2   . GLN A 1  1146 ? 190.182 161.525 133.381 1.00 157.20 ? 1146 GLN A NE2   1 
ATOM   8660  N  N     . SER A 1  1147 ? 185.398 156.577 135.121 1.00 153.18 ? 1147 SER A N     1 
ATOM   8661  C  CA    . SER A 1  1147 ? 184.831 155.256 134.881 1.00 153.18 ? 1147 SER A CA    1 
ATOM   8662  C  C     . SER A 1  1147 ? 183.445 155.353 134.259 1.00 153.18 ? 1147 SER A C     1 
ATOM   8663  O  O     . SER A 1  1147 ? 183.007 154.439 133.553 1.00 153.18 ? 1147 SER A O     1 
ATOM   8664  C  CB    . SER A 1  1147 ? 184.779 154.468 136.191 1.00 152.60 ? 1147 SER A CB    1 
ATOM   8665  O  OG    . SER A 1  1147 ? 183.939 155.107 137.136 1.00 152.60 ? 1147 SER A OG    1 
ATOM   8666  N  N     . ALA A 1  1148 ? 182.741 156.457 134.507 1.00 151.44 ? 1148 ALA A N     1 
ATOM   8667  C  CA    . ALA A 1  1148 ? 181.394 156.610 133.969 1.00 151.44 ? 1148 ALA A CA    1 
ATOM   8668  C  C     . ALA A 1  1148 ? 181.421 156.818 132.461 1.00 151.44 ? 1148 ALA A C     1 
ATOM   8669  O  O     . ALA A 1  1148 ? 180.749 156.102 131.710 1.00 151.44 ? 1148 ALA A O     1 
ATOM   8670  C  CB    . ALA A 1  1148 ? 180.690 157.778 134.657 1.00 150.53 ? 1148 ALA A CB    1 
ATOM   8671  N  N     . ARG A 1  1149 ? 182.200 157.795 131.999 1.00 153.99 ? 1149 ARG A N     1 
ATOM   8672  C  CA    . ARG A 1  1149 ? 182.196 158.150 130.584 1.00 153.99 ? 1149 ARG A CA    1 
ATOM   8673  C  C     . ARG A 1  1149 ? 183.011 157.170 129.748 1.00 153.99 ? 1149 ARG A C     1 
ATOM   8674  O  O     . ARG A 1  1149 ? 182.579 156.774 128.660 1.00 153.99 ? 1149 ARG A O     1 
ATOM   8675  C  CB    . ARG A 1  1149 ? 182.723 159.574 130.414 1.00 154.97 ? 1149 ARG A CB    1 
ATOM   8676  C  CG    . ARG A 1  1149 ? 182.745 160.084 128.986 1.00 154.97 ? 1149 ARG A CG    1 
ATOM   8677  C  CD    . ARG A 1  1149 ? 183.274 161.509 128.937 1.00 154.97 ? 1149 ARG A CD    1 
ATOM   8678  N  NE    . ARG A 1  1149 ? 184.659 161.592 129.395 1.00 154.97 ? 1149 ARG A NE    1 
ATOM   8679  C  CZ    . ARG A 1  1149 ? 185.022 162.033 130.596 1.00 154.97 ? 1149 ARG A CZ    1 
ATOM   8680  N  NH1   . ARG A 1  1149 ? 184.100 162.427 131.463 1.00 154.97 ? 1149 ARG A NH1   1 
ATOM   8681  N  NH2   . ARG A 1  1149 ? 186.303 162.074 130.931 1.00 154.97 ? 1149 ARG A NH2   1 
ATOM   8682  N  N     . ASP A 1  1150 ? 184.183 156.769 130.234 1.00 156.49 ? 1150 ASP A N     1 
ATOM   8683  C  CA    . ASP A 1  1150 ? 185.039 155.832 129.518 1.00 156.49 ? 1150 ASP A CA    1 
ATOM   8684  C  C     . ASP A 1  1150 ? 184.581 154.409 129.814 1.00 156.49 ? 1150 ASP A C     1 
ATOM   8685  O  O     . ASP A 1  1150 ? 184.279 154.075 130.965 1.00 156.49 ? 1150 ASP A O     1 
ATOM   8686  C  CB    . ASP A 1  1150 ? 186.502 156.024 129.914 1.00 158.18 ? 1150 ASP A CB    1 
ATOM   8687  C  CG    . ASP A 1  1150 ? 187.079 157.327 129.396 1.00 158.18 ? 1150 ASP A CG    1 
ATOM   8688  O  OD1   . ASP A 1  1150 ? 186.466 157.931 128.491 1.00 158.18 ? 1150 ASP A OD1   1 
ATOM   8689  O  OD2   . ASP A 1  1150 ? 188.144 157.748 129.893 1.00 158.18 ? 1150 ASP A OD2   1 
ATOM   8690  N  N     . ALA A 1  1151 ? 184.530 153.573 128.775 1.00 153.09 ? 1151 ALA A N     1 
ATOM   8691  C  CA    . ALA A 1  1151 ? 184.070 152.200 128.949 1.00 153.09 ? 1151 ALA A CA    1 
ATOM   8692  C  C     . ALA A 1  1151 ? 185.151 151.293 129.522 1.00 153.09 ? 1151 ALA A C     1 
ATOM   8693  O  O     . ALA A 1  1151 ? 184.857 150.148 129.881 1.00 153.09 ? 1151 ALA A O     1 
ATOM   8694  C  CB    . ALA A 1  1151 ? 183.575 151.640 127.616 1.00 150.52 ? 1151 ALA A CB    1 
ATOM   8695  N  N     . GLU A 1  1152 ? 186.390 151.776 129.617 1.00 154.58 ? 1152 GLU A N     1 
ATOM   8696  C  CA    . GLU A 1  1152 ? 187.501 150.962 130.095 1.00 154.58 ? 1152 GLU A CA    1 
ATOM   8697  C  C     . GLU A 1  1152 ? 187.455 150.803 131.610 1.00 154.58 ? 1152 GLU A C     1 
ATOM   8698  O  O     . GLU A 1  1152 ? 187.305 149.687 132.119 1.00 154.58 ? 1152 GLU A O     1 
ATOM   8699  C  CB    . GLU A 1  1152 ? 188.831 151.576 129.659 1.00 159.58 ? 1152 GLU A CB    1 
ATOM   8700  C  CG    . GLU A 1  1152 ? 190.050 150.759 130.041 1.00 159.58 ? 1152 GLU A CG    1 
ATOM   8701  C  CD    . GLU A 1  1152 ? 191.340 151.370 129.533 1.00 159.58 ? 1152 GLU A CD    1 
ATOM   8702  O  OE1   . GLU A 1  1152 ? 191.282 152.448 128.903 1.00 159.58 ? 1152 GLU A OE1   1 
ATOM   8703  O  OE2   . GLU A 1  1152 ? 192.412 150.773 129.763 1.00 159.58 ? 1152 GLU A OE2   1 
ATOM   8704  N  N     . ARG A 1  1153 ? 187.605 151.913 132.340 1.00 155.15 ? 1153 ARG A N     1 
ATOM   8705  C  CA    . ARG A 1  1153 ? 187.462 151.866 133.792 1.00 155.15 ? 1153 ARG A CA    1 
ATOM   8706  C  C     . ARG A 1  1153 ? 186.098 151.312 134.184 1.00 155.15 ? 1153 ARG A C     1 
ATOM   8707  O  O     . ARG A 1  1153 ? 185.965 150.610 135.195 1.00 155.15 ? 1153 ARG A O     1 
ATOM   8708  C  CB    . ARG A 1  1153 ? 187.658 153.261 134.385 1.00 155.45 ? 1153 ARG A CB    1 
ATOM   8709  C  CG    . ARG A 1  1153 ? 188.988 153.926 134.074 1.00 155.45 ? 1153 ARG A CG    1 
ATOM   8710  C  CD    . ARG A 1  1153 ? 190.134 153.291 134.836 1.00 155.45 ? 1153 ARG A CD    1 
ATOM   8711  N  NE    . ARG A 1  1153 ? 191.382 154.016 134.621 1.00 155.45 ? 1153 ARG A NE    1 
ATOM   8712  C  CZ    . ARG A 1  1153 ? 192.254 153.739 133.657 1.00 155.45 ? 1153 ARG A CZ    1 
ATOM   8713  N  NH1   . ARG A 1  1153 ? 192.017 152.747 132.810 1.00 155.45 ? 1153 ARG A NH1   1 
ATOM   8714  N  NH2   . ARG A 1  1153 ? 193.363 154.456 133.539 1.00 155.45 ? 1153 ARG A NH2   1 
ATOM   8715  N  N     . ALA A 1  1154 ? 185.070 151.625 133.390 1.00 153.50 ? 1154 ALA A N     1 
ATOM   8716  C  CA    . ALA A 1  1154 ? 183.765 151.003 133.576 1.00 153.50 ? 1154 ALA A CA    1 
ATOM   8717  C  C     . ALA A 1  1154 ? 183.877 149.488 133.509 1.00 153.50 ? 1154 ALA A C     1 
ATOM   8718  O  O     . ALA A 1  1154 ? 183.297 148.776 134.334 1.00 153.50 ? 1154 ALA A O     1 
ATOM   8719  C  CB    . ALA A 1  1154 ? 182.783 151.514 132.521 1.00 153.70 ? 1154 ALA A CB    1 
ATOM   8720  N  N     . LYS A 1  1155 ? 184.620 148.976 132.524 1.00 152.52 ? 1155 LYS A N     1 
ATOM   8721  C  CA    . LYS A 1  1155 ? 184.854 147.538 132.440 1.00 152.52 ? 1155 LYS A CA    1 
ATOM   8722  C  C     . LYS A 1  1155 ? 185.579 147.027 133.678 1.00 152.52 ? 1155 LYS A C     1 
ATOM   8723  O  O     . LYS A 1  1155 ? 185.328 145.907 134.139 1.00 152.52 ? 1155 LYS A O     1 
ATOM   8724  C  CB    . LYS A 1  1155 ? 185.649 147.212 131.174 1.00 149.75 ? 1155 LYS A CB    1 
ATOM   8725  C  CG    . LYS A 1  1155 ? 186.000 145.745 131.003 1.00 149.75 ? 1155 LYS A CG    1 
ATOM   8726  C  CD    . LYS A 1  1155 ? 184.754 144.895 130.879 1.00 149.75 ? 1155 LYS A CD    1 
ATOM   8727  C  CE    . LYS A 1  1155 ? 185.097 143.451 130.564 1.00 149.75 ? 1155 LYS A CE    1 
ATOM   8728  N  NZ    . LYS A 1  1155 ? 183.896 142.575 130.636 1.00 149.75 ? 1155 LYS A NZ    1 
ATOM   8729  N  N     . ASP A 1  1156 ? 186.479 147.839 134.236 1.00 154.37 ? 1156 ASP A N     1 
ATOM   8730  C  CA    . ASP A 1  1156 ? 187.182 147.445 135.452 1.00 154.37 ? 1156 ASP A CA    1 
ATOM   8731  C  C     . ASP A 1  1156 ? 186.206 147.263 136.609 1.00 154.37 ? 1156 ASP A C     1 
ATOM   8732  O  O     . ASP A 1  1156 ? 186.258 146.262 137.334 1.00 154.37 ? 1156 ASP A O     1 
ATOM   8733  C  CB    . ASP A 1  1156 ? 188.248 148.485 135.801 1.00 161.82 ? 1156 ASP A CB    1 
ATOM   8734  C  CG    . ASP A 1  1156 ? 189.384 148.511 134.801 1.00 161.82 ? 1156 ASP A CG    1 
ATOM   8735  O  OD1   . ASP A 1  1156 ? 189.514 147.542 134.022 1.00 161.82 ? 1156 ASP A OD1   1 
ATOM   8736  O  OD2   . ASP A 1  1156 ? 190.144 149.501 134.788 1.00 161.82 ? 1156 ASP A OD2   1 
ATOM   8737  N  N     . ILE A 1  1157 ? 185.302 148.228 136.796 1.00 152.83 ? 1157 ILE A N     1 
ATOM   8738  C  CA    . ILE A 1  1157 ? 184.295 148.098 137.848 1.00 152.83 ? 1157 ILE A CA    1 
ATOM   8739  C  C     . ILE A 1  1157 ? 183.367 146.927 137.546 1.00 152.83 ? 1157 ILE A C     1 
ATOM   8740  O  O     . ILE A 1  1157 ? 182.895 146.234 138.457 1.00 152.83 ? 1157 ILE A O     1 
ATOM   8741  C  CB    . ILE A 1  1157 ? 183.518 149.417 138.009 1.00 149.21 ? 1157 ILE A CB    1 
ATOM   8742  C  CG1   . ILE A 1  1157 ? 184.485 150.571 138.272 1.00 149.21 ? 1157 ILE A CG1   1 
ATOM   8743  C  CG2   . ILE A 1  1157 ? 182.514 149.312 139.144 1.00 149.21 ? 1157 ILE A CG2   1 
ATOM   8744  C  CD1   . ILE A 1  1157 ? 185.342 150.377 139.502 1.00 149.21 ? 1157 ILE A CD1   1 
ATOM   8745  N  N     . LEU A 1  1158 ? 183.098 146.688 136.261 1.00 153.24 ? 1158 LEU A N     1 
ATOM   8746  C  CA    . LEU A 1  1158 ? 182.314 145.530 135.844 1.00 153.24 ? 1158 LEU A CA    1 
ATOM   8747  C  C     . LEU A 1  1158 ? 182.969 144.236 136.303 1.00 153.24 ? 1158 LEU A C     1 
ATOM   8748  O  O     . LEU A 1  1158 ? 182.286 143.279 136.683 1.00 153.24 ? 1158 LEU A O     1 
ATOM   8749  C  CB    . LEU A 1  1158 ? 182.152 145.544 134.323 1.00 154.13 ? 1158 LEU A CB    1 
ATOM   8750  C  CG    . LEU A 1  1158 ? 181.459 144.364 133.643 1.00 154.13 ? 1158 LEU A CG    1 
ATOM   8751  C  CD1   . LEU A 1  1158 ? 180.050 144.243 134.137 1.00 154.13 ? 1158 LEU A CD1   1 
ATOM   8752  C  CD2   . LEU A 1  1158 ? 181.465 144.535 132.134 1.00 154.13 ? 1158 LEU A CD2   1 
ATOM   8753  N  N     . CYS A 1  1159 ? 184.301 144.192 136.273 1.00 154.65 ? 1159 CYS A N     1 
ATOM   8754  C  CA    . CYS A 1  1159 ? 185.005 143.012 136.758 1.00 154.65 ? 1159 CYS A CA    1 
ATOM   8755  C  C     . CYS A 1  1159 ? 185.020 142.968 138.281 1.00 154.65 ? 1159 CYS A C     1 
ATOM   8756  O  O     . CYS A 1  1159 ? 185.017 141.886 138.878 1.00 154.65 ? 1159 CYS A O     1 
ATOM   8757  C  CB    . CYS A 1  1159 ? 186.430 142.989 136.209 1.00 164.89 ? 1159 CYS A CB    1 
ATOM   8758  S  SG    . CYS A 1  1159 ? 186.541 142.824 134.412 1.00 164.89 ? 1159 CYS A SG    1 
ATOM   8759  N  N     . ARG A 1  1160 ? 185.036 144.136 138.928 1.00 151.14 ? 1160 ARG A N     1 
ATOM   8760  C  CA    . ARG A 1  1160 ? 185.153 144.174 140.381 1.00 151.14 ? 1160 ARG A CA    1 
ATOM   8761  C  C     . ARG A 1  1160 ? 183.829 143.925 141.094 1.00 151.14 ? 1160 ARG A C     1 
ATOM   8762  O  O     . ARG A 1  1160 ? 183.841 143.614 142.289 1.00 151.14 ? 1160 ARG A O     1 
ATOM   8763  C  CB    . ARG A 1  1160 ? 185.733 145.514 140.835 1.00 150.31 ? 1160 ARG A CB    1 
ATOM   8764  C  CG    . ARG A 1  1160 ? 187.180 145.743 140.435 1.00 150.31 ? 1160 ARG A CG    1 
ATOM   8765  C  CD    . ARG A 1  1160 ? 187.693 147.059 140.995 1.00 150.31 ? 1160 ARG A CD    1 
ATOM   8766  N  NE    . ARG A 1  1160 ? 189.073 147.328 140.603 1.00 150.31 ? 1160 ARG A NE    1 
ATOM   8767  C  CZ    . ARG A 1  1160 ? 189.724 148.450 140.892 1.00 150.31 ? 1160 ARG A CZ    1 
ATOM   8768  N  NH1   . ARG A 1  1160 ? 189.120 149.410 141.578 1.00 150.31 ? 1160 ARG A NH1   1 
ATOM   8769  N  NH2   . ARG A 1  1160 ? 190.980 148.613 140.497 1.00 150.31 ? 1160 ARG A NH2   1 
ATOM   8770  N  N     . LEU A 1  1161 ? 182.694 144.088 140.414 1.00 152.28 ? 1161 LEU A N     1 
ATOM   8771  C  CA    . LEU A 1  1161 ? 181.396 143.871 141.043 1.00 152.28 ? 1161 LEU A CA    1 
ATOM   8772  C  C     . LEU A 1  1161 ? 180.829 142.471 140.834 1.00 152.28 ? 1161 LEU A C     1 
ATOM   8773  O  O     . LEU A 1  1161 ? 179.812 142.141 141.454 1.00 152.28 ? 1161 LEU A O     1 
ATOM   8774  C  CB    . LEU A 1  1161 ? 180.377 144.896 140.537 1.00 151.54 ? 1161 LEU A CB    1 
ATOM   8775  C  CG    . LEU A 1  1161 ? 180.616 146.351 140.930 1.00 151.54 ? 1161 LEU A CG    1 
ATOM   8776  C  CD1   . LEU A 1  1161 ? 179.582 147.249 140.280 1.00 151.54 ? 1161 LEU A CD1   1 
ATOM   8777  C  CD2   . LEU A 1  1161 ? 180.579 146.501 142.436 1.00 151.54 ? 1161 LEU A CD2   1 
ATOM   8778  N  N     . GLU A 1  1162 ? 181.441 141.644 139.993 1.00 155.39 ? 1162 GLU A N     1 
ATOM   8779  C  CA    . GLU A 1  1162 ? 180.854 140.373 139.589 1.00 155.39 ? 1162 GLU A CA    1 
ATOM   8780  C  C     . GLU A 1  1162 ? 181.569 139.218 140.277 1.00 155.39 ? 1162 GLU A C     1 
ATOM   8781  O  O     . GLU A 1  1162 ? 182.791 139.253 140.452 1.00 155.39 ? 1162 GLU A O     1 
ATOM   8782  C  CB    . GLU A 1  1162 ? 180.912 140.210 138.069 1.00 157.94 ? 1162 GLU A CB    1 
ATOM   8783  C  CG    . GLU A 1  1162 ? 180.208 138.970 137.549 1.00 157.94 ? 1162 GLU A CG    1 
ATOM   8784  C  CD    . GLU A 1  1162 ? 180.232 138.880 136.039 1.00 157.94 ? 1162 GLU A CD    1 
ATOM   8785  O  OE1   . GLU A 1  1162 ? 180.835 139.767 135.399 1.00 157.94 ? 1162 GLU A OE1   1 
ATOM   8786  O  OE2   . GLU A 1  1162 ? 179.646 137.926 135.489 1.00 157.94 ? 1162 GLU A OE2   1 
ATOM   8787  N  N     . HIS A 1  1163 ? 180.807 138.189 140.641 1.00 156.40 ? 1163 HIS A N     1 
ATOM   8788  C  CA    . HIS A 1  1163 ? 181.352 137.064 141.388 1.00 156.40 ? 1163 HIS A CA    1 
ATOM   8789  C  C     . HIS A 1  1163 ? 181.865 135.991 140.436 1.00 156.40 ? 1163 HIS A C     1 
ATOM   8790  O  O     . HIS A 1  1163 ? 181.087 135.367 139.708 1.00 156.40 ? 1163 HIS A O     1 
ATOM   8791  C  CB    . HIS A 1  1163 ? 180.278 136.487 142.308 1.00 156.85 ? 1163 HIS A CB    1 
ATOM   8792  C  CG    . HIS A 1  1163 ? 180.735 135.316 143.117 1.00 156.85 ? 1163 HIS A CG    1 
ATOM   8793  N  ND1   . HIS A 1  1163 ? 181.749 135.402 144.046 1.00 156.85 ? 1163 HIS A ND1   1 
ATOM   8794  C  CD2   . HIS A 1  1163 ? 180.310 134.030 143.142 1.00 156.85 ? 1163 HIS A CD2   1 
ATOM   8795  C  CE1   . HIS A 1  1163 ? 181.930 134.219 144.606 1.00 156.85 ? 1163 HIS A CE1   1 
ATOM   8796  N  NE2   . HIS A 1  1163 ? 181.069 133.370 144.076 1.00 156.85 ? 1163 HIS A NE2   1 
ATOM   8797  N  N     . THR A 1  1164 ? 183.179 135.772 140.446 1.00 162.33 ? 1164 THR A N     1 
ATOM   8798  C  CA    . THR A 1  1164 ? 183.821 134.776 139.592 1.00 162.33 ? 1164 THR A CA    1 
ATOM   8799  C  C     . THR A 1  1164 ? 184.448 133.702 140.469 1.00 162.33 ? 1164 THR A C     1 
ATOM   8800  O  O     . THR A 1  1164 ? 185.428 133.965 141.173 1.00 162.33 ? 1164 THR A O     1 
ATOM   8801  C  CB    . THR A 1  1164 ? 184.875 135.413 138.688 1.00 163.36 ? 1164 THR A CB    1 
ATOM   8802  O  OG1   . THR A 1  1164 ? 184.251 136.359 137.811 1.00 163.36 ? 1164 THR A OG1   1 
ATOM   8803  C  CG2   . THR A 1  1164 ? 185.577 134.346 137.864 1.00 163.36 ? 1164 THR A CG2   1 
ATOM   8804  N  N     . THR A 1  1165 ? 183.884 132.500 140.428 1.00 166.21 ? 1165 THR A N     1 
ATOM   8805  C  CA    . THR A 1  1165 ? 184.484 131.354 141.091 1.00 166.21 ? 1165 THR A CA    1 
ATOM   8806  C  C     . THR A 1  1165 ? 185.611 130.782 140.239 1.00 166.21 ? 1165 THR A C     1 
ATOM   8807  O  O     . THR A 1  1165 ? 185.649 130.964 139.019 1.00 166.21 ? 1165 THR A O     1 
ATOM   8808  C  CB    . THR A 1  1165 ? 183.435 130.277 141.368 1.00 168.47 ? 1165 THR A CB    1 
ATOM   8809  O  OG1   . THR A 1  1165 ? 182.846 129.852 140.133 1.00 168.47 ? 1165 THR A OG1   1 
ATOM   8810  C  CG2   . THR A 1  1165 ? 182.348 130.818 142.282 1.00 168.47 ? 1165 THR A CG2   1 
ATOM   8811  N  N     . LEU A 1  1166 ? 186.539 130.086 140.901 1.00 168.39 ? 1166 LEU A N     1 
ATOM   8812  C  CA    . LEU A 1  1166 ? 187.692 129.527 140.201 1.00 168.39 ? 1166 LEU A CA    1 
ATOM   8813  C  C     . LEU A 1  1166 ? 187.276 128.516 139.139 1.00 168.39 ? 1166 LEU A C     1 
ATOM   8814  O  O     . LEU A 1  1166 ? 188.044 128.242 138.211 1.00 168.39 ? 1166 LEU A O     1 
ATOM   8815  C  CB    . LEU A 1  1166 ? 188.652 128.895 141.213 1.00 171.04 ? 1166 LEU A CB    1 
ATOM   8816  C  CG    . LEU A 1  1166 ? 190.020 128.376 140.764 1.00 171.04 ? 1166 LEU A CG    1 
ATOM   8817  C  CD1   . LEU A 1  1166 ? 191.048 128.634 141.848 1.00 171.04 ? 1166 LEU A CD1   1 
ATOM   8818  C  CD2   . LEU A 1  1166 ? 189.958 126.888 140.462 1.00 171.04 ? 1166 LEU A CD2   1 
ATOM   8819  N  N     . ARG A 1  1167 ? 186.066 127.960 139.246 1.00 169.56 ? 1167 ARG A N     1 
ATOM   8820  C  CA    . ARG A 1  1167 ? 185.608 127.002 138.244 1.00 169.56 ? 1167 ARG A CA    1 
ATOM   8821  C  C     . ARG A 1  1167 ? 185.313 127.679 136.911 1.00 169.56 ? 1167 ARG A C     1 
ATOM   8822  O  O     . ARG A 1  1167 ? 185.464 127.054 135.855 1.00 169.56 ? 1167 ARG A O     1 
ATOM   8823  C  CB    . ARG A 1  1167 ? 184.366 126.262 138.746 1.00 177.51 ? 1167 ARG A CB    1 
ATOM   8824  C  CG    . ARG A 1  1167 ? 183.906 125.148 137.817 1.00 177.51 ? 1167 ARG A CG    1 
ATOM   8825  C  CD    . ARG A 1  1167 ? 182.661 124.424 138.312 1.00 177.51 ? 1167 ARG A CD    1 
ATOM   8826  N  NE    . ARG A 1  1167 ? 181.474 125.274 138.300 1.00 177.51 ? 1167 ARG A NE    1 
ATOM   8827  C  CZ    . ARG A 1  1167 ? 180.916 125.797 139.385 1.00 177.51 ? 1167 ARG A CZ    1 
ATOM   8828  N  NH1   . ARG A 1  1167 ? 181.432 125.553 140.582 1.00 177.51 ? 1167 ARG A NH1   1 
ATOM   8829  N  NH2   . ARG A 1  1167 ? 179.837 126.559 139.275 1.00 177.51 ? 1167 ARG A NH2   1 
ATOM   8830  N  N     . LYS A 1  1168 ? 184.898 128.948 136.938 1.00 167.30 ? 1168 LYS A N     1 
ATOM   8831  C  CA    . LYS A 1  1168 ? 184.539 129.639 135.702 1.00 167.30 ? 1168 LYS A CA    1 
ATOM   8832  C  C     . LYS A 1  1168 ? 185.736 129.777 134.772 1.00 167.30 ? 1168 LYS A C     1 
ATOM   8833  O  O     . LYS A 1  1168 ? 185.604 129.635 133.551 1.00 167.30 ? 1168 LYS A O     1 
ATOM   8834  C  CB    . LYS A 1  1168 ? 183.954 131.014 136.018 1.00 163.56 ? 1168 LYS A CB    1 
ATOM   8835  C  CG    . LYS A 1  1168 ? 182.613 130.977 136.723 1.00 163.56 ? 1168 LYS A CG    1 
ATOM   8836  C  CD    . LYS A 1  1168 ? 182.138 132.380 137.058 1.00 163.56 ? 1168 LYS A CD    1 
ATOM   8837  C  CE    . LYS A 1  1168 ? 180.773 132.357 137.722 1.00 163.56 ? 1168 LYS A CE    1 
ATOM   8838  N  NZ    . LYS A 1  1168 ? 180.319 133.723 138.101 1.00 163.56 ? 1168 LYS A NZ    1 
ATOM   8839  N  N     . VAL A 1  1169 ? 186.917 130.061 135.331 1.00 172.04 ? 1169 VAL A N     1 
ATOM   8840  C  CA    . VAL A 1  1169 ? 188.112 130.256 134.519 1.00 172.04 ? 1169 VAL A CA    1 
ATOM   8841  C  C     . VAL A 1  1169 ? 188.923 128.982 134.357 1.00 172.04 ? 1169 VAL A C     1 
ATOM   8842  O  O     . VAL A 1  1169 ? 189.956 129.001 133.674 1.00 172.04 ? 1169 VAL A O     1 
ATOM   8843  C  CB    . VAL A 1  1169 ? 189.009 131.357 135.120 1.00 170.96 ? 1169 VAL A CB    1 
ATOM   8844  C  CG1   . VAL A 1  1169 ? 188.273 132.682 135.140 1.00 170.96 ? 1169 VAL A CG1   1 
ATOM   8845  C  CG2   . VAL A 1  1169 ? 189.458 130.969 136.517 1.00 170.96 ? 1169 VAL A CG2   1 
ATOM   8846  N  N     . THR A 1  1170 ? 188.491 127.875 134.955 1.00 175.28 ? 1170 THR A N     1 
ATOM   8847  C  CA    . THR A 1  1170 ? 189.258 126.637 134.938 1.00 175.28 ? 1170 THR A CA    1 
ATOM   8848  C  C     . THR A 1  1170 ? 188.802 125.767 133.774 1.00 175.28 ? 1170 THR A C     1 
ATOM   8849  O  O     . THR A 1  1170 ? 187.633 125.373 133.708 1.00 175.28 ? 1170 THR A O     1 
ATOM   8850  C  CB    . THR A 1  1170 ? 189.105 125.887 136.260 1.00 176.11 ? 1170 THR A CB    1 
ATOM   8851  O  OG1   . THR A 1  1170 ? 189.564 126.718 137.332 1.00 176.11 ? 1170 THR A OG1   1 
ATOM   8852  C  CG2   . THR A 1  1170 ? 189.929 124.613 136.238 1.00 176.11 ? 1170 THR A CG2   1 
ATOM   8853  N  N     . ALA A 1  1171 ? 189.726 125.469 132.859 1.00 176.93 ? 1171 ALA A N     1 
ATOM   8854  C  CA    . ALA A 1  1171 ? 189.384 124.654 131.698 1.00 176.93 ? 1171 ALA A CA    1 
ATOM   8855  C  C     . ALA A 1  1171 ? 189.136 123.204 132.097 1.00 176.93 ? 1171 ALA A C     1 
ATOM   8856  O  O     . ALA A 1  1171 ? 188.079 122.637 131.796 1.00 176.93 ? 1171 ALA A O     1 
ATOM   8857  C  CB    . ALA A 1  1171 ? 190.494 124.746 130.649 1.00 176.49 ? 1171 ALA A CB    1 
ATOM   8858  N  N     . ASN A 1  1172 ? 190.101 122.587 132.776 1.00 177.02 ? 1172 ASN A N     1 
ATOM   8859  C  CA    . ASN A 1  1172 ? 189.954 121.208 133.222 1.00 177.02 ? 1172 ASN A CA    1 
ATOM   8860  C  C     . ASN A 1  1172 ? 190.891 120.957 134.396 1.00 177.02 ? 1172 ASN A C     1 
ATOM   8861  O  O     . ASN A 1  1172 ? 191.821 121.727 134.648 1.00 177.02 ? 1172 ASN A O     1 
ATOM   8862  C  CB    . ASN A 1  1172 ? 190.201 120.212 132.076 1.00 176.94 ? 1172 ASN A CB    1 
ATOM   8863  C  CG    . ASN A 1  1172 ? 191.607 120.294 131.491 1.00 176.94 ? 1172 ASN A CG    1 
ATOM   8864  O  OD1   . ASN A 1  1172 ? 192.588 120.507 132.199 1.00 176.94 ? 1172 ASN A OD1   1 
ATOM   8865  N  ND2   . ASN A 1  1172 ? 191.702 120.119 130.178 1.00 176.94 ? 1172 ASN A ND2   1 
ATOM   8866  N  N     . THR A 1  1173 ? 190.629 119.869 135.113 1.00 177.63 ? 1173 THR A N     1 
ATOM   8867  C  CA    . THR A 1  1173 ? 191.397 119.497 136.293 1.00 177.63 ? 1173 THR A CA    1 
ATOM   8868  C  C     . THR A 1  1173 ? 191.826 118.039 136.201 1.00 177.63 ? 1173 THR A C     1 
ATOM   8869  O  O     . THR A 1  1173 ? 191.053 117.182 135.762 1.00 177.63 ? 1173 THR A O     1 
ATOM   8870  C  CB    . THR A 1  1173 ? 190.579 119.717 137.569 1.00 179.91 ? 1173 THR A CB    1 
ATOM   8871  O  OG1   . THR A 1  1173 ? 190.236 121.103 137.684 1.00 179.91 ? 1173 THR A OG1   1 
ATOM   8872  C  CG2   . THR A 1  1173 ? 191.372 119.292 138.790 1.00 179.91 ? 1173 THR A CG2   1 
ATOM   8873  N  N     . ALA A 1  1174 ? 193.062 117.763 136.613 1.00 173.90 ? 1174 ALA A N     1 
ATOM   8874  C  CA    . ALA A 1  1174 ? 193.575 116.400 136.668 1.00 173.90 ? 1174 ALA A CA    1 
ATOM   8875  C  C     . ALA A 1  1174 ? 194.377 116.232 137.948 1.00 173.90 ? 1174 ALA A C     1 
ATOM   8876  O  O     . ALA A 1  1174 ? 195.273 117.034 138.228 1.00 173.90 ? 1174 ALA A O     1 
ATOM   8877  C  CB    . ALA A 1  1174 ? 194.439 116.082 135.444 1.00 172.95 ? 1174 ALA A CB    1 
ATOM   8878  N  N     . ILE A 1  1175 ? 194.046 115.206 138.725 1.00 171.49 ? 1175 ILE A N     1 
ATOM   8879  C  CA    . ILE A 1  1175 ? 194.835 114.826 139.890 1.00 171.49 ? 1175 ILE A CA    1 
ATOM   8880  C  C     . ILE A 1  1175 ? 195.859 113.790 139.457 1.00 171.49 ? 1175 ILE A C     1 
ATOM   8881  O  O     . ILE A 1  1175 ? 195.503 112.738 138.912 1.00 171.49 ? 1175 ILE A O     1 
ATOM   8882  C  CB    . ILE A 1  1175 ? 193.941 114.284 141.017 1.00 170.89 ? 1175 ILE A CB    1 
ATOM   8883  C  CG1   . ILE A 1  1175 ? 193.076 115.403 141.596 1.00 170.89 ? 1175 ILE A CG1   1 
ATOM   8884  C  CG2   . ILE A 1  1175 ? 194.782 113.641 142.106 1.00 170.89 ? 1175 ILE A CG2   1 
ATOM   8885  C  CD1   . ILE A 1  1175 ? 192.039 114.928 142.582 1.00 170.89 ? 1175 ILE A CD1   1 
ATOM   8886  N  N     . TYR A 1  1176 ? 197.130 114.083 139.703 1.00 174.66 ? 1176 TYR A N     1 
ATOM   8887  C  CA    . TYR A 1  1176 ? 198.234 113.225 139.311 1.00 174.66 ? 1176 TYR A CA    1 
ATOM   8888  C  C     . TYR A 1  1176 ? 198.943 112.704 140.550 1.00 174.66 ? 1176 TYR A C     1 
ATOM   8889  O  O     . TYR A 1  1176 ? 198.867 113.294 141.631 1.00 174.66 ? 1176 TYR A O     1 
ATOM   8890  C  CB    . TYR A 1  1176 ? 199.243 113.977 138.433 1.00 177.83 ? 1176 TYR A CB    1 
ATOM   8891  C  CG    . TYR A 1  1176 ? 198.704 114.435 137.100 1.00 177.83 ? 1176 TYR A CG    1 
ATOM   8892  C  CD1   . TYR A 1  1176 ? 197.912 113.602 136.323 1.00 177.83 ? 1176 TYR A CD1   1 
ATOM   8893  C  CD2   . TYR A 1  1176 ? 198.990 115.704 136.617 1.00 177.83 ? 1176 TYR A CD2   1 
ATOM   8894  C  CE1   . TYR A 1  1176 ? 197.422 114.020 135.101 1.00 177.83 ? 1176 TYR A CE1   1 
ATOM   8895  C  CE2   . TYR A 1  1176 ? 198.503 116.130 135.400 1.00 177.83 ? 1176 TYR A CE2   1 
ATOM   8896  C  CZ    . TYR A 1  1176 ? 197.721 115.285 134.645 1.00 177.83 ? 1176 TYR A CZ    1 
ATOM   8897  O  OH    . TYR A 1  1176 ? 197.236 115.710 133.430 1.00 177.83 ? 1176 TYR A OH    1 
ATOM   8898  N  N     . TYR A 1  1177 ? 199.634 111.581 140.386 1.00 178.73 ? 1177 TYR A N     1 
ATOM   8899  C  CA    . TYR A 1  1177 ? 200.543 111.079 141.407 1.00 178.73 ? 1177 TYR A CA    1 
ATOM   8900  C  C     . TYR A 1  1177 ? 201.962 111.225 140.874 1.00 178.73 ? 1177 TYR A C     1 
ATOM   8901  O  O     . TYR A 1  1177 ? 202.393 110.447 140.016 1.00 178.73 ? 1177 TYR A O     1 
ATOM   8902  C  CB    . TYR A 1  1177 ? 200.232 109.626 141.755 1.00 176.50 ? 1177 TYR A CB    1 
ATOM   8903  C  CG    . TYR A 1  1177 ? 201.204 109.022 142.741 1.00 176.50 ? 1177 TYR A CG    1 
ATOM   8904  C  CD1   . TYR A 1  1177 ? 201.111 109.303 144.097 1.00 176.50 ? 1177 TYR A CD1   1 
ATOM   8905  C  CD2   . TYR A 1  1177 ? 202.217 108.173 142.314 1.00 176.50 ? 1177 TYR A CD2   1 
ATOM   8906  C  CE1   . TYR A 1  1177 ? 201.998 108.755 145.000 1.00 176.50 ? 1177 TYR A CE1   1 
ATOM   8907  C  CE2   . TYR A 1  1177 ? 203.107 107.620 143.211 1.00 176.50 ? 1177 TYR A CE2   1 
ATOM   8908  C  CZ    . TYR A 1  1177 ? 202.993 107.914 144.552 1.00 176.50 ? 1177 TYR A CZ    1 
ATOM   8909  O  OH    . TYR A 1  1177 ? 203.878 107.366 145.450 1.00 176.50 ? 1177 TYR A OH    1 
ATOM   8910  N  N     . ASP A 1  1178 ? 202.680 112.218 141.382 1.00 183.76 ? 1178 ASP A N     1 
ATOM   8911  C  CA    . ASP A 1  1178 ? 204.111 112.366 141.126 1.00 183.76 ? 1178 ASP A CA    1 
ATOM   8912  C  C     . ASP A 1  1178 ? 204.851 112.297 142.451 1.00 183.76 ? 1178 ASP A C     1 
ATOM   8913  O  O     . ASP A 1  1178 ? 204.788 113.259 143.240 1.00 183.76 ? 1178 ASP A O     1 
ATOM   8914  C  CB    . ASP A 1  1178 ? 204.408 113.681 140.405 1.00 189.47 ? 1178 ASP A CB    1 
ATOM   8915  C  CG    . ASP A 1  1178 ? 203.930 113.674 138.966 1.00 189.47 ? 1178 ASP A CG    1 
ATOM   8916  O  OD1   . ASP A 1  1178 ? 203.668 112.574 138.438 1.00 189.47 ? 1178 ASP A OD1   1 
ATOM   8917  O  OD2   . ASP A 1  1178 ? 203.815 114.762 138.364 1.00 189.47 ? 1178 ASP A OD2   1 
ATOM   8918  N  N     . PRO A 1  1179 ? 205.570 111.214 142.742 1.00 184.47 ? 1179 PRO A N     1 
ATOM   8919  C  CA    . PRO A 1  1179 ? 206.268 111.138 144.032 1.00 184.47 ? 1179 PRO A CA    1 
ATOM   8920  C  C     . PRO A 1  1179 ? 207.434 112.102 144.139 1.00 184.47 ? 1179 PRO A C     1 
ATOM   8921  O  O     . PRO A 1  1179 ? 207.784 112.513 145.252 1.00 184.47 ? 1179 PRO A O     1 
ATOM   8922  C  CB    . PRO A 1  1179 ? 206.733 109.678 144.091 1.00 183.41 ? 1179 PRO A CB    1 
ATOM   8923  C  CG    . PRO A 1  1179 ? 206.873 109.281 142.661 1.00 183.41 ? 1179 PRO A CG    1 
ATOM   8924  C  CD    . PRO A 1  1179 ? 205.781 110.006 141.924 1.00 183.41 ? 1179 PRO A CD    1 
ATOM   8925  N  N     . ASN A 1  1180 ? 208.037 112.483 143.015 1.00 191.19 ? 1180 ASN A N     1 
ATOM   8926  C  CA    . ASN A 1  1180 ? 209.192 113.362 143.025 1.00 191.19 ? 1180 ASN A CA    1 
ATOM   8927  C  C     . ASN A 1  1180 ? 208.897 114.641 142.254 1.00 191.19 ? 1180 ASN A C     1 
ATOM   8928  O  O     . ASN A 1  1180 ? 208.135 114.626 141.279 1.00 191.19 ? 1180 ASN A O     1 
ATOM   8929  C  CB    . ASN A 1  1180 ? 210.416 112.669 142.415 1.00 188.08 ? 1180 ASN A CB    1 
ATOM   8930  C  CG    . ASN A 1  1180 ? 210.948 111.554 143.291 1.00 188.08 ? 1180 ASN A CG    1 
ATOM   8931  O  OD1   . ASN A 1  1180 ? 211.624 111.802 144.290 1.00 188.08 ? 1180 ASN A OD1   1 
ATOM   8932  N  ND2   . ASN A 1  1180 ? 210.638 110.317 142.925 1.00 188.08 ? 1180 ASN A ND2   1 
ATOM   8933  N  N     . PRO A 1  1181 ? 209.475 115.769 142.676 1.00 195.39 ? 1181 PRO A N     1 
ATOM   8934  C  CA    . PRO A 1  1181 ? 209.233 117.030 141.954 1.00 195.39 ? 1181 PRO A CA    1 
ATOM   8935  C  C     . PRO A 1  1181 ? 209.685 116.988 140.504 1.00 195.39 ? 1181 PRO A C     1 
ATOM   8936  O  O     . PRO A 1  1181 ? 208.963 117.455 139.612 1.00 195.39 ? 1181 PRO A O     1 
ATOM   8937  C  CB    . PRO A 1  1181 ? 210.038 118.044 142.773 1.00 195.17 ? 1181 PRO A CB    1 
ATOM   8938  C  CG    . PRO A 1  1181 ? 210.125 117.447 144.137 1.00 195.17 ? 1181 PRO A CG    1 
ATOM   8939  C  CD    . PRO A 1  1181 ? 210.252 115.974 143.910 1.00 195.17 ? 1181 PRO A CD    1 
ATOM   8940  N  N     . GLN A 1  1182 ? 210.867 116.438 140.243 1.00 194.51 ? 1182 GLN A N     1 
ATOM   8941  C  CA    . GLN A 1  1182 ? 211.436 116.399 138.905 1.00 194.51 ? 1182 GLN A CA    1 
ATOM   8942  C  C     . GLN A 1  1182 ? 210.980 115.192 138.098 1.00 194.51 ? 1182 GLN A C     1 
ATOM   8943  O  O     . GLN A 1  1182 ? 211.418 115.031 136.955 1.00 194.51 ? 1182 GLN A O     1 
ATOM   8944  C  CB    . GLN A 1  1182 ? 212.965 116.419 138.989 1.00 192.35 ? 1182 GLN A CB    1 
ATOM   8945  C  CG    . GLN A 1  1182 ? 213.537 117.709 139.563 1.00 192.35 ? 1182 GLN A CG    1 
ATOM   8946  C  CD    . GLN A 1  1182 ? 213.522 117.736 141.080 1.00 192.35 ? 1182 GLN A CD    1 
ATOM   8947  O  OE1   . GLN A 1  1182 ? 213.084 116.784 141.726 1.00 192.35 ? 1182 GLN A OE1   1 
ATOM   8948  N  NE2   . GLN A 1  1182 ? 213.999 118.833 141.656 1.00 192.35 ? 1182 GLN A NE2   1 
ATOM   8949  N  N     . SER A 1  1183 ? 210.125 114.338 138.666 1.00 197.58 ? 1183 SER A N     1 
ATOM   8950  C  CA    . SER A 1  1183 ? 209.588 113.212 137.910 1.00 197.58 ? 1183 SER A CA    1 
ATOM   8951  C  C     . SER A 1  1183 ? 208.773 113.703 136.719 1.00 197.58 ? 1183 SER A C     1 
ATOM   8952  O  O     . SER A 1  1183 ? 209.073 113.374 135.566 1.00 197.58 ? 1183 SER A O     1 
ATOM   8953  C  CB    . SER A 1  1183 ? 208.743 112.324 138.825 1.00 193.23 ? 1183 SER A CB    1 
ATOM   8954  O  OG    . SER A 1  1183 ? 207.621 113.029 139.328 1.00 193.23 ? 1183 SER A OG    1 
ATOM   8955  N  N     . THR A 1  1184 ? 207.744 114.508 136.987 1.00 200.34 ? 1184 THR A N     1 
ATOM   8956  C  CA    . THR A 1  1184 ? 206.984 115.234 135.966 1.00 200.34 ? 1184 THR A CA    1 
ATOM   8957  C  C     . THR A 1  1184 ? 206.474 114.292 134.871 1.00 200.34 ? 1184 THR A C     1 
ATOM   8958  O  O     . THR A 1  1184 ? 206.977 114.262 133.748 1.00 200.34 ? 1184 THR A O     1 
ATOM   8959  C  CB    . THR A 1  1184 ? 207.821 116.368 135.365 1.00 202.89 ? 1184 THR A CB    1 
ATOM   8960  O  OG1   . THR A 1  1184 ? 208.989 115.829 134.734 1.00 202.89 ? 1184 THR A OG1   1 
ATOM   8961  C  CG2   . THR A 1  1184 ? 208.237 117.355 136.445 1.00 202.89 ? 1184 THR A CG2   1 
ATOM   8962  N  N     . VAL A 1  1185 ? 205.464 113.501 135.244 1.00 199.13 ? 1185 VAL A N     1 
ATOM   8963  C  CA    . VAL A 1  1185 ? 204.852 112.578 134.290 1.00 199.13 ? 1185 VAL A CA    1 
ATOM   8964  C  C     . VAL A 1  1185 ? 204.300 113.330 133.084 1.00 199.13 ? 1185 VAL A C     1 
ATOM   8965  O  O     . VAL A 1  1185 ? 204.238 112.784 131.976 1.00 199.13 ? 1185 VAL A O     1 
ATOM   8966  C  CB    . VAL A 1  1185 ? 203.760 111.738 134.983 1.00 196.19 ? 1185 VAL A CB    1 
ATOM   8967  C  CG1   . VAL A 1  1185 ? 202.602 112.620 135.434 1.00 196.19 ? 1185 VAL A CG1   1 
ATOM   8968  C  CG2   . VAL A 1  1185 ? 203.272 110.622 134.068 1.00 196.19 ? 1185 VAL A CG2   1 
ATOM   8969  N  N     . VAL A 1  1186 ? 203.904 114.590 133.271 1.00 202.24 ? 1186 VAL A N     1 
ATOM   8970  C  CA    . VAL A 1  1186 ? 203.427 115.401 132.159 1.00 202.24 ? 1186 VAL A CA    1 
ATOM   8971  C  C     . VAL A 1  1186 ? 204.614 115.807 131.288 1.00 202.24 ? 1186 VAL A C     1 
ATOM   8972  O  O     . VAL A 1  1186 ? 205.760 115.872 131.749 1.00 202.24 ? 1186 VAL A O     1 
ATOM   8973  C  CB    . VAL A 1  1186 ? 202.663 116.628 132.695 1.00 199.50 ? 1186 VAL A CB    1 
ATOM   8974  C  CG1   . VAL A 1  1186 ? 202.118 117.495 131.563 1.00 199.50 ? 1186 VAL A CG1   1 
ATOM   8975  C  CG2   . VAL A 1  1186 ? 201.547 116.188 133.629 1.00 199.50 ? 1186 VAL A CG2   1 
ATOM   8976  N  N     . ALA A 1  1187 ? 204.344 116.057 130.005 1.00 202.52 ? 1187 ALA A N     1 
ATOM   8977  C  CA    . ALA A 1  1187 ? 205.417 116.412 129.082 1.00 202.52 ? 1187 ALA A CA    1 
ATOM   8978  C  C     . ALA A 1  1187 ? 205.904 117.839 129.312 1.00 202.52 ? 1187 ALA A C     1 
ATOM   8979  O  O     . ALA A 1  1187 ? 207.112 118.087 129.398 1.00 202.52 ? 1187 ALA A O     1 
ATOM   8980  C  CB    . ALA A 1  1187 ? 204.946 116.231 127.638 1.00 201.09 ? 1187 ALA A CB    1 
ATOM   8981  N  N     . GLU A 1  1188 ? 204.976 118.793 129.409 1.00 203.24 ? 1188 GLU A N     1 
ATOM   8982  C  CA    . GLU A 1  1188 ? 205.350 120.204 129.432 1.00 203.24 ? 1188 GLU A CA    1 
ATOM   8983  C  C     . GLU A 1  1188 ? 205.825 120.674 130.801 1.00 203.24 ? 1188 GLU A C     1 
ATOM   8984  O  O     . GLU A 1  1188 ? 206.612 121.625 130.879 1.00 203.24 ? 1188 GLU A O     1 
ATOM   8985  C  CB    . GLU A 1  1188 ? 204.170 121.068 128.987 1.00 199.46 ? 1188 GLU A CB    1 
ATOM   8986  C  CG    . GLU A 1  1188 ? 203.755 120.877 127.540 1.00 199.46 ? 1188 GLU A CG    1 
ATOM   8987  C  CD    . GLU A 1  1188 ? 202.544 121.713 127.173 1.00 199.46 ? 1188 GLU A CD    1 
ATOM   8988  O  OE1   . GLU A 1  1188 ? 201.924 122.296 128.089 1.00 199.46 ? 1188 GLU A OE1   1 
ATOM   8989  O  OE2   . GLU A 1  1188 ? 202.213 121.787 125.972 1.00 199.46 ? 1188 GLU A OE2   1 
ATOM   8990  N  N     . ASP A 1  1189 ? 205.368 120.033 131.879 1.00 204.61 ? 1189 ASP A N     1 
ATOM   8991  C  CA    . ASP A 1  1189 ? 205.499 120.628 133.206 1.00 204.61 ? 1189 ASP A CA    1 
ATOM   8992  C  C     . ASP A 1  1189 ? 206.955 120.746 133.645 1.00 204.61 ? 1189 ASP A C     1 
ATOM   8993  O  O     . ASP A 1  1189 ? 207.300 121.647 134.416 1.00 204.61 ? 1189 ASP A O     1 
ATOM   8994  C  CB    . ASP A 1  1189 ? 204.696 119.818 134.225 1.00 205.41 ? 1189 ASP A CB    1 
ATOM   8995  C  CG    . ASP A 1  1189 ? 205.133 118.372 134.294 1.00 205.41 ? 1189 ASP A CG    1 
ATOM   8996  O  OD1   . ASP A 1  1189 ? 205.956 117.965 133.450 1.00 205.41 ? 1189 ASP A OD1   1 
ATOM   8997  O  OD2   . ASP A 1  1189 ? 204.655 117.643 135.188 1.00 205.41 ? 1189 ASP A OD2   1 
ATOM   8998  N  N     . GLN A 1  1190 ? 207.825 119.862 133.146 1.00 202.92 ? 1190 GLN A N     1 
ATOM   8999  C  CA    . GLN A 1  1190 ? 209.180 119.749 133.684 1.00 202.92 ? 1190 GLN A CA    1 
ATOM   9000  C  C     . GLN A 1  1190 ? 209.933 121.075 133.676 1.00 202.92 ? 1190 GLN A C     1 
ATOM   9001  O  O     . GLN A 1  1190 ? 210.726 121.342 134.589 1.00 202.92 ? 1190 GLN A O     1 
ATOM   9002  C  CB    . GLN A 1  1190 ? 209.963 118.698 132.893 1.00 199.48 ? 1190 GLN A CB    1 
ATOM   9003  C  CG    . GLN A 1  1190 ? 211.365 118.431 133.421 1.00 199.48 ? 1190 GLN A CG    1 
ATOM   9004  C  CD    . GLN A 1  1190 ? 211.366 117.776 134.789 1.00 199.48 ? 1190 GLN A CD    1 
ATOM   9005  O  OE1   . GLN A 1  1190 ? 211.520 118.444 135.810 1.00 199.48 ? 1190 GLN A OE1   1 
ATOM   9006  N  NE2   . GLN A 1  1190 ? 211.207 116.458 134.813 1.00 199.48 ? 1190 GLN A NE2   1 
ATOM   9007  N  N     . GLU A 1  1191 ? 209.700 121.919 132.669 1.00 203.24 ? 1191 GLU A N     1 
ATOM   9008  C  CA    . GLU A 1  1191 ? 210.451 123.161 132.515 1.00 203.24 ? 1191 GLU A CA    1 
ATOM   9009  C  C     . GLU A 1  1191 ? 210.337 124.075 133.731 1.00 203.24 ? 1191 GLU A C     1 
ATOM   9010  O  O     . GLU A 1  1191 ? 211.307 124.239 134.479 1.00 203.24 ? 1191 GLU A O     1 
ATOM   9011  C  CB    . GLU A 1  1191 ? 209.993 123.908 131.259 1.00 201.57 ? 1191 GLU A CB    1 
ATOM   9012  C  CG    . GLU A 1  1191 ? 210.770 125.189 130.979 1.00 201.57 ? 1191 GLU A CG    1 
ATOM   9013  C  CD    . GLU A 1  1191 ? 212.229 124.940 130.630 1.00 201.57 ? 1191 GLU A CD    1 
ATOM   9014  O  OE1   . GLU A 1  1191 ? 212.592 123.782 130.334 1.00 201.57 ? 1191 GLU A OE1   1 
ATOM   9015  O  OE2   . GLU A 1  1191 ? 213.017 125.909 130.656 1.00 201.57 ? 1191 GLU A OE2   1 
ATOM   9016  N  N     . TRP A 1  1192 ? 209.158 124.670 133.944 1.00 204.93 ? 1192 TRP A N     1 
ATOM   9017  C  CA    . TRP A 1  1192 ? 209.004 125.613 135.048 1.00 204.93 ? 1192 TRP A CA    1 
ATOM   9018  C  C     . TRP A 1  1192 ? 209.080 124.931 136.405 1.00 204.93 ? 1192 TRP A C     1 
ATOM   9019  O  O     . TRP A 1  1192 ? 209.442 125.582 137.393 1.00 204.93 ? 1192 TRP A O     1 
ATOM   9020  C  CB    . TRP A 1  1192 ? 207.687 126.380 134.926 1.00 201.92 ? 1192 TRP A CB    1 
ATOM   9021  C  CG    . TRP A 1  1192 ? 206.466 125.519 134.960 1.00 201.92 ? 1192 TRP A CG    1 
ATOM   9022  C  CD1   . TRP A 1  1192 ? 205.769 125.128 136.066 1.00 201.92 ? 1192 TRP A CD1   1 
ATOM   9023  C  CD2   . TRP A 1  1192 ? 205.777 124.963 133.834 1.00 201.92 ? 1192 TRP A CD2   1 
ATOM   9024  N  NE1   . TRP A 1  1192 ? 204.696 124.352 135.700 1.00 201.92 ? 1192 TRP A NE1   1 
ATOM   9025  C  CE2   . TRP A 1  1192 ? 204.680 124.234 134.335 1.00 201.92 ? 1192 TRP A CE2   1 
ATOM   9026  C  CE3   . TRP A 1  1192 ? 205.982 125.010 132.452 1.00 201.92 ? 1192 TRP A CE3   1 
ATOM   9027  C  CZ2   . TRP A 1  1192 ? 203.788 123.564 133.503 1.00 201.92 ? 1192 TRP A CZ2   1 
ATOM   9028  C  CZ3   . TRP A 1  1192 ? 205.100 124.337 131.628 1.00 201.92 ? 1192 TRP A CZ3   1 
ATOM   9029  C  CH2   . TRP A 1  1192 ? 204.016 123.623 132.156 1.00 201.92 ? 1192 TRP A CH2   1 
ATOM   9030  N  N     . VAL A 1  1193 ? 208.731 123.645 136.477 1.00 205.95 ? 1193 VAL A N     1 
ATOM   9031  C  CA    . VAL A 1  1193 ? 208.998 122.860 137.680 1.00 205.95 ? 1193 VAL A CA    1 
ATOM   9032  C  C     . VAL A 1  1193 ? 210.471 122.965 138.056 1.00 205.95 ? 1193 VAL A C     1 
ATOM   9033  O  O     . VAL A 1  1193 ? 210.824 123.322 139.187 1.00 205.95 ? 1193 VAL A O     1 
ATOM   9034  C  CB    . VAL A 1  1193 ? 208.567 121.398 137.472 1.00 203.20 ? 1193 VAL A CB    1 
ATOM   9035  C  CG1   . VAL A 1  1193 ? 209.107 120.524 138.573 1.00 203.20 ? 1193 VAL A CG1   1 
ATOM   9036  C  CG2   . VAL A 1  1193 ? 207.050 121.300 137.447 1.00 203.20 ? 1193 VAL A CG2   1 
ATOM   9037  N  N     . ASN A 1  1194 ? 211.356 122.676 137.099 1.00 207.81 ? 1194 ASN A N     1 
ATOM   9038  C  CA    . ASN A 1  1194 ? 212.783 122.817 137.358 1.00 207.81 ? 1194 ASN A CA    1 
ATOM   9039  C  C     . ASN A 1  1194 ? 213.178 124.269 137.589 1.00 207.81 ? 1194 ASN A C     1 
ATOM   9040  O  O     . ASN A 1  1194 ? 214.124 124.534 138.336 1.00 207.81 ? 1194 ASN A O     1 
ATOM   9041  C  CB    . ASN A 1  1194 ? 213.593 122.224 136.207 1.00 203.11 ? 1194 ASN A CB    1 
ATOM   9042  C  CG    . ASN A 1  1194 ? 213.552 120.713 136.189 1.00 203.11 ? 1194 ASN A CG    1 
ATOM   9043  O  OD1   . ASN A 1  1194 ? 213.323 120.076 137.217 1.00 203.11 ? 1194 ASN A OD1   1 
ATOM   9044  N  ND2   . ASN A 1  1194 ? 213.777 120.128 135.018 1.00 203.11 ? 1194 ASN A ND2   1 
ATOM   9045  N  N     . VAL A 1  1195 ? 212.476 125.219 136.965 1.00 209.95 ? 1195 VAL A N     1 
ATOM   9046  C  CA    . VAL A 1  1195 ? 212.786 126.632 137.186 1.00 209.95 ? 1195 VAL A CA    1 
ATOM   9047  C  C     . VAL A 1  1195 ? 212.595 126.991 138.655 1.00 209.95 ? 1195 VAL A C     1 
ATOM   9048  O  O     . VAL A 1  1195 ? 213.437 127.657 139.269 1.00 209.95 ? 1195 VAL A O     1 
ATOM   9049  C  CB    . VAL A 1  1195 ? 211.929 127.527 136.274 1.00 206.19 ? 1195 VAL A CB    1 
ATOM   9050  C  CG1   . VAL A 1  1195 ? 212.128 128.991 136.635 1.00 206.19 ? 1195 VAL A CG1   1 
ATOM   9051  C  CG2   . VAL A 1  1195 ? 212.288 127.294 134.817 1.00 206.19 ? 1195 VAL A CG2   1 
ATOM   9052  N  N     . TYR A 1  1196 ? 211.484 126.542 139.244 1.00 210.77 ? 1196 TYR A N     1 
ATOM   9053  C  CA    . TYR A 1  1196 ? 211.221 126.850 140.645 1.00 210.77 ? 1196 TYR A CA    1 
ATOM   9054  C  C     . TYR A 1  1196 ? 212.040 125.975 141.584 1.00 210.77 ? 1196 TYR A C     1 
ATOM   9055  O  O     . TYR A 1  1196 ? 212.315 126.379 142.720 1.00 210.77 ? 1196 TYR A O     1 
ATOM   9056  C  CB    . TYR A 1  1196 ? 209.731 126.698 140.941 1.00 203.85 ? 1196 TYR A CB    1 
ATOM   9057  C  CG    . TYR A 1  1196 ? 208.874 127.702 140.214 1.00 203.85 ? 1196 TYR A CG    1 
ATOM   9058  C  CD1   . TYR A 1  1196 ? 209.242 129.038 140.151 1.00 203.85 ? 1196 TYR A CD1   1 
ATOM   9059  C  CD2   . TYR A 1  1196 ? 207.713 127.312 139.568 1.00 203.85 ? 1196 TYR A CD2   1 
ATOM   9060  C  CE1   . TYR A 1  1196 ? 208.465 129.961 139.483 1.00 203.85 ? 1196 TYR A CE1   1 
ATOM   9061  C  CE2   . TYR A 1  1196 ? 206.928 128.226 138.895 1.00 203.85 ? 1196 TYR A CE2   1 
ATOM   9062  C  CZ    . TYR A 1  1196 ? 207.309 129.549 138.855 1.00 203.85 ? 1196 TYR A CZ    1 
ATOM   9063  O  OH    . TYR A 1  1196 ? 206.533 130.465 138.185 1.00 203.85 ? 1196 TYR A OH    1 
ATOM   9064  N  N     . TYR A 1  1197 ? 212.436 124.783 141.140 1.00 214.29 ? 1197 TYR A N     1 
ATOM   9065  C  CA    . TYR A 1  1197 ? 213.190 123.874 141.994 1.00 214.29 ? 1197 TYR A CA    1 
ATOM   9066  C  C     . TYR A 1  1197 ? 214.701 123.966 141.807 1.00 214.29 ? 1197 TYR A C     1 
ATOM   9067  O  O     . TYR A 1  1197 ? 215.427 123.161 142.400 1.00 214.29 ? 1197 TYR A O     1 
ATOM   9068  C  CB    . TYR A 1  1197 ? 212.713 122.434 141.783 1.00 205.94 ? 1197 TYR A CB    1 
ATOM   9069  C  CG    . TYR A 1  1197 ? 211.288 122.224 142.250 1.00 205.94 ? 1197 TYR A CG    1 
ATOM   9070  C  CD1   . TYR A 1  1197 ? 210.821 122.839 143.404 1.00 205.94 ? 1197 TYR A CD1   1 
ATOM   9071  C  CD2   . TYR A 1  1197 ? 210.414 121.416 141.545 1.00 205.94 ? 1197 TYR A CD2   1 
ATOM   9072  C  CE1   . TYR A 1  1197 ? 209.520 122.657 143.837 1.00 205.94 ? 1197 TYR A CE1   1 
ATOM   9073  C  CE2   . TYR A 1  1197 ? 209.110 121.231 141.967 1.00 205.94 ? 1197 TYR A CE2   1 
ATOM   9074  C  CZ    . TYR A 1  1197 ? 208.670 121.849 143.115 1.00 205.94 ? 1197 TYR A CZ    1 
ATOM   9075  O  OH    . TYR A 1  1197 ? 207.374 121.661 143.539 1.00 205.94 ? 1197 TYR A OH    1 
ATOM   9076  N  N     . GLU A 1  1198 ? 215.196 124.902 140.991 1.00 220.66 ? 1198 GLU A N     1 
ATOM   9077  C  CA    . GLU A 1  1198 ? 216.616 125.238 141.056 1.00 220.66 ? 1198 GLU A CA    1 
ATOM   9078  C  C     . GLU A 1  1198 ? 216.930 125.975 142.351 1.00 220.66 ? 1198 GLU A C     1 
ATOM   9079  O  O     . GLU A 1  1198 ? 217.997 125.784 142.945 1.00 220.66 ? 1198 GLU A O     1 
ATOM   9080  C  CB    . GLU A 1  1198 ? 217.032 126.077 139.848 1.00 220.49 ? 1198 GLU A CB    1 
ATOM   9081  C  CG    . GLU A 1  1198 ? 217.071 125.315 138.534 1.00 220.49 ? 1198 GLU A CG    1 
ATOM   9082  C  CD    . GLU A 1  1198 ? 217.418 126.203 137.357 1.00 220.49 ? 1198 GLU A CD    1 
ATOM   9083  O  OE1   . GLU A 1  1198 ? 217.451 127.439 137.534 1.00 220.49 ? 1198 GLU A OE1   1 
ATOM   9084  O  OE2   . GLU A 1  1198 ? 217.656 125.667 136.255 1.00 220.49 ? 1198 GLU A OE2   1 
ATOM   9085  N  N     . MET A 1  1199 ? 216.006 126.822 142.799 1.00 226.10 ? 1199 MET A N     1 
ATOM   9086  C  CA    . MET A 1  1199 ? 216.060 127.445 144.122 1.00 226.10 ? 1199 MET A CA    1 
ATOM   9087  C  C     . MET A 1  1199 ? 214.774 127.124 144.872 1.00 226.10 ? 1199 MET A C     1 
ATOM   9088  O  O     . MET A 1  1199 ? 213.972 128.015 145.170 1.00 226.10 ? 1199 MET A O     1 
ATOM   9089  C  CB    . MET A 1  1199 ? 216.264 128.954 144.003 1.00 230.20 ? 1199 MET A CB    1 
ATOM   9090  C  CG    . MET A 1  1199 ? 217.617 129.366 143.455 1.00 230.20 ? 1199 MET A CG    1 
ATOM   9091  S  SD    . MET A 1  1199 ? 218.973 128.825 144.511 1.00 230.20 ? 1199 MET A SD    1 
ATOM   9092  C  CE    . MET A 1  1199 ? 218.665 129.805 145.978 1.00 230.20 ? 1199 MET A CE    1 
ATOM   9093  N  N     . PRO A 1  1200 ? 214.541 125.850 145.186 1.00 228.08 ? 1200 PRO A N     1 
ATOM   9094  C  CA    . PRO A 1  1200 ? 213.265 125.476 145.806 1.00 228.08 ? 1200 PRO A CA    1 
ATOM   9095  C  C     . PRO A 1  1200 ? 213.158 126.035 147.213 1.00 228.08 ? 1200 PRO A C     1 
ATOM   9096  O  O     . PRO A 1  1200 ? 214.073 125.900 148.030 1.00 228.08 ? 1200 PRO A O     1 
ATOM   9097  C  CB    . PRO A 1  1200 ? 213.313 123.945 145.807 1.00 222.98 ? 1200 PRO A CB    1 
ATOM   9098  C  CG    . PRO A 1  1200 ? 214.761 123.625 145.886 1.00 222.98 ? 1200 PRO A CG    1 
ATOM   9099  C  CD    . PRO A 1  1200 ? 215.488 124.720 145.147 1.00 222.98 ? 1200 PRO A CD    1 
ATOM   9100  N  N     . ASP A 1  1201 ? 212.021 126.665 147.495 1.00 232.01 ? 1201 ASP A N     1 
ATOM   9101