data_5FLZ
# 
_entry.id   5FLZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.283 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5FLZ         
PDBE  EBI-65416    
WWPDB D_1290065416 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB  5FM1     unspecified            
'STRUCTURE OF GAMMA-TUBULIN SMALL COMPLEX BASED ON A CRYO-EM MAP, CHEMICAL CROSS-LINKS, AND A REMOTELY RELATED STRUCTURE' 
EMDB EMD-2799 'associated EM volume' . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        5FLZ 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2015-10-29 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Greenberg, C.H.' 1 
'Kollman, J.'     2 
'Zelter, A.'      3 
'Johnson, R.'     4 
'MacCoss, M.J.'   5 
'Davis, T.N.'     6 
'Agard, D.A.'     7 
'Sali, A.'        8 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure of Gamma-Tubulin Small Complex Based on a Cryo-Em Map, Chemical Cross-Links, and a Remotely Related Structure.' 
J.Struct.Biol.       194 303 ? 2016 JSBIEM US 1047-8477 0803 ? 26968363 10.1016/J.JSB.2016.03.006 
1       'Ring Closure Activates Yeast Gamma-Turc for Species-Specific Microtubule Nucleation.'                                     
Nat.Struct.Mol.Biol. 22  132 ? 2015 ?      US 1545-9993 ?    ? 25599398 10.1038/NSMB.2953         
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Greenberg, C.H.' 1  
primary 'Kollman, J.'     2  
primary 'Zelter, A.'      3  
primary 'Johnson, R.'     4  
primary 'Maccoss, M.J.'   5  
primary 'Davis, T.N.'     6  
primary 'Agard, D.A.'     7  
primary 'Sali, A.'        8  
1       'Kollman, J.M.'   9  
1       'Greenberg, C.H.' 10 
1       'Li, S.'          11 
1       'Moritz, M.'      12 
1       'Zelter, A.'      13 
1       'Fong, K.K.'      14 
1       'Fernandez, J.'   15 
1       'Sali, A.'        16 
1       'Kilmartin, J.'   17 
1       'Davis, T.N.'     18 
1       'Agard, D.A.'     19 
# 
_cell.entry_id           5FLZ 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5FLZ 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'SPINDLE POLE BODY COMPONENT SPC97' 96940.594 1 ? ?   ? ? 
2 polymer man 'SPINDLE POLE BODY COMPONENT SPC98' 98336.211 1 ? ?   ? ? 
3 polymer man 'TUBULIN GAMMA CHAIN'               52733.340 2 ? YES ? 
'CYSTEINE RESIDUES WERE INTRODUCED AT POSITIONS 58 AND 288 TO PROMOTE CROSSLINKING OF THE HELICAL COMPLEX' 
4 polymer man 'SPINDLE POLE BODY COMPONENT 110'   3762.629  2 ? ?   ? 
;RESIDUES 1-220 OF SPC110 WERE EXPRESSED WITH AN N-TERMINAL GST TAG, WHICH WAS CLEAVED OFF DURING PURIFICATION. IT CANNOT BE UNIQUELY IDENTIFIED WHICH FRAGMENT OF SPC110 IS PRESENT IN THE MAP, THUS A POLY-ALANINE HELIX WAS FITTED INTO THE MAP.
;
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 GCP2 
2 GCP3 
3 GAMMA-TUBULIN 
4 
;EXTRAGENIC SUPPRESSOR OF CMD1-1 MUTANT PROTEIN 1, NUCLEAR FILAMENT-RELATED PROTEIN 1, SPINDLE POLE BODY SPACER PROTEIN SPC110, SPC110
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MEIKEVDDRAELLRYTNNIPLLGKLVNHQPLWSTNPKLKSFSLEKISAPDQRRVQEALVVKDLLNVLIGLEGTYIRYFND
YEPSDPETPIEFKIAKKMDPSFKTFSRRIVRYGKQYMILTRAYEKWSDTSFGMVLQRFAYEIRRFLEDVYLKTLVERLER
DFNKVPNFSIRELEQIINETEVNKQMELLYNIYEEIFREIEERRTNQSSQEDFNNFMDSMKNESSLHLRLMVAFDTTVYP
VPKGGAILKIFQQKILENLGDRSSVMFLKKLLNNISQDYCTMLYEWLTQGILNDPYQEFMTYDDLEGKTDNIFDTRDRAW
DTQYFIRKDVLLRDCDSEEDKNLLFKMLRTGILLKVVRASLQIPTIPSNSSDITIQEINDFADLMEGSNLELYVDKCYSR
ANEIFLKLFFQGYDLINVLKHLQQIFLGYQSGHNVLKFLTKNMGELTKHYRNDNNANYDKLLQNFELERQSENPNNLMRQ
LLMIQFDTETLPQVLSHYLQIYPEVPENNSANDDSDPLMHANNFKNMNAILFDELSKERTGAYHGSNLELYTPKSAIYHL
KFDINIPYPLNIIISRTCMIKYQIILRYQLVLQYHSRLLDETWMDLNKTPSWKYRGYSHTVKRRIVRATRVLHAKMNHFI
KTIMEYFNQNVIDKEVYSLEKCYRNPTLAVAIQNELEGGLTNIMTNRCLSDLIPLQLQIFDIVYKFCKFIKSMRAKLCQL
DPVLYEKHKSGMMKTLNEGYRTNNGGQEDVGYQEDAALELIQKLIEYISNASSIFRKCLINFTQELSTEKFDFYDSSSVD
AAGIERVLYSIVPPRSASASSQR
;
;MEIKEVDDRAELLRYTNNIPLLGKLVNHQPLWSTNPKLKSFSLEKISAPDQRRVQEALVVKDLLNVLIGLEGTYIRYFND
YEPSDPETPIEFKIAKKMDPSFKTFSRRIVRYGKQYMILTRAYEKWSDTSFGMVLQRFAYEIRRFLEDVYLKTLVERLER
DFNKVPNFSIRELEQIINETEVNKQMELLYNIYEEIFREIEERRTNQSSQEDFNNFMDSMKNESSLHLRLMVAFDTTVYP
VPKGGAILKIFQQKILENLGDRSSVMFLKKLLNNISQDYCTMLYEWLTQGILNDPYQEFMTYDDLEGKTDNIFDTRDRAW
DTQYFIRKDVLLRDCDSEEDKNLLFKMLRTGILLKVVRASLQIPTIPSNSSDITIQEINDFADLMEGSNLELYVDKCYSR
ANEIFLKLFFQGYDLINVLKHLQQIFLGYQSGHNVLKFLTKNMGELTKHYRNDNNANYDKLLQNFELERQSENPNNLMRQ
LLMIQFDTETLPQVLSHYLQIYPEVPENNSANDDSDPLMHANNFKNMNAILFDELSKERTGAYHGSNLELYTPKSAIYHL
KFDINIPYPLNIIISRTCMIKYQIILRYQLVLQYHSRLLDETWMDLNKTPSWKYRGYSHTVKRRIVRATRVLHAKMNHFI
KTIMEYFNQNVIDKEVYSLEKCYRNPTLAVAIQNELEGGLTNIMTNRCLSDLIPLQLQIFDIVYKFCKFIKSMRAKLCQL
DPVLYEKHKSGMMKTLNEGYRTNNGGQEDVGYQEDAALELIQKLIEYISNASSIFRKCLINFTQELSTEKFDFYDSSSVD
AAGIERVLYSIVPPRSASASSQR
;
A   ? 
2 'polypeptide(L)' no no 
;MELEPTLFGIIEALAPQLLSQSHLQTFVSDVVNLLRSSTKSATQLGPLIDFYKLQSLDSPETTIMWHKIEKFLDALFGIQ
NTDDMVKYLSVFQSLLPSNYRAKIVQKSSGLNMENLANHEHLLSPVRAPSIYTEASFENMDRFSERRSMVSSPNRYVPSS
TYSSVTLRQLSNPYYVNTIPEEDILKYVSYTLLATTSALFPFDHEQIQIPSKIPNFESGLLHLIFEAGLLYQSLGYKVEK
FRMLNISPMKKALIIEISEELQNYTAFVNNLVSSGTVVSLKSLYREIYENIIRLRIYCRFTEHLEELSGDTFLIELNIFK
SHGDLTIRKIATNLFNSMISLYYEYLMNWLTKGLLRATYGEFFIAENTDTNGTDDDFIYHIPIEFNQERVPAFIPKELAY
KIFMIGKSYIFLEKYCKEVQWTNEFSKKYHVLYQSNSYRGISTNFFEIINDQYSEIVNHTNQILNQKFHYRDVVFALKNI
LLMGKSDFMDALIEKANDILATPSDSLPNYKLTRVLQEAVQLSSLRHLMNSPRNSSVINGLDARVLDLGHGSVGWDVFTL
DYILYPPLSLVLNVNRPFGRKEYLRIFNFLWRFKKNNYFYQKEMLKSNDIIRSFKKIRGYNPLIRDIINKLSRISILRTQ
FQQFNSKMESYYLNCIIEENFKEMTRKLQRTENKSQNQFDLIRLNNGTIELNGILTPKAEVLTKSSSSKPQKHAIEKTLN
IDELESVHNTFLTNILSHKLFATNTSEISVGDYSGQPYPTSLVLLLNSVYEFVKVYCNLNDIGYEIFIKMNLNDHEASNG
LLGKFNTNLKEIVSQYKNFKDRLYIFRADLKNDGDEELFLLSKSLR
;
;MELEPTLFGIIEALAPQLLSQSHLQTFVSDVVNLLRSSTKSATQLGPLIDFYKLQSLDSPETTIMWHKIEKFLDALFGIQ
NTDDMVKYLSVFQSLLPSNYRAKIVQKSSGLNMENLANHEHLLSPVRAPSIYTEASFENMDRFSERRSMVSSPNRYVPSS
TYSSVTLRQLSNPYYVNTIPEEDILKYVSYTLLATTSALFPFDHEQIQIPSKIPNFESGLLHLIFEAGLLYQSLGYKVEK
FRMLNISPMKKALIIEISEELQNYTAFVNNLVSSGTVVSLKSLYREIYENIIRLRIYCRFTEHLEELSGDTFLIELNIFK
SHGDLTIRKIATNLFNSMISLYYEYLMNWLTKGLLRATYGEFFIAENTDTNGTDDDFIYHIPIEFNQERVPAFIPKELAY
KIFMIGKSYIFLEKYCKEVQWTNEFSKKYHVLYQSNSYRGISTNFFEIINDQYSEIVNHTNQILNQKFHYRDVVFALKNI
LLMGKSDFMDALIEKANDILATPSDSLPNYKLTRVLQEAVQLSSLRHLMNSPRNSSVINGLDARVLDLGHGSVGWDVFTL
DYILYPPLSLVLNVNRPFGRKEYLRIFNFLWRFKKNNYFYQKEMLKSNDIIRSFKKIRGYNPLIRDIINKLSRISILRTQ
FQQFNSKMESYYLNCIIEENFKEMTRKLQRTENKSQNQFDLIRLNNGTIELNGILTPKAEVLTKSSSSKPQKHAIEKTLN
IDELESVHNTFLTNILSHKLFATNTSEISVGDYSGQPYPTSLVLLLNSVYEFVKVYCNLNDIGYEIFIKMNLNDHEASNG
LLGKFNTNLKEIVSQYKNFKDRLYIFRADLKNDGDEELFLLSKSLR
;
B   ? 
3 'polypeptide(L)' no no 
;MGGEIITLQAGQCGNHVGKFLWSQLAKEHAIGTDGLSQLPDSSTERDDDTKPFFRENCRNKFTPRAIMMDSEPSVIADVE
NTFRGFFDPRNTWVASDGASAGNSWANGYDIGTRNQDDILNKIDKEIDSTDNFEGFQLLHSVAGGTGSGLGSNLLEALCD
RYPKKILTTYSVFPARSSEVVVQSYNTILALRRLIEDSDATVVFDNASLLNISGKVFRNPNIDLQHTNQLISTIISSVTN
SIRFPSYMYSSMSSIYSTLIPSPELHFLSPSFTPFTSDYIHDDIAHKCHSSYDVMLDLLDPSNSLVSTAMNNPTYFNVYN
TIIGNVEPRQISRAMTKLQQRIKFPSWSSSAMHVNIGRRSPYLPLQPNENEVSGMMLSNMSTVVNVFENACNTFDKVFAK
GAFLNNYNVGDLFQSMQNVQDEFAESREVVQSLMEDYVAAEQDSYLDDVLVDDENMVGELEEDLDADGDHKLV
;
;MGGEIITLQAGQCGNHVGKFLWSQLAKEHAIGTDGLSQLPDSSTERDDDTKPFFRENCRNKFTPRAIMMDSEPSVIADVE
NTFRGFFDPRNTWVASDGASAGNSWANGYDIGTRNQDDILNKIDKEIDSTDNFEGFQLLHSVAGGTGSGLGSNLLEALCD
RYPKKILTTYSVFPARSSEVVVQSYNTILALRRLIEDSDATVVFDNASLLNISGKVFRNPNIDLQHTNQLISTIISSVTN
SIRFPSYMYSSMSSIYSTLIPSPELHFLSPSFTPFTSDYIHDDIAHKCHSSYDVMLDLLDPSNSLVSTAMNNPTYFNVYN
TIIGNVEPRQISRAMTKLQQRIKFPSWSSSAMHVNIGRRSPYLPLQPNENEVSGMMLSNMSTVVNVFENACNTFDKVFAK
GAFLNNYNVGDLFQSMQNVQDEFAESREVVQSLMEDYVAAEQDSYLDDVLVDDENMVGELEEDLDADGDHKLV
;
C,D ? 
4 'polypeptide(L)' no no 
;(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
;
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX E,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   ILE n 
1 4   LYS n 
1 5   GLU n 
1 6   VAL n 
1 7   ASP n 
1 8   ASP n 
1 9   ARG n 
1 10  ALA n 
1 11  GLU n 
1 12  LEU n 
1 13  LEU n 
1 14  ARG n 
1 15  TYR n 
1 16  THR n 
1 17  ASN n 
1 18  ASN n 
1 19  ILE n 
1 20  PRO n 
1 21  LEU n 
1 22  LEU n 
1 23  GLY n 
1 24  LYS n 
1 25  LEU n 
1 26  VAL n 
1 27  ASN n 
1 28  HIS n 
1 29  GLN n 
1 30  PRO n 
1 31  LEU n 
1 32  TRP n 
1 33  SER n 
1 34  THR n 
1 35  ASN n 
1 36  PRO n 
1 37  LYS n 
1 38  LEU n 
1 39  LYS n 
1 40  SER n 
1 41  PHE n 
1 42  SER n 
1 43  LEU n 
1 44  GLU n 
1 45  LYS n 
1 46  ILE n 
1 47  SER n 
1 48  ALA n 
1 49  PRO n 
1 50  ASP n 
1 51  GLN n 
1 52  ARG n 
1 53  ARG n 
1 54  VAL n 
1 55  GLN n 
1 56  GLU n 
1 57  ALA n 
1 58  LEU n 
1 59  VAL n 
1 60  VAL n 
1 61  LYS n 
1 62  ASP n 
1 63  LEU n 
1 64  LEU n 
1 65  ASN n 
1 66  VAL n 
1 67  LEU n 
1 68  ILE n 
1 69  GLY n 
1 70  LEU n 
1 71  GLU n 
1 72  GLY n 
1 73  THR n 
1 74  TYR n 
1 75  ILE n 
1 76  ARG n 
1 77  TYR n 
1 78  PHE n 
1 79  ASN n 
1 80  ASP n 
1 81  TYR n 
1 82  GLU n 
1 83  PRO n 
1 84  SER n 
1 85  ASP n 
1 86  PRO n 
1 87  GLU n 
1 88  THR n 
1 89  PRO n 
1 90  ILE n 
1 91  GLU n 
1 92  PHE n 
1 93  LYS n 
1 94  ILE n 
1 95  ALA n 
1 96  LYS n 
1 97  LYS n 
1 98  MET n 
1 99  ASP n 
1 100 PRO n 
1 101 SER n 
1 102 PHE n 
1 103 LYS n 
1 104 THR n 
1 105 PHE n 
1 106 SER n 
1 107 ARG n 
1 108 ARG n 
1 109 ILE n 
1 110 VAL n 
1 111 ARG n 
1 112 TYR n 
1 113 GLY n 
1 114 LYS n 
1 115 GLN n 
1 116 TYR n 
1 117 MET n 
1 118 ILE n 
1 119 LEU n 
1 120 THR n 
1 121 ARG n 
1 122 ALA n 
1 123 TYR n 
1 124 GLU n 
1 125 LYS n 
1 126 TRP n 
1 127 SER n 
1 128 ASP n 
1 129 THR n 
1 130 SER n 
1 131 PHE n 
1 132 GLY n 
1 133 MET n 
1 134 VAL n 
1 135 LEU n 
1 136 GLN n 
1 137 ARG n 
1 138 PHE n 
1 139 ALA n 
1 140 TYR n 
1 141 GLU n 
1 142 ILE n 
1 143 ARG n 
1 144 ARG n 
1 145 PHE n 
1 146 LEU n 
1 147 GLU n 
1 148 ASP n 
1 149 VAL n 
1 150 TYR n 
1 151 LEU n 
1 152 LYS n 
1 153 THR n 
1 154 LEU n 
1 155 VAL n 
1 156 GLU n 
1 157 ARG n 
1 158 LEU n 
1 159 GLU n 
1 160 ARG n 
1 161 ASP n 
1 162 PHE n 
1 163 ASN n 
1 164 LYS n 
1 165 VAL n 
1 166 PRO n 
1 167 ASN n 
1 168 PHE n 
1 169 SER n 
1 170 ILE n 
1 171 ARG n 
1 172 GLU n 
1 173 LEU n 
1 174 GLU n 
1 175 GLN n 
1 176 ILE n 
1 177 ILE n 
1 178 ASN n 
1 179 GLU n 
1 180 THR n 
1 181 GLU n 
1 182 VAL n 
1 183 ASN n 
1 184 LYS n 
1 185 GLN n 
1 186 MET n 
1 187 GLU n 
1 188 LEU n 
1 189 LEU n 
1 190 TYR n 
1 191 ASN n 
1 192 ILE n 
1 193 TYR n 
1 194 GLU n 
1 195 GLU n 
1 196 ILE n 
1 197 PHE n 
1 198 ARG n 
1 199 GLU n 
1 200 ILE n 
1 201 GLU n 
1 202 GLU n 
1 203 ARG n 
1 204 ARG n 
1 205 THR n 
1 206 ASN n 
1 207 GLN n 
1 208 SER n 
1 209 SER n 
1 210 GLN n 
1 211 GLU n 
1 212 ASP n 
1 213 PHE n 
1 214 ASN n 
1 215 ASN n 
1 216 PHE n 
1 217 MET n 
1 218 ASP n 
1 219 SER n 
1 220 MET n 
1 221 LYS n 
1 222 ASN n 
1 223 GLU n 
1 224 SER n 
1 225 SER n 
1 226 LEU n 
1 227 HIS n 
1 228 LEU n 
1 229 ARG n 
1 230 LEU n 
1 231 MET n 
1 232 VAL n 
1 233 ALA n 
1 234 PHE n 
1 235 ASP n 
1 236 THR n 
1 237 THR n 
1 238 VAL n 
1 239 TYR n 
1 240 PRO n 
1 241 VAL n 
1 242 PRO n 
1 243 LYS n 
1 244 GLY n 
1 245 GLY n 
1 246 ALA n 
1 247 ILE n 
1 248 LEU n 
1 249 LYS n 
1 250 ILE n 
1 251 PHE n 
1 252 GLN n 
1 253 GLN n 
1 254 LYS n 
1 255 ILE n 
1 256 LEU n 
1 257 GLU n 
1 258 ASN n 
1 259 LEU n 
1 260 GLY n 
1 261 ASP n 
1 262 ARG n 
1 263 SER n 
1 264 SER n 
1 265 VAL n 
1 266 MET n 
1 267 PHE n 
1 268 LEU n 
1 269 LYS n 
1 270 LYS n 
1 271 LEU n 
1 272 LEU n 
1 273 ASN n 
1 274 ASN n 
1 275 ILE n 
1 276 SER n 
1 277 GLN n 
1 278 ASP n 
1 279 TYR n 
1 280 CYS n 
1 281 THR n 
1 282 MET n 
1 283 LEU n 
1 284 TYR n 
1 285 GLU n 
1 286 TRP n 
1 287 LEU n 
1 288 THR n 
1 289 GLN n 
1 290 GLY n 
1 291 ILE n 
1 292 LEU n 
1 293 ASN n 
1 294 ASP n 
1 295 PRO n 
1 296 TYR n 
1 297 GLN n 
1 298 GLU n 
1 299 PHE n 
1 300 MET n 
1 301 THR n 
1 302 TYR n 
1 303 ASP n 
1 304 ASP n 
1 305 LEU n 
1 306 GLU n 
1 307 GLY n 
1 308 LYS n 
1 309 THR n 
1 310 ASP n 
1 311 ASN n 
1 312 ILE n 
1 313 PHE n 
1 314 ASP n 
1 315 THR n 
1 316 ARG n 
1 317 ASP n 
1 318 ARG n 
1 319 ALA n 
1 320 TRP n 
1 321 ASP n 
1 322 THR n 
1 323 GLN n 
1 324 TYR n 
1 325 PHE n 
1 326 ILE n 
1 327 ARG n 
1 328 LYS n 
1 329 ASP n 
1 330 VAL n 
1 331 LEU n 
1 332 LEU n 
1 333 ARG n 
1 334 ASP n 
1 335 CYS n 
1 336 ASP n 
1 337 SER n 
1 338 GLU n 
1 339 GLU n 
1 340 ASP n 
1 341 LYS n 
1 342 ASN n 
1 343 LEU n 
1 344 LEU n 
1 345 PHE n 
1 346 LYS n 
1 347 MET n 
1 348 LEU n 
1 349 ARG n 
1 350 THR n 
1 351 GLY n 
1 352 ILE n 
1 353 LEU n 
1 354 LEU n 
1 355 LYS n 
1 356 VAL n 
1 357 VAL n 
1 358 ARG n 
1 359 ALA n 
1 360 SER n 
1 361 LEU n 
1 362 GLN n 
1 363 ILE n 
1 364 PRO n 
1 365 THR n 
1 366 ILE n 
1 367 PRO n 
1 368 SER n 
1 369 ASN n 
1 370 SER n 
1 371 SER n 
1 372 ASP n 
1 373 ILE n 
1 374 THR n 
1 375 ILE n 
1 376 GLN n 
1 377 GLU n 
1 378 ILE n 
1 379 ASN n 
1 380 ASP n 
1 381 PHE n 
1 382 ALA n 
1 383 ASP n 
1 384 LEU n 
1 385 MET n 
1 386 GLU n 
1 387 GLY n 
1 388 SER n 
1 389 ASN n 
1 390 LEU n 
1 391 GLU n 
1 392 LEU n 
1 393 TYR n 
1 394 VAL n 
1 395 ASP n 
1 396 LYS n 
1 397 CYS n 
1 398 TYR n 
1 399 SER n 
1 400 ARG n 
1 401 ALA n 
1 402 ASN n 
1 403 GLU n 
1 404 ILE n 
1 405 PHE n 
1 406 LEU n 
1 407 LYS n 
1 408 LEU n 
1 409 PHE n 
1 410 PHE n 
1 411 GLN n 
1 412 GLY n 
1 413 TYR n 
1 414 ASP n 
1 415 LEU n 
1 416 ILE n 
1 417 ASN n 
1 418 VAL n 
1 419 LEU n 
1 420 LYS n 
1 421 HIS n 
1 422 LEU n 
1 423 GLN n 
1 424 GLN n 
1 425 ILE n 
1 426 PHE n 
1 427 LEU n 
1 428 GLY n 
1 429 TYR n 
1 430 GLN n 
1 431 SER n 
1 432 GLY n 
1 433 HIS n 
1 434 ASN n 
1 435 VAL n 
1 436 LEU n 
1 437 LYS n 
1 438 PHE n 
1 439 LEU n 
1 440 THR n 
1 441 LYS n 
1 442 ASN n 
1 443 MET n 
1 444 GLY n 
1 445 GLU n 
1 446 LEU n 
1 447 THR n 
1 448 LYS n 
1 449 HIS n 
1 450 TYR n 
1 451 ARG n 
1 452 ASN n 
1 453 ASP n 
1 454 ASN n 
1 455 ASN n 
1 456 ALA n 
1 457 ASN n 
1 458 TYR n 
1 459 ASP n 
1 460 LYS n 
1 461 LEU n 
1 462 LEU n 
1 463 GLN n 
1 464 ASN n 
1 465 PHE n 
1 466 GLU n 
1 467 LEU n 
1 468 GLU n 
1 469 ARG n 
1 470 GLN n 
1 471 SER n 
1 472 GLU n 
1 473 ASN n 
1 474 PRO n 
1 475 ASN n 
1 476 ASN n 
1 477 LEU n 
1 478 MET n 
1 479 ARG n 
1 480 GLN n 
1 481 LEU n 
1 482 LEU n 
1 483 MET n 
1 484 ILE n 
1 485 GLN n 
1 486 PHE n 
1 487 ASP n 
1 488 THR n 
1 489 GLU n 
1 490 THR n 
1 491 LEU n 
1 492 PRO n 
1 493 GLN n 
1 494 VAL n 
1 495 LEU n 
1 496 SER n 
1 497 HIS n 
1 498 TYR n 
1 499 LEU n 
1 500 GLN n 
1 501 ILE n 
1 502 TYR n 
1 503 PRO n 
1 504 GLU n 
1 505 VAL n 
1 506 PRO n 
1 507 GLU n 
1 508 ASN n 
1 509 ASN n 
1 510 SER n 
1 511 ALA n 
1 512 ASN n 
1 513 ASP n 
1 514 ASP n 
1 515 SER n 
1 516 ASP n 
1 517 PRO n 
1 518 LEU n 
1 519 MET n 
1 520 HIS n 
1 521 ALA n 
1 522 ASN n 
1 523 ASN n 
1 524 PHE n 
1 525 LYS n 
1 526 ASN n 
1 527 MET n 
1 528 ASN n 
1 529 ALA n 
1 530 ILE n 
1 531 LEU n 
1 532 PHE n 
1 533 ASP n 
1 534 GLU n 
1 535 LEU n 
1 536 SER n 
1 537 LYS n 
1 538 GLU n 
1 539 ARG n 
1 540 THR n 
1 541 GLY n 
1 542 ALA n 
1 543 TYR n 
1 544 HIS n 
1 545 GLY n 
1 546 SER n 
1 547 ASN n 
1 548 LEU n 
1 549 GLU n 
1 550 LEU n 
1 551 TYR n 
1 552 THR n 
1 553 PRO n 
1 554 LYS n 
1 555 SER n 
1 556 ALA n 
1 557 ILE n 
1 558 TYR n 
1 559 HIS n 
1 560 LEU n 
1 561 LYS n 
1 562 PHE n 
1 563 ASP n 
1 564 ILE n 
1 565 ASN n 
1 566 ILE n 
1 567 PRO n 
1 568 TYR n 
1 569 PRO n 
1 570 LEU n 
1 571 ASN n 
1 572 ILE n 
1 573 ILE n 
1 574 ILE n 
1 575 SER n 
1 576 ARG n 
1 577 THR n 
1 578 CYS n 
1 579 MET n 
1 580 ILE n 
1 581 LYS n 
1 582 TYR n 
1 583 GLN n 
1 584 ILE n 
1 585 ILE n 
1 586 LEU n 
1 587 ARG n 
1 588 TYR n 
1 589 GLN n 
1 590 LEU n 
1 591 VAL n 
1 592 LEU n 
1 593 GLN n 
1 594 TYR n 
1 595 HIS n 
1 596 SER n 
1 597 ARG n 
1 598 LEU n 
1 599 LEU n 
1 600 ASP n 
1 601 GLU n 
1 602 THR n 
1 603 TRP n 
1 604 MET n 
1 605 ASP n 
1 606 LEU n 
1 607 ASN n 
1 608 LYS n 
1 609 THR n 
1 610 PRO n 
1 611 SER n 
1 612 TRP n 
1 613 LYS n 
1 614 TYR n 
1 615 ARG n 
1 616 GLY n 
1 617 TYR n 
1 618 SER n 
1 619 HIS n 
1 620 THR n 
1 621 VAL n 
1 622 LYS n 
1 623 ARG n 
1 624 ARG n 
1 625 ILE n 
1 626 VAL n 
1 627 ARG n 
1 628 ALA n 
1 629 THR n 
1 630 ARG n 
1 631 VAL n 
1 632 LEU n 
1 633 HIS n 
1 634 ALA n 
1 635 LYS n 
1 636 MET n 
1 637 ASN n 
1 638 HIS n 
1 639 PHE n 
1 640 ILE n 
1 641 LYS n 
1 642 THR n 
1 643 ILE n 
1 644 MET n 
1 645 GLU n 
1 646 TYR n 
1 647 PHE n 
1 648 ASN n 
1 649 GLN n 
1 650 ASN n 
1 651 VAL n 
1 652 ILE n 
1 653 ASP n 
1 654 LYS n 
1 655 GLU n 
1 656 VAL n 
1 657 TYR n 
1 658 SER n 
1 659 LEU n 
1 660 GLU n 
1 661 LYS n 
1 662 CYS n 
1 663 TYR n 
1 664 ARG n 
1 665 ASN n 
1 666 PRO n 
1 667 THR n 
1 668 LEU n 
1 669 ALA n 
1 670 VAL n 
1 671 ALA n 
1 672 ILE n 
1 673 GLN n 
1 674 ASN n 
1 675 GLU n 
1 676 LEU n 
1 677 GLU n 
1 678 GLY n 
1 679 GLY n 
1 680 LEU n 
1 681 THR n 
1 682 ASN n 
1 683 ILE n 
1 684 MET n 
1 685 THR n 
1 686 ASN n 
1 687 ARG n 
1 688 CYS n 
1 689 LEU n 
1 690 SER n 
1 691 ASP n 
1 692 LEU n 
1 693 ILE n 
1 694 PRO n 
1 695 LEU n 
1 696 GLN n 
1 697 LEU n 
1 698 GLN n 
1 699 ILE n 
1 700 PHE n 
1 701 ASP n 
1 702 ILE n 
1 703 VAL n 
1 704 TYR n 
1 705 LYS n 
1 706 PHE n 
1 707 CYS n 
1 708 LYS n 
1 709 PHE n 
1 710 ILE n 
1 711 LYS n 
1 712 SER n 
1 713 MET n 
1 714 ARG n 
1 715 ALA n 
1 716 LYS n 
1 717 LEU n 
1 718 CYS n 
1 719 GLN n 
1 720 LEU n 
1 721 ASP n 
1 722 PRO n 
1 723 VAL n 
1 724 LEU n 
1 725 TYR n 
1 726 GLU n 
1 727 LYS n 
1 728 HIS n 
1 729 LYS n 
1 730 SER n 
1 731 GLY n 
1 732 MET n 
1 733 MET n 
1 734 LYS n 
1 735 THR n 
1 736 LEU n 
1 737 ASN n 
1 738 GLU n 
1 739 GLY n 
1 740 TYR n 
1 741 ARG n 
1 742 THR n 
1 743 ASN n 
1 744 ASN n 
1 745 GLY n 
1 746 GLY n 
1 747 GLN n 
1 748 GLU n 
1 749 ASP n 
1 750 VAL n 
1 751 GLY n 
1 752 TYR n 
1 753 GLN n 
1 754 GLU n 
1 755 ASP n 
1 756 ALA n 
1 757 ALA n 
1 758 LEU n 
1 759 GLU n 
1 760 LEU n 
1 761 ILE n 
1 762 GLN n 
1 763 LYS n 
1 764 LEU n 
1 765 ILE n 
1 766 GLU n 
1 767 TYR n 
1 768 ILE n 
1 769 SER n 
1 770 ASN n 
1 771 ALA n 
1 772 SER n 
1 773 SER n 
1 774 ILE n 
1 775 PHE n 
1 776 ARG n 
1 777 LYS n 
1 778 CYS n 
1 779 LEU n 
1 780 ILE n 
1 781 ASN n 
1 782 PHE n 
1 783 THR n 
1 784 GLN n 
1 785 GLU n 
1 786 LEU n 
1 787 SER n 
1 788 THR n 
1 789 GLU n 
1 790 LYS n 
1 791 PHE n 
1 792 ASP n 
1 793 PHE n 
1 794 TYR n 
1 795 ASP n 
1 796 SER n 
1 797 SER n 
1 798 SER n 
1 799 VAL n 
1 800 ASP n 
1 801 ALA n 
1 802 ALA n 
1 803 GLY n 
1 804 ILE n 
1 805 GLU n 
1 806 ARG n 
1 807 VAL n 
1 808 LEU n 
1 809 TYR n 
1 810 SER n 
1 811 ILE n 
1 812 VAL n 
1 813 PRO n 
1 814 PRO n 
1 815 ARG n 
1 816 SER n 
1 817 ALA n 
1 818 SER n 
1 819 ALA n 
1 820 SER n 
1 821 SER n 
1 822 GLN n 
1 823 ARG n 
2 1   MET n 
2 2   GLU n 
2 3   LEU n 
2 4   GLU n 
2 5   PRO n 
2 6   THR n 
2 7   LEU n 
2 8   PHE n 
2 9   GLY n 
2 10  ILE n 
2 11  ILE n 
2 12  GLU n 
2 13  ALA n 
2 14  LEU n 
2 15  ALA n 
2 16  PRO n 
2 17  GLN n 
2 18  LEU n 
2 19  LEU n 
2 20  SER n 
2 21  GLN n 
2 22  SER n 
2 23  HIS n 
2 24  LEU n 
2 25  GLN n 
2 26  THR n 
2 27  PHE n 
2 28  VAL n 
2 29  SER n 
2 30  ASP n 
2 31  VAL n 
2 32  VAL n 
2 33  ASN n 
2 34  LEU n 
2 35  LEU n 
2 36  ARG n 
2 37  SER n 
2 38  SER n 
2 39  THR n 
2 40  LYS n 
2 41  SER n 
2 42  ALA n 
2 43  THR n 
2 44  GLN n 
2 45  LEU n 
2 46  GLY n 
2 47  PRO n 
2 48  LEU n 
2 49  ILE n 
2 50  ASP n 
2 51  PHE n 
2 52  TYR n 
2 53  LYS n 
2 54  LEU n 
2 55  GLN n 
2 56  SER n 
2 57  LEU n 
2 58  ASP n 
2 59  SER n 
2 60  PRO n 
2 61  GLU n 
2 62  THR n 
2 63  THR n 
2 64  ILE n 
2 65  MET n 
2 66  TRP n 
2 67  HIS n 
2 68  LYS n 
2 69  ILE n 
2 70  GLU n 
2 71  LYS n 
2 72  PHE n 
2 73  LEU n 
2 74  ASP n 
2 75  ALA n 
2 76  LEU n 
2 77  PHE n 
2 78  GLY n 
2 79  ILE n 
2 80  GLN n 
2 81  ASN n 
2 82  THR n 
2 83  ASP n 
2 84  ASP n 
2 85  MET n 
2 86  VAL n 
2 87  LYS n 
2 88  TYR n 
2 89  LEU n 
2 90  SER n 
2 91  VAL n 
2 92  PHE n 
2 93  GLN n 
2 94  SER n 
2 95  LEU n 
2 96  LEU n 
2 97  PRO n 
2 98  SER n 
2 99  ASN n 
2 100 TYR n 
2 101 ARG n 
2 102 ALA n 
2 103 LYS n 
2 104 ILE n 
2 105 VAL n 
2 106 GLN n 
2 107 LYS n 
2 108 SER n 
2 109 SER n 
2 110 GLY n 
2 111 LEU n 
2 112 ASN n 
2 113 MET n 
2 114 GLU n 
2 115 ASN n 
2 116 LEU n 
2 117 ALA n 
2 118 ASN n 
2 119 HIS n 
2 120 GLU n 
2 121 HIS n 
2 122 LEU n 
2 123 LEU n 
2 124 SER n 
2 125 PRO n 
2 126 VAL n 
2 127 ARG n 
2 128 ALA n 
2 129 PRO n 
2 130 SER n 
2 131 ILE n 
2 132 TYR n 
2 133 THR n 
2 134 GLU n 
2 135 ALA n 
2 136 SER n 
2 137 PHE n 
2 138 GLU n 
2 139 ASN n 
2 140 MET n 
2 141 ASP n 
2 142 ARG n 
2 143 PHE n 
2 144 SER n 
2 145 GLU n 
2 146 ARG n 
2 147 ARG n 
2 148 SER n 
2 149 MET n 
2 150 VAL n 
2 151 SER n 
2 152 SER n 
2 153 PRO n 
2 154 ASN n 
2 155 ARG n 
2 156 TYR n 
2 157 VAL n 
2 158 PRO n 
2 159 SER n 
2 160 SER n 
2 161 THR n 
2 162 TYR n 
2 163 SER n 
2 164 SER n 
2 165 VAL n 
2 166 THR n 
2 167 LEU n 
2 168 ARG n 
2 169 GLN n 
2 170 LEU n 
2 171 SER n 
2 172 ASN n 
2 173 PRO n 
2 174 TYR n 
2 175 TYR n 
2 176 VAL n 
2 177 ASN n 
2 178 THR n 
2 179 ILE n 
2 180 PRO n 
2 181 GLU n 
2 182 GLU n 
2 183 ASP n 
2 184 ILE n 
2 185 LEU n 
2 186 LYS n 
2 187 TYR n 
2 188 VAL n 
2 189 SER n 
2 190 TYR n 
2 191 THR n 
2 192 LEU n 
2 193 LEU n 
2 194 ALA n 
2 195 THR n 
2 196 THR n 
2 197 SER n 
2 198 ALA n 
2 199 LEU n 
2 200 PHE n 
2 201 PRO n 
2 202 PHE n 
2 203 ASP n 
2 204 HIS n 
2 205 GLU n 
2 206 GLN n 
2 207 ILE n 
2 208 GLN n 
2 209 ILE n 
2 210 PRO n 
2 211 SER n 
2 212 LYS n 
2 213 ILE n 
2 214 PRO n 
2 215 ASN n 
2 216 PHE n 
2 217 GLU n 
2 218 SER n 
2 219 GLY n 
2 220 LEU n 
2 221 LEU n 
2 222 HIS n 
2 223 LEU n 
2 224 ILE n 
2 225 PHE n 
2 226 GLU n 
2 227 ALA n 
2 228 GLY n 
2 229 LEU n 
2 230 LEU n 
2 231 TYR n 
2 232 GLN n 
2 233 SER n 
2 234 LEU n 
2 235 GLY n 
2 236 TYR n 
2 237 LYS n 
2 238 VAL n 
2 239 GLU n 
2 240 LYS n 
2 241 PHE n 
2 242 ARG n 
2 243 MET n 
2 244 LEU n 
2 245 ASN n 
2 246 ILE n 
2 247 SER n 
2 248 PRO n 
2 249 MET n 
2 250 LYS n 
2 251 LYS n 
2 252 ALA n 
2 253 LEU n 
2 254 ILE n 
2 255 ILE n 
2 256 GLU n 
2 257 ILE n 
2 258 SER n 
2 259 GLU n 
2 260 GLU n 
2 261 LEU n 
2 262 GLN n 
2 263 ASN n 
2 264 TYR n 
2 265 THR n 
2 266 ALA n 
2 267 PHE n 
2 268 VAL n 
2 269 ASN n 
2 270 ASN n 
2 271 LEU n 
2 272 VAL n 
2 273 SER n 
2 274 SER n 
2 275 GLY n 
2 276 THR n 
2 277 VAL n 
2 278 VAL n 
2 279 SER n 
2 280 LEU n 
2 281 LYS n 
2 282 SER n 
2 283 LEU n 
2 284 TYR n 
2 285 ARG n 
2 286 GLU n 
2 287 ILE n 
2 288 TYR n 
2 289 GLU n 
2 290 ASN n 
2 291 ILE n 
2 292 ILE n 
2 293 ARG n 
2 294 LEU n 
2 295 ARG n 
2 296 ILE n 
2 297 TYR n 
2 298 CYS n 
2 299 ARG n 
2 300 PHE n 
2 301 THR n 
2 302 GLU n 
2 303 HIS n 
2 304 LEU n 
2 305 GLU n 
2 306 GLU n 
2 307 LEU n 
2 308 SER n 
2 309 GLY n 
2 310 ASP n 
2 311 THR n 
2 312 PHE n 
2 313 LEU n 
2 314 ILE n 
2 315 GLU n 
2 316 LEU n 
2 317 ASN n 
2 318 ILE n 
2 319 PHE n 
2 320 LYS n 
2 321 SER n 
2 322 HIS n 
2 323 GLY n 
2 324 ASP n 
2 325 LEU n 
2 326 THR n 
2 327 ILE n 
2 328 ARG n 
2 329 LYS n 
2 330 ILE n 
2 331 ALA n 
2 332 THR n 
2 333 ASN n 
2 334 LEU n 
2 335 PHE n 
2 336 ASN n 
2 337 SER n 
2 338 MET n 
2 339 ILE n 
2 340 SER n 
2 341 LEU n 
2 342 TYR n 
2 343 TYR n 
2 344 GLU n 
2 345 TYR n 
2 346 LEU n 
2 347 MET n 
2 348 ASN n 
2 349 TRP n 
2 350 LEU n 
2 351 THR n 
2 352 LYS n 
2 353 GLY n 
2 354 LEU n 
2 355 LEU n 
2 356 ARG n 
2 357 ALA n 
2 358 THR n 
2 359 TYR n 
2 360 GLY n 
2 361 GLU n 
2 362 PHE n 
2 363 PHE n 
2 364 ILE n 
2 365 ALA n 
2 366 GLU n 
2 367 ASN n 
2 368 THR n 
2 369 ASP n 
2 370 THR n 
2 371 ASN n 
2 372 GLY n 
2 373 THR n 
2 374 ASP n 
2 375 ASP n 
2 376 ASP n 
2 377 PHE n 
2 378 ILE n 
2 379 TYR n 
2 380 HIS n 
2 381 ILE n 
2 382 PRO n 
2 383 ILE n 
2 384 GLU n 
2 385 PHE n 
2 386 ASN n 
2 387 GLN n 
2 388 GLU n 
2 389 ARG n 
2 390 VAL n 
2 391 PRO n 
2 392 ALA n 
2 393 PHE n 
2 394 ILE n 
2 395 PRO n 
2 396 LYS n 
2 397 GLU n 
2 398 LEU n 
2 399 ALA n 
2 400 TYR n 
2 401 LYS n 
2 402 ILE n 
2 403 PHE n 
2 404 MET n 
2 405 ILE n 
2 406 GLY n 
2 407 LYS n 
2 408 SER n 
2 409 TYR n 
2 410 ILE n 
2 411 PHE n 
2 412 LEU n 
2 413 GLU n 
2 414 LYS n 
2 415 TYR n 
2 416 CYS n 
2 417 LYS n 
2 418 GLU n 
2 419 VAL n 
2 420 GLN n 
2 421 TRP n 
2 422 THR n 
2 423 ASN n 
2 424 GLU n 
2 425 PHE n 
2 426 SER n 
2 427 LYS n 
2 428 LYS n 
2 429 TYR n 
2 430 HIS n 
2 431 VAL n 
2 432 LEU n 
2 433 TYR n 
2 434 GLN n 
2 435 SER n 
2 436 ASN n 
2 437 SER n 
2 438 TYR n 
2 439 ARG n 
2 440 GLY n 
2 441 ILE n 
2 442 SER n 
2 443 THR n 
2 444 ASN n 
2 445 PHE n 
2 446 PHE n 
2 447 GLU n 
2 448 ILE n 
2 449 ILE n 
2 450 ASN n 
2 451 ASP n 
2 452 GLN n 
2 453 TYR n 
2 454 SER n 
2 455 GLU n 
2 456 ILE n 
2 457 VAL n 
2 458 ASN n 
2 459 HIS n 
2 460 THR n 
2 461 ASN n 
2 462 GLN n 
2 463 ILE n 
2 464 LEU n 
2 465 ASN n 
2 466 GLN n 
2 467 LYS n 
2 468 PHE n 
2 469 HIS n 
2 470 TYR n 
2 471 ARG n 
2 472 ASP n 
2 473 VAL n 
2 474 VAL n 
2 475 PHE n 
2 476 ALA n 
2 477 LEU n 
2 478 LYS n 
2 479 ASN n 
2 480 ILE n 
2 481 LEU n 
2 482 LEU n 
2 483 MET n 
2 484 GLY n 
2 485 LYS n 
2 486 SER n 
2 487 ASP n 
2 488 PHE n 
2 489 MET n 
2 490 ASP n 
2 491 ALA n 
2 492 LEU n 
2 493 ILE n 
2 494 GLU n 
2 495 LYS n 
2 496 ALA n 
2 497 ASN n 
2 498 ASP n 
2 499 ILE n 
2 500 LEU n 
2 501 ALA n 
2 502 THR n 
2 503 PRO n 
2 504 SER n 
2 505 ASP n 
2 506 SER n 
2 507 LEU n 
2 508 PRO n 
2 509 ASN n 
2 510 TYR n 
2 511 LYS n 
2 512 LEU n 
2 513 THR n 
2 514 ARG n 
2 515 VAL n 
2 516 LEU n 
2 517 GLN n 
2 518 GLU n 
2 519 ALA n 
2 520 VAL n 
2 521 GLN n 
2 522 LEU n 
2 523 SER n 
2 524 SER n 
2 525 LEU n 
2 526 ARG n 
2 527 HIS n 
2 528 LEU n 
2 529 MET n 
2 530 ASN n 
2 531 SER n 
2 532 PRO n 
2 533 ARG n 
2 534 ASN n 
2 535 SER n 
2 536 SER n 
2 537 VAL n 
2 538 ILE n 
2 539 ASN n 
2 540 GLY n 
2 541 LEU n 
2 542 ASP n 
2 543 ALA n 
2 544 ARG n 
2 545 VAL n 
2 546 LEU n 
2 547 ASP n 
2 548 LEU n 
2 549 GLY n 
2 550 HIS n 
2 551 GLY n 
2 552 SER n 
2 553 VAL n 
2 554 GLY n 
2 555 TRP n 
2 556 ASP n 
2 557 VAL n 
2 558 PHE n 
2 559 THR n 
2 560 LEU n 
2 561 ASP n 
2 562 TYR n 
2 563 ILE n 
2 564 LEU n 
2 565 TYR n 
2 566 PRO n 
2 567 PRO n 
2 568 LEU n 
2 569 SER n 
2 570 LEU n 
2 571 VAL n 
2 572 LEU n 
2 573 ASN n 
2 574 VAL n 
2 575 ASN n 
2 576 ARG n 
2 577 PRO n 
2 578 PHE n 
2 579 GLY n 
2 580 ARG n 
2 581 LYS n 
2 582 GLU n 
2 583 TYR n 
2 584 LEU n 
2 585 ARG n 
2 586 ILE n 
2 587 PHE n 
2 588 ASN n 
2 589 PHE n 
2 590 LEU n 
2 591 TRP n 
2 592 ARG n 
2 593 PHE n 
2 594 LYS n 
2 595 LYS n 
2 596 ASN n 
2 597 ASN n 
2 598 TYR n 
2 599 PHE n 
2 600 TYR n 
2 601 GLN n 
2 602 LYS n 
2 603 GLU n 
2 604 MET n 
2 605 LEU n 
2 606 LYS n 
2 607 SER n 
2 608 ASN n 
2 609 ASP n 
2 610 ILE n 
2 611 ILE n 
2 612 ARG n 
2 613 SER n 
2 614 PHE n 
2 615 LYS n 
2 616 LYS n 
2 617 ILE n 
2 618 ARG n 
2 619 GLY n 
2 620 TYR n 
2 621 ASN n 
2 622 PRO n 
2 623 LEU n 
2 624 ILE n 
2 625 ARG n 
2 626 ASP n 
2 627 ILE n 
2 628 ILE n 
2 629 ASN n 
2 630 LYS n 
2 631 LEU n 
2 632 SER n 
2 633 ARG n 
2 634 ILE n 
2 635 SER n 
2 636 ILE n 
2 637 LEU n 
2 638 ARG n 
2 639 THR n 
2 640 GLN n 
2 641 PHE n 
2 642 GLN n 
2 643 GLN n 
2 644 PHE n 
2 645 ASN n 
2 646 SER n 
2 647 LYS n 
2 648 MET n 
2 649 GLU n 
2 650 SER n 
2 651 TYR n 
2 652 TYR n 
2 653 LEU n 
2 654 ASN n 
2 655 CYS n 
2 656 ILE n 
2 657 ILE n 
2 658 GLU n 
2 659 GLU n 
2 660 ASN n 
2 661 PHE n 
2 662 LYS n 
2 663 GLU n 
2 664 MET n 
2 665 THR n 
2 666 ARG n 
2 667 LYS n 
2 668 LEU n 
2 669 GLN n 
2 670 ARG n 
2 671 THR n 
2 672 GLU n 
2 673 ASN n 
2 674 LYS n 
2 675 SER n 
2 676 GLN n 
2 677 ASN n 
2 678 GLN n 
2 679 PHE n 
2 680 ASP n 
2 681 LEU n 
2 682 ILE n 
2 683 ARG n 
2 684 LEU n 
2 685 ASN n 
2 686 ASN n 
2 687 GLY n 
2 688 THR n 
2 689 ILE n 
2 690 GLU n 
2 691 LEU n 
2 692 ASN n 
2 693 GLY n 
2 694 ILE n 
2 695 LEU n 
2 696 THR n 
2 697 PRO n 
2 698 LYS n 
2 699 ALA n 
2 700 GLU n 
2 701 VAL n 
2 702 LEU n 
2 703 THR n 
2 704 LYS n 
2 705 SER n 
2 706 SER n 
2 707 SER n 
2 708 SER n 
2 709 LYS n 
2 710 PRO n 
2 711 GLN n 
2 712 LYS n 
2 713 HIS n 
2 714 ALA n 
2 715 ILE n 
2 716 GLU n 
2 717 LYS n 
2 718 THR n 
2 719 LEU n 
2 720 ASN n 
2 721 ILE n 
2 722 ASP n 
2 723 GLU n 
2 724 LEU n 
2 725 GLU n 
2 726 SER n 
2 727 VAL n 
2 728 HIS n 
2 729 ASN n 
2 730 THR n 
2 731 PHE n 
2 732 LEU n 
2 733 THR n 
2 734 ASN n 
2 735 ILE n 
2 736 LEU n 
2 737 SER n 
2 738 HIS n 
2 739 LYS n 
2 740 LEU n 
2 741 PHE n 
2 742 ALA n 
2 743 THR n 
2 744 ASN n 
2 745 THR n 
2 746 SER n 
2 747 GLU n 
2 748 ILE n 
2 749 SER n 
2 750 VAL n 
2 751 GLY n 
2 752 ASP n 
2 753 TYR n 
2 754 SER n 
2 755 GLY n 
2 756 GLN n 
2 757 PRO n 
2 758 TYR n 
2 759 PRO n 
2 760 THR n 
2 761 SER n 
2 762 LEU n 
2 763 VAL n 
2 764 LEU n 
2 765 LEU n 
2 766 LEU n 
2 767 ASN n 
2 768 SER n 
2 769 VAL n 
2 770 TYR n 
2 771 GLU n 
2 772 PHE n 
2 773 VAL n 
2 774 LYS n 
2 775 VAL n 
2 776 TYR n 
2 777 CYS n 
2 778 ASN n 
2 779 LEU n 
2 780 ASN n 
2 781 ASP n 
2 782 ILE n 
2 783 GLY n 
2 784 TYR n 
2 785 GLU n 
2 786 ILE n 
2 787 PHE n 
2 788 ILE n 
2 789 LYS n 
2 790 MET n 
2 791 ASN n 
2 792 LEU n 
2 793 ASN n 
2 794 ASP n 
2 795 HIS n 
2 796 GLU n 
2 797 ALA n 
2 798 SER n 
2 799 ASN n 
2 800 GLY n 
2 801 LEU n 
2 802 LEU n 
2 803 GLY n 
2 804 LYS n 
2 805 PHE n 
2 806 ASN n 
2 807 THR n 
2 808 ASN n 
2 809 LEU n 
2 810 LYS n 
2 811 GLU n 
2 812 ILE n 
2 813 VAL n 
2 814 SER n 
2 815 GLN n 
2 816 TYR n 
2 817 LYS n 
2 818 ASN n 
2 819 PHE n 
2 820 LYS n 
2 821 ASP n 
2 822 ARG n 
2 823 LEU n 
2 824 TYR n 
2 825 ILE n 
2 826 PHE n 
2 827 ARG n 
2 828 ALA n 
2 829 ASP n 
2 830 LEU n 
2 831 LYS n 
2 832 ASN n 
2 833 ASP n 
2 834 GLY n 
2 835 ASP n 
2 836 GLU n 
2 837 GLU n 
2 838 LEU n 
2 839 PHE n 
2 840 LEU n 
2 841 LEU n 
2 842 SER n 
2 843 LYS n 
2 844 SER n 
2 845 LEU n 
2 846 ARG n 
3 1   MET n 
3 2   GLY n 
3 3   GLY n 
3 4   GLU n 
3 5   ILE n 
3 6   ILE n 
3 7   THR n 
3 8   LEU n 
3 9   GLN n 
3 10  ALA n 
3 11  GLY n 
3 12  GLN n 
3 13  CYS n 
3 14  GLY n 
3 15  ASN n 
3 16  HIS n 
3 17  VAL n 
3 18  GLY n 
3 19  LYS n 
3 20  PHE n 
3 21  LEU n 
3 22  TRP n 
3 23  SER n 
3 24  GLN n 
3 25  LEU n 
3 26  ALA n 
3 27  LYS n 
3 28  GLU n 
3 29  HIS n 
3 30  ALA n 
3 31  ILE n 
3 32  GLY n 
3 33  THR n 
3 34  ASP n 
3 35  GLY n 
3 36  LEU n 
3 37  SER n 
3 38  GLN n 
3 39  LEU n 
3 40  PRO n 
3 41  ASP n 
3 42  SER n 
3 43  SER n 
3 44  THR n 
3 45  GLU n 
3 46  ARG n 
3 47  ASP n 
3 48  ASP n 
3 49  ASP n 
3 50  THR n 
3 51  LYS n 
3 52  PRO n 
3 53  PHE n 
3 54  PHE n 
3 55  ARG n 
3 56  GLU n 
3 57  ASN n 
3 58  CYS n 
3 59  ARG n 
3 60  ASN n 
3 61  LYS n 
3 62  PHE n 
3 63  THR n 
3 64  PRO n 
3 65  ARG n 
3 66  ALA n 
3 67  ILE n 
3 68  MET n 
3 69  MET n 
3 70  ASP n 
3 71  SER n 
3 72  GLU n 
3 73  PRO n 
3 74  SER n 
3 75  VAL n 
3 76  ILE n 
3 77  ALA n 
3 78  ASP n 
3 79  VAL n 
3 80  GLU n 
3 81  ASN n 
3 82  THR n 
3 83  PHE n 
3 84  ARG n 
3 85  GLY n 
3 86  PHE n 
3 87  PHE n 
3 88  ASP n 
3 89  PRO n 
3 90  ARG n 
3 91  ASN n 
3 92  THR n 
3 93  TRP n 
3 94  VAL n 
3 95  ALA n 
3 96  SER n 
3 97  ASP n 
3 98  GLY n 
3 99  ALA n 
3 100 SER n 
3 101 ALA n 
3 102 GLY n 
3 103 ASN n 
3 104 SER n 
3 105 TRP n 
3 106 ALA n 
3 107 ASN n 
3 108 GLY n 
3 109 TYR n 
3 110 ASP n 
3 111 ILE n 
3 112 GLY n 
3 113 THR n 
3 114 ARG n 
3 115 ASN n 
3 116 GLN n 
3 117 ASP n 
3 118 ASP n 
3 119 ILE n 
3 120 LEU n 
3 121 ASN n 
3 122 LYS n 
3 123 ILE n 
3 124 ASP n 
3 125 LYS n 
3 126 GLU n 
3 127 ILE n 
3 128 ASP n 
3 129 SER n 
3 130 THR n 
3 131 ASP n 
3 132 ASN n 
3 133 PHE n 
3 134 GLU n 
3 135 GLY n 
3 136 PHE n 
3 137 GLN n 
3 138 LEU n 
3 139 LEU n 
3 140 HIS n 
3 141 SER n 
3 142 VAL n 
3 143 ALA n 
3 144 GLY n 
3 145 GLY n 
3 146 THR n 
3 147 GLY n 
3 148 SER n 
3 149 GLY n 
3 150 LEU n 
3 151 GLY n 
3 152 SER n 
3 153 ASN n 
3 154 LEU n 
3 155 LEU n 
3 156 GLU n 
3 157 ALA n 
3 158 LEU n 
3 159 CYS n 
3 160 ASP n 
3 161 ARG n 
3 162 TYR n 
3 163 PRO n 
3 164 LYS n 
3 165 LYS n 
3 166 ILE n 
3 167 LEU n 
3 168 THR n 
3 169 THR n 
3 170 TYR n 
3 171 SER n 
3 172 VAL n 
3 173 PHE n 
3 174 PRO n 
3 175 ALA n 
3 176 ARG n 
3 177 SER n 
3 178 SER n 
3 179 GLU n 
3 180 VAL n 
3 181 VAL n 
3 182 VAL n 
3 183 GLN n 
3 184 SER n 
3 185 TYR n 
3 186 ASN n 
3 187 THR n 
3 188 ILE n 
3 189 LEU n 
3 190 ALA n 
3 191 LEU n 
3 192 ARG n 
3 193 ARG n 
3 194 LEU n 
3 195 ILE n 
3 196 GLU n 
3 197 ASP n 
3 198 SER n 
3 199 ASP n 
3 200 ALA n 
3 201 THR n 
3 202 VAL n 
3 203 VAL n 
3 204 PHE n 
3 205 ASP n 
3 206 ASN n 
3 207 ALA n 
3 208 SER n 
3 209 LEU n 
3 210 LEU n 
3 211 ASN n 
3 212 ILE n 
3 213 SER n 
3 214 GLY n 
3 215 LYS n 
3 216 VAL n 
3 217 PHE n 
3 218 ARG n 
3 219 ASN n 
3 220 PRO n 
3 221 ASN n 
3 222 ILE n 
3 223 ASP n 
3 224 LEU n 
3 225 GLN n 
3 226 HIS n 
3 227 THR n 
3 228 ASN n 
3 229 GLN n 
3 230 LEU n 
3 231 ILE n 
3 232 SER n 
3 233 THR n 
3 234 ILE n 
3 235 ILE n 
3 236 SER n 
3 237 SER n 
3 238 VAL n 
3 239 THR n 
3 240 ASN n 
3 241 SER n 
3 242 ILE n 
3 243 ARG n 
3 244 PHE n 
3 245 PRO n 
3 246 SER n 
3 247 TYR n 
3 248 MET n 
3 249 TYR n 
3 250 SER n 
3 251 SER n 
3 252 MET n 
3 253 SER n 
3 254 SER n 
3 255 ILE n 
3 256 TYR n 
3 257 SER n 
3 258 THR n 
3 259 LEU n 
3 260 ILE n 
3 261 PRO n 
3 262 SER n 
3 263 PRO n 
3 264 GLU n 
3 265 LEU n 
3 266 HIS n 
3 267 PHE n 
3 268 LEU n 
3 269 SER n 
3 270 PRO n 
3 271 SER n 
3 272 PHE n 
3 273 THR n 
3 274 PRO n 
3 275 PHE n 
3 276 THR n 
3 277 SER n 
3 278 ASP n 
3 279 TYR n 
3 280 ILE n 
3 281 HIS n 
3 282 ASP n 
3 283 ASP n 
3 284 ILE n 
3 285 ALA n 
3 286 HIS n 
3 287 LYS n 
3 288 CYS n 
3 289 HIS n 
3 290 SER n 
3 291 SER n 
3 292 TYR n 
3 293 ASP n 
3 294 VAL n 
3 295 MET n 
3 296 LEU n 
3 297 ASP n 
3 298 LEU n 
3 299 LEU n 
3 300 ASP n 
3 301 PRO n 
3 302 SER n 
3 303 ASN n 
3 304 SER n 
3 305 LEU n 
3 306 VAL n 
3 307 SER n 
3 308 THR n 
3 309 ALA n 
3 310 MET n 
3 311 ASN n 
3 312 ASN n 
3 313 PRO n 
3 314 THR n 
3 315 TYR n 
3 316 PHE n 
3 317 ASN n 
3 318 VAL n 
3 319 TYR n 
3 320 ASN n 
3 321 THR n 
3 322 ILE n 
3 323 ILE n 
3 324 GLY n 
3 325 ASN n 
3 326 VAL n 
3 327 GLU n 
3 328 PRO n 
3 329 ARG n 
3 330 GLN n 
3 331 ILE n 
3 332 SER n 
3 333 ARG n 
3 334 ALA n 
3 335 MET n 
3 336 THR n 
3 337 LYS n 
3 338 LEU n 
3 339 GLN n 
3 340 GLN n 
3 341 ARG n 
3 342 ILE n 
3 343 LYS n 
3 344 PHE n 
3 345 PRO n 
3 346 SER n 
3 347 TRP n 
3 348 SER n 
3 349 SER n 
3 350 SER n 
3 351 ALA n 
3 352 MET n 
3 353 HIS n 
3 354 VAL n 
3 355 ASN n 
3 356 ILE n 
3 357 GLY n 
3 358 ARG n 
3 359 ARG n 
3 360 SER n 
3 361 PRO n 
3 362 TYR n 
3 363 LEU n 
3 364 PRO n 
3 365 LEU n 
3 366 GLN n 
3 367 PRO n 
3 368 ASN n 
3 369 GLU n 
3 370 ASN n 
3 371 GLU n 
3 372 VAL n 
3 373 SER n 
3 374 GLY n 
3 375 MET n 
3 376 MET n 
3 377 LEU n 
3 378 SER n 
3 379 ASN n 
3 380 MET n 
3 381 SER n 
3 382 THR n 
3 383 VAL n 
3 384 VAL n 
3 385 ASN n 
3 386 VAL n 
3 387 PHE n 
3 388 GLU n 
3 389 ASN n 
3 390 ALA n 
3 391 CYS n 
3 392 ASN n 
3 393 THR n 
3 394 PHE n 
3 395 ASP n 
3 396 LYS n 
3 397 VAL n 
3 398 PHE n 
3 399 ALA n 
3 400 LYS n 
3 401 GLY n 
3 402 ALA n 
3 403 PHE n 
3 404 LEU n 
3 405 ASN n 
3 406 ASN n 
3 407 TYR n 
3 408 ASN n 
3 409 VAL n 
3 410 GLY n 
3 411 ASP n 
3 412 LEU n 
3 413 PHE n 
3 414 GLN n 
3 415 SER n 
3 416 MET n 
3 417 GLN n 
3 418 ASN n 
3 419 VAL n 
3 420 GLN n 
3 421 ASP n 
3 422 GLU n 
3 423 PHE n 
3 424 ALA n 
3 425 GLU n 
3 426 SER n 
3 427 ARG n 
3 428 GLU n 
3 429 VAL n 
3 430 VAL n 
3 431 GLN n 
3 432 SER n 
3 433 LEU n 
3 434 MET n 
3 435 GLU n 
3 436 ASP n 
3 437 TYR n 
3 438 VAL n 
3 439 ALA n 
3 440 ALA n 
3 441 GLU n 
3 442 GLN n 
3 443 ASP n 
3 444 SER n 
3 445 TYR n 
3 446 LEU n 
3 447 ASP n 
3 448 ASP n 
3 449 VAL n 
3 450 LEU n 
3 451 VAL n 
3 452 ASP n 
3 453 ASP n 
3 454 GLU n 
3 455 ASN n 
3 456 MET n 
3 457 VAL n 
3 458 GLY n 
3 459 GLU n 
3 460 LEU n 
3 461 GLU n 
3 462 GLU n 
3 463 ASP n 
3 464 LEU n 
3 465 ASP n 
3 466 ALA n 
3 467 ASP n 
3 468 GLY n 
3 469 ASP n 
3 470 HIS n 
3 471 LYS n 
3 472 LEU n 
3 473 VAL n 
4 1   UNK n 
4 2   UNK n 
4 3   UNK n 
4 4   UNK n 
4 5   UNK n 
4 6   UNK n 
4 7   UNK n 
4 8   UNK n 
4 9   UNK n 
4 10  UNK n 
4 11  UNK n 
4 12  UNK n 
4 13  UNK n 
4 14  UNK n 
4 15  UNK n 
4 16  UNK n 
4 17  UNK n 
4 18  UNK n 
4 19  UNK n 
4 20  UNK n 
4 21  UNK n 
4 22  UNK n 
4 23  UNK n 
4 24  UNK n 
4 25  UNK n 
4 26  UNK n 
4 27  UNK n 
4 28  UNK n 
4 29  UNK n 
4 30  UNK n 
4 31  UNK n 
4 32  UNK n 
4 33  UNK n 
4 34  UNK n 
4 35  UNK n 
4 36  UNK n 
4 37  UNK n 
4 38  UNK n 
4 39  UNK n 
4 40  UNK n 
4 41  UNK n 
4 42  UNK n 
4 43  UNK n 
4 44  UNK n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 
;BAKER'S YEAST
;
? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? 'UNIDENTIFIED BACULOVIRUS' 10469 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? 
2 1 sample ? ? ? 
;BAKER'S YEAST
;
? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? 'UNIDENTIFIED BACULOVIRUS' 10469 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? 
3 1 sample ? ? ? 
;BAKER'S YEAST
;
? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? 'UNIDENTIFIED BACULOVIRUS' 10469 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? 
4 1 sample ? ? ? 
;BAKER'S YEAST
;
? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? 'UNIDENTIFIED BACULOVIRUS' 10469 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP SPC97_YEAST 1 ? ? P38863 ? 
2 UNP SPC98_YEAST 2 ? ? P53540 ? 
3 UNP TBG_YEAST   3 ? ? P53378 ? 
4 PDB 5FLZ        4 ? ? 5FLZ   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5FLZ A 1 ? 823 ? P38863 1 ? 823 ? 1 823 
2 2 5FLZ B 1 ? 846 ? P53540 1 ? 846 ? 1 846 
3 3 5FLZ C 1 ? 473 ? P53378 1 ? 473 ? 1 473 
4 3 5FLZ D 1 ? 473 ? P53378 1 ? 473 ? 1 473 
5 4 5FLZ E 1 ? 44  ? 5FLZ   1 ? 44  ? 1 44  
6 4 5FLZ F 1 ? 44  ? 5FLZ   1 ? 44  ? 1 44  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 5FLZ CYS C 58  ? UNP P53378 SER 58  'engineered mutation' 58  1 
3 5FLZ CYS C 288 ? UNP P53378 GLY 288 'engineered mutation' 288 2 
4 5FLZ CYS D 58  ? UNP P53378 SER 58  'engineered mutation' 58  3 
4 5FLZ CYS D 288 ? UNP P53378 GLY 288 'engineered mutation' 288 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
UNK 'L-peptide linking' . UNKNOWN         ? 'C4 H9 N O2'     103.120 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          5FLZ 
_exptl.method            'ELECTRON MICROSCOPY' 
_exptl.crystals_number   ? 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 5FLZ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            6.90 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        16942 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               16942 
_refine_hist.d_res_high                       6.90 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  5FLZ 
_struct.title                     'Cryo-EM structure of gamma-TuSC oligomers in a closed conformation' 
_struct.pdbx_descriptor           
'SPINDLE POLE BODY COMPONENT SPC97, SPINDLE POLE BODY COMPONENT SPC98, TUBULIN GAMMA CHAIN, SPINDLE POLE BODY COMPONENT 110' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        5FLZ 
_struct_keywords.pdbx_keywords   'CELL CYCLE' 
_struct_keywords.text            'CELL CYCLE, MICROTUBULE NUCLEATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLN A 55  ? GLY A 69  ? GLN A 55  GLY A 69  1 ? 15 
HELX_P HELX_P2  2  ASP A 99  ? SER A 127 ? ASP A 99  SER A 127 1 ? 29 
HELX_P HELX_P3  3  GLY A 132 ? VAL A 165 ? GLY A 132 VAL A 165 1 ? 34 
HELX_P HELX_P4  4  ILE A 170 ? THR A 205 ? ILE A 170 THR A 205 1 ? 36 
HELX_P HELX_P5  5  LYS A 243 ? LEU A 259 ? LYS A 243 LEU A 259 1 ? 17 
HELX_P HELX_P6  6  ASP A 261 ? GLY A 290 ? ASP A 261 GLY A 290 1 ? 30 
HELX_P HELX_P7  7  LEU A 332 ? ASP A 336 ? LEU A 332 ASP A 336 5 ? 5  
HELX_P HELX_P8  8  SER A 337 ? SER A 360 ? SER A 337 SER A 360 1 ? 24 
HELX_P HELX_P9  9  LEU A 361 ? ILE A 363 ? LEU A 361 ILE A 363 5 ? 3  
HELX_P HELX_P10 10 ASP A 372 ? ASP A 383 ? ASP A 372 ASP A 383 1 ? 12 
HELX_P HELX_P11 11 GLU A 386 ? GLN A 411 ? GLU A 386 GLN A 411 1 ? 26 
HELX_P HELX_P12 12 ASP A 414 ? PHE A 426 ? ASP A 414 PHE A 426 1 ? 13 
HELX_P HELX_P13 13 SER A 431 ? LYS A 441 ? SER A 431 LYS A 441 1 ? 11 
HELX_P HELX_P14 14 ASN A 442 ? LYS A 448 ? ASN A 442 LYS A 448 1 ? 7  
HELX_P HELX_P15 15 ARG A 451 ? ARG A 469 ? ARG A 451 ARG A 469 1 ? 19 
HELX_P HELX_P16 16 ASN A 476 ? LEU A 481 ? ASN A 476 LEU A 481 1 ? 6  
HELX_P HELX_P17 17 SER A 555 ? HIS A 559 ? SER A 555 HIS A 559 1 ? 5  
HELX_P HELX_P18 18 PRO A 569 ? ILE A 573 ? PRO A 569 ILE A 573 5 ? 5  
HELX_P HELX_P19 19 SER A 575 ? LYS A 608 ? SER A 575 LYS A 608 1 ? 34 
HELX_P HELX_P20 20 THR A 609 ? TRP A 612 ? THR A 609 TRP A 612 5 ? 4  
HELX_P HELX_P21 21 ARG A 623 ? VAL A 651 ? ARG A 623 VAL A 651 1 ? 29 
HELX_P HELX_P22 22 VAL A 651 ? ASN A 665 ? VAL A 651 ASN A 665 1 ? 15 
HELX_P HELX_P23 23 LEU A 668 ? SER A 690 ? LEU A 668 SER A 690 1 ? 23 
HELX_P HELX_P24 24 LEU A 692 ? SER A 712 ? LEU A 692 SER A 712 1 ? 21 
HELX_P HELX_P25 25 GLU A 754 ? GLN A 784 ? GLU A 754 GLN A 784 1 ? 31 
HELX_P HELX_P26 26 SER A 787 ? VAL A 799 ? SER A 787 VAL A 799 1 ? 13 
HELX_P HELX_P27 27 PRO B 180 ? LEU B 193 ? PRO B 180 LEU B 193 1 ? 14 
HELX_P HELX_P28 28 PRO B 214 ? ARG B 242 ? PRO B 214 ARG B 242 1 ? 29 
HELX_P HELX_P29 29 SER B 247 ? SER B 274 ? SER B 247 SER B 274 1 ? 28 
HELX_P HELX_P30 30 SER B 279 ? ILE B 287 ? SER B 279 ILE B 287 1 ? 9  
HELX_P HELX_P31 31 ILE B 287 ? GLU B 305 ? ILE B 287 GLU B 305 1 ? 19 
HELX_P HELX_P32 32 ASP B 310 ? HIS B 322 ? ASP B 310 HIS B 322 1 ? 13 
HELX_P HELX_P33 33 ASP B 324 ? GLY B 353 ? ASP B 324 GLY B 353 1 ? 30 
HELX_P HELX_P34 34 PRO B 395 ? CYS B 416 ? PRO B 395 CYS B 416 1 ? 22 
HELX_P HELX_P35 35 TRP B 421 ? SER B 437 ? TRP B 421 SER B 437 1 ? 17 
HELX_P HELX_P36 36 ILE B 441 ? PHE B 468 ? ILE B 441 PHE B 468 1 ? 28 
HELX_P HELX_P37 37 HIS B 469 ? LEU B 482 ? HIS B 469 LEU B 482 1 ? 14 
HELX_P HELX_P38 38 LYS B 485 ? THR B 502 ? LYS B 485 THR B 502 1 ? 18 
HELX_P HELX_P39 39 ASP B 505 ? SER B 523 ? ASP B 505 SER B 523 1 ? 19 
HELX_P HELX_P40 40 SER B 535 ? GLY B 540 ? SER B 535 GLY B 540 1 ? 6  
HELX_P HELX_P41 41 VAL B 553 ? VAL B 557 ? VAL B 553 VAL B 557 1 ? 5  
HELX_P HELX_P42 42 TYR B 565 ? SER B 569 ? TYR B 565 SER B 569 5 ? 5  
HELX_P HELX_P43 43 PRO B 577 ? ASP B 609 ? PRO B 577 ASP B 609 1 ? 33 
HELX_P HELX_P44 44 ILE B 628 ? ILE B 656 ? ILE B 628 ILE B 656 1 ? 29 
HELX_P HELX_P45 45 ILE B 656 ? THR B 671 ? ILE B 656 THR B 671 1 ? 16 
HELX_P HELX_P46 46 ILE B 721 ? ALA B 742 ? ILE B 721 ALA B 742 1 ? 22 
HELX_P HELX_P47 47 PRO B 757 ? LEU B 779 ? PRO B 757 LEU B 779 1 ? 23 
HELX_P HELX_P48 48 SER B 798 ? ASP B 833 ? SER B 798 ASP B 833 1 ? 36 
HELX_P HELX_P49 49 ASP B 835 ? ARG B 846 ? ASP B 835 ARG B 846 1 ? 12 
HELX_P HELX_P50 50 ALA C 10  ? HIS C 29  ? ALA C 10  HIS C 29  1 ? 20 
HELX_P HELX_P51 51 GLN C 38  ? SER C 42  ? GLN C 38  SER C 42  5 ? 5  
HELX_P HELX_P52 52 ASP C 49  ? PHE C 53  ? ASP C 49  PHE C 53  1 ? 5  
HELX_P HELX_P53 53 SER C 71  ? ASN C 81  ? SER C 71  ASN C 81  1 ? 11 
HELX_P HELX_P54 54 SER C 104 ? ASN C 115 ? SER C 104 ASN C 115 1 ? 12 
HELX_P HELX_P55 55 ASN C 115 ? SER C 129 ? ASN C 115 SER C 129 1 ? 15 
HELX_P HELX_P56 56 GLY C 145 ? TYR C 162 ? GLY C 145 TYR C 162 1 ? 18 
HELX_P HELX_P57 57 VAL C 182 ? SER C 198 ? VAL C 182 SER C 198 1 ? 17 
HELX_P HELX_P58 58 ASN C 206 ? VAL C 216 ? ASN C 206 VAL C 216 1 ? 11 
HELX_P HELX_P59 59 ASP C 223 ? THR C 239 ? ASP C 223 THR C 239 1 ? 17 
HELX_P HELX_P60 60 SER C 251 ? ILE C 260 ? SER C 251 ILE C 260 1 ? 10 
HELX_P HELX_P61 61 CYS C 288 ? LEU C 296 ? CYS C 288 LEU C 296 1 ? 9  
HELX_P HELX_P62 62 PRO C 328 ? LYS C 343 ? PRO C 328 LYS C 343 1 ? 16 
HELX_P HELX_P63 63 VAL C 383 ? GLY C 401 ? VAL C 383 GLY C 401 1 ? 19 
HELX_P HELX_P64 64 LEU C 404 ? GLY C 410 ? LEU C 404 GLY C 410 1 ? 7  
HELX_P HELX_P65 65 GLY C 410 ? MET C 416 ? GLY C 410 MET C 416 1 ? 7  
HELX_P HELX_P66 66 GLN C 417 ? ALA C 439 ? GLN C 417 ALA C 439 1 ? 23 
HELX_P HELX_P67 67 ALA C 440 ? ASP C 443 ? ALA C 440 ASP C 443 5 ? 4  
HELX_P HELX_P68 68 ALA D 10  ? HIS D 29  ? ALA D 10  HIS D 29  1 ? 20 
HELX_P HELX_P69 69 SER D 71  ? ASN D 81  ? SER D 71  ASN D 81  1 ? 11 
HELX_P HELX_P70 70 ASP D 88  ? ARG D 90  ? ASP D 88  ARG D 90  5 ? 3  
HELX_P HELX_P71 71 SER D 104 ? ASN D 115 ? SER D 104 ASN D 115 1 ? 12 
HELX_P HELX_P72 72 ASN D 115 ? THR D 130 ? ASN D 115 THR D 130 1 ? 16 
HELX_P HELX_P73 73 GLY D 145 ? TYR D 162 ? GLY D 145 TYR D 162 1 ? 18 
HELX_P HELX_P74 74 VAL D 182 ? SER D 198 ? VAL D 182 SER D 198 1 ? 17 
HELX_P HELX_P75 75 ASN D 206 ? ARG D 218 ? ASN D 206 ARG D 218 1 ? 13 
HELX_P HELX_P76 76 ASP D 223 ? THR D 239 ? ASP D 223 THR D 239 1 ? 17 
HELX_P HELX_P77 77 THR D 239 ? PHE D 244 ? THR D 239 PHE D 244 1 ? 6  
HELX_P HELX_P78 78 SER D 251 ? ILE D 260 ? SER D 251 ILE D 260 1 ? 10 
HELX_P HELX_P79 79 CYS D 288 ? LEU D 298 ? CYS D 288 LEU D 298 1 ? 11 
HELX_P HELX_P80 80 PRO D 328 ? LYS D 343 ? PRO D 328 LYS D 343 1 ? 16 
HELX_P HELX_P81 81 VAL D 383 ? GLY D 401 ? VAL D 383 GLY D 401 1 ? 19 
HELX_P HELX_P82 82 LEU D 404 ? GLY D 410 ? LEU D 404 GLY D 410 1 ? 7  
HELX_P HELX_P83 83 ASP D 411 ? GLN D 414 ? ASP D 411 GLN D 414 5 ? 4  
HELX_P HELX_P84 84 GLN D 417 ? ALA D 439 ? GLN D 417 ALA D 439 1 ? 23 
HELX_P HELX_P85 85 ALA D 440 ? ASP D 443 ? ALA D 440 ASP D 443 5 ? 4  
HELX_P HELX_P86 86 UNK E 1   ? UNK E 44  ? UNK E 1   UNK E 44  1 ? 44 
HELX_P HELX_P87 87 UNK F 1   ? UNK F 44  ? UNK F 1   UNK F 44  1 ? 44 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  TYR 568 A . ? TYR 568 A PRO 569 A ? PRO 569 A 1  4.79   
2  THR 273 C . ? THR 273 C PRO 274 C ? PRO 274 C 1  -1.20  
3  THR 273 D . ? THR 273 D PRO 274 D ? PRO 274 D 1  -1.92  
4  TYR 568 A . ? TYR 568 A PRO 569 A ? PRO 569 A 2  -6.43  
5  THR 273 C . ? THR 273 C PRO 274 C ? PRO 274 C 2  -1.06  
6  THR 273 D . ? THR 273 D PRO 274 D ? PRO 274 D 2  -3.28  
7  ALA 309 D . ? ALA 309 D MET 310 D ? MET 310 D 2  -2.06  
8  TYR 568 A . ? TYR 568 A PRO 569 A ? PRO 569 A 3  -7.66  
9  THR 273 C . ? THR 273 C PRO 274 C ? PRO 274 C 3  0.64   
10 THR 273 D . ? THR 273 D PRO 274 D ? PRO 274 D 3  -8.31  
11 ALA 309 D . ? ALA 309 D MET 310 D ? MET 310 D 3  -4.34  
12 TYR 568 A . ? TYR 568 A PRO 569 A ? PRO 569 A 4  1.06   
13 PRO 566 B . ? PRO 566 B PRO 567 B ? PRO 567 B 4  -0.08  
14 THR 273 C . ? THR 273 C PRO 274 C ? PRO 274 C 4  -12.57 
15 THR 273 D . ? THR 273 D PRO 274 D ? PRO 274 D 4  0.56   
16 THR 129 A . ? THR 129 A SER 130 A ? SER 130 A 5  -2.96  
17 TYR 568 A . ? TYR 568 A PRO 569 A ? PRO 569 A 5  3.02   
18 PRO 566 B . ? PRO 566 B PRO 567 B ? PRO 567 B 5  9.07   
19 THR 273 C . ? THR 273 C PRO 274 C ? PRO 274 C 5  -0.92  
20 ALA 309 C . ? ALA 309 C MET 310 C ? MET 310 C 5  2.41   
21 THR 273 D . ? THR 273 D PRO 274 D ? PRO 274 D 5  -2.23  
22 ALA 309 D . ? ALA 309 D MET 310 D ? MET 310 D 5  -3.17  
23 TYR 568 A . ? TYR 568 A PRO 569 A ? PRO 569 A 6  -6.35  
24 THR 273 C . ? THR 273 C PRO 274 C ? PRO 274 C 6  -3.27  
25 THR 273 D . ? THR 273 D PRO 274 D ? PRO 274 D 6  1.14   
26 TYR 568 A . ? TYR 568 A PRO 569 A ? PRO 569 A 7  1.90   
27 THR 273 C . ? THR 273 C PRO 274 C ? PRO 274 C 7  -12.67 
28 THR 273 D . ? THR 273 D PRO 274 D ? PRO 274 D 7  -6.75  
29 THR 273 C . ? THR 273 C PRO 274 C ? PRO 274 C 8  0.41   
30 THR 273 D . ? THR 273 D PRO 274 D ? PRO 274 D 8  -14.45 
31 TYR 568 A . ? TYR 568 A PRO 569 A ? PRO 569 A 9  -9.95  
32 PRO 566 B . ? PRO 566 B PRO 567 B ? PRO 567 B 9  1.63   
33 THR 273 C . ? THR 273 C PRO 274 C ? PRO 274 C 9  -0.33  
34 THR 273 D . ? THR 273 D PRO 274 D ? PRO 274 D 9  -1.41  
35 TYR 568 A . ? TYR 568 A PRO 569 A ? PRO 569 A 10 -5.40  
36 PRO 566 B . ? PRO 566 B PRO 567 B ? PRO 567 B 10 -5.39  
37 THR 273 C . ? THR 273 C PRO 274 C ? PRO 274 C 10 -4.94  
38 THR 273 D . ? THR 273 D PRO 274 D ? PRO 274 D 10 -1.25  
39 ALA 309 D . ? ALA 309 D MET 310 D ? MET 310 D 10 5.48   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2  ? 
AB ? 2  ? 
AC ? 2  ? 
BA ? 2  ? 
BB ? 2  ? 
CA ? 10 ? 
CB ? 2  ? 
DA ? 10 ? 
DB ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2  ? anti-parallel 
AB 1 2  ? anti-parallel 
AC 1 2  ? anti-parallel 
BA 1 2  ? anti-parallel 
BB 1 2  ? anti-parallel 
CA 1 2  ? parallel      
CA 2 3  ? parallel      
CA 3 4  ? parallel      
CA 4 5  ? parallel      
CA 5 6  ? parallel      
CA 6 7  ? parallel      
CA 7 8  ? anti-parallel 
CA 8 9  ? anti-parallel 
CA 9 10 ? parallel      
CB 1 2  ? anti-parallel 
DA 1 2  ? parallel      
DA 2 3  ? parallel      
DA 3 4  ? parallel      
DA 4 5  ? parallel      
DA 5 6  ? parallel      
DA 6 7  ? parallel      
DA 7 8  ? anti-parallel 
DA 8 9  ? anti-parallel 
DA 9 10 ? parallel      
DB 1 2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  ARG A 76  ? TYR A 77  ? ARG A 76  TYR A 77  
AA 2  PHE A 92  ? LYS A 93  ? PHE A 92  LYS A 93  
AB 1  THR A 301 ? ASP A 303 ? THR A 301 ASP A 303 
AB 2  TYR A 324 ? ILE A 326 ? TYR A 324 ILE A 326 
AC 1  LEU A 482 ? PHE A 486 ? LEU A 482 PHE A 486 
AC 2  LEU A 560 ? ILE A 564 ? LEU A 560 ILE A 564 
BA 1  ILE B 364 ? GLU B 366 ? ILE B 364 GLU B 366 
BA 2  ILE B 383 ? PHE B 385 ? ILE B 383 PHE B 385 
BB 1  LEU B 541 ? VAL B 545 ? LEU B 541 VAL B 545 
BB 2  PHE B 558 ? TYR B 562 ? PHE B 558 TYR B 562 
CA 1  THR C 92  ? VAL C 94  ? THR C 92  VAL C 94  
CA 2  ALA C 66  ? ASP C 70  ? ALA C 66  ASP C 70  
CA 3  GLU C 4   ? GLN C 9   ? GLU C 4   GLN C 9   
CA 4  PHE C 133 ? SER C 141 ? PHE C 133 SER C 141 
CA 5  ILE C 166 ? PHE C 173 ? ILE C 166 PHE C 173 
CA 6  ALA C 200 ? ASP C 205 ? ALA C 200 ASP C 205 
CA 7  PHE C 267 ? THR C 273 ? PHE C 267 THR C 273 
CA 8  SER C 373 ? MET C 380 ? SER C 373 MET C 380 
CA 9  PHE C 316 ? GLY C 324 ? PHE C 316 GLY C 324 
CA 10 ASN C 355 ? SER C 360 ? ASN C 355 SER C 360 
CB 1  PHE C 54  ? GLU C 56  ? PHE C 54  GLU C 56  
CB 2  PHE C 62  ? PRO C 64  ? PHE C 62  PRO C 64  
DA 1  THR D 92  ? VAL D 94  ? THR D 92  VAL D 94  
DA 2  ALA D 66  ? ASP D 70  ? ALA D 66  ASP D 70  
DA 3  GLU D 4   ? GLN D 9   ? GLU D 4   GLN D 9   
DA 4  PHE D 133 ? SER D 141 ? PHE D 133 SER D 141 
DA 5  ILE D 166 ? PHE D 173 ? ILE D 166 PHE D 173 
DA 6  ALA D 200 ? ASP D 205 ? ALA D 200 ASP D 205 
DA 7  PHE D 267 ? THR D 273 ? PHE D 267 THR D 273 
DA 8  SER D 373 ? MET D 380 ? SER D 373 MET D 380 
DA 9  PHE D 316 ? GLY D 324 ? PHE D 316 GLY D 324 
DA 10 ASN D 355 ? SER D 360 ? ASN D 355 SER D 360 
DB 1  PHE D 54  ? GLU D 56  ? PHE D 54  GLU D 56  
DB 2  PHE D 62  ? PRO D 64  ? PHE D 62  PRO D 64  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2  N ARG A 76  ? N ARG A 76  O LYS A 93  ? O LYS A 93  
AB 1 2  N TYR A 302 ? N TYR A 302 O PHE A 325 ? O PHE A 325 
AC 1 2  N GLN A 485 ? N GLN A 485 O LYS A 561 ? O LYS A 561 
BA 1 2  N ALA B 365 ? N ALA B 365 O GLU B 384 ? O GLU B 384 
BB 1 2  N ARG B 544 ? N ARG B 544 O THR B 559 ? O THR B 559 
CA 1 2  N TRP C 93  ? N TRP C 93  O MET C 68  ? O MET C 68  
CA 2 3  N ILE C 67  ? N ILE C 67  O THR C 7   ? O THR C 7   
CA 3 4  O GLU C 4   ? O GLU C 4   N GLU C 134 ? N GLU C 134 
CA 4 5  N PHE C 136 ? N PHE C 136 O ILE C 166 ? O ILE C 166 
CA 5 6  N THR C 169 ? N THR C 169 O ALA C 200 ? O ALA C 200 
CA 6 7  N VAL C 203 ? N VAL C 203 O LEU C 268 ? O LEU C 268 
CA 7 8  N THR C 273 ? N THR C 273 O GLY C 374 ? O GLY C 374 
CA 8 9  O ASN C 379 ? O ASN C 379 N ASN C 317 ? N ASN C 317 
CA 9 10 N THR C 321 ? N THR C 321 O ILE C 356 ? O ILE C 356 
CB 1 2  N ARG C 55  ? N ARG C 55  O THR C 63  ? O THR C 63  
DA 1 2  N TRP D 93  ? N TRP D 93  O MET D 68  ? O MET D 68  
DA 2 3  N ILE D 67  ? N ILE D 67  O THR D 7   ? O THR D 7   
DA 3 4  O GLU D 4   ? O GLU D 4   N GLU D 134 ? N GLU D 134 
DA 4 5  N PHE D 136 ? N PHE D 136 O ILE D 166 ? O ILE D 166 
DA 5 6  N THR D 169 ? N THR D 169 O ALA D 200 ? O ALA D 200 
DA 6 7  N VAL D 203 ? N VAL D 203 O LEU D 268 ? O LEU D 268 
DA 7 8  N THR D 273 ? N THR D 273 O GLY D 374 ? O GLY D 374 
DA 8 9  O ASN D 379 ? O ASN D 379 N ASN D 317 ? N ASN D 317 
DA 9 10 N THR D 321 ? N THR D 321 O ILE D 356 ? O ILE D 356 
DB 1 2  N ARG D 55  ? N ARG D 55  O THR D 63  ? O THR D 63  
# 
_database_PDB_matrix.entry_id          5FLZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5FLZ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      N N   . GLN A 1 55  ? -29.024  -20.986 -63.898 1.00 0.00 ? 55  GLN A N   1  
ATOM 2      C CA  . GLN A 1 55  ? -30.110  -21.924 -63.785 1.00 0.00 ? 55  GLN A CA  1  
ATOM 3      C C   . GLN A 1 55  ? -30.139  -22.386 -62.404 1.00 0.00 ? 55  GLN A C   1  
ATOM 4      O O   . GLN A 1 55  ? -31.123  -22.384 -61.691 1.00 0.00 ? 55  GLN A O   1  
ATOM 5      C CB  . GLN A 1 55  ? -30.041  -23.114 -64.912 1.00 0.00 ? 55  GLN A CB  1  
ATOM 6      C CG  . GLN A 1 55  ? -28.747  -23.787 -65.316 1.00 0.00 ? 55  GLN A CG  1  
ATOM 7      C CD  . GLN A 1 55  ? -27.999  -23.031 -66.474 1.00 0.00 ? 55  GLN A CD  1  
ATOM 8      O OE1 . GLN A 1 55  ? -26.938  -22.492 -66.222 1.00 0.00 ? 55  GLN A OE1 1  
ATOM 9      N NE2 . GLN A 1 55  ? -28.718  -22.877 -67.661 1.00 0.00 ? 55  GLN A NE2 1  
ATOM 10     N N   . GLU A 1 56  ? -28.934  -22.878 -61.979 1.00 0.00 ? 56  GLU A N   1  
ATOM 11     C CA  . GLU A 1 56  ? -28.622  -23.456 -60.700 1.00 0.00 ? 56  GLU A CA  1  
ATOM 12     C C   . GLU A 1 56  ? -28.786  -22.486 -59.537 1.00 0.00 ? 56  GLU A C   1  
ATOM 13     O O   . GLU A 1 56  ? -29.354  -22.896 -58.539 1.00 0.00 ? 56  GLU A O   1  
ATOM 14     C CB  . GLU A 1 56  ? -27.120  -23.898 -60.696 1.00 0.00 ? 56  GLU A CB  1  
ATOM 15     C CG  . GLU A 1 56  ? -25.910  -22.977 -61.083 1.00 0.00 ? 56  GLU A CG  1  
ATOM 16     C CD  . GLU A 1 56  ? -26.040  -22.012 -62.283 1.00 0.00 ? 56  GLU A CD  1  
ATOM 17     O OE1 . GLU A 1 56  ? -25.978  -22.567 -63.411 1.00 0.00 ? 56  GLU A OE1 1  
ATOM 18     O OE2 . GLU A 1 56  ? -26.148  -20.756 -62.129 1.00 0.00 ? 56  GLU A OE2 1  
ATOM 19     N N   . ALA A 1 57  ? -28.334  -21.222 -59.780 1.00 0.00 ? 57  ALA A N   1  
ATOM 20     C CA  . ALA A 1 57  ? -28.420  -20.080 -58.918 1.00 0.00 ? 57  ALA A CA  1  
ATOM 21     C C   . ALA A 1 57  ? -29.835  -19.727 -58.662 1.00 0.00 ? 57  ALA A C   1  
ATOM 22     O O   . ALA A 1 57  ? -30.201  -19.431 -57.514 1.00 0.00 ? 57  ALA A O   1  
ATOM 23     C CB  . ALA A 1 57  ? -27.669  -18.955 -59.574 1.00 0.00 ? 57  ALA A CB  1  
ATOM 24     N N   . LEU A 1 58  ? -30.629  -19.806 -59.758 1.00 0.00 ? 58  LEU A N   1  
ATOM 25     C CA  . LEU A 1 58  ? -32.012  -19.450 -59.703 1.00 0.00 ? 58  LEU A CA  1  
ATOM 26     C C   . LEU A 1 58  ? -32.738  -20.407 -58.798 1.00 0.00 ? 58  LEU A C   1  
ATOM 27     O O   . LEU A 1 58  ? -33.614  -19.936 -58.102 1.00 0.00 ? 58  LEU A O   1  
ATOM 28     C CB  . LEU A 1 58  ? -32.680  -19.526 -61.067 1.00 0.00 ? 58  LEU A CB  1  
ATOM 29     C CG  . LEU A 1 58  ? -32.296  -18.327 -61.998 1.00 0.00 ? 58  LEU A CG  1  
ATOM 30     C CD1 . LEU A 1 58  ? -31.034  -18.577 -62.915 1.00 0.00 ? 58  LEU A CD1 1  
ATOM 31     C CD2 . LEU A 1 58  ? -33.378  -17.781 -63.023 1.00 0.00 ? 58  LEU A CD2 1  
ATOM 32     N N   . VAL A 1 59  ? -32.360  -21.713 -58.931 1.00 0.00 ? 59  VAL A N   1  
ATOM 33     C CA  . VAL A 1 59  ? -32.996  -22.783 -58.177 1.00 0.00 ? 59  VAL A CA  1  
ATOM 34     C C   . VAL A 1 59  ? -32.787  -22.656 -56.734 1.00 0.00 ? 59  VAL A C   1  
ATOM 35     O O   . VAL A 1 59  ? -33.766  -22.792 -56.011 1.00 0.00 ? 59  VAL A O   1  
ATOM 36     C CB  . VAL A 1 59  ? -32.430  -24.084 -58.848 1.00 0.00 ? 59  VAL A CB  1  
ATOM 37     C CG1 . VAL A 1 59  ? -32.508  -25.172 -57.740 1.00 0.00 ? 59  VAL A CG1 1  
ATOM 38     C CG2 . VAL A 1 59  ? -33.311  -24.406 -60.069 1.00 0.00 ? 59  VAL A CG2 1  
ATOM 39     N N   . VAL A 1 60  ? -31.544  -22.351 -56.300 1.00 0.00 ? 60  VAL A N   1  
ATOM 40     C CA  . VAL A 1 60  ? -31.214  -22.169 -54.874 1.00 0.00 ? 60  VAL A CA  1  
ATOM 41     C C   . VAL A 1 60  ? -31.932  -20.951 -54.249 1.00 0.00 ? 60  VAL A C   1  
ATOM 42     O O   . VAL A 1 60  ? -32.435  -21.100 -53.151 1.00 0.00 ? 60  VAL A O   1  
ATOM 43     C CB  . VAL A 1 60  ? -29.728  -22.263 -54.581 1.00 0.00 ? 60  VAL A CB  1  
ATOM 44     C CG1 . VAL A 1 60  ? -29.117  -23.602 -54.993 1.00 0.00 ? 60  VAL A CG1 1  
ATOM 45     C CG2 . VAL A 1 60  ? -28.942  -21.115 -55.285 1.00 0.00 ? 60  VAL A CG2 1  
ATOM 46     N N   . LYS A 1 61  ? -32.068  -19.791 -54.993 1.00 0.00 ? 61  LYS A N   1  
ATOM 47     C CA  . LYS A 1 61  ? -32.763  -18.598 -54.570 1.00 0.00 ? 61  LYS A CA  1  
ATOM 48     C C   . LYS A 1 61  ? -34.226  -18.929 -54.434 1.00 0.00 ? 61  LYS A C   1  
ATOM 49     O O   . LYS A 1 61  ? -34.835  -18.564 -53.444 1.00 0.00 ? 61  LYS A O   1  
ATOM 50     C CB  . LYS A 1 61  ? -32.601  -17.429 -55.602 1.00 0.00 ? 61  LYS A CB  1  
ATOM 51     C CG  . LYS A 1 61  ? -32.569  -16.022 -54.845 1.00 0.00 ? 61  LYS A CG  1  
ATOM 52     C CD  . LYS A 1 61  ? -31.462  -15.031 -55.434 1.00 0.00 ? 61  LYS A CD  1  
ATOM 53     C CE  . LYS A 1 61  ? -31.184  -13.832 -54.531 1.00 0.00 ? 61  LYS A CE  1  
ATOM 54     N NZ  . LYS A 1 61  ? -30.099  -13.023 -55.165 1.00 0.00 ? 61  LYS A NZ  1  
ATOM 55     N N   . ASP A 1 62  ? -34.783  -19.706 -55.359 1.00 0.00 ? 62  ASP A N   1  
ATOM 56     C CA  . ASP A 1 62  ? -36.148  -20.187 -55.348 1.00 0.00 ? 62  ASP A CA  1  
ATOM 57     C C   . ASP A 1 62  ? -36.326  -21.131 -54.110 1.00 0.00 ? 62  ASP A C   1  
ATOM 58     O O   . ASP A 1 62  ? -37.374  -21.150 -53.433 1.00 0.00 ? 62  ASP A O   1  
ATOM 59     C CB  . ASP A 1 62  ? -36.529  -20.818 -56.710 1.00 0.00 ? 62  ASP A CB  1  
ATOM 60     C CG  . ASP A 1 62  ? -38.045  -21.038 -56.797 1.00 0.00 ? 62  ASP A CG  1  
ATOM 61     O OD1 . ASP A 1 62  ? -38.746  -20.055 -57.055 1.00 0.00 ? 62  ASP A OD1 1  
ATOM 62     O OD2 . ASP A 1 62  ? -38.499  -22.195 -56.502 1.00 0.00 ? 62  ASP A OD2 1  
ATOM 63     N N   . LEU A 1 63  ? -35.342  -21.937 -53.778 1.00 0.00 ? 63  LEU A N   1  
ATOM 64     C CA  . LEU A 1 63  ? -35.332  -22.917 -52.672 1.00 0.00 ? 63  LEU A CA  1  
ATOM 65     C C   . LEU A 1 63  ? -35.429  -22.338 -51.358 1.00 0.00 ? 63  LEU A C   1  
ATOM 66     O O   . LEU A 1 63  ? -36.180  -22.833 -50.489 1.00 0.00 ? 63  LEU A O   1  
ATOM 67     C CB  . LEU A 1 63  ? -34.135  -23.869 -52.757 1.00 0.00 ? 63  LEU A CB  1  
ATOM 68     C CG  . LEU A 1 63  ? -34.042  -24.959 -51.674 1.00 0.00 ? 63  LEU A CG  1  
ATOM 69     C CD1 . LEU A 1 63  ? -35.163  -25.962 -51.661 1.00 0.00 ? 63  LEU A CD1 1  
ATOM 70     C CD2 . LEU A 1 63  ? -32.677  -25.687 -51.890 1.00 0.00 ? 63  LEU A CD2 1  
ATOM 71     N N   . LEU A 1 64  ? -34.700  -21.216 -51.094 1.00 0.00 ? 64  LEU A N   1  
ATOM 72     C CA  . LEU A 1 64  ? -34.730  -20.485 -49.865 1.00 0.00 ? 64  LEU A CA  1  
ATOM 73     C C   . LEU A 1 64  ? -36.031  -19.902 -49.566 1.00 0.00 ? 64  LEU A C   1  
ATOM 74     O O   . LEU A 1 64  ? -36.539  -19.999 -48.468 1.00 0.00 ? 64  LEU A O   1  
ATOM 75     C CB  . LEU A 1 64  ? -33.699  -19.300 -49.952 1.00 0.00 ? 64  LEU A CB  1  
ATOM 76     C CG  . LEU A 1 64  ? -33.285  -18.681 -48.645 1.00 0.00 ? 64  LEU A CG  1  
ATOM 77     C CD1 . LEU A 1 64  ? -32.411  -19.695 -47.856 1.00 0.00 ? 64  LEU A CD1 1  
ATOM 78     C CD2 . LEU A 1 64  ? -32.372  -17.484 -48.949 1.00 0.00 ? 64  LEU A CD2 1  
ATOM 79     N N   . ASN A 1 65  ? -36.607  -19.350 -50.628 1.00 0.00 ? 65  ASN A N   1  
ATOM 80     C CA  . ASN A 1 65  ? -37.923  -18.756 -50.567 1.00 0.00 ? 65  ASN A CA  1  
ATOM 81     C C   . ASN A 1 65  ? -38.976  -19.832 -50.242 1.00 0.00 ? 65  ASN A C   1  
ATOM 82     O O   . ASN A 1 65  ? -39.854  -19.592 -49.417 1.00 0.00 ? 65  ASN A O   1  
ATOM 83     C CB  . ASN A 1 65  ? -38.371  -18.135 -51.978 1.00 0.00 ? 65  ASN A CB  1  
ATOM 84     C CG  . ASN A 1 65  ? -37.627  -16.840 -52.281 1.00 0.00 ? 65  ASN A CG  1  
ATOM 85     O OD1 . ASN A 1 65  ? -37.139  -16.738 -53.425 1.00 0.00 ? 65  ASN A OD1 1  
ATOM 86     N ND2 . ASN A 1 65  ? -37.536  -15.889 -51.276 1.00 0.00 ? 65  ASN A ND2 1  
ATOM 87     N N   . VAL A 1 66  ? -38.878  -21.028 -50.828 1.00 0.00 ? 66  VAL A N   1  
ATOM 88     C CA  . VAL A 1 66  ? -39.854  -22.131 -50.619 1.00 0.00 ? 66  VAL A CA  1  
ATOM 89     C C   . VAL A 1 66  ? -39.885  -22.674 -49.161 1.00 0.00 ? 66  VAL A C   1  
ATOM 90     O O   . VAL A 1 66  ? -40.900  -23.011 -48.537 1.00 0.00 ? 66  VAL A O   1  
ATOM 91     C CB  . VAL A 1 66  ? -39.629  -23.156 -51.741 1.00 0.00 ? 66  VAL A CB  1  
ATOM 92     C CG1 . VAL A 1 66  ? -40.251  -24.513 -51.408 1.00 0.00 ? 66  VAL A CG1 1  
ATOM 93     C CG2 . VAL A 1 66  ? -40.178  -22.772 -53.071 1.00 0.00 ? 66  VAL A CG2 1  
ATOM 94     N N   . LEU A 1 67  ? -38.597  -22.762 -48.668 1.00 0.00 ? 67  LEU A N   1  
ATOM 95     C CA  . LEU A 1 67  ? -38.306  -23.334 -47.393 1.00 0.00 ? 67  LEU A CA  1  
ATOM 96     C C   . LEU A 1 67  ? -38.899  -22.612 -46.210 1.00 0.00 ? 67  LEU A C   1  
ATOM 97     O O   . LEU A 1 67  ? -39.272  -23.243 -45.248 1.00 0.00 ? 67  LEU A O   1  
ATOM 98     C CB  . LEU A 1 67  ? -36.759  -23.403 -47.196 1.00 0.00 ? 67  LEU A CB  1  
ATOM 99     C CG  . LEU A 1 67  ? -36.210  -23.806 -45.802 1.00 0.00 ? 67  LEU A CG  1  
ATOM 100    C CD1 . LEU A 1 67  ? -36.675  -25.241 -45.367 1.00 0.00 ? 67  LEU A CD1 1  
ATOM 101    C CD2 . LEU A 1 67  ? -34.657  -23.679 -45.736 1.00 0.00 ? 67  LEU A CD2 1  
ATOM 102    N N   . ILE A 1 68  ? -38.984  -21.231 -46.313 1.00 0.00 ? 68  ILE A N   1  
ATOM 103    C CA  . ILE A 1 68  ? -39.651  -20.596 -45.248 1.00 0.00 ? 68  ILE A CA  1  
ATOM 104    C C   . ILE A 1 68  ? -41.171  -20.954 -45.215 1.00 0.00 ? 68  ILE A C   1  
ATOM 105    O O   . ILE A 1 68  ? -41.817  -21.082 -44.187 1.00 0.00 ? 68  ILE A O   1  
ATOM 106    C CB  . ILE A 1 68  ? -39.381  -19.085 -45.169 1.00 0.00 ? 68  ILE A CB  1  
ATOM 107    C CG1 . ILE A 1 68  ? -40.136  -18.386 -44.056 1.00 0.00 ? 68  ILE A CG1 1  
ATOM 108    C CG2 . ILE A 1 68  ? -39.790  -18.435 -46.477 1.00 0.00 ? 68  ILE A CG2 1  
ATOM 109    C CD1 . ILE A 1 68  ? -39.871  -16.874 -43.970 1.00 0.00 ? 68  ILE A CD1 1  
ATOM 110    N N   . GLY A 1 69  ? -41.817  -21.317 -46.357 1.00 0.00 ? 69  GLY A N   1  
ATOM 111    C CA  . GLY A 1 69  ? -43.102  -21.888 -46.384 1.00 0.00 ? 69  GLY A CA  1  
ATOM 112    C C   . GLY A 1 69  ? -44.130  -20.805 -46.167 1.00 0.00 ? 69  GLY A C   1  
ATOM 113    O O   . GLY A 1 69  ? -45.034  -20.981 -45.354 1.00 0.00 ? 69  GLY A O   1  
ATOM 114    N N   . LEU A 1 70  ? -43.846  -19.667 -46.910 1.00 0.00 ? 70  LEU A N   1  
ATOM 115    C CA  . LEU A 1 70  ? -44.863  -18.580 -46.927 1.00 0.00 ? 70  LEU A CA  1  
ATOM 116    C C   . LEU A 1 70  ? -46.088  -18.907 -47.704 1.00 0.00 ? 70  LEU A C   1  
ATOM 117    O O   . LEU A 1 70  ? -45.976  -19.699 -48.673 1.00 0.00 ? 70  LEU A O   1  
ATOM 118    C CB  . LEU A 1 70  ? -44.349  -17.155 -47.211 1.00 0.00 ? 70  LEU A CB  1  
ATOM 119    C CG  . LEU A 1 70  ? -43.460  -16.677 -46.054 1.00 0.00 ? 70  LEU A CG  1  
ATOM 120    C CD1 . LEU A 1 70  ? -42.636  -15.485 -46.401 1.00 0.00 ? 70  LEU A CD1 1  
ATOM 121    C CD2 . LEU A 1 70  ? -44.185  -16.396 -44.788 1.00 0.00 ? 70  LEU A CD2 1  
ATOM 122    N N   . GLU A 1 71  ? -47.283  -18.329 -47.365 1.00 0.00 ? 71  GLU A N   1  
ATOM 123    C CA  . GLU A 1 71  ? -48.536  -18.533 -48.035 1.00 0.00 ? 71  GLU A CA  1  
ATOM 124    C C   . GLU A 1 71  ? -48.734  -17.518 -49.130 1.00 0.00 ? 71  GLU A C   1  
ATOM 125    O O   . GLU A 1 71  ? -47.868  -16.613 -49.305 1.00 0.00 ? 71  GLU A O   1  
ATOM 126    C CB  . GLU A 1 71  ? -49.778  -18.500 -47.095 1.00 0.00 ? 71  GLU A CB  1  
ATOM 127    C CG  . GLU A 1 71  ? -50.166  -17.119 -46.473 1.00 0.00 ? 71  GLU A CG  1  
ATOM 128    C CD  . GLU A 1 71  ? -51.435  -17.327 -45.649 1.00 0.00 ? 71  GLU A CD  1  
ATOM 129    O OE1 . GLU A 1 71  ? -52.488  -17.720 -46.196 1.00 0.00 ? 71  GLU A OE1 1  
ATOM 130    O OE2 . GLU A 1 71  ? -51.364  -17.006 -44.443 1.00 0.00 ? 71  GLU A OE2 1  
ATOM 131    N N   . GLY A 1 72  ? -49.783  -17.637 -49.997 1.00 0.00 ? 72  GLY A N   1  
ATOM 132    C CA  . GLY A 1 72  ? -49.879  -16.744 -51.080 1.00 0.00 ? 72  GLY A CA  1  
ATOM 133    C C   . GLY A 1 72  ? -51.033  -17.067 -51.956 1.00 0.00 ? 72  GLY A C   1  
ATOM 134    O O   . GLY A 1 72  ? -51.916  -17.858 -51.566 1.00 0.00 ? 72  GLY A O   1  
ATOM 135    N N   . THR A 1 73  ? -50.995  -16.543 -53.193 1.00 0.00 ? 73  THR A N   1  
ATOM 136    C CA  . THR A 1 73  ? -51.982  -16.852 -54.212 1.00 0.00 ? 73  THR A CA  1  
ATOM 137    C C   . THR A 1 73  ? -51.374  -17.936 -55.044 1.00 0.00 ? 73  THR A C   1  
ATOM 138    O O   . THR A 1 73  ? -52.039  -18.756 -55.664 1.00 0.00 ? 73  THR A O   1  
ATOM 139    C CB  . THR A 1 73  ? -52.212  -15.581 -55.082 1.00 0.00 ? 73  THR A CB  1  
ATOM 140    O OG1 . THR A 1 73  ? -53.371  -15.785 -55.805 1.00 0.00 ? 73  THR A OG1 1  
ATOM 141    C CG2 . THR A 1 73  ? -50.991  -15.257 -55.996 1.00 0.00 ? 73  THR A CG2 1  
ATOM 142    N N   . TYR A 1 74  ? -50.027  -17.985 -55.120 1.00 0.00 ? 74  TYR A N   1  
ATOM 143    C CA  . TYR A 1 74  ? -49.447  -19.025 -56.033 1.00 0.00 ? 74  TYR A CA  1  
ATOM 144    C C   . TYR A 1 74  ? -49.526  -20.371 -55.357 1.00 0.00 ? 74  TYR A C   1  
ATOM 145    O O   . TYR A 1 74  ? -49.647  -21.376 -56.043 1.00 0.00 ? 74  TYR A O   1  
ATOM 146    C CB  . TYR A 1 74  ? -47.957  -18.527 -56.326 1.00 0.00 ? 74  TYR A CB  1  
ATOM 147    C CG  . TYR A 1 74  ? -46.829  -18.578 -55.336 1.00 0.00 ? 74  TYR A CG  1  
ATOM 148    C CD1 . TYR A 1 74  ? -46.882  -18.228 -53.951 1.00 0.00 ? 74  TYR A CD1 1  
ATOM 149    C CD2 . TYR A 1 74  ? -45.648  -18.865 -55.828 1.00 0.00 ? 74  TYR A CD2 1  
ATOM 150    C CE1 . TYR A 1 74  ? -45.730  -18.142 -53.144 1.00 0.00 ? 74  TYR A CE1 1  
ATOM 151    C CE2 . TYR A 1 74  ? -44.499  -18.906 -55.043 1.00 0.00 ? 74  TYR A CE2 1  
ATOM 152    C CZ  . TYR A 1 74  ? -44.510  -18.444 -53.723 1.00 0.00 ? 74  TYR A CZ  1  
ATOM 153    O OH  . TYR A 1 74  ? -43.241  -18.475 -52.992 1.00 0.00 ? 74  TYR A OH  1  
ATOM 154    N N   . ILE A 1 75  ? -49.498  -20.364 -54.036 1.00 0.00 ? 75  ILE A N   1  
ATOM 155    C CA  . ILE A 1 75  ? -49.575  -21.494 -53.127 1.00 0.00 ? 75  ILE A CA  1  
ATOM 156    C C   . ILE A 1 75  ? -50.946  -21.505 -52.627 1.00 0.00 ? 75  ILE A C   1  
ATOM 157    O O   . ILE A 1 75  ? -51.304  -20.583 -51.870 1.00 0.00 ? 75  ILE A O   1  
ATOM 158    C CB  . ILE A 1 75  ? -48.566  -21.690 -51.957 1.00 0.00 ? 75  ILE A CB  1  
ATOM 159    C CG1 . ILE A 1 75  ? -49.044  -22.935 -51.119 1.00 0.00 ? 75  ILE A CG1 1  
ATOM 160    C CG2 . ILE A 1 75  ? -48.374  -20.410 -51.127 1.00 0.00 ? 75  ILE A CG2 1  
ATOM 161    C CD1 . ILE A 1 75  ? -48.144  -23.265 -49.915 1.00 0.00 ? 75  ILE A CD1 1  
ATOM 162    N N   . ARG A 1 76  ? -51.757  -22.427 -53.137 1.00 0.00 ? 76  ARG A N   1  
ATOM 163    C CA  . ARG A 1 76  ? -53.189  -22.342 -52.926 1.00 0.00 ? 76  ARG A CA  1  
ATOM 164    C C   . ARG A 1 76  ? -53.590  -23.269 -51.810 1.00 0.00 ? 76  ARG A C   1  
ATOM 165    O O   . ARG A 1 76  ? -52.684  -23.944 -51.296 1.00 0.00 ? 76  ARG A O   1  
ATOM 166    C CB  . ARG A 1 76  ? -54.081  -22.446 -54.210 1.00 0.00 ? 76  ARG A CB  1  
ATOM 167    C CG  . ARG A 1 76  ? -54.085  -21.037 -54.842 1.00 0.00 ? 76  ARG A CG  1  
ATOM 168    C CD  . ARG A 1 76  ? -55.259  -20.161 -54.286 1.00 0.00 ? 76  ARG A CD  1  
ATOM 169    N NE  . ARG A 1 76  ? -55.353  -18.675 -54.800 1.00 0.00 ? 76  ARG A NE  1  
ATOM 170    C CZ  . ARG A 1 76  ? -55.605  -17.599 -53.965 1.00 0.00 ? 76  ARG A CZ  1  
ATOM 171    N NH1 . ARG A 1 76  ? -55.485  -17.728 -52.593 1.00 0.00 ? 76  ARG A NH1 1  
ATOM 172    N NH2 . ARG A 1 76  ? -55.863  -16.410 -54.538 1.00 0.00 ? 76  ARG A NH2 1  
ATOM 173    N N   . TYR A 1 77  ? -54.855  -23.098 -51.330 1.00 0.00 ? 77  TYR A N   1  
ATOM 174    C CA  . TYR A 1 77  ? -55.424  -23.584 -50.108 1.00 0.00 ? 77  TYR A CA  1  
ATOM 175    C C   . TYR A 1 77  ? -56.546  -24.493 -50.420 1.00 0.00 ? 77  TYR A C   1  
ATOM 176    O O   . TYR A 1 77  ? -57.428  -24.109 -51.171 1.00 0.00 ? 77  TYR A O   1  
ATOM 177    C CB  . TYR A 1 77  ? -55.935  -22.424 -49.231 1.00 0.00 ? 77  TYR A CB  1  
ATOM 178    C CG  . TYR A 1 77  ? -56.673  -22.762 -47.925 1.00 0.00 ? 77  TYR A CG  1  
ATOM 179    C CD1 . TYR A 1 77  ? -56.176  -23.712 -46.993 1.00 0.00 ? 77  TYR A CD1 1  
ATOM 180    C CD2 . TYR A 1 77  ? -57.873  -22.123 -47.631 1.00 0.00 ? 77  TYR A CD2 1  
ATOM 181    C CE1 . TYR A 1 77  ? -56.836  -23.792 -45.745 1.00 0.00 ? 77  TYR A CE1 1  
ATOM 182    C CE2 . TYR A 1 77  ? -58.503  -22.155 -46.395 1.00 0.00 ? 77  TYR A CE2 1  
ATOM 183    C CZ  . TYR A 1 77  ? -57.937  -22.976 -45.412 1.00 0.00 ? 77  TYR A CZ  1  
ATOM 184    O OH  . TYR A 1 77  ? -58.538  -23.084 -44.155 1.00 0.00 ? 77  TYR A OH  1  
ATOM 185    N N   . PHE A 1 78  ? -56.517  -25.686 -49.813 1.00 0.00 ? 78  PHE A N   1  
ATOM 186    C CA  . PHE A 1 78  ? -57.619  -26.612 -49.860 1.00 0.00 ? 78  PHE A CA  1  
ATOM 187    C C   . PHE A 1 78  ? -57.951  -26.640 -48.372 1.00 0.00 ? 78  PHE A C   1  
ATOM 188    O O   . PHE A 1 78  ? -57.007  -26.556 -47.577 1.00 0.00 ? 78  PHE A O   1  
ATOM 189    C CB  . PHE A 1 78  ? -57.286  -27.983 -50.430 1.00 0.00 ? 78  PHE A CB  1  
ATOM 190    C CG  . PHE A 1 78  ? -56.708  -27.794 -51.826 1.00 0.00 ? 78  PHE A CG  1  
ATOM 191    C CD1 . PHE A 1 78  ? -57.517  -27.574 -52.920 1.00 0.00 ? 78  PHE A CD1 1  
ATOM 192    C CD2 . PHE A 1 78  ? -55.318  -27.520 -52.001 1.00 0.00 ? 78  PHE A CD2 1  
ATOM 193    C CE1 . PHE A 1 78  ? -57.101  -27.052 -54.137 1.00 0.00 ? 78  PHE A CE1 1  
ATOM 194    C CE2 . PHE A 1 78  ? -54.906  -27.008 -53.216 1.00 0.00 ? 78  PHE A CE2 1  
ATOM 195    C CZ  . PHE A 1 78  ? -55.735  -26.754 -54.291 1.00 0.00 ? 78  PHE A CZ  1  
ATOM 196    N N   . ASN A 1 79  ? -59.244  -26.482 -48.036 1.00 0.00 ? 79  ASN A N   1  
ATOM 197    C CA  . ASN A 1 79  ? -59.678  -26.079 -46.681 1.00 0.00 ? 79  ASN A CA  1  
ATOM 198    C C   . ASN A 1 79  ? -59.295  -27.111 -45.675 1.00 0.00 ? 79  ASN A C   1  
ATOM 199    O O   . ASN A 1 79  ? -58.648  -26.763 -44.671 1.00 0.00 ? 79  ASN A O   1  
ATOM 200    C CB  . ASN A 1 79  ? -61.211  -25.881 -46.529 1.00 0.00 ? 79  ASN A CB  1  
ATOM 201    C CG  . ASN A 1 79  ? -61.498  -25.138 -45.203 1.00 0.00 ? 79  ASN A CG  1  
ATOM 202    O OD1 . ASN A 1 79  ? -61.692  -25.796 -44.195 1.00 0.00 ? 79  ASN A OD1 1  
ATOM 203    N ND2 . ASN A 1 79  ? -61.635  -23.772 -45.311 1.00 0.00 ? 79  ASN A ND2 1  
ATOM 204    N N   . ASP A 1 80  ? -59.532  -28.403 -45.839 1.00 0.00 ? 80  ASP A N   1  
ATOM 205    C CA  . ASP A 1 80  ? -59.297  -29.454 -44.892 1.00 0.00 ? 80  ASP A CA  1  
ATOM 206    C C   . ASP A 1 80  ? -57.826  -29.607 -44.615 1.00 0.00 ? 80  ASP A C   1  
ATOM 207    O O   . ASP A 1 80  ? -57.028  -28.838 -45.214 1.00 0.00 ? 80  ASP A O   1  
ATOM 208    C CB  . ASP A 1 80  ? -59.993  -30.760 -45.359 1.00 0.00 ? 80  ASP A CB  1  
ATOM 209    C CG  . ASP A 1 80  ? -59.534  -31.245 -46.763 1.00 0.00 ? 80  ASP A CG  1  
ATOM 210    O OD1 . ASP A 1 80  ? -59.852  -30.561 -47.726 1.00 0.00 ? 80  ASP A OD1 1  
ATOM 211    O OD2 . ASP A 1 80  ? -58.829  -32.291 -46.793 1.00 0.00 ? 80  ASP A OD2 1  
ATOM 212    N N   . ILE A 1 90  ? -56.537  -30.856 -48.660 1.00 0.00 ? 90  ILE A N   1  
ATOM 213    C CA  . ILE A 1 90  ? -55.184  -31.351 -48.162 1.00 0.00 ? 90  ILE A CA  1  
ATOM 214    C C   . ILE A 1 90  ? -54.634  -30.344 -47.178 1.00 0.00 ? 90  ILE A C   1  
ATOM 215    O O   . ILE A 1 90  ? -54.094  -30.894 -46.212 1.00 0.00 ? 90  ILE A O   1  
ATOM 216    C CB  . ILE A 1 90  ? -54.222  -31.649 -49.358 1.00 0.00 ? 90  ILE A CB  1  
ATOM 217    C CG1 . ILE A 1 90  ? -52.721  -31.842 -48.907 1.00 0.00 ? 90  ILE A CG1 1  
ATOM 218    C CG2 . ILE A 1 90  ? -54.369  -30.554 -50.443 1.00 0.00 ? 90  ILE A CG2 1  
ATOM 219    C CD1 . ILE A 1 90  ? -51.751  -32.137 -50.064 1.00 0.00 ? 90  ILE A CD1 1  
ATOM 220    N N   . GLU A 1 91  ? -54.747  -29.060 -47.470 1.00 0.00 ? 91  GLU A N   1  
ATOM 221    C CA  . GLU A 1 91  ? -54.138  -27.944 -46.705 1.00 0.00 ? 91  GLU A CA  1  
ATOM 222    C C   . GLU A 1 91  ? -53.700  -27.087 -47.839 1.00 0.00 ? 91  GLU A C   1  
ATOM 223    O O   . GLU A 1 91  ? -54.317  -27.156 -48.942 1.00 0.00 ? 91  GLU A O   1  
ATOM 224    C CB  . GLU A 1 91  ? -52.862  -28.306 -45.804 1.00 0.00 ? 91  GLU A CB  1  
ATOM 225    C CG  . GLU A 1 91  ? -51.608  -28.808 -46.493 1.00 0.00 ? 91  GLU A CG  1  
ATOM 226    C CD  . GLU A 1 91  ? -50.792  -29.768 -45.565 1.00 0.00 ? 91  GLU A CD  1  
ATOM 227    O OE1 . GLU A 1 91  ? -51.216  -29.983 -44.380 1.00 0.00 ? 91  GLU A OE1 1  
ATOM 228    O OE2 . GLU A 1 91  ? -49.791  -30.319 -46.048 1.00 0.00 ? 91  GLU A OE2 1  
ATOM 229    N N   . PHE A 1 92  ? -52.595  -26.323 -47.613 1.00 0.00 ? 92  PHE A N   1  
ATOM 230    C CA  . PHE A 1 92  ? -52.011  -25.545 -48.661 1.00 0.00 ? 92  PHE A CA  1  
ATOM 231    C C   . PHE A 1 92  ? -51.245  -26.533 -49.590 1.00 0.00 ? 92  PHE A C   1  
ATOM 232    O O   . PHE A 1 92  ? -50.405  -27.305 -49.173 1.00 0.00 ? 92  PHE A O   1  
ATOM 233    C CB  . PHE A 1 92  ? -50.932  -24.569 -48.182 1.00 0.00 ? 92  PHE A CB  1  
ATOM 234    C CG  . PHE A 1 92  ? -51.435  -23.392 -47.411 1.00 0.00 ? 92  PHE A CG  1  
ATOM 235    C CD1 . PHE A 1 92  ? -51.989  -22.350 -48.152 1.00 0.00 ? 92  PHE A CD1 1  
ATOM 236    C CD2 . PHE A 1 92  ? -51.410  -23.272 -46.049 1.00 0.00 ? 92  PHE A CD2 1  
ATOM 237    C CE1 . PHE A 1 92  ? -52.479  -21.221 -47.532 1.00 0.00 ? 92  PHE A CE1 1  
ATOM 238    C CE2 . PHE A 1 92  ? -51.793  -22.097 -45.368 1.00 0.00 ? 92  PHE A CE2 1  
ATOM 239    C CZ  . PHE A 1 92  ? -52.321  -21.077 -46.181 1.00 0.00 ? 92  PHE A CZ  1  
ATOM 240    N N   . LYS A 1 93  ? -51.357  -26.412 -50.904 1.00 0.00 ? 93  LYS A N   1  
ATOM 241    C CA  . LYS A 1 93  ? -50.529  -27.155 -51.788 1.00 0.00 ? 93  LYS A CA  1  
ATOM 242    C C   . LYS A 1 93  ? -50.111  -26.237 -52.840 1.00 0.00 ? 93  LYS A C   1  
ATOM 243    O O   . LYS A 1 93  ? -50.794  -25.277 -53.127 1.00 0.00 ? 93  LYS A O   1  
ATOM 244    C CB  . LYS A 1 93  ? -51.324  -28.347 -52.323 1.00 0.00 ? 93  LYS A CB  1  
ATOM 245    C CG  . LYS A 1 93  ? -50.457  -29.350 -53.073 1.00 0.00 ? 93  LYS A CG  1  
ATOM 246    C CD  . LYS A 1 93  ? -51.238  -30.219 -54.107 1.00 0.00 ? 93  LYS A CD  1  
ATOM 247    C CE  . LYS A 1 93  ? -51.683  -29.507 -55.346 1.00 0.00 ? 93  LYS A CE  1  
ATOM 248    N NZ  . LYS A 1 93  ? -50.407  -29.046 -55.967 1.00 0.00 ? 93  LYS A NZ  1  
ATOM 249    N N   . ILE A 1 94  ? -48.922  -26.441 -53.475 1.00 0.00 ? 94  ILE A N   1  
ATOM 250    C CA  . ILE A 1 94  ? -48.359  -25.652 -54.608 1.00 0.00 ? 94  ILE A CA  1  
ATOM 251    C C   . ILE A 1 94  ? -47.887  -26.629 -55.603 1.00 0.00 ? 94  ILE A C   1  
ATOM 252    O O   . ILE A 1 94  ? -47.623  -27.817 -55.273 1.00 0.00 ? 94  ILE A O   1  
ATOM 253    C CB  . ILE A 1 94  ? -47.213  -24.709 -54.197 1.00 0.00 ? 94  ILE A CB  1  
ATOM 254    C CG1 . ILE A 1 94  ? -46.893  -23.732 -55.374 1.00 0.00 ? 94  ILE A CG1 1  
ATOM 255    C CG2 . ILE A 1 94  ? -45.931  -25.519 -53.728 1.00 0.00 ? 94  ILE A CG2 1  
ATOM 256    C CD1 . ILE A 1 94  ? -45.759  -22.737 -55.074 1.00 0.00 ? 94  ILE A CD1 1  
ATOM 257    N N   . ALA A 1 95  ? -47.816  -26.199 -56.891 1.00 0.00 ? 95  ALA A N   1  
ATOM 258    C CA  . ALA A 1 95  ? -47.363  -26.931 -58.030 1.00 0.00 ? 95  ALA A CA  1  
ATOM 259    C C   . ALA A 1 95  ? -45.886  -27.273 -57.847 1.00 0.00 ? 95  ALA A C   1  
ATOM 260    O O   . ALA A 1 95  ? -45.140  -26.485 -57.305 1.00 0.00 ? 95  ALA A O   1  
ATOM 261    C CB  . ALA A 1 95  ? -47.373  -26.024 -59.283 1.00 0.00 ? 95  ALA A CB  1  
ATOM 262    N N   . LYS A 1 96  ? -45.458  -28.465 -58.284 1.00 0.00 ? 96  LYS A N   1  
ATOM 263    C CA  . LYS A 1 96  ? -44.115  -28.942 -58.129 1.00 0.00 ? 96  LYS A CA  1  
ATOM 264    C C   . LYS A 1 96  ? -43.567  -28.973 -59.516 1.00 0.00 ? 96  LYS A C   1  
ATOM 265    O O   . LYS A 1 96  ? -44.295  -29.271 -60.425 1.00 0.00 ? 96  LYS A O   1  
ATOM 266    C CB  . LYS A 1 96  ? -44.181  -30.304 -57.581 1.00 0.00 ? 96  LYS A CB  1  
ATOM 267    C CG  . LYS A 1 96  ? -44.677  -30.221 -56.148 1.00 0.00 ? 96  LYS A CG  1  
ATOM 268    C CD  . LYS A 1 96  ? -44.273  -31.439 -55.237 1.00 0.00 ? 96  LYS A CD  1  
ATOM 269    C CE  . LYS A 1 96  ? -42.752  -31.812 -55.313 1.00 0.00 ? 96  LYS A CE  1  
ATOM 270    N NZ  . LYS A 1 96  ? -42.210  -32.527 -54.123 1.00 0.00 ? 96  LYS A NZ  1  
ATOM 271    N N   . LYS A 1 97  ? -42.222  -28.757 -59.779 1.00 0.00 ? 97  LYS A N   1  
ATOM 272    C CA  . LYS A 1 97  ? -41.717  -28.633 -61.136 1.00 0.00 ? 97  LYS A CA  1  
ATOM 273    C C   . LYS A 1 97  ? -40.281  -28.225 -60.961 1.00 0.00 ? 97  LYS A C   1  
ATOM 274    O O   . LYS A 1 97  ? -40.074  -26.987 -61.007 1.00 0.00 ? 97  LYS A O   1  
ATOM 275    C CB  . LYS A 1 97  ? -42.503  -27.602 -62.060 1.00 0.00 ? 97  LYS A CB  1  
ATOM 276    C CG  . LYS A 1 97  ? -41.836  -27.494 -63.459 1.00 0.00 ? 97  LYS A CG  1  
ATOM 277    C CD  . LYS A 1 97  ? -41.809  -28.850 -64.179 1.00 0.00 ? 97  LYS A CD  1  
ATOM 278    C CE  . LYS A 1 97  ? -41.295  -28.903 -65.627 1.00 0.00 ? 97  LYS A CE  1  
ATOM 279    N NZ  . LYS A 1 97  ? -39.839  -28.938 -65.688 1.00 0.00 ? 97  LYS A NZ  1  
ATOM 280    N N   . MET A 1 98  ? -39.407  -29.190 -60.686 1.00 0.00 ? 98  MET A N   1  
ATOM 281    C CA  . MET A 1 98  ? -38.101  -28.903 -60.257 1.00 0.00 ? 98  MET A CA  1  
ATOM 282    C C   . MET A 1 98  ? -37.295  -29.929 -60.927 1.00 0.00 ? 98  MET A C   1  
ATOM 283    O O   . MET A 1 98  ? -37.901  -30.851 -61.486 1.00 0.00 ? 98  MET A O   1  
ATOM 284    C CB  . MET A 1 98  ? -37.829  -29.122 -58.722 1.00 0.00 ? 98  MET A CB  1  
ATOM 285    C CG  . MET A 1 98  ? -38.779  -28.348 -57.832 1.00 0.00 ? 98  MET A CG  1  
ATOM 286    S SD  . MET A 1 98  ? -40.146  -29.446 -57.381 1.00 0.00 ? 98  MET A SD  1  
ATOM 287    C CE  . MET A 1 98  ? -41.117  -28.352 -56.332 1.00 0.00 ? 98  MET A CE  1  
ATOM 288    N N   . ASP A 1 99  ? -35.985  -29.901 -60.666 1.00 0.00 ? 99  ASP A N   1  
ATOM 289    C CA  . ASP A 1 99  ? -35.033  -30.862 -61.014 1.00 0.00 ? 99  ASP A CA  1  
ATOM 290    C C   . ASP A 1 99  ? -35.426  -32.154 -60.274 1.00 0.00 ? 99  ASP A C   1  
ATOM 291    O O   . ASP A 1 99  ? -35.945  -32.107 -59.143 1.00 0.00 ? 99  ASP A O   1  
ATOM 292    C CB  . ASP A 1 99  ? -33.685  -30.401 -60.438 1.00 0.00 ? 99  ASP A CB  1  
ATOM 293    C CG  . ASP A 1 99  ? -32.524  -31.148 -61.170 1.00 0.00 ? 99  ASP A CG  1  
ATOM 294    O OD1 . ASP A 1 99  ? -32.274  -30.717 -62.289 1.00 0.00 ? 99  ASP A OD1 1  
ATOM 295    O OD2 . ASP A 1 99  ? -31.961  -32.103 -60.546 1.00 0.00 ? 99  ASP A OD2 1  
ATOM 296    N N   . PRO A 1 100 ? -35.106  -33.335 -60.794 1.00 0.00 ? 100 PRO A N   1  
ATOM 297    C CA  . PRO A 1 100 ? -35.482  -34.607 -60.213 1.00 0.00 ? 100 PRO A CA  1  
ATOM 298    C C   . PRO A 1 100 ? -34.841  -34.690 -58.770 1.00 0.00 ? 100 PRO A C   1  
ATOM 299    O O   . PRO A 1 100 ? -35.458  -35.201 -57.877 1.00 0.00 ? 100 PRO A O   1  
ATOM 300    C CB  . PRO A 1 100 ? -34.816  -35.685 -61.149 1.00 0.00 ? 100 PRO A CB  1  
ATOM 301    C CG  . PRO A 1 100 ? -34.037  -34.912 -62.138 1.00 0.00 ? 100 PRO A CG  1  
ATOM 302    C CD  . PRO A 1 100 ? -34.762  -33.557 -62.185 1.00 0.00 ? 100 PRO A CD  1  
ATOM 303    N N   . SER A 1 101 ? -33.600  -34.158 -58.655 1.00 0.00 ? 101 SER A N   1  
ATOM 304    C CA  . SER A 1 101 ? -32.768  -34.127 -57.476 1.00 0.00 ? 101 SER A CA  1  
ATOM 305    C C   . SER A 1 101 ? -33.503  -33.327 -56.381 1.00 0.00 ? 101 SER A C   1  
ATOM 306    O O   . SER A 1 101 ? -33.772  -33.862 -55.303 1.00 0.00 ? 101 SER A O   1  
ATOM 307    C CB  . SER A 1 101 ? -31.416  -33.440 -57.774 1.00 0.00 ? 101 SER A CB  1  
ATOM 308    O OG  . SER A 1 101 ? -30.788  -34.070 -58.879 1.00 0.00 ? 101 SER A OG  1  
ATOM 309    N N   . PHE A 1 102 ? -33.835  -32.050 -56.711 1.00 0.00 ? 102 PHE A N   1  
ATOM 310    C CA  . PHE A 1 102 ? -34.428  -31.101 -55.838 1.00 0.00 ? 102 PHE A CA  1  
ATOM 311    C C   . PHE A 1 102 ? -35.815  -31.492 -55.479 1.00 0.00 ? 102 PHE A C   1  
ATOM 312    O O   . PHE A 1 102 ? -36.244  -31.334 -54.364 1.00 0.00 ? 102 PHE A O   1  
ATOM 313    C CB  . PHE A 1 102 ? -34.459  -29.719 -56.479 1.00 0.00 ? 102 PHE A CB  1  
ATOM 314    C CG  . PHE A 1 102 ? -33.072  -29.137 -56.506 1.00 0.00 ? 102 PHE A CG  1  
ATOM 315    C CD1 . PHE A 1 102 ? -32.049  -29.544 -57.443 1.00 0.00 ? 102 PHE A CD1 1  
ATOM 316    C CD2 . PHE A 1 102 ? -32.732  -28.059 -55.649 1.00 0.00 ? 102 PHE A CD2 1  
ATOM 317    C CE1 . PHE A 1 102 ? -30.779  -28.972 -57.400 1.00 0.00 ? 102 PHE A CE1 1  
ATOM 318    C CE2 . PHE A 1 102 ? -31.556  -27.437 -55.645 1.00 0.00 ? 102 PHE A CE2 1  
ATOM 319    C CZ  . PHE A 1 102 ? -30.500  -27.913 -56.537 1.00 0.00 ? 102 PHE A CZ  1  
ATOM 320    N N   . LYS A 1 103 ? -36.598  -32.018 -56.490 1.00 0.00 ? 103 LYS A N   1  
ATOM 321    C CA  . LYS A 1 103 ? -37.967  -32.409 -56.364 1.00 0.00 ? 103 LYS A CA  1  
ATOM 322    C C   . LYS A 1 103 ? -38.166  -33.475 -55.342 1.00 0.00 ? 103 LYS A C   1  
ATOM 323    O O   . LYS A 1 103 ? -39.082  -33.351 -54.551 1.00 0.00 ? 103 LYS A O   1  
ATOM 324    C CB  . LYS A 1 103 ? -38.593  -33.004 -57.607 1.00 0.00 ? 103 LYS A CB  1  
ATOM 325    C CG  . LYS A 1 103 ? -40.128  -33.307 -57.695 1.00 0.00 ? 103 LYS A CG  1  
ATOM 326    C CD  . LYS A 1 103 ? -40.540  -34.082 -58.869 1.00 0.00 ? 103 LYS A CD  1  
ATOM 327    C CE  . LYS A 1 103 ? -39.896  -33.599 -60.258 1.00 0.00 ? 103 LYS A CE  1  
ATOM 328    N NZ  . LYS A 1 103 ? -40.533  -32.246 -60.582 1.00 0.00 ? 103 LYS A NZ  1  
ATOM 329    N N   . THR A 1 104 ? -37.270  -34.514 -55.267 1.00 0.00 ? 104 THR A N   1  
ATOM 330    C CA  . THR A 1 104 ? -37.253  -35.556 -54.316 1.00 0.00 ? 104 THR A CA  1  
ATOM 331    C C   . THR A 1 104 ? -37.005  -35.010 -52.885 1.00 0.00 ? 104 THR A C   1  
ATOM 332    O O   . THR A 1 104 ? -37.656  -35.320 -51.844 1.00 0.00 ? 104 THR A O   1  
ATOM 333    C CB  . THR A 1 104 ? -36.261  -36.640 -54.568 1.00 0.00 ? 104 THR A CB  1  
ATOM 334    O OG1 . THR A 1 104 ? -36.437  -37.092 -55.890 1.00 0.00 ? 104 THR A OG1 1  
ATOM 335    C CG2 . THR A 1 104 ? -36.449  -37.806 -53.595 1.00 0.00 ? 104 THR A CG2 1  
ATOM 336    N N   . PHE A 1 105 ? -35.998  -34.103 -52.780 1.00 0.00 ? 105 PHE A N   1  
ATOM 337    C CA  . PHE A 1 105 ? -35.662  -33.540 -51.457 1.00 0.00 ? 105 PHE A CA  1  
ATOM 338    C C   . PHE A 1 105 ? -36.853  -32.755 -50.957 1.00 0.00 ? 105 PHE A C   1  
ATOM 339    O O   . PHE A 1 105 ? -37.151  -32.840 -49.788 1.00 0.00 ? 105 PHE A O   1  
ATOM 340    C CB  . PHE A 1 105 ? -34.484  -32.535 -51.471 1.00 0.00 ? 105 PHE A CB  1  
ATOM 341    C CG  . PHE A 1 105 ? -33.174  -33.175 -51.715 1.00 0.00 ? 105 PHE A CG  1  
ATOM 342    C CD1 . PHE A 1 105 ? -32.723  -34.217 -50.959 1.00 0.00 ? 105 PHE A CD1 1  
ATOM 343    C CD2 . PHE A 1 105 ? -32.391  -32.714 -52.836 1.00 0.00 ? 105 PHE A CD2 1  
ATOM 344    C CE1 . PHE A 1 105 ? -31.457  -34.797 -51.163 1.00 0.00 ? 105 PHE A CE1 1  
ATOM 345    C CE2 . PHE A 1 105 ? -31.082  -33.266 -53.003 1.00 0.00 ? 105 PHE A CE2 1  
ATOM 346    C CZ  . PHE A 1 105 ? -30.600  -34.263 -52.141 1.00 0.00 ? 105 PHE A CZ  1  
ATOM 347    N N   . SER A 1 106 ? -37.450  -32.044 -51.884 1.00 0.00 ? 106 SER A N   1  
ATOM 348    C CA  . SER A 1 106 ? -38.629  -31.123 -51.650 1.00 0.00 ? 106 SER A CA  1  
ATOM 349    C C   . SER A 1 106 ? -39.795  -31.962 -51.140 1.00 0.00 ? 106 SER A C   1  
ATOM 350    O O   . SER A 1 106 ? -40.495  -31.526 -50.238 1.00 0.00 ? 106 SER A O   1  
ATOM 351    C CB  . SER A 1 106 ? -39.047  -30.178 -52.838 1.00 0.00 ? 106 SER A CB  1  
ATOM 352    O OG  . SER A 1 106 ? -39.851  -30.795 -53.842 1.00 0.00 ? 106 SER A OG  1  
ATOM 353    N N   . ARG A 1 107 ? -39.981  -33.237 -51.570 1.00 0.00 ? 107 ARG A N   1  
ATOM 354    C CA  . ARG A 1 107 ? -40.969  -34.145 -51.054 1.00 0.00 ? 107 ARG A CA  1  
ATOM 355    C C   . ARG A 1 107 ? -40.740  -34.491 -49.652 1.00 0.00 ? 107 ARG A C   1  
ATOM 356    O O   . ARG A 1 107 ? -41.682  -34.405 -48.860 1.00 0.00 ? 107 ARG A O   1  
ATOM 357    C CB  . ARG A 1 107 ? -40.995  -35.437 -51.890 1.00 0.00 ? 107 ARG A CB  1  
ATOM 358    C CG  . ARG A 1 107 ? -42.169  -36.304 -51.580 1.00 0.00 ? 107 ARG A CG  1  
ATOM 359    C CD  . ARG A 1 107 ? -43.578  -35.784 -51.913 1.00 0.00 ? 107 ARG A CD  1  
ATOM 360    N NE  . ARG A 1 107 ? -44.598  -36.909 -51.813 1.00 0.00 ? 107 ARG A NE  1  
ATOM 361    C CZ  . ARG A 1 107 ? -45.724  -36.910 -51.055 1.00 0.00 ? 107 ARG A CZ  1  
ATOM 362    N NH1 . ARG A 1 107 ? -46.178  -36.007 -50.132 1.00 0.00 ? 107 ARG A NH1 1  
ATOM 363    N NH2 . ARG A 1 107 ? -46.455  -38.002 -51.216 1.00 0.00 ? 107 ARG A NH2 1  
ATOM 364    N N   . ARG A 1 108 ? -39.472  -34.757 -49.272 1.00 0.00 ? 108 ARG A N   1  
ATOM 365    C CA  . ARG A 1 108 ? -39.292  -35.098 -47.807 1.00 0.00 ? 108 ARG A CA  1  
ATOM 366    C C   . ARG A 1 108 ? -39.621  -33.962 -46.878 1.00 0.00 ? 108 ARG A C   1  
ATOM 367    O O   . ARG A 1 108 ? -40.225  -34.046 -45.855 1.00 0.00 ? 108 ARG A O   1  
ATOM 368    C CB  . ARG A 1 108 ? -37.823  -35.459 -47.671 1.00 0.00 ? 108 ARG A CB  1  
ATOM 369    C CG  . ARG A 1 108 ? -37.291  -36.197 -46.378 1.00 0.00 ? 108 ARG A CG  1  
ATOM 370    C CD  . ARG A 1 108 ? -36.971  -35.290 -45.171 1.00 0.00 ? 108 ARG A CD  1  
ATOM 371    N NE  . ARG A 1 108 ? -38.030  -35.408 -44.154 1.00 0.00 ? 108 ARG A NE  1  
ATOM 372    C CZ  . ARG A 1 108 ? -38.683  -34.456 -43.411 1.00 0.00 ? 108 ARG A CZ  1  
ATOM 373    N NH1 . ARG A 1 108 ? -38.402  -33.142 -43.595 1.00 0.00 ? 108 ARG A NH1 1  
ATOM 374    N NH2 . ARG A 1 108 ? -39.661  -34.838 -42.529 1.00 0.00 ? 108 ARG A NH2 1  
ATOM 375    N N   . ILE A 1 109 ? -39.133  -32.854 -47.392 1.00 0.00 ? 109 ILE A N   1  
ATOM 376    C CA  . ILE A 1 109 ? -39.236  -31.555 -46.720 1.00 0.00 ? 109 ILE A CA  1  
ATOM 377    C C   . ILE A 1 109 ? -40.690  -31.097 -46.479 1.00 0.00 ? 109 ILE A C   1  
ATOM 378    O O   . ILE A 1 109 ? -41.053  -30.497 -45.469 1.00 0.00 ? 109 ILE A O   1  
ATOM 379    C CB  . ILE A 1 109 ? -38.508  -30.424 -47.421 1.00 0.00 ? 109 ILE A CB  1  
ATOM 380    C CG1 . ILE A 1 109 ? -36.988  -30.613 -47.166 1.00 0.00 ? 109 ILE A CG1 1  
ATOM 381    C CG2 . ILE A 1 109 ? -38.860  -28.983 -47.003 1.00 0.00 ? 109 ILE A CG2 1  
ATOM 382    C CD1 . ILE A 1 109 ? -36.103  -29.537 -47.817 1.00 0.00 ? 109 ILE A CD1 1  
ATOM 383    N N   . VAL A 1 110 ? -41.521  -31.476 -47.467 1.00 0.00 ? 110 VAL A N   1  
ATOM 384    C CA  . VAL A 1 110 ? -42.932  -31.155 -47.577 1.00 0.00 ? 110 VAL A CA  1  
ATOM 385    C C   . VAL A 1 110 ? -43.550  -31.770 -46.313 1.00 0.00 ? 110 VAL A C   1  
ATOM 386    O O   . VAL A 1 110 ? -44.360  -31.050 -45.679 1.00 0.00 ? 110 VAL A O   1  
ATOM 387    C CB  . VAL A 1 110 ? -43.587  -31.652 -48.821 1.00 0.00 ? 110 VAL A CB  1  
ATOM 388    C CG1 . VAL A 1 110 ? -44.953  -32.319 -48.776 1.00 0.00 ? 110 VAL A CG1 1  
ATOM 389    C CG2 . VAL A 1 110 ? -43.436  -30.672 -49.996 1.00 0.00 ? 110 VAL A CG2 1  
ATOM 390    N N   . ARG A 1 111 ? -43.087  -33.038 -45.869 1.00 0.00 ? 111 ARG A N   1  
ATOM 391    C CA  . ARG A 1 111 ? -43.547  -33.650 -44.740 1.00 0.00 ? 111 ARG A CA  1  
ATOM 392    C C   . ARG A 1 111 ? -43.282  -32.929 -43.493 1.00 0.00 ? 111 ARG A C   1  
ATOM 393    O O   . ARG A 1 111 ? -44.227  -32.735 -42.703 1.00 0.00 ? 111 ARG A O   1  
ATOM 394    C CB  . ARG A 1 111 ? -43.015  -35.035 -44.616 1.00 0.00 ? 111 ARG A CB  1  
ATOM 395    C CG  . ARG A 1 111 ? -42.914  -35.750 -45.989 1.00 0.00 ? 111 ARG A CG  1  
ATOM 396    C CD  . ARG A 1 111 ? -42.601  -37.261 -45.952 1.00 0.00 ? 111 ARG A CD  1  
ATOM 397    N NE  . ARG A 1 111 ? -41.193  -37.550 -45.298 1.00 0.00 ? 111 ARG A NE  1  
ATOM 398    C CZ  . ARG A 1 111 ? -40.849  -37.762 -43.997 1.00 0.00 ? 111 ARG A CZ  1  
ATOM 399    N NH1 . ARG A 1 111 ? -41.753  -37.616 -43.008 1.00 0.00 ? 111 ARG A NH1 1  
ATOM 400    N NH2 . ARG A 1 111 ? -39.578  -38.253 -43.633 1.00 0.00 ? 111 ARG A NH2 1  
ATOM 401    N N   . TYR A 1 112 ? -42.077  -32.401 -43.303 1.00 0.00 ? 112 TYR A N   1  
ATOM 402    C CA  . TYR A 1 112 ? -41.840  -31.608 -42.095 1.00 0.00 ? 112 TYR A CA  1  
ATOM 403    C C   . TYR A 1 112 ? -42.773  -30.406 -42.009 1.00 0.00 ? 112 TYR A C   1  
ATOM 404    O O   . TYR A 1 112 ? -43.287  -30.058 -40.983 1.00 0.00 ? 112 TYR A O   1  
ATOM 405    C CB  . TYR A 1 112 ? -40.397  -31.090 -41.821 1.00 0.00 ? 112 TYR A CB  1  
ATOM 406    C CG  . TYR A 1 112 ? -40.271  -30.332 -40.504 1.00 0.00 ? 112 TYR A CG  1  
ATOM 407    C CD1 . TYR A 1 112 ? -40.543  -31.024 -39.272 1.00 0.00 ? 112 TYR A CD1 1  
ATOM 408    C CD2 . TYR A 1 112 ? -40.379  -28.919 -40.474 1.00 0.00 ? 112 TYR A CD2 1  
ATOM 409    C CE1 . TYR A 1 112 ? -40.800  -30.368 -38.104 1.00 0.00 ? 112 TYR A CE1 1  
ATOM 410    C CE2 . TYR A 1 112 ? -40.594  -28.259 -39.325 1.00 0.00 ? 112 TYR A CE2 1  
ATOM 411    C CZ  . TYR A 1 112 ? -40.774  -28.971 -38.047 1.00 0.00 ? 112 TYR A CZ  1  
ATOM 412    O OH  . TYR A 1 112 ? -41.095  -28.371 -36.832 1.00 0.00 ? 112 TYR A OH  1  
ATOM 413    N N   . GLY A 1 113 ? -42.931  -29.678 -43.121 1.00 0.00 ? 113 GLY A N   1  
ATOM 414    C CA  . GLY A 1 113 ? -43.643  -28.433 -43.148 1.00 0.00 ? 113 GLY A CA  1  
ATOM 415    C C   . GLY A 1 113 ? -45.091  -28.457 -42.823 1.00 0.00 ? 113 GLY A C   1  
ATOM 416    O O   . GLY A 1 113 ? -45.667  -27.602 -42.180 1.00 0.00 ? 113 GLY A O   1  
ATOM 417    N N   . LYS A 1 114 ? -45.663  -29.647 -43.337 1.00 0.00 ? 114 LYS A N   1  
ATOM 418    C CA  . LYS A 1 114 ? -47.027  -30.108 -43.175 1.00 0.00 ? 114 LYS A CA  1  
ATOM 419    C C   . LYS A 1 114 ? -47.230  -30.330 -41.678 1.00 0.00 ? 114 LYS A C   1  
ATOM 420    O O   . LYS A 1 114 ? -48.172  -29.747 -41.225 1.00 0.00 ? 114 LYS A O   1  
ATOM 421    C CB  . LYS A 1 114 ? -47.064  -31.434 -43.914 1.00 0.00 ? 114 LYS A CB  1  
ATOM 422    C CG  . LYS A 1 114 ? -48.403  -32.168 -43.782 1.00 0.00 ? 114 LYS A CG  1  
ATOM 423    C CD  . LYS A 1 114 ? -48.547  -33.356 -44.705 1.00 0.00 ? 114 LYS A CD  1  
ATOM 424    C CE  . LYS A 1 114 ? -50.024  -33.913 -44.810 1.00 0.00 ? 114 LYS A CE  1  
ATOM 425    N NZ  . LYS A 1 114 ? -50.836  -32.972 -45.670 1.00 0.00 ? 114 LYS A NZ  1  
ATOM 426    N N   . GLN A 1 115 ? -46.335  -31.035 -40.970 1.00 0.00 ? 115 GLN A N   1  
ATOM 427    C CA  . GLN A 1 115 ? -46.547  -31.119 -39.588 1.00 0.00 ? 115 GLN A CA  1  
ATOM 428    C C   . GLN A 1 115 ? -46.503  -29.811 -38.910 1.00 0.00 ? 115 GLN A C   1  
ATOM 429    O O   . GLN A 1 115 ? -47.355  -29.615 -38.076 1.00 0.00 ? 115 GLN A O   1  
ATOM 430    C CB  . GLN A 1 115 ? -45.538  -32.025 -38.779 1.00 0.00 ? 115 GLN A CB  1  
ATOM 431    C CG  . GLN A 1 115 ? -45.759  -33.534 -38.985 1.00 0.00 ? 115 GLN A CG  1  
ATOM 432    C CD  . GLN A 1 115 ? -47.160  -33.963 -38.376 1.00 0.00 ? 115 GLN A CD  1  
ATOM 433    O OE1 . GLN A 1 115 ? -47.290  -33.963 -37.113 1.00 0.00 ? 115 GLN A OE1 1  
ATOM 434    N NE2 . GLN A 1 115 ? -48.048  -34.373 -39.343 1.00 0.00 ? 115 GLN A NE2 1  
ATOM 435    N N   . TYR A 1 116 ? -45.568  -28.915 -39.240 1.00 0.00 ? 116 TYR A N   1  
ATOM 436    C CA  . TYR A 1 116 ? -45.521  -27.649 -38.549 1.00 0.00 ? 116 TYR A CA  1  
ATOM 437    C C   . TYR A 1 116 ? -46.821  -26.827 -38.567 1.00 0.00 ? 116 TYR A C   1  
ATOM 438    O O   . TYR A 1 116 ? -47.358  -26.326 -37.571 1.00 0.00 ? 116 TYR A O   1  
ATOM 439    C CB  . TYR A 1 116 ? -44.283  -26.748 -38.928 1.00 0.00 ? 116 TYR A CB  1  
ATOM 440    C CG  . TYR A 1 116 ? -44.432  -25.479 -39.824 1.00 0.00 ? 116 TYR A CG  1  
ATOM 441    C CD1 . TYR A 1 116 ? -45.255  -24.362 -39.584 1.00 0.00 ? 116 TYR A CD1 1  
ATOM 442    C CD2 . TYR A 1 116 ? -43.599  -25.310 -40.883 1.00 0.00 ? 116 TYR A CD2 1  
ATOM 443    C CE1 . TYR A 1 116 ? -45.274  -23.229 -40.475 1.00 0.00 ? 116 TYR A CE1 1  
ATOM 444    C CE2 . TYR A 1 116 ? -43.598  -24.266 -41.813 1.00 0.00 ? 116 TYR A CE2 1  
ATOM 445    C CZ  . TYR A 1 116 ? -44.386  -23.103 -41.529 1.00 0.00 ? 116 TYR A CZ  1  
ATOM 446    O OH  . TYR A 1 116 ? -44.232  -21.875 -42.282 1.00 0.00 ? 116 TYR A OH  1  
ATOM 447    N N   . MET A 1 117 ? -47.431  -26.781 -39.712 1.00 0.00 ? 117 MET A N   1  
ATOM 448    C CA  . MET A 1 117 ? -48.705  -26.208 -40.009 1.00 0.00 ? 117 MET A CA  1  
ATOM 449    C C   . MET A 1 117 ? -49.912  -26.843 -39.384 1.00 0.00 ? 117 MET A C   1  
ATOM 450    O O   . MET A 1 117 ? -50.763  -26.152 -38.811 1.00 0.00 ? 117 MET A O   1  
ATOM 451    C CB  . MET A 1 117 ? -48.990  -26.172 -41.490 1.00 0.00 ? 117 MET A CB  1  
ATOM 452    C CG  . MET A 1 117 ? -48.053  -25.233 -42.324 1.00 0.00 ? 117 MET A CG  1  
ATOM 453    S SD  . MET A 1 117 ? -48.229  -25.501 -44.090 1.00 0.00 ? 117 MET A SD  1  
ATOM 454    C CE  . MET A 1 117 ? -46.696  -24.601 -44.470 1.00 0.00 ? 117 MET A CE  1  
ATOM 455    N N   . ILE A 1 118 ? -49.854  -28.191 -39.363 1.00 0.00 ? 118 ILE A N   1  
ATOM 456    C CA  . ILE A 1 118 ? -50.935  -29.053 -38.705 1.00 0.00 ? 118 ILE A CA  1  
ATOM 457    C C   . ILE A 1 118 ? -50.864  -28.719 -37.179 1.00 0.00 ? 118 ILE A C   1  
ATOM 458    O O   . ILE A 1 118 ? -51.841  -28.618 -36.483 1.00 0.00 ? 118 ILE A O   1  
ATOM 459    C CB  . ILE A 1 118 ? -50.945  -30.583 -39.065 1.00 0.00 ? 118 ILE A CB  1  
ATOM 460    C CG1 . ILE A 1 118 ? -51.508  -30.698 -40.547 1.00 0.00 ? 118 ILE A CG1 1  
ATOM 461    C CG2 . ILE A 1 118 ? -51.918  -31.230 -38.045 1.00 0.00 ? 118 ILE A CG2 1  
ATOM 462    C CD1 . ILE A 1 118 ? -51.591  -32.139 -41.078 1.00 0.00 ? 118 ILE A CD1 1  
ATOM 463    N N   . LEU A 1 119 ? -49.580  -28.648 -36.654 1.00 0.00 ? 119 LEU A N   1  
ATOM 464    C CA  . LEU A 1 119 ? -49.396  -28.485 -35.237 1.00 0.00 ? 119 LEU A CA  1  
ATOM 465    C C   . LEU A 1 119 ? -49.998  -27.207 -34.721 1.00 0.00 ? 119 LEU A C   1  
ATOM 466    O O   . LEU A 1 119 ? -50.701  -27.104 -33.742 1.00 0.00 ? 119 LEU A O   1  
ATOM 467    C CB  . LEU A 1 119 ? -47.907  -28.485 -35.010 1.00 0.00 ? 119 LEU A CB  1  
ATOM 468    C CG  . LEU A 1 119 ? -47.424  -27.975 -33.670 1.00 0.00 ? 119 LEU A CG  1  
ATOM 469    C CD1 . LEU A 1 119 ? -48.061  -28.786 -32.478 1.00 0.00 ? 119 LEU A CD1 1  
ATOM 470    C CD2 . LEU A 1 119 ? -45.934  -28.057 -33.557 1.00 0.00 ? 119 LEU A CD2 1  
ATOM 471    N N   . THR A 1 120 ? -49.749  -26.115 -35.450 1.00 0.00 ? 120 THR A N   1  
ATOM 472    C CA  . THR A 1 120 ? -50.304  -24.821 -35.083 1.00 0.00 ? 120 THR A CA  1  
ATOM 473    C C   . THR A 1 120 ? -51.826  -24.828 -35.062 1.00 0.00 ? 120 THR A C   1  
ATOM 474    O O   . THR A 1 120 ? -52.506  -24.261 -34.208 1.00 0.00 ? 120 THR A O   1  
ATOM 475    C CB  . THR A 1 120 ? -49.735  -23.676 -35.885 1.00 0.00 ? 120 THR A CB  1  
ATOM 476    O OG1 . THR A 1 120 ? -49.861  -23.933 -37.287 1.00 0.00 ? 120 THR A OG1 1  
ATOM 477    C CG2 . THR A 1 120 ? -48.262  -23.592 -35.611 1.00 0.00 ? 120 THR A CG2 1  
ATOM 478    N N   . ARG A 1 121 ? -52.421  -25.574 -36.048 1.00 0.00 ? 121 ARG A N   1  
ATOM 479    C CA  . ARG A 1 121 ? -53.798  -25.705 -36.163 1.00 0.00 ? 121 ARG A CA  1  
ATOM 480    C C   . ARG A 1 121 ? -54.425  -26.394 -34.952 1.00 0.00 ? 121 ARG A C   1  
ATOM 481    O O   . ARG A 1 121 ? -55.452  -25.895 -34.379 1.00 0.00 ? 121 ARG A O   1  
ATOM 482    C CB  . ARG A 1 121 ? -54.237  -26.513 -37.425 1.00 0.00 ? 121 ARG A CB  1  
ATOM 483    C CG  . ARG A 1 121 ? -55.596  -26.015 -37.974 1.00 0.00 ? 121 ARG A CG  1  
ATOM 484    C CD  . ARG A 1 121 ? -56.080  -26.893 -39.142 1.00 0.00 ? 121 ARG A CD  1  
ATOM 485    N NE  . ARG A 1 121 ? -57.276  -26.304 -39.791 1.00 0.00 ? 121 ARG A NE  1  
ATOM 486    C CZ  . ARG A 1 121 ? -58.028  -26.858 -40.787 1.00 0.00 ? 121 ARG A CZ  1  
ATOM 487    N NH1 . ARG A 1 121 ? -57.810  -28.090 -41.230 1.00 0.00 ? 121 ARG A NH1 1  
ATOM 488    N NH2 . ARG A 1 121 ? -58.947  -26.095 -41.421 1.00 0.00 ? 121 ARG A NH2 1  
ATOM 489    N N   . ALA A 1 122 ? -53.721  -27.467 -34.535 1.00 0.00 ? 122 ALA A N   1  
ATOM 490    C CA  . ALA A 1 122 ? -54.024  -28.379 -33.486 1.00 0.00 ? 122 ALA A CA  1  
ATOM 491    C C   . ALA A 1 122 ? -54.019  -27.576 -32.231 1.00 0.00 ? 122 ALA A C   1  
ATOM 492    O O   . ALA A 1 122 ? -54.837  -27.593 -31.299 1.00 0.00 ? 122 ALA A O   1  
ATOM 493    C CB  . ALA A 1 122 ? -52.977  -29.504 -33.470 1.00 0.00 ? 122 ALA A CB  1  
ATOM 494    N N   . TYR A 1 123 ? -52.964  -26.703 -32.177 1.00 0.00 ? 123 TYR A N   1  
ATOM 495    C CA  . TYR A 1 123 ? -52.747  -25.908 -30.982 1.00 0.00 ? 123 TYR A CA  1  
ATOM 496    C C   . TYR A 1 123 ? -53.893  -24.993 -30.654 1.00 0.00 ? 123 TYR A C   1  
ATOM 497    O O   . TYR A 1 123 ? -54.273  -24.919 -29.458 1.00 0.00 ? 123 TYR A O   1  
ATOM 498    C CB  . TYR A 1 123 ? -51.425  -25.115 -31.039 1.00 0.00 ? 123 TYR A CB  1  
ATOM 499    C CG  . TYR A 1 123 ? -51.374  -24.104 -29.866 1.00 0.00 ? 123 TYR A CG  1  
ATOM 500    C CD1 . TYR A 1 123 ? -51.423  -24.550 -28.539 1.00 0.00 ? 123 TYR A CD1 1  
ATOM 501    C CD2 . TYR A 1 123 ? -51.580  -22.739 -30.112 1.00 0.00 ? 123 TYR A CD2 1  
ATOM 502    C CE1 . TYR A 1 123 ? -51.672  -23.643 -27.460 1.00 0.00 ? 123 TYR A CE1 1  
ATOM 503    C CE2 . TYR A 1 123 ? -51.803  -21.846 -29.099 1.00 0.00 ? 123 TYR A CE2 1  
ATOM 504    C CZ  . TYR A 1 123 ? -51.862  -22.319 -27.781 1.00 0.00 ? 123 TYR A CZ  1  
ATOM 505    O OH  . TYR A 1 123 ? -52.030  -21.528 -26.648 1.00 0.00 ? 123 TYR A OH  1  
ATOM 506    N N   . GLU A 1 124 ? -54.514  -24.303 -31.649 1.00 0.00 ? 124 GLU A N   1  
ATOM 507    C CA  . GLU A 1 124 ? -55.605  -23.368 -31.496 1.00 0.00 ? 124 GLU A CA  1  
ATOM 508    C C   . GLU A 1 124 ? -56.774  -24.029 -30.914 1.00 0.00 ? 124 GLU A C   1  
ATOM 509    O O   . GLU A 1 124 ? -57.473  -23.497 -30.090 1.00 0.00 ? 124 GLU A O   1  
ATOM 510    C CB  . GLU A 1 124 ? -56.064  -22.810 -32.910 1.00 0.00 ? 124 GLU A CB  1  
ATOM 511    C CG  . GLU A 1 124 ? -54.923  -21.926 -33.524 1.00 0.00 ? 124 GLU A CG  1  
ATOM 512    C CD  . GLU A 1 124 ? -54.982  -20.607 -32.688 1.00 0.00 ? 124 GLU A CD  1  
ATOM 513    O OE1 . GLU A 1 124 ? -56.005  -19.871 -32.855 1.00 0.00 ? 124 GLU A OE1 1  
ATOM 514    O OE2 . GLU A 1 124 ? -54.150  -20.336 -31.872 1.00 0.00 ? 124 GLU A OE2 1  
ATOM 515    N N   . LYS A 1 125 ? -57.008  -25.309 -31.421 1.00 0.00 ? 125 LYS A N   1  
ATOM 516    C CA  . LYS A 1 125 ? -58.135  -26.052 -31.067 1.00 0.00 ? 125 LYS A CA  1  
ATOM 517    C C   . LYS A 1 125 ? -58.178  -26.365 -29.588 1.00 0.00 ? 125 LYS A C   1  
ATOM 518    O O   . LYS A 1 125 ? -59.200  -26.164 -28.890 1.00 0.00 ? 125 LYS A O   1  
ATOM 519    C CB  . LYS A 1 125 ? -58.019  -27.296 -31.954 1.00 0.00 ? 125 LYS A CB  1  
ATOM 520    C CG  . LYS A 1 125 ? -59.179  -28.290 -32.037 1.00 0.00 ? 125 LYS A CG  1  
ATOM 521    C CD  . LYS A 1 125 ? -59.166  -29.245 -33.138 1.00 0.00 ? 125 LYS A CD  1  
ATOM 522    C CE  . LYS A 1 125 ? -57.801  -29.779 -33.502 1.00 0.00 ? 125 LYS A CE  1  
ATOM 523    N NZ  . LYS A 1 125 ? -57.979  -30.863 -34.508 1.00 0.00 ? 125 LYS A NZ  1  
ATOM 524    N N   . TRP A 1 126 ? -56.976  -26.842 -29.097 1.00 0.00 ? 126 TRP A N   1  
ATOM 525    C CA  . TRP A 1 126 ? -56.804  -27.338 -27.780 1.00 0.00 ? 126 TRP A CA  1  
ATOM 526    C C   . TRP A 1 126 ? -56.856  -26.184 -26.844 1.00 0.00 ? 126 TRP A C   1  
ATOM 527    O O   . TRP A 1 126 ? -57.283  -26.414 -25.731 1.00 0.00 ? 126 TRP A O   1  
ATOM 528    C CB  . TRP A 1 126 ? -55.449  -27.937 -27.575 1.00 0.00 ? 126 TRP A CB  1  
ATOM 529    C CG  . TRP A 1 126 ? -55.260  -29.138 -28.456 1.00 0.00 ? 126 TRP A CG  1  
ATOM 530    C CD1 . TRP A 1 126 ? -56.146  -30.128 -28.861 1.00 0.00 ? 126 TRP A CD1 1  
ATOM 531    C CD2 . TRP A 1 126 ? -53.922  -29.477 -29.050 1.00 0.00 ? 126 TRP A CD2 1  
ATOM 532    N NE1 . TRP A 1 126 ? -55.372  -31.057 -29.639 1.00 0.00 ? 126 TRP A NE1 1  
ATOM 533    C CE2 . TRP A 1 126 ? -54.037  -30.676 -29.716 1.00 0.00 ? 126 TRP A CE2 1  
ATOM 534    C CE3 . TRP A 1 126 ? -52.682  -28.897 -28.886 1.00 0.00 ? 126 TRP A CE3 1  
ATOM 535    C CZ2 . TRP A 1 126 ? -52.934  -31.217 -30.331 1.00 0.00 ? 126 TRP A CZ2 1  
ATOM 536    C CZ3 . TRP A 1 126 ? -51.573  -29.446 -29.569 1.00 0.00 ? 126 TRP A CZ3 1  
ATOM 537    C CH2 . TRP A 1 126 ? -51.636  -30.719 -30.128 1.00 0.00 ? 126 TRP A CH2 1  
ATOM 538    N N   . SER A 1 127 ? -56.429  -25.000 -27.226 1.00 0.00 ? 127 SER A N   1  
ATOM 539    C CA  . SER A 1 127 ? -56.435  -23.808 -26.406 1.00 0.00 ? 127 SER A CA  1  
ATOM 540    C C   . SER A 1 127 ? -56.846  -22.663 -27.231 1.00 0.00 ? 127 SER A C   1  
ATOM 541    O O   . SER A 1 127 ? -56.190  -22.206 -28.155 1.00 0.00 ? 127 SER A O   1  
ATOM 542    C CB  . SER A 1 127 ? -55.012  -23.567 -25.764 1.00 0.00 ? 127 SER A CB  1  
ATOM 543    O OG  . SER A 1 127 ? -54.369  -24.738 -25.260 1.00 0.00 ? 127 SER A OG  1  
ATOM 544    N N   . ASP A 1 128 ? -57.978  -22.083 -26.777 1.00 0.00 ? 128 ASP A N   1  
ATOM 545    C CA  . ASP A 1 128 ? -58.593  -20.878 -27.340 1.00 0.00 ? 128 ASP A CA  1  
ATOM 546    C C   . ASP A 1 128 ? -59.538  -20.404 -26.175 1.00 0.00 ? 128 ASP A C   1  
ATOM 547    O O   . ASP A 1 128 ? -59.366  -19.333 -25.628 1.00 0.00 ? 128 ASP A O   1  
ATOM 548    C CB  . ASP A 1 128 ? -59.437  -21.124 -28.575 1.00 0.00 ? 128 ASP A CB  1  
ATOM 549    C CG  . ASP A 1 128 ? -60.210  -20.018 -29.160 1.00 0.00 ? 128 ASP A CG  1  
ATOM 550    O OD1 . ASP A 1 128 ? -59.588  -19.050 -29.642 1.00 0.00 ? 128 ASP A OD1 1  
ATOM 551    O OD2 . ASP A 1 128 ? -61.450  -20.085 -29.139 1.00 0.00 ? 128 ASP A OD2 1  
ATOM 552    N N   . THR A 1 129 ? -60.625  -21.212 -25.898 1.00 0.00 ? 129 THR A N   1  
ATOM 553    C CA  . THR A 1 129 ? -61.480  -21.012 -24.776 1.00 0.00 ? 129 THR A CA  1  
ATOM 554    C C   . THR A 1 129 ? -62.115  -22.363 -24.547 1.00 0.00 ? 129 THR A C   1  
ATOM 555    O O   . THR A 1 129 ? -63.149  -22.401 -23.911 1.00 0.00 ? 129 THR A O   1  
ATOM 556    C CB  . THR A 1 129 ? -62.563  -19.972 -25.163 1.00 0.00 ? 129 THR A CB  1  
ATOM 557    O OG1 . THR A 1 129 ? -62.062  -18.823 -25.796 1.00 0.00 ? 129 THR A OG1 1  
ATOM 558    C CG2 . THR A 1 129 ? -63.276  -19.470 -23.898 1.00 0.00 ? 129 THR A CG2 1  
ATOM 559    N N   . SER A 1 130 ? -61.496  -23.467 -25.083 1.00 0.00 ? 130 SER A N   1  
ATOM 560    C CA  . SER A 1 130 ? -61.688  -24.849 -24.741 1.00 0.00 ? 130 SER A CA  1  
ATOM 561    C C   . SER A 1 130 ? -61.966  -25.183 -23.312 1.00 0.00 ? 130 SER A C   1  
ATOM 562    O O   . SER A 1 130 ? -61.854  -24.434 -22.385 1.00 0.00 ? 130 SER A O   1  
ATOM 563    C CB  . SER A 1 130 ? -60.528  -25.709 -25.173 1.00 0.00 ? 130 SER A CB  1  
ATOM 564    O OG  . SER A 1 130 ? -59.807  -25.232 -26.269 1.00 0.00 ? 130 SER A OG  1  
ATOM 565    N N   . PHE A 1 131 ? -62.427  -26.497 -23.170 1.00 0.00 ? 131 PHE A N   1  
ATOM 566    C CA  . PHE A 1 131 ? -62.661  -27.065 -21.902 1.00 0.00 ? 131 PHE A CA  1  
ATOM 567    C C   . PHE A 1 131 ? -61.726  -28.191 -21.853 1.00 0.00 ? 131 PHE A C   1  
ATOM 568    O O   . PHE A 1 131 ? -61.285  -28.653 -22.869 1.00 0.00 ? 131 PHE A O   1  
ATOM 569    C CB  . PHE A 1 131 ? -64.155  -27.463 -21.744 1.00 0.00 ? 131 PHE A CB  1  
ATOM 570    C CG  . PHE A 1 131 ? -65.011  -26.260 -22.017 1.00 0.00 ? 131 PHE A CG  1  
ATOM 571    C CD1 . PHE A 1 131 ? -64.909  -24.938 -21.383 1.00 0.00 ? 131 PHE A CD1 1  
ATOM 572    C CD2 . PHE A 1 131 ? -66.046  -26.462 -22.896 1.00 0.00 ? 131 PHE A CD2 1  
ATOM 573    C CE1 . PHE A 1 131 ? -65.857  -23.983 -21.580 1.00 0.00 ? 131 PHE A CE1 1  
ATOM 574    C CE2 . PHE A 1 131 ? -67.001  -25.454 -23.175 1.00 0.00 ? 131 PHE A CE2 1  
ATOM 575    C CZ  . PHE A 1 131 ? -66.931  -24.231 -22.500 1.00 0.00 ? 131 PHE A CZ  1  
ATOM 576    N N   . GLY A 1 132 ? -61.335  -28.723 -20.632 1.00 0.00 ? 132 GLY A N   1  
ATOM 577    C CA  . GLY A 1 132 ? -60.403  -29.834 -20.439 1.00 0.00 ? 132 GLY A CA  1  
ATOM 578    C C   . GLY A 1 132 ? -59.263  -28.987 -19.885 1.00 0.00 ? 132 GLY A C   1  
ATOM 579    O O   . GLY A 1 132 ? -58.530  -28.439 -20.662 1.00 0.00 ? 132 GLY A O   1  
ATOM 580    N N   . MET A 1 133 ? -59.164  -28.824 -18.564 1.00 0.00 ? 133 MET A N   1  
ATOM 581    C CA  . MET A 1 133 ? -58.173  -27.962 -17.932 1.00 0.00 ? 133 MET A CA  1  
ATOM 582    C C   . MET A 1 133 ? -56.851  -28.466 -18.148 1.00 0.00 ? 133 MET A C   1  
ATOM 583    O O   . MET A 1 133 ? -55.944  -27.689 -18.419 1.00 0.00 ? 133 MET A O   1  
ATOM 584    C CB  . MET A 1 133 ? -58.571  -27.823 -16.464 1.00 0.00 ? 133 MET A CB  1  
ATOM 585    C CG  . MET A 1 133 ? -57.448  -27.234 -15.578 1.00 0.00 ? 133 MET A CG  1  
ATOM 586    S SD  . MET A 1 133 ? -57.977  -26.719 -13.935 1.00 0.00 ? 133 MET A SD  1  
ATOM 587    C CE  . MET A 1 133 ? -57.809  -28.432 -13.192 1.00 0.00 ? 133 MET A CE  1  
ATOM 588    N N   . VAL A 1 134 ? -56.782  -29.754 -18.048 1.00 0.00 ? 134 VAL A N   1  
ATOM 589    C CA  . VAL A 1 134 ? -55.630  -30.543 -18.262 1.00 0.00 ? 134 VAL A CA  1  
ATOM 590    C C   . VAL A 1 134 ? -55.119  -30.475 -19.690 1.00 0.00 ? 134 VAL A C   1  
ATOM 591    O O   . VAL A 1 134 ? -53.926  -30.379 -19.994 1.00 0.00 ? 134 VAL A O   1  
ATOM 592    C CB  . VAL A 1 134 ? -55.823  -32.040 -17.926 1.00 0.00 ? 134 VAL A CB  1  
ATOM 593    C CG1 . VAL A 1 134 ? -54.551  -32.792 -17.594 1.00 0.00 ? 134 VAL A CG1 1  
ATOM 594    C CG2 . VAL A 1 134 ? -56.879  -32.087 -16.778 1.00 0.00 ? 134 VAL A CG2 1  
ATOM 595    N N   . LEU A 1 135 ? -56.143  -30.505 -20.618 1.00 0.00 ? 135 LEU A N   1  
ATOM 596    C CA  . LEU A 1 135 ? -55.965  -30.562 -22.032 1.00 0.00 ? 135 LEU A CA  1  
ATOM 597    C C   . LEU A 1 135 ? -55.236  -29.310 -22.558 1.00 0.00 ? 135 LEU A C   1  
ATOM 598    O O   . LEU A 1 135 ? -54.222  -29.311 -23.201 1.00 0.00 ? 135 LEU A O   1  
ATOM 599    C CB  . LEU A 1 135 ? -57.400  -30.760 -22.767 1.00 0.00 ? 135 LEU A CB  1  
ATOM 600    C CG  . LEU A 1 135 ? -57.513  -31.263 -24.172 1.00 0.00 ? 135 LEU A CG  1  
ATOM 601    C CD1 . LEU A 1 135 ? -58.903  -31.766 -24.550 1.00 0.00 ? 135 LEU A CD1 1  
ATOM 602    C CD2 . LEU A 1 135 ? -56.977  -30.312 -25.189 1.00 0.00 ? 135 LEU A CD2 1  
ATOM 603    N N   . GLN A 1 136 ? -55.713  -28.189 -22.022 1.00 0.00 ? 136 GLN A N   1  
ATOM 604    C CA  . GLN A 1 136 ? -55.062  -26.918 -22.304 1.00 0.00 ? 136 GLN A CA  1  
ATOM 605    C C   . GLN A 1 136 ? -53.686  -26.780 -21.824 1.00 0.00 ? 136 GLN A C   1  
ATOM 606    O O   . GLN A 1 136 ? -52.876  -26.097 -22.420 1.00 0.00 ? 136 GLN A O   1  
ATOM 607    C CB  . GLN A 1 136 ? -55.834  -25.653 -21.788 1.00 0.00 ? 136 GLN A CB  1  
ATOM 608    C CG  . GLN A 1 136 ? -57.132  -25.526 -22.515 1.00 0.00 ? 136 GLN A CG  1  
ATOM 609    C CD  . GLN A 1 136 ? -58.150  -24.520 -21.853 1.00 0.00 ? 136 GLN A CD  1  
ATOM 610    O OE1 . GLN A 1 136 ? -57.966  -23.267 -21.900 1.00 0.00 ? 136 GLN A OE1 1  
ATOM 611    N NE2 . GLN A 1 136 ? -59.257  -25.153 -21.312 1.00 0.00 ? 136 GLN A NE2 1  
ATOM 612    N N   . ARG A 1 137 ? -53.451  -27.295 -20.567 1.00 0.00 ? 137 ARG A N   1  
ATOM 613    C CA  . ARG A 1 137 ? -52.294  -27.070 -19.796 1.00 0.00 ? 137 ARG A CA  1  
ATOM 614    C C   . ARG A 1 137 ? -51.089  -27.706 -20.511 1.00 0.00 ? 137 ARG A C   1  
ATOM 615    O O   . ARG A 1 137 ? -50.011  -27.095 -20.694 1.00 0.00 ? 137 ARG A O   1  
ATOM 616    C CB  . ARG A 1 137 ? -52.485  -27.627 -18.321 1.00 0.00 ? 137 ARG A CB  1  
ATOM 617    C CG  . ARG A 1 137 ? -51.264  -27.618 -17.350 1.00 0.00 ? 137 ARG A CG  1  
ATOM 618    C CD  . ARG A 1 137 ? -51.062  -26.223 -16.700 1.00 0.00 ? 137 ARG A CD  1  
ATOM 619    N NE  . ARG A 1 137 ? -50.665  -25.202 -17.748 1.00 0.00 ? 137 ARG A NE  1  
ATOM 620    C CZ  . ARG A 1 137 ? -49.497  -24.506 -17.705 1.00 0.00 ? 137 ARG A CZ  1  
ATOM 621    N NH1 . ARG A 1 137 ? -48.515  -24.973 -16.894 1.00 0.00 ? 137 ARG A NH1 1  
ATOM 622    N NH2 . ARG A 1 137 ? -49.258  -23.406 -18.524 1.00 0.00 ? 137 ARG A NH2 1  
ATOM 623    N N   . PHE A 1 138 ? -51.361  -28.881 -21.091 1.00 0.00 ? 138 PHE A N   1  
ATOM 624    C CA  . PHE A 1 138 ? -50.400  -29.485 -21.947 1.00 0.00 ? 138 PHE A CA  1  
ATOM 625    C C   . PHE A 1 138 ? -50.104  -28.716 -23.222 1.00 0.00 ? 138 PHE A C   1  
ATOM 626    O O   . PHE A 1 138 ? -48.968  -28.629 -23.640 1.00 0.00 ? 138 PHE A O   1  
ATOM 627    C CB  . PHE A 1 138 ? -50.747  -31.031 -22.332 1.00 0.00 ? 138 PHE A CB  1  
ATOM 628    C CG  . PHE A 1 138 ? -51.698  -31.308 -23.455 1.00 0.00 ? 138 PHE A CG  1  
ATOM 629    C CD1 . PHE A 1 138 ? -51.382  -31.084 -24.789 1.00 0.00 ? 138 PHE A CD1 1  
ATOM 630    C CD2 . PHE A 1 138 ? -52.985  -31.976 -23.193 1.00 0.00 ? 138 PHE A CD2 1  
ATOM 631    C CE1 . PHE A 1 138 ? -52.203  -31.518 -25.827 1.00 0.00 ? 138 PHE A CE1 1  
ATOM 632    C CE2 . PHE A 1 138 ? -53.796  -32.489 -24.209 1.00 0.00 ? 138 PHE A CE2 1  
ATOM 633    C CZ  . PHE A 1 138 ? -53.438  -32.202 -25.552 1.00 0.00 ? 138 PHE A CZ  1  
ATOM 634    N N   . ALA A 1 139 ? -51.235  -28.239 -23.874 1.00 0.00 ? 139 ALA A N   1  
ATOM 635    C CA  . ALA A 1 139 ? -51.096  -27.624 -25.161 1.00 0.00 ? 139 ALA A CA  1  
ATOM 636    C C   . ALA A 1 139 ? -50.335  -26.368 -25.158 1.00 0.00 ? 139 ALA A C   1  
ATOM 637    O O   . ALA A 1 139 ? -49.488  -26.200 -26.005 1.00 0.00 ? 139 ALA A O   1  
ATOM 638    C CB  . ALA A 1 139 ? -52.479  -27.377 -25.734 1.00 0.00 ? 139 ALA A CB  1  
ATOM 639    N N   . TYR A 1 140 ? -50.529  -25.512 -24.148 1.00 0.00 ? 140 TYR A N   1  
ATOM 640    C CA  . TYR A 1 140 ? -49.820  -24.263 -24.040 1.00 0.00 ? 140 TYR A CA  1  
ATOM 641    C C   . TYR A 1 140 ? -48.374  -24.465 -23.813 1.00 0.00 ? 140 TYR A C   1  
ATOM 642    O O   . TYR A 1 140 ? -47.544  -23.770 -24.452 1.00 0.00 ? 140 TYR A O   1  
ATOM 643    C CB  . TYR A 1 140 ? -50.421  -23.362 -22.832 1.00 0.00 ? 140 TYR A CB  1  
ATOM 644    C CG  . TYR A 1 140 ? -49.614  -22.139 -22.386 1.00 0.00 ? 140 TYR A CG  1  
ATOM 645    C CD1 . TYR A 1 140 ? -48.514  -22.291 -21.607 1.00 0.00 ? 140 TYR A CD1 1  
ATOM 646    C CD2 . TYR A 1 140 ? -49.979  -20.891 -22.800 1.00 0.00 ? 140 TYR A CD2 1  
ATOM 647    C CE1 . TYR A 1 140 ? -47.740  -21.262 -21.140 1.00 0.00 ? 140 TYR A CE1 1  
ATOM 648    C CE2 . TYR A 1 140 ? -49.252  -19.782 -22.331 1.00 0.00 ? 140 TYR A CE2 1  
ATOM 649    C CZ  . TYR A 1 140 ? -48.166  -19.938 -21.433 1.00 0.00 ? 140 TYR A CZ  1  
ATOM 650    O OH  . TYR A 1 140 ? -47.457  -18.862 -20.929 1.00 0.00 ? 140 TYR A OH  1  
ATOM 651    N N   . GLU A 1 141 ? -48.081  -25.461 -22.940 1.00 0.00 ? 141 GLU A N   1  
ATOM 652    C CA  . GLU A 1 141 ? -46.676  -25.709 -22.686 1.00 0.00 ? 141 GLU A CA  1  
ATOM 653    C C   . GLU A 1 141 ? -45.906  -26.241 -23.839 1.00 0.00 ? 141 GLU A C   1  
ATOM 654    O O   . GLU A 1 141 ? -44.799  -25.723 -24.064 1.00 0.00 ? 141 GLU A O   1  
ATOM 655    C CB  . GLU A 1 141 ? -46.468  -26.732 -21.544 1.00 0.00 ? 141 GLU A CB  1  
ATOM 656    C CG  . GLU A 1 141 ? -46.819  -25.996 -20.269 1.00 0.00 ? 141 GLU A CG  1  
ATOM 657    C CD  . GLU A 1 141 ? -46.701  -26.999 -19.115 1.00 0.00 ? 141 GLU A CD  1  
ATOM 658    O OE1 . GLU A 1 141 ? -47.360  -28.035 -19.178 1.00 0.00 ? 141 GLU A OE1 1  
ATOM 659    O OE2 . GLU A 1 141 ? -46.034  -26.573 -18.102 1.00 0.00 ? 141 GLU A OE2 1  
ATOM 660    N N   . ILE A 1 142 ? -46.457  -27.163 -24.599 1.00 0.00 ? 142 ILE A N   1  
ATOM 661    C CA  . ILE A 1 142 ? -45.831  -27.769 -25.757 1.00 0.00 ? 142 ILE A CA  1  
ATOM 662    C C   . ILE A 1 142 ? -45.650  -26.675 -26.824 1.00 0.00 ? 142 ILE A C   1  
ATOM 663    O O   . ILE A 1 142 ? -44.593  -26.502 -27.421 1.00 0.00 ? 142 ILE A O   1  
ATOM 664    C CB  . ILE A 1 142 ? -46.565  -28.938 -26.479 1.00 0.00 ? 142 ILE A CB  1  
ATOM 665    C CG1 . ILE A 1 142 ? -46.775  -30.192 -25.563 1.00 0.00 ? 142 ILE A CG1 1  
ATOM 666    C CG2 . ILE A 1 142 ? -45.793  -29.296 -27.789 1.00 0.00 ? 142 ILE A CG2 1  
ATOM 667    C CD1 . ILE A 1 142 ? -47.498  -31.360 -26.255 1.00 0.00 ? 142 ILE A CD1 1  
ATOM 668    N N   . ARG A 1 143 ? -46.725  -25.820 -27.025 1.00 0.00 ? 143 ARG A N   1  
ATOM 669    C CA  . ARG A 1 143 ? -46.595  -24.810 -28.135 1.00 0.00 ? 143 ARG A CA  1  
ATOM 670    C C   . ARG A 1 143 ? -45.470  -23.844 -27.857 1.00 0.00 ? 143 ARG A C   1  
ATOM 671    O O   . ARG A 1 143 ? -44.651  -23.499 -28.707 1.00 0.00 ? 143 ARG A O   1  
ATOM 672    C CB  . ARG A 1 143 ? -47.954  -24.022 -28.276 1.00 0.00 ? 143 ARG A CB  1  
ATOM 673    C CG  . ARG A 1 143 ? -47.783  -22.893 -29.330 1.00 0.00 ? 143 ARG A CG  1  
ATOM 674    C CD  . ARG A 1 143 ? -47.639  -23.525 -30.703 1.00 0.00 ? 143 ARG A CD  1  
ATOM 675    N NE  . ARG A 1 143 ? -47.330  -22.353 -31.532 1.00 0.00 ? 143 ARG A NE  1  
ATOM 676    C CZ  . ARG A 1 143 ? -48.177  -21.812 -32.454 1.00 0.00 ? 143 ARG A CZ  1  
ATOM 677    N NH1 . ARG A 1 143 ? -49.421  -22.363 -32.646 1.00 0.00 ? 143 ARG A NH1 1  
ATOM 678    N NH2 . ARG A 1 143 ? -47.790  -20.725 -33.120 1.00 0.00 ? 143 ARG A NH2 1  
ATOM 679    N N   . ARG A 1 144 ? -45.362  -23.422 -26.596 1.00 0.00 ? 144 ARG A N   1  
ATOM 680    C CA  . ARG A 1 144 ? -44.338  -22.515 -26.184 1.00 0.00 ? 144 ARG A CA  1  
ATOM 681    C C   . ARG A 1 144 ? -42.989  -23.192 -26.339 1.00 0.00 ? 144 ARG A C   1  
ATOM 682    O O   . ARG A 1 144 ? -42.056  -22.537 -26.830 1.00 0.00 ? 144 ARG A O   1  
ATOM 683    C CB  . ARG A 1 144 ? -44.598  -22.138 -24.712 1.00 0.00 ? 144 ARG A CB  1  
ATOM 684    C CG  . ARG A 1 144 ? -43.524  -21.222 -24.036 1.00 0.00 ? 144 ARG A CG  1  
ATOM 685    C CD  . ARG A 1 144 ? -43.927  -20.958 -22.549 1.00 0.00 ? 144 ARG A CD  1  
ATOM 686    N NE  . ARG A 1 144 ? -43.997  -22.240 -21.718 1.00 0.00 ? 144 ARG A NE  1  
ATOM 687    C CZ  . ARG A 1 144 ? -44.384  -22.305 -20.371 1.00 0.00 ? 144 ARG A CZ  1  
ATOM 688    N NH1 . ARG A 1 144 ? -44.554  -21.214 -19.621 1.00 0.00 ? 144 ARG A NH1 1  
ATOM 689    N NH2 . ARG A 1 144 ? -44.700  -23.512 -19.829 1.00 0.00 ? 144 ARG A NH2 1  
ATOM 690    N N   . PHE A 1 145 ? -42.771  -24.499 -25.959 1.00 0.00 ? 145 PHE A N   1  
ATOM 691    C CA  . PHE A 1 145 ? -41.466  -25.083 -26.101 1.00 0.00 ? 145 PHE A CA  1  
ATOM 692    C C   . PHE A 1 145 ? -41.017  -25.263 -27.556 1.00 0.00 ? 145 PHE A C   1  
ATOM 693    O O   . PHE A 1 145 ? -39.917  -24.882 -27.842 1.00 0.00 ? 145 PHE A O   1  
ATOM 694    C CB  . PHE A 1 145 ? -41.385  -26.424 -25.325 1.00 0.00 ? 145 PHE A CB  1  
ATOM 695    C CG  . PHE A 1 145 ? -41.811  -26.237 -23.864 1.00 0.00 ? 145 PHE A CG  1  
ATOM 696    C CD1 . PHE A 1 145 ? -41.665  -25.087 -23.055 1.00 0.00 ? 145 PHE A CD1 1  
ATOM 697    C CD2 . PHE A 1 145 ? -42.280  -27.401 -23.247 1.00 0.00 ? 145 PHE A CD2 1  
ATOM 698    C CE1 . PHE A 1 145 ? -42.061  -25.076 -21.724 1.00 0.00 ? 145 PHE A CE1 1  
ATOM 699    C CE2 . PHE A 1 145 ? -42.682  -27.385 -21.953 1.00 0.00 ? 145 PHE A CE2 1  
ATOM 700    C CZ  . PHE A 1 145 ? -42.768  -26.242 -21.223 1.00 0.00 ? 145 PHE A CZ  1  
ATOM 701    N N   . LEU A 1 146 ? -41.942  -25.751 -28.458 1.00 0.00 ? 146 LEU A N   1  
ATOM 702    C CA  . LEU A 1 146 ? -41.648  -26.004 -29.862 1.00 0.00 ? 146 LEU A CA  1  
ATOM 703    C C   . LEU A 1 146 ? -41.334  -24.691 -30.470 1.00 0.00 ? 146 LEU A C   1  
ATOM 704    O O   . LEU A 1 146 ? -40.341  -24.652 -31.165 1.00 0.00 ? 146 LEU A O   1  
ATOM 705    C CB  . LEU A 1 146 ? -42.882  -26.591 -30.545 1.00 0.00 ? 146 LEU A CB  1  
ATOM 706    C CG  . LEU A 1 146 ? -42.597  -26.891 -32.048 1.00 0.00 ? 146 LEU A CG  1  
ATOM 707    C CD1 . LEU A 1 146 ? -43.104  -25.787 -33.017 1.00 0.00 ? 146 LEU A CD1 1  
ATOM 708    C CD2 . LEU A 1 146 ? -41.227  -27.546 -32.329 1.00 0.00 ? 146 LEU A CD2 1  
ATOM 709    N N   . GLU A 1 147 ? -42.083  -23.607 -30.139 1.00 0.00 ? 147 GLU A N   1  
ATOM 710    C CA  . GLU A 1 147 ? -41.774  -22.329 -30.741 1.00 0.00 ? 147 GLU A CA  1  
ATOM 711    C C   . GLU A 1 147 ? -40.409  -21.862 -30.381 1.00 0.00 ? 147 GLU A C   1  
ATOM 712    O O   . GLU A 1 147 ? -39.753  -21.368 -31.248 1.00 0.00 ? 147 GLU A O   1  
ATOM 713    C CB  . GLU A 1 147 ? -42.758  -21.269 -30.324 1.00 0.00 ? 147 GLU A CB  1  
ATOM 714    C CG  . GLU A 1 147 ? -44.147  -21.362 -30.911 1.00 0.00 ? 147 GLU A CG  1  
ATOM 715    C CD  . GLU A 1 147 ? -44.153  -20.773 -32.288 1.00 0.00 ? 147 GLU A CD  1  
ATOM 716    O OE1 . GLU A 1 147 ? -43.582  -21.411 -33.240 1.00 0.00 ? 147 GLU A OE1 1  
ATOM 717    O OE2 . GLU A 1 147 ? -44.775  -19.677 -32.461 1.00 0.00 ? 147 GLU A OE2 1  
ATOM 718    N N   . ASP A 1 148 ? -39.952  -21.989 -29.063 1.00 0.00 ? 148 ASP A N   1  
ATOM 719    C CA  . ASP A 1 148 ? -38.707  -21.465 -28.734 1.00 0.00 ? 148 ASP A CA  1  
ATOM 720    C C   . ASP A 1 148 ? -37.499  -22.147 -29.504 1.00 0.00 ? 148 ASP A C   1  
ATOM 721    O O   . ASP A 1 148 ? -36.677  -21.510 -30.196 1.00 0.00 ? 148 ASP A O   1  
ATOM 722    C CB  . ASP A 1 148 ? -38.389  -21.620 -27.196 1.00 0.00 ? 148 ASP A CB  1  
ATOM 723    C CG  . ASP A 1 148 ? -39.507  -21.012 -26.344 1.00 0.00 ? 148 ASP A CG  1  
ATOM 724    O OD1 . ASP A 1 148 ? -40.331  -20.229 -26.851 1.00 0.00 ? 148 ASP A OD1 1  
ATOM 725    O OD2 . ASP A 1 148 ? -39.633  -21.400 -25.153 1.00 0.00 ? 148 ASP A OD2 1  
ATOM 726    N N   . VAL A 1 149 ? -37.534  -23.497 -29.551 1.00 0.00 ? 149 VAL A N   1  
ATOM 727    C CA  . VAL A 1 149 ? -36.479  -24.199 -30.213 1.00 0.00 ? 149 VAL A CA  1  
ATOM 728    C C   . VAL A 1 149 ? -36.445  -23.885 -31.694 1.00 0.00 ? 149 VAL A C   1  
ATOM 729    O O   . VAL A 1 149 ? -35.385  -23.453 -32.187 1.00 0.00 ? 149 VAL A O   1  
ATOM 730    C CB  . VAL A 1 149 ? -36.572  -25.708 -29.849 1.00 0.00 ? 149 VAL A CB  1  
ATOM 731    C CG1 . VAL A 1 149 ? -36.522  -25.777 -28.367 1.00 0.00 ? 149 VAL A CG1 1  
ATOM 732    C CG2 . VAL A 1 149 ? -37.905  -26.358 -30.360 1.00 0.00 ? 149 VAL A CG2 1  
ATOM 733    N N   . TYR A 1 150 ? -37.616  -23.932 -32.389 1.00 0.00 ? 150 TYR A N   1  
ATOM 734    C CA  . TYR A 1 150 ? -37.689  -23.825 -33.838 1.00 0.00 ? 150 TYR A CA  1  
ATOM 735    C C   . TYR A 1 150 ? -37.278  -22.506 -34.339 1.00 0.00 ? 150 TYR A C   1  
ATOM 736    O O   . TYR A 1 150 ? -36.423  -22.363 -35.194 1.00 0.00 ? 150 TYR A O   1  
ATOM 737    C CB  . TYR A 1 150 ? -39.134  -24.135 -34.384 1.00 0.00 ? 150 TYR A CB  1  
ATOM 738    C CG  . TYR A 1 150 ? -39.262  -24.263 -35.849 1.00 0.00 ? 150 TYR A CG  1  
ATOM 739    C CD1 . TYR A 1 150 ? -38.432  -25.214 -36.510 1.00 0.00 ? 150 TYR A CD1 1  
ATOM 740    C CD2 . TYR A 1 150 ? -39.980  -23.317 -36.607 1.00 0.00 ? 150 TYR A CD2 1  
ATOM 741    C CE1 . TYR A 1 150 ? -38.432  -25.299 -37.819 1.00 0.00 ? 150 TYR A CE1 1  
ATOM 742    C CE2 . TYR A 1 150 ? -39.989  -23.391 -37.990 1.00 0.00 ? 150 TYR A CE2 1  
ATOM 743    C CZ  . TYR A 1 150 ? -39.251  -24.385 -38.636 1.00 0.00 ? 150 TYR A CZ  1  
ATOM 744    O OH  . TYR A 1 150 ? -39.334  -24.460 -40.057 1.00 0.00 ? 150 TYR A OH  1  
ATOM 745    N N   . LEU A 1 151 ? -37.784  -21.491 -33.641 1.00 0.00 ? 151 LEU A N   1  
ATOM 746    C CA  . LEU A 1 151 ? -37.655  -20.057 -33.953 1.00 0.00 ? 151 LEU A CA  1  
ATOM 747    C C   . LEU A 1 151 ? -36.236  -19.722 -33.873 1.00 0.00 ? 151 LEU A C   1  
ATOM 748    O O   . LEU A 1 151 ? -35.742  -19.118 -34.799 1.00 0.00 ? 151 LEU A O   1  
ATOM 749    C CB  . LEU A 1 151 ? -38.547  -19.133 -33.051 1.00 0.00 ? 151 LEU A CB  1  
ATOM 750    C CG  . LEU A 1 151 ? -39.989  -19.306 -33.577 1.00 0.00 ? 151 LEU A CG  1  
ATOM 751    C CD1 . LEU A 1 151 ? -41.028  -18.966 -32.585 1.00 0.00 ? 151 LEU A CD1 1  
ATOM 752    C CD2 . LEU A 1 151 ? -40.281  -18.517 -34.915 1.00 0.00 ? 151 LEU A CD2 1  
ATOM 753    N N   . LYS A 1 152 ? -35.513  -20.125 -32.818 1.00 0.00 ? 152 LYS A N   1  
ATOM 754    C CA  . LYS A 1 152 ? -34.160  -19.671 -32.610 1.00 0.00 ? 152 LYS A CA  1  
ATOM 755    C C   . LYS A 1 152 ? -33.289  -20.231 -33.774 1.00 0.00 ? 152 LYS A C   1  
ATOM 756    O O   . LYS A 1 152 ? -32.544  -19.545 -34.476 1.00 0.00 ? 152 LYS A O   1  
ATOM 757    C CB  . LYS A 1 152 ? -33.507  -20.197 -31.377 1.00 0.00 ? 152 LYS A CB  1  
ATOM 758    C CG  . LYS A 1 152 ? -32.123  -19.570 -31.105 1.00 0.00 ? 152 LYS A CG  1  
ATOM 759    C CD  . LYS A 1 152 ? -31.406  -20.143 -29.934 1.00 0.00 ? 152 LYS A CD  1  
ATOM 760    C CE  . LYS A 1 152 ? -30.745  -21.518 -30.016 1.00 0.00 ? 152 LYS A CE  1  
ATOM 761    N NZ  . LYS A 1 152 ? -30.827  -22.154 -31.372 1.00 0.00 ? 152 LYS A NZ  1  
ATOM 762    N N   . THR A 1 153 ? -33.461  -21.530 -33.997 1.00 0.00 ? 153 THR A N   1  
ATOM 763    C CA  . THR A 1 153 ? -32.691  -22.324 -34.819 1.00 0.00 ? 153 THR A CA  1  
ATOM 764    C C   . THR A 1 153 ? -32.797  -21.957 -36.206 1.00 0.00 ? 153 THR A C   1  
ATOM 765    O O   . THR A 1 153 ? -31.780  -21.681 -36.868 1.00 0.00 ? 153 THR A O   1  
ATOM 766    C CB  . THR A 1 153 ? -32.821  -23.828 -34.511 1.00 0.00 ? 153 THR A CB  1  
ATOM 767    O OG1 . THR A 1 153 ? -31.502  -24.342 -34.687 1.00 0.00 ? 153 THR A OG1 1  
ATOM 768    C CG2 . THR A 1 153 ? -33.861  -24.534 -35.312 1.00 0.00 ? 153 THR A CG2 1  
ATOM 769    N N   . LEU A 1 154 ? -34.031  -21.781 -36.674 1.00 0.00 ? 154 LEU A N   1  
ATOM 770    C CA  . LEU A 1 154 ? -34.402  -21.522 -38.044 1.00 0.00 ? 154 LEU A CA  1  
ATOM 771    C C   . LEU A 1 154 ? -33.876  -20.206 -38.436 1.00 0.00 ? 154 LEU A C   1  
ATOM 772    O O   . LEU A 1 154 ? -33.291  -20.006 -39.499 1.00 0.00 ? 154 LEU A O   1  
ATOM 773    C CB  . LEU A 1 154 ? -35.927  -21.536 -38.277 1.00 0.00 ? 154 LEU A CB  1  
ATOM 774    C CG  . LEU A 1 154 ? -36.507  -21.329 -39.718 1.00 0.00 ? 154 LEU A CG  1  
ATOM 775    C CD1 . LEU A 1 154 ? -36.788  -19.901 -40.211 1.00 0.00 ? 154 LEU A CD1 1  
ATOM 776    C CD2 . LEU A 1 154 ? -35.797  -22.129 -40.871 1.00 0.00 ? 154 LEU A CD2 1  
ATOM 777    N N   . VAL A 1 155 ? -34.054  -19.184 -37.545 1.00 0.00 ? 155 VAL A N   1  
ATOM 778    C CA  . VAL A 1 155 ? -33.783  -17.758 -37.843 1.00 0.00 ? 155 VAL A CA  1  
ATOM 779    C C   . VAL A 1 155 ? -32.366  -17.573 -38.087 1.00 0.00 ? 155 VAL A C   1  
ATOM 780    O O   . VAL A 1 155 ? -31.883  -16.875 -38.988 1.00 0.00 ? 155 VAL A O   1  
ATOM 781    C CB  . VAL A 1 155 ? -34.280  -16.892 -36.720 1.00 0.00 ? 155 VAL A CB  1  
ATOM 782    C CG1 . VAL A 1 155 ? -33.665  -15.469 -36.892 1.00 0.00 ? 155 VAL A CG1 1  
ATOM 783    C CG2 . VAL A 1 155 ? -35.827  -16.885 -36.784 1.00 0.00 ? 155 VAL A CG2 1  
ATOM 784    N N   . GLU A 1 156 ? -31.599  -18.262 -37.193 1.00 0.00 ? 156 GLU A N   1  
ATOM 785    C CA  . GLU A 1 156 ? -30.197  -18.123 -37.183 1.00 0.00 ? 156 GLU A CA  1  
ATOM 786    C C   . GLU A 1 156 ? -29.688  -18.710 -38.559 1.00 0.00 ? 156 GLU A C   1  
ATOM 787    O O   . GLU A 1 156 ? -28.894  -18.063 -39.165 1.00 0.00 ? 156 GLU A O   1  
ATOM 788    C CB  . GLU A 1 156 ? -29.723  -18.899 -35.925 1.00 0.00 ? 156 GLU A CB  1  
ATOM 789    C CG  . GLU A 1 156 ? -28.251  -18.550 -35.310 1.00 0.00 ? 156 GLU A CG  1  
ATOM 790    C CD  . GLU A 1 156 ? -27.024  -19.115 -36.138 1.00 0.00 ? 156 GLU A CD  1  
ATOM 791    O OE1 . GLU A 1 156 ? -27.230  -20.217 -36.646 1.00 0.00 ? 156 GLU A OE1 1  
ATOM 792    O OE2 . GLU A 1 156 ? -26.017  -18.403 -36.350 1.00 0.00 ? 156 GLU A OE2 1  
ATOM 793    N N   . ARG A 1 157 ? -30.279  -19.857 -38.944 1.00 0.00 ? 157 ARG A N   1  
ATOM 794    C CA  . ARG A 1 157 ? -29.944  -20.569 -40.124 1.00 0.00 ? 157 ARG A CA  1  
ATOM 795    C C   . ARG A 1 157 ? -30.224  -19.799 -41.421 1.00 0.00 ? 157 ARG A C   1  
ATOM 796    O O   . ARG A 1 157 ? -29.375  -19.620 -42.272 1.00 0.00 ? 157 ARG A O   1  
ATOM 797    C CB  . ARG A 1 157 ? -30.681  -21.962 -40.228 1.00 0.00 ? 157 ARG A CB  1  
ATOM 798    C CG  . ARG A 1 157 ? -29.880  -23.026 -39.501 1.00 0.00 ? 157 ARG A CG  1  
ATOM 799    C CD  . ARG A 1 157 ? -30.787  -24.184 -38.969 1.00 0.00 ? 157 ARG A CD  1  
ATOM 800    N NE  . ARG A 1 157 ? -30.004  -25.398 -38.405 1.00 0.00 ? 157 ARG A NE  1  
ATOM 801    C CZ  . ARG A 1 157 ? -29.074  -25.287 -37.395 1.00 0.00 ? 157 ARG A CZ  1  
ATOM 802    N NH1 . ARG A 1 157 ? -29.115  -24.254 -36.483 1.00 0.00 ? 157 ARG A NH1 1  
ATOM 803    N NH2 . ARG A 1 157 ? -28.155  -26.289 -37.188 1.00 0.00 ? 157 ARG A NH2 1  
ATOM 804    N N   . LEU A 1 158 ? -31.362  -19.121 -41.618 1.00 0.00 ? 158 LEU A N   1  
ATOM 805    C CA  . LEU A 1 158 ? -31.677  -18.392 -42.781 1.00 0.00 ? 158 LEU A CA  1  
ATOM 806    C C   . LEU A 1 158 ? -30.797  -17.223 -42.957 1.00 0.00 ? 158 LEU A C   1  
ATOM 807    O O   . LEU A 1 158 ? -30.305  -17.025 -44.062 1.00 0.00 ? 158 LEU A O   1  
ATOM 808    C CB  . LEU A 1 158 ? -33.126  -18.021 -43.179 1.00 0.00 ? 158 LEU A CB  1  
ATOM 809    C CG  . LEU A 1 158 ? -34.127  -19.171 -43.012 1.00 0.00 ? 158 LEU A CG  1  
ATOM 810    C CD1 . LEU A 1 158 ? -35.485  -18.675 -43.619 1.00 0.00 ? 158 LEU A CD1 1  
ATOM 811    C CD2 . LEU A 1 158 ? -33.646  -20.429 -43.814 1.00 0.00 ? 158 LEU A CD2 1  
ATOM 812    N N   . GLU A 1 159 ? -30.495  -16.499 -41.806 1.00 0.00 ? 159 GLU A N   1  
ATOM 813    C CA  . GLU A 1 159 ? -29.606  -15.423 -41.900 1.00 0.00 ? 159 GLU A CA  1  
ATOM 814    C C   . GLU A 1 159 ? -28.177  -15.809 -42.322 1.00 0.00 ? 159 GLU A C   1  
ATOM 815    O O   . GLU A 1 159 ? -27.584  -15.165 -43.152 1.00 0.00 ? 159 GLU A O   1  
ATOM 816    C CB  . GLU A 1 159 ? -29.621  -14.494 -40.585 1.00 0.00 ? 159 GLU A CB  1  
ATOM 817    C CG  . GLU A 1 159 ? -28.347  -14.053 -39.963 1.00 0.00 ? 159 GLU A CG  1  
ATOM 818    C CD  . GLU A 1 159 ? -27.599  -15.092 -39.063 1.00 0.00 ? 159 GLU A CD  1  
ATOM 819    O OE1 . GLU A 1 159 ? -28.169  -15.441 -37.953 1.00 0.00 ? 159 GLU A OE1 1  
ATOM 820    O OE2 . GLU A 1 159 ? -26.469  -15.416 -39.387 1.00 0.00 ? 159 GLU A OE2 1  
ATOM 821    N N   . ARG A 1 160 ? -27.547  -16.947 -41.840 1.00 0.00 ? 160 ARG A N   1  
ATOM 822    C CA  . ARG A 1 160 ? -26.221  -17.350 -42.127 1.00 0.00 ? 160 ARG A CA  1  
ATOM 823    C C   . ARG A 1 160 ? -26.157  -17.661 -43.628 1.00 0.00 ? 160 ARG A C   1  
ATOM 824    O O   . ARG A 1 160 ? -25.242  -17.241 -44.323 1.00 0.00 ? 160 ARG A O   1  
ATOM 825    C CB  . ARG A 1 160 ? -25.503  -18.529 -41.301 1.00 0.00 ? 160 ARG A CB  1  
ATOM 826    C CG  . ARG A 1 160 ? -26.077  -19.929 -41.471 1.00 0.00 ? 160 ARG A CG  1  
ATOM 827    C CD  . ARG A 1 160 ? -25.119  -20.966 -42.138 1.00 0.00 ? 160 ARG A CD  1  
ATOM 828    N NE  . ARG A 1 160 ? -24.862  -20.798 -43.600 1.00 0.00 ? 160 ARG A NE  1  
ATOM 829    C CZ  . ARG A 1 160 ? -23.842  -20.031 -44.144 1.00 0.00 ? 160 ARG A CZ  1  
ATOM 830    N NH1 . ARG A 1 160 ? -22.851  -19.520 -43.385 1.00 0.00 ? 160 ARG A NH1 1  
ATOM 831    N NH2 . ARG A 1 160 ? -23.848  -19.771 -45.481 1.00 0.00 ? 160 ARG A NH2 1  
ATOM 832    N N   . ASP A 1 161 ? -27.204  -18.366 -44.192 1.00 0.00 ? 161 ASP A N   1  
ATOM 833    C CA  . ASP A 1 161 ? -27.279  -18.727 -45.536 1.00 0.00 ? 161 ASP A CA  1  
ATOM 834    C C   . ASP A 1 161 ? -27.407  -17.651 -46.548 1.00 0.00 ? 161 ASP A C   1  
ATOM 835    O O   . ASP A 1 161 ? -26.634  -17.497 -47.522 1.00 0.00 ? 161 ASP A O   1  
ATOM 836    C CB  . ASP A 1 161 ? -28.364  -19.699 -45.919 1.00 0.00 ? 161 ASP A CB  1  
ATOM 837    C CG  . ASP A 1 161 ? -28.128  -21.051 -45.275 1.00 0.00 ? 161 ASP A CG  1  
ATOM 838    O OD1 . ASP A 1 161 ? -26.958  -21.582 -45.297 1.00 0.00 ? 161 ASP A OD1 1  
ATOM 839    O OD2 . ASP A 1 161 ? -29.106  -21.524 -44.619 1.00 0.00 ? 161 ASP A OD2 1  
ATOM 840    N N   . PHE A 1 162 ? -28.252  -16.606 -46.276 1.00 0.00 ? 162 PHE A N   1  
ATOM 841    C CA  . PHE A 1 162 ? -28.416  -15.437 -47.062 1.00 0.00 ? 162 PHE A CA  1  
ATOM 842    C C   . PHE A 1 162 ? -27.095  -14.601 -47.053 1.00 0.00 ? 162 PHE A C   1  
ATOM 843    O O   . PHE A 1 162 ? -26.715  -14.046 -48.065 1.00 0.00 ? 162 PHE A O   1  
ATOM 844    C CB  . PHE A 1 162 ? -29.614  -14.503 -46.727 1.00 0.00 ? 162 PHE A CB  1  
ATOM 845    C CG  . PHE A 1 162 ? -29.779  -13.583 -47.890 1.00 0.00 ? 162 PHE A CG  1  
ATOM 846    C CD1 . PHE A 1 162 ? -30.477  -14.035 -49.022 1.00 0.00 ? 162 PHE A CD1 1  
ATOM 847    C CD2 . PHE A 1 162 ? -29.147  -12.318 -47.939 1.00 0.00 ? 162 PHE A CD2 1  
ATOM 848    C CE1 . PHE A 1 162 ? -30.571  -13.290 -50.235 1.00 0.00 ? 162 PHE A CE1 1  
ATOM 849    C CE2 . PHE A 1 162 ? -29.181  -11.641 -49.207 1.00 0.00 ? 162 PHE A CE2 1  
ATOM 850    C CZ  . PHE A 1 162 ? -29.839  -12.090 -50.358 1.00 0.00 ? 162 PHE A CZ  1  
ATOM 851    N N   . ASN A 1 163 ? -26.517  -14.427 -45.829 1.00 0.00 ? 163 ASN A N   1  
ATOM 852    C CA  . ASN A 1 163 ? -25.440  -13.497 -45.468 1.00 0.00 ? 163 ASN A CA  1  
ATOM 853    C C   . ASN A 1 163 ? -24.216  -13.818 -46.210 1.00 0.00 ? 163 ASN A C   1  
ATOM 854    O O   . ASN A 1 163 ? -23.513  -12.931 -46.734 1.00 0.00 ? 163 ASN A O   1  
ATOM 855    C CB  . ASN A 1 163 ? -25.154  -13.245 -43.971 1.00 0.00 ? 163 ASN A CB  1  
ATOM 856    C CG  . ASN A 1 163 ? -24.398  -14.274 -42.994 1.00 0.00 ? 163 ASN A CG  1  
ATOM 857    O OD1 . ASN A 1 163 ? -23.480  -15.093 -43.259 1.00 0.00 ? 163 ASN A OD1 1  
ATOM 858    N ND2 . ASN A 1 163 ? -24.785  -14.157 -41.706 1.00 0.00 ? 163 ASN A ND2 1  
ATOM 859    N N   . LYS A 1 164 ? -23.859  -15.101 -46.293 1.00 0.00 ? 164 LYS A N   1  
ATOM 860    C CA  . LYS A 1 164 ? -22.548  -15.532 -46.806 1.00 0.00 ? 164 LYS A CA  1  
ATOM 861    C C   . LYS A 1 164 ? -22.340  -15.260 -48.223 1.00 0.00 ? 164 LYS A C   1  
ATOM 862    O O   . LYS A 1 164 ? -21.430  -14.584 -48.732 1.00 0.00 ? 164 LYS A O   1  
ATOM 863    C CB  . LYS A 1 164 ? -22.244  -17.068 -46.500 1.00 0.00 ? 164 LYS A CB  1  
ATOM 864    C CG  . LYS A 1 164 ? -20.870  -17.564 -46.856 1.00 0.00 ? 164 LYS A CG  1  
ATOM 865    C CD  . LYS A 1 164 ? -20.636  -18.891 -46.229 1.00 0.00 ? 164 LYS A CD  1  
ATOM 866    C CE  . LYS A 1 164 ? -19.173  -19.243 -46.385 1.00 0.00 ? 164 LYS A CE  1  
ATOM 867    N NZ  . LYS A 1 164 ? -18.868  -19.599 -47.738 1.00 0.00 ? 164 LYS A NZ  1  
ATOM 868    N N   . VAL A 1 165 ? -23.325  -15.713 -48.958 1.00 0.00 ? 165 VAL A N   1  
ATOM 869    C CA  . VAL A 1 165 ? -23.484  -15.602 -50.399 1.00 0.00 ? 165 VAL A CA  1  
ATOM 870    C C   . VAL A 1 165 ? -25.030  -15.534 -50.347 1.00 0.00 ? 165 VAL A C   1  
ATOM 871    O O   . VAL A 1 165 ? -25.549  -15.933 -49.357 1.00 0.00 ? 165 VAL A O   1  
ATOM 872    C CB  . VAL A 1 165 ? -22.880  -16.833 -51.247 1.00 0.00 ? 165 VAL A CB  1  
ATOM 873    C CG1 . VAL A 1 165 ? -23.487  -17.175 -52.597 1.00 0.00 ? 165 VAL A CG1 1  
ATOM 874    C CG2 . VAL A 1 165 ? -21.328  -16.773 -51.339 1.00 0.00 ? 165 VAL A CG2 1  
ATOM 875    N N   . PRO A 1 166 ? -25.809  -15.054 -51.338 1.00 0.00 ? 166 PRO A N   1  
ATOM 876    C CA  . PRO A 1 166 ? -27.215  -14.940 -51.243 1.00 0.00 ? 166 PRO A CA  1  
ATOM 877    C C   . PRO A 1 166 ? -27.951  -16.199 -50.955 1.00 0.00 ? 166 PRO A C   1  
ATOM 878    O O   . PRO A 1 166 ? -28.977  -16.078 -50.310 1.00 0.00 ? 166 PRO A O   1  
ATOM 879    C CB  . PRO A 1 166 ? -27.702  -14.299 -52.560 1.00 0.00 ? 166 PRO A CB  1  
ATOM 880    C CG  . PRO A 1 166 ? -26.458  -13.401 -52.867 1.00 0.00 ? 166 PRO A CG  1  
ATOM 881    C CD  . PRO A 1 166 ? -25.264  -14.163 -52.296 1.00 0.00 ? 166 PRO A CD  1  
ATOM 882    N N   . ASN A 1 167 ? -27.461  -17.388 -51.222 1.00 0.00 ? 167 ASN A N   1  
ATOM 883    C CA  . ASN A 1 167 ? -28.006  -18.646 -50.809 1.00 0.00 ? 167 ASN A CA  1  
ATOM 884    C C   . ASN A 1 167 ? -26.848  -19.658 -50.428 1.00 0.00 ? 167 ASN A C   1  
ATOM 885    O O   . ASN A 1 167 ? -25.741  -19.484 -50.926 1.00 0.00 ? 167 ASN A O   1  
ATOM 886    C CB  . ASN A 1 167 ? -28.872  -19.335 -51.921 1.00 0.00 ? 167 ASN A CB  1  
ATOM 887    C CG  . ASN A 1 167 ? -29.771  -18.317 -52.575 1.00 0.00 ? 167 ASN A CG  1  
ATOM 888    O OD1 . ASN A 1 167 ? -30.780  -17.937 -51.912 1.00 0.00 ? 167 ASN A OD1 1  
ATOM 889    N ND2 . ASN A 1 167 ? -29.256  -17.772 -53.724 1.00 0.00 ? 167 ASN A ND2 1  
ATOM 890    N N   . PHE A 1 168 ? -27.199  -20.652 -49.581 1.00 0.00 ? 168 PHE A N   1  
ATOM 891    C CA  . PHE A 1 168 ? -26.293  -21.609 -49.255 1.00 0.00 ? 168 PHE A CA  1  
ATOM 892    C C   . PHE A 1 168 ? -27.099  -22.811 -48.784 1.00 0.00 ? 168 PHE A C   1  
ATOM 893    O O   . PHE A 1 168 ? -28.287  -22.680 -48.514 1.00 0.00 ? 168 PHE A O   1  
ATOM 894    C CB  . PHE A 1 168 ? -25.238  -21.144 -48.089 1.00 0.00 ? 168 PHE A CB  1  
ATOM 895    C CG  . PHE A 1 168 ? -23.899  -21.144 -48.646 1.00 0.00 ? 168 PHE A CG  1  
ATOM 896    C CD1 . PHE A 1 168 ? -23.230  -22.330 -48.942 1.00 0.00 ? 168 PHE A CD1 1  
ATOM 897    C CD2 . PHE A 1 168 ? -23.215  -19.932 -48.946 1.00 0.00 ? 168 PHE A CD2 1  
ATOM 898    C CE1 . PHE A 1 168 ? -21.853  -22.341 -49.254 1.00 0.00 ? 168 PHE A CE1 1  
ATOM 899    C CE2 . PHE A 1 168 ? -21.922  -19.887 -49.408 1.00 0.00 ? 168 PHE A CE2 1  
ATOM 900    C CZ  . PHE A 1 168 ? -21.178  -21.112 -49.476 1.00 0.00 ? 168 PHE A CZ  1  
ATOM 901    N N   . SER A 1 169 ? -26.462  -24.039 -48.847 1.00 0.00 ? 169 SER A N   1  
ATOM 902    C CA  . SER A 1 169 ? -27.213  -25.292 -48.742 1.00 0.00 ? 169 SER A CA  1  
ATOM 903    C C   . SER A 1 169 ? -27.660  -25.673 -47.273 1.00 0.00 ? 169 SER A C   1  
ATOM 904    O O   . SER A 1 169 ? -26.974  -25.542 -46.216 1.00 0.00 ? 169 SER A O   1  
ATOM 905    C CB  . SER A 1 169 ? -26.428  -26.425 -49.275 1.00 0.00 ? 169 SER A CB  1  
ATOM 906    O OG  . SER A 1 169 ? -26.072  -26.207 -50.652 1.00 0.00 ? 169 SER A OG  1  
ATOM 907    N N   . ILE A 1 170 ? -28.957  -26.031 -47.268 1.00 0.00 ? 170 ILE A N   1  
ATOM 908    C CA  . ILE A 1 170 ? -29.847  -26.366 -46.277 1.00 0.00 ? 170 ILE A CA  1  
ATOM 909    C C   . ILE A 1 170 ? -29.570  -27.587 -45.489 1.00 0.00 ? 170 ILE A C   1  
ATOM 910    O O   . ILE A 1 170 ? -29.940  -27.672 -44.351 1.00 0.00 ? 170 ILE A O   1  
ATOM 911    C CB  . ILE A 1 170 ? -31.230  -26.466 -46.901 1.00 0.00 ? 170 ILE A CB  1  
ATOM 912    C CG1 . ILE A 1 170 ? -31.628  -25.431 -48.079 1.00 0.00 ? 170 ILE A CG1 1  
ATOM 913    C CG2 . ILE A 1 170 ? -32.315  -26.379 -45.737 1.00 0.00 ? 170 ILE A CG2 1  
ATOM 914    C CD1 . ILE A 1 170 ? -33.049  -25.627 -48.633 1.00 0.00 ? 170 ILE A CD1 1  
ATOM 915    N N   . ARG A 1 171 ? -29.065  -28.595 -46.208 1.00 0.00 ? 171 ARG A N   1  
ATOM 916    C CA  . ARG A 1 171 ? -29.189  -29.953 -45.866 1.00 0.00 ? 171 ARG A CA  1  
ATOM 917    C C   . ARG A 1 171 ? -28.610  -30.408 -44.578 1.00 0.00 ? 171 ARG A C   1  
ATOM 918    O O   . ARG A 1 171 ? -29.352  -31.144 -43.887 1.00 0.00 ? 171 ARG A O   1  
ATOM 919    C CB  . ARG A 1 171 ? -28.636  -30.728 -47.057 1.00 0.00 ? 171 ARG A CB  1  
ATOM 920    C CG  . ARG A 1 171 ? -29.593  -30.658 -48.325 1.00 0.00 ? 171 ARG A CG  1  
ATOM 921    C CD  . ARG A 1 171 ? -29.337  -29.491 -49.291 1.00 0.00 ? 171 ARG A CD  1  
ATOM 922    N NE  . ARG A 1 171 ? -30.222  -29.601 -50.537 1.00 0.00 ? 171 ARG A NE  1  
ATOM 923    C CZ  . ARG A 1 171 ? -30.103  -28.753 -51.577 1.00 0.00 ? 171 ARG A CZ  1  
ATOM 924    N NH1 . ARG A 1 171 ? -29.022  -27.871 -51.503 1.00 0.00 ? 171 ARG A NH1 1  
ATOM 925    N NH2 . ARG A 1 171 ? -30.931  -28.867 -52.612 1.00 0.00 ? 171 ARG A NH2 1  
ATOM 926    N N   . GLU A 1 172 ? -27.362  -29.946 -44.215 1.00 0.00 ? 172 GLU A N   1  
ATOM 927    C CA  . GLU A 1 172 ? -26.647  -30.243 -42.997 1.00 0.00 ? 172 GLU A CA  1  
ATOM 928    C C   . GLU A 1 172 ? -27.438  -29.621 -41.876 1.00 0.00 ? 172 GLU A C   1  
ATOM 929    O O   . GLU A 1 172 ? -27.630  -30.243 -40.884 1.00 0.00 ? 172 GLU A O   1  
ATOM 930    C CB  . GLU A 1 172 ? -25.295  -29.546 -42.964 1.00 0.00 ? 172 GLU A CB  1  
ATOM 931    C CG  . GLU A 1 172 ? -24.547  -29.492 -41.639 1.00 0.00 ? 172 GLU A CG  1  
ATOM 932    C CD  . GLU A 1 172 ? -23.269  -28.665 -41.682 1.00 0.00 ? 172 GLU A CD  1  
ATOM 933    O OE1 . GLU A 1 172 ? -23.092  -27.746 -42.528 1.00 0.00 ? 172 GLU A OE1 1  
ATOM 934    O OE2 . GLU A 1 172 ? -22.444  -28.921 -40.808 1.00 0.00 ? 172 GLU A OE2 1  
ATOM 935    N N   . LEU A 1 173 ? -27.893  -28.389 -42.161 1.00 0.00 ? 173 LEU A N   1  
ATOM 936    C CA  . LEU A 1 173 ? -28.590  -27.569 -41.150 1.00 0.00 ? 173 LEU A CA  1  
ATOM 937    C C   . LEU A 1 173 ? -29.849  -28.205 -40.705 1.00 0.00 ? 173 LEU A C   1  
ATOM 938    O O   . LEU A 1 173 ? -30.085  -28.425 -39.499 1.00 0.00 ? 173 LEU A O   1  
ATOM 939    C CB  . LEU A 1 173 ? -28.841  -26.118 -41.719 1.00 0.00 ? 173 LEU A CB  1  
ATOM 940    C CG  . LEU A 1 173 ? -27.598  -25.479 -42.366 1.00 0.00 ? 173 LEU A CG  1  
ATOM 941    C CD1 . LEU A 1 173 ? -28.143  -24.256 -43.085 1.00 0.00 ? 173 LEU A CD1 1  
ATOM 942    C CD2 . LEU A 1 173 ? -26.434  -25.205 -41.418 1.00 0.00 ? 173 LEU A CD2 1  
ATOM 943    N N   . GLU A 1 174 ? -30.562  -28.685 -41.716 1.00 0.00 ? 174 GLU A N   1  
ATOM 944    C CA  . GLU A 1 174 ? -31.847  -29.405 -41.684 1.00 0.00 ? 174 GLU A CA  1  
ATOM 945    C C   . GLU A 1 174 ? -31.737  -30.690 -40.997 1.00 0.00 ? 174 GLU A C   1  
ATOM 946    O O   . GLU A 1 174 ? -32.605  -30.953 -40.196 1.00 0.00 ? 174 GLU A O   1  
ATOM 947    C CB  . GLU A 1 174 ? -32.236  -29.514 -43.204 1.00 0.00 ? 174 GLU A CB  1  
ATOM 948    C CG  . GLU A 1 174 ? -33.087  -30.764 -43.516 1.00 0.00 ? 174 GLU A CG  1  
ATOM 949    C CD  . GLU A 1 174 ? -32.243  -31.984 -43.996 1.00 0.00 ? 174 GLU A CD  1  
ATOM 950    O OE1 . GLU A 1 174 ? -31.694  -31.825 -45.208 1.00 0.00 ? 174 GLU A OE1 1  
ATOM 951    O OE2 . GLU A 1 174 ? -32.209  -33.030 -43.337 1.00 0.00 ? 174 GLU A OE2 1  
ATOM 952    N N   . GLN A 1 175 ? -30.657  -31.440 -41.203 1.00 0.00 ? 175 GLN A N   1  
ATOM 953    C CA  . GLN A 1 175 ? -30.599  -32.731 -40.569 1.00 0.00 ? 175 GLN A CA  1  
ATOM 954    C C   . GLN A 1 175 ? -30.595  -32.619 -39.065 1.00 0.00 ? 175 GLN A C   1  
ATOM 955    O O   . GLN A 1 175 ? -31.352  -33.286 -38.360 1.00 0.00 ? 175 GLN A O   1  
ATOM 956    C CB  . GLN A 1 175 ? -29.315  -33.501 -40.943 1.00 0.00 ? 175 GLN A CB  1  
ATOM 957    C CG  . GLN A 1 175 ? -29.130  -34.990 -40.300 1.00 0.00 ? 175 GLN A CG  1  
ATOM 958    C CD  . GLN A 1 175 ? -30.310  -35.912 -40.643 1.00 0.00 ? 175 GLN A CD  1  
ATOM 959    O OE1 . GLN A 1 175 ? -31.062  -35.680 -41.629 1.00 0.00 ? 175 GLN A OE1 1  
ATOM 960    N NE2 . GLN A 1 175 ? -30.557  -36.911 -39.778 1.00 0.00 ? 175 GLN A NE2 1  
ATOM 961    N N   . ILE A 1 176 ? -29.787  -31.663 -38.525 1.00 0.00 ? 176 ILE A N   1  
ATOM 962    C CA  . ILE A 1 176 ? -29.708  -31.547 -37.129 1.00 0.00 ? 176 ILE A CA  1  
ATOM 963    C C   . ILE A 1 176 ? -30.988  -31.127 -36.456 1.00 0.00 ? 176 ILE A C   1  
ATOM 964    O O   . ILE A 1 176 ? -31.494  -31.776 -35.526 1.00 0.00 ? 176 ILE A O   1  
ATOM 965    C CB  . ILE A 1 176 ? -28.653  -30.649 -36.786 1.00 0.00 ? 176 ILE A CB  1  
ATOM 966    C CG1 . ILE A 1 176 ? -27.327  -31.082 -37.437 1.00 0.00 ? 176 ILE A CG1 1  
ATOM 967    C CG2 . ILE A 1 176 ? -28.510  -30.537 -35.264 1.00 0.00 ? 176 ILE A CG2 1  
ATOM 968    C CD1 . ILE A 1 176 ? -26.139  -30.161 -37.113 1.00 0.00 ? 176 ILE A CD1 1  
ATOM 969    N N   . ILE A 1 177 ? -31.568  -30.096 -37.033 1.00 0.00 ? 177 ILE A N   1  
ATOM 970    C CA  . ILE A 1 177 ? -32.730  -29.503 -36.507 1.00 0.00 ? 177 ILE A CA  1  
ATOM 971    C C   . ILE A 1 177 ? -33.849  -30.510 -36.491 1.00 0.00 ? 177 ILE A C   1  
ATOM 972    O O   . ILE A 1 177 ? -34.500  -30.616 -35.442 1.00 0.00 ? 177 ILE A O   1  
ATOM 973    C CB  . ILE A 1 177 ? -33.133  -28.198 -37.116 1.00 0.00 ? 177 ILE A CB  1  
ATOM 974    C CG1 . ILE A 1 177 ? -33.426  -28.272 -38.641 1.00 0.00 ? 177 ILE A CG1 1  
ATOM 975    C CG2 . ILE A 1 177 ? -32.022  -27.192 -36.719 1.00 0.00 ? 177 ILE A CG2 1  
ATOM 976    C CD1 . ILE A 1 177 ? -33.841  -26.930 -39.267 1.00 0.00 ? 177 ILE A CD1 1  
ATOM 977    N N   . ASN A 1 178 ? -33.871  -31.304 -37.632 1.00 0.00 ? 178 ASN A N   1  
ATOM 978    C CA  . ASN A 1 178 ? -34.848  -32.312 -37.912 1.00 0.00 ? 178 ASN A CA  1  
ATOM 979    C C   . ASN A 1 178 ? -34.873  -33.315 -36.871 1.00 0.00 ? 178 ASN A C   1  
ATOM 980    O O   . ASN A 1 178 ? -35.931  -33.710 -36.444 1.00 0.00 ? 178 ASN A O   1  
ATOM 981    C CB  . ASN A 1 178 ? -34.610  -33.175 -39.208 1.00 0.00 ? 178 ASN A CB  1  
ATOM 982    C CG  . ASN A 1 178 ? -35.083  -32.392 -40.440 1.00 0.00 ? 178 ASN A CG  1  
ATOM 983    O OD1 . ASN A 1 178 ? -35.764  -31.379 -40.386 1.00 0.00 ? 178 ASN A OD1 1  
ATOM 984    N ND2 . ASN A 1 178 ? -34.918  -32.991 -41.654 1.00 0.00 ? 178 ASN A ND2 1  
ATOM 985    N N   . GLU A 1 179 ? -33.721  -33.828 -36.344 1.00 0.00 ? 179 GLU A N   1  
ATOM 986    C CA  . GLU A 1 179 ? -34.004  -34.914 -35.422 1.00 0.00 ? 179 GLU A CA  1  
ATOM 987    C C   . GLU A 1 179 ? -34.710  -34.590 -34.185 1.00 0.00 ? 179 GLU A C   1  
ATOM 988    O O   . GLU A 1 179 ? -35.766  -35.171 -33.868 1.00 0.00 ? 179 GLU A O   1  
ATOM 989    C CB  . GLU A 1 179 ? -32.777  -35.702 -35.063 1.00 0.00 ? 179 GLU A CB  1  
ATOM 990    C CG  . GLU A 1 179 ? -31.435  -34.934 -34.863 1.00 0.00 ? 179 GLU A CG  1  
ATOM 991    C CD  . GLU A 1 179 ? -30.251  -35.883 -34.511 1.00 0.00 ? 179 GLU A CD  1  
ATOM 992    O OE1 . GLU A 1 179 ? -30.045  -36.876 -35.295 1.00 0.00 ? 179 GLU A OE1 1  
ATOM 993    O OE2 . GLU A 1 179 ? -29.741  -35.738 -33.392 1.00 0.00 ? 179 GLU A OE2 1  
ATOM 994    N N   . THR A 1 180 ? -34.283  -33.504 -33.582 1.00 0.00 ? 180 THR A N   1  
ATOM 995    C CA  . THR A 1 180 ? -34.831  -33.108 -32.266 1.00 0.00 ? 180 THR A CA  1  
ATOM 996    C C   . THR A 1 180 ? -36.323  -32.831 -32.459 1.00 0.00 ? 180 THR A C   1  
ATOM 997    O O   . THR A 1 180 ? -37.125  -33.477 -31.750 1.00 0.00 ? 180 THR A O   1  
ATOM 998    C CB  . THR A 1 180 ? -34.089  -31.956 -31.579 1.00 0.00 ? 180 THR A CB  1  
ATOM 999    O OG1 . THR A 1 180 ? -33.853  -30.986 -32.594 1.00 0.00 ? 180 THR A OG1 1  
ATOM 1000   C CG2 . THR A 1 180 ? -32.727  -32.390 -31.070 1.00 0.00 ? 180 THR A CG2 1  
ATOM 1001   N N   . GLU A 1 181 ? -36.652  -32.016 -33.534 1.00 0.00 ? 181 GLU A N   1  
ATOM 1002   C CA  . GLU A 1 181 ? -37.976  -31.521 -33.689 1.00 0.00 ? 181 GLU A CA  1  
ATOM 1003   C C   . GLU A 1 181 ? -38.991  -32.617 -33.897 1.00 0.00 ? 181 GLU A C   1  
ATOM 1004   O O   . GLU A 1 181 ? -39.904  -32.742 -33.053 1.00 0.00 ? 181 GLU A O   1  
ATOM 1005   C CB  . GLU A 1 181 ? -38.204  -30.457 -34.841 1.00 0.00 ? 181 GLU A CB  1  
ATOM 1006   C CG  . GLU A 1 181 ? -37.492  -30.781 -36.181 1.00 0.00 ? 181 GLU A CG  1  
ATOM 1007   C CD  . GLU A 1 181 ? -37.333  -29.590 -37.074 1.00 0.00 ? 181 GLU A CD  1  
ATOM 1008   O OE1 . GLU A 1 181 ? -36.899  -28.516 -36.496 1.00 0.00 ? 181 GLU A OE1 1  
ATOM 1009   O OE2 . GLU A 1 181 ? -37.606  -29.687 -38.311 1.00 0.00 ? 181 GLU A OE2 1  
ATOM 1010   N N   . VAL A 1 182 ? -38.587  -33.510 -34.880 1.00 0.00 ? 182 VAL A N   1  
ATOM 1011   C CA  . VAL A 1 182 ? -39.439  -34.402 -35.624 1.00 0.00 ? 182 VAL A CA  1  
ATOM 1012   C C   . VAL A 1 182 ? -40.108  -35.331 -34.596 1.00 0.00 ? 182 VAL A C   1  
ATOM 1013   O O   . VAL A 1 182 ? -41.300  -35.379 -34.482 1.00 0.00 ? 182 VAL A O   1  
ATOM 1014   C CB  . VAL A 1 182 ? -38.917  -35.208 -36.820 1.00 0.00 ? 182 VAL A CB  1  
ATOM 1015   C CG1 . VAL A 1 182 ? -38.639  -34.208 -37.867 1.00 0.00 ? 182 VAL A CG1 1  
ATOM 1016   C CG2 . VAL A 1 182 ? -37.720  -36.207 -36.547 1.00 0.00 ? 182 VAL A CG2 1  
ATOM 1017   N N   . ASN A 1 183 ? -39.194  -35.890 -33.761 1.00 0.00 ? 183 ASN A N   1  
ATOM 1018   C CA  . ASN A 1 183 ? -39.443  -37.090 -32.971 1.00 0.00 ? 183 ASN A CA  1  
ATOM 1019   C C   . ASN A 1 183 ? -40.547  -36.728 -31.953 1.00 0.00 ? 183 ASN A C   1  
ATOM 1020   O O   . ASN A 1 183 ? -41.675  -37.216 -32.152 1.00 0.00 ? 183 ASN A O   1  
ATOM 1021   C CB  . ASN A 1 183 ? -38.212  -37.514 -32.287 1.00 0.00 ? 183 ASN A CB  1  
ATOM 1022   C CG  . ASN A 1 183 ? -38.330  -38.754 -31.399 1.00 0.00 ? 183 ASN A CG  1  
ATOM 1023   O OD1 . ASN A 1 183 ? -38.649  -38.658 -30.179 1.00 0.00 ? 183 ASN A OD1 1  
ATOM 1024   N ND2 . ASN A 1 183 ? -38.156  -39.979 -31.913 1.00 0.00 ? 183 ASN A ND2 1  
ATOM 1025   N N   . LYS A 1 184 ? -40.374  -35.661 -31.236 1.00 0.00 ? 184 LYS A N   1  
ATOM 1026   C CA  . LYS A 1 184 ? -41.205  -35.291 -30.035 1.00 0.00 ? 184 LYS A CA  1  
ATOM 1027   C C   . LYS A 1 184 ? -42.604  -34.964 -30.507 1.00 0.00 ? 184 LYS A C   1  
ATOM 1028   O O   . LYS A 1 184 ? -43.551  -35.689 -30.193 1.00 0.00 ? 184 LYS A O   1  
ATOM 1029   C CB  . LYS A 1 184 ? -40.523  -34.093 -29.233 1.00 0.00 ? 184 LYS A CB  1  
ATOM 1030   C CG  . LYS A 1 184 ? -38.991  -34.282 -28.973 1.00 0.00 ? 184 LYS A CG  1  
ATOM 1031   C CD  . LYS A 1 184 ? -38.682  -35.436 -28.058 1.00 0.00 ? 184 LYS A CD  1  
ATOM 1032   C CE  . LYS A 1 184 ? -37.159  -35.760 -28.071 1.00 0.00 ? 184 LYS A CE  1  
ATOM 1033   N NZ  . LYS A 1 184 ? -36.691  -36.377 -29.357 1.00 0.00 ? 184 LYS A NZ  1  
ATOM 1034   N N   . GLN A 1 185 ? -42.622  -34.063 -31.495 1.00 0.00 ? 185 GLN A N   1  
ATOM 1035   C CA  . GLN A 1 185 ? -43.872  -33.409 -31.909 1.00 0.00 ? 185 GLN A CA  1  
ATOM 1036   C C   . GLN A 1 185 ? -44.821  -34.301 -32.583 1.00 0.00 ? 185 GLN A C   1  
ATOM 1037   O O   . GLN A 1 185 ? -45.936  -34.450 -32.187 1.00 0.00 ? 185 GLN A O   1  
ATOM 1038   C CB  . GLN A 1 185 ? -43.510  -32.247 -32.869 1.00 0.00 ? 185 GLN A CB  1  
ATOM 1039   C CG  . GLN A 1 185 ? -42.761  -31.045 -32.223 1.00 0.00 ? 185 GLN A CG  1  
ATOM 1040   C CD  . GLN A 1 185 ? -43.471  -30.675 -30.899 1.00 0.00 ? 185 GLN A CD  1  
ATOM 1041   O OE1 . GLN A 1 185 ? -42.942  -30.813 -29.791 1.00 0.00 ? 185 GLN A OE1 1  
ATOM 1042   N NE2 . GLN A 1 185 ? -44.768  -30.253 -31.036 1.00 0.00 ? 185 GLN A NE2 1  
ATOM 1043   N N   . MET A 1 186 ? -44.308  -35.159 -33.527 1.00 0.00 ? 186 MET A N   1  
ATOM 1044   C CA  . MET A 1 186 ? -45.005  -35.960 -34.427 1.00 0.00 ? 186 MET A CA  1  
ATOM 1045   C C   . MET A 1 186 ? -45.744  -36.930 -33.666 1.00 0.00 ? 186 MET A C   1  
ATOM 1046   O O   . MET A 1 186 ? -46.923  -37.037 -33.879 1.00 0.00 ? 186 MET A O   1  
ATOM 1047   C CB  . MET A 1 186 ? -43.972  -36.589 -35.389 1.00 0.00 ? 186 MET A CB  1  
ATOM 1048   C CG  . MET A 1 186 ? -43.532  -35.572 -36.463 1.00 0.00 ? 186 MET A CG  1  
ATOM 1049   S SD  . MET A 1 186 ? -42.478  -36.335 -37.759 1.00 0.00 ? 186 MET A SD  1  
ATOM 1050   C CE  . MET A 1 186 ? -42.175  -34.763 -38.717 1.00 0.00 ? 186 MET A CE  1  
ATOM 1051   N N   . GLU A 1 187 ? -45.125  -37.619 -32.623 1.00 0.00 ? 187 GLU A N   1  
ATOM 1052   C CA  . GLU A 1 187 ? -45.571  -38.768 -31.885 1.00 0.00 ? 187 GLU A CA  1  
ATOM 1053   C C   . GLU A 1 187 ? -46.752  -38.324 -31.122 1.00 0.00 ? 187 GLU A C   1  
ATOM 1054   O O   . GLU A 1 187 ? -47.826  -38.931 -31.217 1.00 0.00 ? 187 GLU A O   1  
ATOM 1055   C CB  . GLU A 1 187 ? -44.529  -39.206 -30.849 1.00 0.00 ? 187 GLU A CB  1  
ATOM 1056   C CG  . GLU A 1 187 ? -44.850  -40.459 -29.974 1.00 0.00 ? 187 GLU A CG  1  
ATOM 1057   C CD  . GLU A 1 187 ? -44.737  -41.703 -30.812 1.00 0.00 ? 187 GLU A CD  1  
ATOM 1058   O OE1 . GLU A 1 187 ? -43.673  -41.993 -31.484 1.00 0.00 ? 187 GLU A OE1 1  
ATOM 1059   O OE2 . GLU A 1 187 ? -45.758  -42.461 -30.872 1.00 0.00 ? 187 GLU A OE2 1  
ATOM 1060   N N   . LEU A 1 188 ? -46.694  -37.113 -30.492 1.00 0.00 ? 188 LEU A N   1  
ATOM 1061   C CA  . LEU A 1 188 ? -47.670  -36.594 -29.656 1.00 0.00 ? 188 LEU A CA  1  
ATOM 1062   C C   . LEU A 1 188 ? -48.964  -36.364 -30.413 1.00 0.00 ? 188 LEU A C   1  
ATOM 1063   O O   . LEU A 1 188 ? -49.999  -36.862 -30.012 1.00 0.00 ? 188 LEU A O   1  
ATOM 1064   C CB  . LEU A 1 188 ? -47.235  -35.161 -29.071 1.00 0.00 ? 188 LEU A CB  1  
ATOM 1065   C CG  . LEU A 1 188 ? -46.058  -35.221 -28.047 1.00 0.00 ? 188 LEU A CG  1  
ATOM 1066   C CD1 . LEU A 1 188 ? -45.395  -33.862 -27.831 1.00 0.00 ? 188 LEU A CD1 1  
ATOM 1067   C CD2 . LEU A 1 188 ? -46.626  -35.712 -26.742 1.00 0.00 ? 188 LEU A CD2 1  
ATOM 1068   N N   . LEU A 1 189 ? -48.841  -35.699 -31.589 1.00 0.00 ? 189 LEU A N   1  
ATOM 1069   C CA  . LEU A 1 189 ? -49.959  -35.249 -32.388 1.00 0.00 ? 189 LEU A CA  1  
ATOM 1070   C C   . LEU A 1 189 ? -50.638  -36.369 -32.993 1.00 0.00 ? 189 LEU A C   1  
ATOM 1071   O O   . LEU A 1 189 ? -51.877  -36.374 -33.042 1.00 0.00 ? 189 LEU A O   1  
ATOM 1072   C CB  . LEU A 1 189 ? -49.582  -34.348 -33.547 1.00 0.00 ? 189 LEU A CB  1  
ATOM 1073   C CG  . LEU A 1 189 ? -48.994  -33.025 -33.168 1.00 0.00 ? 189 LEU A CG  1  
ATOM 1074   C CD1 . LEU A 1 189 ? -47.930  -32.568 -34.234 1.00 0.00 ? 189 LEU A CD1 1  
ATOM 1075   C CD2 . LEU A 1 189 ? -50.093  -31.903 -32.999 1.00 0.00 ? 189 LEU A CD2 1  
ATOM 1076   N N   . TYR A 1 190 ? -49.912  -37.453 -33.397 1.00 0.00 ? 190 TYR A N   1  
ATOM 1077   C CA  . TYR A 1 190 ? -50.523  -38.637 -33.947 1.00 0.00 ? 190 TYR A CA  1  
ATOM 1078   C C   . TYR A 1 190 ? -51.501  -39.395 -33.015 1.00 0.00 ? 190 TYR A C   1  
ATOM 1079   O O   . TYR A 1 190 ? -52.600  -39.732 -33.434 1.00 0.00 ? 190 TYR A O   1  
ATOM 1080   C CB  . TYR A 1 190 ? -49.541  -39.724 -34.501 1.00 0.00 ? 190 TYR A CB  1  
ATOM 1081   C CG  . TYR A 1 190 ? -48.535  -39.153 -35.534 1.00 0.00 ? 190 TYR A CG  1  
ATOM 1082   C CD1 . TYR A 1 190 ? -48.743  -37.986 -36.302 1.00 0.00 ? 190 TYR A CD1 1  
ATOM 1083   C CD2 . TYR A 1 190 ? -47.442  -39.972 -35.914 1.00 0.00 ? 190 TYR A CD2 1  
ATOM 1084   C CE1 . TYR A 1 190 ? -47.823  -37.533 -37.214 1.00 0.00 ? 190 TYR A CE1 1  
ATOM 1085   C CE2 . TYR A 1 190 ? -46.509  -39.522 -36.856 1.00 0.00 ? 190 TYR A CE2 1  
ATOM 1086   C CZ  . TYR A 1 190 ? -46.637  -38.278 -37.465 1.00 0.00 ? 190 TYR A CZ  1  
ATOM 1087   O OH  . TYR A 1 190 ? -45.692  -37.767 -38.420 1.00 0.00 ? 190 TYR A OH  1  
ATOM 1088   N N   . ASN A 1 191 ? -51.128  -39.548 -31.744 1.00 0.00 ? 191 ASN A N   1  
ATOM 1089   C CA  . ASN A 1 191 ? -52.009  -40.183 -30.755 1.00 0.00 ? 191 ASN A CA  1  
ATOM 1090   C C   . ASN A 1 191 ? -53.275  -39.425 -30.496 1.00 0.00 ? 191 ASN A C   1  
ATOM 1091   O O   . ASN A 1 191 ? -54.372  -39.885 -30.364 1.00 0.00 ? 191 ASN A O   1  
ATOM 1092   C CB  . ASN A 1 191 ? -51.338  -40.880 -29.569 1.00 0.00 ? 191 ASN A CB  1  
ATOM 1093   C CG  . ASN A 1 191 ? -50.521  -39.837 -28.671 1.00 0.00 ? 191 ASN A CG  1  
ATOM 1094   O OD1 . ASN A 1 191 ? -51.170  -39.013 -28.012 1.00 0.00 ? 191 ASN A OD1 1  
ATOM 1095   N ND2 . ASN A 1 191 ? -49.178  -39.857 -28.807 1.00 0.00 ? 191 ASN A ND2 1  
ATOM 1096   N N   . ILE A 1 192 ? -53.092  -38.116 -30.434 1.00 0.00 ? 192 ILE A N   1  
ATOM 1097   C CA  . ILE A 1 192 ? -54.041  -37.124 -30.103 1.00 0.00 ? 192 ILE A CA  1  
ATOM 1098   C C   . ILE A 1 192 ? -55.086  -37.129 -31.173 1.00 0.00 ? 192 ILE A C   1  
ATOM 1099   O O   . ILE A 1 192 ? -56.261  -37.015 -30.884 1.00 0.00 ? 192 ILE A O   1  
ATOM 1100   C CB  . ILE A 1 192 ? -53.322  -35.805 -29.838 1.00 0.00 ? 192 ILE A CB  1  
ATOM 1101   C CG1 . ILE A 1 192 ? -52.735  -35.908 -28.350 1.00 0.00 ? 192 ILE A CG1 1  
ATOM 1102   C CG2 . ILE A 1 192 ? -54.307  -34.642 -30.086 1.00 0.00 ? 192 ILE A CG2 1  
ATOM 1103   C CD1 . ILE A 1 192 ? -51.964  -34.658 -27.890 1.00 0.00 ? 192 ILE A CD1 1  
ATOM 1104   N N   . TYR A 1 193 ? -54.678  -37.250 -32.483 1.00 0.00 ? 193 TYR A N   1  
ATOM 1105   C CA  . TYR A 1 193 ? -55.550  -37.160 -33.686 1.00 0.00 ? 193 TYR A CA  1  
ATOM 1106   C C   . TYR A 1 193 ? -56.512  -38.374 -33.546 1.00 0.00 ? 193 TYR A C   1  
ATOM 1107   O O   . TYR A 1 193 ? -57.704  -38.256 -33.812 1.00 0.00 ? 193 TYR A O   1  
ATOM 1108   C CB  . TYR A 1 193 ? -54.947  -37.470 -35.027 1.00 0.00 ? 193 TYR A CB  1  
ATOM 1109   C CG  . TYR A 1 193 ? -53.875  -36.525 -35.318 1.00 0.00 ? 193 TYR A CG  1  
ATOM 1110   C CD1 . TYR A 1 193 ? -53.855  -35.145 -34.919 1.00 0.00 ? 193 TYR A CD1 1  
ATOM 1111   C CD2 . TYR A 1 193 ? -52.823  -36.929 -36.095 1.00 0.00 ? 193 TYR A CD2 1  
ATOM 1112   C CE1 . TYR A 1 193 ? -52.896  -34.262 -35.468 1.00 0.00 ? 193 TYR A CE1 1  
ATOM 1113   C CE2 . TYR A 1 193 ? -51.797  -36.123 -36.594 1.00 0.00 ? 193 TYR A CE2 1  
ATOM 1114   C CZ  . TYR A 1 193 ? -51.860  -34.730 -36.246 1.00 0.00 ? 193 TYR A CZ  1  
ATOM 1115   O OH  . TYR A 1 193 ? -50.799  -33.973 -36.603 1.00 0.00 ? 193 TYR A OH  1  
ATOM 1116   N N   . GLU A 1 194 ? -55.936  -39.525 -33.162 1.00 0.00 ? 194 GLU A N   1  
ATOM 1117   C CA  . GLU A 1 194 ? -56.730  -40.756 -33.025 1.00 0.00 ? 194 GLU A CA  1  
ATOM 1118   C C   . GLU A 1 194 ? -57.711  -40.569 -31.927 1.00 0.00 ? 194 GLU A C   1  
ATOM 1119   O O   . GLU A 1 194 ? -58.877  -40.954 -32.081 1.00 0.00 ? 194 GLU A O   1  
ATOM 1120   C CB  . GLU A 1 194 ? -55.761  -41.915 -32.851 1.00 0.00 ? 194 GLU A CB  1  
ATOM 1121   C CG  . GLU A 1 194 ? -56.515  -43.175 -32.411 1.00 0.00 ? 194 GLU A CG  1  
ATOM 1122   C CD  . GLU A 1 194 ? -56.679  -43.296 -30.882 1.00 0.00 ? 194 GLU A CD  1  
ATOM 1123   O OE1 . GLU A 1 194 ? -55.629  -43.520 -30.273 1.00 0.00 ? 194 GLU A OE1 1  
ATOM 1124   O OE2 . GLU A 1 194 ? -57.832  -43.352 -30.381 1.00 0.00 ? 194 GLU A OE2 1  
ATOM 1125   N N   . GLU A 1 195 ? -57.373  -39.976 -30.753 1.00 0.00 ? 195 GLU A N   1  
ATOM 1126   C CA  . GLU A 1 195 ? -58.194  -39.804 -29.600 1.00 0.00 ? 195 GLU A CA  1  
ATOM 1127   C C   . GLU A 1 195 ? -59.356  -38.787 -29.958 1.00 0.00 ? 195 GLU A C   1  
ATOM 1128   O O   . GLU A 1 195 ? -60.519  -38.941 -29.524 1.00 0.00 ? 195 GLU A O   1  
ATOM 1129   C CB  . GLU A 1 195 ? -57.452  -39.390 -28.247 1.00 0.00 ? 195 GLU A CB  1  
ATOM 1130   C CG  . GLU A 1 195 ? -58.391  -39.043 -27.022 1.00 0.00 ? 195 GLU A CG  1  
ATOM 1131   C CD  . GLU A 1 195 ? -59.248  -40.339 -26.690 1.00 0.00 ? 195 GLU A CD  1  
ATOM 1132   O OE1 . GLU A 1 195 ? -58.723  -41.341 -26.165 1.00 0.00 ? 195 GLU A OE1 1  
ATOM 1133   O OE2 . GLU A 1 195 ? -60.504  -40.251 -26.947 1.00 0.00 ? 195 GLU A OE2 1  
ATOM 1134   N N   . ILE A 1 196 ? -59.132  -37.743 -30.710 1.00 0.00 ? 196 ILE A N   1  
ATOM 1135   C CA  . ILE A 1 196 ? -60.082  -36.745 -31.041 1.00 0.00 ? 196 ILE A CA  1  
ATOM 1136   C C   . ILE A 1 196 ? -61.185  -37.366 -31.853 1.00 0.00 ? 196 ILE A C   1  
ATOM 1137   O O   . ILE A 1 196 ? -62.375  -37.113 -31.566 1.00 0.00 ? 196 ILE A O   1  
ATOM 1138   C CB  . ILE A 1 196 ? -59.523  -35.720 -31.939 1.00 0.00 ? 196 ILE A CB  1  
ATOM 1139   C CG1 . ILE A 1 196 ? -58.802  -34.697 -31.049 1.00 0.00 ? 196 ILE A CG1 1  
ATOM 1140   C CG2 . ILE A 1 196 ? -60.478  -34.899 -32.900 1.00 0.00 ? 196 ILE A CG2 1  
ATOM 1141   C CD1 . ILE A 1 196 ? -58.149  -33.539 -31.824 1.00 0.00 ? 196 ILE A CD1 1  
ATOM 1142   N N   . PHE A 1 197 ? -60.776  -38.292 -32.796 1.00 0.00 ? 197 PHE A N   1  
ATOM 1143   C CA  . PHE A 1 197 ? -61.630  -39.055 -33.694 1.00 0.00 ? 197 PHE A CA  1  
ATOM 1144   C C   . PHE A 1 197 ? -62.497  -39.979 -32.861 1.00 0.00 ? 197 PHE A C   1  
ATOM 1145   O O   . PHE A 1 197 ? -63.674  -40.112 -33.080 1.00 0.00 ? 197 PHE A O   1  
ATOM 1146   C CB  . PHE A 1 197 ? -60.798  -39.811 -34.756 1.00 0.00 ? 197 PHE A CB  1  
ATOM 1147   C CG  . PHE A 1 197 ? -61.724  -40.619 -35.716 1.00 0.00 ? 197 PHE A CG  1  
ATOM 1148   C CD1 . PHE A 1 197 ? -62.363  -39.984 -36.809 1.00 0.00 ? 197 PHE A CD1 1  
ATOM 1149   C CD2 . PHE A 1 197 ? -62.049  -41.924 -35.359 1.00 0.00 ? 197 PHE A CD2 1  
ATOM 1150   C CE1 . PHE A 1 197 ? -63.251  -40.733 -37.564 1.00 0.00 ? 197 PHE A CE1 1  
ATOM 1151   C CE2 . PHE A 1 197 ? -62.964  -42.659 -36.146 1.00 0.00 ? 197 PHE A CE2 1  
ATOM 1152   C CZ  . PHE A 1 197 ? -63.522  -42.060 -37.234 1.00 0.00 ? 197 PHE A CZ  1  
ATOM 1153   N N   . ARG A 1 198 ? -61.887  -40.603 -31.880 1.00 0.00 ? 198 ARG A N   1  
ATOM 1154   C CA  . ARG A 1 198 ? -62.477  -41.525 -31.013 1.00 0.00 ? 198 ARG A CA  1  
ATOM 1155   C C   . ARG A 1 198 ? -63.567  -40.871 -30.214 1.00 0.00 ? 198 ARG A C   1  
ATOM 1156   O O   . ARG A 1 198 ? -64.607  -41.412 -30.011 1.00 0.00 ? 198 ARG A O   1  
ATOM 1157   C CB  . ARG A 1 198 ? -61.438  -42.167 -30.054 1.00 0.00 ? 198 ARG A CB  1  
ATOM 1158   C CG  . ARG A 1 198 ? -61.931  -42.911 -28.826 1.00 0.00 ? 198 ARG A CG  1  
ATOM 1159   C CD  . ARG A 1 198 ? -62.500  -44.324 -29.067 1.00 0.00 ? 198 ARG A CD  1  
ATOM 1160   N NE  . ARG A 1 198 ? -63.826  -44.262 -29.782 1.00 0.00 ? 198 ARG A NE  1  
ATOM 1161   C CZ  . ARG A 1 198 ? -64.791  -45.259 -29.790 1.00 0.00 ? 198 ARG A CZ  1  
ATOM 1162   N NH1 . ARG A 1 198 ? -64.504  -46.464 -29.300 1.00 0.00 ? 198 ARG A NH1 1  
ATOM 1163   N NH2 . ARG A 1 198 ? -66.041  -45.015 -30.259 1.00 0.00 ? 198 ARG A NH2 1  
ATOM 1164   N N   . GLU A 1 199 ? -63.299  -39.608 -29.787 1.00 0.00 ? 199 GLU A N   1  
ATOM 1165   C CA  . GLU A 1 199 ? -64.287  -38.827 -29.006 1.00 0.00 ? 199 GLU A CA  1  
ATOM 1166   C C   . GLU A 1 199 ? -65.484  -38.566 -29.840 1.00 0.00 ? 199 GLU A C   1  
ATOM 1167   O O   . GLU A 1 199 ? -66.620  -38.635 -29.293 1.00 0.00 ? 199 GLU A O   1  
ATOM 1168   C CB  . GLU A 1 199 ? -63.719  -37.436 -28.470 1.00 0.00 ? 199 GLU A CB  1  
ATOM 1169   C CG  . GLU A 1 199 ? -64.800  -36.846 -27.494 1.00 0.00 ? 199 GLU A CG  1  
ATOM 1170   C CD  . GLU A 1 199 ? -64.941  -37.638 -26.153 1.00 0.00 ? 199 GLU A CD  1  
ATOM 1171   O OE1 . GLU A 1 199 ? -64.031  -38.417 -25.821 1.00 0.00 ? 199 GLU A OE1 1  
ATOM 1172   O OE2 . GLU A 1 199 ? -65.947  -37.451 -25.492 1.00 0.00 ? 199 GLU A OE2 1  
ATOM 1173   N N   . ILE A 1 200 ? -65.353  -38.263 -31.152 1.00 0.00 ? 200 ILE A N   1  
ATOM 1174   C CA  . ILE A 1 200 ? -66.545  -38.005 -32.012 1.00 0.00 ? 200 ILE A CA  1  
ATOM 1175   C C   . ILE A 1 200 ? -67.317  -39.312 -32.069 1.00 0.00 ? 200 ILE A C   1  
ATOM 1176   O O   . ILE A 1 200 ? -68.501  -39.284 -31.881 1.00 0.00 ? 200 ILE A O   1  
ATOM 1177   C CB  . ILE A 1 200 ? -66.324  -37.631 -33.449 1.00 0.00 ? 200 ILE A CB  1  
ATOM 1178   C CG1 . ILE A 1 200 ? -65.245  -36.528 -33.432 1.00 0.00 ? 200 ILE A CG1 1  
ATOM 1179   C CG2 . ILE A 1 200 ? -67.602  -37.054 -34.024 1.00 0.00 ? 200 ILE A CG2 1  
ATOM 1180   C CD1 . ILE A 1 200 ? -64.867  -35.998 -34.825 1.00 0.00 ? 200 ILE A CD1 1  
ATOM 1181   N N   . GLU A 1 201 ? -66.641  -40.457 -32.215 1.00 0.00 ? 201 GLU A N   1  
ATOM 1182   C CA  . GLU A 1 201 ? -67.232  -41.747 -32.260 1.00 0.00 ? 201 GLU A CA  1  
ATOM 1183   C C   . GLU A 1 201 ? -67.930  -42.127 -30.986 1.00 0.00 ? 201 GLU A C   1  
ATOM 1184   O O   . GLU A 1 201 ? -69.047  -42.663 -31.120 1.00 0.00 ? 201 GLU A O   1  
ATOM 1185   C CB  . GLU A 1 201 ? -66.278  -42.886 -32.713 1.00 0.00 ? 201 GLU A CB  1  
ATOM 1186   C CG  . GLU A 1 201 ? -66.998  -44.186 -33.171 1.00 0.00 ? 201 GLU A CG  1  
ATOM 1187   C CD  . GLU A 1 201 ? -67.542  -43.937 -34.545 1.00 0.00 ? 201 GLU A CD  1  
ATOM 1188   O OE1 . GLU A 1 201 ? -66.748  -43.941 -35.556 1.00 0.00 ? 201 GLU A OE1 1  
ATOM 1189   O OE2 . GLU A 1 201 ? -68.727  -43.488 -34.638 1.00 0.00 ? 201 GLU A OE2 1  
ATOM 1190   N N   . GLU A 1 202 ? -67.363  -41.778 -29.741 1.00 0.00 ? 202 GLU A N   1  
ATOM 1191   C CA  . GLU A 1 202 ? -68.035  -42.040 -28.473 1.00 0.00 ? 202 GLU A CA  1  
ATOM 1192   C C   . GLU A 1 202 ? -69.351  -41.257 -28.332 1.00 0.00 ? 202 GLU A C   1  
ATOM 1193   O O   . GLU A 1 202 ? -70.339  -41.751 -27.760 1.00 0.00 ? 202 GLU A O   1  
ATOM 1194   C CB  . GLU A 1 202 ? -67.180  -41.561 -27.307 1.00 0.00 ? 202 GLU A CB  1  
ATOM 1195   C CG  . GLU A 1 202 ? -65.706  -42.128 -27.124 1.00 0.00 ? 202 GLU A CG  1  
ATOM 1196   C CD  . GLU A 1 202 ? -64.814  -41.435 -26.084 1.00 0.00 ? 202 GLU A CD  1  
ATOM 1197   O OE1 . GLU A 1 202 ? -65.264  -40.794 -25.151 1.00 0.00 ? 202 GLU A OE1 1  
ATOM 1198   O OE2 . GLU A 1 202 ? -63.608  -41.685 -26.189 1.00 0.00 ? 202 GLU A OE2 1  
ATOM 1199   N N   . ARG A 1 203 ? -69.234  -39.981 -28.793 1.00 0.00 ? 203 ARG A N   1  
ATOM 1200   C CA  . ARG A 1 203 ? -70.340  -39.064 -28.713 1.00 0.00 ? 203 ARG A CA  1  
ATOM 1201   C C   . ARG A 1 203 ? -71.492  -39.546 -29.588 1.00 0.00 ? 203 ARG A C   1  
ATOM 1202   O O   . ARG A 1 203 ? -72.657  -39.558 -29.133 1.00 0.00 ? 203 ARG A O   1  
ATOM 1203   C CB  . ARG A 1 203 ? -69.947  -37.628 -29.099 1.00 0.00 ? 203 ARG A CB  1  
ATOM 1204   C CG  . ARG A 1 203 ? -69.173  -36.958 -27.948 1.00 0.00 ? 203 ARG A CG  1  
ATOM 1205   C CD  . ARG A 1 203 ? -69.853  -36.844 -26.551 1.00 0.00 ? 203 ARG A CD  1  
ATOM 1206   N NE  . ARG A 1 203 ? -68.880  -36.314 -25.549 1.00 0.00 ? 203 ARG A NE  1  
ATOM 1207   C CZ  . ARG A 1 203 ? -68.920  -36.599 -24.200 1.00 0.00 ? 203 ARG A CZ  1  
ATOM 1208   N NH1 . ARG A 1 203 ? -69.857  -37.415 -23.634 1.00 0.00 ? 203 ARG A NH1 1  
ATOM 1209   N NH2 . ARG A 1 203 ? -67.892  -36.137 -23.350 1.00 0.00 ? 203 ARG A NH2 1  
ATOM 1210   N N   . ARG A 1 204 ? -71.184  -40.079 -30.813 1.00 0.00 ? 204 ARG A N   1  
ATOM 1211   C CA  . ARG A 1 204 ? -72.136  -40.692 -31.765 1.00 0.00 ? 204 ARG A CA  1  
ATOM 1212   C C   . ARG A 1 204 ? -72.803  -41.936 -31.224 1.00 0.00 ? 204 ARG A C   1  
ATOM 1213   O O   . ARG A 1 204 ? -73.970  -42.209 -31.512 1.00 0.00 ? 204 ARG A O   1  
ATOM 1214   C CB  . ARG A 1 204 ? -71.409  -40.944 -33.104 1.00 0.00 ? 204 ARG A CB  1  
ATOM 1215   C CG  . ARG A 1 204 ? -71.444  -39.712 -33.958 1.00 0.00 ? 204 ARG A CG  1  
ATOM 1216   C CD  . ARG A 1 204 ? -70.627  -39.659 -35.207 1.00 0.00 ? 204 ARG A CD  1  
ATOM 1217   N NE  . ARG A 1 204 ? -69.261  -40.167 -34.982 1.00 0.00 ? 204 ARG A NE  1  
ATOM 1218   C CZ  . ARG A 1 204 ? -68.351  -40.517 -35.892 1.00 0.00 ? 204 ARG A CZ  1  
ATOM 1219   N NH1 . ARG A 1 204 ? -68.715  -40.457 -37.225 1.00 0.00 ? 204 ARG A NH1 1  
ATOM 1220   N NH2 . ARG A 1 204 ? -67.009  -40.709 -35.662 1.00 0.00 ? 204 ARG A NH2 1  
ATOM 1221   N N   . THR A 1 205 ? -72.010  -42.757 -30.536 1.00 0.00 ? 205 THR A N   1  
ATOM 1222   C CA  . THR A 1 205 ? -72.446  -44.066 -30.120 1.00 0.00 ? 205 THR A CA  1  
ATOM 1223   C C   . THR A 1 205 ? -71.416  -44.701 -29.144 1.00 0.00 ? 205 THR A C   1  
ATOM 1224   O O   . THR A 1 205 ? -70.387  -44.035 -28.853 1.00 0.00 ? 205 THR A O   1  
ATOM 1225   C CB  . THR A 1 205 ? -72.829  -45.069 -31.260 1.00 0.00 ? 205 THR A CB  1  
ATOM 1226   O OG1 . THR A 1 205 ? -73.472  -46.266 -30.788 1.00 0.00 ? 205 THR A OG1 1  
ATOM 1227   C CG2 . THR A 1 205 ? -71.564  -45.442 -32.108 1.00 0.00 ? 205 THR A CG2 1  
ATOM 1228   N N   . LYS A 1 243 ? -62.562  -40.111 -17.805 1.00 0.00 ? 243 LYS A N   1  
ATOM 1229   C CA  . LYS A 1 243 ? -61.682  -39.216 -18.691 1.00 0.00 ? 243 LYS A CA  1  
ATOM 1230   C C   . LYS A 1 243 ? -60.351  -39.002 -18.062 1.00 0.00 ? 243 LYS A C   1  
ATOM 1231   O O   . LYS A 1 243 ? -59.304  -39.234 -18.685 1.00 0.00 ? 243 LYS A O   1  
ATOM 1232   C CB  . LYS A 1 243 ? -62.254  -37.772 -18.855 1.00 0.00 ? 243 LYS A CB  1  
ATOM 1233   C CG  . LYS A 1 243 ? -63.422  -37.756 -19.930 1.00 0.00 ? 243 LYS A CG  1  
ATOM 1234   C CD  . LYS A 1 243 ? -63.018  -38.010 -21.375 1.00 0.00 ? 243 LYS A CD  1  
ATOM 1235   C CE  . LYS A 1 243 ? -64.183  -38.572 -22.232 1.00 0.00 ? 243 LYS A CE  1  
ATOM 1236   N NZ  . LYS A 1 243 ? -65.279  -37.550 -22.329 1.00 0.00 ? 243 LYS A NZ  1  
ATOM 1237   N N   . GLY A 1 244 ? -60.235  -38.603 -16.748 1.00 0.00 ? 244 GLY A N   1  
ATOM 1238   C CA  . GLY A 1 244 ? -58.990  -38.226 -16.150 1.00 0.00 ? 244 GLY A CA  1  
ATOM 1239   C C   . GLY A 1 244 ? -57.969  -39.387 -16.211 1.00 0.00 ? 244 GLY A C   1  
ATOM 1240   O O   . GLY A 1 244 ? -56.879  -39.219 -16.672 1.00 0.00 ? 244 GLY A O   1  
ATOM 1241   N N   . GLY A 1 245 ? -58.339  -40.562 -15.747 1.00 0.00 ? 245 GLY A N   1  
ATOM 1242   C CA  . GLY A 1 245 ? -57.542  -41.728 -15.627 1.00 0.00 ? 245 GLY A CA  1  
ATOM 1243   C C   . GLY A 1 245 ? -57.166  -42.175 -17.071 1.00 0.00 ? 245 GLY A C   1  
ATOM 1244   O O   . GLY A 1 245 ? -56.023  -42.592 -17.273 1.00 0.00 ? 245 GLY A O   1  
ATOM 1245   N N   . ALA A 1 246 ? -58.102  -41.998 -18.036 1.00 0.00 ? 246 ALA A N   1  
ATOM 1246   C CA  . ALA A 1 246 ? -57.825  -42.238 -19.393 1.00 0.00 ? 246 ALA A CA  1  
ATOM 1247   C C   . ALA A 1 246 ? -56.744  -41.350 -19.963 1.00 0.00 ? 246 ALA A C   1  
ATOM 1248   O O   . ALA A 1 246 ? -55.903  -41.826 -20.672 1.00 0.00 ? 246 ALA A O   1  
ATOM 1249   C CB  . ALA A 1 246 ? -59.026  -42.094 -20.408 1.00 0.00 ? 246 ALA A CB  1  
ATOM 1250   N N   . ILE A 1 247 ? -56.661  -40.062 -19.649 1.00 0.00 ? 247 ILE A N   1  
ATOM 1251   C CA  . ILE A 1 247 ? -55.549  -39.244 -20.099 1.00 0.00 ? 247 ILE A CA  1  
ATOM 1252   C C   . ILE A 1 247 ? -54.186  -39.627 -19.576 1.00 0.00 ? 247 ILE A C   1  
ATOM 1253   O O   . ILE A 1 247 ? -53.204  -39.701 -20.327 1.00 0.00 ? 247 ILE A O   1  
ATOM 1254   C CB  . ILE A 1 247 ? -55.811  -37.766 -19.761 1.00 0.00 ? 247 ILE A CB  1  
ATOM 1255   C CG1 . ILE A 1 247 ? -57.196  -37.334 -20.548 1.00 0.00 ? 247 ILE A CG1 1  
ATOM 1256   C CG2 . ILE A 1 247 ? -54.585  -36.908 -20.269 1.00 0.00 ? 247 ILE A CG2 1  
ATOM 1257   C CD1 . ILE A 1 247 ? -57.616  -35.871 -20.322 1.00 0.00 ? 247 ILE A CD1 1  
ATOM 1258   N N   . LEU A 1 248 ? -54.051  -39.998 -18.276 1.00 0.00 ? 248 LEU A N   1  
ATOM 1259   C CA  . LEU A 1 248 ? -52.937  -40.490 -17.603 1.00 0.00 ? 248 LEU A CA  1  
ATOM 1260   C C   . LEU A 1 248 ? -52.511  -41.826 -18.224 1.00 0.00 ? 248 LEU A C   1  
ATOM 1261   O O   . LEU A 1 248 ? -51.337  -42.044 -18.397 1.00 0.00 ? 248 LEU A O   1  
ATOM 1262   C CB  . LEU A 1 248 ? -53.254  -40.564 -16.017 1.00 0.00 ? 248 LEU A CB  1  
ATOM 1263   C CG  . LEU A 1 248 ? -52.158  -41.231 -15.149 1.00 0.00 ? 248 LEU A CG  1  
ATOM 1264   C CD1 . LEU A 1 248 ? -50.933  -40.273 -15.046 1.00 0.00 ? 248 LEU A CD1 1  
ATOM 1265   C CD2 . LEU A 1 248 ? -52.717  -41.626 -13.784 1.00 0.00 ? 248 LEU A CD2 1  
ATOM 1266   N N   . LYS A 1 249 ? -53.512  -42.669 -18.525 1.00 0.00 ? 249 LYS A N   1  
ATOM 1267   C CA  . LYS A 1 249 ? -53.311  -43.986 -19.058 1.00 0.00 ? 249 LYS A CA  1  
ATOM 1268   C C   . LYS A 1 249 ? -52.679  -44.043 -20.423 1.00 0.00 ? 249 LYS A C   1  
ATOM 1269   O O   . LYS A 1 249 ? -51.754  -44.789 -20.709 1.00 0.00 ? 249 LYS A O   1  
ATOM 1270   C CB  . LYS A 1 249 ? -54.673  -44.740 -19.125 1.00 0.00 ? 249 LYS A CB  1  
ATOM 1271   C CG  . LYS A 1 249 ? -54.584  -46.194 -19.593 1.00 0.00 ? 249 LYS A CG  1  
ATOM 1272   C CD  . LYS A 1 249 ? -55.965  -46.908 -19.780 1.00 0.00 ? 249 LYS A CD  1  
ATOM 1273   C CE  . LYS A 1 249 ? -55.725  -48.332 -20.226 1.00 0.00 ? 249 LYS A CE  1  
ATOM 1274   N NZ  . LYS A 1 249 ? -55.418  -49.317 -19.185 1.00 0.00 ? 249 LYS A NZ  1  
ATOM 1275   N N   . ILE A 1 250 ? -53.197  -43.105 -21.315 1.00 0.00 ? 250 ILE A N   1  
ATOM 1276   C CA  . ILE A 1 250 ? -52.803  -42.901 -22.673 1.00 0.00 ? 250 ILE A CA  1  
ATOM 1277   C C   . ILE A 1 250 ? -51.353  -42.450 -22.631 1.00 0.00 ? 250 ILE A C   1  
ATOM 1278   O O   . ILE A 1 250 ? -50.497  -42.922 -23.380 1.00 0.00 ? 250 ILE A O   1  
ATOM 1279   C CB  . ILE A 1 250 ? -53.633  -41.881 -23.443 1.00 0.00 ? 250 ILE A CB  1  
ATOM 1280   C CG1 . ILE A 1 250 ? -54.925  -42.591 -23.731 1.00 0.00 ? 250 ILE A CG1 1  
ATOM 1281   C CG2 . ILE A 1 250 ? -52.960  -41.381 -24.699 1.00 0.00 ? 250 ILE A CG2 1  
ATOM 1282   C CD1 . ILE A 1 250 ? -55.944  -41.747 -24.515 1.00 0.00 ? 250 ILE A CD1 1  
ATOM 1283   N N   . PHE A 1 251 ? -50.986  -41.525 -21.653 1.00 0.00 ? 251 PHE A N   1  
ATOM 1284   C CA  . PHE A 1 251 ? -49.623  -41.014 -21.466 1.00 0.00 ? 251 PHE A CA  1  
ATOM 1285   C C   . PHE A 1 251 ? -48.673  -42.119 -21.030 1.00 0.00 ? 251 PHE A C   1  
ATOM 1286   O O   . PHE A 1 251 ? -47.520  -42.312 -21.407 1.00 0.00 ? 251 PHE A O   1  
ATOM 1287   C CB  . PHE A 1 251 ? -49.585  -39.870 -20.415 1.00 0.00 ? 251 PHE A CB  1  
ATOM 1288   C CG  . PHE A 1 251 ? -48.532  -38.792 -20.557 1.00 0.00 ? 251 PHE A CG  1  
ATOM 1289   C CD1 . PHE A 1 251 ? -47.114  -39.006 -20.680 1.00 0.00 ? 251 PHE A CD1 1  
ATOM 1290   C CD2 . PHE A 1 251 ? -49.002  -37.480 -20.752 1.00 0.00 ? 251 PHE A CD2 1  
ATOM 1291   C CE1 . PHE A 1 251 ? -46.305  -38.048 -21.093 1.00 0.00 ? 251 PHE A CE1 1  
ATOM 1292   C CE2 . PHE A 1 251 ? -48.169  -36.453 -21.078 1.00 0.00 ? 251 PHE A CE2 1  
ATOM 1293   C CZ  . PHE A 1 251 ? -46.776  -36.724 -21.156 1.00 0.00 ? 251 PHE A CZ  1  
ATOM 1294   N N   . GLN A 1 252 ? -49.174  -43.003 -20.171 1.00 0.00 ? 252 GLN A N   1  
ATOM 1295   C CA  . GLN A 1 252 ? -48.488  -44.166 -19.696 1.00 0.00 ? 252 GLN A CA  1  
ATOM 1296   C C   . GLN A 1 252 ? -48.163  -45.175 -20.758 1.00 0.00 ? 252 GLN A C   1  
ATOM 1297   O O   . GLN A 1 252 ? -47.088  -45.708 -20.782 1.00 0.00 ? 252 GLN A O   1  
ATOM 1298   C CB  . GLN A 1 252 ? -49.213  -44.875 -18.512 1.00 0.00 ? 252 GLN A CB  1  
ATOM 1299   C CG  . GLN A 1 252 ? -48.443  -44.698 -17.198 1.00 0.00 ? 252 GLN A CG  1  
ATOM 1300   C CD  . GLN A 1 252 ? -48.481  -43.285 -16.645 1.00 0.00 ? 252 GLN A CD  1  
ATOM 1301   O OE1 . GLN A 1 252 ? -49.036  -43.044 -15.586 1.00 0.00 ? 252 GLN A OE1 1  
ATOM 1302   N NE2 . GLN A 1 252 ? -47.764  -42.328 -17.330 1.00 0.00 ? 252 GLN A NE2 1  
ATOM 1303   N N   . GLN A 1 253 ? -49.103  -45.382 -21.712 1.00 0.00 ? 253 GLN A N   1  
ATOM 1304   C CA  . GLN A 1 253 ? -48.970  -46.287 -22.849 1.00 0.00 ? 253 GLN A CA  1  
ATOM 1305   C C   . GLN A 1 253 ? -47.932  -45.768 -23.730 1.00 0.00 ? 253 GLN A C   1  
ATOM 1306   O O   . GLN A 1 253 ? -47.042  -46.455 -24.250 1.00 0.00 ? 253 GLN A O   1  
ATOM 1307   C CB  . GLN A 1 253 ? -50.169  -46.542 -23.692 1.00 0.00 ? 253 GLN A CB  1  
ATOM 1308   C CG  . GLN A 1 253 ? -51.407  -47.227 -23.080 1.00 0.00 ? 253 GLN A CG  1  
ATOM 1309   C CD  . GLN A 1 253 ? -51.110  -48.253 -22.055 1.00 0.00 ? 253 GLN A CD  1  
ATOM 1310   O OE1 . GLN A 1 253 ? -51.679  -48.093 -20.989 1.00 0.00 ? 253 GLN A OE1 1  
ATOM 1311   N NE2 . GLN A 1 253 ? -50.212  -49.264 -22.374 1.00 0.00 ? 253 GLN A NE2 1  
ATOM 1312   N N   . LYS A 1 254 ? -47.960  -44.417 -23.902 1.00 0.00 ? 254 LYS A N   1  
ATOM 1313   C CA  . LYS A 1 254 ? -46.972  -43.705 -24.755 1.00 0.00 ? 254 LYS A CA  1  
ATOM 1314   C C   . LYS A 1 254 ? -45.555  -43.792 -24.227 1.00 0.00 ? 254 LYS A C   1  
ATOM 1315   O O   . LYS A 1 254 ? -44.634  -44.026 -25.082 1.00 0.00 ? 254 LYS A O   1  
ATOM 1316   C CB  . LYS A 1 254 ? -47.190  -42.170 -24.816 1.00 0.00 ? 254 LYS A CB  1  
ATOM 1317   C CG  . LYS A 1 254 ? -48.457  -41.684 -25.602 1.00 0.00 ? 254 LYS A CG  1  
ATOM 1318   C CD  . LYS A 1 254 ? -48.916  -40.255 -25.379 1.00 0.00 ? 254 LYS A CD  1  
ATOM 1319   C CE  . LYS A 1 254 ? -47.851  -39.111 -25.234 1.00 0.00 ? 254 LYS A CE  1  
ATOM 1320   N NZ  . LYS A 1 254 ? -48.614  -37.931 -25.139 1.00 0.00 ? 254 LYS A NZ  1  
ATOM 1321   N N   . ILE A 1 255 ? -45.311  -43.727 -22.901 1.00 0.00 ? 255 ILE A N   1  
ATOM 1322   C CA  . ILE A 1 255 ? -44.001  -43.903 -22.353 1.00 0.00 ? 255 ILE A CA  1  
ATOM 1323   C C   . ILE A 1 255 ? -43.495  -45.252 -22.579 1.00 0.00 ? 255 ILE A C   1  
ATOM 1324   O O   . ILE A 1 255 ? -42.348  -45.565 -22.927 1.00 0.00 ? 255 ILE A O   1  
ATOM 1325   C CB  . ILE A 1 255 ? -43.807  -43.400 -20.878 1.00 0.00 ? 255 ILE A CB  1  
ATOM 1326   C CG1 . ILE A 1 255 ? -44.874  -43.837 -19.896 1.00 0.00 ? 255 ILE A CG1 1  
ATOM 1327   C CG2 . ILE A 1 255 ? -43.685  -41.823 -21.051 1.00 0.00 ? 255 ILE A CG2 1  
ATOM 1328   C CD1 . ILE A 1 255 ? -44.654  -43.327 -18.462 1.00 0.00 ? 255 ILE A CD1 1  
ATOM 1329   N N   . LEU A 1 256 ? -44.452  -46.214 -22.401 1.00 0.00 ? 256 LEU A N   1  
ATOM 1330   C CA  . LEU A 1 256 ? -44.201  -47.592 -22.528 1.00 0.00 ? 256 LEU A CA  1  
ATOM 1331   C C   . LEU A 1 256 ? -43.825  -47.944 -23.989 1.00 0.00 ? 256 LEU A C   1  
ATOM 1332   O O   . LEU A 1 256 ? -42.844  -48.682 -24.130 1.00 0.00 ? 256 LEU A O   1  
ATOM 1333   C CB  . LEU A 1 256 ? -45.488  -48.482 -22.138 1.00 0.00 ? 256 LEU A CB  1  
ATOM 1334   C CG  . LEU A 1 256 ? -45.202  -49.895 -21.580 1.00 0.00 ? 256 LEU A CG  1  
ATOM 1335   C CD1 . LEU A 1 256 ? -44.557  -49.754 -20.238 1.00 0.00 ? 256 LEU A CD1 1  
ATOM 1336   C CD2 . LEU A 1 256 ? -46.521  -50.708 -21.409 1.00 0.00 ? 256 LEU A CD2 1  
ATOM 1337   N N   . GLU A 1 257 ? -44.370  -47.427 -25.094 1.00 0.00 ? 257 GLU A N   1  
ATOM 1338   C CA  . GLU A 1 257 ? -43.950  -47.662 -26.404 1.00 0.00 ? 257 GLU A CA  1  
ATOM 1339   C C   . GLU A 1 257 ? -42.500  -47.065 -26.746 1.00 0.00 ? 257 GLU A C   1  
ATOM 1340   O O   . GLU A 1 257 ? -41.621  -47.525 -27.459 1.00 0.00 ? 257 GLU A O   1  
ATOM 1341   C CB  . GLU A 1 257 ? -44.907  -47.014 -27.475 1.00 0.00 ? 257 GLU A CB  1  
ATOM 1342   C CG  . GLU A 1 257 ? -46.406  -47.097 -27.303 1.00 0.00 ? 257 GLU A CG  1  
ATOM 1343   C CD  . GLU A 1 257 ? -46.743  -48.550 -26.977 1.00 0.00 ? 257 GLU A CD  1  
ATOM 1344   O OE1 . GLU A 1 257 ? -46.604  -49.455 -27.801 1.00 0.00 ? 257 GLU A OE1 1  
ATOM 1345   O OE2 . GLU A 1 257 ? -47.123  -48.729 -25.812 1.00 0.00 ? 257 GLU A OE2 1  
ATOM 1346   N N   . ASN A 1 258 ? -42.237  -45.844 -26.143 1.00 0.00 ? 258 ASN A N   1  
ATOM 1347   C CA  . ASN A 1 258 ? -41.134  -45.028 -26.215 1.00 0.00 ? 258 ASN A CA  1  
ATOM 1348   C C   . ASN A 1 258 ? -39.836  -45.572 -25.673 1.00 0.00 ? 258 ASN A C   1  
ATOM 1349   O O   . ASN A 1 258 ? -38.779  -45.057 -26.092 1.00 0.00 ? 258 ASN A O   1  
ATOM 1350   C CB  . ASN A 1 258 ? -41.405  -43.548 -25.770 1.00 0.00 ? 258 ASN A CB  1  
ATOM 1351   C CG  . ASN A 1 258 ? -42.138  -42.850 -26.930 1.00 0.00 ? 258 ASN A CG  1  
ATOM 1352   O OD1 . ASN A 1 258 ? -43.166  -43.319 -27.490 1.00 0.00 ? 258 ASN A OD1 1  
ATOM 1353   N ND2 . ASN A 1 258 ? -41.619  -41.642 -27.184 1.00 0.00 ? 258 ASN A ND2 1  
ATOM 1354   N N   . LEU A 1 259 ? -39.980  -46.525 -24.648 1.00 0.00 ? 259 LEU A N   1  
ATOM 1355   C CA  . LEU A 1 259 ? -38.976  -47.027 -23.800 1.00 0.00 ? 259 LEU A CA  1  
ATOM 1356   C C   . LEU A 1 259 ? -37.745  -47.418 -24.573 1.00 0.00 ? 259 LEU A C   1  
ATOM 1357   O O   . LEU A 1 259 ? -37.860  -48.187 -25.541 1.00 0.00 ? 259 LEU A O   1  
ATOM 1358   C CB  . LEU A 1 259 ? -39.381  -48.244 -22.935 1.00 0.00 ? 259 LEU A CB  1  
ATOM 1359   C CG  . LEU A 1 259 ? -38.393  -48.540 -21.751 1.00 0.00 ? 259 LEU A CG  1  
ATOM 1360   C CD1 . LEU A 1 259 ? -38.359  -47.371 -20.776 1.00 0.00 ? 259 LEU A CD1 1  
ATOM 1361   C CD2 . LEU A 1 259 ? -38.944  -49.738 -21.055 1.00 0.00 ? 259 LEU A CD2 1  
ATOM 1362   N N   . GLY A 1 260 ? -36.592  -46.842 -24.188 1.00 0.00 ? 260 GLY A N   1  
ATOM 1363   C CA  . GLY A 1 260 ? -35.294  -47.237 -24.809 1.00 0.00 ? 260 GLY A CA  1  
ATOM 1364   C C   . GLY A 1 260 ? -34.778  -46.218 -25.709 1.00 0.00 ? 260 GLY A C   1  
ATOM 1365   O O   . GLY A 1 260 ? -33.794  -46.504 -26.391 1.00 0.00 ? 260 GLY A O   1  
ATOM 1366   N N   . ASP A 1 261 ? -35.376  -45.031 -25.646 1.00 0.00 ? 261 ASP A N   1  
ATOM 1367   C CA  . ASP A 1 261 ? -34.908  -43.843 -26.202 1.00 0.00 ? 261 ASP A CA  1  
ATOM 1368   C C   . ASP A 1 261 ? -35.000  -42.730 -25.139 1.00 0.00 ? 261 ASP A C   1  
ATOM 1369   O O   . ASP A 1 261 ? -36.063  -42.227 -24.830 1.00 0.00 ? 261 ASP A O   1  
ATOM 1370   C CB  . ASP A 1 261 ? -35.770  -43.515 -27.493 1.00 0.00 ? 261 ASP A CB  1  
ATOM 1371   C CG  . ASP A 1 261 ? -35.336  -42.297 -28.380 1.00 0.00 ? 261 ASP A CG  1  
ATOM 1372   O OD1 . ASP A 1 261 ? -35.166  -41.177 -27.874 1.00 0.00 ? 261 ASP A OD1 1  
ATOM 1373   O OD2 . ASP A 1 261 ? -35.190  -42.567 -29.581 1.00 0.00 ? 261 ASP A OD2 1  
ATOM 1374   N N   . ARG A 1 262 ? -33.790  -42.389 -24.749 1.00 0.00 ? 262 ARG A N   1  
ATOM 1375   C CA  . ARG A 1 262 ? -33.589  -41.468 -23.584 1.00 0.00 ? 262 ARG A CA  1  
ATOM 1376   C C   . ARG A 1 262 ? -34.347  -40.122 -23.683 1.00 0.00 ? 262 ARG A C   1  
ATOM 1377   O O   . ARG A 1 262 ? -34.921  -39.664 -22.690 1.00 0.00 ? 262 ARG A O   1  
ATOM 1378   C CB  . ARG A 1 262 ? -32.040  -41.218 -23.291 1.00 0.00 ? 262 ARG A CB  1  
ATOM 1379   C CG  . ARG A 1 262 ? -31.164  -40.653 -24.401 1.00 0.00 ? 262 ARG A CG  1  
ATOM 1380   C CD  . ARG A 1 262 ? -29.709  -40.473 -23.955 1.00 0.00 ? 262 ARG A CD  1  
ATOM 1381   N NE  . ARG A 1 262 ? -29.065  -39.517 -24.993 1.00 0.00 ? 262 ARG A NE  1  
ATOM 1382   C CZ  . ARG A 1 262 ? -27.914  -38.834 -24.676 1.00 0.00 ? 262 ARG A CZ  1  
ATOM 1383   N NH1 . ARG A 1 262 ? -27.215  -38.959 -23.523 1.00 0.00 ? 262 ARG A NH1 1  
ATOM 1384   N NH2 . ARG A 1 262 ? -27.495  -37.884 -25.562 1.00 0.00 ? 262 ARG A NH2 1  
ATOM 1385   N N   . SER A 1 263 ? -34.188  -39.517 -24.879 1.00 0.00 ? 263 SER A N   1  
ATOM 1386   C CA  . SER A 1 263 ? -34.580  -38.200 -25.283 1.00 0.00 ? 263 SER A CA  1  
ATOM 1387   C C   . SER A 1 263 ? -36.081  -38.065 -25.195 1.00 0.00 ? 263 SER A C   1  
ATOM 1388   O O   . SER A 1 263 ? -36.585  -37.194 -24.498 1.00 0.00 ? 263 SER A O   1  
ATOM 1389   C CB  . SER A 1 263 ? -34.161  -37.930 -26.676 1.00 0.00 ? 263 SER A CB  1  
ATOM 1390   O OG  . SER A 1 263 ? -32.782  -37.933 -26.815 1.00 0.00 ? 263 SER A OG  1  
ATOM 1391   N N   . SER A 1 264 ? -36.757  -38.999 -25.831 1.00 0.00 ? 264 SER A N   1  
ATOM 1392   C CA  . SER A 1 264 ? -38.169  -39.016 -25.892 1.00 0.00 ? 264 SER A CA  1  
ATOM 1393   C C   . SER A 1 264 ? -38.832  -39.126 -24.481 1.00 0.00 ? 264 SER A C   1  
ATOM 1394   O O   . SER A 1 264 ? -39.623  -38.281 -24.090 1.00 0.00 ? 264 SER A O   1  
ATOM 1395   C CB  . SER A 1 264 ? -38.706  -40.148 -26.825 1.00 0.00 ? 264 SER A CB  1  
ATOM 1396   O OG  . SER A 1 264 ? -38.385  -41.440 -26.362 1.00 0.00 ? 264 SER A OG  1  
ATOM 1397   N N   . VAL A 1 265 ? -38.545  -40.104 -23.686 1.00 0.00 ? 265 VAL A N   1  
ATOM 1398   C CA  . VAL A 1 265 ? -39.103  -40.340 -22.472 1.00 0.00 ? 265 VAL A CA  1  
ATOM 1399   C C   . VAL A 1 265 ? -38.832  -39.248 -21.482 1.00 0.00 ? 265 VAL A C   1  
ATOM 1400   O O   . VAL A 1 265 ? -39.672  -38.726 -20.798 1.00 0.00 ? 265 VAL A O   1  
ATOM 1401   C CB  . VAL A 1 265 ? -38.765  -41.604 -21.903 1.00 0.00 ? 265 VAL A CB  1  
ATOM 1402   C CG1 . VAL A 1 265 ? -39.277  -42.741 -22.830 1.00 0.00 ? 265 VAL A CG1 1  
ATOM 1403   C CG2 . VAL A 1 265 ? -37.263  -41.789 -21.773 1.00 0.00 ? 265 VAL A CG2 1  
ATOM 1404   N N   . MET A 1 266 ? -37.578  -38.697 -21.559 1.00 0.00 ? 266 MET A N   1  
ATOM 1405   C CA  . MET A 1 266 ? -37.247  -37.511 -20.702 1.00 0.00 ? 266 MET A CA  1  
ATOM 1406   C C   . MET A 1 266 ? -38.142  -36.351 -21.001 1.00 0.00 ? 266 MET A C   1  
ATOM 1407   O O   . MET A 1 266 ? -38.652  -35.809 -20.032 1.00 0.00 ? 266 MET A O   1  
ATOM 1408   C CB  . MET A 1 266 ? -35.849  -36.947 -20.873 1.00 0.00 ? 266 MET A CB  1  
ATOM 1409   C CG  . MET A 1 266 ? -35.487  -35.799 -19.930 1.00 0.00 ? 266 MET A CG  1  
ATOM 1410   S SD  . MET A 1 266 ? -35.815  -36.256 -18.208 1.00 0.00 ? 266 MET A SD  1  
ATOM 1411   C CE  . MET A 1 266 ? -35.795  -34.549 -17.404 1.00 0.00 ? 266 MET A CE  1  
ATOM 1412   N N   . PHE A 1 267 ? -38.419  -35.967 -22.328 1.00 0.00 ? 267 PHE A N   1  
ATOM 1413   C CA  . PHE A 1 267 ? -39.326  -34.905 -22.671 1.00 0.00 ? 267 PHE A CA  1  
ATOM 1414   C C   . PHE A 1 267 ? -40.711  -35.177 -22.276 1.00 0.00 ? 267 PHE A C   1  
ATOM 1415   O O   . PHE A 1 267 ? -41.385  -34.333 -21.673 1.00 0.00 ? 267 PHE A O   1  
ATOM 1416   C CB  . PHE A 1 267 ? -39.266  -34.443 -24.178 1.00 0.00 ? 267 PHE A CB  1  
ATOM 1417   C CG  . PHE A 1 267 ? -39.900  -33.136 -24.545 1.00 0.00 ? 267 PHE A CG  1  
ATOM 1418   C CD1 . PHE A 1 267 ? -39.197  -31.924 -24.372 1.00 0.00 ? 267 PHE A CD1 1  
ATOM 1419   C CD2 . PHE A 1 267 ? -41.165  -33.057 -25.170 1.00 0.00 ? 267 PHE A CD2 1  
ATOM 1420   C CE1 . PHE A 1 267 ? -39.749  -30.702 -24.818 1.00 0.00 ? 267 PHE A CE1 1  
ATOM 1421   C CE2 . PHE A 1 267 ? -41.709  -31.822 -25.560 1.00 0.00 ? 267 PHE A CE2 1  
ATOM 1422   C CZ  . PHE A 1 267 ? -41.039  -30.632 -25.361 1.00 0.00 ? 267 PHE A CZ  1  
ATOM 1423   N N   . LEU A 1 268 ? -41.146  -36.440 -22.586 1.00 0.00 ? 268 LEU A N   1  
ATOM 1424   C CA  . LEU A 1 268 ? -42.473  -36.770 -22.292 1.00 0.00 ? 268 LEU A CA  1  
ATOM 1425   C C   . LEU A 1 268 ? -42.724  -36.752 -20.814 1.00 0.00 ? 268 LEU A C   1  
ATOM 1426   O O   . LEU A 1 268 ? -43.739  -36.333 -20.421 1.00 0.00 ? 268 LEU A O   1  
ATOM 1427   C CB  . LEU A 1 268 ? -42.802  -38.131 -22.874 1.00 0.00 ? 268 LEU A CB  1  
ATOM 1428   C CG  . LEU A 1 268 ? -43.602  -38.168 -24.156 1.00 0.00 ? 268 LEU A CG  1  
ATOM 1429   C CD1 . LEU A 1 268 ? -42.780  -37.570 -25.393 1.00 0.00 ? 268 LEU A CD1 1  
ATOM 1430   C CD2 . LEU A 1 268 ? -44.035  -39.604 -24.486 1.00 0.00 ? 268 LEU A CD2 1  
ATOM 1431   N N   . LYS A 1 269 ? -41.693  -37.250 -20.016 1.00 0.00 ? 269 LYS A N   1  
ATOM 1432   C CA  . LYS A 1 269 ? -41.811  -37.273 -18.593 1.00 0.00 ? 269 LYS A CA  1  
ATOM 1433   C C   . LYS A 1 269 ? -41.910  -35.958 -18.011 1.00 0.00 ? 269 LYS A C   1  
ATOM 1434   O O   . LYS A 1 269 ? -42.743  -35.788 -17.175 1.00 0.00 ? 269 LYS A O   1  
ATOM 1435   C CB  . LYS A 1 269 ? -40.586  -38.016 -17.945 1.00 0.00 ? 269 LYS A CB  1  
ATOM 1436   C CG  . LYS A 1 269 ? -40.694  -38.120 -16.376 1.00 0.00 ? 269 LYS A CG  1  
ATOM 1437   C CD  . LYS A 1 269 ? -39.650  -39.013 -15.749 1.00 0.00 ? 269 LYS A CD  1  
ATOM 1438   C CE  . LYS A 1 269 ? -39.828  -39.060 -14.195 1.00 0.00 ? 269 LYS A CE  1  
ATOM 1439   N NZ  . LYS A 1 269 ? -38.755  -39.881 -13.699 1.00 0.00 ? 269 LYS A NZ  1  
ATOM 1440   N N   . LYS A 1 270 ? -41.191  -34.944 -18.508 1.00 0.00 ? 270 LYS A N   1  
ATOM 1441   C CA  . LYS A 1 270 ? -41.343  -33.626 -18.078 1.00 0.00 ? 270 LYS A CA  1  
ATOM 1442   C C   . LYS A 1 270 ? -42.677  -32.966 -18.267 1.00 0.00 ? 270 LYS A C   1  
ATOM 1443   O O   . LYS A 1 270 ? -43.182  -32.391 -17.328 1.00 0.00 ? 270 LYS A O   1  
ATOM 1444   C CB  . LYS A 1 270 ? -40.297  -32.666 -18.583 1.00 0.00 ? 270 LYS A CB  1  
ATOM 1445   C CG  . LYS A 1 270 ? -38.893  -32.940 -18.188 1.00 0.00 ? 270 LYS A CG  1  
ATOM 1446   C CD  . LYS A 1 270 ? -37.897  -31.936 -18.780 1.00 0.00 ? 270 LYS A CD  1  
ATOM 1447   C CE  . LYS A 1 270 ? -37.680  -32.174 -20.274 1.00 0.00 ? 270 LYS A CE  1  
ATOM 1448   N NZ  . LYS A 1 270 ? -36.377  -31.540 -20.722 1.00 0.00 ? 270 LYS A NZ  1  
ATOM 1449   N N   . LEU A 1 271 ? -43.321  -33.236 -19.446 1.00 0.00 ? 271 LEU A N   1  
ATOM 1450   C CA  . LEU A 1 271 ? -44.702  -32.830 -19.643 1.00 0.00 ? 271 LEU A CA  1  
ATOM 1451   C C   . LEU A 1 271 ? -45.668  -33.564 -18.758 1.00 0.00 ? 271 LEU A C   1  
ATOM 1452   O O   . LEU A 1 271 ? -46.544  -32.975 -18.176 1.00 0.00 ? 271 LEU A O   1  
ATOM 1453   C CB  . LEU A 1 271 ? -45.158  -33.024 -21.055 1.00 0.00 ? 271 LEU A CB  1  
ATOM 1454   C CG  . LEU A 1 271 ? -46.608  -32.427 -21.345 1.00 0.00 ? 271 LEU A CG  1  
ATOM 1455   C CD1 . LEU A 1 271 ? -46.727  -30.881 -21.096 1.00 0.00 ? 271 LEU A CD1 1  
ATOM 1456   C CD2 . LEU A 1 271 ? -47.134  -32.850 -22.732 1.00 0.00 ? 271 LEU A CD2 1  
ATOM 1457   N N   . LEU A 1 272 ? -45.375  -34.857 -18.545 1.00 0.00 ? 272 LEU A N   1  
ATOM 1458   C CA  . LEU A 1 272 ? -46.228  -35.595 -17.685 1.00 0.00 ? 272 LEU A CA  1  
ATOM 1459   C C   . LEU A 1 272 ? -46.172  -34.983 -16.331 1.00 0.00 ? 272 LEU A C   1  
ATOM 1460   O O   . LEU A 1 272 ? -47.222  -34.869 -15.722 1.00 0.00 ? 272 LEU A O   1  
ATOM 1461   C CB  . LEU A 1 272 ? -45.758  -37.067 -17.528 1.00 0.00 ? 272 LEU A CB  1  
ATOM 1462   C CG  . LEU A 1 272 ? -46.669  -38.006 -16.624 1.00 0.00 ? 272 LEU A CG  1  
ATOM 1463   C CD1 . LEU A 1 272 ? -48.163  -38.339 -17.066 1.00 0.00 ? 272 LEU A CD1 1  
ATOM 1464   C CD2 . LEU A 1 272 ? -46.005  -39.376 -16.586 1.00 0.00 ? 272 LEU A CD2 1  
ATOM 1465   N N   . ASN A 1 273 ? -44.954  -34.616 -15.916 1.00 0.00 ? 273 ASN A N   1  
ATOM 1466   C CA  . ASN A 1 273 ? -44.833  -34.158 -14.578 1.00 0.00 ? 273 ASN A CA  1  
ATOM 1467   C C   . ASN A 1 273 ? -45.654  -32.997 -14.239 1.00 0.00 ? 273 ASN A C   1  
ATOM 1468   O O   . ASN A 1 273 ? -46.317  -32.958 -13.215 1.00 0.00 ? 273 ASN A O   1  
ATOM 1469   C CB  . ASN A 1 273 ? -43.382  -33.806 -14.312 1.00 0.00 ? 273 ASN A CB  1  
ATOM 1470   C CG  . ASN A 1 273 ? -42.957  -33.822 -12.786 1.00 0.00 ? 273 ASN A CG  1  
ATOM 1471   O OD1 . ASN A 1 273 ? -43.663  -33.180 -12.014 1.00 0.00 ? 273 ASN A OD1 1  
ATOM 1472   N ND2 . ASN A 1 273 ? -41.832  -34.474 -12.422 1.00 0.00 ? 273 ASN A ND2 1  
ATOM 1473   N N   . ASN A 1 274 ? -45.620  -31.918 -15.133 1.00 0.00 ? 274 ASN A N   1  
ATOM 1474   C CA  . ASN A 1 274 ? -46.302  -30.652 -14.934 1.00 0.00 ? 274 ASN A CA  1  
ATOM 1475   C C   . ASN A 1 274 ? -47.846  -30.900 -14.829 1.00 0.00 ? 274 ASN A C   1  
ATOM 1476   O O   . ASN A 1 274 ? -48.546  -30.377 -13.971 1.00 0.00 ? 274 ASN A O   1  
ATOM 1477   C CB  . ASN A 1 274 ? -46.114  -29.695 -16.128 1.00 0.00 ? 274 ASN A CB  1  
ATOM 1478   C CG  . ASN A 1 274 ? -44.579  -29.517 -16.465 1.00 0.00 ? 274 ASN A CG  1  
ATOM 1479   O OD1 . ASN A 1 274 ? -43.826  -29.229 -15.559 1.00 0.00 ? 274 ASN A OD1 1  
ATOM 1480   N ND2 . ASN A 1 274 ? -44.282  -29.572 -17.753 1.00 0.00 ? 274 ASN A ND2 1  
ATOM 1481   N N   . ILE A 1 275 ? -48.329  -31.781 -15.687 1.00 0.00 ? 275 ILE A N   1  
ATOM 1482   C CA  . ILE A 1 275 ? -49.703  -32.180 -15.845 1.00 0.00 ? 275 ILE A CA  1  
ATOM 1483   C C   . ILE A 1 275 ? -50.026  -32.944 -14.540 1.00 0.00 ? 275 ILE A C   1  
ATOM 1484   O O   . ILE A 1 275 ? -51.056  -32.704 -13.952 1.00 0.00 ? 275 ILE A O   1  
ATOM 1485   C CB  . ILE A 1 275 ? -49.944  -32.976 -17.113 1.00 0.00 ? 275 ILE A CB  1  
ATOM 1486   C CG1 . ILE A 1 275 ? -50.386  -32.005 -18.212 1.00 0.00 ? 275 ILE A CG1 1  
ATOM 1487   C CG2 . ILE A 1 275 ? -50.957  -34.130 -16.968 1.00 0.00 ? 275 ILE A CG2 1  
ATOM 1488   C CD1 . ILE A 1 275 ? -50.670  -32.676 -19.567 1.00 0.00 ? 275 ILE A CD1 1  
ATOM 1489   N N   . SER A 1 276 ? -49.081  -33.773 -14.077 1.00 0.00 ? 276 SER A N   1  
ATOM 1490   C CA  . SER A 1 276 ? -49.256  -34.475 -12.825 1.00 0.00 ? 276 SER A CA  1  
ATOM 1491   C C   . SER A 1 276 ? -49.362  -33.631 -11.610 1.00 0.00 ? 276 SER A C   1  
ATOM 1492   O O   . SER A 1 276 ? -50.108  -34.000 -10.673 1.00 0.00 ? 276 SER A O   1  
ATOM 1493   C CB  . SER A 1 276 ? -48.094  -35.489 -12.604 1.00 0.00 ? 276 SER A CB  1  
ATOM 1494   O OG  . SER A 1 276 ? -48.522  -36.489 -11.704 1.00 0.00 ? 276 SER A OG  1  
ATOM 1495   N N   . GLN A 1 277 ? -48.815  -32.429 -11.633 1.00 0.00 ? 277 GLN A N   1  
ATOM 1496   C CA  . GLN A 1 277 ? -48.873  -31.411 -10.672 1.00 0.00 ? 277 GLN A CA  1  
ATOM 1497   C C   . GLN A 1 277 ? -50.254  -30.972 -10.367 1.00 0.00 ? 277 GLN A C   1  
ATOM 1498   O O   . GLN A 1 277 ? -50.596  -30.846 -9.188  1.00 0.00 ? 277 GLN A O   1  
ATOM 1499   C CB  . GLN A 1 277 ? -47.927  -30.186 -10.920 1.00 0.00 ? 277 GLN A CB  1  
ATOM 1500   C CG  . GLN A 1 277 ? -46.441  -30.531 -10.773 1.00 0.00 ? 277 GLN A CG  1  
ATOM 1501   C CD  . GLN A 1 277 ? -46.076  -31.470 -9.604  1.00 0.00 ? 277 GLN A CD  1  
ATOM 1502   O OE1 . GLN A 1 277 ? -45.432  -32.547 -9.778  1.00 0.00 ? 277 GLN A OE1 1  
ATOM 1503   N NE2 . GLN A 1 277 ? -46.547  -31.167 -8.377  1.00 0.00 ? 277 GLN A NE2 1  
ATOM 1504   N N   . ASP A 1 278 ? -51.143  -30.862 -11.408 1.00 0.00 ? 278 ASP A N   1  
ATOM 1505   C CA  . ASP A 1 278 ? -52.570  -30.614 -11.260 1.00 0.00 ? 278 ASP A CA  1  
ATOM 1506   C C   . ASP A 1 278 ? -53.308  -31.706 -10.630 1.00 0.00 ? 278 ASP A C   1  
ATOM 1507   O O   . ASP A 1 278 ? -54.101  -31.446 -9.784  1.00 0.00 ? 278 ASP A O   1  
ATOM 1508   C CB  . ASP A 1 278 ? -53.195  -30.405 -12.660 1.00 0.00 ? 278 ASP A CB  1  
ATOM 1509   C CG  . ASP A 1 278 ? -52.327  -29.358 -13.455 1.00 0.00 ? 278 ASP A CG  1  
ATOM 1510   O OD1 . ASP A 1 278 ? -52.457  -28.148 -13.131 1.00 0.00 ? 278 ASP A OD1 1  
ATOM 1511   O OD2 . ASP A 1 278 ? -51.561  -29.647 -14.384 1.00 0.00 ? 278 ASP A OD2 1  
ATOM 1512   N N   . TYR A 1 279 ? -52.939  -32.905 -11.010 1.00 0.00 ? 279 TYR A N   1  
ATOM 1513   C CA  . TYR A 1 279 ? -53.474  -34.105 -10.459 1.00 0.00 ? 279 TYR A CA  1  
ATOM 1514   C C   . TYR A 1 279 ? -53.103  -34.222 -9.009  1.00 0.00 ? 279 TYR A C   1  
ATOM 1515   O O   . TYR A 1 279 ? -53.905  -34.556 -8.167  1.00 0.00 ? 279 TYR A O   1  
ATOM 1516   C CB  . TYR A 1 279 ? -52.885  -35.347 -11.172 1.00 0.00 ? 279 TYR A CB  1  
ATOM 1517   C CG  . TYR A 1 279 ? -53.081  -35.490 -12.623 1.00 0.00 ? 279 TYR A CG  1  
ATOM 1518   C CD1 . TYR A 1 279 ? -54.183  -34.914 -13.249 1.00 0.00 ? 279 TYR A CD1 1  
ATOM 1519   C CD2 . TYR A 1 279 ? -52.308  -36.398 -13.333 1.00 0.00 ? 279 TYR A CD2 1  
ATOM 1520   C CE1 . TYR A 1 279 ? -54.300  -34.925 -14.649 1.00 0.00 ? 279 TYR A CE1 1  
ATOM 1521   C CE2 . TYR A 1 279 ? -52.504  -36.489 -14.712 1.00 0.00 ? 279 TYR A CE2 1  
ATOM 1522   C CZ  . TYR A 1 279 ? -53.496  -35.776 -15.374 1.00 0.00 ? 279 TYR A CZ  1  
ATOM 1523   O OH  . TYR A 1 279 ? -53.692  -35.994 -16.742 1.00 0.00 ? 279 TYR A OH  1  
ATOM 1524   N N   . CYS A 1 280 ? -51.839  -33.950 -8.666  1.00 0.00 ? 280 CYS A N   1  
ATOM 1525   C CA  . CYS A 1 280 ? -51.296  -34.057 -7.325  1.00 0.00 ? 280 CYS A CA  1  
ATOM 1526   C C   . CYS A 1 280 ? -51.991  -33.075 -6.405  1.00 0.00 ? 280 CYS A C   1  
ATOM 1527   O O   . CYS A 1 280 ? -52.373  -33.449 -5.256  1.00 0.00 ? 280 CYS A O   1  
ATOM 1528   C CB  . CYS A 1 280 ? -49.754  -33.722 -7.304  1.00 0.00 ? 280 CYS A CB  1  
ATOM 1529   S SG  . CYS A 1 280 ? -48.798  -35.196 -7.804  1.00 0.00 ? 280 CYS A SG  1  
ATOM 1530   N N   . THR A 1 281 ? -52.290  -31.784 -6.910  1.00 0.00 ? 281 THR A N   1  
ATOM 1531   C CA  . THR A 1 281 ? -53.017  -30.775 -6.142  1.00 0.00 ? 281 THR A CA  1  
ATOM 1532   C C   . THR A 1 281 ? -54.386  -31.114 -5.824  1.00 0.00 ? 281 THR A C   1  
ATOM 1533   O O   . THR A 1 281 ? -54.856  -30.937 -4.746  1.00 0.00 ? 281 THR A O   1  
ATOM 1534   C CB  . THR A 1 281 ? -53.135  -29.549 -6.981  1.00 0.00 ? 281 THR A CB  1  
ATOM 1535   O OG1 . THR A 1 281 ? -51.877  -29.032 -7.301  1.00 0.00 ? 281 THR A OG1 1  
ATOM 1536   C CG2 . THR A 1 281 ? -53.942  -28.342 -6.311  1.00 0.00 ? 281 THR A CG2 1  
ATOM 1537   N N   . MET A 1 282 ? -55.159  -31.708 -6.791  1.00 0.00 ? 282 MET A N   1  
ATOM 1538   C CA  . MET A 1 282 ? -56.539  -32.138 -6.537  1.00 0.00 ? 282 MET A CA  1  
ATOM 1539   C C   . MET A 1 282 ? -56.552  -33.333 -5.531  1.00 0.00 ? 282 MET A C   1  
ATOM 1540   O O   . MET A 1 282 ? -57.429  -33.391 -4.704  1.00 0.00 ? 282 MET A O   1  
ATOM 1541   C CB  . MET A 1 282 ? -57.316  -32.372 -7.841  1.00 0.00 ? 282 MET A CB  1  
ATOM 1542   C CG  . MET A 1 282 ? -56.887  -33.386 -8.833  1.00 0.00 ? 282 MET A CG  1  
ATOM 1543   S SD  . MET A 1 282 ? -57.930  -33.450 -10.256 1.00 0.00 ? 282 MET A SD  1  
ATOM 1544   C CE  . MET A 1 282 ? -56.894  -32.352 -11.275 1.00 0.00 ? 282 MET A CE  1  
ATOM 1545   N N   . LEU A 1 283 ? -55.595  -34.255 -5.665  1.00 0.00 ? 283 LEU A N   1  
ATOM 1546   C CA  . LEU A 1 283 ? -55.475  -35.392 -4.800  1.00 0.00 ? 283 LEU A CA  1  
ATOM 1547   C C   . LEU A 1 283 ? -55.183  -35.053 -3.396  1.00 0.00 ? 283 LEU A C   1  
ATOM 1548   O O   . LEU A 1 283 ? -55.763  -35.519 -2.421  1.00 0.00 ? 283 LEU A O   1  
ATOM 1549   C CB  . LEU A 1 283 ? -54.387  -36.424 -5.172  1.00 0.00 ? 283 LEU A CB  1  
ATOM 1550   C CG  . LEU A 1 283 ? -54.683  -37.289 -6.443  1.00 0.00 ? 283 LEU A CG  1  
ATOM 1551   C CD1 . LEU A 1 283 ? -53.496  -38.038 -6.864  1.00 0.00 ? 283 LEU A CD1 1  
ATOM 1552   C CD2 . LEU A 1 283 ? -55.845  -38.213 -6.174  1.00 0.00 ? 283 LEU A CD2 1  
ATOM 1553   N N   . TYR A 1 284 ? -54.193  -34.053 -3.294  1.00 0.00 ? 284 TYR A N   1  
ATOM 1554   C CA  . TYR A 1 284 ? -53.752  -33.495 -2.140  1.00 0.00 ? 284 TYR A CA  1  
ATOM 1555   C C   . TYR A 1 284 ? -54.892  -32.795 -1.468  1.00 0.00 ? 284 TYR A C   1  
ATOM 1556   O O   . TYR A 1 284 ? -54.895  -32.875 -0.244  1.00 0.00 ? 284 TYR A O   1  
ATOM 1557   C CB  . TYR A 1 284 ? -52.526  -32.544 -2.348  1.00 0.00 ? 284 TYR A CB  1  
ATOM 1558   C CG  . TYR A 1 284 ? -51.905  -32.032 -1.079  1.00 0.00 ? 284 TYR A CG  1  
ATOM 1559   C CD1 . TYR A 1 284 ? -52.477  -30.899 -0.394  1.00 0.00 ? 284 TYR A CD1 1  
ATOM 1560   C CD2 . TYR A 1 284 ? -50.921  -32.758 -0.474  1.00 0.00 ? 284 TYR A CD2 1  
ATOM 1561   C CE1 . TYR A 1 284 ? -52.070  -30.492 0.872   1.00 0.00 ? 284 TYR A CE1 1  
ATOM 1562   C CE2 . TYR A 1 284 ? -50.415  -32.380 0.795   1.00 0.00 ? 284 TYR A CE2 1  
ATOM 1563   C CZ  . TYR A 1 284 ? -51.100  -31.298 1.549   1.00 0.00 ? 284 TYR A CZ  1  
ATOM 1564   O OH  . TYR A 1 284 ? -50.643  -30.792 2.777   1.00 0.00 ? 284 TYR A OH  1  
ATOM 1565   N N   . GLU A 1 285 ? -55.779  -32.049 -2.203  1.00 0.00 ? 285 GLU A N   1  
ATOM 1566   C CA  . GLU A 1 285 ? -56.838  -31.201 -1.639  1.00 0.00 ? 285 GLU A CA  1  
ATOM 1567   C C   . GLU A 1 285 ? -57.748  -32.176 -0.922  1.00 0.00 ? 285 GLU A C   1  
ATOM 1568   O O   . GLU A 1 285 ? -58.173  -31.827 0.193   1.00 0.00 ? 285 GLU A O   1  
ATOM 1569   C CB  . GLU A 1 285 ? -57.723  -30.448 -2.679  1.00 0.00 ? 285 GLU A CB  1  
ATOM 1570   C CG  . GLU A 1 285 ? -58.445  -29.203 -2.029  1.00 0.00 ? 285 GLU A CG  1  
ATOM 1571   C CD  . GLU A 1 285 ? -57.470  -28.016 -2.141  1.00 0.00 ? 285 GLU A CD  1  
ATOM 1572   O OE1 . GLU A 1 285 ? -57.523  -27.253 -3.152  1.00 0.00 ? 285 GLU A OE1 1  
ATOM 1573   O OE2 . GLU A 1 285 ? -56.698  -27.789 -1.159  1.00 0.00 ? 285 GLU A OE2 1  
ATOM 1574   N N   . TRP A 1 286 ? -58.039  -33.304 -1.621  1.00 0.00 ? 286 TRP A N   1  
ATOM 1575   C CA  . TRP A 1 286 ? -58.978  -34.294 -1.189  1.00 0.00 ? 286 TRP A CA  1  
ATOM 1576   C C   . TRP A 1 286 ? -58.499  -35.024 0.038   1.00 0.00 ? 286 TRP A C   1  
ATOM 1577   O O   . TRP A 1 286 ? -59.168  -35.044 1.063   1.00 0.00 ? 286 TRP A O   1  
ATOM 1578   C CB  . TRP A 1 286 ? -59.140  -35.259 -2.386  1.00 0.00 ? 286 TRP A CB  1  
ATOM 1579   C CG  . TRP A 1 286 ? -60.127  -36.360 -2.450  1.00 0.00 ? 286 TRP A CG  1  
ATOM 1580   C CD1 . TRP A 1 286 ? -59.900  -37.588 -2.920  1.00 0.00 ? 286 TRP A CD1 1  
ATOM 1581   C CD2 . TRP A 1 286 ? -61.520  -36.268 -2.150  1.00 0.00 ? 286 TRP A CD2 1  
ATOM 1582   N NE1 . TRP A 1 286 ? -61.003  -38.378 -2.947  1.00 0.00 ? 286 TRP A NE1 1  
ATOM 1583   C CE2 . TRP A 1 286 ? -62.041  -37.566 -2.452  1.00 0.00 ? 286 TRP A CE2 1  
ATOM 1584   C CE3 . TRP A 1 286 ? -62.300  -35.218 -1.737  1.00 0.00 ? 286 TRP A CE3 1  
ATOM 1585   C CZ2 . TRP A 1 286 ? -63.396  -37.811 -2.304  1.00 0.00 ? 286 TRP A CZ2 1  
ATOM 1586   C CZ3 . TRP A 1 286 ? -63.652  -35.435 -1.557  1.00 0.00 ? 286 TRP A CZ3 1  
ATOM 1587   C CH2 . TRP A 1 286 ? -64.176  -36.697 -1.831  1.00 0.00 ? 286 TRP A CH2 1  
ATOM 1588   N N   . LEU A 1 287 ? -57.299  -35.617 -0.045  1.00 0.00 ? 287 LEU A N   1  
ATOM 1589   C CA  . LEU A 1 287 ? -56.739  -36.412 1.008   1.00 0.00 ? 287 LEU A CA  1  
ATOM 1590   C C   . LEU A 1 287 ? -56.432  -35.572 2.257   1.00 0.00 ? 287 LEU A C   1  
ATOM 1591   O O   . LEU A 1 287 ? -56.622  -36.038 3.362   1.00 0.00 ? 287 LEU A O   1  
ATOM 1592   C CB  . LEU A 1 287 ? -55.394  -37.133 0.508   1.00 0.00 ? 287 LEU A CB  1  
ATOM 1593   C CG  . LEU A 1 287 ? -55.882  -38.209 -0.566  1.00 0.00 ? 287 LEU A CG  1  
ATOM 1594   C CD1 . LEU A 1 287 ? -54.623  -38.784 -1.363  1.00 0.00 ? 287 LEU A CD1 1  
ATOM 1595   C CD2 . LEU A 1 287 ? -56.591  -39.379 0.155   1.00 0.00 ? 287 LEU A CD2 1  
ATOM 1596   N N   . THR A 1 288 ? -55.902  -34.355 2.138   1.00 0.00 ? 288 THR A N   1  
ATOM 1597   C CA  . THR A 1 288 ? -55.727  -33.595 3.298   1.00 0.00 ? 288 THR A CA  1  
ATOM 1598   C C   . THR A 1 288 ? -56.962  -32.854 3.808   1.00 0.00 ? 288 THR A C   1  
ATOM 1599   O O   . THR A 1 288 ? -57.110  -32.715 5.011   1.00 0.00 ? 288 THR A O   1  
ATOM 1600   C CB  . THR A 1 288 ? -54.505  -32.615 3.105   1.00 0.00 ? 288 THR A CB  1  
ATOM 1601   O OG1 . THR A 1 288 ? -53.549  -33.146 2.191   1.00 0.00 ? 288 THR A OG1 1  
ATOM 1602   C CG2 . THR A 1 288 ? -53.985  -32.172 4.504   1.00 0.00 ? 288 THR A CG2 1  
ATOM 1603   N N   . GLN A 1 289 ? -57.845  -32.350 2.882   1.00 0.00 ? 289 GLN A N   1  
ATOM 1604   C CA  . GLN A 1 289 ? -58.972  -31.482 3.288   1.00 0.00 ? 289 GLN A CA  1  
ATOM 1605   C C   . GLN A 1 289 ? -60.266  -31.810 2.709   1.00 0.00 ? 289 GLN A C   1  
ATOM 1606   O O   . GLN A 1 289 ? -61.100  -30.979 2.773   1.00 0.00 ? 289 GLN A O   1  
ATOM 1607   C CB  . GLN A 1 289 ? -58.813  -29.975 2.759   1.00 0.00 ? 289 GLN A CB  1  
ATOM 1608   C CG  . GLN A 1 289 ? -57.374  -29.391 2.907   1.00 0.00 ? 289 GLN A CG  1  
ATOM 1609   C CD  . GLN A 1 289 ? -57.247  -29.319 4.413   1.00 0.00 ? 289 GLN A CD  1  
ATOM 1610   O OE1 . GLN A 1 289 ? -58.181  -28.818 5.070   1.00 0.00 ? 289 GLN A OE1 1  
ATOM 1611   N NE2 . GLN A 1 289 ? -56.056  -29.668 4.950   1.00 0.00 ? 289 GLN A NE2 1  
ATOM 1612   N N   . GLY A 1 290 ? -60.459  -32.988 2.206   1.00 0.00 ? 290 GLY A N   1  
ATOM 1613   C CA  . GLY A 1 290 ? -61.781  -33.446 1.685   1.00 0.00 ? 290 GLY A CA  1  
ATOM 1614   C C   . GLY A 1 290 ? -62.371  -32.620 0.609   1.00 0.00 ? 290 GLY A C   1  
ATOM 1615   O O   . GLY A 1 290 ? -63.605  -32.603 0.567   1.00 0.00 ? 290 GLY A O   1  
ATOM 1616   N N   . ILE A 1 291 ? -61.626  -31.868 -0.285  1.00 0.00 ? 291 ILE A N   1  
ATOM 1617   C CA  . ILE A 1 291 ? -62.263  -31.005 -1.280  1.00 0.00 ? 291 ILE A CA  1  
ATOM 1618   C C   . ILE A 1 291 ? -61.740  -31.441 -2.594  1.00 0.00 ? 291 ILE A C   1  
ATOM 1619   O O   . ILE A 1 291 ? -60.555  -31.465 -2.780  1.00 0.00 ? 291 ILE A O   1  
ATOM 1620   C CB  . ILE A 1 291 ? -61.883  -29.552 -1.012  1.00 0.00 ? 291 ILE A CB  1  
ATOM 1621   C CG1 . ILE A 1 291 ? -62.735  -29.055 0.191   1.00 0.00 ? 291 ILE A CG1 1  
ATOM 1622   C CG2 . ILE A 1 291 ? -62.205  -28.625 -2.153  1.00 0.00 ? 291 ILE A CG2 1  
ATOM 1623   C CD1 . ILE A 1 291 ? -62.466  -27.594 0.589   1.00 0.00 ? 291 ILE A CD1 1  
ATOM 1624   N N   . LEU A 1 292 ? -62.707  -31.710 -3.543  1.00 0.00 ? 292 LEU A N   1  
ATOM 1625   C CA  . LEU A 1 292 ? -62.320  -32.020 -4.931  1.00 0.00 ? 292 LEU A CA  1  
ATOM 1626   C C   . LEU A 1 292 ? -62.250  -30.724 -5.681  1.00 0.00 ? 292 LEU A C   1  
ATOM 1627   O O   . LEU A 1 292 ? -62.470  -29.725 -5.039  1.00 0.00 ? 292 LEU A O   1  
ATOM 1628   C CB  . LEU A 1 292 ? -63.398  -32.881 -5.730  1.00 0.00 ? 292 LEU A CB  1  
ATOM 1629   C CG  . LEU A 1 292 ? -63.701  -34.267 -5.051  1.00 0.00 ? 292 LEU A CG  1  
ATOM 1630   C CD1 . LEU A 1 292 ? -64.778  -35.104 -5.717  1.00 0.00 ? 292 LEU A CD1 1  
ATOM 1631   C CD2 . LEU A 1 292 ? -62.463  -35.104 -4.857  1.00 0.00 ? 292 LEU A CD2 1  
ATOM 1632   N N   . ASN A 1 293 ? -61.929  -30.750 -7.002  1.00 0.00 ? 293 ASN A N   1  
ATOM 1633   C CA  . ASN A 1 293 ? -61.936  -29.499 -7.744  1.00 0.00 ? 293 ASN A CA  1  
ATOM 1634   C C   . ASN A 1 293 ? -62.560  -29.686 -9.072  1.00 0.00 ? 293 ASN A C   1  
ATOM 1635   O O   . ASN A 1 293 ? -62.265  -30.672 -9.737  1.00 0.00 ? 293 ASN A O   1  
ATOM 1636   C CB  . ASN A 1 293 ? -60.591  -28.821 -7.988  1.00 0.00 ? 293 ASN A CB  1  
ATOM 1637   C CG  . ASN A 1 293 ? -60.010  -28.290 -6.701  1.00 0.00 ? 293 ASN A CG  1  
ATOM 1638   O OD1 . ASN A 1 293 ? -60.169  -27.086 -6.454  1.00 0.00 ? 293 ASN A OD1 1  
ATOM 1639   N ND2 . ASN A 1 293 ? -59.275  -29.150 -5.927  1.00 0.00 ? 293 ASN A ND2 1  
ATOM 1640   N N   . ASP A 1 294 ? -63.465  -28.843 -9.527  1.00 0.00 ? 294 ASP A N   1  
ATOM 1641   C CA  . ASP A 1 294 ? -64.191  -29.042 -10.700 1.00 0.00 ? 294 ASP A CA  1  
ATOM 1642   C C   . ASP A 1 294 ? -64.465  -27.714 -11.362 1.00 0.00 ? 294 ASP A C   1  
ATOM 1643   O O   . ASP A 1 294 ? -65.321  -26.943 -10.974 1.00 0.00 ? 294 ASP A O   1  
ATOM 1644   C CB  . ASP A 1 294 ? -65.560  -29.614 -10.367 1.00 0.00 ? 294 ASP A CB  1  
ATOM 1645   C CG  . ASP A 1 294 ? -65.496  -31.078 -9.808  1.00 0.00 ? 294 ASP A CG  1  
ATOM 1646   O OD1 . ASP A 1 294 ? -64.932  -31.884 -10.625 1.00 0.00 ? 294 ASP A OD1 1  
ATOM 1647   O OD2 . ASP A 1 294 ? -65.924  -31.243 -8.662  1.00 0.00 ? 294 ASP A OD2 1  
ATOM 1648   N N   . PRO A 1 295 ? -63.796  -27.329 -12.458 1.00 0.00 ? 295 PRO A N   1  
ATOM 1649   C CA  . PRO A 1 295 ? -64.094  -26.100 -13.178 1.00 0.00 ? 295 PRO A CA  1  
ATOM 1650   C C   . PRO A 1 295 ? -65.346  -26.379 -14.031 1.00 0.00 ? 295 PRO A C   1  
ATOM 1651   O O   . PRO A 1 295 ? -66.061  -25.470 -14.354 1.00 0.00 ? 295 PRO A O   1  
ATOM 1652   C CB  . PRO A 1 295 ? -62.867  -25.783 -14.048 1.00 0.00 ? 295 PRO A CB  1  
ATOM 1653   C CG  . PRO A 1 295 ? -61.947  -26.975 -13.973 1.00 0.00 ? 295 PRO A CG  1  
ATOM 1654   C CD  . PRO A 1 295 ? -62.522  -27.862 -12.923 1.00 0.00 ? 295 PRO A CD  1  
ATOM 1655   N N   . TYR A 1 296 ? -65.418  -27.612 -14.604 1.00 0.00 ? 296 TYR A N   1  
ATOM 1656   C CA  . TYR A 1 296 ? -66.287  -28.014 -15.632 1.00 0.00 ? 296 TYR A CA  1  
ATOM 1657   C C   . TYR A 1 296 ? -66.047  -29.502 -15.571 1.00 0.00 ? 296 TYR A C   1  
ATOM 1658   O O   . TYR A 1 296 ? -65.922  -30.150 -16.582 1.00 0.00 ? 296 TYR A O   1  
ATOM 1659   C CB  . TYR A 1 296 ? -66.042  -27.454 -17.105 1.00 0.00 ? 296 TYR A CB  1  
ATOM 1660   C CG  . TYR A 1 296 ? -64.647  -27.134 -17.385 1.00 0.00 ? 296 TYR A CG  1  
ATOM 1661   C CD1 . TYR A 1 296 ? -63.561  -28.024 -17.418 1.00 0.00 ? 296 TYR A CD1 1  
ATOM 1662   C CD2 . TYR A 1 296 ? -64.384  -25.736 -17.575 1.00 0.00 ? 296 TYR A CD2 1  
ATOM 1663   C CE1 . TYR A 1 296 ? -62.294  -27.521 -17.740 1.00 0.00 ? 296 TYR A CE1 1  
ATOM 1664   C CE2 . TYR A 1 296 ? -63.157  -25.239 -17.987 1.00 0.00 ? 296 TYR A CE2 1  
ATOM 1665   C CZ  . TYR A 1 296 ? -62.130  -26.201 -18.169 1.00 0.00 ? 296 TYR A CZ  1  
ATOM 1666   O OH  . TYR A 1 296 ? -60.829  -25.876 -18.527 1.00 0.00 ? 296 TYR A OH  1  
ATOM 1667   N N   . GLN A 1 297 ? -65.852  -30.043 -14.297 1.00 0.00 ? 297 GLN A N   1  
ATOM 1668   C CA  . GLN A 1 297 ? -65.537  -31.376 -13.937 1.00 0.00 ? 297 GLN A CA  1  
ATOM 1669   C C   . GLN A 1 297 ? -64.090  -31.732 -14.263 1.00 0.00 ? 297 GLN A C   1  
ATOM 1670   O O   . GLN A 1 297 ? -63.576  -31.432 -15.331 1.00 0.00 ? 297 GLN A O   1  
ATOM 1671   C CB  . GLN A 1 297 ? -66.448  -32.548 -14.459 1.00 0.00 ? 297 GLN A CB  1  
ATOM 1672   C CG  . GLN A 1 297 ? -67.946  -32.350 -14.019 1.00 0.00 ? 297 GLN A CG  1  
ATOM 1673   C CD  . GLN A 1 297 ? -68.119  -32.490 -12.473 1.00 0.00 ? 297 GLN A CD  1  
ATOM 1674   O OE1 . GLN A 1 297 ? -68.614  -31.500 -11.842 1.00 0.00 ? 297 GLN A OE1 1  
ATOM 1675   N NE2 . GLN A 1 297 ? -67.766  -33.674 -11.859 1.00 0.00 ? 297 GLN A NE2 1  
ATOM 1676   N N   . GLU A 1 298 ? -63.468  -32.390 -13.286 1.00 0.00 ? 298 GLU A N   1  
ATOM 1677   C CA  . GLU A 1 298 ? -62.114  -32.945 -13.523 1.00 0.00 ? 298 GLU A CA  1  
ATOM 1678   C C   . GLU A 1 298 ? -62.025  -34.175 -12.672 1.00 0.00 ? 298 GLU A C   1  
ATOM 1679   O O   . GLU A 1 298 ? -60.946  -34.762 -12.536 1.00 0.00 ? 298 GLU A O   1  
ATOM 1680   C CB  . GLU A 1 298 ? -60.968  -31.986 -13.085 1.00 0.00 ? 298 GLU A CB  1  
ATOM 1681   C CG  . GLU A 1 298 ? -59.976  -31.618 -14.254 1.00 0.00 ? 298 GLU A CG  1  
ATOM 1682   C CD  . GLU A 1 298 ? -60.630  -30.865 -15.398 1.00 0.00 ? 298 GLU A CD  1  
ATOM 1683   O OE1 . GLU A 1 298 ? -61.252  -29.813 -15.103 1.00 0.00 ? 298 GLU A OE1 1  
ATOM 1684   O OE2 . GLU A 1 298 ? -60.607  -31.419 -16.541 1.00 0.00 ? 298 GLU A OE2 1  
ATOM 1685   N N   . PHE A 1 299 ? -63.246  -34.715 -12.287 1.00 0.00 ? 299 PHE A N   1  
ATOM 1686   C CA  . PHE A 1 299 ? -63.383  -35.939 -11.613 1.00 0.00 ? 299 PHE A CA  1  
ATOM 1687   C C   . PHE A 1 299 ? -64.676  -36.511 -12.160 1.00 0.00 ? 299 PHE A C   1  
ATOM 1688   O O   . PHE A 1 299 ? -65.500  -35.838 -12.773 1.00 0.00 ? 299 PHE A O   1  
ATOM 1689   C CB  . PHE A 1 299 ? -63.596  -35.664 -10.122 1.00 0.00 ? 299 PHE A CB  1  
ATOM 1690   C CG  . PHE A 1 299 ? -62.310  -35.443 -9.409  1.00 0.00 ? 299 PHE A CG  1  
ATOM 1691   C CD1 . PHE A 1 299 ? -61.574  -36.469 -8.816  1.00 0.00 ? 299 PHE A CD1 1  
ATOM 1692   C CD2 . PHE A 1 299 ? -61.771  -34.160 -9.266  1.00 0.00 ? 299 PHE A CD2 1  
ATOM 1693   C CE1 . PHE A 1 299 ? -60.495  -36.235 -7.904  1.00 0.00 ? 299 PHE A CE1 1  
ATOM 1694   C CE2 . PHE A 1 299 ? -60.793  -33.901 -8.357  1.00 0.00 ? 299 PHE A CE2 1  
ATOM 1695   C CZ  . PHE A 1 299 ? -60.115  -34.930 -7.644  1.00 0.00 ? 299 PHE A CZ  1  
ATOM 1696   N N   . MET A 1 300 ? -64.868  -37.824 -11.910 1.00 0.00 ? 300 MET A N   1  
ATOM 1697   C CA  . MET A 1 300 ? -65.951  -38.533 -12.392 1.00 0.00 ? 300 MET A CA  1  
ATOM 1698   C C   . MET A 1 300 ? -66.961  -38.678 -11.289 1.00 0.00 ? 300 MET A C   1  
ATOM 1699   O O   . MET A 1 300 ? -68.054  -39.167 -11.510 1.00 0.00 ? 300 MET A O   1  
ATOM 1700   C CB  . MET A 1 300 ? -65.527  -39.965 -12.774 1.00 0.00 ? 300 MET A CB  1  
ATOM 1701   C CG  . MET A 1 300 ? -64.490  -40.106 -13.884 1.00 0.00 ? 300 MET A CG  1  
ATOM 1702   S SD  . MET A 1 300 ? -64.995  -39.617 -15.578 1.00 0.00 ? 300 MET A SD  1  
ATOM 1703   C CE  . MET A 1 300 ? -64.861  -37.796 -15.452 1.00 0.00 ? 300 MET A CE  1  
ATOM 1704   N N   . THR A 1 301 ? -66.726  -38.111 -10.127 1.00 0.00 ? 301 THR A N   1  
ATOM 1705   C CA  . THR A 1 301 ? -67.662  -37.937 -9.048  1.00 0.00 ? 301 THR A CA  1  
ATOM 1706   C C   . THR A 1 301 ? -68.128  -36.491 -9.144  1.00 0.00 ? 301 THR A C   1  
ATOM 1707   O O   . THR A 1 301 ? -67.349  -35.551 -9.346  1.00 0.00 ? 301 THR A O   1  
ATOM 1708   C CB  . THR A 1 301 ? -67.176  -38.218 -7.723  1.00 0.00 ? 301 THR A CB  1  
ATOM 1709   O OG1 . THR A 1 301 ? -65.928  -37.623 -7.589  1.00 0.00 ? 301 THR A OG1 1  
ATOM 1710   C CG2 . THR A 1 301 ? -67.138  -39.734 -7.634  1.00 0.00 ? 301 THR A CG2 1  
ATOM 1711   N N   . TYR A 1 302 ? -69.458  -36.362 -9.052  1.00 0.00 ? 302 TYR A N   1  
ATOM 1712   C CA  . TYR A 1 302 ? -70.129  -35.064 -9.192  1.00 0.00 ? 302 TYR A CA  1  
ATOM 1713   C C   . TYR A 1 302 ? -71.017  -35.104 -7.981  1.00 0.00 ? 302 TYR A C   1  
ATOM 1714   O O   . TYR A 1 302 ? -71.453  -36.145 -7.530  1.00 0.00 ? 302 TYR A O   1  
ATOM 1715   C CB  . TYR A 1 302 ? -71.011  -34.921 -10.523 1.00 0.00 ? 302 TYR A CB  1  
ATOM 1716   C CG  . TYR A 1 302 ? -72.188  -35.853 -10.636 1.00 0.00 ? 302 TYR A CG  1  
ATOM 1717   C CD1 . TYR A 1 302 ? -71.945  -37.222 -10.922 1.00 0.00 ? 302 TYR A CD1 1  
ATOM 1718   C CD2 . TYR A 1 302 ? -73.493  -35.361 -10.558 1.00 0.00 ? 302 TYR A CD2 1  
ATOM 1719   C CE1 . TYR A 1 302 ? -72.978  -38.069 -11.135 1.00 0.00 ? 302 TYR A CE1 1  
ATOM 1720   C CE2 . TYR A 1 302 ? -74.531  -36.327 -10.562 1.00 0.00 ? 302 TYR A CE2 1  
ATOM 1721   C CZ  . TYR A 1 302 ? -74.294  -37.619 -10.966 1.00 0.00 ? 302 TYR A CZ  1  
ATOM 1722   O OH  . TYR A 1 302 ? -75.418  -38.509 -10.937 1.00 0.00 ? 302 TYR A OH  1  
ATOM 1723   N N   . ASP A 1 303 ? -71.315  -33.933 -7.373  1.00 0.00 ? 303 ASP A N   1  
ATOM 1724   C CA  . ASP A 1 303 ? -72.212  -33.847 -6.299  1.00 0.00 ? 303 ASP A CA  1  
ATOM 1725   C C   . ASP A 1 303 ? -73.633  -33.894 -6.779  1.00 0.00 ? 303 ASP A C   1  
ATOM 1726   O O   . ASP A 1 303 ? -73.882  -33.348 -7.881  1.00 0.00 ? 303 ASP A O   1  
ATOM 1727   C CB  . ASP A 1 303 ? -71.985  -32.571 -5.558  1.00 0.00 ? 303 ASP A CB  1  
ATOM 1728   C CG  . ASP A 1 303 ? -72.949  -32.454 -4.328  1.00 0.00 ? 303 ASP A CG  1  
ATOM 1729   O OD1 . ASP A 1 303 ? -74.109  -32.022 -4.452  1.00 0.00 ? 303 ASP A OD1 1  
ATOM 1730   O OD2 . ASP A 1 303 ? -72.436  -32.797 -3.225  1.00 0.00 ? 303 ASP A OD2 1  
ATOM 1731   N N   . ASP A 1 304 ? -74.474  -34.678 -6.101  1.00 0.00 ? 304 ASP A N   1  
ATOM 1732   C CA  . ASP A 1 304 ? -75.781  -34.918 -6.677  1.00 0.00 ? 304 ASP A CA  1  
ATOM 1733   C C   . ASP A 1 304 ? -76.662  -33.823 -5.994  1.00 0.00 ? 304 ASP A C   1  
ATOM 1734   O O   . ASP A 1 304 ? -76.108  -33.044 -5.173  1.00 0.00 ? 304 ASP A O   1  
ATOM 1735   C CB  . ASP A 1 304 ? -76.317  -36.333 -6.323  1.00 0.00 ? 304 ASP A CB  1  
ATOM 1736   C CG  . ASP A 1 304 ? -75.254  -37.392 -6.550  1.00 0.00 ? 304 ASP A CG  1  
ATOM 1737   O OD1 . ASP A 1 304 ? -74.468  -37.354 -7.556  1.00 0.00 ? 304 ASP A OD1 1  
ATOM 1738   O OD2 . ASP A 1 304 ? -75.126  -38.306 -5.677  1.00 0.00 ? 304 ASP A OD2 1  
ATOM 1739   N N   . TRP A 1 320 ? -78.412  -29.724 2.387   1.00 0.00 ? 320 TRP A N   1  
ATOM 1740   C CA  . TRP A 1 320 ? -78.757  -30.411 3.659   1.00 0.00 ? 320 TRP A CA  1  
ATOM 1741   C C   . TRP A 1 320 ? -77.507  -30.987 4.196   1.00 0.00 ? 320 TRP A C   1  
ATOM 1742   O O   . TRP A 1 320 ? -76.883  -30.644 5.198   1.00 0.00 ? 320 TRP A O   1  
ATOM 1743   C CB  . TRP A 1 320 ? -79.781  -31.561 3.516   1.00 0.00 ? 320 TRP A CB  1  
ATOM 1744   C CG  . TRP A 1 320 ? -81.187  -30.947 3.272   1.00 0.00 ? 320 TRP A CG  1  
ATOM 1745   C CD1 . TRP A 1 320 ? -81.744  -30.696 2.086   1.00 0.00 ? 320 TRP A CD1 1  
ATOM 1746   C CD2 . TRP A 1 320 ? -81.983  -30.147 4.200   1.00 0.00 ? 320 TRP A CD2 1  
ATOM 1747   N NE1 . TRP A 1 320 ? -82.914  -30.032 2.149   1.00 0.00 ? 320 TRP A NE1 1  
ATOM 1748   C CE2 . TRP A 1 320 ? -82.994  -29.558 3.400   1.00 0.00 ? 320 TRP A CE2 1  
ATOM 1749   C CE3 . TRP A 1 320 ? -81.765  -29.749 5.482   1.00 0.00 ? 320 TRP A CE3 1  
ATOM 1750   C CZ2 . TRP A 1 320 ? -83.901  -28.632 3.956   1.00 0.00 ? 320 TRP A CZ2 1  
ATOM 1751   C CZ3 . TRP A 1 320 ? -82.678  -28.861 6.029   1.00 0.00 ? 320 TRP A CZ3 1  
ATOM 1752   C CH2 . TRP A 1 320 ? -83.731  -28.232 5.295   1.00 0.00 ? 320 TRP A CH2 1  
ATOM 1753   N N   . ASP A 1 321 ? -77.067  -32.017 3.474   1.00 0.00 ? 321 ASP A N   1  
ATOM 1754   C CA  . ASP A 1 321 ? -75.872  -32.867 3.807   1.00 0.00 ? 321 ASP A CA  1  
ATOM 1755   C C   . ASP A 1 321 ? -75.193  -33.483 2.555   1.00 0.00 ? 321 ASP A C   1  
ATOM 1756   O O   . ASP A 1 321 ? -74.014  -33.737 2.564   1.00 0.00 ? 321 ASP A O   1  
ATOM 1757   C CB  . ASP A 1 321 ? -76.193  -34.056 4.745   1.00 0.00 ? 321 ASP A CB  1  
ATOM 1758   C CG  . ASP A 1 321 ? -76.653  -33.692 6.188   1.00 0.00 ? 321 ASP A CG  1  
ATOM 1759   O OD1 . ASP A 1 321 ? -75.843  -33.594 7.113   1.00 0.00 ? 321 ASP A OD1 1  
ATOM 1760   O OD2 . ASP A 1 321 ? -77.923  -33.612 6.319   1.00 0.00 ? 321 ASP A OD2 1  
ATOM 1761   N N   . THR A 1 322 ? -75.936  -33.484 1.416   1.00 0.00 ? 322 THR A N   1  
ATOM 1762   C CA  . THR A 1 322 ? -75.501  -33.860 0.029   1.00 0.00 ? 322 THR A CA  1  
ATOM 1763   C C   . THR A 1 322 ? -74.956  -35.217 -0.122  1.00 0.00 ? 322 THR A C   1  
ATOM 1764   O O   . THR A 1 322 ? -74.684  -35.901 0.866   1.00 0.00 ? 322 THR A O   1  
ATOM 1765   C CB  . THR A 1 322 ? -74.692  -32.810 -0.791  1.00 0.00 ? 322 THR A CB  1  
ATOM 1766   O OG1 . THR A 1 322 ? -73.399  -32.648 -0.223  1.00 0.00 ? 322 THR A OG1 1  
ATOM 1767   C CG2 . THR A 1 322 ? -75.361  -31.423 -0.725  1.00 0.00 ? 322 THR A CG2 1  
ATOM 1768   N N   . GLN A 1 323 ? -74.780  -35.708 -1.367  1.00 0.00 ? 323 GLN A N   1  
ATOM 1769   C CA  . GLN A 1 323 ? -74.100  -36.971 -1.609  1.00 0.00 ? 323 GLN A CA  1  
ATOM 1770   C C   . GLN A 1 323 ? -73.318  -36.747 -2.866  1.00 0.00 ? 323 GLN A C   1  
ATOM 1771   O O   . GLN A 1 323 ? -73.446  -35.711 -3.494  1.00 0.00 ? 323 GLN A O   1  
ATOM 1772   C CB  . GLN A 1 323 ? -75.090  -38.221 -1.577  1.00 0.00 ? 323 GLN A CB  1  
ATOM 1773   C CG  . GLN A 1 323 ? -74.287  -39.472 -1.144  1.00 0.00 ? 323 GLN A CG  1  
ATOM 1774   C CD  . GLN A 1 323 ? -75.102  -40.773 -1.530  1.00 0.00 ? 323 GLN A CD  1  
ATOM 1775   O OE1 . GLN A 1 323 ? -74.755  -41.541 -2.433  1.00 0.00 ? 323 GLN A OE1 1  
ATOM 1776   N NE2 . GLN A 1 323 ? -76.193  -41.018 -0.742  1.00 0.00 ? 323 GLN A NE2 1  
ATOM 1777   N N   . TYR A 1 324 ? -72.500  -37.749 -3.348  1.00 0.00 ? 324 TYR A N   1  
ATOM 1778   C CA  . TYR A 1 324 ? -71.787  -37.616 -4.538  1.00 0.00 ? 324 TYR A CA  1  
ATOM 1779   C C   . TYR A 1 324 ? -72.005  -38.964 -5.182  1.00 0.00 ? 324 TYR A C   1  
ATOM 1780   O O   . TYR A 1 324 ? -72.189  -39.934 -4.542  1.00 0.00 ? 324 TYR A O   1  
ATOM 1781   C CB  . TYR A 1 324 ? -70.251  -37.541 -4.407  1.00 0.00 ? 324 TYR A CB  1  
ATOM 1782   C CG  . TYR A 1 324 ? -69.690  -36.096 -4.288  1.00 0.00 ? 324 TYR A CG  1  
ATOM 1783   C CD1 . TYR A 1 324 ? -69.747  -35.372 -3.070  1.00 0.00 ? 324 TYR A CD1 1  
ATOM 1784   C CD2 . TYR A 1 324 ? -68.934  -35.538 -5.345  1.00 0.00 ? 324 TYR A CD2 1  
ATOM 1785   C CE1 . TYR A 1 324 ? -69.174  -34.137 -3.001  1.00 0.00 ? 324 TYR A CE1 1  
ATOM 1786   C CE2 . TYR A 1 324 ? -68.284  -34.306 -5.219  1.00 0.00 ? 324 TYR A CE2 1  
ATOM 1787   C CZ  . TYR A 1 324 ? -68.424  -33.559 -4.046  1.00 0.00 ? 324 TYR A CZ  1  
ATOM 1788   O OH  . TYR A 1 324 ? -67.755  -32.350 -3.890  1.00 0.00 ? 324 TYR A OH  1  
ATOM 1789   N N   . PHE A 1 325 ? -71.920  -39.007 -6.581  1.00 0.00 ? 325 PHE A N   1  
ATOM 1790   C CA  . PHE A 1 325 ? -71.940  -40.263 -7.359  1.00 0.00 ? 325 PHE A CA  1  
ATOM 1791   C C   . PHE A 1 325 ? -71.219  -40.024 -8.558  1.00 0.00 ? 325 PHE A C   1  
ATOM 1792   O O   . PHE A 1 325 ? -70.774  -38.920 -8.837  1.00 0.00 ? 325 PHE A O   1  
ATOM 1793   C CB  . PHE A 1 325 ? -73.415  -40.819 -7.671  1.00 0.00 ? 325 PHE A CB  1  
ATOM 1794   C CG  . PHE A 1 325 ? -73.747  -42.108 -6.916  1.00 0.00 ? 325 PHE A CG  1  
ATOM 1795   C CD1 . PHE A 1 325 ? -72.874  -43.189 -7.003  1.00 0.00 ? 325 PHE A CD1 1  
ATOM 1796   C CD2 . PHE A 1 325 ? -74.914  -42.252 -6.215  1.00 0.00 ? 325 PHE A CD2 1  
ATOM 1797   C CE1 . PHE A 1 325 ? -73.141  -44.375 -6.275  1.00 0.00 ? 325 PHE A CE1 1  
ATOM 1798   C CE2 . PHE A 1 325 ? -75.237  -43.448 -5.624  1.00 0.00 ? 325 PHE A CE2 1  
ATOM 1799   C CZ  . PHE A 1 325 ? -74.344  -44.535 -5.547  1.00 0.00 ? 325 PHE A CZ  1  
ATOM 1800   N N   . ILE A 1 326 ? -70.988  -41.192 -9.239  1.00 0.00 ? 326 ILE A N   1  
ATOM 1801   C CA  . ILE A 1 326 ? -70.205  -41.249 -10.403 1.00 0.00 ? 326 ILE A CA  1  
ATOM 1802   C C   . ILE A 1 326 ? -71.153  -41.167 -11.626 1.00 0.00 ? 326 ILE A C   1  
ATOM 1803   O O   . ILE A 1 326 ? -72.269  -41.744 -11.832 1.00 0.00 ? 326 ILE A O   1  
ATOM 1804   C CB  . ILE A 1 326 ? -69.465  -42.623 -10.519 1.00 0.00 ? 326 ILE A CB  1  
ATOM 1805   C CG1 . ILE A 1 326 ? -70.179  -43.992 -10.244 1.00 0.00 ? 326 ILE A CG1 1  
ATOM 1806   C CG2 . ILE A 1 326 ? -68.195  -42.462 -9.572  1.00 0.00 ? 326 ILE A CG2 1  
ATOM 1807   C CD1 . ILE A 1 326 ? -69.270  -45.220 -10.414 1.00 0.00 ? 326 ILE A CD1 1  
ATOM 1808   N N   . ARG A 1 327 ? -70.798  -40.271 -12.579 1.00 0.00 ? 327 ARG A N   1  
ATOM 1809   C CA  . ARG A 1 327 ? -71.581  -40.107 -13.833 1.00 0.00 ? 327 ARG A CA  1  
ATOM 1810   C C   . ARG A 1 327 ? -70.936  -41.015 -14.791 1.00 0.00 ? 327 ARG A C   1  
ATOM 1811   O O   . ARG A 1 327 ? -69.738  -40.916 -15.198 1.00 0.00 ? 327 ARG A O   1  
ATOM 1812   C CB  . ARG A 1 327 ? -71.483  -38.650 -14.286 1.00 0.00 ? 327 ARG A CB  1  
ATOM 1813   C CG  . ARG A 1 327 ? -70.159  -37.820 -14.113 1.00 0.00 ? 327 ARG A CG  1  
ATOM 1814   C CD  . ARG A 1 327 ? -70.411  -36.317 -14.491 1.00 0.00 ? 327 ARG A CD  1  
ATOM 1815   N NE  . ARG A 1 327 ? -70.658  -36.389 -15.971 1.00 0.00 ? 327 ARG A NE  1  
ATOM 1816   C CZ  . ARG A 1 327 ? -70.240  -35.485 -16.897 1.00 0.00 ? 327 ARG A CZ  1  
ATOM 1817   N NH1 . ARG A 1 327 ? -69.489  -34.452 -16.606 1.00 0.00 ? 327 ARG A NH1 1  
ATOM 1818   N NH2 . ARG A 1 327 ? -70.687  -35.706 -18.179 1.00 0.00 ? 327 ARG A NH2 1  
ATOM 1819   N N   . LYS A 1 328 ? -71.789  -42.046 -15.176 1.00 0.00 ? 328 LYS A N   1  
ATOM 1820   C CA  . LYS A 1 328 ? -71.285  -43.131 -15.891 1.00 0.00 ? 328 LYS A CA  1  
ATOM 1821   C C   . LYS A 1 328 ? -70.725  -42.870 -17.309 1.00 0.00 ? 328 LYS A C   1  
ATOM 1822   O O   . LYS A 1 328 ? -69.884  -43.645 -17.802 1.00 0.00 ? 328 LYS A O   1  
ATOM 1823   C CB  . LYS A 1 328 ? -72.421  -44.170 -16.131 1.00 0.00 ? 328 LYS A CB  1  
ATOM 1824   C CG  . LYS A 1 328 ? -72.916  -44.819 -14.844 1.00 0.00 ? 328 LYS A CG  1  
ATOM 1825   C CD  . LYS A 1 328 ? -74.307  -45.448 -14.901 1.00 0.00 ? 328 LYS A CD  1  
ATOM 1826   C CE  . LYS A 1 328 ? -74.673  -46.239 -13.624 1.00 0.00 ? 328 LYS A CE  1  
ATOM 1827   N NZ  . LYS A 1 328 ? -74.649  -45.336 -12.393 1.00 0.00 ? 328 LYS A NZ  1  
ATOM 1828   N N   . ASP A 1 329 ? -71.356  -41.916 -18.055 1.00 0.00 ? 329 ASP A N   1  
ATOM 1829   C CA  . ASP A 1 329 ? -70.961  -41.859 -19.452 1.00 0.00 ? 329 ASP A CA  1  
ATOM 1830   C C   . ASP A 1 329 ? -69.529  -41.590 -19.754 1.00 0.00 ? 329 ASP A C   1  
ATOM 1831   O O   . ASP A 1 329 ? -68.997  -42.371 -20.548 1.00 0.00 ? 329 ASP A O   1  
ATOM 1832   C CB  . ASP A 1 329 ? -71.744  -40.813 -20.246 1.00 0.00 ? 329 ASP A CB  1  
ATOM 1833   C CG  . ASP A 1 329 ? -73.253  -41.086 -20.395 1.00 0.00 ? 329 ASP A CG  1  
ATOM 1834   O OD1 . ASP A 1 329 ? -73.627  -42.260 -20.203 1.00 0.00 ? 329 ASP A OD1 1  
ATOM 1835   O OD2 . ASP A 1 329 ? -73.923  -40.106 -20.774 1.00 0.00 ? 329 ASP A OD2 1  
ATOM 1836   N N   . VAL A 1 330 ? -68.918  -40.598 -19.076 1.00 0.00 ? 330 VAL A N   1  
ATOM 1837   C CA  . VAL A 1 330 ? -67.554  -40.100 -19.124 1.00 0.00 ? 330 VAL A CA  1  
ATOM 1838   C C   . VAL A 1 330 ? -66.577  -41.009 -18.468 1.00 0.00 ? 330 VAL A C   1  
ATOM 1839   O O   . VAL A 1 330 ? -65.428  -40.834 -18.744 1.00 0.00 ? 330 VAL A O   1  
ATOM 1840   C CB  . VAL A 1 330 ? -67.523  -38.693 -18.630 1.00 0.00 ? 330 VAL A CB  1  
ATOM 1841   C CG1 . VAL A 1 330 ? -68.213  -37.886 -19.725 1.00 0.00 ? 330 VAL A CG1 1  
ATOM 1842   C CG2 . VAL A 1 330 ? -68.153  -38.625 -17.163 1.00 0.00 ? 330 VAL A CG2 1  
ATOM 1843   N N   . LEU A 1 331 ? -67.071  -41.915 -17.534 1.00 0.00 ? 331 LEU A N   1  
ATOM 1844   C CA  . LEU A 1 331 ? -66.373  -42.721 -16.570 1.00 0.00 ? 331 LEU A CA  1  
ATOM 1845   C C   . LEU A 1 331 ? -65.039  -43.264 -17.032 1.00 0.00 ? 331 LEU A C   1  
ATOM 1846   O O   . LEU A 1 331 ? -65.038  -43.692 -18.213 1.00 0.00 ? 331 LEU A O   1  
ATOM 1847   C CB  . LEU A 1 331 ? -67.200  -43.896 -16.087 1.00 0.00 ? 331 LEU A CB  1  
ATOM 1848   C CG  . LEU A 1 331 ? -67.054  -44.466 -14.672 1.00 0.00 ? 331 LEU A CG  1  
ATOM 1849   C CD1 . LEU A 1 331 ? -65.958  -45.607 -14.585 1.00 0.00 ? 331 LEU A CD1 1  
ATOM 1850   C CD2 . LEU A 1 331 ? -66.929  -43.338 -13.625 1.00 0.00 ? 331 LEU A CD2 1  
ATOM 1851   N N   . LEU A 1 332 ? -63.925  -43.120 -16.228 1.00 0.00 ? 332 LEU A N   1  
ATOM 1852   C CA  . LEU A 1 332 ? -62.515  -43.334 -16.613 1.00 0.00 ? 332 LEU A CA  1  
ATOM 1853   C C   . LEU A 1 332 ? -62.200  -44.807 -16.886 1.00 0.00 ? 332 LEU A C   1  
ATOM 1854   O O   . LEU A 1 332 ? -62.718  -45.722 -16.268 1.00 0.00 ? 332 LEU A O   1  
ATOM 1855   C CB  . LEU A 1 332 ? -61.459  -42.842 -15.571 1.00 0.00 ? 332 LEU A CB  1  
ATOM 1856   C CG  . LEU A 1 332 ? -61.437  -43.614 -14.194 1.00 0.00 ? 332 LEU A CG  1  
ATOM 1857   C CD1 . LEU A 1 332 ? -60.478  -42.975 -13.283 1.00 0.00 ? 332 LEU A CD1 1  
ATOM 1858   C CD2 . LEU A 1 332 ? -62.728  -43.580 -13.314 1.00 0.00 ? 332 LEU A CD2 1  
ATOM 1859   N N   . ARG A 1 333 ? -61.358  -44.939 -17.890 1.00 0.00 ? 333 ARG A N   1  
ATOM 1860   C CA  . ARG A 1 333 ? -60.854  -46.162 -18.493 1.00 0.00 ? 333 ARG A CA  1  
ATOM 1861   C C   . ARG A 1 333 ? -60.002  -46.942 -17.585 1.00 0.00 ? 333 ARG A C   1  
ATOM 1862   O O   . ARG A 1 333 ? -60.009  -48.185 -17.676 1.00 0.00 ? 333 ARG A O   1  
ATOM 1863   C CB  . ARG A 1 333 ? -60.052  -45.988 -19.773 1.00 0.00 ? 333 ARG A CB  1  
ATOM 1864   C CG  . ARG A 1 333 ? -60.869  -45.349 -20.964 1.00 0.00 ? 333 ARG A CG  1  
ATOM 1865   C CD  . ARG A 1 333 ? -60.230  -45.537 -22.323 1.00 0.00 ? 333 ARG A CD  1  
ATOM 1866   N NE  . ARG A 1 333 ? -61.040  -44.866 -23.423 1.00 0.00 ? 333 ARG A NE  1  
ATOM 1867   C CZ  . ARG A 1 333 ? -60.570  -43.728 -24.096 1.00 0.00 ? 333 ARG A CZ  1  
ATOM 1868   N NH1 . ARG A 1 333 ? -59.411  -43.110 -23.785 1.00 0.00 ? 333 ARG A NH1 1  
ATOM 1869   N NH2 . ARG A 1 333 ? -61.387  -43.193 -25.070 1.00 0.00 ? 333 ARG A NH2 1  
ATOM 1870   N N   . ASP A 1 334 ? -59.256  -46.233 -16.772 1.00 0.00 ? 334 ASP A N   1  
ATOM 1871   C CA  . ASP A 1 334 ? -58.261  -46.819 -15.842 1.00 0.00 ? 334 ASP A CA  1  
ATOM 1872   C C   . ASP A 1 334 ? -58.719  -47.725 -14.775 1.00 0.00 ? 334 ASP A C   1  
ATOM 1873   O O   . ASP A 1 334 ? -57.938  -48.531 -14.299 1.00 0.00 ? 334 ASP A O   1  
ATOM 1874   C CB  . ASP A 1 334 ? -57.662  -45.505 -15.131 1.00 0.00 ? 334 ASP A CB  1  
ATOM 1875   C CG  . ASP A 1 334 ? -56.310  -45.746 -14.503 1.00 0.00 ? 334 ASP A CG  1  
ATOM 1876   O OD1 . ASP A 1 334 ? -55.460  -46.209 -15.397 1.00 0.00 ? 334 ASP A OD1 1  
ATOM 1877   O OD2 . ASP A 1 334 ? -56.052  -45.267 -13.343 1.00 0.00 ? 334 ASP A OD2 1  
ATOM 1878   N N   . CYS A 1 335 ? -59.916  -47.489 -14.234 1.00 0.00 ? 335 CYS A N   1  
ATOM 1879   C CA  . CYS A 1 335 ? -60.484  -48.241 -13.089 1.00 0.00 ? 335 CYS A CA  1  
ATOM 1880   C C   . CYS A 1 335 ? -61.610  -49.267 -13.359 1.00 0.00 ? 335 CYS A C   1  
ATOM 1881   O O   . CYS A 1 335 ? -62.430  -49.469 -12.471 1.00 0.00 ? 335 CYS A O   1  
ATOM 1882   C CB  . CYS A 1 335 ? -60.892  -47.307 -11.947 1.00 0.00 ? 335 CYS A CB  1  
ATOM 1883   S SG  . CYS A 1 335 ? -59.607  -46.200 -11.513 1.00 0.00 ? 335 CYS A SG  1  
ATOM 1884   N N   . ASP A 1 336 ? -61.664  -49.846 -14.589 1.00 0.00 ? 336 ASP A N   1  
ATOM 1885   C CA  . ASP A 1 336 ? -62.743  -50.819 -14.960 1.00 0.00 ? 336 ASP A CA  1  
ATOM 1886   C C   . ASP A 1 336 ? -62.162  -52.175 -15.072 1.00 0.00 ? 336 ASP A C   1  
ATOM 1887   O O   . ASP A 1 336 ? -61.282  -52.404 -15.906 1.00 0.00 ? 336 ASP A O   1  
ATOM 1888   C CB  . ASP A 1 336 ? -63.434  -50.457 -16.240 1.00 0.00 ? 336 ASP A CB  1  
ATOM 1889   C CG  . ASP A 1 336 ? -64.618  -51.295 -16.603 1.00 0.00 ? 336 ASP A CG  1  
ATOM 1890   O OD1 . ASP A 1 336 ? -65.113  -52.121 -15.828 1.00 0.00 ? 336 ASP A OD1 1  
ATOM 1891   O OD2 . ASP A 1 336 ? -65.071  -51.223 -17.780 1.00 0.00 ? 336 ASP A OD2 1  
ATOM 1892   N N   . SER A 1 337 ? -62.805  -53.045 -14.285 1.00 0.00 ? 337 SER A N   1  
ATOM 1893   C CA  . SER A 1 337 ? -62.646  -54.433 -14.040 1.00 0.00 ? 337 SER A CA  1  
ATOM 1894   C C   . SER A 1 337 ? -63.234  -54.510 -12.650 1.00 0.00 ? 337 SER A C   1  
ATOM 1895   O O   . SER A 1 337 ? -63.436  -53.509 -12.026 1.00 0.00 ? 337 SER A O   1  
ATOM 1896   C CB  . SER A 1 337 ? -61.239  -54.945 -13.998 1.00 0.00 ? 337 SER A CB  1  
ATOM 1897   O OG  . SER A 1 337 ? -61.177  -56.303 -14.445 1.00 0.00 ? 337 SER A OG  1  
ATOM 1898   N N   . GLU A 1 338 ? -63.689  -55.705 -12.238 1.00 0.00 ? 338 GLU A N   1  
ATOM 1899   C CA  . GLU A 1 338 ? -64.365  -55.998 -10.984 1.00 0.00 ? 338 GLU A CA  1  
ATOM 1900   C C   . GLU A 1 338 ? -63.398  -55.747 -9.881  1.00 0.00 ? 338 GLU A C   1  
ATOM 1901   O O   . GLU A 1 338 ? -63.737  -55.002 -8.942  1.00 0.00 ? 338 GLU A O   1  
ATOM 1902   C CB  . GLU A 1 338 ? -64.728  -57.456 -10.855 1.00 0.00 ? 338 GLU A CB  1  
ATOM 1903   C CG  . GLU A 1 338 ? -65.607  -57.897 -12.091 1.00 0.00 ? 338 GLU A CG  1  
ATOM 1904   C CD  . GLU A 1 338 ? -66.954  -57.232 -11.900 1.00 0.00 ? 338 GLU A CD  1  
ATOM 1905   O OE1 . GLU A 1 338 ? -67.632  -57.486 -10.892 1.00 0.00 ? 338 GLU A OE1 1  
ATOM 1906   O OE2 . GLU A 1 338 ? -67.352  -56.454 -12.817 1.00 0.00 ? 338 GLU A OE2 1  
ATOM 1907   N N   . GLU A 1 339 ? -62.186  -56.294 -10.022 1.00 0.00 ? 339 GLU A N   1  
ATOM 1908   C CA  . GLU A 1 339 ? -61.147  -56.158 -9.024  1.00 0.00 ? 339 GLU A CA  1  
ATOM 1909   C C   . GLU A 1 339 ? -60.680  -54.668 -8.894  1.00 0.00 ? 339 GLU A C   1  
ATOM 1910   O O   . GLU A 1 339 ? -60.551  -54.113 -7.787  1.00 0.00 ? 339 GLU A O   1  
ATOM 1911   C CB  . GLU A 1 339 ? -59.957  -57.184 -9.216  1.00 0.00 ? 339 GLU A CB  1  
ATOM 1912   C CG  . GLU A 1 339 ? -59.577  -57.767 -7.836  1.00 0.00 ? 339 GLU A CG  1  
ATOM 1913   C CD  . GLU A 1 339 ? -59.377  -56.756 -6.743  1.00 0.00 ? 339 GLU A CD  1  
ATOM 1914   O OE1 . GLU A 1 339 ? -58.383  -55.952 -6.792  1.00 0.00 ? 339 GLU A OE1 1  
ATOM 1915   O OE2 . GLU A 1 339 ? -60.210  -56.848 -5.786  1.00 0.00 ? 339 GLU A OE2 1  
ATOM 1916   N N   . ASP A 1 340 ? -60.530  -54.008 -10.108 1.00 0.00 ? 340 ASP A N   1  
ATOM 1917   C CA  . ASP A 1 340 ? -60.115  -52.658 -10.174 1.00 0.00 ? 340 ASP A CA  1  
ATOM 1918   C C   . ASP A 1 340 ? -61.118  -51.854 -9.574  1.00 0.00 ? 340 ASP A C   1  
ATOM 1919   O O   . ASP A 1 340 ? -60.718  -50.964 -8.831  1.00 0.00 ? 340 ASP A O   1  
ATOM 1920   C CB  . ASP A 1 340 ? -59.877  -52.136 -11.577 1.00 0.00 ? 340 ASP A CB  1  
ATOM 1921   C CG  . ASP A 1 340 ? -58.772  -52.794 -12.349 1.00 0.00 ? 340 ASP A CG  1  
ATOM 1922   O OD1 . ASP A 1 340 ? -58.138  -53.714 -11.764 1.00 0.00 ? 340 ASP A OD1 1  
ATOM 1923   O OD2 . ASP A 1 340 ? -58.553  -52.456 -13.557 1.00 0.00 ? 340 ASP A OD2 1  
ATOM 1924   N N   . LYS A 1 341 ? -62.408  -52.078 -9.791  1.00 0.00 ? 341 LYS A N   1  
ATOM 1925   C CA  . LYS A 1 341 ? -63.415  -51.301 -9.112  1.00 0.00 ? 341 LYS A CA  1  
ATOM 1926   C C   . LYS A 1 341 ? -63.424  -51.526 -7.616  1.00 0.00 ? 341 LYS A C   1  
ATOM 1927   O O   . LYS A 1 341 ? -63.686  -50.573 -6.892  1.00 0.00 ? 341 LYS A O   1  
ATOM 1928   C CB  . LYS A 1 341 ? -64.889  -51.414 -9.635  1.00 0.00 ? 341 LYS A CB  1  
ATOM 1929   C CG  . LYS A 1 341 ? -65.675  -52.656 -9.415  1.00 0.00 ? 341 LYS A CG  1  
ATOM 1930   C CD  . LYS A 1 341 ? -67.068  -52.734 -10.067 1.00 0.00 ? 341 LYS A CD  1  
ATOM 1931   C CE  . LYS A 1 341 ? -67.727  -53.999 -9.457  1.00 0.00 ? 341 LYS A CE  1  
ATOM 1932   N NZ  . LYS A 1 341 ? -69.124  -54.173 -9.876  1.00 0.00 ? 341 LYS A NZ  1  
ATOM 1933   N N   . ASN A 1 342 ? -63.210  -52.737 -7.039  1.00 0.00 ? 342 ASN A N   1  
ATOM 1934   C CA  . ASN A 1 342 ? -63.339  -52.933 -5.594  1.00 0.00 ? 342 ASN A CA  1  
ATOM 1935   C C   . ASN A 1 342 ? -62.318  -52.145 -4.841  1.00 0.00 ? 342 ASN A C   1  
ATOM 1936   O O   . ASN A 1 342 ? -62.510  -51.474 -3.819  1.00 0.00 ? 342 ASN A O   1  
ATOM 1937   C CB  . ASN A 1 342 ? -63.098  -54.355 -5.239  1.00 0.00 ? 342 ASN A CB  1  
ATOM 1938   C CG  . ASN A 1 342 ? -64.052  -55.292 -6.066  1.00 0.00 ? 342 ASN A CG  1  
ATOM 1939   O OD1 . ASN A 1 342 ? -65.177  -54.944 -6.270  1.00 0.00 ? 342 ASN A OD1 1  
ATOM 1940   N ND2 . ASN A 1 342 ? -63.514  -56.505 -6.483  1.00 0.00 ? 342 ASN A ND2 1  
ATOM 1941   N N   . LEU A 1 343 ? -61.130  -52.147 -5.436  1.00 0.00 ? 343 LEU A N   1  
ATOM 1942   C CA  . LEU A 1 343 ? -59.980  -51.402 -4.970  1.00 0.00 ? 343 LEU A CA  1  
ATOM 1943   C C   . LEU A 1 343 ? -60.206  -49.977 -4.984  1.00 0.00 ? 343 LEU A C   1  
ATOM 1944   O O   . LEU A 1 343 ? -59.873  -49.243 -4.050  1.00 0.00 ? 343 LEU A O   1  
ATOM 1945   C CB  . LEU A 1 343 ? -58.681  -51.628 -5.787  1.00 0.00 ? 343 LEU A CB  1  
ATOM 1946   C CG  . LEU A 1 343 ? -58.068  -53.038 -5.773  1.00 0.00 ? 343 LEU A CG  1  
ATOM 1947   C CD1 . LEU A 1 343 ? -57.231  -53.241 -7.066  1.00 0.00 ? 343 LEU A CD1 1  
ATOM 1948   C CD2 . LEU A 1 343 ? -57.341  -53.297 -4.406  1.00 0.00 ? 343 LEU A CD2 1  
ATOM 1949   N N   . LEU A 1 344 ? -60.859  -49.476 -6.052  1.00 0.00 ? 344 LEU A N   1  
ATOM 1950   C CA  . LEU A 1 344 ? -61.292  -48.108 -6.232  1.00 0.00 ? 344 LEU A CA  1  
ATOM 1951   C C   . LEU A 1 344 ? -62.312  -47.779 -5.181  1.00 0.00 ? 344 LEU A C   1  
ATOM 1952   O O   . LEU A 1 344 ? -62.277  -46.633 -4.756  1.00 0.00 ? 344 LEU A O   1  
ATOM 1953   C CB  . LEU A 1 344 ? -61.804  -47.917 -7.673  1.00 0.00 ? 344 LEU A CB  1  
ATOM 1954   C CG  . LEU A 1 344 ? -62.337  -46.564 -7.993  1.00 0.00 ? 344 LEU A CG  1  
ATOM 1955   C CD1 . LEU A 1 344 ? -61.121  -45.480 -8.263  1.00 0.00 ? 344 LEU A CD1 1  
ATOM 1956   C CD2 . LEU A 1 344 ? -63.403  -46.511 -9.109  1.00 0.00 ? 344 LEU A CD2 1  
ATOM 1957   N N   . PHE A 1 345 ? -63.250  -48.719 -4.793  1.00 0.00 ? 345 PHE A N   1  
ATOM 1958   C CA  . PHE A 1 345 ? -64.280  -48.367 -3.867  1.00 0.00 ? 345 PHE A CA  1  
ATOM 1959   C C   . PHE A 1 345 ? -63.678  -47.999 -2.591  1.00 0.00 ? 345 PHE A C   1  
ATOM 1960   O O   . PHE A 1 345 ? -64.048  -47.063 -1.898  1.00 0.00 ? 345 PHE A O   1  
ATOM 1961   C CB  . PHE A 1 345 ? -65.311  -49.506 -3.631  1.00 0.00 ? 345 PHE A CB  1  
ATOM 1962   C CG  . PHE A 1 345 ? -66.249  -49.668 -4.859  1.00 0.00 ? 345 PHE A CG  1  
ATOM 1963   C CD1 . PHE A 1 345 ? -66.772  -48.598 -5.604  1.00 0.00 ? 345 PHE A CD1 1  
ATOM 1964   C CD2 . PHE A 1 345 ? -66.581  -50.972 -5.301  1.00 0.00 ? 345 PHE A CD2 1  
ATOM 1965   C CE1 . PHE A 1 345 ? -67.637  -48.739 -6.685  1.00 0.00 ? 345 PHE A CE1 1  
ATOM 1966   C CE2 . PHE A 1 345 ? -67.439  -51.124 -6.442  1.00 0.00 ? 345 PHE A CE2 1  
ATOM 1967   C CZ  . PHE A 1 345 ? -67.870  -50.021 -7.188  1.00 0.00 ? 345 PHE A CZ  1  
ATOM 1968   N N   . LYS A 1 346 ? -62.646  -48.782 -2.179  1.00 0.00 ? 346 LYS A N   1  
ATOM 1969   C CA  . LYS A 1 346 ? -61.937  -48.583 -0.887  1.00 0.00 ? 346 LYS A CA  1  
ATOM 1970   C C   . LYS A 1 346 ? -61.226  -47.225 -0.936  1.00 0.00 ? 346 LYS A C   1  
ATOM 1971   O O   . LYS A 1 346 ? -61.187  -46.466 0.059   1.00 0.00 ? 346 LYS A O   1  
ATOM 1972   C CB  . LYS A 1 346 ? -60.922  -49.701 -0.657  1.00 0.00 ? 346 LYS A CB  1  
ATOM 1973   C CG  . LYS A 1 346 ? -59.837  -49.642 0.566   1.00 0.00 ? 346 LYS A CG  1  
ATOM 1974   C CD  . LYS A 1 346 ? -58.526  -48.971 0.115   1.00 0.00 ? 346 LYS A CD  1  
ATOM 1975   C CE  . LYS A 1 346 ? -57.533  -48.620 1.296   1.00 0.00 ? 346 LYS A CE  1  
ATOM 1976   N NZ  . LYS A 1 346 ? -57.951  -47.453 2.110   1.00 0.00 ? 346 LYS A NZ  1  
ATOM 1977   N N   . MET A 1 347 ? -60.672  -46.859 -2.097  1.00 0.00 ? 347 MET A N   1  
ATOM 1978   C CA  . MET A 1 347 ? -59.998  -45.575 -2.275  1.00 0.00 ? 347 MET A CA  1  
ATOM 1979   C C   . MET A 1 347 ? -60.961  -44.420 -2.136  1.00 0.00 ? 347 MET A C   1  
ATOM 1980   O O   . MET A 1 347 ? -60.636  -43.399 -1.542  1.00 0.00 ? 347 MET A O   1  
ATOM 1981   C CB  . MET A 1 347 ? -59.220  -45.343 -3.648  1.00 0.00 ? 347 MET A CB  1  
ATOM 1982   C CG  . MET A 1 347 ? -58.269  -46.461 -4.130  1.00 0.00 ? 347 MET A CG  1  
ATOM 1983   S SD  . MET A 1 347 ? -57.295  -47.116 -2.739  1.00 0.00 ? 347 MET A SD  1  
ATOM 1984   C CE  . MET A 1 347 ? -56.789  -48.728 -3.487  1.00 0.00 ? 347 MET A CE  1  
ATOM 1985   N N   . LEU A 1 348 ? -62.165  -44.613 -2.686  1.00 0.00 ? 348 LEU A N   1  
ATOM 1986   C CA  . LEU A 1 348 ? -63.270  -43.692 -2.690  1.00 0.00 ? 348 LEU A CA  1  
ATOM 1987   C C   . LEU A 1 348 ? -63.749  -43.474 -1.302  1.00 0.00 ? 348 LEU A C   1  
ATOM 1988   O O   . LEU A 1 348 ? -64.157  -42.362 -0.946  1.00 0.00 ? 348 LEU A O   1  
ATOM 1989   C CB  . LEU A 1 348 ? -64.517  -44.210 -3.554  1.00 0.00 ? 348 LEU A CB  1  
ATOM 1990   C CG  . LEU A 1 348 ? -65.656  -43.184 -3.806  1.00 0.00 ? 348 LEU A CG  1  
ATOM 1991   C CD1 . LEU A 1 348 ? -65.295  -42.152 -4.904  1.00 0.00 ? 348 LEU A CD1 1  
ATOM 1992   C CD2 . LEU A 1 348 ? -67.025  -43.878 -3.986  1.00 0.00 ? 348 LEU A CD2 1  
ATOM 1993   N N   . ARG A 1 349 ? -63.800  -44.546 -0.550  1.00 0.00 ? 349 ARG A N   1  
ATOM 1994   C CA  . ARG A 1 349 ? -64.356  -44.649 0.826   1.00 0.00 ? 349 ARG A CA  1  
ATOM 1995   C C   . ARG A 1 349 ? -63.490  -43.748 1.697   1.00 0.00 ? 349 ARG A C   1  
ATOM 1996   O O   . ARG A 1 349 ? -64.032  -42.957 2.507   1.00 0.00 ? 349 ARG A O   1  
ATOM 1997   C CB  . ARG A 1 349 ? -64.264  -46.064 1.433   1.00 0.00 ? 349 ARG A CB  1  
ATOM 1998   C CG  . ARG A 1 349 ? -64.953  -46.272 2.775   1.00 0.00 ? 349 ARG A CG  1  
ATOM 1999   C CD  . ARG A 1 349 ? -66.434  -46.096 2.908   1.00 0.00 ? 349 ARG A CD  1  
ATOM 2000   N NE  . ARG A 1 349 ? -67.041  -47.111 2.006   1.00 0.00 ? 349 ARG A NE  1  
ATOM 2001   C CZ  . ARG A 1 349 ? -68.278  -47.087 1.436   1.00 0.00 ? 349 ARG A CZ  1  
ATOM 2002   N NH1 . ARG A 1 349 ? -69.208  -46.137 1.737   1.00 0.00 ? 349 ARG A NH1 1  
ATOM 2003   N NH2 . ARG A 1 349 ? -68.565  -48.088 0.543   1.00 0.00 ? 349 ARG A NH2 1  
ATOM 2004   N N   . THR A 1 350 ? -62.141  -43.710 1.553   1.00 0.00 ? 350 THR A N   1  
ATOM 2005   C CA  . THR A 1 350 ? -61.219  -42.808 2.199   1.00 0.00 ? 350 THR A CA  1  
ATOM 2006   C C   . THR A 1 350 ? -61.547  -41.450 1.767   1.00 0.00 ? 350 THR A C   1  
ATOM 2007   O O   . THR A 1 350 ? -61.620  -40.547 2.595   1.00 0.00 ? 350 THR A O   1  
ATOM 2008   C CB  . THR A 1 350 ? -59.721  -43.131 1.881   1.00 0.00 ? 350 THR A CB  1  
ATOM 2009   O OG1 . THR A 1 350 ? -59.387  -44.414 2.337   1.00 0.00 ? 350 THR A OG1 1  
ATOM 2010   C CG2 . THR A 1 350 ? -58.799  -41.944 2.350   1.00 0.00 ? 350 THR A CG2 1  
ATOM 2011   N N   . GLY A 1 351 ? -61.824  -41.225 0.481   1.00 0.00 ? 351 GLY A N   1  
ATOM 2012   C CA  . GLY A 1 351 ? -62.204  -39.892 0.034   1.00 0.00 ? 351 GLY A CA  1  
ATOM 2013   C C   . GLY A 1 351 ? -63.520  -39.315 0.584   1.00 0.00 ? 351 GLY A C   1  
ATOM 2014   O O   . GLY A 1 351 ? -63.480  -38.128 0.909   1.00 0.00 ? 351 GLY A O   1  
ATOM 2015   N N   . ILE A 1 352 ? -64.554  -40.108 0.729   1.00 0.00 ? 352 ILE A N   1  
ATOM 2016   C CA  . ILE A 1 352 ? -65.785  -39.733 1.298   1.00 0.00 ? 352 ILE A CA  1  
ATOM 2017   C C   . ILE A 1 352 ? -65.574  -39.395 2.742   1.00 0.00 ? 352 ILE A C   1  
ATOM 2018   O O   . ILE A 1 352 ? -66.179  -38.463 3.268   1.00 0.00 ? 352 ILE A O   1  
ATOM 2019   C CB  . ILE A 1 352 ? -66.888  -40.813 0.958   1.00 0.00 ? 352 ILE A CB  1  
ATOM 2020   C CG1 . ILE A 1 352 ? -67.240  -40.737 -0.546  1.00 0.00 ? 352 ILE A CG1 1  
ATOM 2021   C CG2 . ILE A 1 352 ? -68.130  -40.631 1.848   1.00 0.00 ? 352 ILE A CG2 1  
ATOM 2022   C CD1 . ILE A 1 352 ? -68.309  -41.748 -0.992  1.00 0.00 ? 352 ILE A CD1 1  
ATOM 2023   N N   . LEU A 1 353 ? -64.740  -40.138 3.479   1.00 0.00 ? 353 LEU A N   1  
ATOM 2024   C CA  . LEU A 1 353 ? -64.478  -39.975 4.887   1.00 0.00 ? 353 LEU A CA  1  
ATOM 2025   C C   . LEU A 1 353 ? -63.855  -38.622 5.075   1.00 0.00 ? 353 LEU A C   1  
ATOM 2026   O O   . LEU A 1 353 ? -64.225  -37.953 6.027   1.00 0.00 ? 353 LEU A O   1  
ATOM 2027   C CB  . LEU A 1 353 ? -63.545  -41.036 5.425   1.00 0.00 ? 353 LEU A CB  1  
ATOM 2028   C CG  . LEU A 1 353 ? -62.999  -40.803 6.851   1.00 0.00 ? 353 LEU A CG  1  
ATOM 2029   C CD1 . LEU A 1 353 ? -64.083  -40.818 7.952   1.00 0.00 ? 353 LEU A CD1 1  
ATOM 2030   C CD2 . LEU A 1 353 ? -61.771  -41.621 7.173   1.00 0.00 ? 353 LEU A CD2 1  
ATOM 2031   N N   . LEU A 1 354 ? -62.953  -38.192 4.185   1.00 0.00 ? 354 LEU A N   1  
ATOM 2032   C CA  . LEU A 1 354 ? -62.293  -36.961 4.170   1.00 0.00 ? 354 LEU A CA  1  
ATOM 2033   C C   . LEU A 1 354 ? -63.271  -35.792 3.922   1.00 0.00 ? 354 LEU A C   1  
ATOM 2034   O O   . LEU A 1 354 ? -63.247  -34.816 4.648   1.00 0.00 ? 354 LEU A O   1  
ATOM 2035   C CB  . LEU A 1 354 ? -61.061  -36.843 3.197   1.00 0.00 ? 354 LEU A CB  1  
ATOM 2036   C CG  . LEU A 1 354 ? -59.661  -37.024 3.832   1.00 0.00 ? 354 LEU A CG  1  
ATOM 2037   C CD1 . LEU A 1 354 ? -59.304  -35.820 4.770   1.00 0.00 ? 354 LEU A CD1 1  
ATOM 2038   C CD2 . LEU A 1 354 ? -59.326  -38.363 4.402   1.00 0.00 ? 354 LEU A CD2 1  
ATOM 2039   N N   . LYS A 1 355 ? -64.272  -35.904 2.998   1.00 0.00 ? 355 LYS A N   1  
ATOM 2040   C CA  . LYS A 1 355 ? -65.276  -34.881 2.736   1.00 0.00 ? 355 LYS A CA  1  
ATOM 2041   C C   . LYS A 1 355 ? -66.202  -34.684 3.931   1.00 0.00 ? 355 LYS A C   1  
ATOM 2042   O O   . LYS A 1 355 ? -66.531  -33.564 4.313   1.00 0.00 ? 355 LYS A O   1  
ATOM 2043   C CB  . LYS A 1 355 ? -65.992  -35.343 1.476   1.00 0.00 ? 355 LYS A CB  1  
ATOM 2044   C CG  . LYS A 1 355 ? -67.315  -34.594 1.063   1.00 0.00 ? 355 LYS A CG  1  
ATOM 2045   C CD  . LYS A 1 355 ? -68.285  -35.339 0.087   1.00 0.00 ? 355 LYS A CD  1  
ATOM 2046   C CE  . LYS A 1 355 ? -68.872  -36.725 0.580   1.00 0.00 ? 355 LYS A CE  1  
ATOM 2047   N NZ  . LYS A 1 355 ? -70.101  -37.165 -0.109  1.00 0.00 ? 355 LYS A NZ  1  
ATOM 2048   N N   . VAL A 1 356 ? -66.592  -35.750 4.659   1.00 0.00 ? 356 VAL A N   1  
ATOM 2049   C CA  . VAL A 1 356 ? -67.349  -35.758 5.863   1.00 0.00 ? 356 VAL A CA  1  
ATOM 2050   C C   . VAL A 1 356 ? -66.606  -35.075 7.022   1.00 0.00 ? 356 VAL A C   1  
ATOM 2051   O O   . VAL A 1 356 ? -67.224  -34.406 7.787   1.00 0.00 ? 356 VAL A O   1  
ATOM 2052   C CB  . VAL A 1 356 ? -67.886  -37.112 6.254   1.00 0.00 ? 356 VAL A CB  1  
ATOM 2053   C CG1 . VAL A 1 356 ? -68.630  -37.186 7.614   1.00 0.00 ? 356 VAL A CG1 1  
ATOM 2054   C CG2 . VAL A 1 356 ? -68.843  -37.649 5.098   1.00 0.00 ? 356 VAL A CG2 1  
ATOM 2055   N N   . VAL A 1 357 ? -65.249  -35.243 7.078   1.00 0.00 ? 357 VAL A N   1  
ATOM 2056   C CA  . VAL A 1 357 ? -64.380  -34.574 8.036   1.00 0.00 ? 357 VAL A CA  1  
ATOM 2057   C C   . VAL A 1 357 ? -64.425  -33.056 7.724   1.00 0.00 ? 357 VAL A C   1  
ATOM 2058   O O   . VAL A 1 357 ? -64.395  -32.223 8.639   1.00 0.00 ? 357 VAL A O   1  
ATOM 2059   C CB  . VAL A 1 357 ? -62.896  -35.045 8.057   1.00 0.00 ? 357 VAL A CB  1  
ATOM 2060   C CG1 . VAL A 1 357 ? -61.973  -34.039 8.716   1.00 0.00 ? 357 VAL A CG1 1  
ATOM 2061   C CG2 . VAL A 1 357 ? -62.890  -36.406 8.800   1.00 0.00 ? 357 VAL A CG2 1  
ATOM 2062   N N   . ARG A 1 358 ? -64.461  -32.675 6.470   1.00 0.00 ? 358 ARG A N   1  
ATOM 2063   C CA  . ARG A 1 358 ? -64.635  -31.340 6.157   1.00 0.00 ? 358 ARG A CA  1  
ATOM 2064   C C   . ARG A 1 358 ? -65.986  -30.743 6.557   1.00 0.00 ? 358 ARG A C   1  
ATOM 2065   O O   . ARG A 1 358 ? -66.021  -29.616 7.038   1.00 0.00 ? 358 ARG A O   1  
ATOM 2066   C CB  . ARG A 1 358 ? -64.310  -31.000 4.670   1.00 0.00 ? 358 ARG A CB  1  
ATOM 2067   C CG  . ARG A 1 358 ? -63.220  -29.761 4.577   1.00 0.00 ? 358 ARG A CG  1  
ATOM 2068   C CD  . ARG A 1 358 ? -63.635  -28.417 5.131   1.00 0.00 ? 358 ARG A CD  1  
ATOM 2069   N NE  . ARG A 1 358 ? -62.540  -27.390 4.727   1.00 0.00 ? 358 ARG A NE  1  
ATOM 2070   C CZ  . ARG A 1 358 ? -61.322  -27.282 5.342   1.00 0.00 ? 358 ARG A CZ  1  
ATOM 2071   N NH1 . ARG A 1 358 ? -61.114  -28.001 6.459   1.00 0.00 ? 358 ARG A NH1 1  
ATOM 2072   N NH2 . ARG A 1 358 ? -60.426  -26.404 4.869   1.00 0.00 ? 358 ARG A NH2 1  
ATOM 2073   N N   . ALA A 1 359 ? -67.069  -31.548 6.464   1.00 0.00 ? 359 ALA A N   1  
ATOM 2074   C CA  . ALA A 1 359 ? -68.393  -31.155 6.910   1.00 0.00 ? 359 ALA A CA  1  
ATOM 2075   C C   . ALA A 1 359 ? -68.444  -30.869 8.386   1.00 0.00 ? 359 ALA A C   1  
ATOM 2076   O O   . ALA A 1 359 ? -69.207  -29.984 8.766   1.00 0.00 ? 359 ALA A O   1  
ATOM 2077   C CB  . ALA A 1 359 ? -69.462  -32.239 6.471   1.00 0.00 ? 359 ALA A CB  1  
ATOM 2078   N N   . SER A 1 360 ? -67.597  -31.589 9.099   1.00 0.00 ? 360 SER A N   1  
ATOM 2079   C CA  . SER A 1 360 ? -67.338  -31.469 10.527  1.00 0.00 ? 360 SER A CA  1  
ATOM 2080   C C   . SER A 1 360 ? -66.761  -30.127 10.959  1.00 0.00 ? 360 SER A C   1  
ATOM 2081   O O   . SER A 1 360 ? -66.336  -30.023 12.125  1.00 0.00 ? 360 SER A O   1  
ATOM 2082   C CB  . SER A 1 360 ? -66.445  -32.626 10.960  1.00 0.00 ? 360 SER A CB  1  
ATOM 2083   O OG  . SER A 1 360 ? -66.855  -33.847 10.454  1.00 0.00 ? 360 SER A OG  1  
ATOM 2084   N N   . LEU A 1 361 ? -66.837  -29.046 10.108  1.00 0.00 ? 361 LEU A N   1  
ATOM 2085   C CA  . LEU A 1 361 ? -66.311  -27.732 10.343  1.00 0.00 ? 361 LEU A CA  1  
ATOM 2086   C C   . LEU A 1 361 ? -67.455  -26.939 10.944  1.00 0.00 ? 361 LEU A C   1  
ATOM 2087   O O   . LEU A 1 361 ? -67.312  -25.728 11.288  1.00 0.00 ? 361 LEU A O   1  
ATOM 2088   C CB  . LEU A 1 361 ? -65.775  -27.038 9.055   1.00 0.00 ? 361 LEU A CB  1  
ATOM 2089   C CG  . LEU A 1 361 ? -64.722  -25.912 9.145   1.00 0.00 ? 361 LEU A CG  1  
ATOM 2090   C CD1 . LEU A 1 361 ? -64.027  -25.677 7.854   1.00 0.00 ? 361 LEU A CD1 1  
ATOM 2091   C CD2 . LEU A 1 361 ? -65.244  -24.495 9.543   1.00 0.00 ? 361 LEU A CD2 1  
ATOM 2092   N N   . GLN A 1 362 ? -68.513  -27.624 11.395  1.00 0.00 ? 362 GLN A N   1  
ATOM 2093   C CA  . GLN A 1 362 ? -69.633  -27.140 12.170  1.00 0.00 ? 362 GLN A CA  1  
ATOM 2094   C C   . GLN A 1 362 ? -69.068  -26.691 13.458  1.00 0.00 ? 362 GLN A C   1  
ATOM 2095   O O   . GLN A 1 362 ? -69.251  -25.592 13.979  1.00 0.00 ? 362 GLN A O   1  
ATOM 2096   C CB  . GLN A 1 362 ? -70.698  -28.318 12.342  1.00 0.00 ? 362 GLN A CB  1  
ATOM 2097   C CG  . GLN A 1 362 ? -71.484  -28.270 13.666  1.00 0.00 ? 362 GLN A CG  1  
ATOM 2098   C CD  . GLN A 1 362 ? -72.468  -29.458 13.664  1.00 0.00 ? 362 GLN A CD  1  
ATOM 2099   O OE1 . GLN A 1 362 ? -72.623  -30.246 12.741  1.00 0.00 ? 362 GLN A OE1 1  
ATOM 2100   N NE2 . GLN A 1 362 ? -73.246  -29.523 14.790  1.00 0.00 ? 362 GLN A NE2 1  
ATOM 2101   N N   . ILE A 1 363 ? -68.074  -27.541 13.996  1.00 0.00 ? 363 ILE A N   1  
ATOM 2102   C CA  . ILE A 1 363 ? -67.168  -27.185 15.120  1.00 0.00 ? 363 ILE A CA  1  
ATOM 2103   C C   . ILE A 1 363 ? -65.948  -27.080 14.247  1.00 0.00 ? 363 ILE A C   1  
ATOM 2104   O O   . ILE A 1 363 ? -65.451  -28.095 13.819  1.00 0.00 ? 363 ILE A O   1  
ATOM 2105   C CB  . ILE A 1 363 ? -67.144  -28.191 16.261  1.00 0.00 ? 363 ILE A CB  1  
ATOM 2106   C CG1 . ILE A 1 363 ? -66.004  -27.902 17.291  1.00 0.00 ? 363 ILE A CG1 1  
ATOM 2107   C CG2 . ILE A 1 363 ? -67.205  -29.724 15.888  1.00 0.00 ? 363 ILE A CG2 1  
ATOM 2108   C CD1 . ILE A 1 363 ? -65.947  -28.899 18.461  1.00 0.00 ? 363 ILE A CD1 1  
ATOM 2109   N N   . PRO A 1 364 ? -65.364  -25.929 13.880  1.00 0.00 ? 364 PRO A N   1  
ATOM 2110   C CA  . PRO A 1 364 ? -64.243  -25.740 12.851  1.00 0.00 ? 364 PRO A CA  1  
ATOM 2111   C C   . PRO A 1 364 ? -63.137  -26.764 12.944  1.00 0.00 ? 364 PRO A C   1  
ATOM 2112   O O   . PRO A 1 364 ? -62.619  -27.020 14.079  1.00 0.00 ? 364 PRO A O   1  
ATOM 2113   C CB  . PRO A 1 364 ? -63.685  -24.294 13.071  1.00 0.00 ? 364 PRO A CB  1  
ATOM 2114   C CG  . PRO A 1 364 ? -64.891  -23.639 13.878  1.00 0.00 ? 364 PRO A CG  1  
ATOM 2115   C CD  . PRO A 1 364 ? -65.876  -24.699 14.399  1.00 0.00 ? 364 PRO A CD  1  
ATOM 2116   N N   . THR A 1 365 ? -62.725  -27.229 11.739  1.00 0.00 ? 365 THR A N   1  
ATOM 2117   C CA  . THR A 1 365 ? -61.584  -27.986 11.558  1.00 0.00 ? 365 THR A CA  1  
ATOM 2118   C C   . THR A 1 365 ? -60.953  -27.454 10.365  1.00 0.00 ? 365 THR A C   1  
ATOM 2119   O O   . THR A 1 365 ? -61.577  -27.431 9.257   1.00 0.00 ? 365 THR A O   1  
ATOM 2120   C CB  . THR A 1 365 ? -61.981  -29.450 11.619  1.00 0.00 ? 365 THR A CB  1  
ATOM 2121   O OG1 . THR A 1 365 ? -60.919  -30.368 11.620  1.00 0.00 ? 365 THR A OG1 1  
ATOM 2122   C CG2 . THR A 1 365 ? -62.985  -29.809 10.500  1.00 0.00 ? 365 THR A CG2 1  
ATOM 2123   N N   . ILE A 1 366 ? -59.680  -27.087 10.492  1.00 0.00 ? 366 ILE A N   1  
ATOM 2124   C CA  . ILE A 1 366 ? -58.776  -26.778 9.441   1.00 0.00 ? 366 ILE A CA  1  
ATOM 2125   C C   . ILE A 1 366 ? -57.672  -27.677 9.915   1.00 0.00 ? 366 ILE A C   1  
ATOM 2126   O O   . ILE A 1 366 ? -57.011  -27.236 10.890  1.00 0.00 ? 366 ILE A O   1  
ATOM 2127   C CB  . ILE A 1 366 ? -58.274  -25.301 9.406   1.00 0.00 ? 366 ILE A CB  1  
ATOM 2128   C CG1 . ILE A 1 366 ? -59.443  -24.363 9.171   1.00 0.00 ? 366 ILE A CG1 1  
ATOM 2129   C CG2 . ILE A 1 366 ? -57.133  -25.194 8.353   1.00 0.00 ? 366 ILE A CG2 1  
ATOM 2130   C CD1 . ILE A 1 366 ? -59.054  -22.876 9.119   1.00 0.00 ? 366 ILE A CD1 1  
ATOM 2131   N N   . PRO A 1 367 ? -57.337  -28.866 9.314   1.00 0.00 ? 367 PRO A N   1  
ATOM 2132   C CA  . PRO A 1 367 ? -56.215  -29.706 9.734   1.00 0.00 ? 367 PRO A CA  1  
ATOM 2133   C C   . PRO A 1 367 ? -54.895  -28.965 9.869   1.00 0.00 ? 367 PRO A C   1  
ATOM 2134   O O   . PRO A 1 367 ? -54.517  -28.417 8.834   1.00 0.00 ? 367 PRO A O   1  
ATOM 2135   C CB  . PRO A 1 367 ? -56.130  -30.718 8.572   1.00 0.00 ? 367 PRO A CB  1  
ATOM 2136   C CG  . PRO A 1 367 ? -57.513  -30.813 8.068   1.00 0.00 ? 367 PRO A CG  1  
ATOM 2137   C CD  . PRO A 1 367 ? -57.837  -29.308 8.064   1.00 0.00 ? 367 PRO A CD  1  
ATOM 2138   N N   . SER A 1 368 ? -54.286  -29.025 11.051  1.00 0.00 ? 368 SER A N   1  
ATOM 2139   C CA  . SER A 1 368 ? -53.040  -28.402 11.226  1.00 0.00 ? 368 SER A CA  1  
ATOM 2140   C C   . SER A 1 368 ? -52.313  -29.128 12.272  1.00 0.00 ? 368 SER A C   1  
ATOM 2141   O O   . SER A 1 368 ? -51.132  -28.874 12.506  1.00 0.00 ? 368 SER A O   1  
ATOM 2142   C CB  . SER A 1 368 ? -53.217  -26.959 11.710  1.00 0.00 ? 368 SER A CB  1  
ATOM 2143   O OG  . SER A 1 368 ? -53.514  -26.161 10.626  1.00 0.00 ? 368 SER A OG  1  
ATOM 2144   N N   . ASN A 1 369 ? -52.992  -30.106 12.946  1.00 0.00 ? 369 ASN A N   1  
ATOM 2145   C CA  . ASN A 1 369 ? -52.381  -30.938 13.942  1.00 0.00 ? 369 ASN A CA  1  
ATOM 2146   C C   . ASN A 1 369 ? -51.314  -31.785 13.280  1.00 0.00 ? 369 ASN A C   1  
ATOM 2147   O O   . ASN A 1 369 ? -51.443  -32.121 12.112  1.00 0.00 ? 369 ASN A O   1  
ATOM 2148   C CB  . ASN A 1 369 ? -53.498  -31.808 14.666  1.00 0.00 ? 369 ASN A CB  1  
ATOM 2149   C CG  . ASN A 1 369 ? -52.926  -32.727 15.732  1.00 0.00 ? 369 ASN A CG  1  
ATOM 2150   O OD1 . ASN A 1 369 ? -52.980  -33.987 15.628  1.00 0.00 ? 369 ASN A OD1 1  
ATOM 2151   N ND2 . ASN A 1 369 ? -52.561  -32.065 16.933  1.00 0.00 ? 369 ASN A ND2 1  
ATOM 2152   N N   . SER A 1 370 ? -50.252  -32.142 13.999  1.00 0.00 ? 370 SER A N   1  
ATOM 2153   C CA  . SER A 1 370 ? -49.142  -32.987 13.621  1.00 0.00 ? 370 SER A CA  1  
ATOM 2154   C C   . SER A 1 370 ? -49.709  -34.300 13.118  1.00 0.00 ? 370 SER A C   1  
ATOM 2155   O O   . SER A 1 370 ? -50.426  -34.882 13.906  1.00 0.00 ? 370 SER A O   1  
ATOM 2156   C CB  . SER A 1 370 ? -48.147  -33.250 14.849  1.00 0.00 ? 370 SER A CB  1  
ATOM 2157   O OG  . SER A 1 370 ? -47.764  -31.906 15.228  1.00 0.00 ? 370 SER A OG  1  
ATOM 2158   N N   . SER A 1 371 ? -49.523  -34.670 11.819  1.00 0.00 ? 371 SER A N   1  
ATOM 2159   C CA  . SER A 1 371 ? -50.201  -35.775 11.233  1.00 0.00 ? 371 SER A CA  1  
ATOM 2160   C C   . SER A 1 371 ? -49.131  -36.509 10.395  1.00 0.00 ? 371 SER A C   1  
ATOM 2161   O O   . SER A 1 371 ? -48.131  -37.040 10.863  1.00 0.00 ? 371 SER A O   1  
ATOM 2162   C CB  . SER A 1 371 ? -51.407  -35.292 10.436  1.00 0.00 ? 371 SER A CB  1  
ATOM 2163   O OG  . SER A 1 371 ? -52.413  -34.884 11.326  1.00 0.00 ? 371 SER A OG  1  
ATOM 2164   N N   . ASP A 1 372 ? -49.466  -36.753 9.110   1.00 0.00 ? 372 ASP A N   1  
ATOM 2165   C CA  . ASP A 1 372 ? -48.748  -37.500 8.164   1.00 0.00 ? 372 ASP A CA  1  
ATOM 2166   C C   . ASP A 1 372 ? -48.529  -36.486 6.996   1.00 0.00 ? 372 ASP A C   1  
ATOM 2167   O O   . ASP A 1 372 ? -48.506  -36.893 5.821   1.00 0.00 ? 372 ASP A O   1  
ATOM 2168   C CB  . ASP A 1 372 ? -49.557  -38.708 7.680   1.00 0.00 ? 372 ASP A CB  1  
ATOM 2169   C CG  . ASP A 1 372 ? -50.031  -39.737 8.744   1.00 0.00 ? 372 ASP A CG  1  
ATOM 2170   O OD1 . ASP A 1 372 ? -49.785  -39.581 9.959   1.00 0.00 ? 372 ASP A OD1 1  
ATOM 2171   O OD2 . ASP A 1 372 ? -50.691  -40.735 8.362   1.00 0.00 ? 372 ASP A OD2 1  
ATOM 2172   N N   . ILE A 1 373 ? -48.617  -35.188 7.295   1.00 0.00 ? 373 ILE A N   1  
ATOM 2173   C CA  . ILE A 1 373 ? -48.665  -34.117 6.377   1.00 0.00 ? 373 ILE A CA  1  
ATOM 2174   C C   . ILE A 1 373 ? -47.452  -33.954 5.497   1.00 0.00 ? 373 ILE A C   1  
ATOM 2175   O O   . ILE A 1 373 ? -47.607  -33.596 4.325   1.00 0.00 ? 373 ILE A O   1  
ATOM 2176   C CB  . ILE A 1 373 ? -48.982  -32.823 7.119   1.00 0.00 ? 373 ILE A CB  1  
ATOM 2177   C CG1 . ILE A 1 373 ? -48.347  -32.785 8.593   1.00 0.00 ? 373 ILE A CG1 1  
ATOM 2178   C CG2 . ILE A 1 373 ? -50.511  -32.614 7.133   1.00 0.00 ? 373 ILE A CG2 1  
ATOM 2179   C CD1 . ILE A 1 373 ? -48.647  -31.494 9.373   1.00 0.00 ? 373 ILE A CD1 1  
ATOM 2180   N N   . THR A 1 374 ? -46.225  -34.077 6.027   1.00 0.00 ? 374 THR A N   1  
ATOM 2181   C CA  . THR A 1 374 ? -45.021  -33.744 5.350   1.00 0.00 ? 374 THR A CA  1  
ATOM 2182   C C   . THR A 1 374 ? -44.954  -34.692 4.205   1.00 0.00 ? 374 THR A C   1  
ATOM 2183   O O   . THR A 1 374 ? -44.600  -34.346 3.092   1.00 0.00 ? 374 THR A O   1  
ATOM 2184   C CB  . THR A 1 374 ? -43.765  -33.872 6.261   1.00 0.00 ? 374 THR A CB  1  
ATOM 2185   O OG1 . THR A 1 374 ? -43.718  -35.061 7.029   1.00 0.00 ? 374 THR A OG1 1  
ATOM 2186   C CG2 . THR A 1 374 ? -43.755  -32.769 7.255   1.00 0.00 ? 374 THR A CG2 1  
ATOM 2187   N N   . ILE A 1 375 ? -45.284  -35.955 4.454   1.00 0.00 ? 375 ILE A N   1  
ATOM 2188   C CA  . ILE A 1 375 ? -45.102  -37.078 3.533   1.00 0.00 ? 375 ILE A CA  1  
ATOM 2189   C C   . ILE A 1 375 ? -45.929  -36.880 2.334   1.00 0.00 ? 375 ILE A C   1  
ATOM 2190   O O   . ILE A 1 375 ? -45.410  -37.008 1.252   1.00 0.00 ? 375 ILE A O   1  
ATOM 2191   C CB  . ILE A 1 375 ? -45.363  -38.408 4.247   1.00 0.00 ? 375 ILE A CB  1  
ATOM 2192   C CG1 . ILE A 1 375 ? -44.710  -38.396 5.685   1.00 0.00 ? 375 ILE A CG1 1  
ATOM 2193   C CG2 . ILE A 1 375 ? -44.906  -39.528 3.297   1.00 0.00 ? 375 ILE A CG2 1  
ATOM 2194   C CD1 . ILE A 1 375 ? -44.920  -39.695 6.481   1.00 0.00 ? 375 ILE A CD1 1  
ATOM 2195   N N   . GLN A 1 376 ? -47.192  -36.420 2.564   1.00 0.00 ? 376 GLN A N   1  
ATOM 2196   C CA  . GLN A 1 376 ? -48.145  -36.059 1.523   1.00 0.00 ? 376 GLN A CA  1  
ATOM 2197   C C   . GLN A 1 376 ? -47.787  -34.927 0.665   1.00 0.00 ? 376 GLN A C   1  
ATOM 2198   O O   . GLN A 1 376 ? -48.008  -35.000 -0.557  1.00 0.00 ? 376 GLN A O   1  
ATOM 2199   C CB  . GLN A 1 376 ? -49.553  -35.719 2.039   1.00 0.00 ? 376 GLN A CB  1  
ATOM 2200   C CG  . GLN A 1 376 ? -50.605  -35.865 0.952   1.00 0.00 ? 376 GLN A CG  1  
ATOM 2201   C CD  . GLN A 1 376 ? -52.011  -35.632 1.568   1.00 0.00 ? 376 GLN A CD  1  
ATOM 2202   O OE1 . GLN A 1 376 ? -52.947  -35.292 0.822   1.00 0.00 ? 376 GLN A OE1 1  
ATOM 2203   N NE2 . GLN A 1 376 ? -52.294  -35.971 2.852   1.00 0.00 ? 376 GLN A NE2 1  
ATOM 2204   N N   . GLU A 1 377 ? -47.195  -33.878 1.235   1.00 0.00 ? 377 GLU A N   1  
ATOM 2205   C CA  . GLU A 1 377 ? -46.665  -32.685 0.553   1.00 0.00 ? 377 GLU A CA  1  
ATOM 2206   C C   . GLU A 1 377 ? -45.550  -33.091 -0.375  1.00 0.00 ? 377 GLU A C   1  
ATOM 2207   O O   . GLU A 1 377 ? -45.508  -32.702 -1.509  1.00 0.00 ? 377 GLU A O   1  
ATOM 2208   C CB  . GLU A 1 377 ? -46.117  -31.716 1.609   1.00 0.00 ? 377 GLU A CB  1  
ATOM 2209   C CG  . GLU A 1 377 ? -47.212  -30.936 2.435   1.00 0.00 ? 377 GLU A CG  1  
ATOM 2210   C CD  . GLU A 1 377 ? -46.532  -30.340 3.607   1.00 0.00 ? 377 GLU A CD  1  
ATOM 2211   O OE1 . GLU A 1 377 ? -45.651  -29.459 3.505   1.00 0.00 ? 377 GLU A OE1 1  
ATOM 2212   O OE2 . GLU A 1 377 ? -46.860  -30.735 4.751   1.00 0.00 ? 377 GLU A OE2 1  
ATOM 2213   N N   . ILE A 1 378 ? -44.617  -34.035 0.070   1.00 0.00 ? 378 ILE A N   1  
ATOM 2214   C CA  . ILE A 1 378 ? -43.538  -34.533 -0.778  1.00 0.00 ? 378 ILE A CA  1  
ATOM 2215   C C   . ILE A 1 378 ? -44.120  -35.270 -1.940  1.00 0.00 ? 378 ILE A C   1  
ATOM 2216   O O   . ILE A 1 378 ? -43.693  -35.199 -3.045  1.00 0.00 ? 378 ILE A O   1  
ATOM 2217   C CB  . ILE A 1 378 ? -42.531  -35.279 0.079   1.00 0.00 ? 378 ILE A CB  1  
ATOM 2218   C CG1 . ILE A 1 378 ? -41.862  -34.423 1.184   1.00 0.00 ? 378 ILE A CG1 1  
ATOM 2219   C CG2 . ILE A 1 378 ? -41.527  -35.930 -0.808  1.00 0.00 ? 378 ILE A CG2 1  
ATOM 2220   C CD1 . ILE A 1 378 ? -40.845  -35.191 2.044   1.00 0.00 ? 378 ILE A CD1 1  
ATOM 2221   N N   . ASN A 1 379 ? -45.180  -36.060 -1.645  1.00 0.00 ? 379 ASN A N   1  
ATOM 2222   C CA  . ASN A 1 379 ? -45.859  -36.893 -2.598  1.00 0.00 ? 379 ASN A CA  1  
ATOM 2223   C C   . ASN A 1 379 ? -46.479  -36.017 -3.628  1.00 0.00 ? 379 ASN A C   1  
ATOM 2224   O O   . ASN A 1 379 ? -46.379  -36.402 -4.827  1.00 0.00 ? 379 ASN A O   1  
ATOM 2225   C CB  . ASN A 1 379 ? -46.939  -37.821 -2.009  1.00 0.00 ? 379 ASN A CB  1  
ATOM 2226   C CG  . ASN A 1 379 ? -46.438  -38.981 -1.159  1.00 0.00 ? 379 ASN A CG  1  
ATOM 2227   O OD1 . ASN A 1 379 ? -46.800  -39.059 -0.021  1.00 0.00 ? 379 ASN A OD1 1  
ATOM 2228   N ND2 . ASN A 1 379 ? -45.568  -39.942 -1.680  1.00 0.00 ? 379 ASN A ND2 1  
ATOM 2229   N N   . ASP A 1 380 ? -47.093  -34.821 -3.338  1.00 0.00 ? 380 ASP A N   1  
ATOM 2230   C CA  . ASP A 1 380 ? -47.711  -34.008 -4.307  1.00 0.00 ? 380 ASP A CA  1  
ATOM 2231   C C   . ASP A 1 380 ? -46.643  -33.525 -5.293  1.00 0.00 ? 380 ASP A C   1  
ATOM 2232   O O   . ASP A 1 380 ? -46.777  -33.470 -6.524  1.00 0.00 ? 380 ASP A O   1  
ATOM 2233   C CB  . ASP A 1 380 ? -48.416  -32.842 -3.599  1.00 0.00 ? 380 ASP A CB  1  
ATOM 2234   C CG  . ASP A 1 380 ? -49.110  -31.756 -4.463  1.00 0.00 ? 380 ASP A CG  1  
ATOM 2235   O OD1 . ASP A 1 380 ? -48.576  -31.239 -5.455  1.00 0.00 ? 380 ASP A OD1 1  
ATOM 2236   O OD2 . ASP A 1 380 ? -50.349  -31.542 -4.145  1.00 0.00 ? 380 ASP A OD2 1  
ATOM 2237   N N   . PHE A 1 381 ? -45.439  -33.157 -4.750  1.00 0.00 ? 381 PHE A N   1  
ATOM 2238   C CA  . PHE A 1 381 ? -44.343  -32.723 -5.545  1.00 0.00 ? 381 PHE A CA  1  
ATOM 2239   C C   . PHE A 1 381 ? -43.792  -33.769 -6.450  1.00 0.00 ? 381 PHE A C   1  
ATOM 2240   O O   . PHE A 1 381 ? -43.243  -33.402 -7.499  1.00 0.00 ? 381 PHE A O   1  
ATOM 2241   C CB  . PHE A 1 381 ? -43.201  -32.040 -4.712  1.00 0.00 ? 381 PHE A CB  1  
ATOM 2242   C CG  . PHE A 1 381 ? -43.782  -30.896 -3.962  1.00 0.00 ? 381 PHE A CG  1  
ATOM 2243   C CD1 . PHE A 1 381 ? -44.614  -29.972 -4.576  1.00 0.00 ? 381 PHE A CD1 1  
ATOM 2244   C CD2 . PHE A 1 381 ? -43.468  -30.696 -2.625  1.00 0.00 ? 381 PHE A CD2 1  
ATOM 2245   C CE1 . PHE A 1 381 ? -45.192  -28.893 -3.870  1.00 0.00 ? 381 PHE A CE1 1  
ATOM 2246   C CE2 . PHE A 1 381 ? -44.183  -29.716 -1.853  1.00 0.00 ? 381 PHE A CE2 1  
ATOM 2247   C CZ  . PHE A 1 381 ? -45.048  -28.802 -2.500  1.00 0.00 ? 381 PHE A CZ  1  
ATOM 2248   N N   . ALA A 1 382 ? -43.906  -35.062 -6.050  1.00 0.00 ? 382 ALA A N   1  
ATOM 2249   C CA  . ALA A 1 382 ? -43.207  -36.198 -6.650  1.00 0.00 ? 382 ALA A CA  1  
ATOM 2250   C C   . ALA A 1 382 ? -43.309  -36.456 -8.114  1.00 0.00 ? 382 ALA A C   1  
ATOM 2251   O O   . ALA A 1 382 ? -42.310  -36.809 -8.728  1.00 0.00 ? 382 ALA A O   1  
ATOM 2252   C CB  . ALA A 1 382 ? -43.656  -37.497 -6.037  1.00 0.00 ? 382 ALA A CB  1  
ATOM 2253   N N   . ASP A 1 383 ? -44.622  -36.354 -8.630  1.00 0.00 ? 383 ASP A N   1  
ATOM 2254   C CA  . ASP A 1 383 ? -45.068  -36.682 -9.943  1.00 0.00 ? 383 ASP A CA  1  
ATOM 2255   C C   . ASP A 1 383 ? -45.602  -38.078 -9.549  1.00 0.00 ? 383 ASP A C   1  
ATOM 2256   O O   . ASP A 1 383 ? -44.851  -38.850 -9.000  1.00 0.00 ? 383 ASP A O   1  
ATOM 2257   C CB  . ASP A 1 383 ? -44.076  -36.825 -11.101 1.00 0.00 ? 383 ASP A CB  1  
ATOM 2258   C CG  . ASP A 1 383 ? -44.663  -37.349 -12.396 1.00 0.00 ? 383 ASP A CG  1  
ATOM 2259   O OD1 . ASP A 1 383 ? -45.810  -37.933 -12.381 1.00 0.00 ? 383 ASP A OD1 1  
ATOM 2260   O OD2 . ASP A 1 383 ? -44.026  -37.123 -13.419 1.00 0.00 ? 383 ASP A OD2 1  
ATOM 2261   N N   . LEU A 1 384 ? -46.913  -38.339 -9.700  1.00 0.00 ? 384 LEU A N   1  
ATOM 2262   C CA  . LEU A 1 384 ? -47.384  -39.605 -9.249  1.00 0.00 ? 384 LEU A CA  1  
ATOM 2263   C C   . LEU A 1 384 ? -48.098  -40.209 -10.372 1.00 0.00 ? 384 LEU A C   1  
ATOM 2264   O O   . LEU A 1 384 ? -48.895  -39.561 -11.037 1.00 0.00 ? 384 LEU A O   1  
ATOM 2265   C CB  . LEU A 1 384 ? -48.404  -39.455 -8.170  1.00 0.00 ? 384 LEU A CB  1  
ATOM 2266   C CG  . LEU A 1 384 ? -47.996  -38.835 -6.826  1.00 0.00 ? 384 LEU A CG  1  
ATOM 2267   C CD1 . LEU A 1 384 ? -49.246  -38.421 -6.098  1.00 0.00 ? 384 LEU A CD1 1  
ATOM 2268   C CD2 . LEU A 1 384 ? -47.088  -39.752 -5.955  1.00 0.00 ? 384 LEU A CD2 1  
ATOM 2269   N N   . MET A 1 385 ? -47.735  -41.485 -10.667 1.00 0.00 ? 385 MET A N   1  
ATOM 2270   C CA  . MET A 1 385 ? -48.147  -42.158 -11.810 1.00 0.00 ? 385 MET A CA  1  
ATOM 2271   C C   . MET A 1 385 ? -48.021  -43.666 -11.333 1.00 0.00 ? 385 MET A C   1  
ATOM 2272   O O   . MET A 1 385 ? -47.975  -44.515 -12.211 1.00 0.00 ? 385 MET A O   1  
ATOM 2273   C CB  . MET A 1 385 ? -47.040  -41.800 -12.922 1.00 0.00 ? 385 MET A CB  1  
ATOM 2274   C CG  . MET A 1 385 ? -45.593  -42.068 -12.530 1.00 0.00 ? 385 MET A CG  1  
ATOM 2275   S SD  . MET A 1 385 ? -44.648  -40.913 -11.456 1.00 0.00 ? 385 MET A SD  1  
ATOM 2276   C CE  . MET A 1 385 ? -43.077  -41.918 -11.263 1.00 0.00 ? 385 MET A CE  1  
ATOM 2277   N N   . GLU A 1 386 ? -47.932  -43.939 -10.034 1.00 0.00 ? 386 GLU A N   1  
ATOM 2278   C CA  . GLU A 1 386 ? -47.732  -45.314 -9.582  1.00 0.00 ? 386 GLU A CA  1  
ATOM 2279   C C   . GLU A 1 386 ? -48.985  -45.696 -8.863  1.00 0.00 ? 386 GLU A C   1  
ATOM 2280   O O   . GLU A 1 386 ? -49.392  -45.015 -7.949  1.00 0.00 ? 386 GLU A O   1  
ATOM 2281   C CB  . GLU A 1 386 ? -46.622  -45.499 -8.544  1.00 0.00 ? 386 GLU A CB  1  
ATOM 2282   C CG  . GLU A 1 386 ? -45.389  -44.548 -8.396  1.00 0.00 ? 386 GLU A CG  1  
ATOM 2283   C CD  . GLU A 1 386 ? -45.802  -43.082 -8.145  1.00 0.00 ? 386 GLU A CD  1  
ATOM 2284   O OE1 . GLU A 1 386 ? -46.926  -42.833 -7.564  1.00 0.00 ? 386 GLU A OE1 1  
ATOM 2285   O OE2 . GLU A 1 386 ? -45.016  -42.184 -8.490  1.00 0.00 ? 386 GLU A OE2 1  
ATOM 2286   N N   . GLY A 1 387 ? -49.636  -46.846 -9.121  1.00 0.00 ? 387 GLY A N   1  
ATOM 2287   C CA  . GLY A 1 387 ? -50.697  -47.264 -8.320  1.00 0.00 ? 387 GLY A CA  1  
ATOM 2288   C C   . GLY A 1 387 ? -50.283  -47.633 -6.925  1.00 0.00 ? 387 GLY A C   1  
ATOM 2289   O O   . GLY A 1 387 ? -50.924  -47.212 -5.955  1.00 0.00 ? 387 GLY A O   1  
ATOM 2290   N N   . SER A 1 388 ? -49.170  -48.411 -6.878  1.00 0.00 ? 388 SER A N   1  
ATOM 2291   C CA  . SER A 1 388 ? -48.741  -48.812 -5.579  1.00 0.00 ? 388 SER A CA  1  
ATOM 2292   C C   . SER A 1 388 ? -48.313  -47.713 -4.569  1.00 0.00 ? 388 SER A C   1  
ATOM 2293   O O   . SER A 1 388 ? -48.659  -47.750 -3.398  1.00 0.00 ? 388 SER A O   1  
ATOM 2294   C CB  . SER A 1 388 ? -47.644  -49.918 -5.784  1.00 0.00 ? 388 SER A CB  1  
ATOM 2295   O OG  . SER A 1 388 ? -48.184  -51.111 -6.371  1.00 0.00 ? 388 SER A OG  1  
ATOM 2296   N N   . ASN A 1 389 ? -47.510  -46.740 -5.043  1.00 0.00 ? 389 ASN A N   1  
ATOM 2297   C CA  . ASN A 1 389 ? -47.065  -45.717 -4.103  1.00 0.00 ? 389 ASN A CA  1  
ATOM 2298   C C   . ASN A 1 389 ? -48.222  -44.952 -3.595  1.00 0.00 ? 389 ASN A C   1  
ATOM 2299   O O   . ASN A 1 389 ? -48.301  -44.603 -2.451  1.00 0.00 ? 389 ASN A O   1  
ATOM 2300   C CB  . ASN A 1 389 ? -46.049  -44.755 -4.798  1.00 0.00 ? 389 ASN A CB  1  
ATOM 2301   C CG  . ASN A 1 389 ? -45.196  -43.843 -3.955  1.00 0.00 ? 389 ASN A CG  1  
ATOM 2302   O OD1 . ASN A 1 389 ? -44.543  -44.284 -3.010  1.00 0.00 ? 389 ASN A OD1 1  
ATOM 2303   N ND2 . ASN A 1 389 ? -45.120  -42.564 -4.449  1.00 0.00 ? 389 ASN A ND2 1  
ATOM 2304   N N   . LEU A 1 390 ? -49.137  -44.640 -4.548  1.00 0.00 ? 390 LEU A N   1  
ATOM 2305   C CA  . LEU A 1 390 ? -50.252  -43.811 -4.158  1.00 0.00 ? 390 LEU A CA  1  
ATOM 2306   C C   . LEU A 1 390 ? -51.139  -44.450 -3.175  1.00 0.00 ? 390 LEU A C   1  
ATOM 2307   O O   . LEU A 1 390 ? -51.568  -43.840 -2.186  1.00 0.00 ? 390 LEU A O   1  
ATOM 2308   C CB  . LEU A 1 390 ? -51.023  -43.505 -5.386  1.00 0.00 ? 390 LEU A CB  1  
ATOM 2309   C CG  . LEU A 1 390 ? -52.072  -42.300 -5.308  1.00 0.00 ? 390 LEU A CG  1  
ATOM 2310   C CD1 . LEU A 1 390 ? -51.594  -41.142 -4.410  1.00 0.00 ? 390 LEU A CD1 1  
ATOM 2311   C CD2 . LEU A 1 390 ? -52.555  -41.856 -6.713  1.00 0.00 ? 390 LEU A CD2 1  
ATOM 2312   N N   . GLU A 1 391 ? -51.446  -45.780 -3.342  1.00 0.00 ? 391 GLU A N   1  
ATOM 2313   C CA  . GLU A 1 391 ? -52.293  -46.517 -2.491  1.00 0.00 ? 391 GLU A CA  1  
ATOM 2314   C C   . GLU A 1 391 ? -51.733  -46.699 -1.166  1.00 0.00 ? 391 GLU A C   1  
ATOM 2315   O O   . GLU A 1 391 ? -52.451  -46.558 -0.143  1.00 0.00 ? 391 GLU A O   1  
ATOM 2316   C CB  . GLU A 1 391 ? -52.880  -47.886 -3.151  1.00 0.00 ? 391 GLU A CB  1  
ATOM 2317   C CG  . GLU A 1 391 ? -51.707  -48.886 -3.309  1.00 0.00 ? 391 GLU A CG  1  
ATOM 2318   C CD  . GLU A 1 391 ? -52.215  -50.212 -3.984  1.00 0.00 ? 391 GLU A CD  1  
ATOM 2319   O OE1 . GLU A 1 391 ? -52.217  -50.200 -5.283  1.00 0.00 ? 391 GLU A OE1 1  
ATOM 2320   O OE2 . GLU A 1 391 ? -52.582  -51.065 -3.213  1.00 0.00 ? 391 GLU A OE2 1  
ATOM 2321   N N   . LEU A 1 392 ? -50.399  -46.818 -1.058  1.00 0.00 ? 392 LEU A N   1  
ATOM 2322   C CA  . LEU A 1 392 ? -49.684  -46.826 0.191   1.00 0.00 ? 392 LEU A CA  1  
ATOM 2323   C C   . LEU A 1 392 ? -49.867  -45.574 0.980   1.00 0.00 ? 392 LEU A C   1  
ATOM 2324   O O   . LEU A 1 392 ? -50.120  -45.530 2.192   1.00 0.00 ? 392 LEU A O   1  
ATOM 2325   C CB  . LEU A 1 392 ? -48.143  -47.008 -0.061  1.00 0.00 ? 392 LEU A CB  1  
ATOM 2326   C CG  . LEU A 1 392 ? -47.317  -47.088 1.280   1.00 0.00 ? 392 LEU A CG  1  
ATOM 2327   C CD1 . LEU A 1 392 ? -47.721  -48.438 1.976   1.00 0.00 ? 392 LEU A CD1 1  
ATOM 2328   C CD2 . LEU A 1 392 ? -45.741  -46.973 1.095   1.00 0.00 ? 392 LEU A CD2 1  
ATOM 2329   N N   . TYR A 1 393 ? -49.815  -44.455 0.259   1.00 0.00 ? 393 TYR A N   1  
ATOM 2330   C CA  . TYR A 1 393 ? -50.103  -43.160 0.740   1.00 0.00 ? 393 TYR A CA  1  
ATOM 2331   C C   . TYR A 1 393 ? -51.503  -43.001 1.218   1.00 0.00 ? 393 TYR A C   1  
ATOM 2332   O O   . TYR A 1 393 ? -51.657  -42.456 2.320   1.00 0.00 ? 393 TYR A O   1  
ATOM 2333   C CB  . TYR A 1 393 ? -49.818  -41.960 -0.284  1.00 0.00 ? 393 TYR A CB  1  
ATOM 2334   C CG  . TYR A 1 393 ? -49.483  -40.838 0.661   1.00 0.00 ? 393 TYR A CG  1  
ATOM 2335   C CD1 . TYR A 1 393 ? -48.378  -40.969 1.456   1.00 0.00 ? 393 TYR A CD1 1  
ATOM 2336   C CD2 . TYR A 1 393 ? -50.494  -39.892 0.935   1.00 0.00 ? 393 TYR A CD2 1  
ATOM 2337   C CE1 . TYR A 1 393 ? -48.321  -40.175 2.669   1.00 0.00 ? 393 TYR A CE1 1  
ATOM 2338   C CE2 . TYR A 1 393 ? -50.475  -39.241 2.167   1.00 0.00 ? 393 TYR A CE2 1  
ATOM 2339   C CZ  . TYR A 1 393 ? -49.404  -39.370 3.004   1.00 0.00 ? 393 TYR A CZ  1  
ATOM 2340   O OH  . TYR A 1 393 ? -49.506  -38.929 4.247   1.00 0.00 ? 393 TYR A OH  1  
ATOM 2341   N N   . VAL A 1 394 ? -52.561  -43.452 0.492   1.00 0.00 ? 394 VAL A N   1  
ATOM 2342   C CA  . VAL A 1 394 ? -53.980  -43.282 0.873   1.00 0.00 ? 394 VAL A CA  1  
ATOM 2343   C C   . VAL A 1 394 ? -54.194  -44.049 2.091   1.00 0.00 ? 394 VAL A C   1  
ATOM 2344   O O   . VAL A 1 394 ? -54.848  -43.482 2.919   1.00 0.00 ? 394 VAL A O   1  
ATOM 2345   C CB  . VAL A 1 394 ? -55.048  -43.540 -0.111  1.00 0.00 ? 394 VAL A CB  1  
ATOM 2346   C CG1 . VAL A 1 394 ? -54.638  -42.895 -1.469  1.00 0.00 ? 394 VAL A CG1 1  
ATOM 2347   C CG2 . VAL A 1 394 ? -55.524  -45.055 -0.186  1.00 0.00 ? 394 VAL A CG2 1  
ATOM 2348   N N   . ASP A 1 395 ? -53.631  -45.269 2.260   1.00 0.00 ? 395 ASP A N   1  
ATOM 2349   C CA  . ASP A 1 395 ? -53.840  -45.991 3.464   1.00 0.00 ? 395 ASP A CA  1  
ATOM 2350   C C   . ASP A 1 395 ? -53.364  -45.217 4.643   1.00 0.00 ? 395 ASP A C   1  
ATOM 2351   O O   . ASP A 1 395 ? -53.987  -45.177 5.698   1.00 0.00 ? 395 ASP A O   1  
ATOM 2352   C CB  . ASP A 1 395 ? -53.112  -47.349 3.443   1.00 0.00 ? 395 ASP A CB  1  
ATOM 2353   C CG  . ASP A 1 395 ? -53.536  -48.315 4.618   1.00 0.00 ? 395 ASP A CG  1  
ATOM 2354   O OD1 . ASP A 1 395 ? -54.731  -48.571 4.859   1.00 0.00 ? 395 ASP A OD1 1  
ATOM 2355   O OD2 . ASP A 1 395 ? -52.587  -48.849 5.178   1.00 0.00 ? 395 ASP A OD2 1  
ATOM 2356   N N   . LYS A 1 396 ? -52.156  -44.566 4.496   1.00 0.00 ? 396 LYS A N   1  
ATOM 2357   C CA  . LYS A 1 396 ? -51.564  -43.869 5.568   1.00 0.00 ? 396 LYS A CA  1  
ATOM 2358   C C   . LYS A 1 396 ? -52.422  -42.686 6.010   1.00 0.00 ? 396 LYS A C   1  
ATOM 2359   O O   . LYS A 1 396 ? -52.686  -42.439 7.161   1.00 0.00 ? 396 LYS A O   1  
ATOM 2360   C CB  . LYS A 1 396 ? -50.263  -43.267 5.086   1.00 0.00 ? 396 LYS A CB  1  
ATOM 2361   C CG  . LYS A 1 396 ? -49.317  -43.117 6.261   1.00 0.00 ? 396 LYS A CG  1  
ATOM 2362   C CD  . LYS A 1 396 ? -47.892  -42.489 6.009   1.00 0.00 ? 396 LYS A CD  1  
ATOM 2363   C CE  . LYS A 1 396 ? -46.848  -43.320 5.246   1.00 0.00 ? 396 LYS A CE  1  
ATOM 2364   N NZ  . LYS A 1 396 ? -47.281  -43.463 3.850   1.00 0.00 ? 396 LYS A NZ  1  
ATOM 2365   N N   . CYS A 1 397 ? -52.941  -41.953 5.015   1.00 0.00 ? 397 CYS A N   1  
ATOM 2366   C CA  . CYS A 1 397 ? -53.779  -40.776 5.156   1.00 0.00 ? 397 CYS A CA  1  
ATOM 2367   C C   . CYS A 1 397 ? -55.110  -41.089 5.778   1.00 0.00 ? 397 CYS A C   1  
ATOM 2368   O O   . CYS A 1 397 ? -55.693  -40.441 6.623   1.00 0.00 ? 397 CYS A O   1  
ATOM 2369   C CB  . CYS A 1 397 ? -53.964  -40.060 3.795   1.00 0.00 ? 397 CYS A CB  1  
ATOM 2370   S SG  . CYS A 1 397 ? -54.803  -38.451 4.104   1.00 0.00 ? 397 CYS A SG  1  
ATOM 2371   N N   . TYR A 1 398 ? -55.638  -42.259 5.313   1.00 0.00 ? 398 TYR A N   1  
ATOM 2372   C CA  . TYR A 1 398 ? -56.932  -42.786 5.729   1.00 0.00 ? 398 TYR A CA  1  
ATOM 2373   C C   . TYR A 1 398 ? -56.873  -43.055 7.191   1.00 0.00 ? 398 TYR A C   1  
ATOM 2374   O O   . TYR A 1 398 ? -57.793  -42.660 7.851   1.00 0.00 ? 398 TYR A O   1  
ATOM 2375   C CB  . TYR A 1 398 ? -57.258  -44.108 4.995   1.00 0.00 ? 398 TYR A CB  1  
ATOM 2376   C CG  . TYR A 1 398 ? -58.317  -44.973 5.758   1.00 0.00 ? 398 TYR A CG  1  
ATOM 2377   C CD1 . TYR A 1 398 ? -59.618  -44.490 5.980   1.00 0.00 ? 398 TYR A CD1 1  
ATOM 2378   C CD2 . TYR A 1 398 ? -57.944  -46.218 6.323   1.00 0.00 ? 398 TYR A CD2 1  
ATOM 2379   C CE1 . TYR A 1 398 ? -60.529  -45.210 6.603   1.00 0.00 ? 398 TYR A CE1 1  
ATOM 2380   C CE2 . TYR A 1 398 ? -58.844  -46.979 7.082   1.00 0.00 ? 398 TYR A CE2 1  
ATOM 2381   C CZ  . TYR A 1 398 ? -60.175  -46.496 7.152   1.00 0.00 ? 398 TYR A CZ  1  
ATOM 2382   O OH  . TYR A 1 398 ? -61.136  -47.270 7.790   1.00 0.00 ? 398 TYR A OH  1  
ATOM 2383   N N   . SER A 1 399 ? -55.825  -43.752 7.607   1.00 0.00 ? 399 SER A N   1  
ATOM 2384   C CA  . SER A 1 399 ? -55.746  -44.237 8.990   1.00 0.00 ? 399 SER A CA  1  
ATOM 2385   C C   . SER A 1 399 ? -55.824  -42.978 9.855   1.00 0.00 ? 399 SER A C   1  
ATOM 2386   O O   . SER A 1 399 ? -56.623  -42.931 10.786  1.00 0.00 ? 399 SER A O   1  
ATOM 2387   C CB  . SER A 1 399 ? -54.467  -45.090 9.306   1.00 0.00 ? 399 SER A CB  1  
ATOM 2388   O OG  . SER A 1 399 ? -54.431  -46.259 8.543   1.00 0.00 ? 399 SER A OG  1  
ATOM 2389   N N   . ARG A 1 400 ? -55.071  -41.936 9.492   1.00 0.00 ? 400 ARG A N   1  
ATOM 2390   C CA  . ARG A 1 400 ? -55.034  -40.686 10.212  1.00 0.00 ? 400 ARG A CA  1  
ATOM 2391   C C   . ARG A 1 400 ? -56.352  -39.933 10.229  1.00 0.00 ? 400 ARG A C   1  
ATOM 2392   O O   . ARG A 1 400 ? -56.844  -39.450 11.241  1.00 0.00 ? 400 ARG A O   1  
ATOM 2393   C CB  . ARG A 1 400 ? -53.962  -39.722 9.711   1.00 0.00 ? 400 ARG A CB  1  
ATOM 2394   C CG  . ARG A 1 400 ? -53.837  -38.324 10.367  1.00 0.00 ? 400 ARG A CG  1  
ATOM 2395   C CD  . ARG A 1 400 ? -53.493  -38.346 11.882  1.00 0.00 ? 400 ARG A CD  1  
ATOM 2396   N NE  . ARG A 1 400 ? -52.069  -38.683 12.046  1.00 0.00 ? 400 ARG A NE  1  
ATOM 2397   C CZ  . ARG A 1 400 ? -51.562  -38.596 13.353  1.00 0.00 ? 400 ARG A CZ  1  
ATOM 2398   N NH1 . ARG A 1 400 ? -52.327  -38.344 14.445  1.00 0.00 ? 400 ARG A NH1 1  
ATOM 2399   N NH2 . ARG A 1 400 ? -50.237  -38.920 13.534  1.00 0.00 ? 400 ARG A NH2 1  
ATOM 2400   N N   . ALA A 1 401 ? -57.021  -39.951 9.104   1.00 0.00 ? 401 ALA A N   1  
ATOM 2401   C CA  . ALA A 1 401 ? -58.338  -39.336 8.969   1.00 0.00 ? 401 ALA A CA  1  
ATOM 2402   C C   . ALA A 1 401 ? -59.386  -39.961 9.797   1.00 0.00 ? 401 ALA A C   1  
ATOM 2403   O O   . ALA A 1 401 ? -60.173  -39.270 10.419  1.00 0.00 ? 401 ALA A O   1  
ATOM 2404   C CB  . ALA A 1 401 ? -58.735  -39.398 7.473   1.00 0.00 ? 401 ALA A CB  1  
ATOM 2405   N N   . ASN A 1 402 ? -59.350  -41.359 9.893   1.00 0.00 ? 402 ASN A N   1  
ATOM 2406   C CA  . ASN A 1 402 ? -60.219  -42.077 10.746  1.00 0.00 ? 402 ASN A CA  1  
ATOM 2407   C C   . ASN A 1 402 ? -59.893  -41.864 12.168  1.00 0.00 ? 402 ASN A C   1  
ATOM 2408   O O   . ASN A 1 402 ? -60.844  -41.696 12.913  1.00 0.00 ? 402 ASN A O   1  
ATOM 2409   C CB  . ASN A 1 402 ? -60.559  -43.574 10.465  1.00 0.00 ? 402 ASN A CB  1  
ATOM 2410   C CG  . ASN A 1 402 ? -59.490  -44.605 10.623  1.00 0.00 ? 402 ASN A CG  1  
ATOM 2411   O OD1 . ASN A 1 402 ? -58.923  -45.089 9.633   1.00 0.00 ? 402 ASN A OD1 1  
ATOM 2412   N ND2 . ASN A 1 402 ? -59.104  -44.938 11.906  1.00 0.00 ? 402 ASN A ND2 1  
ATOM 2413   N N   . GLU A 1 403 ? -58.586  -41.836 12.564  1.00 0.00 ? 403 GLU A N   1  
ATOM 2414   C CA  . GLU A 1 403 ? -58.214  -41.621 13.949  1.00 0.00 ? 403 GLU A CA  1  
ATOM 2415   C C   . GLU A 1 403 ? -58.662  -40.304 14.490  1.00 0.00 ? 403 GLU A C   1  
ATOM 2416   O O   . GLU A 1 403 ? -59.285  -40.289 15.530  1.00 0.00 ? 403 GLU A O   1  
ATOM 2417   C CB  . GLU A 1 403 ? -56.617  -41.420 14.158  1.00 0.00 ? 403 GLU A CB  1  
ATOM 2418   C CG  . GLU A 1 403 ? -55.821  -42.665 13.922  1.00 0.00 ? 403 GLU A CG  1  
ATOM 2419   C CD  . GLU A 1 403 ? -54.364  -42.317 13.523  1.00 0.00 ? 403 GLU A CD  1  
ATOM 2420   O OE1 . GLU A 1 403 ? -53.860  -41.203 13.891  1.00 0.00 ? 403 GLU A OE1 1  
ATOM 2421   O OE2 . GLU A 1 403 ? -53.806  -43.029 12.641  1.00 0.00 ? 403 GLU A OE2 1  
ATOM 2422   N N   . ILE A 1 404 ? -58.486  -39.266 13.663  1.00 0.00 ? 404 ILE A N   1  
ATOM 2423   C CA  . ILE A 1 404 ? -58.980  -37.903 13.918  1.00 0.00 ? 404 ILE A CA  1  
ATOM 2424   C C   . ILE A 1 404 ? -60.455  -37.753 14.025  1.00 0.00 ? 404 ILE A C   1  
ATOM 2425   O O   . ILE A 1 404 ? -60.924  -37.065 14.923  1.00 0.00 ? 404 ILE A O   1  
ATOM 2426   C CB  . ILE A 1 404 ? -58.463  -36.915 12.859  1.00 0.00 ? 404 ILE A CB  1  
ATOM 2427   C CG1 . ILE A 1 404 ? -56.969  -36.695 13.110  1.00 0.00 ? 404 ILE A CG1 1  
ATOM 2428   C CG2 . ILE A 1 404 ? -59.265  -35.563 12.930  1.00 0.00 ? 404 ILE A CG2 1  
ATOM 2429   C CD1 . ILE A 1 404 ? -56.302  -35.723 12.123  1.00 0.00 ? 404 ILE A CD1 1  
ATOM 2430   N N   . PHE A 1 405 ? -61.172  -38.510 13.218  1.00 0.00 ? 405 PHE A N   1  
ATOM 2431   C CA  . PHE A 1 405 ? -62.635  -38.559 13.255  1.00 0.00 ? 405 PHE A CA  1  
ATOM 2432   C C   . PHE A 1 405 ? -63.157  -39.107 14.478  1.00 0.00 ? 405 PHE A C   1  
ATOM 2433   O O   . PHE A 1 405 ? -64.050  -38.611 15.155  1.00 0.00 ? 405 PHE A O   1  
ATOM 2434   C CB  . PHE A 1 405 ? -63.161  -39.425 12.066  1.00 0.00 ? 405 PHE A CB  1  
ATOM 2435   C CG  . PHE A 1 405 ? -64.722  -39.366 11.948  1.00 0.00 ? 405 PHE A CG  1  
ATOM 2436   C CD1 . PHE A 1 405 ? -65.284  -38.172 11.437  1.00 0.00 ? 405 PHE A CD1 1  
ATOM 2437   C CD2 . PHE A 1 405 ? -65.611  -40.430 12.139  1.00 0.00 ? 405 PHE A CD2 1  
ATOM 2438   C CE1 . PHE A 1 405 ? -66.659  -38.034 11.149  1.00 0.00 ? 405 PHE A CE1 1  
ATOM 2439   C CE2 . PHE A 1 405 ? -67.004  -40.263 11.926  1.00 0.00 ? 405 PHE A CE2 1  
ATOM 2440   C CZ  . PHE A 1 405 ? -67.528  -39.096 11.441  1.00 0.00 ? 405 PHE A CZ  1  
ATOM 2441   N N   . LEU A 1 406 ? -62.549  -40.219 14.853  1.00 0.00 ? 406 LEU A N   1  
ATOM 2442   C CA  . LEU A 1 406 ? -62.829  -40.909 16.056  1.00 0.00 ? 406 LEU A CA  1  
ATOM 2443   C C   . LEU A 1 406 ? -62.609  -40.153 17.297  1.00 0.00 ? 406 LEU A C   1  
ATOM 2444   O O   . LEU A 1 406 ? -63.490  -40.015 18.191  1.00 0.00 ? 406 LEU A O   1  
ATOM 2445   C CB  . LEU A 1 406 ? -62.007  -42.222 16.168  1.00 0.00 ? 406 LEU A CB  1  
ATOM 2446   C CG  . LEU A 1 406 ? -62.382  -43.172 17.316  1.00 0.00 ? 406 LEU A CG  1  
ATOM 2447   C CD1 . LEU A 1 406 ? -63.855  -43.619 17.270  1.00 0.00 ? 406 LEU A CD1 1  
ATOM 2448   C CD2 . LEU A 1 406 ? -61.411  -44.413 17.419  1.00 0.00 ? 406 LEU A CD2 1  
ATOM 2449   N N   . LYS A 1 407 ? -61.423  -39.478 17.372  1.00 0.00 ? 407 LYS A N   1  
ATOM 2450   C CA  . LYS A 1 407 ? -60.944  -38.646 18.526  1.00 0.00 ? 407 LYS A CA  1  
ATOM 2451   C C   . LYS A 1 407 ? -61.960  -37.543 18.732  1.00 0.00 ? 407 LYS A C   1  
ATOM 2452   O O   . LYS A 1 407 ? -62.380  -37.252 19.850  1.00 0.00 ? 407 LYS A O   1  
ATOM 2453   C CB  . LYS A 1 407 ? -59.550  -38.070 18.139  1.00 0.00 ? 407 LYS A CB  1  
ATOM 2454   C CG  . LYS A 1 407 ? -58.866  -37.187 19.165  1.00 0.00 ? 407 LYS A CG  1  
ATOM 2455   C CD  . LYS A 1 407 ? -57.246  -37.302 19.225  1.00 0.00 ? 407 LYS A CD  1  
ATOM 2456   C CE  . LYS A 1 407 ? -56.443  -36.709 18.048  1.00 0.00 ? 407 LYS A CE  1  
ATOM 2457   N NZ  . LYS A 1 407 ? -56.439  -37.576 16.909  1.00 0.00 ? 407 LYS A NZ  1  
ATOM 2458   N N   . LEU A 1 408 ? -62.396  -36.947 17.601  1.00 0.00 ? 408 LEU A N   1  
ATOM 2459   C CA  . LEU A 1 408 ? -63.387  -35.867 17.539  1.00 0.00 ? 408 LEU A CA  1  
ATOM 2460   C C   . LEU A 1 408 ? -64.712  -36.291 18.099  1.00 0.00 ? 408 LEU A C   1  
ATOM 2461   O O   . LEU A 1 408 ? -65.337  -35.607 18.867  1.00 0.00 ? 408 LEU A O   1  
ATOM 2462   C CB  . LEU A 1 408 ? -63.474  -35.527 16.069  1.00 0.00 ? 408 LEU A CB  1  
ATOM 2463   C CG  . LEU A 1 408 ? -64.212  -34.249 15.659  1.00 0.00 ? 408 LEU A CG  1  
ATOM 2464   C CD1 . LEU A 1 408 ? -63.803  -32.981 16.396  1.00 0.00 ? 408 LEU A CD1 1  
ATOM 2465   C CD2 . LEU A 1 408 ? -64.407  -34.096 14.155  1.00 0.00 ? 408 LEU A CD2 1  
ATOM 2466   N N   . PHE A 1 409 ? -65.187  -37.478 17.688  1.00 0.00 ? 409 PHE A N   1  
ATOM 2467   C CA  . PHE A 1 409 ? -66.479  -38.062 18.050  1.00 0.00 ? 409 PHE A CA  1  
ATOM 2468   C C   . PHE A 1 409 ? -66.576  -38.453 19.490  1.00 0.00 ? 409 PHE A C   1  
ATOM 2469   O O   . PHE A 1 409 ? -67.593  -38.090 20.096  1.00 0.00 ? 409 PHE A O   1  
ATOM 2470   C CB  . PHE A 1 409 ? -66.872  -39.210 17.093  1.00 0.00 ? 409 PHE A CB  1  
ATOM 2471   C CG  . PHE A 1 409 ? -67.756  -38.652 15.988  1.00 0.00 ? 409 PHE A CG  1  
ATOM 2472   C CD1 . PHE A 1 409 ? -67.243  -37.758 15.034  1.00 0.00 ? 409 PHE A CD1 1  
ATOM 2473   C CD2 . PHE A 1 409 ? -69.157  -38.883 16.022  1.00 0.00 ? 409 PHE A CD2 1  
ATOM 2474   C CE1 . PHE A 1 409 ? -68.106  -37.177 14.112  1.00 0.00 ? 409 PHE A CE1 1  
ATOM 2475   C CE2 . PHE A 1 409 ? -69.995  -38.288 15.081  1.00 0.00 ? 409 PHE A CE2 1  
ATOM 2476   C CZ  . PHE A 1 409 ? -69.480  -37.412 14.144  1.00 0.00 ? 409 PHE A CZ  1  
ATOM 2477   N N   . PHE A 1 410 ? -65.588  -39.284 19.907  1.00 0.00 ? 410 PHE A N   1  
ATOM 2478   C CA  . PHE A 1 410 ? -65.489  -40.022 21.041  1.00 0.00 ? 410 PHE A CA  1  
ATOM 2479   C C   . PHE A 1 410 ? -65.388  -39.045 22.117  1.00 0.00 ? 410 PHE A C   1  
ATOM 2480   O O   . PHE A 1 410 ? -66.182  -39.139 23.071  1.00 0.00 ? 410 PHE A O   1  
ATOM 2481   C CB  . PHE A 1 410 ? -64.072  -40.886 21.042  1.00 0.00 ? 410 PHE A CB  1  
ATOM 2482   C CG  . PHE A 1 410 ? -63.749  -41.918 22.148  1.00 0.00 ? 410 PHE A CG  1  
ATOM 2483   C CD1 . PHE A 1 410 ? -64.664  -42.472 23.028  1.00 0.00 ? 410 PHE A CD1 1  
ATOM 2484   C CD2 . PHE A 1 410 ? -62.397  -42.218 22.292  1.00 0.00 ? 410 PHE A CD2 1  
ATOM 2485   C CE1 . PHE A 1 410 ? -64.250  -43.275 24.069  1.00 0.00 ? 410 PHE A CE1 1  
ATOM 2486   C CE2 . PHE A 1 410 ? -62.000  -43.119 23.256  1.00 0.00 ? 410 PHE A CE2 1  
ATOM 2487   C CZ  . PHE A 1 410 ? -62.919  -43.633 24.285  1.00 0.00 ? 410 PHE A CZ  1  
ATOM 2488   N N   . GLN A 1 411 ? -64.545  -37.978 22.050  1.00 0.00 ? 411 GLN A N   1  
ATOM 2489   C CA  . GLN A 1 411 ? -64.528  -36.973 23.124  1.00 0.00 ? 411 GLN A CA  1  
ATOM 2490   C C   . GLN A 1 411 ? -64.432  -35.698 22.321  1.00 0.00 ? 411 GLN A C   1  
ATOM 2491   O O   . GLN A 1 411 ? -63.914  -35.519 21.215  1.00 0.00 ? 411 GLN A O   1  
ATOM 2492   C CB  . GLN A 1 411 ? -63.440  -37.158 24.225  1.00 0.00 ? 411 GLN A CB  1  
ATOM 2493   C CG  . GLN A 1 411 ? -62.023  -37.393 23.712  1.00 0.00 ? 411 GLN A CG  1  
ATOM 2494   C CD  . GLN A 1 411 ? -61.767  -38.858 23.330  1.00 0.00 ? 411 GLN A CD  1  
ATOM 2495   O OE1 . GLN A 1 411 ? -62.213  -39.767 24.070  1.00 0.00 ? 411 GLN A OE1 1  
ATOM 2496   N NE2 . GLN A 1 411 ? -61.098  -38.988 22.171  1.00 0.00 ? 411 GLN A NE2 1  
ATOM 2497   N N   . GLY A 1 412 ? -65.077  -34.750 22.942  1.00 0.00 ? 412 GLY A N   1  
ATOM 2498   C CA  . GLY A 1 412 ? -65.251  -33.463 22.298  1.00 0.00 ? 412 GLY A CA  1  
ATOM 2499   C C   . GLY A 1 412 ? -66.531  -33.385 21.445  1.00 0.00 ? 412 GLY A C   1  
ATOM 2500   O O   . GLY A 1 412 ? -66.821  -32.265 20.972  1.00 0.00 ? 412 GLY A O   1  
ATOM 2501   N N   . TYR A 1 413 ? -67.318  -34.516 21.277  1.00 0.00 ? 413 TYR A N   1  
ATOM 2502   C CA  . TYR A 1 413 ? -68.601  -34.634 20.707  1.00 0.00 ? 413 TYR A CA  1  
ATOM 2503   C C   . TYR A 1 413 ? -69.338  -35.605 21.531  1.00 0.00 ? 413 TYR A C   1  
ATOM 2504   O O   . TYR A 1 413 ? -70.574  -35.645 21.498  1.00 0.00 ? 413 TYR A O   1  
ATOM 2505   C CB  . TYR A 1 413 ? -68.610  -34.780 19.147  1.00 0.00 ? 413 TYR A CB  1  
ATOM 2506   C CG  . TYR A 1 413 ? -69.657  -33.970 18.515  1.00 0.00 ? 413 TYR A CG  1  
ATOM 2507   C CD1 . TYR A 1 413 ? -70.951  -34.459 18.518  1.00 0.00 ? 413 TYR A CD1 1  
ATOM 2508   C CD2 . TYR A 1 413 ? -69.361  -32.712 18.002  1.00 0.00 ? 413 TYR A CD2 1  
ATOM 2509   C CE1 . TYR A 1 413 ? -72.009  -33.651 18.153  1.00 0.00 ? 413 TYR A CE1 1  
ATOM 2510   C CE2 . TYR A 1 413 ? -70.429  -31.900 17.669  1.00 0.00 ? 413 TYR A CE2 1  
ATOM 2511   C CZ  . TYR A 1 413 ? -71.773  -32.344 17.697  1.00 0.00 ? 413 TYR A CZ  1  
ATOM 2512   O OH  . TYR A 1 413 ? -72.920  -31.516 17.427  1.00 0.00 ? 413 TYR A OH  1  
ATOM 2513   N N   . ASP A 1 414 ? -68.606  -36.302 22.429  1.00 0.00 ? 414 ASP A N   1  
ATOM 2514   C CA  . ASP A 1 414 ? -69.029  -37.262 23.349  1.00 0.00 ? 414 ASP A CA  1  
ATOM 2515   C C   . ASP A 1 414 ? -69.983  -38.351 22.806  1.00 0.00 ? 414 ASP A C   1  
ATOM 2516   O O   . ASP A 1 414 ? -71.155  -38.394 23.277  1.00 0.00 ? 414 ASP A O   1  
ATOM 2517   C CB  . ASP A 1 414 ? -69.540  -36.613 24.694  1.00 0.00 ? 414 ASP A CB  1  
ATOM 2518   C CG  . ASP A 1 414 ? -68.508  -35.563 25.077  1.00 0.00 ? 414 ASP A CG  1  
ATOM 2519   O OD1 . ASP A 1 414 ? -67.335  -35.897 25.465  1.00 0.00 ? 414 ASP A OD1 1  
ATOM 2520   O OD2 . ASP A 1 414 ? -68.979  -34.373 25.041  1.00 0.00 ? 414 ASP A OD2 1  
ATOM 2521   N N   . LEU A 1 415 ? -69.481  -39.139 21.809  1.00 0.00 ? 415 LEU A N   1  
ATOM 2522   C CA  . LEU A 1 415 ? -70.056  -40.204 21.066  1.00 0.00 ? 415 LEU A CA  1  
ATOM 2523   C C   . LEU A 1 415 ? -70.422  -41.274 22.089  1.00 0.00 ? 415 LEU A C   1  
ATOM 2524   O O   . LEU A 1 415 ? -71.461  -41.896 21.935  1.00 0.00 ? 415 LEU A O   1  
ATOM 2525   C CB  . LEU A 1 415 ? -69.093  -40.946 20.131  1.00 0.00 ? 415 LEU A CB  1  
ATOM 2526   C CG  . LEU A 1 415 ? -69.883  -42.055 19.350  1.00 0.00 ? 415 LEU A CG  1  
ATOM 2527   C CD1 . LEU A 1 415 ? -71.014  -41.521 18.475  1.00 0.00 ? 415 LEU A CD1 1  
ATOM 2528   C CD2 . LEU A 1 415 ? -68.825  -42.607 18.480  1.00 0.00 ? 415 LEU A CD2 1  
ATOM 2529   N N   . ILE A 1 416 ? -69.580  -41.509 23.069  1.00 0.00 ? 416 ILE A N   1  
ATOM 2530   C CA  . ILE A 1 416 ? -69.777  -42.627 23.919  1.00 0.00 ? 416 ILE A CA  1  
ATOM 2531   C C   . ILE A 1 416 ? -71.084  -42.661 24.697  1.00 0.00 ? 416 ILE A C   1  
ATOM 2532   O O   . ILE A 1 416 ? -71.807  -43.634 24.859  1.00 0.00 ? 416 ILE A O   1  
ATOM 2533   C CB  . ILE A 1 416 ? -68.520  -42.789 24.818  1.00 0.00 ? 416 ILE A CB  1  
ATOM 2534   C CG1 . ILE A 1 416 ? -68.444  -44.193 25.444  1.00 0.00 ? 416 ILE A CG1 1  
ATOM 2535   C CG2 . ILE A 1 416 ? -68.290  -41.637 25.816  1.00 0.00 ? 416 ILE A CG2 1  
ATOM 2536   C CD1 . ILE A 1 416 ? -67.218  -44.412 26.347  1.00 0.00 ? 416 ILE A CD1 1  
ATOM 2537   N N   . ASN A 1 417 ? -71.428  -41.482 25.165  1.00 0.00 ? 417 ASN A N   1  
ATOM 2538   C CA  . ASN A 1 417 ? -72.576  -41.254 25.903  1.00 0.00 ? 417 ASN A CA  1  
ATOM 2539   C C   . ASN A 1 417 ? -73.888  -41.456 25.190  1.00 0.00 ? 417 ASN A C   1  
ATOM 2540   O O   . ASN A 1 417 ? -74.762  -42.139 25.753  1.00 0.00 ? 417 ASN A O   1  
ATOM 2541   C CB  . ASN A 1 417 ? -72.598  -39.850 26.607  1.00 0.00 ? 417 ASN A CB  1  
ATOM 2542   C CG  . ASN A 1 417 ? -71.450  -39.745 27.663  1.00 0.00 ? 417 ASN A CG  1  
ATOM 2543   O OD1 . ASN A 1 417 ? -70.452  -38.982 27.492  1.00 0.00 ? 417 ASN A OD1 1  
ATOM 2544   N ND2 . ASN A 1 417 ? -71.534  -40.611 28.738  1.00 0.00 ? 417 ASN A ND2 1  
ATOM 2545   N N   . VAL A 1 418 ? -73.865  -40.963 23.956  1.00 0.00 ? 418 VAL A N   1  
ATOM 2546   C CA  . VAL A 1 418 ? -74.934  -41.085 23.020  1.00 0.00 ? 418 VAL A CA  1  
ATOM 2547   C C   . VAL A 1 418 ? -75.099  -42.473 22.610  1.00 0.00 ? 418 VAL A C   1  
ATOM 2548   O O   . VAL A 1 418 ? -76.268  -42.881 22.489  1.00 0.00 ? 418 VAL A O   1  
ATOM 2549   C CB  . VAL A 1 418 ? -74.915  -40.130 21.835  1.00 0.00 ? 418 VAL A CB  1  
ATOM 2550   C CG1 . VAL A 1 418 ? -75.058  -38.666 22.363  1.00 0.00 ? 418 VAL A CG1 1  
ATOM 2551   C CG2 . VAL A 1 418 ? -73.765  -40.171 20.876  1.00 0.00 ? 418 VAL A CG2 1  
ATOM 2552   N N   . LEU A 1 419 ? -74.013  -43.298 22.462  1.00 0.00 ? 419 LEU A N   1  
ATOM 2553   C CA  . LEU A 1 419 ? -74.144  -44.664 22.131  1.00 0.00 ? 419 LEU A CA  1  
ATOM 2554   C C   . LEU A 1 419 ? -74.936  -45.389 23.173  1.00 0.00 ? 419 LEU A C   1  
ATOM 2555   O O   . LEU A 1 419 ? -75.860  -46.116 22.840  1.00 0.00 ? 419 LEU A O   1  
ATOM 2556   C CB  . LEU A 1 419 ? -72.727  -45.328 22.137  1.00 0.00 ? 419 LEU A CB  1  
ATOM 2557   C CG  . LEU A 1 419 ? -72.661  -46.663 21.308  1.00 0.00 ? 419 LEU A CG  1  
ATOM 2558   C CD1 . LEU A 1 419 ? -73.359  -46.565 19.880  1.00 0.00 ? 419 LEU A CD1 1  
ATOM 2559   C CD2 . LEU A 1 419 ? -71.197  -47.175 21.201  1.00 0.00 ? 419 LEU A CD2 1  
ATOM 2560   N N   . LYS A 1 420 ? -74.671  -45.090 24.491  1.00 0.00 ? 420 LYS A N   1  
ATOM 2561   C CA  . LYS A 1 420 ? -75.388  -45.692 25.600  1.00 0.00 ? 420 LYS A CA  1  
ATOM 2562   C C   . LYS A 1 420 ? -76.874  -45.397 25.575  1.00 0.00 ? 420 LYS A C   1  
ATOM 2563   O O   . LYS A 1 420 ? -77.700  -46.286 25.860  1.00 0.00 ? 420 LYS A O   1  
ATOM 2564   C CB  . LYS A 1 420 ? -74.748  -45.130 26.871  1.00 0.00 ? 420 LYS A CB  1  
ATOM 2565   C CG  . LYS A 1 420 ? -73.361  -45.756 27.080  1.00 0.00 ? 420 LYS A CG  1  
ATOM 2566   C CD  . LYS A 1 420 ? -72.731  -45.398 28.470  1.00 0.00 ? 420 LYS A CD  1  
ATOM 2567   C CE  . LYS A 1 420 ? -72.216  -43.926 28.690  1.00 0.00 ? 420 LYS A CE  1  
ATOM 2568   N NZ  . LYS A 1 420 ? -70.924  -43.632 28.037  1.00 0.00 ? 420 LYS A NZ  1  
ATOM 2569   N N   . HIS A 1 421 ? -77.170  -44.144 25.211  1.00 0.00 ? 421 HIS A N   1  
ATOM 2570   C CA  . HIS A 1 421 ? -78.535  -43.613 25.053  1.00 0.00 ? 421 HIS A CA  1  
ATOM 2571   C C   . HIS A 1 421 ? -79.268  -44.301 24.048  1.00 0.00 ? 421 HIS A C   1  
ATOM 2572   O O   . HIS A 1 421 ? -80.468  -44.720 24.186  1.00 0.00 ? 421 HIS A O   1  
ATOM 2573   C CB  . HIS A 1 421 ? -78.587  -42.089 24.591  1.00 0.00 ? 421 HIS A CB  1  
ATOM 2574   C CG  . HIS A 1 421 ? -77.820  -41.225 25.544  1.00 0.00 ? 421 HIS A CG  1  
ATOM 2575   N ND1 . HIS A 1 421 ? -77.787  -41.503 26.892  1.00 0.00 ? 421 HIS A ND1 1  
ATOM 2576   C CD2 . HIS A 1 421 ? -77.189  -40.058 25.402  1.00 0.00 ? 421 HIS A CD2 1  
ATOM 2577   C CE1 . HIS A 1 421 ? -77.068  -40.506 27.430  1.00 0.00 ? 421 HIS A CE1 1  
ATOM 2578   N NE2 . HIS A 1 421 ? -76.711  -39.601 26.541  1.00 0.00 ? 421 HIS A NE2 1  
ATOM 2579   N N   . LEU A 1 422 ? -78.621  -44.647 22.954  1.00 0.00 ? 422 LEU A N   1  
ATOM 2580   C CA  . LEU A 1 422 ? -79.137  -45.407 21.804  1.00 0.00 ? 422 LEU A CA  1  
ATOM 2581   C C   . LEU A 1 422 ? -79.469  -46.768 22.196  1.00 0.00 ? 422 LEU A C   1  
ATOM 2582   O O   . LEU A 1 422 ? -80.535  -47.274 21.835  1.00 0.00 ? 422 LEU A O   1  
ATOM 2583   C CB  . LEU A 1 422 ? -78.148  -45.449 20.609  1.00 0.00 ? 422 LEU A CB  1  
ATOM 2584   C CG  . LEU A 1 422 ? -78.078  -44.105 19.968  1.00 0.00 ? 422 LEU A CG  1  
ATOM 2585   C CD1 . LEU A 1 422 ? -76.771  -43.908 19.164  1.00 0.00 ? 422 LEU A CD1 1  
ATOM 2586   C CD2 . LEU A 1 422 ? -79.229  -43.827 18.915  1.00 0.00 ? 422 LEU A CD2 1  
ATOM 2587   N N   . GLN A 1 423 ? -78.599  -47.433 22.987  1.00 0.00 ? 423 GLN A N   1  
ATOM 2588   C CA  . GLN A 1 423 ? -78.781  -48.781 23.505  1.00 0.00 ? 423 GLN A CA  1  
ATOM 2589   C C   . GLN A 1 423 ? -79.965  -48.845 24.390  1.00 0.00 ? 423 GLN A C   1  
ATOM 2590   O O   . GLN A 1 423 ? -80.862  -49.652 24.273  1.00 0.00 ? 423 GLN A O   1  
ATOM 2591   C CB  . GLN A 1 423 ? -77.530  -49.183 24.358  1.00 0.00 ? 423 GLN A CB  1  
ATOM 2592   C CG  . GLN A 1 423 ? -76.298  -49.470 23.457  1.00 0.00 ? 423 GLN A CG  1  
ATOM 2593   C CD  . GLN A 1 423 ? -75.138  -49.844 24.364  1.00 0.00 ? 423 GLN A CD  1  
ATOM 2594   O OE1 . GLN A 1 423 ? -74.828  -51.057 24.432  1.00 0.00 ? 423 GLN A OE1 1  
ATOM 2595   N NE2 . GLN A 1 423 ? -74.393  -48.917 24.967  1.00 0.00 ? 423 GLN A NE2 1  
ATOM 2596   N N   . GLN A 1 424 ? -80.174  -47.769 25.169  1.00 0.00 ? 424 GLN A N   1  
ATOM 2597   C CA  . GLN A 1 424 ? -81.376  -47.552 25.928  1.00 0.00 ? 424 GLN A CA  1  
ATOM 2598   C C   . GLN A 1 424 ? -82.703  -47.426 25.218  1.00 0.00 ? 424 GLN A C   1  
ATOM 2599   O O   . GLN A 1 424 ? -83.548  -48.228 25.489  1.00 0.00 ? 424 GLN A O   1  
ATOM 2600   C CB  . GLN A 1 424 ? -81.057  -46.363 26.927  1.00 0.00 ? 424 GLN A CB  1  
ATOM 2601   C CG  . GLN A 1 424 ? -82.290  -45.759 27.653  1.00 0.00 ? 424 GLN A CG  1  
ATOM 2602   C CD  . GLN A 1 424 ? -82.900  -44.535 26.824  1.00 0.00 ? 424 GLN A CD  1  
ATOM 2603   O OE1 . GLN A 1 424 ? -84.113  -44.503 26.580  1.00 0.00 ? 424 GLN A OE1 1  
ATOM 2604   N NE2 . GLN A 1 424 ? -82.027  -43.497 26.505  1.00 0.00 ? 424 GLN A NE2 1  
ATOM 2605   N N   . ILE A 1 425 ? -82.817  -46.470 24.241  1.00 0.00 ? 425 ILE A N   1  
ATOM 2606   C CA  . ILE A 1 425 ? -84.063  -46.357 23.501  1.00 0.00 ? 425 ILE A CA  1  
ATOM 2607   C C   . ILE A 1 425 ? -84.243  -47.355 22.376  1.00 0.00 ? 425 ILE A C   1  
ATOM 2608   O O   . ILE A 1 425 ? -85.258  -48.048 22.331  1.00 0.00 ? 425 ILE A O   1  
ATOM 2609   C CB  . ILE A 1 425 ? -84.262  -44.918 22.960  1.00 0.00 ? 425 ILE A CB  1  
ATOM 2610   C CG1 . ILE A 1 425 ? -85.709  -44.511 22.526  1.00 0.00 ? 425 ILE A CG1 1  
ATOM 2611   C CG2 . ILE A 1 425 ? -83.272  -44.471 21.832  1.00 0.00 ? 425 ILE A CG2 1  
ATOM 2612   C CD1 . ILE A 1 425 ? -85.825  -43.069 22.001  1.00 0.00 ? 425 ILE A CD1 1  
ATOM 2613   N N   . PHE A 1 426 ? -83.344  -47.448 21.400  1.00 0.00 ? 426 PHE A N   1  
ATOM 2614   C CA  . PHE A 1 426 ? -83.528  -48.145 20.212  1.00 0.00 ? 426 PHE A CA  1  
ATOM 2615   C C   . PHE A 1 426 ? -83.578  -49.600 20.467  1.00 0.00 ? 426 PHE A C   1  
ATOM 2616   O O   . PHE A 1 426 ? -84.530  -50.343 20.163  1.00 0.00 ? 426 PHE A O   1  
ATOM 2617   C CB  . PHE A 1 426 ? -82.376  -48.114 19.111  1.00 0.00 ? 426 PHE A CB  1  
ATOM 2618   C CG  . PHE A 1 426 ? -82.543  -46.906 18.179  1.00 0.00 ? 426 PHE A CG  1  
ATOM 2619   C CD1 . PHE A 1 426 ? -83.782  -46.611 17.590  1.00 0.00 ? 426 PHE A CD1 1  
ATOM 2620   C CD2 . PHE A 1 426 ? -81.475  -46.207 17.777  1.00 0.00 ? 426 PHE A CD2 1  
ATOM 2621   C CE1 . PHE A 1 426 ? -83.912  -45.692 16.524  1.00 0.00 ? 426 PHE A CE1 1  
ATOM 2622   C CE2 . PHE A 1 426 ? -81.520  -45.339 16.737  1.00 0.00 ? 426 PHE A CE2 1  
ATOM 2623   C CZ  . PHE A 1 426 ? -82.737  -45.060 16.073  1.00 0.00 ? 426 PHE A CZ  1  
ATOM 2624   N N   . LEU A 1 427 ? -82.606  -50.063 21.280  1.00 0.00 ? 427 LEU A N   1  
ATOM 2625   C CA  . LEU A 1 427 ? -82.609  -51.425 21.770  1.00 0.00 ? 427 LEU A CA  1  
ATOM 2626   C C   . LEU A 1 427 ? -83.707  -51.679 22.806  1.00 0.00 ? 427 LEU A C   1  
ATOM 2627   O O   . LEU A 1 427 ? -84.134  -52.813 23.064  1.00 0.00 ? 427 LEU A O   1  
ATOM 2628   C CB  . LEU A 1 427 ? -81.246  -52.007 22.201  1.00 0.00 ? 427 LEU A CB  1  
ATOM 2629   C CG  . LEU A 1 427 ? -80.069  -51.729 21.227  1.00 0.00 ? 427 LEU A CG  1  
ATOM 2630   C CD1 . LEU A 1 427 ? -78.796  -52.459 21.659  1.00 0.00 ? 427 LEU A CD1 1  
ATOM 2631   C CD2 . LEU A 1 427 ? -80.498  -52.029 19.767  1.00 0.00 ? 427 LEU A CD2 1  
ATOM 2632   N N   . GLY A 1 428 ? -84.076  -50.562 23.555  1.00 0.00 ? 428 GLY A N   1  
ATOM 2633   C CA  . GLY A 1 428 ? -85.231  -50.532 24.399  1.00 0.00 ? 428 GLY A CA  1  
ATOM 2634   C C   . GLY A 1 428 ? -85.100  -51.278 25.639  1.00 0.00 ? 428 GLY A C   1  
ATOM 2635   O O   . GLY A 1 428 ? -86.071  -51.749 26.206  1.00 0.00 ? 428 GLY A O   1  
ATOM 2636   N N   . TYR A 1 429 ? -83.854  -51.556 26.066  1.00 0.00 ? 429 TYR A N   1  
ATOM 2637   C CA  . TYR A 1 429 ? -83.550  -52.461 27.088  1.00 0.00 ? 429 TYR A CA  1  
ATOM 2638   C C   . TYR A 1 429 ? -83.646  -51.701 28.414  1.00 0.00 ? 429 TYR A C   1  
ATOM 2639   O O   . TYR A 1 429 ? -83.435  -52.344 29.460  1.00 0.00 ? 429 TYR A O   1  
ATOM 2640   C CB  . TYR A 1 429 ? -82.159  -53.115 26.911  1.00 0.00 ? 429 TYR A CB  1  
ATOM 2641   C CG  . TYR A 1 429 ? -81.848  -54.085 27.955  1.00 0.00 ? 429 TYR A CG  1  
ATOM 2642   C CD1 . TYR A 1 429 ? -82.812  -55.049 28.445  1.00 0.00 ? 429 TYR A CD1 1  
ATOM 2643   C CD2 . TYR A 1 429 ? -80.531  -54.043 28.587  1.00 0.00 ? 429 TYR A CD2 1  
ATOM 2644   C CE1 . TYR A 1 429 ? -82.489  -55.895 29.469  1.00 0.00 ? 429 TYR A CE1 1  
ATOM 2645   C CE2 . TYR A 1 429 ? -80.319  -54.892 29.688  1.00 0.00 ? 429 TYR A CE2 1  
ATOM 2646   C CZ  . TYR A 1 429 ? -81.261  -55.791 30.170  1.00 0.00 ? 429 TYR A CZ  1  
ATOM 2647   O OH  . TYR A 1 429 ? -81.083  -56.451 31.409  1.00 0.00 ? 429 TYR A OH  1  
ATOM 2648   N N   . GLN A 1 430 ? -83.952  -50.356 28.481  1.00 0.00 ? 430 GLN A N   1  
ATOM 2649   C CA  . GLN A 1 430 ? -83.951  -49.542 29.696  1.00 0.00 ? 430 GLN A CA  1  
ATOM 2650   C C   . GLN A 1 430 ? -85.017  -48.554 29.482  1.00 0.00 ? 430 GLN A C   1  
ATOM 2651   O O   . GLN A 1 430 ? -84.875  -47.366 29.737  1.00 0.00 ? 430 GLN A O   1  
ATOM 2652   C CB  . GLN A 1 430 ? -82.693  -48.737 30.001  1.00 0.00 ? 430 GLN A CB  1  
ATOM 2653   C CG  . GLN A 1 430 ? -81.481  -49.573 30.528  1.00 0.00 ? 430 GLN A CG  1  
ATOM 2654   C CD  . GLN A 1 430 ? -80.610  -50.272 29.450  1.00 0.00 ? 430 GLN A CD  1  
ATOM 2655   O OE1 . GLN A 1 430 ? -80.594  -49.905 28.270  1.00 0.00 ? 430 GLN A OE1 1  
ATOM 2656   N NE2 . GLN A 1 430 ? -79.993  -51.350 30.017  1.00 0.00 ? 430 GLN A NE2 1  
ATOM 2657   N N   . SER A 1 431 ? -86.191  -48.972 29.065  1.00 0.00 ? 431 SER A N   1  
ATOM 2658   C CA  . SER A 1 431 ? -87.333  -48.098 28.911  1.00 0.00 ? 431 SER A CA  1  
ATOM 2659   C C   . SER A 1 431 ? -88.526  -48.837 29.420  1.00 0.00 ? 431 SER A C   1  
ATOM 2660   O O   . SER A 1 431 ? -89.624  -48.687 28.914  1.00 0.00 ? 431 SER A O   1  
ATOM 2661   C CB  . SER A 1 431 ? -87.649  -47.656 27.444  1.00 0.00 ? 431 SER A CB  1  
ATOM 2662   O OG  . SER A 1 431 ? -86.652  -46.870 26.793  1.00 0.00 ? 431 SER A OG  1  
ATOM 2663   N N   . GLY A 1 432 ? -88.373  -49.770 30.418  1.00 0.00 ? 432 GLY A N   1  
ATOM 2664   C CA  . GLY A 1 432 ? -89.463  -50.672 30.728  1.00 0.00 ? 432 GLY A CA  1  
ATOM 2665   C C   . GLY A 1 432 ? -90.665  -50.053 31.316  1.00 0.00 ? 432 GLY A C   1  
ATOM 2666   O O   . GLY A 1 432 ? -91.780  -50.417 30.910  1.00 0.00 ? 432 GLY A O   1  
ATOM 2667   N N   . HIS A 1 433 ? -90.457  -49.081 32.214  1.00 0.00 ? 433 HIS A N   1  
ATOM 2668   C CA  . HIS A 1 433 ? -91.464  -48.471 32.989  1.00 0.00 ? 433 HIS A CA  1  
ATOM 2669   C C   . HIS A 1 433 ? -92.348  -47.729 32.082  1.00 0.00 ? 433 HIS A C   1  
ATOM 2670   O O   . HIS A 1 433 ? -93.564  -47.834 32.149  1.00 0.00 ? 433 HIS A O   1  
ATOM 2671   C CB  . HIS A 1 433 ? -90.989  -47.487 34.127  1.00 0.00 ? 433 HIS A CB  1  
ATOM 2672   C CG  . HIS A 1 433 ? -92.114  -47.125 35.142  1.00 0.00 ? 433 HIS A CG  1  
ATOM 2673   N ND1 . HIS A 1 433 ? -93.121  -48.040 35.416  1.00 0.00 ? 433 HIS A ND1 1  
ATOM 2674   C CD2 . HIS A 1 433 ? -92.409  -45.947 35.782  1.00 0.00 ? 433 HIS A CD2 1  
ATOM 2675   C CE1 . HIS A 1 433 ? -93.919  -47.469 36.265  1.00 0.00 ? 433 HIS A CE1 1  
ATOM 2676   N NE2 . HIS A 1 433 ? -93.527  -46.233 36.551  1.00 0.00 ? 433 HIS A NE2 1  
ATOM 2677   N N   . ASN A 1 434 ? -91.756  -47.003 31.091  1.00 0.00 ? 434 ASN A N   1  
ATOM 2678   C CA  . ASN A 1 434 ? -92.496  -46.262 30.194  1.00 0.00 ? 434 ASN A CA  1  
ATOM 2679   C C   . ASN A 1 434 ? -93.465  -47.135 29.326  1.00 0.00 ? 434 ASN A C   1  
ATOM 2680   O O   . ASN A 1 434 ? -94.617  -46.728 29.135  1.00 0.00 ? 434 ASN A O   1  
ATOM 2681   C CB  . ASN A 1 434 ? -91.603  -45.567 29.172  1.00 0.00 ? 434 ASN A CB  1  
ATOM 2682   C CG  . ASN A 1 434 ? -92.241  -44.612 28.180  1.00 0.00 ? 434 ASN A CG  1  
ATOM 2683   O OD1 . ASN A 1 434 ? -93.353  -44.142 28.294  1.00 0.00 ? 434 ASN A OD1 1  
ATOM 2684   N ND2 . ASN A 1 434 ? -91.497  -44.445 27.017  1.00 0.00 ? 434 ASN A ND2 1  
ATOM 2685   N N   . VAL A 1 435 ? -93.029  -48.308 28.855  1.00 0.00 ? 435 VAL A N   1  
ATOM 2686   C CA  . VAL A 1 435 ? -93.879  -49.199 28.037  1.00 0.00 ? 435 VAL A CA  1  
ATOM 2687   C C   . VAL A 1 435 ? -95.006  -49.692 28.802  1.00 0.00 ? 435 VAL A C   1  
ATOM 2688   O O   . VAL A 1 435 ? -96.146  -49.751 28.324  1.00 0.00 ? 435 VAL A O   1  
ATOM 2689   C CB  . VAL A 1 435 ? -92.887  -50.321 27.488  1.00 0.00 ? 435 VAL A CB  1  
ATOM 2690   C CG1 . VAL A 1 435 ? -93.755  -51.262 26.626  1.00 0.00 ? 435 VAL A CG1 1  
ATOM 2691   C CG2 . VAL A 1 435 ? -91.888  -49.650 26.530  1.00 0.00 ? 435 VAL A CG2 1  
ATOM 2692   N N   . LEU A 1 436 ? -94.834  -50.017 30.066  1.00 0.00 ? 436 LEU A N   1  
ATOM 2693   C CA  . LEU A 1 436 ? -95.922  -50.414 30.885  1.00 0.00 ? 436 LEU A CA  1  
ATOM 2694   C C   . LEU A 1 436 ? -96.965  -49.326 31.072  1.00 0.00 ? 436 LEU A C   1  
ATOM 2695   O O   . LEU A 1 436 ? -98.141  -49.506 30.946  1.00 0.00 ? 436 LEU A O   1  
ATOM 2696   C CB  . LEU A 1 436 ? -95.389  -50.879 32.234  1.00 0.00 ? 436 LEU A CB  1  
ATOM 2697   C CG  . LEU A 1 436 ? -94.377  -51.979 32.166  1.00 0.00 ? 436 LEU A CG  1  
ATOM 2698   C CD1 . LEU A 1 436 ? -93.700  -52.305 33.552  1.00 0.00 ? 436 LEU A CD1 1  
ATOM 2699   C CD2 . LEU A 1 436 ? -94.953  -53.264 31.517  1.00 0.00 ? 436 LEU A CD2 1  
ATOM 2700   N N   . LYS A 1 437 ? -96.556  -48.126 31.430  1.00 0.00 ? 437 LYS A N   1  
ATOM 2701   C CA  . LYS A 1 437 ? -97.493  -47.099 31.686  1.00 0.00 ? 437 LYS A CA  1  
ATOM 2702   C C   . LYS A 1 437 ? -98.147  -46.588 30.375  1.00 0.00 ? 437 LYS A C   1  
ATOM 2703   O O   . LYS A 1 437 ? -99.283  -46.174 30.377  1.00 0.00 ? 437 LYS A O   1  
ATOM 2704   C CB  . LYS A 1 437 ? -96.821  -45.890 32.381  1.00 0.00 ? 437 LYS A CB  1  
ATOM 2705   C CG  . LYS A 1 437 ? -96.273  -46.215 33.783  1.00 0.00 ? 437 LYS A CG  1  
ATOM 2706   C CD  . LYS A 1 437 ? -97.304  -45.929 34.911  1.00 0.00 ? 437 LYS A CD  1  
ATOM 2707   C CE  . LYS A 1 437 ? -98.300  -47.025 35.204  1.00 0.00 ? 437 LYS A CE  1  
ATOM 2708   N NZ  . LYS A 1 437 ? -99.260  -46.598 36.287  1.00 0.00 ? 437 LYS A NZ  1  
ATOM 2709   N N   . PHE A 1 438 ? -97.393  -46.637 29.227  1.00 0.00 ? 438 PHE A N   1  
ATOM 2710   C CA  . PHE A 1 438 ? -97.907  -46.312 27.893  1.00 0.00 ? 438 PHE A CA  1  
ATOM 2711   C C   . PHE A 1 438 ? -99.081  -47.249 27.490  1.00 0.00 ? 438 PHE A C   1  
ATOM 2712   O O   . PHE A 1 438 ? -100.094 -46.817 26.988  1.00 0.00 ? 438 PHE A O   1  
ATOM 2713   C CB  . PHE A 1 438 ? -96.750  -46.558 26.834  1.00 0.00 ? 438 PHE A CB  1  
ATOM 2714   C CG  . PHE A 1 438 ? -97.190  -46.540 25.355  1.00 0.00 ? 438 PHE A CG  1  
ATOM 2715   C CD1 . PHE A 1 438 ? -98.023  -45.488 24.889  1.00 0.00 ? 438 PHE A CD1 1  
ATOM 2716   C CD2 . PHE A 1 438 ? -96.846  -47.629 24.498  1.00 0.00 ? 438 PHE A CD2 1  
ATOM 2717   C CE1 . PHE A 1 438 ? -98.392  -45.392 23.544  1.00 0.00 ? 438 PHE A CE1 1  
ATOM 2718   C CE2 . PHE A 1 438 ? -97.112  -47.482 23.156  1.00 0.00 ? 438 PHE A CE2 1  
ATOM 2719   C CZ  . PHE A 1 438 ? -97.876  -46.378 22.663  1.00 0.00 ? 438 PHE A CZ  1  
ATOM 2720   N N   . LEU A 1 439 ? -98.933  -48.632 27.790  1.00 0.00 ? 439 LEU A N   1  
ATOM 2721   C CA  . LEU A 1 439 ? -99.936  -49.585 27.569  1.00 0.00 ? 439 LEU A CA  1  
ATOM 2722   C C   . LEU A 1 439 ? -101.143 -49.390 28.445  1.00 0.00 ? 439 LEU A C   1  
ATOM 2723   O O   . LEU A 1 439 ? -102.239 -49.694 27.917  1.00 0.00 ? 439 LEU A O   1  
ATOM 2724   C CB  . LEU A 1 439 ? -99.279  -50.965 27.705  1.00 0.00 ? 439 LEU A CB  1  
ATOM 2725   C CG  . LEU A 1 439 ? -98.225  -51.356 26.590  1.00 0.00 ? 439 LEU A CG  1  
ATOM 2726   C CD1 . LEU A 1 439 ? -97.454  -52.601 27.055  1.00 0.00 ? 439 LEU A CD1 1  
ATOM 2727   C CD2 . LEU A 1 439 ? -98.899  -51.577 25.289  1.00 0.00 ? 439 LEU A CD2 1  
ATOM 2728   N N   . THR A 1 440 ? -100.935 -49.008 29.733  1.00 0.00 ? 440 THR A N   1  
ATOM 2729   C CA  . THR A 1 440 ? -102.062 -49.013 30.650  1.00 0.00 ? 440 THR A CA  1  
ATOM 2730   C C   . THR A 1 440 ? -103.110 -47.938 30.117  1.00 0.00 ? 440 THR A C   1  
ATOM 2731   O O   . THR A 1 440 ? -104.296 -48.224 30.071  1.00 0.00 ? 440 THR A O   1  
ATOM 2732   C CB  . THR A 1 440 ? -101.684 -48.648 32.109  1.00 0.00 ? 440 THR A CB  1  
ATOM 2733   O OG1 . THR A 1 440 ? -100.788 -47.539 32.245  1.00 0.00 ? 440 THR A OG1 1  
ATOM 2734   C CG2 . THR A 1 440 ? -101.023 -49.915 32.774  1.00 0.00 ? 440 THR A CG2 1  
ATOM 2735   N N   . LYS A 1 441 ? -102.630 -46.767 29.774  1.00 0.00 ? 441 LYS A N   1  
ATOM 2736   C CA  . LYS A 1 441 ? -103.457 -45.743 29.221  1.00 0.00 ? 441 LYS A CA  1  
ATOM 2737   C C   . LYS A 1 441 ? -103.750 -46.092 27.813  1.00 0.00 ? 441 LYS A C   1  
ATOM 2738   O O   . LYS A 1 441 ? -102.879 -46.443 27.109  1.00 0.00 ? 441 LYS A O   1  
ATOM 2739   C CB  . LYS A 1 441 ? -102.668 -44.339 29.371  1.00 0.00 ? 441 LYS A CB  1  
ATOM 2740   C CG  . LYS A 1 441 ? -102.312 -43.811 30.706  1.00 0.00 ? 441 LYS A CG  1  
ATOM 2741   C CD  . LYS A 1 441 ? -101.421 -42.570 30.661  1.00 0.00 ? 441 LYS A CD  1  
ATOM 2742   C CE  . LYS A 1 441 ? -100.062 -42.768 29.943  1.00 0.00 ? 441 LYS A CE  1  
ATOM 2743   N NZ  . LYS A 1 441 ? -99.315  -41.460 30.002  1.00 0.00 ? 441 LYS A NZ  1  
ATOM 2744   N N   . ASN A 1 442 ? -105.023 -46.125 27.480  1.00 0.00 ? 442 ASN A N   1  
ATOM 2745   C CA  . ASN A 1 442 ? -105.576 -46.381 26.179  1.00 0.00 ? 442 ASN A CA  1  
ATOM 2746   C C   . ASN A 1 442 ? -105.576 -47.841 25.837  1.00 0.00 ? 442 ASN A C   1  
ATOM 2747   O O   . ASN A 1 442 ? -105.414 -48.314 24.682  1.00 0.00 ? 442 ASN A O   1  
ATOM 2748   C CB  . ASN A 1 442 ? -104.928 -45.729 24.857  1.00 0.00 ? 442 ASN A CB  1  
ATOM 2749   C CG  . ASN A 1 442 ? -104.954 -44.199 24.761  1.00 0.00 ? 442 ASN A CG  1  
ATOM 2750   O OD1 . ASN A 1 442 ? -104.193 -43.636 23.966  1.00 0.00 ? 442 ASN A OD1 1  
ATOM 2751   N ND2 . ASN A 1 442 ? -105.815 -43.587 25.607  1.00 0.00 ? 442 ASN A ND2 1  
ATOM 2752   N N   . MET A 1 443 ? -105.851 -48.775 26.854  1.00 0.00 ? 443 MET A N   1  
ATOM 2753   C CA  . MET A 1 443 ? -105.810 -50.220 26.685  1.00 0.00 ? 443 MET A CA  1  
ATOM 2754   C C   . MET A 1 443 ? -106.887 -50.686 25.703  1.00 0.00 ? 443 MET A C   1  
ATOM 2755   O O   . MET A 1 443 ? -106.592 -51.432 24.807  1.00 0.00 ? 443 MET A O   1  
ATOM 2756   C CB  . MET A 1 443 ? -105.962 -50.964 28.053  1.00 0.00 ? 443 MET A CB  1  
ATOM 2757   C CG  . MET A 1 443 ? -105.718 -52.501 27.942  1.00 0.00 ? 443 MET A CG  1  
ATOM 2758   S SD  . MET A 1 443 ? -107.328 -53.222 27.506  1.00 0.00 ? 443 MET A SD  1  
ATOM 2759   C CE  . MET A 1 443 ? -108.285 -53.077 29.108  1.00 0.00 ? 443 MET A CE  1  
ATOM 2760   N N   . GLY A 1 444 ? -108.076 -50.183 25.787  1.00 0.00 ? 444 GLY A N   1  
ATOM 2761   C CA  . GLY A 1 444 ? -109.232 -50.507 24.984  1.00 0.00 ? 444 GLY A CA  1  
ATOM 2762   C C   . GLY A 1 444 ? -109.119 -50.153 23.516  1.00 0.00 ? 444 GLY A C   1  
ATOM 2763   O O   . GLY A 1 444 ? -109.599 -50.943 22.711  1.00 0.00 ? 444 GLY A O   1  
ATOM 2764   N N   . GLU A 1 445 ? -108.497 -48.963 23.202  1.00 0.00 ? 445 GLU A N   1  
ATOM 2765   C CA  . GLU A 1 445 ? -108.253 -48.318 22.012  1.00 0.00 ? 445 GLU A CA  1  
ATOM 2766   C C   . GLU A 1 445 ? -107.212 -49.059 21.153  1.00 0.00 ? 445 GLU A C   1  
ATOM 2767   O O   . GLU A 1 445 ? -107.259 -49.155 19.920  1.00 0.00 ? 445 GLU A O   1  
ATOM 2768   C CB  . GLU A 1 445 ? -107.734 -46.922 22.274  1.00 0.00 ? 445 GLU A CB  1  
ATOM 2769   C CG  . GLU A 1 445 ? -108.642 -46.122 23.211  1.00 0.00 ? 445 GLU A CG  1  
ATOM 2770   C CD  . GLU A 1 445 ? -108.136 -44.685 23.298  1.00 0.00 ? 445 GLU A CD  1  
ATOM 2771   O OE1 . GLU A 1 445 ? -107.463 -44.287 22.324  1.00 0.00 ? 445 GLU A OE1 1  
ATOM 2772   O OE2 . GLU A 1 445 ? -108.468 -44.022 24.287  1.00 0.00 ? 445 GLU A OE2 1  
ATOM 2773   N N   . LEU A 1 446 ? -106.252 -49.611 21.863  1.00 0.00 ? 446 LEU A N   1  
ATOM 2774   C CA  . LEU A 1 446 ? -105.167 -50.445 21.246  1.00 0.00 ? 446 LEU A CA  1  
ATOM 2775   C C   . LEU A 1 446 ? -105.668 -51.825 20.898  1.00 0.00 ? 446 LEU A C   1  
ATOM 2776   O O   . LEU A 1 446 ? -105.242 -52.370 19.840  1.00 0.00 ? 446 LEU A O   1  
ATOM 2777   C CB  . LEU A 1 446 ? -103.948 -50.532 22.172  1.00 0.00 ? 446 LEU A CB  1  
ATOM 2778   C CG  . LEU A 1 446 ? -103.168 -49.197 22.216  1.00 0.00 ? 446 LEU A CG  1  
ATOM 2779   C CD1 . LEU A 1 446 ? -102.102 -49.314 23.298  1.00 0.00 ? 446 LEU A CD1 1  
ATOM 2780   C CD2 . LEU A 1 446 ? -102.707 -48.804 20.814  1.00 0.00 ? 446 LEU A CD2 1  
ATOM 2781   N N   . THR A 1 447 ? -106.625 -52.390 21.636  1.00 0.00 ? 447 THR A N   1  
ATOM 2782   C CA  . THR A 1 447 ? -107.158 -53.681 21.375  1.00 0.00 ? 447 THR A CA  1  
ATOM 2783   C C   . THR A 1 447 ? -107.833 -53.781 20.051  1.00 0.00 ? 447 THR A C   1  
ATOM 2784   O O   . THR A 1 447 ? -107.735 -54.711 19.250  1.00 0.00 ? 447 THR A O   1  
ATOM 2785   C CB  . THR A 1 447 ? -108.047 -54.103 22.493  1.00 0.00 ? 447 THR A CB  1  
ATOM 2786   O OG1 . THR A 1 447 ? -107.324 -54.067 23.733  1.00 0.00 ? 447 THR A OG1 1  
ATOM 2787   C CG2 . THR A 1 447 ? -108.450 -55.590 22.176  1.00 0.00 ? 447 THR A CG2 1  
ATOM 2788   N N   . LYS A 1 448 ? -108.536 -52.622 19.745  1.00 0.00 ? 448 LYS A N   1  
ATOM 2789   C CA  . LYS A 1 448 ? -109.209 -52.435 18.472  1.00 0.00 ? 448 LYS A CA  1  
ATOM 2790   C C   . LYS A 1 448 ? -108.293 -51.880 17.456  1.00 0.00 ? 448 LYS A C   1  
ATOM 2791   O O   . LYS A 1 448 ? -107.170 -51.572 17.811  1.00 0.00 ? 448 LYS A O   1  
ATOM 2792   C CB  . LYS A 1 448 ? -110.257 -51.253 18.629  1.00 0.00 ? 448 LYS A CB  1  
ATOM 2793   C CG  . LYS A 1 448 ? -111.419 -51.619 19.612  1.00 0.00 ? 448 LYS A CG  1  
ATOM 2794   C CD  . LYS A 1 448 ? -112.159 -50.407 20.156  1.00 0.00 ? 448 LYS A CD  1  
ATOM 2795   C CE  . LYS A 1 448 ? -113.357 -50.643 20.988  1.00 0.00 ? 448 LYS A CE  1  
ATOM 2796   N NZ  . LYS A 1 448 ? -114.512 -51.083 20.171  1.00 0.00 ? 448 LYS A NZ  1  
ATOM 2797   N N   . HIS A 1 449 ? -108.782 -51.722 16.218  1.00 0.00 ? 449 HIS A N   1  
ATOM 2798   C CA  . HIS A 1 449 ? -108.103 -51.160 15.132  1.00 0.00 ? 449 HIS A CA  1  
ATOM 2799   C C   . HIS A 1 449 ? -108.267 -49.652 15.226  1.00 0.00 ? 449 HIS A C   1  
ATOM 2800   O O   . HIS A 1 449 ? -108.945 -49.130 16.110  1.00 0.00 ? 449 HIS A O   1  
ATOM 2801   C CB  . HIS A 1 449 ? -108.764 -51.715 13.805  1.00 0.00 ? 449 HIS A CB  1  
ATOM 2802   C CG  . HIS A 1 449 ? -110.213 -51.376 13.720  1.00 0.00 ? 449 HIS A CG  1  
ATOM 2803   N ND1 . HIS A 1 449 ? -110.745 -50.124 13.571  1.00 0.00 ? 449 HIS A ND1 1  
ATOM 2804   C CD2 . HIS A 1 449 ? -111.277 -52.259 13.646  1.00 0.00 ? 449 HIS A CD2 1  
ATOM 2805   C CE1 . HIS A 1 449 ? -112.062 -50.290 13.401  1.00 0.00 ? 449 HIS A CE1 1  
ATOM 2806   N NE2 . HIS A 1 449 ? -112.422 -51.572 13.436  1.00 0.00 ? 449 HIS A NE2 1  
ATOM 2807   N N   . TYR A 1 450 ? -107.537 -48.960 14.366  1.00 0.00 ? 450 TYR A N   1  
ATOM 2808   C CA  . TYR A 1 450 ? -107.472 -47.547 14.276  1.00 0.00 ? 450 TYR A CA  1  
ATOM 2809   C C   . TYR A 1 450 ? -108.837 -47.010 14.092  1.00 0.00 ? 450 TYR A C   1  
ATOM 2810   O O   . TYR A 1 450 ? -109.570 -47.307 13.126  1.00 0.00 ? 450 TYR A O   1  
ATOM 2811   C CB  . TYR A 1 450 ? -106.552 -47.092 13.071  1.00 0.00 ? 450 TYR A CB  1  
ATOM 2812   C CG  . TYR A 1 450 ? -106.397 -45.633 12.957  1.00 0.00 ? 450 TYR A CG  1  
ATOM 2813   C CD1 . TYR A 1 450 ? -107.376 -44.788 12.376  1.00 0.00 ? 450 TYR A CD1 1  
ATOM 2814   C CD2 . TYR A 1 450 ? -105.110 -44.998 13.067  1.00 0.00 ? 450 TYR A CD2 1  
ATOM 2815   C CE1 . TYR A 1 450 ? -107.265 -43.409 12.384  1.00 0.00 ? 450 TYR A CE1 1  
ATOM 2816   C CE2 . TYR A 1 450 ? -104.933 -43.560 13.121  1.00 0.00 ? 450 TYR A CE2 1  
ATOM 2817   C CZ  . TYR A 1 450 ? -106.040 -42.780 12.647  1.00 0.00 ? 450 TYR A CZ  1  
ATOM 2818   O OH  . TYR A 1 450 ? -105.963 -41.410 12.459  1.00 0.00 ? 450 TYR A OH  1  
ATOM 2819   N N   . ARG A 1 451 ? -109.131 -46.046 14.965  1.00 0.00 ? 451 ARG A N   1  
ATOM 2820   C CA  . ARG A 1 451 ? -110.230 -45.124 14.758  1.00 0.00 ? 451 ARG A CA  1  
ATOM 2821   C C   . ARG A 1 451 ? -109.582 -43.811 14.899  1.00 0.00 ? 451 ARG A C   1  
ATOM 2822   O O   . ARG A 1 451 ? -108.491 -43.686 15.472  1.00 0.00 ? 451 ARG A O   1  
ATOM 2823   C CB  . ARG A 1 451 ? -111.335 -45.323 15.846  1.00 0.00 ? 451 ARG A CB  1  
ATOM 2824   C CG  . ARG A 1 451 ? -112.362 -46.446 15.503  1.00 0.00 ? 451 ARG A CG  1  
ATOM 2825   C CD  . ARG A 1 451 ? -113.463 -46.647 16.579  1.00 0.00 ? 451 ARG A CD  1  
ATOM 2826   N NE  . ARG A 1 451 ? -114.424 -47.775 16.175  1.00 0.00 ? 451 ARG A NE  1  
ATOM 2827   C CZ  . ARG A 1 451 ? -114.133 -49.167 16.334  1.00 0.00 ? 451 ARG A CZ  1  
ATOM 2828   N NH1 . ARG A 1 451 ? -112.831 -49.448 16.350  1.00 0.00 ? 451 ARG A NH1 1  
ATOM 2829   N NH2 . ARG A 1 451 ? -115.092 -50.163 16.378  1.00 0.00 ? 451 ARG A NH2 1  
ATOM 2830   N N   . ASN A 1 452 ? -110.157 -42.740 14.425  1.00 0.00 ? 452 ASN A N   1  
ATOM 2831   C CA  . ASN A 1 452 ? -109.696 -41.377 14.433  1.00 0.00 ? 452 ASN A CA  1  
ATOM 2832   C C   . ASN A 1 452 ? -109.441 -40.890 15.826  1.00 0.00 ? 452 ASN A C   1  
ATOM 2833   O O   . ASN A 1 452 ? -108.422 -40.219 16.037  1.00 0.00 ? 452 ASN A O   1  
ATOM 2834   C CB  . ASN A 1 452 ? -110.651 -40.378 13.766  1.00 0.00 ? 452 ASN A CB  1  
ATOM 2835   C CG  . ASN A 1 452 ? -110.667 -40.527 12.218  1.00 0.00 ? 452 ASN A CG  1  
ATOM 2836   O OD1 . ASN A 1 452 ? -111.795 -40.976 11.818  1.00 0.00 ? 452 ASN A OD1 1  
ATOM 2837   N ND2 . ASN A 1 452 ? -109.599 -40.291 11.390  1.00 0.00 ? 452 ASN A ND2 1  
ATOM 2838   N N   . ASP A 1 453 ? -110.368 -41.239 16.793  1.00 0.00 ? 453 ASP A N   1  
ATOM 2839   C CA  . ASP A 1 453 ? -110.244 -40.732 18.095  1.00 0.00 ? 453 ASP A CA  1  
ATOM 2840   C C   . ASP A 1 453 ? -109.085 -41.376 18.811  1.00 0.00 ? 453 ASP A C   1  
ATOM 2841   O O   . ASP A 1 453 ? -108.395 -40.667 19.587  1.00 0.00 ? 453 ASP A O   1  
ATOM 2842   C CB  . ASP A 1 453 ? -111.553 -40.940 18.999  1.00 0.00 ? 453 ASP A CB  1  
ATOM 2843   C CG  . ASP A 1 453 ? -112.022 -42.365 19.101  1.00 0.00 ? 453 ASP A CG  1  
ATOM 2844   O OD1 . ASP A 1 453 ? -112.526 -42.964 18.138  1.00 0.00 ? 453 ASP A OD1 1  
ATOM 2845   O OD2 . ASP A 1 453 ? -111.663 -42.836 20.214  1.00 0.00 ? 453 ASP A OD2 1  
ATOM 2846   N N   . ASN A 1 454 ? -108.731 -42.668 18.403  1.00 0.00 ? 454 ASN A N   1  
ATOM 2847   C CA  . ASN A 1 454 ? -107.720 -43.528 18.939  1.00 0.00 ? 454 ASN A CA  1  
ATOM 2848   C C   . ASN A 1 454 ? -106.418 -42.822 18.968  1.00 0.00 ? 454 ASN A C   1  
ATOM 2849   O O   . ASN A 1 454 ? -105.724 -42.780 20.010  1.00 0.00 ? 454 ASN A O   1  
ATOM 2850   C CB  . ASN A 1 454 ? -107.566 -44.953 18.306  1.00 0.00 ? 454 ASN A CB  1  
ATOM 2851   C CG  . ASN A 1 454 ? -108.722 -45.956 18.482  1.00 0.00 ? 454 ASN A CG  1  
ATOM 2852   O OD1 . ASN A 1 454 ? -108.675 -47.074 18.013  1.00 0.00 ? 454 ASN A OD1 1  
ATOM 2853   N ND2 . ASN A 1 454 ? -109.732 -45.497 19.243  1.00 0.00 ? 454 ASN A ND2 1  
ATOM 2854   N N   . ASN A 1 455 ? -106.175 -42.220 17.775  1.00 0.00 ? 455 ASN A N   1  
ATOM 2855   C CA  . ASN A 1 455 ? -105.060 -41.497 17.273  1.00 0.00 ? 455 ASN A CA  1  
ATOM 2856   C C   . ASN A 1 455 ? -104.758 -40.250 18.107  1.00 0.00 ? 455 ASN A C   1  
ATOM 2857   O O   . ASN A 1 455 ? -103.588 -39.927 18.402  1.00 0.00 ? 455 ASN A O   1  
ATOM 2858   C CB  . ASN A 1 455 ? -105.149 -41.095 15.791  1.00 0.00 ? 455 ASN A CB  1  
ATOM 2859   C CG  . ASN A 1 455 ? -103.965 -40.285 15.245  1.00 0.00 ? 455 ASN A CG  1  
ATOM 2860   O OD1 . ASN A 1 455 ? -104.110 -39.132 14.900  1.00 0.00 ? 455 ASN A OD1 1  
ATOM 2861   N ND2 . ASN A 1 455 ? -102.788 -40.982 15.127  1.00 0.00 ? 455 ASN A ND2 1  
ATOM 2862   N N   . ALA A 1 456 ? -105.892 -39.510 18.480  1.00 0.00 ? 456 ALA A N   1  
ATOM 2863   C CA  . ALA A 1 456 ? -105.829 -38.228 19.234  1.00 0.00 ? 456 ALA A CA  1  
ATOM 2864   C C   . ALA A 1 456 ? -105.284 -38.513 20.618  1.00 0.00 ? 456 ALA A C   1  
ATOM 2865   O O   . ALA A 1 456 ? -104.329 -37.911 21.082  1.00 0.00 ? 456 ALA A O   1  
ATOM 2866   C CB  . ALA A 1 456 ? -107.251 -37.698 19.373  1.00 0.00 ? 456 ALA A CB  1  
ATOM 2867   N N   . ASN A 1 457 ? -105.862 -39.593 21.180  1.00 0.00 ? 457 ASN A N   1  
ATOM 2868   C CA  . ASN A 1 457 ? -105.486 -40.068 22.467  1.00 0.00 ? 457 ASN A CA  1  
ATOM 2869   C C   . ASN A 1 457 ? -104.069 -40.590 22.553  1.00 0.00 ? 457 ASN A C   1  
ATOM 2870   O O   . ASN A 1 457 ? -103.261 -40.326 23.393  1.00 0.00 ? 457 ASN A O   1  
ATOM 2871   C CB  . ASN A 1 457 ? -106.463 -41.072 23.096  1.00 0.00 ? 457 ASN A CB  1  
ATOM 2872   C CG  . ASN A 1 457 ? -107.936 -40.658 22.952  1.00 0.00 ? 457 ASN A CG  1  
ATOM 2873   O OD1 . ASN A 1 457 ? -108.718 -41.469 22.352  1.00 0.00 ? 457 ASN A OD1 1  
ATOM 2874   N ND2 . ASN A 1 457 ? -108.256 -39.429 23.511  1.00 0.00 ? 457 ASN A ND2 1  
ATOM 2875   N N   . TYR A 1 458 ? -103.695 -41.353 21.540  1.00 0.00 ? 458 TYR A N   1  
ATOM 2876   C CA  . TYR A 1 458 ? -102.397 -41.984 21.417  1.00 0.00 ? 458 TYR A CA  1  
ATOM 2877   C C   . TYR A 1 458 ? -101.291 -40.986 21.346  1.00 0.00 ? 458 TYR A C   1  
ATOM 2878   O O   . TYR A 1 458 ? -100.289 -41.097 22.058  1.00 0.00 ? 458 TYR A O   1  
ATOM 2879   C CB  . TYR A 1 458 ? -102.484 -42.760 20.109  1.00 0.00 ? 458 TYR A CB  1  
ATOM 2880   C CG  . TYR A 1 458 ? -101.073 -43.271 19.564  1.00 0.00 ? 458 TYR A CG  1  
ATOM 2881   C CD1 . TYR A 1 458 ? -100.617 -44.592 19.908  1.00 0.00 ? 458 TYR A CD1 1  
ATOM 2882   C CD2 . TYR A 1 458 ? -100.322 -42.593 18.559  1.00 0.00 ? 458 TYR A CD2 1  
ATOM 2883   C CE1 . TYR A 1 458 ? -99.494  -45.121 19.256  1.00 0.00 ? 458 TYR A CE1 1  
ATOM 2884   C CE2 . TYR A 1 458 ? -99.132  -43.082 17.991  1.00 0.00 ? 458 TYR A CE2 1  
ATOM 2885   C CZ  . TYR A 1 458 ? -98.722  -44.369 18.428  1.00 0.00 ? 458 TYR A CZ  1  
ATOM 2886   O OH  . TYR A 1 458 ? -97.441  -44.858 18.058  1.00 0.00 ? 458 TYR A OH  1  
ATOM 2887   N N   . ASP A 1 459 ? -101.467 -39.889 20.585  1.00 0.00 ? 459 ASP A N   1  
ATOM 2888   C CA  . ASP A 1 459 ? -100.609 -38.732 20.346  1.00 0.00 ? 459 ASP A CA  1  
ATOM 2889   C C   . ASP A 1 459 ? -100.489 -37.999 21.678  1.00 0.00 ? 459 ASP A C   1  
ATOM 2890   O O   . ASP A 1 459 ? -99.388  -37.495 21.912  1.00 0.00 ? 459 ASP A O   1  
ATOM 2891   C CB  . ASP A 1 459 ? -101.107 -37.700 19.285  1.00 0.00 ? 459 ASP A CB  1  
ATOM 2892   C CG  . ASP A 1 459 ? -101.376 -38.352 17.897  1.00 0.00 ? 459 ASP A CG  1  
ATOM 2893   O OD1 . ASP A 1 459 ? -100.546 -39.152 17.470  1.00 0.00 ? 459 ASP A OD1 1  
ATOM 2894   O OD2 . ASP A 1 459 ? -102.345 -37.941 17.217  1.00 0.00 ? 459 ASP A OD2 1  
ATOM 2895   N N   . LYS A 1 460 ? -101.574 -37.875 22.602  1.00 0.00 ? 460 LYS A N   1  
ATOM 2896   C CA  . LYS A 1 460 ? -101.571 -37.207 23.873  1.00 0.00 ? 460 LYS A CA  1  
ATOM 2897   C C   . LYS A 1 460 ? -100.665 -37.884 24.797  1.00 0.00 ? 460 LYS A C   1  
ATOM 2898   O O   . LYS A 1 460 ? -99.898  -37.342 25.492  1.00 0.00 ? 460 LYS A O   1  
ATOM 2899   C CB  . LYS A 1 460 ? -102.964 -37.187 24.451  1.00 0.00 ? 460 LYS A CB  1  
ATOM 2900   C CG  . LYS A 1 460 ? -103.106 -36.346 25.708  1.00 0.00 ? 460 LYS A CG  1  
ATOM 2901   C CD  . LYS A 1 460 ? -102.986 -34.904 25.528  1.00 0.00 ? 460 LYS A CD  1  
ATOM 2902   C CE  . LYS A 1 460 ? -102.678 -34.113 26.895  1.00 0.00 ? 460 LYS A CE  1  
ATOM 2903   N NZ  . LYS A 1 460 ? -102.762 -32.660 26.671  1.00 0.00 ? 460 LYS A NZ  1  
ATOM 2904   N N   . LEU A 1 461 ? -100.735 -39.285 24.783  1.00 0.00 ? 461 LEU A N   1  
ATOM 2905   C CA  . LEU A 1 461 ? -99.871  -40.047 25.643  1.00 0.00 ? 461 LEU A CA  1  
ATOM 2906   C C   . LEU A 1 461 ? -98.365  -39.858 25.284  1.00 0.00 ? 461 LEU A C   1  
ATOM 2907   O O   . LEU A 1 461 ? -97.478  -39.727 26.135  1.00 0.00 ? 461 LEU A O   1  
ATOM 2908   C CB  . LEU A 1 461 ? -100.040 -41.591 25.573  1.00 0.00 ? 461 LEU A CB  1  
ATOM 2909   C CG  . LEU A 1 461 ? -101.499 -42.155 25.870  1.00 0.00 ? 461 LEU A CG  1  
ATOM 2910   C CD1 . LEU A 1 461 ? -101.370 -43.671 25.936  1.00 0.00 ? 461 LEU A CD1 1  
ATOM 2911   C CD2 . LEU A 1 461 ? -102.207 -41.392 27.075  1.00 0.00 ? 461 LEU A CD2 1  
ATOM 2912   N N   . LEU A 1 462 ? -98.194  -39.733 23.915  1.00 0.00 ? 462 LEU A N   1  
ATOM 2913   C CA  . LEU A 1 462 ? -96.863  -39.392 23.411  1.00 0.00 ? 462 LEU A CA  1  
ATOM 2914   C C   . LEU A 1 462 ? -96.334  -38.024 23.892  1.00 0.00 ? 462 LEU A C   1  
ATOM 2915   O O   . LEU A 1 462 ? -95.205  -37.881 24.308  1.00 0.00 ? 462 LEU A O   1  
ATOM 2916   C CB  . LEU A 1 462 ? -96.814  -39.379 21.872  1.00 0.00 ? 462 LEU A CB  1  
ATOM 2917   C CG  . LEU A 1 462 ? -96.989  -40.656 21.125  1.00 0.00 ? 462 LEU A CG  1  
ATOM 2918   C CD1 . LEU A 1 462 ? -96.872  -40.435 19.663  1.00 0.00 ? 462 LEU A CD1 1  
ATOM 2919   C CD2 . LEU A 1 462 ? -96.137  -41.862 21.624  1.00 0.00 ? 462 LEU A CD2 1  
ATOM 2920   N N   . GLN A 1 463 ? -97.171  -36.966 23.837  1.00 0.00 ? 463 GLN A N   1  
ATOM 2921   C CA  . GLN A 1 463 ? -96.837  -35.608 24.268  1.00 0.00 ? 463 GLN A CA  1  
ATOM 2922   C C   . GLN A 1 463 ? -96.646  -35.634 25.728  1.00 0.00 ? 463 GLN A C   1  
ATOM 2923   O O   . GLN A 1 463 ? -95.613  -35.039 26.098  1.00 0.00 ? 463 GLN A O   1  
ATOM 2924   C CB  . GLN A 1 463 ? -97.923  -34.489 24.009  1.00 0.00 ? 463 GLN A CB  1  
ATOM 2925   C CG  . GLN A 1 463 ? -97.670  -33.972 22.618  1.00 0.00 ? 463 GLN A CG  1  
ATOM 2926   C CD  . GLN A 1 463 ? -98.791  -33.012 22.213  1.00 0.00 ? 463 GLN A CD  1  
ATOM 2927   O OE1 . GLN A 1 463 ? -98.752  -31.869 22.653  1.00 0.00 ? 463 GLN A OE1 1  
ATOM 2928   N NE2 . GLN A 1 463 ? -99.793  -33.458 21.489  1.00 0.00 ? 463 GLN A NE2 1  
ATOM 2929   N N   . ASN A 1 464 ? -97.464  -36.361 26.515  1.00 0.00 ? 464 ASN A N   1  
ATOM 2930   C CA  . ASN A 1 464 ? -97.165  -36.402 27.944  1.00 0.00 ? 464 ASN A CA  1  
ATOM 2931   C C   . ASN A 1 464 ? -95.840  -36.973 28.315  1.00 0.00 ? 464 ASN A C   1  
ATOM 2932   O O   . ASN A 1 464 ? -95.115  -36.469 29.184  1.00 0.00 ? 464 ASN A O   1  
ATOM 2933   C CB  . ASN A 1 464 ? -98.244  -37.169 28.723  1.00 0.00 ? 464 ASN A CB  1  
ATOM 2934   C CG  . ASN A 1 464 ? -99.568  -36.326 28.774  1.00 0.00 ? 464 ASN A CG  1  
ATOM 2935   O OD1 . ASN A 1 464 ? -99.590  -35.215 29.287  1.00 0.00 ? 464 ASN A OD1 1  
ATOM 2936   N ND2 . ASN A 1 464 ? -100.693 -37.036 28.543  1.00 0.00 ? 464 ASN A ND2 1  
ATOM 2937   N N   . PHE A 1 465 ? -95.391  -38.094 27.703  1.00 0.00 ? 465 PHE A N   1  
ATOM 2938   C CA  . PHE A 1 465 ? -94.147  -38.830 27.983  1.00 0.00 ? 465 PHE A CA  1  
ATOM 2939   C C   . PHE A 1 465 ? -92.974  -37.955 27.599  1.00 0.00 ? 465 PHE A C   1  
ATOM 2940   O O   . PHE A 1 465 ? -91.944  -37.946 28.257  1.00 0.00 ? 465 PHE A O   1  
ATOM 2941   C CB  . PHE A 1 465 ? -93.959  -40.159 27.310  1.00 0.00 ? 465 PHE A CB  1  
ATOM 2942   C CG  . PHE A 1 465 ? -94.785  -41.150 27.941  1.00 0.00 ? 465 PHE A CG  1  
ATOM 2943   C CD1 . PHE A 1 465 ? -94.918  -41.337 29.330  1.00 0.00 ? 465 PHE A CD1 1  
ATOM 2944   C CD2 . PHE A 1 465 ? -95.589  -41.954 27.096  1.00 0.00 ? 465 PHE A CD2 1  
ATOM 2945   C CE1 . PHE A 1 465 ? -95.900  -42.199 29.865  1.00 0.00 ? 465 PHE A CE1 1  
ATOM 2946   C CE2 . PHE A 1 465 ? -96.471  -42.847 27.691  1.00 0.00 ? 465 PHE A CE2 1  
ATOM 2947   C CZ  . PHE A 1 465 ? -96.584  -43.060 29.024  1.00 0.00 ? 465 PHE A CZ  1  
ATOM 2948   N N   . GLU A 1 466 ? -93.076  -37.156 26.526  1.00 0.00 ? 466 GLU A N   1  
ATOM 2949   C CA  . GLU A 1 466 ? -92.067  -36.203 26.144  1.00 0.00 ? 466 GLU A CA  1  
ATOM 2950   C C   . GLU A 1 466 ? -91.836  -35.097 27.121  1.00 0.00 ? 466 GLU A C   1  
ATOM 2951   O O   . GLU A 1 466 ? -90.928  -34.328 27.037  1.00 0.00 ? 466 GLU A O   1  
ATOM 2952   C CB  . GLU A 1 466 ? -92.291  -35.602 24.724  1.00 0.00 ? 466 GLU A CB  1  
ATOM 2953   C CG  . GLU A 1 466 ? -92.261  -36.669 23.607  1.00 0.00 ? 466 GLU A CG  1  
ATOM 2954   C CD  . GLU A 1 466 ? -92.624  -36.175 22.212  1.00 0.00 ? 466 GLU A CD  1  
ATOM 2955   O OE1 . GLU A 1 466 ? -91.728  -35.692 21.458  1.00 0.00 ? 466 GLU A OE1 1  
ATOM 2956   O OE2 . GLU A 1 466 ? -93.835  -36.224 21.988  1.00 0.00 ? 466 GLU A OE2 1  
ATOM 2957   N N   . LEU A 1 467 ? -92.747  -34.851 28.000  1.00 0.00 ? 467 LEU A N   1  
ATOM 2958   C CA  . LEU A 1 467 ? -92.607  -33.986 29.160  1.00 0.00 ? 467 LEU A CA  1  
ATOM 2959   C C   . LEU A 1 467 ? -91.930  -34.683 30.332  1.00 0.00 ? 467 LEU A C   1  
ATOM 2960   O O   . LEU A 1 467 ? -91.462  -34.017 31.257  1.00 0.00 ? 467 LEU A O   1  
ATOM 2961   C CB  . LEU A 1 467 ? -93.980  -33.446 29.662  1.00 0.00 ? 467 LEU A CB  1  
ATOM 2962   C CG  . LEU A 1 467 ? -94.762  -32.701 28.527  1.00 0.00 ? 467 LEU A CG  1  
ATOM 2963   C CD1 . LEU A 1 467 ? -96.163  -32.334 29.080  1.00 0.00 ? 467 LEU A CD1 1  
ATOM 2964   C CD2 . LEU A 1 467 ? -93.997  -31.425 28.124  1.00 0.00 ? 467 LEU A CD2 1  
ATOM 2965   N N   . GLU A 1 468 ? -92.108  -36.014 30.518  1.00 0.00 ? 468 GLU A N   1  
ATOM 2966   C CA  . GLU A 1 468 ? -91.834  -36.792 31.780  1.00 0.00 ? 468 GLU A CA  1  
ATOM 2967   C C   . GLU A 1 468 ? -90.411  -37.199 32.004  1.00 0.00 ? 468 GLU A C   1  
ATOM 2968   O O   . GLU A 1 468 ? -90.051  -37.170 33.165  1.00 0.00 ? 468 GLU A O   1  
ATOM 2969   C CB  . GLU A 1 468 ? -92.746  -38.031 31.969  1.00 0.00 ? 468 GLU A CB  1  
ATOM 2970   C CG  . GLU A 1 468 ? -94.163  -37.661 32.410  1.00 0.00 ? 468 GLU A CG  1  
ATOM 2971   C CD  . GLU A 1 468 ? -95.132  -38.792 32.209  1.00 0.00 ? 468 GLU A CD  1  
ATOM 2972   O OE1 . GLU A 1 468 ? -95.014  -39.804 32.939  1.00 0.00 ? 468 GLU A OE1 1  
ATOM 2973   O OE2 . GLU A 1 468 ? -96.160  -38.618 31.455  1.00 0.00 ? 468 GLU A OE2 1  
ATOM 2974   N N   . ARG A 1 469 ? -89.592  -37.625 31.000  1.00 0.00 ? 469 ARG A N   1  
ATOM 2975   C CA  . ARG A 1 469 ? -88.190  -37.922 31.273  1.00 0.00 ? 469 ARG A CA  1  
ATOM 2976   C C   . ARG A 1 469 ? -87.277  -37.158 30.393  1.00 0.00 ? 469 ARG A C   1  
ATOM 2977   O O   . ARG A 1 469 ? -87.670  -36.480 29.438  1.00 0.00 ? 469 ARG A O   1  
ATOM 2978   C CB  . ARG A 1 469 ? -87.848  -39.478 31.260  1.00 0.00 ? 469 ARG A CB  1  
ATOM 2979   C CG  . ARG A 1 469 ? -88.148  -40.224 29.968  1.00 0.00 ? 469 ARG A CG  1  
ATOM 2980   C CD  . ARG A 1 469 ? -87.791  -41.743 30.116  1.00 0.00 ? 469 ARG A CD  1  
ATOM 2981   N NE  . ARG A 1 469 ? -88.333  -42.573 29.008  1.00 0.00 ? 469 ARG A NE  1  
ATOM 2982   C CZ  . ARG A 1 469 ? -87.621  -42.818 27.868  1.00 0.00 ? 469 ARG A CZ  1  
ATOM 2983   N NH1 . ARG A 1 469 ? -86.275  -42.605 27.805  1.00 0.00 ? 469 ARG A NH1 1  
ATOM 2984   N NH2 . ARG A 1 469 ? -88.301  -43.314 26.797  1.00 0.00 ? 469 ARG A NH2 1  
ATOM 2985   N N   . GLN A 1 470 ? -85.985  -37.310 30.784  1.00 0.00 ? 470 GLN A N   1  
ATOM 2986   C CA  . GLN A 1 470 ? -84.798  -36.691 30.242  1.00 0.00 ? 470 GLN A CA  1  
ATOM 2987   C C   . GLN A 1 470 ? -84.816  -35.275 30.719  1.00 0.00 ? 470 GLN A C   1  
ATOM 2988   O O   . GLN A 1 470 ? -85.685  -34.446 30.350  1.00 0.00 ? 470 GLN A O   1  
ATOM 2989   C CB  . GLN A 1 470 ? -84.580  -36.929 28.711  1.00 0.00 ? 470 GLN A CB  1  
ATOM 2990   C CG  . GLN A 1 470 ? -83.059  -37.227 28.330  1.00 0.00 ? 470 GLN A CG  1  
ATOM 2991   C CD  . GLN A 1 470 ? -82.778  -37.379 26.871  1.00 0.00 ? 470 GLN A CD  1  
ATOM 2992   O OE1 . GLN A 1 470 ? -83.734  -37.408 26.148  1.00 0.00 ? 470 GLN A OE1 1  
ATOM 2993   N NE2 . GLN A 1 470 ? -81.504  -37.551 26.464  1.00 0.00 ? 470 GLN A NE2 1  
ATOM 2994   N N   . SER A 1 471 ? -83.811  -34.998 31.592  1.00 0.00 ? 471 SER A N   1  
ATOM 2995   C CA  . SER A 1 471 ? -83.615  -33.617 32.128  1.00 0.00 ? 471 SER A CA  1  
ATOM 2996   C C   . SER A 1 471 ? -82.146  -33.623 32.462  1.00 0.00 ? 471 SER A C   1  
ATOM 2997   O O   . SER A 1 471 ? -81.635  -32.849 33.296  1.00 0.00 ? 471 SER A O   1  
ATOM 2998   C CB  . SER A 1 471 ? -84.428  -33.376 33.439  1.00 0.00 ? 471 SER A CB  1  
ATOM 2999   O OG  . SER A 1 471 ? -85.829  -33.629 33.273  1.00 0.00 ? 471 SER A OG  1  
ATOM 3000   N N   . GLU A 1 472 ? -81.354  -34.458 31.751  1.00 0.00 ? 472 GLU A N   1  
ATOM 3001   C CA  . GLU A 1 472 ? -79.915  -34.639 31.847  1.00 0.00 ? 472 GLU A CA  1  
ATOM 3002   C C   . GLU A 1 472 ? -79.186  -33.779 30.906  1.00 0.00 ? 472 GLU A C   1  
ATOM 3003   O O   . GLU A 1 472 ? -78.032  -33.894 30.627  1.00 0.00 ? 472 GLU A O   1  
ATOM 3004   C CB  . GLU A 1 472 ? -79.534  -36.104 31.572  1.00 0.00 ? 472 GLU A CB  1  
ATOM 3005   C CG  . GLU A 1 472 ? -80.474  -37.132 32.291  1.00 0.00 ? 472 GLU A CG  1  
ATOM 3006   C CD  . GLU A 1 472 ? -80.647  -36.765 33.759  1.00 0.00 ? 472 GLU A CD  1  
ATOM 3007   O OE1 . GLU A 1 472 ? -79.646  -36.771 34.495  1.00 0.00 ? 472 GLU A OE1 1  
ATOM 3008   O OE2 . GLU A 1 472 ? -81.791  -36.404 34.147  1.00 0.00 ? 472 GLU A OE2 1  
ATOM 3009   N N   . ASN A 1 473 ? -79.968  -32.804 30.351  1.00 0.00 ? 473 ASN A N   1  
ATOM 3010   C CA  . ASN A 1 473 ? -79.526  -32.050 29.185  1.00 0.00 ? 473 ASN A CA  1  
ATOM 3011   C C   . ASN A 1 473 ? -80.445  -30.870 28.960  1.00 0.00 ? 473 ASN A C   1  
ATOM 3012   O O   . ASN A 1 473 ? -81.549  -30.966 29.316  1.00 0.00 ? 473 ASN A O   1  
ATOM 3013   C CB  . ASN A 1 473 ? -79.420  -33.032 27.916  1.00 0.00 ? 473 ASN A CB  1  
ATOM 3014   C CG  . ASN A 1 473 ? -80.609  -33.950 27.653  1.00 0.00 ? 473 ASN A CG  1  
ATOM 3015   O OD1 . ASN A 1 473 ? -81.766  -33.827 28.137  1.00 0.00 ? 473 ASN A OD1 1  
ATOM 3016   N ND2 . ASN A 1 473 ? -80.348  -34.826 26.644  1.00 0.00 ? 473 ASN A ND2 1  
ATOM 3017   N N   . PRO A 1 474 ? -80.021  -29.763 28.245  1.00 0.00 ? 474 PRO A N   1  
ATOM 3018   C CA  . PRO A 1 474 ? -80.844  -28.726 27.889  1.00 0.00 ? 474 PRO A CA  1  
ATOM 3019   C C   . PRO A 1 474 ? -81.941  -29.199 26.953  1.00 0.00 ? 474 PRO A C   1  
ATOM 3020   O O   . PRO A 1 474 ? -83.053  -28.659 27.020  1.00 0.00 ? 474 PRO A O   1  
ATOM 3021   C CB  . PRO A 1 474 ? -80.019  -27.654 27.134  1.00 0.00 ? 474 PRO A CB  1  
ATOM 3022   C CG  . PRO A 1 474 ? -78.550  -27.913 27.527  1.00 0.00 ? 474 PRO A CG  1  
ATOM 3023   C CD  . PRO A 1 474 ? -78.659  -29.470 27.823  1.00 0.00 ? 474 PRO A CD  1  
ATOM 3024   N N   . ASN A 1 475 ? -81.621  -30.154 26.049  1.00 0.00 ? 475 ASN A N   1  
ATOM 3025   C CA  . ASN A 1 475 ? -82.423  -30.678 24.932  1.00 0.00 ? 475 ASN A CA  1  
ATOM 3026   C C   . ASN A 1 475 ? -82.438  -32.177 25.000  1.00 0.00 ? 475 ASN A C   1  
ATOM 3027   O O   . ASN A 1 475 ? -81.415  -32.824 25.066  1.00 0.00 ? 475 ASN A O   1  
ATOM 3028   C CB  . ASN A 1 475 ? -81.900  -30.201 23.554  1.00 0.00 ? 475 ASN A CB  1  
ATOM 3029   C CG  . ASN A 1 475 ? -81.829  -28.701 23.407  1.00 0.00 ? 475 ASN A CG  1  
ATOM 3030   O OD1 . ASN A 1 475 ? -80.797  -28.058 23.565  1.00 0.00 ? 475 ASN A OD1 1  
ATOM 3031   N ND2 . ASN A 1 475 ? -82.952  -28.144 22.945  1.00 0.00 ? 475 ASN A ND2 1  
ATOM 3032   N N   . ASN A 1 476 ? -83.672  -32.740 25.099  1.00 0.00 ? 476 ASN A N   1  
ATOM 3033   C CA  . ASN A 1 476 ? -83.848  -34.145 25.285  1.00 0.00 ? 476 ASN A CA  1  
ATOM 3034   C C   . ASN A 1 476 ? -83.569  -34.727 23.958  1.00 0.00 ? 476 ASN A C   1  
ATOM 3035   O O   . ASN A 1 476 ? -84.303  -34.497 23.038  1.00 0.00 ? 476 ASN A O   1  
ATOM 3036   C CB  . ASN A 1 476 ? -85.310  -34.492 25.687  1.00 0.00 ? 476 ASN A CB  1  
ATOM 3037   C CG  . ASN A 1 476 ? -85.658  -33.818 27.069  1.00 0.00 ? 476 ASN A CG  1  
ATOM 3038   O OD1 . ASN A 1 476 ? -86.849  -33.919 27.449  1.00 0.00 ? 476 ASN A OD1 1  
ATOM 3039   N ND2 . ASN A 1 476 ? -84.648  -33.206 27.737  1.00 0.00 ? 476 ASN A ND2 1  
ATOM 3040   N N   . LEU A 1 477 ? -82.506  -35.507 23.763  1.00 0.00 ? 477 LEU A N   1  
ATOM 3041   C CA  . LEU A 1 477 ? -82.458  -36.347 22.538  1.00 0.00 ? 477 LEU A CA  1  
ATOM 3042   C C   . LEU A 1 477 ? -83.505  -37.380 22.361  1.00 0.00 ? 477 LEU A C   1  
ATOM 3043   O O   . LEU A 1 477 ? -84.051  -37.523 21.261  1.00 0.00 ? 477 LEU A O   1  
ATOM 3044   C CB  . LEU A 1 477 ? -81.129  -37.111 22.416  1.00 0.00 ? 477 LEU A CB  1  
ATOM 3045   C CG  . LEU A 1 477 ? -79.793  -36.278 22.320  1.00 0.00 ? 477 LEU A CG  1  
ATOM 3046   C CD1 . LEU A 1 477 ? -78.625  -37.111 22.638  1.00 0.00 ? 477 LEU A CD1 1  
ATOM 3047   C CD2 . LEU A 1 477 ? -79.630  -35.701 20.904  1.00 0.00 ? 477 LEU A CD2 1  
ATOM 3048   N N   . MET A 1 478 ? -83.796  -38.162 23.395  1.00 0.00 ? 478 MET A N   1  
ATOM 3049   C CA  . MET A 1 478 ? -84.693  -39.301 23.239  1.00 0.00 ? 478 MET A CA  1  
ATOM 3050   C C   . MET A 1 478 ? -86.026  -38.929 22.896  1.00 0.00 ? 478 MET A C   1  
ATOM 3051   O O   . MET A 1 478 ? -86.623  -39.422 21.929  1.00 0.00 ? 478 MET A O   1  
ATOM 3052   C CB  . MET A 1 478 ? -84.736  -40.159 24.506  1.00 0.00 ? 478 MET A CB  1  
ATOM 3053   C CG  . MET A 1 478 ? -83.457  -40.663 25.092  1.00 0.00 ? 478 MET A CG  1  
ATOM 3054   S SD  . MET A 1 478 ? -82.612  -41.830 23.988  1.00 0.00 ? 478 MET A SD  1  
ATOM 3055   C CE  . MET A 1 478 ? -81.502  -40.713 23.128  1.00 0.00 ? 478 MET A CE  1  
ATOM 3056   N N   . ARG A 1 479 ? -86.507  -37.962 23.721  1.00 0.00 ? 479 ARG A N   1  
ATOM 3057   C CA  . ARG A 1 479 ? -87.912  -37.610 23.682  1.00 0.00 ? 479 ARG A CA  1  
ATOM 3058   C C   . ARG A 1 479 ? -88.223  -36.920 22.376  1.00 0.00 ? 479 ARG A C   1  
ATOM 3059   O O   . ARG A 1 479 ? -89.236  -37.235 21.763  1.00 0.00 ? 479 ARG A O   1  
ATOM 3060   C CB  . ARG A 1 479 ? -88.298  -36.932 24.999  1.00 0.00 ? 479 ARG A CB  1  
ATOM 3061   C CG  . ARG A 1 479 ? -88.069  -37.828 26.301  1.00 0.00 ? 479 ARG A CG  1  
ATOM 3062   C CD  . ARG A 1 479 ? -88.774  -39.208 26.271  1.00 0.00 ? 479 ARG A CD  1  
ATOM 3063   N NE  . ARG A 1 479 ? -90.061  -39.042 25.513  1.00 0.00 ? 479 ARG A NE  1  
ATOM 3064   C CZ  . ARG A 1 479 ? -90.798  -40.055 24.957  1.00 0.00 ? 479 ARG A CZ  1  
ATOM 3065   N NH1 . ARG A 1 479 ? -90.607  -41.354 25.293  1.00 0.00 ? 479 ARG A NH1 1  
ATOM 3066   N NH2 . ARG A 1 479 ? -91.818  -39.706 24.086  1.00 0.00 ? 479 ARG A NH2 1  
ATOM 3067   N N   . GLN A 1 480 ? -87.381  -35.920 22.039  1.00 0.00 ? 480 GLN A N   1  
ATOM 3068   C CA  . GLN A 1 480 ? -87.619  -35.058 20.881  1.00 0.00 ? 480 GLN A CA  1  
ATOM 3069   C C   . GLN A 1 480 ? -87.442  -35.801 19.584  1.00 0.00 ? 480 GLN A C   1  
ATOM 3070   O O   . GLN A 1 480 ? -88.197  -35.637 18.679  1.00 0.00 ? 480 GLN A O   1  
ATOM 3071   C CB  . GLN A 1 480 ? -86.666  -33.795 20.862  1.00 0.00 ? 480 GLN A CB  1  
ATOM 3072   C CG  . GLN A 1 480 ? -87.284  -32.698 19.989  1.00 0.00 ? 480 GLN A CG  1  
ATOM 3073   C CD  . GLN A 1 480 ? -86.386  -31.472 19.796  1.00 0.00 ? 480 GLN A CD  1  
ATOM 3074   O OE1 . GLN A 1 480 ? -86.640  -30.558 18.982  1.00 0.00 ? 480 GLN A OE1 1  
ATOM 3075   N NE2 . GLN A 1 480 ? -85.324  -31.424 20.652  1.00 0.00 ? 480 GLN A NE2 1  
ATOM 3076   N N   . LEU A 1 481 ? -86.321  -36.536 19.377  1.00 0.00 ? 481 LEU A N   1  
ATOM 3077   C CA  . LEU A 1 481 ? -85.899  -37.082 18.115  1.00 0.00 ? 481 LEU A CA  1  
ATOM 3078   C C   . LEU A 1 481 ? -86.735  -38.295 17.817  1.00 0.00 ? 481 LEU A C   1  
ATOM 3079   O O   . LEU A 1 481 ? -86.852  -38.663 16.671  1.00 0.00 ? 481 LEU A O   1  
ATOM 3080   C CB  . LEU A 1 481 ? -84.413  -37.501 18.109  1.00 0.00 ? 481 LEU A CB  1  
ATOM 3081   C CG  . LEU A 1 481 ? -83.333  -36.352 18.085  1.00 0.00 ? 481 LEU A CG  1  
ATOM 3082   C CD1 . LEU A 1 481 ? -82.912  -35.912 16.607  1.00 0.00 ? 481 LEU A CD1 1  
ATOM 3083   C CD2 . LEU A 1 481 ? -83.517  -35.158 18.974  1.00 0.00 ? 481 LEU A CD2 1  
ATOM 3084   N N   . LEU A 1 482 ? -87.282  -38.993 18.839  1.00 0.00 ? 482 LEU A N   1  
ATOM 3085   C CA  . LEU A 1 482 ? -87.947  -40.288 18.652  1.00 0.00 ? 482 LEU A CA  1  
ATOM 3086   C C   . LEU A 1 482 ? -89.358  -40.093 19.116  1.00 0.00 ? 482 LEU A C   1  
ATOM 3087   O O   . LEU A 1 482 ? -89.661  -39.702 20.238  1.00 0.00 ? 482 LEU A O   1  
ATOM 3088   C CB  . LEU A 1 482 ? -87.193  -41.453 19.329  1.00 0.00 ? 482 LEU A CB  1  
ATOM 3089   C CG  . LEU A 1 482 ? -85.779  -41.571 18.791  1.00 0.00 ? 482 LEU A CG  1  
ATOM 3090   C CD1 . LEU A 1 482 ? -84.699  -41.084 19.766  1.00 0.00 ? 482 LEU A CD1 1  
ATOM 3091   C CD2 . LEU A 1 482 ? -85.559  -43.002 18.197  1.00 0.00 ? 482 LEU A CD2 1  
ATOM 3092   N N   . MET A 1 483 ? -90.267  -40.494 18.211  1.00 0.00 ? 483 MET A N   1  
ATOM 3093   C CA  . MET A 1 483 ? -91.692  -40.502 18.477  1.00 0.00 ? 483 MET A CA  1  
ATOM 3094   C C   . MET A 1 483 ? -92.122  -41.841 17.958  1.00 0.00 ? 483 MET A C   1  
ATOM 3095   O O   . MET A 1 483 ? -91.409  -42.474 17.253  1.00 0.00 ? 483 MET A O   1  
ATOM 3096   C CB  . MET A 1 483 ? -92.539  -39.423 17.813  1.00 0.00 ? 483 MET A CB  1  
ATOM 3097   C CG  . MET A 1 483 ? -91.833  -38.031 17.994  1.00 0.00 ? 483 MET A CG  1  
ATOM 3098   S SD  . MET A 1 483 ? -90.908  -37.412 16.591  1.00 0.00 ? 483 MET A SD  1  
ATOM 3099   C CE  . MET A 1 483 ? -92.363  -37.070 15.555  1.00 0.00 ? 483 MET A CE  1  
ATOM 3100   N N   . ILE A 1 484 ? -93.305  -42.342 18.356  1.00 0.00 ? 484 ILE A N   1  
ATOM 3101   C CA  . ILE A 1 484 ? -93.888  -43.583 18.005  1.00 0.00 ? 484 ILE A CA  1  
ATOM 3102   C C   . ILE A 1 484 ? -95.084  -43.321 17.056  1.00 0.00 ? 484 ILE A C   1  
ATOM 3103   O O   . ILE A 1 484 ? -95.714  -42.313 17.247  1.00 0.00 ? 484 ILE A O   1  
ATOM 3104   C CB  . ILE A 1 484 ? -94.544  -44.483 19.109  1.00 0.00 ? 484 ILE A CB  1  
ATOM 3105   C CG1 . ILE A 1 484 ? -93.730  -44.369 20.471  1.00 0.00 ? 484 ILE A CG1 1  
ATOM 3106   C CG2 . ILE A 1 484 ? -94.614  -45.909 18.628  1.00 0.00 ? 484 ILE A CG2 1  
ATOM 3107   C CD1 . ILE A 1 484 ? -94.302  -45.221 21.616  1.00 0.00 ? 484 ILE A CD1 1  
ATOM 3108   N N   . GLN A 1 485 ? -95.282  -44.156 15.977  1.00 0.00 ? 485 GLN A N   1  
ATOM 3109   C CA  . GLN A 1 485 ? -96.232  -43.865 14.882  1.00 0.00 ? 485 GLN A CA  1  
ATOM 3110   C C   . GLN A 1 485 ? -97.429  -44.777 14.841  1.00 0.00 ? 485 GLN A C   1  
ATOM 3111   O O   . GLN A 1 485 ? -97.343  -45.953 15.286  1.00 0.00 ? 485 GLN A O   1  
ATOM 3112   C CB  . GLN A 1 485 ? -95.425  -43.984 13.537  1.00 0.00 ? 485 GLN A CB  1  
ATOM 3113   C CG  . GLN A 1 485 ? -96.101  -43.813 12.192  1.00 0.00 ? 485 GLN A CG  1  
ATOM 3114   C CD  . GLN A 1 485 ? -96.513  -45.151 11.650  1.00 0.00 ? 485 GLN A CD  1  
ATOM 3115   O OE1 . GLN A 1 485 ? -96.920  -46.118 12.338  1.00 0.00 ? 485 GLN A OE1 1  
ATOM 3116   N NE2 . GLN A 1 485 ? -96.275  -45.240 10.253  1.00 0.00 ? 485 GLN A NE2 1  
ATOM 3117   N N   . PHE A 1 486 ? -98.563  -44.269 14.316  1.00 0.00 ? 486 PHE A N   1  
ATOM 3118   C CA  . PHE A 1 486 ? -99.716  -45.158 14.118  1.00 0.00 ? 486 PHE A CA  1  
ATOM 3119   C C   . PHE A 1 486 ? -100.216 -45.089 12.615  1.00 0.00 ? 486 PHE A C   1  
ATOM 3120   O O   . PHE A 1 486 ? -100.337 -44.025 12.000  1.00 0.00 ? 486 PHE A O   1  
ATOM 3121   C CB  . PHE A 1 486 ? -100.844 -44.572 14.990  1.00 0.00 ? 486 PHE A CB  1  
ATOM 3122   C CG  . PHE A 1 486 ? -102.081 -45.314 15.319  1.00 0.00 ? 486 PHE A CG  1  
ATOM 3123   C CD1 . PHE A 1 486 ? -102.289 -46.647 14.980  1.00 0.00 ? 486 PHE A CD1 1  
ATOM 3124   C CD2 . PHE A 1 486 ? -103.128 -44.663 15.997  1.00 0.00 ? 486 PHE A CD2 1  
ATOM 3125   C CE1 . PHE A 1 486 ? -103.464 -47.331 15.287  1.00 0.00 ? 486 PHE A CE1 1  
ATOM 3126   C CE2 . PHE A 1 486 ? -104.284 -45.366 16.389  1.00 0.00 ? 486 PHE A CE2 1  
ATOM 3127   C CZ  . PHE A 1 486 ? -104.490 -46.720 16.017  1.00 0.00 ? 486 PHE A CZ  1  
ATOM 3128   N N   . ASP A 1 487 ? -100.508 -46.223 11.987  1.00 0.00 ? 487 ASP A N   1  
ATOM 3129   C CA  . ASP A 1 487 ? -101.082 -46.241 10.648  1.00 0.00 ? 487 ASP A CA  1  
ATOM 3130   C C   . ASP A 1 487 ? -102.610 -46.190 10.652  1.00 0.00 ? 487 ASP A C   1  
ATOM 3131   O O   . ASP A 1 487 ? -103.338 -46.765 11.405  1.00 0.00 ? 487 ASP A O   1  
ATOM 3132   C CB  . ASP A 1 487 ? -100.509 -47.412 9.828   1.00 0.00 ? 487 ASP A CB  1  
ATOM 3133   C CG  . ASP A 1 487 ? -99.060  -47.174 9.373   1.00 0.00 ? 487 ASP A CG  1  
ATOM 3134   O OD1 . ASP A 1 487 ? -98.963  -46.296 8.507   1.00 0.00 ? 487 ASP A OD1 1  
ATOM 3135   O OD2 . ASP A 1 487 ? -98.117  -47.998 9.722   1.00 0.00 ? 487 ASP A OD2 1  
ATOM 3136   N N   . THR A 1 488 ? -103.122 -45.381 9.722   1.00 0.00 ? 488 THR A N   1  
ATOM 3137   C CA  . THR A 1 488 ? -104.551 -45.052 9.591   1.00 0.00 ? 488 THR A CA  1  
ATOM 3138   C C   . THR A 1 488 ? -105.308 -46.135 8.877   1.00 0.00 ? 488 THR A C   1  
ATOM 3139   O O   . THR A 1 488 ? -104.766 -46.825 8.044   1.00 0.00 ? 488 THR A O   1  
ATOM 3140   C CB  . THR A 1 488 ? -104.650 -43.742 8.766   1.00 0.00 ? 488 THR A CB  1  
ATOM 3141   O OG1 . THR A 1 488 ? -103.979 -43.717 7.527   1.00 0.00 ? 488 THR A OG1 1  
ATOM 3142   C CG2 . THR A 1 488 ? -104.135 -42.584 9.653   1.00 0.00 ? 488 THR A CG2 1  
ATOM 3143   N N   . GLU A 1 489 ? -106.597 -46.213 9.256   1.00 0.00 ? 489 GLU A N   1  
ATOM 3144   C CA  . GLU A 1 489 ? -107.558 -47.176 8.732   1.00 0.00 ? 489 GLU A CA  1  
ATOM 3145   C C   . GLU A 1 489 ? -108.685 -46.247 8.400   1.00 0.00 ? 489 GLU A C   1  
ATOM 3146   O O   . GLU A 1 489 ? -108.883 -45.872 7.258   1.00 0.00 ? 489 GLU A O   1  
ATOM 3147   C CB  . GLU A 1 489 ? -108.083 -48.196 9.774   1.00 0.00 ? 489 GLU A CB  1  
ATOM 3148   C CG  . GLU A 1 489 ? -109.148 -49.231 9.204   1.00 0.00 ? 489 GLU A CG  1  
ATOM 3149   C CD  . GLU A 1 489 ? -109.779 -50.255 10.150  1.00 0.00 ? 489 GLU A CD  1  
ATOM 3150   O OE1 . GLU A 1 489 ? -110.812 -49.871 10.760  1.00 0.00 ? 489 GLU A OE1 1  
ATOM 3151   O OE2 . GLU A 1 489 ? -109.314 -51.443 10.185  1.00 0.00 ? 489 GLU A OE2 1  
ATOM 3152   N N   . THR A 1 490 ? -109.567 -45.970 9.360   1.00 0.00 ? 490 THR A N   1  
ATOM 3153   C CA  . THR A 1 490 ? -110.751 -45.172 9.202   1.00 0.00 ? 490 THR A CA  1  
ATOM 3154   C C   . THR A 1 490 ? -110.534 -43.749 9.708   1.00 0.00 ? 490 THR A C   1  
ATOM 3155   O O   . THR A 1 490 ? -109.403 -43.455 10.179  1.00 0.00 ? 490 THR A O   1  
ATOM 3156   C CB  . THR A 1 490 ? -111.980 -45.888 9.791   1.00 0.00 ? 490 THR A CB  1  
ATOM 3157   O OG1 . THR A 1 490 ? -113.053 -44.988 9.886   1.00 0.00 ? 490 THR A OG1 1  
ATOM 3158   C CG2 . THR A 1 490 ? -111.753 -46.471 11.183  1.00 0.00 ? 490 THR A CG2 1  
ATOM 3159   N N   . LYS A 1 554 ? -107.127 -53.573 11.275  1.00 0.00 ? 554 LYS A N   1  
ATOM 3160   C CA  . LYS A 1 554 ? -107.366 -54.892 11.971  1.00 0.00 ? 554 LYS A CA  1  
ATOM 3161   C C   . LYS A 1 554 ? -107.257 -54.799 13.471  1.00 0.00 ? 554 LYS A C   1  
ATOM 3162   O O   . LYS A 1 554 ? -108.146 -55.127 14.308  1.00 0.00 ? 554 LYS A O   1  
ATOM 3163   C CB  . LYS A 1 554 ? -106.324 -55.969 11.555  1.00 0.00 ? 554 LYS A CB  1  
ATOM 3164   C CG  . LYS A 1 554 ? -106.497 -57.327 12.346  1.00 0.00 ? 554 LYS A CG  1  
ATOM 3165   C CD  . LYS A 1 554 ? -105.753 -58.483 11.784  1.00 0.00 ? 554 LYS A CD  1  
ATOM 3166   C CE  . LYS A 1 554 ? -104.256 -58.174 11.649  1.00 0.00 ? 554 LYS A CE  1  
ATOM 3167   N NZ  . LYS A 1 554 ? -103.445 -57.973 12.847  1.00 0.00 ? 554 LYS A NZ  1  
ATOM 3168   N N   . SER A 1 555 ? -106.051 -54.308 13.912  1.00 0.00 ? 555 SER A N   1  
ATOM 3169   C CA  . SER A 1 555 ? -105.823 -54.083 15.264  1.00 0.00 ? 555 SER A CA  1  
ATOM 3170   C C   . SER A 1 555 ? -104.831 -53.054 15.275  1.00 0.00 ? 555 SER A C   1  
ATOM 3171   O O   . SER A 1 555 ? -104.079 -52.916 14.284  1.00 0.00 ? 555 SER A O   1  
ATOM 3172   C CB  . SER A 1 555 ? -105.386 -55.364 16.022  1.00 0.00 ? 555 SER A CB  1  
ATOM 3173   O OG  . SER A 1 555 ? -104.242 -55.886 15.359  1.00 0.00 ? 555 SER A OG  1  
ATOM 3174   N N   . ALA A 1 556 ? -104.625 -52.269 16.388  1.00 0.00 ? 556 ALA A N   1  
ATOM 3175   C CA  . ALA A 1 556 ? -103.656 -51.177 16.492  1.00 0.00 ? 556 ALA A CA  1  
ATOM 3176   C C   . ALA A 1 556 ? -102.318 -51.699 16.380  1.00 0.00 ? 556 ALA A C   1  
ATOM 3177   O O   . ALA A 1 556 ? -101.435 -51.014 15.930  1.00 0.00 ? 556 ALA A O   1  
ATOM 3178   C CB  . ALA A 1 556 ? -103.715 -50.573 17.905  1.00 0.00 ? 556 ALA A CB  1  
ATOM 3179   N N   . ILE A 1 557 ? -102.085 -52.867 16.968  1.00 0.00 ? 557 ILE A N   1  
ATOM 3180   C CA  . ILE A 1 557 ? -100.826 -53.446 17.330  1.00 0.00 ? 557 ILE A CA  1  
ATOM 3181   C C   . ILE A 1 557 ? -100.043 -53.583 16.043  1.00 0.00 ? 557 ILE A C   1  
ATOM 3182   O O   . ILE A 1 557 ? -98.860  -53.191 15.979  1.00 0.00 ? 557 ILE A O   1  
ATOM 3183   C CB  . ILE A 1 557 ? -101.090 -54.787 18.003  1.00 0.00 ? 557 ILE A CB  1  
ATOM 3184   C CG1 . ILE A 1 557 ? -101.886 -54.623 19.371  1.00 0.00 ? 557 ILE A CG1 1  
ATOM 3185   C CG2 . ILE A 1 557 ? -99.748  -55.462 18.363  1.00 0.00 ? 557 ILE A CG2 1  
ATOM 3186   C CD1 . ILE A 1 557 ? -102.178 -55.951 20.090  1.00 0.00 ? 557 ILE A CD1 1  
ATOM 3187   N N   . TYR A 1 558 ? -100.740 -54.041 14.947  1.00 0.00 ? 558 TYR A N   1  
ATOM 3188   C CA  . TYR A 1 558 ? -100.073 -54.109 13.654  1.00 0.00 ? 558 TYR A CA  1  
ATOM 3189   C C   . TYR A 1 558 ? -99.647  -52.770 13.070  1.00 0.00 ? 558 TYR A C   1  
ATOM 3190   O O   . TYR A 1 558 ? -98.546  -52.610 12.578  1.00 0.00 ? 558 TYR A O   1  
ATOM 3191   C CB  . TYR A 1 558 ? -101.021 -54.827 12.668  1.00 0.00 ? 558 TYR A CB  1  
ATOM 3192   C CG  . TYR A 1 558 ? -100.504 -55.371 11.362  1.00 0.00 ? 558 TYR A CG  1  
ATOM 3193   C CD1 . TYR A 1 558 ? -99.090  -55.589 11.085  1.00 0.00 ? 558 TYR A CD1 1  
ATOM 3194   C CD2 . TYR A 1 558 ? -101.395 -55.770 10.416  1.00 0.00 ? 558 TYR A CD2 1  
ATOM 3195   C CE1 . TYR A 1 558 ? -98.565  -56.002 9.900   1.00 0.00 ? 558 TYR A CE1 1  
ATOM 3196   C CE2 . TYR A 1 558 ? -100.875 -56.239 9.153   1.00 0.00 ? 558 TYR A CE2 1  
ATOM 3197   C CZ  . TYR A 1 558 ? -99.506  -56.372 8.956   1.00 0.00 ? 558 TYR A CZ  1  
ATOM 3198   O OH  . TYR A 1 558 ? -99.104  -56.723 7.660   1.00 0.00 ? 558 TYR A OH  1  
ATOM 3199   N N   . HIS A 1 559 ? -100.558 -51.805 13.232  1.00 0.00 ? 559 HIS A N   1  
ATOM 3200   C CA  . HIS A 1 559 ? -100.500 -50.487 12.711  1.00 0.00 ? 559 HIS A CA  1  
ATOM 3201   C C   . HIS A 1 559 ? -99.432  -49.645 13.343  1.00 0.00 ? 559 HIS A C   1  
ATOM 3202   O O   . HIS A 1 559 ? -98.934  -48.661 12.755  1.00 0.00 ? 559 HIS A O   1  
ATOM 3203   C CB  . HIS A 1 559 ? -101.797 -49.738 12.952  1.00 0.00 ? 559 HIS A CB  1  
ATOM 3204   C CG  . HIS A 1 559 ? -103.005 -50.500 12.520  1.00 0.00 ? 559 HIS A CG  1  
ATOM 3205   N ND1 . HIS A 1 559 ? -104.285 -49.962 12.680  1.00 0.00 ? 559 HIS A ND1 1  
ATOM 3206   C CD2 . HIS A 1 559 ? -103.170 -51.572 11.712  1.00 0.00 ? 559 HIS A CD2 1  
ATOM 3207   C CE1 . HIS A 1 559 ? -105.098 -50.776 11.984  1.00 0.00 ? 559 HIS A CE1 1  
ATOM 3208   N NE2 . HIS A 1 559 ? -104.449 -51.727 11.349  1.00 0.00 ? 559 HIS A NE2 1  
ATOM 3209   N N   . LEU A 1 560 ? -98.940  -50.017 14.542  1.00 0.00 ? 560 LEU A N   1  
ATOM 3210   C CA  . LEU A 1 560 ? -97.904  -49.254 15.160  1.00 0.00 ? 560 LEU A CA  1  
ATOM 3211   C C   . LEU A 1 560 ? -96.561  -49.560 14.460  1.00 0.00 ? 560 LEU A C   1  
ATOM 3212   O O   . LEU A 1 560 ? -96.272  -50.658 13.980  1.00 0.00 ? 560 LEU A O   1  
ATOM 3213   C CB  . LEU A 1 560 ? -97.712  -49.549 16.648  1.00 0.00 ? 560 LEU A CB  1  
ATOM 3214   C CG  . LEU A 1 560 ? -98.494  -48.622 17.566  1.00 0.00 ? 560 LEU A CG  1  
ATOM 3215   C CD1 . LEU A 1 560 ? -100.039 -48.831 17.580  1.00 0.00 ? 560 LEU A CD1 1  
ATOM 3216   C CD2 . LEU A 1 560 ? -97.899  -48.869 18.982  1.00 0.00 ? 560 LEU A CD2 1  
ATOM 3217   N N   . LYS A 1 561 ? -95.748  -48.501 14.436  1.00 0.00 ? 561 LYS A N   1  
ATOM 3218   C CA  . LYS A 1 561 ? -94.395  -48.405 13.913  1.00 0.00 ? 561 LYS A CA  1  
ATOM 3219   C C   . LYS A 1 561 ? -93.770  -47.340 14.784  1.00 0.00 ? 561 LYS A C   1  
ATOM 3220   O O   . LYS A 1 561 ? -94.364  -46.660 15.604  1.00 0.00 ? 561 LYS A O   1  
ATOM 3221   C CB  . LYS A 1 561 ? -94.296  -47.969 12.452  1.00 0.00 ? 561 LYS A CB  1  
ATOM 3222   C CG  . LYS A 1 561 ? -95.143  -48.740 11.468  1.00 0.00 ? 561 LYS A CG  1  
ATOM 3223   C CD  . LYS A 1 561 ? -94.609  -50.144 11.163  1.00 0.00 ? 561 LYS A CD  1  
ATOM 3224   C CE  . LYS A 1 561 ? -95.576  -50.912 10.204  1.00 0.00 ? 561 LYS A CE  1  
ATOM 3225   N NZ  . LYS A 1 561 ? -96.924  -51.074 10.728  1.00 0.00 ? 561 LYS A NZ  1  
ATOM 3226   N N   . PHE A 1 562 ? -92.461  -47.157 14.748  1.00 0.00 ? 562 PHE A N   1  
ATOM 3227   C CA  . PHE A 1 562 ? -91.717  -46.292 15.605  1.00 0.00 ? 562 PHE A CA  1  
ATOM 3228   C C   . PHE A 1 562 ? -90.985  -45.456 14.620  1.00 0.00 ? 562 PHE A C   1  
ATOM 3229   O O   . PHE A 1 562 ? -90.563  -45.961 13.549  1.00 0.00 ? 562 PHE A O   1  
ATOM 3230   C CB  . PHE A 1 562 ? -90.822  -47.066 16.605  1.00 0.00 ? 562 PHE A CB  1  
ATOM 3231   C CG  . PHE A 1 562 ? -90.113  -46.125 17.554  1.00 0.00 ? 562 PHE A CG  1  
ATOM 3232   C CD1 . PHE A 1 562 ? -90.640  -45.720 18.817  1.00 0.00 ? 562 PHE A CD1 1  
ATOM 3233   C CD2 . PHE A 1 562 ? -88.739  -45.837 17.274  1.00 0.00 ? 562 PHE A CD2 1  
ATOM 3234   C CE1 . PHE A 1 562 ? -89.784  -45.135 19.728  1.00 0.00 ? 562 PHE A CE1 1  
ATOM 3235   C CE2 . PHE A 1 562 ? -87.863  -45.444 18.287  1.00 0.00 ? 562 PHE A CE2 1  
ATOM 3236   C CZ  . PHE A 1 562 ? -88.404  -45.034 19.465  1.00 0.00 ? 562 PHE A CZ  1  
ATOM 3237   N N   . ASP A 1 563 ? -90.879  -44.122 14.854  1.00 0.00 ? 563 ASP A N   1  
ATOM 3238   C CA  . ASP A 1 563 ? -90.305  -43.174 13.889  1.00 0.00 ? 563 ASP A CA  1  
ATOM 3239   C C   . ASP A 1 563 ? -89.223  -42.356 14.518  1.00 0.00 ? 563 ASP A C   1  
ATOM 3240   O O   . ASP A 1 563 ? -89.298  -42.010 15.674  1.00 0.00 ? 563 ASP A O   1  
ATOM 3241   C CB  . ASP A 1 563 ? -91.369  -42.313 13.158  1.00 0.00 ? 563 ASP A CB  1  
ATOM 3242   C CG  . ASP A 1 563 ? -92.236  -41.500 14.173  1.00 0.00 ? 563 ASP A CG  1  
ATOM 3243   O OD1 . ASP A 1 563 ? -92.972  -42.146 14.944  1.00 0.00 ? 563 ASP A OD1 1  
ATOM 3244   O OD2 . ASP A 1 563 ? -92.267  -40.272 14.019  1.00 0.00 ? 563 ASP A OD2 1  
ATOM 3245   N N   . ILE A 1 564 ? -88.137  -42.044 13.817  1.00 0.00 ? 564 ILE A N   1  
ATOM 3246   C CA  . ILE A 1 564 ? -87.048  -41.234 14.259  1.00 0.00 ? 564 ILE A CA  1  
ATOM 3247   C C   . ILE A 1 564 ? -86.909  -40.028 13.323  1.00 0.00 ? 564 ILE A C   1  
ATOM 3248   O O   . ILE A 1 564 ? -86.850  -40.094 12.113  1.00 0.00 ? 564 ILE A O   1  
ATOM 3249   C CB  . ILE A 1 564 ? -85.705  -41.979 14.360  1.00 0.00 ? 564 ILE A CB  1  
ATOM 3250   C CG1 . ILE A 1 564 ? -84.512  -41.001 14.643  1.00 0.00 ? 564 ILE A CG1 1  
ATOM 3251   C CG2 . ILE A 1 564 ? -85.593  -42.873 13.085  1.00 0.00 ? 564 ILE A CG2 1  
ATOM 3252   C CD1 . ILE A 1 564 ? -83.145  -41.696 14.754  1.00 0.00 ? 564 ILE A CD1 1  
ATOM 3253   N N   . ASN A 1 565 ? -86.730  -38.801 13.925  1.00 0.00 ? 565 ASN A N   1  
ATOM 3254   C CA  . ASN A 1 565 ? -86.449  -37.544 13.322  1.00 0.00 ? 565 ASN A CA  1  
ATOM 3255   C C   . ASN A 1 565 ? -85.002  -37.406 13.518  1.00 0.00 ? 565 ASN A C   1  
ATOM 3256   O O   . ASN A 1 565 ? -84.540  -37.679 14.603  1.00 0.00 ? 565 ASN A O   1  
ATOM 3257   C CB  . ASN A 1 565 ? -87.129  -36.307 14.062  1.00 0.00 ? 565 ASN A CB  1  
ATOM 3258   C CG  . ASN A 1 565 ? -88.637  -36.091 13.693  1.00 0.00 ? 565 ASN A CG  1  
ATOM 3259   O OD1 . ASN A 1 565 ? -89.307  -36.965 13.116  1.00 0.00 ? 565 ASN A OD1 1  
ATOM 3260   N ND2 . ASN A 1 565 ? -89.100  -34.891 14.039  1.00 0.00 ? 565 ASN A ND2 1  
ATOM 3261   N N   . ILE A 1 566 ? -84.277  -37.073 12.427  1.00 0.00 ? 566 ILE A N   1  
ATOM 3262   C CA  . ILE A 1 566 ? -82.832  -37.092 12.369  1.00 0.00 ? 566 ILE A CA  1  
ATOM 3263   C C   . ILE A 1 566 ? -82.073  -35.862 12.987  1.00 0.00 ? 566 ILE A C   1  
ATOM 3264   O O   . ILE A 1 566 ? -82.595  -34.749 13.043  1.00 0.00 ? 566 ILE A O   1  
ATOM 3265   C CB  . ILE A 1 566 ? -82.349  -37.225 10.968  1.00 0.00 ? 566 ILE A CB  1  
ATOM 3266   C CG1 . ILE A 1 566 ? -82.931  -36.107 9.996   1.00 0.00 ? 566 ILE A CG1 1  
ATOM 3267   C CG2 . ILE A 1 566 ? -82.659  -38.680 10.521  1.00 0.00 ? 566 ILE A CG2 1  
ATOM 3268   C CD1 . ILE A 1 566 ? -82.444  -36.225 8.541   1.00 0.00 ? 566 ILE A CD1 1  
ATOM 3269   N N   . PRO A 1 567 ? -80.826  -36.115 13.534  1.00 0.00 ? 567 PRO A N   1  
ATOM 3270   C CA  . PRO A 1 567 ? -79.987  -35.081 14.081  1.00 0.00 ? 567 PRO A CA  1  
ATOM 3271   C C   . PRO A 1 567 ? -79.046  -34.595 12.984  1.00 0.00 ? 567 PRO A C   1  
ATOM 3272   O O   . PRO A 1 567 ? -79.380  -34.620 11.781  1.00 0.00 ? 567 PRO A O   1  
ATOM 3273   C CB  . PRO A 1 567 ? -79.286  -35.804 15.233  1.00 0.00 ? 567 PRO A CB  1  
ATOM 3274   C CG  . PRO A 1 567 ? -79.115  -37.253 14.624  1.00 0.00 ? 567 PRO A CG  1  
ATOM 3275   C CD  . PRO A 1 567 ? -80.314  -37.460 13.681  1.00 0.00 ? 567 PRO A CD  1  
ATOM 3276   N N   . TYR A 1 568 ? -77.874  -34.076 13.344  1.00 0.00 ? 568 TYR A N   1  
ATOM 3277   C CA  . TYR A 1 568 ? -76.881  -33.564 12.404  1.00 0.00 ? 568 TYR A CA  1  
ATOM 3278   C C   . TYR A 1 568 ? -75.818  -33.353 13.396  1.00 0.00 ? 568 TYR A C   1  
ATOM 3279   O O   . TYR A 1 568 ? -76.147  -32.888 14.466  1.00 0.00 ? 568 TYR A O   1  
ATOM 3280   C CB  . TYR A 1 568 ? -77.337  -32.293 11.599  1.00 0.00 ? 568 TYR A CB  1  
ATOM 3281   C CG  . TYR A 1 568 ? -77.613  -31.109 12.413  1.00 0.00 ? 568 TYR A CG  1  
ATOM 3282   C CD1 . TYR A 1 568 ? -76.575  -30.258 12.755  1.00 0.00 ? 568 TYR A CD1 1  
ATOM 3283   C CD2 . TYR A 1 568 ? -78.923  -30.898 12.932  1.00 0.00 ? 568 TYR A CD2 1  
ATOM 3284   C CE1 . TYR A 1 568 ? -76.856  -29.144 13.575  1.00 0.00 ? 568 TYR A CE1 1  
ATOM 3285   C CE2 . TYR A 1 568 ? -79.166  -29.832 13.842  1.00 0.00 ? 568 TYR A CE2 1  
ATOM 3286   C CZ  . TYR A 1 568 ? -78.140  -28.937 14.158  1.00 0.00 ? 568 TYR A CZ  1  
ATOM 3287   O OH  . TYR A 1 568 ? -78.269  -27.724 14.889  1.00 0.00 ? 568 TYR A OH  1  
ATOM 3288   N N   . PRO A 1 569 ? -74.531  -33.702 13.298  1.00 0.00 ? 569 PRO A N   1  
ATOM 3289   C CA  . PRO A 1 569 ? -73.885  -34.306 12.078  1.00 0.00 ? 569 PRO A CA  1  
ATOM 3290   C C   . PRO A 1 569 ? -73.993  -35.784 12.317  1.00 0.00 ? 569 PRO A C   1  
ATOM 3291   O O   . PRO A 1 569 ? -73.647  -36.604 11.474  1.00 0.00 ? 569 PRO A O   1  
ATOM 3292   C CB  . PRO A 1 569 ? -72.505  -33.641 12.129  1.00 0.00 ? 569 PRO A CB  1  
ATOM 3293   C CG  . PRO A 1 569 ? -72.250  -33.560 13.700  1.00 0.00 ? 569 PRO A CG  1  
ATOM 3294   C CD  . PRO A 1 569 ? -73.582  -33.145 14.243  1.00 0.00 ? 569 PRO A CD  1  
ATOM 3295   N N   . LEU A 1 570 ? -74.652  -36.164 13.405  1.00 0.00 ? 570 LEU A N   1  
ATOM 3296   C CA  . LEU A 1 570 ? -74.830  -37.525 13.815  1.00 0.00 ? 570 LEU A CA  1  
ATOM 3297   C C   . LEU A 1 570 ? -75.616  -38.305 12.813  1.00 0.00 ? 570 LEU A C   1  
ATOM 3298   O O   . LEU A 1 570 ? -75.349  -39.502 12.686  1.00 0.00 ? 570 LEU A O   1  
ATOM 3299   C CB  . LEU A 1 570 ? -75.374  -37.607 15.228  1.00 0.00 ? 570 LEU A CB  1  
ATOM 3300   C CG  . LEU A 1 570 ? -74.676  -36.648 16.306  1.00 0.00 ? 570 LEU A CG  1  
ATOM 3301   C CD1 . LEU A 1 570 ? -75.237  -36.858 17.707  1.00 0.00 ? 570 LEU A CD1 1  
ATOM 3302   C CD2 . LEU A 1 570 ? -73.167  -36.841 16.243  1.00 0.00 ? 570 LEU A CD2 1  
ATOM 3303   N N   . ASN A 1 571 ? -76.498  -37.590 12.044  1.00 0.00 ? 571 ASN A N   1  
ATOM 3304   C CA  . ASN A 1 571 ? -77.336  -38.169 11.011  1.00 0.00 ? 571 ASN A CA  1  
ATOM 3305   C C   . ASN A 1 571 ? -76.674  -38.980 9.943   1.00 0.00 ? 571 ASN A C   1  
ATOM 3306   O O   . ASN A 1 571 ? -77.257  -39.954 9.517   1.00 0.00 ? 571 ASN A O   1  
ATOM 3307   C CB  . ASN A 1 571 ? -78.171  -37.094 10.342  1.00 0.00 ? 571 ASN A CB  1  
ATOM 3308   C CG  . ASN A 1 571 ? -77.329  -35.958 9.690   1.00 0.00 ? 571 ASN A CG  1  
ATOM 3309   O OD1 . ASN A 1 571 ? -76.144  -35.784 9.822   1.00 0.00 ? 571 ASN A OD1 1  
ATOM 3310   N ND2 . ASN A 1 571 ? -78.120  -35.078 8.972   1.00 0.00 ? 571 ASN A ND2 1  
ATOM 3311   N N   . ILE A 1 572 ? -75.412  -38.661 9.565   1.00 0.00 ? 572 ILE A N   1  
ATOM 3312   C CA  . ILE A 1 572 ? -74.605  -39.350 8.572   1.00 0.00 ? 572 ILE A CA  1  
ATOM 3313   C C   . ILE A 1 572 ? -74.348  -40.844 8.881   1.00 0.00 ? 572 ILE A C   1  
ATOM 3314   O O   . ILE A 1 572 ? -74.272  -41.699 8.002   1.00 0.00 ? 572 ILE A O   1  
ATOM 3315   C CB  . ILE A 1 572 ? -73.292  -38.587 8.307   1.00 0.00 ? 572 ILE A CB  1  
ATOM 3316   C CG1 . ILE A 1 572 ? -73.631  -37.180 7.771   1.00 0.00 ? 572 ILE A CG1 1  
ATOM 3317   C CG2 . ILE A 1 572 ? -72.397  -39.339 7.300   1.00 0.00 ? 572 ILE A CG2 1  
ATOM 3318   C CD1 . ILE A 1 572 ? -72.400  -36.311 7.465   1.00 0.00 ? 572 ILE A CD1 1  
ATOM 3319   N N   . ILE A 1 573 ? -74.101  -41.163 10.134  1.00 0.00 ? 573 ILE A N   1  
ATOM 3320   C CA  . ILE A 1 573 ? -73.954  -42.466 10.751  1.00 0.00 ? 573 ILE A CA  1  
ATOM 3321   C C   . ILE A 1 573 ? -75.106  -43.391 10.648  1.00 0.00 ? 573 ILE A C   1  
ATOM 3322   O O   . ILE A 1 573 ? -74.990  -44.572 10.266  1.00 0.00 ? 573 ILE A O   1  
ATOM 3323   C CB  . ILE A 1 573 ? -73.449  -42.450 12.161  1.00 0.00 ? 573 ILE A CB  1  
ATOM 3324   C CG1 . ILE A 1 573 ? -72.319  -41.355 12.350  1.00 0.00 ? 573 ILE A CG1 1  
ATOM 3325   C CG2 . ILE A 1 573 ? -72.915  -43.858 12.558  1.00 0.00 ? 573 ILE A CG2 1  
ATOM 3326   C CD1 . ILE A 1 573 ? -71.750  -41.279 13.778  1.00 0.00 ? 573 ILE A CD1 1  
ATOM 3327   N N   . ILE A 1 574 ? -76.258  -42.846 10.980  1.00 0.00 ? 574 ILE A N   1  
ATOM 3328   C CA  . ILE A 1 574 ? -77.519  -43.594 11.016  1.00 0.00 ? 574 ILE A CA  1  
ATOM 3329   C C   . ILE A 1 574 ? -77.968  -43.894 9.547   1.00 0.00 ? 574 ILE A C   1  
ATOM 3330   O O   . ILE A 1 574 ? -77.717  -43.114 8.622   1.00 0.00 ? 574 ILE A O   1  
ATOM 3331   C CB  . ILE A 1 574 ? -78.648  -42.959 11.866  1.00 0.00 ? 574 ILE A CB  1  
ATOM 3332   C CG1 . ILE A 1 574 ? -79.137  -41.596 11.256  1.00 0.00 ? 574 ILE A CG1 1  
ATOM 3333   C CG2 . ILE A 1 574 ? -78.035  -42.840 13.243  1.00 0.00 ? 574 ILE A CG2 1  
ATOM 3334   C CD1 . ILE A 1 574 ? -80.259  -40.915 12.058  1.00 0.00 ? 574 ILE A CD1 1  
ATOM 3335   N N   . SER A 1 575 ? -78.642  -45.029 9.298   1.00 0.00 ? 575 SER A N   1  
ATOM 3336   C CA  . SER A 1 575 ? -79.021  -45.373 7.940   1.00 0.00 ? 575 SER A CA  1  
ATOM 3337   C C   . SER A 1 575 ? -80.435  -45.976 7.995   1.00 0.00 ? 575 SER A C   1  
ATOM 3338   O O   . SER A 1 575 ? -81.015  -46.158 9.059   1.00 0.00 ? 575 SER A O   1  
ATOM 3339   C CB  . SER A 1 575 ? -78.041  -46.351 7.463   1.00 0.00 ? 575 SER A CB  1  
ATOM 3340   O OG  . SER A 1 575 ? -76.655  -45.948 7.631   1.00 0.00 ? 575 SER A OG  1  
ATOM 3341   N N   . ARG A 1 576 ? -81.019  -46.072 6.817   1.00 0.00 ? 576 ARG A N   1  
ATOM 3342   C CA  . ARG A 1 576 ? -82.416  -46.353 6.802   1.00 0.00 ? 576 ARG A CA  1  
ATOM 3343   C C   . ARG A 1 576 ? -82.691  -47.718 7.383   1.00 0.00 ? 576 ARG A C   1  
ATOM 3344   O O   . ARG A 1 576 ? -83.638  -48.012 8.060   1.00 0.00 ? 576 ARG A O   1  
ATOM 3345   C CB  . ARG A 1 576 ? -83.023  -46.222 5.343   1.00 0.00 ? 576 ARG A CB  1  
ATOM 3346   C CG  . ARG A 1 576 ? -82.700  -47.369 4.370   1.00 0.00 ? 576 ARG A CG  1  
ATOM 3347   C CD  . ARG A 1 576 ? -83.230  -47.149 3.051   1.00 0.00 ? 576 ARG A CD  1  
ATOM 3348   N NE  . ARG A 1 576 ? -83.074  -48.306 2.115   1.00 0.00 ? 576 ARG A NE  1  
ATOM 3349   C CZ  . ARG A 1 576 ? -83.572  -48.340 0.813   1.00 0.00 ? 576 ARG A CZ  1  
ATOM 3350   N NH1 . ARG A 1 576 ? -84.349  -47.298 0.360   1.00 0.00 ? 576 ARG A NH1 1  
ATOM 3351   N NH2 . ARG A 1 576 ? -83.212  -49.381 0.016   1.00 0.00 ? 576 ARG A NH2 1  
ATOM 3352   N N   . THR A 1 577 ? -81.804  -48.639 7.073   1.00 0.00 ? 577 THR A N   1  
ATOM 3353   C CA  . THR A 1 577 ? -81.872  -49.992 7.440   1.00 0.00 ? 577 THR A CA  1  
ATOM 3354   C C   . THR A 1 577 ? -81.791  -50.174 8.909   1.00 0.00 ? 577 THR A C   1  
ATOM 3355   O O   . THR A 1 577 ? -82.494  -50.956 9.529   1.00 0.00 ? 577 THR A O   1  
ATOM 3356   C CB  . THR A 1 577 ? -80.811  -50.842 6.667   1.00 0.00 ? 577 THR A CB  1  
ATOM 3357   O OG1 . THR A 1 577 ? -79.540  -50.168 6.813   1.00 0.00 ? 577 THR A OG1 1  
ATOM 3358   C CG2 . THR A 1 577 ? -81.253  -50.888 5.170   1.00 0.00 ? 577 THR A CG2 1  
ATOM 3359   N N   . CYS A 1 578 ? -80.844  -49.367 9.546   1.00 0.00 ? 578 CYS A N   1  
ATOM 3360   C CA  . CYS A 1 578 ? -80.654  -49.486 10.934  1.00 0.00 ? 578 CYS A CA  1  
ATOM 3361   C C   . CYS A 1 578 ? -81.874  -49.152 11.829  1.00 0.00 ? 578 CYS A C   1  
ATOM 3362   O O   . CYS A 1 578 ? -82.258  -49.842 12.687  1.00 0.00 ? 578 CYS A O   1  
ATOM 3363   C CB  . CYS A 1 578 ? -79.585  -48.575 11.487  1.00 0.00 ? 578 CYS A CB  1  
ATOM 3364   S SG  . CYS A 1 578 ? -77.921  -48.665 10.698  1.00 0.00 ? 578 CYS A SG  1  
ATOM 3365   N N   . MET A 1 579 ? -82.561  -48.014 11.415  1.00 0.00 ? 579 MET A N   1  
ATOM 3366   C CA  . MET A 1 579 ? -83.780  -47.594 12.132  1.00 0.00 ? 579 MET A CA  1  
ATOM 3367   C C   . MET A 1 579 ? -84.950  -48.579 12.042  1.00 0.00 ? 579 MET A C   1  
ATOM 3368   O O   . MET A 1 579 ? -85.674  -48.812 12.995  1.00 0.00 ? 579 MET A O   1  
ATOM 3369   C CB  . MET A 1 579 ? -84.377  -46.435 11.349  1.00 0.00 ? 579 MET A CB  1  
ATOM 3370   C CG  . MET A 1 579 ? -83.485  -45.179 11.005  1.00 0.00 ? 579 MET A CG  1  
ATOM 3371   S SD  . MET A 1 579 ? -84.126  -44.075 9.764   1.00 0.00 ? 579 MET A SD  1  
ATOM 3372   C CE  . MET A 1 579 ? -82.606  -43.038 9.680   1.00 0.00 ? 579 MET A CE  1  
ATOM 3373   N N   . ILE A 1 580 ? -85.069  -49.180 10.903  1.00 0.00 ? 580 ILE A N   1  
ATOM 3374   C CA  . ILE A 1 580 ? -85.995  -50.264 10.693  1.00 0.00 ? 580 ILE A CA  1  
ATOM 3375   C C   . ILE A 1 580 ? -85.754  -51.525 11.441  1.00 0.00 ? 580 ILE A C   1  
ATOM 3376   O O   . ILE A 1 580 ? -86.704  -52.069 11.936  1.00 0.00 ? 580 ILE A O   1  
ATOM 3377   C CB  . ILE A 1 580 ? -86.392  -50.543 9.209   1.00 0.00 ? 580 ILE A CB  1  
ATOM 3378   C CG1 . ILE A 1 580 ? -85.346  -51.256 8.364   1.00 0.00 ? 580 ILE A CG1 1  
ATOM 3379   C CG2 . ILE A 1 580 ? -86.746  -49.186 8.561   1.00 0.00 ? 580 ILE A CG2 1  
ATOM 3380   C CD1 . ILE A 1 580 ? -85.780  -51.510 6.910   1.00 0.00 ? 580 ILE A CD1 1  
ATOM 3381   N N   . LYS A 1 581 ? -84.458  -51.908 11.627  1.00 0.00 ? 581 LYS A N   1  
ATOM 3382   C CA  . LYS A 1 581 ? -84.094  -53.021 12.420  1.00 0.00 ? 581 LYS A CA  1  
ATOM 3383   C C   . LYS A 1 581 ? -84.564  -52.820 13.873  1.00 0.00 ? 581 LYS A C   1  
ATOM 3384   O O   . LYS A 1 581 ? -85.257  -53.648 14.373  1.00 0.00 ? 581 LYS A O   1  
ATOM 3385   C CB  . LYS A 1 581 ? -82.605  -53.288 12.551  1.00 0.00 ? 581 LYS A CB  1  
ATOM 3386   C CG  . LYS A 1 581 ? -81.811  -53.739 11.322  1.00 0.00 ? 581 LYS A CG  1  
ATOM 3387   C CD  . LYS A 1 581 ? -82.579  -54.636 10.325  1.00 0.00 ? 581 LYS A CD  1  
ATOM 3388   C CE  . LYS A 1 581 ? -81.622  -55.163 9.238   1.00 0.00 ? 581 LYS A CE  1  
ATOM 3389   N NZ  . LYS A 1 581 ? -82.444  -56.072 8.402   1.00 0.00 ? 581 LYS A NZ  1  
ATOM 3390   N N   . TYR A 1 582 ? -84.194  -51.622 14.444  1.00 0.00 ? 582 TYR A N   1  
ATOM 3391   C CA  . TYR A 1 582 ? -84.559  -51.266 15.818  1.00 0.00 ? 582 TYR A CA  1  
ATOM 3392   C C   . TYR A 1 582 ? -86.065  -51.198 16.057  1.00 0.00 ? 582 TYR A C   1  
ATOM 3393   O O   . TYR A 1 582 ? -86.502  -51.606 17.109  1.00 0.00 ? 582 TYR A O   1  
ATOM 3394   C CB  . TYR A 1 582 ? -83.918  -49.882 16.139  1.00 0.00 ? 582 TYR A CB  1  
ATOM 3395   C CG  . TYR A 1 582 ? -82.384  -49.855 15.991  1.00 0.00 ? 582 TYR A CG  1  
ATOM 3396   C CD1 . TYR A 1 582 ? -81.532  -50.956 16.341  1.00 0.00 ? 582 TYR A CD1 1  
ATOM 3397   C CD2 . TYR A 1 582 ? -81.808  -48.640 15.535  1.00 0.00 ? 582 TYR A CD2 1  
ATOM 3398   C CE1 . TYR A 1 582 ? -80.133  -50.806 16.209  1.00 0.00 ? 582 TYR A CE1 1  
ATOM 3399   C CE2 . TYR A 1 582 ? -80.411  -48.528 15.352  1.00 0.00 ? 582 TYR A CE2 1  
ATOM 3400   C CZ  . TYR A 1 582 ? -79.557  -49.628 15.665  1.00 0.00 ? 582 TYR A CZ  1  
ATOM 3401   O OH  . TYR A 1 582 ? -78.189  -49.576 15.625  1.00 0.00 ? 582 TYR A OH  1  
ATOM 3402   N N   . GLN A 1 583 ? -86.829  -50.661 15.092  1.00 0.00 ? 583 GLN A N   1  
ATOM 3403   C CA  . GLN A 1 583 ? -88.260  -50.492 15.222  1.00 0.00 ? 583 GLN A CA  1  
ATOM 3404   C C   . GLN A 1 583 ? -88.935  -51.754 15.330  1.00 0.00 ? 583 GLN A C   1  
ATOM 3405   O O   . GLN A 1 583 ? -89.831  -51.924 16.122  1.00 0.00 ? 583 GLN A O   1  
ATOM 3406   C CB  . GLN A 1 583 ? -88.859  -49.607 14.050  1.00 0.00 ? 583 GLN A CB  1  
ATOM 3407   C CG  . GLN A 1 583 ? -90.334  -49.433 14.054  1.00 0.00 ? 583 GLN A CG  1  
ATOM 3408   C CD  . GLN A 1 583 ? -91.063  -50.466 13.257  1.00 0.00 ? 583 GLN A CD  1  
ATOM 3409   O OE1 . GLN A 1 583 ? -91.851  -51.243 13.778  1.00 0.00 ? 583 GLN A OE1 1  
ATOM 3410   N NE2 . GLN A 1 583 ? -90.911  -50.392 11.878  1.00 0.00 ? 583 GLN A NE2 1  
ATOM 3411   N N   . ILE A 1 584 ? -88.444  -52.820 14.613  1.00 0.00 ? 584 ILE A N   1  
ATOM 3412   C CA  . ILE A 1 584 ? -88.880  -54.164 14.713  1.00 0.00 ? 584 ILE A CA  1  
ATOM 3413   C C   . ILE A 1 584 ? -88.660  -54.884 16.029  1.00 0.00 ? 584 ILE A C   1  
ATOM 3414   O O   . ILE A 1 584 ? -89.687  -55.437 16.528  1.00 0.00 ? 584 ILE A O   1  
ATOM 3415   C CB  . ILE A 1 584 ? -88.349  -55.002 13.474  1.00 0.00 ? 584 ILE A CB  1  
ATOM 3416   C CG1 . ILE A 1 584 ? -89.238  -54.522 12.269  1.00 0.00 ? 584 ILE A CG1 1  
ATOM 3417   C CG2 . ILE A 1 584 ? -88.673  -56.496 13.759  1.00 0.00 ? 584 ILE A CG2 1  
ATOM 3418   C CD1 . ILE A 1 584 ? -88.904  -55.206 10.932  1.00 0.00 ? 584 ILE A CD1 1  
ATOM 3419   N N   . ILE A 1 585 ? -87.373  -54.761 16.642  1.00 0.00 ? 585 ILE A N   1  
ATOM 3420   C CA  . ILE A 1 585 ? -87.226  -55.332 17.959  1.00 0.00 ? 585 ILE A CA  1  
ATOM 3421   C C   . ILE A 1 585 ? -88.153  -54.658 18.939  1.00 0.00 ? 585 ILE A C   1  
ATOM 3422   O O   . ILE A 1 585 ? -88.783  -55.434 19.642  1.00 0.00 ? 585 ILE A O   1  
ATOM 3423   C CB  . ILE A 1 585 ? -85.730  -55.452 18.387  1.00 0.00 ? 585 ILE A CB  1  
ATOM 3424   C CG1 . ILE A 1 585 ? -85.663  -55.893 19.880  1.00 0.00 ? 585 ILE A CG1 1  
ATOM 3425   C CG2 . ILE A 1 585 ? -84.932  -54.139 18.255  1.00 0.00 ? 585 ILE A CG2 1  
ATOM 3426   C CD1 . ILE A 1 585 ? -84.233  -56.049 20.425  1.00 0.00 ? 585 ILE A CD1 1  
ATOM 3427   N N   . LEU A 1 586 ? -88.349  -53.336 18.865  1.00 0.00 ? 586 LEU A N   1  
ATOM 3428   C CA  . LEU A 1 586 ? -89.251  -52.678 19.692  1.00 0.00 ? 586 LEU A CA  1  
ATOM 3429   C C   . LEU A 1 586 ? -90.706  -53.193 19.601  1.00 0.00 ? 586 LEU A C   1  
ATOM 3430   O O   . LEU A 1 586 ? -91.366  -53.335 20.657  1.00 0.00 ? 586 LEU A O   1  
ATOM 3431   C CB  . LEU A 1 586 ? -89.260  -51.161 19.470  1.00 0.00 ? 586 LEU A CB  1  
ATOM 3432   C CG  . LEU A 1 586 ? -87.848  -50.566 19.865  1.00 0.00 ? 586 LEU A CG  1  
ATOM 3433   C CD1 . LEU A 1 586 ? -87.658  -49.189 19.187  1.00 0.00 ? 586 LEU A CD1 1  
ATOM 3434   C CD2 . LEU A 1 586 ? -87.611  -50.445 21.374  1.00 0.00 ? 586 LEU A CD2 1  
ATOM 3435   N N   . ARG A 1 587 ? -91.242  -53.497 18.410  1.00 0.00 ? 587 ARG A N   1  
ATOM 3436   C CA  . ARG A 1 587 ? -92.560  -53.937 18.202  1.00 0.00 ? 587 ARG A CA  1  
ATOM 3437   C C   . ARG A 1 587 ? -92.863  -55.335 18.835  1.00 0.00 ? 587 ARG A C   1  
ATOM 3438   O O   . ARG A 1 587 ? -93.909  -55.559 19.433  1.00 0.00 ? 587 ARG A O   1  
ATOM 3439   C CB  . ARG A 1 587 ? -92.815  -54.078 16.651  1.00 0.00 ? 587 ARG A CB  1  
ATOM 3440   C CG  . ARG A 1 587 ? -94.353  -54.010 16.327  1.00 0.00 ? 587 ARG A CG  1  
ATOM 3441   C CD  . ARG A 1 587 ? -95.004  -52.737 16.789  1.00 0.00 ? 587 ARG A CD  1  
ATOM 3442   N NE  . ARG A 1 587 ? -94.155  -51.554 16.422  1.00 0.00 ? 587 ARG A NE  1  
ATOM 3443   C CZ  . ARG A 1 587 ? -93.720  -50.569 17.216  1.00 0.00 ? 587 ARG A CZ  1  
ATOM 3444   N NH1 . ARG A 1 587 ? -94.335  -50.254 18.416  1.00 0.00 ? 587 ARG A NH1 1  
ATOM 3445   N NH2 . ARG A 1 587 ? -92.635  -49.880 16.806  1.00 0.00 ? 587 ARG A NH2 1  
ATOM 3446   N N   . TYR A 1 588 ? -91.924  -56.263 18.664  1.00 0.00 ? 588 TYR A N   1  
ATOM 3447   C CA  . TYR A 1 588 ? -92.075  -57.635 19.197  1.00 0.00 ? 588 TYR A CA  1  
ATOM 3448   C C   . TYR A 1 588 ? -92.036  -57.547 20.646  1.00 0.00 ? 588 TYR A C   1  
ATOM 3449   O O   . TYR A 1 588 ? -92.775  -58.308 21.241  1.00 0.00 ? 588 TYR A O   1  
ATOM 3450   C CB  . TYR A 1 588 ? -90.983  -58.594 18.792  1.00 0.00 ? 588 TYR A CB  1  
ATOM 3451   C CG  . TYR A 1 588 ? -90.698  -58.904 17.357  1.00 0.00 ? 588 TYR A CG  1  
ATOM 3452   C CD1 . TYR A 1 588 ? -91.611  -58.501 16.390  1.00 0.00 ? 588 TYR A CD1 1  
ATOM 3453   C CD2 . TYR A 1 588 ? -89.461  -59.508 16.994  1.00 0.00 ? 588 TYR A CD2 1  
ATOM 3454   C CE1 . TYR A 1 588 ? -91.345  -58.785 15.060  1.00 0.00 ? 588 TYR A CE1 1  
ATOM 3455   C CE2 . TYR A 1 588 ? -89.237  -59.708 15.635  1.00 0.00 ? 588 TYR A CE2 1  
ATOM 3456   C CZ  . TYR A 1 588 ? -90.209  -59.433 14.708  1.00 0.00 ? 588 TYR A CZ  1  
ATOM 3457   O OH  . TYR A 1 588 ? -90.137  -60.018 13.421  1.00 0.00 ? 588 TYR A OH  1  
ATOM 3458   N N   . GLN A 1 589 ? -91.122  -56.671 21.180  1.00 0.00 ? 589 GLN A N   1  
ATOM 3459   C CA  . GLN A 1 589 ? -90.885  -56.512 22.628  1.00 0.00 ? 589 GLN A CA  1  
ATOM 3460   C C   . GLN A 1 589 ? -92.097  -56.015 23.321  1.00 0.00 ? 589 GLN A C   1  
ATOM 3461   O O   . GLN A 1 589 ? -92.629  -56.565 24.286  1.00 0.00 ? 589 GLN A O   1  
ATOM 3462   C CB  . GLN A 1 589 ? -89.825  -55.455 22.992  1.00 0.00 ? 589 GLN A CB  1  
ATOM 3463   C CG  . GLN A 1 589 ? -89.523  -55.303 24.513  1.00 0.00 ? 589 GLN A CG  1  
ATOM 3464   C CD  . GLN A 1 589 ? -88.922  -56.507 25.197  1.00 0.00 ? 589 GLN A CD  1  
ATOM 3465   O OE1 . GLN A 1 589 ? -87.749  -56.451 25.681  1.00 0.00 ? 589 GLN A OE1 1  
ATOM 3466   N NE2 . GLN A 1 589 ? -89.584  -57.695 25.189  1.00 0.00 ? 589 GLN A NE2 1  
ATOM 3467   N N   . LEU A 1 590 ? -92.621  -55.043 22.602  1.00 0.00 ? 590 LEU A N   1  
ATOM 3468   C CA  . LEU A 1 590 ? -93.800  -54.342 23.025  1.00 0.00 ? 590 LEU A CA  1  
ATOM 3469   C C   . LEU A 1 590 ? -94.960  -55.314 23.059  1.00 0.00 ? 590 LEU A C   1  
ATOM 3470   O O   . LEU A 1 590 ? -95.838  -55.266 23.930  1.00 0.00 ? 590 LEU A O   1  
ATOM 3471   C CB  . LEU A 1 590 ? -94.133  -53.183 22.066  1.00 0.00 ? 590 LEU A CB  1  
ATOM 3472   C CG  . LEU A 1 590 ? -95.467  -52.479 22.368  1.00 0.00 ? 590 LEU A CG  1  
ATOM 3473   C CD1 . LEU A 1 590 ? -95.400  -51.626 23.610  1.00 0.00 ? 590 LEU A CD1 1  
ATOM 3474   C CD2 . LEU A 1 590 ? -95.988  -51.583 21.253  1.00 0.00 ? 590 LEU A CD2 1  
ATOM 3475   N N   . VAL A 1 591 ? -94.998  -56.222 22.084  1.00 0.00 ? 591 VAL A N   1  
ATOM 3476   C CA  . VAL A 1 591 ? -96.066  -57.199 21.984  1.00 0.00 ? 591 VAL A CA  1  
ATOM 3477   C C   . VAL A 1 591 ? -96.206  -58.160 23.068  1.00 0.00 ? 591 VAL A C   1  
ATOM 3478   O O   . VAL A 1 591 ? -97.355  -58.421 23.611  1.00 0.00 ? 591 VAL A O   1  
ATOM 3479   C CB  . VAL A 1 591 ? -96.158  -57.900 20.607  1.00 0.00 ? 591 VAL A CB  1  
ATOM 3480   C CG1 . VAL A 1 591 ? -96.696  -59.371 20.603  1.00 0.00 ? 591 VAL A CG1 1  
ATOM 3481   C CG2 . VAL A 1 591 ? -96.841  -56.935 19.654  1.00 0.00 ? 591 VAL A CG2 1  
ATOM 3482   N N   . LEU A 1 592 ? -94.969  -58.691 23.583  1.00 0.00 ? 592 LEU A N   1  
ATOM 3483   C CA  . LEU A 1 592 ? -94.763  -59.524 24.694  1.00 0.00 ? 592 LEU A CA  1  
ATOM 3484   C C   . LEU A 1 592 ? -95.148  -58.736 25.906  1.00 0.00 ? 592 LEU A C   1  
ATOM 3485   O O   . LEU A 1 592 ? -95.830  -59.300 26.785  1.00 0.00 ? 592 LEU A O   1  
ATOM 3486   C CB  . LEU A 1 592 ? -93.297  -60.192 24.673  1.00 0.00 ? 592 LEU A CB  1  
ATOM 3487   C CG  . LEU A 1 592 ? -93.087  -61.159 23.457  1.00 0.00 ? 592 LEU A CG  1  
ATOM 3488   C CD1 . LEU A 1 592 ? -91.571  -61.635 23.411  1.00 0.00 ? 592 LEU A CD1 1  
ATOM 3489   C CD2 . LEU A 1 592 ? -94.089  -62.380 23.467  1.00 0.00 ? 592 LEU A CD2 1  
ATOM 3490   N N   . GLN A 1 593 ? -94.771  -57.508 26.014  1.00 0.00 ? 593 GLN A N   1  
ATOM 3491   C CA  . GLN A 1 593 ? -95.009  -56.744 27.138  1.00 0.00 ? 593 GLN A CA  1  
ATOM 3492   C C   . GLN A 1 593 ? -96.447  -56.486 27.446  1.00 0.00 ? 593 GLN A C   1  
ATOM 3493   O O   . GLN A 1 593 ? -96.906  -56.491 28.611  1.00 0.00 ? 593 GLN A O   1  
ATOM 3494   C CB  . GLN A 1 593 ? -94.199  -55.445 27.013  1.00 0.00 ? 593 GLN A CB  1  
ATOM 3495   C CG  . GLN A 1 593 ? -93.959  -54.663 28.316  1.00 0.00 ? 593 GLN A CG  1  
ATOM 3496   C CD  . GLN A 1 593 ? -92.947  -55.435 29.218  1.00 0.00 ? 593 GLN A CD  1  
ATOM 3497   O OE1 . GLN A 1 593 ? -93.242  -56.511 29.729  1.00 0.00 ? 593 GLN A OE1 1  
ATOM 3498   N NE2 . GLN A 1 593 ? -91.743  -54.823 29.399  1.00 0.00 ? 593 GLN A NE2 1  
ATOM 3499   N N   . TYR A 1 594 ? -97.326  -56.194 26.403  1.00 0.00 ? 594 TYR A N   1  
ATOM 3500   C CA  . TYR A 1 594 ? -98.730  -55.926 26.726  1.00 0.00 ? 594 TYR A CA  1  
ATOM 3501   C C   . TYR A 1 594 ? -99.477  -57.139 27.199  1.00 0.00 ? 594 TYR A C   1  
ATOM 3502   O O   . TYR A 1 594 ? -100.246 -57.159 28.174  1.00 0.00 ? 594 TYR A O   1  
ATOM 3503   C CB  . TYR A 1 594 ? -99.591  -55.102 25.700  1.00 0.00 ? 594 TYR A CB  1  
ATOM 3504   C CG  . TYR A 1 594 ? -100.201 -55.877 24.647  1.00 0.00 ? 594 TYR A CG  1  
ATOM 3505   C CD1 . TYR A 1 594 ? -99.458  -56.390 23.520  1.00 0.00 ? 594 TYR A CD1 1  
ATOM 3506   C CD2 . TYR A 1 594 ? -101.565 -56.160 24.589  1.00 0.00 ? 594 TYR A CD2 1  
ATOM 3507   C CE1 . TYR A 1 594 ? -100.131 -57.028 22.399  1.00 0.00 ? 594 TYR A CE1 1  
ATOM 3508   C CE2 . TYR A 1 594 ? -102.269 -56.787 23.526  1.00 0.00 ? 594 TYR A CE2 1  
ATOM 3509   C CZ  . TYR A 1 594 ? -101.566 -57.032 22.341  1.00 0.00 ? 594 TYR A CZ  1  
ATOM 3510   O OH  . TYR A 1 594 ? -102.157 -57.659 21.187  1.00 0.00 ? 594 TYR A OH  1  
ATOM 3511   N N   . HIS A 1 595 ? -99.137  -58.283 26.513  1.00 0.00 ? 595 HIS A N   1  
ATOM 3512   C CA  . HIS A 1 595 ? -99.756  -59.522 26.904  1.00 0.00 ? 595 HIS A CA  1  
ATOM 3513   C C   . HIS A 1 595 ? -99.457  -59.973 28.358  1.00 0.00 ? 595 HIS A C   1  
ATOM 3514   O O   . HIS A 1 595 ? -100.307 -60.423 29.087  1.00 0.00 ? 595 HIS A O   1  
ATOM 3515   C CB  . HIS A 1 595 ? -99.218  -60.660 26.090  1.00 0.00 ? 595 HIS A CB  1  
ATOM 3516   C CG  . HIS A 1 595 ? -99.564  -60.563 24.674  1.00 0.00 ? 595 HIS A CG  1  
ATOM 3517   N ND1 . HIS A 1 595 ? -100.626 -59.896 24.092  1.00 0.00 ? 595 HIS A ND1 1  
ATOM 3518   C CD2 . HIS A 1 595 ? -98.886  -61.178 23.691  1.00 0.00 ? 595 HIS A CD2 1  
ATOM 3519   C CE1 . HIS A 1 595 ? -100.496 -60.164 22.774  1.00 0.00 ? 595 HIS A CE1 1  
ATOM 3520   N NE2 . HIS A 1 595 ? -99.442  -60.897 22.508  1.00 0.00 ? 595 HIS A NE2 1  
ATOM 3521   N N   . SER A 1 596 ? -98.217  -59.802 28.781  1.00 0.00 ? 596 SER A N   1  
ATOM 3522   C CA  . SER A 1 596 ? -97.809  -60.149 30.135  1.00 0.00 ? 596 SER A CA  1  
ATOM 3523   C C   . SER A 1 596 ? -98.528  -59.358 31.128  1.00 0.00 ? 596 SER A C   1  
ATOM 3524   O O   . SER A 1 596 ? -98.812  -59.944 32.121  1.00 0.00 ? 596 SER A O   1  
ATOM 3525   C CB  . SER A 1 596 ? -96.263  -59.864 30.336  1.00 0.00 ? 596 SER A CB  1  
ATOM 3526   O OG  . SER A 1 596 ? -95.767  -60.476 31.548  1.00 0.00 ? 596 SER A OG  1  
ATOM 3527   N N   . ARG A 1 597 ? -98.762  -58.004 30.909  1.00 0.00 ? 597 ARG A N   1  
ATOM 3528   C CA  . ARG A 1 597 ? -99.395  -57.147 31.856  1.00 0.00 ? 597 ARG A CA  1  
ATOM 3529   C C   . ARG A 1 597 ? -100.767 -57.533 32.103  1.00 0.00 ? 597 ARG A C   1  
ATOM 3530   O O   . ARG A 1 597 ? -101.255 -57.603 33.226  1.00 0.00 ? 597 ARG A O   1  
ATOM 3531   C CB  . ARG A 1 597 ? -99.369  -55.671 31.429  1.00 0.00 ? 597 ARG A CB  1  
ATOM 3532   C CG  . ARG A 1 597 ? -99.842  -54.572 32.474  1.00 0.00 ? 597 ARG A CG  1  
ATOM 3533   C CD  . ARG A 1 597 ? -99.842  -53.169 31.832  1.00 0.00 ? 597 ARG A CD  1  
ATOM 3534   N NE  . ARG A 1 597 ? -100.534 -53.169 30.477  1.00 0.00 ? 597 ARG A NE  1  
ATOM 3535   C CZ  . ARG A 1 597 ? -101.886 -53.032 30.337  1.00 0.00 ? 597 ARG A CZ  1  
ATOM 3536   N NH1 . ARG A 1 597 ? -102.760 -53.024 31.404  1.00 0.00 ? 597 ARG A NH1 1  
ATOM 3537   N NH2 . ARG A 1 597 ? -102.400 -52.743 29.107  1.00 0.00 ? 597 ARG A NH2 1  
ATOM 3538   N N   . LEU A 1 598 ? -101.467 -57.890 30.961  1.00 0.00 ? 598 LEU A N   1  
ATOM 3539   C CA  . LEU A 1 598 ? -102.786 -58.370 30.989  1.00 0.00 ? 598 LEU A CA  1  
ATOM 3540   C C   . LEU A 1 598 ? -102.899 -59.714 31.663  1.00 0.00 ? 598 LEU A C   1  
ATOM 3541   O O   . LEU A 1 598 ? -103.921 -59.850 32.343  1.00 0.00 ? 598 LEU A O   1  
ATOM 3542   C CB  . LEU A 1 598 ? -103.397 -58.494 29.602  1.00 0.00 ? 598 LEU A CB  1  
ATOM 3543   C CG  . LEU A 1 598 ? -103.805 -57.038 29.055  1.00 0.00 ? 598 LEU A CG  1  
ATOM 3544   C CD1 . LEU A 1 598 ? -103.608 -56.870 27.502  1.00 0.00 ? 598 LEU A CD1 1  
ATOM 3545   C CD2 . LEU A 1 598 ? -105.284 -56.840 29.417  1.00 0.00 ? 598 LEU A CD2 1  
ATOM 3546   N N   . LEU A 1 599 ? -101.955 -60.668 31.522  1.00 0.00 ? 599 LEU A N   1  
ATOM 3547   C CA  . LEU A 1 599 ? -101.998 -61.934 32.143  1.00 0.00 ? 599 LEU A CA  1  
ATOM 3548   C C   . LEU A 1 599 ? -101.872 -61.821 33.676  1.00 0.00 ? 599 LEU A C   1  
ATOM 3549   O O   . LEU A 1 599 ? -102.665 -62.322 34.462  1.00 0.00 ? 599 LEU A O   1  
ATOM 3550   C CB  . LEU A 1 599 ? -100.959 -62.914 31.632  1.00 0.00 ? 599 LEU A CB  1  
ATOM 3551   C CG  . LEU A 1 599 ? -101.594 -63.906 30.589  1.00 0.00 ? 599 LEU A CG  1  
ATOM 3552   C CD1 . LEU A 1 599 ? -101.659 -63.202 29.241  1.00 0.00 ? 599 LEU A CD1 1  
ATOM 3553   C CD2 . LEU A 1 599 ? -100.812 -65.186 30.458  1.00 0.00 ? 599 LEU A CD2 1  
ATOM 3554   N N   . ASP A 1 600 ? -100.942 -60.957 34.117  1.00 0.00 ? 600 ASP A N   1  
ATOM 3555   C CA  . ASP A 1 600 ? -100.846 -60.656 35.529  1.00 0.00 ? 600 ASP A CA  1  
ATOM 3556   C C   . ASP A 1 600 ? -102.033 -59.975 36.254  1.00 0.00 ? 600 ASP A C   1  
ATOM 3557   O O   . ASP A 1 600 ? -102.319 -60.327 37.410  1.00 0.00 ? 600 ASP A O   1  
ATOM 3558   C CB  . ASP A 1 600 ? -99.603  -59.794 35.862  1.00 0.00 ? 600 ASP A CB  1  
ATOM 3559   C CG  . ASP A 1 600 ? -98.273  -60.261 35.273  1.00 0.00 ? 600 ASP A CG  1  
ATOM 3560   O OD1 . ASP A 1 600 ? -98.107  -61.495 35.209  1.00 0.00 ? 600 ASP A OD1 1  
ATOM 3561   O OD2 . ASP A 1 600 ? -97.432  -59.436 34.809  1.00 0.00 ? 600 ASP A OD2 1  
ATOM 3562   N N   . GLU A 1 601 ? -102.704 -58.984 35.564  1.00 0.00 ? 601 GLU A N   1  
ATOM 3563   C CA  . GLU A 1 601 ? -103.708 -58.270 36.256  1.00 0.00 ? 601 GLU A CA  1  
ATOM 3564   C C   . GLU A 1 601 ? -104.926 -59.124 36.618  1.00 0.00 ? 601 GLU A C   1  
ATOM 3565   O O   . GLU A 1 601 ? -105.429 -59.084 37.730  1.00 0.00 ? 601 GLU A O   1  
ATOM 3566   C CB  . GLU A 1 601 ? -104.207 -56.987 35.552  1.00 0.00 ? 601 GLU A CB  1  
ATOM 3567   C CG  . GLU A 1 601 ? -104.620 -55.833 36.499  1.00 0.00 ? 601 GLU A CG  1  
ATOM 3568   C CD  . GLU A 1 601 ? -105.123 -54.598 35.697  1.00 0.00 ? 601 GLU A CD  1  
ATOM 3569   O OE1 . GLU A 1 601 ? -106.248 -54.540 35.122  1.00 0.00 ? 601 GLU A OE1 1  
ATOM 3570   O OE2 . GLU A 1 601 ? -104.218 -53.700 35.635  1.00 0.00 ? 601 GLU A OE2 1  
ATOM 3571   N N   . THR A 1 602 ? -105.279 -60.019 35.630  1.00 0.00 ? 602 THR A N   1  
ATOM 3572   C CA  . THR A 1 602 ? -106.337 -60.990 35.689  1.00 0.00 ? 602 THR A CA  1  
ATOM 3573   C C   . THR A 1 602 ? -106.181 -62.025 36.753  1.00 0.00 ? 602 THR A C   1  
ATOM 3574   O O   . THR A 1 602 ? -107.128 -62.244 37.457  1.00 0.00 ? 602 THR A O   1  
ATOM 3575   C CB  . THR A 1 602 ? -106.601 -61.689 34.320  1.00 0.00 ? 602 THR A CB  1  
ATOM 3576   O OG1 . THR A 1 602 ? -105.452 -62.327 33.756  1.00 0.00 ? 602 THR A OG1 1  
ATOM 3577   C CG2 . THR A 1 602 ? -107.073 -60.593 33.406  1.00 0.00 ? 602 THR A CG2 1  
ATOM 3578   N N   . TRP A 1 603 ? -104.934 -62.562 36.870  1.00 0.00 ? 603 TRP A N   1  
ATOM 3579   C CA  . TRP A 1 603 ? -104.580 -63.522 37.899  1.00 0.00 ? 603 TRP A CA  1  
ATOM 3580   C C   . TRP A 1 603 ? -104.616 -62.924 39.293  1.00 0.00 ? 603 TRP A C   1  
ATOM 3581   O O   . TRP A 1 603 ? -105.119 -63.597 40.217  1.00 0.00 ? 603 TRP A O   1  
ATOM 3582   C CB  . TRP A 1 603 ? -103.293 -64.345 37.713  1.00 0.00 ? 603 TRP A CB  1  
ATOM 3583   C CG  . TRP A 1 603 ? -103.017 -64.918 36.277  1.00 0.00 ? 603 TRP A CG  1  
ATOM 3584   C CD1 . TRP A 1 603 ? -101.820 -65.294 35.744  1.00 0.00 ? 603 TRP A CD1 1  
ATOM 3585   C CD2 . TRP A 1 603 ? -103.984 -65.195 35.189  1.00 0.00 ? 603 TRP A CD2 1  
ATOM 3586   N NE1 . TRP A 1 603 ? -101.921 -65.468 34.366  1.00 0.00 ? 603 TRP A NE1 1  
ATOM 3587   C CE2 . TRP A 1 603 ? -103.258 -65.512 33.979  1.00 0.00 ? 603 TRP A CE2 1  
ATOM 3588   C CE3 . TRP A 1 603 ? -105.433 -65.257 35.128  1.00 0.00 ? 603 TRP A CE3 1  
ATOM 3589   C CZ2 . TRP A 1 603 ? -103.837 -65.837 32.806  1.00 0.00 ? 603 TRP A CZ2 1  
ATOM 3590   C CZ3 . TRP A 1 603 ? -106.068 -65.490 33.929  1.00 0.00 ? 603 TRP A CZ3 1  
ATOM 3591   C CH2 . TRP A 1 603 ? -105.265 -65.753 32.759  1.00 0.00 ? 603 TRP A CH2 1  
ATOM 3592   N N   . MET A 1 604 ? -104.087 -61.700 39.450  1.00 0.00 ? 604 MET A N   1  
ATOM 3593   C CA  . MET A 1 604 ? -103.963 -61.071 40.769  1.00 0.00 ? 604 MET A CA  1  
ATOM 3594   C C   . MET A 1 604 ? -105.396 -60.953 41.323  1.00 0.00 ? 604 MET A C   1  
ATOM 3595   O O   . MET A 1 604 ? -105.647 -61.258 42.484  1.00 0.00 ? 604 MET A O   1  
ATOM 3596   C CB  . MET A 1 604 ? -103.293 -59.643 40.726  1.00 0.00 ? 604 MET A CB  1  
ATOM 3597   C CG  . MET A 1 604 ? -102.998 -58.898 42.162  1.00 0.00 ? 604 MET A CG  1  
ATOM 3598   S SD  . MET A 1 604 ? -104.395 -57.931 42.828  1.00 0.00 ? 604 MET A SD  1  
ATOM 3599   C CE  . MET A 1 604 ? -103.608 -57.630 44.461  1.00 0.00 ? 604 MET A CE  1  
ATOM 3600   N N   . ASP A 1 605 ? -106.361 -60.576 40.434  1.00 0.00 ? 605 ASP A N   1  
ATOM 3601   C CA  . ASP A 1 605 ? -107.741 -60.477 40.786  1.00 0.00 ? 605 ASP A CA  1  
ATOM 3602   C C   . ASP A 1 605 ? -108.456 -61.667 41.267  1.00 0.00 ? 605 ASP A C   1  
ATOM 3603   O O   . ASP A 1 605 ? -109.188 -61.680 42.285  1.00 0.00 ? 605 ASP A O   1  
ATOM 3604   C CB  . ASP A 1 605 ? -108.629 -60.057 39.610  1.00 0.00 ? 605 ASP A CB  1  
ATOM 3605   C CG  . ASP A 1 605 ? -108.141 -58.752 39.003  1.00 0.00 ? 605 ASP A CG  1  
ATOM 3606   O OD1 . ASP A 1 605 ? -107.397 -58.033 39.734  1.00 0.00 ? 605 ASP A OD1 1  
ATOM 3607   O OD2 . ASP A 1 605 ? -108.472 -58.437 37.852  1.00 0.00 ? 605 ASP A OD2 1  
ATOM 3608   N N   . LEU A 1 606 ? -108.144 -62.787 40.582  1.00 0.00 ? 606 LEU A N   1  
ATOM 3609   C CA  . LEU A 1 606 ? -108.627 -64.151 40.715  1.00 0.00 ? 606 LEU A CA  1  
ATOM 3610   C C   . LEU A 1 606 ? -108.178 -64.704 41.943  1.00 0.00 ? 606 LEU A C   1  
ATOM 3611   O O   . LEU A 1 606 ? -108.922 -65.497 42.477  1.00 0.00 ? 606 LEU A O   1  
ATOM 3612   C CB  . LEU A 1 606 ? -108.228 -65.109 39.604  1.00 0.00 ? 606 LEU A CB  1  
ATOM 3613   C CG  . LEU A 1 606 ? -108.998 -66.444 39.425  1.00 0.00 ? 606 LEU A CG  1  
ATOM 3614   C CD1 . LEU A 1 606 ? -110.411 -66.213 38.962  1.00 0.00 ? 606 LEU A CD1 1  
ATOM 3615   C CD2 . LEU A 1 606 ? -108.325 -67.375 38.429  1.00 0.00 ? 606 LEU A CD2 1  
ATOM 3616   N N   . ASN A 1 607 ? -106.996 -64.322 42.504  1.00 0.00 ? 607 ASN A N   1  
ATOM 3617   C CA  . ASN A 1 607 ? -106.568 -64.873 43.758  1.00 0.00 ? 607 ASN A CA  1  
ATOM 3618   C C   . ASN A 1 607 ? -107.366 -64.469 45.006  1.00 0.00 ? 607 ASN A C   1  
ATOM 3619   O O   . ASN A 1 607 ? -107.408 -65.313 45.954  1.00 0.00 ? 607 ASN A O   1  
ATOM 3620   C CB  . ASN A 1 607 ? -105.095 -64.304 43.992  1.00 0.00 ? 607 ASN A CB  1  
ATOM 3621   C CG  . ASN A 1 607 ? -104.093 -64.994 43.020  1.00 0.00 ? 607 ASN A CG  1  
ATOM 3622   O OD1 . ASN A 1 607 ? -103.262 -64.359 42.324  1.00 0.00 ? 607 ASN A OD1 1  
ATOM 3623   N ND2 . ASN A 1 607 ? -104.139 -66.336 42.960  1.00 0.00 ? 607 ASN A ND2 1  
ATOM 3624   N N   . LYS A 1 608 ? -108.066 -63.309 44.903  1.00 0.00 ? 608 LYS A N   1  
ATOM 3625   C CA  . LYS A 1 608 ? -108.970 -62.659 45.812  1.00 0.00 ? 608 LYS A CA  1  
ATOM 3626   C C   . LYS A 1 608 ? -110.304 -63.300 45.883  1.00 0.00 ? 608 LYS A C   1  
ATOM 3627   O O   . LYS A 1 608 ? -110.692 -63.902 44.854  1.00 0.00 ? 608 LYS A O   1  
ATOM 3628   C CB  . LYS A 1 608 ? -109.083 -61.157 45.588  1.00 0.00 ? 608 LYS A CB  1  
ATOM 3629   C CG  . LYS A 1 608 ? -107.738 -60.418 45.707  1.00 0.00 ? 608 LYS A CG  1  
ATOM 3630   C CD  . LYS A 1 608 ? -107.944 -58.880 45.609  1.00 0.00 ? 608 LYS A CD  1  
ATOM 3631   C CE  . LYS A 1 608 ? -108.288 -58.317 44.274  1.00 0.00 ? 608 LYS A CE  1  
ATOM 3632   N NZ  . LYS A 1 608 ? -108.360 -56.887 44.218  1.00 0.00 ? 608 LYS A NZ  1  
ATOM 3633   N N   . THR A 1 609 ? -111.048 -63.144 47.013  1.00 0.00 ? 609 THR A N   1  
ATOM 3634   C CA  . THR A 1 609 ? -112.298 -63.685 47.404  1.00 0.00 ? 609 THR A CA  1  
ATOM 3635   C C   . THR A 1 609 ? -113.409 -63.367 46.446  1.00 0.00 ? 609 THR A C   1  
ATOM 3636   O O   . THR A 1 609 ? -114.083 -64.342 46.194  1.00 0.00 ? 609 THR A O   1  
ATOM 3637   C CB  . THR A 1 609 ? -112.687 -63.259 48.845  1.00 0.00 ? 609 THR A CB  1  
ATOM 3638   O OG1 . THR A 1 609 ? -111.618 -63.249 49.718  1.00 0.00 ? 609 THR A OG1 1  
ATOM 3639   C CG2 . THR A 1 609 ? -113.734 -64.277 49.436  1.00 0.00 ? 609 THR A CG2 1  
ATOM 3640   N N   . PRO A 1 610 ? -113.779 -62.192 45.918  1.00 0.00 ? 610 PRO A N   1  
ATOM 3641   C CA  . PRO A 1 610 ? -115.010 -61.984 45.196  1.00 0.00 ? 610 PRO A CA  1  
ATOM 3642   C C   . PRO A 1 610 ? -115.201 -62.864 44.011  1.00 0.00 ? 610 PRO A C   1  
ATOM 3643   O O   . PRO A 1 610 ? -116.340 -63.108 43.652  1.00 0.00 ? 610 PRO A O   1  
ATOM 3644   C CB  . PRO A 1 610 ? -115.066 -60.528 44.698  1.00 0.00 ? 610 PRO A CB  1  
ATOM 3645   C CG  . PRO A 1 610 ? -114.081 -59.863 45.656  1.00 0.00 ? 610 PRO A CG  1  
ATOM 3646   C CD  . PRO A 1 610 ? -113.094 -60.965 46.100  1.00 0.00 ? 610 PRO A CD  1  
ATOM 3647   N N   . SER A 1 611 ? -114.173 -63.344 43.259  1.00 0.00 ? 611 SER A N   1  
ATOM 3648   C CA  . SER A 1 611 ? -114.366 -64.148 42.054  1.00 0.00 ? 611 SER A CA  1  
ATOM 3649   C C   . SER A 1 611 ? -114.715 -65.586 42.336  1.00 0.00 ? 611 SER A C   1  
ATOM 3650   O O   . SER A 1 611 ? -115.305 -66.276 41.490  1.00 0.00 ? 611 SER A O   1  
ATOM 3651   C CB  . SER A 1 611 ? -113.073 -64.021 41.203  1.00 0.00 ? 611 SER A CB  1  
ATOM 3652   O OG  . SER A 1 611 ? -111.906 -64.142 41.963  1.00 0.00 ? 611 SER A OG  1  
ATOM 3653   N N   . TRP A 1 612 ? -114.418 -66.075 43.547  1.00 0.00 ? 612 TRP A N   1  
ATOM 3654   C CA  . TRP A 1 612 ? -114.629 -67.418 43.940  1.00 0.00 ? 612 TRP A CA  1  
ATOM 3655   C C   . TRP A 1 612 ? -115.578 -67.538 45.138  1.00 0.00 ? 612 TRP A C   1  
ATOM 3656   O O   . TRP A 1 612 ? -115.418 -66.790 46.170  1.00 0.00 ? 612 TRP A O   1  
ATOM 3657   C CB  . TRP A 1 612 ? -113.297 -68.182 44.215  1.00 0.00 ? 612 TRP A CB  1  
ATOM 3658   C CG  . TRP A 1 612 ? -112.245 -67.493 44.910  1.00 0.00 ? 612 TRP A CG  1  
ATOM 3659   C CD1 . TRP A 1 612 ? -111.213 -66.829 44.370  1.00 0.00 ? 612 TRP A CD1 1  
ATOM 3660   C CD2 . TRP A 1 612 ? -111.989 -67.554 46.339  1.00 0.00 ? 612 TRP A CD2 1  
ATOM 3661   N NE1 . TRP A 1 612 ? -110.262 -66.590 45.358  1.00 0.00 ? 612 TRP A NE1 1  
ATOM 3662   C CE2 . TRP A 1 612 ? -110.744 -66.925 46.615  1.00 0.00 ? 612 TRP A CE2 1  
ATOM 3663   C CE3 . TRP A 1 612 ? -112.727 -68.036 47.410  1.00 0.00 ? 612 TRP A CE3 1  
ATOM 3664   C CZ2 . TRP A 1 612 ? -110.258 -66.813 47.846  1.00 0.00 ? 612 TRP A CZ2 1  
ATOM 3665   C CZ3 . TRP A 1 612 ? -112.288 -67.743 48.736  1.00 0.00 ? 612 TRP A CZ3 1  
ATOM 3666   C CH2 . TRP A 1 612 ? -111.090 -67.065 48.894  1.00 0.00 ? 612 TRP A CH2 1  
ATOM 3667   N N   . LYS A 1 613 ? -116.446 -68.490 44.937  1.00 0.00 ? 613 LYS A N   1  
ATOM 3668   C CA  . LYS A 1 613 ? -117.417 -68.953 45.941  1.00 0.00 ? 613 LYS A CA  1  
ATOM 3669   C C   . LYS A 1 613 ? -118.521 -68.031 46.326  1.00 0.00 ? 613 LYS A C   1  
ATOM 3670   O O   . LYS A 1 613 ? -118.313 -67.013 46.950  1.00 0.00 ? 613 LYS A O   1  
ATOM 3671   C CB  . LYS A 1 613 ? -116.789 -69.527 47.278  1.00 0.00 ? 613 LYS A CB  1  
ATOM 3672   C CG  . LYS A 1 613 ? -117.694 -70.604 47.967  1.00 0.00 ? 613 LYS A CG  1  
ATOM 3673   C CD  . LYS A 1 613 ? -118.661 -70.050 49.041  1.00 0.00 ? 613 LYS A CD  1  
ATOM 3674   C CE  . LYS A 1 613 ? -119.735 -71.118 49.348  1.00 0.00 ? 613 LYS A CE  1  
ATOM 3675   N NZ  . LYS A 1 613 ? -120.416 -71.662 48.142  1.00 0.00 ? 613 LYS A NZ  1  
ATOM 3676   N N   . TYR A 1 614 ? -119.775 -68.459 45.894  1.00 0.00 ? 614 TYR A N   1  
ATOM 3677   C CA  . TYR A 1 614 ? -121.055 -67.734 45.958  1.00 0.00 ? 614 TYR A CA  1  
ATOM 3678   C C   . TYR A 1 614 ? -121.456 -67.959 47.416  1.00 0.00 ? 614 TYR A C   1  
ATOM 3679   O O   . TYR A 1 614 ? -120.683 -68.638 48.145  1.00 0.00 ? 614 TYR A O   1  
ATOM 3680   C CB  . TYR A 1 614 ? -122.105 -68.302 44.938  1.00 0.00 ? 614 TYR A CB  1  
ATOM 3681   C CG  . TYR A 1 614 ? -123.449 -67.525 45.125  1.00 0.00 ? 614 TYR A CG  1  
ATOM 3682   C CD1 . TYR A 1 614 ? -123.535 -66.137 45.025  1.00 0.00 ? 614 TYR A CD1 1  
ATOM 3683   C CD2 . TYR A 1 614 ? -124.685 -68.148 45.169  1.00 0.00 ? 614 TYR A CD2 1  
ATOM 3684   C CE1 . TYR A 1 614 ? -124.660 -65.353 45.074  1.00 0.00 ? 614 TYR A CE1 1  
ATOM 3685   C CE2 . TYR A 1 614 ? -125.897 -67.433 45.238  1.00 0.00 ? 614 TYR A CE2 1  
ATOM 3686   C CZ  . TYR A 1 614 ? -125.919 -66.021 45.172  1.00 0.00 ? 614 TYR A CZ  1  
ATOM 3687   O OH  . TYR A 1 614 ? -127.221 -65.435 45.353  1.00 0.00 ? 614 TYR A OH  1  
ATOM 3688   N N   . ARG A 1 623 ? -117.432 -75.974 40.916  1.00 0.00 ? 623 ARG A N   1  
ATOM 3689   C CA  . ARG A 1 623 ? -116.397 -76.572 41.701  1.00 0.00 ? 623 ARG A CA  1  
ATOM 3690   C C   . ARG A 1 623 ? -115.200 -76.978 40.905  1.00 0.00 ? 623 ARG A C   1  
ATOM 3691   O O   . ARG A 1 623 ? -114.124 -76.380 41.040  1.00 0.00 ? 623 ARG A O   1  
ATOM 3692   C CB  . ARG A 1 623 ? -117.067 -77.730 42.596  1.00 0.00 ? 623 ARG A CB  1  
ATOM 3693   C CG  . ARG A 1 623 ? -117.636 -79.065 42.039  1.00 0.00 ? 623 ARG A CG  1  
ATOM 3694   C CD  . ARG A 1 623 ? -118.736 -79.055 40.998  1.00 0.00 ? 623 ARG A CD  1  
ATOM 3695   N NE  . ARG A 1 623 ? -119.853 -78.176 41.458  1.00 0.00 ? 623 ARG A NE  1  
ATOM 3696   C CZ  . ARG A 1 623 ? -120.680 -77.510 40.563  1.00 0.00 ? 623 ARG A CZ  1  
ATOM 3697   N NH1 . ARG A 1 623 ? -120.344 -77.431 39.261  1.00 0.00 ? 623 ARG A NH1 1  
ATOM 3698   N NH2 . ARG A 1 623 ? -121.840 -76.885 40.919  1.00 0.00 ? 623 ARG A NH2 1  
ATOM 3699   N N   . ARG A 1 624 ? -115.361 -77.952 39.997  1.00 0.00 ? 624 ARG A N   1  
ATOM 3700   C CA  . ARG A 1 624 ? -114.260 -78.420 39.151  1.00 0.00 ? 624 ARG A CA  1  
ATOM 3701   C C   . ARG A 1 624 ? -113.759 -77.412 38.138  1.00 0.00 ? 624 ARG A C   1  
ATOM 3702   O O   . ARG A 1 624 ? -112.568 -77.317 37.919  1.00 0.00 ? 624 ARG A O   1  
ATOM 3703   C CB  . ARG A 1 624 ? -114.702 -79.741 38.423  1.00 0.00 ? 624 ARG A CB  1  
ATOM 3704   C CG  . ARG A 1 624 ? -116.116 -79.594 37.733  1.00 0.00 ? 624 ARG A CG  1  
ATOM 3705   C CD  . ARG A 1 624 ? -116.355 -80.727 36.651  1.00 0.00 ? 624 ARG A CD  1  
ATOM 3706   N NE  . ARG A 1 624 ? -117.284 -80.244 35.660  1.00 0.00 ? 624 ARG A NE  1  
ATOM 3707   C CZ  . ARG A 1 624 ? -116.868 -79.609 34.502  1.00 0.00 ? 624 ARG A CZ  1  
ATOM 3708   N NH1 . ARG A 1 624 ? -115.536 -79.271 34.334  1.00 0.00 ? 624 ARG A NH1 1  
ATOM 3709   N NH2 . ARG A 1 624 ? -117.818 -79.456 33.562  1.00 0.00 ? 624 ARG A NH2 1  
ATOM 3710   N N   . ILE A 1 625 ? -114.674 -76.631 37.554  1.00 0.00 ? 625 ILE A N   1  
ATOM 3711   C CA  . ILE A 1 625 ? -114.533 -75.650 36.511  1.00 0.00 ? 625 ILE A CA  1  
ATOM 3712   C C   . ILE A 1 625 ? -113.577 -74.585 36.992  1.00 0.00 ? 625 ILE A C   1  
ATOM 3713   O O   . ILE A 1 625 ? -112.757 -74.133 36.251  1.00 0.00 ? 625 ILE A O   1  
ATOM 3714   C CB  . ILE A 1 625 ? -115.853 -75.078 36.041  1.00 0.00 ? 625 ILE A CB  1  
ATOM 3715   C CG1 . ILE A 1 625 ? -116.710 -74.302 37.186  1.00 0.00 ? 625 ILE A CG1 1  
ATOM 3716   C CG2 . ILE A 1 625 ? -116.750 -76.145 35.284  1.00 0.00 ? 625 ILE A CG2 1  
ATOM 3717   C CD1 . ILE A 1 625 ? -118.048 -73.729 36.689  1.00 0.00 ? 625 ILE A CD1 1  
ATOM 3718   N N   . VAL A 1 626 ? -113.618 -74.298 38.299  1.00 0.00 ? 626 VAL A N   1  
ATOM 3719   C CA  . VAL A 1 626 ? -112.735 -73.365 38.939  1.00 0.00 ? 626 VAL A CA  1  
ATOM 3720   C C   . VAL A 1 626 ? -111.328 -73.747 38.855  1.00 0.00 ? 626 VAL A C   1  
ATOM 3721   O O   . VAL A 1 626 ? -110.463 -72.943 38.527  1.00 0.00 ? 626 VAL A O   1  
ATOM 3722   C CB  . VAL A 1 626 ? -113.259 -73.201 40.430  1.00 0.00 ? 626 VAL A CB  1  
ATOM 3723   C CG1 . VAL A 1 626 ? -112.514 -72.028 41.022  1.00 0.00 ? 626 VAL A CG1 1  
ATOM 3724   C CG2 . VAL A 1 626 ? -114.770 -72.930 40.514  1.00 0.00 ? 626 VAL A CG2 1  
ATOM 3725   N N   . ARG A 1 627 ? -111.140 -75.077 39.097  1.00 0.00 ? 627 ARG A N   1  
ATOM 3726   C CA  . ARG A 1 627 ? -109.853 -75.766 39.074  1.00 0.00 ? 627 ARG A CA  1  
ATOM 3727   C C   . ARG A 1 627 ? -109.303 -75.774 37.719  1.00 0.00 ? 627 ARG A C   1  
ATOM 3728   O O   . ARG A 1 627 ? -108.079 -75.559 37.605  1.00 0.00 ? 627 ARG A O   1  
ATOM 3729   C CB  . ARG A 1 627 ? -109.901 -77.240 39.606  1.00 0.00 ? 627 ARG A CB  1  
ATOM 3730   C CG  . ARG A 1 627 ? -110.500 -77.350 41.025  1.00 0.00 ? 627 ARG A CG  1  
ATOM 3731   C CD  . ARG A 1 627 ? -110.394 -78.715 41.717  1.00 0.00 ? 627 ARG A CD  1  
ATOM 3732   N NE  . ARG A 1 627 ? -111.236 -79.678 41.110  1.00 0.00 ? 627 ARG A NE  1  
ATOM 3733   C CZ  . ARG A 1 627 ? -112.348 -80.137 41.712  1.00 0.00 ? 627 ARG A CZ  1  
ATOM 3734   N NH1 . ARG A 1 627 ? -112.894 -79.432 42.796  1.00 0.00 ? 627 ARG A NH1 1  
ATOM 3735   N NH2 . ARG A 1 627 ? -112.933 -81.319 41.210  1.00 0.00 ? 627 ARG A NH2 1  
ATOM 3736   N N   . ALA A 1 628 ? -110.182 -75.943 36.673  1.00 0.00 ? 628 ALA A N   1  
ATOM 3737   C CA  . ALA A 1 628 ? -109.676 -75.902 35.266  1.00 0.00 ? 628 ALA A CA  1  
ATOM 3738   C C   . ALA A 1 628 ? -109.150 -74.512 34.984  1.00 0.00 ? 628 ALA A C   1  
ATOM 3739   O O   . ALA A 1 628 ? -108.007 -74.449 34.483  1.00 0.00 ? 628 ALA A O   1  
ATOM 3740   C CB  . ALA A 1 628 ? -110.725 -76.333 34.259  1.00 0.00 ? 628 ALA A CB  1  
ATOM 3741   N N   . THR A 1 629 ? -109.861 -73.448 35.363  1.00 0.00 ? 629 THR A N   1  
ATOM 3742   C CA  . THR A 1 629 ? -109.365 -72.059 35.098  1.00 0.00 ? 629 THR A CA  1  
ATOM 3743   C C   . THR A 1 629 ? -108.000 -71.753 35.800  1.00 0.00 ? 629 THR A C   1  
ATOM 3744   O O   . THR A 1 629 ? -107.089 -71.117 35.255  1.00 0.00 ? 629 THR A O   1  
ATOM 3745   C CB  . THR A 1 629 ? -110.438 -70.940 35.280  1.00 0.00 ? 629 THR A CB  1  
ATOM 3746   O OG1 . THR A 1 629 ? -109.899 -69.702 34.791  1.00 0.00 ? 629 THR A OG1 1  
ATOM 3747   C CG2 . THR A 1 629 ? -110.961 -70.813 36.631  1.00 0.00 ? 629 THR A CG2 1  
ATOM 3748   N N   . ARG A 1 630 ? -107.800 -72.241 37.022  1.00 0.00 ? 630 ARG A N   1  
ATOM 3749   C CA  . ARG A 1 630 ? -106.668 -72.095 37.791  1.00 0.00 ? 630 ARG A CA  1  
ATOM 3750   C C   . ARG A 1 630 ? -105.417 -72.725 37.207  1.00 0.00 ? 630 ARG A C   1  
ATOM 3751   O O   . ARG A 1 630 ? -104.399 -72.100 37.168  1.00 0.00 ? 630 ARG A O   1  
ATOM 3752   C CB  . ARG A 1 630 ? -106.895 -72.736 39.247  1.00 0.00 ? 630 ARG A CB  1  
ATOM 3753   C CG  . ARG A 1 630 ? -107.685 -71.935 40.367  1.00 0.00 ? 630 ARG A CG  1  
ATOM 3754   C CD  . ARG A 1 630 ? -106.804 -70.787 40.896  1.00 0.00 ? 630 ARG A CD  1  
ATOM 3755   N NE  . ARG A 1 630 ? -107.651 -70.108 41.962  1.00 0.00 ? 630 ARG A NE  1  
ATOM 3756   C CZ  . ARG A 1 630 ? -107.424 -68.808 42.303  1.00 0.00 ? 630 ARG A CZ  1  
ATOM 3757   N NH1 . ARG A 1 630 ? -106.605 -68.005 41.587  1.00 0.00 ? 630 ARG A NH1 1  
ATOM 3758   N NH2 . ARG A 1 630 ? -108.022 -68.322 43.435  1.00 0.00 ? 630 ARG A NH2 1  
ATOM 3759   N N   . VAL A 1 631 ? -105.522 -74.009 36.709  1.00 0.00 ? 631 VAL A N   1  
ATOM 3760   C CA  . VAL A 1 631 ? -104.486 -74.685 36.078  1.00 0.00 ? 631 VAL A CA  1  
ATOM 3761   C C   . VAL A 1 631 ? -104.033 -74.122 34.731  1.00 0.00 ? 631 VAL A C   1  
ATOM 3762   O O   . VAL A 1 631 ? -102.811 -73.896 34.543  1.00 0.00 ? 631 VAL A O   1  
ATOM 3763   C CB  . VAL A 1 631 ? -104.587 -76.231 35.986  1.00 0.00 ? 631 VAL A CB  1  
ATOM 3764   C CG1 . VAL A 1 631 ? -104.562 -76.903 37.400  1.00 0.00 ? 631 VAL A CG1 1  
ATOM 3765   C CG2 . VAL A 1 631 ? -105.763 -76.765 35.193  1.00 0.00 ? 631 VAL A CG2 1  
ATOM 3766   N N   . LEU A 1 632 ? -105.061 -73.775 33.878  1.00 0.00 ? 632 LEU A N   1  
ATOM 3767   C CA  . LEU A 1 632 ? -104.737 -73.257 32.573  1.00 0.00 ? 632 LEU A CA  1  
ATOM 3768   C C   . LEU A 1 632 ? -104.003 -71.960 32.693  1.00 0.00 ? 632 LEU A C   1  
ATOM 3769   O O   . LEU A 1 632 ? -102.993 -71.781 31.994  1.00 0.00 ? 632 LEU A O   1  
ATOM 3770   C CB  . LEU A 1 632 ? -105.908 -72.994 31.769  1.00 0.00 ? 632 LEU A CB  1  
ATOM 3771   C CG  . LEU A 1 632 ? -105.731 -72.986 30.277  1.00 0.00 ? 632 LEU A CG  1  
ATOM 3772   C CD1 . LEU A 1 632 ? -105.582 -74.416 29.745  1.00 0.00 ? 632 LEU A CD1 1  
ATOM 3773   C CD2 . LEU A 1 632 ? -106.949 -72.114 29.632  1.00 0.00 ? 632 LEU A CD2 1  
ATOM 3774   N N   . HIS A 1 633 ? -104.453 -71.044 33.637  1.00 0.00 ? 633 HIS A N   1  
ATOM 3775   C CA  . HIS A 1 633 ? -103.840 -69.772 33.941  1.00 0.00 ? 633 HIS A CA  1  
ATOM 3776   C C   . HIS A 1 633 ? -102.423 -69.837 34.412  1.00 0.00 ? 633 HIS A C   1  
ATOM 3777   O O   . HIS A 1 633 ? -101.601 -69.097 33.891  1.00 0.00 ? 633 HIS A O   1  
ATOM 3778   C CB  . HIS A 1 633 ? -104.631 -68.791 34.871  1.00 0.00 ? 633 HIS A CB  1  
ATOM 3779   C CG  . HIS A 1 633 ? -104.243 -68.681 36.293  1.00 0.00 ? 633 HIS A CG  1  
ATOM 3780   N ND1 . HIS A 1 633 ? -103.103 -68.216 36.903  1.00 0.00 ? 633 HIS A ND1 1  
ATOM 3781   C CD2 . HIS A 1 633 ? -105.124 -68.875 37.322  1.00 0.00 ? 633 HIS A CD2 1  
ATOM 3782   C CE1 . HIS A 1 633 ? -103.312 -68.263 38.241  1.00 0.00 ? 633 HIS A CE1 1  
ATOM 3783   N NE2 . HIS A 1 633 ? -104.506 -68.635 38.573  1.00 0.00 ? 633 HIS A NE2 1  
ATOM 3784   N N   . ALA A 1 634 ? -102.097 -70.784 35.346  1.00 0.00 ? 634 ALA A N   1  
ATOM 3785   C CA  . ALA A 1 634 ? -100.736 -71.028 35.878  1.00 0.00 ? 634 ALA A CA  1  
ATOM 3786   C C   . ALA A 1 634 ? -99.842  -71.419 34.772  1.00 0.00 ? 634 ALA A C   1  
ATOM 3787   O O   . ALA A 1 634 ? -98.714  -70.984 34.623  1.00 0.00 ? 634 ALA A O   1  
ATOM 3788   C CB  . ALA A 1 634 ? -100.735 -72.154 36.913  1.00 0.00 ? 634 ALA A CB  1  
ATOM 3789   N N   . LYS A 1 635 ? -100.355 -72.368 33.884  1.00 0.00 ? 635 LYS A N   1  
ATOM 3790   C CA  . LYS A 1 635 ? -99.562  -72.916 32.768  1.00 0.00 ? 635 LYS A CA  1  
ATOM 3791   C C   . LYS A 1 635 ? -99.239  -71.851 31.822  1.00 0.00 ? 635 LYS A C   1  
ATOM 3792   O O   . LYS A 1 635 ? -98.075  -71.721 31.461  1.00 0.00 ? 635 LYS A O   1  
ATOM 3793   C CB  . LYS A 1 635 ? -100.397 -74.072 32.181  1.00 0.00 ? 635 LYS A CB  1  
ATOM 3794   C CG  . LYS A 1 635 ? -100.295 -75.294 33.067  1.00 0.00 ? 635 LYS A CG  1  
ATOM 3795   C CD  . LYS A 1 635 ? -101.462 -76.297 32.698  1.00 0.00 ? 635 LYS A CD  1  
ATOM 3796   C CE  . LYS A 1 635 ? -101.400 -77.713 33.435  1.00 0.00 ? 635 LYS A CE  1  
ATOM 3797   N NZ  . LYS A 1 635 ? -101.526 -77.439 34.928  1.00 0.00 ? 635 LYS A NZ  1  
ATOM 3798   N N   . MET A 1 636 ? -100.148 -70.954 31.408  1.00 0.00 ? 636 MET A N   1  
ATOM 3799   C CA  . MET A 1 636 ? -99.925  -69.889 30.460  1.00 0.00 ? 636 MET A CA  1  
ATOM 3800   C C   . MET A 1 636 ? -98.921  -68.904 30.903  1.00 0.00 ? 636 MET A C   1  
ATOM 3801   O O   . MET A 1 636 ? -98.111  -68.528 30.054  1.00 0.00 ? 636 MET A O   1  
ATOM 3802   C CB  . MET A 1 636 ? -101.202 -69.211 30.027  1.00 0.00 ? 636 MET A CB  1  
ATOM 3803   C CG  . MET A 1 636 ? -102.158 -70.117 29.168  1.00 0.00 ? 636 MET A CG  1  
ATOM 3804   S SD  . MET A 1 636 ? -103.769 -69.361 28.626  1.00 0.00 ? 636 MET A SD  1  
ATOM 3805   C CE  . MET A 1 636 ? -104.407 -68.812 30.254  1.00 0.00 ? 636 MET A CE  1  
ATOM 3806   N N   . ASN A 1 637 ? -98.901  -68.571 32.200  1.00 0.00 ? 637 ASN A N   1  
ATOM 3807   C CA  . ASN A 1 637 ? -97.924  -67.684 32.846  1.00 0.00 ? 637 ASN A CA  1  
ATOM 3808   C C   . ASN A 1 637 ? -96.512  -68.262 32.814  1.00 0.00 ? 637 ASN A C   1  
ATOM 3809   O O   . ASN A 1 637 ? -95.502  -67.579 32.574  1.00 0.00 ? 637 ASN A O   1  
ATOM 3810   C CB  . ASN A 1 637 ? -98.319  -67.316 34.311  1.00 0.00 ? 637 ASN A CB  1  
ATOM 3811   C CG  . ASN A 1 637 ? -97.950  -65.846 34.663  1.00 0.00 ? 637 ASN A CG  1  
ATOM 3812   O OD1 . ASN A 1 637 ? -98.830  -65.014 34.603  1.00 0.00 ? 637 ASN A OD1 1  
ATOM 3813   N ND2 . ASN A 1 637 ? -96.658  -65.638 35.089  1.00 0.00 ? 637 ASN A ND2 1  
ATOM 3814   N N   . HIS A 1 638 ? -96.502  -69.599 32.982  1.00 0.00 ? 638 HIS A N   1  
ATOM 3815   C CA  . HIS A 1 638 ? -95.251  -70.224 32.794  1.00 0.00 ? 638 HIS A CA  1  
ATOM 3816   C C   . HIS A 1 638 ? -94.665  -70.170 31.413  1.00 0.00 ? 638 HIS A C   1  
ATOM 3817   O O   . HIS A 1 638 ? -93.539  -69.795 31.184  1.00 0.00 ? 638 HIS A O   1  
ATOM 3818   C CB  . HIS A 1 638 ? -95.214  -71.642 33.354  1.00 0.00 ? 638 HIS A CB  1  
ATOM 3819   C CG  . HIS A 1 638 ? -93.741  -71.898 33.644  1.00 0.00 ? 638 HIS A CG  1  
ATOM 3820   N ND1 . HIS A 1 638 ? -93.009  -71.356 34.652  1.00 0.00 ? 638 HIS A ND1 1  
ATOM 3821   C CD2 . HIS A 1 638 ? -92.834  -72.581 32.914  1.00 0.00 ? 638 HIS A CD2 1  
ATOM 3822   C CE1 . HIS A 1 638 ? -91.751  -71.670 34.468  1.00 0.00 ? 638 HIS A CE1 1  
ATOM 3823   N NE2 . HIS A 1 638 ? -91.589  -72.431 33.405  1.00 0.00 ? 638 HIS A NE2 1  
ATOM 3824   N N   . PHE A 1 639 ? -95.564  -70.409 30.491  1.00 0.00 ? 639 PHE A N   1  
ATOM 3825   C CA  . PHE A 1 639 ? -95.168  -70.404 29.063  1.00 0.00 ? 639 PHE A CA  1  
ATOM 3826   C C   . PHE A 1 639 ? -94.615  -69.090 28.560  1.00 0.00 ? 639 PHE A C   1  
ATOM 3827   O O   . PHE A 1 639 ? -93.502  -69.043 28.076  1.00 0.00 ? 639 PHE A O   1  
ATOM 3828   C CB  . PHE A 1 639 ? -96.273  -70.663 28.053  1.00 0.00 ? 639 PHE A CB  1  
ATOM 3829   C CG  . PHE A 1 639 ? -96.889  -72.046 28.140  1.00 0.00 ? 639 PHE A CG  1  
ATOM 3830   C CD1 . PHE A 1 639 ? -96.041  -73.168 28.431  1.00 0.00 ? 639 PHE A CD1 1  
ATOM 3831   C CD2 . PHE A 1 639 ? -98.250  -72.289 27.964  1.00 0.00 ? 639 PHE A CD2 1  
ATOM 3832   C CE1 . PHE A 1 639 ? -96.523  -74.425 28.573  1.00 0.00 ? 639 PHE A CE1 1  
ATOM 3833   C CE2 . PHE A 1 639 ? -98.679  -73.615 27.948  1.00 0.00 ? 639 PHE A CE2 1  
ATOM 3834   C CZ  . PHE A 1 639 ? -97.899  -74.692 28.286  1.00 0.00 ? 639 PHE A CZ  1  
ATOM 3835   N N   . ILE A 1 640 ? -95.319  -67.988 28.878  1.00 0.00 ? 640 ILE A N   1  
ATOM 3836   C CA  . ILE A 1 640 ? -94.869  -66.627 28.576  1.00 0.00 ? 640 ILE A CA  1  
ATOM 3837   C C   . ILE A 1 640 ? -93.547  -66.193 29.270  1.00 0.00 ? 640 ILE A C   1  
ATOM 3838   O O   . ILE A 1 640 ? -92.642  -65.720 28.542  1.00 0.00 ? 640 ILE A O   1  
ATOM 3839   C CB  . ILE A 1 640 ? -95.951  -65.536 28.797  1.00 0.00 ? 640 ILE A CB  1  
ATOM 3840   C CG1 . ILE A 1 640 ? -96.343  -65.409 30.296  1.00 0.00 ? 640 ILE A CG1 1  
ATOM 3841   C CG2 . ILE A 1 640 ? -97.134  -65.825 27.774  1.00 0.00 ? 640 ILE A CG2 1  
ATOM 3842   C CD1 . ILE A 1 640 ? -97.413  -64.342 30.578  1.00 0.00 ? 640 ILE A CD1 1  
ATOM 3843   N N   . LYS A 1 641 ? -93.323  -66.510 30.553  1.00 0.00 ? 641 LYS A N   1  
ATOM 3844   C CA  . LYS A 1 641 ? -92.076  -66.295 31.269  1.00 0.00 ? 641 LYS A CA  1  
ATOM 3845   C C   . LYS A 1 641 ? -90.890  -67.092 30.698  1.00 0.00 ? 641 LYS A C   1  
ATOM 3846   O O   . LYS A 1 641 ? -89.831  -66.551 30.593  1.00 0.00 ? 641 LYS A O   1  
ATOM 3847   C CB  . LYS A 1 641 ? -92.317  -66.436 32.814  1.00 0.00 ? 641 LYS A CB  1  
ATOM 3848   C CG  . LYS A 1 641 ? -91.056  -66.283 33.679  1.00 0.00 ? 641 LYS A CG  1  
ATOM 3849   C CD  . LYS A 1 641 ? -90.800  -64.767 33.744  1.00 0.00 ? 641 LYS A CD  1  
ATOM 3850   C CE  . LYS A 1 641 ? -89.516  -64.229 34.462  1.00 0.00 ? 641 LYS A CE  1  
ATOM 3851   N NZ  . LYS A 1 641 ? -88.248  -64.625 33.819  1.00 0.00 ? 641 LYS A NZ  1  
ATOM 3852   N N   . THR A 1 642 ? -91.105  -68.363 30.219  1.00 0.00 ? 642 THR A N   1  
ATOM 3853   C CA  . THR A 1 642 ? -90.039  -69.098 29.583  1.00 0.00 ? 642 THR A CA  1  
ATOM 3854   C C   . THR A 1 642 ? -89.645  -68.492 28.256  1.00 0.00 ? 642 THR A C   1  
ATOM 3855   O O   . THR A 1 642 ? -88.526  -68.330 27.971  1.00 0.00 ? 642 THR A O   1  
ATOM 3856   C CB  . THR A 1 642 ? -90.421  -70.591 29.417  1.00 0.00 ? 642 THR A CB  1  
ATOM 3857   O OG1 . THR A 1 642 ? -91.062  -71.053 30.547  1.00 0.00 ? 642 THR A OG1 1  
ATOM 3858   C CG2 . THR A 1 642 ? -89.116  -71.334 29.170  1.00 0.00 ? 642 THR A CG2 1  
ATOM 3859   N N   . ILE A 1 643 ? -90.647  -68.001 27.486  1.00 0.00 ? 643 ILE A N   1  
ATOM 3860   C CA  . ILE A 1 643 ? -90.477  -67.292 26.248  1.00 0.00 ? 643 ILE A CA  1  
ATOM 3861   C C   . ILE A 1 643 ? -89.680  -66.046 26.463  1.00 0.00 ? 643 ILE A C   1  
ATOM 3862   O O   . ILE A 1 643 ? -88.776  -65.875 25.672  1.00 0.00 ? 643 ILE A O   1  
ATOM 3863   C CB  . ILE A 1 643 ? -91.924  -66.982 25.714  1.00 0.00 ? 643 ILE A CB  1  
ATOM 3864   C CG1 . ILE A 1 643 ? -92.559  -68.274 25.088  1.00 0.00 ? 643 ILE A CG1 1  
ATOM 3865   C CG2 . ILE A 1 643 ? -91.822  -65.828 24.683  1.00 0.00 ? 643 ILE A CG2 1  
ATOM 3866   C CD1 . ILE A 1 643 ? -93.979  -68.072 24.536  1.00 0.00 ? 643 ILE A CD1 1  
ATOM 3867   N N   . MET A 1 644 ? -90.022  -65.214 27.462  1.00 0.00 ? 644 MET A N   1  
ATOM 3868   C CA  . MET A 1 644 ? -89.415  -63.963 27.716  1.00 0.00 ? 644 MET A CA  1  
ATOM 3869   C C   . MET A 1 644 ? -87.931  -64.187 28.115  1.00 0.00 ? 644 MET A C   1  
ATOM 3870   O O   . MET A 1 644 ? -87.126  -63.479 27.571  1.00 0.00 ? 644 MET A O   1  
ATOM 3871   C CB  . MET A 1 644 ? -90.152  -63.322 28.862  1.00 0.00 ? 644 MET A CB  1  
ATOM 3872   C CG  . MET A 1 644 ? -89.927  -61.766 28.887  1.00 0.00 ? 644 MET A CG  1  
ATOM 3873   S SD  . MET A 1 644 ? -90.705  -60.902 27.484  1.00 0.00 ? 644 MET A SD  1  
ATOM 3874   C CE  . MET A 1 644 ? -92.449  -61.237 28.009  1.00 0.00 ? 644 MET A CE  1  
ATOM 3875   N N   . GLU A 1 645 ? -87.594  -65.258 28.891  1.00 0.00 ? 645 GLU A N   1  
ATOM 3876   C CA  . GLU A 1 645 ? -86.241  -65.597 29.273  1.00 0.00 ? 645 GLU A CA  1  
ATOM 3877   C C   . GLU A 1 645 ? -85.432  -65.849 28.050  1.00 0.00 ? 645 GLU A C   1  
ATOM 3878   O O   . GLU A 1 645 ? -84.329  -65.315 27.964  1.00 0.00 ? 645 GLU A O   1  
ATOM 3879   C CB  . GLU A 1 645 ? -86.054  -66.826 30.229  1.00 0.00 ? 645 GLU A CB  1  
ATOM 3880   C CG  . GLU A 1 645 ? -86.646  -66.525 31.600  1.00 0.00 ? 645 GLU A CG  1  
ATOM 3881   C CD  . GLU A 1 645 ? -86.576  -67.800 32.491  1.00 0.00 ? 645 GLU A CD  1  
ATOM 3882   O OE1 . GLU A 1 645 ? -85.402  -68.326 32.597  1.00 0.00 ? 645 GLU A OE1 1  
ATOM 3883   O OE2 . GLU A 1 645 ? -87.579  -68.240 33.003  1.00 0.00 ? 645 GLU A OE2 1  
ATOM 3884   N N   . TYR A 1 646 ? -85.940  -66.675 27.084  1.00 0.00 ? 646 TYR A N   1  
ATOM 3885   C CA  . TYR A 1 646 ? -85.188  -67.038 25.890  1.00 0.00 ? 646 TYR A CA  1  
ATOM 3886   C C   . TYR A 1 646 ? -84.991  -65.832 24.932  1.00 0.00 ? 646 TYR A C   1  
ATOM 3887   O O   . TYR A 1 646 ? -83.937  -65.620 24.389  1.00 0.00 ? 646 TYR A O   1  
ATOM 3888   C CB  . TYR A 1 646 ? -86.025  -68.138 25.102  1.00 0.00 ? 646 TYR A CB  1  
ATOM 3889   C CG  . TYR A 1 646 ? -85.285  -69.527 25.337  1.00 0.00 ? 646 TYR A CG  1  
ATOM 3890   C CD1 . TYR A 1 646 ? -85.071  -70.069 26.643  1.00 0.00 ? 646 TYR A CD1 1  
ATOM 3891   C CD2 . TYR A 1 646 ? -84.604  -70.027 24.284  1.00 0.00 ? 646 TYR A CD2 1  
ATOM 3892   C CE1 . TYR A 1 646 ? -84.249  -71.246 26.837  1.00 0.00 ? 646 TYR A CE1 1  
ATOM 3893   C CE2 . TYR A 1 646 ? -83.775  -71.245 24.402  1.00 0.00 ? 646 TYR A CE2 1  
ATOM 3894   C CZ  . TYR A 1 646 ? -83.729  -71.839 25.662  1.00 0.00 ? 646 TYR A CZ  1  
ATOM 3895   O OH  . TYR A 1 646 ? -83.172  -73.127 25.769  1.00 0.00 ? 646 TYR A OH  1  
ATOM 3896   N N   . PHE A 1 647 ? -86.107  -65.048 24.754  1.00 0.00 ? 647 PHE A N   1  
ATOM 3897   C CA  . PHE A 1 647 ? -86.089  -63.891 23.895  1.00 0.00 ? 647 PHE A CA  1  
ATOM 3898   C C   . PHE A 1 647 ? -84.975  -62.881 24.427  1.00 0.00 ? 647 PHE A C   1  
ATOM 3899   O O   . PHE A 1 647 ? -84.063  -62.401 23.776  1.00 0.00 ? 647 PHE A O   1  
ATOM 3900   C CB  . PHE A 1 647 ? -87.522  -63.284 23.900  1.00 0.00 ? 647 PHE A CB  1  
ATOM 3901   C CG  . PHE A 1 647 ? -87.650  -62.144 22.993  1.00 0.00 ? 647 PHE A CG  1  
ATOM 3902   C CD1 . PHE A 1 647 ? -88.045  -62.258 21.700  1.00 0.00 ? 647 PHE A CD1 1  
ATOM 3903   C CD2 . PHE A 1 647 ? -87.435  -60.838 23.495  1.00 0.00 ? 647 PHE A CD2 1  
ATOM 3904   C CE1 . PHE A 1 647 ? -88.009  -61.099 20.828  1.00 0.00 ? 647 PHE A CE1 1  
ATOM 3905   C CE2 . PHE A 1 647 ? -87.587  -59.690 22.754  1.00 0.00 ? 647 PHE A CE2 1  
ATOM 3906   C CZ  . PHE A 1 647 ? -87.844  -59.782 21.364  1.00 0.00 ? 647 PHE A CZ  1  
ATOM 3907   N N   . ASN A 1 648 ? -84.984  -62.617 25.788  1.00 0.00 ? 648 ASN A N   1  
ATOM 3908   C CA  . ASN A 1 648 ? -84.010  -61.697 26.324  1.00 0.00 ? 648 ASN A CA  1  
ATOM 3909   C C   . ASN A 1 648 ? -82.590  -62.278 26.320  1.00 0.00 ? 648 ASN A C   1  
ATOM 3910   O O   . ASN A 1 648 ? -81.634  -61.680 25.872  1.00 0.00 ? 648 ASN A O   1  
ATOM 3911   C CB  . ASN A 1 648 ? -84.299  -61.108 27.748  1.00 0.00 ? 648 ASN A CB  1  
ATOM 3912   C CG  . ASN A 1 648 ? -84.230  -62.032 29.007  1.00 0.00 ? 648 ASN A CG  1  
ATOM 3913   O OD1 . ASN A 1 648 ? -85.364  -62.289 29.494  1.00 0.00 ? 648 ASN A OD1 1  
ATOM 3914   N ND2 . ASN A 1 648 ? -83.042  -62.290 29.555  1.00 0.00 ? 648 ASN A ND2 1  
ATOM 3915   N N   . GLN A 1 649 ? -82.359  -63.583 26.796  1.00 0.00 ? 649 GLN A N   1  
ATOM 3916   C CA  . GLN A 1 649 ? -80.977  -64.100 26.865  1.00 0.00 ? 649 GLN A CA  1  
ATOM 3917   C C   . GLN A 1 649 ? -80.356  -64.345 25.572  1.00 0.00 ? 649 GLN A C   1  
ATOM 3918   O O   . GLN A 1 649 ? -79.208  -64.035 25.231  1.00 0.00 ? 649 GLN A O   1  
ATOM 3919   C CB  . GLN A 1 649 ? -80.831  -65.448 27.634  1.00 0.00 ? 649 GLN A CB  1  
ATOM 3920   C CG  . GLN A 1 649 ? -81.119  -65.324 29.128  1.00 0.00 ? 649 GLN A CG  1  
ATOM 3921   C CD  . GLN A 1 649 ? -81.338  -66.721 29.689  1.00 0.00 ? 649 GLN A CD  1  
ATOM 3922   O OE1 . GLN A 1 649 ? -82.076  -67.576 29.186  1.00 0.00 ? 649 GLN A OE1 1  
ATOM 3923   N NE2 . GLN A 1 649 ? -80.676  -66.906 30.871  1.00 0.00 ? 649 GLN A NE2 1  
ATOM 3924   N N   . ASN A 1 650 ? -81.085  -65.158 24.759  1.00 0.00 ? 650 ASN A N   1  
ATOM 3925   C CA  . ASN A 1 650 ? -80.593  -65.812 23.591  1.00 0.00 ? 650 ASN A CA  1  
ATOM 3926   C C   . ASN A 1 650 ? -80.452  -64.830 22.452  1.00 0.00 ? 650 ASN A C   1  
ATOM 3927   O O   . ASN A 1 650 ? -79.733  -65.021 21.440  1.00 0.00 ? 650 ASN A O   1  
ATOM 3928   C CB  . ASN A 1 650 ? -81.351  -67.063 23.101  1.00 0.00 ? 650 ASN A CB  1  
ATOM 3929   C CG  . ASN A 1 650 ? -81.301  -68.169 24.144  1.00 0.00 ? 650 ASN A CG  1  
ATOM 3930   O OD1 . ASN A 1 650 ? -82.050  -68.183 25.127  1.00 0.00 ? 650 ASN A OD1 1  
ATOM 3931   N ND2 . ASN A 1 650 ? -80.319  -69.163 24.054  1.00 0.00 ? 650 ASN A ND2 1  
ATOM 3932   N N   . VAL A 1 651 ? -81.182  -63.654 22.473  1.00 0.00 ? 651 VAL A N   1  
ATOM 3933   C CA  . VAL A 1 651 ? -81.198  -62.700 21.444  1.00 0.00 ? 651 VAL A CA  1  
ATOM 3934   C C   . VAL A 1 651 ? -80.427  -61.597 22.042  1.00 0.00 ? 651 VAL A C   1  
ATOM 3935   O O   . VAL A 1 651 ? -79.249  -61.433 21.712  1.00 0.00 ? 651 VAL A O   1  
ATOM 3936   C CB  . VAL A 1 651 ? -82.612  -62.313 21.109  1.00 0.00 ? 651 VAL A CB  1  
ATOM 3937   C CG1 . VAL A 1 651 ? -82.601  -61.406 19.848  1.00 0.00 ? 651 VAL A CG1 1  
ATOM 3938   C CG2 . VAL A 1 651 ? -83.494  -63.556 20.940  1.00 0.00 ? 651 VAL A CG2 1  
ATOM 3939   N N   . ILE A 1 652 ? -81.149  -60.765 22.860  1.00 0.00 ? 652 ILE A N   1  
ATOM 3940   C CA  . ILE A 1 652 ? -80.696  -59.367 23.327  1.00 0.00 ? 652 ILE A CA  1  
ATOM 3941   C C   . ILE A 1 652 ? -79.390  -59.426 24.174  1.00 0.00 ? 652 ILE A C   1  
ATOM 3942   O O   . ILE A 1 652 ? -78.444  -58.743 23.877  1.00 0.00 ? 652 ILE A O   1  
ATOM 3943   C CB  . ILE A 1 652 ? -81.865  -58.563 24.086  1.00 0.00 ? 652 ILE A CB  1  
ATOM 3944   C CG1 . ILE A 1 652 ? -83.154  -58.746 23.378  1.00 0.00 ? 652 ILE A CG1 1  
ATOM 3945   C CG2 . ILE A 1 652 ? -81.341  -57.077 24.255  1.00 0.00 ? 652 ILE A CG2 1  
ATOM 3946   C CD1 . ILE A 1 652 ? -84.339  -58.013 24.030  1.00 0.00 ? 652 ILE A CD1 1  
ATOM 3947   N N   . ASP A 1 653 ? -79.383  -60.234 25.207  1.00 0.00 ? 653 ASP A N   1  
ATOM 3948   C CA  . ASP A 1 653 ? -78.280  -60.255 26.142  1.00 0.00 ? 653 ASP A CA  1  
ATOM 3949   C C   . ASP A 1 653 ? -77.020  -60.689 25.441  1.00 0.00 ? 653 ASP A C   1  
ATOM 3950   O O   . ASP A 1 653 ? -75.948  -60.069 25.560  1.00 0.00 ? 653 ASP A O   1  
ATOM 3951   C CB  . ASP A 1 653 ? -78.470  -61.260 27.362  1.00 0.00 ? 653 ASP A CB  1  
ATOM 3952   C CG  . ASP A 1 653 ? -79.514  -60.765 28.464  1.00 0.00 ? 653 ASP A CG  1  
ATOM 3953   O OD1 . ASP A 1 653 ? -80.025  -59.658 28.161  1.00 0.00 ? 653 ASP A OD1 1  
ATOM 3954   O OD2 . ASP A 1 653 ? -79.798  -61.520 29.409  1.00 0.00 ? 653 ASP A OD2 1  
ATOM 3955   N N   . LYS A 1 654 ? -77.170  -61.729 24.533  1.00 0.00 ? 654 LYS A N   1  
ATOM 3956   C CA  . LYS A 1 654 ? -76.101  -62.185 23.745  1.00 0.00 ? 654 LYS A CA  1  
ATOM 3957   C C   . LYS A 1 654 ? -75.524  -61.170 22.773  1.00 0.00 ? 654 LYS A C   1  
ATOM 3958   O O   . LYS A 1 654 ? -74.326  -60.965 22.731  1.00 0.00 ? 654 LYS A O   1  
ATOM 3959   C CB  . LYS A 1 654 ? -76.629  -63.442 23.022  1.00 0.00 ? 654 LYS A CB  1  
ATOM 3960   C CG  . LYS A 1 654 ? -75.603  -64.117 22.153  1.00 0.00 ? 654 LYS A CG  1  
ATOM 3961   C CD  . LYS A 1 654 ? -76.031  -65.493 21.552  1.00 0.00 ? 654 LYS A CD  1  
ATOM 3962   C CE  . LYS A 1 654 ? -76.029  -66.756 22.542  1.00 0.00 ? 654 LYS A CE  1  
ATOM 3963   N NZ  . LYS A 1 654 ? -74.732  -66.929 23.232  1.00 0.00 ? 654 LYS A NZ  1  
ATOM 3964   N N   . GLU A 1 655 ? -76.413  -60.462 21.990  1.00 0.00 ? 655 GLU A N   1  
ATOM 3965   C CA  . GLU A 1 655 ? -75.894  -59.544 21.044  1.00 0.00 ? 655 GLU A CA  1  
ATOM 3966   C C   . GLU A 1 655 ? -75.241  -58.346 21.719  1.00 0.00 ? 655 GLU A C   1  
ATOM 3967   O O   . GLU A 1 655 ? -74.264  -57.836 21.248  1.00 0.00 ? 655 GLU A O   1  
ATOM 3968   C CB  . GLU A 1 655 ? -76.977  -59.202 19.983  1.00 0.00 ? 655 GLU A CB  1  
ATOM 3969   C CG  . GLU A 1 655 ? -76.637  -58.091 18.932  1.00 0.00 ? 655 GLU A CG  1  
ATOM 3970   C CD  . GLU A 1 655 ? -75.290  -58.318 18.184  1.00 0.00 ? 655 GLU A CD  1  
ATOM 3971   O OE1 . GLU A 1 655 ? -75.184  -59.294 17.348  1.00 0.00 ? 655 GLU A OE1 1  
ATOM 3972   O OE2 . GLU A 1 655 ? -74.347  -57.503 18.442  1.00 0.00 ? 655 GLU A OE2 1  
ATOM 3973   N N   . VAL A 1 656 ? -75.861  -57.862 22.880  1.00 0.00 ? 656 VAL A N   1  
ATOM 3974   C CA  . VAL A 1 656 ? -75.316  -56.707 23.533  1.00 0.00 ? 656 VAL A CA  1  
ATOM 3975   C C   . VAL A 1 656 ? -73.977  -56.854 24.105  1.00 0.00 ? 656 VAL A C   1  
ATOM 3976   O O   . VAL A 1 656 ? -73.099  -56.014 24.144  1.00 0.00 ? 656 VAL A O   1  
ATOM 3977   C CB  . VAL A 1 656 ? -76.222  -56.034 24.574  1.00 0.00 ? 656 VAL A CB  1  
ATOM 3978   C CG1 . VAL A 1 656 ? -77.546  -55.559 23.959  1.00 0.00 ? 656 VAL A CG1 1  
ATOM 3979   C CG2 . VAL A 1 656 ? -76.562  -56.811 25.857  1.00 0.00 ? 656 VAL A CG2 1  
ATOM 3980   N N   . TYR A 1 657 ? -73.736  -58.132 24.598  1.00 0.00 ? 657 TYR A N   1  
ATOM 3981   C CA  . TYR A 1 657 ? -72.509  -58.560 25.208  1.00 0.00 ? 657 TYR A CA  1  
ATOM 3982   C C   . TYR A 1 657 ? -71.384  -58.413 24.219  1.00 0.00 ? 657 TYR A C   1  
ATOM 3983   O O   . TYR A 1 657 ? -70.305  -57.862 24.448  1.00 0.00 ? 657 TYR A O   1  
ATOM 3984   C CB  . TYR A 1 657 ? -72.609  -59.975 25.833  1.00 0.00 ? 657 TYR A CB  1  
ATOM 3985   C CG  . TYR A 1 657 ? -71.422  -60.373 26.680  1.00 0.00 ? 657 TYR A CG  1  
ATOM 3986   C CD1 . TYR A 1 657 ? -71.190  -59.698 27.908  1.00 0.00 ? 657 TYR A CD1 1  
ATOM 3987   C CD2 . TYR A 1 657 ? -70.543  -61.344 26.284  1.00 0.00 ? 657 TYR A CD2 1  
ATOM 3988   C CE1 . TYR A 1 657 ? -70.038  -59.951 28.663  1.00 0.00 ? 657 TYR A CE1 1  
ATOM 3989   C CE2 . TYR A 1 657 ? -69.381  -61.649 27.075  1.00 0.00 ? 657 TYR A CE2 1  
ATOM 3990   C CZ  . TYR A 1 657 ? -69.129  -60.913 28.236  1.00 0.00 ? 657 TYR A CZ  1  
ATOM 3991   O OH  . TYR A 1 657 ? -67.942  -61.259 28.965  1.00 0.00 ? 657 TYR A OH  1  
ATOM 3992   N N   . SER A 1 658 ? -71.734  -58.932 22.995  1.00 0.00 ? 658 SER A N   1  
ATOM 3993   C CA  . SER A 1 658 ? -70.848  -58.814 21.869  1.00 0.00 ? 658 SER A CA  1  
ATOM 3994   C C   . SER A 1 658 ? -70.570  -57.447 21.325  1.00 0.00 ? 658 SER A C   1  
ATOM 3995   O O   . SER A 1 658 ? -69.400  -57.182 20.986  1.00 0.00 ? 658 SER A O   1  
ATOM 3996   C CB  . SER A 1 658 ? -71.573  -59.644 20.718  1.00 0.00 ? 658 SER A CB  1  
ATOM 3997   O OG  . SER A 1 658 ? -71.971  -60.996 21.079  1.00 0.00 ? 658 SER A OG  1  
ATOM 3998   N N   . LEU A 1 659 ? -71.539  -56.603 21.344  1.00 0.00 ? 659 LEU A N   1  
ATOM 3999   C CA  . LEU A 1 659 ? -71.446  -55.247 20.863  1.00 0.00 ? 659 LEU A CA  1  
ATOM 4000   C C   . LEU A 1 659 ? -70.417  -54.487 21.654  1.00 0.00 ? 659 LEU A C   1  
ATOM 4001   O O   . LEU A 1 659 ? -69.550  -53.781 21.126  1.00 0.00 ? 659 LEU A O   1  
ATOM 4002   C CB  . LEU A 1 659 ? -72.814  -54.569 20.850  1.00 0.00 ? 659 LEU A CB  1  
ATOM 4003   C CG  . LEU A 1 659 ? -72.991  -53.019 20.655  1.00 0.00 ? 659 LEU A CG  1  
ATOM 4004   C CD1 . LEU A 1 659 ? -74.308  -52.725 19.939  1.00 0.00 ? 659 LEU A CD1 1  
ATOM 4005   C CD2 . LEU A 1 659 ? -72.788  -52.281 21.931  1.00 0.00 ? 659 LEU A CD2 1  
ATOM 4006   N N   . GLU A 1 660 ? -70.493  -54.696 23.035  1.00 0.00 ? 660 GLU A N   1  
ATOM 4007   C CA  . GLU A 1 660 ? -69.692  -54.011 24.004  1.00 0.00 ? 660 GLU A CA  1  
ATOM 4008   C C   . GLU A 1 660 ? -68.261  -54.382 23.818  1.00 0.00 ? 660 GLU A C   1  
ATOM 4009   O O   . GLU A 1 660 ? -67.365  -53.536 23.826  1.00 0.00 ? 660 GLU A O   1  
ATOM 4010   C CB  . GLU A 1 660 ? -70.042  -54.336 25.489  1.00 0.00 ? 660 GLU A CB  1  
ATOM 4011   C CG  . GLU A 1 660 ? -71.328  -53.655 25.936  1.00 0.00 ? 660 GLU A CG  1  
ATOM 4012   C CD  . GLU A 1 660 ? -71.688  -54.098 27.337  1.00 0.00 ? 660 GLU A CD  1  
ATOM 4013   O OE1 . GLU A 1 660 ? -72.243  -55.190 27.446  1.00 0.00 ? 660 GLU A OE1 1  
ATOM 4014   O OE2 . GLU A 1 660 ? -71.449  -53.397 28.347  1.00 0.00 ? 660 GLU A OE2 1  
ATOM 4015   N N   . LYS A 1 661 ? -68.024  -55.669 23.521  1.00 0.00 ? 661 LYS A N   1  
ATOM 4016   C CA  . LYS A 1 661 ? -66.634  -56.095 23.338  1.00 0.00 ? 661 LYS A CA  1  
ATOM 4017   C C   . LYS A 1 661 ? -66.029  -55.440 22.210  1.00 0.00 ? 661 LYS A C   1  
ATOM 4018   O O   . LYS A 1 661 ? -64.907  -54.969 22.295  1.00 0.00 ? 661 LYS A O   1  
ATOM 4019   C CB  . LYS A 1 661 ? -66.596  -57.660 23.092  1.00 0.00 ? 661 LYS A CB  1  
ATOM 4020   C CG  . LYS A 1 661 ? -65.224  -58.402 22.937  1.00 0.00 ? 661 LYS A CG  1  
ATOM 4021   C CD  . LYS A 1 661 ? -64.435  -58.214 21.637  1.00 0.00 ? 661 LYS A CD  1  
ATOM 4022   C CE  . LYS A 1 661 ? -65.142  -58.536 20.315  1.00 0.00 ? 661 LYS A CE  1  
ATOM 4023   N NZ  . LYS A 1 661 ? -64.193  -58.329 19.204  1.00 0.00 ? 661 LYS A NZ  1  
ATOM 4024   N N   . CYS A 1 662 ? -66.854  -55.428 21.074  1.00 0.00 ? 662 CYS A N   1  
ATOM 4025   C CA  . CYS A 1 662 ? -66.316  -54.919 19.858  1.00 0.00 ? 662 CYS A CA  1  
ATOM 4026   C C   . CYS A 1 662 ? -65.951  -53.484 20.018  1.00 0.00 ? 662 CYS A C   1  
ATOM 4027   O O   . CYS A 1 662 ? -64.842  -53.098 19.663  1.00 0.00 ? 662 CYS A O   1  
ATOM 4028   C CB  . CYS A 1 662 ? -67.372  -55.035 18.764  1.00 0.00 ? 662 CYS A CB  1  
ATOM 4029   S SG  . CYS A 1 662 ? -66.677  -54.485 17.207  1.00 0.00 ? 662 CYS A SG  1  
ATOM 4030   N N   . TYR A 1 663 ? -66.738  -52.574 20.680  1.00 0.00 ? 663 TYR A N   1  
ATOM 4031   C CA  . TYR A 1 663 ? -66.256  -51.274 20.871  1.00 0.00 ? 663 TYR A CA  1  
ATOM 4032   C C   . TYR A 1 663 ? -65.053  -51.126 21.727  1.00 0.00 ? 663 TYR A C   1  
ATOM 4033   O O   . TYR A 1 663 ? -64.142  -50.324 21.454  1.00 0.00 ? 663 TYR A O   1  
ATOM 4034   C CB  . TYR A 1 663 ? -67.370  -50.254 21.256  1.00 0.00 ? 663 TYR A CB  1  
ATOM 4035   C CG  . TYR A 1 663 ? -67.751  -50.156 22.682  1.00 0.00 ? 663 TYR A CG  1  
ATOM 4036   C CD1 . TYR A 1 663 ? -66.989  -49.294 23.464  1.00 0.00 ? 663 TYR A CD1 1  
ATOM 4037   C CD2 . TYR A 1 663 ? -68.881  -50.819 23.196  1.00 0.00 ? 663 TYR A CD2 1  
ATOM 4038   C CE1 . TYR A 1 663 ? -67.422  -49.061 24.797  1.00 0.00 ? 663 TYR A CE1 1  
ATOM 4039   C CE2 . TYR A 1 663 ? -69.271  -50.602 24.478  1.00 0.00 ? 663 TYR A CE2 1  
ATOM 4040   C CZ  . TYR A 1 663 ? -68.536  -49.759 25.304  1.00 0.00 ? 663 TYR A CZ  1  
ATOM 4041   O OH  . TYR A 1 663 ? -68.799  -49.678 26.640  1.00 0.00 ? 663 TYR A OH  1  
ATOM 4042   N N   . ARG A 1 664 ? -64.955  -51.802 22.902  1.00 0.00 ? 664 ARG A N   1  
ATOM 4043   C CA  . ARG A 1 664 ? -63.706  -51.534 23.724  1.00 0.00 ? 664 ARG A CA  1  
ATOM 4044   C C   . ARG A 1 664 ? -62.343  -51.984 23.220  1.00 0.00 ? 664 ARG A C   1  
ATOM 4045   O O   . ARG A 1 664 ? -61.297  -51.286 23.403  1.00 0.00 ? 664 ARG A O   1  
ATOM 4046   C CB  . ARG A 1 664 ? -63.944  -52.298 25.088  1.00 0.00 ? 664 ARG A CB  1  
ATOM 4047   C CG  . ARG A 1 664 ? -65.118  -51.801 26.044  1.00 0.00 ? 664 ARG A CG  1  
ATOM 4048   C CD  . ARG A 1 664 ? -65.405  -52.699 27.220  1.00 0.00 ? 664 ARG A CD  1  
ATOM 4049   N NE  . ARG A 1 664 ? -65.348  -54.103 26.805  1.00 0.00 ? 664 ARG A NE  1  
ATOM 4050   C CZ  . ARG A 1 664 ? -66.168  -55.094 27.294  1.00 0.00 ? 664 ARG A CZ  1  
ATOM 4051   N NH1 . ARG A 1 664 ? -67.334  -54.801 27.955  1.00 0.00 ? 664 ARG A NH1 1  
ATOM 4052   N NH2 . ARG A 1 664 ? -65.844  -56.412 27.280  1.00 0.00 ? 664 ARG A NH2 1  
ATOM 4053   N N   . ASN A 1 665 ? -62.337  -53.226 22.723  1.00 0.00 ? 665 ASN A N   1  
ATOM 4054   C CA  . ASN A 1 665 ? -61.127  -54.022 22.452  1.00 0.00 ? 665 ASN A CA  1  
ATOM 4055   C C   . ASN A 1 665 ? -60.334  -53.444 21.327  1.00 0.00 ? 665 ASN A C   1  
ATOM 4056   O O   . ASN A 1 665 ? -59.259  -52.910 21.475  1.00 0.00 ? 665 ASN A O   1  
ATOM 4057   C CB  . ASN A 1 665 ? -61.517  -55.561 22.372  1.00 0.00 ? 665 ASN A CB  1  
ATOM 4058   C CG  . ASN A 1 665 ? -61.668  -56.106 23.789  1.00 0.00 ? 665 ASN A CG  1  
ATOM 4059   O OD1 . ASN A 1 665 ? -62.682  -55.924 24.464  1.00 0.00 ? 665 ASN A OD1 1  
ATOM 4060   N ND2 . ASN A 1 665 ? -60.595  -56.743 24.306  1.00 0.00 ? 665 ASN A ND2 1  
ATOM 4061   N N   . PRO A 1 666 ? -61.043  -53.167 20.216  1.00 0.00 ? 666 PRO A N   1  
ATOM 4062   C CA  . PRO A 1 666 ? -60.618  -52.299 19.213  1.00 0.00 ? 666 PRO A CA  1  
ATOM 4063   C C   . PRO A 1 666 ? -61.327  -51.015 19.351  1.00 0.00 ? 666 PRO A C   1  
ATOM 4064   O O   . PRO A 1 666 ? -62.481  -50.986 18.955  1.00 0.00 ? 666 PRO A O   1  
ATOM 4065   C CB  . PRO A 1 666 ? -60.833  -53.003 17.893  1.00 0.00 ? 666 PRO A CB  1  
ATOM 4066   C CG  . PRO A 1 666 ? -62.032  -53.877 18.240  1.00 0.00 ? 666 PRO A CG  1  
ATOM 4067   C CD  . PRO A 1 666 ? -61.891  -54.207 19.666  1.00 0.00 ? 666 PRO A CD  1  
ATOM 4068   N N   . THR A 1 667 ? -60.598  -49.993 19.798  1.00 0.00 ? 667 THR A N   1  
ATOM 4069   C CA  . THR A 1 667 ? -61.113  -48.622 19.766  1.00 0.00 ? 667 THR A CA  1  
ATOM 4070   C C   . THR A 1 667 ? -60.575  -48.082 18.453  1.00 0.00 ? 667 THR A C   1  
ATOM 4071   O O   . THR A 1 667 ? -59.486  -47.551 18.478  1.00 0.00 ? 667 THR A O   1  
ATOM 4072   C CB  . THR A 1 667 ? -60.597  -47.722 20.906  1.00 0.00 ? 667 THR A CB  1  
ATOM 4073   O OG1 . THR A 1 667 ? -59.308  -48.249 21.334  1.00 0.00 ? 667 THR A OG1 1  
ATOM 4074   C CG2 . THR A 1 667 ? -61.487  -47.901 22.124  1.00 0.00 ? 667 THR A CG2 1  
ATOM 4075   N N   . LEU A 1 668 ? -61.423  -48.161 17.390  1.00 0.00 ? 668 LEU A N   1  
ATOM 4076   C CA  . LEU A 1 668 ? -61.094  -47.710 16.121  1.00 0.00 ? 668 LEU A CA  1  
ATOM 4077   C C   . LEU A 1 668 ? -62.425  -47.363 15.440  1.00 0.00 ? 668 LEU A C   1  
ATOM 4078   O O   . LEU A 1 668 ? -63.448  -47.904 15.860  1.00 0.00 ? 668 LEU A O   1  
ATOM 4079   C CB  . LEU A 1 668 ? -60.474  -48.858 15.260  1.00 0.00 ? 668 LEU A CB  1  
ATOM 4080   C CG  . LEU A 1 668 ? -58.960  -49.254 15.417  1.00 0.00 ? 668 LEU A CG  1  
ATOM 4081   C CD1 . LEU A 1 668 ? -58.723  -50.522 14.473  1.00 0.00 ? 668 LEU A CD1 1  
ATOM 4082   C CD2 . LEU A 1 668 ? -58.023  -48.106 14.980  1.00 0.00 ? 668 LEU A CD2 1  
ATOM 4083   N N   . ALA A 1 669 ? -62.477  -46.510 14.393  1.00 0.00 ? 669 ALA A N   1  
ATOM 4084   C CA  . ALA A 1 669 ? -63.596  -46.111 13.642  1.00 0.00 ? 669 ALA A CA  1  
ATOM 4085   C C   . ALA A 1 669 ? -64.186  -47.336 12.954  1.00 0.00 ? 669 ALA A C   1  
ATOM 4086   O O   . ALA A 1 669 ? -65.368  -47.534 12.858  1.00 0.00 ? 669 ALA A O   1  
ATOM 4087   C CB  . ALA A 1 669 ? -63.327  -45.076 12.502  1.00 0.00 ? 669 ALA A CB  1  
ATOM 4088   N N   . VAL A 1 670 ? -63.212  -48.192 12.491  1.00 0.00 ? 670 VAL A N   1  
ATOM 4089   C CA  . VAL A 1 670 ? -63.477  -49.469 11.715  1.00 0.00 ? 670 VAL A CA  1  
ATOM 4090   C C   . VAL A 1 670 ? -64.315  -50.346 12.615  1.00 0.00 ? 670 VAL A C   1  
ATOM 4091   O O   . VAL A 1 670 ? -65.255  -51.104 12.249  1.00 0.00 ? 670 VAL A O   1  
ATOM 4092   C CB  . VAL A 1 670 ? -62.227  -50.170 11.313  1.00 0.00 ? 670 VAL A CB  1  
ATOM 4093   C CG1 . VAL A 1 670 ? -62.696  -51.193 10.329  1.00 0.00 ? 670 VAL A CG1 1  
ATOM 4094   C CG2 . VAL A 1 670 ? -61.143  -49.227 10.712  1.00 0.00 ? 670 VAL A CG2 1  
ATOM 4095   N N   . ALA A 1 671 ? -63.964  -50.302 13.968  1.00 0.00 ? 671 ALA A N   1  
ATOM 4096   C CA  . ALA A 1 671 ? -64.648  -51.128 14.984  1.00 0.00 ? 671 ALA A CA  1  
ATOM 4097   C C   . ALA A 1 671 ? -66.175  -50.792 15.085  1.00 0.00 ? 671 ALA A C   1  
ATOM 4098   O O   . ALA A 1 671 ? -66.962  -51.769 15.248  1.00 0.00 ? 671 ALA A O   1  
ATOM 4099   C CB  . ALA A 1 671 ? -64.052  -51.259 16.385  1.00 0.00 ? 671 ALA A CB  1  
ATOM 4100   N N   . ILE A 1 672 ? -66.596  -49.476 15.001  1.00 0.00 ? 672 ILE A N   1  
ATOM 4101   C CA  . ILE A 1 672 ? -67.977  -49.013 15.035  1.00 0.00 ? 672 ILE A CA  1  
ATOM 4102   C C   . ILE A 1 672 ? -68.729  -49.549 13.835  1.00 0.00 ? 672 ILE A C   1  
ATOM 4103   O O   . ILE A 1 672 ? -69.776  -50.180 14.018  1.00 0.00 ? 672 ILE A O   1  
ATOM 4104   C CB  . ILE A 1 672 ? -68.134  -47.513 15.063  1.00 0.00 ? 672 ILE A CB  1  
ATOM 4105   C CG1 . ILE A 1 672 ? -67.118  -46.969 16.098  1.00 0.00 ? 672 ILE A CG1 1  
ATOM 4106   C CG2 . ILE A 1 672 ? -69.681  -47.320 15.434  1.00 0.00 ? 672 ILE A CG2 1  
ATOM 4107   C CD1 . ILE A 1 672 ? -67.141  -45.439 16.256  1.00 0.00 ? 672 ILE A CD1 1  
ATOM 4108   N N   . GLN A 1 673 ? -68.123  -49.455 12.596  1.00 0.00 ? 673 GLN A N   1  
ATOM 4109   C CA  . GLN A 1 673 ? -68.695  -49.958 11.294  1.00 0.00 ? 673 GLN A CA  1  
ATOM 4110   C C   . GLN A 1 673 ? -68.966  -51.520 11.324  1.00 0.00 ? 673 GLN A C   1  
ATOM 4111   O O   . GLN A 1 673 ? -70.061  -51.996 10.990  1.00 0.00 ? 673 GLN A O   1  
ATOM 4112   C CB  . GLN A 1 673 ? -67.741  -49.827 10.173  1.00 0.00 ? 673 GLN A CB  1  
ATOM 4113   C CG  . GLN A 1 673 ? -68.258  -50.368 8.777   1.00 0.00 ? 673 GLN A CG  1  
ATOM 4114   C CD  . GLN A 1 673 ? -69.559  -49.712 8.331   1.00 0.00 ? 673 GLN A CD  1  
ATOM 4115   O OE1 . GLN A 1 673 ? -70.595  -50.246 8.413   1.00 0.00 ? 673 GLN A OE1 1  
ATOM 4116   N NE2 . GLN A 1 673 ? -69.392  -48.419 7.798   1.00 0.00 ? 673 GLN A NE2 1  
ATOM 4117   N N   . ASN A 1 674 ? -68.025  -52.240 11.881  1.00 0.00 ? 674 ASN A N   1  
ATOM 4118   C CA  . ASN A 1 674 ? -68.079  -53.660 12.115  1.00 0.00 ? 674 ASN A CA  1  
ATOM 4119   C C   . ASN A 1 674 ? -69.198  -53.953 12.990  1.00 0.00 ? 674 ASN A C   1  
ATOM 4120   O O   . ASN A 1 674 ? -70.027  -54.823 12.659  1.00 0.00 ? 674 ASN A O   1  
ATOM 4121   C CB  . ASN A 1 674 ? -66.861  -54.237 12.820  1.00 0.00 ? 674 ASN A CB  1  
ATOM 4122   C CG  . ASN A 1 674 ? -65.584  -54.092 12.002  1.00 0.00 ? 674 ASN A CG  1  
ATOM 4123   O OD1 . ASN A 1 674 ? -65.640  -53.961 10.795  1.00 0.00 ? 674 ASN A OD1 1  
ATOM 4124   N ND2 . ASN A 1 674 ? -64.457  -54.091 12.692  1.00 0.00 ? 674 ASN A ND2 1  
ATOM 4125   N N   . GLU A 1 675 ? -69.252  -53.139 14.132  1.00 0.00 ? 675 GLU A N   1  
ATOM 4126   C CA  . GLU A 1 675 ? -70.257  -53.376 15.131  1.00 0.00 ? 675 GLU A CA  1  
ATOM 4127   C C   . GLU A 1 675 ? -71.615  -53.116 14.596  1.00 0.00 ? 675 GLU A C   1  
ATOM 4128   O O   . GLU A 1 675 ? -72.553  -53.813 14.931  1.00 0.00 ? 675 GLU A O   1  
ATOM 4129   C CB  . GLU A 1 675 ? -69.995  -52.504 16.436  1.00 0.00 ? 675 GLU A CB  1  
ATOM 4130   C CG  . GLU A 1 675 ? -70.945  -52.747 17.588  1.00 0.00 ? 675 GLU A CG  1  
ATOM 4131   C CD  . GLU A 1 675 ? -71.213  -54.228 17.656  1.00 0.00 ? 675 GLU A CD  1  
ATOM 4132   O OE1 . GLU A 1 675 ? -70.364  -55.090 17.612  1.00 0.00 ? 675 GLU A OE1 1  
ATOM 4133   O OE2 . GLU A 1 675 ? -72.475  -54.542 17.771  1.00 0.00 ? 675 GLU A OE2 1  
ATOM 4134   N N   . LEU A 1 676 ? -71.819  -52.084 13.724  1.00 0.00 ? 676 LEU A N   1  
ATOM 4135   C CA  . LEU A 1 676 ? -73.144  -51.722 13.231  1.00 0.00 ? 676 LEU A CA  1  
ATOM 4136   C C   . LEU A 1 676 ? -73.668  -52.871 12.419  1.00 0.00 ? 676 LEU A C   1  
ATOM 4137   O O   . LEU A 1 676 ? -74.831  -53.223 12.541  1.00 0.00 ? 676 LEU A O   1  
ATOM 4138   C CB  . LEU A 1 676 ? -73.030  -50.428 12.396  1.00 0.00 ? 676 LEU A CB  1  
ATOM 4139   C CG  . LEU A 1 676 ? -74.296  -49.768 11.840  1.00 0.00 ? 676 LEU A CG  1  
ATOM 4140   C CD1 . LEU A 1 676 ? -74.327  -48.235 11.521  1.00 0.00 ? 676 LEU A CD1 1  
ATOM 4141   C CD2 . LEU A 1 676 ? -74.582  -50.434 10.437  1.00 0.00 ? 676 LEU A CD2 1  
ATOM 4142   N N   . GLU A 1 677 ? -72.842  -53.491 11.634  1.00 0.00 ? 677 GLU A N   1  
ATOM 4143   C CA  . GLU A 1 677 ? -73.184  -54.564 10.800  1.00 0.00 ? 677 GLU A CA  1  
ATOM 4144   C C   . GLU A 1 677 ? -73.687  -55.733 11.646  1.00 0.00 ? 677 GLU A C   1  
ATOM 4145   O O   . GLU A 1 677 ? -74.647  -56.380 11.377  1.00 0.00 ? 677 GLU A O   1  
ATOM 4146   C CB  . GLU A 1 677 ? -72.013  -55.012 9.870   1.00 0.00 ? 677 GLU A CB  1  
ATOM 4147   C CG  . GLU A 1 677 ? -71.599  -53.864 8.888   1.00 0.00 ? 677 GLU A CG  1  
ATOM 4148   C CD  . GLU A 1 677 ? -72.625  -53.283 7.941   1.00 0.00 ? 677 GLU A CD  1  
ATOM 4149   O OE1 . GLU A 1 677 ? -73.700  -52.770 8.416   1.00 0.00 ? 677 GLU A OE1 1  
ATOM 4150   O OE2 . GLU A 1 677 ? -72.327  -53.246 6.738   1.00 0.00 ? 677 GLU A OE2 1  
ATOM 4151   N N   . GLY A 1 678 ? -73.004  -55.985 12.854  1.00 0.00 ? 678 GLY A N   1  
ATOM 4152   C CA  . GLY A 1 678 ? -73.255  -57.017 13.897  1.00 0.00 ? 678 GLY A CA  1  
ATOM 4153   C C   . GLY A 1 678 ? -74.650  -56.663 14.491  1.00 0.00 ? 678 GLY A C   1  
ATOM 4154   O O   . GLY A 1 678 ? -75.497  -57.516 14.659  1.00 0.00 ? 678 GLY A O   1  
ATOM 4155   N N   . GLY A 1 679 ? -74.932  -55.407 14.738  1.00 0.00 ? 679 GLY A N   1  
ATOM 4156   C CA  . GLY A 1 679 ? -76.176  -55.029 15.320  1.00 0.00 ? 679 GLY A CA  1  
ATOM 4157   C C   . GLY A 1 679 ? -77.405  -55.314 14.388  1.00 0.00 ? 679 GLY A C   1  
ATOM 4158   O O   . GLY A 1 679 ? -78.444  -55.825 14.854  1.00 0.00 ? 679 GLY A O   1  
ATOM 4159   N N   . LEU A 1 680 ? -77.221  -55.062 13.102  1.00 0.00 ? 680 LEU A N   1  
ATOM 4160   C CA  . LEU A 1 680 ? -78.224  -55.461 12.068  1.00 0.00 ? 680 LEU A CA  1  
ATOM 4161   C C   . LEU A 1 680 ? -78.451  -57.005 11.870  1.00 0.00 ? 680 LEU A C   1  
ATOM 4162   O O   . LEU A 1 680 ? -79.595  -57.420 11.829  1.00 0.00 ? 680 LEU A O   1  
ATOM 4163   C CB  . LEU A 1 680 ? -77.810  -54.976 10.633  1.00 0.00 ? 680 LEU A CB  1  
ATOM 4164   C CG  . LEU A 1 680 ? -77.284  -53.494 10.459  1.00 0.00 ? 680 LEU A CG  1  
ATOM 4165   C CD1 . LEU A 1 680 ? -77.050  -53.223 9.004   1.00 0.00 ? 680 LEU A CD1 1  
ATOM 4166   C CD2 . LEU A 1 680 ? -78.263  -52.419 11.002  1.00 0.00 ? 680 LEU A CD2 1  
ATOM 4167   N N   . THR A 1 681 ? -77.301  -57.739 11.921  1.00 0.00 ? 681 THR A N   1  
ATOM 4168   C CA  . THR A 1 681 ? -77.403  -59.170 12.107  1.00 0.00 ? 681 THR A CA  1  
ATOM 4169   C C   . THR A 1 681 ? -77.729  -59.599 13.502  1.00 0.00 ? 681 THR A C   1  
ATOM 4170   O O   . THR A 1 681 ? -77.792  -58.696 14.357  1.00 0.00 ? 681 THR A O   1  
ATOM 4171   C CB  . THR A 1 681 ? -76.117  -59.942 11.652  1.00 0.00 ? 681 THR A CB  1  
ATOM 4172   O OG1 . THR A 1 681 ? -74.928  -59.193 11.761  1.00 0.00 ? 681 THR A OG1 1  
ATOM 4173   C CG2 . THR A 1 681 ? -76.291  -60.297 10.144  1.00 0.00 ? 681 THR A CG2 1  
ATOM 4174   N N   . ASN A 1 682 ? -78.073  -60.910 13.681  1.00 0.00 ? 682 ASN A N   1  
ATOM 4175   C CA  . ASN A 1 682 ? -78.542  -61.553 14.876  1.00 0.00 ? 682 ASN A CA  1  
ATOM 4176   C C   . ASN A 1 682 ? -79.984  -61.157 15.097  1.00 0.00 ? 682 ASN A C   1  
ATOM 4177   O O   . ASN A 1 682 ? -80.781  -62.057 15.339  1.00 0.00 ? 682 ASN A O   1  
ATOM 4178   C CB  . ASN A 1 682 ? -77.780  -61.303 16.173  1.00 0.00 ? 682 ASN A CB  1  
ATOM 4179   C CG  . ASN A 1 682 ? -78.253  -62.326 17.282  1.00 0.00 ? 682 ASN A CG  1  
ATOM 4180   O OD1 . ASN A 1 682 ? -78.003  -63.529 17.208  1.00 0.00 ? 682 ASN A OD1 1  
ATOM 4181   N ND2 . ASN A 1 682 ? -78.971  -61.819 18.339  1.00 0.00 ? 682 ASN A ND2 1  
ATOM 4182   N N   . ILE A 1 683 ? -80.330  -59.804 14.858  1.00 0.00 ? 683 ILE A N   1  
ATOM 4183   C CA  . ILE A 1 683 ? -81.775  -59.498 14.888  1.00 0.00 ? 683 ILE A CA  1  
ATOM 4184   C C   . ILE A 1 683 ? -82.325  -60.136 13.568  1.00 0.00 ? 683 ILE A C   1  
ATOM 4185   O O   . ILE A 1 683 ? -83.444  -60.631 13.530  1.00 0.00 ? 683 ILE A O   1  
ATOM 4186   C CB  . ILE A 1 683 ? -82.110  -58.046 15.125  1.00 0.00 ? 683 ILE A CB  1  
ATOM 4187   C CG1 . ILE A 1 683 ? -83.664  -57.829 15.143  1.00 0.00 ? 683 ILE A CG1 1  
ATOM 4188   C CG2 . ILE A 1 683 ? -81.499  -57.222 14.064  1.00 0.00 ? 683 ILE A CG2 1  
ATOM 4189   C CD1 . ILE A 1 683 ? -84.092  -56.371 15.381  1.00 0.00 ? 683 ILE A CD1 1  
ATOM 4190   N N   . MET A 1 684 ? -81.545  -60.031 12.389  1.00 0.00 ? 684 MET A N   1  
ATOM 4191   C CA  . MET A 1 684 ? -81.898  -60.469 11.100  1.00 0.00 ? 684 MET A CA  1  
ATOM 4192   C C   . MET A 1 684 ? -81.956  -61.927 11.063  1.00 0.00 ? 684 MET A C   1  
ATOM 4193   O O   . MET A 1 684 ? -82.931  -62.534 10.586  1.00 0.00 ? 684 MET A O   1  
ATOM 4194   C CB  . MET A 1 684 ? -80.794  -60.060 10.108  1.00 0.00 ? 684 MET A CB  1  
ATOM 4195   C CG  . MET A 1 684 ? -81.013  -60.385 8.602   1.00 0.00 ? 684 MET A CG  1  
ATOM 4196   S SD  . MET A 1 684 ? -79.705  -59.857 7.439   1.00 0.00 ? 684 MET A SD  1  
ATOM 4197   C CE  . MET A 1 684 ? -80.416  -60.238 5.785   1.00 0.00 ? 684 MET A CE  1  
ATOM 4198   N N   . THR A 1 685 ? -81.045  -62.666 11.679  1.00 0.00 ? 685 THR A N   1  
ATOM 4199   C CA  . THR A 1 685 ? -81.037  -64.137 11.868  1.00 0.00 ? 685 THR A CA  1  
ATOM 4200   C C   . THR A 1 685 ? -82.168  -64.557 12.688  1.00 0.00 ? 685 THR A C   1  
ATOM 4201   O O   . THR A 1 685 ? -82.796  -65.526 12.257  1.00 0.00 ? 685 THR A O   1  
ATOM 4202   C CB  . THR A 1 685 ? -79.666  -64.767 12.337  1.00 0.00 ? 685 THR A CB  1  
ATOM 4203   O OG1 . THR A 1 685 ? -79.375  -64.709 13.767  1.00 0.00 ? 685 THR A OG1 1  
ATOM 4204   C CG2 . THR A 1 685 ? -78.598  -63.952 11.565  1.00 0.00 ? 685 THR A CG2 1  
ATOM 4205   N N   . ASN A 1 686 ? -82.459  -63.861 13.813  1.00 0.00 ? 686 ASN A N   1  
ATOM 4206   C CA  . ASN A 1 686 ? -83.495  -64.177 14.768  1.00 0.00 ? 686 ASN A CA  1  
ATOM 4207   C C   . ASN A 1 686 ? -84.847  -64.056 14.101  1.00 0.00 ? 686 ASN A C   1  
ATOM 4208   O O   . ASN A 1 686 ? -85.769  -64.833 14.258  1.00 0.00 ? 686 ASN A O   1  
ATOM 4209   C CB  . ASN A 1 686 ? -83.553  -63.284 16.045  1.00 0.00 ? 686 ASN A CB  1  
ATOM 4210   C CG  . ASN A 1 686 ? -84.595  -63.770 17.116  1.00 0.00 ? 686 ASN A CG  1  
ATOM 4211   O OD1 . ASN A 1 686 ? -85.525  -63.010 17.428  1.00 0.00 ? 686 ASN A OD1 1  
ATOM 4212   N ND2 . ASN A 1 686 ? -84.461  -65.048 17.593  1.00 0.00 ? 686 ASN A ND2 1  
ATOM 4213   N N   . ARG A 1 687 ? -85.036  -63.066 13.200  1.00 0.00 ? 687 ARG A N   1  
ATOM 4214   C CA  . ARG A 1 687 ? -86.172  -62.850 12.407  1.00 0.00 ? 687 ARG A CA  1  
ATOM 4215   C C   . ARG A 1 687 ? -86.420  -64.096 11.598  1.00 0.00 ? 687 ARG A C   1  
ATOM 4216   O O   . ARG A 1 687 ? -87.561  -64.560 11.583  1.00 0.00 ? 687 ARG A O   1  
ATOM 4217   C CB  . ARG A 1 687 ? -86.178  -61.691 11.368  1.00 0.00 ? 687 ARG A CB  1  
ATOM 4218   C CG  . ARG A 1 687 ? -87.583  -61.242 10.889  1.00 0.00 ? 687 ARG A CG  1  
ATOM 4219   C CD  . ARG A 1 687 ? -88.084  -61.717 9.541   1.00 0.00 ? 687 ARG A CD  1  
ATOM 4220   N NE  . ARG A 1 687 ? -89.304  -60.940 9.148   1.00 0.00 ? 687 ARG A NE  1  
ATOM 4221   C CZ  . ARG A 1 687 ? -90.090  -61.219 8.037   1.00 0.00 ? 687 ARG A CZ  1  
ATOM 4222   N NH1 . ARG A 1 687 ? -89.659  -62.195 7.218   1.00 0.00 ? 687 ARG A NH1 1  
ATOM 4223   N NH2 . ARG A 1 687 ? -91.208  -60.517 7.722   1.00 0.00 ? 687 ARG A NH2 1  
ATOM 4224   N N   . CYS A 1 688 ? -85.390  -64.628 10.930  1.00 0.00 ? 688 CYS A N   1  
ATOM 4225   C CA  . CYS A 1 688 ? -85.505  -65.826 10.126  1.00 0.00 ? 688 CYS A CA  1  
ATOM 4226   C C   . CYS A 1 688 ? -85.758  -67.049 10.968  1.00 0.00 ? 688 CYS A C   1  
ATOM 4227   O O   . CYS A 1 688 ? -86.687  -67.799 10.654  1.00 0.00 ? 688 CYS A O   1  
ATOM 4228   C CB  . CYS A 1 688 ? -84.218  -66.127 9.220   1.00 0.00 ? 688 CYS A CB  1  
ATOM 4229   S SG  . CYS A 1 688 ? -83.777  -64.704 8.253   1.00 0.00 ? 688 CYS A SG  1  
ATOM 4230   N N   . LEU A 1 689 ? -85.045  -67.182 12.126  1.00 0.00 ? 689 LEU A N   1  
ATOM 4231   C CA  . LEU A 1 689 ? -85.300  -68.354 12.922  1.00 0.00 ? 689 LEU A CA  1  
ATOM 4232   C C   . LEU A 1 689 ? -86.659  -68.409 13.574  1.00 0.00 ? 689 LEU A C   1  
ATOM 4233   O O   . LEU A 1 689 ? -87.225  -69.550 13.680  1.00 0.00 ? 689 LEU A O   1  
ATOM 4234   C CB  . LEU A 1 689 ? -84.163  -68.406 13.975  1.00 0.00 ? 689 LEU A CB  1  
ATOM 4235   C CG  . LEU A 1 689 ? -84.170  -69.518 14.936  1.00 0.00 ? 689 LEU A CG  1  
ATOM 4236   C CD1 . LEU A 1 689 ? -83.795  -70.854 14.427  1.00 0.00 ? 689 LEU A CD1 1  
ATOM 4237   C CD2 . LEU A 1 689 ? -83.415  -69.449 16.340  1.00 0.00 ? 689 LEU A CD2 1  
ATOM 4238   N N   . SER A 1 690 ? -87.230  -67.318 14.057  1.00 0.00 ? 690 SER A N   1  
ATOM 4239   C CA  . SER A 1 690 ? -88.428  -67.320 14.898  1.00 0.00 ? 690 SER A CA  1  
ATOM 4240   C C   . SER A 1 690 ? -89.440  -66.563 14.049  1.00 0.00 ? 690 SER A C   1  
ATOM 4241   O O   . SER A 1 690 ? -89.153  -65.550 13.461  1.00 0.00 ? 690 SER A O   1  
ATOM 4242   C CB  . SER A 1 690 ? -88.082  -66.557 16.153  1.00 0.00 ? 690 SER A CB  1  
ATOM 4243   O OG  . SER A 1 690 ? -87.186  -67.266 16.953  1.00 0.00 ? 690 SER A OG  1  
ATOM 4244   N N   . ASP A 1 691 ? -90.661  -67.100 14.035  1.00 0.00 ? 691 ASP A N   1  
ATOM 4245   C CA  . ASP A 1 691 ? -91.753  -66.616 13.211  1.00 0.00 ? 691 ASP A CA  1  
ATOM 4246   C C   . ASP A 1 691 ? -92.968  -67.170 13.880  1.00 0.00 ? 691 ASP A C   1  
ATOM 4247   O O   . ASP A 1 691 ? -93.941  -67.625 13.317  1.00 0.00 ? 691 ASP A O   1  
ATOM 4248   C CB  . ASP A 1 691 ? -91.588  -67.122 11.783  1.00 0.00 ? 691 ASP A CB  1  
ATOM 4249   C CG  . ASP A 1 691 ? -90.724  -68.401 11.644  1.00 0.00 ? 691 ASP A CG  1  
ATOM 4250   O OD1 . ASP A 1 691 ? -91.147  -69.530 12.004  1.00 0.00 ? 691 ASP A OD1 1  
ATOM 4251   O OD2 . ASP A 1 691 ? -89.633  -68.192 11.062  1.00 0.00 ? 691 ASP A OD2 1  
ATOM 4252   N N   . LEU A 1 692 ? -92.922  -67.110 15.273  1.00 0.00 ? 692 LEU A N   1  
ATOM 4253   C CA  . LEU A 1 692 ? -93.810  -67.511 16.337  1.00 0.00 ? 692 LEU A CA  1  
ATOM 4254   C C   . LEU A 1 692 ? -95.099  -66.797 16.484  1.00 0.00 ? 692 LEU A C   1  
ATOM 4255   O O   . LEU A 1 692 ? -96.042  -67.363 16.996  1.00 0.00 ? 692 LEU A O   1  
ATOM 4256   C CB  . LEU A 1 692 ? -93.019  -67.570 17.676  1.00 0.00 ? 692 LEU A CB  1  
ATOM 4257   C CG  . LEU A 1 692 ? -91.682  -68.359 17.590  1.00 0.00 ? 692 LEU A CG  1  
ATOM 4258   C CD1 . LEU A 1 692 ? -90.981  -68.531 18.958  1.00 0.00 ? 692 LEU A CD1 1  
ATOM 4259   C CD2 . LEU A 1 692 ? -91.747  -69.775 16.943  1.00 0.00 ? 692 LEU A CD2 1  
ATOM 4260   N N   . ILE A 1 693 ? -95.062  -65.458 16.265  1.00 0.00 ? 693 ILE A N   1  
ATOM 4261   C CA  . ILE A 1 693 ? -96.027  -64.426 16.662  1.00 0.00 ? 693 ILE A CA  1  
ATOM 4262   C C   . ILE A 1 693 ? -97.365  -64.655 16.041  1.00 0.00 ? 693 ILE A C   1  
ATOM 4263   O O   . ILE A 1 693 ? -98.300  -64.559 16.843  1.00 0.00 ? 693 ILE A O   1  
ATOM 4264   C CB  . ILE A 1 693 ? -95.455  -63.086 16.434  1.00 0.00 ? 693 ILE A CB  1  
ATOM 4265   C CG1 . ILE A 1 693 ? -93.943  -62.944 16.838  1.00 0.00 ? 693 ILE A CG1 1  
ATOM 4266   C CG2 . ILE A 1 693 ? -96.331  -61.999 17.188  1.00 0.00 ? 693 ILE A CG2 1  
ATOM 4267   C CD1 . ILE A 1 693 ? -93.358  -61.543 16.597  1.00 0.00 ? 693 ILE A CD1 1  
ATOM 4268   N N   . PRO A 1 694 ? -97.600  -65.012 14.797  1.00 0.00 ? 694 PRO A N   1  
ATOM 4269   C CA  . PRO A 1 694 ? -98.983  -65.157 14.330  1.00 0.00 ? 694 PRO A CA  1  
ATOM 4270   C C   . PRO A 1 694 ? -99.794  -66.225 15.012  1.00 0.00 ? 694 PRO A C   1  
ATOM 4271   O O   . PRO A 1 694 ? -100.968 -66.059 15.313  1.00 0.00 ? 694 PRO A O   1  
ATOM 4272   C CB  . PRO A 1 694 ? -98.934  -65.348 12.834  1.00 0.00 ? 694 PRO A CB  1  
ATOM 4273   C CG  . PRO A 1 694 ? -97.726  -64.458 12.544  1.00 0.00 ? 694 PRO A CG  1  
ATOM 4274   C CD  . PRO A 1 694 ? -96.702  -64.784 13.663  1.00 0.00 ? 694 PRO A CD  1  
ATOM 4275   N N   . LEU A 1 695 ? -99.057  -67.387 15.374  1.00 0.00 ? 695 LEU A N   1  
ATOM 4276   C CA  . LEU A 1 695 ? -99.652  -68.435 16.080  1.00 0.00 ? 695 LEU A CA  1  
ATOM 4277   C C   . LEU A 1 695 ? -99.982  -68.044 17.419  1.00 0.00 ? 695 LEU A C   1  
ATOM 4278   O O   . LEU A 1 695 ? -101.023 -68.369 17.986  1.00 0.00 ? 695 LEU A O   1  
ATOM 4279   C CB  . LEU A 1 695 ? -98.743  -69.665 16.047  1.00 0.00 ? 695 LEU A CB  1  
ATOM 4280   C CG  . LEU A 1 695 ? -98.433  -70.196 14.604  1.00 0.00 ? 695 LEU A CG  1  
ATOM 4281   C CD1 . LEU A 1 695 ? -97.541  -71.386 14.769  1.00 0.00 ? 695 LEU A CD1 1  
ATOM 4282   C CD2 . LEU A 1 695 ? -99.619  -70.470 13.702  1.00 0.00 ? 695 LEU A CD2 1  
ATOM 4283   N N   . GLN A 1 696 ? -98.964  -67.330 18.030  1.00 0.00 ? 696 GLN A N   1  
ATOM 4284   C CA  . GLN A 1 696 ? -99.042  -66.959 19.402  1.00 0.00 ? 696 GLN A CA  1  
ATOM 4285   C C   . GLN A 1 696 ? -100.226 -66.036 19.647  1.00 0.00 ? 696 GLN A C   1  
ATOM 4286   O O   . GLN A 1 696 ? -100.977 -66.213 20.609  1.00 0.00 ? 696 GLN A O   1  
ATOM 4287   C CB  . GLN A 1 696 ? -97.725  -66.372 19.968  1.00 0.00 ? 696 GLN A CB  1  
ATOM 4288   C CG  . GLN A 1 696 ? -97.805  -65.781 21.393  1.00 0.00 ? 696 GLN A CG  1  
ATOM 4289   C CD  . GLN A 1 696 ? -98.421  -64.306 21.373  1.00 0.00 ? 696 GLN A CD  1  
ATOM 4290   O OE1 . GLN A 1 696 ? -99.400  -64.060 22.024  1.00 0.00 ? 696 GLN A OE1 1  
ATOM 4291   N NE2 . GLN A 1 696 ? -97.772  -63.368 20.608  1.00 0.00 ? 696 GLN A NE2 1  
ATOM 4292   N N   . LEU A 1 697 ? -100.371 -65.177 18.708  1.00 0.00 ? 697 LEU A N   1  
ATOM 4293   C CA  . LEU A 1 697 ? -101.378 -64.155 18.584  1.00 0.00 ? 697 LEU A CA  1  
ATOM 4294   C C   . LEU A 1 697 ? -102.702 -64.742 18.493  1.00 0.00 ? 697 LEU A C   1  
ATOM 4295   O O   . LEU A 1 697 ? -103.649 -64.230 19.129  1.00 0.00 ? 697 LEU A O   1  
ATOM 4296   C CB  . LEU A 1 697 ? -101.104 -63.229 17.316  1.00 0.00 ? 697 LEU A CB  1  
ATOM 4297   C CG  . LEU A 1 697 ? -101.881 -61.949 17.064  1.00 0.00 ? 697 LEU A CG  1  
ATOM 4298   C CD1 . LEU A 1 697 ? -101.698 -60.885 18.136  1.00 0.00 ? 697 LEU A CD1 1  
ATOM 4299   C CD2 . LEU A 1 697 ? -101.639 -61.415 15.633  1.00 0.00 ? 697 LEU A CD2 1  
ATOM 4300   N N   . GLN A 1 698 ? -102.853 -65.917 17.790  1.00 0.00 ? 698 GLN A N   1  
ATOM 4301   C CA  . GLN A 1 698 ? -104.136 -66.601 17.789  1.00 0.00 ? 698 GLN A CA  1  
ATOM 4302   C C   . GLN A 1 698 ? -104.525 -67.088 19.145  1.00 0.00 ? 698 GLN A C   1  
ATOM 4303   O O   . GLN A 1 698 ? -105.658 -66.855 19.602  1.00 0.00 ? 698 GLN A O   1  
ATOM 4304   C CB  . GLN A 1 698 ? -103.999 -67.779 16.816  1.00 0.00 ? 698 GLN A CB  1  
ATOM 4305   C CG  . GLN A 1 698 ? -105.257 -68.661 16.651  1.00 0.00 ? 698 GLN A CG  1  
ATOM 4306   C CD  . GLN A 1 698 ? -105.110 -69.460 15.432  1.00 0.00 ? 698 GLN A CD  1  
ATOM 4307   O OE1 . GLN A 1 698 ? -105.630 -69.158 14.352  1.00 0.00 ? 698 GLN A OE1 1  
ATOM 4308   N NE2 . GLN A 1 698 ? -104.103 -70.420 15.564  1.00 0.00 ? 698 GLN A NE2 1  
ATOM 4309   N N   . ILE A 1 699 ? -103.534 -67.680 19.818  1.00 0.00 ? 699 ILE A N   1  
ATOM 4310   C CA  . ILE A 1 699 ? -103.749 -68.115 21.143  1.00 0.00 ? 699 ILE A CA  1  
ATOM 4311   C C   . ILE A 1 699 ? -104.041 -66.904 22.074  1.00 0.00 ? 699 ILE A C   1  
ATOM 4312   O O   . ILE A 1 699 ? -104.982 -67.024 22.894  1.00 0.00 ? 699 ILE A O   1  
ATOM 4313   C CB  . ILE A 1 699 ? -102.470 -68.941 21.618  1.00 0.00 ? 699 ILE A CB  1  
ATOM 4314   C CG1 . ILE A 1 699 ? -102.289 -70.068 20.602  1.00 0.00 ? 699 ILE A CG1 1  
ATOM 4315   C CG2 . ILE A 1 699 ? -102.602 -69.303 23.135  1.00 0.00 ? 699 ILE A CG2 1  
ATOM 4316   C CD1 . ILE A 1 699 ? -101.091 -70.988 20.891  1.00 0.00 ? 699 ILE A CD1 1  
ATOM 4317   N N   . PHE A 1 700 ? -103.361 -65.706 21.935  1.00 0.00 ? 700 PHE A N   1  
ATOM 4318   C CA  . PHE A 1 700 ? -103.618 -64.484 22.775  1.00 0.00 ? 700 PHE A CA  1  
ATOM 4319   C C   . PHE A 1 700 ? -105.060 -64.027 22.666  1.00 0.00 ? 700 PHE A C   1  
ATOM 4320   O O   . PHE A 1 700 ? -105.652 -63.574 23.629  1.00 0.00 ? 700 PHE A O   1  
ATOM 4321   C CB  . PHE A 1 700 ? -102.773 -63.265 22.398  1.00 0.00 ? 700 PHE A CB  1  
ATOM 4322   C CG  . PHE A 1 700 ? -103.062 -62.174 23.408  1.00 0.00 ? 700 PHE A CG  1  
ATOM 4323   C CD1 . PHE A 1 700 ? -102.830 -62.253 24.823  1.00 0.00 ? 700 PHE A CD1 1  
ATOM 4324   C CD2 . PHE A 1 700 ? -103.488 -60.950 22.950  1.00 0.00 ? 700 PHE A CD2 1  
ATOM 4325   C CE1 . PHE A 1 700 ? -103.170 -61.211 25.698  1.00 0.00 ? 700 PHE A CE1 1  
ATOM 4326   C CE2 . PHE A 1 700 ? -103.843 -59.880 23.809  1.00 0.00 ? 700 PHE A CE2 1  
ATOM 4327   C CZ  . PHE A 1 700 ? -103.758 -60.100 25.149  1.00 0.00 ? 700 PHE A CZ  1  
ATOM 4328   N N   . ASP A 1 701 ? -105.680 -64.028 21.476  1.00 0.00 ? 701 ASP A N   1  
ATOM 4329   C CA  . ASP A 1 701 ? -107.047 -63.623 21.238  1.00 0.00 ? 701 ASP A CA  1  
ATOM 4330   C C   . ASP A 1 701 ? -107.983 -64.551 22.000  1.00 0.00 ? 701 ASP A C   1  
ATOM 4331   O O   . ASP A 1 701 ? -108.926 -64.114 22.655  1.00 0.00 ? 701 ASP A O   1  
ATOM 4332   C CB  . ASP A 1 701 ? -107.506 -63.669 19.739  1.00 0.00 ? 701 ASP A CB  1  
ATOM 4333   C CG  . ASP A 1 701 ? -106.826 -62.595 18.928  1.00 0.00 ? 701 ASP A CG  1  
ATOM 4334   O OD1 . ASP A 1 701 ? -107.024 -61.374 19.295  1.00 0.00 ? 701 ASP A OD1 1  
ATOM 4335   O OD2 . ASP A 1 701 ? -105.859 -62.916 18.173  1.00 0.00 ? 701 ASP A OD2 1  
ATOM 4336   N N   . ILE A 1 702 ? -107.695 -65.878 21.982  1.00 0.00 ? 702 ILE A N   1  
ATOM 4337   C CA  . ILE A 1 702 ? -108.542 -66.846 22.730  1.00 0.00 ? 702 ILE A CA  1  
ATOM 4338   C C   . ILE A 1 702 ? -108.463 -66.554 24.219  1.00 0.00 ? 702 ILE A C   1  
ATOM 4339   O O   . ILE A 1 702 ? -109.483 -66.548 24.946  1.00 0.00 ? 702 ILE A O   1  
ATOM 4340   C CB  . ILE A 1 702 ? -108.201 -68.300 22.311  1.00 0.00 ? 702 ILE A CB  1  
ATOM 4341   C CG1 . ILE A 1 702 ? -108.690 -68.540 20.911  1.00 0.00 ? 702 ILE A CG1 1  
ATOM 4342   C CG2 . ILE A 1 702 ? -108.816 -69.343 23.389  1.00 0.00 ? 702 ILE A CG2 1  
ATOM 4343   C CD1 . ILE A 1 702 ? -108.408 -69.957 20.381  1.00 0.00 ? 702 ILE A CD1 1  
ATOM 4344   N N   . VAL A 1 703 ? -107.164 -66.204 24.671  1.00 0.00 ? 703 VAL A N   1  
ATOM 4345   C CA  . VAL A 1 703 ? -106.817 -65.780 26.014  1.00 0.00 ? 703 VAL A CA  1  
ATOM 4346   C C   . VAL A 1 703 ? -107.560 -64.539 26.430  1.00 0.00 ? 703 VAL A C   1  
ATOM 4347   O O   . VAL A 1 703 ? -108.120 -64.529 27.551  1.00 0.00 ? 703 VAL A O   1  
ATOM 4348   C CB  . VAL A 1 703 ? -105.385 -65.671 26.190  1.00 0.00 ? 703 VAL A CB  1  
ATOM 4349   C CG1 . VAL A 1 703 ? -105.019 -65.126 27.588  1.00 0.00 ? 703 VAL A CG1 1  
ATOM 4350   C CG2 . VAL A 1 703 ? -104.770 -67.049 25.991  1.00 0.00 ? 703 VAL A CG2 1  
ATOM 4351   N N   . TYR A 1 704 ? -107.661 -63.481 25.503  1.00 0.00 ? 704 TYR A N   1  
ATOM 4352   C CA  . TYR A 1 704 ? -108.361 -62.249 25.737  1.00 0.00 ? 704 TYR A CA  1  
ATOM 4353   C C   . TYR A 1 704 ? -109.826 -62.419 25.942  1.00 0.00 ? 704 TYR A C   1  
ATOM 4354   O O   . TYR A 1 704 ? -110.329 -61.885 26.859  1.00 0.00 ? 704 TYR A O   1  
ATOM 4355   C CB  . TYR A 1 704 ? -108.091 -61.157 24.648  1.00 0.00 ? 704 TYR A CB  1  
ATOM 4356   C CG  . TYR A 1 704 ? -108.556 -59.811 25.110  1.00 0.00 ? 704 TYR A CG  1  
ATOM 4357   C CD1 . TYR A 1 704 ? -107.923 -59.263 26.291  1.00 0.00 ? 704 TYR A CD1 1  
ATOM 4358   C CD2 . TYR A 1 704 ? -109.569 -59.024 24.473  1.00 0.00 ? 704 TYR A CD2 1  
ATOM 4359   C CE1 . TYR A 1 704 ? -108.261 -57.984 26.775  1.00 0.00 ? 704 TYR A CE1 1  
ATOM 4360   C CE2 . TYR A 1 704 ? -109.932 -57.808 24.961  1.00 0.00 ? 704 TYR A CE2 1  
ATOM 4361   C CZ  . TYR A 1 704 ? -109.233 -57.276 26.090  1.00 0.00 ? 704 TYR A CZ  1  
ATOM 4362   O OH  . TYR A 1 704 ? -109.488 -55.952 26.589  1.00 0.00 ? 704 TYR A OH  1  
ATOM 4363   N N   . LYS A 1 705 ? -110.374 -63.276 25.107  1.00 0.00 ? 705 LYS A N   1  
ATOM 4364   C CA  . LYS A 1 705 ? -111.758 -63.699 25.287  1.00 0.00 ? 705 LYS A CA  1  
ATOM 4365   C C   . LYS A 1 705 ? -111.974 -64.437 26.642  1.00 0.00 ? 705 LYS A C   1  
ATOM 4366   O O   . LYS A 1 705 ? -112.941 -64.099 27.314  1.00 0.00 ? 705 LYS A O   1  
ATOM 4367   C CB  . LYS A 1 705 ? -112.116 -64.684 24.166  1.00 0.00 ? 705 LYS A CB  1  
ATOM 4368   C CG  . LYS A 1 705 ? -113.424 -65.484 24.106  1.00 0.00 ? 705 LYS A CG  1  
ATOM 4369   C CD  . LYS A 1 705 ? -113.534 -66.355 22.878  1.00 0.00 ? 705 LYS A CD  1  
ATOM 4370   C CE  . LYS A 1 705 ? -114.542 -67.484 23.060  1.00 0.00 ? 705 LYS A CE  1  
ATOM 4371   N NZ  . LYS A 1 705 ? -115.920 -67.016 23.124  1.00 0.00 ? 705 LYS A NZ  1  
ATOM 4372   N N   . PHE A 1 706 ? -111.073 -65.343 27.001  1.00 0.00 ? 706 PHE A N   1  
ATOM 4373   C CA  . PHE A 1 706 ? -111.241 -66.123 28.201  1.00 0.00 ? 706 PHE A CA  1  
ATOM 4374   C C   . PHE A 1 706 ? -111.286 -65.332 29.470  1.00 0.00 ? 706 PHE A C   1  
ATOM 4375   O O   . PHE A 1 706 ? -112.237 -65.328 30.269  1.00 0.00 ? 706 PHE A O   1  
ATOM 4376   C CB  . PHE A 1 706 ? -110.051 -67.090 28.356  1.00 0.00 ? 706 PHE A CB  1  
ATOM 4377   C CG  . PHE A 1 706 ? -110.255 -68.131 29.458  1.00 0.00 ? 706 PHE A CG  1  
ATOM 4378   C CD1 . PHE A 1 706 ? -111.417 -68.936 29.503  1.00 0.00 ? 706 PHE A CD1 1  
ATOM 4379   C CD2 . PHE A 1 706 ? -109.078 -68.486 30.234  1.00 0.00 ? 706 PHE A CD2 1  
ATOM 4380   C CE1 . PHE A 1 706 ? -111.447 -70.169 30.247  1.00 0.00 ? 706 PHE A CE1 1  
ATOM 4381   C CE2 . PHE A 1 706 ? -109.099 -69.709 31.011  1.00 0.00 ? 706 PHE A CE2 1  
ATOM 4382   C CZ  . PHE A 1 706 ? -110.250 -70.527 30.925  1.00 0.00 ? 706 PHE A CZ  1  
ATOM 4383   N N   . CYS A 1 707 ? -110.242 -64.454 29.541  1.00 0.00 ? 707 CYS A N   1  
ATOM 4384   C CA  . CYS A 1 707 ? -110.043 -63.487 30.602  1.00 0.00 ? 707 CYS A CA  1  
ATOM 4385   C C   . CYS A 1 707 ? -111.173 -62.443 30.692  1.00 0.00 ? 707 CYS A C   1  
ATOM 4386   O O   . CYS A 1 707 ? -111.539 -62.054 31.792  1.00 0.00 ? 707 CYS A O   1  
ATOM 4387   C CB  . CYS A 1 707 ? -108.696 -62.780 30.625  1.00 0.00 ? 707 CYS A CB  1  
ATOM 4388   S SG  . CYS A 1 707 ? -108.452 -61.590 29.247  1.00 0.00 ? 707 CYS A SG  1  
ATOM 4389   N N   . LYS A 1 708 ? -111.713 -62.019 29.545  1.00 0.00 ? 708 LYS A N   1  
ATOM 4390   C CA  . LYS A 1 708 ? -112.792 -61.028 29.472  1.00 0.00 ? 708 LYS A CA  1  
ATOM 4391   C C   . LYS A 1 708 ? -113.957 -61.658 30.161  1.00 0.00 ? 708 LYS A C   1  
ATOM 4392   O O   . LYS A 1 708 ? -114.582 -60.946 31.014  1.00 0.00 ? 708 LYS A O   1  
ATOM 4393   C CB  . LYS A 1 708 ? -113.037 -60.713 28.003  1.00 0.00 ? 708 LYS A CB  1  
ATOM 4394   C CG  . LYS A 1 708 ? -114.329 -59.902 27.680  1.00 0.00 ? 708 LYS A CG  1  
ATOM 4395   C CD  . LYS A 1 708 ? -114.664 -60.023 26.176  1.00 0.00 ? 708 LYS A CD  1  
ATOM 4396   C CE  . LYS A 1 708 ? -114.852 -61.387 25.620  1.00 0.00 ? 708 LYS A CE  1  
ATOM 4397   N NZ  . LYS A 1 708 ? -115.961 -61.981 26.321  1.00 0.00 ? 708 LYS A NZ  1  
ATOM 4398   N N   . PHE A 1 709 ? -114.271 -62.965 29.954  1.00 0.00 ? 709 PHE A N   1  
ATOM 4399   C CA  . PHE A 1 709 ? -115.330 -63.666 30.536  1.00 0.00 ? 709 PHE A CA  1  
ATOM 4400   C C   . PHE A 1 709 ? -115.117 -63.777 32.003  1.00 0.00 ? 709 PHE A C   1  
ATOM 4401   O O   . PHE A 1 709 ? -116.003 -63.617 32.822  1.00 0.00 ? 709 PHE A O   1  
ATOM 4402   C CB  . PHE A 1 709 ? -115.667 -65.127 30.044  1.00 0.00 ? 709 PHE A CB  1  
ATOM 4403   C CG  . PHE A 1 709 ? -116.467 -65.014 28.763  1.00 0.00 ? 709 PHE A CG  1  
ATOM 4404   C CD1 . PHE A 1 709 ? -117.768 -64.441 28.771  1.00 0.00 ? 709 PHE A CD1 1  
ATOM 4405   C CD2 . PHE A 1 709 ? -115.966 -65.436 27.553  1.00 0.00 ? 709 PHE A CD2 1  
ATOM 4406   C CE1 . PHE A 1 709 ? -118.555 -64.434 27.567  1.00 0.00 ? 709 PHE A CE1 1  
ATOM 4407   C CE2 . PHE A 1 709 ? -116.715 -65.545 26.392  1.00 0.00 ? 709 PHE A CE2 1  
ATOM 4408   C CZ  . PHE A 1 709 ? -118.053 -65.074 26.454  1.00 0.00 ? 709 PHE A CZ  1  
ATOM 4409   N N   . ILE A 1 710 ? -113.868 -64.108 32.447  1.00 0.00 ? 710 ILE A N   1  
ATOM 4410   C CA  . ILE A 1 710 ? -113.488 -64.424 33.856  1.00 0.00 ? 710 ILE A CA  1  
ATOM 4411   C C   . ILE A 1 710 ? -113.743 -63.199 34.755  1.00 0.00 ? 710 ILE A C   1  
ATOM 4412   O O   . ILE A 1 710 ? -114.251 -63.502 35.828  1.00 0.00 ? 710 ILE A O   1  
ATOM 4413   C CB  . ILE A 1 710 ? -112.033 -64.785 33.953  1.00 0.00 ? 710 ILE A CB  1  
ATOM 4414   C CG1 . ILE A 1 710 ? -111.733 -66.222 33.434  1.00 0.00 ? 710 ILE A CG1 1  
ATOM 4415   C CG2 . ILE A 1 710 ? -111.477 -64.616 35.391  1.00 0.00 ? 710 ILE A CG2 1  
ATOM 4416   C CD1 . ILE A 1 710 ? -110.251 -66.624 33.520  1.00 0.00 ? 710 ILE A CD1 1  
ATOM 4417   N N   . LYS A 1 711 ? -113.495 -61.995 34.278  1.00 0.00 ? 711 LYS A N   1  
ATOM 4418   C CA  . LYS A 1 711 ? -113.677 -60.740 34.962  1.00 0.00 ? 711 LYS A CA  1  
ATOM 4419   C C   . LYS A 1 711 ? -115.132 -60.489 35.439  1.00 0.00 ? 711 LYS A C   1  
ATOM 4420   O O   . LYS A 1 711 ? -115.269 -59.877 36.483  1.00 0.00 ? 711 LYS A O   1  
ATOM 4421   C CB  . LYS A 1 711 ? -113.387 -59.611 33.970  1.00 0.00 ? 711 LYS A CB  1  
ATOM 4422   C CG  . LYS A 1 711 ? -111.925 -59.301 33.632  1.00 0.00 ? 711 LYS A CG  1  
ATOM 4423   C CD  . LYS A 1 711 ? -111.777 -58.450 32.344  1.00 0.00 ? 711 LYS A CD  1  
ATOM 4424   C CE  . LYS A 1 711 ? -110.325 -58.480 31.798  1.00 0.00 ? 711 LYS A CE  1  
ATOM 4425   N NZ  . LYS A 1 711 ? -110.199 -57.759 30.494  1.00 0.00 ? 711 LYS A NZ  1  
ATOM 4426   N N   . SER A 1 712 ? -116.202 -61.040 34.754  1.00 0.00 ? 712 SER A N   1  
ATOM 4427   C CA  . SER A 1 712 ? -117.518 -60.869 35.197  1.00 0.00 ? 712 SER A CA  1  
ATOM 4428   C C   . SER A 1 712 ? -118.036 -61.332 36.601  1.00 0.00 ? 712 SER A C   1  
ATOM 4429   O O   . SER A 1 712 ? -118.936 -60.686 37.100  1.00 0.00 ? 712 SER A O   1  
ATOM 4430   C CB  . SER A 1 712 ? -118.592 -61.369 34.177  1.00 0.00 ? 712 SER A CB  1  
ATOM 4431   O OG  . SER A 1 712 ? -118.432 -62.807 34.121  1.00 0.00 ? 712 SER A OG  1  
ATOM 4432   N N   . MET A 1 713 ? -117.424 -62.373 37.222  1.00 0.00 ? 713 MET A N   1  
ATOM 4433   C CA  . MET A 1 713 ? -117.676 -62.993 38.515  1.00 0.00 ? 713 MET A CA  1  
ATOM 4434   C C   . MET A 1 713 ? -119.135 -63.351 38.735  1.00 0.00 ? 713 MET A C   1  
ATOM 4435   O O   . MET A 1 713 ? -119.814 -63.547 37.747  1.00 0.00 ? 713 MET A O   1  
ATOM 4436   C CB  . MET A 1 713 ? -117.049 -62.126 39.655  1.00 0.00 ? 713 MET A CB  1  
ATOM 4437   C CG  . MET A 1 713 ? -115.637 -61.651 39.375  1.00 0.00 ? 713 MET A CG  1  
ATOM 4438   S SD  . MET A 1 713 ? -114.808 -60.865 40.851  1.00 0.00 ? 713 MET A SD  1  
ATOM 4439   C CE  . MET A 1 713 ? -113.382 -60.355 39.912  1.00 0.00 ? 713 MET A CE  1  
ATOM 4440   N N   . ARG A 1 714 ? -119.633 -63.427 40.066  1.00 0.00 ? 714 ARG A N   1  
ATOM 4441   C CA  . ARG A 1 714 ? -121.052 -63.612 40.280  1.00 0.00 ? 714 ARG A CA  1  
ATOM 4442   C C   . ARG A 1 714 ? -121.636 -62.168 40.682  1.00 0.00 ? 714 ARG A C   1  
ATOM 4443   O O   . ARG A 1 714 ? -120.832 -61.200 40.739  1.00 0.00 ? 714 ARG A O   1  
ATOM 4444   C CB  . ARG A 1 714 ? -121.392 -64.540 41.423  1.00 0.00 ? 714 ARG A CB  1  
ATOM 4445   C CG  . ARG A 1 714 ? -122.797 -65.216 41.462  1.00 0.00 ? 714 ARG A CG  1  
ATOM 4446   C CD  . ARG A 1 714 ? -123.995 -64.291 41.877  1.00 0.00 ? 714 ARG A CD  1  
ATOM 4447   N NE  . ARG A 1 714 ? -125.366 -64.926 41.524  1.00 0.00 ? 714 ARG A NE  1  
ATOM 4448   C CZ  . ARG A 1 714 ? -126.585 -64.320 41.679  1.00 0.00 ? 714 ARG A CZ  1  
ATOM 4449   N NH1 . ARG A 1 714 ? -126.568 -62.987 41.932  1.00 0.00 ? 714 ARG A NH1 1  
ATOM 4450   N NH2 . ARG A 1 714 ? -127.702 -65.117 41.582  1.00 0.00 ? 714 ARG A NH2 1  
ATOM 4451   N N   . GLU A 1 754 ? -126.885 -70.625 37.790  1.00 0.00 ? 754 GLU A N   1  
ATOM 4452   C CA  . GLU A 1 754 ? -128.169 -71.171 37.407  1.00 0.00 ? 754 GLU A CA  1  
ATOM 4453   C C   . GLU A 1 754 ? -127.991 -71.974 36.112  1.00 0.00 ? 754 GLU A C   1  
ATOM 4454   O O   . GLU A 1 754 ? -126.906 -72.475 35.833  1.00 0.00 ? 754 GLU A O   1  
ATOM 4455   C CB  . GLU A 1 754 ? -129.221 -70.074 37.243  1.00 0.00 ? 754 GLU A CB  1  
ATOM 4456   C CG  . GLU A 1 754 ? -129.503 -69.457 38.585  1.00 0.00 ? 754 GLU A CG  1  
ATOM 4457   C CD  . GLU A 1 754 ? -130.050 -70.451 39.623  1.00 0.00 ? 754 GLU A CD  1  
ATOM 4458   O OE1 . GLU A 1 754 ? -131.254 -70.868 39.462  1.00 0.00 ? 754 GLU A OE1 1  
ATOM 4459   O OE2 . GLU A 1 754 ? -129.382 -70.713 40.602  1.00 0.00 ? 754 GLU A OE2 1  
ATOM 4460   N N   . ASP A 1 755 ? -129.070 -72.170 35.300  1.00 0.00 ? 755 ASP A N   1  
ATOM 4461   C CA  . ASP A 1 755 ? -129.158 -72.884 34.079  1.00 0.00 ? 755 ASP A CA  1  
ATOM 4462   C C   . ASP A 1 755 ? -128.285 -72.168 33.066  1.00 0.00 ? 755 ASP A C   1  
ATOM 4463   O O   . ASP A 1 755 ? -127.565 -72.848 32.330  1.00 0.00 ? 755 ASP A O   1  
ATOM 4464   C CB  . ASP A 1 755 ? -130.549 -72.982 33.501  1.00 0.00 ? 755 ASP A CB  1  
ATOM 4465   C CG  . ASP A 1 755 ? -131.602 -73.755 34.432  1.00 0.00 ? 755 ASP A CG  1  
ATOM 4466   O OD1 . ASP A 1 755 ? -131.812 -73.391 35.628  1.00 0.00 ? 755 ASP A OD1 1  
ATOM 4467   O OD2 . ASP A 1 755 ? -132.412 -74.547 33.866  1.00 0.00 ? 755 ASP A OD2 1  
ATOM 4468   N N   . ALA A 1 756 ? -128.291 -70.824 32.958  1.00 0.00 ? 756 ALA A N   1  
ATOM 4469   C CA  . ALA A 1 756 ? -127.516 -70.121 31.953  1.00 0.00 ? 756 ALA A CA  1  
ATOM 4470   C C   . ALA A 1 756 ? -126.019 -70.310 32.039  1.00 0.00 ? 756 ALA A C   1  
ATOM 4471   O O   . ALA A 1 756 ? -125.364 -70.421 31.015  1.00 0.00 ? 756 ALA A O   1  
ATOM 4472   C CB  . ALA A 1 756 ? -127.783 -68.632 31.921  1.00 0.00 ? 756 ALA A CB  1  
ATOM 4473   N N   . ALA A 1 757 ? -125.467 -70.309 33.296  1.00 0.00 ? 757 ALA A N   1  
ATOM 4474   C CA  . ALA A 1 757 ? -124.098 -70.383 33.583  1.00 0.00 ? 757 ALA A CA  1  
ATOM 4475   C C   . ALA A 1 757 ? -123.515 -71.635 33.049  1.00 0.00 ? 757 ALA A C   1  
ATOM 4476   O O   . ALA A 1 757 ? -122.409 -71.646 32.506  1.00 0.00 ? 757 ALA A O   1  
ATOM 4477   C CB  . ALA A 1 757 ? -123.937 -70.420 35.100  1.00 0.00 ? 757 ALA A CB  1  
ATOM 4478   N N   . LEU A 1 758 ? -124.296 -72.725 33.274  1.00 0.00 ? 758 LEU A N   1  
ATOM 4479   C CA  . LEU A 1 758 ? -123.899 -74.050 32.939  1.00 0.00 ? 758 LEU A CA  1  
ATOM 4480   C C   . LEU A 1 758 ? -123.728 -74.226 31.478  1.00 0.00 ? 758 LEU A C   1  
ATOM 4481   O O   . LEU A 1 758 ? -122.803 -74.848 31.015  1.00 0.00 ? 758 LEU A O   1  
ATOM 4482   C CB  . LEU A 1 758 ? -124.948 -75.062 33.447  1.00 0.00 ? 758 LEU A CB  1  
ATOM 4483   C CG  . LEU A 1 758 ? -125.094 -75.151 35.022  1.00 0.00 ? 758 LEU A CG  1  
ATOM 4484   C CD1 . LEU A 1 758 ? -126.178 -76.176 35.469  1.00 0.00 ? 758 LEU A CD1 1  
ATOM 4485   C CD2 . LEU A 1 758 ? -123.696 -75.258 35.735  1.00 0.00 ? 758 LEU A CD2 1  
ATOM 4486   N N   . GLU A 1 759 ? -124.658 -73.631 30.633  1.00 0.00 ? 759 GLU A N   1  
ATOM 4487   C CA  . GLU A 1 759 ? -124.693 -73.687 29.168  1.00 0.00 ? 759 GLU A CA  1  
ATOM 4488   C C   . GLU A 1 759 ? -123.527 -73.003 28.613  1.00 0.00 ? 759 GLU A C   1  
ATOM 4489   O O   . GLU A 1 759 ? -122.777 -73.594 27.817  1.00 0.00 ? 759 GLU A O   1  
ATOM 4490   C CB  . GLU A 1 759 ? -125.982 -73.081 28.576  1.00 0.00 ? 759 GLU A CB  1  
ATOM 4491   C CG  . GLU A 1 759 ? -127.270 -73.863 28.803  1.00 0.00 ? 759 GLU A CG  1  
ATOM 4492   C CD  . GLU A 1 759 ? -128.449 -72.989 28.461  1.00 0.00 ? 759 GLU A CD  1  
ATOM 4493   O OE1 . GLU A 1 759 ? -128.595 -72.678 27.223  1.00 0.00 ? 759 GLU A OE1 1  
ATOM 4494   O OE2 . GLU A 1 759 ? -129.239 -72.814 29.390  1.00 0.00 ? 759 GLU A OE2 1  
ATOM 4495   N N   . LEU A 1 760 ? -123.276 -71.801 29.166  1.00 0.00 ? 760 LEU A N   1  
ATOM 4496   C CA  . LEU A 1 760 ? -122.145 -70.982 28.786  1.00 0.00 ? 760 LEU A CA  1  
ATOM 4497   C C   . LEU A 1 760 ? -120.853 -71.638 29.108  1.00 0.00 ? 760 LEU A C   1  
ATOM 4498   O O   . LEU A 1 760 ? -119.971 -71.556 28.270  1.00 0.00 ? 760 LEU A O   1  
ATOM 4499   C CB  . LEU A 1 760 ? -122.199 -69.617 29.539  1.00 0.00 ? 760 LEU A CB  1  
ATOM 4500   C CG  . LEU A 1 760 ? -120.920 -68.758 29.619  1.00 0.00 ? 760 LEU A CG  1  
ATOM 4501   C CD1 . LEU A 1 760 ? -120.573 -68.137 28.281  1.00 0.00 ? 760 LEU A CD1 1  
ATOM 4502   C CD2 . LEU A 1 760 ? -120.998 -67.625 30.741  1.00 0.00 ? 760 LEU A CD2 1  
ATOM 4503   N N   . ILE A 1 761 ? -120.729 -72.354 30.278  1.00 0.00 ? 761 ILE A N   1  
ATOM 4504   C CA  . ILE A 1 761 ? -119.593 -73.085 30.859  1.00 0.00 ? 761 ILE A CA  1  
ATOM 4505   C C   . ILE A 1 761 ? -119.238 -74.126 29.851  1.00 0.00 ? 761 ILE A C   1  
ATOM 4506   O O   . ILE A 1 761 ? -118.057 -74.400 29.723  1.00 0.00 ? 761 ILE A O   1  
ATOM 4507   C CB  . ILE A 1 761 ? -119.877 -73.606 32.253  1.00 0.00 ? 761 ILE A CB  1  
ATOM 4508   C CG1 . ILE A 1 761 ? -119.475 -72.580 33.325  1.00 0.00 ? 761 ILE A CG1 1  
ATOM 4509   C CG2 . ILE A 1 761 ? -119.216 -74.963 32.480  1.00 0.00 ? 761 ILE A CG2 1  
ATOM 4510   C CD1 . ILE A 1 761 ? -119.736 -73.045 34.768  1.00 0.00 ? 761 ILE A CD1 1  
ATOM 4511   N N   . GLN A 1 762 ? -120.275 -74.760 29.268  1.00 0.00 ? 762 GLN A N   1  
ATOM 4512   C CA  . GLN A 1 762 ? -120.138 -75.874 28.365  1.00 0.00 ? 762 GLN A CA  1  
ATOM 4513   C C   . GLN A 1 762 ? -119.471 -75.312 27.195  1.00 0.00 ? 762 GLN A C   1  
ATOM 4514   O O   . GLN A 1 762 ? -118.520 -75.912 26.651  1.00 0.00 ? 762 GLN A O   1  
ATOM 4515   C CB  . GLN A 1 762 ? -121.393 -76.671 27.976  1.00 0.00 ? 762 GLN A CB  1  
ATOM 4516   C CG  . GLN A 1 762 ? -122.001 -77.509 29.131  1.00 0.00 ? 762 GLN A CG  1  
ATOM 4517   C CD  . GLN A 1 762 ? -121.056 -78.549 29.751  1.00 0.00 ? 762 GLN A CD  1  
ATOM 4518   O OE1 . GLN A 1 762 ? -121.154 -79.687 29.285  1.00 0.00 ? 762 GLN A OE1 1  
ATOM 4519   N NE2 . GLN A 1 762 ? -120.260 -78.226 30.795  1.00 0.00 ? 762 GLN A NE2 1  
ATOM 4520   N N   . LYS A 1 763 ? -119.885 -74.120 26.731  1.00 0.00 ? 763 LYS A N   1  
ATOM 4521   C CA  . LYS A 1 763 ? -119.293 -73.511 25.513  1.00 0.00 ? 763 LYS A CA  1  
ATOM 4522   C C   . LYS A 1 763 ? -117.783 -73.185 25.701  1.00 0.00 ? 763 LYS A C   1  
ATOM 4523   O O   . LYS A 1 763 ? -116.902 -73.422 24.825  1.00 0.00 ? 763 LYS A O   1  
ATOM 4524   C CB  . LYS A 1 763 ? -120.126 -72.235 25.140  1.00 0.00 ? 763 LYS A CB  1  
ATOM 4525   C CG  . LYS A 1 763 ? -119.720 -71.649 23.752  1.00 0.00 ? 763 LYS A CG  1  
ATOM 4526   C CD  . LYS A 1 763 ? -120.474 -70.288 23.344  1.00 0.00 ? 763 LYS A CD  1  
ATOM 4527   C CE  . LYS A 1 763 ? -120.397 -69.182 24.372  1.00 0.00 ? 763 LYS A CE  1  
ATOM 4528   N NZ  . LYS A 1 763 ? -119.024 -68.777 25.065  1.00 0.00 ? 763 LYS A NZ  1  
ATOM 4529   N N   . LEU A 1 764 ? -117.497 -72.673 26.937  1.00 0.00 ? 764 LEU A N   1  
ATOM 4530   C CA  . LEU A 1 764 ? -116.126 -72.370 27.366  1.00 0.00 ? 764 LEU A CA  1  
ATOM 4531   C C   . LEU A 1 764 ? -115.257 -73.582 27.405  1.00 0.00 ? 764 LEU A C   1  
ATOM 4532   O O   . LEU A 1 764 ? -114.100 -73.466 27.002  1.00 0.00 ? 764 LEU A O   1  
ATOM 4533   C CB  . LEU A 1 764 ? -116.170 -71.680 28.811  1.00 0.00 ? 764 LEU A CB  1  
ATOM 4534   C CG  . LEU A 1 764 ? -116.831 -70.282 28.870  1.00 0.00 ? 764 LEU A CG  1  
ATOM 4535   C CD1 . LEU A 1 764 ? -117.010 -69.730 30.348  1.00 0.00 ? 764 LEU A CD1 1  
ATOM 4536   C CD2 . LEU A 1 764 ? -116.131 -69.315 28.031  1.00 0.00 ? 764 LEU A CD2 1  
ATOM 4537   N N   . ILE A 1 765 ? -115.855 -74.765 27.879  1.00 0.00 ? 765 ILE A N   1  
ATOM 4538   C CA  . ILE A 1 765 ? -115.210 -76.002 28.083  1.00 0.00 ? 765 ILE A CA  1  
ATOM 4539   C C   . ILE A 1 765 ? -114.687 -76.569 26.810  1.00 0.00 ? 765 ILE A C   1  
ATOM 4540   O O   . ILE A 1 765 ? -113.566 -77.073 26.777  1.00 0.00 ? 765 ILE A O   1  
ATOM 4541   C CB  . ILE A 1 765 ? -116.040 -77.030 28.831  1.00 0.00 ? 765 ILE A CB  1  
ATOM 4542   C CG1 . ILE A 1 765 ? -115.846 -76.627 30.362  1.00 0.00 ? 765 ILE A CG1 1  
ATOM 4543   C CG2 . ILE A 1 765 ? -115.650 -78.506 28.661  1.00 0.00 ? 765 ILE A CG2 1  
ATOM 4544   C CD1 . ILE A 1 765 ? -116.600 -77.533 31.350  1.00 0.00 ? 765 ILE A CD1 1  
ATOM 4545   N N   . GLU A 1 766 ? -115.473 -76.482 25.704  1.00 0.00 ? 766 GLU A N   1  
ATOM 4546   C CA  . GLU A 1 766 ? -114.907 -77.030 24.434  1.00 0.00 ? 766 GLU A CA  1  
ATOM 4547   C C   . GLU A 1 766 ? -113.715 -76.164 24.068  1.00 0.00 ? 766 GLU A C   1  
ATOM 4548   O O   . GLU A 1 766 ? -112.708 -76.637 23.584  1.00 0.00 ? 766 GLU A O   1  
ATOM 4549   C CB  . GLU A 1 766 ? -115.944 -76.933 23.302  1.00 0.00 ? 766 GLU A CB  1  
ATOM 4550   C CG  . GLU A 1 766 ? -115.933 -77.950 22.090  1.00 0.00 ? 766 GLU A CG  1  
ATOM 4551   C CD  . GLU A 1 766 ? -114.796 -77.766 21.128  1.00 0.00 ? 766 GLU A CD  1  
ATOM 4552   O OE1 . GLU A 1 766 ? -114.530 -76.558 20.769  1.00 0.00 ? 766 GLU A OE1 1  
ATOM 4553   O OE2 . GLU A 1 766 ? -114.102 -78.804 20.787  1.00 0.00 ? 766 GLU A OE2 1  
ATOM 4554   N N   . TYR A 1 767 ? -113.737 -74.840 24.294  1.00 0.00 ? 767 TYR A N   1  
ATOM 4555   C CA  . TYR A 1 767 ? -112.779 -73.767 23.952  1.00 0.00 ? 767 TYR A CA  1  
ATOM 4556   C C   . TYR A 1 767 ? -111.517 -74.152 24.704  1.00 0.00 ? 767 TYR A C   1  
ATOM 4557   O O   . TYR A 1 767 ? -110.443 -74.240 24.111  1.00 0.00 ? 767 TYR A O   1  
ATOM 4558   C CB  . TYR A 1 767 ? -113.317 -72.349 24.158  1.00 0.00 ? 767 TYR A CB  1  
ATOM 4559   C CG  . TYR A 1 767 ? -114.523 -72.082 23.373  1.00 0.00 ? 767 TYR A CG  1  
ATOM 4560   C CD1 . TYR A 1 767 ? -114.966 -72.880 22.226  1.00 0.00 ? 767 TYR A CD1 1  
ATOM 4561   C CD2 . TYR A 1 767 ? -115.376 -70.952 23.672  1.00 0.00 ? 767 TYR A CD2 1  
ATOM 4562   C CE1 . TYR A 1 767 ? -116.035 -72.542 21.370  1.00 0.00 ? 767 TYR A CE1 1  
ATOM 4563   C CE2 . TYR A 1 767 ? -116.421 -70.588 22.795  1.00 0.00 ? 767 TYR A CE2 1  
ATOM 4564   C CZ  . TYR A 1 767 ? -116.733 -71.326 21.706  1.00 0.00 ? 767 TYR A CZ  1  
ATOM 4565   O OH  . TYR A 1 767 ? -117.700 -70.843 20.749  1.00 0.00 ? 767 TYR A OH  1  
ATOM 4566   N N   . ILE A 1 768 ? -111.680 -74.509 25.987  1.00 0.00 ? 768 ILE A N   1  
ATOM 4567   C CA  . ILE A 1 768 ? -110.539 -74.961 26.855  1.00 0.00 ? 768 ILE A CA  1  
ATOM 4568   C C   . ILE A 1 768 ? -109.807 -76.176 26.512  1.00 0.00 ? 768 ILE A C   1  
ATOM 4569   O O   . ILE A 1 768 ? -108.581 -76.244 26.479  1.00 0.00 ? 768 ILE A O   1  
ATOM 4570   C CB  . ILE A 1 768 ? -111.029 -75.289 28.351  1.00 0.00 ? 768 ILE A CB  1  
ATOM 4571   C CG1 . ILE A 1 768 ? -111.264 -73.903 28.996  1.00 0.00 ? 768 ILE A CG1 1  
ATOM 4572   C CG2 . ILE A 1 768 ? -110.134 -76.102 29.350  1.00 0.00 ? 768 ILE A CG2 1  
ATOM 4573   C CD1 . ILE A 1 768 ? -111.745 -73.964 30.455  1.00 0.00 ? 768 ILE A CD1 1  
ATOM 4574   N N   . SER A 1 769 ? -110.582 -77.201 26.083  1.00 0.00 ? 769 SER A N   1  
ATOM 4575   C CA  . SER A 1 769 ? -109.965 -78.473 25.653  1.00 0.00 ? 769 SER A CA  1  
ATOM 4576   C C   . SER A 1 769 ? -109.110 -78.268 24.459  1.00 0.00 ? 769 SER A C   1  
ATOM 4577   O O   . SER A 1 769 ? -107.990 -78.805 24.398  1.00 0.00 ? 769 SER A O   1  
ATOM 4578   C CB  . SER A 1 769 ? -110.952 -79.622 25.435  1.00 0.00 ? 769 SER A CB  1  
ATOM 4579   O OG  . SER A 1 769 ? -111.875 -79.205 24.425  1.00 0.00 ? 769 SER A OG  1  
ATOM 4580   N N   . ASN A 1 770 ? -109.609 -77.419 23.481  1.00 0.00 ? 770 ASN A N   1  
ATOM 4581   C CA  . ASN A 1 770 ? -108.852 -77.176 22.242  1.00 0.00 ? 770 ASN A CA  1  
ATOM 4582   C C   . ASN A 1 770 ? -107.635 -76.476 22.572  1.00 0.00 ? 770 ASN A C   1  
ATOM 4583   O O   . ASN A 1 770 ? -106.578 -76.904 22.145  1.00 0.00 ? 770 ASN A O   1  
ATOM 4584   C CB  . ASN A 1 770 ? -109.612 -76.276 21.328  1.00 0.00 ? 770 ASN A CB  1  
ATOM 4585   C CG  . ASN A 1 770 ? -110.967 -76.828 20.911  1.00 0.00 ? 770 ASN A CG  1  
ATOM 4586   O OD1 . ASN A 1 770 ? -111.743 -76.129 20.263  1.00 0.00 ? 770 ASN A OD1 1  
ATOM 4587   N ND2 . ASN A 1 770 ? -111.201 -78.150 21.188  1.00 0.00 ? 770 ASN A ND2 1  
ATOM 4588   N N   . ALA A 1 771 ? -107.770 -75.400 23.448  1.00 0.00 ? 771 ALA A N   1  
ATOM 4589   C CA  . ALA A 1 771 ? -106.546 -74.662 23.907  1.00 0.00 ? 771 ALA A CA  1  
ATOM 4590   C C   . ALA A 1 771 ? -105.607 -75.547 24.649  1.00 0.00 ? 771 ALA A C   1  
ATOM 4591   O O   . ALA A 1 771 ? -104.380 -75.491 24.484  1.00 0.00 ? 771 ALA A O   1  
ATOM 4592   C CB  . ALA A 1 771 ? -106.871 -73.385 24.756  1.00 0.00 ? 771 ALA A CB  1  
ATOM 4593   N N   . SER A 1 772 ? -106.054 -76.460 25.495  1.00 0.00 ? 772 SER A N   1  
ATOM 4594   C CA  . SER A 1 772 ? -105.279 -77.435 26.215  1.00 0.00 ? 772 SER A CA  1  
ATOM 4595   C C   . SER A 1 772 ? -104.620 -78.356 25.291  1.00 0.00 ? 772 SER A C   1  
ATOM 4596   O O   . SER A 1 772 ? -103.426 -78.633 25.422  1.00 0.00 ? 772 SER A O   1  
ATOM 4597   C CB  . SER A 1 772 ? -106.133 -78.259 27.231  1.00 0.00 ? 772 SER A CB  1  
ATOM 4598   O OG  . SER A 1 772 ? -106.546 -77.409 28.303  1.00 0.00 ? 772 SER A OG  1  
ATOM 4599   N N   . SER A 1 773 ? -105.249 -78.849 24.245  1.00 0.00 ? 773 SER A N   1  
ATOM 4600   C CA  . SER A 1 773 ? -104.608 -79.807 23.315  1.00 0.00 ? 773 SER A CA  1  
ATOM 4601   C C   . SER A 1 773 ? -103.454 -79.201 22.556  1.00 0.00 ? 773 SER A C   1  
ATOM 4602   O O   . SER A 1 773 ? -102.414 -79.824 22.471  1.00 0.00 ? 773 SER A O   1  
ATOM 4603   C CB  . SER A 1 773 ? -105.644 -80.400 22.394  1.00 0.00 ? 773 SER A CB  1  
ATOM 4604   O OG  . SER A 1 773 ? -105.115 -81.406 21.632  1.00 0.00 ? 773 SER A OG  1  
ATOM 4605   N N   . ILE A 1 774 ? -103.508 -77.914 22.044  1.00 0.00 ? 774 ILE A N   1  
ATOM 4606   C CA  . ILE A 1 774 ? -102.441 -77.153 21.326  1.00 0.00 ? 774 ILE A CA  1  
ATOM 4607   C C   . ILE A 1 774 ? -101.304 -76.926 22.257  1.00 0.00 ? 774 ILE A C   1  
ATOM 4608   O O   . ILE A 1 774 ? -100.170 -77.051 21.845  1.00 0.00 ? 774 ILE A O   1  
ATOM 4609   C CB  . ILE A 1 774 ? -102.882 -75.850 20.688  1.00 0.00 ? 774 ILE A CB  1  
ATOM 4610   C CG1 . ILE A 1 774 ? -103.682 -74.908 21.578  1.00 0.00 ? 774 ILE A CG1 1  
ATOM 4611   C CG2 . ILE A 1 774 ? -103.654 -76.340 19.412  1.00 0.00 ? 774 ILE A CG2 1  
ATOM 4612   C CD1 . ILE A 1 774 ? -104.106 -73.600 20.888  1.00 0.00 ? 774 ILE A CD1 1  
ATOM 4613   N N   . PHE A 1 775 ? -101.658 -76.585 23.550  1.00 0.00 ? 775 PHE A N   1  
ATOM 4614   C CA  . PHE A 1 775 ? -100.618 -76.300 24.560  1.00 0.00 ? 775 PHE A CA  1  
ATOM 4615   C C   . PHE A 1 775 ? -99.810  -77.544 24.777  1.00 0.00 ? 775 PHE A C   1  
ATOM 4616   O O   . PHE A 1 775 ? -98.573  -77.499 24.870  1.00 0.00 ? 775 PHE A O   1  
ATOM 4617   C CB  . PHE A 1 775 ? -101.231 -75.803 25.903  1.00 0.00 ? 775 PHE A CB  1  
ATOM 4618   C CG  . PHE A 1 775 ? -101.986 -74.503 25.782  1.00 0.00 ? 775 PHE A CG  1  
ATOM 4619   C CD1 . PHE A 1 775 ? -101.997 -73.635 24.658  1.00 0.00 ? 775 PHE A CD1 1  
ATOM 4620   C CD2 . PHE A 1 775 ? -102.698 -74.055 26.910  1.00 0.00 ? 775 PHE A CD2 1  
ATOM 4621   C CE1 . PHE A 1 775 ? -102.517 -72.325 24.769  1.00 0.00 ? 775 PHE A CE1 1  
ATOM 4622   C CE2 . PHE A 1 775 ? -103.324 -72.861 26.948  1.00 0.00 ? 775 PHE A CE2 1  
ATOM 4623   C CZ  . PHE A 1 775 ? -103.239 -71.957 25.869  1.00 0.00 ? 775 PHE A CZ  1  
ATOM 4624   N N   . ARG A 1 776 ? -100.502 -78.699 24.776  1.00 0.00 ? 776 ARG A N   1  
ATOM 4625   C CA  . ARG A 1 776 ? -99.875  -80.021 24.962  1.00 0.00 ? 776 ARG A CA  1  
ATOM 4626   C C   . ARG A 1 776 ? -98.907  -80.358 23.842  1.00 0.00 ? 776 ARG A C   1  
ATOM 4627   O O   . ARG A 1 776 ? -97.730  -80.639 24.075  1.00 0.00 ? 776 ARG A O   1  
ATOM 4628   C CB  . ARG A 1 776 ? -100.859 -81.210 25.146  1.00 0.00 ? 776 ARG A CB  1  
ATOM 4629   C CG  . ARG A 1 776 ? -100.139 -82.428 25.727  1.00 0.00 ? 776 ARG A CG  1  
ATOM 4630   C CD  . ARG A 1 776 ? -101.094 -83.634 25.637  1.00 0.00 ? 776 ARG A CD  1  
ATOM 4631   N NE  . ARG A 1 776 ? -100.918 -84.288 24.271  1.00 0.00 ? 776 ARG A NE  1  
ATOM 4632   C CZ  . ARG A 1 776 ? -101.020 -85.633 24.054  1.00 0.00 ? 776 ARG A CZ  1  
ATOM 4633   N NH1 . ARG A 1 776 ? -101.310 -86.499 25.047  1.00 0.00 ? 776 ARG A NH1 1  
ATOM 4634   N NH2 . ARG A 1 776 ? -100.967 -86.093 22.780  1.00 0.00 ? 776 ARG A NH2 1  
ATOM 4635   N N   . LYS A 1 777 ? -99.299  -80.045 22.578  1.00 0.00 ? 777 LYS A N   1  
ATOM 4636   C CA  . LYS A 1 777 ? -98.478  -80.078 21.404  1.00 0.00 ? 777 LYS A CA  1  
ATOM 4637   C C   . LYS A 1 777 ? -97.297  -79.099 21.501  1.00 0.00 ? 777 LYS A C   1  
ATOM 4638   O O   . LYS A 1 777 ? -96.198  -79.359 21.078  1.00 0.00 ? 777 LYS A O   1  
ATOM 4639   C CB  . LYS A 1 777 ? -99.258  -79.833 20.084  1.00 0.00 ? 777 LYS A CB  1  
ATOM 4640   C CG  . LYS A 1 777 ? -98.736  -80.644 18.893  1.00 0.00 ? 777 LYS A CG  1  
ATOM 4641   C CD  . LYS A 1 777 ? -97.209  -80.533 18.653  1.00 0.00 ? 777 LYS A CD  1  
ATOM 4642   C CE  . LYS A 1 777 ? -96.629  -81.298 17.403  1.00 0.00 ? 777 LYS A CE  1  
ATOM 4643   N NZ  . LYS A 1 777 ? -95.147  -81.375 17.420  1.00 0.00 ? 777 LYS A NZ  1  
ATOM 4644   N N   . CYS A 1 778 ? -97.512  -77.914 22.042  1.00 0.00 ? 778 CYS A N   1  
ATOM 4645   C CA  . CYS A 1 778 ? -96.554  -76.875 22.082  1.00 0.00 ? 778 CYS A CA  1  
ATOM 4646   C C   . CYS A 1 778 ? -95.372  -77.246 22.936  1.00 0.00 ? 778 CYS A C   1  
ATOM 4647   O O   . CYS A 1 778 ? -94.265  -76.786 22.622  1.00 0.00 ? 778 CYS A O   1  
ATOM 4648   C CB  . CYS A 1 778 ? -97.144  -75.541 22.555  1.00 0.00 ? 778 CYS A CB  1  
ATOM 4649   S SG  . CYS A 1 778 ? -98.213  -74.862 21.221  1.00 0.00 ? 778 CYS A SG  1  
ATOM 4650   N N   . LEU A 1 779 ? -95.502  -78.078 23.946  1.00 0.00 ? 779 LEU A N   1  
ATOM 4651   C CA  . LEU A 1 779 ? -94.414  -78.516 24.865  1.00 0.00 ? 779 LEU A CA  1  
ATOM 4652   C C   . LEU A 1 779 ? -93.344  -79.201 24.138  1.00 0.00 ? 779 LEU A C   1  
ATOM 4653   O O   . LEU A 1 779 ? -92.135  -78.978 24.432  1.00 0.00 ? 779 LEU A O   1  
ATOM 4654   C CB  . LEU A 1 779 ? -94.875  -79.638 25.922  1.00 0.00 ? 779 LEU A CB  1  
ATOM 4655   C CG  . LEU A 1 779 ? -95.983  -79.316 26.954  1.00 0.00 ? 779 LEU A CG  1  
ATOM 4656   C CD1 . LEU A 1 779 ? -96.291  -80.507 27.894  1.00 0.00 ? 779 LEU A CD1 1  
ATOM 4657   C CD2 . LEU A 1 779 ? -95.823  -78.005 27.660  1.00 0.00 ? 779 LEU A CD2 1  
ATOM 4658   N N   . ILE A 1 780 ? -93.754  -79.998 23.083  1.00 0.00 ? 780 ILE A N   1  
ATOM 4659   C CA  . ILE A 1 780 ? -92.922  -80.767 22.147  1.00 0.00 ? 780 ILE A CA  1  
ATOM 4660   C C   . ILE A 1 780 ? -91.988  -79.880 21.322  1.00 0.00 ? 780 ILE A C   1  
ATOM 4661   O O   . ILE A 1 780 ? -90.829  -80.207 21.170  1.00 0.00 ? 780 ILE A O   1  
ATOM 4662   C CB  . ILE A 1 780 ? -93.762  -81.649 21.266  1.00 0.00 ? 780 ILE A CB  1  
ATOM 4663   C CG1 . ILE A 1 780 ? -94.901  -82.438 22.007  1.00 0.00 ? 780 ILE A CG1 1  
ATOM 4664   C CG2 . ILE A 1 780 ? -92.810  -82.562 20.428  1.00 0.00 ? 780 ILE A CG2 1  
ATOM 4665   C CD1 . ILE A 1 780 ? -95.745  -83.334 21.085  1.00 0.00 ? 780 ILE A CD1 1  
ATOM 4666   N N   . ASN A 1 781 ? -92.468  -78.704 20.883  1.00 0.00 ? 781 ASN A N   1  
ATOM 4667   C CA  . ASN A 1 781 ? -91.831  -77.642 20.085  1.00 0.00 ? 781 ASN A CA  1  
ATOM 4668   C C   . ASN A 1 781 ? -90.599  -77.118 20.767  1.00 0.00 ? 781 ASN A C   1  
ATOM 4669   O O   . ASN A 1 781 ? -89.601  -76.843 20.112  1.00 0.00 ? 781 ASN A O   1  
ATOM 4670   C CB  . ASN A 1 781 ? -92.596  -76.332 19.799  1.00 0.00 ? 781 ASN A CB  1  
ATOM 4671   C CG  . ASN A 1 781 ? -94.021  -76.639 19.246  1.00 0.00 ? 781 ASN A CG  1  
ATOM 4672   O OD1 . ASN A 1 781 ? -94.577  -77.758 19.178  1.00 0.00 ? 781 ASN A OD1 1  
ATOM 4673   N ND2 . ASN A 1 781 ? -94.635  -75.486 18.923  1.00 0.00 ? 781 ASN A ND2 1  
ATOM 4674   N N   . PHE A 1 782 ? -90.624  -76.881 22.106  1.00 0.00 ? 782 PHE A N   1  
ATOM 4675   C CA  . PHE A 1 782 ? -89.503  -76.309 22.943  1.00 0.00 ? 782 PHE A CA  1  
ATOM 4676   C C   . PHE A 1 782 ? -88.293  -77.213 22.855  1.00 0.00 ? 782 PHE A C   1  
ATOM 4677   O O   . PHE A 1 782 ? -87.185  -76.829 22.499  1.00 0.00 ? 782 PHE A O   1  
ATOM 4678   C CB  . PHE A 1 782 ? -89.927  -76.099 24.477  1.00 0.00 ? 782 PHE A CB  1  
ATOM 4679   C CG  . PHE A 1 782 ? -88.812  -75.644 25.305  1.00 0.00 ? 782 PHE A CG  1  
ATOM 4680   C CD1 . PHE A 1 782 ? -88.120  -74.422 24.958  1.00 0.00 ? 782 PHE A CD1 1  
ATOM 4681   C CD2 . PHE A 1 782 ? -88.436  -76.295 26.453  1.00 0.00 ? 782 PHE A CD2 1  
ATOM 4682   C CE1 . PHE A 1 782 ? -87.017  -74.039 25.646  1.00 0.00 ? 782 PHE A CE1 1  
ATOM 4683   C CE2 . PHE A 1 782 ? -87.397  -75.831 27.256  1.00 0.00 ? 782 PHE A CE2 1  
ATOM 4684   C CZ  . PHE A 1 782 ? -86.675  -74.741 26.824  1.00 0.00 ? 782 PHE A CZ  1  
ATOM 4685   N N   . THR A 1 783 ? -88.582  -78.575 22.932  1.00 0.00 ? 783 THR A N   1  
ATOM 4686   C CA  . THR A 1 783 ? -87.586  -79.650 22.565  1.00 0.00 ? 783 THR A CA  1  
ATOM 4687   C C   . THR A 1 783 ? -87.119  -79.624 21.092  1.00 0.00 ? 783 THR A C   1  
ATOM 4688   O O   . THR A 1 783 ? -85.934  -79.522 20.794  1.00 0.00 ? 783 THR A O   1  
ATOM 4689   C CB  . THR A 1 783 ? -88.057  -80.985 22.981  1.00 0.00 ? 783 THR A CB  1  
ATOM 4690   O OG1 . THR A 1 783 ? -88.239  -81.033 24.350  1.00 0.00 ? 783 THR A OG1 1  
ATOM 4691   C CG2 . THR A 1 783 ? -87.141  -82.143 22.571  1.00 0.00 ? 783 THR A CG2 1  
ATOM 4692   N N   . GLN A 1 784 ? -88.105  -79.668 20.133  1.00 0.00 ? 784 GLN A N   1  
ATOM 4693   C CA  . GLN A 1 784 ? -87.807  -79.535 18.786  1.00 0.00 ? 784 GLN A CA  1  
ATOM 4694   C C   . GLN A 1 784 ? -89.016  -78.926 18.124  1.00 0.00 ? 784 GLN A C   1  
ATOM 4695   O O   . GLN A 1 784 ? -90.123  -79.454 18.223  1.00 0.00 ? 784 GLN A O   1  
ATOM 4696   C CB  . GLN A 1 784 ? -87.573  -80.863 18.164  1.00 0.00 ? 784 GLN A CB  1  
ATOM 4697   C CG  . GLN A 1 784 ? -86.190  -81.346 17.784  1.00 0.00 ? 784 GLN A CG  1  
ATOM 4698   C CD  . GLN A 1 784 ? -85.522  -80.551 16.688  1.00 0.00 ? 784 GLN A CD  1  
ATOM 4699   O OE1 . GLN A 1 784 ? -84.912  -79.500 16.984  1.00 0.00 ? 784 GLN A OE1 1  
ATOM 4700   N NE2 . GLN A 1 784 ? -85.637  -81.036 15.397  1.00 0.00 ? 784 GLN A NE2 1  
ATOM 4701   N N   . GLU A 1 785 ? -88.700  -77.721 17.473  1.00 0.00 ? 785 GLU A N   1  
ATOM 4702   C CA  . GLU A 1 785 ? -89.644  -76.703 16.952  1.00 0.00 ? 785 GLU A CA  1  
ATOM 4703   C C   . GLU A 1 785 ? -90.896  -77.234 16.249  1.00 0.00 ? 785 GLU A C   1  
ATOM 4704   O O   . GLU A 1 785 ? -91.119  -78.414 15.872  1.00 0.00 ? 785 GLU A O   1  
ATOM 4705   C CB  . GLU A 1 785 ? -88.954  -75.809 15.892  1.00 0.00 ? 785 GLU A CB  1  
ATOM 4706   C CG  . GLU A 1 785 ? -88.423  -76.493 14.593  1.00 0.00 ? 785 GLU A CG  1  
ATOM 4707   C CD  . GLU A 1 785 ? -87.312  -77.529 14.770  1.00 0.00 ? 785 GLU A CD  1  
ATOM 4708   O OE1 . GLU A 1 785 ? -86.126  -77.166 14.835  1.00 0.00 ? 785 GLU A OE1 1  
ATOM 4709   O OE2 . GLU A 1 785 ? -87.645  -78.739 14.843  1.00 0.00 ? 785 GLU A OE2 1  
ATOM 4710   N N   . LEU A 1 786 ? -91.885  -76.323 15.993  1.00 0.00 ? 786 LEU A N   1  
ATOM 4711   C CA  . LEU A 1 786 ? -93.133  -76.512 15.228  1.00 0.00 ? 786 LEU A CA  1  
ATOM 4712   C C   . LEU A 1 786 ? -94.187  -77.278 15.951  1.00 0.00 ? 786 LEU A C   1  
ATOM 4713   O O   . LEU A 1 786 ? -93.952  -78.417 16.344  1.00 0.00 ? 786 LEU A O   1  
ATOM 4714   C CB  . LEU A 1 786 ? -93.002  -77.018 13.769  1.00 0.00 ? 786 LEU A CB  1  
ATOM 4715   C CG  . LEU A 1 786 ? -94.165  -77.352 12.866  1.00 0.00 ? 786 LEU A CG  1  
ATOM 4716   C CD1 . LEU A 1 786 ? -94.790  -78.702 13.094  1.00 0.00 ? 786 LEU A CD1 1  
ATOM 4717   C CD2 . LEU A 1 786 ? -95.143  -76.171 12.749  1.00 0.00 ? 786 LEU A CD2 1  
ATOM 4718   N N   . SER A 1 787 ? -95.449  -76.690 16.142  1.00 0.00 ? 787 SER A N   1  
ATOM 4719   C CA  . SER A 1 787 ? -96.592  -77.410 16.653  1.00 0.00 ? 787 SER A CA  1  
ATOM 4720   C C   . SER A 1 787 ? -97.584  -77.482 15.466  1.00 0.00 ? 787 SER A C   1  
ATOM 4721   O O   . SER A 1 787 ? -97.937  -76.479 14.894  1.00 0.00 ? 787 SER A O   1  
ATOM 4722   C CB  . SER A 1 787 ? -97.385  -76.656 17.808  1.00 0.00 ? 787 SER A CB  1  
ATOM 4723   O OG  . SER A 1 787 ? -98.665  -77.195 18.209  1.00 0.00 ? 787 SER A OG  1  
ATOM 4724   N N   . THR A 1 788 ? -97.897  -78.682 14.992  1.00 0.00 ? 788 THR A N   1  
ATOM 4725   C CA  . THR A 1 788 ? -98.695  -78.972 13.804  1.00 0.00 ? 788 THR A CA  1  
ATOM 4726   C C   . THR A 1 788 ? -100.065 -78.614 14.169  1.00 0.00 ? 788 THR A C   1  
ATOM 4727   O O   . THR A 1 788 ? -100.786 -78.071 13.367  1.00 0.00 ? 788 THR A O   1  
ATOM 4728   C CB  . THR A 1 788 ? -98.418  -80.326 13.262  1.00 0.00 ? 788 THR A CB  1  
ATOM 4729   O OG1 . THR A 1 788 ? -99.028  -80.494 11.997  1.00 0.00 ? 788 THR A OG1 1  
ATOM 4730   C CG2 . THR A 1 788 ? -98.972  -81.478 14.159  1.00 0.00 ? 788 THR A CG2 1  
ATOM 4731   N N   . GLU A 1 789 ? -100.420 -78.946 15.459  1.00 0.00 ? 789 GLU A N   1  
ATOM 4732   C CA  . GLU A 1 789 ? -101.795 -78.792 15.950  1.00 0.00 ? 789 GLU A CA  1  
ATOM 4733   C C   . GLU A 1 789 ? -102.361 -77.362 15.902  1.00 0.00 ? 789 GLU A C   1  
ATOM 4734   O O   . GLU A 1 789 ? -103.496 -77.186 15.551  1.00 0.00 ? 789 GLU A O   1  
ATOM 4735   C CB  . GLU A 1 789 ? -102.094 -79.325 17.386  1.00 0.00 ? 789 GLU A CB  1  
ATOM 4736   C CG  . GLU A 1 789 ? -103.548 -79.666 17.517  1.00 0.00 ? 789 GLU A CG  1  
ATOM 4737   C CD  . GLU A 1 789 ? -103.994 -79.867 18.954  1.00 0.00 ? 789 GLU A CD  1  
ATOM 4738   O OE1 . GLU A 1 789 ? -103.261 -80.581 19.701  1.00 0.00 ? 789 GLU A OE1 1  
ATOM 4739   O OE2 . GLU A 1 789 ? -105.019 -79.242 19.355  1.00 0.00 ? 789 GLU A OE2 1  
ATOM 4740   N N   . LYS A 1 790 ? -101.603 -76.318 16.307  1.00 0.00 ? 790 LYS A N   1  
ATOM 4741   C CA  . LYS A 1 790 ? -102.148 -75.019 16.224  1.00 0.00 ? 790 LYS A CA  1  
ATOM 4742   C C   . LYS A 1 790 ? -102.347 -74.598 14.801  1.00 0.00 ? 790 LYS A C   1  
ATOM 4743   O O   . LYS A 1 790 ? -103.413 -73.996 14.462  1.00 0.00 ? 790 LYS A O   1  
ATOM 4744   C CB  . LYS A 1 790 ? -101.478 -73.984 17.010  1.00 0.00 ? 790 LYS A CB  1  
ATOM 4745   C CG  . LYS A 1 790 ? -99.965  -74.149 17.401  1.00 0.00 ? 790 LYS A CG  1  
ATOM 4746   C CD  . LYS A 1 790 ? -99.496  -73.046 18.302  1.00 0.00 ? 790 LYS A CD  1  
ATOM 4747   C CE  . LYS A 1 790 ? -97.965  -72.819 18.457  1.00 0.00 ? 790 LYS A CE  1  
ATOM 4748   N NZ  . LYS A 1 790 ? -97.661  -71.928 19.584  1.00 0.00 ? 790 LYS A NZ  1  
ATOM 4749   N N   . PHE A 1 791 ? -101.351 -74.976 13.861  1.00 0.00 ? 791 PHE A N   1  
ATOM 4750   C CA  . PHE A 1 791 ? -101.397 -74.641 12.449  1.00 0.00 ? 791 PHE A CA  1  
ATOM 4751   C C   . PHE A 1 791 ? -102.626 -75.292 11.918  1.00 0.00 ? 791 PHE A C   1  
ATOM 4752   O O   . PHE A 1 791 ? -103.457 -74.729 11.227  1.00 0.00 ? 791 PHE A O   1  
ATOM 4753   C CB  . PHE A 1 791 ? -100.145 -75.135 11.671  1.00 0.00 ? 791 PHE A CB  1  
ATOM 4754   C CG  . PHE A 1 791 ? -99.846  -74.383 10.422  1.00 0.00 ? 791 PHE A CG  1  
ATOM 4755   C CD1 . PHE A 1 791 ? -98.934  -73.295 10.515  1.00 0.00 ? 791 PHE A CD1 1  
ATOM 4756   C CD2 . PHE A 1 791 ? -100.263 -74.771 9.183   1.00 0.00 ? 791 PHE A CD2 1  
ATOM 4757   C CE1 . PHE A 1 791 ? -98.547  -72.596 9.402   1.00 0.00 ? 791 PHE A CE1 1  
ATOM 4758   C CE2 . PHE A 1 791 ? -99.945  -74.129 8.028   1.00 0.00 ? 791 PHE A CE2 1  
ATOM 4759   C CZ  . PHE A 1 791 ? -99.019  -73.038 8.088   1.00 0.00 ? 791 PHE A CZ  1  
ATOM 4760   N N   . ASP A 1 792 ? -102.829 -76.622 12.324  1.00 0.00 ? 792 ASP A N   1  
ATOM 4761   C CA  . ASP A 1 792 ? -103.902 -77.402 11.925  1.00 0.00 ? 792 ASP A CA  1  
ATOM 4762   C C   . ASP A 1 792 ? -105.243 -76.881 12.409  1.00 0.00 ? 792 ASP A C   1  
ATOM 4763   O O   . ASP A 1 792 ? -106.139 -76.805 11.581  1.00 0.00 ? 792 ASP A O   1  
ATOM 4764   C CB  . ASP A 1 792 ? -103.763 -78.888 12.443  1.00 0.00 ? 792 ASP A CB  1  
ATOM 4765   C CG  . ASP A 1 792 ? -102.654 -79.705 11.751  1.00 0.00 ? 792 ASP A CG  1  
ATOM 4766   O OD1 . ASP A 1 792 ? -102.238 -79.531 10.576  1.00 0.00 ? 792 ASP A OD1 1  
ATOM 4767   O OD2 . ASP A 1 792 ? -102.112 -80.586 12.497  1.00 0.00 ? 792 ASP A OD2 1  
ATOM 4768   N N   . PHE A 1 793 ? -105.352 -76.349 13.593  1.00 0.00 ? 793 PHE A N   1  
ATOM 4769   C CA  . PHE A 1 793 ? -106.640 -75.695 14.007  1.00 0.00 ? 793 PHE A CA  1  
ATOM 4770   C C   . PHE A 1 793 ? -106.984 -74.501 13.142  1.00 0.00 ? 793 PHE A C   1  
ATOM 4771   O O   . PHE A 1 793 ? -108.135 -74.411 12.712  1.00 0.00 ? 793 PHE A O   1  
ATOM 4772   C CB  . PHE A 1 793 ? -106.575 -75.279 15.479  1.00 0.00 ? 793 PHE A CB  1  
ATOM 4773   C CG  . PHE A 1 793 ? -107.643 -75.975 16.229  1.00 0.00 ? 793 PHE A CG  1  
ATOM 4774   C CD1 . PHE A 1 793 ? -107.615 -77.311 16.594  1.00 0.00 ? 793 PHE A CD1 1  
ATOM 4775   C CD2 . PHE A 1 793 ? -108.775 -75.219 16.533  1.00 0.00 ? 793 PHE A CD2 1  
ATOM 4776   C CE1 . PHE A 1 793 ? -108.601 -77.857 17.449  1.00 0.00 ? 793 PHE A CE1 1  
ATOM 4777   C CE2 . PHE A 1 793 ? -109.760 -75.785 17.348  1.00 0.00 ? 793 PHE A CE2 1  
ATOM 4778   C CZ  . PHE A 1 793 ? -109.688 -77.099 17.818  1.00 0.00 ? 793 PHE A CZ  1  
ATOM 4779   N N   . TYR A 1 794 ? -105.996 -73.606 12.824  1.00 0.00 ? 794 TYR A N   1  
ATOM 4780   C CA  . TYR A 1 794 ? -106.418 -72.524 11.964  1.00 0.00 ? 794 TYR A CA  1  
ATOM 4781   C C   . TYR A 1 794 ? -106.897 -72.955 10.638  1.00 0.00 ? 794 TYR A C   1  
ATOM 4782   O O   . TYR A 1 794 ? -107.894 -72.491 10.191  1.00 0.00 ? 794 TYR A O   1  
ATOM 4783   C CB  . TYR A 1 794 ? -105.416 -71.322 11.910  1.00 0.00 ? 794 TYR A CB  1  
ATOM 4784   C CG  . TYR A 1 794 ? -104.743 -71.145 10.556  1.00 0.00 ? 794 TYR A CG  1  
ATOM 4785   C CD1 . TYR A 1 794 ? -105.476 -70.572 9.518   1.00 0.00 ? 794 TYR A CD1 1  
ATOM 4786   C CD2 . TYR A 1 794 ? -103.487 -71.677 10.320  1.00 0.00 ? 794 TYR A CD2 1  
ATOM 4787   C CE1 . TYR A 1 794 ? -104.888 -70.449 8.231   1.00 0.00 ? 794 TYR A CE1 1  
ATOM 4788   C CE2 . TYR A 1 794 ? -102.925 -71.640 9.055   1.00 0.00 ? 794 TYR A CE2 1  
ATOM 4789   C CZ  . TYR A 1 794 ? -103.626 -70.972 7.997   1.00 0.00 ? 794 TYR A CZ  1  
ATOM 4790   O OH  . TYR A 1 794 ? -103.037 -71.167 6.726   1.00 0.00 ? 794 TYR A OH  1  
ATOM 4791   N N   . ASP A 1 795 ? -106.202 -73.933 10.032  1.00 0.00 ? 795 ASP A N   1  
ATOM 4792   C CA  . ASP A 1 795 ? -106.495 -74.506 8.735   1.00 0.00 ? 795 ASP A CA  1  
ATOM 4793   C C   . ASP A 1 795 ? -107.871 -75.118 8.718   1.00 0.00 ? 795 ASP A C   1  
ATOM 4794   O O   . ASP A 1 795 ? -108.555 -74.948 7.762   1.00 0.00 ? 795 ASP A O   1  
ATOM 4795   C CB  . ASP A 1 795 ? -105.483 -75.624 8.207   1.00 0.00 ? 795 ASP A CB  1  
ATOM 4796   C CG  . ASP A 1 795 ? -104.110 -74.999 8.057   1.00 0.00 ? 795 ASP A CG  1  
ATOM 4797   O OD1 . ASP A 1 795 ? -103.933 -74.100 7.193   1.00 0.00 ? 795 ASP A OD1 1  
ATOM 4798   O OD2 . ASP A 1 795 ? -103.203 -75.611 8.631   1.00 0.00 ? 795 ASP A OD2 1  
ATOM 4799   N N   . SER A 1 796 ? -108.218 -75.828 9.843   1.00 0.00 ? 796 SER A N   1  
ATOM 4800   C CA  . SER A 1 796 ? -109.448 -76.590 9.947   1.00 0.00 ? 796 SER A CA  1  
ATOM 4801   C C   . SER A 1 796 ? -110.575 -75.591 9.848   1.00 0.00 ? 796 SER A C   1  
ATOM 4802   O O   . SER A 1 796 ? -111.604 -75.694 9.156   1.00 0.00 ? 796 SER A O   1  
ATOM 4803   C CB  . SER A 1 796 ? -109.584 -77.269 11.330  1.00 0.00 ? 796 SER A CB  1  
ATOM 4804   O OG  . SER A 1 796 ? -108.683 -78.411 11.406  1.00 0.00 ? 796 SER A OG  1  
ATOM 4805   N N   . SER A 1 797 ? -110.327 -74.516 10.541  1.00 0.00 ? 797 SER A N   1  
ATOM 4806   C CA  . SER A 1 797 ? -111.271 -73.383 10.564  1.00 0.00 ? 797 SER A CA  1  
ATOM 4807   C C   . SER A 1 797 ? -111.356 -72.780 9.210   1.00 0.00 ? 797 SER A C   1  
ATOM 4808   O O   . SER A 1 797 ? -112.479 -72.429 8.760   1.00 0.00 ? 797 SER A O   1  
ATOM 4809   C CB  . SER A 1 797 ? -111.023 -72.340 11.634  1.00 0.00 ? 797 SER A CB  1  
ATOM 4810   O OG  . SER A 1 797 ? -111.069 -73.002 12.879  1.00 0.00 ? 797 SER A OG  1  
ATOM 4811   N N   . SER A 1 798 ? -110.249 -72.690 8.499   1.00 0.00 ? 798 SER A N   1  
ATOM 4812   C CA  . SER A 1 798 ? -110.212 -72.160 7.077   1.00 0.00 ? 798 SER A CA  1  
ATOM 4813   C C   . SER A 1 798 ? -111.154 -73.056 6.228   1.00 0.00 ? 798 SER A C   1  
ATOM 4814   O O   . SER A 1 798 ? -112.091 -72.567 5.614   1.00 0.00 ? 798 SER A O   1  
ATOM 4815   C CB  . SER A 1 798 ? -108.786 -72.116 6.472   1.00 0.00 ? 798 SER A CB  1  
ATOM 4816   O OG  . SER A 1 798 ? -107.869 -71.343 7.223   1.00 0.00 ? 798 SER A OG  1  
ATOM 4817   N N   . VAL A 1 799 ? -110.922 -74.316 6.272   1.00 0.00 ? 799 VAL A N   1  
ATOM 4818   C CA  . VAL A 1 799 ? -111.585 -75.391 5.661   1.00 0.00 ? 799 VAL A CA  1  
ATOM 4819   C C   . VAL A 1 799 ? -111.073 -76.595 6.292   1.00 0.00 ? 799 VAL A C   1  
ATOM 4820   O O   . VAL A 1 799 ? -109.822 -76.819 6.518   1.00 0.00 ? 799 VAL A O   1  
ATOM 4821   C CB  . VAL A 1 799 ? -111.306 -75.582 4.138   1.00 0.00 ? 799 VAL A CB  1  
ATOM 4822   C CG1 . VAL A 1 799 ? -112.483 -74.885 3.371   1.00 0.00 ? 799 VAL A CG1 1  
ATOM 4823   C CG2 . VAL A 1 799 ? -109.918 -74.896 3.764   1.00 0.00 ? 799 VAL A CG2 1  
ATOM 4824   N N   . ASP A 1 800 ? -112.023 -77.445 6.755   1.00 0.00 ? 800 ASP A N   1  
ATOM 4825   C CA  . ASP A 1 800 ? -111.834 -78.565 7.515   1.00 0.00 ? 800 ASP A CA  1  
ATOM 4826   C C   . ASP A 1 800 ? -111.205 -79.642 6.632   1.00 0.00 ? 800 ASP A C   1  
ATOM 4827   O O   . ASP A 1 800 ? -110.972 -79.357 5.427   1.00 0.00 ? 800 ASP A O   1  
ATOM 4828   C CB  . ASP A 1 800 ? -113.177 -79.065 8.197   1.00 0.00 ? 800 ASP A CB  1  
ATOM 4829   C CG  . ASP A 1 800 ? -112.907 -80.444 8.844   1.00 0.00 ? 800 ASP A CG  1  
ATOM 4830   O OD1 . ASP A 1 800 ? -112.199 -80.439 9.913   1.00 0.00 ? 800 ASP A OD1 1  
ATOM 4831   O OD2 . ASP A 1 800 ? -113.445 -81.501 8.371   1.00 0.00 ? 800 ASP A OD2 1  
ATOM 4832   N N   . PRO B 2 180 ? -35.517  -4.125  -49.211 1.00 0.00 ? 180 PRO B N   1  
ATOM 4833   C CA  . PRO B 2 180 ? -36.019  -2.878  -48.625 1.00 0.00 ? 180 PRO B CA  1  
ATOM 4834   C C   . PRO B 2 180 ? -36.461  -3.065  -47.206 1.00 0.00 ? 180 PRO B C   1  
ATOM 4835   O O   . PRO B 2 180 ? -37.234  -2.325  -46.631 1.00 0.00 ? 180 PRO B O   1  
ATOM 4836   C CB  . PRO B 2 180 ? -37.182  -2.367  -49.492 1.00 0.00 ? 180 PRO B CB  1  
ATOM 4837   C CG  . PRO B 2 180 ? -36.824  -2.991  -50.851 1.00 0.00 ? 180 PRO B CG  1  
ATOM 4838   C CD  . PRO B 2 180 ? -36.238  -4.361  -50.517 1.00 0.00 ? 180 PRO B CD  1  
ATOM 4839   N N   . GLU B 2 181 ? -35.973  -4.135  -46.524 1.00 0.00 ? 181 GLU B N   1  
ATOM 4840   C CA  . GLU B 2 181 ? -36.467  -4.597  -45.266 1.00 0.00 ? 181 GLU B CA  1  
ATOM 4841   C C   . GLU B 2 181 ? -36.293  -3.600  -44.116 1.00 0.00 ? 181 GLU B C   1  
ATOM 4842   O O   . GLU B 2 181 ? -37.119  -3.477  -43.222 1.00 0.00 ? 181 GLU B O   1  
ATOM 4843   C CB  . GLU B 2 181 ? -35.835  -5.997  -44.867 1.00 0.00 ? 181 GLU B CB  1  
ATOM 4844   C CG  . GLU B 2 181 ? -36.643  -6.803  -43.842 1.00 0.00 ? 181 GLU B CG  1  
ATOM 4845   C CD  . GLU B 2 181 ? -36.407  -6.416  -42.406 1.00 0.00 ? 181 GLU B CD  1  
ATOM 4846   O OE1 . GLU B 2 181 ? -35.217  -6.387  -41.991 1.00 0.00 ? 181 GLU B OE1 1  
ATOM 4847   O OE2 . GLU B 2 181 ? -37.343  -6.068  -41.655 1.00 0.00 ? 181 GLU B OE2 1  
ATOM 4848   N N   . GLU B 2 182 ? -35.197  -2.907  -44.034 1.00 0.00 ? 182 GLU B N   1  
ATOM 4849   C CA  . GLU B 2 182 ? -34.934  -2.037  -42.903 1.00 0.00 ? 182 GLU B CA  1  
ATOM 4850   C C   . GLU B 2 182 ? -35.959  -0.941  -42.912 1.00 0.00 ? 182 GLU B C   1  
ATOM 4851   O O   . GLU B 2 182 ? -36.509  -0.719  -41.813 1.00 0.00 ? 182 GLU B O   1  
ATOM 4852   C CB  . GLU B 2 182 ? -33.562  -1.389  -43.012 1.00 0.00 ? 182 GLU B CB  1  
ATOM 4853   C CG  . GLU B 2 182 ? -32.858  -1.583  -44.308 1.00 0.00 ? 182 GLU B CG  1  
ATOM 4854   C CD  . GLU B 2 182 ? -33.462  -0.618  -45.369 1.00 0.00 ? 182 GLU B CD  1  
ATOM 4855   O OE1 . GLU B 2 182 ? -33.511  0.625   -45.129 1.00 0.00 ? 182 GLU B OE1 1  
ATOM 4856   O OE2 . GLU B 2 182 ? -33.940  -1.202  -46.365 1.00 0.00 ? 182 GLU B OE2 1  
ATOM 4857   N N   . ASP B 2 183 ? -36.243  -0.354  -44.136 1.00 0.00 ? 183 ASP B N   1  
ATOM 4858   C CA  . ASP B 2 183 ? -37.234  0.755   -44.304 1.00 0.00 ? 183 ASP B CA  1  
ATOM 4859   C C   . ASP B 2 183 ? -38.591  0.291   -43.967 1.00 0.00 ? 183 ASP B C   1  
ATOM 4860   O O   . ASP B 2 183 ? -39.272  0.991   -43.231 1.00 0.00 ? 183 ASP B O   1  
ATOM 4861   C CB  . ASP B 2 183 ? -37.238  1.508   -45.667 1.00 0.00 ? 183 ASP B CB  1  
ATOM 4862   C CG  . ASP B 2 183 ? -37.420  0.695   -46.909 1.00 0.00 ? 183 ASP B CG  1  
ATOM 4863   O OD1 . ASP B 2 183 ? -38.630  0.472   -47.145 1.00 0.00 ? 183 ASP B OD1 1  
ATOM 4864   O OD2 . ASP B 2 183 ? -36.546  0.260   -47.659 1.00 0.00 ? 183 ASP B OD2 1  
ATOM 4865   N N   . ILE B 2 184 ? -38.860  -0.970  -44.403 1.00 0.00 ? 184 ILE B N   1  
ATOM 4866   C CA  . ILE B 2 184 ? -40.144  -1.601  -44.149 1.00 0.00 ? 184 ILE B CA  1  
ATOM 4867   C C   . ILE B 2 184 ? -40.207  -1.761  -42.652 1.00 0.00 ? 184 ILE B C   1  
ATOM 4868   O O   . ILE B 2 184 ? -41.273  -1.582  -42.076 1.00 0.00 ? 184 ILE B O   1  
ATOM 4869   C CB  . ILE B 2 184 ? -40.374  -2.930  -44.873 1.00 0.00 ? 184 ILE B CB  1  
ATOM 4870   C CG1 . ILE B 2 184 ? -40.450  -2.737  -46.421 1.00 0.00 ? 184 ILE B CG1 1  
ATOM 4871   C CG2 . ILE B 2 184 ? -41.630  -3.523  -44.398 1.00 0.00 ? 184 ILE B CG2 1  
ATOM 4872   C CD1 . ILE B 2 184 ? -40.680  -4.040  -47.206 1.00 0.00 ? 184 ILE B CD1 1  
ATOM 4873   N N   . LEU B 2 185 ? -39.138  -2.145  -41.910 1.00 0.00 ? 185 LEU B N   1  
ATOM 4874   C CA  . LEU B 2 185 ? -39.164  -2.389  -40.457 1.00 0.00 ? 185 LEU B CA  1  
ATOM 4875   C C   . LEU B 2 185 ? -39.455  -1.152  -39.765 1.00 0.00 ? 185 LEU B C   1  
ATOM 4876   O O   . LEU B 2 185 ? -40.232  -1.262  -38.852 1.00 0.00 ? 185 LEU B O   1  
ATOM 4877   C CB  . LEU B 2 185 ? -37.838  -3.006  -39.986 1.00 0.00 ? 185 LEU B CB  1  
ATOM 4878   C CG  . LEU B 2 185 ? -37.888  -3.499  -38.485 1.00 0.00 ? 185 LEU B CG  1  
ATOM 4879   C CD1 . LEU B 2 185 ? -38.888  -4.608  -38.226 1.00 0.00 ? 185 LEU B CD1 1  
ATOM 4880   C CD2 . LEU B 2 185 ? -36.516  -3.952  -37.985 1.00 0.00 ? 185 LEU B CD2 1  
ATOM 4881   N N   . LYS B 2 186 ? -38.941  0.030   -40.053 1.00 0.00 ? 186 LYS B N   1  
ATOM 4882   C CA  . LYS B 2 186 ? -39.259  1.251   -39.339 1.00 0.00 ? 186 LYS B CA  1  
ATOM 4883   C C   . LYS B 2 186 ? -40.706  1.564   -39.536 1.00 0.00 ? 186 LYS B C   1  
ATOM 4884   O O   . LYS B 2 186 ? -41.357  1.916   -38.540 1.00 0.00 ? 186 LYS B O   1  
ATOM 4885   C CB  . LYS B 2 186 ? -38.276  2.427   -39.636 1.00 0.00 ? 186 LYS B CB  1  
ATOM 4886   C CG  . LYS B 2 186 ? -38.161  2.885   -41.117 1.00 0.00 ? 186 LYS B CG  1  
ATOM 4887   C CD  . LYS B 2 186 ? -37.194  4.020   -41.465 1.00 0.00 ? 186 LYS B CD  1  
ATOM 4888   C CE  . LYS B 2 186 ? -35.787  3.692   -40.837 1.00 0.00 ? 186 LYS B CE  1  
ATOM 4889   N NZ  . LYS B 2 186 ? -35.280  2.363   -41.311 1.00 0.00 ? 186 LYS B NZ  1  
ATOM 4890   N N   . TYR B 2 187 ? -41.288  1.379   -40.695 1.00 0.00 ? 187 TYR B N   1  
ATOM 4891   C CA  . TYR B 2 187 ? -42.701  1.666   -41.007 1.00 0.00 ? 187 TYR B CA  1  
ATOM 4892   C C   . TYR B 2 187 ? -43.589  0.790   -40.143 1.00 0.00 ? 187 TYR B C   1  
ATOM 4893   O O   . TYR B 2 187 ? -44.572  1.260   -39.550 1.00 0.00 ? 187 TYR B O   1  
ATOM 4894   C CB  . TYR B 2 187 ? -42.994  1.369   -42.526 1.00 0.00 ? 187 TYR B CB  1  
ATOM 4895   C CG  . TYR B 2 187 ? -42.227  2.296   -43.422 1.00 0.00 ? 187 TYR B CG  1  
ATOM 4896   C CD1 . TYR B 2 187 ? -42.070  3.698   -43.095 1.00 0.00 ? 187 TYR B CD1 1  
ATOM 4897   C CD2 . TYR B 2 187 ? -41.707  1.838   -44.665 1.00 0.00 ? 187 TYR B CD2 1  
ATOM 4898   C CE1 . TYR B 2 187 ? -41.430  4.540   -44.006 1.00 0.00 ? 187 TYR B CE1 1  
ATOM 4899   C CE2 . TYR B 2 187 ? -41.108  2.770   -45.565 1.00 0.00 ? 187 TYR B CE2 1  
ATOM 4900   C CZ  . TYR B 2 187 ? -40.979  4.131   -45.257 1.00 0.00 ? 187 TYR B CZ  1  
ATOM 4901   O OH  . TYR B 2 187 ? -40.473  5.160   -46.117 1.00 0.00 ? 187 TYR B OH  1  
ATOM 4902   N N   . VAL B 2 188 ? -43.214  -0.570  -40.060 1.00 0.00 ? 188 VAL B N   1  
ATOM 4903   C CA  . VAL B 2 188 ? -43.856  -1.618  -39.366 1.00 0.00 ? 188 VAL B CA  1  
ATOM 4904   C C   . VAL B 2 188 ? -43.801  -1.262  -37.878 1.00 0.00 ? 188 VAL B C   1  
ATOM 4905   O O   . VAL B 2 188 ? -44.756  -1.575  -37.183 1.00 0.00 ? 188 VAL B O   1  
ATOM 4906   C CB  . VAL B 2 188 ? -43.394  -2.997  -39.708 1.00 0.00 ? 188 VAL B CB  1  
ATOM 4907   C CG1 . VAL B 2 188 ? -44.020  -4.029  -38.820 1.00 0.00 ? 188 VAL B CG1 1  
ATOM 4908   C CG2 . VAL B 2 188 ? -43.886  -3.374  -41.081 1.00 0.00 ? 188 VAL B CG2 1  
ATOM 4909   N N   . SER B 2 189 ? -42.727  -0.770  -37.338 1.00 0.00 ? 189 SER B N   1  
ATOM 4910   C CA  . SER B 2 189 ? -42.533  -0.536  -35.922 1.00 0.00 ? 189 SER B CA  1  
ATOM 4911   C C   . SER B 2 189 ? -43.487  0.490   -35.489 1.00 0.00 ? 189 SER B C   1  
ATOM 4912   O O   . SER B 2 189 ? -44.192  0.334   -34.488 1.00 0.00 ? 189 SER B O   1  
ATOM 4913   C CB  . SER B 2 189 ? -41.100  -0.094  -35.515 1.00 0.00 ? 189 SER B CB  1  
ATOM 4914   O OG  . SER B 2 189 ? -40.715  1.207   -35.969 1.00 0.00 ? 189 SER B OG  1  
ATOM 4915   N N   . TYR B 2 190 ? -43.617  1.497   -36.298 1.00 0.00 ? 190 TYR B N   1  
ATOM 4916   C CA  . TYR B 2 190 ? -44.567  2.531   -36.101 1.00 0.00 ? 190 TYR B CA  1  
ATOM 4917   C C   . TYR B 2 190 ? -45.995  1.978   -36.212 1.00 0.00 ? 190 TYR B C   1  
ATOM 4918   O O   . TYR B 2 190 ? -46.916  2.347   -35.492 1.00 0.00 ? 190 TYR B O   1  
ATOM 4919   C CB  . TYR B 2 190 ? -44.382  3.676   -37.007 1.00 0.00 ? 190 TYR B CB  1  
ATOM 4920   C CG  . TYR B 2 190 ? -42.968  4.208   -37.002 1.00 0.00 ? 190 TYR B CG  1  
ATOM 4921   C CD1 . TYR B 2 190 ? -42.212  4.375   -35.848 1.00 0.00 ? 190 TYR B CD1 1  
ATOM 4922   C CD2 . TYR B 2 190 ? -42.430  4.560   -38.267 1.00 0.00 ? 190 TYR B CD2 1  
ATOM 4923   C CE1 . TYR B 2 190 ? -40.904  4.884   -35.963 1.00 0.00 ? 190 TYR B CE1 1  
ATOM 4924   C CE2 . TYR B 2 190 ? -41.187  5.210   -38.379 1.00 0.00 ? 190 TYR B CE2 1  
ATOM 4925   C CZ  . TYR B 2 190 ? -40.410  5.265   -37.234 1.00 0.00 ? 190 TYR B CZ  1  
ATOM 4926   O OH  . TYR B 2 190 ? -39.050  5.778   -37.230 1.00 0.00 ? 190 TYR B OH  1  
ATOM 4927   N N   . THR B 2 191 ? -46.168  1.024   -37.141 1.00 0.00 ? 191 THR B N   1  
ATOM 4928   C CA  . THR B 2 191 ? -47.488  0.431   -37.310 1.00 0.00 ? 191 THR B CA  1  
ATOM 4929   C C   . THR B 2 191 ? -48.022  -0.323  -36.112 1.00 0.00 ? 191 THR B C   1  
ATOM 4930   O O   . THR B 2 191 ? -49.217  -0.138  -35.847 1.00 0.00 ? 191 THR B O   1  
ATOM 4931   C CB  . THR B 2 191 ? -47.487  -0.237  -38.669 1.00 0.00 ? 191 THR B CB  1  
ATOM 4932   O OG1 . THR B 2 191 ? -47.332  0.813   -39.613 1.00 0.00 ? 191 THR B OG1 1  
ATOM 4933   C CG2 . THR B 2 191 ? -48.849  -0.970  -38.975 1.00 0.00 ? 191 THR B CG2 1  
ATOM 4934   N N   . LEU B 2 192 ? -47.180  -1.070  -35.435 1.00 0.00 ? 192 LEU B N   1  
ATOM 4935   C CA  . LEU B 2 192 ? -47.591  -1.767  -34.238 1.00 0.00 ? 192 LEU B CA  1  
ATOM 4936   C C   . LEU B 2 192 ? -48.006  -0.883  -33.133 1.00 0.00 ? 192 LEU B C   1  
ATOM 4937   O O   . LEU B 2 192 ? -48.827  -1.305  -32.282 1.00 0.00 ? 192 LEU B O   1  
ATOM 4938   C CB  . LEU B 2 192 ? -46.461  -2.741  -33.733 1.00 0.00 ? 192 LEU B CB  1  
ATOM 4939   C CG  . LEU B 2 192 ? -45.912  -3.807  -34.739 1.00 0.00 ? 192 LEU B CG  1  
ATOM 4940   C CD1 . LEU B 2 192 ? -44.548  -4.444  -34.289 1.00 0.00 ? 192 LEU B CD1 1  
ATOM 4941   C CD2 . LEU B 2 192 ? -46.965  -4.803  -35.150 1.00 0.00 ? 192 LEU B CD2 1  
ATOM 4942   N N   . LEU B 2 193 ? -47.462  0.349   -33.081 1.00 0.00 ? 193 LEU B N   1  
ATOM 4943   C CA  . LEU B 2 193 ? -47.911  1.360   -32.146 1.00 0.00 ? 193 LEU B CA  1  
ATOM 4944   C C   . LEU B 2 193 ? -49.292  1.966   -32.577 1.00 0.00 ? 193 LEU B C   1  
ATOM 4945   O O   . LEU B 2 193 ? -49.841  2.711   -31.786 1.00 0.00 ? 193 LEU B O   1  
ATOM 4946   C CB  . LEU B 2 193 ? -46.963  2.552   -31.770 1.00 0.00 ? 193 LEU B CB  1  
ATOM 4947   C CG  . LEU B 2 193 ? -45.751  2.160   -30.931 1.00 0.00 ? 193 LEU B CG  1  
ATOM 4948   C CD1 . LEU B 2 193 ? -46.103  1.342   -29.631 1.00 0.00 ? 193 LEU B CD1 1  
ATOM 4949   C CD2 . LEU B 2 193 ? -44.602  1.616   -31.833 1.00 0.00 ? 193 LEU B CD2 1  
ATOM 4950   N N   . ALA B 2 194 ? -49.845  1.620   -33.774 1.00 0.00 ? 194 ALA B N   1  
ATOM 4951   C CA  . ALA B 2 194 ? -51.115  2.073   -34.283 1.00 0.00 ? 194 ALA B CA  1  
ATOM 4952   C C   . ALA B 2 194 ? -51.018  3.377   -35.096 1.00 0.00 ? 194 ALA B C   1  
ATOM 4953   O O   . ALA B 2 194 ? -52.053  4.063   -35.140 1.00 0.00 ? 194 ALA B O   1  
ATOM 4954   C CB  . ALA B 2 194 ? -52.315  1.950   -33.352 1.00 0.00 ? 194 ALA B CB  1  
ATOM 4955   N N   . THR B 2 195 ? -49.810  3.647   -35.754 1.00 0.00 ? 195 THR B N   1  
ATOM 4956   C CA  . THR B 2 195 ? -49.711  4.752   -36.607 1.00 0.00 ? 195 THR B CA  1  
ATOM 4957   C C   . THR B 2 195 ? -49.173  4.256   -37.930 1.00 0.00 ? 195 THR B C   1  
ATOM 4958   O O   . THR B 2 195 ? -48.182  3.556   -38.003 1.00 0.00 ? 195 THR B O   1  
ATOM 4959   C CB  . THR B 2 195 ? -48.770  5.834   -36.065 1.00 0.00 ? 195 THR B CB  1  
ATOM 4960   O OG1 . THR B 2 195 ? -47.411  5.325   -36.090 1.00 0.00 ? 195 THR B OG1 1  
ATOM 4961   C CG2 . THR B 2 195 ? -49.231  6.112   -34.605 1.00 0.00 ? 195 THR B CG2 1  
ATOM 4962   N N   . THR B 2 196 ? -50.013  4.447   -38.961 1.00 0.00 ? 196 THR B N   1  
ATOM 4963   C CA  . THR B 2 196 ? -49.880  3.898   -40.316 1.00 0.00 ? 196 THR B CA  1  
ATOM 4964   C C   . THR B 2 196 ? -48.690  4.608   -40.930 1.00 0.00 ? 196 THR B C   1  
ATOM 4965   O O   . THR B 2 196 ? -48.123  5.567   -40.362 1.00 0.00 ? 196 THR B O   1  
ATOM 4966   C CB  . THR B 2 196 ? -51.161  4.142   -41.121 1.00 0.00 ? 196 THR B CB  1  
ATOM 4967   O OG1 . THR B 2 196 ? -51.197  3.342   -42.320 1.00 0.00 ? 196 THR B OG1 1  
ATOM 4968   C CG2 . THR B 2 196 ? -51.327  5.623   -41.500 1.00 0.00 ? 196 THR B CG2 1  
ATOM 4969   N N   . SER B 2 197 ? -48.278  4.082   -42.094 1.00 0.00 ? 197 SER B N   1  
ATOM 4970   C CA  . SER B 2 197 ? -47.104  4.552   -42.882 1.00 0.00 ? 197 SER B CA  1  
ATOM 4971   C C   . SER B 2 197 ? -47.562  4.802   -44.198 1.00 0.00 ? 197 SER B C   1  
ATOM 4972   O O   . SER B 2 197 ? -48.700  4.523   -44.585 1.00 0.00 ? 197 SER B O   1  
ATOM 4973   C CB  . SER B 2 197 ? -45.932  3.544   -42.802 1.00 0.00 ? 197 SER B CB  1  
ATOM 4974   O OG  . SER B 2 197 ? -45.838  3.240   -41.448 1.00 0.00 ? 197 SER B OG  1  
ATOM 4975   N N   . ALA B 2 198 ? -46.681  5.407   -44.964 1.00 0.00 ? 198 ALA B N   1  
ATOM 4976   C CA  . ALA B 2 198 ? -46.976  5.809   -46.308 1.00 0.00 ? 198 ALA B CA  1  
ATOM 4977   C C   . ALA B 2 198 ? -47.178  4.711   -47.331 1.00 0.00 ? 198 ALA B C   1  
ATOM 4978   O O   . ALA B 2 198 ? -47.746  4.992   -48.426 1.00 0.00 ? 198 ALA B O   1  
ATOM 4979   C CB  . ALA B 2 198 ? -45.899  6.767   -46.834 1.00 0.00 ? 198 ALA B CB  1  
ATOM 4980   N N   . LEU B 2 199 ? -46.806  3.505   -46.982 1.00 0.00 ? 199 LEU B N   1  
ATOM 4981   C CA  . LEU B 2 199 ? -47.013  2.388   -47.804 1.00 0.00 ? 199 LEU B CA  1  
ATOM 4982   C C   . LEU B 2 199 ? -48.137  1.406   -47.311 1.00 0.00 ? 199 LEU B C   1  
ATOM 4983   O O   . LEU B 2 199 ? -48.411  0.373   -47.837 1.00 0.00 ? 199 LEU B O   1  
ATOM 4984   C CB  . LEU B 2 199 ? -45.735  1.528   -47.794 1.00 0.00 ? 199 LEU B CB  1  
ATOM 4985   C CG  . LEU B 2 199 ? -44.476  2.233   -48.452 1.00 0.00 ? 199 LEU B CG  1  
ATOM 4986   C CD1 . LEU B 2 199 ? -43.149  1.626   -48.073 1.00 0.00 ? 199 LEU B CD1 1  
ATOM 4987   C CD2 . LEU B 2 199 ? -44.399  2.500   -49.963 1.00 0.00 ? 199 LEU B CD2 1  
ATOM 4988   N N   . PHE B 2 200 ? -48.766  1.729   -46.120 1.00 0.00 ? 200 PHE B N   1  
ATOM 4989   C CA  . PHE B 2 200 ? -49.845  0.890   -45.578 1.00 0.00 ? 200 PHE B CA  1  
ATOM 4990   C C   . PHE B 2 200 ? -51.189  1.743   -45.629 1.00 0.00 ? 200 PHE B C   1  
ATOM 4991   O O   . PHE B 2 200 ? -51.109  2.849   -45.121 1.00 0.00 ? 200 PHE B O   1  
ATOM 4992   C CB  . PHE B 2 200 ? -49.581  0.427   -44.137 1.00 0.00 ? 200 PHE B CB  1  
ATOM 4993   C CG  . PHE B 2 200 ? -48.195  -0.081  -43.980 1.00 0.00 ? 200 PHE B CG  1  
ATOM 4994   C CD1 . PHE B 2 200 ? -47.651  -1.009  -44.919 1.00 0.00 ? 200 PHE B CD1 1  
ATOM 4995   C CD2 . PHE B 2 200 ? -47.413  0.311   -42.887 1.00 0.00 ? 200 PHE B CD2 1  
ATOM 4996   C CE1 . PHE B 2 200 ? -46.283  -1.302  -44.837 1.00 0.00 ? 200 PHE B CE1 1  
ATOM 4997   C CE2 . PHE B 2 200 ? -46.067  -0.099  -42.673 1.00 0.00 ? 200 PHE B CE2 1  
ATOM 4998   C CZ  . PHE B 2 200 ? -45.470  -0.775  -43.806 1.00 0.00 ? 200 PHE B CZ  1  
ATOM 4999   N N   . PRO B 2 201 ? -52.268  1.104   -46.078 1.00 0.00 ? 201 PRO B N   1  
ATOM 5000   C CA  . PRO B 2 201 ? -53.572  1.827   -46.051 1.00 0.00 ? 201 PRO B CA  1  
ATOM 5001   C C   . PRO B 2 201 ? -54.229  1.262   -44.900 1.00 0.00 ? 201 PRO B C   1  
ATOM 5002   O O   . PRO B 2 201 ? -55.130  0.458   -44.976 1.00 0.00 ? 201 PRO B O   1  
ATOM 5003   C CB  . PRO B 2 201 ? -54.264  1.519   -47.400 1.00 0.00 ? 201 PRO B CB  1  
ATOM 5004   C CG  . PRO B 2 201 ? -53.622  0.239   -47.884 1.00 0.00 ? 201 PRO B CG  1  
ATOM 5005   C CD  . PRO B 2 201 ? -52.201  0.304   -47.368 1.00 0.00 ? 201 PRO B CD  1  
ATOM 5006   N N   . PHE B 2 202 ? -53.854  1.771   -43.742 1.00 0.00 ? 202 PHE B N   1  
ATOM 5007   C CA  . PHE B 2 202 ? -54.472  1.375   -42.490 1.00 0.00 ? 202 PHE B CA  1  
ATOM 5008   C C   . PHE B 2 202 ? -55.091  2.642   -42.118 1.00 0.00 ? 202 PHE B C   1  
ATOM 5009   O O   . PHE B 2 202 ? -54.533  3.686   -42.472 1.00 0.00 ? 202 PHE B O   1  
ATOM 5010   C CB  . PHE B 2 202 ? -53.382  1.016   -41.448 1.00 0.00 ? 202 PHE B CB  1  
ATOM 5011   C CG  . PHE B 2 202 ? -53.976  0.508   -40.185 1.00 0.00 ? 202 PHE B CG  1  
ATOM 5012   C CD1 . PHE B 2 202 ? -54.273  1.392   -39.155 1.00 0.00 ? 202 PHE B CD1 1  
ATOM 5013   C CD2 . PHE B 2 202 ? -54.005  -0.843  -39.918 1.00 0.00 ? 202 PHE B CD2 1  
ATOM 5014   C CE1 . PHE B 2 202 ? -54.784  0.949   -37.974 1.00 0.00 ? 202 PHE B CE1 1  
ATOM 5015   C CE2 . PHE B 2 202 ? -54.406  -1.316  -38.616 1.00 0.00 ? 202 PHE B CE2 1  
ATOM 5016   C CZ  . PHE B 2 202 ? -54.837  -0.425  -37.704 1.00 0.00 ? 202 PHE B CZ  1  
ATOM 5017   N N   . ASP B 2 203 ? -56.304  2.624   -41.671 1.00 0.00 ? 203 ASP B N   1  
ATOM 5018   C CA  . ASP B 2 203 ? -57.102  3.773   -41.472 1.00 0.00 ? 203 ASP B CA  1  
ATOM 5019   C C   . ASP B 2 203 ? -57.830  3.602   -40.201 1.00 0.00 ? 203 ASP B C   1  
ATOM 5020   O O   . ASP B 2 203 ? -57.202  3.497   -39.160 1.00 0.00 ? 203 ASP B O   1  
ATOM 5021   C CB  . ASP B 2 203 ? -58.177  3.811   -42.591 1.00 0.00 ? 203 ASP B CB  1  
ATOM 5022   C CG  . ASP B 2 203 ? -57.443  4.262   -43.865 1.00 0.00 ? 203 ASP B CG  1  
ATOM 5023   O OD1 . ASP B 2 203 ? -57.098  5.454   -44.019 1.00 0.00 ? 203 ASP B OD1 1  
ATOM 5024   O OD2 . ASP B 2 203 ? -57.177  3.332   -44.698 1.00 0.00 ? 203 ASP B OD2 1  
ATOM 5025   N N   . HIS B 2 204 ? -59.169  3.459   -40.262 1.00 0.00 ? 204 HIS B N   1  
ATOM 5026   C CA  . HIS B 2 204 ? -60.004  3.088   -39.171 1.00 0.00 ? 204 HIS B CA  1  
ATOM 5027   C C   . HIS B 2 204 ? -60.185  1.626   -39.440 1.00 0.00 ? 204 HIS B C   1  
ATOM 5028   O O   . HIS B 2 204 ? -61.154  1.040   -38.987 1.00 0.00 ? 204 HIS B O   1  
ATOM 5029   C CB  . HIS B 2 204 ? -61.277  3.742   -39.141 1.00 0.00 ? 204 HIS B CB  1  
ATOM 5030   C CG  . HIS B 2 204 ? -62.279  3.268   -38.057 1.00 0.00 ? 204 HIS B CG  1  
ATOM 5031   N ND1 . HIS B 2 204 ? -61.836  2.861   -36.800 1.00 0.00 ? 204 HIS B ND1 1  
ATOM 5032   C CD2 . HIS B 2 204 ? -63.539  2.832   -38.175 1.00 0.00 ? 204 HIS B CD2 1  
ATOM 5033   C CE1 . HIS B 2 204 ? -62.864  2.168   -36.270 1.00 0.00 ? 204 HIS B CE1 1  
ATOM 5034   N NE2 . HIS B 2 204 ? -63.886  2.125   -37.040 1.00 0.00 ? 204 HIS B NE2 1  
ATOM 5035   N N   . GLU B 2 205 ? -59.294  0.982   -40.230 1.00 0.00 ? 205 GLU B N   1  
ATOM 5036   C CA  . GLU B 2 205 ? -59.361  -0.357  -40.658 1.00 0.00 ? 205 GLU B CA  1  
ATOM 5037   C C   . GLU B 2 205 ? -57.942  -0.819  -40.844 1.00 0.00 ? 205 GLU B C   1  
ATOM 5038   O O   . GLU B 2 205 ? -57.032  -0.002  -40.794 1.00 0.00 ? 205 GLU B O   1  
ATOM 5039   C CB  . GLU B 2 205 ? -60.029  -0.466  -42.046 1.00 0.00 ? 205 GLU B CB  1  
ATOM 5040   C CG  . GLU B 2 205 ? -61.525  -0.032  -42.186 1.00 0.00 ? 205 GLU B CG  1  
ATOM 5041   C CD  . GLU B 2 205 ? -61.749  1.524   -42.196 1.00 0.00 ? 205 GLU B CD  1  
ATOM 5042   O OE1 . GLU B 2 205 ? -60.985  2.231   -42.976 1.00 0.00 ? 205 GLU B OE1 1  
ATOM 5043   O OE2 . GLU B 2 205 ? -62.681  2.034   -41.522 1.00 0.00 ? 205 GLU B OE2 1  
ATOM 5044   N N   . GLN B 2 206 ? -57.766  -2.106  -41.137 1.00 0.00 ? 206 GLN B N   1  
ATOM 5045   C CA  . GLN B 2 206 ? -56.562  -2.832  -41.387 1.00 0.00 ? 206 GLN B CA  1  
ATOM 5046   C C   . GLN B 2 206 ? -55.816  -2.270  -42.581 1.00 0.00 ? 206 GLN B C   1  
ATOM 5047   O O   . GLN B 2 206 ? -56.326  -1.361  -43.259 1.00 0.00 ? 206 GLN B O   1  
ATOM 5048   C CB  . GLN B 2 206 ? -56.872  -4.230  -41.626 1.00 0.00 ? 206 GLN B CB  1  
ATOM 5049   C CG  . GLN B 2 206 ? -57.778  -4.546  -42.857 1.00 0.00 ? 206 GLN B CG  1  
ATOM 5050   C CD  . GLN B 2 206 ? -57.958  -6.108  -42.957 1.00 0.00 ? 206 GLN B CD  1  
ATOM 5051   O OE1 . GLN B 2 206 ? -57.776  -6.773  -41.978 1.00 0.00 ? 206 GLN B OE1 1  
ATOM 5052   N NE2 . GLN B 2 206 ? -58.099  -6.570  -44.184 1.00 0.00 ? 206 GLN B NE2 1  
ATOM 5053   N N   . ILE B 2 207 ? -54.722  -2.973  -42.948 1.00 0.00 ? 207 ILE B N   1  
ATOM 5054   C CA  . ILE B 2 207 ? -54.090  -2.770  -44.197 1.00 0.00 ? 207 ILE B CA  1  
ATOM 5055   C C   . ILE B 2 207 ? -55.010  -3.314  -45.243 1.00 0.00 ? 207 ILE B C   1  
ATOM 5056   O O   . ILE B 2 207 ? -55.191  -4.517  -45.431 1.00 0.00 ? 207 ILE B O   1  
ATOM 5057   C CB  . ILE B 2 207 ? -52.697  -3.382  -44.262 1.00 0.00 ? 207 ILE B CB  1  
ATOM 5058   C CG1 . ILE B 2 207 ? -51.900  -3.017  -42.965 1.00 0.00 ? 207 ILE B CG1 1  
ATOM 5059   C CG2 . ILE B 2 207 ? -51.994  -2.875  -45.515 1.00 0.00 ? 207 ILE B CG2 1  
ATOM 5060   C CD1 . ILE B 2 207 ? -50.472  -3.587  -42.924 1.00 0.00 ? 207 ILE B CD1 1  
ATOM 5061   N N   . GLN B 2 208 ? -55.746  -2.469  -46.055 1.00 0.00 ? 208 GLN B N   1  
ATOM 5062   C CA  . GLN B 2 208 ? -56.735  -2.827  -47.022 1.00 0.00 ? 208 GLN B CA  1  
ATOM 5063   C C   . GLN B 2 208 ? -56.095  -3.544  -48.191 1.00 0.00 ? 208 GLN B C   1  
ATOM 5064   O O   . GLN B 2 208 ? -56.522  -4.633  -48.542 1.00 0.00 ? 208 GLN B O   1  
ATOM 5065   C CB  . GLN B 2 208 ? -57.477  -1.577  -47.515 1.00 0.00 ? 208 GLN B CB  1  
ATOM 5066   C CG  . GLN B 2 208 ? -58.143  -0.804  -46.403 1.00 0.00 ? 208 GLN B CG  1  
ATOM 5067   C CD  . GLN B 2 208 ? -59.087  -1.811  -45.747 1.00 0.00 ? 208 GLN B CD  1  
ATOM 5068   O OE1 . GLN B 2 208 ? -58.915  -2.214  -44.619 1.00 0.00 ? 208 GLN B OE1 1  
ATOM 5069   N NE2 . GLN B 2 208 ? -60.199  -2.064  -46.511 1.00 0.00 ? 208 GLN B NE2 1  
ATOM 5070   N N   . ILE B 2 209 ? -54.986  -3.010  -48.618 1.00 0.00 ? 209 ILE B N   1  
ATOM 5071   C CA  . ILE B 2 209 ? -54.068  -3.790  -49.486 1.00 0.00 ? 209 ILE B CA  1  
ATOM 5072   C C   . ILE B 2 209 ? -52.644  -3.413  -49.200 1.00 0.00 ? 209 ILE B C   1  
ATOM 5073   O O   . ILE B 2 209 ? -52.458  -2.296  -48.756 1.00 0.00 ? 209 ILE B O   1  
ATOM 5074   C CB  . ILE B 2 209 ? -54.462  -3.553  -50.934 1.00 0.00 ? 209 ILE B CB  1  
ATOM 5075   C CG1 . ILE B 2 209 ? -54.834  -2.149  -51.347 1.00 0.00 ? 209 ILE B CG1 1  
ATOM 5076   C CG2 . ILE B 2 209 ? -55.589  -4.543  -51.378 1.00 0.00 ? 209 ILE B CG2 1  
ATOM 5077   C CD1 . ILE B 2 209 ? -55.217  -2.012  -52.830 1.00 0.00 ? 209 ILE B CD1 1  
ATOM 5078   N N   . PRO B 2 210 ? -51.608  -4.204  -49.426 1.00 0.00 ? 210 PRO B N   1  
ATOM 5079   C CA  . PRO B 2 210 ? -50.184  -3.752  -49.382 1.00 0.00 ? 210 PRO B CA  1  
ATOM 5080   C C   . PRO B 2 210 ? -49.793  -3.120  -50.652 1.00 0.00 ? 210 PRO B C   1  
ATOM 5081   O O   . PRO B 2 210 ? -50.320  -3.510  -51.694 1.00 0.00 ? 210 PRO B O   1  
ATOM 5082   C CB  . PRO B 2 210 ? -49.536  -5.139  -49.262 1.00 0.00 ? 210 PRO B CB  1  
ATOM 5083   C CG  . PRO B 2 210 ? -50.281  -6.117  -50.176 1.00 0.00 ? 210 PRO B CG  1  
ATOM 5084   C CD  . PRO B 2 210 ? -51.709  -5.562  -50.027 1.00 0.00 ? 210 PRO B CD  1  
ATOM 5085   N N   . SER B 2 211 ? -49.026  -2.004  -50.600 1.00 0.00 ? 211 SER B N   1  
ATOM 5086   C CA  . SER B 2 211 ? -48.761  -1.209  -51.778 1.00 0.00 ? 211 SER B CA  1  
ATOM 5087   C C   . SER B 2 211 ? -47.843  -1.962  -52.771 1.00 0.00 ? 211 SER B C   1  
ATOM 5088   O O   . SER B 2 211 ? -48.047  -1.861  -54.036 1.00 0.00 ? 211 SER B O   1  
ATOM 5089   C CB  . SER B 2 211 ? -48.093  0.058   -51.297 1.00 0.00 ? 211 SER B CB  1  
ATOM 5090   O OG  . SER B 2 211 ? -49.024  0.901   -50.596 1.00 0.00 ? 211 SER B OG  1  
ATOM 5091   N N   . LYS B 2 212 ? -46.908  -2.819  -52.239 1.00 0.00 ? 212 LYS B N   1  
ATOM 5092   C CA  . LYS B 2 212 ? -46.194  -3.831  -52.966 1.00 0.00 ? 212 LYS B CA  1  
ATOM 5093   C C   . LYS B 2 212 ? -46.970  -5.060  -52.786 1.00 0.00 ? 212 LYS B C   1  
ATOM 5094   O O   . LYS B 2 212 ? -47.343  -5.304  -51.687 1.00 0.00 ? 212 LYS B O   1  
ATOM 5095   C CB  . LYS B 2 212 ? -44.752  -3.906  -52.484 1.00 0.00 ? 212 LYS B CB  1  
ATOM 5096   C CG  . LYS B 2 212 ? -43.685  -4.474  -53.456 1.00 0.00 ? 212 LYS B CG  1  
ATOM 5097   C CD  . LYS B 2 212 ? -42.378  -3.759  -53.255 1.00 0.00 ? 212 LYS B CD  1  
ATOM 5098   C CE  . LYS B 2 212 ? -41.225  -4.373  -54.049 1.00 0.00 ? 212 LYS B CE  1  
ATOM 5099   N NZ  . LYS B 2 212 ? -39.934  -3.579  -53.870 1.00 0.00 ? 212 LYS B NZ  1  
ATOM 5100   N N   . ILE B 2 213 ? -47.276  -5.808  -53.875 1.00 0.00 ? 213 ILE B N   1  
ATOM 5101   C CA  . ILE B 2 213 ? -48.130  -6.954  -53.816 1.00 0.00 ? 213 ILE B CA  1  
ATOM 5102   C C   . ILE B 2 213 ? -47.592  -8.329  -53.677 1.00 0.00 ? 213 ILE B C   1  
ATOM 5103   O O   . ILE B 2 213 ? -48.354  -9.256  -53.895 1.00 0.00 ? 213 ILE B O   1  
ATOM 5104   C CB  . ILE B 2 213 ? -49.080  -6.921  -55.011 1.00 0.00 ? 213 ILE B CB  1  
ATOM 5105   C CG1 . ILE B 2 213 ? -48.311  -6.911  -56.371 1.00 0.00 ? 213 ILE B CG1 1  
ATOM 5106   C CG2 . ILE B 2 213 ? -49.972  -5.674  -54.962 1.00 0.00 ? 213 ILE B CG2 1  
ATOM 5107   C CD1 . ILE B 2 213 ? -49.224  -6.878  -57.608 1.00 0.00 ? 213 ILE B CD1 1  
ATOM 5108   N N   . PRO B 2 214 ? -46.245  -8.685  -53.438 1.00 0.00 ? 214 PRO B N   1  
ATOM 5109   C CA  . PRO B 2 214 ? -45.861  -10.108 -53.387 1.00 0.00 ? 214 PRO B CA  1  
ATOM 5110   C C   . PRO B 2 214 ? -46.452  -10.954 -52.320 1.00 0.00 ? 214 PRO B C   1  
ATOM 5111   O O   . PRO B 2 214 ? -46.690  -10.442 -51.246 1.00 0.00 ? 214 PRO B O   1  
ATOM 5112   C CB  . PRO B 2 214 ? -44.350  -10.117 -53.378 1.00 0.00 ? 214 PRO B CB  1  
ATOM 5113   C CG  . PRO B 2 214 ? -43.919  -8.751  -53.916 1.00 0.00 ? 214 PRO B CG  1  
ATOM 5114   C CD  . PRO B 2 214 ? -45.111  -7.876  -53.602 1.00 0.00 ? 214 PRO B CD  1  
ATOM 5115   N N   . ASN B 2 215 ? -46.625  -12.263 -52.673 1.00 0.00 ? 215 ASN B N   1  
ATOM 5116   C CA  . ASN B 2 215 ? -47.272  -13.297 -51.900 1.00 0.00 ? 215 ASN B CA  1  
ATOM 5117   C C   . ASN B 2 215 ? -46.598  -13.441 -50.599 1.00 0.00 ? 215 ASN B C   1  
ATOM 5118   O O   . ASN B 2 215 ? -47.213  -13.630 -49.542 1.00 0.00 ? 215 ASN B O   1  
ATOM 5119   C CB  . ASN B 2 215 ? -47.365  -14.723 -52.555 1.00 0.00 ? 215 ASN B CB  1  
ATOM 5120   C CG  . ASN B 2 215 ? -48.104  -14.512 -53.907 1.00 0.00 ? 215 ASN B CG  1  
ATOM 5121   O OD1 . ASN B 2 215 ? -49.174  -13.933 -54.007 1.00 0.00 ? 215 ASN B OD1 1  
ATOM 5122   N ND2 . ASN B 2 215 ? -47.341  -14.858 -55.011 1.00 0.00 ? 215 ASN B ND2 1  
ATOM 5123   N N   . PHE B 2 216 ? -45.259  -13.373 -50.705 1.00 0.00 ? 216 PHE B N   1  
ATOM 5124   C CA  . PHE B 2 216 ? -44.252  -13.569 -49.641 1.00 0.00 ? 216 PHE B CA  1  
ATOM 5125   C C   . PHE B 2 216 ? -44.574  -12.568 -48.540 1.00 0.00 ? 216 PHE B C   1  
ATOM 5126   O O   . PHE B 2 216 ? -44.664  -12.779 -47.386 1.00 0.00 ? 216 PHE B O   1  
ATOM 5127   C CB  . PHE B 2 216 ? -42.862  -13.236 -50.155 1.00 0.00 ? 216 PHE B CB  1  
ATOM 5128   C CG  . PHE B 2 216 ? -41.749  -13.612 -49.097 1.00 0.00 ? 216 PHE B CG  1  
ATOM 5129   C CD1 . PHE B 2 216 ? -41.256  -12.635 -48.117 1.00 0.00 ? 216 PHE B CD1 1  
ATOM 5130   C CD2 . PHE B 2 216 ? -41.081  -14.897 -49.144 1.00 0.00 ? 216 PHE B CD2 1  
ATOM 5131   C CE1 . PHE B 2 216 ? -40.285  -13.079 -47.149 1.00 0.00 ? 216 PHE B CE1 1  
ATOM 5132   C CE2 . PHE B 2 216 ? -40.121  -15.227 -48.198 1.00 0.00 ? 216 PHE B CE2 1  
ATOM 5133   C CZ  . PHE B 2 216 ? -39.779  -14.347 -47.143 1.00 0.00 ? 216 PHE B CZ  1  
ATOM 5134   N N   . GLU B 2 217 ? -44.762  -11.235 -48.909 1.00 0.00 ? 217 GLU B N   1  
ATOM 5135   C CA  . GLU B 2 217 ? -45.053  -10.107 -48.072 1.00 0.00 ? 217 GLU B CA  1  
ATOM 5136   C C   . GLU B 2 217 ? -46.400  -10.255 -47.526 1.00 0.00 ? 217 GLU B C   1  
ATOM 5137   O O   . GLU B 2 217 ? -46.647  -9.874  -46.413 1.00 0.00 ? 217 GLU B O   1  
ATOM 5138   C CB  . GLU B 2 217 ? -44.983  -8.906  -48.887 1.00 0.00 ? 217 GLU B CB  1  
ATOM 5139   C CG  . GLU B 2 217 ? -43.523  -8.533  -49.246 1.00 0.00 ? 217 GLU B CG  1  
ATOM 5140   C CD  . GLU B 2 217 ? -43.513  -7.272  -50.047 1.00 0.00 ? 217 GLU B CD  1  
ATOM 5141   O OE1 . GLU B 2 217 ? -44.562  -6.615  -50.302 1.00 0.00 ? 217 GLU B OE1 1  
ATOM 5142   O OE2 . GLU B 2 217 ? -42.322  -6.797  -50.319 1.00 0.00 ? 217 GLU B OE2 1  
ATOM 5143   N N   . SER B 2 218 ? -47.359  -10.773 -48.382 1.00 0.00 ? 218 SER B N   1  
ATOM 5144   C CA  . SER B 2 218 ? -48.761  -10.923 -48.142 1.00 0.00 ? 218 SER B CA  1  
ATOM 5145   C C   . SER B 2 218 ? -49.031  -11.842 -46.994 1.00 0.00 ? 218 SER B C   1  
ATOM 5146   O O   . SER B 2 218 ? -49.832  -11.570 -46.088 1.00 0.00 ? 218 SER B O   1  
ATOM 5147   C CB  . SER B 2 218 ? -49.733  -11.296 -49.334 1.00 0.00 ? 218 SER B CB  1  
ATOM 5148   O OG  . SER B 2 218 ? -51.106  -10.920 -49.153 1.00 0.00 ? 218 SER B OG  1  
ATOM 5149   N N   . GLY B 2 219 ? -48.248  -12.960 -46.983 1.00 0.00 ? 219 GLY B N   1  
ATOM 5150   C CA  . GLY B 2 219 ? -48.338  -13.976 -45.944 1.00 0.00 ? 219 GLY B CA  1  
ATOM 5151   C C   . GLY B 2 219 ? -47.921  -13.484 -44.655 1.00 0.00 ? 219 GLY B C   1  
ATOM 5152   O O   . GLY B 2 219 ? -48.667  -13.700 -43.697 1.00 0.00 ? 219 GLY B O   1  
ATOM 5153   N N   . LEU B 2 220 ? -46.854  -12.706 -44.676 1.00 0.00 ? 220 LEU B N   1  
ATOM 5154   C CA  . LEU B 2 220 ? -46.449  -11.927 -43.424 1.00 0.00 ? 220 LEU B CA  1  
ATOM 5155   C C   . LEU B 2 220 ? -47.483  -10.940 -43.021 1.00 0.00 ? 220 LEU B C   1  
ATOM 5156   O O   . LEU B 2 220 ? -47.774  -10.648 -41.848 1.00 0.00 ? 220 LEU B O   1  
ATOM 5157   C CB  . LEU B 2 220 ? -45.102  -11.227 -43.773 1.00 0.00 ? 220 LEU B CB  1  
ATOM 5158   C CG  . LEU B 2 220 ? -43.924  -12.101 -44.140 1.00 0.00 ? 220 LEU B CG  1  
ATOM 5159   C CD1 . LEU B 2 220 ? -42.875  -11.125 -44.697 1.00 0.00 ? 220 LEU B CD1 1  
ATOM 5160   C CD2 . LEU B 2 220 ? -43.463  -12.950 -42.985 1.00 0.00 ? 220 LEU B CD2 1  
ATOM 5161   N N   . LEU B 2 221 ? -48.104  -10.310 -44.009 1.00 0.00 ? 221 LEU B N   1  
ATOM 5162   C CA  . LEU B 2 221 ? -49.101  -9.274  -43.887 1.00 0.00 ? 221 LEU B CA  1  
ATOM 5163   C C   . LEU B 2 221 ? -50.353  -9.769  -43.175 1.00 0.00 ? 221 LEU B C   1  
ATOM 5164   O O   . LEU B 2 221 ? -50.964  -8.997  -42.458 1.00 0.00 ? 221 LEU B O   1  
ATOM 5165   C CB  . LEU B 2 221 ? -49.622  -8.583  -45.206 1.00 0.00 ? 221 LEU B CB  1  
ATOM 5166   C CG  . LEU B 2 221 ? -50.391  -7.279  -45.075 1.00 0.00 ? 221 LEU B CG  1  
ATOM 5167   C CD1 . LEU B 2 221 ? -49.524  -6.019  -44.824 1.00 0.00 ? 221 LEU B CD1 1  
ATOM 5168   C CD2 . LEU B 2 221 ? -51.315  -7.126  -46.329 1.00 0.00 ? 221 LEU B CD2 1  
ATOM 5169   N N   . HIS B 2 222 ? -50.745  -11.096 -43.379 1.00 0.00 ? 222 HIS B N   1  
ATOM 5170   C CA  . HIS B 2 222 ? -51.928  -11.578 -42.709 1.00 0.00 ? 222 HIS B CA  1  
ATOM 5171   C C   . HIS B 2 222 ? -51.799  -11.516 -41.187 1.00 0.00 ? 222 HIS B C   1  
ATOM 5172   O O   . HIS B 2 222 ? -52.556  -10.918 -40.522 1.00 0.00 ? 222 HIS B O   1  
ATOM 5173   C CB  . HIS B 2 222 ? -52.092  -13.050 -43.104 1.00 0.00 ? 222 HIS B CB  1  
ATOM 5174   C CG  . HIS B 2 222 ? -52.901  -13.221 -44.385 1.00 0.00 ? 222 HIS B CG  1  
ATOM 5175   N ND1 . HIS B 2 222 ? -52.736  -12.484 -45.554 1.00 0.00 ? 222 HIS B ND1 1  
ATOM 5176   C CD2 . HIS B 2 222 ? -53.895  -14.117 -44.626 1.00 0.00 ? 222 HIS B CD2 1  
ATOM 5177   C CE1 . HIS B 2 222 ? -53.655  -12.934 -46.394 1.00 0.00 ? 222 HIS B CE1 1  
ATOM 5178   N NE2 . HIS B 2 222 ? -54.370  -13.967 -45.911 1.00 0.00 ? 222 HIS B NE2 1  
ATOM 5179   N N   . LEU B 2 223 ? -50.630  -12.025 -40.698 1.00 0.00 ? 223 LEU B N   1  
ATOM 5180   C CA  . LEU B 2 223 ? -50.310  -12.004 -39.250 1.00 0.00 ? 223 LEU B CA  1  
ATOM 5181   C C   . LEU B 2 223 ? -50.140  -10.602 -38.764 1.00 0.00 ? 223 LEU B C   1  
ATOM 5182   O O   . LEU B 2 223 ? -50.595  -10.254 -37.669 1.00 0.00 ? 223 LEU B O   1  
ATOM 5183   C CB  . LEU B 2 223 ? -48.932  -12.574 -38.968 1.00 0.00 ? 223 LEU B CB  1  
ATOM 5184   C CG  . LEU B 2 223 ? -48.657  -13.947 -39.644 1.00 0.00 ? 223 LEU B CG  1  
ATOM 5185   C CD1 . LEU B 2 223 ? -47.174  -14.343 -39.412 1.00 0.00 ? 223 LEU B CD1 1  
ATOM 5186   C CD2 . LEU B 2 223 ? -49.568  -15.099 -39.202 1.00 0.00 ? 223 LEU B CD2 1  
ATOM 5187   N N   . ILE B 2 224 ? -49.495  -9.650  -39.538 1.00 0.00 ? 224 ILE B N   1  
ATOM 5188   C CA  . ILE B 2 224 ? -49.439  -8.271  -39.116 1.00 0.00 ? 224 ILE B CA  1  
ATOM 5189   C C   . ILE B 2 224 ? -50.735  -7.570  -39.029 1.00 0.00 ? 224 ILE B C   1  
ATOM 5190   O O   . ILE B 2 224 ? -51.019  -6.823  -38.126 1.00 0.00 ? 224 ILE B O   1  
ATOM 5191   C CB  . ILE B 2 224 ? -48.355  -7.411  -39.884 1.00 0.00 ? 224 ILE B CB  1  
ATOM 5192   C CG1 . ILE B 2 224 ? -47.511  -6.411  -39.096 1.00 0.00 ? 224 ILE B CG1 1  
ATOM 5193   C CG2 . ILE B 2 224 ? -48.875  -6.651  -41.069 1.00 0.00 ? 224 ILE B CG2 1  
ATOM 5194   C CD1 . ILE B 2 224 ? -46.494  -5.636  -39.951 1.00 0.00 ? 224 ILE B CD1 1  
ATOM 5195   N N   . PHE B 2 225 ? -51.693  -7.890  -40.004 1.00 0.00 ? 225 PHE B N   1  
ATOM 5196   C CA  . PHE B 2 225 ? -52.971  -7.212  -39.994 1.00 0.00 ? 225 PHE B CA  1  
ATOM 5197   C C   . PHE B 2 225 ? -53.824  -7.416  -38.771 1.00 0.00 ? 225 PHE B C   1  
ATOM 5198   O O   . PHE B 2 225 ? -54.440  -6.458  -38.216 1.00 0.00 ? 225 PHE B O   1  
ATOM 5199   C CB  . PHE B 2 225 ? -53.862  -7.323  -41.329 1.00 0.00 ? 225 PHE B CB  1  
ATOM 5200   C CG  . PHE B 2 225 ? -54.738  -8.521  -41.597 1.00 0.00 ? 225 PHE B CG  1  
ATOM 5201   C CD1 . PHE B 2 225 ? -55.754  -9.024  -40.733 1.00 0.00 ? 225 PHE B CD1 1  
ATOM 5202   C CD2 . PHE B 2 225 ? -54.597  -9.198  -42.784 1.00 0.00 ? 225 PHE B CD2 1  
ATOM 5203   C CE1 . PHE B 2 225 ? -56.607  -10.070 -41.079 1.00 0.00 ? 225 PHE B CE1 1  
ATOM 5204   C CE2 . PHE B 2 225 ? -55.438  -10.261 -43.170 1.00 0.00 ? 225 PHE B CE2 1  
ATOM 5205   C CZ  . PHE B 2 225 ? -56.543  -10.582 -42.377 1.00 0.00 ? 225 PHE B CZ  1  
ATOM 5206   N N   . GLU B 2 226 ? -53.816  -8.683  -38.191 1.00 0.00 ? 226 GLU B N   1  
ATOM 5207   C CA  . GLU B 2 226 ? -54.420  -9.056  -37.008 1.00 0.00 ? 226 GLU B CA  1  
ATOM 5208   C C   . GLU B 2 226 ? -53.850  -8.300  -35.899 1.00 0.00 ? 226 GLU B C   1  
ATOM 5209   O O   . GLU B 2 226 ? -54.605  -7.676  -35.144 1.00 0.00 ? 226 GLU B O   1  
ATOM 5210   C CB  . GLU B 2 226 ? -54.214  -10.530 -36.722 1.00 0.00 ? 226 GLU B CB  1  
ATOM 5211   C CG  . GLU B 2 226 ? -54.986  -11.514 -37.642 1.00 0.00 ? 226 GLU B CG  1  
ATOM 5212   C CD  . GLU B 2 226 ? -56.434  -11.707 -37.175 1.00 0.00 ? 226 GLU B CD  1  
ATOM 5213   O OE1 . GLU B 2 226 ? -56.632  -12.011 -35.986 1.00 0.00 ? 226 GLU B OE1 1  
ATOM 5214   O OE2 . GLU B 2 226 ? -57.330  -11.417 -38.043 1.00 0.00 ? 226 GLU B OE2 1  
ATOM 5215   N N   . ALA B 2 227 ? -52.479  -8.166  -35.854 1.00 0.00 ? 227 ALA B N   1  
ATOM 5216   C CA  . ALA B 2 227 ? -51.757  -7.429  -34.844 1.00 0.00 ? 227 ALA B CA  1  
ATOM 5217   C C   . ALA B 2 227 ? -52.092  -5.940  -34.713 1.00 0.00 ? 227 ALA B C   1  
ATOM 5218   O O   . ALA B 2 227 ? -52.284  -5.430  -33.563 1.00 0.00 ? 227 ALA B O   1  
ATOM 5219   C CB  . ALA B 2 227 ? -50.237  -7.554  -35.016 1.00 0.00 ? 227 ALA B CB  1  
ATOM 5220   N N   . GLY B 2 228 ? -52.217  -5.285  -35.833 1.00 0.00 ? 228 GLY B N   1  
ATOM 5221   C CA  . GLY B 2 228 ? -52.578  -3.890  -35.909 1.00 0.00 ? 228 GLY B CA  1  
ATOM 5222   C C   . GLY B 2 228 ? -53.897  -3.564  -35.515 1.00 0.00 ? 228 GLY B C   1  
ATOM 5223   O O   . GLY B 2 228 ? -54.130  -2.520  -34.902 1.00 0.00 ? 228 GLY B O   1  
ATOM 5224   N N   . LEU B 2 229 ? -54.852  -4.448  -35.807 1.00 0.00 ? 229 LEU B N   1  
ATOM 5225   C CA  . LEU B 2 229 ? -56.269  -4.418  -35.509 1.00 0.00 ? 229 LEU B CA  1  
ATOM 5226   C C   . LEU B 2 229 ? -56.509  -4.421  -34.071 1.00 0.00 ? 229 LEU B C   1  
ATOM 5227   O O   . LEU B 2 229 ? -57.244  -3.609  -33.584 1.00 0.00 ? 229 LEU B O   1  
ATOM 5228   C CB  . LEU B 2 229 ? -57.209  -5.470  -36.150 1.00 0.00 ? 229 LEU B CB  1  
ATOM 5229   C CG  . LEU B 2 229 ? -57.615  -5.290  -37.617 1.00 0.00 ? 229 LEU B CG  1  
ATOM 5230   C CD1 . LEU B 2 229 ? -58.390  -6.541  -38.195 1.00 0.00 ? 229 LEU B CD1 1  
ATOM 5231   C CD2 . LEU B 2 229 ? -58.358  -3.960  -37.834 1.00 0.00 ? 229 LEU B CD2 1  
ATOM 5232   N N   . LEU B 2 230 ? -55.773  -5.329  -33.337 1.00 0.00 ? 230 LEU B N   1  
ATOM 5233   C CA  . LEU B 2 230 ? -55.853  -5.410  -31.898 1.00 0.00 ? 230 LEU B CA  1  
ATOM 5234   C C   . LEU B 2 230 ? -55.372  -4.174  -31.127 1.00 0.00 ? 230 LEU B C   1  
ATOM 5235   O O   . LEU B 2 230 ? -56.135  -3.677  -30.312 1.00 0.00 ? 230 LEU B O   1  
ATOM 5236   C CB  . LEU B 2 230 ? -55.097  -6.678  -31.418 1.00 0.00 ? 230 LEU B CB  1  
ATOM 5237   C CG  . LEU B 2 230 ? -55.627  -7.990  -32.017 1.00 0.00 ? 230 LEU B CG  1  
ATOM 5238   C CD1 . LEU B 2 230 ? -54.437  -9.017  -31.815 1.00 0.00 ? 230 LEU B CD1 1  
ATOM 5239   C CD2 . LEU B 2 230 ? -56.970  -8.440  -31.448 1.00 0.00 ? 230 LEU B CD2 1  
ATOM 5240   N N   . TYR B 2 231 ? -54.249  -3.552  -31.595 1.00 0.00 ? 231 TYR B N   1  
ATOM 5241   C CA  . TYR B 2 231 ? -53.714  -2.285  -31.073 1.00 0.00 ? 231 TYR B CA  1  
ATOM 5242   C C   . TYR B 2 231 ? -54.776  -1.163  -31.177 1.00 0.00 ? 231 TYR B C   1  
ATOM 5243   O O   . TYR B 2 231 ? -54.960  -0.343  -30.211 1.00 0.00 ? 231 TYR B O   1  
ATOM 5244   C CB  . TYR B 2 231 ? -52.434  -1.757  -31.671 1.00 0.00 ? 231 TYR B CB  1  
ATOM 5245   C CG  . TYR B 2 231 ? -51.484  -1.356  -30.558 1.00 0.00 ? 231 TYR B CG  1  
ATOM 5246   C CD1 . TYR B 2 231 ? -50.622  -2.327  -29.920 1.00 0.00 ? 231 TYR B CD1 1  
ATOM 5247   C CD2 . TYR B 2 231 ? -51.388  -0.039  -30.026 1.00 0.00 ? 231 TYR B CD2 1  
ATOM 5248   C CE1 . TYR B 2 231 ? -49.703  -1.957  -28.928 1.00 0.00 ? 231 TYR B CE1 1  
ATOM 5249   C CE2 . TYR B 2 231 ? -50.361  0.356   -29.148 1.00 0.00 ? 231 TYR B CE2 1  
ATOM 5250   C CZ  . TYR B 2 231 ? -49.486  -0.586  -28.571 1.00 0.00 ? 231 TYR B CZ  1  
ATOM 5251   O OH  . TYR B 2 231 ? -48.331  -0.371  -27.795 1.00 0.00 ? 231 TYR B OH  1  
ATOM 5252   N N   . GLN B 2 232 ? -55.466  -1.117  -32.355 1.00 0.00 ? 232 GLN B N   1  
ATOM 5253   C CA  . GLN B 2 232 ? -56.445  -0.136  -32.662 1.00 0.00 ? 232 GLN B CA  1  
ATOM 5254   C C   . GLN B 2 232 ? -57.649  -0.318  -31.728 1.00 0.00 ? 232 GLN B C   1  
ATOM 5255   O O   . GLN B 2 232 ? -58.138  0.615   -31.173 1.00 0.00 ? 232 GLN B O   1  
ATOM 5256   C CB  . GLN B 2 232 ? -57.005  -0.204  -34.175 1.00 0.00 ? 232 GLN B CB  1  
ATOM 5257   C CG  . GLN B 2 232 ? -58.040  0.876   -34.565 1.00 0.00 ? 232 GLN B CG  1  
ATOM 5258   C CD  . GLN B 2 232 ? -58.023  1.092   -36.088 1.00 0.00 ? 232 GLN B CD  1  
ATOM 5259   O OE1 . GLN B 2 232 ? -57.899  2.209   -36.587 1.00 0.00 ? 232 GLN B OE1 1  
ATOM 5260   N NE2 . GLN B 2 232 ? -58.166  0.003   -36.822 1.00 0.00 ? 232 GLN B NE2 1  
ATOM 5261   N N   . SER B 2 233 ? -58.031  -1.607  -31.476 1.00 0.00 ? 233 SER B N   1  
ATOM 5262   C CA  . SER B 2 233 ? -59.105  -2.023  -30.539 1.00 0.00 ? 233 SER B CA  1  
ATOM 5263   C C   . SER B 2 233 ? -58.822  -1.713  -29.146 1.00 0.00 ? 233 SER B C   1  
ATOM 5264   O O   . SER B 2 233 ? -59.720  -1.164  -28.507 1.00 0.00 ? 233 SER B O   1  
ATOM 5265   C CB  . SER B 2 233 ? -59.455  -3.522  -30.638 1.00 0.00 ? 233 SER B CB  1  
ATOM 5266   O OG  . SER B 2 233 ? -59.582  -3.960  -32.038 1.00 0.00 ? 233 SER B OG  1  
ATOM 5267   N N   . LEU B 2 234 ? -57.607  -1.939  -28.631 1.00 0.00 ? 234 LEU B N   1  
ATOM 5268   C CA  . LEU B 2 234 ? -57.285  -1.642  -27.290 1.00 0.00 ? 234 LEU B CA  1  
ATOM 5269   C C   . LEU B 2 234 ? -57.434  -0.200  -27.042 1.00 0.00 ? 234 LEU B C   1  
ATOM 5270   O O   . LEU B 2 234 ? -58.130  0.109   -26.085 1.00 0.00 ? 234 LEU B O   1  
ATOM 5271   C CB  . LEU B 2 234 ? -55.823  -1.888  -26.899 1.00 0.00 ? 234 LEU B CB  1  
ATOM 5272   C CG  . LEU B 2 234 ? -55.306  -3.302  -26.902 1.00 0.00 ? 234 LEU B CG  1  
ATOM 5273   C CD1 . LEU B 2 234 ? -53.824  -3.305  -26.803 1.00 0.00 ? 234 LEU B CD1 1  
ATOM 5274   C CD2 . LEU B 2 234 ? -56.023  -4.108  -25.785 1.00 0.00 ? 234 LEU B CD2 1  
ATOM 5275   N N   . GLY B 2 235 ? -56.918  0.683   -27.948 1.00 0.00 ? 235 GLY B N   1  
ATOM 5276   C CA  . GLY B 2 235 ? -57.025  2.067   -27.818 1.00 0.00 ? 235 GLY B CA  1  
ATOM 5277   C C   . GLY B 2 235 ? -58.409  2.567   -27.777 1.00 0.00 ? 235 GLY B C   1  
ATOM 5278   O O   . GLY B 2 235 ? -58.762  3.423   -26.948 1.00 0.00 ? 235 GLY B O   1  
ATOM 5279   N N   . TYR B 2 236 ? -59.258  1.919   -28.611 1.00 0.00 ? 236 TYR B N   1  
ATOM 5280   C CA  . TYR B 2 236 ? -60.690  2.198   -28.668 1.00 0.00 ? 236 TYR B CA  1  
ATOM 5281   C C   . TYR B 2 236 ? -61.398  1.923   -27.334 1.00 0.00 ? 236 TYR B C   1  
ATOM 5282   O O   . TYR B 2 236 ? -62.115  2.791   -26.854 1.00 0.00 ? 236 TYR B O   1  
ATOM 5283   C CB  . TYR B 2 236 ? -61.522  1.467   -29.712 1.00 0.00 ? 236 TYR B CB  1  
ATOM 5284   C CG  . TYR B 2 236 ? -61.426  2.303   -30.931 1.00 0.00 ? 236 TYR B CG  1  
ATOM 5285   C CD1 . TYR B 2 236 ? -62.046  3.589   -30.861 1.00 0.00 ? 236 TYR B CD1 1  
ATOM 5286   C CD2 . TYR B 2 236 ? -60.887  1.828   -32.120 1.00 0.00 ? 236 TYR B CD2 1  
ATOM 5287   C CE1 . TYR B 2 236 ? -61.898  4.468   -31.927 1.00 0.00 ? 236 TYR B CE1 1  
ATOM 5288   C CE2 . TYR B 2 236 ? -60.920  2.638   -33.222 1.00 0.00 ? 236 TYR B CE2 1  
ATOM 5289   C CZ  . TYR B 2 236 ? -61.472  3.941   -33.192 1.00 0.00 ? 236 TYR B CZ  1  
ATOM 5290   O OH  . TYR B 2 236 ? -61.485  4.792   -34.345 1.00 0.00 ? 236 TYR B OH  1  
ATOM 5291   N N   . LYS B 2 237 ? -61.123  0.760   -26.707 1.00 0.00 ? 237 LYS B N   1  
ATOM 5292   C CA  . LYS B 2 237 ? -61.671  0.336   -25.493 1.00 0.00 ? 237 LYS B CA  1  
ATOM 5293   C C   . LYS B 2 237 ? -61.279  1.248   -24.327 1.00 0.00 ? 237 LYS B C   1  
ATOM 5294   O O   . LYS B 2 237 ? -62.164  1.569   -23.553 1.00 0.00 ? 237 LYS B O   1  
ATOM 5295   C CB  . LYS B 2 237 ? -61.157  -1.087  -25.203 1.00 0.00 ? 237 LYS B CB  1  
ATOM 5296   C CG  . LYS B 2 237 ? -61.743  -2.100  -26.146 1.00 0.00 ? 237 LYS B CG  1  
ATOM 5297   C CD  . LYS B 2 237 ? -60.868  -3.341  -26.288 1.00 0.00 ? 237 LYS B CD  1  
ATOM 5298   C CE  . LYS B 2 237 ? -61.698  -4.484  -26.879 1.00 0.00 ? 237 LYS B CE  1  
ATOM 5299   N NZ  . LYS B 2 237 ? -60.956  -5.739  -26.818 1.00 0.00 ? 237 LYS B NZ  1  
ATOM 5300   N N   . VAL B 2 238 ? -59.967  1.581   -24.269 1.00 0.00 ? 238 VAL B N   1  
ATOM 5301   C CA  . VAL B 2 238 ? -59.367  2.347   -23.216 1.00 0.00 ? 238 VAL B CA  1  
ATOM 5302   C C   . VAL B 2 238 ? -60.031  3.646   -23.125 1.00 0.00 ? 238 VAL B C   1  
ATOM 5303   O O   . VAL B 2 238 ? -60.382  4.024   -22.017 1.00 0.00 ? 238 VAL B O   1  
ATOM 5304   C CB  . VAL B 2 238 ? -57.898  2.559   -23.464 1.00 0.00 ? 238 VAL B CB  1  
ATOM 5305   C CG1 . VAL B 2 238 ? -57.351  3.627   -22.565 1.00 0.00 ? 238 VAL B CG1 1  
ATOM 5306   C CG2 . VAL B 2 238 ? -57.189  1.193   -23.290 1.00 0.00 ? 238 VAL B CG2 1  
ATOM 5307   N N   . GLU B 2 239 ? -60.276  4.327   -24.348 1.00 0.00 ? 239 GLU B N   1  
ATOM 5308   C CA  . GLU B 2 239 ? -60.859  5.620   -24.591 1.00 0.00 ? 239 GLU B CA  1  
ATOM 5309   C C   . GLU B 2 239 ? -62.289  5.635   -24.078 1.00 0.00 ? 239 GLU B C   1  
ATOM 5310   O O   . GLU B 2 239 ? -62.711  6.537   -23.389 1.00 0.00 ? 239 GLU B O   1  
ATOM 5311   C CB  . GLU B 2 239 ? -60.751  6.085   -26.191 1.00 0.00 ? 239 GLU B CB  1  
ATOM 5312   C CG  . GLU B 2 239 ? -61.827  7.116   -26.544 1.00 0.00 ? 239 GLU B CG  1  
ATOM 5313   C CD  . GLU B 2 239 ? -63.086  6.374   -27.004 1.00 0.00 ? 239 GLU B CD  1  
ATOM 5314   O OE1 . GLU B 2 239 ? -62.906  5.634   -27.985 1.00 0.00 ? 239 GLU B OE1 1  
ATOM 5315   O OE2 . GLU B 2 239 ? -64.174  6.586   -26.389 1.00 0.00 ? 239 GLU B OE2 1  
ATOM 5316   N N   . LYS B 2 240 ? -63.012  4.515   -24.353 1.00 0.00 ? 240 LYS B N   1  
ATOM 5317   C CA  . LYS B 2 240 ? -64.351  4.237   -23.998 1.00 0.00 ? 240 LYS B CA  1  
ATOM 5318   C C   . LYS B 2 240 ? -64.495  4.217   -22.529 1.00 0.00 ? 240 LYS B C   1  
ATOM 5319   O O   . LYS B 2 240 ? -65.319  4.864   -21.928 1.00 0.00 ? 240 LYS B O   1  
ATOM 5320   C CB  . LYS B 2 240 ? -64.900  2.938   -24.534 1.00 0.00 ? 240 LYS B CB  1  
ATOM 5321   C CG  . LYS B 2 240 ? -66.213  2.437   -23.975 1.00 0.00 ? 240 LYS B CG  1  
ATOM 5322   C CD  . LYS B 2 240 ? -67.442  3.274   -24.393 1.00 0.00 ? 240 LYS B CD  1  
ATOM 5323   C CE  . LYS B 2 240 ? -68.680  3.082   -23.468 1.00 0.00 ? 240 LYS B CE  1  
ATOM 5324   N NZ  . LYS B 2 240 ? -68.364  3.657   -22.081 1.00 0.00 ? 240 LYS B NZ  1  
ATOM 5325   N N   . PHE B 2 241 ? -63.605  3.525   -21.834 1.00 0.00 ? 241 PHE B N   1  
ATOM 5326   C CA  . PHE B 2 241 ? -63.689  3.355   -20.378 1.00 0.00 ? 241 PHE B CA  1  
ATOM 5327   C C   . PHE B 2 241 ? -63.239  4.656   -19.716 1.00 0.00 ? 241 PHE B C   1  
ATOM 5328   O O   . PHE B 2 241 ? -63.706  5.030   -18.657 1.00 0.00 ? 241 PHE B O   1  
ATOM 5329   C CB  . PHE B 2 241 ? -62.884  2.187   -19.759 1.00 0.00 ? 241 PHE B CB  1  
ATOM 5330   C CG  . PHE B 2 241 ? -63.366  0.917   -20.258 1.00 0.00 ? 241 PHE B CG  1  
ATOM 5331   C CD1 . PHE B 2 241 ? -64.791  0.620   -20.209 1.00 0.00 ? 241 PHE B CD1 1  
ATOM 5332   C CD2 . PHE B 2 241 ? -62.517  -0.107  -20.805 1.00 0.00 ? 241 PHE B CD2 1  
ATOM 5333   C CE1 . PHE B 2 241 ? -65.333  -0.530  -20.763 1.00 0.00 ? 241 PHE B CE1 1  
ATOM 5334   C CE2 . PHE B 2 241 ? -63.048  -1.210  -21.402 1.00 0.00 ? 241 PHE B CE2 1  
ATOM 5335   C CZ  . PHE B 2 241 ? -64.447  -1.483  -21.308 1.00 0.00 ? 241 PHE B CZ  1  
ATOM 5336   N N   . ARG B 2 242 ? -62.406  5.385   -20.386 1.00 0.00 ? 242 ARG B N   1  
ATOM 5337   C CA  . ARG B 2 242 ? -62.096  6.753   -20.087 1.00 0.00 ? 242 ARG B CA  1  
ATOM 5338   C C   . ARG B 2 242 ? -63.088  7.633   -20.659 1.00 0.00 ? 242 ARG B C   1  
ATOM 5339   O O   . ARG B 2 242 ? -62.785  8.526   -21.494 1.00 0.00 ? 242 ARG B O   1  
ATOM 5340   C CB  . ARG B 2 242 ? -60.685  7.200   -20.614 1.00 0.00 ? 242 ARG B CB  1  
ATOM 5341   C CG  . ARG B 2 242 ? -59.545  6.465   -19.885 1.00 0.00 ? 242 ARG B CG  1  
ATOM 5342   C CD  . ARG B 2 242 ? -58.125  6.843   -20.350 1.00 0.00 ? 242 ARG B CD  1  
ATOM 5343   N NE  . ARG B 2 242 ? -57.051  6.005   -19.740 1.00 0.00 ? 242 ARG B NE  1  
ATOM 5344   C CZ  . ARG B 2 242 ? -56.486  6.278   -18.511 1.00 0.00 ? 242 ARG B CZ  1  
ATOM 5345   N NH1 . ARG B 2 242 ? -56.833  7.361   -17.812 1.00 0.00 ? 242 ARG B NH1 1  
ATOM 5346   N NH2 . ARG B 2 242 ? -55.579  5.390   -18.006 1.00 0.00 ? 242 ARG B NH2 1  
ATOM 5347   N N   . MET B 2 243 ? -64.214  7.470   -20.033 1.00 0.00 ? 243 MET B N   1  
ATOM 5348   C CA  . MET B 2 243 ? -65.328  8.374   -20.275 1.00 0.00 ? 243 MET B CA  1  
ATOM 5349   C C   . MET B 2 243 ? -66.070  8.415   -18.911 1.00 0.00 ? 243 MET B C   1  
ATOM 5350   O O   . MET B 2 243 ? -67.146  8.975   -18.818 1.00 0.00 ? 243 MET B O   1  
ATOM 5351   C CB  . MET B 2 243 ? -66.479  7.846   -21.201 1.00 0.00 ? 243 MET B CB  1  
ATOM 5352   C CG  . MET B 2 243 ? -66.071  7.877   -22.706 1.00 0.00 ? 243 MET B CG  1  
ATOM 5353   S SD  . MET B 2 243 ? -67.186  7.025   -23.758 1.00 0.00 ? 243 MET B SD  1  
ATOM 5354   C CE  . MET B 2 243 ? -68.794  7.781   -23.282 1.00 0.00 ? 243 MET B CE  1  
ATOM 5355   N N   . LEU B 2 244 ? -65.465  7.788   -17.831 1.00 0.00 ? 244 LEU B N   1  
ATOM 5356   C CA  . LEU B 2 244 ? -65.871  7.931   -16.488 1.00 0.00 ? 244 LEU B CA  1  
ATOM 5357   C C   . LEU B 2 244 ? -67.290  7.438   -16.300 1.00 0.00 ? 244 LEU B C   1  
ATOM 5358   O O   . LEU B 2 244 ? -68.190  8.186   -15.948 1.00 0.00 ? 244 LEU B O   1  
ATOM 5359   C CB  . LEU B 2 244 ? -65.793  9.249   -15.690 1.00 0.00 ? 244 LEU B CB  1  
ATOM 5360   C CG  . LEU B 2 244 ? -64.368  9.765   -15.460 1.00 0.00 ? 244 LEU B CG  1  
ATOM 5361   C CD1 . LEU B 2 244 ? -63.411  8.699   -14.819 1.00 0.00 ? 244 LEU B CD1 1  
ATOM 5362   C CD2 . LEU B 2 244 ? -63.712  10.463  -16.644 1.00 0.00 ? 244 LEU B CD2 1  
ATOM 5363   N N   . ASN B 2 245 ? -67.508  6.139   -16.589 1.00 0.00 ? 245 ASN B N   1  
ATOM 5364   C CA  . ASN B 2 245 ? -68.747  5.527   -16.678 1.00 0.00 ? 245 ASN B CA  1  
ATOM 5365   C C   . ASN B 2 245 ? -69.131  4.741   -15.495 1.00 0.00 ? 245 ASN B C   1  
ATOM 5366   O O   . ASN B 2 245 ? -69.964  5.255   -14.741 1.00 0.00 ? 245 ASN B O   1  
ATOM 5367   C CB  . ASN B 2 245 ? -68.691  4.600   -17.896 1.00 0.00 ? 245 ASN B CB  1  
ATOM 5368   C CG  . ASN B 2 245 ? -68.167  5.247   -19.193 1.00 0.00 ? 245 ASN B CG  1  
ATOM 5369   O OD1 . ASN B 2 245 ? -67.074  4.924   -19.679 1.00 0.00 ? 245 ASN B OD1 1  
ATOM 5370   N ND2 . ASN B 2 245 ? -68.941  6.233   -19.706 1.00 0.00 ? 245 ASN B ND2 1  
ATOM 5371   N N   . ILE B 2 246 ? -68.695  3.410   -15.271 1.00 0.00 ? 246 ILE B N   1  
ATOM 5372   C CA  . ILE B 2 246 ? -69.285  2.571   -14.263 1.00 0.00 ? 246 ILE B CA  1  
ATOM 5373   C C   . ILE B 2 246 ? -68.277  2.274   -13.209 1.00 0.00 ? 246 ILE B C   1  
ATOM 5374   O O   . ILE B 2 246 ? -67.240  2.947   -13.114 1.00 0.00 ? 246 ILE B O   1  
ATOM 5375   C CB  . ILE B 2 246 ? -69.906  1.360   -14.972 1.00 0.00 ? 246 ILE B CB  1  
ATOM 5376   C CG1 . ILE B 2 246 ? -70.998  0.576   -14.176 1.00 0.00 ? 246 ILE B CG1 1  
ATOM 5377   C CG2 . ILE B 2 246 ? -68.791  0.357   -15.501 1.00 0.00 ? 246 ILE B CG2 1  
ATOM 5378   C CD1 . ILE B 2 246 ? -71.585  -0.627  -14.934 1.00 0.00 ? 246 ILE B CD1 1  
ATOM 5379   N N   . SER B 2 247 ? -68.483  1.176   -12.438 1.00 0.00 ? 247 SER B N   1  
ATOM 5380   C CA  . SER B 2 247 ? -67.794  0.645   -11.262 1.00 0.00 ? 247 SER B CA  1  
ATOM 5381   C C   . SER B 2 247 ? -66.363  0.969   -10.989 1.00 0.00 ? 247 SER B C   1  
ATOM 5382   O O   . SER B 2 247 ? -65.459  1.035   -11.869 1.00 0.00 ? 247 SER B O   1  
ATOM 5383   C CB  . SER B 2 247 ? -67.918  -0.844  -11.414 1.00 0.00 ? 247 SER B CB  1  
ATOM 5384   O OG  . SER B 2 247 ? -69.323  -1.171  -11.435 1.00 0.00 ? 247 SER B OG  1  
ATOM 5385   N N   . PRO B 2 248 ? -66.014  0.960   -9.656  1.00 0.00 ? 248 PRO B N   1  
ATOM 5386   C CA  . PRO B 2 248 ? -64.593  0.859   -9.220  1.00 0.00 ? 248 PRO B CA  1  
ATOM 5387   C C   . PRO B 2 248 ? -64.071  -0.472  -9.559  1.00 0.00 ? 248 PRO B C   1  
ATOM 5388   O O   . PRO B 2 248 ? -62.839  -0.649  -9.649  1.00 0.00 ? 248 PRO B O   1  
ATOM 5389   C CB  . PRO B 2 248 ? -64.652  1.060   -7.747  1.00 0.00 ? 248 PRO B CB  1  
ATOM 5390   C CG  . PRO B 2 248 ? -65.977  0.466   -7.303  1.00 0.00 ? 248 PRO B CG  1  
ATOM 5391   C CD  . PRO B 2 248 ? -66.917  0.863   -8.457  1.00 0.00 ? 248 PRO B CD  1  
ATOM 5392   N N   . MET B 2 249 ? -64.907  -1.486  -9.795  1.00 0.00 ? 249 MET B N   1  
ATOM 5393   C CA  . MET B 2 249 ? -64.515  -2.772  -10.214 1.00 0.00 ? 249 MET B CA  1  
ATOM 5394   C C   . MET B 2 249 ? -63.921  -2.629  -11.627 1.00 0.00 ? 249 MET B C   1  
ATOM 5395   O O   . MET B 2 249 ? -62.920  -3.267  -11.878 1.00 0.00 ? 249 MET B O   1  
ATOM 5396   C CB  . MET B 2 249 ? -65.720  -3.716  -10.287 1.00 0.00 ? 249 MET B CB  1  
ATOM 5397   C CG  . MET B 2 249 ? -66.693  -3.793  -9.021  1.00 0.00 ? 249 MET B CG  1  
ATOM 5398   S SD  . MET B 2 249 ? -65.752  -4.287  -7.533  1.00 0.00 ? 249 MET B SD  1  
ATOM 5399   C CE  . MET B 2 249 ? -67.142  -3.921  -6.426  1.00 0.00 ? 249 MET B CE  1  
ATOM 5400   N N   . LYS B 2 250 ? -64.566  -1.824  -12.424 1.00 0.00 ? 250 LYS B N   1  
ATOM 5401   C CA  . LYS B 2 250 ? -64.297  -1.521  -13.783 1.00 0.00 ? 250 LYS B CA  1  
ATOM 5402   C C   . LYS B 2 250 ? -62.939  -0.816  -13.846 1.00 0.00 ? 250 LYS B C   1  
ATOM 5403   O O   . LYS B 2 250 ? -62.030  -1.110  -14.659 1.00 0.00 ? 250 LYS B O   1  
ATOM 5404   C CB  . LYS B 2 250 ? -65.402  -0.704  -14.476 1.00 0.00 ? 250 LYS B CB  1  
ATOM 5405   C CG  . LYS B 2 250 ? -65.182  -0.398  -16.011 1.00 0.00 ? 250 LYS B CG  1  
ATOM 5406   C CD  . LYS B 2 250 ? -64.514  0.982   -16.254 1.00 0.00 ? 250 LYS B CD  1  
ATOM 5407   C CE  . LYS B 2 250 ? -65.570  2.106   -16.525 1.00 0.00 ? 250 LYS B CE  1  
ATOM 5408   N NZ  . LYS B 2 250 ? -64.956  3.438   -16.684 1.00 0.00 ? 250 LYS B NZ  1  
ATOM 5409   N N   . LYS B 2 251 ? -62.752  0.125   -12.883 1.00 0.00 ? 251 LYS B N   1  
ATOM 5410   C CA  . LYS B 2 251 ? -61.553  0.955   -12.726 1.00 0.00 ? 251 LYS B CA  1  
ATOM 5411   C C   . LYS B 2 251 ? -60.402  0.118   -12.499 1.00 0.00 ? 251 LYS B C   1  
ATOM 5412   O O   . LYS B 2 251 ? -59.251  0.310   -12.943 1.00 0.00 ? 251 LYS B O   1  
ATOM 5413   C CB  . LYS B 2 251 ? -61.532  1.867   -11.516 1.00 0.00 ? 251 LYS B CB  1  
ATOM 5414   C CG  . LYS B 2 251 ? -60.624  3.130   -11.597 1.00 0.00 ? 251 LYS B CG  1  
ATOM 5415   C CD  . LYS B 2 251 ? -60.087  3.494   -10.170 1.00 0.00 ? 251 LYS B CD  1  
ATOM 5416   C CE  . LYS B 2 251 ? -59.240  4.783   -10.420 1.00 0.00 ? 251 LYS B CE  1  
ATOM 5417   N NZ  . LYS B 2 251 ? -60.094  5.923   -10.806 1.00 0.00 ? 251 LYS B NZ  1  
ATOM 5418   N N   . ALA B 2 252 ? -60.573  -0.922  -11.690 1.00 0.00 ? 252 ALA B N   1  
ATOM 5419   C CA  . ALA B 2 252 ? -59.500  -1.810  -11.290 1.00 0.00 ? 252 ALA B CA  1  
ATOM 5420   C C   . ALA B 2 252 ? -58.957  -2.495  -12.511 1.00 0.00 ? 252 ALA B C   1  
ATOM 5421   O O   . ALA B 2 252 ? -57.766  -2.729  -12.734 1.00 0.00 ? 252 ALA B O   1  
ATOM 5422   C CB  . ALA B 2 252 ? -59.958  -2.736  -10.238 1.00 0.00 ? 252 ALA B CB  1  
ATOM 5423   N N   . LEU B 2 253 ? -59.896  -2.809  -13.435 1.00 0.00 ? 253 LEU B N   1  
ATOM 5424   C CA  . LEU B 2 253 ? -59.575  -3.419  -14.718 1.00 0.00 ? 253 LEU B CA  1  
ATOM 5425   C C   . LEU B 2 253 ? -58.808  -2.572  -15.696 1.00 0.00 ? 253 LEU B C   1  
ATOM 5426   O O   . LEU B 2 253 ? -57.787  -3.024  -16.246 1.00 0.00 ? 253 LEU B O   1  
ATOM 5427   C CB  . LEU B 2 253 ? -60.958  -3.845  -15.526 1.00 0.00 ? 253 LEU B CB  1  
ATOM 5428   C CG  . LEU B 2 253 ? -61.842  -4.885  -14.748 1.00 0.00 ? 253 LEU B CG  1  
ATOM 5429   C CD1 . LEU B 2 253 ? -63.067  -5.320  -15.636 1.00 0.00 ? 253 LEU B CD1 1  
ATOM 5430   C CD2 . LEU B 2 253 ? -61.127  -6.282  -14.343 1.00 0.00 ? 253 LEU B CD2 1  
ATOM 5431   N N   . ILE B 2 254 ? -59.180  -1.243  -15.798 1.00 0.00 ? 254 ILE B N   1  
ATOM 5432   C CA  . ILE B 2 254 ? -58.479  -0.242  -16.553 1.00 0.00 ? 254 ILE B CA  1  
ATOM 5433   C C   . ILE B 2 254 ? -57.051  -0.092  -16.081 1.00 0.00 ? 254 ILE B C   1  
ATOM 5434   O O   . ILE B 2 254 ? -56.097  -0.104  -16.873 1.00 0.00 ? 254 ILE B O   1  
ATOM 5435   C CB  . ILE B 2 254 ? -58.995  1.179   -16.407 1.00 0.00 ? 254 ILE B CB  1  
ATOM 5436   C CG1 . ILE B 2 254 ? -60.538  1.493   -16.591 1.00 0.00 ? 254 ILE B CG1 1  
ATOM 5437   C CG2 . ILE B 2 254 ? -58.197  2.174   -17.339 1.00 0.00 ? 254 ILE B CG2 1  
ATOM 5438   C CD1 . ILE B 2 254 ? -60.902  2.977   -16.412 1.00 0.00 ? 254 ILE B CD1 1  
ATOM 5439   N N   . ILE B 2 255 ? -56.835  -0.101  -14.711 1.00 0.00 ? 255 ILE B N   1  
ATOM 5440   C CA  . ILE B 2 255 ? -55.515  -0.028  -14.148 1.00 0.00 ? 255 ILE B CA  1  
ATOM 5441   C C   . ILE B 2 255 ? -54.700  -1.248  -14.572 1.00 0.00 ? 255 ILE B C   1  
ATOM 5442   O O   . ILE B 2 255 ? -53.545  -1.078  -14.931 1.00 0.00 ? 255 ILE B O   1  
ATOM 5443   C CB  . ILE B 2 255 ? -55.462  0.062   -12.649 1.00 0.00 ? 255 ILE B CB  1  
ATOM 5444   C CG1 . ILE B 2 255 ? -56.224  1.360   -12.232 1.00 0.00 ? 255 ILE B CG1 1  
ATOM 5445   C CG2 . ILE B 2 255 ? -53.963  0.251   -12.105 1.00 0.00 ? 255 ILE B CG2 1  
ATOM 5446   C CD1 . ILE B 2 255 ? -56.264  1.604   -10.714 1.00 0.00 ? 255 ILE B CD1 1  
ATOM 5447   N N   . GLU B 2 256 ? -55.242  -2.517  -14.554 1.00 0.00 ? 256 GLU B N   1  
ATOM 5448   C CA  . GLU B 2 256 ? -54.539  -3.717  -14.948 1.00 0.00 ? 256 GLU B CA  1  
ATOM 5449   C C   . GLU B 2 256 ? -54.148  -3.795  -16.427 1.00 0.00 ? 256 GLU B C   1  
ATOM 5450   O O   . GLU B 2 256 ? -53.029  -4.099  -16.736 1.00 0.00 ? 256 GLU B O   1  
ATOM 5451   C CB  . GLU B 2 256 ? -55.423  -4.967  -14.565 1.00 0.00 ? 256 GLU B CB  1  
ATOM 5452   C CG  . GLU B 2 256 ? -55.634  -5.135  -13.065 1.00 0.00 ? 256 GLU B CG  1  
ATOM 5453   C CD  . GLU B 2 256 ? -54.595  -6.118  -12.473 1.00 0.00 ? 256 GLU B CD  1  
ATOM 5454   O OE1 . GLU B 2 256 ? -53.560  -6.454  -13.058 1.00 0.00 ? 256 GLU B OE1 1  
ATOM 5455   O OE2 . GLU B 2 256 ? -54.743  -6.578  -11.300 1.00 0.00 ? 256 GLU B OE2 1  
ATOM 5456   N N   . ILE B 2 257 ? -55.050  -3.370  -17.327 1.00 0.00 ? 257 ILE B N   1  
ATOM 5457   C CA  . ILE B 2 257 ? -54.769  -3.294  -18.708 1.00 0.00 ? 257 ILE B CA  1  
ATOM 5458   C C   . ILE B 2 257 ? -53.685  -2.287  -18.991 1.00 0.00 ? 257 ILE B C   1  
ATOM 5459   O O   . ILE B 2 257 ? -52.727  -2.520  -19.677 1.00 0.00 ? 257 ILE B O   1  
ATOM 5460   C CB  . ILE B 2 257 ? -55.882  -3.103  -19.727 1.00 0.00 ? 257 ILE B CB  1  
ATOM 5461   C CG1 . ILE B 2 257 ? -55.486  -3.159  -21.238 1.00 0.00 ? 257 ILE B CG1 1  
ATOM 5462   C CG2 . ILE B 2 257 ? -56.688  -1.761  -19.430 1.00 0.00 ? 257 ILE B CG2 1  
ATOM 5463   C CD1 . ILE B 2 257 ? -56.666  -2.957  -22.204 1.00 0.00 ? 257 ILE B CD1 1  
ATOM 5464   N N   . SER B 2 258 ? -53.799  -1.066  -18.316 1.00 0.00 ? 258 SER B N   1  
ATOM 5465   C CA  . SER B 2 258 ? -52.918  0.033   -18.431 1.00 0.00 ? 258 SER B CA  1  
ATOM 5466   C C   . SER B 2 258 ? -51.553  -0.400  -18.095 1.00 0.00 ? 258 SER B C   1  
ATOM 5467   O O   . SER B 2 258 ? -50.660  0.071   -18.740 1.00 0.00 ? 258 SER B O   1  
ATOM 5468   C CB  . SER B 2 258 ? -53.303  1.235   -17.589 1.00 0.00 ? 258 SER B CB  1  
ATOM 5469   O OG  . SER B 2 258 ? -54.544  1.805   -18.149 1.00 0.00 ? 258 SER B OG  1  
ATOM 5470   N N   . GLU B 2 259 ? -51.352  -1.324  -17.095 1.00 0.00 ? 259 GLU B N   1  
ATOM 5471   C CA  . GLU B 2 259 ? -50.085  -1.906  -16.660 1.00 0.00 ? 259 GLU B CA  1  
ATOM 5472   C C   . GLU B 2 259 ? -49.562  -2.708  -17.735 1.00 0.00 ? 259 GLU B C   1  
ATOM 5473   O O   . GLU B 2 259 ? -48.390  -2.707  -18.042 1.00 0.00 ? 259 GLU B O   1  
ATOM 5474   C CB  . GLU B 2 259 ? -50.246  -2.792  -15.346 1.00 0.00 ? 259 GLU B CB  1  
ATOM 5475   C CG  . GLU B 2 259 ? -48.916  -2.941  -14.499 1.00 0.00 ? 259 GLU B CG  1  
ATOM 5476   C CD  . GLU B 2 259 ? -47.919  -3.774  -15.214 1.00 0.00 ? 259 GLU B CD  1  
ATOM 5477   O OE1 . GLU B 2 259 ? -48.314  -4.886  -15.535 1.00 0.00 ? 259 GLU B OE1 1  
ATOM 5478   O OE2 . GLU B 2 259 ? -46.833  -3.319  -15.722 1.00 0.00 ? 259 GLU B OE2 1  
ATOM 5479   N N   . GLU B 2 260 ? -50.426  -3.482  -18.444 1.00 0.00 ? 260 GLU B N   1  
ATOM 5480   C CA  . GLU B 2 260 ? -49.961  -4.386  -19.471 1.00 0.00 ? 260 GLU B CA  1  
ATOM 5481   C C   . GLU B 2 260 ? -49.404  -3.608  -20.699 1.00 0.00 ? 260 GLU B C   1  
ATOM 5482   O O   . GLU B 2 260 ? -48.567  -4.158  -21.374 1.00 0.00 ? 260 GLU B O   1  
ATOM 5483   C CB  . GLU B 2 260 ? -50.899  -5.522  -19.993 1.00 0.00 ? 260 GLU B CB  1  
ATOM 5484   C CG  . GLU B 2 260 ? -51.611  -6.272  -18.938 1.00 0.00 ? 260 GLU B CG  1  
ATOM 5485   C CD  . GLU B 2 260 ? -50.759  -7.364  -18.333 1.00 0.00 ? 260 GLU B CD  1  
ATOM 5486   O OE1 . GLU B 2 260 ? -49.702  -7.098  -17.700 1.00 0.00 ? 260 GLU B OE1 1  
ATOM 5487   O OE2 . GLU B 2 260 ? -51.216  -8.523  -18.560 1.00 0.00 ? 260 GLU B OE2 1  
ATOM 5488   N N   . LEU B 2 261 ? -49.905  -2.473  -20.966 1.00 0.00 ? 261 LEU B N   1  
ATOM 5489   C CA  . LEU B 2 261 ? -49.370  -1.779  -22.140 1.00 0.00 ? 261 LEU B CA  1  
ATOM 5490   C C   . LEU B 2 261 ? -47.966  -1.383  -21.909 1.00 0.00 ? 261 LEU B C   1  
ATOM 5491   O O   . LEU B 2 261 ? -47.148  -1.420  -22.897 1.00 0.00 ? 261 LEU B O   1  
ATOM 5492   C CB  . LEU B 2 261 ? -50.184  -0.480  -22.509 1.00 0.00 ? 261 LEU B CB  1  
ATOM 5493   C CG  . LEU B 2 261 ? -51.746  -0.594  -22.337 1.00 0.00 ? 261 LEU B CG  1  
ATOM 5494   C CD1 . LEU B 2 261 ? -52.371  0.657   -22.891 1.00 0.00 ? 261 LEU B CD1 1  
ATOM 5495   C CD2 . LEU B 2 261 ? -52.219  -1.819  -23.194 1.00 0.00 ? 261 LEU B CD2 1  
ATOM 5496   N N   . GLN B 2 262 ? -47.584  -1.244  -20.565 1.00 0.00 ? 262 GLN B N   1  
ATOM 5497   C CA  . GLN B 2 262 ? -46.128  -0.955  -20.199 1.00 0.00 ? 262 GLN B CA  1  
ATOM 5498   C C   . GLN B 2 262 ? -45.176  -1.997  -20.751 1.00 0.00 ? 262 GLN B C   1  
ATOM 5499   O O   . GLN B 2 262 ? -44.076  -1.602  -21.171 1.00 0.00 ? 262 GLN B O   1  
ATOM 5500   C CB  . GLN B 2 262 ? -45.859  -0.941  -18.677 1.00 0.00 ? 262 GLN B CB  1  
ATOM 5501   C CG  . GLN B 2 262 ? -46.657  0.089   -17.876 1.00 0.00 ? 262 GLN B CG  1  
ATOM 5502   C CD  . GLN B 2 262 ? -46.832  1.462   -18.595 1.00 0.00 ? 262 GLN B CD  1  
ATOM 5503   O OE1 . GLN B 2 262 ? -45.793  2.120   -18.836 1.00 0.00 ? 262 GLN B OE1 1  
ATOM 5504   N NE2 . GLN B 2 262 ? -48.122  1.842   -18.758 1.00 0.00 ? 262 GLN B NE2 1  
ATOM 5505   N N   . ASN B 2 263 ? -45.576  -3.263  -20.719 1.00 0.00 ? 263 ASN B N   1  
ATOM 5506   C CA  . ASN B 2 263 ? -44.786  -4.407  -21.199 1.00 0.00 ? 263 ASN B CA  1  
ATOM 5507   C C   . ASN B 2 263 ? -44.472  -4.283  -22.690 1.00 0.00 ? 263 ASN B C   1  
ATOM 5508   O O   . ASN B 2 263 ? -43.348  -4.596  -23.078 1.00 0.00 ? 263 ASN B O   1  
ATOM 5509   C CB  . ASN B 2 263 ? -45.231  -5.851  -20.889 1.00 0.00 ? 263 ASN B CB  1  
ATOM 5510   C CG  . ASN B 2 263 ? -46.587  -6.331  -21.438 1.00 0.00 ? 263 ASN B CG  1  
ATOM 5511   O OD1 . ASN B 2 263 ? -46.817  -6.340  -22.642 1.00 0.00 ? 263 ASN B OD1 1  
ATOM 5512   N ND2 . ASN B 2 263 ? -47.445  -6.795  -20.427 1.00 0.00 ? 263 ASN B ND2 1  
ATOM 5513   N N   . TYR B 2 264 ? -45.453  -3.811  -23.460 1.00 0.00 ? 264 TYR B N   1  
ATOM 5514   C CA  . TYR B 2 264 ? -45.296  -3.648  -24.872 1.00 0.00 ? 264 TYR B CA  1  
ATOM 5515   C C   . TYR B 2 264 ? -44.258  -2.738  -25.137 1.00 0.00 ? 264 TYR B C   1  
ATOM 5516   O O   . TYR B 2 264 ? -43.498  -3.058  -26.038 1.00 0.00 ? 264 TYR B O   1  
ATOM 5517   C CB  . TYR B 2 264 ? -46.557  -3.115  -25.483 1.00 0.00 ? 264 TYR B CB  1  
ATOM 5518   C CG  . TYR B 2 264 ? -46.679  -3.549  -26.947 1.00 0.00 ? 264 TYR B CG  1  
ATOM 5519   C CD1 . TYR B 2 264 ? -47.168  -4.845  -27.200 1.00 0.00 ? 264 TYR B CD1 1  
ATOM 5520   C CD2 . TYR B 2 264 ? -46.137  -2.868  -27.996 1.00 0.00 ? 264 TYR B CD2 1  
ATOM 5521   C CE1 . TYR B 2 264 ? -47.390  -5.247  -28.480 1.00 0.00 ? 264 TYR B CE1 1  
ATOM 5522   C CE2 . TYR B 2 264 ? -46.202  -3.337  -29.372 1.00 0.00 ? 264 TYR B CE2 1  
ATOM 5523   C CZ  . TYR B 2 264 ? -46.879  -4.492  -29.597 1.00 0.00 ? 264 TYR B CZ  1  
ATOM 5524   O OH  . TYR B 2 264 ? -47.066  -4.967  -30.904 1.00 0.00 ? 264 TYR B OH  1  
ATOM 5525   N N   . THR B 2 265 ? -44.277  -1.583  -24.437 1.00 0.00 ? 265 THR B N   1  
ATOM 5526   C CA  . THR B 2 265 ? -43.353  -0.508  -24.700 1.00 0.00 ? 265 THR B CA  1  
ATOM 5527   C C   . THR B 2 265 ? -42.003  -1.010  -24.498 1.00 0.00 ? 265 THR B C   1  
ATOM 5528   O O   . THR B 2 265 ? -41.094  -0.725  -25.283 1.00 0.00 ? 265 THR B O   1  
ATOM 5529   C CB  . THR B 2 265 ? -43.709  0.580   -23.767 1.00 0.00 ? 265 THR B CB  1  
ATOM 5530   O OG1 . THR B 2 265 ? -45.168  0.660   -23.673 1.00 0.00 ? 265 THR B OG1 1  
ATOM 5531   C CG2 . THR B 2 265 ? -43.141  1.825   -24.312 1.00 0.00 ? 265 THR B CG2 1  
ATOM 5532   N N   . ALA B 2 266 ? -41.888  -1.839  -23.466 1.00 0.00 ? 266 ALA B N   1  
ATOM 5533   C CA  . ALA B 2 266 ? -40.653  -2.437  -23.143 1.00 0.00 ? 266 ALA B CA  1  
ATOM 5534   C C   . ALA B 2 266 ? -40.130  -3.305  -24.261 1.00 0.00 ? 266 ALA B C   1  
ATOM 5535   O O   . ALA B 2 266 ? -39.010  -3.177  -24.632 1.00 0.00 ? 266 ALA B O   1  
ATOM 5536   C CB  . ALA B 2 266 ? -40.744  -3.362  -21.909 1.00 0.00 ? 266 ALA B CB  1  
ATOM 5537   N N   . PHE B 2 267 ? -41.018  -4.050  -24.852 1.00 0.00 ? 267 PHE B N   1  
ATOM 5538   C CA  . PHE B 2 267 ? -40.699  -4.783  -25.995 1.00 0.00 ? 267 PHE B CA  1  
ATOM 5539   C C   . PHE B 2 267 ? -40.286  -3.889  -27.094 1.00 0.00 ? 267 PHE B C   1  
ATOM 5540   O O   . PHE B 2 267 ? -39.275  -4.230  -27.706 1.00 0.00 ? 267 PHE B O   1  
ATOM 5541   C CB  . PHE B 2 267 ? -41.731  -5.810  -26.458 1.00 0.00 ? 267 PHE B CB  1  
ATOM 5542   C CG  . PHE B 2 267 ? -41.860  -6.859  -25.450 1.00 0.00 ? 267 PHE B CG  1  
ATOM 5543   C CD1 . PHE B 2 267 ? -40.878  -7.909  -25.293 1.00 0.00 ? 267 PHE B CD1 1  
ATOM 5544   C CD2 . PHE B 2 267 ? -43.085  -7.090  -24.791 1.00 0.00 ? 267 PHE B CD2 1  
ATOM 5545   C CE1 . PHE B 2 267 ? -41.070  -8.975  -24.396 1.00 0.00 ? 267 PHE B CE1 1  
ATOM 5546   C CE2 . PHE B 2 267 ? -43.295  -8.184  -23.949 1.00 0.00 ? 267 PHE B CE2 1  
ATOM 5547   C CZ  . PHE B 2 267 ? -42.308  -9.116  -23.785 1.00 0.00 ? 267 PHE B CZ  1  
ATOM 5548   N N   . VAL B 2 268 ? -40.942  -2.764  -27.418 1.00 0.00 ? 268 VAL B N   1  
ATOM 5549   C CA  . VAL B 2 268 ? -40.511  -1.926  -28.529 1.00 0.00 ? 268 VAL B CA  1  
ATOM 5550   C C   . VAL B 2 268 ? -39.104  -1.424  -28.321 1.00 0.00 ? 268 VAL B C   1  
ATOM 5551   O O   . VAL B 2 268 ? -38.292  -1.656  -29.220 1.00 0.00 ? 268 VAL B O   1  
ATOM 5552   C CB  . VAL B 2 268 ? -41.431  -0.675  -28.780 1.00 0.00 ? 268 VAL B CB  1  
ATOM 5553   C CG1 . VAL B 2 268 ? -41.025  0.050   -30.102 1.00 0.00 ? 268 VAL B CG1 1  
ATOM 5554   C CG2 . VAL B 2 268 ? -42.894  -0.991  -28.843 1.00 0.00 ? 268 VAL B CG2 1  
ATOM 5555   N N   . ASN B 2 269 ? -38.700  -0.894  -27.140 1.00 0.00 ? 269 ASN B N   1  
ATOM 5556   C CA  . ASN B 2 269 ? -37.241  -0.518  -27.017 1.00 0.00 ? 269 ASN B CA  1  
ATOM 5557   C C   . ASN B 2 269 ? -36.378  -1.713  -27.131 1.00 0.00 ? 269 ASN B C   1  
ATOM 5558   O O   . ASN B 2 269 ? -35.297  -1.647  -27.678 1.00 0.00 ? 269 ASN B O   1  
ATOM 5559   C CB  . ASN B 2 269 ? -36.996  0.311   -25.735 1.00 0.00 ? 269 ASN B CB  1  
ATOM 5560   C CG  . ASN B 2 269 ? -37.403  -0.329  -24.405 1.00 0.00 ? 269 ASN B CG  1  
ATOM 5561   O OD1 . ASN B 2 269 ? -38.578  -0.113  -24.063 1.00 0.00 ? 269 ASN B OD1 1  
ATOM 5562   N ND2 . ASN B 2 269 ? -36.549  -1.020  -23.648 1.00 0.00 ? 269 ASN B ND2 1  
ATOM 5563   N N   . ASN B 2 270 ? -36.810  -2.895  -26.616 1.00 0.00 ? 270 ASN B N   1  
ATOM 5564   C CA  . ASN B 2 270 ? -35.998  -4.102  -26.646 1.00 0.00 ? 270 ASN B CA  1  
ATOM 5565   C C   . ASN B 2 270 ? -35.716  -4.491  -28.107 1.00 0.00 ? 270 ASN B C   1  
ATOM 5566   O O   . ASN B 2 270 ? -34.589  -4.770  -28.460 1.00 0.00 ? 270 ASN B O   1  
ATOM 5567   C CB  . ASN B 2 270 ? -36.692  -5.307  -25.956 1.00 0.00 ? 270 ASN B CB  1  
ATOM 5568   C CG  . ASN B 2 270 ? -36.657  -5.084  -24.436 1.00 0.00 ? 270 ASN B CG  1  
ATOM 5569   O OD1 . ASN B 2 270 ? -35.965  -4.127  -23.988 1.00 0.00 ? 270 ASN B OD1 1  
ATOM 5570   N ND2 . ASN B 2 270 ? -37.289  -5.969  -23.627 1.00 0.00 ? 270 ASN B ND2 1  
ATOM 5571   N N   . LEU B 2 271 ? -36.690  -4.448  -29.028 1.00 0.00 ? 271 LEU B N   1  
ATOM 5572   C CA  . LEU B 2 271 ? -36.507  -4.779  -30.462 1.00 0.00 ? 271 LEU B CA  1  
ATOM 5573   C C   . LEU B 2 271 ? -35.533  -3.830  -31.103 1.00 0.00 ? 271 LEU B C   1  
ATOM 5574   O O   . LEU B 2 271 ? -34.576  -4.285  -31.820 1.00 0.00 ? 271 LEU B O   1  
ATOM 5575   C CB  . LEU B 2 271 ? -37.909  -4.708  -31.187 1.00 0.00 ? 271 LEU B CB  1  
ATOM 5576   C CG  . LEU B 2 271 ? -38.965  -5.780  -30.765 1.00 0.00 ? 271 LEU B CG  1  
ATOM 5577   C CD1 . LEU B 2 271 ? -40.306  -5.234  -31.294 1.00 0.00 ? 271 LEU B CD1 1  
ATOM 5578   C CD2 . LEU B 2 271 ? -38.527  -7.158  -31.314 1.00 0.00 ? 271 LEU B CD2 1  
ATOM 5579   N N   . VAL B 2 272 ? -35.677  -2.501  -30.752 1.00 0.00 ? 272 VAL B N   1  
ATOM 5580   C CA  . VAL B 2 272 ? -34.790  -1.519  -31.233 1.00 0.00 ? 272 VAL B CA  1  
ATOM 5581   C C   . VAL B 2 272 ? -33.376  -1.741  -30.726 1.00 0.00 ? 272 VAL B C   1  
ATOM 5582   O O   . VAL B 2 272 ? -32.424  -1.663  -31.454 1.00 0.00 ? 272 VAL B O   1  
ATOM 5583   C CB  . VAL B 2 272 ? -35.282  -0.066  -30.948 1.00 0.00 ? 272 VAL B CB  1  
ATOM 5584   C CG1 . VAL B 2 272 ? -34.165  0.952   -31.468 1.00 0.00 ? 272 VAL B CG1 1  
ATOM 5585   C CG2 . VAL B 2 272 ? -36.622  0.328   -31.609 1.00 0.00 ? 272 VAL B CG2 1  
ATOM 5586   N N   . SER B 2 273 ? -33.242  -2.085  -29.384 1.00 0.00 ? 273 SER B N   1  
ATOM 5587   C CA  . SER B 2 273 ? -32.044  -2.299  -28.625 1.00 0.00 ? 273 SER B CA  1  
ATOM 5588   C C   . SER B 2 273 ? -31.226  -3.390  -29.196 1.00 0.00 ? 273 SER B C   1  
ATOM 5589   O O   . SER B 2 273 ? -30.027  -3.314  -29.000 1.00 0.00 ? 273 SER B O   1  
ATOM 5590   C CB  . SER B 2 273 ? -32.248  -2.621  -27.106 1.00 0.00 ? 273 SER B CB  1  
ATOM 5591   O OG  . SER B 2 273 ? -32.044  -1.411  -26.419 1.00 0.00 ? 273 SER B OG  1  
ATOM 5592   N N   . SER B 2 274 ? -31.891  -4.405  -29.823 1.00 0.00 ? 274 SER B N   1  
ATOM 5593   C CA  . SER B 2 274 ? -31.244  -5.565  -30.478 1.00 0.00 ? 274 SER B CA  1  
ATOM 5594   C C   . SER B 2 274 ? -30.066  -5.111  -31.247 1.00 0.00 ? 274 SER B C   1  
ATOM 5595   O O   . SER B 2 274 ? -29.005  -5.706  -31.058 1.00 0.00 ? 274 SER B O   1  
ATOM 5596   C CB  . SER B 2 274 ? -32.113  -6.251  -31.525 1.00 0.00 ? 274 SER B CB  1  
ATOM 5597   O OG  . SER B 2 274 ? -33.183  -6.965  -30.858 1.00 0.00 ? 274 SER B OG  1  
ATOM 5598   N N   . GLY B 2 275 ? -30.191  -4.048  -32.144 1.00 0.00 ? 275 GLY B N   1  
ATOM 5599   C CA  . GLY B 2 275 ? -29.076  -3.534  -32.926 1.00 0.00 ? 275 GLY B CA  1  
ATOM 5600   C C   . GLY B 2 275 ? -28.721  -4.370  -34.052 1.00 0.00 ? 275 GLY B C   1  
ATOM 5601   O O   . GLY B 2 275 ? -27.826  -4.013  -34.828 1.00 0.00 ? 275 GLY B O   1  
ATOM 5602   N N   . THR B 2 276 ? -29.403  -5.603  -34.232 1.00 0.00 ? 276 THR B N   1  
ATOM 5603   C CA  . THR B 2 276 ? -29.213  -6.435  -35.338 1.00 0.00 ? 276 THR B CA  1  
ATOM 5604   C C   . THR B 2 276 ? -30.349  -6.208  -36.283 1.00 0.00 ? 276 THR B C   1  
ATOM 5605   O O   . THR B 2 276 ? -31.382  -5.805  -35.775 1.00 0.00 ? 276 THR B O   1  
ATOM 5606   C CB  . THR B 2 276 ? -29.088  -7.945  -34.992 1.00 0.00 ? 276 THR B CB  1  
ATOM 5607   O OG1 . THR B 2 276 ? -28.443  -8.714  -36.026 1.00 0.00 ? 276 THR B OG1 1  
ATOM 5608   C CG2 . THR B 2 276 ? -30.389  -8.562  -34.541 1.00 0.00 ? 276 THR B CG2 1  
ATOM 5609   N N   . VAL B 2 277 ? -30.168  -6.515  -37.571 1.00 0.00 ? 277 VAL B N   1  
ATOM 5610   C CA  . VAL B 2 277 ? -31.321  -6.469  -38.427 1.00 0.00 ? 277 VAL B CA  1  
ATOM 5611   C C   . VAL B 2 277 ? -32.294  -7.511  -38.001 1.00 0.00 ? 277 VAL B C   1  
ATOM 5612   O O   . VAL B 2 277 ? -31.947  -8.698  -37.925 1.00 0.00 ? 277 VAL B O   1  
ATOM 5613   C CB  . VAL B 2 277 ? -31.000  -6.531  -39.945 1.00 0.00 ? 277 VAL B CB  1  
ATOM 5614   C CG1 . VAL B 2 277 ? -30.466  -7.894  -40.437 1.00 0.00 ? 277 VAL B CG1 1  
ATOM 5615   C CG2 . VAL B 2 277 ? -32.255  -5.946  -40.738 1.00 0.00 ? 277 VAL B CG2 1  
ATOM 5616   N N   . VAL B 2 278 ? -33.557  -7.082  -37.803 1.00 0.00 ? 278 VAL B N   1  
ATOM 5617   C CA  . VAL B 2 278 ? -34.636  -7.908  -37.325 1.00 0.00 ? 278 VAL B CA  1  
ATOM 5618   C C   . VAL B 2 278 ? -35.594  -8.003  -38.525 1.00 0.00 ? 278 VAL B C   1  
ATOM 5619   O O   . VAL B 2 278 ? -35.838  -7.048  -39.296 1.00 0.00 ? 278 VAL B O   1  
ATOM 5620   C CB  . VAL B 2 278 ? -35.415  -7.355  -36.169 1.00 0.00 ? 278 VAL B CB  1  
ATOM 5621   C CG1 . VAL B 2 278 ? -36.629  -8.202  -35.689 1.00 0.00 ? 278 VAL B CG1 1  
ATOM 5622   C CG2 . VAL B 2 278 ? -34.517  -7.056  -34.967 1.00 0.00 ? 278 VAL B CG2 1  
ATOM 5623   N N   . SER B 2 279 ? -36.109  -9.180  -38.811 1.00 0.00 ? 279 SER B N   1  
ATOM 5624   C CA  . SER B 2 279 ? -36.989  -9.464  -39.943 1.00 0.00 ? 279 SER B CA  1  
ATOM 5625   C C   . SER B 2 279 ? -38.382  -9.341  -39.469 1.00 0.00 ? 279 SER B C   1  
ATOM 5626   O O   . SER B 2 279 ? -38.537  -9.277  -38.283 1.00 0.00 ? 279 SER B O   1  
ATOM 5627   C CB  . SER B 2 279 ? -36.761  -10.848 -40.483 1.00 0.00 ? 279 SER B CB  1  
ATOM 5628   O OG  . SER B 2 279 ? -37.402  -11.085 -41.754 1.00 0.00 ? 279 SER B OG  1  
ATOM 5629   N N   . LEU B 2 280 ? -39.361  -9.375  -40.358 1.00 0.00 ? 280 LEU B N   1  
ATOM 5630   C CA  . LEU B 2 280 ? -40.727  -9.488  -39.936 1.00 0.00 ? 280 LEU B CA  1  
ATOM 5631   C C   . LEU B 2 280 ? -41.054  -10.843 -39.279 1.00 0.00 ? 280 LEU B C   1  
ATOM 5632   O O   . LEU B 2 280 ? -41.749  -10.976 -38.288 1.00 0.00 ? 280 LEU B O   1  
ATOM 5633   C CB  . LEU B 2 280 ? -41.654  -9.327  -41.179 1.00 0.00 ? 280 LEU B CB  1  
ATOM 5634   C CG  . LEU B 2 280 ? -41.566  -7.821  -41.722 1.00 0.00 ? 280 LEU B CG  1  
ATOM 5635   C CD1 . LEU B 2 280 ? -41.799  -6.787  -40.623 1.00 0.00 ? 280 LEU B CD1 1  
ATOM 5636   C CD2 . LEU B 2 280 ? -40.383  -7.551  -42.605 1.00 0.00 ? 280 LEU B CD2 1  
ATOM 5637   N N   . LYS B 2 281 ? -40.348  -11.895 -39.775 1.00 0.00 ? 281 LYS B N   1  
ATOM 5638   C CA  . LYS B 2 281 ? -40.377  -13.274 -39.293 1.00 0.00 ? 281 LYS B CA  1  
ATOM 5639   C C   . LYS B 2 281 ? -39.939  -13.302 -37.809 1.00 0.00 ? 281 LYS B C   1  
ATOM 5640   O O   . LYS B 2 281 ? -40.650  -13.858 -36.946 1.00 0.00 ? 281 LYS B O   1  
ATOM 5641   C CB  . LYS B 2 281 ? -39.505  -14.245 -40.108 1.00 0.00 ? 281 LYS B CB  1  
ATOM 5642   C CG  . LYS B 2 281 ? -39.887  -14.387 -41.546 1.00 0.00 ? 281 LYS B CG  1  
ATOM 5643   C CD  . LYS B 2 281 ? -38.965  -15.168 -42.441 1.00 0.00 ? 281 LYS B CD  1  
ATOM 5644   C CE  . LYS B 2 281 ? -37.528  -14.605 -42.573 1.00 0.00 ? 281 LYS B CE  1  
ATOM 5645   N NZ  . LYS B 2 281 ? -36.576  -15.494 -43.411 1.00 0.00 ? 281 LYS B NZ  1  
ATOM 5646   N N   . SER B 2 282 ? -38.807  -12.561 -37.607 1.00 0.00 ? 282 SER B N   1  
ATOM 5647   C CA  . SER B 2 282 ? -38.213  -12.370 -36.329 1.00 0.00 ? 282 SER B CA  1  
ATOM 5648   C C   . SER B 2 282 ? -39.133  -11.610 -35.434 1.00 0.00 ? 282 SER B C   1  
ATOM 5649   O O   . SER B 2 282 ? -39.235  -11.878 -34.202 1.00 0.00 ? 282 SER B O   1  
ATOM 5650   C CB  . SER B 2 282 ? -36.908  -11.643 -36.443 1.00 0.00 ? 282 SER B CB  1  
ATOM 5651   O OG  . SER B 2 282 ? -36.117  -12.166 -37.415 1.00 0.00 ? 282 SER B OG  1  
ATOM 5652   N N   . LEU B 2 283 ? -39.844  -10.564 -35.961 1.00 0.00 ? 283 LEU B N   1  
ATOM 5653   C CA  . LEU B 2 283 ? -40.660  -9.722  -35.152 1.00 0.00 ? 283 LEU B CA  1  
ATOM 5654   C C   . LEU B 2 283 ? -41.703  -10.575 -34.513 1.00 0.00 ? 283 LEU B C   1  
ATOM 5655   O O   . LEU B 2 283 ? -42.041  -10.397 -33.351 1.00 0.00 ? 283 LEU B O   1  
ATOM 5656   C CB  . LEU B 2 283 ? -41.143  -8.551  -36.016 1.00 0.00 ? 283 LEU B CB  1  
ATOM 5657   C CG  . LEU B 2 283 ? -42.087  -7.588  -35.382 1.00 0.00 ? 283 LEU B CG  1  
ATOM 5658   C CD1 . LEU B 2 283 ? -43.566  -8.109  -35.444 1.00 0.00 ? 283 LEU B CD1 1  
ATOM 5659   C CD2 . LEU B 2 283 ? -41.700  -7.041  -33.972 1.00 0.00 ? 283 LEU B CD2 1  
ATOM 5660   N N   . TYR B 2 284 ? -42.277  -11.531 -35.280 1.00 0.00 ? 284 TYR B N   1  
ATOM 5661   C CA  . TYR B 2 284 ? -43.372  -12.395 -34.776 1.00 0.00 ? 284 TYR B CA  1  
ATOM 5662   C C   . TYR B 2 284 ? -42.931  -13.311 -33.637 1.00 0.00 ? 284 TYR B C   1  
ATOM 5663   O O   . TYR B 2 284 ? -43.687  -13.424 -32.670 1.00 0.00 ? 284 TYR B O   1  
ATOM 5664   C CB  . TYR B 2 284 ? -43.856  -13.313 -35.906 1.00 0.00 ? 284 TYR B CB  1  
ATOM 5665   C CG  . TYR B 2 284 ? -44.521  -12.518 -36.908 1.00 0.00 ? 284 TYR B CG  1  
ATOM 5666   C CD1 . TYR B 2 284 ? -45.613  -11.694 -36.655 1.00 0.00 ? 284 TYR B CD1 1  
ATOM 5667   C CD2 . TYR B 2 284 ? -43.975  -12.550 -38.199 1.00 0.00 ? 284 TYR B CD2 1  
ATOM 5668   C CE1 . TYR B 2 284 ? -46.083  -10.862 -37.661 1.00 0.00 ? 284 TYR B CE1 1  
ATOM 5669   C CE2 . TYR B 2 284 ? -44.490  -11.793 -39.268 1.00 0.00 ? 284 TYR B CE2 1  
ATOM 5670   C CZ  . TYR B 2 284 ? -45.562  -10.977 -38.989 1.00 0.00 ? 284 TYR B CZ  1  
ATOM 5671   O OH  . TYR B 2 284 ? -46.105  -10.143 -39.971 1.00 0.00 ? 284 TYR B OH  1  
ATOM 5672   N N   . ARG B 2 285 ? -41.725  -13.942 -33.855 1.00 0.00 ? 285 ARG B N   1  
ATOM 5673   C CA  . ARG B 2 285 ? -41.315  -14.835 -32.906 1.00 0.00 ? 285 ARG B CA  1  
ATOM 5674   C C   . ARG B 2 285 ? -41.025  -14.291 -31.585 1.00 0.00 ? 285 ARG B C   1  
ATOM 5675   O O   . ARG B 2 285 ? -41.572  -14.745 -30.555 1.00 0.00 ? 285 ARG B O   1  
ATOM 5676   C CB  . ARG B 2 285 ? -40.195  -15.748 -33.519 1.00 0.00 ? 285 ARG B CB  1  
ATOM 5677   C CG  . ARG B 2 285 ? -38.977  -15.132 -34.272 1.00 0.00 ? 285 ARG B CG  1  
ATOM 5678   C CD  . ARG B 2 285 ? -37.721  -14.968 -33.457 1.00 0.00 ? 285 ARG B CD  1  
ATOM 5679   N NE  . ARG B 2 285 ? -36.635  -14.071 -34.094 1.00 0.00 ? 285 ARG B NE  1  
ATOM 5680   C CZ  . ARG B 2 285 ? -35.460  -14.001 -33.475 1.00 0.00 ? 285 ARG B CZ  1  
ATOM 5681   N NH1 . ARG B 2 285 ? -35.065  -15.082 -32.687 1.00 0.00 ? 285 ARG B NH1 1  
ATOM 5682   N NH2 . ARG B 2 285 ? -34.514  -13.023 -33.674 1.00 0.00 ? 285 ARG B NH2 1  
ATOM 5683   N N   . GLU B 2 286 ? -40.321  -13.115 -31.582 1.00 0.00 ? 286 GLU B N   1  
ATOM 5684   C CA  . GLU B 2 286 ? -39.994  -12.450 -30.388 1.00 0.00 ? 286 GLU B CA  1  
ATOM 5685   C C   . GLU B 2 286 ? -41.196  -11.969 -29.587 1.00 0.00 ? 286 GLU B C   1  
ATOM 5686   O O   . GLU B 2 286 ? -41.187  -12.015 -28.366 1.00 0.00 ? 286 GLU B O   1  
ATOM 5687   C CB  . GLU B 2 286 ? -39.119  -11.215 -30.644 1.00 0.00 ? 286 GLU B CB  1  
ATOM 5688   C CG  . GLU B 2 286 ? -37.681  -11.571 -31.128 1.00 0.00 ? 286 GLU B CG  1  
ATOM 5689   C CD  . GLU B 2 286 ? -37.075  -12.587 -30.141 1.00 0.00 ? 286 GLU B CD  1  
ATOM 5690   O OE1 . GLU B 2 286 ? -36.932  -12.318 -28.915 1.00 0.00 ? 286 GLU B OE1 1  
ATOM 5691   O OE2 . GLU B 2 286 ? -36.894  -13.788 -30.669 1.00 0.00 ? 286 GLU B OE2 1  
ATOM 5692   N N   . ILE B 2 287 ? -42.261  -11.470 -30.215 1.00 0.00 ? 287 ILE B N   1  
ATOM 5693   C CA  . ILE B 2 287 ? -43.441  -10.971 -29.522 1.00 0.00 ? 287 ILE B CA  1  
ATOM 5694   C C   . ILE B 2 287 ? -44.700  -11.857 -29.591 1.00 0.00 ? 287 ILE B C   1  
ATOM 5695   O O   . ILE B 2 287 ? -45.817  -11.328 -29.613 1.00 0.00 ? 287 ILE B O   1  
ATOM 5696   C CB  . ILE B 2 287 ? -43.547  -9.505  -30.116 1.00 0.00 ? 287 ILE B CB  1  
ATOM 5697   C CG1 . ILE B 2 287 ? -44.188  -8.563  -29.084 1.00 0.00 ? 287 ILE B CG1 1  
ATOM 5698   C CG2 . ILE B 2 287 ? -44.360  -9.515  -31.378 1.00 0.00 ? 287 ILE B CG2 1  
ATOM 5699   C CD1 . ILE B 2 287 ? -44.336  -7.110  -29.567 1.00 0.00 ? 287 ILE B CD1 1  
ATOM 5700   N N   . TYR B 2 288 ? -44.543  -13.199 -29.466 1.00 0.00 ? 288 TYR B N   1  
ATOM 5701   C CA  . TYR B 2 288 ? -45.629  -14.077 -29.487 1.00 0.00 ? 288 TYR B CA  1  
ATOM 5702   C C   . TYR B 2 288 ? -46.449  -13.909 -28.233 1.00 0.00 ? 288 TYR B C   1  
ATOM 5703   O O   . TYR B 2 288 ? -47.703  -14.003 -28.279 1.00 0.00 ? 288 TYR B O   1  
ATOM 5704   C CB  . TYR B 2 288 ? -45.303  -15.625 -29.608 1.00 0.00 ? 288 TYR B CB  1  
ATOM 5705   C CG  . TYR B 2 288 ? -44.901  -16.080 -31.001 1.00 0.00 ? 288 TYR B CG  1  
ATOM 5706   C CD1 . TYR B 2 288 ? -45.748  -15.716 -32.087 1.00 0.00 ? 288 TYR B CD1 1  
ATOM 5707   C CD2 . TYR B 2 288 ? -43.863  -17.034 -31.151 1.00 0.00 ? 288 TYR B CD2 1  
ATOM 5708   C CE1 . TYR B 2 288 ? -45.422  -16.206 -33.370 1.00 0.00 ? 288 TYR B CE1 1  
ATOM 5709   C CE2 . TYR B 2 288 ? -43.654  -17.536 -32.410 1.00 0.00 ? 288 TYR B CE2 1  
ATOM 5710   C CZ  . TYR B 2 288 ? -44.441  -17.130 -33.533 1.00 0.00 ? 288 TYR B CZ  1  
ATOM 5711   O OH  . TYR B 2 288 ? -44.264  -17.678 -34.839 1.00 0.00 ? 288 TYR B OH  1  
ATOM 5712   N N   . GLU B 2 289 ? -45.706  -13.807 -27.125 1.00 0.00 ? 289 GLU B N   1  
ATOM 5713   C CA  . GLU B 2 289 ? -46.250  -13.978 -25.790 1.00 0.00 ? 289 GLU B CA  1  
ATOM 5714   C C   . GLU B 2 289 ? -47.361  -12.940 -25.542 1.00 0.00 ? 289 GLU B C   1  
ATOM 5715   O O   . GLU B 2 289 ? -48.457  -13.302 -25.128 1.00 0.00 ? 289 GLU B O   1  
ATOM 5716   C CB  . GLU B 2 289 ? -45.157  -13.912 -24.669 1.00 0.00 ? 289 GLU B CB  1  
ATOM 5717   C CG  . GLU B 2 289 ? -43.826  -14.506 -25.061 1.00 0.00 ? 289 GLU B CG  1  
ATOM 5718   C CD  . GLU B 2 289 ? -43.027  -13.616 -25.995 1.00 0.00 ? 289 GLU B CD  1  
ATOM 5719   O OE1 . GLU B 2 289 ? -43.269  -12.356 -26.038 1.00 0.00 ? 289 GLU B OE1 1  
ATOM 5720   O OE2 . GLU B 2 289 ? -42.085  -14.172 -26.663 1.00 0.00 ? 289 GLU B OE2 1  
ATOM 5721   N N   . ASN B 2 290 ? -47.155  -11.620 -26.011 1.00 0.00 ? 290 ASN B N   1  
ATOM 5722   C CA  . ASN B 2 290 ? -48.106  -10.528 -26.014 1.00 0.00 ? 290 ASN B CA  1  
ATOM 5723   C C   . ASN B 2 290 ? -49.314  -10.735 -26.808 1.00 0.00 ? 290 ASN B C   1  
ATOM 5724   O O   . ASN B 2 290 ? -50.374  -10.322 -26.306 1.00 0.00 ? 290 ASN B O   1  
ATOM 5725   C CB  . ASN B 2 290 ? -47.508  -9.179  -26.614 1.00 0.00 ? 290 ASN B CB  1  
ATOM 5726   C CG  . ASN B 2 290 ? -46.242  -8.698  -25.953 1.00 0.00 ? 290 ASN B CG  1  
ATOM 5727   O OD1 . ASN B 2 290 ? -46.172  -7.507  -25.576 1.00 0.00 ? 290 ASN B OD1 1  
ATOM 5728   N ND2 . ASN B 2 290 ? -45.171  -9.591  -25.856 1.00 0.00 ? 290 ASN B ND2 1  
ATOM 5729   N N   . ILE B 2 291 ? -49.277  -11.490 -27.971 1.00 0.00 ? 291 ILE B N   1  
ATOM 5730   C CA  . ILE B 2 291 ? -50.401  -11.861 -28.714 1.00 0.00 ? 291 ILE B CA  1  
ATOM 5731   C C   . ILE B 2 291 ? -51.275  -12.691 -27.987 1.00 0.00 ? 291 ILE B C   1  
ATOM 5732   O O   . ILE B 2 291 ? -52.439  -12.499 -28.044 1.00 0.00 ? 291 ILE B O   1  
ATOM 5733   C CB  . ILE B 2 291 ? -50.081  -12.481 -30.084 1.00 0.00 ? 291 ILE B CB  1  
ATOM 5734   C CG1 . ILE B 2 291 ? -49.255  -11.415 -30.925 1.00 0.00 ? 291 ILE B CG1 1  
ATOM 5735   C CG2 . ILE B 2 291 ? -51.339  -12.916 -30.831 1.00 0.00 ? 291 ILE B CG2 1  
ATOM 5736   C CD1 . ILE B 2 291 ? -48.859  -11.896 -32.331 1.00 0.00 ? 291 ILE B CD1 1  
ATOM 5737   N N   . ILE B 2 292 ? -50.726  -13.648 -27.219 1.00 0.00 ? 292 ILE B N   1  
ATOM 5738   C CA  . ILE B 2 292 ? -51.554  -14.502 -26.426 1.00 0.00 ? 292 ILE B CA  1  
ATOM 5739   C C   . ILE B 2 292 ? -52.221  -13.772 -25.247 1.00 0.00 ? 292 ILE B C   1  
ATOM 5740   O O   . ILE B 2 292 ? -53.417  -13.894 -25.105 1.00 0.00 ? 292 ILE B O   1  
ATOM 5741   C CB  . ILE B 2 292 ? -50.843  -15.662 -25.801 1.00 0.00 ? 292 ILE B CB  1  
ATOM 5742   C CG1 . ILE B 2 292 ? -49.835  -16.516 -26.752 1.00 0.00 ? 292 ILE B CG1 1  
ATOM 5743   C CG2 . ILE B 2 292 ? -51.886  -16.697 -25.263 1.00 0.00 ? 292 ILE B CG2 1  
ATOM 5744   C CD1 . ILE B 2 292 ? -49.143  -17.690 -26.039 1.00 0.00 ? 292 ILE B CD1 1  
ATOM 5745   N N   . ARG B 2 293 ? -51.457  -12.981 -24.441 1.00 0.00 ? 293 ARG B N   1  
ATOM 5746   C CA  . ARG B 2 293 ? -52.067  -12.449 -23.272 1.00 0.00 ? 293 ARG B CA  1  
ATOM 5747   C C   . ARG B 2 293 ? -53.187  -11.431 -23.632 1.00 0.00 ? 293 ARG B C   1  
ATOM 5748   O O   . ARG B 2 293 ? -54.340  -11.553 -23.161 1.00 0.00 ? 293 ARG B O   1  
ATOM 5749   C CB  . ARG B 2 293 ? -51.035  -11.894 -22.239 1.00 0.00 ? 293 ARG B CB  1  
ATOM 5750   C CG  . ARG B 2 293 ? -50.212  -10.695 -22.791 1.00 0.00 ? 293 ARG B CG  1  
ATOM 5751   C CD  . ARG B 2 293 ? -49.139  -10.046 -21.904 1.00 0.00 ? 293 ARG B CD  1  
ATOM 5752   N NE  . ARG B 2 293 ? -48.160  -11.176 -21.683 1.00 0.00 ? 293 ARG B NE  1  
ATOM 5753   C CZ  . ARG B 2 293 ? -46.844  -11.185 -21.886 1.00 0.00 ? 293 ARG B CZ  1  
ATOM 5754   N NH1 . ARG B 2 293 ? -46.093  -10.052 -22.266 1.00 0.00 ? 293 ARG B NH1 1  
ATOM 5755   N NH2 . ARG B 2 293 ? -46.138  -12.338 -21.742 1.00 0.00 ? 293 ARG B NH2 1  
ATOM 5756   N N   . LEU B 2 294 ? -52.860  -10.574 -24.580 1.00 0.00 ? 294 LEU B N   1  
ATOM 5757   C CA  . LEU B 2 294 ? -53.646  -9.495  -25.046 1.00 0.00 ? 294 LEU B CA  1  
ATOM 5758   C C   . LEU B 2 294 ? -54.984  -9.965  -25.589 1.00 0.00 ? 294 LEU B C   1  
ATOM 5759   O O   . LEU B 2 294 ? -56.017  -9.445  -25.280 1.00 0.00 ? 294 LEU B O   1  
ATOM 5760   C CB  . LEU B 2 294 ? -52.982  -8.477  -25.955 1.00 0.00 ? 294 LEU B CB  1  
ATOM 5761   C CG  . LEU B 2 294 ? -51.831  -7.698  -25.289 1.00 0.00 ? 294 LEU B CG  1  
ATOM 5762   C CD1 . LEU B 2 294 ? -51.185  -6.852  -26.437 1.00 0.00 ? 294 LEU B CD1 1  
ATOM 5763   C CD2 . LEU B 2 294 ? -52.257  -6.797  -24.107 1.00 0.00 ? 294 LEU B CD2 1  
ATOM 5764   N N   . ARG B 2 295 ? -54.938  -11.086 -26.328 1.00 0.00 ? 295 ARG B N   1  
ATOM 5765   C CA  . ARG B 2 295 ? -56.109  -11.663 -26.930 1.00 0.00 ? 295 ARG B CA  1  
ATOM 5766   C C   . ARG B 2 295 ? -57.132  -12.196 -25.894 1.00 0.00 ? 295 ARG B C   1  
ATOM 5767   O O   . ARG B 2 295 ? -58.347  -11.945 -26.000 1.00 0.00 ? 295 ARG B O   1  
ATOM 5768   C CB  . ARG B 2 295 ? -55.654  -12.821 -27.823 1.00 0.00 ? 295 ARG B CB  1  
ATOM 5769   C CG  . ARG B 2 295 ? -56.857  -13.577 -28.445 1.00 0.00 ? 295 ARG B CG  1  
ATOM 5770   C CD  . ARG B 2 295 ? -56.415  -14.660 -29.521 1.00 0.00 ? 295 ARG B CD  1  
ATOM 5771   N NE  . ARG B 2 295 ? -57.745  -15.129 -30.115 1.00 0.00 ? 295 ARG B NE  1  
ATOM 5772   C CZ  . ARG B 2 295 ? -57.924  -15.564 -31.412 1.00 0.00 ? 295 ARG B CZ  1  
ATOM 5773   N NH1 . ARG B 2 295 ? -56.919  -15.534 -32.296 1.00 0.00 ? 295 ARG B NH1 1  
ATOM 5774   N NH2 . ARG B 2 295 ? -59.146  -15.847 -31.889 1.00 0.00 ? 295 ARG B NH2 1  
ATOM 5775   N N   . ILE B 2 296 ? -56.510  -12.819 -24.821 1.00 0.00 ? 296 ILE B N   1  
ATOM 5776   C CA  . ILE B 2 296 ? -57.381  -13.252 -23.741 1.00 0.00 ? 296 ILE B CA  1  
ATOM 5777   C C   . ILE B 2 296 ? -58.085  -12.058 -23.100 1.00 0.00 ? 296 ILE B C   1  
ATOM 5778   O O   . ILE B 2 296 ? -59.293  -12.127 -22.866 1.00 0.00 ? 296 ILE B O   1  
ATOM 5779   C CB  . ILE B 2 296 ? -56.658  -14.034 -22.697 1.00 0.00 ? 296 ILE B CB  1  
ATOM 5780   C CG1 . ILE B 2 296 ? -55.935  -15.277 -23.371 1.00 0.00 ? 296 ILE B CG1 1  
ATOM 5781   C CG2 . ILE B 2 296 ? -57.697  -14.290 -21.523 1.00 0.00 ? 296 ILE B CG2 1  
ATOM 5782   C CD1 . ILE B 2 296 ? -55.154  -16.160 -22.383 1.00 0.00 ? 296 ILE B CD1 1  
ATOM 5783   N N   . TYR B 2 297 ? -57.403  -10.959 -22.817 1.00 0.00 ? 297 TYR B N   1  
ATOM 5784   C CA  . TYR B 2 297 ? -57.917  -9.791  -22.181 1.00 0.00 ? 297 TYR B CA  1  
ATOM 5785   C C   . TYR B 2 297 ? -59.062  -9.189  -22.975 1.00 0.00 ? 297 TYR B C   1  
ATOM 5786   O O   . TYR B 2 297 ? -60.075  -8.810  -22.384 1.00 0.00 ? 297 TYR B O   1  
ATOM 5787   C CB  . TYR B 2 297 ? -56.835  -8.666  -22.012 1.00 0.00 ? 297 TYR B CB  1  
ATOM 5788   C CG  . TYR B 2 297 ? -57.224  -7.940  -20.714 1.00 0.00 ? 297 TYR B CG  1  
ATOM 5789   C CD1 . TYR B 2 297 ? -58.132  -6.835  -20.760 1.00 0.00 ? 297 TYR B CD1 1  
ATOM 5790   C CD2 . TYR B 2 297 ? -56.705  -8.359  -19.441 1.00 0.00 ? 297 TYR B CD2 1  
ATOM 5791   C CE1 . TYR B 2 297 ? -58.627  -6.318  -19.574 1.00 0.00 ? 297 TYR B CE1 1  
ATOM 5792   C CE2 . TYR B 2 297 ? -57.146  -7.782  -18.225 1.00 0.00 ? 297 TYR B CE2 1  
ATOM 5793   C CZ  . TYR B 2 297 ? -58.165  -6.752  -18.303 1.00 0.00 ? 297 TYR B CZ  1  
ATOM 5794   O OH  . TYR B 2 297 ? -58.697  -6.230  -17.162 1.00 0.00 ? 297 TYR B OH  1  
ATOM 5795   N N   . CYS B 2 298 ? -59.030  -9.248  -24.362 1.00 0.00 ? 298 CYS B N   1  
ATOM 5796   C CA  . CYS B 2 298 ? -60.177  -8.897  -25.143 1.00 0.00 ? 298 CYS B CA  1  
ATOM 5797   C C   . CYS B 2 298 ? -61.383  -9.779  -24.924 1.00 0.00 ? 298 CYS B C   1  
ATOM 5798   O O   . CYS B 2 298 ? -62.472  -9.233  -24.933 1.00 0.00 ? 298 CYS B O   1  
ATOM 5799   C CB  . CYS B 2 298 ? -59.877  -9.028  -26.669 1.00 0.00 ? 298 CYS B CB  1  
ATOM 5800   S SG  . CYS B 2 298 ? -58.404  -7.991  -27.199 1.00 0.00 ? 298 CYS B SG  1  
ATOM 5801   N N   . ARG B 2 299 ? -61.263  -11.069 -24.648 1.00 0.00 ? 299 ARG B N   1  
ATOM 5802   C CA  . ARG B 2 299 ? -62.389  -11.924 -24.438 1.00 0.00 ? 299 ARG B CA  1  
ATOM 5803   C C   . ARG B 2 299 ? -63.234  -11.407 -23.247 1.00 0.00 ? 299 ARG B C   1  
ATOM 5804   O O   . ARG B 2 299 ? -64.465  -11.323 -23.414 1.00 0.00 ? 299 ARG B O   1  
ATOM 5805   C CB  . ARG B 2 299 ? -61.958  -13.365 -24.178 1.00 0.00 ? 299 ARG B CB  1  
ATOM 5806   C CG  . ARG B 2 299 ? -61.079  -13.790 -25.368 1.00 0.00 ? 299 ARG B CG  1  
ATOM 5807   C CD  . ARG B 2 299 ? -60.796  -15.306 -25.518 1.00 0.00 ? 299 ARG B CD  1  
ATOM 5808   N NE  . ARG B 2 299 ? -60.071  -15.581 -26.781 1.00 0.00 ? 299 ARG B NE  1  
ATOM 5809   C CZ  . ARG B 2 299 ? -60.531  -16.316 -27.806 1.00 0.00 ? 299 ARG B CZ  1  
ATOM 5810   N NH1 . ARG B 2 299 ? -61.846  -16.720 -27.937 1.00 0.00 ? 299 ARG B NH1 1  
ATOM 5811   N NH2 . ARG B 2 299 ? -59.705  -16.891 -28.727 1.00 0.00 ? 299 ARG B NH2 1  
ATOM 5812   N N   . PHE B 2 300 ? -62.529  -11.040 -22.190 1.00 0.00 ? 300 PHE B N   1  
ATOM 5813   C CA  . PHE B 2 300 ? -63.171  -10.512 -20.999 1.00 0.00 ? 300 PHE B CA  1  
ATOM 5814   C C   . PHE B 2 300 ? -63.869  -9.280  -21.300 1.00 0.00 ? 300 PHE B C   1  
ATOM 5815   O O   . PHE B 2 300 ? -64.939  -9.111  -20.798 1.00 0.00 ? 300 PHE B O   1  
ATOM 5816   C CB  . PHE B 2 300 ? -62.043  -10.178 -19.935 1.00 0.00 ? 300 PHE B CB  1  
ATOM 5817   C CG  . PHE B 2 300 ? -62.588  -10.245 -18.497 1.00 0.00 ? 300 PHE B CG  1  
ATOM 5818   C CD1 . PHE B 2 300 ? -62.759  -11.464 -17.822 1.00 0.00 ? 300 PHE B CD1 1  
ATOM 5819   C CD2 . PHE B 2 300 ? -62.821  -9.022  -17.880 1.00 0.00 ? 300 PHE B CD2 1  
ATOM 5820   C CE1 . PHE B 2 300 ? -63.313  -11.394 -16.535 1.00 0.00 ? 300 PHE B CE1 1  
ATOM 5821   C CE2 . PHE B 2 300 ? -63.377  -9.000  -16.586 1.00 0.00 ? 300 PHE B CE2 1  
ATOM 5822   C CZ  . PHE B 2 300 ? -63.715  -10.163 -15.958 1.00 0.00 ? 300 PHE B CZ  1  
ATOM 5823   N N   . THR B 2 301 ? -63.237  -8.362  -22.069 1.00 0.00 ? 301 THR B N   1  
ATOM 5824   C CA  . THR B 2 301 ? -63.701  -7.063  -22.464 1.00 0.00 ? 301 THR B CA  1  
ATOM 5825   C C   . THR B 2 301 ? -64.937  -7.187  -23.291 1.00 0.00 ? 301 THR B C   1  
ATOM 5826   O O   . THR B 2 301 ? -65.838  -6.379  -23.029 1.00 0.00 ? 301 THR B O   1  
ATOM 5827   C CB  . THR B 2 301 ? -62.690  -6.196  -23.248 1.00 0.00 ? 301 THR B CB  1  
ATOM 5828   O OG1 . THR B 2 301 ? -61.405  -6.247  -22.687 1.00 0.00 ? 301 THR B OG1 1  
ATOM 5829   C CG2 . THR B 2 301 ? -63.182  -4.728  -23.328 1.00 0.00 ? 301 THR B CG2 1  
ATOM 5830   N N   . GLU B 2 302 ? -65.051  -8.178  -24.253 1.00 0.00 ? 302 GLU B N   1  
ATOM 5831   C CA  . GLU B 2 302 ? -66.257  -8.224  -25.053 1.00 0.00 ? 302 GLU B CA  1  
ATOM 5832   C C   . GLU B 2 302 ? -67.448  -8.559  -24.178 1.00 0.00 ? 302 GLU B C   1  
ATOM 5833   O O   . GLU B 2 302 ? -68.428  -7.862  -24.306 1.00 0.00 ? 302 GLU B O   1  
ATOM 5834   C CB  . GLU B 2 302 ? -66.034  -9.294  -26.128 1.00 0.00 ? 302 GLU B CB  1  
ATOM 5835   C CG  . GLU B 2 302 ? -64.939  -8.988  -27.137 1.00 0.00 ? 302 GLU B CG  1  
ATOM 5836   C CD  . GLU B 2 302 ? -65.260  -7.708  -27.954 1.00 0.00 ? 302 GLU B CD  1  
ATOM 5837   O OE1 . GLU B 2 302 ? -66.211  -7.604  -28.751 1.00 0.00 ? 302 GLU B OE1 1  
ATOM 5838   O OE2 . GLU B 2 302 ? -64.419  -6.722  -27.737 1.00 0.00 ? 302 GLU B OE2 1  
ATOM 5839   N N   . HIS B 2 303 ? -67.288  -9.539  -23.301 1.00 0.00 ? 303 HIS B N   1  
ATOM 5840   C CA  . HIS B 2 303 ? -68.374  -9.923  -22.413 1.00 0.00 ? 303 HIS B CA  1  
ATOM 5841   C C   . HIS B 2 303 ? -68.820  -8.870  -21.412 1.00 0.00 ? 303 HIS B C   1  
ATOM 5842   O O   . HIS B 2 303 ? -70.002  -8.686  -21.194 1.00 0.00 ? 303 HIS B O   1  
ATOM 5843   C CB  . HIS B 2 303 ? -67.904  -11.208 -21.653 1.00 0.00 ? 303 HIS B CB  1  
ATOM 5844   C CG  . HIS B 2 303 ? -69.044  -11.879 -20.828 1.00 0.00 ? 303 HIS B CG  1  
ATOM 5845   N ND1 . HIS B 2 303 ? -68.711  -12.599 -19.714 1.00 0.00 ? 303 HIS B ND1 1  
ATOM 5846   C CD2 . HIS B 2 303 ? -70.405  -11.839 -20.827 1.00 0.00 ? 303 HIS B CD2 1  
ATOM 5847   C CE1 . HIS B 2 303 ? -69.838  -12.892 -19.064 1.00 0.00 ? 303 HIS B CE1 1  
ATOM 5848   N NE2 . HIS B 2 303 ? -70.888  -12.470 -19.716 1.00 0.00 ? 303 HIS B NE2 1  
ATOM 5849   N N   . LEU B 2 304 ? -67.876  -8.068  -20.953 1.00 0.00 ? 304 LEU B N   1  
ATOM 5850   C CA  . LEU B 2 304 ? -68.081  -6.964  -20.092 1.00 0.00 ? 304 LEU B CA  1  
ATOM 5851   C C   . LEU B 2 304 ? -69.015  -5.865  -20.640 1.00 0.00 ? 304 LEU B C   1  
ATOM 5852   O O   . LEU B 2 304 ? -69.747  -5.232  -19.910 1.00 0.00 ? 304 LEU B O   1  
ATOM 5853   C CB  . LEU B 2 304 ? -66.707  -6.255  -19.838 1.00 0.00 ? 304 LEU B CB  1  
ATOM 5854   C CG  . LEU B 2 304 ? -66.737  -4.983  -18.952 1.00 0.00 ? 304 LEU B CG  1  
ATOM 5855   C CD1 . LEU B 2 304 ? -65.712  -5.105  -17.730 1.00 0.00 ? 304 LEU B CD1 1  
ATOM 5856   C CD2 . LEU B 2 304 ? -66.642  -3.757  -19.814 1.00 0.00 ? 304 LEU B CD2 1  
ATOM 5857   N N   . GLU B 2 305 ? -69.040  -5.685  -21.983 1.00 0.00 ? 305 GLU B N   1  
ATOM 5858   C CA  . GLU B 2 305 ? -69.857  -4.701  -22.726 1.00 0.00 ? 305 GLU B CA  1  
ATOM 5859   C C   . GLU B 2 305 ? -71.365  -4.823  -22.396 1.00 0.00 ? 305 GLU B C   1  
ATOM 5860   O O   . GLU B 2 305 ? -72.046  -3.817  -22.216 1.00 0.00 ? 305 GLU B O   1  
ATOM 5861   C CB  . GLU B 2 305 ? -69.740  -4.894  -24.287 1.00 0.00 ? 305 GLU B CB  1  
ATOM 5862   C CG  . GLU B 2 305 ? -70.472  -3.984  -25.318 1.00 0.00 ? 305 GLU B CG  1  
ATOM 5863   C CD  . GLU B 2 305 ? -70.296  -4.555  -26.694 1.00 0.00 ? 305 GLU B CD  1  
ATOM 5864   O OE1 . GLU B 2 305 ? -69.154  -4.928  -27.048 1.00 0.00 ? 305 GLU B OE1 1  
ATOM 5865   O OE2 . GLU B 2 305 ? -71.374  -4.810  -27.378 1.00 0.00 ? 305 GLU B OE2 1  
ATOM 5866   N N   . GLU B 2 306 ? -71.808  -6.077  -22.182 1.00 0.00 ? 306 GLU B N   1  
ATOM 5867   C CA  . GLU B 2 306 ? -73.108  -6.426  -21.696 1.00 0.00 ? 306 GLU B CA  1  
ATOM 5868   C C   . GLU B 2 306 ? -73.332  -6.177  -20.236 1.00 0.00 ? 306 GLU B C   1  
ATOM 5869   O O   . GLU B 2 306 ? -74.314  -5.619  -19.750 1.00 0.00 ? 306 GLU B O   1  
ATOM 5870   C CB  . GLU B 2 306 ? -73.392  -7.929  -22.069 1.00 0.00 ? 306 GLU B CB  1  
ATOM 5871   C CG  . GLU B 2 306 ? -73.545  -8.244  -23.553 1.00 0.00 ? 306 GLU B CG  1  
ATOM 5872   C CD  . GLU B 2 306 ? -72.457  -7.849  -24.591 1.00 0.00 ? 306 GLU B CD  1  
ATOM 5873   O OE1 . GLU B 2 306 ? -71.282  -8.003  -24.268 1.00 0.00 ? 306 GLU B OE1 1  
ATOM 5874   O OE2 . GLU B 2 306 ? -72.830  -7.485  -25.743 1.00 0.00 ? 306 GLU B OE2 1  
ATOM 5875   N N   . LEU B 2 307 ? -72.338  -6.567  -19.497 1.00 0.00 ? 307 LEU B N   1  
ATOM 5876   C CA  . LEU B 2 307 ? -72.426  -6.623  -18.031 1.00 0.00 ? 307 LEU B CA  1  
ATOM 5877   C C   . LEU B 2 307 ? -72.210  -5.262  -17.452 1.00 0.00 ? 307 LEU B C   1  
ATOM 5878   O O   . LEU B 2 307 ? -71.561  -4.448  -18.078 1.00 0.00 ? 307 LEU B O   1  
ATOM 5879   C CB  . LEU B 2 307 ? -71.216  -7.453  -17.525 1.00 0.00 ? 307 LEU B CB  1  
ATOM 5880   C CG  . LEU B 2 307 ? -71.362  -9.013  -17.590 1.00 0.00 ? 307 LEU B CG  1  
ATOM 5881   C CD1 . LEU B 2 307 ? -72.133  -9.537  -18.800 1.00 0.00 ? 307 LEU B CD1 1  
ATOM 5882   C CD2 . LEU B 2 307 ? -69.985  -9.740  -17.575 1.00 0.00 ? 307 LEU B CD2 1  
ATOM 5883   N N   . SER B 2 308 ? -72.848  -5.012  -16.301 1.00 0.00 ? 308 SER B N   1  
ATOM 5884   C CA  . SER B 2 308 ? -72.933  -3.820  -15.568 1.00 0.00 ? 308 SER B CA  1  
ATOM 5885   C C   . SER B 2 308 ? -73.188  -4.362  -14.138 1.00 0.00 ? 308 SER B C   1  
ATOM 5886   O O   . SER B 2 308 ? -74.194  -5.068  -13.986 1.00 0.00 ? 308 SER B O   1  
ATOM 5887   C CB  . SER B 2 308 ? -74.158  -2.892  -16.022 1.00 0.00 ? 308 SER B CB  1  
ATOM 5888   O OG  . SER B 2 308 ? -73.875  -2.362  -17.290 1.00 0.00 ? 308 SER B OG  1  
ATOM 5889   N N   . GLY B 2 309 ? -72.399  -3.985  -13.163 1.00 0.00 ? 309 GLY B N   1  
ATOM 5890   C CA  . GLY B 2 309 ? -72.524  -4.146  -11.702 1.00 0.00 ? 309 GLY B CA  1  
ATOM 5891   C C   . GLY B 2 309 ? -72.023  -5.452  -11.199 1.00 0.00 ? 309 GLY B C   1  
ATOM 5892   O O   . GLY B 2 309 ? -70.856  -5.836  -11.407 1.00 0.00 ? 309 GLY B O   1  
ATOM 5893   N N   . ASP B 2 310 ? -72.888  -6.155  -10.404 1.00 0.00 ? 310 ASP B N   1  
ATOM 5894   C CA  . ASP B 2 310 ? -72.608  -7.344  -9.657  1.00 0.00 ? 310 ASP B CA  1  
ATOM 5895   C C   . ASP B 2 310 ? -72.224  -8.569  -10.520 1.00 0.00 ? 310 ASP B C   1  
ATOM 5896   O O   . ASP B 2 310 ? -71.603  -9.473  -10.037 1.00 0.00 ? 310 ASP B O   1  
ATOM 5897   C CB  . ASP B 2 310 ? -73.820  -7.607  -8.663  1.00 0.00 ? 310 ASP B CB  1  
ATOM 5898   C CG  . ASP B 2 310 ? -73.313  -8.542  -7.552  1.00 0.00 ? 310 ASP B CG  1  
ATOM 5899   O OD1 . ASP B 2 310 ? -72.450  -8.100  -6.738  1.00 0.00 ? 310 ASP B OD1 1  
ATOM 5900   O OD2 . ASP B 2 310 ? -73.932  -9.632  -7.425  1.00 0.00 ? 310 ASP B OD2 1  
ATOM 5901   N N   . THR B 2 311 ? -72.616  -8.649  -11.803 1.00 0.00 ? 311 THR B N   1  
ATOM 5902   C CA  . THR B 2 311 ? -72.317  -9.636  -12.773 1.00 0.00 ? 311 THR B CA  1  
ATOM 5903   C C   . THR B 2 311 ? -70.854  -9.714  -13.072 1.00 0.00 ? 311 THR B C   1  
ATOM 5904   O O   . THR B 2 311 ? -70.359  -10.816 -13.316 1.00 0.00 ? 311 THR B O   1  
ATOM 5905   C CB  . THR B 2 311 ? -73.172  -9.429  -14.004 1.00 0.00 ? 311 THR B CB  1  
ATOM 5906   O OG1 . THR B 2 311 ? -72.878  -10.427 -14.929 1.00 0.00 ? 311 THR B OG1 1  
ATOM 5907   C CG2 . THR B 2 311 ? -73.010  -8.012  -14.478 1.00 0.00 ? 311 THR B CG2 1  
ATOM 5908   N N   . PHE B 2 312 ? -70.068  -8.586  -12.976 1.00 0.00 ? 312 PHE B N   1  
ATOM 5909   C CA  . PHE B 2 312 ? -68.695  -8.583  -13.080 1.00 0.00 ? 312 PHE B CA  1  
ATOM 5910   C C   . PHE B 2 312 ? -68.048  -9.506  -12.042 1.00 0.00 ? 312 PHE B C   1  
ATOM 5911   O O   . PHE B 2 312 ? -67.177  -10.324 -12.320 1.00 0.00 ? 312 PHE B O   1  
ATOM 5912   C CB  . PHE B 2 312 ? -68.075  -7.150  -12.864 1.00 0.00 ? 312 PHE B CB  1  
ATOM 5913   C CG  . PHE B 2 312 ? -68.490  -6.009  -13.871 1.00 0.00 ? 312 PHE B CG  1  
ATOM 5914   C CD1 . PHE B 2 312 ? -68.837  -6.251  -15.198 1.00 0.00 ? 312 PHE B CD1 1  
ATOM 5915   C CD2 . PHE B 2 312 ? -68.431  -4.673  -13.396 1.00 0.00 ? 312 PHE B CD2 1  
ATOM 5916   C CE1 . PHE B 2 312 ? -69.323  -5.220  -15.977 1.00 0.00 ? 312 PHE B CE1 1  
ATOM 5917   C CE2 . PHE B 2 312 ? -68.769  -3.655  -14.214 1.00 0.00 ? 312 PHE B CE2 1  
ATOM 5918   C CZ  . PHE B 2 312 ? -69.206  -3.851  -15.539 1.00 0.00 ? 312 PHE B CZ  1  
ATOM 5919   N N   . LEU B 2 313 ? -68.583  -9.526  -10.830 1.00 0.00 ? 313 LEU B N   1  
ATOM 5920   C CA  . LEU B 2 313 ? -68.141  -10.388 -9.739  1.00 0.00 ? 313 LEU B CA  1  
ATOM 5921   C C   . LEU B 2 313 ? -68.321  -11.858 -10.060 1.00 0.00 ? 313 LEU B C   1  
ATOM 5922   O O   . LEU B 2 313 ? -67.393  -12.547 -9.705  1.00 0.00 ? 313 LEU B O   1  
ATOM 5923   C CB  . LEU B 2 313 ? -68.901  -10.208 -8.426  1.00 0.00 ? 313 LEU B CB  1  
ATOM 5924   C CG  . LEU B 2 313 ? -68.385  -10.866 -7.068  1.00 0.00 ? 313 LEU B CG  1  
ATOM 5925   C CD1 . LEU B 2 313 ? -67.061  -10.189 -6.666  1.00 0.00 ? 313 LEU B CD1 1  
ATOM 5926   C CD2 . LEU B 2 313 ? -69.441  -10.678 -5.972  1.00 0.00 ? 313 LEU B CD2 1  
ATOM 5927   N N   . ILE B 2 314 ? -69.412  -12.305 -10.730 1.00 0.00 ? 314 ILE B N   1  
ATOM 5928   C CA  . ILE B 2 314 ? -69.616  -13.771 -11.073 1.00 0.00 ? 314 ILE B CA  1  
ATOM 5929   C C   . ILE B 2 314 ? -68.553  -14.238 -12.141 1.00 0.00 ? 314 ILE B C   1  
ATOM 5930   O O   . ILE B 2 314 ? -67.977  -15.319 -11.991 1.00 0.00 ? 314 ILE B O   1  
ATOM 5931   C CB  . ILE B 2 314 ? -71.048  -14.082 -11.331 1.00 0.00 ? 314 ILE B CB  1  
ATOM 5932   C CG1 . ILE B 2 314 ? -71.747  -13.477 -12.601 1.00 0.00 ? 314 ILE B CG1 1  
ATOM 5933   C CG2 . ILE B 2 314 ? -71.753  -13.746 -10.032 1.00 0.00 ? 314 ILE B CG2 1  
ATOM 5934   C CD1 . ILE B 2 314 ? -73.225  -13.874 -12.753 1.00 0.00 ? 314 ILE B CD1 1  
ATOM 5935   N N   . GLU B 2 315 ? -68.364  -13.398 -13.155 1.00 0.00 ? 315 GLU B N   1  
ATOM 5936   C CA  . GLU B 2 315 ? -67.505  -13.481 -14.333 1.00 0.00 ? 315 GLU B CA  1  
ATOM 5937   C C   . GLU B 2 315 ? -66.105  -13.569 -13.751 1.00 0.00 ? 315 GLU B C   1  
ATOM 5938   O O   . GLU B 2 315 ? -65.362  -14.473 -14.106 1.00 0.00 ? 315 GLU B O   1  
ATOM 5939   C CB  . GLU B 2 315 ? -67.584  -12.193 -15.256 1.00 0.00 ? 315 GLU B CB  1  
ATOM 5940   C CG  . GLU B 2 315 ? -66.853  -12.279 -16.599 1.00 0.00 ? 315 GLU B CG  1  
ATOM 5941   C CD  . GLU B 2 315 ? -66.936  -10.880 -17.236 1.00 0.00 ? 315 GLU B CD  1  
ATOM 5942   O OE1 . GLU B 2 315 ? -66.994  -9.852  -16.557 1.00 0.00 ? 315 GLU B OE1 1  
ATOM 5943   O OE2 . GLU B 2 315 ? -66.764  -10.907 -18.484 1.00 0.00 ? 315 GLU B OE2 1  
ATOM 5944   N N   . LEU B 2 316 ? -65.708  -12.745 -12.734 1.00 0.00 ? 316 LEU B N   1  
ATOM 5945   C CA  . LEU B 2 316 ? -64.411  -12.766 -12.052 1.00 0.00 ? 316 LEU B CA  1  
ATOM 5946   C C   . LEU B 2 316 ? -64.250  -14.013 -11.378 1.00 0.00 ? 316 LEU B C   1  
ATOM 5947   O O   . LEU B 2 316 ? -63.206  -14.601 -11.427 1.00 0.00 ? 316 LEU B O   1  
ATOM 5948   C CB  . LEU B 2 316 ? -64.320  -11.660 -10.923 1.00 0.00 ? 316 LEU B CB  1  
ATOM 5949   C CG  . LEU B 2 316 ? -62.956  -11.549 -10.200 1.00 0.00 ? 316 LEU B CG  1  
ATOM 5950   C CD1 . LEU B 2 316 ? -61.800  -11.454 -11.172 1.00 0.00 ? 316 LEU B CD1 1  
ATOM 5951   C CD2 . LEU B 2 316 ? -63.115  -10.365 -9.130  1.00 0.00 ? 316 LEU B CD2 1  
ATOM 5952   N N   . ASN B 2 317 ? -65.302  -14.598 -10.741 1.00 0.00 ? 317 ASN B N   1  
ATOM 5953   C CA  . ASN B 2 317 ? -65.159  -15.830 -10.001 1.00 0.00 ? 317 ASN B CA  1  
ATOM 5954   C C   . ASN B 2 317 ? -64.826  -16.972 -10.968 1.00 0.00 ? 317 ASN B C   1  
ATOM 5955   O O   . ASN B 2 317 ? -63.930  -17.778 -10.680 1.00 0.00 ? 317 ASN B O   1  
ATOM 5956   C CB  . ASN B 2 317 ? -66.422  -16.304 -9.310  1.00 0.00 ? 317 ASN B CB  1  
ATOM 5957   C CG  . ASN B 2 317 ? -66.697  -15.175 -8.401  1.00 0.00 ? 317 ASN B CG  1  
ATOM 5958   O OD1 . ASN B 2 317 ? -65.932  -14.442 -7.849  1.00 0.00 ? 317 ASN B OD1 1  
ATOM 5959   N ND2 . ASN B 2 317 ? -68.058  -15.038 -8.145  1.00 0.00 ? 317 ASN B ND2 1  
ATOM 5960   N N   . ILE B 2 318 ? -65.573  -17.106 -12.133 1.00 0.00 ? 318 ILE B N   1  
ATOM 5961   C CA  . ILE B 2 318 ? -65.385  -18.198 -13.037 1.00 0.00 ? 318 ILE B CA  1  
ATOM 5962   C C   . ILE B 2 318 ? -64.026  -18.172 -13.634 1.00 0.00 ? 318 ILE B C   1  
ATOM 5963   O O   . ILE B 2 318 ? -63.356  -19.147 -13.846 1.00 0.00 ? 318 ILE B O   1  
ATOM 5964   C CB  . ILE B 2 318 ? -66.553  -18.417 -14.000 1.00 0.00 ? 318 ILE B CB  1  
ATOM 5965   C CG1 . ILE B 2 318 ? -66.470  -19.765 -14.662 1.00 0.00 ? 318 ILE B CG1 1  
ATOM 5966   C CG2 . ILE B 2 318 ? -66.692  -17.225 -14.914 1.00 0.00 ? 318 ILE B CG2 1  
ATOM 5967   C CD1 . ILE B 2 318 ? -67.616  -20.053 -15.646 1.00 0.00 ? 318 ILE B CD1 1  
ATOM 5968   N N   . PHE B 2 319 ? -63.585  -16.952 -14.070 1.00 0.00 ? 319 PHE B N   1  
ATOM 5969   C CA  . PHE B 2 319 ? -62.361  -16.787 -14.756 1.00 0.00 ? 319 PHE B CA  1  
ATOM 5970   C C   . PHE B 2 319 ? -61.142  -17.218 -13.931 1.00 0.00 ? 319 PHE B C   1  
ATOM 5971   O O   . PHE B 2 319 ? -60.273  -17.883 -14.407 1.00 0.00 ? 319 PHE B O   1  
ATOM 5972   C CB  . PHE B 2 319 ? -62.283  -15.267 -15.057 1.00 0.00 ? 319 PHE B CB  1  
ATOM 5973   C CG  . PHE B 2 319 ? -61.093  -14.959 -15.953 1.00 0.00 ? 319 PHE B CG  1  
ATOM 5974   C CD1 . PHE B 2 319 ? -61.088  -15.482 -17.244 1.00 0.00 ? 319 PHE B CD1 1  
ATOM 5975   C CD2 . PHE B 2 319 ? -60.128  -13.961 -15.594 1.00 0.00 ? 319 PHE B CD2 1  
ATOM 5976   C CE1 . PHE B 2 319 ? -60.175  -14.979 -18.152 1.00 0.00 ? 319 PHE B CE1 1  
ATOM 5977   C CE2 . PHE B 2 319 ? -59.103  -13.587 -16.445 1.00 0.00 ? 319 PHE B CE2 1  
ATOM 5978   C CZ  . PHE B 2 319 ? -59.169  -14.122 -17.769 1.00 0.00 ? 319 PHE B CZ  1  
ATOM 5979   N N   . LYS B 2 320 ? -61.229  -16.888 -12.603 1.00 0.00 ? 320 LYS B N   1  
ATOM 5980   C CA  . LYS B 2 320 ? -60.302  -17.227 -11.653 1.00 0.00 ? 320 LYS B CA  1  
ATOM 5981   C C   . LYS B 2 320 ? -60.055  -18.691 -11.450 1.00 0.00 ? 320 LYS B C   1  
ATOM 5982   O O   . LYS B 2 320 ? -58.960  -19.148 -11.230 1.00 0.00 ? 320 LYS B O   1  
ATOM 5983   C CB  . LYS B 2 320 ? -60.654  -16.586 -10.344 1.00 0.00 ? 320 LYS B CB  1  
ATOM 5984   C CG  . LYS B 2 320 ? -59.456  -16.467 -9.382  1.00 0.00 ? 320 LYS B CG  1  
ATOM 5985   C CD  . LYS B 2 320 ? -59.829  -16.938 -7.962  1.00 0.00 ? 320 LYS B CD  1  
ATOM 5986   C CE  . LYS B 2 320 ? -58.719  -16.713 -6.933  1.00 0.00 ? 320 LYS B CE  1  
ATOM 5987   N NZ  . LYS B 2 320 ? -58.682  -15.508 -6.139  1.00 0.00 ? 320 LYS B NZ  1  
ATOM 5988   N N   . SER B 2 321 ? -61.133  -19.480 -11.579 1.00 0.00 ? 321 SER B N   1  
ATOM 5989   C CA  . SER B 2 321 ? -61.042  -20.951 -11.516 1.00 0.00 ? 321 SER B CA  1  
ATOM 5990   C C   . SER B 2 321 ? -60.229  -21.576 -12.637 1.00 0.00 ? 321 SER B C   1  
ATOM 5991   O O   . SER B 2 321 ? -59.553  -22.609 -12.473 1.00 0.00 ? 321 SER B O   1  
ATOM 5992   C CB  . SER B 2 321 ? -62.417  -21.667 -11.558 1.00 0.00 ? 321 SER B CB  1  
ATOM 5993   O OG  . SER B 2 321 ? -62.350  -23.083 -11.734 1.00 0.00 ? 321 SER B OG  1  
ATOM 5994   N N   . HIS B 2 322 ? -60.243  -20.980 -13.880 1.00 0.00 ? 322 HIS B N   1  
ATOM 5995   C CA  . HIS B 2 322 ? -59.496  -21.543 -15.024 1.00 0.00 ? 322 HIS B CA  1  
ATOM 5996   C C   . HIS B 2 322 ? -58.057  -21.456 -14.794 1.00 0.00 ? 322 HIS B C   1  
ATOM 5997   O O   . HIS B 2 322 ? -57.550  -20.486 -14.273 1.00 0.00 ? 322 HIS B O   1  
ATOM 5998   C CB  . HIS B 2 322 ? -59.824  -20.999 -16.367 1.00 0.00 ? 322 HIS B CB  1  
ATOM 5999   C CG  . HIS B 2 322 ? -58.904  -21.419 -17.538 1.00 0.00 ? 322 HIS B CG  1  
ATOM 6000   N ND1 . HIS B 2 322 ? -58.878  -22.591 -18.258 1.00 0.00 ? 322 HIS B ND1 1  
ATOM 6001   C CD2 . HIS B 2 322 ? -57.770  -20.748 -17.894 1.00 0.00 ? 322 HIS B CD2 1  
ATOM 6002   C CE1 . HIS B 2 322 ? -57.833  -22.508 -19.101 1.00 0.00 ? 322 HIS B CE1 1  
ATOM 6003   N NE2 . HIS B 2 322 ? -57.099  -21.378 -18.894 1.00 0.00 ? 322 HIS B NE2 1  
ATOM 6004   N N   . GLY B 2 323 ? -57.334  -22.540 -15.148 1.00 0.00 ? 323 GLY B N   1  
ATOM 6005   C CA  . GLY B 2 323 ? -55.945  -22.935 -14.931 1.00 0.00 ? 323 GLY B CA  1  
ATOM 6006   C C   . GLY B 2 323 ? -55.169  -22.108 -15.960 1.00 0.00 ? 323 GLY B C   1  
ATOM 6007   O O   . GLY B 2 323 ? -55.471  -20.941 -16.257 1.00 0.00 ? 323 GLY B O   1  
ATOM 6008   N N   . ASP B 2 324 ? -54.083  -22.782 -16.454 1.00 0.00 ? 324 ASP B N   1  
ATOM 6009   C CA  . ASP B 2 324 ? -52.987  -22.249 -17.167 1.00 0.00 ? 324 ASP B CA  1  
ATOM 6010   C C   . ASP B 2 324 ? -52.238  -21.220 -16.376 1.00 0.00 ? 324 ASP B C   1  
ATOM 6011   O O   . ASP B 2 324 ? -52.833  -20.212 -16.019 1.00 0.00 ? 324 ASP B O   1  
ATOM 6012   C CB  . ASP B 2 324 ? -53.323  -21.723 -18.614 1.00 0.00 ? 324 ASP B CB  1  
ATOM 6013   C CG  . ASP B 2 324 ? -53.695  -23.016 -19.451 1.00 0.00 ? 324 ASP B CG  1  
ATOM 6014   O OD1 . ASP B 2 324 ? -54.731  -23.680 -19.167 1.00 0.00 ? 324 ASP B OD1 1  
ATOM 6015   O OD2 . ASP B 2 324 ? -53.032  -23.214 -20.469 1.00 0.00 ? 324 ASP B OD2 1  
ATOM 6016   N N   . LEU B 2 325 ? -50.926  -21.375 -16.065 1.00 0.00 ? 325 LEU B N   1  
ATOM 6017   C CA  . LEU B 2 325 ? -50.334  -20.556 -15.088 1.00 0.00 ? 325 LEU B CA  1  
ATOM 6018   C C   . LEU B 2 325 ? -50.387  -19.050 -15.235 1.00 0.00 ? 325 LEU B C   1  
ATOM 6019   O O   . LEU B 2 325 ? -50.704  -18.358 -14.291 1.00 0.00 ? 325 LEU B O   1  
ATOM 6020   C CB  . LEU B 2 325 ? -48.881  -21.001 -14.868 1.00 0.00 ? 325 LEU B CB  1  
ATOM 6021   C CG  . LEU B 2 325 ? -48.296  -20.602 -13.413 1.00 0.00 ? 325 LEU B CG  1  
ATOM 6022   C CD1 . LEU B 2 325 ? -49.061  -21.396 -12.335 1.00 0.00 ? 325 LEU B CD1 1  
ATOM 6023   C CD2 . LEU B 2 325 ? -46.827  -20.820 -13.316 1.00 0.00 ? 325 LEU B CD2 1  
ATOM 6024   N N   . THR B 2 326 ? -50.133  -18.543 -16.408 1.00 0.00 ? 326 THR B N   1  
ATOM 6025   C CA  . THR B 2 326 ? -50.235  -17.180 -16.772 1.00 0.00 ? 326 THR B CA  1  
ATOM 6026   C C   . THR B 2 326 ? -51.603  -16.599 -16.748 1.00 0.00 ? 326 THR B C   1  
ATOM 6027   O O   . THR B 2 326 ? -51.818  -15.488 -16.296 1.00 0.00 ? 326 THR B O   1  
ATOM 6028   C CB  . THR B 2 326 ? -49.699  -17.105 -18.173 1.00 0.00 ? 326 THR B CB  1  
ATOM 6029   O OG1 . THR B 2 326 ? -50.034  -18.112 -19.021 1.00 0.00 ? 326 THR B OG1 1  
ATOM 6030   C CG2 . THR B 2 326 ? -48.193  -17.016 -18.003 1.00 0.00 ? 326 THR B CG2 1  
ATOM 6031   N N   . ILE B 2 327 ? -52.561  -17.409 -17.296 1.00 0.00 ? 327 ILE B N   1  
ATOM 6032   C CA  . ILE B 2 327 ? -53.988  -16.965 -17.393 1.00 0.00 ? 327 ILE B CA  1  
ATOM 6033   C C   . ILE B 2 327 ? -54.734  -16.816 -16.097 1.00 0.00 ? 327 ILE B C   1  
ATOM 6034   O O   . ILE B 2 327 ? -55.403  -15.823 -15.712 1.00 0.00 ? 327 ILE B O   1  
ATOM 6035   C CB  . ILE B 2 327 ? -54.802  -17.851 -18.382 1.00 0.00 ? 327 ILE B CB  1  
ATOM 6036   C CG1 . ILE B 2 327 ? -53.953  -18.328 -19.590 1.00 0.00 ? 327 ILE B CG1 1  
ATOM 6037   C CG2 . ILE B 2 327 ? -56.026  -17.211 -18.788 1.00 0.00 ? 327 ILE B CG2 1  
ATOM 6038   C CD1 . ILE B 2 327 ? -54.723  -19.207 -20.590 1.00 0.00 ? 327 ILE B CD1 1  
ATOM 6039   N N   . ARG B 2 328 ? -54.493  -17.859 -15.302 1.00 0.00 ? 328 ARG B N   1  
ATOM 6040   C CA  . ARG B 2 328 ? -54.960  -17.955 -13.956 1.00 0.00 ? 328 ARG B CA  1  
ATOM 6041   C C   . ARG B 2 328 ? -54.324  -16.828 -13.080 1.00 0.00 ? 328 ARG B C   1  
ATOM 6042   O O   . ARG B 2 328 ? -55.019  -16.241 -12.284 1.00 0.00 ? 328 ARG B O   1  
ATOM 6043   C CB  . ARG B 2 328 ? -54.501  -19.306 -13.310 1.00 0.00 ? 328 ARG B CB  1  
ATOM 6044   C CG  . ARG B 2 328 ? -54.279  -19.499 -11.715 1.00 0.00 ? 328 ARG B CG  1  
ATOM 6045   C CD  . ARG B 2 328 ? -55.566  -19.959 -11.088 1.00 0.00 ? 328 ARG B CD  1  
ATOM 6046   N NE  . ARG B 2 328 ? -56.124  -21.267 -11.633 1.00 0.00 ? 328 ARG B NE  1  
ATOM 6047   C CZ  . ARG B 2 328 ? -56.980  -21.994 -10.872 1.00 0.00 ? 328 ARG B CZ  1  
ATOM 6048   N NH1 . ARG B 2 328 ? -57.550  -21.505 -9.758  1.00 0.00 ? 328 ARG B NH1 1  
ATOM 6049   N NH2 . ARG B 2 328 ? -57.186  -23.302 -11.221 1.00 0.00 ? 328 ARG B NH2 1  
ATOM 6050   N N   . LYS B 2 329 ? -52.994  -16.552 -13.336 1.00 0.00 ? 329 LYS B N   1  
ATOM 6051   C CA  . LYS B 2 329 ? -52.201  -15.552 -12.653 1.00 0.00 ? 329 LYS B CA  1  
ATOM 6052   C C   . LYS B 2 329 ? -52.774  -14.181 -12.916 1.00 0.00 ? 329 LYS B C   1  
ATOM 6053   O O   . LYS B 2 329 ? -52.952  -13.345 -11.972 1.00 0.00 ? 329 LYS B O   1  
ATOM 6054   C CB  . LYS B 2 329 ? -50.716  -15.625 -13.101 1.00 0.00 ? 329 LYS B CB  1  
ATOM 6055   C CG  . LYS B 2 329 ? -49.729  -14.600 -12.494 1.00 0.00 ? 329 LYS B CG  1  
ATOM 6056   C CD  . LYS B 2 329 ? -49.700  -14.526 -10.973 1.00 0.00 ? 329 LYS B CD  1  
ATOM 6057   C CE  . LYS B 2 329 ? -48.666  -13.623 -10.302 1.00 0.00 ? 329 LYS B CE  1  
ATOM 6058   N NZ  . LYS B 2 329 ? -48.725  -12.183 -10.694 1.00 0.00 ? 329 LYS B NZ  1  
ATOM 6059   N N   . ILE B 2 330 ? -53.134  -13.907 -14.188 1.00 0.00 ? 330 ILE B N   1  
ATOM 6060   C CA  . ILE B 2 330 ? -53.733  -12.594 -14.497 1.00 0.00 ? 330 ILE B CA  1  
ATOM 6061   C C   . ILE B 2 330 ? -55.036  -12.487 -13.689 1.00 0.00 ? 330 ILE B C   1  
ATOM 6062   O O   . ILE B 2 330 ? -55.352  -11.436 -13.139 1.00 0.00 ? 330 ILE B O   1  
ATOM 6063   C CB  . ILE B 2 330 ? -54.067  -12.367 -16.004 1.00 0.00 ? 330 ILE B CB  1  
ATOM 6064   C CG1 . ILE B 2 330 ? -52.760  -12.171 -16.806 1.00 0.00 ? 330 ILE B CG1 1  
ATOM 6065   C CG2 . ILE B 2 330 ? -54.874  -11.056 -16.270 1.00 0.00 ? 330 ILE B CG2 1  
ATOM 6066   C CD1 . ILE B 2 330 ? -52.976  -11.938 -18.311 1.00 0.00 ? 330 ILE B CD1 1  
ATOM 6067   N N   . ALA B 2 331 ? -55.814  -13.605 -13.702 1.00 0.00 ? 331 ALA B N   1  
ATOM 6068   C CA  . ALA B 2 331 ? -57.145  -13.587 -13.178 1.00 0.00 ? 331 ALA B CA  1  
ATOM 6069   C C   . ALA B 2 331 ? -57.129  -13.260 -11.598 1.00 0.00 ? 331 ALA B C   1  
ATOM 6070   O O   . ALA B 2 331 ? -57.917  -12.470 -11.113 1.00 0.00 ? 331 ALA B O   1  
ATOM 6071   C CB  . ALA B 2 331 ? -57.804  -15.010 -13.380 1.00 0.00 ? 331 ALA B CB  1  
ATOM 6072   N N   . THR B 2 332 ? -56.169  -13.842 -10.947 1.00 0.00 ? 332 THR B N   1  
ATOM 6073   C CA  . THR B 2 332 ? -55.842  -13.720 -9.504  1.00 0.00 ? 332 THR B CA  1  
ATOM 6074   C C   . THR B 2 332 ? -55.504  -12.275 -9.147  1.00 0.00 ? 332 THR B C   1  
ATOM 6075   O O   . THR B 2 332 ? -55.996  -11.792 -8.143  1.00 0.00 ? 332 THR B O   1  
ATOM 6076   C CB  . THR B 2 332 ? -54.646  -14.602 -9.103  1.00 0.00 ? 332 THR B CB  1  
ATOM 6077   O OG1 . THR B 2 332 ? -54.972  -16.042 -9.290  1.00 0.00 ? 332 THR B OG1 1  
ATOM 6078   C CG2 . THR B 2 332 ? -54.388  -14.420 -7.618  1.00 0.00 ? 332 THR B CG2 1  
ATOM 6079   N N   . ASN B 2 333 ? -54.713  -11.635 -10.052 1.00 0.00 ? 333 ASN B N   1  
ATOM 6080   C CA  . ASN B 2 333 ? -54.341  -10.244 -9.842  1.00 0.00 ? 333 ASN B CA  1  
ATOM 6081   C C   . ASN B 2 333 ? -55.568  -9.385  -9.844  1.00 0.00 ? 333 ASN B C   1  
ATOM 6082   O O   . ASN B 2 333 ? -55.581  -8.506  -8.987  1.00 0.00 ? 333 ASN B O   1  
ATOM 6083   C CB  . ASN B 2 333 ? -53.351  -9.831  -10.891 1.00 0.00 ? 333 ASN B CB  1  
ATOM 6084   C CG  . ASN B 2 333 ? -51.918  -10.371 -10.617 1.00 0.00 ? 333 ASN B CG  1  
ATOM 6085   O OD1 . ASN B 2 333 ? -51.700  -11.084 -9.650  1.00 0.00 ? 333 ASN B OD1 1  
ATOM 6086   N ND2 . ASN B 2 333 ? -51.023  -10.043 -11.556 1.00 0.00 ? 333 ASN B ND2 1  
ATOM 6087   N N   . LEU B 2 334 ? -56.535  -9.620  -10.746 1.00 0.00 ? 334 LEU B N   1  
ATOM 6088   C CA  . LEU B 2 334 ? -57.743  -8.839  -10.808 1.00 0.00 ? 334 LEU B CA  1  
ATOM 6089   C C   . LEU B 2 334 ? -58.594  -9.006  -9.526  1.00 0.00 ? 334 LEU B C   1  
ATOM 6090   O O   . LEU B 2 334 ? -59.077  -8.030  -8.980  1.00 0.00 ? 334 LEU B O   1  
ATOM 6091   C CB  . LEU B 2 334 ? -58.663  -9.260  -11.887 1.00 0.00 ? 334 LEU B CB  1  
ATOM 6092   C CG  . LEU B 2 334 ? -58.030  -9.505  -13.299 1.00 0.00 ? 334 LEU B CG  1  
ATOM 6093   C CD1 . LEU B 2 334 ? -59.014  -10.102 -14.318 1.00 0.00 ? 334 LEU B CD1 1  
ATOM 6094   C CD2 . LEU B 2 334 ? -57.312  -8.284  -13.905 1.00 0.00 ? 334 LEU B CD2 1  
ATOM 6095   N N   . PHE B 2 335 ? -58.634  -10.237 -8.993  1.00 0.00 ? 335 PHE B N   1  
ATOM 6096   C CA  . PHE B 2 335 ? -59.326  -10.635 -7.767  1.00 0.00 ? 335 PHE B CA  1  
ATOM 6097   C C   . PHE B 2 335 ? -58.770  -9.894  -6.562  1.00 0.00 ? 335 PHE B C   1  
ATOM 6098   O O   . PHE B 2 335 ? -59.492  -9.238  -5.832  1.00 0.00 ? 335 PHE B O   1  
ATOM 6099   C CB  . PHE B 2 335 ? -59.140  -12.130 -7.532  1.00 0.00 ? 335 PHE B CB  1  
ATOM 6100   C CG  . PHE B 2 335 ? -60.403  -12.756 -7.153  1.00 0.00 ? 335 PHE B CG  1  
ATOM 6101   C CD1 . PHE B 2 335 ? -60.979  -12.573 -5.922  1.00 0.00 ? 335 PHE B CD1 1  
ATOM 6102   C CD2 . PHE B 2 335 ? -61.035  -13.544 -8.110  1.00 0.00 ? 335 PHE B CD2 1  
ATOM 6103   C CE1 . PHE B 2 335 ? -62.225  -13.106 -5.593  1.00 0.00 ? 335 PHE B CE1 1  
ATOM 6104   C CE2 . PHE B 2 335 ? -62.261  -14.101 -7.841  1.00 0.00 ? 335 PHE B CE2 1  
ATOM 6105   C CZ  . PHE B 2 335 ? -62.939  -13.882 -6.508  1.00 0.00 ? 335 PHE B CZ  1  
ATOM 6106   N N   . ASN B 2 336 ? -57.384  -9.849  -6.492  1.00 0.00 ? 336 ASN B N   1  
ATOM 6107   C CA  . ASN B 2 336 ? -56.809  -9.153  -5.374  1.00 0.00 ? 336 ASN B CA  1  
ATOM 6108   C C   . ASN B 2 336 ? -57.222  -7.680  -5.316  1.00 0.00 ? 336 ASN B C   1  
ATOM 6109   O O   . ASN B 2 336 ? -57.613  -7.222  -4.255  1.00 0.00 ? 336 ASN B O   1  
ATOM 6110   C CB  . ASN B 2 336 ? -55.307  -9.139  -5.335  1.00 0.00 ? 336 ASN B CB  1  
ATOM 6111   C CG  . ASN B 2 336 ? -54.804  -10.569 -5.193  1.00 0.00 ? 336 ASN B CG  1  
ATOM 6112   O OD1 . ASN B 2 336 ? -54.068  -10.986 -6.088  1.00 0.00 ? 336 ASN B OD1 1  
ATOM 6113   N ND2 . ASN B 2 336 ? -54.913  -11.169 -4.028  1.00 0.00 ? 336 ASN B ND2 1  
ATOM 6114   N N   . SER B 2 337 ? -57.214  -6.916  -6.472  1.00 0.00 ? 337 SER B N   1  
ATOM 6115   C CA  . SER B 2 337 ? -57.664  -5.522  -6.418  1.00 0.00 ? 337 SER B CA  1  
ATOM 6116   C C   . SER B 2 337 ? -59.151  -5.327  -6.103  1.00 0.00 ? 337 SER B C   1  
ATOM 6117   O O   . SER B 2 337 ? -59.498  -4.482  -5.245  1.00 0.00 ? 337 SER B O   1  
ATOM 6118   C CB  . SER B 2 337 ? -57.330  -4.806  -7.827  1.00 0.00 ? 337 SER B CB  1  
ATOM 6119   O OG  . SER B 2 337 ? -57.999  -5.279  -9.009  1.00 0.00 ? 337 SER B OG  1  
ATOM 6120   N N   . MET B 2 338 ? -59.980  -6.229  -6.627  1.00 0.00 ? 338 MET B N   1  
ATOM 6121   C CA  . MET B 2 338 ? -61.348  -6.178  -6.156  1.00 0.00 ? 338 MET B CA  1  
ATOM 6122   C C   . MET B 2 338 ? -61.604  -6.480  -4.754  1.00 0.00 ? 338 MET B C   1  
ATOM 6123   O O   . MET B 2 338 ? -62.486  -5.818  -4.145  1.00 0.00 ? 338 MET B O   1  
ATOM 6124   C CB  . MET B 2 338 ? -62.384  -7.064  -6.902  1.00 0.00 ? 338 MET B CB  1  
ATOM 6125   C CG  . MET B 2 338 ? -62.316  -7.199  -8.412  1.00 0.00 ? 338 MET B CG  1  
ATOM 6126   S SD  . MET B 2 338 ? -61.894  -5.663  -9.252  1.00 0.00 ? 338 MET B SD  1  
ATOM 6127   C CE  . MET B 2 338 ? -62.227  -6.384  -10.861 1.00 0.00 ? 338 MET B CE  1  
ATOM 6128   N N   . ILE B 2 339 ? -60.923  -7.506  -4.152  1.00 0.00 ? 339 ILE B N   1  
ATOM 6129   C CA  . ILE B 2 339 ? -61.326  -7.860  -2.798  1.00 0.00 ? 339 ILE B CA  1  
ATOM 6130   C C   . ILE B 2 339 ? -61.171  -6.743  -1.778  1.00 0.00 ? 339 ILE B C   1  
ATOM 6131   O O   . ILE B 2 339 ? -61.997  -6.468  -0.968  1.00 0.00 ? 339 ILE B O   1  
ATOM 6132   C CB  . ILE B 2 339 ? -60.688  -9.153  -2.282  1.00 0.00 ? 339 ILE B CB  1  
ATOM 6133   C CG1 . ILE B 2 339 ? -61.260  -9.799  -1.040  1.00 0.00 ? 339 ILE B CG1 1  
ATOM 6134   C CG2 . ILE B 2 339 ? -59.181  -8.856  -2.124  1.00 0.00 ? 339 ILE B CG2 1  
ATOM 6135   C CD1 . ILE B 2 339 ? -60.540  -11.090 -0.616  1.00 0.00 ? 339 ILE B CD1 1  
ATOM 6136   N N   . SER B 2 340 ? -60.151  -5.907  -2.073  1.00 0.00 ? 340 SER B N   1  
ATOM 6137   C CA  . SER B 2 340 ? -59.911  -4.658  -1.509  1.00 0.00 ? 340 SER B CA  1  
ATOM 6138   C C   . SER B 2 340 ? -61.044  -3.593  -1.593  1.00 0.00 ? 340 SER B C   1  
ATOM 6139   O O   . SER B 2 340 ? -61.274  -2.844  -0.616  1.00 0.00 ? 340 SER B O   1  
ATOM 6140   C CB  . SER B 2 340 ? -58.672  -4.012  -2.060  1.00 0.00 ? 340 SER B CB  1  
ATOM 6141   O OG  . SER B 2 340 ? -57.517  -4.853  -2.132  1.00 0.00 ? 340 SER B OG  1  
ATOM 6142   N N   . LEU B 2 341 ? -61.823  -3.581  -2.698  1.00 0.00 ? 341 LEU B N   1  
ATOM 6143   C CA  . LEU B 2 341 ? -63.005  -2.729  -2.831  1.00 0.00 ? 341 LEU B CA  1  
ATOM 6144   C C   . LEU B 2 341 ? -64.133  -3.095  -1.865  1.00 0.00 ? 341 LEU B C   1  
ATOM 6145   O O   . LEU B 2 341 ? -64.640  -2.256  -1.128  1.00 0.00 ? 341 LEU B O   1  
ATOM 6146   C CB  . LEU B 2 341 ? -63.539  -2.678  -4.309  1.00 0.00 ? 341 LEU B CB  1  
ATOM 6147   C CG  . LEU B 2 341 ? -62.420  -2.361  -5.297  1.00 0.00 ? 341 LEU B CG  1  
ATOM 6148   C CD1 . LEU B 2 341 ? -62.838  -2.553  -6.747  1.00 0.00 ? 341 LEU B CD1 1  
ATOM 6149   C CD2 . LEU B 2 341 ? -61.930  -0.887  -5.123  1.00 0.00 ? 341 LEU B CD2 1  
ATOM 6150   N N   . TYR B 2 342 ? -64.341  -4.430  -1.721  1.00 0.00 ? 342 TYR B N   1  
ATOM 6151   C CA  . TYR B 2 342 ? -65.163  -5.083  -0.732  1.00 0.00 ? 342 TYR B CA  1  
ATOM 6152   C C   . TYR B 2 342 ? -64.751  -4.813  0.683   1.00 0.00 ? 342 TYR B C   1  
ATOM 6153   O O   . TYR B 2 342 ? -65.628  -4.481  1.499   1.00 0.00 ? 342 TYR B O   1  
ATOM 6154   C CB  . TYR B 2 342 ? -65.384  -6.587  -0.894  1.00 0.00 ? 342 TYR B CB  1  
ATOM 6155   C CG  . TYR B 2 342 ? -66.150  -6.716  -2.158  1.00 0.00 ? 342 TYR B CG  1  
ATOM 6156   C CD1 . TYR B 2 342 ? -67.502  -6.232  -2.246  1.00 0.00 ? 342 TYR B CD1 1  
ATOM 6157   C CD2 . TYR B 2 342 ? -65.629  -7.312  -3.313  1.00 0.00 ? 342 TYR B CD2 1  
ATOM 6158   C CE1 . TYR B 2 342 ? -68.258  -6.405  -3.394  1.00 0.00 ? 342 TYR B CE1 1  
ATOM 6159   C CE2 . TYR B 2 342 ? -66.374  -7.285  -4.492  1.00 0.00 ? 342 TYR B CE2 1  
ATOM 6160   C CZ  . TYR B 2 342 ? -67.708  -6.926  -4.531  1.00 0.00 ? 342 TYR B CZ  1  
ATOM 6161   O OH  . TYR B 2 342 ? -68.386  -7.120  -5.740  1.00 0.00 ? 342 TYR B OH  1  
ATOM 6162   N N   . TYR B 2 343 ? -63.493  -4.910  1.040   1.00 0.00 ? 343 TYR B N   1  
ATOM 6163   C CA  . TYR B 2 343 ? -62.977  -4.737  2.390   1.00 0.00 ? 343 TYR B CA  1  
ATOM 6164   C C   . TYR B 2 343 ? -63.268  -3.347  2.905   1.00 0.00 ? 343 TYR B C   1  
ATOM 6165   O O   . TYR B 2 343 ? -63.706  -3.213  4.020   1.00 0.00 ? 343 TYR B O   1  
ATOM 6166   C CB  . TYR B 2 343 ? -61.405  -4.824  2.456   1.00 0.00 ? 343 TYR B CB  1  
ATOM 6167   C CG  . TYR B 2 343 ? -60.755  -6.120  2.209   1.00 0.00 ? 343 TYR B CG  1  
ATOM 6168   C CD1 . TYR B 2 343 ? -61.434  -7.368  2.447   1.00 0.00 ? 343 TYR B CD1 1  
ATOM 6169   C CD2 . TYR B 2 343 ? -59.384  -6.096  1.914   1.00 0.00 ? 343 TYR B CD2 1  
ATOM 6170   C CE1 . TYR B 2 343 ? -60.811  -8.544  2.140   1.00 0.00 ? 343 TYR B CE1 1  
ATOM 6171   C CE2 . TYR B 2 343 ? -58.804  -7.364  1.664   1.00 0.00 ? 343 TYR B CE2 1  
ATOM 6172   C CZ  . TYR B 2 343 ? -59.494  -8.620  1.723   1.00 0.00 ? 343 TYR B CZ  1  
ATOM 6173   O OH  . TYR B 2 343 ? -58.760  -9.726  1.398   1.00 0.00 ? 343 TYR B OH  1  
ATOM 6174   N N   . GLU B 2 344 ? -63.141  -2.353  1.953   1.00 0.00 ? 344 GLU B N   1  
ATOM 6175   C CA  . GLU B 2 344 ? -63.467  -0.934  2.113   1.00 0.00 ? 344 GLU B CA  1  
ATOM 6176   C C   . GLU B 2 344 ? -64.998  -0.730  2.454   1.00 0.00 ? 344 GLU B C   1  
ATOM 6177   O O   . GLU B 2 344 ? -65.327  -0.035  3.444   1.00 0.00 ? 344 GLU B O   1  
ATOM 6178   C CB  . GLU B 2 344 ? -63.196  -0.006  0.844   1.00 0.00 ? 344 GLU B CB  1  
ATOM 6179   C CG  . GLU B 2 344 ? -63.792  1.409   0.771   1.00 0.00 ? 344 GLU B CG  1  
ATOM 6180   C CD  . GLU B 2 344 ? -63.062  2.370   1.716   1.00 0.00 ? 344 GLU B CD  1  
ATOM 6181   O OE1 . GLU B 2 344 ? -63.403  2.366   2.902   1.00 0.00 ? 344 GLU B OE1 1  
ATOM 6182   O OE2 . GLU B 2 344 ? -62.106  3.037   1.230   1.00 0.00 ? 344 GLU B OE2 1  
ATOM 6183   N N   . TYR B 2 345 ? -65.862  -1.464  1.650   1.00 0.00 ? 345 TYR B N   1  
ATOM 6184   C CA  . TYR B 2 345 ? -67.309  -1.398  1.874   1.00 0.00 ? 345 TYR B CA  1  
ATOM 6185   C C   . TYR B 2 345 ? -67.719  -2.008  3.179   1.00 0.00 ? 345 TYR B C   1  
ATOM 6186   O O   . TYR B 2 345 ? -68.484  -1.561  3.971   1.00 0.00 ? 345 TYR B O   1  
ATOM 6187   C CB  . TYR B 2 345 ? -68.060  -2.114  0.773   1.00 0.00 ? 345 TYR B CB  1  
ATOM 6188   C CG  . TYR B 2 345 ? -68.004  -1.599  -0.563  1.00 0.00 ? 345 TYR B CG  1  
ATOM 6189   C CD1 . TYR B 2 345 ? -68.004  -0.170  -0.786  1.00 0.00 ? 345 TYR B CD1 1  
ATOM 6190   C CD2 . TYR B 2 345 ? -67.980  -2.486  -1.668  1.00 0.00 ? 345 TYR B CD2 1  
ATOM 6191   C CE1 . TYR B 2 345 ? -68.158  0.216   -2.163  1.00 0.00 ? 345 TYR B CE1 1  
ATOM 6192   C CE2 . TYR B 2 345 ? -67.927  -2.034  -2.923  1.00 0.00 ? 345 TYR B CE2 1  
ATOM 6193   C CZ  . TYR B 2 345 ? -68.064  -0.695  -3.238  1.00 0.00 ? 345 TYR B CZ  1  
ATOM 6194   O OH  . TYR B 2 345 ? -68.314  -0.411  -4.621  1.00 0.00 ? 345 TYR B OH  1  
ATOM 6195   N N   . LEU B 2 346 ? -67.056  -3.145  3.485   1.00 0.00 ? 346 LEU B N   1  
ATOM 6196   C CA  . LEU B 2 346 ? -67.218  -3.832  4.764   1.00 0.00 ? 346 LEU B CA  1  
ATOM 6197   C C   . LEU B 2 346 ? -66.818  -3.008  5.930   1.00 0.00 ? 346 LEU B C   1  
ATOM 6198   O O   . LEU B 2 346 ? -67.503  -2.962  6.926   1.00 0.00 ? 346 LEU B O   1  
ATOM 6199   C CB  . LEU B 2 346 ? -66.332  -5.103  4.836   1.00 0.00 ? 346 LEU B CB  1  
ATOM 6200   C CG  . LEU B 2 346 ? -66.968  -6.150  4.005   1.00 0.00 ? 346 LEU B CG  1  
ATOM 6201   C CD1 . LEU B 2 346 ? -65.993  -7.319  3.569   1.00 0.00 ? 346 LEU B CD1 1  
ATOM 6202   C CD2 . LEU B 2 346 ? -68.143  -6.763  4.730   1.00 0.00 ? 346 LEU B CD2 1  
ATOM 6203   N N   . MET B 2 347 ? -65.662  -2.352  5.770   1.00 0.00 ? 347 MET B N   1  
ATOM 6204   C CA  . MET B 2 347 ? -64.995  -1.590  6.798   1.00 0.00 ? 347 MET B CA  1  
ATOM 6205   C C   . MET B 2 347 ? -65.943  -0.461  7.212   1.00 0.00 ? 347 MET B C   1  
ATOM 6206   O O   . MET B 2 347 ? -66.110  -0.232  8.430   1.00 0.00 ? 347 MET B O   1  
ATOM 6207   C CB  . MET B 2 347 ? -63.640  -1.046  6.293   1.00 0.00 ? 347 MET B CB  1  
ATOM 6208   C CG  . MET B 2 347 ? -62.767  -0.552  7.462   1.00 0.00 ? 347 MET B CG  1  
ATOM 6209   S SD  . MET B 2 347 ? -63.132  1.090   8.135   1.00 0.00 ? 347 MET B SD  1  
ATOM 6210   C CE  . MET B 2 347 ? -61.428  1.553   8.117   1.00 0.00 ? 347 MET B CE  1  
ATOM 6211   N N   . ASN B 2 348 ? -66.599  0.154   6.228   1.00 0.00 ? 348 ASN B N   1  
ATOM 6212   C CA  . ASN B 2 348 ? -67.548  1.230   6.382   1.00 0.00 ? 348 ASN B CA  1  
ATOM 6213   C C   . ASN B 2 348 ? -68.703  0.778   7.208   1.00 0.00 ? 348 ASN B C   1  
ATOM 6214   O O   . ASN B 2 348 ? -69.164  1.450   8.119   1.00 0.00 ? 348 ASN B O   1  
ATOM 6215   C CB  . ASN B 2 348 ? -68.165  1.627   5.012   1.00 0.00 ? 348 ASN B CB  1  
ATOM 6216   C CG  . ASN B 2 348 ? -67.231  2.247   3.996   1.00 0.00 ? 348 ASN B CG  1  
ATOM 6217   O OD1 . ASN B 2 348 ? -67.101  1.957   2.798   1.00 0.00 ? 348 ASN B OD1 1  
ATOM 6218   N ND2 . ASN B 2 348 ? -66.699  3.345   4.531   1.00 0.00 ? 348 ASN B ND2 1  
ATOM 6219   N N   . TRP B 2 349 ? -69.175  -0.447  6.782   1.00 0.00 ? 349 TRP B N   1  
ATOM 6220   C CA  . TRP B 2 349 ? -70.333  -1.070  7.345   1.00 0.00 ? 349 TRP B CA  1  
ATOM 6221   C C   . TRP B 2 349 ? -70.116  -1.461  8.756   1.00 0.00 ? 349 TRP B C   1  
ATOM 6222   O O   . TRP B 2 349 ? -70.922  -0.977  9.518   1.00 0.00 ? 349 TRP B O   1  
ATOM 6223   C CB  . TRP B 2 349 ? -70.647  -2.314  6.448   1.00 0.00 ? 349 TRP B CB  1  
ATOM 6224   C CG  . TRP B 2 349 ? -71.955  -3.034  6.610   1.00 0.00 ? 349 TRP B CG  1  
ATOM 6225   C CD1 . TRP B 2 349 ? -72.087  -4.364  6.520   1.00 0.00 ? 349 TRP B CD1 1  
ATOM 6226   C CD2 . TRP B 2 349 ? -73.279  -2.435  6.846   1.00 0.00 ? 349 TRP B CD2 1  
ATOM 6227   N NE1 . TRP B 2 349 ? -73.425  -4.626  6.773   1.00 0.00 ? 349 TRP B NE1 1  
ATOM 6228   C CE2 . TRP B 2 349 ? -74.129  -3.502  6.976   1.00 0.00 ? 349 TRP B CE2 1  
ATOM 6229   C CE3 . TRP B 2 349 ? -73.690  -1.113  6.986   1.00 0.00 ? 349 TRP B CE3 1  
ATOM 6230   C CZ2 . TRP B 2 349 ? -75.462  -3.286  7.252   1.00 0.00 ? 349 TRP B CZ2 1  
ATOM 6231   C CZ3 . TRP B 2 349 ? -75.017  -0.908  7.184   1.00 0.00 ? 349 TRP B CZ3 1  
ATOM 6232   C CH2 . TRP B 2 349 ? -75.884  -1.999  7.385   1.00 0.00 ? 349 TRP B CH2 1  
ATOM 6233   N N   . LEU B 2 350 ? -69.082  -2.246  9.041   1.00 0.00 ? 350 LEU B N   1  
ATOM 6234   C CA  . LEU B 2 350 ? -68.911  -2.669  10.393  1.00 0.00 ? 350 LEU B CA  1  
ATOM 6235   C C   . LEU B 2 350 ? -68.576  -1.553  11.421  1.00 0.00 ? 350 LEU B C   1  
ATOM 6236   O O   . LEU B 2 350 ? -69.030  -1.649  12.553  1.00 0.00 ? 350 LEU B O   1  
ATOM 6237   C CB  . LEU B 2 350 ? -67.670  -3.657  10.694  1.00 0.00 ? 350 LEU B CB  1  
ATOM 6238   C CG  . LEU B 2 350 ? -67.977  -5.074  10.134  1.00 0.00 ? 350 LEU B CG  1  
ATOM 6239   C CD1 . LEU B 2 350 ? -69.204  -5.778  10.803  1.00 0.00 ? 350 LEU B CD1 1  
ATOM 6240   C CD2 . LEU B 2 350 ? -67.842  -5.384  8.641   1.00 0.00 ? 350 LEU B CD2 1  
ATOM 6241   N N   . THR B 2 351 ? -67.729  -0.611  11.069  1.00 0.00 ? 351 THR B N   1  
ATOM 6242   C CA  . THR B 2 351 ? -67.380  0.446   11.990  1.00 0.00 ? 351 THR B CA  1  
ATOM 6243   C C   . THR B 2 351 ? -68.269  1.648   12.102  1.00 0.00 ? 351 THR B C   1  
ATOM 6244   O O   . THR B 2 351 ? -68.333  2.155   13.229  1.00 0.00 ? 351 THR B O   1  
ATOM 6245   C CB  . THR B 2 351 ? -65.904  0.855   11.739  1.00 0.00 ? 351 THR B CB  1  
ATOM 6246   O OG1 . THR B 2 351 ? -65.750  1.555   10.497  1.00 0.00 ? 351 THR B OG1 1  
ATOM 6247   C CG2 . THR B 2 351 ? -65.082  -0.477  11.685  1.00 0.00 ? 351 THR B CG2 1  
ATOM 6248   N N   . LYS B 2 352 ? -68.911  2.112   10.998  1.00 0.00 ? 352 LYS B N   1  
ATOM 6249   C CA  . LYS B 2 352 ? -69.645  3.342   11.110  1.00 0.00 ? 352 LYS B CA  1  
ATOM 6250   C C   . LYS B 2 352 ? -71.016  3.071   10.573  1.00 0.00 ? 352 LYS B C   1  
ATOM 6251   O O   . LYS B 2 352 ? -71.813  3.989   10.334  1.00 0.00 ? 352 LYS B O   1  
ATOM 6252   C CB  . LYS B 2 352 ? -69.027  4.490   10.216  1.00 0.00 ? 352 LYS B CB  1  
ATOM 6253   C CG  . LYS B 2 352 ? -67.863  5.185   10.925  1.00 0.00 ? 352 LYS B CG  1  
ATOM 6254   C CD  . LYS B 2 352 ? -68.031  5.790   12.370  1.00 0.00 ? 352 LYS B CD  1  
ATOM 6255   C CE  . LYS B 2 352 ? -69.092  6.935   12.606  1.00 0.00 ? 352 LYS B CE  1  
ATOM 6256   N NZ  . LYS B 2 352 ? -70.536  6.497   12.614  1.00 0.00 ? 352 LYS B NZ  1  
ATOM 6257   N N   . GLY B 2 353 ? -71.471  1.779   10.393  1.00 0.00 ? 353 GLY B N   1  
ATOM 6258   C CA  . GLY B 2 353 ? -72.865  1.452   9.975   1.00 0.00 ? 353 GLY B CA  1  
ATOM 6259   C C   . GLY B 2 353 ? -73.081  2.104   8.587   1.00 0.00 ? 353 GLY B C   1  
ATOM 6260   O O   . GLY B 2 353 ? -74.177  2.464   8.230   1.00 0.00 ? 353 GLY B O   1  
ATOM 6261   N N   . LEU B 2 354 ? -72.054  2.309   7.817   1.00 0.00 ? 354 LEU B N   1  
ATOM 6262   C CA  . LEU B 2 354 ? -72.070  3.059   6.546   1.00 0.00 ? 354 LEU B CA  1  
ATOM 6263   C C   . LEU B 2 354 ? -71.866  2.066   5.411   1.00 0.00 ? 354 LEU B C   1  
ATOM 6264   O O   . LEU B 2 354 ? -71.100  1.062   5.488   1.00 0.00 ? 354 LEU B O   1  
ATOM 6265   C CB  . LEU B 2 354 ? -70.853  4.115   6.506   1.00 0.00 ? 354 LEU B CB  1  
ATOM 6266   C CG  . LEU B 2 354 ? -70.687  4.926   5.254   1.00 0.00 ? 354 LEU B CG  1  
ATOM 6267   C CD1 . LEU B 2 354 ? -71.927  5.721   4.863   1.00 0.00 ? 354 LEU B CD1 1  
ATOM 6268   C CD2 . LEU B 2 354 ? -69.420  5.775   5.289   1.00 0.00 ? 354 LEU B CD2 1  
ATOM 6269   N N   . LEU B 2 355 ? -72.569  2.270   4.232   1.00 0.00 ? 355 LEU B N   1  
ATOM 6270   C CA  . LEU B 2 355 ? -72.455  1.380   3.128   1.00 0.00 ? 355 LEU B CA  1  
ATOM 6271   C C   . LEU B 2 355 ? -72.778  2.136   1.850   1.00 0.00 ? 355 LEU B C   1  
ATOM 6272   O O   . LEU B 2 355 ? -73.557  3.093   1.827   1.00 0.00 ? 355 LEU B O   1  
ATOM 6273   C CB  . LEU B 2 355 ? -73.457  0.127   3.357   1.00 0.00 ? 355 LEU B CB  1  
ATOM 6274   C CG  . LEU B 2 355 ? -73.291  -1.129  2.464   1.00 0.00 ? 355 LEU B CG  1  
ATOM 6275   C CD1 . LEU B 2 355 ? -73.701  -0.991  0.940   1.00 0.00 ? 355 LEU B CD1 1  
ATOM 6276   C CD2 . LEU B 2 355 ? -71.814  -1.683  2.568   1.00 0.00 ? 355 LEU B CD2 1  
ATOM 6277   N N   . ARG B 2 356 ? -72.046  1.697   0.765   1.00 0.00 ? 356 ARG B N   1  
ATOM 6278   C CA  . ARG B 2 356 ? -72.063  2.304   -0.556  1.00 0.00 ? 356 ARG B CA  1  
ATOM 6279   C C   . ARG B 2 356 ? -72.170  1.150   -1.566  1.00 0.00 ? 356 ARG B C   1  
ATOM 6280   O O   . ARG B 2 356 ? -71.410  0.213   -1.331  1.00 0.00 ? 356 ARG B O   1  
ATOM 6281   C CB  . ARG B 2 356 ? -70.869  3.170   -0.880  1.00 0.00 ? 356 ARG B CB  1  
ATOM 6282   C CG  . ARG B 2 356 ? -70.810  4.487   -0.076  1.00 0.00 ? 356 ARG B CG  1  
ATOM 6283   C CD  . ARG B 2 356 ? -71.908  5.516   -0.346  1.00 0.00 ? 356 ARG B CD  1  
ATOM 6284   N NE  . ARG B 2 356 ? -71.699  5.957   -1.752  1.00 0.00 ? 356 ARG B NE  1  
ATOM 6285   C CZ  . ARG B 2 356 ? -72.677  5.960   -2.698  1.00 0.00 ? 356 ARG B CZ  1  
ATOM 6286   N NH1 . ARG B 2 356 ? -73.958  5.648   -2.410  1.00 0.00 ? 356 ARG B NH1 1  
ATOM 6287   N NH2 . ARG B 2 356 ? -72.267  6.187   -3.988  1.00 0.00 ? 356 ARG B NH2 1  
ATOM 6288   N N   . ALA B 2 357 ? -73.186  1.221   -2.438  1.00 0.00 ? 357 ALA B N   1  
ATOM 6289   C CA  . ALA B 2 357 ? -73.620  0.158   -3.389  1.00 0.00 ? 357 ALA B CA  1  
ATOM 6290   C C   . ALA B 2 357 ? -73.420  0.600   -4.803  1.00 0.00 ? 357 ALA B C   1  
ATOM 6291   O O   . ALA B 2 357 ? -73.459  -0.237  -5.674  1.00 0.00 ? 357 ALA B O   1  
ATOM 6292   C CB  . ALA B 2 357 ? -75.136  -0.212  -3.233  1.00 0.00 ? 357 ALA B CB  1  
ATOM 6293   N N   . THR B 2 358 ? -73.109  1.921   -4.955  1.00 0.00 ? 358 THR B N   1  
ATOM 6294   C CA  . THR B 2 358 ? -72.704  2.562   -6.217  1.00 0.00 ? 358 THR B CA  1  
ATOM 6295   C C   . THR B 2 358 ? -73.475  2.119   -7.430  1.00 0.00 ? 358 THR B C   1  
ATOM 6296   O O   . THR B 2 358 ? -74.552  2.681   -7.720  1.00 0.00 ? 358 THR B O   1  
ATOM 6297   C CB  . THR B 2 358 ? -71.161  2.577   -6.472  1.00 0.00 ? 358 THR B CB  1  
ATOM 6298   O OG1 . THR B 2 358 ? -70.587  1.293   -6.720  1.00 0.00 ? 358 THR B OG1 1  
ATOM 6299   C CG2 . THR B 2 358 ? -70.492  3.105   -5.269  1.00 0.00 ? 358 THR B CG2 1  
ATOM 6300   N N   . TYR B 2 359 ? -72.985  1.200   -8.283  1.00 0.00 ? 359 TYR B N   1  
ATOM 6301   C CA  . TYR B 2 359 ? -73.494  0.960   -9.612  1.00 0.00 ? 359 TYR B CA  1  
ATOM 6302   C C   . TYR B 2 359 ? -74.280  -0.293  -9.631  1.00 0.00 ? 359 TYR B C   1  
ATOM 6303   O O   . TYR B 2 359 ? -74.643  -0.753  -10.721 1.00 0.00 ? 359 TYR B O   1  
ATOM 6304   C CB  . TYR B 2 359 ? -72.437  0.717   -10.663 1.00 0.00 ? 359 TYR B CB  1  
ATOM 6305   C CG  . TYR B 2 359 ? -71.607  1.974   -10.798 1.00 0.00 ? 359 TYR B CG  1  
ATOM 6306   C CD1 . TYR B 2 359 ? -70.515  2.125   -9.979  1.00 0.00 ? 359 TYR B CD1 1  
ATOM 6307   C CD2 . TYR B 2 359 ? -72.021  2.933   -11.702 1.00 0.00 ? 359 TYR B CD2 1  
ATOM 6308   C CE1 . TYR B 2 359 ? -69.854  3.355   -9.927  1.00 0.00 ? 359 TYR B CE1 1  
ATOM 6309   C CE2 . TYR B 2 359 ? -71.319  4.106   -11.770 1.00 0.00 ? 359 TYR B CE2 1  
ATOM 6310   C CZ  . TYR B 2 359 ? -70.235  4.279   -10.915 1.00 0.00 ? 359 TYR B CZ  1  
ATOM 6311   O OH  . TYR B 2 359 ? -69.407  5.468   -11.087 1.00 0.00 ? 359 TYR B OH  1  
ATOM 6312   N N   . GLY B 2 360 ? -74.472  -0.898  -8.443  1.00 0.00 ? 360 GLY B N   1  
ATOM 6313   C CA  . GLY B 2 360 ? -75.240  -2.109  -8.252  1.00 0.00 ? 360 GLY B CA  1  
ATOM 6314   C C   . GLY B 2 360 ? -74.376  -3.273  -7.888  1.00 0.00 ? 360 GLY B C   1  
ATOM 6315   O O   . GLY B 2 360 ? -74.439  -4.276  -8.601  1.00 0.00 ? 360 GLY B O   1  
ATOM 6316   N N   . GLU B 2 361 ? -73.559  -3.073  -6.816  1.00 0.00 ? 361 GLU B N   1  
ATOM 6317   C CA  . GLU B 2 361 ? -72.769  -4.150  -6.258  1.00 0.00 ? 361 GLU B CA  1  
ATOM 6318   C C   . GLU B 2 361 ? -72.950  -3.980  -4.753  1.00 0.00 ? 361 GLU B C   1  
ATOM 6319   O O   . GLU B 2 361 ? -73.770  -3.256  -4.304  1.00 0.00 ? 361 GLU B O   1  
ATOM 6320   C CB  . GLU B 2 361 ? -71.295  -4.028  -6.632  1.00 0.00 ? 361 GLU B CB  1  
ATOM 6321   C CG  . GLU B 2 361 ? -70.668  -2.663  -6.418  1.00 0.00 ? 361 GLU B CG  1  
ATOM 6322   C CD  . GLU B 2 361 ? -70.473  -1.944  -7.770  1.00 0.00 ? 361 GLU B CD  1  
ATOM 6323   O OE1 . GLU B 2 361 ? -71.505  -1.605  -8.454  1.00 0.00 ? 361 GLU B OE1 1  
ATOM 6324   O OE2 . GLU B 2 361 ? -69.372  -1.808  -8.225  1.00 0.00 ? 361 GLU B OE2 1  
ATOM 6325   N N   . PHE B 2 362 ? -72.204  -4.866  -3.973  1.00 0.00 ? 362 PHE B N   1  
ATOM 6326   C CA  . PHE B 2 362 ? -72.523  -5.219  -2.574  1.00 0.00 ? 362 PHE B CA  1  
ATOM 6327   C C   . PHE B 2 362 ? -73.882  -5.868  -2.446  1.00 0.00 ? 362 PHE B C   1  
ATOM 6328   O O   . PHE B 2 362 ? -74.268  -6.577  -3.356  1.00 0.00 ? 362 PHE B O   1  
ATOM 6329   C CB  . PHE B 2 362 ? -72.335  -4.003  -1.649  1.00 0.00 ? 362 PHE B CB  1  
ATOM 6330   C CG  . PHE B 2 362 ? -71.860  -4.542  -0.320  1.00 0.00 ? 362 PHE B CG  1  
ATOM 6331   C CD1 . PHE B 2 362 ? -70.513  -4.913  -0.206  1.00 0.00 ? 362 PHE B CD1 1  
ATOM 6332   C CD2 . PHE B 2 362 ? -72.736  -4.717  0.736   1.00 0.00 ? 362 PHE B CD2 1  
ATOM 6333   C CE1 . PHE B 2 362 ? -70.038  -5.560  0.913   1.00 0.00 ? 362 PHE B CE1 1  
ATOM 6334   C CE2 . PHE B 2 362 ? -72.306  -5.449  1.829   1.00 0.00 ? 362 PHE B CE2 1  
ATOM 6335   C CZ  . PHE B 2 362 ? -70.978  -5.812  1.982   1.00 0.00 ? 362 PHE B CZ  1  
ATOM 6336   N N   . PHE B 2 363 ? -74.644  -5.673  -1.309  1.00 0.00 ? 363 PHE B N   1  
ATOM 6337   C CA  . PHE B 2 363 ? -75.913  -6.370  -1.123  1.00 0.00 ? 363 PHE B CA  1  
ATOM 6338   C C   . PHE B 2 363 ? -76.833  -5.626  -0.213  1.00 0.00 ? 363 PHE B C   1  
ATOM 6339   O O   . PHE B 2 363 ? -77.862  -6.188  0.184   1.00 0.00 ? 363 PHE B O   1  
ATOM 6340   C CB  . PHE B 2 363 ? -75.801  -7.846  -0.652  1.00 0.00 ? 363 PHE B CB  1  
ATOM 6341   C CG  . PHE B 2 363 ? -75.190  -8.014  0.761   1.00 0.00 ? 363 PHE B CG  1  
ATOM 6342   C CD1 . PHE B 2 363 ? -75.932  -7.940  1.923   1.00 0.00 ? 363 PHE B CD1 1  
ATOM 6343   C CD2 . PHE B 2 363 ? -73.863  -8.285  0.871   1.00 0.00 ? 363 PHE B CD2 1  
ATOM 6344   C CE1 . PHE B 2 363 ? -75.347  -8.207  3.173   1.00 0.00 ? 363 PHE B CE1 1  
ATOM 6345   C CE2 . PHE B 2 363 ? -73.265  -8.577  2.114   1.00 0.00 ? 363 PHE B CE2 1  
ATOM 6346   C CZ  . PHE B 2 363 ? -74.028  -8.643  3.307   1.00 0.00 ? 363 PHE B CZ  1  
ATOM 6347   N N   . ILE B 2 364 ? -76.494  -4.375  0.229   1.00 0.00 ? 364 ILE B N   1  
ATOM 6348   C CA  . ILE B 2 364 ? -77.436  -3.619  1.123   1.00 0.00 ? 364 ILE B CA  1  
ATOM 6349   C C   . ILE B 2 364 ? -78.216  -2.607  0.319   1.00 0.00 ? 364 ILE B C   1  
ATOM 6350   O O   . ILE B 2 364 ? -77.576  -1.921  -0.420  1.00 0.00 ? 364 ILE B O   1  
ATOM 6351   C CB  . ILE B 2 364 ? -76.620  -2.959  2.192   1.00 0.00 ? 364 ILE B CB  1  
ATOM 6352   C CG1 . ILE B 2 364 ? -75.893  -4.064  2.980   1.00 0.00 ? 364 ILE B CG1 1  
ATOM 6353   C CG2 . ILE B 2 364 ? -77.486  -2.180  3.132   1.00 0.00 ? 364 ILE B CG2 1  
ATOM 6354   C CD1 . ILE B 2 364 ? -75.006  -3.541  4.123   1.00 0.00 ? 364 ILE B CD1 1  
ATOM 6355   N N   . ALA B 2 365 ? -79.588  -2.588  0.507   1.00 0.00 ? 365 ALA B N   1  
ATOM 6356   C CA  . ALA B 2 365 ? -80.465  -1.656  -0.196  1.00 0.00 ? 365 ALA B CA  1  
ATOM 6357   C C   . ALA B 2 365 ? -81.270  -1.000  0.941   1.00 0.00 ? 365 ALA B C   1  
ATOM 6358   O O   . ALA B 2 365 ? -81.741  -1.615  1.900   1.00 0.00 ? 365 ALA B O   1  
ATOM 6359   C CB  . ALA B 2 365 ? -81.379  -2.235  -1.213  1.00 0.00 ? 365 ALA B CB  1  
ATOM 6360   N N   . GLU B 2 366 ? -81.611  0.319   0.794   1.00 0.00 ? 366 GLU B N   1  
ATOM 6361   C CA  . GLU B 2 366 ? -82.540  1.163   1.514   1.00 0.00 ? 366 GLU B CA  1  
ATOM 6362   C C   . GLU B 2 366 ? -83.767  0.843   0.927   1.00 0.00 ? 366 GLU B C   1  
ATOM 6363   O O   . GLU B 2 366 ? -83.758  0.518   -0.255  1.00 0.00 ? 366 GLU B O   1  
ATOM 6364   C CB  . GLU B 2 366 ? -82.279  2.664   1.298   1.00 0.00 ? 366 GLU B CB  1  
ATOM 6365   C CG  . GLU B 2 366 ? -82.934  3.702   2.186   1.00 0.00 ? 366 GLU B CG  1  
ATOM 6366   C CD  . GLU B 2 366 ? -84.246  4.095   1.597   1.00 0.00 ? 366 GLU B CD  1  
ATOM 6367   O OE1 . GLU B 2 366 ? -84.322  4.156   0.359   1.00 0.00 ? 366 GLU B OE1 1  
ATOM 6368   O OE2 . GLU B 2 366 ? -85.206  4.226   2.390   1.00 0.00 ? 366 GLU B OE2 1  
ATOM 6369   N N   . ASN B 2 367 ? -84.885  0.939   1.638   1.00 0.00 ? 367 ASN B N   1  
ATOM 6370   C CA  . ASN B 2 367 ? -86.215  0.689   1.212   1.00 0.00 ? 367 ASN B CA  1  
ATOM 6371   C C   . ASN B 2 367 ? -86.494  -0.690  0.609   1.00 0.00 ? 367 ASN B C   1  
ATOM 6372   O O   . ASN B 2 367 ? -85.537  -1.506  0.530   1.00 0.00 ? 367 ASN B O   1  
ATOM 6373   C CB  . ASN B 2 367 ? -86.967  1.737   0.400   1.00 0.00 ? 367 ASN B CB  1  
ATOM 6374   C CG  . ASN B 2 367 ? -88.503  1.541   0.355   1.00 0.00 ? 367 ASN B CG  1  
ATOM 6375   O OD1 . ASN B 2 367 ? -89.158  1.454   1.386   1.00 0.00 ? 367 ASN B OD1 1  
ATOM 6376   N ND2 . ASN B 2 367 ? -89.129  1.637   -0.848  1.00 0.00 ? 367 ASN B ND2 1  
ATOM 6377   N N   . TYR B 2 379 ? -93.695  7.688   4.340   1.00 0.00 ? 379 TYR B N   1  
ATOM 6378   C CA  . TYR B 2 379 ? -92.539  7.448   5.263   1.00 0.00 ? 379 TYR B CA  1  
ATOM 6379   C C   . TYR B 2 379 ? -92.258  5.988   5.137   1.00 0.00 ? 379 TYR B C   1  
ATOM 6380   O O   . TYR B 2 379 ? -93.134  5.133   5.238   1.00 0.00 ? 379 TYR B O   1  
ATOM 6381   C CB  . TYR B 2 379 ? -92.782  7.775   6.737   1.00 0.00 ? 379 TYR B CB  1  
ATOM 6382   C CG  . TYR B 2 379 ? -91.513  7.709   7.637   1.00 0.00 ? 379 TYR B CG  1  
ATOM 6383   C CD1 . TYR B 2 379 ? -90.920  6.495   7.995   1.00 0.00 ? 379 TYR B CD1 1  
ATOM 6384   C CD2 . TYR B 2 379 ? -90.942  8.861   8.161   1.00 0.00 ? 379 TYR B CD2 1  
ATOM 6385   C CE1 . TYR B 2 379 ? -89.712  6.419   8.642   1.00 0.00 ? 379 TYR B CE1 1  
ATOM 6386   C CE2 . TYR B 2 379 ? -89.713  8.814   8.824   1.00 0.00 ? 379 TYR B CE2 1  
ATOM 6387   C CZ  . TYR B 2 379 ? -89.106  7.558   9.087   1.00 0.00 ? 379 TYR B CZ  1  
ATOM 6388   O OH  . TYR B 2 379 ? -87.828  7.553   9.802   1.00 0.00 ? 379 TYR B OH  1  
ATOM 6389   N N   . HIS B 2 380 ? -90.981  5.712   4.944   1.00 0.00 ? 380 HIS B N   1  
ATOM 6390   C CA  . HIS B 2 380 ? -90.480  4.354   4.852   1.00 0.00 ? 380 HIS B CA  1  
ATOM 6391   C C   . HIS B 2 380 ? -89.209  4.272   5.688   1.00 0.00 ? 380 HIS B C   1  
ATOM 6392   O O   . HIS B 2 380 ? -89.238  3.905   6.866   1.00 0.00 ? 380 HIS B O   1  
ATOM 6393   C CB  . HIS B 2 380 ? -90.151  3.968   3.370   1.00 0.00 ? 380 HIS B CB  1  
ATOM 6394   C CG  . HIS B 2 380 ? -91.479  3.819   2.635   1.00 0.00 ? 380 HIS B CG  1  
ATOM 6395   N ND1 . HIS B 2 380 ? -92.149  2.622   2.569   1.00 0.00 ? 380 HIS B ND1 1  
ATOM 6396   C CD2 . HIS B 2 380 ? -92.037  4.627   1.690   1.00 0.00 ? 380 HIS B CD2 1  
ATOM 6397   C CE1 . HIS B 2 380 ? -93.012  2.730   1.551   1.00 0.00 ? 380 HIS B CE1 1  
ATOM 6398   N NE2 . HIS B 2 380 ? -93.026  3.984   1.007   1.00 0.00 ? 380 HIS B NE2 1  
ATOM 6399   N N   . ILE B 2 381 ? -88.046  4.695   5.156   1.00 0.00 ? 381 ILE B N   1  
ATOM 6400   C CA  . ILE B 2 381 ? -86.781  4.794   5.825   1.00 0.00 ? 381 ILE B CA  1  
ATOM 6401   C C   . ILE B 2 381 ? -86.268  3.573   6.626   1.00 0.00 ? 381 ILE B C   1  
ATOM 6402   O O   . ILE B 2 381 ? -86.076  3.706   7.815   1.00 0.00 ? 381 ILE B O   1  
ATOM 6403   C CB  . ILE B 2 381 ? -86.518  6.046   6.616   1.00 0.00 ? 381 ILE B CB  1  
ATOM 6404   C CG1 . ILE B 2 381 ? -87.151  7.279   5.866   1.00 0.00 ? 381 ILE B CG1 1  
ATOM 6405   C CG2 . ILE B 2 381 ? -84.940  6.307   6.777   1.00 0.00 ? 381 ILE B CG2 1  
ATOM 6406   C CD1 . ILE B 2 381 ? -86.945  8.624   6.584   1.00 0.00 ? 381 ILE B CD1 1  
ATOM 6407   N N   . PRO B 2 382 ? -85.974  2.410   5.985   1.00 0.00 ? 382 PRO B N   1  
ATOM 6408   C CA  . PRO B 2 382 ? -85.347  1.241   6.593   1.00 0.00 ? 382 PRO B CA  1  
ATOM 6409   C C   . PRO B 2 382 ? -84.039  0.961   5.766   1.00 0.00 ? 382 PRO B C   1  
ATOM 6410   O O   . PRO B 2 382 ? -83.892  1.420   4.659   1.00 0.00 ? 382 PRO B O   1  
ATOM 6411   C CB  . PRO B 2 382 ? -86.338  0.077   6.454   1.00 0.00 ? 382 PRO B CB  1  
ATOM 6412   C CG  . PRO B 2 382 ? -86.862  0.347   5.018   1.00 0.00 ? 382 PRO B CG  1  
ATOM 6413   C CD  . PRO B 2 382 ? -86.729  1.854   4.830   1.00 0.00 ? 382 PRO B CD  1  
ATOM 6414   N N   . ILE B 2 383 ? -83.123  0.106   6.294   1.00 0.00 ? 383 ILE B N   1  
ATOM 6415   C CA  . ILE B 2 383 ? -81.954  -0.361  5.562   1.00 0.00 ? 383 ILE B CA  1  
ATOM 6416   C C   . ILE B 2 383 ? -81.930  -1.913  5.711   1.00 0.00 ? 383 ILE B C   1  
ATOM 6417   O O   . ILE B 2 383 ? -82.286  -2.384  6.778   1.00 0.00 ? 383 ILE B O   1  
ATOM 6418   C CB  . ILE B 2 383 ? -80.635  0.216   6.077   1.00 0.00 ? 383 ILE B CB  1  
ATOM 6419   C CG1 . ILE B 2 383 ? -79.467  0.062   4.995   1.00 0.00 ? 383 ILE B CG1 1  
ATOM 6420   C CG2 . ILE B 2 383 ? -80.257  -0.264  7.508   1.00 0.00 ? 383 ILE B CG2 1  
ATOM 6421   C CD1 . ILE B 2 383 ? -78.110  0.624   5.452   1.00 0.00 ? 383 ILE B CD1 1  
ATOM 6422   N N   . GLU B 2 384 ? -81.686  -2.716  4.650   1.00 0.00 ? 384 GLU B N   1  
ATOM 6423   C CA  . GLU B 2 384 ? -81.879  -4.160  4.724   1.00 0.00 ? 384 GLU B CA  1  
ATOM 6424   C C   . GLU B 2 384 ? -81.032  -4.857  3.711   1.00 0.00 ? 384 GLU B C   1  
ATOM 6425   O O   . GLU B 2 384 ? -80.398  -4.169  2.881   1.00 0.00 ? 384 GLU B O   1  
ATOM 6426   C CB  . GLU B 2 384 ? -83.320  -4.699  4.441   1.00 0.00 ? 384 GLU B CB  1  
ATOM 6427   C CG  . GLU B 2 384 ? -83.943  -4.493  3.006   1.00 0.00 ? 384 GLU B CG  1  
ATOM 6428   C CD  . GLU B 2 384 ? -84.383  -3.049  2.805   1.00 0.00 ? 384 GLU B CD  1  
ATOM 6429   O OE1 . GLU B 2 384 ? -84.981  -2.537  3.805   1.00 0.00 ? 384 GLU B OE1 1  
ATOM 6430   O OE2 . GLU B 2 384 ? -84.182  -2.403  1.752   1.00 0.00 ? 384 GLU B OE2 1  
ATOM 6431   N N   . PHE B 2 385 ? -80.906  -6.250  3.848   1.00 0.00 ? 385 PHE B N   1  
ATOM 6432   C CA  . PHE B 2 385 ? -80.099  -7.097  3.030   1.00 0.00 ? 385 PHE B CA  1  
ATOM 6433   C C   . PHE B 2 385 ? -80.800  -7.664  1.898   1.00 0.00 ? 385 PHE B C   1  
ATOM 6434   O O   . PHE B 2 385 ? -81.965  -7.972  1.963   1.00 0.00 ? 385 PHE B O   1  
ATOM 6435   C CB  . PHE B 2 385 ? -79.308  -8.048  3.960   1.00 0.00 ? 385 PHE B CB  1  
ATOM 6436   C CG  . PHE B 2 385 ? -79.762  -9.482  4.100   1.00 0.00 ? 385 PHE B CG  1  
ATOM 6437   C CD1 . PHE B 2 385 ? -81.096  -9.848  4.278   1.00 0.00 ? 385 PHE B CD1 1  
ATOM 6438   C CD2 . PHE B 2 385 ? -78.800  -10.481 4.059   1.00 0.00 ? 385 PHE B CD2 1  
ATOM 6439   C CE1 . PHE B 2 385 ? -81.424  -11.161 4.480   1.00 0.00 ? 385 PHE B CE1 1  
ATOM 6440   C CE2 . PHE B 2 385 ? -79.109  -11.826 4.109   1.00 0.00 ? 385 PHE B CE2 1  
ATOM 6441   C CZ  . PHE B 2 385 ? -80.420  -12.173 4.327   1.00 0.00 ? 385 PHE B CZ  1  
ATOM 6442   N N   . ASN B 2 386 ? -80.107  -7.719  0.727   1.00 0.00 ? 386 ASN B N   1  
ATOM 6443   C CA  . ASN B 2 386 ? -80.589  -8.234  -0.519  1.00 0.00 ? 386 ASN B CA  1  
ATOM 6444   C C   . ASN B 2 386 ? -80.004  -9.663  -0.565  1.00 0.00 ? 386 ASN B C   1  
ATOM 6445   O O   . ASN B 2 386 ? -78.824  -9.836  -0.923  1.00 0.00 ? 386 ASN B O   1  
ATOM 6446   C CB  . ASN B 2 386 ? -80.063  -7.485  -1.704  1.00 0.00 ? 386 ASN B CB  1  
ATOM 6447   C CG  . ASN B 2 386 ? -80.442  -5.966  -1.600  1.00 0.00 ? 386 ASN B CG  1  
ATOM 6448   O OD1 . ASN B 2 386 ? -79.567  -5.153  -1.959  1.00 0.00 ? 386 ASN B OD1 1  
ATOM 6449   N ND2 . ASN B 2 386 ? -81.740  -5.642  -1.250  1.00 0.00 ? 386 ASN B ND2 1  
ATOM 6450   N N   . GLN B 2 387 ? -80.725  -10.754 -0.136  1.00 0.00 ? 387 GLN B N   1  
ATOM 6451   C CA  . GLN B 2 387 ? -80.133  -12.096 0.131   1.00 0.00 ? 387 GLN B CA  1  
ATOM 6452   C C   . GLN B 2 387 ? -79.563  -12.773 -1.139  1.00 0.00 ? 387 GLN B C   1  
ATOM 6453   O O   . GLN B 2 387 ? -78.546  -13.345 -1.122  1.00 0.00 ? 387 GLN B O   1  
ATOM 6454   C CB  . GLN B 2 387 ? -81.129  -13.128 0.686   1.00 0.00 ? 387 GLN B CB  1  
ATOM 6455   C CG  . GLN B 2 387 ? -80.687  -14.546 0.986   1.00 0.00 ? 387 GLN B CG  1  
ATOM 6456   C CD  . GLN B 2 387 ? -79.425  -14.691 1.903   1.00 0.00 ? 387 GLN B CD  1  
ATOM 6457   O OE1 . GLN B 2 387 ? -78.354  -14.088 1.751   1.00 0.00 ? 387 GLN B OE1 1  
ATOM 6458   N NE2 . GLN B 2 387 ? -79.611  -15.697 2.816   1.00 0.00 ? 387 GLN B NE2 1  
ATOM 6459   N N   . GLU B 2 388 ? -80.296  -12.545 -2.337  1.00 0.00 ? 388 GLU B N   1  
ATOM 6460   C CA  . GLU B 2 388 ? -79.841  -13.059 -3.598  1.00 0.00 ? 388 GLU B CA  1  
ATOM 6461   C C   . GLU B 2 388 ? -78.454  -12.484 -3.978  1.00 0.00 ? 388 GLU B C   1  
ATOM 6462   O O   . GLU B 2 388 ? -77.592  -13.198 -4.454  1.00 0.00 ? 388 GLU B O   1  
ATOM 6463   C CB  . GLU B 2 388 ? -80.818  -12.842 -4.758  1.00 0.00 ? 388 GLU B CB  1  
ATOM 6464   C CG  . GLU B 2 388 ? -80.992  -11.366 -5.320  1.00 0.00 ? 388 GLU B CG  1  
ATOM 6465   C CD  . GLU B 2 388 ? -81.739  -10.410 -4.383  1.00 0.00 ? 388 GLU B CD  1  
ATOM 6466   O OE1 . GLU B 2 388 ? -82.724  -10.821 -3.742  1.00 0.00 ? 388 GLU B OE1 1  
ATOM 6467   O OE2 . GLU B 2 388 ? -81.324  -9.247  -4.247  1.00 0.00 ? 388 GLU B OE2 1  
ATOM 6468   N N   . ARG B 2 389 ? -78.217  -11.151 -3.682  1.00 0.00 ? 389 ARG B N   1  
ATOM 6469   C CA  . ARG B 2 389 ? -76.949  -10.550 -3.918  1.00 0.00 ? 389 ARG B CA  1  
ATOM 6470   C C   . ARG B 2 389 ? -75.863  -10.965 -2.896  1.00 0.00 ? 389 ARG B C   1  
ATOM 6471   O O   . ARG B 2 389 ? -74.714  -10.965 -3.373  1.00 0.00 ? 389 ARG B O   1  
ATOM 6472   C CB  . ARG B 2 389 ? -76.893  -8.998  -4.002  1.00 0.00 ? 389 ARG B CB  1  
ATOM 6473   C CG  . ARG B 2 389 ? -77.791  -8.411  -5.088  1.00 0.00 ? 389 ARG B CG  1  
ATOM 6474   C CD  . ARG B 2 389 ? -77.190  -7.117  -5.566  1.00 0.00 ? 389 ARG B CD  1  
ATOM 6475   N NE  . ARG B 2 389 ? -77.173  -6.162  -4.388  1.00 0.00 ? 389 ARG B NE  1  
ATOM 6476   C CZ  . ARG B 2 389 ? -77.046  -4.831  -4.590  1.00 0.00 ? 389 ARG B CZ  1  
ATOM 6477   N NH1 . ARG B 2 389 ? -77.004  -4.300  -5.829  1.00 0.00 ? 389 ARG B NH1 1  
ATOM 6478   N NH2 . ARG B 2 389 ? -76.822  -4.060  -3.471  1.00 0.00 ? 389 ARG B NH2 1  
ATOM 6479   N N   . VAL B 2 390 ? -76.209  -11.426 -1.615  1.00 0.00 ? 390 VAL B N   1  
ATOM 6480   C CA  . VAL B 2 390 ? -75.138  -11.917 -0.750  1.00 0.00 ? 390 VAL B CA  1  
ATOM 6481   C C   . VAL B 2 390 ? -74.307  -12.989 -1.409  1.00 0.00 ? 390 VAL B C   1  
ATOM 6482   O O   . VAL B 2 390 ? -74.839  -13.989 -1.924  1.00 0.00 ? 390 VAL B O   1  
ATOM 6483   C CB  . VAL B 2 390 ? -75.834  -12.530 0.487   1.00 0.00 ? 390 VAL B CB  1  
ATOM 6484   C CG1 . VAL B 2 390 ? -74.760  -13.089 1.522   1.00 0.00 ? 390 VAL B CG1 1  
ATOM 6485   C CG2 . VAL B 2 390 ? -76.661  -11.349 1.134   1.00 0.00 ? 390 VAL B CG2 1  
ATOM 6486   N N   . PRO B 2 391 ? -72.953  -12.830 -1.384  1.00 0.00 ? 391 PRO B N   1  
ATOM 6487   C CA  . PRO B 2 391 ? -72.069  -13.777 -2.040  1.00 0.00 ? 391 PRO B CA  1  
ATOM 6488   C C   . PRO B 2 391 ? -71.821  -14.949 -1.124  1.00 0.00 ? 391 PRO B C   1  
ATOM 6489   O O   . PRO B 2 391 ? -71.889  -14.686 0.070   1.00 0.00 ? 391 PRO B O   1  
ATOM 6490   C CB  . PRO B 2 391 ? -70.802  -12.943 -2.284  1.00 0.00 ? 391 PRO B CB  1  
ATOM 6491   C CG  . PRO B 2 391 ? -70.868  -11.902 -1.115  1.00 0.00 ? 391 PRO B CG  1  
ATOM 6492   C CD  . PRO B 2 391 ? -72.364  -11.579 -1.064  1.00 0.00 ? 391 PRO B CD  1  
ATOM 6493   N N   . ALA B 2 392 ? -71.454  -16.100 -1.666  1.00 0.00 ? 392 ALA B N   1  
ATOM 6494   C CA  . ALA B 2 392 ? -71.121  -17.180 -0.801  1.00 0.00 ? 392 ALA B CA  1  
ATOM 6495   C C   . ALA B 2 392 ? -69.651  -17.414 -0.849  1.00 0.00 ? 392 ALA B C   1  
ATOM 6496   O O   . ALA B 2 392 ? -69.147  -18.377 -0.250  1.00 0.00 ? 392 ALA B O   1  
ATOM 6497   C CB  . ALA B 2 392 ? -71.794  -18.446 -1.271  1.00 0.00 ? 392 ALA B CB  1  
ATOM 6498   N N   . PHE B 2 393 ? -68.844  -16.504 -1.468  1.00 0.00 ? 393 PHE B N   1  
ATOM 6499   C CA  . PHE B 2 393 ? -67.390  -16.618 -1.616  1.00 0.00 ? 393 PHE B CA  1  
ATOM 6500   C C   . PHE B 2 393 ? -66.791  -16.407 -0.318  1.00 0.00 ? 393 PHE B C   1  
ATOM 6501   O O   . PHE B 2 393 ? -65.881  -17.116 0.001   1.00 0.00 ? 393 PHE B O   1  
ATOM 6502   C CB  . PHE B 2 393 ? -66.766  -15.838 -2.812  1.00 0.00 ? 393 PHE B CB  1  
ATOM 6503   C CG  . PHE B 2 393 ? -67.745  -15.946 -3.989  1.00 0.00 ? 393 PHE B CG  1  
ATOM 6504   C CD1 . PHE B 2 393 ? -68.379  -17.206 -4.267  1.00 0.00 ? 393 PHE B CD1 1  
ATOM 6505   C CD2 . PHE B 2 393 ? -68.257  -14.745 -4.585  1.00 0.00 ? 393 PHE B CD2 1  
ATOM 6506   C CE1 . PHE B 2 393 ? -69.429  -17.269 -5.206  1.00 0.00 ? 393 PHE B CE1 1  
ATOM 6507   C CE2 . PHE B 2 393 ? -69.409  -14.865 -5.386  1.00 0.00 ? 393 PHE B CE2 1  
ATOM 6508   C CZ  . PHE B 2 393 ? -69.973  -16.138 -5.720  1.00 0.00 ? 393 PHE B CZ  1  
ATOM 6509   N N   . ILE B 2 394 ? -67.413  -15.511 0.396   1.00 0.00 ? 394 ILE B N   1  
ATOM 6510   C CA  . ILE B 2 394 ? -67.287  -15.221 1.714   1.00 0.00 ? 394 ILE B CA  1  
ATOM 6511   C C   . ILE B 2 394 ? -68.671  -15.706 2.126   1.00 0.00 ? 394 ILE B C   1  
ATOM 6512   O O   . ILE B 2 394 ? -69.582  -15.211 1.461   1.00 0.00 ? 394 ILE B O   1  
ATOM 6513   C CB  . ILE B 2 394 ? -67.017  -13.787 1.995   1.00 0.00 ? 394 ILE B CB  1  
ATOM 6514   C CG1 . ILE B 2 394 ? -66.895  -13.575 3.537   1.00 0.00 ? 394 ILE B CG1 1  
ATOM 6515   C CG2 . ILE B 2 394 ? -67.980  -12.787 1.285   1.00 0.00 ? 394 ILE B CG2 1  
ATOM 6516   C CD1 . ILE B 2 394 ? -66.614  -12.120 3.950   1.00 0.00 ? 394 ILE B CD1 1  
ATOM 6517   N N   . PRO B 2 395 ? -68.956  -16.745 2.920   1.00 0.00 ? 395 PRO B N   1  
ATOM 6518   C CA  . PRO B 2 395 ? -70.261  -17.444 2.964   1.00 0.00 ? 395 PRO B CA  1  
ATOM 6519   C C   . PRO B 2 395 ? -71.463  -16.594 3.166   1.00 0.00 ? 395 PRO B C   1  
ATOM 6520   O O   . PRO B 2 395 ? -71.309  -15.633 3.856   1.00 0.00 ? 395 PRO B O   1  
ATOM 6521   C CB  . PRO B 2 395 ? -70.114  -18.431 4.097   1.00 0.00 ? 395 PRO B CB  1  
ATOM 6522   C CG  . PRO B 2 395 ? -68.584  -18.839 4.008   1.00 0.00 ? 395 PRO B CG  1  
ATOM 6523   C CD  . PRO B 2 395 ? -67.893  -17.660 3.356   1.00 0.00 ? 395 PRO B CD  1  
ATOM 6524   N N   . LYS B 2 396 ? -72.604  -17.000 2.684   1.00 0.00 ? 396 LYS B N   1  
ATOM 6525   C CA  . LYS B 2 396 ? -73.815  -16.237 2.880   1.00 0.00 ? 396 LYS B CA  1  
ATOM 6526   C C   . LYS B 2 396 ? -74.091  -16.088 4.299   1.00 0.00 ? 396 LYS B C   1  
ATOM 6527   O O   . LYS B 2 396 ? -74.535  -15.003 4.730   1.00 0.00 ? 396 LYS B O   1  
ATOM 6528   C CB  . LYS B 2 396 ? -75.005  -16.871 2.270   1.00 0.00 ? 396 LYS B CB  1  
ATOM 6529   C CG  . LYS B 2 396 ? -74.749  -16.969 0.740   1.00 0.00 ? 396 LYS B CG  1  
ATOM 6530   C CD  . LYS B 2 396 ? -75.793  -17.768 -0.107  1.00 0.00 ? 396 LYS B CD  1  
ATOM 6531   C CE  . LYS B 2 396 ? -77.051  -17.086 -0.138  1.00 0.00 ? 396 LYS B CE  1  
ATOM 6532   N NZ  . LYS B 2 396 ? -76.874  -15.648 -0.564  1.00 0.00 ? 396 LYS B NZ  1  
ATOM 6533   N N   . GLU B 2 397 ? -73.854  -17.189 5.153   1.00 0.00 ? 397 GLU B N   1  
ATOM 6534   C CA  . GLU B 2 397 ? -74.114  -17.205 6.562   1.00 0.00 ? 397 GLU B CA  1  
ATOM 6535   C C   . GLU B 2 397 ? -73.300  -16.200 7.254   1.00 0.00 ? 397 GLU B C   1  
ATOM 6536   O O   . GLU B 2 397 ? -73.712  -15.477 8.174   1.00 0.00 ? 397 GLU B O   1  
ATOM 6537   C CB  . GLU B 2 397 ? -73.959  -18.586 7.295   1.00 0.00 ? 397 GLU B CB  1  
ATOM 6538   C CG  . GLU B 2 397 ? -72.589  -19.240 7.135   1.00 0.00 ? 397 GLU B CG  1  
ATOM 6539   C CD  . GLU B 2 397 ? -71.701  -19.180 8.354   1.00 0.00 ? 397 GLU B CD  1  
ATOM 6540   O OE1 . GLU B 2 397 ? -71.121  -18.148 8.693   1.00 0.00 ? 397 GLU B OE1 1  
ATOM 6541   O OE2 . GLU B 2 397 ? -71.672  -20.304 9.009   1.00 0.00 ? 397 GLU B OE2 1  
ATOM 6542   N N   . LEU B 2 398 ? -72.046  -16.061 6.873   1.00 0.00 ? 398 LEU B N   1  
ATOM 6543   C CA  . LEU B 2 398 ? -71.064  -15.194 7.429   1.00 0.00 ? 398 LEU B CA  1  
ATOM 6544   C C   . LEU B 2 398 ? -71.476  -13.770 7.196   1.00 0.00 ? 398 LEU B C   1  
ATOM 6545   O O   . LEU B 2 398 ? -71.524  -12.881 8.072   1.00 0.00 ? 398 LEU B O   1  
ATOM 6546   C CB  . LEU B 2 398 ? -69.727  -15.414 6.713   1.00 0.00 ? 398 LEU B CB  1  
ATOM 6547   C CG  . LEU B 2 398 ? -68.386  -14.936 7.371   1.00 0.00 ? 398 LEU B CG  1  
ATOM 6548   C CD1 . LEU B 2 398 ? -67.201  -15.623 6.671   1.00 0.00 ? 398 LEU B CD1 1  
ATOM 6549   C CD2 . LEU B 2 398 ? -68.294  -13.428 7.429   1.00 0.00 ? 398 LEU B CD2 1  
ATOM 6550   N N   . ALA B 2 399 ? -71.956  -13.480 5.999   1.00 0.00 ? 399 ALA B N   1  
ATOM 6551   C CA  . ALA B 2 399 ? -72.482  -12.181 5.476   1.00 0.00 ? 399 ALA B CA  1  
ATOM 6552   C C   . ALA B 2 399 ? -73.693  -11.738 6.190   1.00 0.00 ? 399 ALA B C   1  
ATOM 6553   O O   . ALA B 2 399 ? -73.878  -10.591 6.562   1.00 0.00 ? 399 ALA B O   1  
ATOM 6554   C CB  . ALA B 2 399 ? -72.727  -12.183 3.979   1.00 0.00 ? 399 ALA B CB  1  
ATOM 6555   N N   . TYR B 2 400 ? -74.594  -12.706 6.522   1.00 0.00 ? 400 TYR B N   1  
ATOM 6556   C CA  . TYR B 2 400 ? -75.801  -12.425 7.285   1.00 0.00 ? 400 TYR B CA  1  
ATOM 6557   C C   . TYR B 2 400 ? -75.597  -11.917 8.672   1.00 0.00 ? 400 TYR B C   1  
ATOM 6558   O O   . TYR B 2 400 ? -76.149  -10.923 9.186   1.00 0.00 ? 400 TYR B O   1  
ATOM 6559   C CB  . TYR B 2 400 ? -76.585  -13.731 7.335   1.00 0.00 ? 400 TYR B CB  1  
ATOM 6560   C CG  . TYR B 2 400 ? -78.050  -13.475 7.829   1.00 0.00 ? 400 TYR B CG  1  
ATOM 6561   C CD1 . TYR B 2 400 ? -78.782  -12.394 7.328   1.00 0.00 ? 400 TYR B CD1 1  
ATOM 6562   C CD2 . TYR B 2 400 ? -78.752  -14.248 8.779   1.00 0.00 ? 400 TYR B CD2 1  
ATOM 6563   C CE1 . TYR B 2 400 ? -80.087  -12.111 7.764   1.00 0.00 ? 400 TYR B CE1 1  
ATOM 6564   C CE2 . TYR B 2 400 ? -80.021  -13.953 9.276   1.00 0.00 ? 400 TYR B CE2 1  
ATOM 6565   C CZ  . TYR B 2 400 ? -80.703  -12.827 8.764   1.00 0.00 ? 400 TYR B CZ  1  
ATOM 6566   O OH  . TYR B 2 400 ? -81.998  -12.504 9.264   1.00 0.00 ? 400 TYR B OH  1  
ATOM 6567   N N   . LYS B 2 401 ? -74.625  -12.515 9.380   1.00 0.00 ? 401 LYS B N   1  
ATOM 6568   C CA  . LYS B 2 401 ? -74.144  -12.069 10.710  1.00 0.00 ? 401 LYS B CA  1  
ATOM 6569   C C   . LYS B 2 401 ? -73.582  -10.711 10.659  1.00 0.00 ? 401 LYS B C   1  
ATOM 6570   O O   . LYS B 2 401 ? -73.853  -9.795  11.438  1.00 0.00 ? 401 LYS B O   1  
ATOM 6571   C CB  . LYS B 2 401 ? -73.094  -12.998 11.264  1.00 0.00 ? 401 LYS B CB  1  
ATOM 6572   C CG  . LYS B 2 401 ? -73.562  -14.387 11.503  1.00 0.00 ? 401 LYS B CG  1  
ATOM 6573   C CD  . LYS B 2 401 ? -72.469  -15.419 11.638  1.00 0.00 ? 401 LYS B CD  1  
ATOM 6574   C CE  . LYS B 2 401 ? -72.844  -16.936 11.686  1.00 0.00 ? 401 LYS B CE  1  
ATOM 6575   N NZ  . LYS B 2 401 ? -73.660  -17.218 10.514  1.00 0.00 ? 401 LYS B NZ  1  
ATOM 6576   N N   . ILE B 2 402 ? -72.783  -10.380 9.577   1.00 0.00 ? 402 ILE B N   1  
ATOM 6577   C CA  . ILE B 2 402 ? -72.138  -9.079  9.289   1.00 0.00 ? 402 ILE B CA  1  
ATOM 6578   C C   . ILE B 2 402 ? -73.169  -8.046  9.099   1.00 0.00 ? 402 ILE B C   1  
ATOM 6579   O O   . ILE B 2 402 ? -73.057  -6.899  9.523   1.00 0.00 ? 402 ILE B O   1  
ATOM 6580   C CB  . ILE B 2 402 ? -71.275  -9.192  7.974   1.00 0.00 ? 402 ILE B CB  1  
ATOM 6581   C CG1 . ILE B 2 402 ? -70.019  -10.054 8.199   1.00 0.00 ? 402 ILE B CG1 1  
ATOM 6582   C CG2 . ILE B 2 402 ? -70.892  -7.816  7.485   1.00 0.00 ? 402 ILE B CG2 1  
ATOM 6583   C CD1 . ILE B 2 402 ? -69.130  -10.206 6.953   1.00 0.00 ? 402 ILE B CD1 1  
ATOM 6584   N N   . PHE B 2 403 ? -74.265  -8.401  8.356   1.00 0.00 ? 403 PHE B N   1  
ATOM 6585   C CA  . PHE B 2 403 ? -75.388  -7.448  8.025   1.00 0.00 ? 403 PHE B CA  1  
ATOM 6586   C C   . PHE B 2 403 ? -75.964  -6.978  9.290   1.00 0.00 ? 403 PHE B C   1  
ATOM 6587   O O   . PHE B 2 403 ? -76.296  -5.804  9.484   1.00 0.00 ? 403 PHE B O   1  
ATOM 6588   C CB  . PHE B 2 403 ? -76.512  -8.116  7.207   1.00 0.00 ? 403 PHE B CB  1  
ATOM 6589   C CG  . PHE B 2 403 ? -77.909  -7.724  7.331   1.00 0.00 ? 403 PHE B CG  1  
ATOM 6590   C CD1 . PHE B 2 403 ? -78.193  -6.398  7.007   1.00 0.00 ? 403 PHE B CD1 1  
ATOM 6591   C CD2 . PHE B 2 403 ? -78.893  -8.645  7.681   1.00 0.00 ? 403 PHE B CD2 1  
ATOM 6592   C CE1 . PHE B 2 403 ? -79.561  -5.995  7.076   1.00 0.00 ? 403 PHE B CE1 1  
ATOM 6593   C CE2 . PHE B 2 403 ? -80.193  -8.268  7.836   1.00 0.00 ? 403 PHE B CE2 1  
ATOM 6594   C CZ  . PHE B 2 403 ? -80.556  -6.923  7.465   1.00 0.00 ? 403 PHE B CZ  1  
ATOM 6595   N N   . MET B 2 404 ? -76.226  -7.936  10.228  1.00 0.00 ? 404 MET B N   1  
ATOM 6596   C CA  . MET B 2 404 ? -76.889  -7.639  11.512  1.00 0.00 ? 404 MET B CA  1  
ATOM 6597   C C   . MET B 2 404 ? -76.107  -6.734  12.369  1.00 0.00 ? 404 MET B C   1  
ATOM 6598   O O   . MET B 2 404 ? -76.596  -5.714  12.821  1.00 0.00 ? 404 MET B O   1  
ATOM 6599   C CB  . MET B 2 404 ? -77.173  -8.945  12.365  1.00 0.00 ? 404 MET B CB  1  
ATOM 6600   C CG  . MET B 2 404 ? -78.057  -9.995  11.648  1.00 0.00 ? 404 MET B CG  1  
ATOM 6601   S SD  . MET B 2 404 ? -77.807  -11.696 12.149  1.00 0.00 ? 404 MET B SD  1  
ATOM 6602   C CE  . MET B 2 404 ? -79.287  -11.827 13.264  1.00 0.00 ? 404 MET B CE  1  
ATOM 6603   N N   . ILE B 2 405 ? -74.788  -6.976  12.441  1.00 0.00 ? 405 ILE B N   1  
ATOM 6604   C CA  . ILE B 2 405 ? -73.817  -6.170  13.149  1.00 0.00 ? 405 ILE B CA  1  
ATOM 6605   C C   . ILE B 2 405 ? -73.684  -4.749  12.642  1.00 0.00 ? 405 ILE B C   1  
ATOM 6606   O O   . ILE B 2 405 ? -73.763  -3.756  13.377  1.00 0.00 ? 405 ILE B O   1  
ATOM 6607   C CB  . ILE B 2 405 ? -72.421  -6.846  13.088  1.00 0.00 ? 405 ILE B CB  1  
ATOM 6608   C CG1 . ILE B 2 405 ? -72.517  -8.209  13.780  1.00 0.00 ? 405 ILE B CG1 1  
ATOM 6609   C CG2 . ILE B 2 405 ? -71.215  -6.069  13.758  1.00 0.00 ? 405 ILE B CG2 1  
ATOM 6610   C CD1 . ILE B 2 405 ? -71.198  -8.999  13.796  1.00 0.00 ? 405 ILE B CD1 1  
ATOM 6611   N N   . GLY B 2 406 ? -73.599  -4.479  11.285  1.00 0.00 ? 406 GLY B N   1  
ATOM 6612   C CA  . GLY B 2 406 ? -73.517  -3.116  10.720  1.00 0.00 ? 406 GLY B CA  1  
ATOM 6613   C C   . GLY B 2 406 ? -74.779  -2.297  11.025  1.00 0.00 ? 406 GLY B C   1  
ATOM 6614   O O   . GLY B 2 406 ? -74.778  -1.094  11.329  1.00 0.00 ? 406 GLY B O   1  
ATOM 6615   N N   . LYS B 2 407 ? -75.911  -3.021  10.870  1.00 0.00 ? 407 LYS B N   1  
ATOM 6616   C CA  . LYS B 2 407 ? -77.217  -2.501  11.012  1.00 0.00 ? 407 LYS B CA  1  
ATOM 6617   C C   . LYS B 2 407 ? -77.497  -2.015  12.383  1.00 0.00 ? 407 LYS B C   1  
ATOM 6618   O O   . LYS B 2 407 ? -78.043  -0.944  12.572  1.00 0.00 ? 407 LYS B O   1  
ATOM 6619   C CB  . LYS B 2 407 ? -78.259  -3.617  10.654  1.00 0.00 ? 407 LYS B CB  1  
ATOM 6620   C CG  . LYS B 2 407 ? -79.728  -3.308  11.044  1.00 0.00 ? 407 LYS B CG  1  
ATOM 6621   C CD  . LYS B 2 407 ? -80.862  -4.304  10.441  1.00 0.00 ? 407 LYS B CD  1  
ATOM 6622   C CE  . LYS B 2 407 ? -80.885  -5.789  10.963  1.00 0.00 ? 407 LYS B CE  1  
ATOM 6623   N NZ  . LYS B 2 407 ? -82.022  -6.527  10.415  1.00 0.00 ? 407 LYS B NZ  1  
ATOM 6624   N N   . SER B 2 408 ? -77.045  -2.803  13.337  1.00 0.00 ? 408 SER B N   1  
ATOM 6625   C CA  . SER B 2 408 ? -77.059  -2.583  14.725  1.00 0.00 ? 408 SER B CA  1  
ATOM 6626   C C   . SER B 2 408 ? -76.220  -1.341  15.072  1.00 0.00 ? 408 SER B C   1  
ATOM 6627   O O   . SER B 2 408 ? -76.690  -0.522  15.877  1.00 0.00 ? 408 SER B O   1  
ATOM 6628   C CB  . SER B 2 408 ? -76.432  -3.720  15.513  1.00 0.00 ? 408 SER B CB  1  
ATOM 6629   O OG  . SER B 2 408 ? -77.155  -4.939  15.274  1.00 0.00 ? 408 SER B OG  1  
ATOM 6630   N N   . TYR B 2 409 ? -75.043  -1.193  14.408  1.00 0.00 ? 409 TYR B N   1  
ATOM 6631   C CA  . TYR B 2 409 ? -74.226  -0.043  14.697  1.00 0.00 ? 409 TYR B CA  1  
ATOM 6632   C C   . TYR B 2 409 ? -74.857  1.227   14.320  1.00 0.00 ? 409 TYR B C   1  
ATOM 6633   O O   . TYR B 2 409 ? -74.854  2.175   15.092  1.00 0.00 ? 409 TYR B O   1  
ATOM 6634   C CB  . TYR B 2 409 ? -72.830  -0.042  14.006  1.00 0.00 ? 409 TYR B CB  1  
ATOM 6635   C CG  . TYR B 2 409 ? -71.890  0.728   14.985  1.00 0.00 ? 409 TYR B CG  1  
ATOM 6636   C CD1 . TYR B 2 409 ? -71.497  0.053   16.158  1.00 0.00 ? 409 TYR B CD1 1  
ATOM 6637   C CD2 . TYR B 2 409 ? -71.407  1.975   14.607  1.00 0.00 ? 409 TYR B CD2 1  
ATOM 6638   C CE1 . TYR B 2 409 ? -70.767  0.721   17.118  1.00 0.00 ? 409 TYR B CE1 1  
ATOM 6639   C CE2 . TYR B 2 409 ? -70.634  2.687   15.599  1.00 0.00 ? 409 TYR B CE2 1  
ATOM 6640   C CZ  . TYR B 2 409 ? -70.334  1.999   16.838  1.00 0.00 ? 409 TYR B CZ  1  
ATOM 6641   O OH  . TYR B 2 409 ? -69.596  2.687   17.832  1.00 0.00 ? 409 TYR B OH  1  
ATOM 6642   N N   . ILE B 2 410 ? -75.473  1.293   13.139  1.00 0.00 ? 410 ILE B N   1  
ATOM 6643   C CA  . ILE B 2 410 ? -76.069  2.544   12.682  1.00 0.00 ? 410 ILE B CA  1  
ATOM 6644   C C   . ILE B 2 410 ? -77.211  2.926   13.606  1.00 0.00 ? 410 ILE B C   1  
ATOM 6645   O O   . ILE B 2 410 ? -77.426  4.077   13.942  1.00 0.00 ? 410 ILE B O   1  
ATOM 6646   C CB  . ILE B 2 410 ? -76.643  2.637   11.264  1.00 0.00 ? 410 ILE B CB  1  
ATOM 6647   C CG1 . ILE B 2 410 ? -76.566  1.378   10.424  1.00 0.00 ? 410 ILE B CG1 1  
ATOM 6648   C CG2 . ILE B 2 410 ? -75.877  3.843   10.576  1.00 0.00 ? 410 ILE B CG2 1  
ATOM 6649   C CD1 . ILE B 2 410 ? -77.156  1.529   9.012   1.00 0.00 ? 410 ILE B CD1 1  
ATOM 6650   N N   . PHE B 2 411 ? -77.985  1.870   13.997  1.00 0.00 ? 411 PHE B N   1  
ATOM 6651   C CA  . PHE B 2 411 ? -79.140  1.988   14.782  1.00 0.00 ? 411 PHE B CA  1  
ATOM 6652   C C   . PHE B 2 411 ? -78.824  2.550   16.184  1.00 0.00 ? 411 PHE B C   1  
ATOM 6653   O O   . PHE B 2 411 ? -79.623  3.374   16.721  1.00 0.00 ? 411 PHE B O   1  
ATOM 6654   C CB  . PHE B 2 411 ? -79.965  0.654   14.867  1.00 0.00 ? 411 PHE B CB  1  
ATOM 6655   C CG  . PHE B 2 411 ? -80.994  0.609   15.953  1.00 0.00 ? 411 PHE B CG  1  
ATOM 6656   C CD1 . PHE B 2 411 ? -82.287  1.308   15.752  1.00 0.00 ? 411 PHE B CD1 1  
ATOM 6657   C CD2 . PHE B 2 411 ? -80.808  -0.033  17.194  1.00 0.00 ? 411 PHE B CD2 1  
ATOM 6658   C CE1 . PHE B 2 411 ? -83.254  1.252   16.798  1.00 0.00 ? 411 PHE B CE1 1  
ATOM 6659   C CE2 . PHE B 2 411 ? -81.846  -0.041  18.229  1.00 0.00 ? 411 PHE B CE2 1  
ATOM 6660   C CZ  . PHE B 2 411 ? -82.989  0.638   18.020  1.00 0.00 ? 411 PHE B CZ  1  
ATOM 6661   N N   . LEU B 2 412 ? -77.686  2.151   16.766  1.00 0.00 ? 412 LEU B N   1  
ATOM 6662   C CA  . LEU B 2 412 ? -77.193  2.590   17.971  1.00 0.00 ? 412 LEU B CA  1  
ATOM 6663   C C   . LEU B 2 412 ? -76.866  4.039   17.923  1.00 0.00 ? 412 LEU B C   1  
ATOM 6664   O O   . LEU B 2 412 ? -77.100  4.875   18.811  1.00 0.00 ? 412 LEU B O   1  
ATOM 6665   C CB  . LEU B 2 412 ? -76.001  1.640   18.381  1.00 0.00 ? 412 LEU B CB  1  
ATOM 6666   C CG  . LEU B 2 412 ? -75.463  1.745   19.908  1.00 0.00 ? 412 LEU B CG  1  
ATOM 6667   C CD1 . LEU B 2 412 ? -76.533  1.275   20.825  1.00 0.00 ? 412 LEU B CD1 1  
ATOM 6668   C CD2 . LEU B 2 412 ? -74.034  1.063   19.978  1.00 0.00 ? 412 LEU B CD2 1  
ATOM 6669   N N   . GLU B 2 413 ? -76.293  4.470   16.784  1.00 0.00 ? 413 GLU B N   1  
ATOM 6670   C CA  . GLU B 2 413 ? -75.963  5.867   16.624  1.00 0.00 ? 413 GLU B CA  1  
ATOM 6671   C C   . GLU B 2 413 ? -77.080  6.725   16.607  1.00 0.00 ? 413 GLU B C   1  
ATOM 6672   O O   . GLU B 2 413 ? -77.079  7.783   17.265  1.00 0.00 ? 413 GLU B O   1  
ATOM 6673   C CB  . GLU B 2 413 ? -75.188  6.229   15.386  1.00 0.00 ? 413 GLU B CB  1  
ATOM 6674   C CG  . GLU B 2 413 ? -73.947  5.339   15.157  1.00 0.00 ? 413 GLU B CG  1  
ATOM 6675   C CD  . GLU B 2 413 ? -73.270  5.179   16.497  1.00 0.00 ? 413 GLU B CD  1  
ATOM 6676   O OE1 . GLU B 2 413 ? -72.898  6.233   17.102  1.00 0.00 ? 413 GLU B OE1 1  
ATOM 6677   O OE2 . GLU B 2 413 ? -73.223  4.010   16.957  1.00 0.00 ? 413 GLU B OE2 1  
ATOM 6678   N N   . LYS B 2 414 ? -78.191  6.297   15.936  1.00 0.00 ? 414 LYS B N   1  
ATOM 6679   C CA  . LYS B 2 414 ? -79.430  7.020   15.843  1.00 0.00 ? 414 LYS B CA  1  
ATOM 6680   C C   . LYS B 2 414 ? -80.084  7.150   17.174  1.00 0.00 ? 414 LYS B C   1  
ATOM 6681   O O   . LYS B 2 414 ? -80.566  8.215   17.525  1.00 0.00 ? 414 LYS B O   1  
ATOM 6682   C CB  . LYS B 2 414 ? -80.397  6.264   14.914  1.00 0.00 ? 414 LYS B CB  1  
ATOM 6683   C CG  . LYS B 2 414 ? -81.758  7.009   14.600  1.00 0.00 ? 414 LYS B CG  1  
ATOM 6684   C CD  . LYS B 2 414 ? -83.038  6.178   14.725  1.00 0.00 ? 414 LYS B CD  1  
ATOM 6685   C CE  . LYS B 2 414 ? -83.432  5.906   16.172  1.00 0.00 ? 414 LYS B CE  1  
ATOM 6686   N NZ  . LYS B 2 414 ? -82.763  4.693   16.701  1.00 0.00 ? 414 LYS B NZ  1  
ATOM 6687   N N   . TYR B 2 415 ? -79.845  6.100   18.001  1.00 0.00 ? 415 TYR B N   1  
ATOM 6688   C CA  . TYR B 2 415 ? -80.394  6.104   19.340  1.00 0.00 ? 415 TYR B CA  1  
ATOM 6689   C C   . TYR B 2 415 ? -79.906  7.238   20.179  1.00 0.00 ? 415 TYR B C   1  
ATOM 6690   O O   . TYR B 2 415 ? -80.657  8.045   20.802  1.00 0.00 ? 415 TYR B O   1  
ATOM 6691   C CB  . TYR B 2 415 ? -80.135  4.755   20.048  1.00 0.00 ? 415 TYR B CB  1  
ATOM 6692   C CG  . TYR B 2 415 ? -81.135  4.546   21.221  1.00 0.00 ? 415 TYR B CG  1  
ATOM 6693   C CD1 . TYR B 2 415 ? -81.045  5.164   22.447  1.00 0.00 ? 415 TYR B CD1 1  
ATOM 6694   C CD2 . TYR B 2 415 ? -82.275  3.703   21.012  1.00 0.00 ? 415 TYR B CD2 1  
ATOM 6695   C CE1 . TYR B 2 415 ? -81.997  5.103   23.464  1.00 0.00 ? 415 TYR B CE1 1  
ATOM 6696   C CE2 . TYR B 2 415 ? -83.237  3.521   22.061  1.00 0.00 ? 415 TYR B CE2 1  
ATOM 6697   C CZ  . TYR B 2 415 ? -83.086  4.192   23.266  1.00 0.00 ? 415 TYR B CZ  1  
ATOM 6698   O OH  . TYR B 2 415 ? -84.018  3.912   24.283  1.00 0.00 ? 415 TYR B OH  1  
ATOM 6699   N N   . CYS B 2 416 ? -78.513  7.334   20.146  1.00 0.00 ? 416 CYS B N   1  
ATOM 6700   C CA  . CYS B 2 416 ? -77.672  8.281   20.910  1.00 0.00 ? 416 CYS B CA  1  
ATOM 6701   C C   . CYS B 2 416 ? -76.445  8.329   20.111  1.00 0.00 ? 416 CYS B C   1  
ATOM 6702   O O   . CYS B 2 416 ? -76.006  7.414   19.556  1.00 0.00 ? 416 CYS B O   1  
ATOM 6703   C CB  . CYS B 2 416 ? -77.340  7.682   22.316  1.00 0.00 ? 416 CYS B CB  1  
ATOM 6704   S SG  . CYS B 2 416 ? -76.517  8.802   23.385  1.00 0.00 ? 416 CYS B SG  1  
ATOM 6705   N N   . LYS B 2 417 ? -75.898  9.574   19.996  1.00 0.00 ? 417 LYS B N   1  
ATOM 6706   C CA  . LYS B 2 417 ? -74.723  9.966   19.286  1.00 0.00 ? 417 LYS B CA  1  
ATOM 6707   C C   . LYS B 2 417 ? -73.592  9.247   19.949  1.00 0.00 ? 417 LYS B C   1  
ATOM 6708   O O   . LYS B 2 417 ? -72.872  8.501   19.268  1.00 0.00 ? 417 LYS B O   1  
ATOM 6709   C CB  . LYS B 2 417 ? -74.331  11.477  19.168  1.00 0.00 ? 417 LYS B CB  1  
ATOM 6710   C CG  . LYS B 2 417 ? -72.896  11.768  18.657  1.00 0.00 ? 417 LYS B CG  1  
ATOM 6711   C CD  . LYS B 2 417 ? -72.532  13.211  18.746  1.00 0.00 ? 417 LYS B CD  1  
ATOM 6712   C CE  . LYS B 2 417 ? -71.036  13.521  18.409  1.00 0.00 ? 417 LYS B CE  1  
ATOM 6713   N NZ  . LYS B 2 417 ? -70.154  12.998  19.547  1.00 0.00 ? 417 LYS B NZ  1  
ATOM 6714   N N   . GLU B 2 418 ? -73.481  9.471   21.325  1.00 0.00 ? 418 GLU B N   1  
ATOM 6715   C CA  . GLU B 2 418 ? -72.466  8.884   22.209  1.00 0.00 ? 418 GLU B CA  1  
ATOM 6716   C C   . GLU B 2 418 ? -72.743  7.447   22.283  1.00 0.00 ? 418 GLU B C   1  
ATOM 6717   O O   . GLU B 2 418 ? -73.667  6.931   22.892  1.00 0.00 ? 418 GLU B O   1  
ATOM 6718   C CB  . GLU B 2 418 ? -72.541  9.603   23.580  1.00 0.00 ? 418 GLU B CB  1  
ATOM 6719   C CG  . GLU B 2 418 ? -71.283  9.281   24.432  1.00 0.00 ? 418 GLU B CG  1  
ATOM 6720   C CD  . GLU B 2 418 ? -71.056  7.810   24.899  1.00 0.00 ? 418 GLU B CD  1  
ATOM 6721   O OE1 . GLU B 2 418 ? -72.024  7.226   25.378  1.00 0.00 ? 418 GLU B OE1 1  
ATOM 6722   O OE2 . GLU B 2 418 ? -69.883  7.318   24.673  1.00 0.00 ? 418 GLU B OE2 1  
ATOM 6723   N N   . VAL B 2 419 ? -71.803  6.683   21.613  1.00 0.00 ? 419 VAL B N   1  
ATOM 6724   C CA  . VAL B 2 419 ? -71.716  5.201   21.575  1.00 0.00 ? 419 VAL B CA  1  
ATOM 6725   C C   . VAL B 2 419 ? -70.365  4.819   22.145  1.00 0.00 ? 419 VAL B C   1  
ATOM 6726   O O   . VAL B 2 419 ? -69.548  5.656   22.508  1.00 0.00 ? 419 VAL B O   1  
ATOM 6727   C CB  . VAL B 2 419 ? -71.862  4.719   20.133  1.00 0.00 ? 419 VAL B CB  1  
ATOM 6728   C CG1 . VAL B 2 419 ? -73.372  4.906   19.816  1.00 0.00 ? 419 VAL B CG1 1  
ATOM 6729   C CG2 . VAL B 2 419 ? -70.855  5.565   19.287  1.00 0.00 ? 419 VAL B CG2 1  
ATOM 6730   N N   . GLN B 2 420 ? -70.100  3.501   22.270  1.00 0.00 ? 420 GLN B N   1  
ATOM 6731   C CA  . GLN B 2 420 ? -68.848  2.878   22.691  1.00 0.00 ? 420 GLN B CA  1  
ATOM 6732   C C   . GLN B 2 420 ? -67.830  3.339   21.591  1.00 0.00 ? 420 GLN B C   1  
ATOM 6733   O O   . GLN B 2 420 ? -67.967  3.117   20.409  1.00 0.00 ? 420 GLN B O   1  
ATOM 6734   C CB  . GLN B 2 420 ? -68.926  1.379   22.639  1.00 0.00 ? 420 GLN B CB  1  
ATOM 6735   C CG  . GLN B 2 420 ? -69.891  0.765   23.713  1.00 0.00 ? 420 GLN B CG  1  
ATOM 6736   C CD  . GLN B 2 420 ? -69.338  1.103   25.142  1.00 0.00 ? 420 GLN B CD  1  
ATOM 6737   O OE1 . GLN B 2 420 ? -68.133  1.177   25.396  1.00 0.00 ? 420 GLN B OE1 1  
ATOM 6738   N NE2 . GLN B 2 420 ? -70.300  0.972   26.162  1.00 0.00 ? 420 GLN B NE2 1  
ATOM 6739   N N   . TRP B 2 421 ? -66.849  4.192   22.034  1.00 0.00 ? 421 TRP B N   1  
ATOM 6740   C CA  . TRP B 2 421 ? -65.972  5.002   21.178  1.00 0.00 ? 421 TRP B CA  1  
ATOM 6741   C C   . TRP B 2 421 ? -64.661  4.315   20.817  1.00 0.00 ? 421 TRP B C   1  
ATOM 6742   O O   . TRP B 2 421 ? -64.381  4.058   19.647  1.00 0.00 ? 421 TRP B O   1  
ATOM 6743   C CB  . TRP B 2 421 ? -65.598  6.413   21.746  1.00 0.00 ? 421 TRP B CB  1  
ATOM 6744   C CG  . TRP B 2 421 ? -66.707  7.293   21.654  1.00 0.00 ? 421 TRP B CG  1  
ATOM 6745   C CD1 . TRP B 2 421 ? -67.316  7.922   22.683  1.00 0.00 ? 421 TRP B CD1 1  
ATOM 6746   C CD2 . TRP B 2 421 ? -67.437  7.624   20.424  1.00 0.00 ? 421 TRP B CD2 1  
ATOM 6747   N NE1 . TRP B 2 421 ? -68.457  8.583   22.204  1.00 0.00 ? 421 TRP B NE1 1  
ATOM 6748   C CE2 . TRP B 2 421 ? -68.521  8.462   20.818  1.00 0.00 ? 421 TRP B CE2 1  
ATOM 6749   C CE3 . TRP B 2 421 ? -67.288  7.247   19.116  1.00 0.00 ? 421 TRP B CE3 1  
ATOM 6750   C CZ2 . TRP B 2 421 ? -69.503  8.969   19.991  1.00 0.00 ? 421 TRP B CZ2 1  
ATOM 6751   C CZ3 . TRP B 2 421 ? -68.353  7.747   18.225  1.00 0.00 ? 421 TRP B CZ3 1  
ATOM 6752   C CH2 . TRP B 2 421 ? -69.431  8.512   18.680  1.00 0.00 ? 421 TRP B CH2 1  
ATOM 6753   N N   . THR B 2 422 ? -63.744  4.276   21.768  1.00 0.00 ? 422 THR B N   1  
ATOM 6754   C CA  . THR B 2 422 ? -62.333  4.167   21.355  1.00 0.00 ? 422 THR B CA  1  
ATOM 6755   C C   . THR B 2 422 ? -62.117  2.843   20.627  1.00 0.00 ? 422 THR B C   1  
ATOM 6756   O O   . THR B 2 422 ? -61.238  2.708   19.694  1.00 0.00 ? 422 THR B O   1  
ATOM 6757   C CB  . THR B 2 422 ? -61.343  4.176   22.552  1.00 0.00 ? 422 THR B CB  1  
ATOM 6758   O OG1 . THR B 2 422 ? -61.697  5.333   23.349  1.00 0.00 ? 422 THR B OG1 1  
ATOM 6759   C CG2 . THR B 2 422 ? -59.911  4.272   22.206  1.00 0.00 ? 422 THR B CG2 1  
ATOM 6760   N N   . ASN B 2 423 ? -62.971  1.826   21.011  1.00 0.00 ? 423 ASN B N   1  
ATOM 6761   C CA  . ASN B 2 423 ? -63.108  0.490   20.531  1.00 0.00 ? 423 ASN B CA  1  
ATOM 6762   C C   . ASN B 2 423 ? -63.434  0.429   19.035  1.00 0.00 ? 423 ASN B C   1  
ATOM 6763   O O   . ASN B 2 423 ? -62.904  -0.359  18.307  1.00 0.00 ? 423 ASN B O   1  
ATOM 6764   C CB  . ASN B 2 423 ? -64.193  -0.202  21.321  1.00 0.00 ? 423 ASN B CB  1  
ATOM 6765   C CG  . ASN B 2 423 ? -65.562  0.473   21.340  1.00 0.00 ? 423 ASN B CG  1  
ATOM 6766   O OD1 . ASN B 2 423 ? -65.615  1.425   22.100  1.00 0.00 ? 423 ASN B OD1 1  
ATOM 6767   N ND2 . ASN B 2 423 ? -66.525  0.057   20.487  1.00 0.00 ? 423 ASN B ND2 1  
ATOM 6768   N N   . GLU B 2 424 ? -64.324  1.338   18.489  1.00 0.00 ? 424 GLU B N   1  
ATOM 6769   C CA  . GLU B 2 424 ? -64.664  1.369   17.116  1.00 0.00 ? 424 GLU B CA  1  
ATOM 6770   C C   . GLU B 2 424 ? -63.448  1.675   16.256  1.00 0.00 ? 424 GLU B C   1  
ATOM 6771   O O   . GLU B 2 424 ? -63.305  1.101   15.161  1.00 0.00 ? 424 GLU B O   1  
ATOM 6772   C CB  . GLU B 2 424 ? -65.913  2.259   16.743  1.00 0.00 ? 424 GLU B CB  1  
ATOM 6773   C CG  . GLU B 2 424 ? -65.954  3.699   17.231  1.00 0.00 ? 424 GLU B CG  1  
ATOM 6774   C CD  . GLU B 2 424 ? -67.196  4.579   16.853  1.00 0.00 ? 424 GLU B CD  1  
ATOM 6775   O OE1 . GLU B 2 424 ? -67.274  4.851   15.653  1.00 0.00 ? 424 GLU B OE1 1  
ATOM 6776   O OE2 . GLU B 2 424 ? -67.947  4.899   17.772  1.00 0.00 ? 424 GLU B OE2 1  
ATOM 6777   N N   . PHE B 2 425 ? -62.605  2.652   16.688  1.00 0.00 ? 425 PHE B N   1  
ATOM 6778   C CA  . PHE B 2 425 ? -61.449  3.191   16.064  1.00 0.00 ? 425 PHE B CA  1  
ATOM 6779   C C   . PHE B 2 425 ? -60.418  2.136   16.004  1.00 0.00 ? 425 PHE B C   1  
ATOM 6780   O O   . PHE B 2 425 ? -59.705  1.980   15.023  1.00 0.00 ? 425 PHE B O   1  
ATOM 6781   C CB  . PHE B 2 425 ? -60.822  4.520   16.636  1.00 0.00 ? 425 PHE B CB  1  
ATOM 6782   C CG  . PHE B 2 425 ? -61.839  5.534   17.200  1.00 0.00 ? 425 PHE B CG  1  
ATOM 6783   C CD1 . PHE B 2 425 ? -62.966  5.905   16.435  1.00 0.00 ? 425 PHE B CD1 1  
ATOM 6784   C CD2 . PHE B 2 425 ? -61.661  6.154   18.470  1.00 0.00 ? 425 PHE B CD2 1  
ATOM 6785   C CE1 . PHE B 2 425 ? -63.963  6.754   17.033  1.00 0.00 ? 425 PHE B CE1 1  
ATOM 6786   C CE2 . PHE B 2 425 ? -62.610  6.971   18.992  1.00 0.00 ? 425 PHE B CE2 1  
ATOM 6787   C CZ  . PHE B 2 425 ? -63.837  7.229   18.298  1.00 0.00 ? 425 PHE B CZ  1  
ATOM 6788   N N   . SER B 2 426 ? -60.279  1.279   17.077  1.00 0.00 ? 426 SER B N   1  
ATOM 6789   C CA  . SER B 2 426 ? -59.355  0.185   17.179  1.00 0.00 ? 426 SER B CA  1  
ATOM 6790   C C   . SER B 2 426 ? -59.763  -0.765  16.105  1.00 0.00 ? 426 SER B C   1  
ATOM 6791   O O   . SER B 2 426 ? -58.903  -1.341  15.509  1.00 0.00 ? 426 SER B O   1  
ATOM 6792   C CB  . SER B 2 426 ? -59.541  -0.572  18.484  1.00 0.00 ? 426 SER B CB  1  
ATOM 6793   O OG  . SER B 2 426 ? -59.297  0.253   19.572  1.00 0.00 ? 426 SER B OG  1  
ATOM 6794   N N   . LYS B 2 427 ? -61.087  -0.993  15.892  1.00 0.00 ? 427 LYS B N   1  
ATOM 6795   C CA  . LYS B 2 427 ? -61.764  -1.886  15.035  1.00 0.00 ? 427 LYS B CA  1  
ATOM 6796   C C   . LYS B 2 427 ? -61.428  -1.462  13.641  1.00 0.00 ? 427 LYS B C   1  
ATOM 6797   O O   . LYS B 2 427 ? -61.215  -2.299  12.748  1.00 0.00 ? 427 LYS B O   1  
ATOM 6798   C CB  . LYS B 2 427 ? -63.308  -1.975  15.149  1.00 0.00 ? 427 LYS B CB  1  
ATOM 6799   C CG  . LYS B 2 427 ? -63.851  -3.202  14.474  1.00 0.00 ? 427 LYS B CG  1  
ATOM 6800   C CD  . LYS B 2 427 ? -63.377  -4.600  15.073  1.00 0.00 ? 427 LYS B CD  1  
ATOM 6801   C CE  . LYS B 2 427 ? -63.890  -5.868  14.349  1.00 0.00 ? 427 LYS B CE  1  
ATOM 6802   N NZ  . LYS B 2 427 ? -63.307  -5.905  13.037  1.00 0.00 ? 427 LYS B NZ  1  
ATOM 6803   N N   . LYS B 2 428 ? -61.372  -0.200  13.361  1.00 0.00 ? 428 LYS B N   1  
ATOM 6804   C CA  . LYS B 2 428 ? -61.065  0.285   12.063  1.00 0.00 ? 428 LYS B CA  1  
ATOM 6805   C C   . LYS B 2 428 ? -59.626  -0.088  11.725  1.00 0.00 ? 428 LYS B C   1  
ATOM 6806   O O   . LYS B 2 428 ? -59.370  -0.496  10.588  1.00 0.00 ? 428 LYS B O   1  
ATOM 6807   C CB  . LYS B 2 428 ? -61.177  1.837   11.895  1.00 0.00 ? 428 LYS B CB  1  
ATOM 6808   C CG  . LYS B 2 428 ? -62.672  2.275   12.026  1.00 0.00 ? 428 LYS B CG  1  
ATOM 6809   C CD  . LYS B 2 428 ? -62.684  3.798   12.054  1.00 0.00 ? 428 LYS B CD  1  
ATOM 6810   C CE  . LYS B 2 428 ? -64.077  4.307   12.374  1.00 0.00 ? 428 LYS B CE  1  
ATOM 6811   N NZ  . LYS B 2 428 ? -64.378  4.029   13.825  1.00 0.00 ? 428 LYS B NZ  1  
ATOM 6812   N N   . TYR B 2 429 ? -58.759  0.050   12.725  1.00 0.00 ? 429 TYR B N   1  
ATOM 6813   C CA  . TYR B 2 429 ? -57.393  -0.237  12.633  1.00 0.00 ? 429 TYR B CA  1  
ATOM 6814   C C   . TYR B 2 429 ? -57.322  -1.683  12.314  1.00 0.00 ? 429 TYR B C   1  
ATOM 6815   O O   . TYR B 2 429 ? -56.520  -2.101  11.510  1.00 0.00 ? 429 TYR B O   1  
ATOM 6816   C CB  . TYR B 2 429 ? -56.659  0.194   13.907  1.00 0.00 ? 429 TYR B CB  1  
ATOM 6817   C CG  . TYR B 2 429 ? -55.345  -0.611  14.137  1.00 0.00 ? 429 TYR B CG  1  
ATOM 6818   C CD1 . TYR B 2 429 ? -54.352  -0.610  13.171  1.00 0.00 ? 429 TYR B CD1 1  
ATOM 6819   C CD2 . TYR B 2 429 ? -55.325  -1.357  15.308  1.00 0.00 ? 429 TYR B CD2 1  
ATOM 6820   C CE1 . TYR B 2 429 ? -53.223  -1.401  13.425  1.00 0.00 ? 429 TYR B CE1 1  
ATOM 6821   C CE2 . TYR B 2 429 ? -54.260  -2.291  15.450  1.00 0.00 ? 429 TYR B CE2 1  
ATOM 6822   C CZ  . TYR B 2 429 ? -53.238  -2.277  14.470  1.00 0.00 ? 429 TYR B CZ  1  
ATOM 6823   O OH  . TYR B 2 429 ? -52.123  -3.072  14.586  1.00 0.00 ? 429 TYR B OH  1  
ATOM 6824   N N   . HIS B 2 430 ? -58.145  -2.632  12.959  1.00 0.00 ? 430 HIS B N   1  
ATOM 6825   C CA  . HIS B 2 430 ? -58.111  -4.040  12.804  1.00 0.00 ? 430 HIS B CA  1  
ATOM 6826   C C   . HIS B 2 430 ? -58.473  -4.543  11.466  1.00 0.00 ? 430 HIS B C   1  
ATOM 6827   O O   . HIS B 2 430 ? -57.827  -5.441  10.927  1.00 0.00 ? 430 HIS B O   1  
ATOM 6828   C CB  . HIS B 2 430 ? -58.948  -4.807  13.896  1.00 0.00 ? 430 HIS B CB  1  
ATOM 6829   C CG  . HIS B 2 430 ? -58.604  -4.164  15.213  1.00 0.00 ? 430 HIS B CG  1  
ATOM 6830   N ND1 . HIS B 2 430 ? -59.498  -4.127  16.294  1.00 0.00 ? 430 HIS B ND1 1  
ATOM 6831   C CD2 . HIS B 2 430 ? -57.467  -3.876  15.750  1.00 0.00 ? 430 HIS B CD2 1  
ATOM 6832   C CE1 . HIS B 2 430 ? -58.742  -3.856  17.402  1.00 0.00 ? 430 HIS B CE1 1  
ATOM 6833   N NE2 . HIS B 2 430 ? -57.485  -3.656  17.076  1.00 0.00 ? 430 HIS B NE2 1  
ATOM 6834   N N   . VAL B 2 431 ? -59.522  -3.895  10.846  1.00 0.00 ? 431 VAL B N   1  
ATOM 6835   C CA  . VAL B 2 431 ? -59.852  -4.259  9.481   1.00 0.00 ? 431 VAL B CA  1  
ATOM 6836   C C   . VAL B 2 431 ? -58.778  -3.959  8.497   1.00 0.00 ? 431 VAL B C   1  
ATOM 6837   O O   . VAL B 2 431 ? -58.417  -4.671  7.556   1.00 0.00 ? 431 VAL B O   1  
ATOM 6838   C CB  . VAL B 2 431 ? -61.055  -3.514  8.878   1.00 0.00 ? 431 VAL B CB  1  
ATOM 6839   C CG1 . VAL B 2 431 ? -61.509  -3.904  7.410   1.00 0.00 ? 431 VAL B CG1 1  
ATOM 6840   C CG2 . VAL B 2 431 ? -62.204  -3.919  9.806   1.00 0.00 ? 431 VAL B CG2 1  
ATOM 6841   N N   . LEU B 2 432 ? -58.177  -2.804  8.732   1.00 0.00 ? 432 LEU B N   1  
ATOM 6842   C CA  . LEU B 2 432 ? -57.085  -2.247  8.054   1.00 0.00 ? 432 LEU B CA  1  
ATOM 6843   C C   . LEU B 2 432 ? -55.934  -3.145  8.265   1.00 0.00 ? 432 LEU B C   1  
ATOM 6844   O O   . LEU B 2 432 ? -55.283  -3.446  7.253   1.00 0.00 ? 432 LEU B O   1  
ATOM 6845   C CB  . LEU B 2 432 ? -56.808  -0.862  8.569   1.00 0.00 ? 432 LEU B CB  1  
ATOM 6846   C CG  . LEU B 2 432 ? -55.563  -0.139  7.996   1.00 0.00 ? 432 LEU B CG  1  
ATOM 6847   C CD1 . LEU B 2 432 ? -55.816  1.396   7.666   1.00 0.00 ? 432 LEU B CD1 1  
ATOM 6848   C CD2 . LEU B 2 432 ? -54.444  -0.046  9.076   1.00 0.00 ? 432 LEU B CD2 1  
ATOM 6849   N N   . TYR B 2 433 ? -55.753  -3.723  9.476   1.00 0.00 ? 433 TYR B N   1  
ATOM 6850   C CA  . TYR B 2 433 ? -54.716  -4.738  9.685   1.00 0.00 ? 433 TYR B CA  1  
ATOM 6851   C C   . TYR B 2 433 ? -54.882  -5.953  8.839   1.00 0.00 ? 433 TYR B C   1  
ATOM 6852   O O   . TYR B 2 433 ? -53.908  -6.404  8.204   1.00 0.00 ? 433 TYR B O   1  
ATOM 6853   C CB  . TYR B 2 433 ? -54.625  -5.228  11.204  1.00 0.00 ? 433 TYR B CB  1  
ATOM 6854   C CG  . TYR B 2 433 ? -53.398  -6.008  11.273  1.00 0.00 ? 433 TYR B CG  1  
ATOM 6855   C CD1 . TYR B 2 433 ? -52.238  -5.247  11.416  1.00 0.00 ? 433 TYR B CD1 1  
ATOM 6856   C CD2 . TYR B 2 433 ? -53.369  -7.435  11.285  1.00 0.00 ? 433 TYR B CD2 1  
ATOM 6857   C CE1 . TYR B 2 433 ? -51.033  -5.922  11.231  1.00 0.00 ? 433 TYR B CE1 1  
ATOM 6858   C CE2 . TYR B 2 433 ? -52.095  -8.098  11.214  1.00 0.00 ? 433 TYR B CE2 1  
ATOM 6859   C CZ  . TYR B 2 433 ? -50.942  -7.298  11.225  1.00 0.00 ? 433 TYR B CZ  1  
ATOM 6860   O OH  . TYR B 2 433 ? -49.723  -7.800  11.065  1.00 0.00 ? 433 TYR B OH  1  
ATOM 6861   N N   . GLN B 2 434 ? -56.083  -6.586  8.650   1.00 0.00 ? 434 GLN B N   1  
ATOM 6862   C CA  . GLN B 2 434 ? -56.145  -7.764  7.759   1.00 0.00 ? 434 GLN B CA  1  
ATOM 6863   C C   . GLN B 2 434 ? -55.851  -7.438  6.389   1.00 0.00 ? 434 GLN B C   1  
ATOM 6864   O O   . GLN B 2 434 ? -55.060  -8.094  5.691   1.00 0.00 ? 434 GLN B O   1  
ATOM 6865   C CB  . GLN B 2 434 ? -57.579  -8.402  7.765   1.00 0.00 ? 434 GLN B CB  1  
ATOM 6866   C CG  . GLN B 2 434 ? -57.652  -9.878  7.218   1.00 0.00 ? 434 GLN B CG  1  
ATOM 6867   C CD  . GLN B 2 434 ? -57.626  -9.988  5.666   1.00 0.00 ? 434 GLN B CD  1  
ATOM 6868   O OE1 . GLN B 2 434 ? -56.847  -10.735 5.114   1.00 0.00 ? 434 GLN B OE1 1  
ATOM 6869   N NE2 . GLN B 2 434 ? -58.445  -9.158  4.923   1.00 0.00 ? 434 GLN B NE2 1  
ATOM 6870   N N   . SER B 2 435 ? -56.309  -6.240  5.932   1.00 0.00 ? 435 SER B N   1  
ATOM 6871   C CA  . SER B 2 435 ? -56.040  -5.642  4.603   1.00 0.00 ? 435 SER B CA  1  
ATOM 6872   C C   . SER B 2 435 ? -54.561  -5.388  4.338   1.00 0.00 ? 435 SER B C   1  
ATOM 6873   O O   . SER B 2 435 ? -54.192  -5.360  3.129   1.00 0.00 ? 435 SER B O   1  
ATOM 6874   C CB  . SER B 2 435 ? -56.759  -4.294  4.398   1.00 0.00 ? 435 SER B CB  1  
ATOM 6875   O OG  . SER B 2 435 ? -58.164  -4.460  4.505   1.00 0.00 ? 435 SER B OG  1  
ATOM 6876   N N   . ASN B 2 436 ? -53.762  -5.199  5.362   1.00 0.00 ? 436 ASN B N   1  
ATOM 6877   C CA  . ASN B 2 436 ? -52.341  -4.827  5.329   1.00 0.00 ? 436 ASN B CA  1  
ATOM 6878   C C   . ASN B 2 436 ? -51.430  -5.895  4.850   1.00 0.00 ? 436 ASN B C   1  
ATOM 6879   O O   . ASN B 2 436 ? -50.467  -5.580  4.183   1.00 0.00 ? 436 ASN B O   1  
ATOM 6880   C CB  . ASN B 2 436 ? -51.805  -4.407  6.708   1.00 0.00 ? 436 ASN B CB  1  
ATOM 6881   C CG  . ASN B 2 436 ? -52.407  -2.973  6.956   1.00 0.00 ? 436 ASN B CG  1  
ATOM 6882   O OD1 . ASN B 2 436 ? -53.017  -2.354  6.045   1.00 0.00 ? 436 ASN B OD1 1  
ATOM 6883   N ND2 . ASN B 2 436 ? -52.245  -2.495  8.234   1.00 0.00 ? 436 ASN B ND2 1  
ATOM 6884   N N   . SER B 2 437 ? -51.756  -7.124  5.117   1.00 0.00 ? 437 SER B N   1  
ATOM 6885   C CA  . SER B 2 437 ? -51.043  -8.319  4.745   1.00 0.00 ? 437 SER B CA  1  
ATOM 6886   C C   . SER B 2 437 ? -51.982  -9.283  4.083   1.00 0.00 ? 437 SER B C   1  
ATOM 6887   O O   . SER B 2 437 ? -51.675  -10.489 4.089   1.00 0.00 ? 437 SER B O   1  
ATOM 6888   C CB  . SER B 2 437 ? -50.314  -9.117  5.905   1.00 0.00 ? 437 SER B CB  1  
ATOM 6889   O OG  . SER B 2 437 ? -51.210  -9.670  6.894   1.00 0.00 ? 437 SER B OG  1  
ATOM 6890   N N   . TYR B 2 438 ? -53.185  -8.816  3.665   1.00 0.00 ? 438 TYR B N   1  
ATOM 6891   C CA  . TYR B 2 438 ? -54.271  -9.579  3.100   1.00 0.00 ? 438 TYR B CA  1  
ATOM 6892   C C   . TYR B 2 438 ? -53.967  -10.793 2.255   1.00 0.00 ? 438 TYR B C   1  
ATOM 6893   O O   . TYR B 2 438 ? -53.190  -10.834 1.302   1.00 0.00 ? 438 TYR B O   1  
ATOM 6894   C CB  . TYR B 2 438 ? -55.411  -8.778  2.371   1.00 0.00 ? 438 TYR B CB  1  
ATOM 6895   C CG  . TYR B 2 438 ? -55.073  -8.202  1.035   1.00 0.00 ? 438 TYR B CG  1  
ATOM 6896   C CD1 . TYR B 2 438 ? -53.870  -7.465  0.799   1.00 0.00 ? 438 TYR B CD1 1  
ATOM 6897   C CD2 . TYR B 2 438 ? -55.834  -8.648  -0.142  1.00 0.00 ? 438 TYR B CD2 1  
ATOM 6898   C CE1 . TYR B 2 438 ? -53.656  -6.841  -0.434  1.00 0.00 ? 438 TYR B CE1 1  
ATOM 6899   C CE2 . TYR B 2 438 ? -55.521  -8.079  -1.381  1.00 0.00 ? 438 TYR B CE2 1  
ATOM 6900   C CZ  . TYR B 2 438 ? -54.515  -7.060  -1.470  1.00 0.00 ? 438 TYR B CZ  1  
ATOM 6901   O OH  . TYR B 2 438 ? -54.264  -6.307  -2.645  1.00 0.00 ? 438 TYR B OH  1  
ATOM 6902   N N   . ARG B 2 439 ? -54.868  -11.785 2.519   1.00 0.00 ? 439 ARG B N   1  
ATOM 6903   C CA  . ARG B 2 439 ? -54.847  -13.006 1.843   1.00 0.00 ? 439 ARG B CA  1  
ATOM 6904   C C   . ARG B 2 439 ? -56.281  -13.340 1.777   1.00 0.00 ? 439 ARG B C   1  
ATOM 6905   O O   . ARG B 2 439 ? -56.704  -14.431 1.308   1.00 0.00 ? 439 ARG B O   1  
ATOM 6906   C CB  . ARG B 2 439 ? -54.062  -14.042 2.692   1.00 0.00 ? 439 ARG B CB  1  
ATOM 6907   C CG  . ARG B 2 439 ? -52.707  -13.672 3.326   1.00 0.00 ? 439 ARG B CG  1  
ATOM 6908   C CD  . ARG B 2 439 ? -52.790  -13.548 4.840   1.00 0.00 ? 439 ARG B CD  1  
ATOM 6909   N NE  . ARG B 2 439 ? -53.607  -12.385 5.234   1.00 0.00 ? 439 ARG B NE  1  
ATOM 6910   C CZ  . ARG B 2 439 ? -53.796  -12.014 6.531   1.00 0.00 ? 439 ARG B CZ  1  
ATOM 6911   N NH1 . ARG B 2 439 ? -53.282  -12.729 7.605   1.00 0.00 ? 439 ARG B NH1 1  
ATOM 6912   N NH2 . ARG B 2 439 ? -54.539  -10.883 6.822   1.00 0.00 ? 439 ARG B NH2 1  
ATOM 6913   N N   . GLY B 2 440 ? -57.178  -12.435 2.174   1.00 0.00 ? 440 GLY B N   1  
ATOM 6914   C CA  . GLY B 2 440 ? -58.594  -12.797 2.108   1.00 0.00 ? 440 GLY B CA  1  
ATOM 6915   C C   . GLY B 2 440 ? -59.044  -13.797 3.019   1.00 0.00 ? 440 GLY B C   1  
ATOM 6916   O O   . GLY B 2 440 ? -59.874  -14.669 2.749   1.00 0.00 ? 440 GLY B O   1  
ATOM 6917   N N   . ILE B 2 441 ? -58.489  -13.793 4.196   1.00 0.00 ? 441 ILE B N   1  
ATOM 6918   C CA  . ILE B 2 441 ? -58.840  -14.787 5.211   1.00 0.00 ? 441 ILE B CA  1  
ATOM 6919   C C   . ILE B 2 441 ? -60.031  -14.300 6.008   1.00 0.00 ? 441 ILE B C   1  
ATOM 6920   O O   . ILE B 2 441 ? -59.866  -13.535 6.969   1.00 0.00 ? 441 ILE B O   1  
ATOM 6921   C CB  . ILE B 2 441 ? -57.637  -15.180 6.048   1.00 0.00 ? 441 ILE B CB  1  
ATOM 6922   C CG1 . ILE B 2 441 ? -57.933  -16.122 7.261   1.00 0.00 ? 441 ILE B CG1 1  
ATOM 6923   C CG2 . ILE B 2 441 ? -56.735  -13.945 6.403   1.00 0.00 ? 441 ILE B CG2 1  
ATOM 6924   C CD1 . ILE B 2 441 ? -56.688  -16.497 8.083   1.00 0.00 ? 441 ILE B CD1 1  
ATOM 6925   N N   . SER B 2 442 ? -61.258  -14.760 5.545   1.00 0.00 ? 442 SER B N   1  
ATOM 6926   C CA  . SER B 2 442 ? -62.607  -14.415 6.118   1.00 0.00 ? 442 SER B CA  1  
ATOM 6927   C C   . SER B 2 442 ? -62.711  -15.007 7.484   1.00 0.00 ? 442 SER B C   1  
ATOM 6928   O O   . SER B 2 442 ? -63.239  -14.303 8.304   1.00 0.00 ? 442 SER B O   1  
ATOM 6929   C CB  . SER B 2 442 ? -63.786  -14.891 5.211   1.00 0.00 ? 442 SER B CB  1  
ATOM 6930   O OG  . SER B 2 442 ? -63.644  -16.188 4.806   1.00 0.00 ? 442 SER B OG  1  
ATOM 6931   N N   . THR B 2 443 ? -62.233  -16.255 7.782   1.00 0.00 ? 443 THR B N   1  
ATOM 6932   C CA  . THR B 2 443 ? -62.473  -16.774 9.161   1.00 0.00 ? 443 THR B CA  1  
ATOM 6933   C C   . THR B 2 443 ? -61.822  -15.871 10.150  1.00 0.00 ? 443 THR B C   1  
ATOM 6934   O O   . THR B 2 443 ? -62.545  -15.477 11.039  1.00 0.00 ? 443 THR B O   1  
ATOM 6935   C CB  . THR B 2 443 ? -61.854  -18.170 9.406   1.00 0.00 ? 443 THR B CB  1  
ATOM 6936   O OG1 . THR B 2 443 ? -60.497  -18.276 9.039   1.00 0.00 ? 443 THR B OG1 1  
ATOM 6937   C CG2 . THR B 2 443 ? -62.608  -19.217 8.575   1.00 0.00 ? 443 THR B CG2 1  
ATOM 6938   N N   . ASN B 2 444 ? -60.555  -15.424 10.002  1.00 0.00 ? 444 ASN B N   1  
ATOM 6939   C CA  . ASN B 2 444 ? -59.937  -14.503 10.946  1.00 0.00 ? 444 ASN B CA  1  
ATOM 6940   C C   . ASN B 2 444 ? -60.552  -13.153 11.062  1.00 0.00 ? 444 ASN B C   1  
ATOM 6941   O O   . ASN B 2 444 ? -60.798  -12.656 12.179  1.00 0.00 ? 444 ASN B O   1  
ATOM 6942   C CB  . ASN B 2 444 ? -58.414  -14.296 10.615  1.00 0.00 ? 444 ASN B CB  1  
ATOM 6943   C CG  . ASN B 2 444 ? -57.532  -13.528 11.635  1.00 0.00 ? 444 ASN B CG  1  
ATOM 6944   O OD1 . ASN B 2 444 ? -56.945  -14.189 12.468  1.00 0.00 ? 444 ASN B OD1 1  
ATOM 6945   N ND2 . ASN B 2 444 ? -57.512  -12.142 11.488  1.00 0.00 ? 444 ASN B ND2 1  
ATOM 6946   N N   . PHE B 2 445 ? -60.965  -12.612 9.936   1.00 0.00 ? 445 PHE B N   1  
ATOM 6947   C CA  . PHE B 2 445 ? -61.685  -11.351 9.799   1.00 0.00 ? 445 PHE B CA  1  
ATOM 6948   C C   . PHE B 2 445 ? -63.070  -11.389 10.542  1.00 0.00 ? 445 PHE B C   1  
ATOM 6949   O O   . PHE B 2 445 ? -63.382  -10.571 11.365  1.00 0.00 ? 445 PHE B O   1  
ATOM 6950   C CB  . PHE B 2 445 ? -61.831  -11.064 8.290   1.00 0.00 ? 445 PHE B CB  1  
ATOM 6951   C CG  . PHE B 2 445 ? -62.557  -9.794  8.001   1.00 0.00 ? 445 PHE B CG  1  
ATOM 6952   C CD1 . PHE B 2 445 ? -62.092  -8.566  8.380   1.00 0.00 ? 445 PHE B CD1 1  
ATOM 6953   C CD2 . PHE B 2 445 ? -63.830  -9.851  7.383   1.00 0.00 ? 445 PHE B CD2 1  
ATOM 6954   C CE1 . PHE B 2 445 ? -62.851  -7.422  8.116   1.00 0.00 ? 445 PHE B CE1 1  
ATOM 6955   C CE2 . PHE B 2 445 ? -64.554  -8.756  7.019   1.00 0.00 ? 445 PHE B CE2 1  
ATOM 6956   C CZ  . PHE B 2 445 ? -64.024  -7.520  7.385   1.00 0.00 ? 445 PHE B CZ  1  
ATOM 6957   N N   . PHE B 2 446 ? -63.779  -12.561 10.360  1.00 0.00 ? 446 PHE B N   1  
ATOM 6958   C CA  . PHE B 2 446 ? -64.939  -12.848 11.154  1.00 0.00 ? 446 PHE B CA  1  
ATOM 6959   C C   . PHE B 2 446 ? -64.661  -12.985 12.618  1.00 0.00 ? 446 PHE B C   1  
ATOM 6960   O O   . PHE B 2 446 ? -65.380  -12.494 13.454  1.00 0.00 ? 446 PHE B O   1  
ATOM 6961   C CB  . PHE B 2 446 ? -65.772  -14.058 10.652  1.00 0.00 ? 446 PHE B CB  1  
ATOM 6962   C CG  . PHE B 2 446 ? -67.172  -14.040 11.193  1.00 0.00 ? 446 PHE B CG  1  
ATOM 6963   C CD1 . PHE B 2 446 ? -68.055  -12.960 11.012  1.00 0.00 ? 446 PHE B CD1 1  
ATOM 6964   C CD2 . PHE B 2 446 ? -67.524  -15.010 12.189  1.00 0.00 ? 446 PHE B CD2 1  
ATOM 6965   C CE1 . PHE B 2 446 ? -69.153  -12.817 11.817  1.00 0.00 ? 446 PHE B CE1 1  
ATOM 6966   C CE2 . PHE B 2 446 ? -68.733  -14.993 12.857  1.00 0.00 ? 446 PHE B CE2 1  
ATOM 6967   C CZ  . PHE B 2 446 ? -69.493  -13.815 12.744  1.00 0.00 ? 446 PHE B CZ  1  
ATOM 6968   N N   . GLU B 2 447 ? -63.540  -13.631 13.021  1.00 0.00 ? 447 GLU B N   1  
ATOM 6969   C CA  . GLU B 2 447 ? -63.215  -13.818 14.415  1.00 0.00 ? 447 GLU B CA  1  
ATOM 6970   C C   . GLU B 2 447 ? -63.110  -12.536 15.116  1.00 0.00 ? 447 GLU B C   1  
ATOM 6971   O O   . GLU B 2 447 ? -63.645  -12.372 16.231  1.00 0.00 ? 447 GLU B O   1  
ATOM 6972   C CB  . GLU B 2 447 ? -62.013  -14.720 14.612  1.00 0.00 ? 447 GLU B CB  1  
ATOM 6973   C CG  . GLU B 2 447 ? -61.731  -15.147 16.076  1.00 0.00 ? 447 GLU B CG  1  
ATOM 6974   C CD  . GLU B 2 447 ? -63.067  -15.696 16.578  1.00 0.00 ? 447 GLU B CD  1  
ATOM 6975   O OE1 . GLU B 2 447 ? -63.472  -16.871 16.143  1.00 0.00 ? 447 GLU B OE1 1  
ATOM 6976   O OE2 . GLU B 2 447 ? -63.586  -15.123 17.563  1.00 0.00 ? 447 GLU B OE2 1  
ATOM 6977   N N   . ILE B 2 448 ? -62.423  -11.525 14.469  1.00 0.00 ? 448 ILE B N   1  
ATOM 6978   C CA  . ILE B 2 448 ? -62.186  -10.213 15.058  1.00 0.00 ? 448 ILE B CA  1  
ATOM 6979   C C   . ILE B 2 448 ? -63.495  -9.554  15.193  1.00 0.00 ? 448 ILE B C   1  
ATOM 6980   O O   . ILE B 2 448 ? -63.808  -9.006  16.277  1.00 0.00 ? 448 ILE B O   1  
ATOM 6981   C CB  . ILE B 2 448 ? -61.198  -9.220  14.472  1.00 0.00 ? 448 ILE B CB  1  
ATOM 6982   C CG1 . ILE B 2 448 ? -61.347  -9.013  12.941  1.00 0.00 ? 448 ILE B CG1 1  
ATOM 6983   C CG2 . ILE B 2 448 ? -59.786  -9.827  14.816  1.00 0.00 ? 448 ILE B CG2 1  
ATOM 6984   C CD1 . ILE B 2 448 ? -60.348  -8.008  12.343  1.00 0.00 ? 448 ILE B CD1 1  
ATOM 6985   N N   . ILE B 2 449 ? -64.318  -9.714  14.143  1.00 0.00 ? 449 ILE B N   1  
ATOM 6986   C CA  . ILE B 2 449 ? -65.658  -9.208  14.075  1.00 0.00 ? 449 ILE B CA  1  
ATOM 6987   C C   . ILE B 2 449 ? -66.563  -9.864  15.101  1.00 0.00 ? 449 ILE B C   1  
ATOM 6988   O O   . ILE B 2 449 ? -67.302  -9.201  15.802  1.00 0.00 ? 449 ILE B O   1  
ATOM 6989   C CB  . ILE B 2 449 ? -66.342  -9.380  12.769  1.00 0.00 ? 449 ILE B CB  1  
ATOM 6990   C CG1 . ILE B 2 449 ? -65.831  -8.288  11.736  1.00 0.00 ? 449 ILE B CG1 1  
ATOM 6991   C CG2 . ILE B 2 449 ? -67.909  -9.189  12.775  1.00 0.00 ? 449 ILE B CG2 1  
ATOM 6992   C CD1 . ILE B 2 449 ? -66.484  -8.384  10.347  1.00 0.00 ? 449 ILE B CD1 1  
ATOM 6993   N N   . ASN B 2 450 ? -66.476  -11.191 15.296  1.00 0.00 ? 450 ASN B N   1  
ATOM 6994   C CA  . ASN B 2 450 ? -67.282  -11.923 16.281  1.00 0.00 ? 450 ASN B CA  1  
ATOM 6995   C C   . ASN B 2 450 ? -67.054  -11.539 17.707  1.00 0.00 ? 450 ASN B C   1  
ATOM 6996   O O   . ASN B 2 450 ? -67.982  -11.317 18.489  1.00 0.00 ? 450 ASN B O   1  
ATOM 6997   C CB  . ASN B 2 450 ? -66.991  -13.450 16.246  1.00 0.00 ? 450 ASN B CB  1  
ATOM 6998   C CG  . ASN B 2 450 ? -68.006  -14.354 16.887  1.00 0.00 ? 450 ASN B CG  1  
ATOM 6999   O OD1 . ASN B 2 450 ? -69.027  -14.619 16.210  1.00 0.00 ? 450 ASN B OD1 1  
ATOM 7000   N ND2 . ASN B 2 450 ? -67.812  -14.661 18.188  1.00 0.00 ? 450 ASN B ND2 1  
ATOM 7001   N N   . ASP B 2 451 ? -65.767  -11.268 18.058  1.00 0.00 ? 451 ASP B N   1  
ATOM 7002   C CA  . ASP B 2 451 ? -65.395  -10.766 19.364  1.00 0.00 ? 451 ASP B CA  1  
ATOM 7003   C C   . ASP B 2 451 ? -66.013  -9.389  19.596  1.00 0.00 ? 451 ASP B C   1  
ATOM 7004   O O   . ASP B 2 451 ? -66.560  -9.177  20.655  1.00 0.00 ? 451 ASP B O   1  
ATOM 7005   C CB  . ASP B 2 451 ? -63.844  -10.648 19.415  1.00 0.00 ? 451 ASP B CB  1  
ATOM 7006   C CG  . ASP B 2 451 ? -63.061  -11.928 19.373  1.00 0.00 ? 451 ASP B CG  1  
ATOM 7007   O OD1 . ASP B 2 451 ? -63.681  -12.992 19.543  1.00 0.00 ? 451 ASP B OD1 1  
ATOM 7008   O OD2 . ASP B 2 451 ? -61.864  -11.843 19.136  1.00 0.00 ? 451 ASP B OD2 1  
ATOM 7009   N N   . GLN B 2 452 ? -65.950  -8.466  18.495  1.00 0.00 ? 452 GLN B N   1  
ATOM 7010   C CA  . GLN B 2 452 ? -66.521  -7.210  18.649  1.00 0.00 ? 452 GLN B CA  1  
ATOM 7011   C C   . GLN B 2 452 ? -68.000  -7.354  18.807  1.00 0.00 ? 452 GLN B C   1  
ATOM 7012   O O   . GLN B 2 452 ? -68.517  -6.563  19.617  1.00 0.00 ? 452 GLN B O   1  
ATOM 7013   C CB  . GLN B 2 452 ? -66.224  -6.373  17.388  1.00 0.00 ? 452 GLN B CB  1  
ATOM 7014   C CG  . GLN B 2 452 ? -67.069  -5.090  17.173  1.00 0.00 ? 452 GLN B CG  1  
ATOM 7015   C CD  . GLN B 2 452 ? -68.441  -5.514  16.471  1.00 0.00 ? 452 GLN B CD  1  
ATOM 7016   O OE1 . GLN B 2 452 ? -68.430  -6.386  15.626  1.00 0.00 ? 452 GLN B OE1 1  
ATOM 7017   N NE2 . GLN B 2 452 ? -69.598  -4.894  16.908  1.00 0.00 ? 452 GLN B NE2 1  
ATOM 7018   N N   . TYR B 2 453 ? -68.712  -8.297  18.099  1.00 0.00 ? 453 TYR B N   1  
ATOM 7019   C CA  . TYR B 2 453 ? -70.124  -8.392  18.226  1.00 0.00 ? 453 TYR B CA  1  
ATOM 7020   C C   . TYR B 2 453 ? -70.537  -8.728  19.620  1.00 0.00 ? 453 TYR B C   1  
ATOM 7021   O O   . TYR B 2 453 ? -71.370  -8.002  20.162  1.00 0.00 ? 453 TYR B O   1  
ATOM 7022   C CB  . TYR B 2 453 ? -70.717  -9.438  17.259  1.00 0.00 ? 453 TYR B CB  1  
ATOM 7023   C CG  . TYR B 2 453 ? -72.269  -9.549  17.239  1.00 0.00 ? 453 TYR B CG  1  
ATOM 7024   C CD1 . TYR B 2 453 ? -73.121  -8.412  17.143  1.00 0.00 ? 453 TYR B CD1 1  
ATOM 7025   C CD2 . TYR B 2 453 ? -72.870  -10.831 17.326  1.00 0.00 ? 453 TYR B CD2 1  
ATOM 7026   C CE1 . TYR B 2 453 ? -74.503  -8.523  17.196  1.00 0.00 ? 453 TYR B CE1 1  
ATOM 7027   C CE2 . TYR B 2 453 ? -74.201  -10.979 17.457  1.00 0.00 ? 453 TYR B CE2 1  
ATOM 7028   C CZ  . TYR B 2 453 ? -75.088  -9.869  17.367  1.00 0.00 ? 453 TYR B CZ  1  
ATOM 7029   O OH  . TYR B 2 453 ? -76.443  -10.068 17.533  1.00 0.00 ? 453 TYR B OH  1  
ATOM 7030   N N   . SER B 2 454 ? -69.915  -9.720  20.219  1.00 0.00 ? 454 SER B N   1  
ATOM 7031   C CA  . SER B 2 454 ? -70.325  -10.157 21.554  1.00 0.00 ? 454 SER B CA  1  
ATOM 7032   C C   . SER B 2 454 ? -70.190  -9.127  22.668  1.00 0.00 ? 454 SER B C   1  
ATOM 7033   O O   . SER B 2 454 ? -71.093  -8.786  23.437  1.00 0.00 ? 454 SER B O   1  
ATOM 7034   C CB  . SER B 2 454 ? -69.452  -11.345 21.951  1.00 0.00 ? 454 SER B CB  1  
ATOM 7035   O OG  . SER B 2 454 ? -68.086  -11.077 21.914  1.00 0.00 ? 454 SER B OG  1  
ATOM 7036   N N   . GLU B 2 455 ? -69.044  -8.420  22.586  1.00 0.00 ? 455 GLU B N   1  
ATOM 7037   C CA  . GLU B 2 455 ? -68.776  -7.361  23.450  1.00 0.00 ? 455 GLU B CA  1  
ATOM 7038   C C   . GLU B 2 455 ? -69.755  -6.229  23.278  1.00 0.00 ? 455 GLU B C   1  
ATOM 7039   O O   . GLU B 2 455 ? -70.289  -5.659  24.217  1.00 0.00 ? 455 GLU B O   1  
ATOM 7040   C CB  . GLU B 2 455 ? -67.329  -6.715  23.247  1.00 0.00 ? 455 GLU B CB  1  
ATOM 7041   C CG  . GLU B 2 455 ? -66.291  -7.690  23.865  1.00 0.00 ? 455 GLU B CG  1  
ATOM 7042   C CD  . GLU B 2 455 ? -64.841  -7.265  23.460  1.00 0.00 ? 455 GLU B CD  1  
ATOM 7043   O OE1 . GLU B 2 455 ? -64.442  -7.522  22.284  1.00 0.00 ? 455 GLU B OE1 1  
ATOM 7044   O OE2 . GLU B 2 455 ? -64.092  -6.696  24.314  1.00 0.00 ? 455 GLU B OE2 1  
ATOM 7045   N N   . ILE B 2 456 ? -70.110  -5.877  22.030  1.00 0.00 ? 456 ILE B N   1  
ATOM 7046   C CA  . ILE B 2 456 ? -71.040  -4.837  21.666  1.00 0.00 ? 456 ILE B CA  1  
ATOM 7047   C C   . ILE B 2 456 ? -72.423  -5.102  22.063  1.00 0.00 ? 456 ILE B C   1  
ATOM 7048   O O   . ILE B 2 456 ? -73.117  -4.235  22.560  1.00 0.00 ? 456 ILE B O   1  
ATOM 7049   C CB  . ILE B 2 456 ? -70.919  -4.246  20.193  1.00 0.00 ? 456 ILE B CB  1  
ATOM 7050   C CG1 . ILE B 2 456 ? -71.478  -2.776  20.000  1.00 0.00 ? 456 ILE B CG1 1  
ATOM 7051   C CG2 . ILE B 2 456 ? -71.708  -5.101  19.240  1.00 0.00 ? 456 ILE B CG2 1  
ATOM 7052   C CD1 . ILE B 2 456 ? -71.345  -2.237  18.566  1.00 0.00 ? 456 ILE B CD1 1  
ATOM 7053   N N   . VAL B 2 457 ? -72.917  -6.359  21.930  1.00 0.00 ? 457 VAL B N   1  
ATOM 7054   C CA  . VAL B 2 457 ? -74.282  -6.719  22.398  1.00 0.00 ? 457 VAL B CA  1  
ATOM 7055   C C   . VAL B 2 457 ? -74.359  -6.658  23.942  1.00 0.00 ? 457 VAL B C   1  
ATOM 7056   O O   . VAL B 2 457 ? -75.276  -6.062  24.432  1.00 0.00 ? 457 VAL B O   1  
ATOM 7057   C CB  . VAL B 2 457 ? -74.821  -8.013  21.731  1.00 0.00 ? 457 VAL B CB  1  
ATOM 7058   C CG1 . VAL B 2 457 ? -74.950  -7.792  20.201  1.00 0.00 ? 457 VAL B CG1 1  
ATOM 7059   C CG2 . VAL B 2 457 ? -73.924  -9.270  21.962  1.00 0.00 ? 457 VAL B CG2 1  
ATOM 7060   N N   . ASN B 2 458 ? -73.314  -7.153  24.628  1.00 0.00 ? 458 ASN B N   1  
ATOM 7061   C CA  . ASN B 2 458 ? -73.273  -7.139  26.059  1.00 0.00 ? 458 ASN B CA  1  
ATOM 7062   C C   . ASN B 2 458 ? -73.236  -5.676  26.606  1.00 0.00 ? 458 ASN B C   1  
ATOM 7063   O O   . ASN B 2 458 ? -74.008  -5.257  27.488  1.00 0.00 ? 458 ASN B O   1  
ATOM 7064   C CB  . ASN B 2 458 ? -71.909  -7.756  26.448  1.00 0.00 ? 458 ASN B CB  1  
ATOM 7065   C CG  . ASN B 2 458 ? -71.803  -8.196  27.926  1.00 0.00 ? 458 ASN B CG  1  
ATOM 7066   O OD1 . ASN B 2 458 ? -72.375  -9.169  28.376  1.00 0.00 ? 458 ASN B OD1 1  
ATOM 7067   N ND2 . ASN B 2 458 ? -70.997  -7.484  28.713  1.00 0.00 ? 458 ASN B ND2 1  
ATOM 7068   N N   . HIS B 2 459 ? -72.436  -4.808  26.029  1.00 0.00 ? 459 HIS B N   1  
ATOM 7069   C CA  . HIS B 2 459 ? -72.354  -3.340  26.326  1.00 0.00 ? 459 HIS B CA  1  
ATOM 7070   C C   . HIS B 2 459 ? -73.605  -2.663  25.954  1.00 0.00 ? 459 HIS B C   1  
ATOM 7071   O O   . HIS B 2 459 ? -73.983  -1.751  26.680  1.00 0.00 ? 459 HIS B O   1  
ATOM 7072   C CB  . HIS B 2 459 ? -71.078  -2.727  25.736  1.00 0.00 ? 459 HIS B CB  1  
ATOM 7073   C CG  . HIS B 2 459 ? -69.860  -3.376  26.270  1.00 0.00 ? 459 HIS B CG  1  
ATOM 7074   N ND1 . HIS B 2 459 ? -68.832  -3.786  25.431  1.00 0.00 ? 459 HIS B ND1 1  
ATOM 7075   C CD2 . HIS B 2 459 ? -69.736  -4.091  27.425  1.00 0.00 ? 459 HIS B CD2 1  
ATOM 7076   C CE1 . HIS B 2 459 ? -68.190  -4.793  26.176  1.00 0.00 ? 459 HIS B CE1 1  
ATOM 7077   N NE2 . HIS B 2 459 ? -68.694  -4.978  27.390  1.00 0.00 ? 459 HIS B NE2 1  
ATOM 7078   N N   . THR B 2 460 ? -74.288  -3.072  24.871  1.00 0.00 ? 460 THR B N   1  
ATOM 7079   C CA  . THR B 2 460 ? -75.578  -2.516  24.446  1.00 0.00 ? 460 THR B CA  1  
ATOM 7080   C C   . THR B 2 460 ? -76.682  -2.925  25.439  1.00 0.00 ? 460 THR B C   1  
ATOM 7081   O O   . THR B 2 460 ? -77.555  -2.097  25.727  1.00 0.00 ? 460 THR B O   1  
ATOM 7082   C CB  . THR B 2 460 ? -75.999  -2.930  23.003  1.00 0.00 ? 460 THR B CB  1  
ATOM 7083   O OG1 . THR B 2 460 ? -75.135  -2.328  22.064  1.00 0.00 ? 460 THR B OG1 1  
ATOM 7084   C CG2 . THR B 2 460 ? -77.466  -2.592  22.648  1.00 0.00 ? 460 THR B CG2 1  
ATOM 7085   N N   . ASN B 2 461 ? -76.611  -4.155  25.986  1.00 0.00 ? 461 ASN B N   1  
ATOM 7086   C CA  . ASN B 2 461 ? -77.545  -4.535  27.010  1.00 0.00 ? 461 ASN B CA  1  
ATOM 7087   C C   . ASN B 2 461 ? -77.270  -3.566  28.168  1.00 0.00 ? 461 ASN B C   1  
ATOM 7088   O O   . ASN B 2 461 ? -78.256  -3.061  28.649  1.00 0.00 ? 461 ASN B O   1  
ATOM 7089   C CB  . ASN B 2 461 ? -77.120  -5.975  27.503  1.00 0.00 ? 461 ASN B CB  1  
ATOM 7090   C CG  . ASN B 2 461 ? -78.276  -6.448  28.361  1.00 0.00 ? 461 ASN B CG  1  
ATOM 7091   O OD1 . ASN B 2 461 ? -79.379  -6.837  27.917  1.00 0.00 ? 461 ASN B OD1 1  
ATOM 7092   N ND2 . ASN B 2 461 ? -77.998  -6.331  29.690  1.00 0.00 ? 461 ASN B ND2 1  
ATOM 7093   N N   . GLN B 2 462 ? -75.987  -3.231  28.625  1.00 0.00 ? 462 GLN B N   1  
ATOM 7094   C CA  . GLN B 2 462 ? -75.857  -2.412  29.729  1.00 0.00 ? 462 GLN B CA  1  
ATOM 7095   C C   . GLN B 2 462 ? -76.460  -1.059  29.416  1.00 0.00 ? 462 GLN B C   1  
ATOM 7096   O O   . GLN B 2 462 ? -77.224  -0.509  30.161  1.00 0.00 ? 462 GLN B O   1  
ATOM 7097   C CB  . GLN B 2 462 ? -74.421  -2.255  30.149  1.00 0.00 ? 462 GLN B CB  1  
ATOM 7098   C CG  . GLN B 2 462 ? -73.667  -3.654  30.270  1.00 0.00 ? 462 GLN B CG  1  
ATOM 7099   C CD  . GLN B 2 462 ? -74.419  -4.734  31.030  1.00 0.00 ? 462 GLN B CD  1  
ATOM 7100   O OE1 . GLN B 2 462 ? -74.733  -5.788  30.402  1.00 0.00 ? 462 GLN B OE1 1  
ATOM 7101   N NE2 . GLN B 2 462 ? -74.873  -4.442  32.289  1.00 0.00 ? 462 GLN B NE2 1  
ATOM 7102   N N   . ILE B 2 463 ? -76.241  -0.539  28.177  1.00 0.00 ? 463 ILE B N   1  
ATOM 7103   C CA  . ILE B 2 463 ? -76.736  0.684   27.730  1.00 0.00 ? 463 ILE B CA  1  
ATOM 7104   C C   . ILE B 2 463 ? -78.327  0.757   27.747  1.00 0.00 ? 463 ILE B C   1  
ATOM 7105   O O   . ILE B 2 463 ? -78.863  1.796   28.246  1.00 0.00 ? 463 ILE B O   1  
ATOM 7106   C CB  . ILE B 2 463 ? -76.195  0.971   26.310  1.00 0.00 ? 463 ILE B CB  1  
ATOM 7107   C CG1 . ILE B 2 463 ? -74.691  1.294   26.412  1.00 0.00 ? 463 ILE B CG1 1  
ATOM 7108   C CG2 . ILE B 2 463 ? -77.058  2.060   25.670  1.00 0.00 ? 463 ILE B CG2 1  
ATOM 7109   C CD1 . ILE B 2 463 ? -74.022  1.601   25.062  1.00 0.00 ? 463 ILE B CD1 1  
ATOM 7110   N N   . LEU B 2 464 ? -79.056  -0.237  27.308  1.00 0.00 ? 464 LEU B N   1  
ATOM 7111   C CA  . LEU B 2 464 ? -80.479  -0.299  27.299  1.00 0.00 ? 464 LEU B CA  1  
ATOM 7112   C C   . LEU B 2 464 ? -81.065  -0.475  28.710  1.00 0.00 ? 464 LEU B C   1  
ATOM 7113   O O   . LEU B 2 464 ? -81.923  0.285   29.063  1.00 0.00 ? 464 LEU B O   1  
ATOM 7114   C CB  . LEU B 2 464 ? -80.867  -1.470  26.368  1.00 0.00 ? 464 LEU B CB  1  
ATOM 7115   C CG  . LEU B 2 464 ? -81.093  -1.171  24.887  1.00 0.00 ? 464 LEU B CG  1  
ATOM 7116   C CD1 . LEU B 2 464 ? -80.164  -0.123  24.217  1.00 0.00 ? 464 LEU B CD1 1  
ATOM 7117   C CD2 . LEU B 2 464 ? -81.159  -2.418  24.013  1.00 0.00 ? 464 LEU B CD2 1  
ATOM 7118   N N   . ASN B 2 465 ? -80.540  -1.512  29.445  1.00 0.00 ? 465 ASN B N   1  
ATOM 7119   C CA  . ASN B 2 465 ? -81.080  -1.927  30.729  1.00 0.00 ? 465 ASN B CA  1  
ATOM 7120   C C   . ASN B 2 465 ? -80.902  -0.984  31.754  1.00 0.00 ? 465 ASN B C   1  
ATOM 7121   O O   . ASN B 2 465 ? -81.835  -0.556  32.391  1.00 0.00 ? 465 ASN B O   1  
ATOM 7122   C CB  . ASN B 2 465 ? -80.389  -3.311  31.027  1.00 0.00 ? 465 ASN B CB  1  
ATOM 7123   C CG  . ASN B 2 465 ? -80.942  -3.965  32.303  1.00 0.00 ? 465 ASN B CG  1  
ATOM 7124   O OD1 . ASN B 2 465 ? -81.847  -3.389  32.927  1.00 0.00 ? 465 ASN B OD1 1  
ATOM 7125   N ND2 . ASN B 2 465 ? -80.490  -5.232  32.469  1.00 0.00 ? 465 ASN B ND2 1  
ATOM 7126   N N   . GLN B 2 466 ? -79.632  -0.621  31.956  1.00 0.00 ? 466 GLN B N   1  
ATOM 7127   C CA  . GLN B 2 466 ? -79.198  0.250   32.959  1.00 0.00 ? 466 GLN B CA  1  
ATOM 7128   C C   . GLN B 2 466 ? -79.541  1.702   32.640  1.00 0.00 ? 466 GLN B C   1  
ATOM 7129   O O   . GLN B 2 466 ? -80.020  2.348   33.527  1.00 0.00 ? 466 GLN B O   1  
ATOM 7130   C CB  . GLN B 2 466 ? -77.700  0.308   33.236  1.00 0.00 ? 466 GLN B CB  1  
ATOM 7131   C CG  . GLN B 2 466 ? -77.143  -1.106  33.365  1.00 0.00 ? 466 GLN B CG  1  
ATOM 7132   C CD  . GLN B 2 466 ? -75.678  -1.153  33.842  1.00 0.00 ? 466 GLN B CD  1  
ATOM 7133   O OE1 . GLN B 2 466 ? -75.377  -2.103  34.667  1.00 0.00 ? 466 GLN B OE1 1  
ATOM 7134   N NE2 . GLN B 2 466 ? -74.834  -0.158  33.340  1.00 0.00 ? 466 GLN B NE2 1  
ATOM 7135   N N   . LYS B 2 467 ? -79.230  2.149   31.450  1.00 0.00 ? 467 LYS B N   1  
ATOM 7136   C CA  . LYS B 2 467 ? -79.388  3.567   31.156  1.00 0.00 ? 467 LYS B CA  1  
ATOM 7137   C C   . LYS B 2 467 ? -80.800  3.914   30.969  1.00 0.00 ? 467 LYS B C   1  
ATOM 7138   O O   . LYS B 2 467 ? -81.286  4.927   31.440  1.00 0.00 ? 467 LYS B O   1  
ATOM 7139   C CB  . LYS B 2 467 ? -78.468  4.158   30.104  1.00 0.00 ? 467 LYS B CB  1  
ATOM 7140   C CG  . LYS B 2 467 ? -77.130  3.337   30.088  1.00 0.00 ? 467 LYS B CG  1  
ATOM 7141   C CD  . LYS B 2 467 ? -76.171  3.625   31.266  1.00 0.00 ? 467 LYS B CD  1  
ATOM 7142   C CE  . LYS B 2 467 ? -74.802  3.114   31.132  1.00 0.00 ? 467 LYS B CE  1  
ATOM 7143   N NZ  . LYS B 2 467 ? -74.798  1.655   30.906  1.00 0.00 ? 467 LYS B NZ  1  
ATOM 7144   N N   . PHE B 2 468 ? -81.488  3.104   30.154  1.00 0.00 ? 468 PHE B N   1  
ATOM 7145   C CA  . PHE B 2 468 ? -82.849  3.519   29.739  1.00 0.00 ? 468 PHE B CA  1  
ATOM 7146   C C   . PHE B 2 468 ? -83.824  2.448   30.048  1.00 0.00 ? 468 PHE B C   1  
ATOM 7147   O O   . PHE B 2 468 ? -84.868  2.274   29.381  1.00 0.00 ? 468 PHE B O   1  
ATOM 7148   C CB  . PHE B 2 468 ? -83.052  3.776   28.246  1.00 0.00 ? 468 PHE B CB  1  
ATOM 7149   C CG  . PHE B 2 468 ? -81.817  4.123   27.444  1.00 0.00 ? 468 PHE B CG  1  
ATOM 7150   C CD1 . PHE B 2 468 ? -81.020  5.241   27.814  1.00 0.00 ? 468 PHE B CD1 1  
ATOM 7151   C CD2 . PHE B 2 468 ? -81.424  3.332   26.361  1.00 0.00 ? 468 PHE B CD2 1  
ATOM 7152   C CE1 . PHE B 2 468 ? -79.806  5.497   27.098  1.00 0.00 ? 468 PHE B CE1 1  
ATOM 7153   C CE2 . PHE B 2 468 ? -80.292  3.610   25.610  1.00 0.00 ? 468 PHE B CE2 1  
ATOM 7154   C CZ  . PHE B 2 468 ? -79.559  4.750   25.965  1.00 0.00 ? 468 PHE B CZ  1  
ATOM 7155   N N   . HIS B 2 469 ? -83.589  1.832   31.276  1.00 0.00 ? 469 HIS B N   1  
ATOM 7156   C CA  . HIS B 2 469 ? -84.483  1.069   32.084  1.00 0.00 ? 469 HIS B CA  1  
ATOM 7157   C C   . HIS B 2 469 ? -85.216  -0.017  31.215  1.00 0.00 ? 469 HIS B C   1  
ATOM 7158   O O   . HIS B 2 469 ? -86.455  -0.101  31.361  1.00 0.00 ? 469 HIS B O   1  
ATOM 7159   C CB  . HIS B 2 469 ? -85.420  2.033   32.871  1.00 0.00 ? 469 HIS B CB  1  
ATOM 7160   C CG  . HIS B 2 469 ? -84.712  3.212   33.538  1.00 0.00 ? 469 HIS B CG  1  
ATOM 7161   N ND1 . HIS B 2 469 ? -85.068  4.520   33.388  1.00 0.00 ? 469 HIS B ND1 1  
ATOM 7162   C CD2 . HIS B 2 469 ? -83.568  3.228   34.289  1.00 0.00 ? 469 HIS B CD2 1  
ATOM 7163   C CE1 . HIS B 2 469 ? -84.128  5.230   34.121  1.00 0.00 ? 469 HIS B CE1 1  
ATOM 7164   N NE2 . HIS B 2 469 ? -83.261  4.486   34.707  1.00 0.00 ? 469 HIS B NE2 1  
ATOM 7165   N N   . TYR B 2 470 ? -84.541  -0.723  30.256  1.00 0.00 ? 470 TYR B N   1  
ATOM 7166   C CA  . TYR B 2 470 ? -85.249  -1.616  29.387  1.00 0.00 ? 470 TYR B CA  1  
ATOM 7167   C C   . TYR B 2 470 ? -85.900  -2.736  30.058  1.00 0.00 ? 470 TYR B C   1  
ATOM 7168   O O   . TYR B 2 470 ? -87.024  -3.080  29.820  1.00 0.00 ? 470 TYR B O   1  
ATOM 7169   C CB  . TYR B 2 470 ? -84.412  -2.269  28.273  1.00 0.00 ? 470 TYR B CB  1  
ATOM 7170   C CG  . TYR B 2 470 ? -84.482  -1.395  27.041  1.00 0.00 ? 470 TYR B CG  1  
ATOM 7171   C CD1 . TYR B 2 470 ? -84.360  -0.016  27.060  1.00 0.00 ? 470 TYR B CD1 1  
ATOM 7172   C CD2 . TYR B 2 470 ? -84.830  -2.007  25.837  1.00 0.00 ? 470 TYR B CD2 1  
ATOM 7173   C CE1 . TYR B 2 470 ? -84.576  0.753   25.917  1.00 0.00 ? 470 TYR B CE1 1  
ATOM 7174   C CE2 . TYR B 2 470 ? -84.948  -1.263  24.635  1.00 0.00 ? 470 TYR B CE2 1  
ATOM 7175   C CZ  . TYR B 2 470 ? -84.853  0.128   24.712  1.00 0.00 ? 470 TYR B CZ  1  
ATOM 7176   O OH  . TYR B 2 470 ? -84.838  0.891   23.496  1.00 0.00 ? 470 TYR B OH  1  
ATOM 7177   N N   . ARG B 2 471 ? -85.191  -3.399  31.018  1.00 0.00 ? 471 ARG B N   1  
ATOM 7178   C CA  . ARG B 2 471 ? -85.662  -4.548  31.752  1.00 0.00 ? 471 ARG B CA  1  
ATOM 7179   C C   . ARG B 2 471 ? -86.962  -4.085  32.510  1.00 0.00 ? 471 ARG B C   1  
ATOM 7180   O O   . ARG B 2 471 ? -87.953  -4.853  32.563  1.00 0.00 ? 471 ARG B O   1  
ATOM 7181   C CB  . ARG B 2 471 ? -84.603  -5.111  32.720  1.00 0.00 ? 471 ARG B CB  1  
ATOM 7182   C CG  . ARG B 2 471 ? -85.103  -6.409  33.470  1.00 0.00 ? 471 ARG B CG  1  
ATOM 7183   C CD  . ARG B 2 471 ? -83.895  -6.921  34.242  1.00 0.00 ? 471 ARG B CD  1  
ATOM 7184   N NE  . ARG B 2 471 ? -83.112  -7.629  33.148  1.00 0.00 ? 471 ARG B NE  1  
ATOM 7185   C CZ  . ARG B 2 471 ? -82.972  -8.972  33.129  1.00 0.00 ? 471 ARG B CZ  1  
ATOM 7186   N NH1 . ARG B 2 471 ? -83.240  -9.808  34.209  1.00 0.00 ? 471 ARG B NH1 1  
ATOM 7187   N NH2 . ARG B 2 471 ? -82.458  -9.577  32.027  1.00 0.00 ? 471 ARG B NH2 1  
ATOM 7188   N N   . ASP B 2 472 ? -86.926  -2.869  33.022  1.00 0.00 ? 472 ASP B N   1  
ATOM 7189   C CA  . ASP B 2 472 ? -87.963  -2.190  33.739  1.00 0.00 ? 472 ASP B CA  1  
ATOM 7190   C C   . ASP B 2 472 ? -89.151  -1.923  32.778  1.00 0.00 ? 472 ASP B C   1  
ATOM 7191   O O   . ASP B 2 472 ? -90.307  -2.036  33.164  1.00 0.00 ? 472 ASP B O   1  
ATOM 7192   C CB  . ASP B 2 472 ? -87.497  -0.806  34.341  1.00 0.00 ? 472 ASP B CB  1  
ATOM 7193   C CG  . ASP B 2 472 ? -88.155  -0.486  35.671  1.00 0.00 ? 472 ASP B CG  1  
ATOM 7194   O OD1 . ASP B 2 472 ? -89.394  -0.864  35.838  1.00 0.00 ? 472 ASP B OD1 1  
ATOM 7195   O OD2 . ASP B 2 472 ? -87.499  0.042   36.582  1.00 0.00 ? 472 ASP B OD2 1  
ATOM 7196   N N   . VAL B 2 473 ? -88.881  -1.521  31.522  1.00 0.00 ? 473 VAL B N   1  
ATOM 7197   C CA  . VAL B 2 473 ? -89.881  -1.193  30.539  1.00 0.00 ? 473 VAL B CA  1  
ATOM 7198   C C   . VAL B 2 473 ? -90.668  -2.360  30.127  1.00 0.00 ? 473 VAL B C   1  
ATOM 7199   O O   . VAL B 2 473 ? -91.840  -2.232  30.025  1.00 0.00 ? 473 VAL B O   1  
ATOM 7200   C CB  . VAL B 2 473 ? -89.341  -0.551  29.273  1.00 0.00 ? 473 VAL B CB  1  
ATOM 7201   C CG1 . VAL B 2 473 ? -90.327  -0.313  28.109  1.00 0.00 ? 473 VAL B CG1 1  
ATOM 7202   C CG2 . VAL B 2 473 ? -88.850  0.879   29.743  1.00 0.00 ? 473 VAL B CG2 1  
ATOM 7203   N N   . VAL B 2 474 ? -90.069  -3.580  29.912  1.00 0.00 ? 474 VAL B N   1  
ATOM 7204   C CA  . VAL B 2 474 ? -90.855  -4.752  29.580  1.00 0.00 ? 474 VAL B CA  1  
ATOM 7205   C C   . VAL B 2 474 ? -91.839  -5.201  30.577  1.00 0.00 ? 474 VAL B C   1  
ATOM 7206   O O   . VAL B 2 474 ? -92.981  -5.470  30.330  1.00 0.00 ? 474 VAL B O   1  
ATOM 7207   C CB  . VAL B 2 474 ? -90.044  -5.873  29.137  1.00 0.00 ? 474 VAL B CB  1  
ATOM 7208   C CG1 . VAL B 2 474 ? -89.392  -5.352  27.832  1.00 0.00 ? 474 VAL B CG1 1  
ATOM 7209   C CG2 . VAL B 2 474 ? -88.911  -6.322  30.024  1.00 0.00 ? 474 VAL B CG2 1  
ATOM 7210   N N   . PHE B 2 475 ? -91.436  -5.156  31.842  1.00 0.00 ? 475 PHE B N   1  
ATOM 7211   C CA  . PHE B 2 475 ? -92.196  -5.452  33.072  1.00 0.00 ? 475 PHE B CA  1  
ATOM 7212   C C   . PHE B 2 475 ? -93.365  -4.560  33.182  1.00 0.00 ? 475 PHE B C   1  
ATOM 7213   O O   . PHE B 2 475 ? -94.571  -4.867  33.399  1.00 0.00 ? 475 PHE B O   1  
ATOM 7214   C CB  . PHE B 2 475 ? -91.303  -5.300  34.290  1.00 0.00 ? 475 PHE B CB  1  
ATOM 7215   C CG  . PHE B 2 475 ? -90.282  -6.340  34.436  1.00 0.00 ? 475 PHE B CG  1  
ATOM 7216   C CD1 . PHE B 2 475 ? -90.200  -7.436  33.598  1.00 0.00 ? 475 PHE B CD1 1  
ATOM 7217   C CD2 . PHE B 2 475 ? -89.354  -6.120  35.443  1.00 0.00 ? 475 PHE B CD2 1  
ATOM 7218   C CE1 . PHE B 2 475 ? -89.200  -8.400  33.859  1.00 0.00 ? 475 PHE B CE1 1  
ATOM 7219   C CE2 . PHE B 2 475 ? -88.411  -7.119  35.683  1.00 0.00 ? 475 PHE B CE2 1  
ATOM 7220   C CZ  . PHE B 2 475 ? -88.282  -8.259  34.859  1.00 0.00 ? 475 PHE B CZ  1  
ATOM 7221   N N   . ALA B 2 476 ? -93.101  -3.220  32.926  1.00 0.00 ? 476 ALA B N   1  
ATOM 7222   C CA  . ALA B 2 476 ? -94.057  -2.119  32.884  1.00 0.00 ? 476 ALA B CA  1  
ATOM 7223   C C   . ALA B 2 476 ? -95.082  -2.274  31.813  1.00 0.00 ? 476 ALA B C   1  
ATOM 7224   O O   . ALA B 2 476 ? -96.222  -1.929  31.975  1.00 0.00 ? 476 ALA B O   1  
ATOM 7225   C CB  . ALA B 2 476 ? -93.408  -0.718  32.683  1.00 0.00 ? 476 ALA B CB  1  
ATOM 7226   N N   . LEU B 2 477 ? -94.583  -2.785  30.643  1.00 0.00 ? 477 LEU B N   1  
ATOM 7227   C CA  . LEU B 2 477 ? -95.464  -2.969  29.459  1.00 0.00 ? 477 LEU B CA  1  
ATOM 7228   C C   . LEU B 2 477 ? -96.466  -3.987  29.884  1.00 0.00 ? 477 LEU B C   1  
ATOM 7229   O O   . LEU B 2 477 ? -97.631  -3.940  29.667  1.00 0.00 ? 477 LEU B O   1  
ATOM 7230   C CB  . LEU B 2 477 ? -94.689  -3.508  28.180  1.00 0.00 ? 477 LEU B CB  1  
ATOM 7231   C CG  . LEU B 2 477 ? -95.521  -3.718  26.885  1.00 0.00 ? 477 LEU B CG  1  
ATOM 7232   C CD1 . LEU B 2 477 ? -96.233  -2.466  26.401  1.00 0.00 ? 477 LEU B CD1 1  
ATOM 7233   C CD2 . LEU B 2 477 ? -94.574  -4.343  25.751  1.00 0.00 ? 477 LEU B CD2 1  
ATOM 7234   N N   . LYS B 2 478 ? -95.989  -5.048  30.564  1.00 0.00 ? 478 LYS B N   1  
ATOM 7235   C CA  . LYS B 2 478 ? -96.816  -6.206  31.004  1.00 0.00 ? 478 LYS B CA  1  
ATOM 7236   C C   . LYS B 2 478 ? -97.870  -5.745  31.985  1.00 0.00 ? 478 LYS B C   1  
ATOM 7237   O O   . LYS B 2 478 ? -99.081  -6.078  31.897  1.00 0.00 ? 478 LYS B O   1  
ATOM 7238   C CB  . LYS B 2 478 ? -96.033  -7.310  31.747  1.00 0.00 ? 478 LYS B CB  1  
ATOM 7239   C CG  . LYS B 2 478 ? -96.896  -8.491  32.376  1.00 0.00 ? 478 LYS B CG  1  
ATOM 7240   C CD  . LYS B 2 478 ? -97.215  -8.319  33.841  1.00 0.00 ? 478 LYS B CD  1  
ATOM 7241   C CE  . LYS B 2 478 ? -98.159  -9.400  34.417  1.00 0.00 ? 478 LYS B CE  1  
ATOM 7242   N NZ  . LYS B 2 478 ? -98.408  -9.062  35.800  1.00 0.00 ? 478 LYS B NZ  1  
ATOM 7243   N N   . ASN B 2 479 ? -97.441  -4.835  32.858  1.00 0.00 ? 479 ASN B N   1  
ATOM 7244   C CA  . ASN B 2 479 ? -98.332  -4.088  33.841  1.00 0.00 ? 479 ASN B CA  1  
ATOM 7245   C C   . ASN B 2 479 ? -99.351  -3.247  33.155  1.00 0.00 ? 479 ASN B C   1  
ATOM 7246   O O   . ASN B 2 479 ? -100.511 -3.343  33.582  1.00 0.00 ? 479 ASN B O   1  
ATOM 7247   C CB  . ASN B 2 479 ? -97.482  -3.299  34.931  1.00 0.00 ? 479 ASN B CB  1  
ATOM 7248   C CG  . ASN B 2 479 ? -96.642  -4.226  35.873  1.00 0.00 ? 479 ASN B CG  1  
ATOM 7249   O OD1 . ASN B 2 479 ? -96.879  -5.438  36.056  1.00 0.00 ? 479 ASN B OD1 1  
ATOM 7250   N ND2 . ASN B 2 479 ? -95.529  -3.638  36.453  1.00 0.00 ? 479 ASN B ND2 1  
ATOM 7251   N N   . ILE B 2 480 ? -99.031  -2.402  32.173  1.00 0.00 ? 480 ILE B N   1  
ATOM 7252   C CA  . ILE B 2 480 ? -99.956  -1.561  31.505  1.00 0.00 ? 480 ILE B CA  1  
ATOM 7253   C C   . ILE B 2 480 ? -100.789 -2.217  30.363  1.00 0.00 ? 480 ILE B C   1  
ATOM 7254   O O   . ILE B 2 480 ? -102.020 -2.209  30.471  1.00 0.00 ? 480 ILE B O   1  
ATOM 7255   C CB  . ILE B 2 480 ? -99.337  -0.236  31.148  1.00 0.00 ? 480 ILE B CB  1  
ATOM 7256   C CG1 . ILE B 2 480 ? -100.432 0.848   30.942  1.00 0.00 ? 480 ILE B CG1 1  
ATOM 7257   C CG2 . ILE B 2 480 ? -98.410  -0.354  29.905  1.00 0.00 ? 480 ILE B CG2 1  
ATOM 7258   C CD1 . ILE B 2 480 ? -99.880  2.236   30.573  1.00 0.00 ? 480 ILE B CD1 1  
ATOM 7259   N N   . LEU B 2 481 ? -100.095 -2.836  29.299  1.00 0.00 ? 481 LEU B N   1  
ATOM 7260   C CA  . LEU B 2 481 ? -100.772 -3.351  28.150  1.00 0.00 ? 481 LEU B CA  1  
ATOM 7261   C C   . LEU B 2 481 ? -101.625 -4.638  28.402  1.00 0.00 ? 481 LEU B C   1  
ATOM 7262   O O   . LEU B 2 481 ? -102.773 -4.662  27.943  1.00 0.00 ? 481 LEU B O   1  
ATOM 7263   C CB  . LEU B 2 481 ? -99.712  -3.713  27.040  1.00 0.00 ? 481 LEU B CB  1  
ATOM 7264   C CG  . LEU B 2 481 ? -100.334 -4.200  25.724  1.00 0.00 ? 481 LEU B CG  1  
ATOM 7265   C CD1 . LEU B 2 481 ? -101.215 -3.100  25.110  1.00 0.00 ? 481 LEU B CD1 1  
ATOM 7266   C CD2 . LEU B 2 481 ? -99.171  -4.714  24.812  1.00 0.00 ? 481 LEU B CD2 1  
ATOM 7267   N N   . LEU B 2 482 ? -101.088 -5.578  29.223  1.00 0.00 ? 482 LEU B N   1  
ATOM 7268   C CA  . LEU B 2 482 ? -101.805 -6.744  29.677  1.00 0.00 ? 482 LEU B CA  1  
ATOM 7269   C C   . LEU B 2 482 ? -102.528 -6.494  30.980  1.00 0.00 ? 482 LEU B C   1  
ATOM 7270   O O   . LEU B 2 482 ? -103.282 -7.335  31.434  1.00 0.00 ? 482 LEU B O   1  
ATOM 7271   C CB  . LEU B 2 482 ? -100.884 -7.991  29.936  1.00 0.00 ? 482 LEU B CB  1  
ATOM 7272   C CG  . LEU B 2 482 ? -100.242 -8.773  28.768  1.00 0.00 ? 482 LEU B CG  1  
ATOM 7273   C CD1 . LEU B 2 482 ? -101.221 -9.315  27.716  1.00 0.00 ? 482 LEU B CD1 1  
ATOM 7274   C CD2 . LEU B 2 482 ? -99.088  -7.930  28.145  1.00 0.00 ? 482 LEU B CD2 1  
ATOM 7275   N N   . MET B 2 483 ? -102.471 -5.247  31.500  1.00 0.00 ? 483 MET B N   1  
ATOM 7276   C CA  . MET B 2 483 ? -103.237 -4.635  32.500  1.00 0.00 ? 483 MET B CA  1  
ATOM 7277   C C   . MET B 2 483 ? -103.060 -5.305  33.790  1.00 0.00 ? 483 MET B C   1  
ATOM 7278   O O   . MET B 2 483 ? -103.971 -5.374  34.564  1.00 0.00 ? 483 MET B O   1  
ATOM 7279   C CB  . MET B 2 483 ? -104.703 -4.443  32.197  1.00 0.00 ? 483 MET B CB  1  
ATOM 7280   C CG  . MET B 2 483 ? -104.894 -3.728  30.809  1.00 0.00 ? 483 MET B CG  1  
ATOM 7281   S SD  . MET B 2 483 ? -106.650 -3.617  30.187  1.00 0.00 ? 483 MET B SD  1  
ATOM 7282   C CE  . MET B 2 483 ? -107.046 -2.211  31.251  1.00 0.00 ? 483 MET B CE  1  
ATOM 7283   N N   . GLY B 2 484 ? -101.834 -5.794  34.085  1.00 0.00 ? 484 GLY B N   1  
ATOM 7284   C CA  . GLY B 2 484 ? -101.499 -6.395  35.312  1.00 0.00 ? 484 GLY B CA  1  
ATOM 7285   C C   . GLY B 2 484 ? -101.026 -5.260  36.139  1.00 0.00 ? 484 GLY B C   1  
ATOM 7286   O O   . GLY B 2 484 ? -99.806  -5.070  36.335  1.00 0.00 ? 484 GLY B O   1  
ATOM 7287   N N   . LYS B 2 485 ? -101.957 -4.399  36.661  1.00 0.00 ? 485 LYS B N   1  
ATOM 7288   C CA  . LYS B 2 485 ? -101.558 -3.282  37.502  1.00 0.00 ? 485 LYS B CA  1  
ATOM 7289   C C   . LYS B 2 485 ? -102.873 -2.846  38.116  1.00 0.00 ? 485 LYS B C   1  
ATOM 7290   O O   . LYS B 2 485 ? -103.469 -1.885  37.733  1.00 0.00 ? 485 LYS B O   1  
ATOM 7291   C CB  . LYS B 2 485 ? -100.892 -2.133  36.798  1.00 0.00 ? 485 LYS B CB  1  
ATOM 7292   C CG  . LYS B 2 485 ? -100.355 -1.032  37.728  1.00 0.00 ? 485 LYS B CG  1  
ATOM 7293   C CD  . LYS B 2 485 ? -99.952  0.274   37.058  1.00 0.00 ? 485 LYS B CD  1  
ATOM 7294   C CE  . LYS B 2 485 ? -98.717  0.162   36.132  1.00 0.00 ? 485 LYS B CE  1  
ATOM 7295   N NZ  . LYS B 2 485 ? -97.533  -0.321  36.787  1.00 0.00 ? 485 LYS B NZ  1  
ATOM 7296   N N   . SER B 2 486 ? -103.392 -3.787  38.976  1.00 0.00 ? 486 SER B N   1  
ATOM 7297   C CA  . SER B 2 486 ? -104.794 -3.834  39.368  1.00 0.00 ? 486 SER B CA  1  
ATOM 7298   C C   . SER B 2 486 ? -105.212 -2.643  40.241  1.00 0.00 ? 486 SER B C   1  
ATOM 7299   O O   . SER B 2 486 ? -106.307 -2.091  40.176  1.00 0.00 ? 486 SER B O   1  
ATOM 7300   C CB  . SER B 2 486 ? -105.170 -5.093  40.191  1.00 0.00 ? 486 SER B CB  1  
ATOM 7301   O OG  . SER B 2 486 ? -104.676 -6.295  39.609  1.00 0.00 ? 486 SER B OG  1  
ATOM 7302   N N   . ASP B 2 487 ? -104.274 -2.102  41.040  1.00 0.00 ? 487 ASP B N   1  
ATOM 7303   C CA  . ASP B 2 487 ? -104.518 -0.973  41.906  1.00 0.00 ? 487 ASP B CA  1  
ATOM 7304   C C   . ASP B 2 487 ? -104.878 0.312   41.231  1.00 0.00 ? 487 ASP B C   1  
ATOM 7305   O O   . ASP B 2 487 ? -105.918 0.894   41.503  1.00 0.00 ? 487 ASP B O   1  
ATOM 7306   C CB  . ASP B 2 487 ? -103.237 -0.746  42.864  1.00 0.00 ? 487 ASP B CB  1  
ATOM 7307   C CG  . ASP B 2 487 ? -103.631 0.194   44.062  1.00 0.00 ? 487 ASP B CG  1  
ATOM 7308   O OD1 . ASP B 2 487 ? -103.896 1.395   43.758  1.00 0.00 ? 487 ASP B OD1 1  
ATOM 7309   O OD2 . ASP B 2 487 ? -103.703 -0.260  45.203  1.00 0.00 ? 487 ASP B OD2 1  
ATOM 7310   N N   . PHE B 2 488 ? -104.090 0.517   40.184  1.00 0.00 ? 488 PHE B N   1  
ATOM 7311   C CA  . PHE B 2 488 ? -104.329 1.608   39.268  1.00 0.00 ? 488 PHE B CA  1  
ATOM 7312   C C   . PHE B 2 488 ? -105.654 1.499   38.551  1.00 0.00 ? 488 PHE B C   1  
ATOM 7313   O O   . PHE B 2 488 ? -106.447 2.479   38.467  1.00 0.00 ? 488 PHE B O   1  
ATOM 7314   C CB  . PHE B 2 488 ? -103.151 1.476   38.258  1.00 0.00 ? 488 PHE B CB  1  
ATOM 7315   C CG  . PHE B 2 488 ? -103.119 2.378   37.113  1.00 0.00 ? 488 PHE B CG  1  
ATOM 7316   C CD1 . PHE B 2 488 ? -103.810 1.990   35.937  1.00 0.00 ? 488 PHE B CD1 1  
ATOM 7317   C CD2 . PHE B 2 488 ? -102.445 3.592   37.057  1.00 0.00 ? 488 PHE B CD2 1  
ATOM 7318   C CE1 . PHE B 2 488 ? -103.838 2.755   34.785  1.00 0.00 ? 488 PHE B CE1 1  
ATOM 7319   C CE2 . PHE B 2 488 ? -102.410 4.413   35.976  1.00 0.00 ? 488 PHE B CE2 1  
ATOM 7320   C CZ  . PHE B 2 488 ? -103.061 3.937   34.748  1.00 0.00 ? 488 PHE B CZ  1  
ATOM 7321   N N   . MET B 2 489 ? -105.949 0.309   38.050  1.00 0.00 ? 489 MET B N   1  
ATOM 7322   C CA  . MET B 2 489 ? -107.179 0.098   37.233  1.00 0.00 ? 489 MET B CA  1  
ATOM 7323   C C   . MET B 2 489 ? -108.501 0.343   37.988  1.00 0.00 ? 489 MET B C   1  
ATOM 7324   O O   . MET B 2 489 ? -109.399 1.009   37.502  1.00 0.00 ? 489 MET B O   1  
ATOM 7325   C CB  . MET B 2 489 ? -107.304 -1.316  36.633  1.00 0.00 ? 489 MET B CB  1  
ATOM 7326   C CG  . MET B 2 489 ? -106.175 -1.858  35.727  1.00 0.00 ? 489 MET B CG  1  
ATOM 7327   S SD  . MET B 2 489 ? -105.665 -0.835  34.327  1.00 0.00 ? 489 MET B SD  1  
ATOM 7328   C CE  . MET B 2 489 ? -103.944 -1.369  34.221  1.00 0.00 ? 489 MET B CE  1  
ATOM 7329   N N   . ASP B 2 490 ? -108.508 -0.127  39.269  1.00 0.00 ? 490 ASP B N   1  
ATOM 7330   C CA  . ASP B 2 490 ? -109.618 0.012   40.166  1.00 0.00 ? 490 ASP B CA  1  
ATOM 7331   C C   . ASP B 2 490 ? -109.791 1.488   40.336  1.00 0.00 ? 490 ASP B C   1  
ATOM 7332   O O   . ASP B 2 490 ? -110.875 2.072   40.273  1.00 0.00 ? 490 ASP B O   1  
ATOM 7333   C CB  . ASP B 2 490 ? -109.372 -0.787  41.436  1.00 0.00 ? 490 ASP B CB  1  
ATOM 7334   C CG  . ASP B 2 490 ? -110.497 -0.778  42.454  1.00 0.00 ? 490 ASP B CG  1  
ATOM 7335   O OD1 . ASP B 2 490 ? -110.780 0.290   43.060  1.00 0.00 ? 490 ASP B OD1 1  
ATOM 7336   O OD2 . ASP B 2 490 ? -111.136 -1.891  42.604  1.00 0.00 ? 490 ASP B OD2 1  
ATOM 7337   N N   . ALA B 2 491 ? -108.742 2.206   40.567  1.00 0.00 ? 491 ALA B N   1  
ATOM 7338   C CA  . ALA B 2 491 ? -108.797 3.642   40.768  1.00 0.00 ? 491 ALA B CA  1  
ATOM 7339   C C   . ALA B 2 491 ? -109.247 4.465   39.591  1.00 0.00 ? 491 ALA B C   1  
ATOM 7340   O O   . ALA B 2 491 ? -110.109 5.342   39.765  1.00 0.00 ? 491 ALA B O   1  
ATOM 7341   C CB  . ALA B 2 491 ? -107.412 4.230   41.256  1.00 0.00 ? 491 ALA B CB  1  
ATOM 7342   N N   . LEU B 2 492 ? -108.729 4.074   38.376  1.00 0.00 ? 492 LEU B N   1  
ATOM 7343   C CA  . LEU B 2 492 ? -109.089 4.719   37.098  1.00 0.00 ? 492 LEU B CA  1  
ATOM 7344   C C   . LEU B 2 492 ? -110.576 4.602   36.817  1.00 0.00 ? 492 LEU B C   1  
ATOM 7345   O O   . LEU B 2 492 ? -111.248 5.550   36.563  1.00 0.00 ? 492 LEU B O   1  
ATOM 7346   C CB  . LEU B 2 492 ? -108.283 4.130   35.936  1.00 0.00 ? 492 LEU B CB  1  
ATOM 7347   C CG  . LEU B 2 492 ? -108.364 4.824   34.465  1.00 0.00 ? 492 LEU B CG  1  
ATOM 7348   C CD1 . LEU B 2 492 ? -106.974 5.364   34.103  1.00 0.00 ? 492 LEU B CD1 1  
ATOM 7349   C CD2 . LEU B 2 492 ? -108.917 3.830   33.366  1.00 0.00 ? 492 LEU B CD2 1  
ATOM 7350   N N   . ILE B 2 493 ? -111.059 3.409   37.007  1.00 0.00 ? 493 ILE B N   1  
ATOM 7351   C CA  . ILE B 2 493 ? -112.443 3.160   36.924  1.00 0.00 ? 493 ILE B CA  1  
ATOM 7352   C C   . ILE B 2 493 ? -113.280 3.923   37.964  1.00 0.00 ? 493 ILE B C   1  
ATOM 7353   O O   . ILE B 2 493 ? -114.321 4.438   37.559  1.00 0.00 ? 493 ILE B O   1  
ATOM 7354   C CB  . ILE B 2 493 ? -112.810 1.607   36.804  1.00 0.00 ? 493 ILE B CB  1  
ATOM 7355   C CG1 . ILE B 2 493 ? -112.002 0.986   35.636  1.00 0.00 ? 493 ILE B CG1 1  
ATOM 7356   C CG2 . ILE B 2 493 ? -114.365 1.602   36.425  1.00 0.00 ? 493 ILE B CG2 1  
ATOM 7357   C CD1 . ILE B 2 493 ? -112.268 -0.513  35.416  1.00 0.00 ? 493 ILE B CD1 1  
ATOM 7358   N N   . GLU B 2 494 ? -112.824 4.054   39.261  1.00 0.00 ? 494 GLU B N   1  
ATOM 7359   C CA  . GLU B 2 494 ? -113.642 4.790   40.233  1.00 0.00 ? 494 GLU B CA  1  
ATOM 7360   C C   . GLU B 2 494 ? -113.779 6.196   39.901  1.00 0.00 ? 494 GLU B C   1  
ATOM 7361   O O   . GLU B 2 494 ? -114.921 6.689   39.891  1.00 0.00 ? 494 GLU B O   1  
ATOM 7362   C CB  . GLU B 2 494 ? -112.977 4.508   41.650  1.00 0.00 ? 494 GLU B CB  1  
ATOM 7363   C CG  . GLU B 2 494 ? -113.584 5.429   42.754  1.00 0.00 ? 494 GLU B CG  1  
ATOM 7364   C CD  . GLU B 2 494 ? -112.900 6.820   42.826  1.00 0.00 ? 494 GLU B CD  1  
ATOM 7365   O OE1 . GLU B 2 494 ? -111.735 6.758   43.309  1.00 0.00 ? 494 GLU B OE1 1  
ATOM 7366   O OE2 . GLU B 2 494 ? -113.476 7.838   42.404  1.00 0.00 ? 494 GLU B OE2 1  
ATOM 7367   N N   . LYS B 2 495 ? -112.677 6.867   39.546  1.00 0.00 ? 495 LYS B N   1  
ATOM 7368   C CA  . LYS B 2 495 ? -112.708 8.237   39.178  1.00 0.00 ? 495 LYS B CA  1  
ATOM 7369   C C   . LYS B 2 495 ? -113.445 8.488   37.873  1.00 0.00 ? 495 LYS B C   1  
ATOM 7370   O O   . LYS B 2 495 ? -114.285 9.428   37.762  1.00 0.00 ? 495 LYS B O   1  
ATOM 7371   C CB  . LYS B 2 495 ? -111.216 8.731   39.031  1.00 0.00 ? 495 LYS B CB  1  
ATOM 7372   C CG  . LYS B 2 495 ? -110.491 8.812   40.363  1.00 0.00 ? 495 LYS B CG  1  
ATOM 7373   C CD  . LYS B 2 495 ? -109.016 8.569   40.296  1.00 0.00 ? 495 LYS B CD  1  
ATOM 7374   C CE  . LYS B 2 495 ? -108.340 8.520   41.701  1.00 0.00 ? 495 LYS B CE  1  
ATOM 7375   N NZ  . LYS B 2 495 ? -108.674 7.298   42.406  1.00 0.00 ? 495 LYS B NZ  1  
ATOM 7376   N N   . ALA B 2 496 ? -113.174 7.656   36.853  1.00 0.00 ? 496 ALA B N   1  
ATOM 7377   C CA  . ALA B 2 496 ? -113.727 7.864   35.538  1.00 0.00 ? 496 ALA B CA  1  
ATOM 7378   C C   . ALA B 2 496 ? -115.179 7.654   35.353  1.00 0.00 ? 496 ALA B C   1  
ATOM 7379   O O   . ALA B 2 496 ? -115.720 8.182   34.367  1.00 0.00 ? 496 ALA B O   1  
ATOM 7380   C CB  . ALA B 2 496 ? -113.078 6.961   34.511  1.00 0.00 ? 496 ALA B CB  1  
ATOM 7381   N N   . ASN B 2 497 ? -115.821 6.716   36.168  1.00 0.00 ? 497 ASN B N   1  
ATOM 7382   C CA  . ASN B 2 497 ? -117.034 6.013   35.871  1.00 0.00 ? 497 ASN B CA  1  
ATOM 7383   C C   . ASN B 2 497 ? -118.224 6.933   35.431  1.00 0.00 ? 497 ASN B C   1  
ATOM 7384   O O   . ASN B 2 497 ? -118.927 6.635   34.463  1.00 0.00 ? 497 ASN B O   1  
ATOM 7385   C CB  . ASN B 2 497 ? -117.405 5.261   37.087  1.00 0.00 ? 497 ASN B CB  1  
ATOM 7386   C CG  . ASN B 2 497 ? -118.310 4.114   36.691  1.00 0.00 ? 497 ASN B CG  1  
ATOM 7387   O OD1 . ASN B 2 497 ? -119.492 4.318   36.462  1.00 0.00 ? 497 ASN B OD1 1  
ATOM 7388   N ND2 . ASN B 2 497 ? -117.769 2.820   36.648  1.00 0.00 ? 497 ASN B ND2 1  
ATOM 7389   N N   . ASP B 2 498 ? -118.274 8.024   36.194  1.00 0.00 ? 498 ASP B N   1  
ATOM 7390   C CA  . ASP B 2 498 ? -119.243 9.048   36.033  1.00 0.00 ? 498 ASP B CA  1  
ATOM 7391   C C   . ASP B 2 498 ? -119.268 9.776   34.711  1.00 0.00 ? 498 ASP B C   1  
ATOM 7392   O O   . ASP B 2 498 ? -120.290 9.951   34.047  1.00 0.00 ? 498 ASP B O   1  
ATOM 7393   C CB  . ASP B 2 498 ? -119.080 10.075  37.201  1.00 0.00 ? 498 ASP B CB  1  
ATOM 7394   C CG  . ASP B 2 498 ? -118.855 9.469   38.592  1.00 0.00 ? 498 ASP B CG  1  
ATOM 7395   O OD1 . ASP B 2 498 ? -119.879 9.204   39.276  1.00 0.00 ? 498 ASP B OD1 1  
ATOM 7396   O OD2 . ASP B 2 498 ? -117.629 9.337   39.033  1.00 0.00 ? 498 ASP B OD2 1  
ATOM 7397   N N   . ILE B 2 499 ? -118.041 10.130  34.263  1.00 0.00 ? 499 ILE B N   1  
ATOM 7398   C CA  . ILE B 2 499 ? -117.672 10.785  33.055  1.00 0.00 ? 499 ILE B CA  1  
ATOM 7399   C C   . ILE B 2 499 ? -117.870 9.981   31.805  1.00 0.00 ? 499 ILE B C   1  
ATOM 7400   O O   . ILE B 2 499 ? -118.210 10.470  30.787  1.00 0.00 ? 499 ILE B O   1  
ATOM 7401   C CB  . ILE B 2 499 ? -116.238 11.212  33.262  1.00 0.00 ? 499 ILE B CB  1  
ATOM 7402   C CG1 . ILE B 2 499 ? -116.131 12.290  34.304  1.00 0.00 ? 499 ILE B CG1 1  
ATOM 7403   C CG2 . ILE B 2 499 ? -115.578 11.807  31.972  1.00 0.00 ? 499 ILE B CG2 1  
ATOM 7404   C CD1 . ILE B 2 499 ? -114.693 12.771  34.564  1.00 0.00 ? 499 ILE B CD1 1  
ATOM 7405   N N   . LEU B 2 500 ? -117.573 8.664   31.900  1.00 0.00 ? 500 LEU B N   1  
ATOM 7406   C CA  . LEU B 2 500 ? -117.740 7.698   30.779  1.00 0.00 ? 500 LEU B CA  1  
ATOM 7407   C C   . LEU B 2 500 ? -119.175 7.292   30.494  1.00 0.00 ? 500 LEU B C   1  
ATOM 7408   O O   . LEU B 2 500 ? -119.609 7.123   29.411  1.00 0.00 ? 500 LEU B O   1  
ATOM 7409   C CB  . LEU B 2 500 ? -116.872 6.466   31.045  1.00 0.00 ? 500 LEU B CB  1  
ATOM 7410   C CG  . LEU B 2 500 ? -115.422 6.815   30.945  1.00 0.00 ? 500 LEU B CG  1  
ATOM 7411   C CD1 . LEU B 2 500 ? -114.600 5.600   31.342  1.00 0.00 ? 500 LEU B CD1 1  
ATOM 7412   C CD2 . LEU B 2 500 ? -114.902 7.397   29.605  1.00 0.00 ? 500 LEU B CD2 1  
ATOM 7413   N N   . ALA B 2 501 ? -119.943 7.291   31.544  1.00 0.00 ? 501 ALA B N   1  
ATOM 7414   C CA  . ALA B 2 501 ? -121.322 7.072   31.524  1.00 0.00 ? 501 ALA B CA  1  
ATOM 7415   C C   . ALA B 2 501 ? -122.009 8.074   30.673  1.00 0.00 ? 501 ALA B C   1  
ATOM 7416   O O   . ALA B 2 501 ? -123.003 7.736   29.983  1.00 0.00 ? 501 ALA B O   1  
ATOM 7417   C CB  . ALA B 2 501 ? -122.064 7.098   32.825  1.00 0.00 ? 501 ALA B CB  1  
ATOM 7418   N N   . THR B 2 502 ? -121.519 9.395   30.641  1.00 0.00 ? 502 THR B N   1  
ATOM 7419   C CA  . THR B 2 502 ? -121.948 10.526  29.869  1.00 0.00 ? 502 THR B CA  1  
ATOM 7420   C C   . THR B 2 502 ? -121.193 10.293  28.526  1.00 0.00 ? 502 THR B C   1  
ATOM 7421   O O   . THR B 2 502 ? -119.956 10.169  28.545  1.00 0.00 ? 502 THR B O   1  
ATOM 7422   C CB  . THR B 2 502 ? -121.390 11.843  30.437  1.00 0.00 ? 502 THR B CB  1  
ATOM 7423   O OG1 . THR B 2 502 ? -121.342 11.665  31.842  1.00 0.00 ? 502 THR B OG1 1  
ATOM 7424   C CG2 . THR B 2 502 ? -122.272 13.074  30.091  1.00 0.00 ? 502 THR B CG2 1  
ATOM 7425   N N   . PRO B 2 503 ? -121.893 10.361  27.376  1.00 0.00 ? 503 PRO B N   1  
ATOM 7426   C CA  . PRO B 2 503 ? -121.317 10.476  26.047  1.00 0.00 ? 503 PRO B CA  1  
ATOM 7427   C C   . PRO B 2 503 ? -120.084 11.427  25.955  1.00 0.00 ? 503 PRO B C   1  
ATOM 7428   O O   . PRO B 2 503 ? -120.035 12.422  26.621  1.00 0.00 ? 503 PRO B O   1  
ATOM 7429   C CB  . PRO B 2 503 ? -122.395 10.933  25.153  1.00 0.00 ? 503 PRO B CB  1  
ATOM 7430   C CG  . PRO B 2 503 ? -123.755 10.616  25.829  1.00 0.00 ? 503 PRO B CG  1  
ATOM 7431   C CD  . PRO B 2 503 ? -123.357 10.498  27.324  1.00 0.00 ? 503 PRO B CD  1  
ATOM 7432   N N   . SER B 2 504 ? -119.138 11.059  25.143  1.00 0.00 ? 504 SER B N   1  
ATOM 7433   C CA  . SER B 2 504 ? -117.871 11.718  24.967  1.00 0.00 ? 504 SER B CA  1  
ATOM 7434   C C   . SER B 2 504 ? -117.979 13.068  24.246  1.00 0.00 ? 504 SER B C   1  
ATOM 7435   O O   . SER B 2 504 ? -118.811 13.359  23.422  1.00 0.00 ? 504 SER B O   1  
ATOM 7436   C CB  . SER B 2 504 ? -116.833 10.979  24.197  1.00 0.00 ? 504 SER B CB  1  
ATOM 7437   O OG  . SER B 2 504 ? -117.362 10.548  22.939  1.00 0.00 ? 504 SER B OG  1  
ATOM 7438   N N   . ASP B 2 505 ? -117.007 13.977  24.629  1.00 0.00 ? 505 ASP B N   1  
ATOM 7439   C CA  . ASP B 2 505 ? -116.797 15.317  24.074  1.00 0.00 ? 505 ASP B CA  1  
ATOM 7440   C C   . ASP B 2 505 ? -115.315 15.551  24.320  1.00 0.00 ? 505 ASP B C   1  
ATOM 7441   O O   . ASP B 2 505 ? -114.627 14.744  24.917  1.00 0.00 ? 505 ASP B O   1  
ATOM 7442   C CB  . ASP B 2 505 ? -117.527 16.482  24.747  1.00 0.00 ? 505 ASP B CB  1  
ATOM 7443   C CG  . ASP B 2 505 ? -119.000 16.211  24.423  1.00 0.00 ? 505 ASP B CG  1  
ATOM 7444   O OD1 . ASP B 2 505 ? -119.222 16.148  23.166  1.00 0.00 ? 505 ASP B OD1 1  
ATOM 7445   O OD2 . ASP B 2 505 ? -119.863 15.943  25.317  1.00 0.00 ? 505 ASP B OD2 1  
ATOM 7446   N N   . SER B 2 506 ? -114.827 16.697  23.827  1.00 0.00 ? 506 SER B N   1  
ATOM 7447   C CA  . SER B 2 506 ? -113.525 17.203  23.893  1.00 0.00 ? 506 SER B CA  1  
ATOM 7448   C C   . SER B 2 506 ? -112.960 17.419  25.299  1.00 0.00 ? 506 SER B C   1  
ATOM 7449   O O   . SER B 2 506 ? -111.778 17.134  25.519  1.00 0.00 ? 506 SER B O   1  
ATOM 7450   C CB  . SER B 2 506 ? -113.527 18.542  23.116  1.00 0.00 ? 506 SER B CB  1  
ATOM 7451   O OG  . SER B 2 506 ? -113.478 18.292  21.717  1.00 0.00 ? 506 SER B OG  1  
ATOM 7452   N N   . LEU B 2 507 ? -113.798 17.938  26.216  1.00 0.00 ? 507 LEU B N   1  
ATOM 7453   C CA  . LEU B 2 507 ? -113.386 18.175  27.573  1.00 0.00 ? 507 LEU B CA  1  
ATOM 7454   C C   . LEU B 2 507 ? -113.179 16.943  28.478  1.00 0.00 ? 507 LEU B C   1  
ATOM 7455   O O   . LEU B 2 507 ? -112.183 17.056  29.194  1.00 0.00 ? 507 LEU B O   1  
ATOM 7456   C CB  . LEU B 2 507 ? -114.282 19.189  28.254  1.00 0.00 ? 507 LEU B CB  1  
ATOM 7457   C CG  . LEU B 2 507 ? -114.391 20.694  27.637  1.00 0.00 ? 507 LEU B CG  1  
ATOM 7458   C CD1 . LEU B 2 507 ? -115.263 21.445  28.597  1.00 0.00 ? 507 LEU B CD1 1  
ATOM 7459   C CD2 . LEU B 2 507 ? -112.972 21.228  27.407  1.00 0.00 ? 507 LEU B CD2 1  
ATOM 7460   N N   . PRO B 2 508 ? -113.901 15.885  28.300  1.00 0.00 ? 508 PRO B N   1  
ATOM 7461   C CA  . PRO B 2 508 ? -113.714 14.662  29.041  1.00 0.00 ? 508 PRO B CA  1  
ATOM 7462   C C   . PRO B 2 508 ? -112.301 14.209  28.957  1.00 0.00 ? 508 PRO B C   1  
ATOM 7463   O O   . PRO B 2 508 ? -111.838 13.689  29.935  1.00 0.00 ? 508 PRO B O   1  
ATOM 7464   C CB  . PRO B 2 508 ? -114.644 13.661  28.450  1.00 0.00 ? 508 PRO B CB  1  
ATOM 7465   C CG  . PRO B 2 508 ? -115.938 14.515  28.203  1.00 0.00 ? 508 PRO B CG  1  
ATOM 7466   C CD  . PRO B 2 508 ? -115.372 15.901  27.979  1.00 0.00 ? 508 PRO B CD  1  
ATOM 7467   N N   . ASN B 2 509 ? -111.659 14.422  27.759  1.00 0.00 ? 509 ASN B N   1  
ATOM 7468   C CA  . ASN B 2 509 ? -110.312 13.966  27.385  1.00 0.00 ? 509 ASN B CA  1  
ATOM 7469   C C   . ASN B 2 509 ? -109.279 14.561  28.403  1.00 0.00 ? 509 ASN B C   1  
ATOM 7470   O O   . ASN B 2 509 ? -108.487 13.780  28.929  1.00 0.00 ? 509 ASN B O   1  
ATOM 7471   C CB  . ASN B 2 509 ? -110.065 14.339  25.860  1.00 0.00 ? 509 ASN B CB  1  
ATOM 7472   C CG  . ASN B 2 509 ? -108.709 13.854  25.384  1.00 0.00 ? 509 ASN B CG  1  
ATOM 7473   O OD1 . ASN B 2 509 ? -108.497 12.637  25.251  1.00 0.00 ? 509 ASN B OD1 1  
ATOM 7474   N ND2 . ASN B 2 509 ? -107.724 14.825  25.239  1.00 0.00 ? 509 ASN B ND2 1  
ATOM 7475   N N   . TYR B 2 510 ? -109.453 15.837  28.732  1.00 0.00 ? 510 TYR B N   1  
ATOM 7476   C CA  . TYR B 2 510 ? -108.634 16.502  29.741  1.00 0.00 ? 510 TYR B CA  1  
ATOM 7477   C C   . TYR B 2 510 ? -108.859 15.929  31.118  1.00 0.00 ? 510 TYR B C   1  
ATOM 7478   O O   . TYR B 2 510 ? -107.872 15.589  31.775  1.00 0.00 ? 510 TYR B O   1  
ATOM 7479   C CB  . TYR B 2 510 ? -108.683 18.076  29.759  1.00 0.00 ? 510 TYR B CB  1  
ATOM 7480   C CG  . TYR B 2 510 ? -109.567 18.898  30.597  1.00 0.00 ? 510 TYR B CG  1  
ATOM 7481   C CD1 . TYR B 2 510 ? -109.265 18.951  31.966  1.00 0.00 ? 510 TYR B CD1 1  
ATOM 7482   C CD2 . TYR B 2 510 ? -110.706 19.627  30.127  1.00 0.00 ? 510 TYR B CD2 1  
ATOM 7483   C CE1 . TYR B 2 510 ? -110.092 19.549  32.886  1.00 0.00 ? 510 TYR B CE1 1  
ATOM 7484   C CE2 . TYR B 2 510 ? -111.492 20.273  31.062  1.00 0.00 ? 510 TYR B CE2 1  
ATOM 7485   C CZ  . TYR B 2 510 ? -111.137 20.300  32.454  1.00 0.00 ? 510 TYR B CZ  1  
ATOM 7486   O OH  . TYR B 2 510 ? -111.931 20.872  33.410  1.00 0.00 ? 510 TYR B OH  1  
ATOM 7487   N N   . LYS B 2 511 ? -110.152 15.710  31.535  1.00 0.00 ? 511 LYS B N   1  
ATOM 7488   C CA  . LYS B 2 511 ? -110.396 15.134  32.829  1.00 0.00 ? 511 LYS B CA  1  
ATOM 7489   C C   . LYS B 2 511 ? -109.853 13.752  32.964  1.00 0.00 ? 511 LYS B C   1  
ATOM 7490   O O   . LYS B 2 511 ? -109.248 13.507  34.010  1.00 0.00 ? 511 LYS B O   1  
ATOM 7491   C CB  . LYS B 2 511 ? -111.894 14.942  33.174  1.00 0.00 ? 511 LYS B CB  1  
ATOM 7492   C CG  . LYS B 2 511 ? -112.845 16.079  32.622  1.00 0.00 ? 511 LYS B CG  1  
ATOM 7493   C CD  . LYS B 2 511 ? -114.357 15.900  32.833  1.00 0.00 ? 511 LYS B CD  1  
ATOM 7494   C CE  . LYS B 2 511 ? -115.119 16.888  31.902  1.00 0.00 ? 511 LYS B CE  1  
ATOM 7495   N NZ  . LYS B 2 511 ? -114.687 18.304  32.053  1.00 0.00 ? 511 LYS B NZ  1  
ATOM 7496   N N   . LEU B 2 512 ? -110.007 12.902  31.909  1.00 0.00 ? 512 LEU B N   1  
ATOM 7497   C CA  . LEU B 2 512 ? -109.554 11.570  31.870  1.00 0.00 ? 512 LEU B CA  1  
ATOM 7498   C C   . LEU B 2 512 ? -108.062 11.554  31.979  1.00 0.00 ? 512 LEU B C   1  
ATOM 7499   O O   . LEU B 2 512 ? -107.538 10.730  32.663  1.00 0.00 ? 512 LEU B O   1  
ATOM 7500   C CB  . LEU B 2 512 ? -109.921 10.913  30.558  1.00 0.00 ? 512 LEU B CB  1  
ATOM 7501   C CG  . LEU B 2 512 ? -111.444 10.483  30.571  1.00 0.00 ? 512 LEU B CG  1  
ATOM 7502   C CD1 . LEU B 2 512 ? -111.923 10.174  29.176  1.00 0.00 ? 512 LEU B CD1 1  
ATOM 7503   C CD2 . LEU B 2 512 ? -111.730 9.367   31.606  1.00 0.00 ? 512 LEU B CD2 1  
ATOM 7504   N N   . THR B 2 513 ? -107.367 12.523  31.310  1.00 0.00 ? 513 THR B N   1  
ATOM 7505   C CA  . THR B 2 513 ? -105.935 12.601  31.464  1.00 0.00 ? 513 THR B CA  1  
ATOM 7506   C C   . THR B 2 513 ? -105.506 12.945  32.887  1.00 0.00 ? 513 THR B C   1  
ATOM 7507   O O   . THR B 2 513 ? -104.508 12.411  33.371  1.00 0.00 ? 513 THR B O   1  
ATOM 7508   C CB  . THR B 2 513 ? -105.361 13.576  30.478  1.00 0.00 ? 513 THR B CB  1  
ATOM 7509   O OG1 . THR B 2 513 ? -105.757 13.206  29.159  1.00 0.00 ? 513 THR B OG1 1  
ATOM 7510   C CG2 . THR B 2 513 ? -103.740 13.529  30.610  1.00 0.00 ? 513 THR B CG2 1  
ATOM 7511   N N   . ARG B 2 514 ? -106.233 13.826  33.577  1.00 0.00 ? 514 ARG B N   1  
ATOM 7512   C CA  . ARG B 2 514 ? -106.059 14.243  34.922  1.00 0.00 ? 514 ARG B CA  1  
ATOM 7513   C C   . ARG B 2 514 ? -106.276 13.088  35.883  1.00 0.00 ? 514 ARG B C   1  
ATOM 7514   O O   . ARG B 2 514 ? -105.447 12.834  36.670  1.00 0.00 ? 514 ARG B O   1  
ATOM 7515   C CB  . ARG B 2 514 ? -106.939 15.488  35.304  1.00 0.00 ? 514 ARG B CB  1  
ATOM 7516   C CG  . ARG B 2 514 ? -106.323 16.348  36.496  1.00 0.00 ? 514 ARG B CG  1  
ATOM 7517   C CD  . ARG B 2 514 ? -105.128 17.231  36.070  1.00 0.00 ? 514 ARG B CD  1  
ATOM 7518   N NE  . ARG B 2 514 ? -104.727 18.144  37.211  1.00 0.00 ? 514 ARG B NE  1  
ATOM 7519   C CZ  . ARG B 2 514 ? -103.912 19.178  36.952  1.00 0.00 ? 514 ARG B CZ  1  
ATOM 7520   N NH1 . ARG B 2 514 ? -103.359 19.449  35.795  1.00 0.00 ? 514 ARG B NH1 1  
ATOM 7521   N NH2 . ARG B 2 514 ? -103.592 19.970  38.029  1.00 0.00 ? 514 ARG B NH2 1  
ATOM 7522   N N   . VAL B 2 515 ? -107.358 12.300  35.646  1.00 0.00 ? 515 VAL B N   1  
ATOM 7523   C CA  . VAL B 2 515 ? -107.709 11.049  36.311  1.00 0.00 ? 515 VAL B CA  1  
ATOM 7524   C C   . VAL B 2 515 ? -106.628 10.002  36.146  1.00 0.00 ? 515 VAL B C   1  
ATOM 7525   O O   . VAL B 2 515 ? -106.314 9.250   37.027  1.00 0.00 ? 515 VAL B O   1  
ATOM 7526   C CB  . VAL B 2 515 ? -109.048 10.510  35.827  1.00 0.00 ? 515 VAL B CB  1  
ATOM 7527   C CG1 . VAL B 2 515 ? -109.302 9.021   36.237  1.00 0.00 ? 515 VAL B CG1 1  
ATOM 7528   C CG2 . VAL B 2 515 ? -110.097 11.539  36.327  1.00 0.00 ? 515 VAL B CG2 1  
ATOM 7529   N N   . LEU B 2 516 ? -105.976 9.959   34.914  1.00 0.00 ? 516 LEU B N   1  
ATOM 7530   C CA  . LEU B 2 516 ? -104.868 9.097   34.508  1.00 0.00 ? 516 LEU B CA  1  
ATOM 7531   C C   . LEU B 2 516 ? -103.620 9.432   35.395  1.00 0.00 ? 516 LEU B C   1  
ATOM 7532   O O   . LEU B 2 516 ? -103.001 8.556   35.904  1.00 0.00 ? 516 LEU B O   1  
ATOM 7533   C CB  . LEU B 2 516 ? -104.520 9.151   33.033  1.00 0.00 ? 516 LEU B CB  1  
ATOM 7534   C CG  . LEU B 2 516 ? -103.491 8.031   32.525  1.00 0.00 ? 516 LEU B CG  1  
ATOM 7535   C CD1 . LEU B 2 516 ? -104.132 6.643   32.269  1.00 0.00 ? 516 LEU B CD1 1  
ATOM 7536   C CD2 . LEU B 2 516 ? -102.829 8.659   31.225  1.00 0.00 ? 516 LEU B CD2 1  
ATOM 7537   N N   . GLN B 2 517 ? -103.359 10.712  35.567  1.00 0.00 ? 517 GLN B N   1  
ATOM 7538   C CA  . GLN B 2 517 ? -102.258 11.283  36.346  1.00 0.00 ? 517 GLN B CA  1  
ATOM 7539   C C   . GLN B 2 517 ? -102.486 10.928  37.813  1.00 0.00 ? 517 GLN B C   1  
ATOM 7540   O O   . GLN B 2 517 ? -101.680 10.404  38.572  1.00 0.00 ? 517 GLN B O   1  
ATOM 7541   C CB  . GLN B 2 517 ? -102.010 12.827  36.155  1.00 0.00 ? 517 GLN B CB  1  
ATOM 7542   C CG  . GLN B 2 517 ? -101.424 13.198  34.766  1.00 0.00 ? 517 GLN B CG  1  
ATOM 7543   C CD  . GLN B 2 517 ? -101.472 14.688  34.678  1.00 0.00 ? 517 GLN B CD  1  
ATOM 7544   O OE1 . GLN B 2 517 ? -101.099 15.467  35.573  1.00 0.00 ? 517 GLN B OE1 1  
ATOM 7545   N NE2 . GLN B 2 517 ? -101.955 15.243  33.505  1.00 0.00 ? 517 GLN B NE2 1  
ATOM 7546   N N   . GLU B 2 518 ? -103.769 11.064  38.242  1.00 0.00 ? 518 GLU B N   1  
ATOM 7547   C CA  . GLU B 2 518 ? -104.207 10.727  39.611  1.00 0.00 ? 518 GLU B CA  1  
ATOM 7548   C C   . GLU B 2 518 ? -104.085 9.277   39.951  1.00 0.00 ? 518 GLU B C   1  
ATOM 7549   O O   . GLU B 2 518 ? -103.711 8.822   41.065  1.00 0.00 ? 518 GLU B O   1  
ATOM 7550   C CB  . GLU B 2 518 ? -105.706 11.024  39.924  1.00 0.00 ? 518 GLU B CB  1  
ATOM 7551   C CG  . GLU B 2 518 ? -105.882 12.539  39.911  1.00 0.00 ? 518 GLU B CG  1  
ATOM 7552   C CD  . GLU B 2 518 ? -107.301 12.788  39.522  1.00 0.00 ? 518 GLU B CD  1  
ATOM 7553   O OE1 . GLU B 2 518 ? -108.184 12.201  40.289  1.00 0.00 ? 518 GLU B OE1 1  
ATOM 7554   O OE2 . GLU B 2 518 ? -107.562 13.525  38.534  1.00 0.00 ? 518 GLU B OE2 1  
ATOM 7555   N N   . ALA B 2 519 ? -104.391 8.426   38.931  1.00 0.00 ? 519 ALA B N   1  
ATOM 7556   C CA  . ALA B 2 519 ? -104.293 6.961   38.958  1.00 0.00 ? 519 ALA B CA  1  
ATOM 7557   C C   . ALA B 2 519 ? -102.850 6.524   39.153  1.00 0.00 ? 519 ALA B C   1  
ATOM 7558   O O   . ALA B 2 519 ? -102.633 5.589   39.894  1.00 0.00 ? 519 ALA B O   1  
ATOM 7559   C CB  . ALA B 2 519 ? -104.904 6.305   37.715  1.00 0.00 ? 519 ALA B CB  1  
ATOM 7560   N N   . VAL B 2 520 ? -101.867 7.199   38.530  1.00 0.00 ? 520 VAL B N   1  
ATOM 7561   C CA  . VAL B 2 520 ? -100.474 6.867   38.672  1.00 0.00 ? 520 VAL B CA  1  
ATOM 7562   C C   . VAL B 2 520 ? -100.029 7.041   40.064  1.00 0.00 ? 520 VAL B C   1  
ATOM 7563   O O   . VAL B 2 520 ? -99.391  6.183   40.611  1.00 0.00 ? 520 VAL B O   1  
ATOM 7564   C CB  . VAL B 2 520 ? -99.399  7.717   37.839  1.00 0.00 ? 520 VAL B CB  1  
ATOM 7565   C CG1 . VAL B 2 520 ? -98.007  7.049   37.916  1.00 0.00 ? 520 VAL B CG1 1  
ATOM 7566   C CG2 . VAL B 2 520 ? -99.795  7.753   36.353  1.00 0.00 ? 520 VAL B CG2 1  
ATOM 7567   N N   . GLN B 2 521 ? -100.505 8.189   40.718  1.00 0.00 ? 521 GLN B N   1  
ATOM 7568   C CA  . GLN B 2 521 ? -100.239 8.508   42.120  1.00 0.00 ? 521 GLN B CA  1  
ATOM 7569   C C   . GLN B 2 521 ? -100.856 7.482   43.056  1.00 0.00 ? 521 GLN B C   1  
ATOM 7570   O O   . GLN B 2 521 ? -100.230 6.994   43.988  1.00 0.00 ? 521 GLN B O   1  
ATOM 7571   C CB  . GLN B 2 521 ? -100.682 9.894   42.461  1.00 0.00 ? 521 GLN B CB  1  
ATOM 7572   C CG  . GLN B 2 521 ? -100.115 11.026  41.597  1.00 0.00 ? 521 GLN B CG  1  
ATOM 7573   C CD  . GLN B 2 521 ? -100.666 12.239  42.335  1.00 0.00 ? 521 GLN B CD  1  
ATOM 7574   O OE1 . GLN B 2 521 ? -101.706 12.832  41.900  1.00 0.00 ? 521 GLN B OE1 1  
ATOM 7575   N NE2 . GLN B 2 521 ? -99.885  12.737  43.360  1.00 0.00 ? 521 GLN B NE2 1  
ATOM 7576   N N   . LEU B 2 522 ? -102.118 7.083   42.760  1.00 0.00 ? 522 LEU B N   1  
ATOM 7577   C CA  . LEU B 2 522 ? -102.910 6.135   43.491  1.00 0.00 ? 522 LEU B CA  1  
ATOM 7578   C C   . LEU B 2 522 ? -102.346 4.750   43.538  1.00 0.00 ? 522 LEU B C   1  
ATOM 7579   O O   . LEU B 2 522 ? -102.317 4.062   44.578  1.00 0.00 ? 522 LEU B O   1  
ATOM 7580   C CB  . LEU B 2 522 ? -104.390 6.118   43.015  1.00 0.00 ? 522 LEU B CB  1  
ATOM 7581   C CG  . LEU B 2 522 ? -105.505 5.839   44.043  1.00 0.00 ? 522 LEU B CG  1  
ATOM 7582   C CD1 . LEU B 2 522 ? -105.547 4.450   44.597  1.00 0.00 ? 522 LEU B CD1 1  
ATOM 7583   C CD2 . LEU B 2 522 ? -105.622 6.875   45.210  1.00 0.00 ? 522 LEU B CD2 1  
ATOM 7584   N N   . SER B 2 523 ? -101.723 4.312   42.447  1.00 0.00 ? 523 SER B N   1  
ATOM 7585   C CA  . SER B 2 523 ? -101.053 3.027   42.276  1.00 0.00 ? 523 SER B CA  1  
ATOM 7586   C C   . SER B 2 523 ? -99.689  2.922   42.988  1.00 0.00 ? 523 SER B C   1  
ATOM 7587   O O   . SER B 2 523 ? -99.192  1.820   43.162  1.00 0.00 ? 523 SER B O   1  
ATOM 7588   C CB  . SER B 2 523 ? -100.752 2.741   40.758  1.00 0.00 ? 523 SER B CB  1  
ATOM 7589   O OG  . SER B 2 523 ? -100.522 1.362   40.574  1.00 0.00 ? 523 SER B OG  1  
ATOM 7590   N N   . SER B 2 524 ? -99.242  4.041   43.562  1.00 0.00 ? 524 SER B N   1  
ATOM 7591   C CA  . SER B 2 524 ? -98.110  4.094   44.447  1.00 0.00 ? 524 SER B CA  1  
ATOM 7592   C C   . SER B 2 524 ? -96.851  3.776   43.654  1.00 0.00 ? 524 SER B C   1  
ATOM 7593   O O   . SER B 2 524 ? -96.162  2.810   43.969  1.00 0.00 ? 524 SER B O   1  
ATOM 7594   C CB  . SER B 2 524 ? -98.254  3.399   45.860  1.00 0.00 ? 524 SER B CB  1  
ATOM 7595   O OG  . SER B 2 524 ? -98.625  2.010   45.735  1.00 0.00 ? 524 SER B OG  1  
ATOM 7596   N N   . LEU B 2 525 ? -96.522  4.485   42.508  1.00 0.00 ? 525 LEU B N   1  
ATOM 7597   C CA  . LEU B 2 525 ? -95.449  4.247   41.717  1.00 0.00 ? 525 LEU B CA  1  
ATOM 7598   C C   . LEU B 2 525 ? -94.599  5.400   41.791  1.00 0.00 ? 525 LEU B C   1  
ATOM 7599   O O   . LEU B 2 525 ? -95.067  6.522   41.515  1.00 0.00 ? 525 LEU B O   1  
ATOM 7600   C CB  . LEU B 2 525 ? -95.843  3.997   40.204  1.00 0.00 ? 525 LEU B CB  1  
ATOM 7601   C CG  . LEU B 2 525 ? -96.838  2.859   39.993  1.00 0.00 ? 525 LEU B CG  1  
ATOM 7602   C CD1 . LEU B 2 525 ? -97.373  2.956   38.600  1.00 0.00 ? 525 LEU B CD1 1  
ATOM 7603   C CD2 . LEU B 2 525 ? -96.033  1.472   40.154  1.00 0.00 ? 525 LEU B CD2 1  
ATOM 7604   N N   . ARG B 2 526 ? -93.338  5.234   42.162  1.00 0.00 ? 526 ARG B N   1  
ATOM 7605   C CA  . ARG B 2 526 ? -92.548  6.414   42.402  1.00 0.00 ? 526 ARG B CA  1  
ATOM 7606   C C   . ARG B 2 526 ? -91.091  6.201   42.274  1.00 0.00 ? 526 ARG B C   1  
ATOM 7607   O O   . ARG B 2 526 ? -90.542  5.096   42.306  1.00 0.00 ? 526 ARG B O   1  
ATOM 7608   C CB  . ARG B 2 526 ? -92.844  7.117   43.726  1.00 0.00 ? 526 ARG B CB  1  
ATOM 7609   C CG  . ARG B 2 526 ? -92.450  8.558   43.917  1.00 0.00 ? 526 ARG B CG  1  
ATOM 7610   C CD  . ARG B 2 526 ? -93.092  9.757   43.124  1.00 0.00 ? 526 ARG B CD  1  
ATOM 7611   N NE  . ARG B 2 526 ? -92.605  9.740   41.664  1.00 0.00 ? 526 ARG B NE  1  
ATOM 7612   C CZ  . ARG B 2 526 ? -93.384  10.221  40.631  1.00 0.00 ? 526 ARG B CZ  1  
ATOM 7613   N NH1 . ARG B 2 526 ? -94.555  10.752  40.948  1.00 0.00 ? 526 ARG B NH1 1  
ATOM 7614   N NH2 . ARG B 2 526 ? -93.039  10.061  39.360  1.00 0.00 ? 526 ARG B NH2 1  
ATOM 7615   N N   . HIS B 2 527 ? -90.336  7.292   42.012  1.00 0.00 ? 527 HIS B N   1  
ATOM 7616   C CA  . HIS B 2 527 ? -88.937  7.442   41.840  1.00 0.00 ? 527 HIS B CA  1  
ATOM 7617   C C   . HIS B 2 527 ? -88.225  7.344   43.147  1.00 0.00 ? 527 HIS B C   1  
ATOM 7618   O O   . HIS B 2 527 ? -88.650  7.955   44.169  1.00 0.00 ? 527 HIS B O   1  
ATOM 7619   C CB  . HIS B 2 527 ? -88.473  8.810   41.441  1.00 0.00 ? 527 HIS B CB  1  
ATOM 7620   C CG  . HIS B 2 527 ? -86.972  9.118   41.226  1.00 0.00 ? 527 HIS B CG  1  
ATOM 7621   N ND1 . HIS B 2 527 ? -86.386  9.316   39.988  1.00 0.00 ? 527 HIS B ND1 1  
ATOM 7622   C CD2 . HIS B 2 527 ? -86.026  9.338   42.166  1.00 0.00 ? 527 HIS B CD2 1  
ATOM 7623   C CE1 . HIS B 2 527 ? -85.077  9.509   40.266  1.00 0.00 ? 527 HIS B CE1 1  
ATOM 7624   N NE2 . HIS B 2 527 ? -84.801  9.560   41.559  1.00 0.00 ? 527 HIS B NE2 1  
ATOM 7625   N N   . LEU B 2 528 ? -87.128  6.545   43.131  1.00 0.00 ? 528 LEU B N   1  
ATOM 7626   C CA  . LEU B 2 528 ? -86.241  6.293   44.264  1.00 0.00 ? 528 LEU B CA  1  
ATOM 7627   C C   . LEU B 2 528 ? -84.941  5.955   43.699  1.00 0.00 ? 528 LEU B C   1  
ATOM 7628   O O   . LEU B 2 528 ? -83.987  5.999   44.426  1.00 0.00 ? 528 LEU B O   1  
ATOM 7629   C CB  . LEU B 2 528 ? -86.796  5.078   45.155  1.00 0.00 ? 528 LEU B CB  1  
ATOM 7630   C CG  . LEU B 2 528 ? -88.029  5.441   46.079  1.00 0.00 ? 528 LEU B CG  1  
ATOM 7631   C CD1 . LEU B 2 528 ? -89.333  4.665   45.626  1.00 0.00 ? 528 LEU B CD1 1  
ATOM 7632   C CD2 . LEU B 2 528 ? -87.677  5.214   47.571  1.00 0.00 ? 528 LEU B CD2 1  
ATOM 7633   N N   . MET B 2 529 ? -84.800  5.566   42.401  1.00 0.00 ? 529 MET B N   1  
ATOM 7634   C CA  . MET B 2 529 ? -83.454  5.239   41.901  1.00 0.00 ? 529 MET B CA  1  
ATOM 7635   C C   . MET B 2 529 ? -83.578  5.231   40.431  1.00 0.00 ? 529 MET B C   1  
ATOM 7636   O O   . MET B 2 529 ? -83.317  4.232   39.741  1.00 0.00 ? 529 MET B O   1  
ATOM 7637   C CB  . MET B 2 529 ? -82.909  3.900   42.468  1.00 0.00 ? 529 MET B CB  1  
ATOM 7638   C CG  . MET B 2 529 ? -81.438  3.717   42.183  1.00 0.00 ? 529 MET B CG  1  
ATOM 7639   S SD  . MET B 2 529 ? -80.525  2.721   43.414  1.00 0.00 ? 529 MET B SD  1  
ATOM 7640   C CE  . MET B 2 529 ? -81.072  1.038   42.977  1.00 0.00 ? 529 MET B CE  1  
ATOM 7641   N N   . ASN B 2 530 ? -84.207  6.366   39.945  1.00 0.00 ? 530 ASN B N   1  
ATOM 7642   C CA  . ASN B 2 530 ? -84.704  6.524   38.619  1.00 0.00 ? 530 ASN B CA  1  
ATOM 7643   C C   . ASN B 2 530 ? -85.693  5.563   38.106  1.00 0.00 ? 530 ASN B C   1  
ATOM 7644   O O   . ASN B 2 530 ? -85.604  4.933   37.036  1.00 0.00 ? 530 ASN B O   1  
ATOM 7645   C CB  . ASN B 2 530 ? -83.635  6.777   37.541  1.00 0.00 ? 530 ASN B CB  1  
ATOM 7646   C CG  . ASN B 2 530 ? -82.748  8.035   37.808  1.00 0.00 ? 530 ASN B CG  1  
ATOM 7647   O OD1 . ASN B 2 530 ? -83.016  9.071   37.210  1.00 0.00 ? 530 ASN B OD1 1  
ATOM 7648   N ND2 . ASN B 2 530 ? -81.634  7.923   38.680  1.00 0.00 ? 530 ASN B ND2 1  
ATOM 7649   N N   . SER B 2 531 ? -86.763  5.352   38.972  1.00 0.00 ? 531 SER B N   1  
ATOM 7650   C CA  . SER B 2 531 ? -87.880  4.402   38.830  1.00 0.00 ? 531 SER B CA  1  
ATOM 7651   C C   . SER B 2 531 ? -88.928  5.422   38.441  1.00 0.00 ? 531 SER B C   1  
ATOM 7652   O O   . SER B 2 531 ? -88.562  6.436   37.872  1.00 0.00 ? 531 SER B O   1  
ATOM 7653   C CB  . SER B 2 531 ? -88.131  3.711   40.193  1.00 0.00 ? 531 SER B CB  1  
ATOM 7654   O OG  . SER B 2 531 ? -86.941  3.053   40.644  1.00 0.00 ? 531 SER B OG  1  
ATOM 7655   N N   . PRO B 2 532 ? -90.345  5.195   38.504  1.00 0.00 ? 532 PRO B N   1  
ATOM 7656   C CA  . PRO B 2 532 ? -91.299  6.038   37.923  1.00 0.00 ? 532 PRO B CA  1  
ATOM 7657   C C   . PRO B 2 532 ? -91.056  7.485   38.213  1.00 0.00 ? 532 PRO B C   1  
ATOM 7658   O O   . PRO B 2 532 ? -91.086  7.991   39.309  1.00 0.00 ? 532 PRO B O   1  
ATOM 7659   C CB  . PRO B 2 532 ? -92.668  5.467   38.346  1.00 0.00 ? 532 PRO B CB  1  
ATOM 7660   C CG  . PRO B 2 532 ? -92.446  3.976   38.476  1.00 0.00 ? 532 PRO B CG  1  
ATOM 7661   C CD  . PRO B 2 532 ? -90.921  3.882   38.828  1.00 0.00 ? 532 PRO B CD  1  
ATOM 7662   N N   . ARG B 2 533 ? -90.790  8.228   37.116  1.00 0.00 ? 533 ARG B N   1  
ATOM 7663   C CA  . ARG B 2 533 ? -90.527  9.625   36.798  1.00 0.00 ? 533 ARG B CA  1  
ATOM 7664   C C   . ARG B 2 533 ? -89.825  9.574   35.533  1.00 0.00 ? 533 ARG B C   1  
ATOM 7665   O O   . ARG B 2 533 ? -89.998  10.410  34.662  1.00 0.00 ? 533 ARG B O   1  
ATOM 7666   C CB  . ARG B 2 533 ? -89.605  10.275  37.789  1.00 0.00 ? 533 ARG B CB  1  
ATOM 7667   C CG  . ARG B 2 533 ? -89.306  11.739  37.498  1.00 0.00 ? 533 ARG B CG  1  
ATOM 7668   C CD  . ARG B 2 533 ? -88.791  12.437  38.736  1.00 0.00 ? 533 ARG B CD  1  
ATOM 7669   N NE  . ARG B 2 533 ? -89.905  12.687  39.735  1.00 0.00 ? 533 ARG B NE  1  
ATOM 7670   C CZ  . ARG B 2 533 ? -89.678  12.933  41.041  1.00 0.00 ? 533 ARG B CZ  1  
ATOM 7671   N NH1 . ARG B 2 533 ? -88.403  13.086  41.469  1.00 0.00 ? 533 ARG B NH1 1  
ATOM 7672   N NH2 . ARG B 2 533 ? -90.661  12.790  41.987  1.00 0.00 ? 533 ARG B NH2 1  
ATOM 7673   N N   . ASN B 2 534 ? -88.985  8.535   35.395  1.00 0.00 ? 534 ASN B N   1  
ATOM 7674   C CA  . ASN B 2 534 ? -88.111  8.152   34.379  1.00 0.00 ? 534 ASN B CA  1  
ATOM 7675   C C   . ASN B 2 534 ? -88.687  6.863   33.812  1.00 0.00 ? 534 ASN B C   1  
ATOM 7676   O O   . ASN B 2 534 ? -88.029  6.076   33.124  1.00 0.00 ? 534 ASN B O   1  
ATOM 7677   C CB  . ASN B 2 534 ? -86.719  7.881   34.934  1.00 0.00 ? 534 ASN B CB  1  
ATOM 7678   C CG  . ASN B 2 534 ? -86.216  9.154   35.390  1.00 0.00 ? 534 ASN B CG  1  
ATOM 7679   O OD1 . ASN B 2 534 ? -85.988  9.445   36.587  1.00 0.00 ? 534 ASN B OD1 1  
ATOM 7680   N ND2 . ASN B 2 534 ? -86.009  10.032  34.349  1.00 0.00 ? 534 ASN B ND2 1  
ATOM 7681   N N   . SER B 2 535 ? -90.015  6.623   34.086  1.00 0.00 ? 535 SER B N   1  
ATOM 7682   C CA  . SER B 2 535 ? -90.674  5.402   33.632  1.00 0.00 ? 535 SER B CA  1  
ATOM 7683   C C   . SER B 2 535 ? -91.551  5.629   32.438  1.00 0.00 ? 535 SER B C   1  
ATOM 7684   O O   . SER B 2 535 ? -91.916  6.739   32.121  1.00 0.00 ? 535 SER B O   1  
ATOM 7685   C CB  . SER B 2 535 ? -91.488  4.574   34.699  1.00 0.00 ? 535 SER B CB  1  
ATOM 7686   O OG  . SER B 2 535 ? -92.832  4.989   34.937  1.00 0.00 ? 535 SER B OG  1  
ATOM 7687   N N   . SER B 2 536 ? -91.994  4.566   31.704  1.00 0.00 ? 536 SER B N   1  
ATOM 7688   C CA  . SER B 2 536 ? -92.841  4.430   30.550  1.00 0.00 ? 536 SER B CA  1  
ATOM 7689   C C   . SER B 2 536 ? -94.160  4.920   30.929  1.00 0.00 ? 536 SER B C   1  
ATOM 7690   O O   . SER B 2 536 ? -94.849  5.617   30.182  1.00 0.00 ? 536 SER B O   1  
ATOM 7691   C CB  . SER B 2 536 ? -92.974  2.900   30.220  1.00 0.00 ? 536 SER B CB  1  
ATOM 7692   O OG  . SER B 2 536 ? -91.665  2.462   29.743  1.00 0.00 ? 536 SER B OG  1  
ATOM 7693   N N   . VAL B 2 537 ? -94.623  4.598   32.129  1.00 0.00 ? 537 VAL B N   1  
ATOM 7694   C CA  . VAL B 2 537 ? -95.924  5.143   32.573  1.00 0.00 ? 537 VAL B CA  1  
ATOM 7695   C C   . VAL B 2 537 ? -95.961  6.647   32.823  1.00 0.00 ? 537 VAL B C   1  
ATOM 7696   O O   . VAL B 2 537 ? -96.920  7.246   32.328  1.00 0.00 ? 537 VAL B O   1  
ATOM 7697   C CB  . VAL B 2 537 ? -96.380  4.510   33.991  1.00 0.00 ? 537 VAL B CB  1  
ATOM 7698   C CG1 . VAL B 2 537 ? -97.778  5.052   34.399  1.00 0.00 ? 537 VAL B CG1 1  
ATOM 7699   C CG2 . VAL B 2 537 ? -96.355  2.965   33.937  1.00 0.00 ? 537 VAL B CG2 1  
ATOM 7700   N N   . ILE B 2 538 ? -94.958  7.303   33.508  1.00 0.00 ? 538 ILE B N   1  
ATOM 7701   C CA  . ILE B 2 538 ? -94.994  8.759   33.722  1.00 0.00 ? 538 ILE B CA  1  
ATOM 7702   C C   . ILE B 2 538 ? -94.866  9.565   32.482  1.00 0.00 ? 538 ILE B C   1  
ATOM 7703   O O   . ILE B 2 538 ? -95.649  10.459  32.249  1.00 0.00 ? 538 ILE B O   1  
ATOM 7704   C CB  . ILE B 2 538 ? -93.874  9.180   34.611  1.00 0.00 ? 538 ILE B CB  1  
ATOM 7705   C CG1 . ILE B 2 538 ? -94.112  8.709   36.066  1.00 0.00 ? 538 ILE B CG1 1  
ATOM 7706   C CG2 . ILE B 2 538 ? -93.695  10.682  34.793  1.00 0.00 ? 538 ILE B CG2 1  
ATOM 7707   C CD1 . ILE B 2 538 ? -92.995  9.107   37.045  1.00 0.00 ? 538 ILE B CD1 1  
ATOM 7708   N N   . ASN B 2 539 ? -93.841  9.292   31.669  1.00 0.00 ? 539 ASN B N   1  
ATOM 7709   C CA  . ASN B 2 539 ? -93.413  9.911   30.537  1.00 0.00 ? 539 ASN B CA  1  
ATOM 7710   C C   . ASN B 2 539 ? -94.346  9.635   29.420  1.00 0.00 ? 539 ASN B C   1  
ATOM 7711   O O   . ASN B 2 539 ? -94.693  10.594  28.683  1.00 0.00 ? 539 ASN B O   1  
ATOM 7712   C CB  . ASN B 2 539 ? -91.956  9.492   30.040  1.00 0.00 ? 539 ASN B CB  1  
ATOM 7713   C CG  . ASN B 2 539 ? -90.940  9.916   31.198  1.00 0.00 ? 539 ASN B CG  1  
ATOM 7714   O OD1 . ASN B 2 539 ? -90.463  8.980   31.839  1.00 0.00 ? 539 ASN B OD1 1  
ATOM 7715   N ND2 . ASN B 2 539 ? -90.726  11.250  31.416  1.00 0.00 ? 539 ASN B ND2 1  
ATOM 7716   N N   . GLY B 2 540 ? -94.579  8.353   29.184  1.00 0.00 ? 540 GLY B N   1  
ATOM 7717   C CA  . GLY B 2 540 ? -95.167  7.832   28.007  1.00 0.00 ? 540 GLY B CA  1  
ATOM 7718   C C   . GLY B 2 540 ? -96.635  7.925   27.798  1.00 0.00 ? 540 GLY B C   1  
ATOM 7719   O O   . GLY B 2 540 ? -97.022  7.890   26.644  1.00 0.00 ? 540 GLY B O   1  
ATOM 7720   N N   . LEU B 2 541 ? -97.505  7.983   28.825  1.00 0.00 ? 541 LEU B N   1  
ATOM 7721   C CA  . LEU B 2 541 ? -98.917  7.939   28.547  1.00 0.00 ? 541 LEU B CA  1  
ATOM 7722   C C   . LEU B 2 541 ? -99.609  9.228   28.623  1.00 0.00 ? 541 LEU B C   1  
ATOM 7723   O O   . LEU B 2 541 ? -99.435  10.103  29.491  1.00 0.00 ? 541 LEU B O   1  
ATOM 7724   C CB  . LEU B 2 541 ? -99.623  6.903   29.343  1.00 0.00 ? 541 LEU B CB  1  
ATOM 7725   C CG  . LEU B 2 541 ? -99.093  5.400   29.224  1.00 0.00 ? 541 LEU B CG  1  
ATOM 7726   C CD1 . LEU B 2 541 ? -99.648  4.584   30.384  1.00 0.00 ? 541 LEU B CD1 1  
ATOM 7727   C CD2 . LEU B 2 541 ? -99.306  4.704   27.896  1.00 0.00 ? 541 LEU B CD2 1  
ATOM 7728   N N   . ASP B 2 542 ? -100.505 9.350   27.575  1.00 0.00 ? 542 ASP B N   1  
ATOM 7729   C CA  . ASP B 2 542 ? -101.441 10.430  27.236  1.00 0.00 ? 542 ASP B CA  1  
ATOM 7730   C C   . ASP B 2 542 ? -102.656 9.617   26.906  1.00 0.00 ? 542 ASP B C   1  
ATOM 7731   O O   . ASP B 2 542 ? -102.557 8.469   26.461  1.00 0.00 ? 542 ASP B O   1  
ATOM 7732   C CB  . ASP B 2 542 ? -101.085 11.267  25.975  1.00 0.00 ? 542 ASP B CB  1  
ATOM 7733   C CG  . ASP B 2 542 ? -101.823 12.622  25.850  1.00 0.00 ? 542 ASP B CG  1  
ATOM 7734   O OD1 . ASP B 2 542 ? -102.047 13.312  26.903  1.00 0.00 ? 542 ASP B OD1 1  
ATOM 7735   O OD2 . ASP B 2 542 ? -102.278 12.947  24.698  1.00 0.00 ? 542 ASP B OD2 1  
ATOM 7736   N N   . ALA B 2 543 ? -103.837 10.235  27.208  1.00 0.00 ? 543 ALA B N   1  
ATOM 7737   C CA  . ALA B 2 543 ? -105.058 9.588   26.890  1.00 0.00 ? 543 ALA B CA  1  
ATOM 7738   C C   . ALA B 2 543 ? -105.592 10.063  25.549  1.00 0.00 ? 543 ALA B C   1  
ATOM 7739   O O   . ALA B 2 543 ? -105.464 11.262  25.201  1.00 0.00 ? 543 ALA B O   1  
ATOM 7740   C CB  . ALA B 2 543 ? -106.164 9.955   27.903  1.00 0.00 ? 543 ALA B CB  1  
ATOM 7741   N N   . ARG B 2 544 ? -106.120 9.047   24.786  1.00 0.00 ? 544 ARG B N   1  
ATOM 7742   C CA  . ARG B 2 544 ? -106.549 9.248   23.435  1.00 0.00 ? 544 ARG B CA  1  
ATOM 7743   C C   . ARG B 2 544 ? -107.997 8.993   23.263  1.00 0.00 ? 544 ARG B C   1  
ATOM 7744   O O   . ARG B 2 544 ? -108.577 8.188   24.025  1.00 0.00 ? 544 ARG B O   1  
ATOM 7745   C CB  . ARG B 2 544 ? -105.865 8.431   22.301  1.00 0.00 ? 544 ARG B CB  1  
ATOM 7746   C CG  . ARG B 2 544 ? -104.927 9.252   21.451  1.00 0.00 ? 544 ARG B CG  1  
ATOM 7747   C CD  . ARG B 2 544 ? -105.628 10.106  20.450  1.00 0.00 ? 544 ARG B CD  1  
ATOM 7748   N NE  . ARG B 2 544 ? -104.523 10.854  19.736  1.00 0.00 ? 544 ARG B NE  1  
ATOM 7749   C CZ  . ARG B 2 544 ? -104.183 12.121  20.129  1.00 0.00 ? 544 ARG B CZ  1  
ATOM 7750   N NH1 . ARG B 2 544 ? -104.966 12.828  21.008  1.00 0.00 ? 544 ARG B NH1 1  
ATOM 7751   N NH2 . ARG B 2 544 ? -103.074 12.719  19.594  1.00 0.00 ? 544 ARG B NH2 1  
ATOM 7752   N N   . VAL B 2 545 ? -108.621 9.666   22.254  1.00 0.00 ? 545 VAL B N   1  
ATOM 7753   C CA  . VAL B 2 545 ? -109.960 9.486   22.004  1.00 0.00 ? 545 VAL B CA  1  
ATOM 7754   C C   . VAL B 2 545 ? -109.767 9.101   20.539  1.00 0.00 ? 545 VAL B C   1  
ATOM 7755   O O   . VAL B 2 545 ? -109.039 9.777   19.785  1.00 0.00 ? 545 VAL B O   1  
ATOM 7756   C CB  . VAL B 2 545 ? -110.819 10.748  22.034  1.00 0.00 ? 545 VAL B CB  1  
ATOM 7757   C CG1 . VAL B 2 545 ? -112.292 10.294  22.071  1.00 0.00 ? 545 VAL B CG1 1  
ATOM 7758   C CG2 . VAL B 2 545 ? -110.399 11.603  23.210  1.00 0.00 ? 545 VAL B CG2 1  
ATOM 7759   N N   . LEU B 2 546 ? -110.377 7.920   20.168  1.00 0.00 ? 546 LEU B N   1  
ATOM 7760   C CA  . LEU B 2 546 ? -110.376 7.375   18.871  1.00 0.00 ? 546 LEU B CA  1  
ATOM 7761   C C   . LEU B 2 546 ? -111.384 6.268   18.893  1.00 0.00 ? 546 LEU B C   1  
ATOM 7762   O O   . LEU B 2 546 ? -111.172 5.287   19.627  1.00 0.00 ? 546 LEU B O   1  
ATOM 7763   C CB  . LEU B 2 546 ? -108.971 6.775   18.455  1.00 0.00 ? 546 LEU B CB  1  
ATOM 7764   C CG  . LEU B 2 546 ? -108.850 6.345   17.011  1.00 0.00 ? 546 LEU B CG  1  
ATOM 7765   C CD1 . LEU B 2 546 ? -109.535 7.221   15.875  1.00 0.00 ? 546 LEU B CD1 1  
ATOM 7766   C CD2 . LEU B 2 546 ? -107.385 6.134   16.702  1.00 0.00 ? 546 LEU B CD2 1  
ATOM 7767   N N   . ASP B 2 547 ? -112.416 6.455   18.062  1.00 0.00 ? 547 ASP B N   1  
ATOM 7768   C CA  . ASP B 2 547 ? -113.482 5.560   17.898  1.00 0.00 ? 547 ASP B CA  1  
ATOM 7769   C C   . ASP B 2 547 ? -114.268 5.821   16.633  1.00 0.00 ? 547 ASP B C   1  
ATOM 7770   O O   . ASP B 2 547 ? -114.492 6.947   16.205  1.00 0.00 ? 547 ASP B O   1  
ATOM 7771   C CB  . ASP B 2 547 ? -114.593 5.535   19.044  1.00 0.00 ? 547 ASP B CB  1  
ATOM 7772   C CG  . ASP B 2 547 ? -115.453 4.267   19.113  1.00 0.00 ? 547 ASP B CG  1  
ATOM 7773   O OD1 . ASP B 2 547 ? -114.929 3.131   19.164  1.00 0.00 ? 547 ASP B OD1 1  
ATOM 7774   O OD2 . ASP B 2 547 ? -116.652 4.525   19.154  1.00 0.00 ? 547 ASP B OD2 1  
ATOM 7775   N N   . LEU B 2 548 ? -114.708 4.700   16.095  1.00 0.00 ? 548 LEU B N   1  
ATOM 7776   C CA  . LEU B 2 548 ? -115.623 4.588   14.956  1.00 0.00 ? 548 LEU B CA  1  
ATOM 7777   C C   . LEU B 2 548 ? -116.992 4.825   15.485  1.00 0.00 ? 548 LEU B C   1  
ATOM 7778   O O   . LEU B 2 548 ? -117.655 3.870   15.999  1.00 0.00 ? 548 LEU B O   1  
ATOM 7779   C CB  . LEU B 2 548 ? -115.640 3.129   14.440  1.00 0.00 ? 548 LEU B CB  1  
ATOM 7780   C CG  . LEU B 2 548 ? -114.619 2.829   13.389  1.00 0.00 ? 548 LEU B CG  1  
ATOM 7781   C CD1 . LEU B 2 548 ? -113.124 2.879   13.846  1.00 0.00 ? 548 LEU B CD1 1  
ATOM 7782   C CD2 . LEU B 2 548 ? -114.803 1.423   12.767  1.00 0.00 ? 548 LEU B CD2 1  
ATOM 7783   N N   . GLY B 2 549 ? -117.506 6.103   15.334  1.00 0.00 ? 549 GLY B N   1  
ATOM 7784   C CA  . GLY B 2 549 ? -118.803 6.492   15.811  1.00 0.00 ? 549 GLY B CA  1  
ATOM 7785   C C   . GLY B 2 549 ? -118.851 6.950   17.213  1.00 0.00 ? 549 GLY B C   1  
ATOM 7786   O O   . GLY B 2 549 ? -117.878 6.874   17.909  1.00 0.00 ? 549 GLY B O   1  
ATOM 7787   N N   . HIS B 2 550 ? -120.102 7.414   17.532  1.00 0.00 ? 550 HIS B N   1  
ATOM 7788   C CA  . HIS B 2 550 ? -120.287 7.807   18.837  1.00 0.00 ? 550 HIS B CA  1  
ATOM 7789   C C   . HIS B 2 550 ? -121.411 7.011   19.419  1.00 0.00 ? 550 HIS B C   1  
ATOM 7790   O O   . HIS B 2 550 ? -122.448 6.817   18.779  1.00 0.00 ? 550 HIS B O   1  
ATOM 7791   C CB  . HIS B 2 550 ? -120.657 9.325   19.098  1.00 0.00 ? 550 HIS B CB  1  
ATOM 7792   C CG  . HIS B 2 550 ? -121.864 9.843   18.268  1.00 0.00 ? 550 HIS B CG  1  
ATOM 7793   N ND1 . HIS B 2 550 ? -121.946 9.888   16.894  1.00 0.00 ? 550 HIS B ND1 1  
ATOM 7794   C CD2 . HIS B 2 550 ? -123.024 10.340  18.740  1.00 0.00 ? 550 HIS B CD2 1  
ATOM 7795   C CE1 . HIS B 2 550 ? -123.164 10.379  16.592  1.00 0.00 ? 550 HIS B CE1 1  
ATOM 7796   N NE2 . HIS B 2 550 ? -123.887 10.631  17.729  1.00 0.00 ? 550 HIS B NE2 1  
ATOM 7797   N N   . GLY B 2 551 ? -121.283 6.557   20.648  1.00 0.00 ? 551 GLY B N   1  
ATOM 7798   C CA  . GLY B 2 551 ? -122.378 5.792   21.261  1.00 0.00 ? 551 GLY B CA  1  
ATOM 7799   C C   . GLY B 2 551 ? -123.283 6.663   22.011  1.00 0.00 ? 551 GLY B C   1  
ATOM 7800   O O   . GLY B 2 551 ? -123.539 7.850   21.693  1.00 0.00 ? 551 GLY B O   1  
ATOM 7801   N N   . SER B 2 552 ? -123.760 6.215   23.163  1.00 0.00 ? 552 SER B N   1  
ATOM 7802   C CA  . SER B 2 552 ? -124.503 6.954   24.169  1.00 0.00 ? 552 SER B CA  1  
ATOM 7803   C C   . SER B 2 552 ? -123.571 6.947   25.385  1.00 0.00 ? 552 SER B C   1  
ATOM 7804   O O   . SER B 2 552 ? -123.879 7.506   26.475  1.00 0.00 ? 552 SER B O   1  
ATOM 7805   C CB  . SER B 2 552 ? -125.756 6.192   24.514  1.00 0.00 ? 552 SER B CB  1  
ATOM 7806   O OG  . SER B 2 552 ? -126.800 6.498   23.541  1.00 0.00 ? 552 SER B OG  1  
ATOM 7807   N N   . VAL B 2 553 ? -122.355 6.355   25.224  1.00 0.00 ? 553 VAL B N   1  
ATOM 7808   C CA  . VAL B 2 553 ? -121.364 6.213   26.296  1.00 0.00 ? 553 VAL B CA  1  
ATOM 7809   C C   . VAL B 2 553 ? -120.008 6.565   25.743  1.00 0.00 ? 553 VAL B C   1  
ATOM 7810   O O   . VAL B 2 553 ? -119.487 6.097   24.722  1.00 0.00 ? 553 VAL B O   1  
ATOM 7811   C CB  . VAL B 2 553 ? -121.318 4.865   26.857  1.00 0.00 ? 553 VAL B CB  1  
ATOM 7812   C CG1 . VAL B 2 553 ? -122.620 4.670   27.634  1.00 0.00 ? 553 VAL B CG1 1  
ATOM 7813   C CG2 . VAL B 2 553 ? -121.248 3.735   25.754  1.00 0.00 ? 553 VAL B CG2 1  
ATOM 7814   N N   . GLY B 2 554 ? -119.323 7.205   26.646  1.00 0.00 ? 554 GLY B N   1  
ATOM 7815   C CA  . GLY B 2 554 ? -117.910 7.571   26.682  1.00 0.00 ? 554 GLY B CA  1  
ATOM 7816   C C   . GLY B 2 554 ? -117.073 6.319   26.685  1.00 0.00 ? 554 GLY B C   1  
ATOM 7817   O O   . GLY B 2 554 ? -115.938 6.361   26.253  1.00 0.00 ? 554 GLY B O   1  
ATOM 7818   N N   . TRP B 2 555 ? -117.534 5.191   27.357  1.00 0.00 ? 555 TRP B N   1  
ATOM 7819   C CA  . TRP B 2 555 ? -116.670 4.039   27.678  1.00 0.00 ? 555 TRP B CA  1  
ATOM 7820   C C   . TRP B 2 555 ? -116.089 3.403   26.448  1.00 0.00 ? 555 TRP B C   1  
ATOM 7821   O O   . TRP B 2 555 ? -114.909 3.112   26.407  1.00 0.00 ? 555 TRP B O   1  
ATOM 7822   C CB  . TRP B 2 555 ? -117.374 2.795   28.330  1.00 0.00 ? 555 TRP B CB  1  
ATOM 7823   C CG  . TRP B 2 555 ? -118.111 3.100   29.642  1.00 0.00 ? 555 TRP B CG  1  
ATOM 7824   C CD1 . TRP B 2 555 ? -119.272 3.728   29.918  1.00 0.00 ? 555 TRP B CD1 1  
ATOM 7825   C CD2 . TRP B 2 555 ? -117.404 2.947   30.888  1.00 0.00 ? 555 TRP B CD2 1  
ATOM 7826   N NE1 . TRP B 2 555 ? -119.429 3.864   31.277  1.00 0.00 ? 555 TRP B NE1 1  
ATOM 7827   C CE2 . TRP B 2 555 ? -118.298 3.372   31.873  1.00 0.00 ? 555 TRP B CE2 1  
ATOM 7828   C CE3 . TRP B 2 555 ? -116.103 2.458   31.150  1.00 0.00 ? 555 TRP B CE3 1  
ATOM 7829   C CZ2 . TRP B 2 555 ? -117.929 3.233   33.174  1.00 0.00 ? 555 TRP B CZ2 1  
ATOM 7830   C CZ3 . TRP B 2 555 ? -115.771 2.371   32.478  1.00 0.00 ? 555 TRP B CZ3 1  
ATOM 7831   C CH2 . TRP B 2 555 ? -116.624 2.821   33.512  1.00 0.00 ? 555 TRP B CH2 1  
ATOM 7832   N N   . ASP B 2 556 ? -116.934 3.213   25.434  1.00 0.00 ? 556 ASP B N   1  
ATOM 7833   C CA  . ASP B 2 556 ? -116.581 2.581   24.170  1.00 0.00 ? 556 ASP B CA  1  
ATOM 7834   C C   . ASP B 2 556 ? -115.558 3.323   23.373  1.00 0.00 ? 556 ASP B C   1  
ATOM 7835   O O   . ASP B 2 556 ? -114.684 2.800   22.724  1.00 0.00 ? 556 ASP B O   1  
ATOM 7836   C CB  . ASP B 2 556 ? -117.930 2.457   23.252  1.00 0.00 ? 556 ASP B CB  1  
ATOM 7837   C CG  . ASP B 2 556 ? -117.594 1.620   21.971  1.00 0.00 ? 556 ASP B CG  1  
ATOM 7838   O OD1 . ASP B 2 556 ? -117.390 0.409   22.117  1.00 0.00 ? 556 ASP B OD1 1  
ATOM 7839   O OD2 . ASP B 2 556 ? -117.516 2.239   20.871  1.00 0.00 ? 556 ASP B OD2 1  
ATOM 7840   N N   . VAL B 2 557 ? -115.682 4.653   23.417  1.00 0.00 ? 557 VAL B N   1  
ATOM 7841   C CA  . VAL B 2 557 ? -114.948 5.559   22.763  1.00 0.00 ? 557 VAL B CA  1  
ATOM 7842   C C   . VAL B 2 557 ? -113.502 5.577   23.236  1.00 0.00 ? 557 VAL B C   1  
ATOM 7843   O O   . VAL B 2 557 ? -112.667 6.011   22.484  1.00 0.00 ? 557 VAL B O   1  
ATOM 7844   C CB  . VAL B 2 557 ? -115.717 6.883   22.814  1.00 0.00 ? 557 VAL B CB  1  
ATOM 7845   C CG1 . VAL B 2 557 ? -115.284 8.099   21.807  1.00 0.00 ? 557 VAL B CG1 1  
ATOM 7846   C CG2 . VAL B 2 557 ? -117.131 6.513   22.334  1.00 0.00 ? 557 VAL B CG2 1  
ATOM 7847   N N   . PHE B 2 558 ? -113.209 5.146   24.496  1.00 0.00 ? 558 PHE B N   1  
ATOM 7848   C CA  . PHE B 2 558 ? -111.910 5.349   25.112  1.00 0.00 ? 558 PHE B CA  1  
ATOM 7849   C C   . PHE B 2 558 ? -110.761 4.540   24.530  1.00 0.00 ? 558 PHE B C   1  
ATOM 7850   O O   . PHE B 2 558 ? -110.892 3.355   24.261  1.00 0.00 ? 558 PHE B O   1  
ATOM 7851   C CB  . PHE B 2 558 ? -111.967 5.033   26.595  1.00 0.00 ? 558 PHE B CB  1  
ATOM 7852   C CG  . PHE B 2 558 ? -110.819 5.320   27.436  1.00 0.00 ? 558 PHE B CG  1  
ATOM 7853   C CD1 . PHE B 2 558 ? -110.206 6.584   27.389  1.00 0.00 ? 558 PHE B CD1 1  
ATOM 7854   C CD2 . PHE B 2 558 ? -110.328 4.348   28.401  1.00 0.00 ? 558 PHE B CD2 1  
ATOM 7855   C CE1 . PHE B 2 558 ? -109.173 6.866   28.263  1.00 0.00 ? 558 PHE B CE1 1  
ATOM 7856   C CE2 . PHE B 2 558 ? -109.269 4.714   29.254  1.00 0.00 ? 558 PHE B CE2 1  
ATOM 7857   C CZ  . PHE B 2 558 ? -108.748 5.963   29.233  1.00 0.00 ? 558 PHE B CZ  1  
ATOM 7858   N N   . THR B 2 559 ? -109.586 5.169   24.446  1.00 0.00 ? 559 THR B N   1  
ATOM 7859   C CA  . THR B 2 559 ? -108.306 4.553   24.164  1.00 0.00 ? 559 THR B CA  1  
ATOM 7860   C C   . THR B 2 559 ? -107.260 5.383   24.891  1.00 0.00 ? 559 THR B C   1  
ATOM 7861   O O   . THR B 2 559 ? -107.387 6.422   25.611  1.00 0.00 ? 559 THR B O   1  
ATOM 7862   C CB  . THR B 2 559 ? -108.108 4.313   22.628  1.00 0.00 ? 559 THR B CB  1  
ATOM 7863   O OG1 . THR B 2 559 ? -106.919 3.637   22.191  1.00 0.00 ? 559 THR B OG1 1  
ATOM 7864   C CG2 . THR B 2 559 ? -108.164 5.632   21.900  1.00 0.00 ? 559 THR B CG2 1  
ATOM 7865   N N   . LEU B 2 560 ? -106.083 4.704   24.827  1.00 0.00 ? 560 LEU B N   1  
ATOM 7866   C CA  . LEU B 2 560 ? -104.874 5.035   25.559  1.00 0.00 ? 560 LEU B CA  1  
ATOM 7867   C C   . LEU B 2 560 ? -103.725 5.194   24.607  1.00 0.00 ? 560 LEU B C   1  
ATOM 7868   O O   . LEU B 2 560 ? -103.580 4.519   23.569  1.00 0.00 ? 560 LEU B O   1  
ATOM 7869   C CB  . LEU B 2 560 ? -104.405 4.030   26.596  1.00 0.00 ? 560 LEU B CB  1  
ATOM 7870   C CG  . LEU B 2 560 ? -105.238 4.095   27.878  1.00 0.00 ? 560 LEU B CG  1  
ATOM 7871   C CD1 . LEU B 2 560 ? -104.792 3.002   28.847  1.00 0.00 ? 560 LEU B CD1 1  
ATOM 7872   C CD2 . LEU B 2 560 ? -105.116 5.516   28.491  1.00 0.00 ? 560 LEU B CD2 1  
ATOM 7873   N N   . ASP B 2 561 ? -102.790 6.211   24.737  1.00 0.00 ? 561 ASP B N   1  
ATOM 7874   C CA  . ASP B 2 561 ? -101.773 6.520   23.754  1.00 0.00 ? 561 ASP B CA  1  
ATOM 7875   C C   . ASP B 2 561 ? -100.439 6.457   24.497  1.00 0.00 ? 561 ASP B C   1  
ATOM 7876   O O   . ASP B 2 561 ? -100.356 7.030   25.570  1.00 0.00 ? 561 ASP B O   1  
ATOM 7877   C CB  . ASP B 2 561 ? -101.857 7.945   23.173  1.00 0.00 ? 561 ASP B CB  1  
ATOM 7878   C CG  . ASP B 2 561 ? -100.780 8.099   22.063  1.00 0.00 ? 561 ASP B CG  1  
ATOM 7879   O OD1 . ASP B 2 561 ? -100.859 7.387   21.045  1.00 0.00 ? 561 ASP B OD1 1  
ATOM 7880   O OD2 . ASP B 2 561 ? -99.832  8.913   22.245  1.00 0.00 ? 561 ASP B OD2 1  
ATOM 7881   N N   . TYR B 2 562 ? -99.410  5.846   23.896  1.00 0.00 ? 562 TYR B N   1  
ATOM 7882   C CA  . TYR B 2 562 ? -98.033  5.679   24.334  1.00 0.00 ? 562 TYR B CA  1  
ATOM 7883   C C   . TYR B 2 562 ? -97.236  6.381   23.342  1.00 0.00 ? 562 TYR B C   1  
ATOM 7884   O O   . TYR B 2 562 ? -97.391  6.244   22.120  1.00 0.00 ? 562 TYR B O   1  
ATOM 7885   C CB  . TYR B 2 562 ? -97.657  4.145   24.358  1.00 0.00 ? 562 TYR B CB  1  
ATOM 7886   C CG  . TYR B 2 562 ? -96.207  3.893   24.852  1.00 0.00 ? 562 TYR B CG  1  
ATOM 7887   C CD1 . TYR B 2 562 ? -95.812  4.595   26.063  1.00 0.00 ? 562 TYR B CD1 1  
ATOM 7888   C CD2 . TYR B 2 562 ? -95.372  2.980   24.245  1.00 0.00 ? 562 TYR B CD2 1  
ATOM 7889   C CE1 . TYR B 2 562 ? -94.546  4.274   26.561  1.00 0.00 ? 562 TYR B CE1 1  
ATOM 7890   C CE2 . TYR B 2 562 ? -94.130  2.694   24.815  1.00 0.00 ? 562 TYR B CE2 1  
ATOM 7891   C CZ  . TYR B 2 562 ? -93.708  3.310   25.994  1.00 0.00 ? 562 TYR B CZ  1  
ATOM 7892   O OH  . TYR B 2 562 ? -92.502  3.003   26.649  1.00 0.00 ? 562 TYR B OH  1  
ATOM 7893   N N   . ILE B 2 563 ? -96.288  7.281   23.877  1.00 0.00 ? 563 ILE B N   1  
ATOM 7894   C CA  . ILE B 2 563 ? -95.418  8.190   23.159  1.00 0.00 ? 563 ILE B CA  1  
ATOM 7895   C C   . ILE B 2 563 ? -94.151  7.468   22.680  1.00 0.00 ? 563 ILE B C   1  
ATOM 7896   O O   . ILE B 2 563 ? -93.611  6.677   23.524  1.00 0.00 ? 563 ILE B O   1  
ATOM 7897   C CB  . ILE B 2 563 ? -95.157  9.433   24.044  1.00 0.00 ? 563 ILE B CB  1  
ATOM 7898   C CG1 . ILE B 2 563 ? -96.469  10.313  24.361  1.00 0.00 ? 563 ILE B CG1 1  
ATOM 7899   C CG2 . ILE B 2 563 ? -93.961  10.292  23.439  1.00 0.00 ? 563 ILE B CG2 1  
ATOM 7900   C CD1 . ILE B 2 563 ? -96.201  11.546  25.241  1.00 0.00 ? 563 ILE B CD1 1  
ATOM 7901   N N   . LEU B 2 564 ? -93.664  7.828   21.456  1.00 0.00 ? 564 LEU B N   1  
ATOM 7902   C CA  . LEU B 2 564 ? -92.516  7.435   20.651  1.00 0.00 ? 564 LEU B CA  1  
ATOM 7903   C C   . LEU B 2 564 ? -91.449  6.815   21.432  1.00 0.00 ? 564 LEU B C   1  
ATOM 7904   O O   . LEU B 2 564 ? -91.067  7.180   22.575  1.00 0.00 ? 564 LEU B O   1  
ATOM 7905   C CB  . LEU B 2 564 ? -91.894  8.709   19.969  1.00 0.00 ? 564 LEU B CB  1  
ATOM 7906   C CG  . LEU B 2 564 ? -90.923  8.464   18.773  1.00 0.00 ? 564 LEU B CG  1  
ATOM 7907   C CD1 . LEU B 2 564 ? -91.579  7.605   17.664  1.00 0.00 ? 564 LEU B CD1 1  
ATOM 7908   C CD2 . LEU B 2 564 ? -90.323  9.791   18.138  1.00 0.00 ? 564 LEU B CD2 1  
ATOM 7909   N N   . TYR B 2 565 ? -90.877  5.746   20.855  1.00 0.00 ? 565 TYR B N   1  
ATOM 7910   C CA  . TYR B 2 565 ? -89.943  4.873   21.488  1.00 0.00 ? 565 TYR B CA  1  
ATOM 7911   C C   . TYR B 2 565 ? -88.913  4.626   20.348  1.00 0.00 ? 565 TYR B C   1  
ATOM 7912   O O   . TYR B 2 565 ? -89.378  4.126   19.310  1.00 0.00 ? 565 TYR B O   1  
ATOM 7913   C CB  . TYR B 2 565 ? -90.643  3.564   21.846  1.00 0.00 ? 565 TYR B CB  1  
ATOM 7914   C CG  . TYR B 2 565 ? -89.796  2.543   22.522  1.00 0.00 ? 565 TYR B CG  1  
ATOM 7915   C CD1 . TYR B 2 565 ? -89.098  2.887   23.758  1.00 0.00 ? 565 TYR B CD1 1  
ATOM 7916   C CD2 . TYR B 2 565 ? -89.911  1.158   22.146  1.00 0.00 ? 565 TYR B CD2 1  
ATOM 7917   C CE1 . TYR B 2 565 ? -88.641  1.774   24.541  1.00 0.00 ? 565 TYR B CE1 1  
ATOM 7918   C CE2 . TYR B 2 565 ? -89.384  0.110   22.933  1.00 0.00 ? 565 TYR B CE2 1  
ATOM 7919   C CZ  . TYR B 2 565 ? -88.825  0.451   24.217  1.00 0.00 ? 565 TYR B CZ  1  
ATOM 7920   O OH  . TYR B 2 565 ? -88.331  -0.436  25.116  1.00 0.00 ? 565 TYR B OH  1  
ATOM 7921   N N   . PRO B 2 566 ? -87.611  4.815   20.456  1.00 0.00 ? 566 PRO B N   1  
ATOM 7922   C CA  . PRO B 2 566 ? -86.740  4.759   19.277  1.00 0.00 ? 566 PRO B CA  1  
ATOM 7923   C C   . PRO B 2 566 ? -86.563  3.430   18.617  1.00 0.00 ? 566 PRO B C   1  
ATOM 7924   O O   . PRO B 2 566 ? -86.301  3.476   17.448  1.00 0.00 ? 566 PRO B O   1  
ATOM 7925   C CB  . PRO B 2 566 ? -85.434  5.406   19.816  1.00 0.00 ? 566 PRO B CB  1  
ATOM 7926   C CG  . PRO B 2 566 ? -85.944  6.308   20.925  1.00 0.00 ? 566 PRO B CG  1  
ATOM 7927   C CD  . PRO B 2 566 ? -87.026  5.551   21.559  1.00 0.00 ? 566 PRO B CD  1  
ATOM 7928   N N   . PRO B 2 567 ? -86.741  2.256   19.151  1.00 0.00 ? 567 PRO B N   1  
ATOM 7929   C CA  . PRO B 2 567 ? -86.819  0.952   18.412  1.00 0.00 ? 567 PRO B CA  1  
ATOM 7930   C C   . PRO B 2 567 ? -87.786  0.970   17.208  1.00 0.00 ? 567 PRO B C   1  
ATOM 7931   O O   . PRO B 2 567 ? -87.687  0.210   16.308  1.00 0.00 ? 567 PRO B O   1  
ATOM 7932   C CB  . PRO B 2 567 ? -86.992  -0.136  19.454  1.00 0.00 ? 567 PRO B CB  1  
ATOM 7933   C CG  . PRO B 2 567 ? -86.393  0.449   20.734  1.00 0.00 ? 567 PRO B CG  1  
ATOM 7934   C CD  . PRO B 2 567 ? -86.687  1.969   20.579  1.00 0.00 ? 567 PRO B CD  1  
ATOM 7935   N N   . LEU B 2 568 ? -88.741  1.888   17.255  1.00 0.00 ? 568 LEU B N   1  
ATOM 7936   C CA  . LEU B 2 568 ? -89.816  1.819   16.364  1.00 0.00 ? 568 LEU B CA  1  
ATOM 7937   C C   . LEU B 2 568 ? -90.023  3.134   15.719  1.00 0.00 ? 568 LEU B C   1  
ATOM 7938   O O   . LEU B 2 568 ? -91.132  3.450   15.319  1.00 0.00 ? 568 LEU B O   1  
ATOM 7939   C CB  . LEU B 2 568 ? -91.150  1.545   17.203  1.00 0.00 ? 568 LEU B CB  1  
ATOM 7940   C CG  . LEU B 2 568 ? -91.082  0.485   18.357  1.00 0.00 ? 568 LEU B CG  1  
ATOM 7941   C CD1 . LEU B 2 568 ? -92.260  0.456   19.327  1.00 0.00 ? 568 LEU B CD1 1  
ATOM 7942   C CD2 . LEU B 2 568 ? -90.802  -0.948  17.892  1.00 0.00 ? 568 LEU B CD2 1  
ATOM 7943   N N   . SER B 2 569 ? -88.970  3.951   15.543  1.00 0.00 ? 569 SER B N   1  
ATOM 7944   C CA  . SER B 2 569 ? -88.991  5.294   15.006  1.00 0.00 ? 569 SER B CA  1  
ATOM 7945   C C   . SER B 2 569 ? -88.808  5.222   13.572  1.00 0.00 ? 569 SER B C   1  
ATOM 7946   O O   . SER B 2 569 ? -88.815  6.278   12.886  1.00 0.00 ? 569 SER B O   1  
ATOM 7947   C CB  . SER B 2 569 ? -87.914  6.296   15.649  1.00 0.00 ? 569 SER B CB  1  
ATOM 7948   O OG  . SER B 2 569 ? -88.328  6.642   16.961  1.00 0.00 ? 569 SER B OG  1  
ATOM 7949   N N   . LEU B 2 570 ? -88.636  4.032   13.046  1.00 0.00 ? 570 LEU B N   1  
ATOM 7950   C CA  . LEU B 2 570 ? -88.378  3.855   11.590  1.00 0.00 ? 570 LEU B CA  1  
ATOM 7951   C C   . LEU B 2 570 ? -88.721  2.468   11.150  1.00 0.00 ? 570 LEU B C   1  
ATOM 7952   O O   . LEU B 2 570 ? -88.405  1.943   10.052  1.00 0.00 ? 570 LEU B O   1  
ATOM 7953   C CB  . LEU B 2 570 ? -86.865  4.087   11.210  1.00 0.00 ? 570 LEU B CB  1  
ATOM 7954   C CG  . LEU B 2 570 ? -85.781  3.025   11.529  1.00 0.00 ? 570 LEU B CG  1  
ATOM 7955   C CD1 . LEU B 2 570 ? -84.553  3.224   10.557  1.00 0.00 ? 570 LEU B CD1 1  
ATOM 7956   C CD2 . LEU B 2 570 ? -85.359  3.163   13.003  1.00 0.00 ? 570 LEU B CD2 1  
ATOM 7957   N N   . VAL B 2 571 ? -89.361  1.686   12.067  1.00 0.00 ? 571 VAL B N   1  
ATOM 7958   C CA  . VAL B 2 571 ? -89.768  0.326   11.916  1.00 0.00 ? 571 VAL B CA  1  
ATOM 7959   C C   . VAL B 2 571 ? -91.316  0.430   11.910  1.00 0.00 ? 571 VAL B C   1  
ATOM 7960   O O   . VAL B 2 571 ? -91.881  -0.241  11.071  1.00 0.00 ? 571 VAL B O   1  
ATOM 7961   C CB  . VAL B 2 571 ? -89.250  -0.510  13.060  1.00 0.00 ? 571 VAL B CB  1  
ATOM 7962   C CG1 . VAL B 2 571 ? -89.387  -2.017  12.767  1.00 0.00 ? 571 VAL B CG1 1  
ATOM 7963   C CG2 . VAL B 2 571 ? -87.743  0.011   13.110  1.00 0.00 ? 571 VAL B CG2 1  
ATOM 7964   N N   . LEU B 2 572 ? -92.013  1.300   12.710  1.00 0.00 ? 572 LEU B N   1  
ATOM 7965   C CA  . LEU B 2 572 ? -93.493  1.352   12.641  1.00 0.00 ? 572 LEU B CA  1  
ATOM 7966   C C   . LEU B 2 572 ? -93.997  2.773   12.331  1.00 0.00 ? 572 LEU B C   1  
ATOM 7967   O O   . LEU B 2 572 ? -95.174  3.123   12.375  1.00 0.00 ? 572 LEU B O   1  
ATOM 7968   C CB  . LEU B 2 572 ? -94.174  0.961   14.002  1.00 0.00 ? 572 LEU B CB  1  
ATOM 7969   C CG  . LEU B 2 572 ? -94.388  -0.580  14.267  1.00 0.00 ? 572 LEU B CG  1  
ATOM 7970   C CD1 . LEU B 2 572 ? -95.297  -1.247  13.265  1.00 0.00 ? 572 LEU B CD1 1  
ATOM 7971   C CD2 . LEU B 2 572 ? -93.149  -1.376  14.585  1.00 0.00 ? 572 LEU B CD2 1  
ATOM 7972   N N   . ASN B 2 573 ? -92.936  3.559   12.080  1.00 0.00 ? 573 ASN B N   1  
ATOM 7973   C CA  . ASN B 2 573 ? -93.142  4.900   11.759  1.00 0.00 ? 573 ASN B CA  1  
ATOM 7974   C C   . ASN B 2 573 ? -93.597  5.012   10.213  1.00 0.00 ? 573 ASN B C   1  
ATOM 7975   O O   . ASN B 2 573 ? -93.705  6.094   9.626   1.00 0.00 ? 573 ASN B O   1  
ATOM 7976   C CB  . ASN B 2 573 ? -91.818  5.571   11.927  1.00 0.00 ? 573 ASN B CB  1  
ATOM 7977   C CG  . ASN B 2 573 ? -91.791  7.105   11.967  1.00 0.00 ? 573 ASN B CG  1  
ATOM 7978   O OD1 . ASN B 2 573 ? -91.263  7.820   11.095  1.00 0.00 ? 573 ASN B OD1 1  
ATOM 7979   N ND2 . ASN B 2 573 ? -92.440  7.653   13.082  1.00 0.00 ? 573 ASN B ND2 1  
ATOM 7980   N N   . VAL B 2 574 ? -93.743  3.858   9.582   1.00 0.00 ? 574 VAL B N   1  
ATOM 7981   C CA  . VAL B 2 574 ? -93.956  3.521   8.176   1.00 0.00 ? 574 VAL B CA  1  
ATOM 7982   C C   . VAL B 2 574 ? -95.400  3.664   7.674   1.00 0.00 ? 574 VAL B C   1  
ATOM 7983   O O   . VAL B 2 574 ? -96.187  4.012   8.540   1.00 0.00 ? 574 VAL B O   1  
ATOM 7984   C CB  . VAL B 2 574 ? -93.401  2.118   7.866   1.00 0.00 ? 574 VAL B CB  1  
ATOM 7985   C CG1 . VAL B 2 574 ? -91.931  2.161   8.280   1.00 0.00 ? 574 VAL B CG1 1  
ATOM 7986   C CG2 . VAL B 2 574 ? -94.195  1.038   8.558   1.00 0.00 ? 574 VAL B CG2 1  
ATOM 7987   N N   . ASN B 2 575 ? -95.734  3.294   6.454   1.00 0.00 ? 575 ASN B N   1  
ATOM 7988   C CA  . ASN B 2 575 ? -97.090  3.285   5.943   1.00 0.00 ? 575 ASN B CA  1  
ATOM 7989   C C   . ASN B 2 575 ? -98.072  2.319   6.710   1.00 0.00 ? 575 ASN B C   1  
ATOM 7990   O O   . ASN B 2 575 ? -99.238  2.381   6.426   1.00 0.00 ? 575 ASN B O   1  
ATOM 7991   C CB  . ASN B 2 575 ? -97.235  2.970   4.474   1.00 0.00 ? 575 ASN B CB  1  
ATOM 7992   C CG  . ASN B 2 575 ? -96.653  1.529   4.103   1.00 0.00 ? 575 ASN B CG  1  
ATOM 7993   O OD1 . ASN B 2 575 ? -97.209  0.496   4.325   1.00 0.00 ? 575 ASN B OD1 1  
ATOM 7994   N ND2 . ASN B 2 575 ? -95.326  1.550   3.582   1.00 0.00 ? 575 ASN B ND2 1  
ATOM 7995   N N   . ARG B 2 576 ? -97.584  1.435   7.619   1.00 0.00 ? 576 ARG B N   1  
ATOM 7996   C CA  . ARG B 2 576 ? -98.435  0.521   8.357   1.00 0.00 ? 576 ARG B CA  1  
ATOM 7997   C C   . ARG B 2 576 ? -97.900  0.562   9.800   1.00 0.00 ? 576 ARG B C   1  
ATOM 7998   O O   . ARG B 2 576 ? -96.710  0.315   10.082  1.00 0.00 ? 576 ARG B O   1  
ATOM 7999   C CB  . ARG B 2 576 ? -98.265  -0.966  7.879   1.00 0.00 ? 576 ARG B CB  1  
ATOM 8000   C CG  . ARG B 2 576 ? -99.345  -2.003  8.227   1.00 0.00 ? 576 ARG B CG  1  
ATOM 8001   C CD  . ARG B 2 576 ? -100.669 -1.955  7.394   1.00 0.00 ? 576 ARG B CD  1  
ATOM 8002   N NE  . ARG B 2 576 ? -101.508 -0.877  8.072   1.00 0.00 ? 576 ARG B NE  1  
ATOM 8003   C CZ  . ARG B 2 576 ? -101.914 0.339   7.499   1.00 0.00 ? 576 ARG B CZ  1  
ATOM 8004   N NH1 . ARG B 2 576 ? -101.570 0.584   6.238   1.00 0.00 ? 576 ARG B NH1 1  
ATOM 8005   N NH2 . ARG B 2 576 ? -102.552 1.245   8.318   1.00 0.00 ? 576 ARG B NH2 1  
ATOM 8006   N N   . PRO B 2 577 ? -98.789  0.884   10.754  1.00 0.00 ? 577 PRO B N   1  
ATOM 8007   C CA  . PRO B 2 577 ? -98.455  0.880   12.175  1.00 0.00 ? 577 PRO B CA  1  
ATOM 8008   C C   . PRO B 2 577 ? -99.147  -0.378  12.642  1.00 0.00 ? 577 PRO B C   1  
ATOM 8009   O O   . PRO B 2 577 ? -99.903  -0.325  13.608  1.00 0.00 ? 577 PRO B O   1  
ATOM 8010   C CB  . PRO B 2 577 ? -98.964  2.178   12.755  1.00 0.00 ? 577 PRO B CB  1  
ATOM 8011   C CG  . PRO B 2 577 ? -100.178 2.448   11.914  1.00 0.00 ? 577 PRO B CG  1  
ATOM 8012   C CD  . PRO B 2 577 ? -99.737  1.969   10.487  1.00 0.00 ? 577 PRO B CD  1  
ATOM 8013   N N   . PHE B 2 578 ? -98.831  -1.561  12.087  1.00 0.00 ? 578 PHE B N   1  
ATOM 8014   C CA  . PHE B 2 578 ? -99.348  -2.881  12.374  1.00 0.00 ? 578 PHE B CA  1  
ATOM 8015   C C   . PHE B 2 578 ? -99.109  -3.310  13.818  1.00 0.00 ? 578 PHE B C   1  
ATOM 8016   O O   . PHE B 2 578 ? -100.078 -3.779  14.433  1.00 0.00 ? 578 PHE B O   1  
ATOM 8017   C CB  . PHE B 2 578 ? -98.668  -3.992  11.508  1.00 0.00 ? 578 PHE B CB  1  
ATOM 8018   C CG  . PHE B 2 578 ? -99.689  -5.005  11.309  1.00 0.00 ? 578 PHE B CG  1  
ATOM 8019   C CD1 . PHE B 2 578 ? -100.755 -4.916  10.385  1.00 0.00 ? 578 PHE B CD1 1  
ATOM 8020   C CD2 . PHE B 2 578 ? -99.586  -6.261  11.980  1.00 0.00 ? 578 PHE B CD2 1  
ATOM 8021   C CE1 . PHE B 2 578 ? -101.662 -6.001  10.122  1.00 0.00 ? 578 PHE B CE1 1  
ATOM 8022   C CE2 . PHE B 2 578 ? -100.487 -7.265  11.765  1.00 0.00 ? 578 PHE B CE2 1  
ATOM 8023   C CZ  . PHE B 2 578 ? -101.453 -7.187  10.781  1.00 0.00 ? 578 PHE B CZ  1  
ATOM 8024   N N   . GLY B 2 579 ? -97.867  -3.170  14.349  1.00 0.00 ? 579 GLY B N   1  
ATOM 8025   C CA  . GLY B 2 579 ? -97.433  -3.675  15.703  1.00 0.00 ? 579 GLY B CA  1  
ATOM 8026   C C   . GLY B 2 579 ? -98.255  -3.083  16.824  1.00 0.00 ? 579 GLY B C   1  
ATOM 8027   O O   . GLY B 2 579 ? -98.740  -3.849  17.647  1.00 0.00 ? 579 GLY B O   1  
ATOM 8028   N N   . ARG B 2 580 ? -98.456  -1.738  16.692  1.00 0.00 ? 580 ARG B N   1  
ATOM 8029   C CA  . ARG B 2 580 ? -99.324  -0.952  17.570  1.00 0.00 ? 580 ARG B CA  1  
ATOM 8030   C C   . ARG B 2 580 ? -100.856 -1.314  17.486  1.00 0.00 ? 580 ARG B C   1  
ATOM 8031   O O   . ARG B 2 580 ? -101.377 -1.507  18.534  1.00 0.00 ? 580 ARG B O   1  
ATOM 8032   C CB  . ARG B 2 580 ? -99.348  0.457   17.075  1.00 0.00 ? 580 ARG B CB  1  
ATOM 8033   C CG  . ARG B 2 580 ? -97.952  1.049   16.755  1.00 0.00 ? 580 ARG B CG  1  
ATOM 8034   C CD  . ARG B 2 580 ? -96.934  0.840   17.859  1.00 0.00 ? 580 ARG B CD  1  
ATOM 8035   N NE  . ARG B 2 580 ? -96.051  -0.231  17.389  1.00 0.00 ? 580 ARG B NE  1  
ATOM 8036   C CZ  . ARG B 2 580 ? -95.657  -1.286  18.172  1.00 0.00 ? 580 ARG B CZ  1  
ATOM 8037   N NH1 . ARG B 2 580 ? -96.159  -1.307  19.449  1.00 0.00 ? 580 ARG B NH1 1  
ATOM 8038   N NH2 . ARG B 2 580 ? -94.720  -2.205  17.860  1.00 0.00 ? 580 ARG B NH2 1  
ATOM 8039   N N   . LYS B 2 581 ? -101.401 -1.609  16.310  1.00 0.00 ? 581 LYS B N   1  
ATOM 8040   C CA  . LYS B 2 581 ? -102.691 -2.172  16.184  1.00 0.00 ? 581 LYS B CA  1  
ATOM 8041   C C   . LYS B 2 581 ? -102.861 -3.520  16.869  1.00 0.00 ? 581 LYS B C   1  
ATOM 8042   O O   . LYS B 2 581 ? -103.895 -3.795  17.482  1.00 0.00 ? 581 LYS B O   1  
ATOM 8043   C CB  . LYS B 2 581 ? -103.184 -2.482  14.828  1.00 0.00 ? 581 LYS B CB  1  
ATOM 8044   C CG  . LYS B 2 581 ? -103.445 -1.215  14.049  1.00 0.00 ? 581 LYS B CG  1  
ATOM 8045   C CD  . LYS B 2 581 ? -104.034 -1.416  12.590  1.00 0.00 ? 581 LYS B CD  1  
ATOM 8046   C CE  . LYS B 2 581 ? -103.041 -1.821  11.561  1.00 0.00 ? 581 LYS B CE  1  
ATOM 8047   N NZ  . LYS B 2 581 ? -102.210 -0.694  11.216  1.00 0.00 ? 581 LYS B NZ  1  
ATOM 8048   N N   . GLU B 2 582 ? -101.868 -4.460  16.792  1.00 0.00 ? 582 GLU B N   1  
ATOM 8049   C CA  . GLU B 2 582 ? -102.067 -5.768  17.429  1.00 0.00 ? 582 GLU B CA  1  
ATOM 8050   C C   . GLU B 2 582 ? -102.228 -5.718  18.895  1.00 0.00 ? 582 GLU B C   1  
ATOM 8051   O O   . GLU B 2 582 ? -103.124 -6.326  19.512  1.00 0.00 ? 582 GLU B O   1  
ATOM 8052   C CB  . GLU B 2 582 ? -100.986 -6.779  16.969  1.00 0.00 ? 582 GLU B CB  1  
ATOM 8053   C CG  . GLU B 2 582 ? -100.771 -6.924  15.445  1.00 0.00 ? 582 GLU B CG  1  
ATOM 8054   C CD  . GLU B 2 582 ? -102.112 -7.083  14.709  1.00 0.00 ? 582 GLU B CD  1  
ATOM 8055   O OE1 . GLU B 2 582 ? -102.822 -8.097  14.918  1.00 0.00 ? 582 GLU B OE1 1  
ATOM 8056   O OE2 . GLU B 2 582 ? -102.450 -6.132  13.935  1.00 0.00 ? 582 GLU B OE2 1  
ATOM 8057   N N   . TYR B 2 583 ? -101.295 -4.945  19.496  1.00 0.00 ? 583 TYR B N   1  
ATOM 8058   C CA  . TYR B 2 583 ? -101.166 -4.782  20.936  1.00 0.00 ? 583 TYR B CA  1  
ATOM 8059   C C   . TYR B 2 583 ? -102.437 -4.199  21.453  1.00 0.00 ? 583 TYR B C   1  
ATOM 8060   O O   . TYR B 2 583 ? -103.022 -4.598  22.484  1.00 0.00 ? 583 TYR B O   1  
ATOM 8061   C CB  . TYR B 2 583 ? -100.009 -3.761  21.302  1.00 0.00 ? 583 TYR B CB  1  
ATOM 8062   C CG  . TYR B 2 583 ? -98.576  -4.382  21.307  1.00 0.00 ? 583 TYR B CG  1  
ATOM 8063   C CD1 . TYR B 2 583 ? -98.284  -5.485  20.513  1.00 0.00 ? 583 TYR B CD1 1  
ATOM 8064   C CD2 . TYR B 2 583 ? -97.522  -3.683  21.920  1.00 0.00 ? 583 TYR B CD2 1  
ATOM 8065   C CE1 . TYR B 2 583 ? -96.971  -5.840  20.329  1.00 0.00 ? 583 TYR B CE1 1  
ATOM 8066   C CE2 . TYR B 2 583 ? -96.240  -4.264  21.929  1.00 0.00 ? 583 TYR B CE2 1  
ATOM 8067   C CZ  . TYR B 2 583 ? -95.896  -5.214  21.038  1.00 0.00 ? 583 TYR B CZ  1  
ATOM 8068   O OH  . TYR B 2 583 ? -94.553  -5.510  20.764  1.00 0.00 ? 583 TYR B OH  1  
ATOM 8069   N N   . LEU B 2 584 ? -103.020 -3.261  20.688  1.00 0.00 ? 584 LEU B N   1  
ATOM 8070   C CA  . LEU B 2 584 ? -104.252 -2.632  20.942  1.00 0.00 ? 584 LEU B CA  1  
ATOM 8071   C C   . LEU B 2 584 ? -105.411 -3.536  20.987  1.00 0.00 ? 584 LEU B C   1  
ATOM 8072   O O   . LEU B 2 584 ? -106.288 -3.372  21.782  1.00 0.00 ? 584 LEU B O   1  
ATOM 8073   C CB  . LEU B 2 584 ? -104.507 -1.578  19.795  1.00 0.00 ? 584 LEU B CB  1  
ATOM 8074   C CG  . LEU B 2 584 ? -104.902 -0.138  20.282  1.00 0.00 ? 584 LEU B CG  1  
ATOM 8075   C CD1 . LEU B 2 584 ? -104.047 0.425   21.423  1.00 0.00 ? 584 LEU B CD1 1  
ATOM 8076   C CD2 . LEU B 2 584 ? -104.857 0.803   19.063  1.00 0.00 ? 584 LEU B CD2 1  
ATOM 8077   N N   . ARG B 2 585 ? -105.344 -4.535  20.102  1.00 0.00 ? 585 ARG B N   1  
ATOM 8078   C CA  . ARG B 2 585 ? -106.423 -5.490  20.111  1.00 0.00 ? 585 ARG B CA  1  
ATOM 8079   C C   . ARG B 2 585 ? -106.504 -6.224  21.326  1.00 0.00 ? 585 ARG B C   1  
ATOM 8080   O O   . ARG B 2 585 ? -107.597 -6.333  21.859  1.00 0.00 ? 585 ARG B O   1  
ATOM 8081   C CB  . ARG B 2 585 ? -106.375 -6.581  19.044  1.00 0.00 ? 585 ARG B CB  1  
ATOM 8082   C CG  . ARG B 2 585 ? -106.081 -6.190  17.580  1.00 0.00 ? 585 ARG B CG  1  
ATOM 8083   C CD  . ARG B 2 585 ? -106.986 -5.218  16.894  1.00 0.00 ? 585 ARG B CD  1  
ATOM 8084   N NE  . ARG B 2 585 ? -107.046 -3.890  17.664  1.00 0.00 ? 585 ARG B NE  1  
ATOM 8085   C CZ  . ARG B 2 585 ? -108.055 -2.996  17.528  1.00 0.00 ? 585 ARG B CZ  1  
ATOM 8086   N NH1 . ARG B 2 585 ? -109.412 -3.433  17.303  1.00 0.00 ? 585 ARG B NH1 1  
ATOM 8087   N NH2 . ARG B 2 585 ? -107.856 -1.676  17.740  1.00 0.00 ? 585 ARG B NH2 1  
ATOM 8088   N N   . ILE B 2 586 ? -105.388 -6.719  21.862  1.00 0.00 ? 586 ILE B N   1  
ATOM 8089   C CA  . ILE B 2 586 ? -105.320 -7.441  23.119  1.00 0.00 ? 586 ILE B CA  1  
ATOM 8090   C C   . ILE B 2 586 ? -105.734 -6.604  24.281  1.00 0.00 ? 586 ILE B C   1  
ATOM 8091   O O   . ILE B 2 586 ? -106.430 -7.044  25.167  1.00 0.00 ? 586 ILE B O   1  
ATOM 8092   C CB  . ILE B 2 586 ? -103.949 -7.957  23.359  1.00 0.00 ? 586 ILE B CB  1  
ATOM 8093   C CG1 . ILE B 2 586 ? -103.440 -8.951  22.261  1.00 0.00 ? 586 ILE B CG1 1  
ATOM 8094   C CG2 . ILE B 2 586 ? -103.818 -8.552  24.788  1.00 0.00 ? 586 ILE B CG2 1  
ATOM 8095   C CD1 . ILE B 2 586 ? -102.019 -9.486  22.509  1.00 0.00 ? 586 ILE B CD1 1  
ATOM 8096   N N   . PHE B 2 587 ? -105.307 -5.339  24.192  1.00 0.00 ? 587 PHE B N   1  
ATOM 8097   C CA  . PHE B 2 587 ? -105.523 -4.281  25.226  1.00 0.00 ? 587 PHE B CA  1  
ATOM 8098   C C   . PHE B 2 587 ? -106.967 -4.085  25.484  1.00 0.00 ? 587 PHE B C   1  
ATOM 8099   O O   . PHE B 2 587 ? -107.420 -4.108  26.629  1.00 0.00 ? 587 PHE B O   1  
ATOM 8100   C CB  . PHE B 2 587 ? -105.039 -2.905  24.869  1.00 0.00 ? 587 PHE B CB  1  
ATOM 8101   C CG  . PHE B 2 587 ? -105.188 -1.919  26.009  1.00 0.00 ? 587 PHE B CG  1  
ATOM 8102   C CD1 . PHE B 2 587 ? -104.451 -1.878  27.168  1.00 0.00 ? 587 PHE B CD1 1  
ATOM 8103   C CD2 . PHE B 2 587 ? -106.330 -1.113  25.880  1.00 0.00 ? 587 PHE B CD2 1  
ATOM 8104   C CE1 . PHE B 2 587 ? -104.905 -1.194  28.311  1.00 0.00 ? 587 PHE B CE1 1  
ATOM 8105   C CE2 . PHE B 2 587 ? -106.853 -0.435  27.032  1.00 0.00 ? 587 PHE B CE2 1  
ATOM 8106   C CZ  . PHE B 2 587 ? -106.107 -0.487  28.215  1.00 0.00 ? 587 PHE B CZ  1  
ATOM 8107   N N   . ASN B 2 588 ? -107.803 -4.056  24.398  1.00 0.00 ? 588 ASN B N   1  
ATOM 8108   C CA  . ASN B 2 588 ? -109.254 -3.939  24.438  1.00 0.00 ? 588 ASN B CA  1  
ATOM 8109   C C   . ASN B 2 588 ? -109.974 -5.031  25.066  1.00 0.00 ? 588 ASN B C   1  
ATOM 8110   O O   . ASN B 2 588 ? -110.995 -4.893  25.736  1.00 0.00 ? 588 ASN B O   1  
ATOM 8111   C CB  . ASN B 2 588 ? -109.824 -3.657  23.025  1.00 0.00 ? 588 ASN B CB  1  
ATOM 8112   C CG  . ASN B 2 588 ? -109.626 -2.162  22.485  1.00 0.00 ? 588 ASN B CG  1  
ATOM 8113   O OD1 . ASN B 2 588 ? -108.668 -1.923  21.680  1.00 0.00 ? 588 ASN B OD1 1  
ATOM 8114   N ND2 . ASN B 2 588 ? -110.448 -1.245  22.998  1.00 0.00 ? 588 ASN B ND2 1  
ATOM 8115   N N   . PHE B 2 589 ? -109.525 -6.264  24.751  1.00 0.00 ? 589 PHE B N   1  
ATOM 8116   C CA  . PHE B 2 589 ? -110.187 -7.481  25.240  1.00 0.00 ? 589 PHE B CA  1  
ATOM 8117   C C   . PHE B 2 589 ? -110.010 -7.511  26.740  1.00 0.00 ? 589 PHE B C   1  
ATOM 8118   O O   . PHE B 2 589 ? -110.943 -7.761  27.529  1.00 0.00 ? 589 PHE B O   1  
ATOM 8119   C CB  . PHE B 2 589 ? -109.675 -8.811  24.703  1.00 0.00 ? 589 PHE B CB  1  
ATOM 8120   C CG  . PHE B 2 589 ? -109.768 -8.821  23.200  1.00 0.00 ? 589 PHE B CG  1  
ATOM 8121   C CD1 . PHE B 2 589 ? -110.980 -8.529  22.564  1.00 0.00 ? 589 PHE B CD1 1  
ATOM 8122   C CD2 . PHE B 2 589 ? -108.713 -9.254  22.363  1.00 0.00 ? 589 PHE B CD2 1  
ATOM 8123   C CE1 . PHE B 2 589 ? -111.026 -8.606  21.151  1.00 0.00 ? 589 PHE B CE1 1  
ATOM 8124   C CE2 . PHE B 2 589 ? -108.730 -9.310  20.999  1.00 0.00 ? 589 PHE B CE2 1  
ATOM 8125   C CZ  . PHE B 2 589 ? -109.937 -8.968  20.295  1.00 0.00 ? 589 PHE B CZ  1  
ATOM 8126   N N   . LEU B 2 590 ? -108.772 -7.174  27.175  1.00 0.00 ? 590 LEU B N   1  
ATOM 8127   C CA  . LEU B 2 590 ? -108.519 -7.065  28.584  1.00 0.00 ? 590 LEU B CA  1  
ATOM 8128   C C   . LEU B 2 590 ? -109.340 -5.984  29.227  1.00 0.00 ? 590 LEU B C   1  
ATOM 8129   O O   . LEU B 2 590 ? -109.921 -6.271  30.212  1.00 0.00 ? 590 LEU B O   1  
ATOM 8130   C CB  . LEU B 2 590 ? -107.054 -6.848  28.826  1.00 0.00 ? 590 LEU B CB  1  
ATOM 8131   C CG  . LEU B 2 590 ? -106.142 -8.032  28.398  1.00 0.00 ? 590 LEU B CG  1  
ATOM 8132   C CD1 . LEU B 2 590 ? -104.674 -7.558  28.298  1.00 0.00 ? 590 LEU B CD1 1  
ATOM 8133   C CD2 . LEU B 2 590 ? -106.268 -9.288  29.275  1.00 0.00 ? 590 LEU B CD2 1  
ATOM 8134   N N   . TRP B 2 591 ? -109.432 -4.763  28.632  1.00 0.00 ? 591 TRP B N   1  
ATOM 8135   C CA  . TRP B 2 591 ? -110.060 -3.635  29.144  1.00 0.00 ? 591 TRP B CA  1  
ATOM 8136   C C   . TRP B 2 591 ? -111.508 -3.821  29.329  1.00 0.00 ? 591 TRP B C   1  
ATOM 8137   O O   . TRP B 2 591 ? -111.992 -3.410  30.385  1.00 0.00 ? 591 TRP B O   1  
ATOM 8138   C CB  . TRP B 2 591 ? -109.864 -2.360  28.237  1.00 0.00 ? 591 TRP B CB  1  
ATOM 8139   C CG  . TRP B 2 591 ? -110.688 -1.145  28.537  1.00 0.00 ? 591 TRP B CG  1  
ATOM 8140   C CD1 . TRP B 2 591 ? -110.494 0.012   29.310  1.00 0.00 ? 591 TRP B CD1 1  
ATOM 8141   C CD2 . TRP B 2 591 ? -112.024 -0.919  27.967  1.00 0.00 ? 591 TRP B CD2 1  
ATOM 8142   N NE1 . TRP B 2 591 ? -111.606 0.788   29.299  1.00 0.00 ? 591 TRP B NE1 1  
ATOM 8143   C CE2 . TRP B 2 591 ? -112.510 0.315   28.452  1.00 0.00 ? 591 TRP B CE2 1  
ATOM 8144   C CE3 . TRP B 2 591 ? -112.806 -1.589  26.960  1.00 0.00 ? 591 TRP B CE3 1  
ATOM 8145   C CZ2 . TRP B 2 591 ? -113.726 0.842   28.145  1.00 0.00 ? 591 TRP B CZ2 1  
ATOM 8146   C CZ3 . TRP B 2 591 ? -114.136 -1.102  26.777  1.00 0.00 ? 591 TRP B CZ3 1  
ATOM 8147   C CH2 . TRP B 2 591 ? -114.588 0.118   27.343  1.00 0.00 ? 591 TRP B CH2 1  
ATOM 8148   N N   . ARG B 2 592 ? -112.275 -4.537  28.430  1.00 0.00 ? 592 ARG B N   1  
ATOM 8149   C CA  . ARG B 2 592 ? -113.680 -4.802  28.610  1.00 0.00 ? 592 ARG B CA  1  
ATOM 8150   C C   . ARG B 2 592 ? -114.036 -5.716  29.802  1.00 0.00 ? 592 ARG B C   1  
ATOM 8151   O O   . ARG B 2 592 ? -115.003 -5.491  30.506  1.00 0.00 ? 592 ARG B O   1  
ATOM 8152   C CB  . ARG B 2 592 ? -114.365 -5.269  27.310  1.00 0.00 ? 592 ARG B CB  1  
ATOM 8153   C CG  . ARG B 2 592 ? -114.199 -6.778  26.927  1.00 0.00 ? 592 ARG B CG  1  
ATOM 8154   C CD  . ARG B 2 592 ? -114.666 -7.040  25.455  1.00 0.00 ? 592 ARG B CD  1  
ATOM 8155   N NE  . ARG B 2 592 ? -113.806 -6.175  24.561  1.00 0.00 ? 592 ARG B NE  1  
ATOM 8156   C CZ  . ARG B 2 592 ? -113.777 -6.220  23.196  1.00 0.00 ? 592 ARG B CZ  1  
ATOM 8157   N NH1 . ARG B 2 592 ? -114.462 -7.213  22.477  1.00 0.00 ? 592 ARG B NH1 1  
ATOM 8158   N NH2 . ARG B 2 592 ? -112.970 -5.332  22.547  1.00 0.00 ? 592 ARG B NH2 1  
ATOM 8159   N N   . PHE B 2 593 ? -113.162 -6.740  29.987  1.00 0.00 ? 593 PHE B N   1  
ATOM 8160   C CA  . PHE B 2 593 ? -113.202 -7.665  31.096  1.00 0.00 ? 593 PHE B CA  1  
ATOM 8161   C C   . PHE B 2 593 ? -113.024 -6.953  32.406  1.00 0.00 ? 593 PHE B C   1  
ATOM 8162   O O   . PHE B 2 593 ? -113.906 -7.080  33.309  1.00 0.00 ? 593 PHE B O   1  
ATOM 8163   C CB  . PHE B 2 593 ? -112.100 -8.765  31.070  1.00 0.00 ? 593 PHE B CB  1  
ATOM 8164   C CG  . PHE B 2 593 ? -112.156 -9.567  29.830  1.00 0.00 ? 593 PHE B CG  1  
ATOM 8165   C CD1 . PHE B 2 593 ? -113.284 -9.762  29.047  1.00 0.00 ? 593 PHE B CD1 1  
ATOM 8166   C CD2 . PHE B 2 593 ? -111.007 -10.219 29.426  1.00 0.00 ? 593 PHE B CD2 1  
ATOM 8167   C CE1 . PHE B 2 593 ? -113.237 -10.546 27.859  1.00 0.00 ? 593 PHE B CE1 1  
ATOM 8168   C CE2 . PHE B 2 593 ? -110.946 -11.110 28.277  1.00 0.00 ? 593 PHE B CE2 1  
ATOM 8169   C CZ  . PHE B 2 593 ? -112.102 -11.267 27.515  1.00 0.00 ? 593 PHE B CZ  1  
ATOM 8170   N N   . LYS B 2 594 ? -111.965 -6.000  32.538  1.00 0.00 ? 594 LYS B N   1  
ATOM 8171   C CA  . LYS B 2 594 ? -111.778 -5.144  33.676  1.00 0.00 ? 594 LYS B CA  1  
ATOM 8172   C C   . LYS B 2 594 ? -112.855 -4.182  33.923  1.00 0.00 ? 594 LYS B C   1  
ATOM 8173   O O   . LYS B 2 594 ? -113.227 -3.978  35.092  1.00 0.00 ? 594 LYS B O   1  
ATOM 8174   C CB  . LYS B 2 594 ? -110.524 -4.249  33.484  1.00 0.00 ? 594 LYS B CB  1  
ATOM 8175   C CG  . LYS B 2 594 ? -109.151 -5.010  33.317  1.00 0.00 ? 594 LYS B CG  1  
ATOM 8176   C CD  . LYS B 2 594 ? -108.763 -5.761  34.651  1.00 0.00 ? 594 LYS B CD  1  
ATOM 8177   C CE  . LYS B 2 594 ? -107.339 -6.294  34.506  1.00 0.00 ? 594 LYS B CE  1  
ATOM 8178   N NZ  . LYS B 2 594 ? -106.806 -6.994  35.708  1.00 0.00 ? 594 LYS B NZ  1  
ATOM 8179   N N   . LYS B 2 595 ? -113.438 -3.596  32.935  1.00 0.00 ? 595 LYS B N   1  
ATOM 8180   C CA  . LYS B 2 595 ? -114.528 -2.687  33.097  1.00 0.00 ? 595 LYS B CA  1  
ATOM 8181   C C   . LYS B 2 595 ? -115.735 -3.330  33.656  1.00 0.00 ? 595 LYS B C   1  
ATOM 8182   O O   . LYS B 2 595 ? -116.293 -2.830  34.687  1.00 0.00 ? 595 LYS B O   1  
ATOM 8183   C CB  . LYS B 2 595 ? -114.811 -2.097  31.675  1.00 0.00 ? 595 LYS B CB  1  
ATOM 8184   C CG  . LYS B 2 595 ? -116.038 -1.242  31.666  1.00 0.00 ? 595 LYS B CG  1  
ATOM 8185   C CD  . LYS B 2 595 ? -116.470 -0.640  30.291  1.00 0.00 ? 595 LYS B CD  1  
ATOM 8186   C CE  . LYS B 2 595 ? -117.510 -1.502  29.660  1.00 0.00 ? 595 LYS B CE  1  
ATOM 8187   N NZ  . LYS B 2 595 ? -116.960 -2.851  29.422  1.00 0.00 ? 595 LYS B NZ  1  
ATOM 8188   N N   . ASN B 2 596 ? -116.117 -4.487  33.138  1.00 0.00 ? 596 ASN B N   1  
ATOM 8189   C CA  . ASN B 2 596 ? -117.202 -5.296  33.690  1.00 0.00 ? 596 ASN B CA  1  
ATOM 8190   C C   . ASN B 2 596 ? -116.845 -5.753  35.102  1.00 0.00 ? 596 ASN B C   1  
ATOM 8191   O O   . ASN B 2 596 ? -117.734 -5.758  35.938  1.00 0.00 ? 596 ASN B O   1  
ATOM 8192   C CB  . ASN B 2 596 ? -117.488 -6.437  32.686  1.00 0.00 ? 596 ASN B CB  1  
ATOM 8193   C CG  . ASN B 2 596 ? -117.996 -5.790  31.336  1.00 0.00 ? 596 ASN B CG  1  
ATOM 8194   O OD1 . ASN B 2 596 ? -118.442 -4.634  31.343  1.00 0.00 ? 596 ASN B OD1 1  
ATOM 8195   N ND2 . ASN B 2 596 ? -117.822 -6.589  30.285  1.00 0.00 ? 596 ASN B ND2 1  
ATOM 8196   N N   . ASN B 2 597 ? -115.596 -6.134  35.427  1.00 0.00 ? 597 ASN B N   1  
ATOM 8197   C CA  . ASN B 2 597 ? -115.169 -6.615  36.695  1.00 0.00 ? 597 ASN B CA  1  
ATOM 8198   C C   . ASN B 2 597 ? -115.336 -5.649  37.792  1.00 0.00 ? 597 ASN B C   1  
ATOM 8199   O O   . ASN B 2 597 ? -115.865 -5.975  38.859  1.00 0.00 ? 597 ASN B O   1  
ATOM 8200   C CB  . ASN B 2 597 ? -113.665 -7.081  36.616  1.00 0.00 ? 597 ASN B CB  1  
ATOM 8201   C CG  . ASN B 2 597 ? -113.192 -7.837  37.856  1.00 0.00 ? 597 ASN B CG  1  
ATOM 8202   O OD1 . ASN B 2 597 ? -112.472 -7.309  38.721  1.00 0.00 ? 597 ASN B OD1 1  
ATOM 8203   N ND2 . ASN B 2 597 ? -113.400 -9.163  37.900  1.00 0.00 ? 597 ASN B ND2 1  
ATOM 8204   N N   . TYR B 2 598 ? -114.972 -4.347  37.512  1.00 0.00 ? 598 TYR B N   1  
ATOM 8205   C CA  . TYR B 2 598 ? -115.160 -3.257  38.465  1.00 0.00 ? 598 TYR B CA  1  
ATOM 8206   C C   . TYR B 2 598 ? -116.631 -3.086  38.689  1.00 0.00 ? 598 TYR B C   1  
ATOM 8207   O O   . TYR B 2 598 ? -117.082 -2.883  39.793  1.00 0.00 ? 598 TYR B O   1  
ATOM 8208   C CB  . TYR B 2 598 ? -114.564 -1.907  37.982  1.00 0.00 ? 598 TYR B CB  1  
ATOM 8209   C CG  . TYR B 2 598 ? -114.634 -0.874  39.101  1.00 0.00 ? 598 TYR B CG  1  
ATOM 8210   C CD1 . TYR B 2 598 ? -113.817 -0.982  40.178  1.00 0.00 ? 598 TYR B CD1 1  
ATOM 8211   C CD2 . TYR B 2 598 ? -115.671 0.092   39.198  1.00 0.00 ? 598 TYR B CD2 1  
ATOM 8212   C CE1 . TYR B 2 598 ? -113.982 -0.287  41.322  1.00 0.00 ? 598 TYR B CE1 1  
ATOM 8213   C CE2 . TYR B 2 598 ? -115.936 0.828   40.364  1.00 0.00 ? 598 TYR B CE2 1  
ATOM 8214   C CZ  . TYR B 2 598 ? -115.106 0.589   41.469  1.00 0.00 ? 598 TYR B CZ  1  
ATOM 8215   O OH  . TYR B 2 598 ? -115.455 1.220   42.660  1.00 0.00 ? 598 TYR B OH  1  
ATOM 8216   N N   . PHE B 2 599 ? -117.497 -3.138  37.562  1.00 0.00 ? 599 PHE B N   1  
ATOM 8217   C CA  . PHE B 2 599 ? -118.917 -2.930  37.741  1.00 0.00 ? 599 PHE B CA  1  
ATOM 8218   C C   . PHE B 2 599 ? -119.582 -3.993  38.623  1.00 0.00 ? 599 PHE B C   1  
ATOM 8219   O O   . PHE B 2 599 ? -120.279 -3.646  39.519  1.00 0.00 ? 599 PHE B O   1  
ATOM 8220   C CB  . PHE B 2 599 ? -119.658 -3.061  36.393  1.00 0.00 ? 599 PHE B CB  1  
ATOM 8221   C CG  . PHE B 2 599 ? -119.308 -2.010  35.285  1.00 0.00 ? 599 PHE B CG  1  
ATOM 8222   C CD1 . PHE B 2 599 ? -118.748 -0.750  35.552  1.00 0.00 ? 599 PHE B CD1 1  
ATOM 8223   C CD2 . PHE B 2 599 ? -119.774 -2.365  34.029  1.00 0.00 ? 599 PHE B CD2 1  
ATOM 8224   C CE1 . PHE B 2 599 ? -118.640 0.209   34.531  1.00 0.00 ? 599 PHE B CE1 1  
ATOM 8225   C CE2 . PHE B 2 599 ? -119.803 -1.386  33.010  1.00 0.00 ? 599 PHE B CE2 1  
ATOM 8226   C CZ  . PHE B 2 599 ? -119.265 -0.065  33.260  1.00 0.00 ? 599 PHE B CZ  1  
ATOM 8227   N N   . TYR B 2 600 ? -119.158 -5.307  38.385  1.00 0.00 ? 600 TYR B N   1  
ATOM 8228   C CA  . TYR B 2 600 ? -119.605 -6.425  39.169  1.00 0.00 ? 600 TYR B CA  1  
ATOM 8229   C C   . TYR B 2 600 ? -119.170 -6.228  40.637  1.00 0.00 ? 600 TYR B C   1  
ATOM 8230   O O   . TYR B 2 600 ? -120.027 -6.278  41.492  1.00 0.00 ? 600 TYR B O   1  
ATOM 8231   C CB  . TYR B 2 600 ? -118.919 -7.598  38.502  1.00 0.00 ? 600 TYR B CB  1  
ATOM 8232   C CG  . TYR B 2 600 ? -119.945 -8.538  37.931  1.00 0.00 ? 600 TYR B CG  1  
ATOM 8233   C CD1 . TYR B 2 600 ? -120.639 -9.481  38.797  1.00 0.00 ? 600 TYR B CD1 1  
ATOM 8234   C CD2 . TYR B 2 600 ? -120.120 -8.642  36.561  1.00 0.00 ? 600 TYR B CD2 1  
ATOM 8235   C CE1 . TYR B 2 600 ? -121.410 -10.556 38.244  1.00 0.00 ? 600 TYR B CE1 1  
ATOM 8236   C CE2 . TYR B 2 600 ? -120.989 -9.693  36.070  1.00 0.00 ? 600 TYR B CE2 1  
ATOM 8237   C CZ  . TYR B 2 600 ? -121.661 -10.644 36.857  1.00 0.00 ? 600 TYR B CZ  1  
ATOM 8238   O OH  . TYR B 2 600 ? -122.478 -11.654 36.371  1.00 0.00 ? 600 TYR B OH  1  
ATOM 8239   N N   . GLN B 2 601 ? -117.918 -5.853  41.020  1.00 0.00 ? 601 GLN B N   1  
ATOM 8240   C CA  . GLN B 2 601 ? -117.657 -5.569  42.394  1.00 0.00 ? 601 GLN B CA  1  
ATOM 8241   C C   . GLN B 2 601 ? -118.463 -4.436  42.907  1.00 0.00 ? 601 GLN B C   1  
ATOM 8242   O O   . GLN B 2 601 ? -118.850 -4.523  44.107  1.00 0.00 ? 601 GLN B O   1  
ATOM 8243   C CB  . GLN B 2 601 ? -116.223 -5.093  42.758  1.00 0.00 ? 601 GLN B CB  1  
ATOM 8244   C CG  . GLN B 2 601 ? -115.128 -6.046  42.304  1.00 0.00 ? 601 GLN B CG  1  
ATOM 8245   C CD  . GLN B 2 601 ? -115.325 -7.450  42.748  1.00 0.00 ? 601 GLN B CD  1  
ATOM 8246   O OE1 . GLN B 2 601 ? -116.046 -7.715  43.716  1.00 0.00 ? 601 GLN B OE1 1  
ATOM 8247   N NE2 . GLN B 2 601 ? -114.519 -8.394  42.137  1.00 0.00 ? 601 GLN B NE2 1  
ATOM 8248   N N   . LYS B 2 602 ? -118.645 -3.388  42.135  1.00 0.00 ? 602 LYS B N   1  
ATOM 8249   C CA  . LYS B 2 602 ? -119.353 -2.202  42.640  1.00 0.00 ? 602 LYS B CA  1  
ATOM 8250   C C   . LYS B 2 602 ? -120.773 -2.522  42.982  1.00 0.00 ? 602 LYS B C   1  
ATOM 8251   O O   . LYS B 2 602 ? -121.342 -2.152  43.995  1.00 0.00 ? 602 LYS B O   1  
ATOM 8252   C CB  . LYS B 2 602 ? -119.256 -1.128  41.568  1.00 0.00 ? 602 LYS B CB  1  
ATOM 8253   C CG  . LYS B 2 602 ? -120.141 0.114   41.798  1.00 0.00 ? 602 LYS B CG  1  
ATOM 8254   C CD  . LYS B 2 602 ? -120.244 0.966   40.514  1.00 0.00 ? 602 LYS B CD  1  
ATOM 8255   C CE  . LYS B 2 602 ? -121.390 2.030   40.477  1.00 0.00 ? 602 LYS B CE  1  
ATOM 8256   N NZ  . LYS B 2 602 ? -121.443 2.724   39.167  1.00 0.00 ? 602 LYS B NZ  1  
ATOM 8257   N N   . GLU B 2 603 ? -121.419 -3.295  42.100  1.00 0.00 ? 603 GLU B N   1  
ATOM 8258   C CA  . GLU B 2 603 ? -122.815 -3.649  42.172  1.00 0.00 ? 603 GLU B CA  1  
ATOM 8259   C C   . GLU B 2 603 ? -123.097 -4.430  43.440  1.00 0.00 ? 603 GLU B C   1  
ATOM 8260   O O   . GLU B 2 603 ? -124.089 -4.241  44.139  1.00 0.00 ? 603 GLU B O   1  
ATOM 8261   C CB  . GLU B 2 603 ? -123.326 -4.436  40.885  1.00 0.00 ? 603 GLU B CB  1  
ATOM 8262   C CG  . GLU B 2 603 ? -123.511 -3.419  39.697  1.00 0.00 ? 603 GLU B CG  1  
ATOM 8263   C CD  . GLU B 2 603 ? -123.976 -4.216  38.448  1.00 0.00 ? 603 GLU B CD  1  
ATOM 8264   O OE1 . GLU B 2 603 ? -125.006 -4.930  38.521  1.00 0.00 ? 603 GLU B OE1 1  
ATOM 8265   O OE2 . GLU B 2 603 ? -123.207 -4.170  37.457  1.00 0.00 ? 603 GLU B OE2 1  
ATOM 8266   N N   . MET B 2 604 ? -122.196 -5.437  43.678  1.00 0.00 ? 604 MET B N   1  
ATOM 8267   C CA  . MET B 2 604 ? -122.315 -6.352  44.758  1.00 0.00 ? 604 MET B CA  1  
ATOM 8268   C C   . MET B 2 604 ? -122.171 -5.611  46.116  1.00 0.00 ? 604 MET B C   1  
ATOM 8269   O O   . MET B 2 604 ? -122.886 -5.769  47.073  1.00 0.00 ? 604 MET B O   1  
ATOM 8270   C CB  . MET B 2 604 ? -121.384 -7.601  44.634  1.00 0.00 ? 604 MET B CB  1  
ATOM 8271   C CG  . MET B 2 604 ? -121.864 -8.779  43.805  1.00 0.00 ? 604 MET B CG  1  
ATOM 8272   S SD  . MET B 2 604 ? -122.043 -8.371  42.046  1.00 0.00 ? 604 MET B SD  1  
ATOM 8273   C CE  . MET B 2 604 ? -123.749 -7.967  41.666  1.00 0.00 ? 604 MET B CE  1  
ATOM 8274   N N   . LEU B 2 605 ? -121.133 -4.701  46.192  1.00 0.00 ? 605 LEU B N   1  
ATOM 8275   C CA  . LEU B 2 605 ? -120.736 -4.019  47.376  1.00 0.00 ? 605 LEU B CA  1  
ATOM 8276   C C   . LEU B 2 605 ? -121.886 -3.158  47.881  1.00 0.00 ? 605 LEU B C   1  
ATOM 8277   O O   . LEU B 2 605 ? -122.154 -3.070  49.088  1.00 0.00 ? 605 LEU B O   1  
ATOM 8278   C CB  . LEU B 2 605 ? -119.426 -3.111  47.245  1.00 0.00 ? 605 LEU B CB  1  
ATOM 8279   C CG  . LEU B 2 605 ? -118.124 -3.929  47.475  1.00 0.00 ? 605 LEU B CG  1  
ATOM 8280   C CD1 . LEU B 2 605 ? -116.851 -3.210  46.791  1.00 0.00 ? 605 LEU B CD1 1  
ATOM 8281   C CD2 . LEU B 2 605 ? -117.746 -3.958  48.971  1.00 0.00 ? 605 LEU B CD2 1  
ATOM 8282   N N   . LYS B 2 606 ? -122.577 -2.465  46.876  1.00 0.00 ? 606 LYS B N   1  
ATOM 8283   C CA  . LYS B 2 606 ? -123.644 -1.482  47.106  1.00 0.00 ? 606 LYS B CA  1  
ATOM 8284   C C   . LYS B 2 606 ? -124.767 -2.218  47.855  1.00 0.00 ? 606 LYS B C   1  
ATOM 8285   O O   . LYS B 2 606 ? -125.432 -1.752  48.776  1.00 0.00 ? 606 LYS B O   1  
ATOM 8286   C CB  . LYS B 2 606 ? -124.210 -0.817  45.916  1.00 0.00 ? 606 LYS B CB  1  
ATOM 8287   C CG  . LYS B 2 606 ? -125.258 0.287   46.060  1.00 0.00 ? 606 LYS B CG  1  
ATOM 8288   C CD  . LYS B 2 606 ? -124.673 1.608   46.608  1.00 0.00 ? 606 LYS B CD  1  
ATOM 8289   C CE  . LYS B 2 606 ? -125.749 2.695   46.671  1.00 0.00 ? 606 LYS B CE  1  
ATOM 8290   N NZ  . LYS B 2 606 ? -125.141 3.952   46.540  1.00 0.00 ? 606 LYS B NZ  1  
ATOM 8291   N N   . SER B 2 607 ? -125.044 -3.528  47.405  1.00 0.00 ? 607 SER B N   1  
ATOM 8292   C CA  . SER B 2 607 ? -126.092 -4.390  47.872  1.00 0.00 ? 607 SER B CA  1  
ATOM 8293   C C   . SER B 2 607 ? -125.956 -4.933  49.289  1.00 0.00 ? 607 SER B C   1  
ATOM 8294   O O   . SER B 2 607 ? -126.919 -5.249  50.006  1.00 0.00 ? 607 SER B O   1  
ATOM 8295   C CB  . SER B 2 607 ? -126.182 -5.659  47.045  1.00 0.00 ? 607 SER B CB  1  
ATOM 8296   O OG  . SER B 2 607 ? -126.414 -5.260  45.682  1.00 0.00 ? 607 SER B OG  1  
ATOM 8297   N N   . ASN B 2 608 ? -124.661 -5.019  49.698  1.00 0.00 ? 608 ASN B N   1  
ATOM 8298   C CA  . ASN B 2 608 ? -124.298 -5.509  51.027  1.00 0.00 ? 608 ASN B CA  1  
ATOM 8299   C C   . ASN B 2 608 ? -124.800 -4.480  52.003  1.00 0.00 ? 608 ASN B C   1  
ATOM 8300   O O   . ASN B 2 608 ? -125.159 -4.933  53.098  1.00 0.00 ? 608 ASN B O   1  
ATOM 8301   C CB  . ASN B 2 608 ? -122.819 -5.751  51.148  1.00 0.00 ? 608 ASN B CB  1  
ATOM 8302   C CG  . ASN B 2 608 ? -122.518 -6.967  50.234  1.00 0.00 ? 608 ASN B CG  1  
ATOM 8303   O OD1 . ASN B 2 608 ? -123.443 -7.724  49.925  1.00 0.00 ? 608 ASN B OD1 1  
ATOM 8304   N ND2 . ASN B 2 608 ? -121.228 -7.104  49.768  1.00 0.00 ? 608 ASN B ND2 1  
ATOM 8305   N N   . ASP B 2 609 ? -124.936 -3.183  51.591  1.00 0.00 ? 609 ASP B N   1  
ATOM 8306   C CA  . ASP B 2 609 ? -125.472 -2.107  52.307  1.00 0.00 ? 609 ASP B CA  1  
ATOM 8307   C C   . ASP B 2 609 ? -126.905 -2.425  52.829  1.00 0.00 ? 609 ASP B C   1  
ATOM 8308   O O   . ASP B 2 609 ? -127.155 -2.230  54.056  1.00 0.00 ? 609 ASP B O   1  
ATOM 8309   C CB  . ASP B 2 609 ? -125.491 -0.738  51.633  1.00 0.00 ? 609 ASP B CB  1  
ATOM 8310   C CG  . ASP B 2 609 ? -124.209 -0.084  51.170  1.00 0.00 ? 609 ASP B CG  1  
ATOM 8311   O OD1 . ASP B 2 609 ? -123.222 -0.172  51.956  1.00 0.00 ? 609 ASP B OD1 1  
ATOM 8312   O OD2 . ASP B 2 609 ? -124.176 0.523   50.117  1.00 0.00 ? 609 ASP B OD2 1  
ATOM 8313   N N   . ILE B 2 610 ? -127.772 -3.047  51.943  1.00 0.00 ? 610 ILE B N   1  
ATOM 8314   C CA  . ILE B 2 610 ? -129.129 -3.529  52.102  1.00 0.00 ? 610 ILE B CA  1  
ATOM 8315   C C   . ILE B 2 610 ? -129.962 -3.012  50.933  1.00 0.00 ? 610 ILE B C   1  
ATOM 8316   O O   . ILE B 2 610 ? -131.033 -3.537  50.668  1.00 0.00 ? 610 ILE B O   1  
ATOM 8317   C CB  . ILE B 2 610 ? -129.842 -3.182  53.424  1.00 0.00 ? 610 ILE B CB  1  
ATOM 8318   C CG1 . ILE B 2 610 ? -131.114 -4.004  53.492  1.00 0.00 ? 610 ILE B CG1 1  
ATOM 8319   C CG2 . ILE B 2 610 ? -130.076 -1.660  53.664  1.00 0.00 ? 610 ILE B CG2 1  
ATOM 8320   C CD1 . ILE B 2 610 ? -131.946 -3.769  54.764  1.00 0.00 ? 610 ILE B CD1 1  
ATOM 8321   N N   . ILE B 2 611 ? -129.446 -2.027  50.138  1.00 0.00 ? 611 ILE B N   1  
ATOM 8322   C CA  . ILE B 2 611 ? -130.198 -1.647  48.960  1.00 0.00 ? 611 ILE B CA  1  
ATOM 8323   C C   . ILE B 2 611 ? -129.277 -1.233  47.810  1.00 0.00 ? 611 ILE B C   1  
ATOM 8324   O O   . ILE B 2 611 ? -128.189 -0.706  47.952  1.00 0.00 ? 611 ILE B O   1  
ATOM 8325   C CB  . ILE B 2 611 ? -131.166 -0.496  49.303  1.00 0.00 ? 611 ILE B CB  1  
ATOM 8326   C CG1 . ILE B 2 611 ? -132.255 -0.229  48.204  1.00 0.00 ? 611 ILE B CG1 1  
ATOM 8327   C CG2 . ILE B 2 611 ? -130.346 0.763   49.860  1.00 0.00 ? 611 ILE B CG2 1  
ATOM 8328   C CD1 . ILE B 2 611 ? -133.222 0.918   48.544  1.00 0.00 ? 611 ILE B CD1 1  
ATOM 8329   N N   . ARG B 2 612 ? -129.836 -1.469  46.605  1.00 0.00 ? 612 ARG B N   1  
ATOM 8330   C CA  . ARG B 2 612 ? -129.365 -1.127  45.328  1.00 0.00 ? 612 ARG B CA  1  
ATOM 8331   C C   . ARG B 2 612 ? -128.274 -2.132  44.928  1.00 0.00 ? 612 ARG B C   1  
ATOM 8332   O O   . ARG B 2 612 ? -127.984 -3.047  45.744  1.00 0.00 ? 612 ARG B O   1  
ATOM 8333   C CB  . ARG B 2 612 ? -128.936 0.341   45.043  1.00 0.00 ? 612 ARG B CB  1  
ATOM 8334   C CG  . ARG B 2 612 ? -128.380 0.536   43.607  1.00 0.00 ? 612 ARG B CG  1  
ATOM 8335   C CD  . ARG B 2 612 ? -128.205 2.023   43.202  1.00 0.00 ? 612 ARG B CD  1  
ATOM 8336   N NE  . ARG B 2 612 ? -127.667 2.077   41.757  1.00 0.00 ? 612 ARG B NE  1  
ATOM 8337   C CZ  . ARG B 2 612 ? -128.348 1.987   40.586  1.00 0.00 ? 612 ARG B CZ  1  
ATOM 8338   N NH1 . ARG B 2 612 ? -129.664 2.186   40.475  1.00 0.00 ? 612 ARG B NH1 1  
ATOM 8339   N NH2 . ARG B 2 612 ? -127.560 1.715   39.446  1.00 0.00 ? 612 ARG B NH2 1  
ATOM 8340   N N   . ILE B 2 628 ? -136.631 -9.995  55.290  1.00 0.00 ? 628 ILE B N   1  
ATOM 8341   C CA  . ILE B 2 628 ? -137.429 -11.217 54.963  1.00 0.00 ? 628 ILE B CA  1  
ATOM 8342   C C   . ILE B 2 628 ? -136.512 -12.169 54.248  1.00 0.00 ? 628 ILE B C   1  
ATOM 8343   O O   . ILE B 2 628 ? -135.297 -11.971 54.048  1.00 0.00 ? 628 ILE B O   1  
ATOM 8344   C CB  . ILE B 2 628 ? -138.695 -10.810 54.183  1.00 0.00 ? 628 ILE B CB  1  
ATOM 8345   C CG1 . ILE B 2 628 ? -139.778 -11.909 54.224  1.00 0.00 ? 628 ILE B CG1 1  
ATOM 8346   C CG2 . ILE B 2 628 ? -138.451 -10.408 52.703  1.00 0.00 ? 628 ILE B CG2 1  
ATOM 8347   C CD1 . ILE B 2 628 ? -141.064 -11.552 53.459  1.00 0.00 ? 628 ILE B CD1 1  
ATOM 8348   N N   . ASN B 2 629 ? -137.118 -13.318 53.905  1.00 0.00 ? 629 ASN B N   1  
ATOM 8349   C CA  . ASN B 2 629 ? -136.484 -14.511 53.296  1.00 0.00 ? 629 ASN B CA  1  
ATOM 8350   C C   . ASN B 2 629 ? -135.918 -14.179 51.869  1.00 0.00 ? 629 ASN B C   1  
ATOM 8351   O O   . ASN B 2 629 ? -134.832 -14.660 51.540  1.00 0.00 ? 629 ASN B O   1  
ATOM 8352   C CB  . ASN B 2 629 ? -137.460 -15.698 53.155  1.00 0.00 ? 629 ASN B CB  1  
ATOM 8353   C CG  . ASN B 2 629 ? -138.262 -15.831 54.477  1.00 0.00 ? 629 ASN B CG  1  
ATOM 8354   O OD1 . ASN B 2 629 ? -137.736 -16.259 55.484  1.00 0.00 ? 629 ASN B OD1 1  
ATOM 8355   N ND2 . ASN B 2 629 ? -139.486 -15.318 54.433  1.00 0.00 ? 629 ASN B ND2 1  
ATOM 8356   N N   . LYS B 2 630 ? -136.640 -13.273 51.137  1.00 0.00 ? 630 LYS B N   1  
ATOM 8357   C CA  . LYS B 2 630 ? -136.311 -12.814 49.844  1.00 0.00 ? 630 LYS B CA  1  
ATOM 8358   C C   . LYS B 2 630 ? -134.939 -12.214 49.825  1.00 0.00 ? 630 LYS B C   1  
ATOM 8359   O O   . LYS B 2 630 ? -134.204 -12.450 48.852  1.00 0.00 ? 630 LYS B O   1  
ATOM 8360   C CB  . LYS B 2 630 ? -137.251 -11.721 49.351  1.00 0.00 ? 630 LYS B CB  1  
ATOM 8361   C CG  . LYS B 2 630 ? -138.831 -11.994 49.298  1.00 0.00 ? 630 LYS B CG  1  
ATOM 8362   C CD  . LYS B 2 630 ? -139.104 -13.089 48.344  1.00 0.00 ? 630 LYS B CD  1  
ATOM 8363   C CE  . LYS B 2 630 ? -140.660 -13.324 48.120  1.00 0.00 ? 630 LYS B CE  1  
ATOM 8364   N NZ  . LYS B 2 630 ? -141.248 -12.107 47.597  1.00 0.00 ? 630 LYS B NZ  1  
ATOM 8365   N N   . LEU B 2 631 ? -134.561 -11.508 50.910  1.00 0.00 ? 631 LEU B N   1  
ATOM 8366   C CA  . LEU B 2 631 ? -133.269 -10.885 51.007  1.00 0.00 ? 631 LEU B CA  1  
ATOM 8367   C C   . LEU B 2 631 ? -132.107 -11.905 50.918  1.00 0.00 ? 631 LEU B C   1  
ATOM 8368   O O   . LEU B 2 631 ? -131.134 -11.712 50.189  1.00 0.00 ? 631 LEU B O   1  
ATOM 8369   C CB  . LEU B 2 631 ? -132.978 -10.153 52.332  1.00 0.00 ? 631 LEU B CB  1  
ATOM 8370   C CG  . LEU B 2 631 ? -133.914 -8.902  52.445  1.00 0.00 ? 631 LEU B CG  1  
ATOM 8371   C CD1 . LEU B 2 631 ? -133.693 -8.113  53.781  1.00 0.00 ? 631 LEU B CD1 1  
ATOM 8372   C CD2 . LEU B 2 631 ? -133.646 -7.803  51.350  1.00 0.00 ? 631 LEU B CD2 1  
ATOM 8373   N N   . SER B 2 632 ? -132.255 -13.061 51.653  1.00 0.00 ? 632 SER B N   1  
ATOM 8374   C CA  . SER B 2 632 ? -131.251 -14.072 51.597  1.00 0.00 ? 632 SER B CA  1  
ATOM 8375   C C   . SER B 2 632 ? -131.198 -14.721 50.286  1.00 0.00 ? 632 SER B C   1  
ATOM 8376   O O   . SER B 2 632 ? -130.147 -15.169 49.897  1.00 0.00 ? 632 SER B O   1  
ATOM 8377   C CB  . SER B 2 632 ? -131.449 -15.244 52.606  1.00 0.00 ? 632 SER B CB  1  
ATOM 8378   O OG  . SER B 2 632 ? -131.595 -14.734 53.852  1.00 0.00 ? 632 SER B OG  1  
ATOM 8379   N N   . ARG B 2 633 ? -132.395 -14.889 49.655  1.00 0.00 ? 633 ARG B N   1  
ATOM 8380   C CA  . ARG B 2 633 ? -132.407 -15.581 48.378  1.00 0.00 ? 633 ARG B CA  1  
ATOM 8381   C C   . ARG B 2 633 ? -131.603 -14.842 47.257  1.00 0.00 ? 633 ARG B C   1  
ATOM 8382   O O   . ARG B 2 633 ? -130.727 -15.447 46.640  1.00 0.00 ? 633 ARG B O   1  
ATOM 8383   C CB  . ARG B 2 633 ? -133.928 -15.681 47.828  1.00 0.00 ? 633 ARG B CB  1  
ATOM 8384   C CG  . ARG B 2 633 ? -134.094 -16.578 46.666  1.00 0.00 ? 633 ARG B CG  1  
ATOM 8385   C CD  . ARG B 2 633 ? -133.550 -18.059 46.673  1.00 0.00 ? 633 ARG B CD  1  
ATOM 8386   N NE  . ARG B 2 633 ? -134.324 -18.780 47.741  1.00 0.00 ? 633 ARG B NE  1  
ATOM 8387   C CZ  . ARG B 2 633 ? -135.346 -19.645 47.516  1.00 0.00 ? 633 ARG B CZ  1  
ATOM 8388   N NH1 . ARG B 2 633 ? -135.811 -19.854 46.228  1.00 0.00 ? 633 ARG B NH1 1  
ATOM 8389   N NH2 . ARG B 2 633 ? -135.927 -20.316 48.624  1.00 0.00 ? 633 ARG B NH2 1  
ATOM 8390   N N   . ILE B 2 634 ? -131.835 -13.498 47.150  1.00 0.00 ? 634 ILE B N   1  
ATOM 8391   C CA  . ILE B 2 634 ? -131.061 -12.725 46.243  1.00 0.00 ? 634 ILE B CA  1  
ATOM 8392   C C   . ILE B 2 634 ? -129.589 -12.729 46.579  1.00 0.00 ? 634 ILE B C   1  
ATOM 8393   O O   . ILE B 2 634 ? -128.803 -12.726 45.667  1.00 0.00 ? 634 ILE B O   1  
ATOM 8394   C CB  . ILE B 2 634 ? -131.682 -11.316 45.910  1.00 0.00 ? 634 ILE B CB  1  
ATOM 8395   C CG1 . ILE B 2 634 ? -130.937 -10.613 44.718  1.00 0.00 ? 634 ILE B CG1 1  
ATOM 8396   C CG2 . ILE B 2 634 ? -131.736 -10.433 47.211  1.00 0.00 ? 634 ILE B CG2 1  
ATOM 8397   C CD1 . ILE B 2 634 ? -131.504 -9.231  44.351  1.00 0.00 ? 634 ILE B CD1 1  
ATOM 8398   N N   . SER B 2 635 ? -129.200 -12.657 47.899  1.00 0.00 ? 635 SER B N   1  
ATOM 8399   C CA  . SER B 2 635 ? -127.819 -12.447 48.297  1.00 0.00 ? 635 SER B CA  1  
ATOM 8400   C C   . SER B 2 635 ? -126.933 -13.624 47.850  1.00 0.00 ? 635 SER B C   1  
ATOM 8401   O O   . SER B 2 635 ? -125.848 -13.389 47.342  1.00 0.00 ? 635 SER B O   1  
ATOM 8402   C CB  . SER B 2 635 ? -127.640 -12.170 49.816  1.00 0.00 ? 635 SER B CB  1  
ATOM 8403   O OG  . SER B 2 635 ? -128.107 -13.148 50.678  1.00 0.00 ? 635 SER B OG  1  
ATOM 8404   N N   . ILE B 2 636 ? -127.436 -14.899 47.975  1.00 0.00 ? 636 ILE B N   1  
ATOM 8405   C CA  . ILE B 2 636 ? -126.711 -16.086 47.552  1.00 0.00 ? 636 ILE B CA  1  
ATOM 8406   C C   . ILE B 2 636 ? -126.629 -16.020 45.999  1.00 0.00 ? 636 ILE B C   1  
ATOM 8407   O O   . ILE B 2 636 ? -125.603 -16.311 45.413  1.00 0.00 ? 636 ILE B O   1  
ATOM 8408   C CB  . ILE B 2 636 ? -127.444 -17.329 47.964  1.00 0.00 ? 636 ILE B CB  1  
ATOM 8409   C CG1 . ILE B 2 636 ? -127.314 -17.472 49.550  1.00 0.00 ? 636 ILE B CG1 1  
ATOM 8410   C CG2 . ILE B 2 636 ? -126.963 -18.629 47.316  1.00 0.00 ? 636 ILE B CG2 1  
ATOM 8411   C CD1 . ILE B 2 636 ? -128.020 -18.710 50.129  1.00 0.00 ? 636 ILE B CD1 1  
ATOM 8412   N N   . LEU B 2 637 ? -127.744 -15.673 45.235  1.00 0.00 ? 637 LEU B N   1  
ATOM 8413   C CA  . LEU B 2 637 ? -127.753 -15.734 43.814  1.00 0.00 ? 637 LEU B CA  1  
ATOM 8414   C C   . LEU B 2 637 ? -126.706 -14.806 43.270  1.00 0.00 ? 637 LEU B C   1  
ATOM 8415   O O   . LEU B 2 637 ? -125.944 -15.219 42.397  1.00 0.00 ? 637 LEU B O   1  
ATOM 8416   C CB  . LEU B 2 637 ? -129.121 -15.315 43.334  1.00 0.00 ? 637 LEU B CB  1  
ATOM 8417   C CG  . LEU B 2 637 ? -130.083 -16.515 43.080  1.00 0.00 ? 637 LEU B CG  1  
ATOM 8418   C CD1 . LEU B 2 637 ? -130.176 -17.641 44.182  1.00 0.00 ? 637 LEU B CD1 1  
ATOM 8419   C CD2 . LEU B 2 637 ? -131.504 -16.133 42.595  1.00 0.00 ? 637 LEU B CD2 1  
ATOM 8420   N N   . ARG B 2 638 ? -126.609 -13.508 43.829  1.00 0.00 ? 638 ARG B N   1  
ATOM 8421   C CA  . ARG B 2 638 ? -125.701 -12.563 43.347  1.00 0.00 ? 638 ARG B CA  1  
ATOM 8422   C C   . ARG B 2 638 ? -124.259 -13.019 43.451  1.00 0.00 ? 638 ARG B C   1  
ATOM 8423   O O   . ARG B 2 638 ? -123.466 -12.934 42.523  1.00 0.00 ? 638 ARG B O   1  
ATOM 8424   C CB  . ARG B 2 638 ? -125.935 -11.387 44.207  1.00 0.00 ? 638 ARG B CB  1  
ATOM 8425   C CG  . ARG B 2 638 ? -125.361 -9.999  43.873  1.00 0.00 ? 638 ARG B CG  1  
ATOM 8426   C CD  . ARG B 2 638 ? -125.616 -9.028  45.074  1.00 0.00 ? 638 ARG B CD  1  
ATOM 8427   N NE  . ARG B 2 638 ? -124.674 -9.500  46.209  1.00 0.00 ? 638 ARG B NE  1  
ATOM 8428   C CZ  . ARG B 2 638 ? -125.131 -9.663  47.500  1.00 0.00 ? 638 ARG B CZ  1  
ATOM 8429   N NH1 . ARG B 2 638 ? -126.353 -9.241  47.904  1.00 0.00 ? 638 ARG B NH1 1  
ATOM 8430   N NH2 . ARG B 2 638 ? -124.339 -10.344 48.335  1.00 0.00 ? 638 ARG B NH2 1  
ATOM 8431   N N   . THR B 2 639 ? -123.898 -13.580 44.564  1.00 0.00 ? 639 THR B N   1  
ATOM 8432   C CA  . THR B 2 639 ? -122.558 -14.029 44.897  1.00 0.00 ? 639 THR B CA  1  
ATOM 8433   C C   . THR B 2 639 ? -122.135 -15.132 44.006  1.00 0.00 ? 639 THR B C   1  
ATOM 8434   O O   . THR B 2 639 ? -121.020 -15.098 43.600  1.00 0.00 ? 639 THR B O   1  
ATOM 8435   C CB  . THR B 2 639 ? -122.459 -14.465 46.358  1.00 0.00 ? 639 THR B CB  1  
ATOM 8436   O OG1 . THR B 2 639 ? -123.123 -13.479 47.123  1.00 0.00 ? 639 THR B OG1 1  
ATOM 8437   C CG2 . THR B 2 639 ? -120.963 -14.509 46.742  1.00 0.00 ? 639 THR B CG2 1  
ATOM 8438   N N   . GLN B 2 640 ? -123.044 -16.105 43.678  1.00 0.00 ? 640 GLN B N   1  
ATOM 8439   C CA  . GLN B 2 640 ? -122.738 -17.236 42.850  1.00 0.00 ? 640 GLN B CA  1  
ATOM 8440   C C   . GLN B 2 640 ? -122.416 -16.764 41.440  1.00 0.00 ? 640 GLN B C   1  
ATOM 8441   O O   . GLN B 2 640 ? -121.424 -17.223 40.837  1.00 0.00 ? 640 GLN B O   1  
ATOM 8442   C CB  . GLN B 2 640 ? -123.660 -18.441 43.009  1.00 0.00 ? 640 GLN B CB  1  
ATOM 8443   C CG  . GLN B 2 640 ? -125.113 -18.291 42.480  1.00 0.00 ? 640 GLN B CG  1  
ATOM 8444   C CD  . GLN B 2 640 ? -125.916 -19.590 42.233  1.00 0.00 ? 640 GLN B CD  1  
ATOM 8445   O OE1 . GLN B 2 640 ? -125.393 -20.573 41.695  1.00 0.00 ? 640 GLN B OE1 1  
ATOM 8446   N NE2 . GLN B 2 640 ? -127.158 -19.560 42.851  1.00 0.00 ? 640 GLN B NE2 1  
ATOM 8447   N N   . PHE B 2 641 ? -123.225 -15.821 40.953  1.00 0.00 ? 641 PHE B N   1  
ATOM 8448   C CA  . PHE B 2 641 ? -123.012 -15.351 39.613  1.00 0.00 ? 641 PHE B CA  1  
ATOM 8449   C C   . PHE B 2 641 ? -121.623 -14.689 39.457  1.00 0.00 ? 641 PHE B C   1  
ATOM 8450   O O   . PHE B 2 641 ? -120.912 -14.991 38.483  1.00 0.00 ? 641 PHE B O   1  
ATOM 8451   C CB  . PHE B 2 641 ? -124.135 -14.297 39.297  1.00 0.00 ? 641 PHE B CB  1  
ATOM 8452   C CG  . PHE B 2 641 ? -124.749 -14.219 38.037  1.00 0.00 ? 641 PHE B CG  1  
ATOM 8453   C CD1 . PHE B 2 641 ? -124.951 -15.336 37.207  1.00 0.00 ? 641 PHE B CD1 1  
ATOM 8454   C CD2 . PHE B 2 641 ? -125.284 -12.983 37.709  1.00 0.00 ? 641 PHE B CD2 1  
ATOM 8455   C CE1 . PHE B 2 641 ? -125.665 -15.161 36.011  1.00 0.00 ? 641 PHE B CE1 1  
ATOM 8456   C CE2 . PHE B 2 641 ? -126.051 -12.790 36.530  1.00 0.00 ? 641 PHE B CE2 1  
ATOM 8457   C CZ  . PHE B 2 641 ? -126.223 -13.929 35.704  1.00 0.00 ? 641 PHE B CZ  1  
ATOM 8458   N N   . GLN B 2 642 ? -121.214 -13.927 40.445  1.00 0.00 ? 642 GLN B N   1  
ATOM 8459   C CA  . GLN B 2 642 ? -119.958 -13.275 40.522  1.00 0.00 ? 642 GLN B CA  1  
ATOM 8460   C C   . GLN B 2 642 ? -118.815 -14.231 40.635  1.00 0.00 ? 642 GLN B C   1  
ATOM 8461   O O   . GLN B 2 642 ? -117.692 -13.997 40.155  1.00 0.00 ? 642 GLN B O   1  
ATOM 8462   C CB  . GLN B 2 642 ? -119.895 -12.254 41.735  1.00 0.00 ? 642 GLN B CB  1  
ATOM 8463   C CG  . GLN B 2 642 ? -118.587 -11.406 41.755  1.00 0.00 ? 642 GLN B CG  1  
ATOM 8464   C CD  . GLN B 2 642 ? -118.761 -10.418 42.940  1.00 0.00 ? 642 GLN B CD  1  
ATOM 8465   O OE1 . GLN B 2 642 ? -118.860 -10.834 44.092  1.00 0.00 ? 642 GLN B OE1 1  
ATOM 8466   N NE2 . GLN B 2 642 ? -118.669 -9.109  42.612  1.00 0.00 ? 642 GLN B NE2 1  
ATOM 8467   N N   . GLN B 2 643 ? -119.055 -15.326 41.362  1.00 0.00 ? 643 GLN B N   1  
ATOM 8468   C CA  . GLN B 2 643 ? -118.061 -16.361 41.622  1.00 0.00 ? 643 GLN B CA  1  
ATOM 8469   C C   . GLN B 2 643 ? -117.599 -17.102 40.388  1.00 0.00 ? 643 GLN B C   1  
ATOM 8470   O O   . GLN B 2 643 ? -116.376 -17.248 40.102  1.00 0.00 ? 643 GLN B O   1  
ATOM 8471   C CB  . GLN B 2 643 ? -118.661 -17.383 42.650  1.00 0.00 ? 643 GLN B CB  1  
ATOM 8472   C CG  . GLN B 2 643 ? -117.679 -18.338 43.395  1.00 0.00 ? 643 GLN B CG  1  
ATOM 8473   C CD  . GLN B 2 643 ? -117.154 -19.439 42.411  1.00 0.00 ? 643 GLN B CD  1  
ATOM 8474   O OE1 . GLN B 2 643 ? -117.845 -20.264 41.816  1.00 0.00 ? 643 GLN B OE1 1  
ATOM 8475   N NE2 . GLN B 2 643 ? -115.787 -19.388 42.178  1.00 0.00 ? 643 GLN B NE2 1  
ATOM 8476   N N   . PHE B 2 644 ? -118.541 -17.529 39.489  1.00 0.00 ? 644 PHE B N   1  
ATOM 8477   C CA  . PHE B 2 644 ? -118.216 -18.206 38.233  1.00 0.00 ? 644 PHE B CA  1  
ATOM 8478   C C   . PHE B 2 644 ? -117.481 -17.350 37.276  1.00 0.00 ? 644 PHE B C   1  
ATOM 8479   O O   . PHE B 2 644 ? -116.473 -17.821 36.802  1.00 0.00 ? 644 PHE B O   1  
ATOM 8480   C CB  . PHE B 2 644 ? -119.417 -18.791 37.443  1.00 0.00 ? 644 PHE B CB  1  
ATOM 8481   C CG  . PHE B 2 644 ? -120.220 -19.611 38.496  1.00 0.00 ? 644 PHE B CG  1  
ATOM 8482   C CD1 . PHE B 2 644 ? -119.605 -20.679 39.162  1.00 0.00 ? 644 PHE B CD1 1  
ATOM 8483   C CD2 . PHE B 2 644 ? -121.606 -19.338 38.715  1.00 0.00 ? 644 PHE B CD2 1  
ATOM 8484   C CE1 . PHE B 2 644 ? -120.401 -21.473 40.071  1.00 0.00 ? 644 PHE B CE1 1  
ATOM 8485   C CE2 . PHE B 2 644 ? -122.373 -20.100 39.608  1.00 0.00 ? 644 PHE B CE2 1  
ATOM 8486   C CZ  . PHE B 2 644 ? -121.752 -21.187 40.254  1.00 0.00 ? 644 PHE B CZ  1  
ATOM 8487   N N   . ASN B 2 645 ? -117.942 -16.069 37.063  1.00 0.00 ? 645 ASN B N   1  
ATOM 8488   C CA  . ASN B 2 645 ? -117.171 -15.185 36.178  1.00 0.00 ? 645 ASN B CA  1  
ATOM 8489   C C   . ASN B 2 645 ? -115.721 -14.859 36.610  1.00 0.00 ? 645 ASN B C   1  
ATOM 8490   O O   . ASN B 2 645 ? -114.818 -14.893 35.774  1.00 0.00 ? 645 ASN B O   1  
ATOM 8491   C CB  . ASN B 2 645 ? -117.647 -13.707 36.004  1.00 0.00 ? 645 ASN B CB  1  
ATOM 8492   C CG  . ASN B 2 645 ? -118.834 -13.573 34.996  1.00 0.00 ? 645 ASN B CG  1  
ATOM 8493   O OD1 . ASN B 2 645 ? -119.462 -14.579 34.655  1.00 0.00 ? 645 ASN B OD1 1  
ATOM 8494   N ND2 . ASN B 2 645 ? -119.245 -12.270 34.857  1.00 0.00 ? 645 ASN B ND2 1  
ATOM 8495   N N   . SER B 2 646 ? -115.575 -14.625 37.909  1.00 0.00 ? 646 SER B N   1  
ATOM 8496   C CA  . SER B 2 646 ? -114.372 -14.341 38.539  1.00 0.00 ? 646 SER B CA  1  
ATOM 8497   C C   . SER B 2 646 ? -113.269 -15.487 38.447  1.00 0.00 ? 646 SER B C   1  
ATOM 8498   O O   . SER B 2 646 ? -112.068 -15.315 38.312  1.00 0.00 ? 646 SER B O   1  
ATOM 8499   C CB  . SER B 2 646 ? -114.476 -13.916 40.031  1.00 0.00 ? 646 SER B CB  1  
ATOM 8500   O OG  . SER B 2 646 ? -115.337 -12.729 40.183  1.00 0.00 ? 646 SER B OG  1  
ATOM 8501   N N   . LYS B 2 647 ? -113.809 -16.710 38.555  1.00 0.00 ? 647 LYS B N   1  
ATOM 8502   C CA  . LYS B 2 647 ? -113.105 -17.978 38.524  1.00 0.00 ? 647 LYS B CA  1  
ATOM 8503   C C   . LYS B 2 647 ? -112.582 -18.119 37.144  1.00 0.00 ? 647 LYS B C   1  
ATOM 8504   O O   . LYS B 2 647 ? -111.409 -18.437 36.967  1.00 0.00 ? 647 LYS B O   1  
ATOM 8505   C CB  . LYS B 2 647 ? -114.045 -19.133 38.845  1.00 0.00 ? 647 LYS B CB  1  
ATOM 8506   C CG  . LYS B 2 647 ? -113.407 -20.555 38.600  1.00 0.00 ? 647 LYS B CG  1  
ATOM 8507   C CD  . LYS B 2 647 ? -114.122 -21.606 39.400  1.00 0.00 ? 647 LYS B CD  1  
ATOM 8508   C CE  . LYS B 2 647 ? -114.791 -22.724 38.600  1.00 0.00 ? 647 LYS B CE  1  
ATOM 8509   N NZ  . LYS B 2 647 ? -115.911 -22.256 37.836  1.00 0.00 ? 647 LYS B NZ  1  
ATOM 8510   N N   . MET B 2 648 ? -113.460 -17.733 36.161  1.00 0.00 ? 648 MET B N   1  
ATOM 8511   C CA  . MET B 2 648 ? -113.136 -17.757 34.759  1.00 0.00 ? 648 MET B CA  1  
ATOM 8512   C C   . MET B 2 648 ? -111.993 -16.871 34.346  1.00 0.00 ? 648 MET B C   1  
ATOM 8513   O O   . MET B 2 648 ? -111.049 -17.274 33.674  1.00 0.00 ? 648 MET B O   1  
ATOM 8514   C CB  . MET B 2 648 ? -114.421 -17.605 33.863  1.00 0.00 ? 648 MET B CB  1  
ATOM 8515   C CG  . MET B 2 648 ? -115.397 -18.718 34.001  1.00 0.00 ? 648 MET B CG  1  
ATOM 8516   S SD  . MET B 2 648 ? -114.920 -20.340 33.166  1.00 0.00 ? 648 MET B SD  1  
ATOM 8517   C CE  . MET B 2 648 ? -115.257 -21.365 34.637  1.00 0.00 ? 648 MET B CE  1  
ATOM 8518   N N   . GLU B 2 649 ? -111.987 -15.666 34.927  1.00 0.00 ? 649 GLU B N   1  
ATOM 8519   C CA  . GLU B 2 649 ? -111.023 -14.587 34.783  1.00 0.00 ? 649 GLU B CA  1  
ATOM 8520   C C   . GLU B 2 649 ? -109.617 -15.019 35.351  1.00 0.00 ? 649 GLU B C   1  
ATOM 8521   O O   . GLU B 2 649 ? -108.570 -14.813 34.753  1.00 0.00 ? 649 GLU B O   1  
ATOM 8522   C CB  . GLU B 2 649 ? -111.650 -13.273 35.364  1.00 0.00 ? 649 GLU B CB  1  
ATOM 8523   C CG  . GLU B 2 649 ? -112.688 -12.373 34.613  1.00 0.00 ? 649 GLU B CG  1  
ATOM 8524   C CD  . GLU B 2 649 ? -112.871 -12.770 33.130  1.00 0.00 ? 649 GLU B CD  1  
ATOM 8525   O OE1 . GLU B 2 649 ? -113.630 -13.699 32.847  1.00 0.00 ? 649 GLU B OE1 1  
ATOM 8526   O OE2 . GLU B 2 649 ? -112.200 -12.185 32.245  1.00 0.00 ? 649 GLU B OE2 1  
ATOM 8527   N N   . SER B 2 650 ? -109.621 -15.774 36.502  1.00 0.00 ? 650 SER B N   1  
ATOM 8528   C CA  . SER B 2 650 ? -108.496 -16.391 37.235  1.00 0.00 ? 650 SER B CA  1  
ATOM 8529   C C   . SER B 2 650 ? -107.872 -17.283 36.233  1.00 0.00 ? 650 SER B C   1  
ATOM 8530   O O   . SER B 2 650 ? -106.671 -17.150 35.917  1.00 0.00 ? 650 SER B O   1  
ATOM 8531   C CB  . SER B 2 650 ? -108.950 -17.118 38.520  1.00 0.00 ? 650 SER B CB  1  
ATOM 8532   O OG  . SER B 2 650 ? -109.436 -16.188 39.518  1.00 0.00 ? 650 SER B OG  1  
ATOM 8533   N N   . TYR B 2 651 ? -108.681 -18.168 35.576  1.00 0.00 ? 651 TYR B N   1  
ATOM 8534   C CA  . TYR B 2 651 ? -108.124 -19.128 34.626  1.00 0.00 ? 651 TYR B CA  1  
ATOM 8535   C C   . TYR B 2 651 ? -107.574 -18.475 33.411  1.00 0.00 ? 651 TYR B C   1  
ATOM 8536   O O   . TYR B 2 651 ? -106.485 -18.838 32.987  1.00 0.00 ? 651 TYR B O   1  
ATOM 8537   C CB  . TYR B 2 651 ? -109.207 -20.135 34.186  1.00 0.00 ? 651 TYR B CB  1  
ATOM 8538   C CG  . TYR B 2 651 ? -109.633 -20.986 35.396  1.00 0.00 ? 651 TYR B CG  1  
ATOM 8539   C CD1 . TYR B 2 651 ? -108.688 -21.570 36.252  1.00 0.00 ? 651 TYR B CD1 1  
ATOM 8540   C CD2 . TYR B 2 651 ? -110.952 -21.452 35.505  1.00 0.00 ? 651 TYR B CD2 1  
ATOM 8541   C CE1 . TYR B 2 651 ? -109.060 -22.621 37.062  1.00 0.00 ? 651 TYR B CE1 1  
ATOM 8542   C CE2 . TYR B 2 651 ? -111.359 -22.374 36.474  1.00 0.00 ? 651 TYR B CE2 1  
ATOM 8543   C CZ  . TYR B 2 651 ? -110.339 -22.951 37.260  1.00 0.00 ? 651 TYR B CZ  1  
ATOM 8544   O OH  . TYR B 2 651 ? -110.598 -23.944 38.208  1.00 0.00 ? 651 TYR B OH  1  
ATOM 8545   N N   . TYR B 2 652 ? -108.263 -17.500 32.855  1.00 0.00 ? 652 TYR B N   1  
ATOM 8546   C CA  . TYR B 2 652 ? -107.636 -16.813 31.704  1.00 0.00 ? 652 TYR B CA  1  
ATOM 8547   C C   . TYR B 2 652 ? -106.312 -16.178 32.000  1.00 0.00 ? 652 TYR B C   1  
ATOM 8548   O O   . TYR B 2 652 ? -105.351 -16.316 31.252  1.00 0.00 ? 652 TYR B O   1  
ATOM 8549   C CB  . TYR B 2 652 ? -108.495 -15.694 31.091  1.00 0.00 ? 652 TYR B CB  1  
ATOM 8550   C CG  . TYR B 2 652 ? -109.722 -16.389 30.506  1.00 0.00 ? 652 TYR B CG  1  
ATOM 8551   C CD1 . TYR B 2 652 ? -109.560 -17.493 29.611  1.00 0.00 ? 652 TYR B CD1 1  
ATOM 8552   C CD2 . TYR B 2 652 ? -110.998 -15.839 30.692  1.00 0.00 ? 652 TYR B CD2 1  
ATOM 8553   C CE1 . TYR B 2 652 ? -110.700 -18.238 29.269  1.00 0.00 ? 652 TYR B CE1 1  
ATOM 8554   C CE2 . TYR B 2 652 ? -112.154 -16.615 30.299  1.00 0.00 ? 652 TYR B CE2 1  
ATOM 8555   C CZ  . TYR B 2 652 ? -111.989 -17.761 29.564  1.00 0.00 ? 652 TYR B CZ  1  
ATOM 8556   O OH  . TYR B 2 652 ? -113.172 -18.474 29.241  1.00 0.00 ? 652 TYR B OH  1  
ATOM 8557   N N   . LEU B 2 653 ? -106.128 -15.443 33.087  1.00 0.00 ? 653 LEU B N   1  
ATOM 8558   C CA  . LEU B 2 653 ? -104.873 -14.833 33.418  1.00 0.00 ? 653 LEU B CA  1  
ATOM 8559   C C   . LEU B 2 653 ? -103.794 -15.742 33.772  1.00 0.00 ? 653 LEU B C   1  
ATOM 8560   O O   . LEU B 2 653 ? -102.692 -15.707 33.318  1.00 0.00 ? 653 LEU B O   1  
ATOM 8561   C CB  . LEU B 2 653 ? -105.211 -13.884 34.574  1.00 0.00 ? 653 LEU B CB  1  
ATOM 8562   C CG  . LEU B 2 653 ? -104.220 -12.774 35.091  1.00 0.00 ? 653 LEU B CG  1  
ATOM 8563   C CD1 . LEU B 2 653 ? -103.154 -13.348 36.023  1.00 0.00 ? 653 LEU B CD1 1  
ATOM 8564   C CD2 . LEU B 2 653 ? -103.669 -11.840 33.966  1.00 0.00 ? 653 LEU B CD2 1  
ATOM 8565   N N   . ASN B 2 654 ? -104.139 -16.674 34.639  1.00 0.00 ? 654 ASN B N   1  
ATOM 8566   C CA  . ASN B 2 654 ? -103.157 -17.565 35.170  1.00 0.00 ? 654 ASN B CA  1  
ATOM 8567   C C   . ASN B 2 654 ? -102.740 -18.520 34.096  1.00 0.00 ? 654 ASN B C   1  
ATOM 8568   O O   . ASN B 2 654 ? -101.557 -18.689 33.917  1.00 0.00 ? 654 ASN B O   1  
ATOM 8569   C CB  . ASN B 2 654 ? -103.708 -18.431 36.395  1.00 0.00 ? 654 ASN B CB  1  
ATOM 8570   C CG  . ASN B 2 654 ? -103.998 -17.601 37.640  1.00 0.00 ? 654 ASN B CG  1  
ATOM 8571   O OD1 . ASN B 2 654 ? -103.633 -16.453 37.847  1.00 0.00 ? 654 ASN B OD1 1  
ATOM 8572   N ND2 . ASN B 2 654 ? -104.685 -18.285 38.562  1.00 0.00 ? 654 ASN B ND2 1  
ATOM 8573   N N   . CYS B 2 655 ? -103.748 -19.241 33.487  1.00 0.00 ? 655 CYS B N   1  
ATOM 8574   C CA  . CYS B 2 655 ? -103.345 -20.324 32.662  1.00 0.00 ? 655 CYS B CA  1  
ATOM 8575   C C   . CYS B 2 655 ? -102.715 -19.946 31.376  1.00 0.00 ? 655 CYS B C   1  
ATOM 8576   O O   . CYS B 2 655 ? -101.848 -20.598 30.860  1.00 0.00 ? 655 CYS B O   1  
ATOM 8577   C CB  . CYS B 2 655 ? -104.540 -21.251 32.308  1.00 0.00 ? 655 CYS B CB  1  
ATOM 8578   S SG  . CYS B 2 655 ? -105.458 -21.682 33.772  1.00 0.00 ? 655 CYS B SG  1  
ATOM 8579   N N   . ILE B 2 656 ? -103.224 -18.937 30.700  1.00 0.00 ? 656 ILE B N   1  
ATOM 8580   C CA  . ILE B 2 656 ? -102.651 -18.422 29.454  1.00 0.00 ? 656 ILE B CA  1  
ATOM 8581   C C   . ILE B 2 656 ? -101.584 -17.446 29.681  1.00 0.00 ? 656 ILE B C   1  
ATOM 8582   O O   . ILE B 2 656 ? -100.460 -17.757 29.306  1.00 0.00 ? 656 ILE B O   1  
ATOM 8583   C CB  . ILE B 2 656 ? -103.749 -17.757 28.575  1.00 0.00 ? 656 ILE B CB  1  
ATOM 8584   C CG1 . ILE B 2 656 ? -104.956 -18.652 28.352  1.00 0.00 ? 656 ILE B CG1 1  
ATOM 8585   C CG2 . ILE B 2 656 ? -103.250 -17.313 27.241  1.00 0.00 ? 656 ILE B CG2 1  
ATOM 8586   C CD1 . ILE B 2 656 ? -106.057 -18.017 27.485  1.00 0.00 ? 656 ILE B CD1 1  
ATOM 8587   N N   . ILE B 2 657 ? -101.896 -16.233 30.236  1.00 0.00 ? 657 ILE B N   1  
ATOM 8588   C CA  . ILE B 2 657 ? -101.046 -15.107 30.161  1.00 0.00 ? 657 ILE B CA  1  
ATOM 8589   C C   . ILE B 2 657 ? -99.799  -15.263 30.983  1.00 0.00 ? 657 ILE B C   1  
ATOM 8590   O O   . ILE B 2 657 ? -98.670  -15.109 30.478  1.00 0.00 ? 657 ILE B O   1  
ATOM 8591   C CB  . ILE B 2 657 ? -101.808 -13.784 30.551  1.00 0.00 ? 657 ILE B CB  1  
ATOM 8592   C CG1 . ILE B 2 657 ? -103.003 -13.596 29.665  1.00 0.00 ? 657 ILE B CG1 1  
ATOM 8593   C CG2 . ILE B 2 657 ? -100.992 -12.439 30.574  1.00 0.00 ? 657 ILE B CG2 1  
ATOM 8594   C CD1 . ILE B 2 657 ? -103.816 -12.326 29.969  1.00 0.00 ? 657 ILE B CD1 1  
ATOM 8595   N N   . GLU B 2 658 ? -99.884  -15.541 32.278  1.00 0.00 ? 658 GLU B N   1  
ATOM 8596   C CA  . GLU B 2 658 ? -98.797  -15.534 33.262  1.00 0.00 ? 658 GLU B CA  1  
ATOM 8597   C C   . GLU B 2 658 ? -97.846  -16.566 32.934  1.00 0.00 ? 658 GLU B C   1  
ATOM 8598   O O   . GLU B 2 658 ? -96.645  -16.275 32.947  1.00 0.00 ? 658 GLU B O   1  
ATOM 8599   C CB  . GLU B 2 658 ? -99.385  -15.695 34.670  1.00 0.00 ? 658 GLU B CB  1  
ATOM 8600   C CG  . GLU B 2 658 ? -98.281  -15.388 35.651  1.00 0.00 ? 658 GLU B CG  1  
ATOM 8601   C CD  . GLU B 2 658 ? -98.852  -15.167 37.059  1.00 0.00 ? 658 GLU B CD  1  
ATOM 8602   O OE1 . GLU B 2 658 ? -99.969  -15.819 37.287  1.00 0.00 ? 658 GLU B OE1 1  
ATOM 8603   O OE2 . GLU B 2 658 ? -98.256  -14.434 37.916  1.00 0.00 ? 658 GLU B OE2 1  
ATOM 8604   N N   . GLU B 2 659 ? -98.311  -17.778 32.570  1.00 0.00 ? 659 GLU B N   1  
ATOM 8605   C CA  . GLU B 2 659 ? -97.472  -18.846 32.172  1.00 0.00 ? 659 GLU B CA  1  
ATOM 8606   C C   . GLU B 2 659 ? -96.765  -18.439 30.913  1.00 0.00 ? 659 GLU B C   1  
ATOM 8607   O O   . GLU B 2 659 ? -95.576  -18.571 30.820  1.00 0.00 ? 659 GLU B O   1  
ATOM 8608   C CB  . GLU B 2 659 ? -98.282  -20.089 32.006  1.00 0.00 ? 659 GLU B CB  1  
ATOM 8609   C CG  . GLU B 2 659 ? -98.535  -20.895 33.295  1.00 0.00 ? 659 GLU B CG  1  
ATOM 8610   C CD  . GLU B 2 659 ? -99.025  -20.176 34.563  1.00 0.00 ? 659 GLU B CD  1  
ATOM 8611   O OE1 . GLU B 2 659 ? -98.270  -19.290 35.041  1.00 0.00 ? 659 GLU B OE1 1  
ATOM 8612   O OE2 . GLU B 2 659 ? -100.058 -20.612 35.106  1.00 0.00 ? 659 GLU B OE2 1  
ATOM 8613   N N   . ASN B 2 660 ? -97.356  -17.838 29.800  1.00 0.00 ? 660 ASN B N   1  
ATOM 8614   C CA  . ASN B 2 660 ? -96.667  -17.583 28.571  1.00 0.00 ? 660 ASN B CA  1  
ATOM 8615   C C   . ASN B 2 660 ? -95.567  -16.548 28.763  1.00 0.00 ? 660 ASN B C   1  
ATOM 8616   O O   . ASN B 2 660 ? -94.407  -16.769 28.356  1.00 0.00 ? 660 ASN B O   1  
ATOM 8617   C CB  . ASN B 2 660 ? -97.576  -16.940 27.551  1.00 0.00 ? 660 ASN B CB  1  
ATOM 8618   C CG  . ASN B 2 660 ? -98.729  -17.952 27.168  1.00 0.00 ? 660 ASN B CG  1  
ATOM 8619   O OD1 . ASN B 2 660 ? -98.727  -19.184 27.513  1.00 0.00 ? 660 ASN B OD1 1  
ATOM 8620   N ND2 . ASN B 2 660 ? -99.584  -17.417 26.246  1.00 0.00 ? 660 ASN B ND2 1  
ATOM 8621   N N   . PHE B 2 661 ? -95.855  -15.411 29.533  1.00 0.00 ? 661 PHE B N   1  
ATOM 8622   C CA  . PHE B 2 661 ? -94.877  -14.344 29.776  1.00 0.00 ? 661 PHE B CA  1  
ATOM 8623   C C   . PHE B 2 661 ? -93.731  -14.912 30.568  1.00 0.00 ? 661 PHE B C   1  
ATOM 8624   O O   . PHE B 2 661 ? -92.602  -14.510 30.287  1.00 0.00 ? 661 PHE B O   1  
ATOM 8625   C CB  . PHE B 2 661 ? -95.603  -13.259 30.459  1.00 0.00 ? 661 PHE B CB  1  
ATOM 8626   C CG  . PHE B 2 661 ? -94.735  -12.008 30.388  1.00 0.00 ? 661 PHE B CG  1  
ATOM 8627   C CD1 . PHE B 2 661 ? -94.476  -11.290 29.190  1.00 0.00 ? 661 PHE B CD1 1  
ATOM 8628   C CD2 . PHE B 2 661 ? -94.398  -11.444 31.648  1.00 0.00 ? 661 PHE B CD2 1  
ATOM 8629   C CE1 . PHE B 2 661 ? -93.652  -10.183 29.218  1.00 0.00 ? 661 PHE B CE1 1  
ATOM 8630   C CE2 . PHE B 2 661 ? -93.593  -10.291 31.668  1.00 0.00 ? 661 PHE B CE2 1  
ATOM 8631   C CZ  . PHE B 2 661 ? -93.198  -9.709  30.497  1.00 0.00 ? 661 PHE B CZ  1  
ATOM 8632   N N   . LYS B 2 662 ? -93.968  -15.780 31.533  1.00 0.00 ? 662 LYS B N   1  
ATOM 8633   C CA  . LYS B 2 662 ? -92.918  -16.332 32.388  1.00 0.00 ? 662 LYS B CA  1  
ATOM 8634   C C   . LYS B 2 662 ? -91.911  -17.079 31.612  1.00 0.00 ? 662 LYS B C   1  
ATOM 8635   O O   . LYS B 2 662 ? -90.728  -16.903 31.748  1.00 0.00 ? 662 LYS B O   1  
ATOM 8636   C CB  . LYS B 2 662 ? -93.464  -17.250 33.485  1.00 0.00 ? 662 LYS B CB  1  
ATOM 8637   C CG  . LYS B 2 662 ? -94.074  -16.413 34.635  1.00 0.00 ? 662 LYS B CG  1  
ATOM 8638   C CD  . LYS B 2 662 ? -93.107  -15.832 35.607  1.00 0.00 ? 662 LYS B CD  1  
ATOM 8639   C CE  . LYS B 2 662 ? -93.635  -14.655 36.375  1.00 0.00 ? 662 LYS B CE  1  
ATOM 8640   N NZ  . LYS B 2 662 ? -94.592  -15.219 37.347  1.00 0.00 ? 662 LYS B NZ  1  
ATOM 8641   N N   . GLU B 2 663 ? -92.445  -17.906 30.706  1.00 0.00 ? 663 GLU B N   1  
ATOM 8642   C CA  . GLU B 2 663 ? -91.607  -18.719 29.862  1.00 0.00 ? 663 GLU B CA  1  
ATOM 8643   C C   . GLU B 2 663 ? -90.745  -17.933 28.956  1.00 0.00 ? 663 GLU B C   1  
ATOM 8644   O O   . GLU B 2 663 ? -89.536  -18.149 28.863  1.00 0.00 ? 663 GLU B O   1  
ATOM 8645   C CB  . GLU B 2 663 ? -92.566  -19.537 29.050  1.00 0.00 ? 663 GLU B CB  1  
ATOM 8646   C CG  . GLU B 2 663 ? -91.970  -20.311 27.846  1.00 0.00 ? 663 GLU B CG  1  
ATOM 8647   C CD  . GLU B 2 663 ? -93.106  -20.969 27.068  1.00 0.00 ? 663 GLU B CD  1  
ATOM 8648   O OE1 . GLU B 2 663 ? -93.977  -20.165 26.675  1.00 0.00 ? 663 GLU B OE1 1  
ATOM 8649   O OE2 . GLU B 2 663 ? -93.189  -22.172 26.770  1.00 0.00 ? 663 GLU B OE2 1  
ATOM 8650   N N   . MET B 2 664 ? -91.323  -16.888 28.435  1.00 0.00 ? 664 MET B N   1  
ATOM 8651   C CA  . MET B 2 664 ? -90.612  -15.924 27.629  1.00 0.00 ? 664 MET B CA  1  
ATOM 8652   C C   . MET B 2 664 ? -89.457  -15.185 28.253  1.00 0.00 ? 664 MET B C   1  
ATOM 8653   O O   . MET B 2 664 ? -88.349  -15.162 27.672  1.00 0.00 ? 664 MET B O   1  
ATOM 8654   C CB  . MET B 2 664 ? -91.681  -14.912 27.149  1.00 0.00 ? 664 MET B CB  1  
ATOM 8655   C CG  . MET B 2 664 ? -92.571  -15.436 26.000  1.00 0.00 ? 664 MET B CG  1  
ATOM 8656   S SD  . MET B 2 664 ? -94.051  -14.532 25.648  1.00 0.00 ? 664 MET B SD  1  
ATOM 8657   C CE  . MET B 2 664 ? -93.587  -12.804 25.745  1.00 0.00 ? 664 MET B CE  1  
ATOM 8658   N N   . THR B 2 665 ? -89.718  -14.700 29.506  1.00 0.00 ? 665 THR B N   1  
ATOM 8659   C CA  . THR B 2 665 ? -88.669  -14.022 30.280  1.00 0.00 ? 665 THR B CA  1  
ATOM 8660   C C   . THR B 2 665 ? -87.552  -14.922 30.659  1.00 0.00 ? 665 THR B C   1  
ATOM 8661   O O   . THR B 2 665 ? -86.472  -14.376 30.607  1.00 0.00 ? 665 THR B O   1  
ATOM 8662   C CB  . THR B 2 665 ? -89.293  -13.169 31.417  1.00 0.00 ? 665 THR B CB  1  
ATOM 8663   O OG1 . THR B 2 665 ? -88.276  -12.326 31.894  1.00 0.00 ? 665 THR B OG1 1  
ATOM 8664   C CG2 . THR B 2 665 ? -89.886  -13.943 32.612  1.00 0.00 ? 665 THR B CG2 1  
ATOM 8665   N N   . ARG B 2 666 ? -87.799  -16.154 31.076  1.00 0.00 ? 666 ARG B N   1  
ATOM 8666   C CA  . ARG B 2 666 ? -86.725  -17.015 31.469  1.00 0.00 ? 666 ARG B CA  1  
ATOM 8667   C C   . ARG B 2 666 ? -85.815  -17.339 30.383  1.00 0.00 ? 666 ARG B C   1  
ATOM 8668   O O   . ARG B 2 666 ? -84.558  -17.273 30.471  1.00 0.00 ? 666 ARG B O   1  
ATOM 8669   C CB  . ARG B 2 666 ? -87.226  -18.197 32.331  1.00 0.00 ? 666 ARG B CB  1  
ATOM 8670   C CG  . ARG B 2 666 ? -88.116  -19.225 31.605  1.00 0.00 ? 666 ARG B CG  1  
ATOM 8671   C CD  . ARG B 2 666 ? -88.827  -20.240 32.479  1.00 0.00 ? 666 ARG B CD  1  
ATOM 8672   N NE  . ARG B 2 666 ? -89.721  -19.433 33.438  1.00 0.00 ? 666 ARG B NE  1  
ATOM 8673   C CZ  . ARG B 2 666 ? -90.574  -20.098 34.326  1.00 0.00 ? 666 ARG B CZ  1  
ATOM 8674   N NH1 . ARG B 2 666 ? -90.773  -21.400 34.439  1.00 0.00 ? 666 ARG B NH1 1  
ATOM 8675   N NH2 . ARG B 2 666 ? -91.108  -19.344 35.306  1.00 0.00 ? 666 ARG B NH2 1  
ATOM 8676   N N   . LYS B 2 667 ? -86.433  -17.613 29.227  1.00 0.00 ? 667 LYS B N   1  
ATOM 8677   C CA  . LYS B 2 667 ? -85.779  -17.938 27.991  1.00 0.00 ? 667 LYS B CA  1  
ATOM 8678   C C   . LYS B 2 667 ? -84.905  -16.784 27.540  1.00 0.00 ? 667 LYS B C   1  
ATOM 8679   O O   . LYS B 2 667 ? -83.725  -16.988 27.330  1.00 0.00 ? 667 LYS B O   1  
ATOM 8680   C CB  . LYS B 2 667 ? -86.819  -18.380 26.991  1.00 0.00 ? 667 LYS B CB  1  
ATOM 8681   C CG  . LYS B 2 667 ? -87.343  -19.780 27.343  1.00 0.00 ? 667 LYS B CG  1  
ATOM 8682   C CD  . LYS B 2 667 ? -88.325  -20.086 26.287  1.00 0.00 ? 667 LYS B CD  1  
ATOM 8683   C CE  . LYS B 2 667 ? -88.541  -21.650 26.202  1.00 0.00 ? 667 LYS B CE  1  
ATOM 8684   N NZ  . LYS B 2 667 ? -89.095  -22.071 24.846  1.00 0.00 ? 667 LYS B NZ  1  
ATOM 8685   N N   . LEU B 2 668 ? -85.288  -15.504 27.671  1.00 0.00 ? 668 LEU B N   1  
ATOM 8686   C CA  . LEU B 2 668 ? -84.461  -14.316 27.564  1.00 0.00 ? 668 LEU B CA  1  
ATOM 8687   C C   . LEU B 2 668 ? -83.414  -14.202 28.600  1.00 0.00 ? 668 LEU B C   1  
ATOM 8688   O O   . LEU B 2 668 ? -82.282  -13.857 28.311  1.00 0.00 ? 668 LEU B O   1  
ATOM 8689   C CB  . LEU B 2 668 ? -85.179  -12.974 27.517  1.00 0.00 ? 668 LEU B CB  1  
ATOM 8690   C CG  . LEU B 2 668 ? -86.199  -12.857 26.331  1.00 0.00 ? 668 LEU B CG  1  
ATOM 8691   C CD1 . LEU B 2 668 ? -87.008  -11.559 26.406  1.00 0.00 ? 668 LEU B CD1 1  
ATOM 8692   C CD2 . LEU B 2 668 ? -85.477  -12.989 24.941  1.00 0.00 ? 668 LEU B CD2 1  
ATOM 8693   N N   . GLN B 2 669 ? -83.673  -14.522 29.882  1.00 0.00 ? 669 GLN B N   1  
ATOM 8694   C CA  . GLN B 2 669 ? -82.662  -14.422 30.935  1.00 0.00 ? 669 GLN B CA  1  
ATOM 8695   C C   . GLN B 2 669 ? -81.599  -15.457 30.775  1.00 0.00 ? 669 GLN B C   1  
ATOM 8696   O O   . GLN B 2 669 ? -80.438  -15.155 31.062  1.00 0.00 ? 669 GLN B O   1  
ATOM 8697   C CB  . GLN B 2 669 ? -83.327  -14.618 32.344  1.00 0.00 ? 669 GLN B CB  1  
ATOM 8698   C CG  . GLN B 2 669 ? -84.107  -13.355 32.649  1.00 0.00 ? 669 GLN B CG  1  
ATOM 8699   C CD  . GLN B 2 669 ? -85.225  -13.635 33.595  1.00 0.00 ? 669 GLN B CD  1  
ATOM 8700   O OE1 . GLN B 2 669 ? -85.600  -14.794 33.813  1.00 0.00 ? 669 GLN B OE1 1  
ATOM 8701   N NE2 . GLN B 2 669 ? -85.835  -12.519 34.189  1.00 0.00 ? 669 GLN B NE2 1  
ATOM 8702   N N   . ARG B 2 670 ? -81.922  -16.701 30.410  1.00 0.00 ? 670 ARG B N   1  
ATOM 8703   C CA  . ARG B 2 670 ? -81.008  -17.794 30.486  1.00 0.00 ? 670 ARG B CA  1  
ATOM 8704   C C   . ARG B 2 670 ? -79.768  -17.536 29.570  1.00 0.00 ? 670 ARG B C   1  
ATOM 8705   O O   . ARG B 2 670 ? -78.660  -17.715 29.989  1.00 0.00 ? 670 ARG B O   1  
ATOM 8706   C CB  . ARG B 2 670 ? -81.711  -19.099 29.992  1.00 0.00 ? 670 ARG B CB  1  
ATOM 8707   C CG  . ARG B 2 670 ? -80.720  -20.314 29.856  1.00 0.00 ? 670 ARG B CG  1  
ATOM 8708   C CD  . ARG B 2 670 ? -81.305  -21.524 29.125  1.00 0.00 ? 670 ARG B CD  1  
ATOM 8709   N NE  . ARG B 2 670 ? -80.303  -22.615 28.902  1.00 0.00 ? 670 ARG B NE  1  
ATOM 8710   C CZ  . ARG B 2 670 ? -80.524  -23.982 28.673  1.00 0.00 ? 670 ARG B CZ  1  
ATOM 8711   N NH1 . ARG B 2 670 ? -81.852  -24.354 28.635  1.00 0.00 ? 670 ARG B NH1 1  
ATOM 8712   N NH2 . ARG B 2 670 ? -79.511  -24.795 28.530  1.00 0.00 ? 670 ARG B NH2 1  
ATOM 8713   N N   . THR B 2 671 ? -80.087  -17.045 28.317  1.00 0.00 ? 671 THR B N   1  
ATOM 8714   C CA  . THR B 2 671 ? -79.038  -16.520 27.436  1.00 0.00 ? 671 THR B CA  1  
ATOM 8715   C C   . THR B 2 671 ? -78.254  -15.387 28.039  1.00 0.00 ? 671 THR B C   1  
ATOM 8716   O O   . THR B 2 671 ? -78.560  -15.009 29.201  1.00 0.00 ? 671 THR B O   1  
ATOM 8717   C CB  . THR B 2 671 ? -79.599  -16.151 26.054  1.00 0.00 ? 671 THR B CB  1  
ATOM 8718   O OG1 . THR B 2 671 ? -80.640  -15.239 26.168  1.00 0.00 ? 671 THR B OG1 1  
ATOM 8719   C CG2 . THR B 2 671 ? -80.173  -17.397 25.396  1.00 0.00 ? 671 THR B CG2 1  
ATOM 8720   N N   . LEU B 2 719 ? -78.204  -10.240 20.936  1.00 0.00 ? 719 LEU B N   1  
ATOM 8721   C CA  . LEU B 2 719 ? -79.225  -9.250  21.409  1.00 0.00 ? 719 LEU B CA  1  
ATOM 8722   C C   . LEU B 2 719 ? -79.752  -8.561  20.211  1.00 0.00 ? 719 LEU B C   1  
ATOM 8723   O O   . LEU B 2 719 ? -78.971  -8.007  19.502  1.00 0.00 ? 719 LEU B O   1  
ATOM 8724   C CB  . LEU B 2 719 ? -78.566  -8.207  22.335  1.00 0.00 ? 719 LEU B CB  1  
ATOM 8725   C CG  . LEU B 2 719 ? -79.465  -7.118  22.945  1.00 0.00 ? 719 LEU B CG  1  
ATOM 8726   C CD1 . LEU B 2 719 ? -80.493  -7.684  23.953  1.00 0.00 ? 719 LEU B CD1 1  
ATOM 8727   C CD2 . LEU B 2 719 ? -78.700  -5.975  23.506  1.00 0.00 ? 719 LEU B CD2 1  
ATOM 8728   N N   . ASN B 2 720 ? -81.076  -8.675  19.981  1.00 0.00 ? 720 ASN B N   1  
ATOM 8729   C CA  . ASN B 2 720 ? -81.583  -8.086  18.742  1.00 0.00 ? 720 ASN B CA  1  
ATOM 8730   C C   . ASN B 2 720 ? -82.959  -7.681  19.147  1.00 0.00 ? 720 ASN B C   1  
ATOM 8731   O O   . ASN B 2 720 ? -83.499  -8.172  20.121  1.00 0.00 ? 720 ASN B O   1  
ATOM 8732   C CB  . ASN B 2 720 ? -81.725  -9.169  17.609  1.00 0.00 ? 720 ASN B CB  1  
ATOM 8733   C CG  . ASN B 2 720 ? -80.387  -9.628  17.148  1.00 0.00 ? 720 ASN B CG  1  
ATOM 8734   O OD1 . ASN B 2 720 ? -80.020  -10.820 17.444  1.00 0.00 ? 720 ASN B OD1 1  
ATOM 8735   N ND2 . ASN B 2 720 ? -79.708  -8.724  16.496  1.00 0.00 ? 720 ASN B ND2 1  
ATOM 8736   N N   . ILE B 2 721 ? -83.530  -6.813  18.297  1.00 0.00 ? 721 ILE B N   1  
ATOM 8737   C CA  . ILE B 2 721 ? -84.857  -6.205  18.311  1.00 0.00 ? 721 ILE B CA  1  
ATOM 8738   C C   . ILE B 2 721 ? -85.811  -7.283  18.153  1.00 0.00 ? 721 ILE B C   1  
ATOM 8739   O O   . ILE B 2 721 ? -86.912  -7.269  18.761  1.00 0.00 ? 721 ILE B O   1  
ATOM 8740   C CB  . ILE B 2 721 ? -85.087  -5.053  17.305  1.00 0.00 ? 721 ILE B CB  1  
ATOM 8741   C CG1 . ILE B 2 721 ? -86.568  -4.496  17.409  1.00 0.00 ? 721 ILE B CG1 1  
ATOM 8742   C CG2 . ILE B 2 721 ? -84.622  -5.454  15.917  1.00 0.00 ? 721 ILE B CG2 1  
ATOM 8743   C CD1 . ILE B 2 721 ? -86.875  -3.344  16.437  1.00 0.00 ? 721 ILE B CD1 1  
ATOM 8744   N N   . ASP B 2 722 ? -85.383  -8.257  17.279  1.00 0.00 ? 722 ASP B N   1  
ATOM 8745   C CA  . ASP B 2 722 ? -86.186  -9.348  16.841  1.00 0.00 ? 722 ASP B CA  1  
ATOM 8746   C C   . ASP B 2 722 ? -86.690  -10.274 17.942  1.00 0.00 ? 722 ASP B C   1  
ATOM 8747   O O   . ASP B 2 722 ? -87.736  -10.850 17.866  1.00 0.00 ? 722 ASP B O   1  
ATOM 8748   C CB  . ASP B 2 722 ? -85.470  -10.231 15.764  1.00 0.00 ? 722 ASP B CB  1  
ATOM 8749   C CG  . ASP B 2 722 ? -85.296  -9.284  14.550  1.00 0.00 ? 722 ASP B CG  1  
ATOM 8750   O OD1 . ASP B 2 722 ? -86.372  -8.856  13.971  1.00 0.00 ? 722 ASP B OD1 1  
ATOM 8751   O OD2 . ASP B 2 722 ? -84.154  -9.028  14.128  1.00 0.00 ? 722 ASP B OD2 1  
ATOM 8752   N N   . GLU B 2 723 ? -85.820  -10.454 18.959  1.00 0.00 ? 723 GLU B N   1  
ATOM 8753   C CA  . GLU B 2 723 ? -86.061  -11.345 20.123  1.00 0.00 ? 723 GLU B CA  1  
ATOM 8754   C C   . GLU B 2 723 ? -87.285  -10.786 20.873  1.00 0.00 ? 723 GLU B C   1  
ATOM 8755   O O   . GLU B 2 723 ? -88.072  -11.596 21.329  1.00 0.00 ? 723 GLU B O   1  
ATOM 8756   C CB  . GLU B 2 723 ? -84.854  -11.418 21.005  1.00 0.00 ? 723 GLU B CB  1  
ATOM 8757   C CG  . GLU B 2 723 ? -83.634  -12.015 20.256  1.00 0.00 ? 723 GLU B CG  1  
ATOM 8758   C CD  . GLU B 2 723 ? -82.405  -11.449 21.010  1.00 0.00 ? 723 GLU B CD  1  
ATOM 8759   O OE1 . GLU B 2 723 ? -82.542  -10.874 22.116  1.00 0.00 ? 723 GLU B OE1 1  
ATOM 8760   O OE2 . GLU B 2 723 ? -81.295  -11.647 20.450  1.00 0.00 ? 723 GLU B OE2 1  
ATOM 8761   N N   . LEU B 2 724 ? -87.438  -9.454  20.965  1.00 0.00 ? 724 LEU B N   1  
ATOM 8762   C CA  . LEU B 2 724 ? -88.592  -8.801  21.573  1.00 0.00 ? 724 LEU B CA  1  
ATOM 8763   C C   . LEU B 2 724 ? -89.793  -9.166  20.742  1.00 0.00 ? 724 LEU B C   1  
ATOM 8764   O O   . LEU B 2 724 ? -90.801  -9.587  21.295  1.00 0.00 ? 724 LEU B O   1  
ATOM 8765   C CB  . LEU B 2 724 ? -88.501  -7.234  21.714  1.00 0.00 ? 724 LEU B CB  1  
ATOM 8766   C CG  . LEU B 2 724 ? -89.604  -6.434  22.395  1.00 0.00 ? 724 LEU B CG  1  
ATOM 8767   C CD1 . LEU B 2 724 ? -90.734  -6.013  21.496  1.00 0.00 ? 724 LEU B CD1 1  
ATOM 8768   C CD2 . LEU B 2 724 ? -90.271  -7.216  23.527  1.00 0.00 ? 724 LEU B CD2 1  
ATOM 8769   N N   . GLU B 2 725 ? -89.619  -8.980  19.428  1.00 0.00 ? 725 GLU B N   1  
ATOM 8770   C CA  . GLU B 2 725 ? -90.751  -9.196  18.573  1.00 0.00 ? 725 GLU B CA  1  
ATOM 8771   C C   . GLU B 2 725 ? -91.260  -10.625 18.586  1.00 0.00 ? 725 GLU B C   1  
ATOM 8772   O O   . GLU B 2 725 ? -92.496  -10.820 18.563  1.00 0.00 ? 725 GLU B O   1  
ATOM 8773   C CB  . GLU B 2 725 ? -90.349  -8.864  17.095  1.00 0.00 ? 725 GLU B CB  1  
ATOM 8774   C CG  . GLU B 2 725 ? -89.590  -7.564  16.904  1.00 0.00 ? 725 GLU B CG  1  
ATOM 8775   C CD  . GLU B 2 725 ? -90.305  -6.427  17.622  1.00 0.00 ? 725 GLU B CD  1  
ATOM 8776   O OE1 . GLU B 2 725 ? -91.552  -6.462  17.572  1.00 0.00 ? 725 GLU B OE1 1  
ATOM 8777   O OE2 . GLU B 2 725 ? -89.634  -5.529  18.187  1.00 0.00 ? 725 GLU B OE2 1  
ATOM 8778   N N   . SER B 2 726 ? -90.353  -11.625 18.615  1.00 0.00 ? 726 SER B N   1  
ATOM 8779   C CA  . SER B 2 726 ? -90.577  -12.966 18.599  1.00 0.00 ? 726 SER B CA  1  
ATOM 8780   C C   . SER B 2 726 ? -91.358  -13.421 19.806  1.00 0.00 ? 726 SER B C   1  
ATOM 8781   O O   . SER B 2 726 ? -92.355  -14.038 19.625  1.00 0.00 ? 726 SER B O   1  
ATOM 8782   C CB  . SER B 2 726 ? -89.241  -13.667 18.427  1.00 0.00 ? 726 SER B CB  1  
ATOM 8783   O OG  . SER B 2 726 ? -89.376  -15.104 18.325  1.00 0.00 ? 726 SER B OG  1  
ATOM 8784   N N   . VAL B 2 727 ? -90.844  -13.026 21.019  1.00 0.00 ? 727 VAL B N   1  
ATOM 8785   C CA  . VAL B 2 727 ? -91.464  -13.393 22.309  1.00 0.00 ? 727 VAL B CA  1  
ATOM 8786   C C   . VAL B 2 727 ? -92.899  -12.760 22.364  1.00 0.00 ? 727 VAL B C   1  
ATOM 8787   O O   . VAL B 2 727 ? -93.901  -13.453 22.730  1.00 0.00 ? 727 VAL B O   1  
ATOM 8788   C CB  . VAL B 2 727 ? -90.685  -13.070 23.555  1.00 0.00 ? 727 VAL B CB  1  
ATOM 8789   C CG1 . VAL B 2 727 ? -89.324  -13.768 23.570  1.00 0.00 ? 727 VAL B CG1 1  
ATOM 8790   C CG2 . VAL B 2 727 ? -90.605  -11.546 23.801  1.00 0.00 ? 727 VAL B CG2 1  
ATOM 8791   N N   . HIS B 2 728 ? -93.093  -11.520 21.892  1.00 0.00 ? 728 HIS B N   1  
ATOM 8792   C CA  . HIS B 2 728 ? -94.359  -10.915 21.849  1.00 0.00 ? 728 HIS B CA  1  
ATOM 8793   C C   . HIS B 2 728 ? -95.326  -11.615 20.956  1.00 0.00 ? 728 HIS B C   1  
ATOM 8794   O O   . HIS B 2 728 ? -96.572  -11.779 21.224  1.00 0.00 ? 728 HIS B O   1  
ATOM 8795   C CB  . HIS B 2 728 ? -94.254  -9.372  21.546  1.00 0.00 ? 728 HIS B CB  1  
ATOM 8796   C CG  . HIS B 2 728 ? -94.556  -8.878  20.207  1.00 0.00 ? 728 HIS B CG  1  
ATOM 8797   N ND1 . HIS B 2 728 ? -93.779  -7.993  19.535  1.00 0.00 ? 728 HIS B ND1 1  
ATOM 8798   C CD2 . HIS B 2 728 ? -95.649  -9.084  19.478  1.00 0.00 ? 728 HIS B CD2 1  
ATOM 8799   C CE1 . HIS B 2 728 ? -94.479  -7.691  18.407  1.00 0.00 ? 728 HIS B CE1 1  
ATOM 8800   N NE2 . HIS B 2 728 ? -95.600  -8.355  18.290  1.00 0.00 ? 728 HIS B NE2 1  
ATOM 8801   N N   . ASN B 2 729 ? -94.725  -12.037 19.801  1.00 0.00 ? 729 ASN B N   1  
ATOM 8802   C CA  . ASN B 2 729 ? -95.473  -12.699 18.693  1.00 0.00 ? 729 ASN B CA  1  
ATOM 8803   C C   . ASN B 2 729 ? -96.038  -13.981 19.221  1.00 0.00 ? 729 ASN B C   1  
ATOM 8804   O O   . ASN B 2 729 ? -97.162  -14.344 18.849  1.00 0.00 ? 729 ASN B O   1  
ATOM 8805   C CB  . ASN B 2 729 ? -94.689  -13.045 17.387  1.00 0.00 ? 729 ASN B CB  1  
ATOM 8806   C CG  . ASN B 2 729 ? -94.347  -11.749 16.650  1.00 0.00 ? 729 ASN B CG  1  
ATOM 8807   O OD1 . ASN B 2 729 ? -94.904  -10.636 16.810  1.00 0.00 ? 729 ASN B OD1 1  
ATOM 8808   N ND2 . ASN B 2 729 ? -93.205  -11.790 15.851  1.00 0.00 ? 729 ASN B ND2 1  
ATOM 8809   N N   . THR B 2 730 ? -95.180  -14.684 19.998  1.00 0.00 ? 730 THR B N   1  
ATOM 8810   C CA  . THR B 2 730 ? -95.491  -16.043 20.516  1.00 0.00 ? 730 THR B CA  1  
ATOM 8811   C C   . THR B 2 730 ? -96.661  -15.840 21.438  1.00 0.00 ? 730 THR B C   1  
ATOM 8812   O O   . THR B 2 730 ? -97.657  -16.629 21.394  1.00 0.00 ? 730 THR B O   1  
ATOM 8813   C CB  . THR B 2 730 ? -94.366  -16.741 21.334  1.00 0.00 ? 730 THR B CB  1  
ATOM 8814   O OG1 . THR B 2 730 ? -93.209  -16.668 20.526  1.00 0.00 ? 730 THR B OG1 1  
ATOM 8815   C CG2 . THR B 2 730 ? -94.769  -18.206 21.683  1.00 0.00 ? 730 THR B CG2 1  
ATOM 8816   N N   . PHE B 2 731 ? -96.687  -14.781 22.255  1.00 0.00 ? 731 PHE B N   1  
ATOM 8817   C CA  . PHE B 2 731 ? -97.712  -14.460 23.238  1.00 0.00 ? 731 PHE B CA  1  
ATOM 8818   C C   . PHE B 2 731 ? -98.994  -14.286 22.506  1.00 0.00 ? 731 PHE B C   1  
ATOM 8819   O O   . PHE B 2 731 ? -100.019 -14.773 22.919  1.00 0.00 ? 731 PHE B O   1  
ATOM 8820   C CB  . PHE B 2 731 ? -97.406  -13.157 24.000  1.00 0.00 ? 731 PHE B CB  1  
ATOM 8821   C CG  . PHE B 2 731 ? -97.779  -12.949 25.447  1.00 0.00 ? 731 PHE B CG  1  
ATOM 8822   C CD1 . PHE B 2 731 ? -98.350  -13.860 26.256  1.00 0.00 ? 731 PHE B CD1 1  
ATOM 8823   C CD2 . PHE B 2 731 ? -97.397  -11.688 25.923  1.00 0.00 ? 731 PHE B CD2 1  
ATOM 8824   C CE1 . PHE B 2 731 ? -98.594  -13.552 27.599  1.00 0.00 ? 731 PHE B CE1 1  
ATOM 8825   C CE2 . PHE B 2 731 ? -97.591  -11.393 27.269  1.00 0.00 ? 731 PHE B CE2 1  
ATOM 8826   C CZ  . PHE B 2 731 ? -98.201  -12.345 28.072  1.00 0.00 ? 731 PHE B CZ  1  
ATOM 8827   N N   . LEU B 2 732 ? -98.972  -13.484 21.429  1.00 0.00 ? 732 LEU B N   1  
ATOM 8828   C CA  . LEU B 2 732 ? -100.041 -13.038 20.676  1.00 0.00 ? 732 LEU B CA  1  
ATOM 8829   C C   . LEU B 2 732 ? -100.644 -14.233 19.955  1.00 0.00 ? 732 LEU B C   1  
ATOM 8830   O O   . LEU B 2 732 ? -101.866 -14.392 19.891  1.00 0.00 ? 732 LEU B O   1  
ATOM 8831   C CB  . LEU B 2 732 ? -99.540  -12.116 19.552  1.00 0.00 ? 732 LEU B CB  1  
ATOM 8832   C CG  . LEU B 2 732 ? -100.537 -11.693 18.452  1.00 0.00 ? 732 LEU B CG  1  
ATOM 8833   C CD1 . LEU B 2 732 ? -101.757 -10.974 19.084  1.00 0.00 ? 732 LEU B CD1 1  
ATOM 8834   C CD2 . LEU B 2 732 ? -99.894  -10.829 17.425  1.00 0.00 ? 732 LEU B CD2 1  
ATOM 8835   N N   . THR B 2 733 ? -99.760  -15.166 19.457  1.00 0.00 ? 733 THR B N   1  
ATOM 8836   C CA  . THR B 2 733 ? -100.252 -16.390 18.800  1.00 0.00 ? 733 THR B CA  1  
ATOM 8837   C C   . THR B 2 733 ? -101.023 -17.262 19.714  1.00 0.00 ? 733 THR B C   1  
ATOM 8838   O O   . THR B 2 733 ? -102.040 -17.827 19.298  1.00 0.00 ? 733 THR B O   1  
ATOM 8839   C CB  . THR B 2 733 ? -99.086  -17.155 18.140  1.00 0.00 ? 733 THR B CB  1  
ATOM 8840   O OG1 . THR B 2 733 ? -98.304  -16.279 17.295  1.00 0.00 ? 733 THR B OG1 1  
ATOM 8841   C CG2 . THR B 2 733 ? -99.641  -18.250 17.200  1.00 0.00 ? 733 THR B CG2 1  
ATOM 8842   N N   . ASN B 2 734 ? -100.606 -17.485 20.957  1.00 0.00 ? 734 ASN B N   1  
ATOM 8843   C CA  . ASN B 2 734 ? -101.352 -18.361 21.790  1.00 0.00 ? 734 ASN B CA  1  
ATOM 8844   C C   . ASN B 2 734 ? -102.737 -17.844 22.088  1.00 0.00 ? 734 ASN B C   1  
ATOM 8845   O O   . ASN B 2 734 ? -103.740 -18.519 21.937  1.00 0.00 ? 734 ASN B O   1  
ATOM 8846   C CB  . ASN B 2 734 ? -100.624 -18.662 23.113  1.00 0.00 ? 734 ASN B CB  1  
ATOM 8847   C CG  . ASN B 2 734 ? -99.154  -19.207 22.789  1.00 0.00 ? 734 ASN B CG  1  
ATOM 8848   O OD1 . ASN B 2 734 ? -98.879  -19.589 21.653  1.00 0.00 ? 734 ASN B OD1 1  
ATOM 8849   N ND2 . ASN B 2 734 ? -98.286  -19.203 23.878  1.00 0.00 ? 734 ASN B ND2 1  
ATOM 8850   N N   . ILE B 2 735 ? -102.789 -16.508 22.329  1.00 0.00 ? 735 ILE B N   1  
ATOM 8851   C CA  . ILE B 2 735 ? -104.024 -15.840 22.493  1.00 0.00 ? 735 ILE B CA  1  
ATOM 8852   C C   . ILE B 2 735 ? -104.927 -15.881 21.287  1.00 0.00 ? 735 ILE B C   1  
ATOM 8853   O O   . ILE B 2 735 ? -106.164 -15.970 21.472  1.00 0.00 ? 735 ILE B O   1  
ATOM 8854   C CB  . ILE B 2 735 ? -103.837 -14.370 22.915  1.00 0.00 ? 735 ILE B CB  1  
ATOM 8855   C CG1 . ILE B 2 735 ? -103.311 -14.186 24.412  1.00 0.00 ? 735 ILE B CG1 1  
ATOM 8856   C CG2 . ILE B 2 735 ? -105.130 -13.618 22.912  1.00 0.00 ? 735 ILE B CG2 1  
ATOM 8857   C CD1 . ILE B 2 735 ? -103.123 -12.719 24.836  1.00 0.00 ? 735 ILE B CD1 1  
ATOM 8858   N N   . LEU B 2 736 ? -104.422 -15.833 20.021  1.00 0.00 ? 736 LEU B N   1  
ATOM 8859   C CA  . LEU B 2 736 ? -105.222 -15.871 18.783  1.00 0.00 ? 736 LEU B CA  1  
ATOM 8860   C C   . LEU B 2 736 ? -105.899 -17.241 18.698  1.00 0.00 ? 736 LEU B C   1  
ATOM 8861   O O   . LEU B 2 736 ? -107.126 -17.354 18.386  1.00 0.00 ? 736 LEU B O   1  
ATOM 8862   C CB  . LEU B 2 736 ? -104.416 -15.677 17.503  1.00 0.00 ? 736 LEU B CB  1  
ATOM 8863   C CG  . LEU B 2 736 ? -103.877 -14.174 17.267  1.00 0.00 ? 736 LEU B CG  1  
ATOM 8864   C CD1 . LEU B 2 736 ? -102.869 -13.996 16.117  1.00 0.00 ? 736 LEU B CD1 1  
ATOM 8865   C CD2 . LEU B 2 736 ? -105.064 -13.138 17.067  1.00 0.00 ? 736 LEU B CD2 1  
ATOM 8866   N N   . SER B 2 737 ? -105.154 -18.331 19.004  1.00 0.00 ? 737 SER B N   1  
ATOM 8867   C CA  . SER B 2 737 ? -105.730 -19.654 18.939  1.00 0.00 ? 737 SER B CA  1  
ATOM 8868   C C   . SER B 2 737 ? -106.883 -19.860 19.897  1.00 0.00 ? 737 SER B C   1  
ATOM 8869   O O   . SER B 2 737 ? -107.956 -20.372 19.584  1.00 0.00 ? 737 SER B O   1  
ATOM 8870   C CB  . SER B 2 737 ? -104.759 -20.756 19.328  1.00 0.00 ? 737 SER B CB  1  
ATOM 8871   O OG  . SER B 2 737 ? -103.551 -20.624 18.529  1.00 0.00 ? 737 SER B OG  1  
ATOM 8872   N N   . HIS B 2 738 ? -106.636 -19.345 21.196  1.00 0.00 ? 738 HIS B N   1  
ATOM 8873   C CA  . HIS B 2 738 ? -107.628 -19.413 22.238  1.00 0.00 ? 738 HIS B CA  1  
ATOM 8874   C C   . HIS B 2 738 ? -108.833 -18.638 21.958  1.00 0.00 ? 738 HIS B C   1  
ATOM 8875   O O   . HIS B 2 738 ? -109.924 -19.169 22.248  1.00 0.00 ? 738 HIS B O   1  
ATOM 8876   C CB  . HIS B 2 738 ? -107.092 -19.020 23.557  1.00 0.00 ? 738 HIS B CB  1  
ATOM 8877   C CG  . HIS B 2 738 ? -105.814 -19.776 23.859  1.00 0.00 ? 738 HIS B CG  1  
ATOM 8878   N ND1 . HIS B 2 738 ? -105.088 -19.470 25.016  1.00 0.00 ? 738 HIS B ND1 1  
ATOM 8879   C CD2 . HIS B 2 738 ? -105.175 -20.771 23.172  1.00 0.00 ? 738 HIS B CD2 1  
ATOM 8880   C CE1 . HIS B 2 738 ? -104.054 -20.315 24.978  1.00 0.00 ? 738 HIS B CE1 1  
ATOM 8881   N NE2 . HIS B 2 738 ? -104.022 -21.031 23.811  1.00 0.00 ? 738 HIS B NE2 1  
ATOM 8882   N N   . LYS B 2 739 ? -108.677 -17.430 21.348  1.00 0.00 ? 739 LYS B N   1  
ATOM 8883   C CA  . LYS B 2 739 ? -109.669 -16.519 20.950  1.00 0.00 ? 739 LYS B CA  1  
ATOM 8884   C C   . LYS B 2 739 ? -110.611 -17.160 19.975  1.00 0.00 ? 739 LYS B C   1  
ATOM 8885   O O   . LYS B 2 739 ? -111.862 -17.093 19.975  1.00 0.00 ? 739 LYS B O   1  
ATOM 8886   C CB  . LYS B 2 739 ? -108.999 -15.339 20.356  1.00 0.00 ? 739 LYS B CB  1  
ATOM 8887   C CG  . LYS B 2 739 ? -109.975 -14.183 19.988  1.00 0.00 ? 739 LYS B CG  1  
ATOM 8888   C CD  . LYS B 2 739 ? -109.334 -13.048 19.139  1.00 0.00 ? 739 LYS B CD  1  
ATOM 8889   C CE  . LYS B 2 739 ? -108.814 -13.494 17.782  1.00 0.00 ? 739 LYS B CE  1  
ATOM 8890   N NZ  . LYS B 2 739 ? -109.926 -13.995 16.943  1.00 0.00 ? 739 LYS B NZ  1  
ATOM 8891   N N   . LEU B 2 740 ? -110.031 -17.808 18.960  1.00 0.00 ? 740 LEU B N   1  
ATOM 8892   C CA  . LEU B 2 740 ? -110.841 -18.322 17.912  1.00 0.00 ? 740 LEU B CA  1  
ATOM 8893   C C   . LEU B 2 740 ? -111.714 -19.450 18.315  1.00 0.00 ? 740 LEU B C   1  
ATOM 8894   O O   . LEU B 2 740 ? -112.925 -19.345 18.129  1.00 0.00 ? 740 LEU B O   1  
ATOM 8895   C CB  . LEU B 2 740 ? -109.921 -18.721 16.690  1.00 0.00 ? 740 LEU B CB  1  
ATOM 8896   C CG  . LEU B 2 740 ? -109.256 -17.514 15.925  1.00 0.00 ? 740 LEU B CG  1  
ATOM 8897   C CD1 . LEU B 2 740 ? -108.052 -17.924 15.015  1.00 0.00 ? 740 LEU B CD1 1  
ATOM 8898   C CD2 . LEU B 2 740 ? -110.248 -16.699 15.039  1.00 0.00 ? 740 LEU B CD2 1  
ATOM 8899   N N   . PHE B 2 741 ? -111.203 -20.454 19.008  1.00 0.00 ? 741 PHE B N   1  
ATOM 8900   C CA  . PHE B 2 741 ? -112.107 -21.430 19.501  1.00 0.00 ? 741 PHE B CA  1  
ATOM 8901   C C   . PHE B 2 741 ? -113.013 -21.041 20.637  1.00 0.00 ? 741 PHE B C   1  
ATOM 8902   O O   . PHE B 2 741 ? -114.217 -21.247 20.512  1.00 0.00 ? 741 PHE B O   1  
ATOM 8903   C CB  . PHE B 2 741 ? -111.331 -22.787 19.824  1.00 0.00 ? 741 PHE B CB  1  
ATOM 8904   C CG  . PHE B 2 741 ? -112.051 -23.954 19.356  1.00 0.00 ? 741 PHE B CG  1  
ATOM 8905   C CD1 . PHE B 2 741 ? -113.318 -24.360 19.901  1.00 0.00 ? 741 PHE B CD1 1  
ATOM 8906   C CD2 . PHE B 2 741 ? -111.664 -24.385 18.045  1.00 0.00 ? 741 PHE B CD2 1  
ATOM 8907   C CE1 . PHE B 2 741 ? -114.084 -25.359 19.237  1.00 0.00 ? 741 PHE B CE1 1  
ATOM 8908   C CE2 . PHE B 2 741 ? -112.461 -25.394 17.503  1.00 0.00 ? 741 PHE B CE2 1  
ATOM 8909   C CZ  . PHE B 2 741 ? -113.617 -25.900 18.094  1.00 0.00 ? 741 PHE B CZ  1  
ATOM 8910   N N   . ALA B 2 742 ? -112.426 -20.648 21.786  1.00 0.00 ? 742 ALA B N   1  
ATOM 8911   C CA  . ALA B 2 742 ? -113.350 -20.375 22.913  1.00 0.00 ? 742 ALA B CA  1  
ATOM 8912   C C   . ALA B 2 742 ? -114.003 -18.977 22.901  1.00 0.00 ? 742 ALA B C   1  
ATOM 8913   O O   . ALA B 2 742 ? -115.221 -18.804 23.033  1.00 0.00 ? 742 ALA B O   1  
ATOM 8914   C CB  . ALA B 2 742 ? -112.601 -20.428 24.294  1.00 0.00 ? 742 ALA B CB  1  
ATOM 8915   N N   . THR B 2 743 ? -113.140 -17.923 22.883  1.00 0.00 ? 743 THR B N   1  
ATOM 8916   C CA  . THR B 2 743 ? -113.531 -16.622 23.382  1.00 0.00 ? 743 THR B CA  1  
ATOM 8917   C C   . THR B 2 743 ? -113.718 -15.739 22.153  1.00 0.00 ? 743 THR B C   1  
ATOM 8918   O O   . THR B 2 743 ? -113.517 -16.252 21.020  1.00 0.00 ? 743 THR B O   1  
ATOM 8919   C CB  . THR B 2 743 ? -112.388 -16.121 24.232  1.00 0.00 ? 743 THR B CB  1  
ATOM 8920   O OG1 . THR B 2 743 ? -112.097 -17.146 25.171  1.00 0.00 ? 743 THR B OG1 1  
ATOM 8921   C CG2 . THR B 2 743 ? -112.687 -14.759 25.045  1.00 0.00 ? 743 THR B CG2 1  
ATOM 8922   N N   . GLN B 2 756 ? -116.225 -19.044 19.644  1.00 0.00 ? 756 GLN B N   1  
ATOM 8923   C CA  . GLN B 2 756 ? -116.964 -17.799 19.765  1.00 0.00 ? 756 GLN B CA  1  
ATOM 8924   C C   . GLN B 2 756 ? -117.969 -17.577 20.832  1.00 0.00 ? 756 GLN B C   1  
ATOM 8925   O O   . GLN B 2 756 ? -118.302 -16.405 20.910  1.00 0.00 ? 756 GLN B O   1  
ATOM 8926   C CB  . GLN B 2 756 ? -117.551 -17.429 18.390  1.00 0.00 ? 756 GLN B CB  1  
ATOM 8927   C CG  . GLN B 2 756 ? -118.708 -18.427 17.991  1.00 0.00 ? 756 GLN B CG  1  
ATOM 8928   C CD  . GLN B 2 756 ? -119.219 -18.010 16.572  1.00 0.00 ? 756 GLN B CD  1  
ATOM 8929   O OE1 . GLN B 2 756 ? -118.347 -17.687 15.743  1.00 0.00 ? 756 GLN B OE1 1  
ATOM 8930   N NE2 . GLN B 2 756 ? -120.604 -18.014 16.420  1.00 0.00 ? 756 GLN B NE2 1  
ATOM 8931   N N   . PRO B 2 757 ? -118.529 -18.452 21.610  1.00 0.00 ? 757 PRO B N   1  
ATOM 8932   C CA  . PRO B 2 757 ? -119.477 -18.154 22.614  1.00 0.00 ? 757 PRO B CA  1  
ATOM 8933   C C   . PRO B 2 757 ? -119.180 -17.358 23.843  1.00 0.00 ? 757 PRO B C   1  
ATOM 8934   O O   . PRO B 2 757 ? -120.197 -16.932 24.384  1.00 0.00 ? 757 PRO B O   1  
ATOM 8935   C CB  . PRO B 2 757 ? -120.081 -19.442 23.101  1.00 0.00 ? 757 PRO B CB  1  
ATOM 8936   C CG  . PRO B 2 757 ? -119.032 -20.474 22.798  1.00 0.00 ? 757 PRO B CG  1  
ATOM 8937   C CD  . PRO B 2 757 ? -118.311 -19.915 21.596  1.00 0.00 ? 757 PRO B CD  1  
ATOM 8938   N N   . TYR B 2 758 ? -117.993 -17.450 24.387  1.00 0.00 ? 758 TYR B N   1  
ATOM 8939   C CA  . TYR B 2 758 ? -117.733 -17.105 25.769  1.00 0.00 ? 758 TYR B CA  1  
ATOM 8940   C C   . TYR B 2 758 ? -117.904 -15.632 26.184  1.00 0.00 ? 758 TYR B C   1  
ATOM 8941   O O   . TYR B 2 758 ? -118.636 -15.455 27.168  1.00 0.00 ? 758 TYR B O   1  
ATOM 8942   C CB  . TYR B 2 758 ? -116.443 -17.770 26.324  1.00 0.00 ? 758 TYR B CB  1  
ATOM 8943   C CG  . TYR B 2 758 ? -116.652 -18.324 27.739  1.00 0.00 ? 758 TYR B CG  1  
ATOM 8944   C CD1 . TYR B 2 758 ? -117.351 -19.563 27.845  1.00 0.00 ? 758 TYR B CD1 1  
ATOM 8945   C CD2 . TYR B 2 758 ? -116.367 -17.597 28.892  1.00 0.00 ? 758 TYR B CD2 1  
ATOM 8946   C CE1 . TYR B 2 758 ? -117.699 -20.101 29.099  1.00 0.00 ? 758 TYR B CE1 1  
ATOM 8947   C CE2 . TYR B 2 758 ? -116.596 -18.173 30.144  1.00 0.00 ? 758 TYR B CE2 1  
ATOM 8948   C CZ  . TYR B 2 758 ? -117.288 -19.437 30.270  1.00 0.00 ? 758 TYR B CZ  1  
ATOM 8949   O OH  . TYR B 2 758 ? -117.716 -19.962 31.540  1.00 0.00 ? 758 TYR B OH  1  
ATOM 8950   N N   . PRO B 2 759 ? -117.350 -14.680 25.470  1.00 0.00 ? 759 PRO B N   1  
ATOM 8951   C CA  . PRO B 2 759 ? -117.717 -13.288 25.645  1.00 0.00 ? 759 PRO B CA  1  
ATOM 8952   C C   . PRO B 2 759 ? -119.144 -12.927 25.397  1.00 0.00 ? 759 PRO B C   1  
ATOM 8953   O O   . PRO B 2 759 ? -119.563 -11.948 25.987  1.00 0.00 ? 759 PRO B O   1  
ATOM 8954   C CB  . PRO B 2 759 ? -116.671 -12.512 24.872  1.00 0.00 ? 759 PRO B CB  1  
ATOM 8955   C CG  . PRO B 2 759 ? -116.411 -13.428 23.679  1.00 0.00 ? 759 PRO B CG  1  
ATOM 8956   C CD  . PRO B 2 759 ? -116.730 -14.864 24.117  1.00 0.00 ? 759 PRO B CD  1  
ATOM 8957   N N   . THR B 2 760 ? -119.893 -13.748 24.548  1.00 0.00 ? 760 THR B N   1  
ATOM 8958   C CA  . THR B 2 760 ? -121.275 -13.527 24.357  1.00 0.00 ? 760 THR B CA  1  
ATOM 8959   C C   . THR B 2 760 ? -122.065 -13.727 25.584  1.00 0.00 ? 760 THR B C   1  
ATOM 8960   O O   . THR B 2 760 ? -122.813 -12.874 26.024  1.00 0.00 ? 760 THR B O   1  
ATOM 8961   C CB  . THR B 2 760 ? -121.845 -14.316 23.244  1.00 0.00 ? 760 THR B CB  1  
ATOM 8962   O OG1 . THR B 2 760 ? -121.014 -14.298 22.069  1.00 0.00 ? 760 THR B OG1 1  
ATOM 8963   C CG2 . THR B 2 760 ? -123.324 -13.809 22.931  1.00 0.00 ? 760 THR B CG2 1  
ATOM 8964   N N   . SER B 2 761 ? -121.672 -14.867 26.193  1.00 0.00 ? 761 SER B N   1  
ATOM 8965   C CA  . SER B 2 761 ? -122.249 -15.140 27.465  1.00 0.00 ? 761 SER B CA  1  
ATOM 8966   C C   . SER B 2 761 ? -121.909 -14.150 28.571  1.00 0.00 ? 761 SER B C   1  
ATOM 8967   O O   . SER B 2 761 ? -122.780 -13.631 29.285  1.00 0.00 ? 761 SER B O   1  
ATOM 8968   C CB  . SER B 2 761 ? -121.826 -16.586 27.944  1.00 0.00 ? 761 SER B CB  1  
ATOM 8969   O OG  . SER B 2 761 ? -121.817 -17.508 26.875  1.00 0.00 ? 761 SER B OG  1  
ATOM 8970   N N   . LEU B 2 762 ? -120.632 -13.733 28.730  1.00 0.00 ? 762 LEU B N   1  
ATOM 8971   C CA  . LEU B 2 762 ? -120.245 -12.837 29.755  1.00 0.00 ? 762 LEU B CA  1  
ATOM 8972   C C   . LEU B 2 762 ? -120.947 -11.430 29.715  1.00 0.00 ? 762 LEU B C   1  
ATOM 8973   O O   . LEU B 2 762 ? -121.444 -10.958 30.751  1.00 0.00 ? 762 LEU B O   1  
ATOM 8974   C CB  . LEU B 2 762 ? -118.704 -12.540 29.692  1.00 0.00 ? 762 LEU B CB  1  
ATOM 8975   C CG  . LEU B 2 762 ? -117.867 -13.818 29.926  1.00 0.00 ? 762 LEU B CG  1  
ATOM 8976   C CD1 . LEU B 2 762 ? -116.415 -13.648 29.554  1.00 0.00 ? 762 LEU B CD1 1  
ATOM 8977   C CD2 . LEU B 2 762 ? -118.026 -14.270 31.473  1.00 0.00 ? 762 LEU B CD2 1  
ATOM 8978   N N   . VAL B 2 763 ? -121.092 -10.896 28.497  1.00 0.00 ? 763 VAL B N   1  
ATOM 8979   C CA  . VAL B 2 763 ? -121.795 -9.586  28.325  1.00 0.00 ? 763 VAL B CA  1  
ATOM 8980   C C   . VAL B 2 763 ? -123.256 -9.567  28.721  1.00 0.00 ? 763 VAL B C   1  
ATOM 8981   O O   . VAL B 2 763 ? -123.813 -8.648  29.356  1.00 0.00 ? 763 VAL B O   1  
ATOM 8982   C CB  . VAL B 2 763 ? -121.490 -8.914  26.945  1.00 0.00 ? 763 VAL B CB  1  
ATOM 8983   C CG1 . VAL B 2 763 ? -122.072 -9.605  25.724  1.00 0.00 ? 763 VAL B CG1 1  
ATOM 8984   C CG2 . VAL B 2 763 ? -121.998 -7.508  27.027  1.00 0.00 ? 763 VAL B CG2 1  
ATOM 8985   N N   . LEU B 2 764 ? -124.019 -10.674 28.446  1.00 0.00 ? 764 LEU B N   1  
ATOM 8986   C CA  . LEU B 2 764 ? -125.406 -10.887 28.842  1.00 0.00 ? 764 LEU B CA  1  
ATOM 8987   C C   . LEU B 2 764 ? -125.531 -10.937 30.328  1.00 0.00 ? 764 LEU B C   1  
ATOM 8988   O O   . LEU B 2 764 ? -126.420 -10.347 30.901  1.00 0.00 ? 764 LEU B O   1  
ATOM 8989   C CB  . LEU B 2 764 ? -126.001 -12.203 28.288  1.00 0.00 ? 764 LEU B CB  1  
ATOM 8990   C CG  . LEU B 2 764 ? -127.442 -12.210 27.846  1.00 0.00 ? 764 LEU B CG  1  
ATOM 8991   C CD1 . LEU B 2 764 ? -128.379 -11.826 29.021  1.00 0.00 ? 764 LEU B CD1 1  
ATOM 8992   C CD2 . LEU B 2 764 ? -127.644 -11.286 26.593  1.00 0.00 ? 764 LEU B CD2 1  
ATOM 8993   N N   . LEU B 2 765 ? -124.574 -11.620 31.070  1.00 0.00 ? 765 LEU B N   1  
ATOM 8994   C CA  . LEU B 2 765 ? -124.573 -11.709 32.540  1.00 0.00 ? 765 LEU B CA  1  
ATOM 8995   C C   . LEU B 2 765 ? -124.485 -10.317 33.149  1.00 0.00 ? 765 LEU B C   1  
ATOM 8996   O O   . LEU B 2 765 ? -125.231 -10.044 34.082  1.00 0.00 ? 765 LEU B O   1  
ATOM 8997   C CB  . LEU B 2 765 ? -123.454 -12.564 33.067  1.00 0.00 ? 765 LEU B CB  1  
ATOM 8998   C CG  . LEU B 2 765 ? -123.719 -14.058 33.255  1.00 0.00 ? 765 LEU B CG  1  
ATOM 8999   C CD1 . LEU B 2 765 ? -124.048 -14.710 31.934  1.00 0.00 ? 765 LEU B CD1 1  
ATOM 9000   C CD2 . LEU B 2 765 ? -122.678 -14.732 34.125  1.00 0.00 ? 765 LEU B CD2 1  
ATOM 9001   N N   . LEU B 2 766 ? -123.597 -9.480  32.462  1.00 0.00 ? 766 LEU B N   1  
ATOM 9002   C CA  . LEU B 2 766 ? -123.433 -8.065  32.955  1.00 0.00 ? 766 LEU B CA  1  
ATOM 9003   C C   . LEU B 2 766 ? -124.658 -7.215  32.908  1.00 0.00 ? 766 LEU B C   1  
ATOM 9004   O O   . LEU B 2 766 ? -125.057 -6.508  33.804  1.00 0.00 ? 766 LEU B O   1  
ATOM 9005   C CB  . LEU B 2 766 ? -122.271 -7.484  32.099  1.00 0.00 ? 766 LEU B CB  1  
ATOM 9006   C CG  . LEU B 2 766 ? -121.612 -6.168  32.619  1.00 0.00 ? 766 LEU B CG  1  
ATOM 9007   C CD1 . LEU B 2 766 ? -122.402 -4.924  32.217  1.00 0.00 ? 766 LEU B CD1 1  
ATOM 9008   C CD2 . LEU B 2 766 ? -121.490 -6.227  34.136  1.00 0.00 ? 766 LEU B CD2 1  
ATOM 9009   N N   . ASN B 2 767 ? -125.451 -7.386  31.795  1.00 0.00 ? 767 ASN B N   1  
ATOM 9010   C CA  . ASN B 2 767 ? -126.742 -6.748  31.694  1.00 0.00 ? 767 ASN B CA  1  
ATOM 9011   C C   . ASN B 2 767 ? -127.751 -7.179  32.718  1.00 0.00 ? 767 ASN B C   1  
ATOM 9012   O O   . ASN B 2 767 ? -128.394 -6.332  33.331  1.00 0.00 ? 767 ASN B O   1  
ATOM 9013   C CB  . ASN B 2 767 ? -127.313 -6.995  30.263  1.00 0.00 ? 767 ASN B CB  1  
ATOM 9014   C CG  . ASN B 2 767 ? -126.366 -6.535  29.203  1.00 0.00 ? 767 ASN B CG  1  
ATOM 9015   O OD1 . ASN B 2 767 ? -125.949 -7.294  28.311  1.00 0.00 ? 767 ASN B OD1 1  
ATOM 9016   N ND2 . ASN B 2 767 ? -125.990 -5.211  29.300  1.00 0.00 ? 767 ASN B ND2 1  
ATOM 9017   N N   . SER B 2 768 ? -127.836 -8.444  32.990  1.00 0.00 ? 768 SER B N   1  
ATOM 9018   C CA  . SER B 2 768 ? -128.761 -8.994  33.927  1.00 0.00 ? 768 SER B CA  1  
ATOM 9019   C C   . SER B 2 768 ? -128.564 -8.520  35.382  1.00 0.00 ? 768 SER B C   1  
ATOM 9020   O O   . SER B 2 768 ? -129.515 -8.068  36.008  1.00 0.00 ? 768 SER B O   1  
ATOM 9021   C CB  . SER B 2 768 ? -128.723 -10.551 33.931  1.00 0.00 ? 768 SER B CB  1  
ATOM 9022   O OG  . SER B 2 768 ? -128.604 -11.186 32.606  1.00 0.00 ? 768 SER B OG  1  
ATOM 9023   N N   . VAL B 2 769 ? -127.273 -8.377  35.823  1.00 0.00 ? 769 VAL B N   1  
ATOM 9024   C CA  . VAL B 2 769 ? -126.931 -7.786  37.091  1.00 0.00 ? 769 VAL B CA  1  
ATOM 9025   C C   . VAL B 2 769 ? -127.332 -6.355  37.186  1.00 0.00 ? 769 VAL B C   1  
ATOM 9026   O O   . VAL B 2 769 ? -127.854 -6.067  38.234  1.00 0.00 ? 769 VAL B O   1  
ATOM 9027   C CB  . VAL B 2 769 ? -125.442 -7.995  37.605  1.00 0.00 ? 769 VAL B CB  1  
ATOM 9028   C CG1 . VAL B 2 769 ? -125.177 -9.487  37.778  1.00 0.00 ? 769 VAL B CG1 1  
ATOM 9029   C CG2 . VAL B 2 769 ? -124.413 -7.458  36.655  1.00 0.00 ? 769 VAL B CG2 1  
ATOM 9030   N N   . TYR B 2 770 ? -127.197 -5.456  36.186  1.00 0.00 ? 770 TYR B N   1  
ATOM 9031   C CA  . TYR B 2 770 ? -127.606 -4.045  36.176  1.00 0.00 ? 770 TYR B CA  1  
ATOM 9032   C C   . TYR B 2 770 ? -129.085 -3.930  36.332  1.00 0.00 ? 770 TYR B C   1  
ATOM 9033   O O   . TYR B 2 770 ? -129.624 -3.085  37.055  1.00 0.00 ? 770 TYR B O   1  
ATOM 9034   C CB  . TYR B 2 770 ? -126.958 -3.265  34.934  1.00 0.00 ? 770 TYR B CB  1  
ATOM 9035   C CG  . TYR B 2 770 ? -125.709 -2.656  35.473  1.00 0.00 ? 770 TYR B CG  1  
ATOM 9036   C CD1 . TYR B 2 770 ? -125.780 -1.800  36.585  1.00 0.00 ? 770 TYR B CD1 1  
ATOM 9037   C CD2 . TYR B 2 770 ? -124.519 -2.824  34.805  1.00 0.00 ? 770 TYR B CD2 1  
ATOM 9038   C CE1 . TYR B 2 770 ? -124.697 -0.998  36.962  1.00 0.00 ? 770 TYR B CE1 1  
ATOM 9039   C CE2 . TYR B 2 770 ? -123.409 -2.061  35.194  1.00 0.00 ? 770 TYR B CE2 1  
ATOM 9040   C CZ  . TYR B 2 770 ? -123.497 -1.174  36.219  1.00 0.00 ? 770 TYR B CZ  1  
ATOM 9041   O OH  . TYR B 2 770 ? -122.458 -0.356  36.610  1.00 0.00 ? 770 TYR B OH  1  
ATOM 9042   N N   . GLU B 2 771 ? -129.875 -4.875  35.600  1.00 0.00 ? 771 GLU B N   1  
ATOM 9043   C CA  . GLU B 2 771 ? -131.296 -4.880  35.626  1.00 0.00 ? 771 GLU B CA  1  
ATOM 9044   C C   . GLU B 2 771 ? -131.742 -5.172  37.030  1.00 0.00 ? 771 GLU B C   1  
ATOM 9045   O O   . GLU B 2 771 ? -132.607 -4.442  37.576  1.00 0.00 ? 771 GLU B O   1  
ATOM 9046   C CB  . GLU B 2 771 ? -131.872 -5.912  34.641  1.00 0.00 ? 771 GLU B CB  1  
ATOM 9047   C CG  . GLU B 2 771 ? -133.369 -6.104  34.465  1.00 0.00 ? 771 GLU B CG  1  
ATOM 9048   C CD  . GLU B 2 771 ? -133.884 -7.211  35.476  1.00 0.00 ? 771 GLU B CD  1  
ATOM 9049   O OE1 . GLU B 2 771 ? -133.215 -8.271  35.568  1.00 0.00 ? 771 GLU B OE1 1  
ATOM 9050   O OE2 . GLU B 2 771 ? -134.933 -6.957  36.124  1.00 0.00 ? 771 GLU B OE2 1  
ATOM 9051   N N   . PHE B 2 772 ? -131.160 -6.171  37.756  1.00 0.00 ? 772 PHE B N   1  
ATOM 9052   C CA  . PHE B 2 772 ? -131.436 -6.398  39.149  1.00 0.00 ? 772 PHE B CA  1  
ATOM 9053   C C   . PHE B 2 772 ? -131.132 -5.313  40.086  1.00 0.00 ? 772 PHE B C   1  
ATOM 9054   O O   . PHE B 2 772 ? -131.976 -4.946  40.895  1.00 0.00 ? 772 PHE B O   1  
ATOM 9055   C CB  . PHE B 2 772 ? -130.967 -7.789  39.514  1.00 0.00 ? 772 PHE B CB  1  
ATOM 9056   C CG  . PHE B 2 772 ? -131.995 -8.491  40.293  1.00 0.00 ? 772 PHE B CG  1  
ATOM 9057   C CD1 . PHE B 2 772 ? -132.189 -8.265  41.675  1.00 0.00 ? 772 PHE B CD1 1  
ATOM 9058   C CD2 . PHE B 2 772 ? -132.855 -9.253  39.596  1.00 0.00 ? 772 PHE B CD2 1  
ATOM 9059   C CE1 . PHE B 2 772 ? -133.255 -9.019  42.346  1.00 0.00 ? 772 PHE B CE1 1  
ATOM 9060   C CE2 . PHE B 2 772 ? -133.916 -9.955  40.261  1.00 0.00 ? 772 PHE B CE2 1  
ATOM 9061   C CZ  . PHE B 2 772 ? -134.061 -9.882  41.652  1.00 0.00 ? 772 PHE B CZ  1  
ATOM 9062   N N   . VAL B 2 773 ? -129.921 -4.718  39.936  1.00 0.00 ? 773 VAL B N   1  
ATOM 9063   C CA  . VAL B 2 773 ? -129.464 -3.669  40.801  1.00 0.00 ? 773 VAL B CA  1  
ATOM 9064   C C   . VAL B 2 773 ? -130.362 -2.491  40.775  1.00 0.00 ? 773 VAL B C   1  
ATOM 9065   O O   . VAL B 2 773 ? -130.654 -1.947  41.855  1.00 0.00 ? 773 VAL B O   1  
ATOM 9066   C CB  . VAL B 2 773 ? -128.028 -3.235  40.429  1.00 0.00 ? 773 VAL B CB  1  
ATOM 9067   C CG1 . VAL B 2 773 ? -127.643 -1.823  40.971  1.00 0.00 ? 773 VAL B CG1 1  
ATOM 9068   C CG2 . VAL B 2 773 ? -127.066 -4.259  41.051  1.00 0.00 ? 773 VAL B CG2 1  
ATOM 9069   N N   . LYS B 2 774 ? -130.836 -2.181  39.530  1.00 0.00 ? 774 LYS B N   1  
ATOM 9070   C CA  . LYS B 2 774 ? -131.791 -1.101  39.217  1.00 0.00 ? 774 LYS B CA  1  
ATOM 9071   C C   . LYS B 2 774 ? -133.077 -1.318  39.834  1.00 0.00 ? 774 LYS B C   1  
ATOM 9072   O O   . LYS B 2 774 ? -133.638 -0.399  40.405  1.00 0.00 ? 774 LYS B O   1  
ATOM 9073   C CB  . LYS B 2 774 ? -132.035 -0.993  37.698  1.00 0.00 ? 774 LYS B CB  1  
ATOM 9074   C CG  . LYS B 2 774 ? -133.263 -0.095  37.122  1.00 0.00 ? 774 LYS B CG  1  
ATOM 9075   C CD  . LYS B 2 774 ? -133.203 0.027   35.600  1.00 0.00 ? 774 LYS B CD  1  
ATOM 9076   C CE  . LYS B 2 774 ? -134.242 0.917   34.917  1.00 0.00 ? 774 LYS B CE  1  
ATOM 9077   N NZ  . LYS B 2 774 ? -135.596 0.300   35.104  1.00 0.00 ? 774 LYS B NZ  1  
ATOM 9078   N N   . VAL B 2 775 ? -133.604 -2.556  39.807  1.00 0.00 ? 775 VAL B N   1  
ATOM 9079   C CA  . VAL B 2 775 ? -134.871 -2.949  40.394  1.00 0.00 ? 775 VAL B CA  1  
ATOM 9080   C C   . VAL B 2 775 ? -134.843 -2.767  41.903  1.00 0.00 ? 775 VAL B C   1  
ATOM 9081   O O   . VAL B 2 775 ? -135.857 -2.392  42.531  1.00 0.00 ? 775 VAL B O   1  
ATOM 9082   C CB  . VAL B 2 775 ? -135.339 -4.315  39.965  1.00 0.00 ? 775 VAL B CB  1  
ATOM 9083   C CG1 . VAL B 2 775 ? -136.505 -4.898  40.763  1.00 0.00 ? 775 VAL B CG1 1  
ATOM 9084   C CG2 . VAL B 2 775 ? -135.701 -4.263  38.435  1.00 0.00 ? 775 VAL B CG2 1  
ATOM 9085   N N   . TYR B 2 776 ? -133.712 -3.180  42.481  1.00 0.00 ? 776 TYR B N   1  
ATOM 9086   C CA  . TYR B 2 776 ? -133.431 -3.280  43.911  1.00 0.00 ? 776 TYR B CA  1  
ATOM 9087   C C   . TYR B 2 776 ? -133.507 -1.870  44.576  1.00 0.00 ? 776 TYR B C   1  
ATOM 9088   O O   . TYR B 2 776 ? -134.051 -1.621  45.694  1.00 0.00 ? 776 TYR B O   1  
ATOM 9089   C CB  . TYR B 2 776 ? -131.966 -3.913  44.148  1.00 0.00 ? 776 TYR B CB  1  
ATOM 9090   C CG  . TYR B 2 776 ? -131.681 -4.521  45.578  1.00 0.00 ? 776 TYR B CG  1  
ATOM 9091   C CD1 . TYR B 2 776 ? -132.499 -4.473  46.676  1.00 0.00 ? 776 TYR B CD1 1  
ATOM 9092   C CD2 . TYR B 2 776 ? -130.399 -5.070  45.786  1.00 0.00 ? 776 TYR B CD2 1  
ATOM 9093   C CE1 . TYR B 2 776 ? -132.149 -4.936  47.944  1.00 0.00 ? 776 TYR B CE1 1  
ATOM 9094   C CE2 . TYR B 2 776 ? -130.000 -5.653  46.998  1.00 0.00 ? 776 TYR B CE2 1  
ATOM 9095   C CZ  . TYR B 2 776 ? -130.825 -5.506  48.116  1.00 0.00 ? 776 TYR B CZ  1  
ATOM 9096   O OH  . TYR B 2 776 ? -130.336 -6.107  49.305  1.00 0.00 ? 776 TYR B OH  1  
ATOM 9097   N N   . CYS B 2 777 ? -132.957 -0.856  43.887  1.00 0.00 ? 777 CYS B N   1  
ATOM 9098   C CA  . CYS B 2 777 ? -133.001 0.426   44.537  1.00 0.00 ? 777 CYS B CA  1  
ATOM 9099   C C   . CYS B 2 777 ? -134.421 0.920   44.765  1.00 0.00 ? 777 CYS B C   1  
ATOM 9100   O O   . CYS B 2 777 ? -134.669 1.532   45.762  1.00 0.00 ? 777 CYS B O   1  
ATOM 9101   C CB  . CYS B 2 777 ? -132.191 1.519   43.738  1.00 0.00 ? 777 CYS B CB  1  
ATOM 9102   S SG  . CYS B 2 777 ? -132.641 1.700   42.010  1.00 0.00 ? 777 CYS B SG  1  
ATOM 9103   N N   . ASN B 2 778 ? -135.277 0.633   43.822  1.00 0.00 ? 778 ASN B N   1  
ATOM 9104   C CA  . ASN B 2 778 ? -136.655 1.084   43.780  1.00 0.00 ? 778 ASN B CA  1  
ATOM 9105   C C   . ASN B 2 778 ? -137.559 0.666   44.868  1.00 0.00 ? 778 ASN B C   1  
ATOM 9106   O O   . ASN B 2 778 ? -138.544 1.414   45.137  1.00 0.00 ? 778 ASN B O   1  
ATOM 9107   C CB  . ASN B 2 778 ? -137.209 0.618   42.393  1.00 0.00 ? 778 ASN B CB  1  
ATOM 9108   C CG  . ASN B 2 778 ? -136.527 1.157   41.112  1.00 0.00 ? 778 ASN B CG  1  
ATOM 9109   O OD1 . ASN B 2 778 ? -136.282 0.345   40.231  1.00 0.00 ? 778 ASN B OD1 1  
ATOM 9110   N ND2 . ASN B 2 778 ? -136.283 2.500   41.030  1.00 0.00 ? 778 ASN B ND2 1  
ATOM 9111   N N   . LEU B 2 779 ? -137.323 -0.548  45.513  1.00 0.00 ? 779 LEU B N   1  
ATOM 9112   C CA  . LEU B 2 779 ? -138.161 -1.267  46.405  1.00 0.00 ? 779 LEU B CA  1  
ATOM 9113   C C   . LEU B 2 779 ? -138.637 -0.490  47.523  1.00 0.00 ? 779 LEU B C   1  
ATOM 9114   O O   . LEU B 2 779 ? -139.835 -0.489  47.848  1.00 0.00 ? 779 LEU B O   1  
ATOM 9115   C CB  . LEU B 2 779 ? -137.488 -2.513  46.978  1.00 0.00 ? 779 LEU B CB  1  
ATOM 9116   C CG  . LEU B 2 779 ? -138.489 -3.458  47.708  1.00 0.00 ? 779 LEU B CG  1  
ATOM 9117   C CD1 . LEU B 2 779 ? -139.354 -4.223  46.652  1.00 0.00 ? 779 LEU B CD1 1  
ATOM 9118   C CD2 . LEU B 2 779 ? -137.683 -4.605  48.406  1.00 0.00 ? 779 LEU B CD2 1  
ATOM 9119   N N   . ASN B 2 780 ? -137.748 0.347   48.247  1.00 0.00 ? 780 ASN B N   1  
ATOM 9120   C CA  . ASN B 2 780 ? -138.203 1.200   49.263  1.00 0.00 ? 780 ASN B CA  1  
ATOM 9121   C C   . ASN B 2 780 ? -137.069 2.245   49.507  1.00 0.00 ? 780 ASN B C   1  
ATOM 9122   O O   . ASN B 2 780 ? -136.023 2.156   48.810  1.00 0.00 ? 780 ASN B O   1  
ATOM 9123   C CB  . ASN B 2 780 ? -138.592 0.317   50.520  1.00 0.00 ? 780 ASN B CB  1  
ATOM 9124   C CG  . ASN B 2 780 ? -139.539 1.145   51.477  1.00 0.00 ? 780 ASN B CG  1  
ATOM 9125   O OD1 . ASN B 2 780 ? -138.989 1.914   52.289  1.00 0.00 ? 780 ASN B OD1 1  
ATOM 9126   N ND2 . ASN B 2 780 ? -140.825 0.668   51.478  1.00 0.00 ? 780 ASN B ND2 1  
ATOM 9127   N N   . SER B 2 798 ? -145.284 0.896   46.069  1.00 0.00 ? 798 SER B N   1  
ATOM 9128   C CA  . SER B 2 798 ? -145.319 -0.212  47.099  1.00 0.00 ? 798 SER B CA  1  
ATOM 9129   C C   . SER B 2 798 ? -145.567 -1.546  46.510  1.00 0.00 ? 798 SER B C   1  
ATOM 9130   O O   . SER B 2 798 ? -144.683 -2.428  46.261  1.00 0.00 ? 798 SER B O   1  
ATOM 9131   C CB  . SER B 2 798 ? -146.357 0.013   48.205  1.00 0.00 ? 798 SER B CB  1  
ATOM 9132   O OG  . SER B 2 798 ? -146.130 1.286   48.797  1.00 0.00 ? 798 SER B OG  1  
ATOM 9133   N N   . ASN B 2 799 ? -146.879 -1.867  46.218  1.00 0.00 ? 799 ASN B N   1  
ATOM 9134   C CA  . ASN B 2 799 ? -147.360 -3.175  45.674  1.00 0.00 ? 799 ASN B CA  1  
ATOM 9135   C C   . ASN B 2 799 ? -146.865 -3.494  44.363  1.00 0.00 ? 799 ASN B C   1  
ATOM 9136   O O   . ASN B 2 799 ? -146.445 -4.625  44.132  1.00 0.00 ? 799 ASN B O   1  
ATOM 9137   C CB  . ASN B 2 799 ? -148.878 -3.300  45.546  1.00 0.00 ? 799 ASN B CB  1  
ATOM 9138   C CG  . ASN B 2 799 ? -149.458 -2.945  46.967  1.00 0.00 ? 799 ASN B CG  1  
ATOM 9139   O OD1 . ASN B 2 799 ? -149.091 -3.450  48.033  1.00 0.00 ? 799 ASN B OD1 1  
ATOM 9140   N ND2 . ASN B 2 799 ? -150.563 -2.058  46.927  1.00 0.00 ? 799 ASN B ND2 1  
ATOM 9141   N N   . GLY B 2 800 ? -146.813 -2.526  43.477  1.00 0.00 ? 800 GLY B N   1  
ATOM 9142   C CA  . GLY B 2 800 ? -146.387 -2.591  42.131  1.00 0.00 ? 800 GLY B CA  1  
ATOM 9143   C C   . GLY B 2 800 ? -144.916 -2.964  42.130  1.00 0.00 ? 800 GLY B C   1  
ATOM 9144   O O   . GLY B 2 800 ? -144.459 -3.763  41.330  1.00 0.00 ? 800 GLY B O   1  
ATOM 9145   N N   . LEU B 2 801 ? -144.124 -2.383  43.035  1.00 0.00 ? 801 LEU B N   1  
ATOM 9146   C CA  . LEU B 2 801 ? -142.729 -2.679  43.138  1.00 0.00 ? 801 LEU B CA  1  
ATOM 9147   C C   . LEU B 2 801 ? -142.501 -4.104  43.523  1.00 0.00 ? 801 LEU B C   1  
ATOM 9148   O O   . LEU B 2 801 ? -141.643 -4.742  42.904  1.00 0.00 ? 801 LEU B O   1  
ATOM 9149   C CB  . LEU B 2 801 ? -141.944 -1.940  44.304  1.00 0.00 ? 801 LEU B CB  1  
ATOM 9150   C CG  . LEU B 2 801 ? -141.605 -0.464  44.018  1.00 0.00 ? 801 LEU B CG  1  
ATOM 9151   C CD1 . LEU B 2 801 ? -140.530 -0.369  42.890  1.00 0.00 ? 801 LEU B CD1 1  
ATOM 9152   C CD2 . LEU B 2 801 ? -142.853 0.335   43.623  1.00 0.00 ? 801 LEU B CD2 1  
ATOM 9153   N N   . LEU B 2 802 ? -143.284 -4.647  44.495  1.00 0.00 ? 802 LEU B N   1  
ATOM 9154   C CA  . LEU B 2 802 ? -143.170 -6.020  44.912  1.00 0.00 ? 802 LEU B CA  1  
ATOM 9155   C C   . LEU B 2 802 ? -143.556 -6.966  43.709  1.00 0.00 ? 802 LEU B C   1  
ATOM 9156   O O   . LEU B 2 802 ? -142.855 -7.946  43.561  1.00 0.00 ? 802 LEU B O   1  
ATOM 9157   C CB  . LEU B 2 802 ? -144.102 -6.167  46.126  1.00 0.00 ? 802 LEU B CB  1  
ATOM 9158   C CG  . LEU B 2 802 ? -143.961 -7.438  47.056  1.00 0.00 ? 802 LEU B CG  1  
ATOM 9159   C CD1 . LEU B 2 802 ? -144.960 -8.543  46.602  1.00 0.00 ? 802 LEU B CD1 1  
ATOM 9160   C CD2 . LEU B 2 802 ? -142.471 -7.979  47.238  1.00 0.00 ? 802 LEU B CD2 1  
ATOM 9161   N N   . GLY B 2 803 ? -144.628 -6.730  42.888  1.00 0.00 ? 803 GLY B N   1  
ATOM 9162   C CA  . GLY B 2 803 ? -145.127 -7.557  41.845  1.00 0.00 ? 803 GLY B CA  1  
ATOM 9163   C C   . GLY B 2 803 ? -144.057 -7.644  40.768  1.00 0.00 ? 803 GLY B C   1  
ATOM 9164   O O   . GLY B 2 803 ? -143.702 -8.797  40.300  1.00 0.00 ? 803 GLY B O   1  
ATOM 9165   N N   . LYS B 2 804 ? -143.401 -6.554  40.421  1.00 0.00 ? 804 LYS B N   1  
ATOM 9166   C CA  . LYS B 2 804 ? -142.328 -6.509  39.518  1.00 0.00 ? 804 LYS B CA  1  
ATOM 9167   C C   . LYS B 2 804 ? -141.057 -7.214  39.915  1.00 0.00 ? 804 LYS B C   1  
ATOM 9168   O O   . LYS B 2 804 ? -140.366 -7.950  39.166  1.00 0.00 ? 804 LYS B O   1  
ATOM 9169   C CB  . LYS B 2 804 ? -141.865 -5.027  39.393  1.00 0.00 ? 804 LYS B CB  1  
ATOM 9170   C CG  . LYS B 2 804 ? -142.839 -4.209  38.491  1.00 0.00 ? 804 LYS B CG  1  
ATOM 9171   C CD  . LYS B 2 804 ? -142.247 -2.914  37.936  1.00 0.00 ? 804 LYS B CD  1  
ATOM 9172   C CE  . LYS B 2 804 ? -142.194 -1.655  38.854  1.00 0.00 ? 804 LYS B CE  1  
ATOM 9173   N NZ  . LYS B 2 804 ? -143.555 -1.222  39.315  1.00 0.00 ? 804 LYS B NZ  1  
ATOM 9174   N N   . PHE B 2 805 ? -140.696 -7.074  41.239  1.00 0.00 ? 805 PHE B N   1  
ATOM 9175   C CA  . PHE B 2 805 ? -139.524 -7.667  41.847  1.00 0.00 ? 805 PHE B CA  1  
ATOM 9176   C C   . PHE B 2 805 ? -139.604 -9.244  41.816  1.00 0.00 ? 805 PHE B C   1  
ATOM 9177   O O   . PHE B 2 805 ? -138.654 -9.914  41.457  1.00 0.00 ? 805 PHE B O   1  
ATOM 9178   C CB  . PHE B 2 805 ? -139.342 -7.198  43.329  1.00 0.00 ? 805 PHE B CB  1  
ATOM 9179   C CG  . PHE B 2 805 ? -138.488 -8.012  44.182  1.00 0.00 ? 805 PHE B CG  1  
ATOM 9180   C CD1 . PHE B 2 805 ? -137.126 -8.193  43.899  1.00 0.00 ? 805 PHE B CD1 1  
ATOM 9181   C CD2 . PHE B 2 805 ? -139.078 -8.699  45.283  1.00 0.00 ? 805 PHE B CD2 1  
ATOM 9182   C CE1 . PHE B 2 805 ? -136.418 -9.112  44.648  1.00 0.00 ? 805 PHE B CE1 1  
ATOM 9183   C CE2 . PHE B 2 805 ? -138.264 -9.575  46.045  1.00 0.00 ? 805 PHE B CE2 1  
ATOM 9184   C CZ  . PHE B 2 805 ? -136.952 -9.830  45.684  1.00 0.00 ? 805 PHE B CZ  1  
ATOM 9185   N N   . ASN B 2 806 ? -140.789 -9.822  42.118  1.00 0.00 ? 806 ASN B N   1  
ATOM 9186   C CA  . ASN B 2 806 ? -141.053 -11.276 42.120  1.00 0.00 ? 806 ASN B CA  1  
ATOM 9187   C C   . ASN B 2 806 ? -140.894 -11.852 40.729  1.00 0.00 ? 806 ASN B C   1  
ATOM 9188   O O   . ASN B 2 806 ? -140.284 -12.915 40.560  1.00 0.00 ? 806 ASN B O   1  
ATOM 9189   C CB  . ASN B 2 806 ? -142.475 -11.677 42.556  1.00 0.00 ? 806 ASN B CB  1  
ATOM 9190   C CG  . ASN B 2 806 ? -142.571 -11.423 44.136  1.00 0.00 ? 806 ASN B CG  1  
ATOM 9191   O OD1 . ASN B 2 806 ? -141.665 -10.876 44.753  1.00 0.00 ? 806 ASN B OD1 1  
ATOM 9192   N ND2 . ASN B 2 806 ? -143.758 -11.802 44.730  1.00 0.00 ? 806 ASN B ND2 1  
ATOM 9193   N N   . THR B 2 807 ? -141.422 -11.064 39.716  1.00 0.00 ? 807 THR B N   1  
ATOM 9194   C CA  . THR B 2 807 ? -141.280 -11.492 38.327  1.00 0.00 ? 807 THR B CA  1  
ATOM 9195   C C   . THR B 2 807 ? -139.843 -11.530 37.896  1.00 0.00 ? 807 THR B C   1  
ATOM 9196   O O   . THR B 2 807 ? -139.334 -12.434 37.271  1.00 0.00 ? 807 THR B O   1  
ATOM 9197   C CB  . THR B 2 807 ? -142.101 -10.728 37.351  1.00 0.00 ? 807 THR B CB  1  
ATOM 9198   O OG1 . THR B 2 807 ? -141.848 -9.389  37.240  1.00 0.00 ? 807 THR B OG1 1  
ATOM 9199   C CG2 . THR B 2 807 ? -143.568 -11.044 37.584  1.00 0.00 ? 807 THR B CG2 1  
ATOM 9200   N N   . ASN B 2 808 ? -139.153 -10.498 38.273  1.00 0.00 ? 808 ASN B N   1  
ATOM 9201   C CA  . ASN B 2 808 ? -137.742 -10.352 37.893  1.00 0.00 ? 808 ASN B CA  1  
ATOM 9202   C C   . ASN B 2 808 ? -136.868 -11.423 38.507  1.00 0.00 ? 808 ASN B C   1  
ATOM 9203   O O   . ASN B 2 808 ? -135.941 -11.905 37.870  1.00 0.00 ? 808 ASN B O   1  
ATOM 9204   C CB  . ASN B 2 808 ? -137.224 -8.988  38.355  1.00 0.00 ? 808 ASN B CB  1  
ATOM 9205   C CG  . ASN B 2 808 ? -137.882 -7.835  37.675  1.00 0.00 ? 808 ASN B CG  1  
ATOM 9206   O OD1 . ASN B 2 808 ? -137.849 -6.762  38.292  1.00 0.00 ? 808 ASN B OD1 1  
ATOM 9207   N ND2 . ASN B 2 808 ? -138.245 -7.977  36.361  1.00 0.00 ? 808 ASN B ND2 1  
ATOM 9208   N N   . LEU B 2 809 ? -137.181 -11.827 39.769  1.00 0.00 ? 809 LEU B N   1  
ATOM 9209   C CA  . LEU B 2 809 ? -136.461 -12.858 40.463  1.00 0.00 ? 809 LEU B CA  1  
ATOM 9210   C C   . LEU B 2 809 ? -136.569 -14.230 39.814  1.00 0.00 ? 809 LEU B C   1  
ATOM 9211   O O   . LEU B 2 809 ? -135.616 -14.970 39.719  1.00 0.00 ? 809 LEU B O   1  
ATOM 9212   C CB  . LEU B 2 809 ? -136.855 -12.917 42.034  1.00 0.00 ? 809 LEU B CB  1  
ATOM 9213   C CG  . LEU B 2 809 ? -135.943 -13.871 42.917  1.00 0.00 ? 809 LEU B CG  1  
ATOM 9214   C CD1 . LEU B 2 809 ? -134.397 -13.629 42.646  1.00 0.00 ? 809 LEU B CD1 1  
ATOM 9215   C CD2 . LEU B 2 809 ? -136.327 -13.708 44.400  1.00 0.00 ? 809 LEU B CD2 1  
ATOM 9216   N N   . LYS B 2 810 ? -137.770 -14.609 39.336  1.00 0.00 ? 810 LYS B N   1  
ATOM 9217   C CA  . LYS B 2 810 ? -138.043 -15.854 38.723  1.00 0.00 ? 810 LYS B CA  1  
ATOM 9218   C C   . LYS B 2 810 ? -137.232 -15.890 37.474  1.00 0.00 ? 810 LYS B C   1  
ATOM 9219   O O   . LYS B 2 810 ? -136.629 -16.957 37.146  1.00 0.00 ? 810 LYS B O   1  
ATOM 9220   C CB  . LYS B 2 810 ? -139.577 -16.238 38.617  1.00 0.00 ? 810 LYS B CB  1  
ATOM 9221   C CG  . LYS B 2 810 ? -139.846 -17.694 38.570  1.00 0.00 ? 810 LYS B CG  1  
ATOM 9222   C CD  . LYS B 2 810 ? -139.603 -18.390 37.207  1.00 0.00 ? 810 LYS B CD  1  
ATOM 9223   C CE  . LYS B 2 810 ? -139.328 -19.943 37.286  1.00 0.00 ? 810 LYS B CE  1  
ATOM 9224   N NZ  . LYS B 2 810 ? -137.861 -20.176 37.493  1.00 0.00 ? 810 LYS B NZ  1  
ATOM 9225   N N   . GLU B 2 811 ? -137.221 -14.758 36.787  1.00 0.00 ? 811 GLU B N   1  
ATOM 9226   C CA  . GLU B 2 811 ? -136.583 -14.693 35.519  1.00 0.00 ? 811 GLU B CA  1  
ATOM 9227   C C   . GLU B 2 811 ? -135.109 -14.922 35.541  1.00 0.00 ? 811 GLU B C   1  
ATOM 9228   O O   . GLU B 2 811 ? -134.577 -15.656 34.740  1.00 0.00 ? 811 GLU B O   1  
ATOM 9229   C CB  . GLU B 2 811 ? -136.886 -13.258 34.934  1.00 0.00 ? 811 GLU B CB  1  
ATOM 9230   C CG  . GLU B 2 811 ? -136.250 -12.820 33.593  1.00 0.00 ? 811 GLU B CG  1  
ATOM 9231   C CD  . GLU B 2 811 ? -134.953 -11.928 33.735  1.00 0.00 ? 811 GLU B CD  1  
ATOM 9232   O OE1 . GLU B 2 811 ? -135.073 -10.639 33.901  1.00 0.00 ? 811 GLU B OE1 1  
ATOM 9233   O OE2 . GLU B 2 811 ? -133.816 -12.498 33.710  1.00 0.00 ? 811 GLU B OE2 1  
ATOM 9234   N N   . ILE B 2 812 ? -134.399 -14.374 36.578  1.00 0.00 ? 812 ILE B N   1  
ATOM 9235   C CA  . ILE B 2 812 ? -132.979 -14.520 36.798  1.00 0.00 ? 812 ILE B CA  1  
ATOM 9236   C C   . ILE B 2 812 ? -132.627 -15.932 37.059  1.00 0.00 ? 812 ILE B C   1  
ATOM 9237   O O   . ILE B 2 812 ? -131.603 -16.389 36.565  1.00 0.00 ? 812 ILE B O   1  
ATOM 9238   C CB  . ILE B 2 812 ? -132.336 -13.468 37.701  1.00 0.00 ? 812 ILE B CB  1  
ATOM 9239   C CG1 . ILE B 2 812 ? -132.715 -13.433 39.242  1.00 0.00 ? 812 ILE B CG1 1  
ATOM 9240   C CG2 . ILE B 2 812 ? -132.578 -12.126 36.977  1.00 0.00 ? 812 ILE B CG2 1  
ATOM 9241   C CD1 . ILE B 2 812 ? -132.000 -12.329 40.039  1.00 0.00 ? 812 ILE B CD1 1  
ATOM 9242   N N   . VAL B 2 813 ? -133.516 -16.624 37.838  1.00 0.00 ? 813 VAL B N   1  
ATOM 9243   C CA  . VAL B 2 813 ? -133.289 -18.050 38.076  1.00 0.00 ? 813 VAL B CA  1  
ATOM 9244   C C   . VAL B 2 813 ? -133.363 -18.951 36.813  1.00 0.00 ? 813 VAL B C   1  
ATOM 9245   O O   . VAL B 2 813 ? -132.492 -19.843 36.641  1.00 0.00 ? 813 VAL B O   1  
ATOM 9246   C CB  . VAL B 2 813 ? -134.343 -18.614 39.073  1.00 0.00 ? 813 VAL B CB  1  
ATOM 9247   C CG1 . VAL B 2 813 ? -134.242 -20.168 39.317  1.00 0.00 ? 813 VAL B CG1 1  
ATOM 9248   C CG2 . VAL B 2 813 ? -134.115 -17.903 40.420  1.00 0.00 ? 813 VAL B CG2 1  
ATOM 9249   N N   . SER B 2 814 ? -134.300 -18.764 35.846  1.00 0.00 ? 814 SER B N   1  
ATOM 9250   C CA  . SER B 2 814 ? -134.285 -19.599 34.616  1.00 0.00 ? 814 SER B CA  1  
ATOM 9251   C C   . SER B 2 814 ? -133.119 -19.437 33.732  1.00 0.00 ? 814 SER B C   1  
ATOM 9252   O O   . SER B 2 814 ? -132.427 -20.371 33.293  1.00 0.00 ? 814 SER B O   1  
ATOM 9253   C CB  . SER B 2 814 ? -135.580 -19.466 33.755  1.00 0.00 ? 814 SER B CB  1  
ATOM 9254   O OG  . SER B 2 814 ? -136.766 -19.563 34.528  1.00 0.00 ? 814 SER B OG  1  
ATOM 9255   N N   . GLN B 2 815 ? -132.698 -18.144 33.621  1.00 0.00 ? 815 GLN B N   1  
ATOM 9256   C CA  . GLN B 2 815 ? -131.498 -17.755 32.918  1.00 0.00 ? 815 GLN B CA  1  
ATOM 9257   C C   . GLN B 2 815 ? -130.309 -18.348 33.682  1.00 0.00 ? 815 GLN B C   1  
ATOM 9258   O O   . GLN B 2 815 ? -129.443 -18.882 32.970  1.00 0.00 ? 815 GLN B O   1  
ATOM 9259   C CB  . GLN B 2 815 ? -131.401 -16.193 32.814  1.00 0.00 ? 815 GLN B CB  1  
ATOM 9260   C CG  . GLN B 2 815 ? -132.573 -15.524 32.054  1.00 0.00 ? 815 GLN B CG  1  
ATOM 9261   C CD  . GLN B 2 815 ? -132.373 -15.803 30.513  1.00 0.00 ? 815 GLN B CD  1  
ATOM 9262   O OE1 . GLN B 2 815 ? -132.917 -16.835 30.088  1.00 0.00 ? 815 GLN B OE1 1  
ATOM 9263   N NE2 . GLN B 2 815 ? -131.422 -14.985 29.969  1.00 0.00 ? 815 GLN B NE2 1  
ATOM 9264   N N   . TYR B 2 816 ? -130.268 -18.397 35.023  1.00 0.00 ? 816 TYR B N   1  
ATOM 9265   C CA  . TYR B 2 816 ? -129.127 -18.998 35.693  1.00 0.00 ? 816 TYR B CA  1  
ATOM 9266   C C   . TYR B 2 816 ? -128.969 -20.511 35.424  1.00 0.00 ? 816 TYR B C   1  
ATOM 9267   O O   . TYR B 2 816 ? -127.810 -20.952 35.352  1.00 0.00 ? 816 TYR B O   1  
ATOM 9268   C CB  . TYR B 2 816 ? -128.969 -18.864 37.291  1.00 0.00 ? 816 TYR B CB  1  
ATOM 9269   C CG  . TYR B 2 816 ? -128.554 -17.507 37.788  1.00 0.00 ? 816 TYR B CG  1  
ATOM 9270   C CD1 . TYR B 2 816 ? -128.722 -16.284 37.063  1.00 0.00 ? 816 TYR B CD1 1  
ATOM 9271   C CD2 . TYR B 2 816 ? -128.112 -17.457 39.080  1.00 0.00 ? 816 TYR B CD2 1  
ATOM 9272   C CE1 . TYR B 2 816 ? -128.555 -15.056 37.780  1.00 0.00 ? 816 TYR B CE1 1  
ATOM 9273   C CE2 . TYR B 2 816 ? -127.814 -16.283 39.735  1.00 0.00 ? 816 TYR B CE2 1  
ATOM 9274   C CZ  . TYR B 2 816 ? -128.061 -15.064 39.103  1.00 0.00 ? 816 TYR B CZ  1  
ATOM 9275   O OH  . TYR B 2 816 ? -127.943 -13.932 39.887  1.00 0.00 ? 816 TYR B OH  1  
ATOM 9276   N N   . LYS B 2 817 ? -130.131 -21.283 35.422  1.00 0.00 ? 817 LYS B N   1  
ATOM 9277   C CA  . LYS B 2 817 ? -130.145 -22.685 35.287  1.00 0.00 ? 817 LYS B CA  1  
ATOM 9278   C C   . LYS B 2 817 ? -129.624 -23.181 33.983  1.00 0.00 ? 817 LYS B C   1  
ATOM 9279   O O   . LYS B 2 817 ? -128.845 -24.113 33.922  1.00 0.00 ? 817 LYS B O   1  
ATOM 9280   C CB  . LYS B 2 817 ? -131.633 -23.238 35.408  1.00 0.00 ? 817 LYS B CB  1  
ATOM 9281   C CG  . LYS B 2 817 ? -131.930 -24.740 35.368  1.00 0.00 ? 817 LYS B CG  1  
ATOM 9282   C CD  . LYS B 2 817 ? -133.381 -24.944 34.981  1.00 0.00 ? 817 LYS B CD  1  
ATOM 9283   C CE  . LYS B 2 817 ? -133.738 -26.393 34.735  1.00 0.00 ? 817 LYS B CE  1  
ATOM 9284   N NZ  . LYS B 2 817 ? -133.452 -27.248 35.871  1.00 0.00 ? 817 LYS B NZ  1  
ATOM 9285   N N   . ASN B 2 818 ? -129.991 -22.478 32.900  1.00 0.00 ? 818 ASN B N   1  
ATOM 9286   C CA  . ASN B 2 818 ? -129.491 -22.674 31.495  1.00 0.00 ? 818 ASN B CA  1  
ATOM 9287   C C   . ASN B 2 818 ? -128.027 -22.367 31.429  1.00 0.00 ? 818 ASN B C   1  
ATOM 9288   O O   . ASN B 2 818 ? -127.268 -23.125 30.851  1.00 0.00 ? 818 ASN B O   1  
ATOM 9289   C CB  . ASN B 2 818 ? -130.159 -21.682 30.509  1.00 0.00 ? 818 ASN B CB  1  
ATOM 9290   C CG  . ASN B 2 818 ? -131.761 -21.874 30.384  1.00 0.00 ? 818 ASN B CG  1  
ATOM 9291   O OD1 . ASN B 2 818 ? -132.384 -22.852 30.816  1.00 0.00 ? 818 ASN B OD1 1  
ATOM 9292   N ND2 . ASN B 2 818 ? -132.378 -20.807 29.802  1.00 0.00 ? 818 ASN B ND2 1  
ATOM 9293   N N   . PHE B 2 819 ? -127.529 -21.300 32.071  1.00 0.00 ? 819 PHE B N   1  
ATOM 9294   C CA  . PHE B 2 819 ? -126.141 -20.943 32.116  1.00 0.00 ? 819 PHE B CA  1  
ATOM 9295   C C   . PHE B 2 819 ? -125.354 -22.054 32.832  1.00 0.00 ? 819 PHE B C   1  
ATOM 9296   O O   . PHE B 2 819 ? -124.223 -22.318 32.427  1.00 0.00 ? 819 PHE B O   1  
ATOM 9297   C CB  . PHE B 2 819 ? -125.762 -19.615 32.821  1.00 0.00 ? 819 PHE B CB  1  
ATOM 9298   C CG  . PHE B 2 819 ? -126.304 -18.362 32.080  1.00 0.00 ? 819 PHE B CG  1  
ATOM 9299   C CD1 . PHE B 2 819 ? -126.249 -18.244 30.662  1.00 0.00 ? 819 PHE B CD1 1  
ATOM 9300   C CD2 . PHE B 2 819 ? -126.751 -17.223 32.770  1.00 0.00 ? 819 PHE B CD2 1  
ATOM 9301   C CE1 . PHE B 2 819 ? -126.677 -17.101 30.036  1.00 0.00 ? 819 PHE B CE1 1  
ATOM 9302   C CE2 . PHE B 2 819 ? -127.087 -16.014 32.144  1.00 0.00 ? 819 PHE B CE2 1  
ATOM 9303   C CZ  . PHE B 2 819 ? -127.073 -15.948 30.737  1.00 0.00 ? 819 PHE B CZ  1  
ATOM 9304   N N   . LYS B 2 820 ? -125.911 -22.621 33.913  1.00 0.00 ? 820 LYS B N   1  
ATOM 9305   C CA  . LYS B 2 820 ? -125.275 -23.640 34.705  1.00 0.00 ? 820 LYS B CA  1  
ATOM 9306   C C   . LYS B 2 820 ? -125.004 -24.891 33.919  1.00 0.00 ? 820 LYS B C   1  
ATOM 9307   O O   . LYS B 2 820 ? -123.960 -25.511 34.077  1.00 0.00 ? 820 LYS B O   1  
ATOM 9308   C CB  . LYS B 2 820 ? -126.081 -23.933 35.959  1.00 0.00 ? 820 LYS B CB  1  
ATOM 9309   C CG  . LYS B 2 820 ? -125.826 -22.849 37.002  1.00 0.00 ? 820 LYS B CG  1  
ATOM 9310   C CD  . LYS B 2 820 ? -126.948 -22.857 38.100  1.00 0.00 ? 820 LYS B CD  1  
ATOM 9311   C CE  . LYS B 2 820 ? -126.558 -23.917 39.199  1.00 0.00 ? 820 LYS B CE  1  
ATOM 9312   N NZ  . LYS B 2 820 ? -127.628 -24.018 40.199  1.00 0.00 ? 820 LYS B NZ  1  
ATOM 9313   N N   . ASP B 2 821 ? -125.957 -25.243 33.034  1.00 0.00 ? 821 ASP B N   1  
ATOM 9314   C CA  . ASP B 2 821 ? -125.821 -26.384 32.153  1.00 0.00 ? 821 ASP B CA  1  
ATOM 9315   C C   . ASP B 2 821 ? -124.728 -26.199 31.180  1.00 0.00 ? 821 ASP B C   1  
ATOM 9316   O O   . ASP B 2 821 ? -123.925 -27.036 30.903  1.00 0.00 ? 821 ASP B O   1  
ATOM 9317   C CB  . ASP B 2 821 ? -127.084 -26.691 31.320  1.00 0.00 ? 821 ASP B CB  1  
ATOM 9318   C CG  . ASP B 2 821 ? -128.378 -26.852 32.199  1.00 0.00 ? 821 ASP B CG  1  
ATOM 9319   O OD1 . ASP B 2 821 ? -128.402 -27.773 33.075  1.00 0.00 ? 821 ASP B OD1 1  
ATOM 9320   O OD2 . ASP B 2 821 ? -129.355 -26.128 31.964  1.00 0.00 ? 821 ASP B OD2 1  
ATOM 9321   N N   . ARG B 2 822 ? -124.583 -24.987 30.608  1.00 0.00 ? 822 ARG B N   1  
ATOM 9322   C CA  . ARG B 2 822 ? -123.483 -24.614 29.657  1.00 0.00 ? 822 ARG B CA  1  
ATOM 9323   C C   . ARG B 2 822 ? -122.290 -24.752 30.470  1.00 0.00 ? 822 ARG B C   1  
ATOM 9324   O O   . ARG B 2 822 ? -121.283 -25.008 29.893  1.00 0.00 ? 822 ARG B O   1  
ATOM 9325   C CB  . ARG B 2 822 ? -123.714 -23.161 29.113  1.00 0.00 ? 822 ARG B CB  1  
ATOM 9326   C CG  . ARG B 2 822 ? -124.953 -23.188 28.132  1.00 0.00 ? 822 ARG B CG  1  
ATOM 9327   C CD  . ARG B 2 822 ? -125.124 -21.851 27.340  1.00 0.00 ? 822 ARG B CD  1  
ATOM 9328   N NE  . ARG B 2 822 ? -126.264 -22.010 26.394  1.00 0.00 ? 822 ARG B NE  1  
ATOM 9329   C CZ  . ARG B 2 822 ? -127.539 -21.938 26.852  1.00 0.00 ? 822 ARG B CZ  1  
ATOM 9330   N NH1 . ARG B 2 822 ? -127.852 -21.480 28.097  1.00 0.00 ? 822 ARG B NH1 1  
ATOM 9331   N NH2 . ARG B 2 822 ? -128.541 -22.266 25.942  1.00 0.00 ? 822 ARG B NH2 1  
ATOM 9332   N N   . LEU B 2 823 ? -122.293 -24.324 31.756  1.00 0.00 ? 823 LEU B N   1  
ATOM 9333   C CA  . LEU B 2 823 ? -121.103 -24.182 32.609  1.00 0.00 ? 823 LEU B CA  1  
ATOM 9334   C C   . LEU B 2 823 ? -120.454 -25.489 32.860  1.00 0.00 ? 823 LEU B C   1  
ATOM 9335   O O   . LEU B 2 823 ? -119.253 -25.609 32.959  1.00 0.00 ? 823 LEU B O   1  
ATOM 9336   C CB  . LEU B 2 823 ? -121.343 -23.530 33.968  1.00 0.00 ? 823 LEU B CB  1  
ATOM 9337   C CG  . LEU B 2 823 ? -120.121 -23.351 35.103  1.00 0.00 ? 823 LEU B CG  1  
ATOM 9338   C CD1 . LEU B 2 823 ? -118.788 -22.618 34.754  1.00 0.00 ? 823 LEU B CD1 1  
ATOM 9339   C CD2 . LEU B 2 823 ? -120.670 -22.714 36.445  1.00 0.00 ? 823 LEU B CD2 1  
ATOM 9340   N N   . TYR B 2 824 ? -121.282 -26.553 33.003  1.00 0.00 ? 824 TYR B N   1  
ATOM 9341   C CA  . TYR B 2 824 ? -120.867 -27.833 33.197  1.00 0.00 ? 824 TYR B CA  1  
ATOM 9342   C C   . TYR B 2 824 ? -120.108 -28.340 31.996  1.00 0.00 ? 824 TYR B C   1  
ATOM 9343   O O   . TYR B 2 824 ? -119.106 -29.044 32.209  1.00 0.00 ? 824 TYR B O   1  
ATOM 9344   C CB  . TYR B 2 824 ? -122.012 -28.840 33.574  1.00 0.00 ? 824 TYR B CB  1  
ATOM 9345   C CG  . TYR B 2 824 ? -122.716 -28.482 34.866  1.00 0.00 ? 824 TYR B CG  1  
ATOM 9346   C CD1 . TYR B 2 824 ? -122.024 -27.935 35.943  1.00 0.00 ? 824 TYR B CD1 1  
ATOM 9347   C CD2 . TYR B 2 824 ? -124.117 -28.558 34.878  1.00 0.00 ? 824 TYR B CD2 1  
ATOM 9348   C CE1 . TYR B 2 824 ? -122.685 -27.457 37.056  1.00 0.00 ? 824 TYR B CE1 1  
ATOM 9349   C CE2 . TYR B 2 824 ? -124.826 -28.136 36.010  1.00 0.00 ? 824 TYR B CE2 1  
ATOM 9350   C CZ  . TYR B 2 824 ? -124.107 -27.622 37.118  1.00 0.00 ? 824 TYR B CZ  1  
ATOM 9351   O OH  . TYR B 2 824 ? -124.843 -27.022 38.229  1.00 0.00 ? 824 TYR B OH  1  
ATOM 9352   N N   . ILE B 2 825 ? -120.623 -28.025 30.682  1.00 0.00 ? 825 ILE B N   1  
ATOM 9353   C CA  . ILE B 2 825 ? -119.998 -28.482 29.455  1.00 0.00 ? 825 ILE B CA  1  
ATOM 9354   C C   . ILE B 2 825 ? -118.633 -27.776 29.455  1.00 0.00 ? 825 ILE B C   1  
ATOM 9355   O O   . ILE B 2 825 ? -117.664 -28.406 29.050  1.00 0.00 ? 825 ILE B O   1  
ATOM 9356   C CB  . ILE B 2 825 ? -120.863 -28.010 28.277  1.00 0.00 ? 825 ILE B CB  1  
ATOM 9357   C CG1 . ILE B 2 825 ? -122.249 -28.732 28.352  1.00 0.00 ? 825 ILE B CG1 1  
ATOM 9358   C CG2 . ILE B 2 825 ? -120.136 -28.241 26.872  1.00 0.00 ? 825 ILE B CG2 1  
ATOM 9359   C CD1 . ILE B 2 825 ? -123.219 -28.347 27.222  1.00 0.00 ? 825 ILE B CD1 1  
ATOM 9360   N N   . PHE B 2 826 ? -118.636 -26.496 29.876  1.00 0.00 ? 826 PHE B N   1  
ATOM 9361   C CA  . PHE B 2 826 ? -117.437 -25.713 29.924  1.00 0.00 ? 826 PHE B CA  1  
ATOM 9362   C C   . PHE B 2 826 ? -116.361 -26.218 30.890  1.00 0.00 ? 826 PHE B C   1  
ATOM 9363   O O   . PHE B 2 826 ? -115.165 -26.211 30.641  1.00 0.00 ? 826 PHE B O   1  
ATOM 9364   C CB  . PHE B 2 826 ? -117.629 -24.220 30.258  1.00 0.00 ? 826 PHE B CB  1  
ATOM 9365   C CG  . PHE B 2 826 ? -116.467 -23.415 29.694  1.00 0.00 ? 826 PHE B CG  1  
ATOM 9366   C CD1 . PHE B 2 826 ? -116.325 -23.364 28.310  1.00 0.00 ? 826 PHE B CD1 1  
ATOM 9367   C CD2 . PHE B 2 826 ? -115.600 -22.629 30.495  1.00 0.00 ? 826 PHE B CD2 1  
ATOM 9368   C CE1 . PHE B 2 826 ? -115.331 -22.488 27.694  1.00 0.00 ? 826 PHE B CE1 1  
ATOM 9369   C CE2 . PHE B 2 826 ? -114.519 -21.942 29.915  1.00 0.00 ? 826 PHE B CE2 1  
ATOM 9370   C CZ  . PHE B 2 826 ? -114.535 -21.730 28.551  1.00 0.00 ? 826 PHE B CZ  1  
ATOM 9371   N N   . ARG B 2 827 ? -116.772 -26.739 32.103  1.00 0.00 ? 827 ARG B N   1  
ATOM 9372   C CA  . ARG B 2 827 ? -115.906 -27.361 33.066  1.00 0.00 ? 827 ARG B CA  1  
ATOM 9373   C C   . ARG B 2 827 ? -115.262 -28.560 32.572  1.00 0.00 ? 827 ARG B C   1  
ATOM 9374   O O   . ARG B 2 827 ? -114.097 -28.858 32.794  1.00 0.00 ? 827 ARG B O   1  
ATOM 9375   C CB  . ARG B 2 827 ? -116.750 -27.798 34.254  1.00 0.00 ? 827 ARG B CB  1  
ATOM 9376   C CG  . ARG B 2 827 ? -117.114 -26.645 35.193  1.00 0.00 ? 827 ARG B CG  1  
ATOM 9377   C CD  . ARG B 2 827 ? -118.080 -27.065 36.334  1.00 0.00 ? 827 ARG B CD  1  
ATOM 9378   N NE  . ARG B 2 827 ? -118.366 -25.825 37.172  1.00 0.00 ? 827 ARG B NE  1  
ATOM 9379   C CZ  . ARG B 2 827 ? -119.144 -25.935 38.276  1.00 0.00 ? 827 ARG B CZ  1  
ATOM 9380   N NH1 . ARG B 2 827 ? -119.535 -27.164 38.673  1.00 0.00 ? 827 ARG B NH1 1  
ATOM 9381   N NH2 . ARG B 2 827 ? -119.401 -24.836 39.059  1.00 0.00 ? 827 ARG B NH2 1  
ATOM 9382   N N   . ALA B 2 828 ? -115.990 -29.366 31.787  1.00 0.00 ? 828 ALA B N   1  
ATOM 9383   C CA  . ALA B 2 828 ? -115.468 -30.517 31.151  1.00 0.00 ? 828 ALA B CA  1  
ATOM 9384   C C   . ALA B 2 828 ? -114.400 -30.148 30.158  1.00 0.00 ? 828 ALA B C   1  
ATOM 9385   O O   . ALA B 2 828 ? -113.393 -30.893 30.123  1.00 0.00 ? 828 ALA B O   1  
ATOM 9386   C CB  . ALA B 2 828 ? -116.589 -31.181 30.315  1.00 0.00 ? 828 ALA B CB  1  
ATOM 9387   N N   . ASP B 2 829 ? -114.647 -29.041 29.442  1.00 0.00 ? 829 ASP B N   1  
ATOM 9388   C CA  . ASP B 2 829 ? -113.700 -28.469 28.452  1.00 0.00 ? 829 ASP B CA  1  
ATOM 9389   C C   . ASP B 2 829 ? -112.402 -28.005 29.075  1.00 0.00 ? 829 ASP B C   1  
ATOM 9390   O O   . ASP B 2 829 ? -111.334 -28.303 28.591  1.00 0.00 ? 829 ASP B O   1  
ATOM 9391   C CB  . ASP B 2 829 ? -114.372 -27.269 27.731  1.00 0.00 ? 829 ASP B CB  1  
ATOM 9392   C CG  . ASP B 2 829 ? -113.754 -26.916 26.375  1.00 0.00 ? 829 ASP B CG  1  
ATOM 9393   O OD1 . ASP B 2 829 ? -113.744 -27.835 25.511  1.00 0.00 ? 829 ASP B OD1 1  
ATOM 9394   O OD2 . ASP B 2 829 ? -113.305 -25.725 26.162  1.00 0.00 ? 829 ASP B OD2 1  
ATOM 9395   N N   . LEU B 2 830 ? -112.423 -27.365 30.221  1.00 0.00 ? 830 LEU B N   1  
ATOM 9396   C CA  . LEU B 2 830 ? -111.197 -27.017 30.914  1.00 0.00 ? 830 LEU B CA  1  
ATOM 9397   C C   . LEU B 2 830 ? -110.431 -28.282 31.363  1.00 0.00 ? 830 LEU B C   1  
ATOM 9398   O O   . LEU B 2 830 ? -109.206 -28.258 31.292  1.00 0.00 ? 830 LEU B O   1  
ATOM 9399   C CB  . LEU B 2 830 ? -111.293 -26.090 32.148  1.00 0.00 ? 830 LEU B CB  1  
ATOM 9400   C CG  . LEU B 2 830 ? -111.845 -24.693 31.966  1.00 0.00 ? 830 LEU B CG  1  
ATOM 9401   C CD1 . LEU B 2 830 ? -112.420 -24.108 33.242  1.00 0.00 ? 830 LEU B CD1 1  
ATOM 9402   C CD2 . LEU B 2 830 ? -110.841 -23.760 31.283  1.00 0.00 ? 830 LEU B CD2 1  
ATOM 9403   N N   . LYS B 2 831 ? -111.133 -29.321 31.831  1.00 0.00 ? 831 LYS B N   1  
ATOM 9404   C CA  . LYS B 2 831 ? -110.460 -30.542 32.244  1.00 0.00 ? 831 LYS B CA  1  
ATOM 9405   C C   . LYS B 2 831 ? -109.778 -31.378 31.204  1.00 0.00 ? 831 LYS B C   1  
ATOM 9406   O O   . LYS B 2 831 ? -108.665 -31.899 31.448  1.00 0.00 ? 831 LYS B O   1  
ATOM 9407   C CB  . LYS B 2 831 ? -111.367 -31.543 32.977  1.00 0.00 ? 831 LYS B CB  1  
ATOM 9408   C CG  . LYS B 2 831 ? -110.687 -32.613 33.891  1.00 0.00 ? 831 LYS B CG  1  
ATOM 9409   C CD  . LYS B 2 831 ? -109.641 -32.140 34.817  1.00 0.00 ? 831 LYS B CD  1  
ATOM 9410   C CE  . LYS B 2 831 ? -109.145 -33.191 35.763  1.00 0.00 ? 831 LYS B CE  1  
ATOM 9411   N NZ  . LYS B 2 831 ? -108.137 -32.632 36.659  1.00 0.00 ? 831 LYS B NZ  1  
ATOM 9412   N N   . ASN B 2 832 ? -110.417 -31.571 29.995  1.00 0.00 ? 832 ASN B N   1  
ATOM 9413   C CA  . ASN B 2 832 ? -109.808 -32.324 28.912  1.00 0.00 ? 832 ASN B CA  1  
ATOM 9414   C C   . ASN B 2 832 ? -108.759 -31.506 28.296  1.00 0.00 ? 832 ASN B C   1  
ATOM 9415   O O   . ASN B 2 832 ? -107.758 -32.033 27.796  1.00 0.00 ? 832 ASN B O   1  
ATOM 9416   C CB  . ASN B 2 832 ? -110.742 -32.701 27.775  1.00 0.00 ? 832 ASN B CB  1  
ATOM 9417   C CG  . ASN B 2 832 ? -111.719 -33.683 28.308  1.00 0.00 ? 832 ASN B CG  1  
ATOM 9418   O OD1 . ASN B 2 832 ? -112.659 -33.423 29.119  1.00 0.00 ? 832 ASN B OD1 1  
ATOM 9419   N ND2 . ASN B 2 832 ? -111.548 -34.979 27.839  1.00 0.00 ? 832 ASN B ND2 1  
ATOM 9420   N N   . ASP B 2 833 ? -108.964 -30.188 28.417  1.00 0.00 ? 833 ASP B N   1  
ATOM 9421   C CA  . ASP B 2 833 ? -108.279 -29.030 27.898  1.00 0.00 ? 833 ASP B CA  1  
ATOM 9422   C C   . ASP B 2 833 ? -109.071 -28.548 26.746  1.00 0.00 ? 833 ASP B C   1  
ATOM 9423   O O   . ASP B 2 833 ? -108.957 -27.355 26.464  1.00 0.00 ? 833 ASP B O   1  
ATOM 9424   C CB  . ASP B 2 833 ? -106.833 -29.233 27.515  1.00 0.00 ? 833 ASP B CB  1  
ATOM 9425   C CG  . ASP B 2 833 ? -106.032 -29.495 28.770  1.00 0.00 ? 833 ASP B CG  1  
ATOM 9426   O OD1 . ASP B 2 833 ? -105.906 -28.609 29.583  1.00 0.00 ? 833 ASP B OD1 1  
ATOM 9427   O OD2 . ASP B 2 833 ? -105.644 -30.691 28.921  1.00 0.00 ? 833 ASP B OD2 1  
ATOM 9428   N N   . GLY B 2 834 ? -109.866 -29.397 26.136  1.00 0.00 ? 834 GLY B N   1  
ATOM 9429   C CA  . GLY B 2 834 ? -110.819 -29.024 25.151  1.00 0.00 ? 834 GLY B CA  1  
ATOM 9430   C C   . GLY B 2 834 ? -111.511 -30.394 24.968  1.00 0.00 ? 834 GLY B C   1  
ATOM 9431   O O   . GLY B 2 834 ? -110.940 -31.304 24.294  1.00 0.00 ? 834 GLY B O   1  
ATOM 9432   N N   . ASP B 2 835 ? -112.753 -30.512 25.552  1.00 0.00 ? 835 ASP B N   1  
ATOM 9433   C CA  . ASP B 2 835 ? -113.660 -31.623 25.392  1.00 0.00 ? 835 ASP B CA  1  
ATOM 9434   C C   . ASP B 2 835 ? -114.384 -31.559 24.120  1.00 0.00 ? 835 ASP B C   1  
ATOM 9435   O O   . ASP B 2 835 ? -114.327 -30.575 23.357  1.00 0.00 ? 835 ASP B O   1  
ATOM 9436   C CB  . ASP B 2 835 ? -114.696 -31.798 26.629  1.00 0.00 ? 835 ASP B CB  1  
ATOM 9437   C CG  . ASP B 2 835 ? -115.785 -30.763 26.725  1.00 0.00 ? 835 ASP B CG  1  
ATOM 9438   O OD1 . ASP B 2 835 ? -115.687 -29.717 26.107  1.00 0.00 ? 835 ASP B OD1 1  
ATOM 9439   O OD2 . ASP B 2 835 ? -116.823 -31.106 27.332  1.00 0.00 ? 835 ASP B OD2 1  
ATOM 9440   N N   . GLU B 2 836 ? -115.141 -32.620 23.778  1.00 0.00 ? 836 GLU B N   1  
ATOM 9441   C CA  . GLU B 2 836 ? -115.881 -32.566 22.560  1.00 0.00 ? 836 GLU B CA  1  
ATOM 9442   C C   . GLU B 2 836 ? -117.055 -31.638 22.661  1.00 0.00 ? 836 GLU B C   1  
ATOM 9443   O O   . GLU B 2 836 ? -117.379 -31.059 21.651  1.00 0.00 ? 836 GLU B O   1  
ATOM 9444   C CB  . GLU B 2 836 ? -116.420 -33.987 22.303  1.00 0.00 ? 836 GLU B CB  1  
ATOM 9445   C CG  . GLU B 2 836 ? -116.789 -34.300 20.892  1.00 0.00 ? 836 GLU B CG  1  
ATOM 9446   C CD  . GLU B 2 836 ? -115.673 -33.906 19.941  1.00 0.00 ? 836 GLU B CD  1  
ATOM 9447   O OE1 . GLU B 2 836 ? -114.548 -34.400 20.050  1.00 0.00 ? 836 GLU B OE1 1  
ATOM 9448   O OE2 . GLU B 2 836 ? -115.987 -33.178 18.966  1.00 0.00 ? 836 GLU B OE2 1  
ATOM 9449   N N   . GLU B 2 837 ? -117.816 -31.678 23.758  1.00 0.00 ? 837 GLU B N   1  
ATOM 9450   C CA  . GLU B 2 837 ? -119.176 -31.168 23.810  1.00 0.00 ? 837 GLU B CA  1  
ATOM 9451   C C   . GLU B 2 837 ? -119.273 -29.748 23.580  1.00 0.00 ? 837 GLU B C   1  
ATOM 9452   O O   . GLU B 2 837 ? -120.269 -29.354 22.970  1.00 0.00 ? 837 GLU B O   1  
ATOM 9453   C CB  . GLU B 2 837 ? -119.872 -31.607 25.090  1.00 0.00 ? 837 GLU B CB  1  
ATOM 9454   C CG  . GLU B 2 837 ? -121.391 -31.310 25.229  1.00 0.00 ? 837 GLU B CG  1  
ATOM 9455   C CD  . GLU B 2 837 ? -122.171 -31.955 24.045  1.00 0.00 ? 837 GLU B CD  1  
ATOM 9456   O OE1 . GLU B 2 837 ? -122.144 -33.215 23.935  1.00 0.00 ? 837 GLU B OE1 1  
ATOM 9457   O OE2 . GLU B 2 837 ? -122.740 -31.170 23.229  1.00 0.00 ? 837 GLU B OE2 1  
ATOM 9458   N N   . LEU B 2 838 ? -118.286 -28.912 24.098  1.00 0.00 ? 838 LEU B N   1  
ATOM 9459   C CA  . LEU B 2 838 ? -118.178 -27.517 23.932  1.00 0.00 ? 838 LEU B CA  1  
ATOM 9460   C C   . LEU B 2 838 ? -117.951 -27.285 22.514  1.00 0.00 ? 838 LEU B C   1  
ATOM 9461   O O   . LEU B 2 838 ? -118.522 -26.352 21.963  1.00 0.00 ? 838 LEU B O   1  
ATOM 9462   C CB  . LEU B 2 838 ? -117.006 -27.058 24.766  1.00 0.00 ? 838 LEU B CB  1  
ATOM 9463   C CG  . LEU B 2 838 ? -116.697 -25.539 24.613  1.00 0.00 ? 838 LEU B CG  1  
ATOM 9464   C CD1 . LEU B 2 838 ? -115.854 -25.170 23.335  1.00 0.00 ? 838 LEU B CD1 1  
ATOM 9465   C CD2 . LEU B 2 838 ? -117.880 -24.523 24.728  1.00 0.00 ? 838 LEU B CD2 1  
ATOM 9466   N N   . PHE B 2 839 ? -117.157 -28.112 21.797  1.00 0.00 ? 839 PHE B N   1  
ATOM 9467   C CA  . PHE B 2 839 ? -116.809 -28.004 20.405  1.00 0.00 ? 839 PHE B CA  1  
ATOM 9468   C C   . PHE B 2 839 ? -118.034 -28.021 19.634  1.00 0.00 ? 839 PHE B C   1  
ATOM 9469   O O   . PHE B 2 839 ? -118.249 -27.142 18.791  1.00 0.00 ? 839 PHE B O   1  
ATOM 9470   C CB  . PHE B 2 839 ? -115.884 -29.115 19.884  1.00 0.00 ? 839 PHE B CB  1  
ATOM 9471   C CG  . PHE B 2 839 ? -114.528 -29.210 20.565  1.00 0.00 ? 839 PHE B CG  1  
ATOM 9472   C CD1 . PHE B 2 839 ? -114.040 -28.232 21.408  1.00 0.00 ? 839 PHE B CD1 1  
ATOM 9473   C CD2 . PHE B 2 839 ? -113.769 -30.314 20.218  1.00 0.00 ? 839 PHE B CD2 1  
ATOM 9474   C CE1 . PHE B 2 839 ? -112.714 -28.291 21.872  1.00 0.00 ? 839 PHE B CE1 1  
ATOM 9475   C CE2 . PHE B 2 839 ? -112.461 -30.362 20.654  1.00 0.00 ? 839 PHE B CE2 1  
ATOM 9476   C CZ  . PHE B 2 839 ? -111.921 -29.388 21.492  1.00 0.00 ? 839 PHE B CZ  1  
ATOM 9477   N N   . LEU B 2 840 ? -118.945 -28.942 19.972  1.00 0.00 ? 840 LEU B N   1  
ATOM 9478   C CA  . LEU B 2 840 ? -120.233 -29.025 19.328  1.00 0.00 ? 840 LEU B CA  1  
ATOM 9479   C C   . LEU B 2 840 ? -121.113 -27.807 19.505  1.00 0.00 ? 840 LEU B C   1  
ATOM 9480   O O   . LEU B 2 840 ? -121.758 -27.379 18.538  1.00 0.00 ? 840 LEU B O   1  
ATOM 9481   C CB  . LEU B 2 840 ? -121.068 -30.231 19.764  1.00 0.00 ? 840 LEU B CB  1  
ATOM 9482   C CG  . LEU B 2 840 ? -120.565 -31.650 19.597  1.00 0.00 ? 840 LEU B CG  1  
ATOM 9483   C CD1 . LEU B 2 840 ? -121.672 -32.706 19.970  1.00 0.00 ? 840 LEU B CD1 1  
ATOM 9484   C CD2 . LEU B 2 840 ? -119.967 -31.934 18.272  1.00 0.00 ? 840 LEU B CD2 1  
ATOM 9485   N N   . LEU B 2 841 ? -121.102 -27.283 20.745  1.00 0.00 ? 841 LEU B N   1  
ATOM 9486   C CA  . LEU B 2 841 ? -121.939 -26.131 21.038  1.00 0.00 ? 841 LEU B CA  1  
ATOM 9487   C C   . LEU B 2 841 ? -121.519 -24.920 20.229  1.00 0.00 ? 841 LEU B C   1  
ATOM 9488   O O   . LEU B 2 841 ? -122.300 -24.299 19.520  1.00 0.00 ? 841 LEU B O   1  
ATOM 9489   C CB  . LEU B 2 841 ? -122.126 -25.871 22.534  1.00 0.00 ? 841 LEU B CB  1  
ATOM 9490   C CG  . LEU B 2 841 ? -122.880 -24.601 22.981  1.00 0.00 ? 841 LEU B CG  1  
ATOM 9491   C CD1 . LEU B 2 841 ? -124.297 -24.596 22.400  1.00 0.00 ? 841 LEU B CD1 1  
ATOM 9492   C CD2 . LEU B 2 841 ? -122.895 -24.637 24.470  1.00 0.00 ? 841 LEU B CD2 1  
ATOM 9493   N N   . SER B 2 842 ? -120.159 -24.661 20.193  1.00 0.00 ? 842 SER B N   1  
ATOM 9494   C CA  . SER B 2 842 ? -119.680 -23.598 19.402  1.00 0.00 ? 842 SER B CA  1  
ATOM 9495   C C   . SER B 2 842 ? -119.892 -23.664 17.923  1.00 0.00 ? 842 SER B C   1  
ATOM 9496   O O   . SER B 2 842 ? -120.283 -22.764 17.244  1.00 0.00 ? 842 SER B O   1  
ATOM 9497   C CB  . SER B 2 842 ? -118.160 -23.454 19.681  1.00 0.00 ? 842 SER B CB  1  
ATOM 9498   O OG  . SER B 2 842 ? -117.297 -24.550 19.357  1.00 0.00 ? 842 SER B OG  1  
ATOM 9499   N N   . LYS B 2 843 ? -119.783 -24.863 17.304  1.00 0.00 ? 843 LYS B N   1  
ATOM 9500   C CA  . LYS B 2 843 ? -119.993 -25.272 15.887  1.00 0.00 ? 843 LYS B CA  1  
ATOM 9501   C C   . LYS B 2 843 ? -121.454 -25.002 15.496  1.00 0.00 ? 843 LYS B C   1  
ATOM 9502   O O   . LYS B 2 843 ? -121.691 -24.424 14.428  1.00 0.00 ? 843 LYS B O   1  
ATOM 9503   C CB  . LYS B 2 843 ? -119.669 -26.717 15.689  1.00 0.00 ? 843 LYS B CB  1  
ATOM 9504   C CG  . LYS B 2 843 ? -118.190 -26.963 15.538  1.00 0.00 ? 843 LYS B CG  1  
ATOM 9505   C CD  . LYS B 2 843 ? -117.816 -28.414 15.311  1.00 0.00 ? 843 LYS B CD  1  
ATOM 9506   C CE  . LYS B 2 843 ? -116.333 -28.706 15.544  1.00 0.00 ? 843 LYS B CE  1  
ATOM 9507   N NZ  . LYS B 2 843 ? -115.519 -27.863 14.673  1.00 0.00 ? 843 LYS B NZ  1  
ATOM 9508   N N   . SER B 2 844 ? -122.474 -25.351 16.403  1.00 0.00 ? 844 SER B N   1  
ATOM 9509   C CA  . SER B 2 844 ? -123.937 -25.187 16.205  1.00 0.00 ? 844 SER B CA  1  
ATOM 9510   C C   . SER B 2 844 ? -124.234 -23.676 16.051  1.00 0.00 ? 844 SER B C   1  
ATOM 9511   O O   . SER B 2 844 ? -125.017 -23.253 15.166  1.00 0.00 ? 844 SER B O   1  
ATOM 9512   C CB  . SER B 2 844 ? -124.868 -25.701 17.353  1.00 0.00 ? 844 SER B CB  1  
ATOM 9513   O OG  . SER B 2 844 ? -124.594 -27.079 17.494  1.00 0.00 ? 844 SER B OG  1  
ATOM 9514   N N   . LEU B 2 845 ? -123.600 -22.773 16.908  1.00 0.00 ? 845 LEU B N   1  
ATOM 9515   C CA  . LEU B 2 845 ? -123.818 -21.345 16.855  1.00 0.00 ? 845 LEU B CA  1  
ATOM 9516   C C   . LEU B 2 845 ? -123.412 -20.715 15.558  1.00 0.00 ? 845 LEU B C   1  
ATOM 9517   O O   . LEU B 2 845 ? -124.167 -20.056 14.899  1.00 0.00 ? 845 LEU B O   1  
ATOM 9518   C CB  . LEU B 2 845 ? -123.161 -20.651 18.060  1.00 0.00 ? 845 LEU B CB  1  
ATOM 9519   C CG  . LEU B 2 845 ? -123.725 -21.082 19.472  1.00 0.00 ? 845 LEU B CG  1  
ATOM 9520   C CD1 . LEU B 2 845 ? -122.838 -20.699 20.613  1.00 0.00 ? 845 LEU B CD1 1  
ATOM 9521   C CD2 . LEU B 2 845 ? -125.152 -20.541 19.597  1.00 0.00 ? 845 LEU B CD2 1  
ATOM 9522   N N   . ARG B 2 846 ? -122.169 -21.171 15.178  1.00 0.00 ? 846 ARG B N   1  
ATOM 9523   C CA  . ARG B 2 846 ? -121.500 -20.870 13.935  1.00 0.00 ? 846 ARG B CA  1  
ATOM 9524   C C   . ARG B 2 846 ? -122.288 -21.481 12.749  1.00 0.00 ? 846 ARG B C   1  
ATOM 9525   O O   . ARG B 2 846 ? -123.343 -22.120 13.006  1.00 0.00 ? 846 ARG B O   1  
ATOM 9526   C CB  . ARG B 2 846 ? -120.043 -21.568 13.927  1.00 0.00 ? 846 ARG B CB  1  
ATOM 9527   C CG  . ARG B 2 846 ? -119.048 -21.062 15.015  1.00 0.00 ? 846 ARG B CG  1  
ATOM 9528   C CD  . ARG B 2 846 ? -117.956 -22.074 15.199  1.00 0.00 ? 846 ARG B CD  1  
ATOM 9529   N NE  . ARG B 2 846 ? -117.139 -21.634 16.392  1.00 0.00 ? 846 ARG B NE  1  
ATOM 9530   C CZ  . ARG B 2 846 ? -116.177 -22.444 16.933  1.00 0.00 ? 846 ARG B CZ  1  
ATOM 9531   N NH1 . ARG B 2 846 ? -116.191 -23.788 16.662  1.00 0.00 ? 846 ARG B NH1 1  
ATOM 9532   N NH2 . ARG B 2 846 ? -115.369 -21.917 17.887  1.00 0.00 ? 846 ARG B NH2 1  
ATOM 9533   N N   . MET C 3 1   ? -94.594  -41.721 40.801  1.00 0.00 ? 1   MET C N   1  
ATOM 9534   C CA  . MET C 3 1   ? -93.644  -41.791 39.710  1.00 0.00 ? 1   MET C CA  1  
ATOM 9535   C C   . MET C 3 1   ? -93.456  -43.282 39.465  1.00 0.00 ? 1   MET C C   1  
ATOM 9536   O O   . MET C 3 1   ? -94.160  -43.879 38.683  1.00 0.00 ? 1   MET C O   1  
ATOM 9537   C CB  . MET C 3 1   ? -92.256  -41.135 40.001  1.00 0.00 ? 1   MET C CB  1  
ATOM 9538   C CG  . MET C 3 1   ? -92.444  -39.586 40.416  1.00 0.00 ? 1   MET C CG  1  
ATOM 9539   S SD  . MET C 3 1   ? -93.613  -38.593 39.446  1.00 0.00 ? 1   MET C SD  1  
ATOM 9540   C CE  . MET C 3 1   ? -94.153  -37.628 40.895  1.00 0.00 ? 1   MET C CE  1  
ATOM 9541   N N   . GLY C 3 2   ? -92.616  -43.957 40.375  1.00 0.00 ? 2   GLY C N   1  
ATOM 9542   C CA  . GLY C 3 2   ? -92.409  -45.362 40.574  1.00 0.00 ? 2   GLY C CA  1  
ATOM 9543   C C   . GLY C 3 2   ? -93.589  -46.022 41.219  1.00 0.00 ? 2   GLY C C   1  
ATOM 9544   O O   . GLY C 3 2   ? -94.529  -45.398 41.617  1.00 0.00 ? 2   GLY C O   1  
ATOM 9545   N N   . GLY C 3 3   ? -93.576  -47.384 41.373  1.00 0.00 ? 3   GLY C N   1  
ATOM 9546   C CA  . GLY C 3 3   ? -94.580  -48.145 42.113  1.00 0.00 ? 3   GLY C CA  1  
ATOM 9547   C C   . GLY C 3 3   ? -94.191  -48.171 43.535  1.00 0.00 ? 3   GLY C C   1  
ATOM 9548   O O   . GLY C 3 3   ? -93.453  -49.017 44.040  1.00 0.00 ? 3   GLY C O   1  
ATOM 9549   N N   . GLU C 3 4   ? -94.666  -47.078 44.246  1.00 0.00 ? 4   GLU C N   1  
ATOM 9550   C CA  . GLU C 3 4   ? -94.108  -46.825 45.537  1.00 0.00 ? 4   GLU C CA  1  
ATOM 9551   C C   . GLU C 3 4   ? -94.666  -47.752 46.596  1.00 0.00 ? 4   GLU C C   1  
ATOM 9552   O O   . GLU C 3 4   ? -95.644  -48.427 46.291  1.00 0.00 ? 4   GLU C O   1  
ATOM 9553   C CB  . GLU C 3 4   ? -94.244  -45.350 45.936  1.00 0.00 ? 4   GLU C CB  1  
ATOM 9554   C CG  . GLU C 3 4   ? -93.666  -44.370 44.943  1.00 0.00 ? 4   GLU C CG  1  
ATOM 9555   C CD  . GLU C 3 4   ? -93.439  -42.962 45.476  1.00 0.00 ? 4   GLU C CD  1  
ATOM 9556   O OE1 . GLU C 3 4   ? -93.991  -42.656 46.572  1.00 0.00 ? 4   GLU C OE1 1  
ATOM 9557   O OE2 . GLU C 3 4   ? -92.687  -42.180 44.830  1.00 0.00 ? 4   GLU C OE2 1  
ATOM 9558   N N   . ILE C 3 5   ? -93.749  -48.001 47.620  1.00 0.00 ? 5   ILE C N   1  
ATOM 9559   C CA  . ILE C 3 5   ? -93.853  -49.091 48.521  1.00 0.00 ? 5   ILE C CA  1  
ATOM 9560   C C   . ILE C 3 5   ? -93.796  -48.537 49.886  1.00 0.00 ? 5   ILE C C   1  
ATOM 9561   O O   . ILE C 3 5   ? -92.901  -47.698 50.110  1.00 0.00 ? 5   ILE C O   1  
ATOM 9562   C CB  . ILE C 3 5   ? -92.696  -50.143 48.279  1.00 0.00 ? 5   ILE C CB  1  
ATOM 9563   C CG1 . ILE C 3 5   ? -92.763  -50.692 46.798  1.00 0.00 ? 5   ILE C CG1 1  
ATOM 9564   C CG2 . ILE C 3 5   ? -92.876  -51.271 49.261  1.00 0.00 ? 5   ILE C CG2 1  
ATOM 9565   C CD1 . ILE C 3 5   ? -91.675  -51.726 46.462  1.00 0.00 ? 5   ILE C CD1 1  
ATOM 9566   N N   . ILE C 3 6   ? -94.627  -48.941 50.835  1.00 0.00 ? 6   ILE C N   1  
ATOM 9567   C CA  . ILE C 3 6   ? -94.587  -48.508 52.211  1.00 0.00 ? 6   ILE C CA  1  
ATOM 9568   C C   . ILE C 3 6   ? -94.161  -49.772 52.949  1.00 0.00 ? 6   ILE C C   1  
ATOM 9569   O O   . ILE C 3 6   ? -94.723  -50.845 52.799  1.00 0.00 ? 6   ILE C O   1  
ATOM 9570   C CB  . ILE C 3 6   ? -95.947  -47.983 52.765  1.00 0.00 ? 6   ILE C CB  1  
ATOM 9571   C CG1 . ILE C 3 6   ? -96.382  -46.646 52.014  1.00 0.00 ? 6   ILE C CG1 1  
ATOM 9572   C CG2 . ILE C 3 6   ? -95.903  -47.763 54.344  1.00 0.00 ? 6   ILE C CG2 1  
ATOM 9573   C CD1 . ILE C 3 6   ? -97.717  -46.058 52.500  1.00 0.00 ? 6   ILE C CD1 1  
ATOM 9574   N N   . THR C 3 7   ? -93.192  -49.560 53.828  1.00 0.00 ? 7   THR C N   1  
ATOM 9575   C CA  . THR C 3 7   ? -92.656  -50.630 54.633  1.00 0.00 ? 7   THR C CA  1  
ATOM 9576   C C   . THR C 3 7   ? -93.225  -50.306 56.009  1.00 0.00 ? 7   THR C C   1  
ATOM 9577   O O   . THR C 3 7   ? -93.225  -49.158 56.459  1.00 0.00 ? 7   THR C O   1  
ATOM 9578   C CB  . THR C 3 7   ? -91.126  -50.494 54.713  1.00 0.00 ? 7   THR C CB  1  
ATOM 9579   O OG1 . THR C 3 7   ? -90.666  -50.395 53.349  1.00 0.00 ? 7   THR C OG1 1  
ATOM 9580   C CG2 . THR C 3 7   ? -90.468  -51.735 55.316  1.00 0.00 ? 7   THR C CG2 1  
ATOM 9581   N N   . LEU C 3 8   ? -93.751  -51.360 56.596  1.00 0.00 ? 8   LEU C N   1  
ATOM 9582   C CA  . LEU C 3 8   ? -94.301  -51.167 57.938  1.00 0.00 ? 8   LEU C CA  1  
ATOM 9583   C C   . LEU C 3 8   ? -93.477  -51.964 58.878  1.00 0.00 ? 8   LEU C C   1  
ATOM 9584   O O   . LEU C 3 8   ? -93.290  -53.148 58.524  1.00 0.00 ? 8   LEU C O   1  
ATOM 9585   C CB  . LEU C 3 8   ? -95.703  -51.859 58.089  1.00 0.00 ? 8   LEU C CB  1  
ATOM 9586   C CG  . LEU C 3 8   ? -96.864  -51.274 57.219  1.00 0.00 ? 8   LEU C CG  1  
ATOM 9587   C CD1 . LEU C 3 8   ? -97.788  -52.454 56.904  1.00 0.00 ? 8   LEU C CD1 1  
ATOM 9588   C CD2 . LEU C 3 8   ? -97.597  -50.081 57.888  1.00 0.00 ? 8   LEU C CD2 1  
ATOM 9589   N N   . GLN C 3 9   ? -92.918  -51.394 60.010  1.00 0.00 ? 9   GLN C N   1  
ATOM 9590   C CA  . GLN C 3 9   ? -92.021  -52.085 60.914  1.00 0.00 ? 9   GLN C CA  1  
ATOM 9591   C C   . GLN C 3 9   ? -92.722  -52.168 62.253  1.00 0.00 ? 9   GLN C C   1  
ATOM 9592   O O   . GLN C 3 9   ? -93.186  -51.210 62.783  1.00 0.00 ? 9   GLN C O   1  
ATOM 9593   C CB  . GLN C 3 9   ? -90.694  -51.398 61.166  1.00 0.00 ? 9   GLN C CB  1  
ATOM 9594   C CG  . GLN C 3 9   ? -89.748  -51.200 59.958  1.00 0.00 ? 9   GLN C CG  1  
ATOM 9595   C CD  . GLN C 3 9   ? -88.873  -49.943 60.129  1.00 0.00 ? 9   GLN C CD  1  
ATOM 9596   O OE1 . GLN C 3 9   ? -88.850  -49.315 61.203  1.00 0.00 ? 9   GLN C OE1 1  
ATOM 9597   N NE2 . GLN C 3 9   ? -88.108  -49.503 59.077  1.00 0.00 ? 9   GLN C NE2 1  
ATOM 9598   N N   . ALA C 3 10  ? -92.819  -53.431 62.761  1.00 0.00 ? 10  ALA C N   1  
ATOM 9599   C CA  . ALA C 3 10  ? -93.559  -53.728 63.951  1.00 0.00 ? 10  ALA C CA  1  
ATOM 9600   C C   . ALA C 3 10  ? -92.691  -54.609 64.783  1.00 0.00 ? 10  ALA C C   1  
ATOM 9601   O O   . ALA C 3 10  ? -92.008  -55.451 64.231  1.00 0.00 ? 10  ALA C O   1  
ATOM 9602   C CB  . ALA C 3 10  ? -94.926  -54.437 63.746  1.00 0.00 ? 10  ALA C CB  1  
ATOM 9603   N N   . GLY C 3 11  ? -92.617  -54.490 66.152  1.00 0.00 ? 11  GLY C N   1  
ATOM 9604   C CA  . GLY C 3 11  ? -91.929  -55.450 67.006  1.00 0.00 ? 11  GLY C CA  1  
ATOM 9605   C C   . GLY C 3 11  ? -90.520  -55.097 67.054  1.00 0.00 ? 11  GLY C C   1  
ATOM 9606   O O   . GLY C 3 11  ? -90.157  -54.201 66.324  1.00 0.00 ? 11  GLY C O   1  
ATOM 9607   N N   . GLN C 3 12  ? -89.706  -55.737 67.991  1.00 0.00 ? 12  GLN C N   1  
ATOM 9608   C CA  . GLN C 3 12  ? -88.368  -55.463 68.246  1.00 0.00 ? 12  GLN C CA  1  
ATOM 9609   C C   . GLN C 3 12  ? -87.562  -55.828 67.000  1.00 0.00 ? 12  GLN C C   1  
ATOM 9610   O O   . GLN C 3 12  ? -86.759  -55.030 66.467  1.00 0.00 ? 12  GLN C O   1  
ATOM 9611   C CB  . GLN C 3 12  ? -87.776  -56.313 69.502  1.00 0.00 ? 12  GLN C CB  1  
ATOM 9612   C CG  . GLN C 3 12  ? -88.660  -56.337 70.805  1.00 0.00 ? 12  GLN C CG  1  
ATOM 9613   C CD  . GLN C 3 12  ? -89.841  -57.307 70.789  1.00 0.00 ? 12  GLN C CD  1  
ATOM 9614   O OE1 . GLN C 3 12  ? -90.957  -56.962 71.160  1.00 0.00 ? 12  GLN C OE1 1  
ATOM 9615   N NE2 . GLN C 3 12  ? -89.644  -58.476 70.117  1.00 0.00 ? 12  GLN C NE2 1  
ATOM 9616   N N   . CYS C 3 13  ? -87.821  -57.085 66.487  1.00 0.00 ? 13  CYS C N   1  
ATOM 9617   C CA  . CYS C 3 13  ? -87.097  -57.745 65.405  1.00 0.00 ? 13  CYS C CA  1  
ATOM 9618   C C   . CYS C 3 13  ? -87.361  -56.930 64.149  1.00 0.00 ? 13  CYS C C   1  
ATOM 9619   O O   . CYS C 3 13  ? -86.402  -56.603 63.479  1.00 0.00 ? 13  CYS C O   1  
ATOM 9620   C CB  . CYS C 3 13  ? -87.360  -59.210 65.332  1.00 0.00 ? 13  CYS C CB  1  
ATOM 9621   S SG  . CYS C 3 13  ? -86.840  -60.014 66.793  1.00 0.00 ? 13  CYS C SG  1  
ATOM 9622   N N   . GLY C 3 14  ? -88.661  -56.574 63.889  1.00 0.00 ? 14  GLY C N   1  
ATOM 9623   C CA  . GLY C 3 14  ? -89.061  -55.890 62.703  1.00 0.00 ? 14  GLY C CA  1  
ATOM 9624   C C   . GLY C 3 14  ? -88.330  -54.516 62.644  1.00 0.00 ? 14  GLY C C   1  
ATOM 9625   O O   . GLY C 3 14  ? -87.838  -54.136 61.585  1.00 0.00 ? 14  GLY C O   1  
ATOM 9626   N N   . ASN C 3 15  ? -88.250  -53.792 63.801  1.00 0.00 ? 15  ASN C N   1  
ATOM 9627   C CA  . ASN C 3 15  ? -87.591  -52.517 63.876  1.00 0.00 ? 15  ASN C CA  1  
ATOM 9628   C C   . ASN C 3 15  ? -86.098  -52.656 63.733  1.00 0.00 ? 15  ASN C C   1  
ATOM 9629   O O   . ASN C 3 15  ? -85.544  -51.830 63.026  1.00 0.00 ? 15  ASN C O   1  
ATOM 9630   C CB  . ASN C 3 15  ? -87.794  -51.819 65.216  1.00 0.00 ? 15  ASN C CB  1  
ATOM 9631   C CG  . ASN C 3 15  ? -89.317  -51.473 65.264  1.00 0.00 ? 15  ASN C CG  1  
ATOM 9632   O OD1 . ASN C 3 15  ? -90.255  -51.957 64.615  1.00 0.00 ? 15  ASN C OD1 1  
ATOM 9633   N ND2 . ASN C 3 15  ? -89.557  -50.370 66.040  1.00 0.00 ? 15  ASN C ND2 1  
ATOM 9634   N N   . HIS C 3 16  ? -85.440  -53.711 64.302  1.00 0.00 ? 16  HIS C N   1  
ATOM 9635   C CA  . HIS C 3 16  ? -84.040  -53.909 64.149  1.00 0.00 ? 16  HIS C CA  1  
ATOM 9636   C C   . HIS C 3 16  ? -83.682  -54.207 62.728  1.00 0.00 ? 16  HIS C C   1  
ATOM 9637   O O   . HIS C 3 16  ? -82.796  -53.518 62.207  1.00 0.00 ? 16  HIS C O   1  
ATOM 9638   C CB  . HIS C 3 16  ? -83.493  -55.001 64.973  1.00 0.00 ? 16  HIS C CB  1  
ATOM 9639   C CG  . HIS C 3 16  ? -83.672  -54.788 66.418  1.00 0.00 ? 16  HIS C CG  1  
ATOM 9640   N ND1 . HIS C 3 16  ? -83.640  -53.565 66.992  1.00 0.00 ? 16  HIS C ND1 1  
ATOM 9641   C CD2 . HIS C 3 16  ? -83.858  -55.676 67.419  1.00 0.00 ? 16  HIS C CD2 1  
ATOM 9642   C CE1 . HIS C 3 16  ? -83.932  -53.819 68.313  1.00 0.00 ? 16  HIS C CE1 1  
ATOM 9643   N NE2 . HIS C 3 16  ? -84.073  -55.090 68.594  1.00 0.00 ? 16  HIS C NE2 1  
ATOM 9644   N N   . VAL C 3 17  ? -84.301  -55.154 61.996  1.00 0.00 ? 17  VAL C N   1  
ATOM 9645   C CA  . VAL C 3 17  ? -83.882  -55.474 60.620  1.00 0.00 ? 17  VAL C CA  1  
ATOM 9646   C C   . VAL C 3 17  ? -84.208  -54.260 59.806  1.00 0.00 ? 17  VAL C C   1  
ATOM 9647   O O   . VAL C 3 17  ? -83.482  -53.928 58.883  1.00 0.00 ? 17  VAL C O   1  
ATOM 9648   C CB  . VAL C 3 17  ? -84.578  -56.681 60.011  1.00 0.00 ? 17  VAL C CB  1  
ATOM 9649   C CG1 . VAL C 3 17  ? -86.192  -56.584 60.204  1.00 0.00 ? 17  VAL C CG1 1  
ATOM 9650   C CG2 . VAL C 3 17  ? -84.241  -57.035 58.559  1.00 0.00 ? 17  VAL C CG2 1  
ATOM 9651   N N   . GLY C 3 18  ? -85.372  -53.568 60.034  1.00 0.00 ? 18  GLY C N   1  
ATOM 9652   C CA  . GLY C 3 18  ? -85.873  -52.446 59.177  1.00 0.00 ? 18  GLY C CA  1  
ATOM 9653   C C   . GLY C 3 18  ? -84.910  -51.243 59.148  1.00 0.00 ? 18  GLY C C   1  
ATOM 9654   O O   . GLY C 3 18  ? -84.533  -50.774 58.107  1.00 0.00 ? 18  GLY C O   1  
ATOM 9655   N N   . LYS C 3 19  ? -84.327  -50.887 60.309  1.00 0.00 ? 19  LYS C N   1  
ATOM 9656   C CA  . LYS C 3 19  ? -83.314  -49.906 60.487  1.00 0.00 ? 19  LYS C CA  1  
ATOM 9657   C C   . LYS C 3 19  ? -82.024  -50.295 59.787  1.00 0.00 ? 19  LYS C C   1  
ATOM 9658   O O   . LYS C 3 19  ? -81.443  -49.470 59.089  1.00 0.00 ? 19  LYS C O   1  
ATOM 9659   C CB  . LYS C 3 19  ? -83.079  -49.716 62.069  1.00 0.00 ? 19  LYS C CB  1  
ATOM 9660   C CG  . LYS C 3 19  ? -82.311  -48.425 62.411  1.00 0.00 ? 19  LYS C CG  1  
ATOM 9661   C CD  . LYS C 3 19  ? -82.192  -48.110 63.913  1.00 0.00 ? 19  LYS C CD  1  
ATOM 9662   C CE  . LYS C 3 19  ? -81.096  -48.778 64.754  1.00 0.00 ? 19  LYS C CE  1  
ATOM 9663   N NZ  . LYS C 3 19  ? -80.952  -48.321 66.153  1.00 0.00 ? 19  LYS C NZ  1  
ATOM 9664   N N   . PHE C 3 20  ? -81.616  -51.574 59.908  1.00 0.00 ? 20  PHE C N   1  
ATOM 9665   C CA  . PHE C 3 20  ? -80.424  -52.043 59.208  1.00 0.00 ? 20  PHE C CA  1  
ATOM 9666   C C   . PHE C 3 20  ? -80.594  -52.013 57.742  1.00 0.00 ? 20  PHE C C   1  
ATOM 9667   O O   . PHE C 3 20  ? -79.578  -51.847 57.014  1.00 0.00 ? 20  PHE C O   1  
ATOM 9668   C CB  . PHE C 3 20  ? -80.147  -53.511 59.553  1.00 0.00 ? 20  PHE C CB  1  
ATOM 9669   C CG  . PHE C 3 20  ? -79.782  -53.799 60.950  1.00 0.00 ? 20  PHE C CG  1  
ATOM 9670   C CD1 . PHE C 3 20  ? -79.080  -52.971 61.760  1.00 0.00 ? 20  PHE C CD1 1  
ATOM 9671   C CD2 . PHE C 3 20  ? -80.251  -55.008 61.562  1.00 0.00 ? 20  PHE C CD2 1  
ATOM 9672   C CE1 . PHE C 3 20  ? -79.001  -53.081 63.151  1.00 0.00 ? 20  PHE C CE1 1  
ATOM 9673   C CE2 . PHE C 3 20  ? -80.198  -55.205 62.960  1.00 0.00 ? 20  PHE C CE2 1  
ATOM 9674   C CZ  . PHE C 3 20  ? -79.650  -54.157 63.730  1.00 0.00 ? 20  PHE C CZ  1  
ATOM 9675   N N   . LEU C 3 21  ? -81.774  -52.317 57.307  1.00 0.00 ? 21  LEU C N   1  
ATOM 9676   C CA  . LEU C 3 21  ? -82.011  -52.449 55.877  1.00 0.00 ? 21  LEU C CA  1  
ATOM 9677   C C   . LEU C 3 21  ? -81.699  -51.100 55.222  1.00 0.00 ? 21  LEU C C   1  
ATOM 9678   O O   . LEU C 3 21  ? -81.047  -50.968 54.231  1.00 0.00 ? 21  LEU C O   1  
ATOM 9679   C CB  . LEU C 3 21  ? -83.541  -52.866 55.639  1.00 0.00 ? 21  LEU C CB  1  
ATOM 9680   C CG  . LEU C 3 21  ? -84.067  -52.727 54.191  1.00 0.00 ? 21  LEU C CG  1  
ATOM 9681   C CD1 . LEU C 3 21  ? -83.143  -53.289 53.150  1.00 0.00 ? 21  LEU C CD1 1  
ATOM 9682   C CD2 . LEU C 3 21  ? -85.583  -53.105 54.125  1.00 0.00 ? 21  LEU C CD2 1  
ATOM 9683   N N   . TRP C 3 22  ? -82.190  -49.975 55.857  1.00 0.00 ? 22  TRP C N   1  
ATOM 9684   C CA  . TRP C 3 22  ? -82.036  -48.565 55.328  1.00 0.00 ? 22  TRP C CA  1  
ATOM 9685   C C   . TRP C 3 22  ? -80.615  -48.219 55.339  1.00 0.00 ? 22  TRP C C   1  
ATOM 9686   O O   . TRP C 3 22  ? -80.220  -47.567 54.353  1.00 0.00 ? 22  TRP C O   1  
ATOM 9687   C CB  . TRP C 3 22  ? -82.928  -47.569 56.060  1.00 0.00 ? 22  TRP C CB  1  
ATOM 9688   C CG  . TRP C 3 22  ? -84.411  -47.795 55.753  1.00 0.00 ? 22  TRP C CG  1  
ATOM 9689   C CD1 . TRP C 3 22  ? -85.386  -48.321 56.561  1.00 0.00 ? 22  TRP C CD1 1  
ATOM 9690   C CD2 . TRP C 3 22  ? -84.942  -47.868 54.395  1.00 0.00 ? 22  TRP C CD2 1  
ATOM 9691   N NE1 . TRP C 3 22  ? -86.414  -48.757 55.801  1.00 0.00 ? 22  TRP C NE1 1  
ATOM 9692   C CE2 . TRP C 3 22  ? -86.193  -48.406 54.501  1.00 0.00 ? 22  TRP C CE2 1  
ATOM 9693   C CE3 . TRP C 3 22  ? -84.449  -47.387 53.210  1.00 0.00 ? 22  TRP C CE3 1  
ATOM 9694   C CZ2 . TRP C 3 22  ? -87.001  -48.580 53.326  1.00 0.00 ? 22  TRP C CZ2 1  
ATOM 9695   C CZ3 . TRP C 3 22  ? -85.192  -47.531 52.075  1.00 0.00 ? 22  TRP C CZ3 1  
ATOM 9696   C CH2 . TRP C 3 22  ? -86.476  -48.201 52.125  1.00 0.00 ? 22  TRP C CH2 1  
ATOM 9697   N N   . SER C 3 23  ? -79.844  -48.669 56.373  1.00 0.00 ? 23  SER C N   1  
ATOM 9698   C CA  . SER C 3 23  ? -78.421  -48.490 56.460  1.00 0.00 ? 23  SER C CA  1  
ATOM 9699   C C   . SER C 3 23  ? -77.656  -49.143 55.301  1.00 0.00 ? 23  SER C C   1  
ATOM 9700   O O   . SER C 3 23  ? -76.830  -48.415 54.742  1.00 0.00 ? 23  SER C O   1  
ATOM 9701   C CB  . SER C 3 23  ? -77.848  -49.057 57.778  1.00 0.00 ? 23  SER C CB  1  
ATOM 9702   O OG  . SER C 3 23  ? -78.530  -48.482 58.900  1.00 0.00 ? 23  SER C OG  1  
ATOM 9703   N N   . GLN C 3 24  ? -77.975  -50.355 54.854  1.00 0.00 ? 24  GLN C N   1  
ATOM 9704   C CA  . GLN C 3 24  ? -77.372  -51.030 53.679  1.00 0.00 ? 24  GLN C CA  1  
ATOM 9705   C C   . GLN C 3 24  ? -77.627  -50.373 52.445  1.00 0.00 ? 24  GLN C C   1  
ATOM 9706   O O   . GLN C 3 24  ? -76.647  -50.154 51.796  1.00 0.00 ? 24  GLN C O   1  
ATOM 9707   C CB  . GLN C 3 24  ? -77.825  -52.531 53.523  1.00 0.00 ? 24  GLN C CB  1  
ATOM 9708   C CG  . GLN C 3 24  ? -77.358  -53.399 54.766  1.00 0.00 ? 24  GLN C CG  1  
ATOM 9709   C CD  . GLN C 3 24  ? -78.181  -54.683 54.897  1.00 0.00 ? 24  GLN C CD  1  
ATOM 9710   O OE1 . GLN C 3 24  ? -79.164  -54.896 54.145  1.00 0.00 ? 24  GLN C OE1 1  
ATOM 9711   N NE2 . GLN C 3 24  ? -77.796  -55.609 55.856  1.00 0.00 ? 24  GLN C NE2 1  
ATOM 9712   N N   . LEU C 3 25  ? -78.881  -49.888 52.110  1.00 0.00 ? 25  LEU C N   1  
ATOM 9713   C CA  . LEU C 3 25  ? -79.209  -49.210 50.950  1.00 0.00 ? 25  LEU C CA  1  
ATOM 9714   C C   . LEU C 3 25  ? -78.483  -47.876 50.830  1.00 0.00 ? 25  LEU C C   1  
ATOM 9715   O O   . LEU C 3 25  ? -78.017  -47.584 49.768  1.00 0.00 ? 25  LEU C O   1  
ATOM 9716   C CB  . LEU C 3 25  ? -80.778  -48.948 50.760  1.00 0.00 ? 25  LEU C CB  1  
ATOM 9717   C CG  . LEU C 3 25  ? -81.497  -50.277 50.685  1.00 0.00 ? 25  LEU C CG  1  
ATOM 9718   C CD1 . LEU C 3 25  ? -82.998  -49.916 50.714  1.00 0.00 ? 25  LEU C CD1 1  
ATOM 9719   C CD2 . LEU C 3 25  ? -81.174  -50.981 49.356  1.00 0.00 ? 25  LEU C CD2 1  
ATOM 9720   N N   . ALA C 3 26  ? -78.336  -47.087 51.970  1.00 0.00 ? 26  ALA C N   1  
ATOM 9721   C CA  . ALA C 3 26  ? -77.679  -45.821 52.046  1.00 0.00 ? 26  ALA C CA  1  
ATOM 9722   C C   . ALA C 3 26  ? -76.235  -46.035 51.668  1.00 0.00 ? 26  ALA C C   1  
ATOM 9723   O O   . ALA C 3 26  ? -75.715  -45.298 50.884  1.00 0.00 ? 26  ALA C O   1  
ATOM 9724   C CB  . ALA C 3 26  ? -77.676  -45.368 53.531  1.00 0.00 ? 26  ALA C CB  1  
ATOM 9725   N N   . LYS C 3 27  ? -75.587  -47.148 52.195  1.00 0.00 ? 27  LYS C N   1  
ATOM 9726   C CA  . LYS C 3 27  ? -74.170  -47.402 51.790  1.00 0.00 ? 27  LYS C CA  1  
ATOM 9727   C C   . LYS C 3 27  ? -74.098  -47.645 50.305  1.00 0.00 ? 27  LYS C C   1  
ATOM 9728   O O   . LYS C 3 27  ? -73.253  -47.203 49.589  1.00 0.00 ? 27  LYS C O   1  
ATOM 9729   C CB  . LYS C 3 27  ? -73.510  -48.585 52.480  1.00 0.00 ? 27  LYS C CB  1  
ATOM 9730   C CG  . LYS C 3 27  ? -73.416  -48.444 54.057  1.00 0.00 ? 27  LYS C CG  1  
ATOM 9731   C CD  . LYS C 3 27  ? -72.626  -49.533 54.733  1.00 0.00 ? 27  LYS C CD  1  
ATOM 9732   C CE  . LYS C 3 27  ? -73.352  -50.919 54.765  1.00 0.00 ? 27  LYS C CE  1  
ATOM 9733   N NZ  . LYS C 3 27  ? -74.535  -50.956 55.693  1.00 0.00 ? 27  LYS C NZ  1  
ATOM 9734   N N   . GLU C 3 28  ? -75.028  -48.517 49.787  1.00 0.00 ? 28  GLU C N   1  
ATOM 9735   C CA  . GLU C 3 28  ? -74.979  -49.030 48.442  1.00 0.00 ? 28  GLU C CA  1  
ATOM 9736   C C   . GLU C 3 28  ? -75.178  -47.885 47.446  1.00 0.00 ? 28  GLU C C   1  
ATOM 9737   O O   . GLU C 3 28  ? -74.493  -47.936 46.427  1.00 0.00 ? 28  GLU C O   1  
ATOM 9738   C CB  . GLU C 3 28  ? -76.131  -50.094 48.241  1.00 0.00 ? 28  GLU C CB  1  
ATOM 9739   C CG  . GLU C 3 28  ? -75.895  -51.481 48.857  1.00 0.00 ? 28  GLU C CG  1  
ATOM 9740   C CD  . GLU C 3 28  ? -77.249  -52.118 49.044  1.00 0.00 ? 28  GLU C CD  1  
ATOM 9741   O OE1 . GLU C 3 28  ? -77.816  -52.460 48.001  1.00 0.00 ? 28  GLU C OE1 1  
ATOM 9742   O OE2 . GLU C 3 28  ? -77.815  -52.145 50.167  1.00 0.00 ? 28  GLU C OE2 1  
ATOM 9743   N N   . HIS C 3 29  ? -76.080  -46.913 47.737  1.00 0.00 ? 29  HIS C N   1  
ATOM 9744   C CA  . HIS C 3 29  ? -76.461  -45.901 46.801  1.00 0.00 ? 29  HIS C CA  1  
ATOM 9745   C C   . HIS C 3 29  ? -75.670  -44.581 47.112  1.00 0.00 ? 29  HIS C C   1  
ATOM 9746   O O   . HIS C 3 29  ? -76.136  -43.546 46.702  1.00 0.00 ? 29  HIS C O   1  
ATOM 9747   C CB  . HIS C 3 29  ? -77.953  -45.593 46.877  1.00 0.00 ? 29  HIS C CB  1  
ATOM 9748   C CG  . HIS C 3 29  ? -78.710  -46.852 46.645  1.00 0.00 ? 29  HIS C CG  1  
ATOM 9749   N ND1 . HIS C 3 29  ? -78.824  -47.504 45.453  1.00 0.00 ? 29  HIS C ND1 1  
ATOM 9750   C CD2 . HIS C 3 29  ? -79.617  -47.508 47.497  1.00 0.00 ? 29  HIS C CD2 1  
ATOM 9751   C CE1 . HIS C 3 29  ? -79.781  -48.482 45.605  1.00 0.00 ? 29  HIS C CE1 1  
ATOM 9752   N NE2 . HIS C 3 29  ? -80.285  -48.510 46.793  1.00 0.00 ? 29  HIS C NE2 1  
ATOM 9753   N N   . ALA C 3 30  ? -74.461  -44.734 47.768  1.00 0.00 ? 30  ALA C N   1  
ATOM 9754   C CA  . ALA C 3 30  ? -73.542  -43.660 48.136  1.00 0.00 ? 30  ALA C CA  1  
ATOM 9755   C C   . ALA C 3 30  ? -74.110  -42.362 48.656  1.00 0.00 ? 30  ALA C C   1  
ATOM 9756   O O   . ALA C 3 30  ? -73.949  -41.336 48.043  1.00 0.00 ? 30  ALA C O   1  
ATOM 9757   C CB  . ALA C 3 30  ? -72.554  -43.389 46.989  1.00 0.00 ? 30  ALA C CB  1  
ATOM 9758   N N   . ILE C 3 31  ? -74.808  -42.483 49.754  1.00 0.00 ? 31  ILE C N   1  
ATOM 9759   C CA  . ILE C 3 31  ? -75.471  -41.405 50.411  1.00 0.00 ? 31  ILE C CA  1  
ATOM 9760   C C   . ILE C 3 31  ? -75.123  -41.516 51.883  1.00 0.00 ? 31  ILE C C   1  
ATOM 9761   O O   . ILE C 3 31  ? -74.768  -42.599 52.354  1.00 0.00 ? 31  ILE C O   1  
ATOM 9762   C CB  . ILE C 3 31  ? -77.027  -41.427 50.142  1.00 0.00 ? 31  ILE C CB  1  
ATOM 9763   C CG1 . ILE C 3 31  ? -77.671  -42.826 50.068  1.00 0.00 ? 31  ILE C CG1 1  
ATOM 9764   C CG2 . ILE C 3 31  ? -77.218  -40.710 48.779  1.00 0.00 ? 31  ILE C CG2 1  
ATOM 9765   C CD1 . ILE C 3 31  ? -79.186  -42.806 49.805  1.00 0.00 ? 31  ILE C CD1 1  
ATOM 9766   N N   . GLY C 3 32  ? -75.273  -40.477 52.678  1.00 0.00 ? 32  GLY C N   1  
ATOM 9767   C CA  . GLY C 3 32  ? -75.079  -40.393 54.059  1.00 0.00 ? 32  GLY C CA  1  
ATOM 9768   C C   . GLY C 3 32  ? -75.957  -41.232 54.910  1.00 0.00 ? 32  GLY C C   1  
ATOM 9769   O O   . GLY C 3 32  ? -76.612  -42.185 54.544  1.00 0.00 ? 32  GLY C O   1  
ATOM 9770   N N   . THR C 3 33  ? -75.811  -40.875 56.190  1.00 0.00 ? 33  THR C N   1  
ATOM 9771   C CA  . THR C 3 33  ? -76.369  -41.507 57.306  1.00 0.00 ? 33  THR C CA  1  
ATOM 9772   C C   . THR C 3 33  ? -77.731  -40.800 57.481  1.00 0.00 ? 33  THR C C   1  
ATOM 9773   O O   . THR C 3 33  ? -78.592  -41.259 58.251  1.00 0.00 ? 33  THR C O   1  
ATOM 9774   C CB  . THR C 3 33  ? -75.501  -41.373 58.608  1.00 0.00 ? 33  THR C CB  1  
ATOM 9775   O OG1 . THR C 3 33  ? -76.046  -42.171 59.578  1.00 0.00 ? 33  THR C OG1 1  
ATOM 9776   C CG2 . THR C 3 33  ? -75.500  -39.950 59.138  1.00 0.00 ? 33  THR C CG2 1  
ATOM 9777   N N   . ASP C 3 34  ? -78.064  -39.759 56.657  1.00 0.00 ? 34  ASP C N   1  
ATOM 9778   C CA  . ASP C 3 34  ? -79.344  -39.160 56.462  1.00 0.00 ? 34  ASP C CA  1  
ATOM 9779   C C   . ASP C 3 34  ? -79.625  -38.920 54.981  1.00 0.00 ? 34  ASP C C   1  
ATOM 9780   O O   . ASP C 3 34  ? -80.385  -38.109 54.521  1.00 0.00 ? 34  ASP C O   1  
ATOM 9781   C CB  . ASP C 3 34  ? -79.583  -37.772 57.184  1.00 0.00 ? 34  ASP C CB  1  
ATOM 9782   C CG  . ASP C 3 34  ? -79.157  -37.864 58.597  1.00 0.00 ? 34  ASP C CG  1  
ATOM 9783   O OD1 . ASP C 3 34  ? -77.920  -37.961 58.969  1.00 0.00 ? 34  ASP C OD1 1  
ATOM 9784   O OD2 . ASP C 3 34  ? -80.058  -37.939 59.455  1.00 0.00 ? 34  ASP C OD2 1  
ATOM 9785   N N   . GLY C 3 35  ? -78.984  -39.789 54.184  1.00 0.00 ? 35  GLY C N   1  
ATOM 9786   C CA  . GLY C 3 35  ? -79.208  -39.878 52.760  1.00 0.00 ? 35  GLY C CA  1  
ATOM 9787   C C   . GLY C 3 35  ? -78.671  -38.706 52.018  1.00 0.00 ? 35  GLY C C   1  
ATOM 9788   O O   . GLY C 3 35  ? -79.346  -38.292 51.066  1.00 0.00 ? 35  GLY C O   1  
ATOM 9789   N N   . LEU C 3 36  ? -77.553  -38.134 52.434  1.00 0.00 ? 36  LEU C N   1  
ATOM 9790   C CA  . LEU C 3 36  ? -76.936  -37.001 51.857  1.00 0.00 ? 36  LEU C CA  1  
ATOM 9791   C C   . LEU C 3 36  ? -75.958  -37.435 50.862  1.00 0.00 ? 36  LEU C C   1  
ATOM 9792   O O   . LEU C 3 36  ? -75.055  -38.195 51.143  1.00 0.00 ? 36  LEU C O   1  
ATOM 9793   C CB  . LEU C 3 36  ? -76.145  -36.159 52.910  1.00 0.00 ? 36  LEU C CB  1  
ATOM 9794   C CG  . LEU C 3 36  ? -75.524  -34.851 52.446  1.00 0.00 ? 36  LEU C CG  1  
ATOM 9795   C CD1 . LEU C 3 36  ? -76.511  -33.975 51.702  1.00 0.00 ? 36  LEU C CD1 1  
ATOM 9796   C CD2 . LEU C 3 36  ? -74.701  -34.142 53.538  1.00 0.00 ? 36  LEU C CD2 1  
ATOM 9797   N N   . SER C 3 37  ? -76.174  -36.965 49.562  1.00 0.00 ? 37  SER C N   1  
ATOM 9798   C CA  . SER C 3 37  ? -75.428  -37.347 48.368  1.00 0.00 ? 37  SER C CA  1  
ATOM 9799   C C   . SER C 3 37  ? -74.009  -36.823 48.328  1.00 0.00 ? 37  SER C C   1  
ATOM 9800   O O   . SER C 3 37  ? -73.769  -35.757 48.814  1.00 0.00 ? 37  SER C O   1  
ATOM 9801   C CB  . SER C 3 37  ? -76.168  -36.961 47.107  1.00 0.00 ? 37  SER C CB  1  
ATOM 9802   O OG  . SER C 3 37  ? -77.494  -37.554 47.101  1.00 0.00 ? 37  SER C OG  1  
ATOM 9803   N N   . GLN C 3 38  ? -73.086  -37.585 47.723  1.00 0.00 ? 38  GLN C N   1  
ATOM 9804   C CA  . GLN C 3 38  ? -71.735  -37.010 47.698  1.00 0.00 ? 38  GLN C CA  1  
ATOM 9805   C C   . GLN C 3 38  ? -71.637  -36.388 46.416  1.00 0.00 ? 38  GLN C C   1  
ATOM 9806   O O   . GLN C 3 38  ? -72.573  -36.406 45.631  1.00 0.00 ? 38  GLN C O   1  
ATOM 9807   C CB  . GLN C 3 38  ? -70.672  -38.116 47.880  1.00 0.00 ? 38  GLN C CB  1  
ATOM 9808   C CG  . GLN C 3 38  ? -70.537  -38.738 49.317  1.00 0.00 ? 38  GLN C CG  1  
ATOM 9809   C CD  . GLN C 3 38  ? -71.612  -39.753 49.627  1.00 0.00 ? 38  GLN C CD  1  
ATOM 9810   O OE1 . GLN C 3 38  ? -71.417  -40.875 49.196  1.00 0.00 ? 38  GLN C OE1 1  
ATOM 9811   N NE2 . GLN C 3 38  ? -72.649  -39.337 50.399  1.00 0.00 ? 38  GLN C NE2 1  
ATOM 9812   N N   . LEU C 3 39  ? -70.492  -35.650 46.216  1.00 0.00 ? 39  LEU C N   1  
ATOM 9813   C CA  . LEU C 3 39  ? -70.319  -34.794 45.049  1.00 0.00 ? 39  LEU C CA  1  
ATOM 9814   C C   . LEU C 3 39  ? -70.491  -35.460 43.659  1.00 0.00 ? 39  LEU C C   1  
ATOM 9815   O O   . LEU C 3 39  ? -71.126  -34.805 42.884  1.00 0.00 ? 39  LEU C O   1  
ATOM 9816   C CB  . LEU C 3 39  ? -68.942  -33.965 45.134  1.00 0.00 ? 39  LEU C CB  1  
ATOM 9817   C CG  . LEU C 3 39  ? -68.620  -32.796 44.130  1.00 0.00 ? 39  LEU C CG  1  
ATOM 9818   C CD1 . LEU C 3 39  ? -68.335  -33.336 42.639  1.00 0.00 ? 39  LEU C CD1 1  
ATOM 9819   C CD2 . LEU C 3 39  ? -69.702  -31.687 44.051  1.00 0.00 ? 39  LEU C CD2 1  
ATOM 9820   N N   . PRO C 3 40  ? -69.956  -36.647 43.303  1.00 0.00 ? 40  PRO C N   1  
ATOM 9821   C CA  . PRO C 3 40  ? -70.140  -37.255 42.007  1.00 0.00 ? 40  PRO C CA  1  
ATOM 9822   C C   . PRO C 3 40  ? -71.545  -37.769 41.788  1.00 0.00 ? 40  PRO C C   1  
ATOM 9823   O O   . PRO C 3 40  ? -71.866  -38.240 40.698  1.00 0.00 ? 40  PRO C O   1  
ATOM 9824   C CB  . PRO C 3 40  ? -69.225  -38.496 41.920  1.00 0.00 ? 40  PRO C CB  1  
ATOM 9825   C CG  . PRO C 3 40  ? -68.163  -38.196 42.963  1.00 0.00 ? 40  PRO C CG  1  
ATOM 9826   C CD  . PRO C 3 40  ? -68.755  -37.272 43.972  1.00 0.00 ? 40  PRO C CD  1  
ATOM 9827   N N   . ASP C 3 41  ? -72.431  -37.672 42.802  1.00 0.00 ? 41  ASP C N   1  
ATOM 9828   C CA  . ASP C 3 41  ? -73.787  -38.248 42.766  1.00 0.00 ? 41  ASP C CA  1  
ATOM 9829   C C   . ASP C 3 41  ? -74.802  -37.152 42.452  1.00 0.00 ? 41  ASP C C   1  
ATOM 9830   O O   . ASP C 3 41  ? -76.020  -37.394 42.279  1.00 0.00 ? 41  ASP C O   1  
ATOM 9831   C CB  . ASP C 3 41  ? -74.228  -38.842 44.162  1.00 0.00 ? 41  ASP C CB  1  
ATOM 9832   C CG  . ASP C 3 41  ? -73.404  -40.110 44.618  1.00 0.00 ? 41  ASP C CG  1  
ATOM 9833   O OD1 . ASP C 3 41  ? -72.153  -39.918 44.860  1.00 0.00 ? 41  ASP C OD1 1  
ATOM 9834   O OD2 . ASP C 3 41  ? -73.952  -41.256 44.705  1.00 0.00 ? 41  ASP C OD2 1  
ATOM 9835   N N   . SER C 3 42  ? -74.315  -35.897 42.364  1.00 0.00 ? 42  SER C N   1  
ATOM 9836   C CA  . SER C 3 42  ? -75.039  -34.641 41.979  1.00 0.00 ? 42  SER C CA  1  
ATOM 9837   C C   . SER C 3 42  ? -74.718  -34.403 40.516  1.00 0.00 ? 42  SER C C   1  
ATOM 9838   O O   . SER C 3 42  ? -74.866  -33.284 40.010  1.00 0.00 ? 42  SER C O   1  
ATOM 9839   C CB  . SER C 3 42  ? -74.465  -33.440 42.769  1.00 0.00 ? 42  SER C CB  1  
ATOM 9840   O OG  . SER C 3 42  ? -74.396  -33.723 44.162  1.00 0.00 ? 42  SER C OG  1  
ATOM 9841   N N   . SER C 3 43  ? -74.277  -35.454 39.845  1.00 0.00 ? 43  SER C N   1  
ATOM 9842   C CA  . SER C 3 43  ? -73.921  -35.445 38.442  1.00 0.00 ? 43  SER C CA  1  
ATOM 9843   C C   . SER C 3 43  ? -75.144  -36.005 37.829  1.00 0.00 ? 43  SER C C   1  
ATOM 9844   O O   . SER C 3 43  ? -76.085  -36.239 38.575  1.00 0.00 ? 43  SER C O   1  
ATOM 9845   C CB  . SER C 3 43  ? -72.750  -36.299 38.168  1.00 0.00 ? 43  SER C CB  1  
ATOM 9846   O OG  . SER C 3 43  ? -71.553  -35.763 38.792  1.00 0.00 ? 43  SER C OG  1  
ATOM 9847   N N   . THR C 3 44  ? -75.220  -36.232 36.478  1.00 0.00 ? 44  THR C N   1  
ATOM 9848   C CA  . THR C 3 44  ? -76.326  -36.789 35.730  1.00 0.00 ? 44  THR C CA  1  
ATOM 9849   C C   . THR C 3 44  ? -76.269  -38.284 35.798  1.00 0.00 ? 44  THR C C   1  
ATOM 9850   O O   . THR C 3 44  ? -75.226  -38.872 35.471  1.00 0.00 ? 44  THR C O   1  
ATOM 9851   C CB  . THR C 3 44  ? -76.187  -36.418 34.226  1.00 0.00 ? 44  THR C CB  1  
ATOM 9852   O OG1 . THR C 3 44  ? -74.910  -36.711 33.670  1.00 0.00 ? 44  THR C OG1 1  
ATOM 9853   C CG2 . THR C 3 44  ? -76.495  -34.988 34.111  1.00 0.00 ? 44  THR C CG2 1  
ATOM 9854   N N   . GLU C 3 45  ? -77.448  -38.865 36.079  1.00 0.00 ? 45  GLU C N   1  
ATOM 9855   C CA  . GLU C 3 45  ? -77.843  -40.259 36.107  1.00 0.00 ? 45  GLU C CA  1  
ATOM 9856   C C   . GLU C 3 45  ? -77.343  -40.928 37.386  1.00 0.00 ? 45  GLU C C   1  
ATOM 9857   O O   . GLU C 3 45  ? -76.127  -40.846 37.657  1.00 0.00 ? 45  GLU C O   1  
ATOM 9858   C CB  . GLU C 3 45  ? -77.532  -41.015 34.795  1.00 0.00 ? 45  GLU C CB  1  
ATOM 9859   C CG  . GLU C 3 45  ? -78.238  -40.531 33.539  1.00 0.00 ? 45  GLU C CG  1  
ATOM 9860   C CD  . GLU C 3 45  ? -79.770  -40.887 33.679  1.00 0.00 ? 45  GLU C CD  1  
ATOM 9861   O OE1 . GLU C 3 45  ? -80.039  -42.047 34.068  1.00 0.00 ? 45  GLU C OE1 1  
ATOM 9862   O OE2 . GLU C 3 45  ? -80.631  -40.008 33.414  1.00 0.00 ? 45  GLU C OE2 1  
ATOM 9863   N N   . ARG C 3 46  ? -78.271  -41.726 38.024  1.00 0.00 ? 46  ARG C N   1  
ATOM 9864   C CA  . ARG C 3 46  ? -77.958  -42.683 39.048  1.00 0.00 ? 46  ARG C CA  1  
ATOM 9865   C C   . ARG C 3 46  ? -79.032  -43.723 38.876  1.00 0.00 ? 46  ARG C C   1  
ATOM 9866   O O   . ARG C 3 46  ? -79.899  -43.481 37.983  1.00 0.00 ? 46  ARG C O   1  
ATOM 9867   C CB  . ARG C 3 46  ? -78.041  -42.174 40.523  1.00 0.00 ? 46  ARG C CB  1  
ATOM 9868   C CG  . ARG C 3 46  ? -77.158  -41.027 40.925  1.00 0.00 ? 46  ARG C CG  1  
ATOM 9869   C CD  . ARG C 3 46  ? -75.712  -41.396 41.426  1.00 0.00 ? 46  ARG C CD  1  
ATOM 9870   N NE  . ARG C 3 46  ? -74.755  -41.226 40.324  1.00 0.00 ? 46  ARG C NE  1  
ATOM 9871   C CZ  . ARG C 3 46  ? -73.416  -41.321 40.413  1.00 0.00 ? 46  ARG C CZ  1  
ATOM 9872   N NH1 . ARG C 3 46  ? -72.806  -41.763 41.564  1.00 0.00 ? 46  ARG C NH1 1  
ATOM 9873   N NH2 . ARG C 3 46  ? -72.613  -41.012 39.333  1.00 0.00 ? 46  ARG C NH2 1  
ATOM 9874   N N   . ASP C 3 47  ? -79.024  -44.823 39.639  1.00 0.00 ? 47  ASP C N   1  
ATOM 9875   C CA  . ASP C 3 47  ? -80.037  -45.906 39.549  1.00 0.00 ? 47  ASP C CA  1  
ATOM 9876   C C   . ASP C 3 47  ? -81.411  -45.336 39.972  1.00 0.00 ? 47  ASP C C   1  
ATOM 9877   O O   . ASP C 3 47  ? -81.454  -44.323 40.657  1.00 0.00 ? 47  ASP C O   1  
ATOM 9878   C CB  . ASP C 3 47  ? -79.681  -47.031 40.631  1.00 0.00 ? 47  ASP C CB  1  
ATOM 9879   C CG  . ASP C 3 47  ? -78.385  -47.752 40.127  1.00 0.00 ? 47  ASP C CG  1  
ATOM 9880   O OD1 . ASP C 3 47  ? -78.533  -48.389 39.024  1.00 0.00 ? 47  ASP C OD1 1  
ATOM 9881   O OD2 . ASP C 3 47  ? -77.311  -47.704 40.781  1.00 0.00 ? 47  ASP C OD2 1  
ATOM 9882   N N   . ASP C 3 48  ? -82.551  -45.894 39.417  1.00 0.00 ? 48  ASP C N   1  
ATOM 9883   C CA  . ASP C 3 48  ? -83.891  -45.438 39.743  1.00 0.00 ? 48  ASP C CA  1  
ATOM 9884   C C   . ASP C 3 48  ? -84.465  -46.186 40.880  1.00 0.00 ? 48  ASP C C   1  
ATOM 9885   O O   . ASP C 3 48  ? -85.604  -46.649 40.969  1.00 0.00 ? 48  ASP C O   1  
ATOM 9886   C CB  . ASP C 3 48  ? -84.867  -45.583 38.555  1.00 0.00 ? 48  ASP C CB  1  
ATOM 9887   C CG  . ASP C 3 48  ? -84.334  -44.755 37.330  1.00 0.00 ? 48  ASP C CG  1  
ATOM 9888   O OD1 . ASP C 3 48  ? -84.350  -43.501 37.518  1.00 0.00 ? 48  ASP C OD1 1  
ATOM 9889   O OD2 . ASP C 3 48  ? -83.986  -45.330 36.281  1.00 0.00 ? 48  ASP C OD2 1  
ATOM 9890   N N   . ASP C 3 49  ? -83.681  -46.342 41.980  1.00 0.00 ? 49  ASP C N   1  
ATOM 9891   C CA  . ASP C 3 49  ? -84.129  -46.932 43.205  1.00 0.00 ? 49  ASP C CA  1  
ATOM 9892   C C   . ASP C 3 49  ? -85.028  -45.996 43.974  1.00 0.00 ? 49  ASP C C   1  
ATOM 9893   O O   . ASP C 3 49  ? -85.935  -46.308 44.778  1.00 0.00 ? 49  ASP C O   1  
ATOM 9894   C CB  . ASP C 3 49  ? -82.976  -47.323 44.150  1.00 0.00 ? 49  ASP C CB  1  
ATOM 9895   C CG  . ASP C 3 49  ? -81.894  -46.275 44.567  1.00 0.00 ? 49  ASP C CG  1  
ATOM 9896   O OD1 . ASP C 3 49  ? -81.009  -46.055 43.773  1.00 0.00 ? 49  ASP C OD1 1  
ATOM 9897   O OD2 . ASP C 3 49  ? -81.956  -45.785 45.673  1.00 0.00 ? 49  ASP C OD2 1  
ATOM 9898   N N   . THR C 3 50  ? -84.746  -44.704 43.721  1.00 0.00 ? 50  THR C N   1  
ATOM 9899   C CA  . THR C 3 50  ? -85.089  -43.549 44.463  1.00 0.00 ? 50  THR C CA  1  
ATOM 9900   C C   . THR C 3 50  ? -86.557  -43.396 44.755  1.00 0.00 ? 50  THR C C   1  
ATOM 9901   O O   . THR C 3 50  ? -87.006  -43.696 45.865  1.00 0.00 ? 50  THR C O   1  
ATOM 9902   C CB  . THR C 3 50  ? -84.480  -42.299 43.781  1.00 0.00 ? 50  THR C CB  1  
ATOM 9903   O OG1 . THR C 3 50  ? -84.787  -42.267 42.323  1.00 0.00 ? 50  THR C OG1 1  
ATOM 9904   C CG2 . THR C 3 50  ? -82.918  -42.227 44.062  1.00 0.00 ? 50  THR C CG2 1  
ATOM 9905   N N   . LYS C 3 51  ? -87.469  -43.165 43.748  1.00 0.00 ? 51  LYS C N   1  
ATOM 9906   C CA  . LYS C 3 51  ? -88.825  -42.931 44.045  1.00 0.00 ? 51  LYS C CA  1  
ATOM 9907   C C   . LYS C 3 51  ? -89.615  -44.104 44.556  1.00 0.00 ? 51  LYS C C   1  
ATOM 9908   O O   . LYS C 3 51  ? -90.355  -43.886 45.544  1.00 0.00 ? 51  LYS C O   1  
ATOM 9909   C CB  . LYS C 3 51  ? -89.681  -42.148 42.990  1.00 0.00 ? 51  LYS C CB  1  
ATOM 9910   C CG  . LYS C 3 51  ? -89.323  -40.718 42.722  1.00 0.00 ? 51  LYS C CG  1  
ATOM 9911   C CD  . LYS C 3 51  ? -90.197  -39.686 43.453  1.00 0.00 ? 51  LYS C CD  1  
ATOM 9912   C CE  . LYS C 3 51  ? -89.641  -39.527 44.884  1.00 0.00 ? 51  LYS C CE  1  
ATOM 9913   N NZ  . LYS C 3 51  ? -90.007  -38.140 45.456  1.00 0.00 ? 51  LYS C NZ  1  
ATOM 9914   N N   . PRO C 3 52  ? -89.479  -45.429 44.174  1.00 0.00 ? 52  PRO C N   1  
ATOM 9915   C CA  . PRO C 3 52  ? -90.218  -46.503 44.857  1.00 0.00 ? 52  PRO C CA  1  
ATOM 9916   C C   . PRO C 3 52  ? -89.963  -46.632 46.292  1.00 0.00 ? 52  PRO C C   1  
ATOM 9917   O O   . PRO C 3 52  ? -91.015  -46.837 46.960  1.00 0.00 ? 52  PRO C O   1  
ATOM 9918   C CB  . PRO C 3 52  ? -89.791  -47.774 44.109  1.00 0.00 ? 52  PRO C CB  1  
ATOM 9919   C CG  . PRO C 3 52  ? -89.556  -47.264 42.624  1.00 0.00 ? 52  PRO C CG  1  
ATOM 9920   C CD  . PRO C 3 52  ? -89.126  -45.790 42.791  1.00 0.00 ? 52  PRO C CD  1  
ATOM 9921   N N   . PHE C 3 53  ? -88.705  -46.692 46.722  1.00 0.00 ? 53  PHE C N   1  
ATOM 9922   C CA  . PHE C 3 53  ? -88.251  -46.933 48.058  1.00 0.00 ? 53  PHE C CA  1  
ATOM 9923   C C   . PHE C 3 53  ? -88.120  -45.723 48.963  1.00 0.00 ? 53  PHE C C   1  
ATOM 9924   O O   . PHE C 3 53  ? -88.240  -45.808 50.208  1.00 0.00 ? 53  PHE C O   1  
ATOM 9925   C CB  . PHE C 3 53  ? -86.925  -47.752 48.067  1.00 0.00 ? 53  PHE C CB  1  
ATOM 9926   C CG  . PHE C 3 53  ? -87.219  -49.246 47.701  1.00 0.00 ? 53  PHE C CG  1  
ATOM 9927   C CD1 . PHE C 3 53  ? -87.757  -50.026 48.729  1.00 0.00 ? 53  PHE C CD1 1  
ATOM 9928   C CD2 . PHE C 3 53  ? -87.234  -49.680 46.325  1.00 0.00 ? 53  PHE C CD2 1  
ATOM 9929   C CE1 . PHE C 3 53  ? -88.328  -51.248 48.498  1.00 0.00 ? 53  PHE C CE1 1  
ATOM 9930   C CE2 . PHE C 3 53  ? -87.953  -50.907 46.091  1.00 0.00 ? 53  PHE C CE2 1  
ATOM 9931   C CZ  . PHE C 3 53  ? -88.417  -51.751 47.142  1.00 0.00 ? 53  PHE C CZ  1  
ATOM 9932   N N   . PHE C 3 54  ? -87.778  -44.643 48.336  1.00 0.00 ? 54  PHE C N   1  
ATOM 9933   C CA  . PHE C 3 54  ? -87.324  -43.394 48.977  1.00 0.00 ? 54  PHE C CA  1  
ATOM 9934   C C   . PHE C 3 54  ? -88.208  -42.336 48.562  1.00 0.00 ? 54  PHE C C   1  
ATOM 9935   O O   . PHE C 3 54  ? -88.834  -42.355 47.496  1.00 0.00 ? 54  PHE C O   1  
ATOM 9936   C CB  . PHE C 3 54  ? -85.882  -42.922 48.838  1.00 0.00 ? 54  PHE C CB  1  
ATOM 9937   C CG  . PHE C 3 54  ? -84.884  -43.874 49.252  1.00 0.00 ? 54  PHE C CG  1  
ATOM 9938   C CD1 . PHE C 3 54  ? -84.393  -44.912 48.468  1.00 0.00 ? 54  PHE C CD1 1  
ATOM 9939   C CD2 . PHE C 3 54  ? -84.274  -43.606 50.511  1.00 0.00 ? 54  PHE C CD2 1  
ATOM 9940   C CE1 . PHE C 3 54  ? -83.246  -45.583 48.917  1.00 0.00 ? 54  PHE C CE1 1  
ATOM 9941   C CE2 . PHE C 3 54  ? -83.262  -44.440 50.988  1.00 0.00 ? 54  PHE C CE2 1  
ATOM 9942   C CZ  . PHE C 3 54  ? -82.710  -45.381 50.166  1.00 0.00 ? 54  PHE C CZ  1  
ATOM 9943   N N   . ARG C 3 55  ? -88.211  -41.243 49.372  1.00 0.00 ? 55  ARG C N   1  
ATOM 9944   C CA  . ARG C 3 55  ? -88.777  -39.951 48.903  1.00 0.00 ? 55  ARG C CA  1  
ATOM 9945   C C   . ARG C 3 55  ? -87.746  -38.909 49.121  1.00 0.00 ? 55  ARG C C   1  
ATOM 9946   O O   . ARG C 3 55  ? -86.771  -39.061 49.855  1.00 0.00 ? 55  ARG C O   1  
ATOM 9947   C CB  . ARG C 3 55  ? -90.023  -39.442 49.651  1.00 0.00 ? 55  ARG C CB  1  
ATOM 9948   C CG  . ARG C 3 55  ? -91.261  -40.387 49.698  1.00 0.00 ? 55  ARG C CG  1  
ATOM 9949   C CD  . ARG C 3 55  ? -92.084  -40.228 50.976  1.00 0.00 ? 55  ARG C CD  1  
ATOM 9950   N NE  . ARG C 3 55  ? -91.308  -40.595 52.193  1.00 0.00 ? 55  ARG C NE  1  
ATOM 9951   C CZ  . ARG C 3 55  ? -91.721  -40.345 53.470  1.00 0.00 ? 55  ARG C CZ  1  
ATOM 9952   N NH1 . ARG C 3 55  ? -92.913  -39.753 53.725  1.00 0.00 ? 55  ARG C NH1 1  
ATOM 9953   N NH2 . ARG C 3 55  ? -90.776  -40.558 54.450  1.00 0.00 ? 55  ARG C NH2 1  
ATOM 9954   N N   . GLU C 3 56  ? -87.936  -37.817 48.418  1.00 0.00 ? 56  GLU C N   1  
ATOM 9955   C CA  . GLU C 3 56  ? -87.160  -36.647 48.352  1.00 0.00 ? 56  GLU C CA  1  
ATOM 9956   C C   . GLU C 3 56  ? -87.739  -35.540 49.046  1.00 0.00 ? 56  GLU C C   1  
ATOM 9957   O O   . GLU C 3 56  ? -88.816  -35.089 48.655  1.00 0.00 ? 56  GLU C O   1  
ATOM 9958   C CB  . GLU C 3 56  ? -86.794  -36.328 46.818  1.00 0.00 ? 56  GLU C CB  1  
ATOM 9959   C CG  . GLU C 3 56  ? -85.538  -37.105 46.324  1.00 0.00 ? 56  GLU C CG  1  
ATOM 9960   C CD  . GLU C 3 56  ? -84.225  -36.403 46.865  1.00 0.00 ? 56  GLU C CD  1  
ATOM 9961   O OE1 . GLU C 3 56  ? -84.000  -35.228 46.509  1.00 0.00 ? 56  GLU C OE1 1  
ATOM 9962   O OE2 . GLU C 3 56  ? -83.655  -36.962 47.807  1.00 0.00 ? 56  GLU C OE2 1  
ATOM 9963   N N   . ASN C 3 57  ? -86.858  -34.875 49.883  1.00 0.00 ? 57  ASN C N   1  
ATOM 9964   C CA  . ASN C 3 57  ? -87.126  -33.465 50.241  1.00 0.00 ? 57  ASN C CA  1  
ATOM 9965   C C   . ASN C 3 57  ? -86.814  -32.583 49.021  1.00 0.00 ? 57  ASN C C   1  
ATOM 9966   O O   . ASN C 3 57  ? -87.109  -31.386 48.950  1.00 0.00 ? 57  ASN C O   1  
ATOM 9967   C CB  . ASN C 3 57  ? -86.125  -33.011 51.297  1.00 0.00 ? 57  ASN C CB  1  
ATOM 9968   C CG  . ASN C 3 57  ? -86.230  -33.864 52.579  1.00 0.00 ? 57  ASN C CG  1  
ATOM 9969   O OD1 . ASN C 3 57  ? -85.633  -34.969 52.616  1.00 0.00 ? 57  ASN C OD1 1  
ATOM 9970   N ND2 . ASN C 3 57  ? -86.957  -33.379 53.606  1.00 0.00 ? 57  ASN C ND2 1  
ATOM 9971   N N   . CYS C 3 58  ? -86.073  -33.132 48.049  1.00 0.00 ? 58  CYS C N   1  
ATOM 9972   C CA  . CYS C 3 58  ? -85.545  -32.469 46.842  1.00 0.00 ? 58  CYS C CA  1  
ATOM 9973   C C   . CYS C 3 58  ? -84.651  -31.297 47.147  1.00 0.00 ? 58  CYS C C   1  
ATOM 9974   O O   . CYS C 3 58  ? -84.801  -30.195 46.696  1.00 0.00 ? 58  CYS C O   1  
ATOM 9975   C CB  . CYS C 3 58  ? -86.595  -32.064 45.752  1.00 0.00 ? 58  CYS C CB  1  
ATOM 9976   S SG  . CYS C 3 58  ? -87.524  -33.542 45.059  1.00 0.00 ? 58  CYS C SG  1  
ATOM 9977   N N   . ARG C 3 59  ? -83.595  -31.620 47.850  1.00 0.00 ? 59  ARG C N   1  
ATOM 9978   C CA  . ARG C 3 59  ? -82.414  -30.869 48.106  1.00 0.00 ? 59  ARG C CA  1  
ATOM 9979   C C   . ARG C 3 59  ? -81.366  -31.998 48.026  1.00 0.00 ? 59  ARG C C   1  
ATOM 9980   O O   . ARG C 3 59  ? -80.221  -31.822 48.475  1.00 0.00 ? 59  ARG C O   1  
ATOM 9981   C CB  . ARG C 3 59  ? -82.542  -30.257 49.508  1.00 0.00 ? 59  ARG C CB  1  
ATOM 9982   C CG  . ARG C 3 59  ? -83.697  -29.210 49.773  1.00 0.00 ? 59  ARG C CG  1  
ATOM 9983   C CD  . ARG C 3 59  ? -83.205  -27.759 49.578  1.00 0.00 ? 59  ARG C CD  1  
ATOM 9984   N NE  . ARG C 3 59  ? -84.392  -26.829 49.722  1.00 0.00 ? 59  ARG C NE  1  
ATOM 9985   C CZ  . ARG C 3 59  ? -84.588  -25.810 50.596  1.00 0.00 ? 59  ARG C CZ  1  
ATOM 9986   N NH1 . ARG C 3 59  ? -83.650  -25.528 51.556  1.00 0.00 ? 59  ARG C NH1 1  
ATOM 9987   N NH2 . ARG C 3 59  ? -85.789  -25.194 50.534  1.00 0.00 ? 59  ARG C NH2 1  
ATOM 9988   N N   . ASN C 3 60  ? -81.782  -33.279 47.547  1.00 0.00 ? 60  ASN C N   1  
ATOM 9989   C CA  . ASN C 3 60  ? -80.925  -34.469 47.455  1.00 0.00 ? 60  ASN C CA  1  
ATOM 9990   C C   . ASN C 3 60  ? -80.755  -35.238 48.707  1.00 0.00 ? 60  ASN C C   1  
ATOM 9991   O O   . ASN C 3 60  ? -79.894  -36.144 48.825  1.00 0.00 ? 60  ASN C O   1  
ATOM 9992   C CB  . ASN C 3 60  ? -79.560  -34.312 46.667  1.00 0.00 ? 60  ASN C CB  1  
ATOM 9993   C CG  . ASN C 3 60  ? -78.380  -33.532 47.250  1.00 0.00 ? 60  ASN C CG  1  
ATOM 9994   O OD1 . ASN C 3 60  ? -77.868  -33.886 48.304  1.00 0.00 ? 60  ASN C OD1 1  
ATOM 9995   N ND2 . ASN C 3 60  ? -77.981  -32.510 46.467  1.00 0.00 ? 60  ASN C ND2 1  
ATOM 9996   N N   . LYS C 3 61  ? -81.607  -34.883 49.705  1.00 0.00 ? 61  LYS C N   1  
ATOM 9997   C CA  . LYS C 3 61  ? -81.715  -35.634 50.976  1.00 0.00 ? 61  LYS C CA  1  
ATOM 9998   C C   . LYS C 3 61  ? -82.779  -36.663 50.858  1.00 0.00 ? 61  LYS C C   1  
ATOM 9999   O O   . LYS C 3 61  ? -83.998  -36.413 50.851  1.00 0.00 ? 61  LYS C O   1  
ATOM 10000  C CB  . LYS C 3 61  ? -82.169  -34.682 52.108  1.00 0.00 ? 61  LYS C CB  1  
ATOM 10001  C CG  . LYS C 3 61  ? -82.125  -35.326 53.453  1.00 0.00 ? 61  LYS C CG  1  
ATOM 10002  C CD  . LYS C 3 61  ? -83.039  -34.802 54.574  1.00 0.00 ? 61  LYS C CD  1  
ATOM 10003  C CE  . LYS C 3 61  ? -82.653  -35.122 55.977  1.00 0.00 ? 61  LYS C CE  1  
ATOM 10004  N NZ  . LYS C 3 61  ? -83.057  -36.578 56.032  1.00 0.00 ? 61  LYS C NZ  1  
ATOM 10005  N N   . PHE C 3 62  ? -82.360  -37.967 50.686  1.00 0.00 ? 62  PHE C N   1  
ATOM 10006  C CA  . PHE C 3 62  ? -83.253  -39.112 50.529  1.00 0.00 ? 62  PHE C CA  1  
ATOM 10007  C C   . PHE C 3 62  ? -83.745  -39.541 51.909  1.00 0.00 ? 62  PHE C C   1  
ATOM 10008  O O   . PHE C 3 62  ? -82.932  -39.457 52.811  1.00 0.00 ? 62  PHE C O   1  
ATOM 10009  C CB  . PHE C 3 62  ? -82.534  -40.280 49.892  1.00 0.00 ? 62  PHE C CB  1  
ATOM 10010  C CG  . PHE C 3 62  ? -82.250  -39.877 48.503  1.00 0.00 ? 62  PHE C CG  1  
ATOM 10011  C CD1 . PHE C 3 62  ? -83.210  -40.049 47.575  1.00 0.00 ? 62  PHE C CD1 1  
ATOM 10012  C CD2 . PHE C 3 62  ? -81.052  -39.316 48.106  1.00 0.00 ? 62  PHE C CD2 1  
ATOM 10013  C CE1 . PHE C 3 62  ? -83.108  -39.502 46.314  1.00 0.00 ? 62  PHE C CE1 1  
ATOM 10014  C CE2 . PHE C 3 62  ? -80.887  -38.780 46.848  1.00 0.00 ? 62  PHE C CE2 1  
ATOM 10015  C CZ  . PHE C 3 62  ? -81.908  -38.931 45.942  1.00 0.00 ? 62  PHE C CZ  1  
ATOM 10016  N N   . THR C 3 63  ? -84.988  -39.981 52.033  1.00 0.00 ? 63  THR C N   1  
ATOM 10017  C CA  . THR C 3 63  ? -85.618  -40.412 53.220  1.00 0.00 ? 63  THR C CA  1  
ATOM 10018  C C   . THR C 3 63  ? -86.323  -41.785 52.962  1.00 0.00 ? 63  THR C C   1  
ATOM 10019  O O   . THR C 3 63  ? -87.003  -41.972 51.927  1.00 0.00 ? 63  THR C O   1  
ATOM 10020  C CB  . THR C 3 63  ? -86.649  -39.513 53.695  1.00 0.00 ? 63  THR C CB  1  
ATOM 10021  O OG1 . THR C 3 63  ? -87.699  -39.292 52.729  1.00 0.00 ? 63  THR C OG1 1  
ATOM 10022  C CG2 . THR C 3 63  ? -86.123  -38.141 54.217  1.00 0.00 ? 63  THR C CG2 1  
ATOM 10023  N N   . PRO C 3 64  ? -86.259  -42.738 53.941  1.00 0.00 ? 64  PRO C N   1  
ATOM 10024  C CA  . PRO C 3 64  ? -86.928  -44.015 53.751  1.00 0.00 ? 64  PRO C CA  1  
ATOM 10025  C C   . PRO C 3 64  ? -88.414  -43.865 53.869  1.00 0.00 ? 64  PRO C C   1  
ATOM 10026  O O   . PRO C 3 64  ? -88.837  -43.161 54.741  1.00 0.00 ? 64  PRO C O   1  
ATOM 10027  C CB  . PRO C 3 64  ? -86.405  -44.822 54.963  1.00 0.00 ? 64  PRO C CB  1  
ATOM 10028  C CG  . PRO C 3 64  ? -84.987  -44.288 55.100  1.00 0.00 ? 64  PRO C CG  1  
ATOM 10029  C CD  . PRO C 3 64  ? -85.206  -42.877 54.913  1.00 0.00 ? 64  PRO C CD  1  
ATOM 10030  N N   . ARG C 3 65  ? -89.153  -44.617 53.002  1.00 0.00 ? 65  ARG C N   1  
ATOM 10031  C CA  . ARG C 3 65  ? -90.528  -44.773 52.946  1.00 0.00 ? 65  ARG C CA  1  
ATOM 10032  C C   . ARG C 3 65  ? -90.876  -45.912 53.838  1.00 0.00 ? 65  ARG C C   1  
ATOM 10033  O O   . ARG C 3 65  ? -91.142  -47.027 53.355  1.00 0.00 ? 65  ARG C O   1  
ATOM 10034  C CB  . ARG C 3 65  ? -90.901  -45.182 51.473  1.00 0.00 ? 65  ARG C CB  1  
ATOM 10035  C CG  . ARG C 3 65  ? -90.780  -43.986 50.564  1.00 0.00 ? 65  ARG C CG  1  
ATOM 10036  C CD  . ARG C 3 65  ? -91.375  -44.225 49.094  1.00 0.00 ? 65  ARG C CD  1  
ATOM 10037  N NE  . ARG C 3 65  ? -92.698  -44.954 49.085  1.00 0.00 ? 65  ARG C NE  1  
ATOM 10038  C CZ  . ARG C 3 65  ? -93.954  -44.452 49.427  1.00 0.00 ? 65  ARG C CZ  1  
ATOM 10039  N NH1 . ARG C 3 65  ? -94.079  -43.197 49.939  1.00 0.00 ? 65  ARG C NH1 1  
ATOM 10040  N NH2 . ARG C 3 65  ? -95.039  -45.221 49.236  1.00 0.00 ? 65  ARG C NH2 1  
ATOM 10041  N N   . ALA C 3 66  ? -90.797  -45.646 55.156  1.00 0.00 ? 66  ALA C N   1  
ATOM 10042  C CA  . ALA C 3 66  ? -90.934  -46.606 56.243  1.00 0.00 ? 66  ALA C CA  1  
ATOM 10043  C C   . ALA C 3 66  ? -91.762  -46.038 57.354  1.00 0.00 ? 66  ALA C C   1  
ATOM 10044  O O   . ALA C 3 66  ? -91.703  -44.855 57.610  1.00 0.00 ? 66  ALA C O   1  
ATOM 10045  C CB  . ALA C 3 66  ? -89.593  -47.025 56.807  1.00 0.00 ? 66  ALA C CB  1  
ATOM 10046  N N   . ILE C 3 67  ? -92.552  -46.925 58.005  1.00 0.00 ? 67  ILE C N   1  
ATOM 10047  C CA  . ILE C 3 67  ? -93.464  -46.614 59.097  1.00 0.00 ? 67  ILE C CA  1  
ATOM 10048  C C   . ILE C 3 67  ? -92.858  -47.466 60.272  1.00 0.00 ? 67  ILE C C   1  
ATOM 10049  O O   . ILE C 3 67  ? -92.681  -48.631 60.071  1.00 0.00 ? 67  ILE C O   1  
ATOM 10050  C CB  . ILE C 3 67  ? -94.842  -47.079 58.711  1.00 0.00 ? 67  ILE C CB  1  
ATOM 10051  C CG1 . ILE C 3 67  ? -95.530  -45.892 57.950  1.00 0.00 ? 67  ILE C CG1 1  
ATOM 10052  C CG2 . ILE C 3 67  ? -95.698  -47.538 59.920  1.00 0.00 ? 67  ILE C CG2 1  
ATOM 10053  C CD1 . ILE C 3 67  ? -96.961  -46.194 57.476  1.00 0.00 ? 67  ILE C CD1 1  
ATOM 10054  N N   . MET C 3 68  ? -92.651  -46.820 61.466  1.00 0.00 ? 68  MET C N   1  
ATOM 10055  C CA  . MET C 3 68  ? -92.181  -47.548 62.673  1.00 0.00 ? 68  MET C CA  1  
ATOM 10056  C C   . MET C 3 68  ? -93.152  -47.568 63.763  1.00 0.00 ? 68  MET C C   1  
ATOM 10057  O O   . MET C 3 68  ? -93.675  -46.544 64.240  1.00 0.00 ? 68  MET C O   1  
ATOM 10058  C CB  . MET C 3 68  ? -90.894  -46.895 63.207  1.00 0.00 ? 68  MET C CB  1  
ATOM 10059  C CG  . MET C 3 68  ? -90.085  -47.825 64.104  1.00 0.00 ? 68  MET C CG  1  
ATOM 10060  S SD  . MET C 3 68  ? -89.366  -47.143 65.562  1.00 0.00 ? 68  MET C SD  1  
ATOM 10061  C CE  . MET C 3 68  ? -88.011  -46.114 64.692  1.00 0.00 ? 68  MET C CE  1  
ATOM 10062  N N   . MET C 3 69  ? -93.395  -48.750 64.250  1.00 0.00 ? 69  MET C N   1  
ATOM 10063  C CA  . MET C 3 69  ? -94.355  -48.955 65.302  1.00 0.00 ? 69  MET C CA  1  
ATOM 10064  C C   . MET C 3 69  ? -93.647  -49.883 66.247  1.00 0.00 ? 69  MET C C   1  
ATOM 10065  O O   . MET C 3 69  ? -92.981  -50.742 65.757  1.00 0.00 ? 69  MET C O   1  
ATOM 10066  C CB  . MET C 3 69  ? -95.672  -49.641 64.799  1.00 0.00 ? 69  MET C CB  1  
ATOM 10067  C CG  . MET C 3 69  ? -96.601  -49.928 65.923  1.00 0.00 ? 69  MET C CG  1  
ATOM 10068  S SD  . MET C 3 69  ? -97.433  -48.355 66.561  1.00 0.00 ? 69  MET C SD  1  
ATOM 10069  C CE  . MET C 3 69  ? -97.955  -48.654 68.225  1.00 0.00 ? 69  MET C CE  1  
ATOM 10070  N N   . ASP C 3 70  ? -93.796  -49.669 67.586  1.00 0.00 ? 70  ASP C N   1  
ATOM 10071  C CA  . ASP C 3 70  ? -93.259  -50.417 68.712  1.00 0.00 ? 70  ASP C CA  1  
ATOM 10072  C C   . ASP C 3 70  ? -93.612  -49.536 69.860  1.00 0.00 ? 70  ASP C C   1  
ATOM 10073  O O   . ASP C 3 70  ? -94.538  -48.719 69.810  1.00 0.00 ? 70  ASP C O   1  
ATOM 10074  C CB  . ASP C 3 70  ? -91.707  -50.521 68.703  1.00 0.00 ? 70  ASP C CB  1  
ATOM 10075  C CG  . ASP C 3 70  ? -91.173  -51.673 69.620  1.00 0.00 ? 70  ASP C CG  1  
ATOM 10076  O OD1 . ASP C 3 70  ? -91.472  -52.865 69.241  1.00 0.00 ? 70  ASP C OD1 1  
ATOM 10077  O OD2 . ASP C 3 70  ? -90.428  -51.324 70.568  1.00 0.00 ? 70  ASP C OD2 1  
ATOM 10078  N N   . SER C 3 71  ? -92.971  -49.716 71.009  1.00 0.00 ? 71  SER C N   1  
ATOM 10079  C CA  . SER C 3 71  ? -93.045  -48.893 72.106  1.00 0.00 ? 71  SER C CA  1  
ATOM 10080  C C   . SER C 3 71  ? -91.753  -48.198 72.227  1.00 0.00 ? 71  SER C C   1  
ATOM 10081  O O   . SER C 3 71  ? -91.023  -47.999 71.268  1.00 0.00 ? 71  SER C O   1  
ATOM 10082  C CB  . SER C 3 71  ? -93.279  -49.833 73.348  1.00 0.00 ? 71  SER C CB  1  
ATOM 10083  O OG  . SER C 3 71  ? -92.227  -50.803 73.674  1.00 0.00 ? 71  SER C OG  1  
ATOM 10084  N N   . GLU C 3 72  ? -91.383  -47.888 73.442  1.00 0.00 ? 72  GLU C N   1  
ATOM 10085  C CA  . GLU C 3 72  ? -90.199  -47.069 73.688  1.00 0.00 ? 72  GLU C CA  1  
ATOM 10086  C C   . GLU C 3 72  ? -88.829  -47.693 73.346  1.00 0.00 ? 72  GLU C C   1  
ATOM 10087  O O   . GLU C 3 72  ? -88.042  -47.052 72.649  1.00 0.00 ? 72  GLU C O   1  
ATOM 10088  C CB  . GLU C 3 72  ? -90.272  -46.506 75.137  1.00 0.00 ? 72  GLU C CB  1  
ATOM 10089  C CG  . GLU C 3 72  ? -91.514  -45.642 75.523  1.00 0.00 ? 72  GLU C CG  1  
ATOM 10090  C CD  . GLU C 3 72  ? -92.810  -46.361 75.444  1.00 0.00 ? 72  GLU C CD  1  
ATOM 10091  O OE1 . GLU C 3 72  ? -92.957  -47.431 76.110  1.00 0.00 ? 72  GLU C OE1 1  
ATOM 10092  O OE2 . GLU C 3 72  ? -93.740  -45.877 74.677  1.00 0.00 ? 72  GLU C OE2 1  
ATOM 10093  N N   . PRO C 3 73  ? -88.435  -48.912 73.598  1.00 0.00 ? 73  PRO C N   1  
ATOM 10094  C CA  . PRO C 3 73  ? -87.097  -49.392 73.354  1.00 0.00 ? 73  PRO C CA  1  
ATOM 10095  C C   . PRO C 3 73  ? -86.455  -49.223 71.977  1.00 0.00 ? 73  PRO C C   1  
ATOM 10096  O O   . PRO C 3 73  ? -85.281  -48.786 71.891  1.00 0.00 ? 73  PRO C O   1  
ATOM 10097  C CB  . PRO C 3 73  ? -87.057  -50.837 73.717  1.00 0.00 ? 73  PRO C CB  1  
ATOM 10098  C CG  . PRO C 3 73  ? -88.019  -50.904 74.958  1.00 0.00 ? 73  PRO C CG  1  
ATOM 10099  C CD  . PRO C 3 73  ? -89.118  -49.927 74.451  1.00 0.00 ? 73  PRO C CD  1  
ATOM 10100  N N   . SER C 3 74  ? -87.193  -49.681 70.899  1.00 0.00 ? 74  SER C N   1  
ATOM 10101  C CA  . SER C 3 74  ? -86.647  -49.713 69.541  1.00 0.00 ? 74  SER C CA  1  
ATOM 10102  C C   . SER C 3 74  ? -86.503  -48.253 69.084  1.00 0.00 ? 74  SER C C   1  
ATOM 10103  O O   . SER C 3 74  ? -85.494  -47.963 68.467  1.00 0.00 ? 74  SER C O   1  
ATOM 10104  C CB  . SER C 3 74  ? -87.526  -50.404 68.447  1.00 0.00 ? 74  SER C CB  1  
ATOM 10105  O OG  . SER C 3 74  ? -87.605  -51.755 68.819  1.00 0.00 ? 74  SER C OG  1  
ATOM 10106  N N   . VAL C 3 75  ? -87.540  -47.442 69.418  1.00 0.00 ? 75  VAL C N   1  
ATOM 10107  C CA  . VAL C 3 75  ? -87.618  -46.009 69.009  1.00 0.00 ? 75  VAL C CA  1  
ATOM 10108  C C   . VAL C 3 75  ? -86.430  -45.332 69.616  1.00 0.00 ? 75  VAL C C   1  
ATOM 10109  O O   . VAL C 3 75  ? -85.817  -44.518 68.926  1.00 0.00 ? 75  VAL C O   1  
ATOM 10110  C CB  . VAL C 3 75  ? -88.929  -45.319 69.395  1.00 0.00 ? 75  VAL C CB  1  
ATOM 10111  C CG1 . VAL C 3 75  ? -89.037  -43.837 68.841  1.00 0.00 ? 75  VAL C CG1 1  
ATOM 10112  C CG2 . VAL C 3 75  ? -90.067  -46.218 68.918  1.00 0.00 ? 75  VAL C CG2 1  
ATOM 10113  N N   . ILE C 3 76  ? -86.083  -45.676 70.873  1.00 0.00 ? 76  ILE C N   1  
ATOM 10114  C CA  . ILE C 3 76  ? -85.000  -45.049 71.637  1.00 0.00 ? 76  ILE C CA  1  
ATOM 10115  C C   . ILE C 3 76  ? -83.695  -45.317 70.941  1.00 0.00 ? 76  ILE C C   1  
ATOM 10116  O O   . ILE C 3 76  ? -82.915  -44.384 70.769  1.00 0.00 ? 76  ILE C O   1  
ATOM 10117  C CB  . ILE C 3 76  ? -84.885  -45.520 73.076  1.00 0.00 ? 76  ILE C CB  1  
ATOM 10118  C CG1 . ILE C 3 76  ? -85.991  -44.889 74.033  1.00 0.00 ? 76  ILE C CG1 1  
ATOM 10119  C CG2 . ILE C 3 76  ? -83.567  -45.108 73.793  1.00 0.00 ? 76  ILE C CG2 1  
ATOM 10120  C CD1 . ILE C 3 76  ? -85.893  -45.353 75.497  1.00 0.00 ? 76  ILE C CD1 1  
ATOM 10121  N N   . ALA C 3 77  ? -83.410  -46.498 70.389  1.00 0.00 ? 77  ALA C N   1  
ATOM 10122  C CA  . ALA C 3 77  ? -82.241  -46.842 69.629  1.00 0.00 ? 77  ALA C CA  1  
ATOM 10123  C C   . ALA C 3 77  ? -82.105  -46.001 68.355  1.00 0.00 ? 77  ALA C C   1  
ATOM 10124  O O   . ALA C 3 77  ? -81.052  -45.454 68.065  1.00 0.00 ? 77  ALA C O   1  
ATOM 10125  C CB  . ALA C 3 77  ? -82.105  -48.362 69.336  1.00 0.00 ? 77  ALA C CB  1  
ATOM 10126  N N   . ASP C 3 78  ? -83.244  -45.777 67.593  1.00 0.00 ? 78  ASP C N   1  
ATOM 10127  C CA  . ASP C 3 78  ? -83.252  -44.932 66.429  1.00 0.00 ? 78  ASP C CA  1  
ATOM 10128  C C   . ASP C 3 78  ? -82.918  -43.496 66.765  1.00 0.00 ? 78  ASP C C   1  
ATOM 10129  O O   . ASP C 3 78  ? -82.161  -42.824 66.011  1.00 0.00 ? 78  ASP C O   1  
ATOM 10130  C CB  . ASP C 3 78  ? -84.548  -45.072 65.691  1.00 0.00 ? 78  ASP C CB  1  
ATOM 10131  C CG  . ASP C 3 78  ? -84.643  -44.291 64.296  1.00 0.00 ? 78  ASP C CG  1  
ATOM 10132  O OD1 . ASP C 3 78  ? -83.740  -44.499 63.441  1.00 0.00 ? 78  ASP C OD1 1  
ATOM 10133  O OD2 . ASP C 3 78  ? -85.605  -43.512 64.168  1.00 0.00 ? 78  ASP C OD2 1  
ATOM 10134  N N   . VAL C 3 79  ? -83.417  -42.966 67.871  1.00 0.00 ? 79  VAL C N   1  
ATOM 10135  C CA  . VAL C 3 79  ? -83.215  -41.590 68.383  1.00 0.00 ? 79  VAL C CA  1  
ATOM 10136  C C   . VAL C 3 79  ? -81.777  -41.356 68.783  1.00 0.00 ? 79  VAL C C   1  
ATOM 10137  O O   . VAL C 3 79  ? -81.311  -40.238 68.647  1.00 0.00 ? 79  VAL C O   1  
ATOM 10138  C CB  . VAL C 3 79  ? -84.167  -41.494 69.544  1.00 0.00 ? 79  VAL C CB  1  
ATOM 10139  C CG1 . VAL C 3 79  ? -83.794  -40.335 70.531  1.00 0.00 ? 79  VAL C CG1 1  
ATOM 10140  C CG2 . VAL C 3 79  ? -85.544  -41.059 68.971  1.00 0.00 ? 79  VAL C CG2 1  
ATOM 10141  N N   . GLU C 3 80  ? -81.082  -42.353 69.291  1.00 0.00 ? 80  GLU C N   1  
ATOM 10142  C CA  . GLU C 3 80  ? -79.698  -42.141 69.748  1.00 0.00 ? 80  GLU C CA  1  
ATOM 10143  C C   . GLU C 3 80  ? -78.801  -41.849 68.556  1.00 0.00 ? 80  GLU C C   1  
ATOM 10144  O O   . GLU C 3 80  ? -77.937  -40.951 68.546  1.00 0.00 ? 80  GLU C O   1  
ATOM 10145  C CB  . GLU C 3 80  ? -79.084  -43.318 70.533  1.00 0.00 ? 80  GLU C CB  1  
ATOM 10146  C CG  . GLU C 3 80  ? -79.828  -43.664 71.805  1.00 0.00 ? 80  GLU C CG  1  
ATOM 10147  C CD  . GLU C 3 80  ? -79.105  -44.811 72.560  1.00 0.00 ? 80  GLU C CD  1  
ATOM 10148  O OE1 . GLU C 3 80  ? -78.675  -45.778 71.937  1.00 0.00 ? 80  GLU C OE1 1  
ATOM 10149  O OE2 . GLU C 3 80  ? -78.995  -44.643 73.804  1.00 0.00 ? 80  GLU C OE2 1  
ATOM 10150  N N   . ASN C 3 81  ? -79.109  -42.527 67.416  1.00 0.00 ? 81  ASN C N   1  
ATOM 10151  C CA  . ASN C 3 81  ? -78.452  -42.418 66.163  1.00 0.00 ? 81  ASN C CA  1  
ATOM 10152  C C   . ASN C 3 81  ? -78.981  -41.204 65.368  1.00 0.00 ? 81  ASN C C   1  
ATOM 10153  O O   . ASN C 3 81  ? -79.926  -40.473 65.755  1.00 0.00 ? 81  ASN C O   1  
ATOM 10154  C CB  . ASN C 3 81  ? -78.562  -43.622 65.226  1.00 0.00 ? 81  ASN C CB  1  
ATOM 10155  C CG  . ASN C 3 81  ? -78.138  -44.920 65.829  1.00 0.00 ? 81  ASN C CG  1  
ATOM 10156  O OD1 . ASN C 3 81  ? -78.794  -45.948 65.651  1.00 0.00 ? 81  ASN C OD1 1  
ATOM 10157  N ND2 . ASN C 3 81  ? -76.935  -44.984 66.353  1.00 0.00 ? 81  ASN C ND2 1  
ATOM 10158  N N   . THR C 3 82  ? -78.348  -41.031 64.221  1.00 0.00 ? 82  THR C N   1  
ATOM 10159  C CA  . THR C 3 82  ? -78.514  -40.059 63.130  1.00 0.00 ? 82  THR C CA  1  
ATOM 10160  C C   . THR C 3 82  ? -79.362  -40.783 62.155  1.00 0.00 ? 82  THR C C   1  
ATOM 10161  O O   . THR C 3 82  ? -79.486  -40.368 61.014  1.00 0.00 ? 82  THR C O   1  
ATOM 10162  C CB  . THR C 3 82  ? -77.254  -39.580 62.411  1.00 0.00 ? 82  THR C CB  1  
ATOM 10163  O OG1 . THR C 3 82  ? -76.504  -40.680 62.011  1.00 0.00 ? 82  THR C OG1 1  
ATOM 10164  C CG2 . THR C 3 82  ? -76.414  -38.581 63.392  1.00 0.00 ? 82  THR C CG2 1  
ATOM 10165  N N   . PHE C 3 83  ? -80.111  -41.854 62.528  1.00 0.00 ? 83  PHE C N   1  
ATOM 10166  C CA  . PHE C 3 83  ? -81.038  -42.522 61.641  1.00 0.00 ? 83  PHE C CA  1  
ATOM 10167  C C   . PHE C 3 83  ? -82.464  -42.006 61.981  1.00 0.00 ? 83  PHE C C   1  
ATOM 10168  O O   . PHE C 3 83  ? -83.459  -42.401 61.345  1.00 0.00 ? 83  PHE C O   1  
ATOM 10169  C CB  . PHE C 3 83  ? -81.043  -44.108 61.711  1.00 0.00 ? 83  PHE C CB  1  
ATOM 10170  C CG  . PHE C 3 83  ? -79.707  -44.688 61.392  1.00 0.00 ? 83  PHE C CG  1  
ATOM 10171  C CD1 . PHE C 3 83  ? -78.997  -44.230 60.245  1.00 0.00 ? 83  PHE C CD1 1  
ATOM 10172  C CD2 . PHE C 3 83  ? -79.183  -45.756 62.092  1.00 0.00 ? 83  PHE C CD2 1  
ATOM 10173  C CE1 . PHE C 3 83  ? -77.746  -44.737 59.879  1.00 0.00 ? 83  PHE C CE1 1  
ATOM 10174  C CE2 . PHE C 3 83  ? -77.922  -46.297 61.833  1.00 0.00 ? 83  PHE C CE2 1  
ATOM 10175  C CZ  . PHE C 3 83  ? -77.198  -45.810 60.673  1.00 0.00 ? 83  PHE C CZ  1  
ATOM 10176  N N   . ARG C 3 84  ? -82.649  -41.060 62.954  1.00 0.00 ? 84  ARG C N   1  
ATOM 10177  C CA  . ARG C 3 84  ? -83.904  -40.497 63.390  1.00 0.00 ? 84  ARG C CA  1  
ATOM 10178  C C   . ARG C 3 84  ? -84.267  -39.414 62.464  1.00 0.00 ? 84  ARG C C   1  
ATOM 10179  O O   . ARG C 3 84  ? -85.397  -39.310 62.060  1.00 0.00 ? 84  ARG C O   1  
ATOM 10180  C CB  . ARG C 3 84  ? -83.576  -39.883 64.849  1.00 0.00 ? 84  ARG C CB  1  
ATOM 10181  C CG  . ARG C 3 84  ? -84.713  -39.101 65.538  1.00 0.00 ? 84  ARG C CG  1  
ATOM 10182  C CD  . ARG C 3 84  ? -86.134  -39.834 65.730  1.00 0.00 ? 84  ARG C CD  1  
ATOM 10183  N NE  . ARG C 3 84  ? -86.870  -39.763 64.441  1.00 0.00 ? 84  ARG C NE  1  
ATOM 10184  C CZ  . ARG C 3 84  ? -87.684  -40.797 64.028  1.00 0.00 ? 84  ARG C CZ  1  
ATOM 10185  N NH1 . ARG C 3 84  ? -88.536  -41.440 64.910  1.00 0.00 ? 84  ARG C NH1 1  
ATOM 10186  N NH2 . ARG C 3 84  ? -87.779  -41.048 62.735  1.00 0.00 ? 84  ARG C NH2 1  
ATOM 10187  N N   . GLY C 3 85  ? -83.296  -38.647 62.043  1.00 0.00 ? 85  GLY C N   1  
ATOM 10188  C CA  . GLY C 3 85  ? -83.423  -37.604 61.099  1.00 0.00 ? 85  GLY C CA  1  
ATOM 10189  C C   . GLY C 3 85  ? -83.490  -37.974 59.628  1.00 0.00 ? 85  GLY C C   1  
ATOM 10190  O O   . GLY C 3 85  ? -84.029  -37.210 58.867  1.00 0.00 ? 85  GLY C O   1  
ATOM 10191  N N   . PHE C 3 86  ? -83.149  -39.221 59.315  1.00 0.00 ? 86  PHE C N   1  
ATOM 10192  C CA  . PHE C 3 86  ? -83.119  -39.904 58.071  1.00 0.00 ? 86  PHE C CA  1  
ATOM 10193  C C   . PHE C 3 86  ? -84.550  -40.239 57.822  1.00 0.00 ? 86  PHE C C   1  
ATOM 10194  O O   . PHE C 3 86  ? -85.019  -40.156 56.715  1.00 0.00 ? 86  PHE C O   1  
ATOM 10195  C CB  . PHE C 3 86  ? -82.325  -41.186 58.158  1.00 0.00 ? 86  PHE C CB  1  
ATOM 10196  C CG  . PHE C 3 86  ? -81.946  -41.862 56.829  1.00 0.00 ? 86  PHE C CG  1  
ATOM 10197  C CD1 . PHE C 3 86  ? -81.869  -41.178 55.659  1.00 0.00 ? 86  PHE C CD1 1  
ATOM 10198  C CD2 . PHE C 3 86  ? -81.458  -43.168 56.854  1.00 0.00 ? 86  PHE C CD2 1  
ATOM 10199  C CE1 . PHE C 3 86  ? -81.483  -41.799 54.440  1.00 0.00 ? 86  PHE C CE1 1  
ATOM 10200  C CE2 . PHE C 3 86  ? -81.068  -43.802 55.713  1.00 0.00 ? 86  PHE C CE2 1  
ATOM 10201  C CZ  . PHE C 3 86  ? -81.081  -43.148 54.464  1.00 0.00 ? 86  PHE C CZ  1  
ATOM 10202  N N   . PHE C 3 87  ? -85.254  -40.675 58.918  1.00 0.00 ? 87  PHE C N   1  
ATOM 10203  C CA  . PHE C 3 87  ? -86.591  -41.240 58.783  1.00 0.00 ? 87  PHE C CA  1  
ATOM 10204  C C   . PHE C 3 87  ? -87.460  -40.132 59.192  1.00 0.00 ? 87  PHE C C   1  
ATOM 10205  O O   . PHE C 3 87  ? -87.061  -39.379 60.090  1.00 0.00 ? 87  PHE C O   1  
ATOM 10206  C CB  . PHE C 3 87  ? -86.838  -42.460 59.739  1.00 0.00 ? 87  PHE C CB  1  
ATOM 10207  C CG  . PHE C 3 87  ? -85.947  -43.595 59.602  1.00 0.00 ? 87  PHE C CG  1  
ATOM 10208  C CD1 . PHE C 3 87  ? -84.882  -43.782 58.573  1.00 0.00 ? 87  PHE C CD1 1  
ATOM 10209  C CD2 . PHE C 3 87  ? -86.090  -44.599 60.592  1.00 0.00 ? 87  PHE C CD2 1  
ATOM 10210  C CE1 . PHE C 3 87  ? -84.082  -44.943 58.666  1.00 0.00 ? 87  PHE C CE1 1  
ATOM 10211  C CE2 . PHE C 3 87  ? -85.417  -45.846 60.527  1.00 0.00 ? 87  PHE C CE2 1  
ATOM 10212  C CZ  . PHE C 3 87  ? -84.341  -45.988 59.628  1.00 0.00 ? 87  PHE C CZ  1  
ATOM 10213  N N   . ASP C 3 88  ? -88.665  -40.022 58.489  1.00 0.00 ? 88  ASP C N   1  
ATOM 10214  C CA  . ASP C 3 88  ? -89.617  -39.070 58.825  1.00 0.00 ? 88  ASP C CA  1  
ATOM 10215  C C   . ASP C 3 88  ? -90.231  -39.379 60.161  1.00 0.00 ? 88  ASP C C   1  
ATOM 10216  O O   . ASP C 3 88  ? -90.795  -40.518 60.309  1.00 0.00 ? 88  ASP C O   1  
ATOM 10217  C CB  . ASP C 3 88  ? -90.669  -39.043 57.663  1.00 0.00 ? 88  ASP C CB  1  
ATOM 10218  C CG  . ASP C 3 88  ? -91.602  -37.802 57.773  1.00 0.00 ? 88  ASP C CG  1  
ATOM 10219  O OD1 . ASP C 3 88  ? -91.095  -36.624 57.750  1.00 0.00 ? 88  ASP C OD1 1  
ATOM 10220  O OD2 . ASP C 3 88  ? -92.845  -38.043 57.833  1.00 0.00 ? 88  ASP C OD2 1  
ATOM 10221  N N   . PRO C 3 89  ? -90.149  -38.526 61.171  1.00 0.00 ? 89  PRO C N   1  
ATOM 10222  C CA  . PRO C 3 89  ? -90.637  -38.773 62.511  1.00 0.00 ? 89  PRO C CA  1  
ATOM 10223  C C   . PRO C 3 89  ? -92.150  -38.943 62.612  1.00 0.00 ? 89  PRO C C   1  
ATOM 10224  O O   . PRO C 3 89  ? -92.588  -39.612 63.510  1.00 0.00 ? 89  PRO C O   1  
ATOM 10225  C CB  . PRO C 3 89  ? -89.968  -37.679 63.364  1.00 0.00 ? 89  PRO C CB  1  
ATOM 10226  C CG  . PRO C 3 89  ? -90.029  -36.454 62.468  1.00 0.00 ? 89  PRO C CG  1  
ATOM 10227  C CD  . PRO C 3 89  ? -89.589  -37.122 61.102  1.00 0.00 ? 89  PRO C CD  1  
ATOM 10228  N N   . ARG C 3 90  ? -92.979  -38.322 61.678  1.00 0.00 ? 90  ARG C N   1  
ATOM 10229  C CA  . ARG C 3 90  ? -94.457  -38.587 61.701  1.00 0.00 ? 90  ARG C CA  1  
ATOM 10230  C C   . ARG C 3 90  ? -94.739  -39.997 61.330  1.00 0.00 ? 90  ARG C C   1  
ATOM 10231  O O   . ARG C 3 90  ? -95.659  -40.558 61.873  1.00 0.00 ? 90  ARG C O   1  
ATOM 10232  C CB  . ARG C 3 90  ? -95.171  -37.546 60.857  1.00 0.00 ? 90  ARG C CB  1  
ATOM 10233  C CG  . ARG C 3 90  ? -96.702  -37.673 60.611  1.00 0.00 ? 90  ARG C CG  1  
ATOM 10234  C CD  . ARG C 3 90  ? -97.520  -37.603 61.917  1.00 0.00 ? 90  ARG C CD  1  
ATOM 10235  N NE  . ARG C 3 90  ? -98.962  -37.716 61.591  1.00 0.00 ? 90  ARG C NE  1  
ATOM 10236  C CZ  . ARG C 3 90  ? -99.570  -38.956 61.431  1.00 0.00 ? 90  ARG C CZ  1  
ATOM 10237  N NH1 . ARG C 3 90  ? -98.885  -40.111 61.190  1.00 0.00 ? 90  ARG C NH1 1  
ATOM 10238  N NH2 . ARG C 3 90  ? -100.926 -39.017 61.618  1.00 0.00 ? 90  ARG C NH2 1  
ATOM 10239  N N   . ASN C 3 91  ? -93.958  -40.692 60.437  1.00 0.00 ? 91  ASN C N   1  
ATOM 10240  C CA  . ASN C 3 91  ? -94.233  -42.070 60.047  1.00 0.00 ? 91  ASN C CA  1  
ATOM 10241  C C   . ASN C 3 91  ? -93.959  -43.000 61.246  1.00 0.00 ? 91  ASN C C   1  
ATOM 10242  O O   . ASN C 3 91  ? -94.371  -44.144 61.299  1.00 0.00 ? 91  ASN C O   1  
ATOM 10243  C CB  . ASN C 3 91  ? -93.359  -42.592 58.864  1.00 0.00 ? 91  ASN C CB  1  
ATOM 10244  C CG  . ASN C 3 91  ? -93.660  -41.778 57.630  1.00 0.00 ? 91  ASN C CG  1  
ATOM 10245  O OD1 . ASN C 3 91  ? -94.325  -40.762 57.549  1.00 0.00 ? 91  ASN C OD1 1  
ATOM 10246  N ND2 . ASN C 3 91  ? -93.045  -42.331 56.555  1.00 0.00 ? 91  ASN C ND2 1  
ATOM 10247  N N   . THR C 3 92  ? -93.203  -42.570 62.288  1.00 0.00 ? 92  THR C N   1  
ATOM 10248  C CA  . THR C 3 92  ? -92.838  -43.254 63.496  1.00 0.00 ? 92  THR C CA  1  
ATOM 10249  C C   . THR C 3 92  ? -93.854  -42.948 64.534  1.00 0.00 ? 92  THR C C   1  
ATOM 10250  O O   . THR C 3 92  ? -94.164  -41.779 64.711  1.00 0.00 ? 92  THR C O   1  
ATOM 10251  C CB  . THR C 3 92  ? -91.410  -42.892 63.992  1.00 0.00 ? 92  THR C CB  1  
ATOM 10252  O OG1 . THR C 3 92  ? -90.341  -43.203 63.096  1.00 0.00 ? 92  THR C OG1 1  
ATOM 10253  C CG2 . THR C 3 92  ? -91.203  -43.706 65.261  1.00 0.00 ? 92  THR C CG2 1  
ATOM 10254  N N   . TRP C 3 93  ? -94.468  -43.976 65.133  1.00 0.00 ? 93  TRP C N   1  
ATOM 10255  C CA  . TRP C 3 93  ? -95.501  -43.982 66.113  1.00 0.00 ? 93  TRP C CA  1  
ATOM 10256  C C   . TRP C 3 93  ? -95.120  -44.825 67.228  1.00 0.00 ? 93  TRP C C   1  
ATOM 10257  O O   . TRP C 3 93  ? -94.612  -45.921 67.116  1.00 0.00 ? 93  TRP C O   1  
ATOM 10258  C CB  . TRP C 3 93  ? -96.837  -44.394 65.324  1.00 0.00 ? 93  TRP C CB  1  
ATOM 10259  C CG  . TRP C 3 93  ? -98.156  -44.643 66.130  1.00 0.00 ? 93  TRP C CG  1  
ATOM 10260  C CD1 . TRP C 3 93  ? -99.094  -45.571 65.827  1.00 0.00 ? 93  TRP C CD1 1  
ATOM 10261  C CD2 . TRP C 3 93  ? -98.707  -43.875 67.279  1.00 0.00 ? 93  TRP C CD2 1  
ATOM 10262  N NE1 . TRP C 3 93  ? -100.145 -45.474 66.731  1.00 0.00 ? 93  TRP C NE1 1  
ATOM 10263  C CE2 . TRP C 3 93  ? -99.893  -44.511 67.680  1.00 0.00 ? 93  TRP C CE2 1  
ATOM 10264  C CE3 . TRP C 3 93  ? -98.283  -42.772 67.910  1.00 0.00 ? 93  TRP C CE3 1  
ATOM 10265  C CZ2 . TRP C 3 93  ? -100.541 -44.051 68.773  1.00 0.00 ? 93  TRP C CZ2 1  
ATOM 10266  C CZ3 . TRP C 3 93  ? -98.861  -42.407 69.124  1.00 0.00 ? 93  TRP C CZ3 1  
ATOM 10267  C CH2 . TRP C 3 93  ? -100.022 -43.048 69.618  1.00 0.00 ? 93  TRP C CH2 1  
ATOM 10268  N N   . VAL C 3 94  ? -95.190  -44.244 68.434  1.00 0.00 ? 94  VAL C N   1  
ATOM 10269  C CA  . VAL C 3 94  ? -94.808  -44.929 69.673  1.00 0.00 ? 94  VAL C CA  1  
ATOM 10270  C C   . VAL C 3 94  ? -95.897  -44.837 70.710  1.00 0.00 ? 94  VAL C C   1  
ATOM 10271  O O   . VAL C 3 94  ? -96.324  -43.739 71.002  1.00 0.00 ? 94  VAL C O   1  
ATOM 10272  C CB  . VAL C 3 94  ? -93.472  -44.385 70.223  1.00 0.00 ? 94  VAL C CB  1  
ATOM 10273  C CG1 . VAL C 3 94  ? -93.383  -42.876 70.378  1.00 0.00 ? 94  VAL C CG1 1  
ATOM 10274  C CG2 . VAL C 3 94  ? -93.118  -45.188 71.521  1.00 0.00 ? 94  VAL C CG2 1  
ATOM 10275  N N   . ALA C 3 95  ? -96.351  -46.013 71.245  1.00 0.00 ? 95  ALA C N   1  
ATOM 10276  C CA  . ALA C 3 95  ? -97.379  -45.997 72.210  1.00 0.00 ? 95  ALA C CA  1  
ATOM 10277  C C   . ALA C 3 95  ? -97.048  -46.970 73.322  1.00 0.00 ? 95  ALA C C   1  
ATOM 10278  O O   . ALA C 3 95  ? -96.351  -47.940 73.140  1.00 0.00 ? 95  ALA C O   1  
ATOM 10279  C CB  . ALA C 3 95  ? -98.832  -46.407 71.779  1.00 0.00 ? 95  ALA C CB  1  
ATOM 10280  N N   . SER C 3 96  ? -97.704  -46.708 74.478  1.00 0.00 ? 96  SER C N   1  
ATOM 10281  C CA  . SER C 3 96  ? -97.748  -47.579 75.580  1.00 0.00 ? 96  SER C CA  1  
ATOM 10282  C C   . SER C 3 96  ? -99.164  -47.504 76.216  1.00 0.00 ? 96  SER C C   1  
ATOM 10283  O O   . SER C 3 96  ? -100.013 -46.717 75.736  1.00 0.00 ? 96  SER C O   1  
ATOM 10284  C CB  . SER C 3 96  ? -96.719  -47.196 76.666  1.00 0.00 ? 96  SER C CB  1  
ATOM 10285  O OG  . SER C 3 96  ? -95.604  -48.117 76.569  1.00 0.00 ? 96  SER C OG  1  
ATOM 10286  N N   . ASP C 3 97  ? -99.351  -48.263 77.247  1.00 0.00 ? 97  ASP C N   1  
ATOM 10287  C CA  . ASP C 3 97  ? -100.601 -48.508 77.825  1.00 0.00 ? 97  ASP C CA  1  
ATOM 10288  C C   . ASP C 3 97  ? -100.172 -48.924 79.171  1.00 0.00 ? 97  ASP C C   1  
ATOM 10289  O O   . ASP C 3 97  ? -99.046  -49.267 79.409  1.00 0.00 ? 97  ASP C O   1  
ATOM 10290  C CB  . ASP C 3 97  ? -101.559 -49.633 77.292  1.00 0.00 ? 97  ASP C CB  1  
ATOM 10291  C CG  . ASP C 3 97  ? -103.004 -49.165 77.589  1.00 0.00 ? 97  ASP C CG  1  
ATOM 10292  O OD1 . ASP C 3 97  ? -103.498 -48.147 77.036  1.00 0.00 ? 97  ASP C OD1 1  
ATOM 10293  O OD2 . ASP C 3 97  ? -103.613 -49.982 78.280  1.00 0.00 ? 97  ASP C OD2 1  
ATOM 10294  N N   . GLY C 3 98  ? -101.029 -48.978 80.155  1.00 0.00 ? 98  GLY C N   1  
ATOM 10295  C CA  . GLY C 3 98  ? -100.753 -49.345 81.540  1.00 0.00 ? 98  GLY C CA  1  
ATOM 10296  C C   . GLY C 3 98  ? -100.690 -50.847 81.727  1.00 0.00 ? 98  GLY C C   1  
ATOM 10297  O O   . GLY C 3 98  ? -100.588 -51.332 82.871  1.00 0.00 ? 98  GLY C O   1  
ATOM 10298  N N   . ALA C 3 99  ? -100.815 -51.578 80.604  1.00 0.00 ? 99  ALA C N   1  
ATOM 10299  C CA  . ALA C 3 99  ? -100.942 -53.000 80.495  1.00 0.00 ? 99  ALA C CA  1  
ATOM 10300  C C   . ALA C 3 99  ? -100.516 -53.161 79.072  1.00 0.00 ? 99  ALA C C   1  
ATOM 10301  O O   . ALA C 3 99  ? -101.418 -53.139 78.202  1.00 0.00 ? 99  ALA C O   1  
ATOM 10302  C CB  . ALA C 3 99  ? -102.407 -53.579 80.757  1.00 0.00 ? 99  ALA C CB  1  
ATOM 10303  N N   . SER C 3 100 ? -99.209  -53.239 78.874  1.00 0.00 ? 100 SER C N   1  
ATOM 10304  C CA  . SER C 3 100 ? -98.596  -53.178 77.563  1.00 0.00 ? 100 SER C CA  1  
ATOM 10305  C C   . SER C 3 100 ? -98.597  -54.562 76.972  1.00 0.00 ? 100 SER C C   1  
ATOM 10306  O O   . SER C 3 100 ? -99.065  -55.456 77.598  1.00 0.00 ? 100 SER C O   1  
ATOM 10307  C CB  . SER C 3 100 ? -97.173  -52.648 77.697  1.00 0.00 ? 100 SER C CB  1  
ATOM 10308  O OG  . SER C 3 100 ? -97.145  -51.257 77.880  1.00 0.00 ? 100 SER C OG  1  
ATOM 10309  N N   . ALA C 3 101 ? -98.196  -54.645 75.666  1.00 0.00 ? 101 ALA C N   1  
ATOM 10310  C CA  . ALA C 3 101 ? -98.120  -55.884 74.900  1.00 0.00 ? 101 ALA C CA  1  
ATOM 10311  C C   . ALA C 3 101 ? -97.556  -57.055 75.639  1.00 0.00 ? 101 ALA C C   1  
ATOM 10312  O O   . ALA C 3 101 ? -98.289  -58.059 75.876  1.00 0.00 ? 101 ALA C O   1  
ATOM 10313  C CB  . ALA C 3 101 ? -97.314  -55.580 73.587  1.00 0.00 ? 101 ALA C CB  1  
ATOM 10314  N N   . GLY C 3 102 ? -96.314  -56.858 76.150  1.00 0.00 ? 102 GLY C N   1  
ATOM 10315  C CA  . GLY C 3 102 ? -95.754  -57.729 77.158  1.00 0.00 ? 102 GLY C CA  1  
ATOM 10316  C C   . GLY C 3 102 ? -95.372  -59.107 76.608  1.00 0.00 ? 102 GLY C C   1  
ATOM 10317  O O   . GLY C 3 102 ? -95.125  -60.125 77.291  1.00 0.00 ? 102 GLY C O   1  
ATOM 10318  N N   . ASN C 3 103 ? -95.330  -59.208 75.260  1.00 0.00 ? 103 ASN C N   1  
ATOM 10319  C CA  . ASN C 3 103 ? -94.997  -60.335 74.470  1.00 0.00 ? 103 ASN C CA  1  
ATOM 10320  C C   . ASN C 3 103 ? -96.104  -61.363 74.596  1.00 0.00 ? 103 ASN C C   1  
ATOM 10321  O O   . ASN C 3 103 ? -95.815  -62.560 74.612  1.00 0.00 ? 103 ASN C O   1  
ATOM 10322  C CB  . ASN C 3 103 ? -93.544  -60.978 74.761  1.00 0.00 ? 103 ASN C CB  1  
ATOM 10323  C CG  . ASN C 3 103 ? -92.592  -59.822 74.543  1.00 0.00 ? 103 ASN C CG  1  
ATOM 10324  O OD1 . ASN C 3 103 ? -92.164  -59.094 75.457  1.00 0.00 ? 103 ASN C OD1 1  
ATOM 10325  N ND2 . ASN C 3 103 ? -92.339  -59.606 73.235  1.00 0.00 ? 103 ASN C ND2 1  
ATOM 10326  N N   . SER C 3 104 ? -97.403  -60.894 74.678  1.00 0.00 ? 104 SER C N   1  
ATOM 10327  C CA  . SER C 3 104 ? -98.634  -61.687 74.815  1.00 0.00 ? 104 SER C CA  1  
ATOM 10328  C C   . SER C 3 104 ? -99.477  -61.025 73.718  1.00 0.00 ? 104 SER C C   1  
ATOM 10329  O O   . SER C 3 104 ? -99.595  -59.780 73.674  1.00 0.00 ? 104 SER C O   1  
ATOM 10330  C CB  . SER C 3 104 ? -99.278  -61.523 76.243  1.00 0.00 ? 104 SER C CB  1  
ATOM 10331  O OG  . SER C 3 104 ? -99.188  -62.679 77.052  1.00 0.00 ? 104 SER C OG  1  
ATOM 10332  N N   . TRP C 3 105 ? -100.152 -61.866 72.871  1.00 0.00 ? 105 TRP C N   1  
ATOM 10333  C CA  . TRP C 3 105 ? -100.977 -61.403 71.794  1.00 0.00 ? 105 TRP C CA  1  
ATOM 10334  C C   . TRP C 3 105 ? -102.205 -60.599 72.220  1.00 0.00 ? 105 TRP C C   1  
ATOM 10335  O O   . TRP C 3 105 ? -102.424 -59.611 71.580  1.00 0.00 ? 105 TRP C O   1  
ATOM 10336  C CB  . TRP C 3 105 ? -101.425 -62.654 70.969  1.00 0.00 ? 105 TRP C CB  1  
ATOM 10337  C CG  . TRP C 3 105 ? -102.070 -62.361 69.622  1.00 0.00 ? 105 TRP C CG  1  
ATOM 10338  C CD1 . TRP C 3 105 ? -101.532 -62.393 68.388  1.00 0.00 ? 105 TRP C CD1 1  
ATOM 10339  C CD2 . TRP C 3 105 ? -103.469 -62.228 69.436  1.00 0.00 ? 105 TRP C CD2 1  
ATOM 10340  N NE1 . TRP C 3 105 ? -102.460 -62.019 67.451  1.00 0.00 ? 105 TRP C NE1 1  
ATOM 10341  C CE2 . TRP C 3 105 ? -103.678 -61.956 68.119  1.00 0.00 ? 105 TRP C CE2 1  
ATOM 10342  C CE3 . TRP C 3 105 ? -104.505 -62.149 70.376  1.00 0.00 ? 105 TRP C CE3 1  
ATOM 10343  C CZ2 . TRP C 3 105 ? -104.947 -61.599 67.673  1.00 0.00 ? 105 TRP C CZ2 1  
ATOM 10344  C CZ3 . TRP C 3 105 ? -105.786 -61.724 69.955  1.00 0.00 ? 105 TRP C CZ3 1  
ATOM 10345  C CH2 . TRP C 3 105 ? -105.994 -61.394 68.563  1.00 0.00 ? 105 TRP C CH2 1  
ATOM 10346  N N   . ALA C 3 106 ? -102.938 -61.019 73.276  1.00 0.00 ? 106 ALA C N   1  
ATOM 10347  C CA  . ALA C 3 106 ? -104.151 -60.449 73.672  1.00 0.00 ? 106 ALA C CA  1  
ATOM 10348  C C   . ALA C 3 106 ? -104.058 -58.997 74.100  1.00 0.00 ? 106 ALA C C   1  
ATOM 10349  O O   . ALA C 3 106 ? -104.845 -58.183 73.626  1.00 0.00 ? 106 ALA C O   1  
ATOM 10350  C CB  . ALA C 3 106 ? -104.649 -61.199 74.901  1.00 0.00 ? 106 ALA C CB  1  
ATOM 10351  N N   . ASN C 3 107 ? -103.029 -58.532 74.905  1.00 0.00 ? 107 ASN C N   1  
ATOM 10352  C CA  . ASN C 3 107 ? -102.742 -57.248 75.289  1.00 0.00 ? 107 ASN C CA  1  
ATOM 10353  C C   . ASN C 3 107 ? -102.380 -56.386 74.152  1.00 0.00 ? 107 ASN C C   1  
ATOM 10354  O O   . ASN C 3 107 ? -102.835 -55.254 74.112  1.00 0.00 ? 107 ASN C O   1  
ATOM 10355  C CB  . ASN C 3 107 ? -101.499 -57.096 76.250  1.00 0.00 ? 107 ASN C CB  1  
ATOM 10356  C CG  . ASN C 3 107 ? -101.601 -57.661 77.687  1.00 0.00 ? 107 ASN C CG  1  
ATOM 10357  O OD1 . ASN C 3 107 ? -101.674 -58.884 77.848  1.00 0.00 ? 107 ASN C OD1 1  
ATOM 10358  N ND2 . ASN C 3 107 ? -101.623 -56.835 78.778  1.00 0.00 ? 107 ASN C ND2 1  
ATOM 10359  N N   . GLY C 3 108 ? -101.568 -56.902 73.202  1.00 0.00 ? 108 GLY C N   1  
ATOM 10360  C CA  . GLY C 3 108 ? -101.075 -56.179 72.031  1.00 0.00 ? 108 GLY C CA  1  
ATOM 10361  C C   . GLY C 3 108 ? -102.268 -55.924 71.183  1.00 0.00 ? 108 GLY C C   1  
ATOM 10362  O O   . GLY C 3 108 ? -102.373 -54.789 70.692  1.00 0.00 ? 108 GLY C O   1  
ATOM 10363  N N   . TYR C 3 109 ? -103.204 -56.898 71.021  1.00 0.00 ? 109 TYR C N   1  
ATOM 10364  C CA  . TYR C 3 109 ? -104.420 -56.845 70.336  1.00 0.00 ? 109 TYR C CA  1  
ATOM 10365  C C   . TYR C 3 109 ? -105.445 -55.866 70.933  1.00 0.00 ? 109 TYR C C   1  
ATOM 10366  O O   . TYR C 3 109 ? -105.990 -55.091 70.143  1.00 0.00 ? 109 TYR C O   1  
ATOM 10367  C CB  . TYR C 3 109 ? -105.112 -58.233 70.343  1.00 0.00 ? 109 TYR C CB  1  
ATOM 10368  C CG  . TYR C 3 109 ? -106.208 -58.248 69.336  1.00 0.00 ? 109 TYR C CG  1  
ATOM 10369  C CD1 . TYR C 3 109 ? -105.857 -58.340 68.005  1.00 0.00 ? 109 TYR C CD1 1  
ATOM 10370  C CD2 . TYR C 3 109 ? -107.544 -57.962 69.642  1.00 0.00 ? 109 TYR C CD2 1  
ATOM 10371  C CE1 . TYR C 3 109 ? -106.803 -57.894 66.996  1.00 0.00 ? 109 TYR C CE1 1  
ATOM 10372  C CE2 . TYR C 3 109 ? -108.473 -57.585 68.694  1.00 0.00 ? 109 TYR C CE2 1  
ATOM 10373  C CZ  . TYR C 3 109 ? -108.124 -57.561 67.367  1.00 0.00 ? 109 TYR C CZ  1  
ATOM 10374  O OH  . TYR C 3 109 ? -108.996 -56.984 66.383  1.00 0.00 ? 109 TYR C OH  1  
ATOM 10375  N N   . ASP C 3 110 ? -105.684 -55.827 72.282  1.00 0.00 ? 110 ASP C N   1  
ATOM 10376  C CA  . ASP C 3 110 ? -106.599 -54.896 72.915  1.00 0.00 ? 110 ASP C CA  1  
ATOM 10377  C C   . ASP C 3 110 ? -106.197 -53.542 72.764  1.00 0.00 ? 110 ASP C C   1  
ATOM 10378  O O   . ASP C 3 110 ? -107.047 -52.741 72.523  1.00 0.00 ? 110 ASP C O   1  
ATOM 10379  C CB  . ASP C 3 110 ? -106.610 -55.169 74.505  1.00 0.00 ? 110 ASP C CB  1  
ATOM 10380  C CG  . ASP C 3 110 ? -107.260 -56.487 74.783  1.00 0.00 ? 110 ASP C CG  1  
ATOM 10381  O OD1 . ASP C 3 110 ? -108.437 -56.671 74.292  1.00 0.00 ? 110 ASP C OD1 1  
ATOM 10382  O OD2 . ASP C 3 110 ? -106.623 -57.394 75.444  1.00 0.00 ? 110 ASP C OD2 1  
ATOM 10383  N N   . ILE C 3 111 ? -104.855 -53.308 72.858  1.00 0.00 ? 111 ILE C N   1  
ATOM 10384  C CA  . ILE C 3 111 ? -104.309 -51.967 72.610  1.00 0.00 ? 111 ILE C CA  1  
ATOM 10385  C C   . ILE C 3 111 ? -104.536 -51.580 71.169  1.00 0.00 ? 111 ILE C C   1  
ATOM 10386  O O   . ILE C 3 111 ? -104.819 -50.375 70.871  1.00 0.00 ? 111 ILE C O   1  
ATOM 10387  C CB  . ILE C 3 111 ? -102.794 -51.926 72.848  1.00 0.00 ? 111 ILE C CB  1  
ATOM 10388  C CG1 . ILE C 3 111 ? -102.537 -52.171 74.405  1.00 0.00 ? 111 ILE C CG1 1  
ATOM 10389  C CG2 . ILE C 3 111 ? -102.223 -50.504 72.553  1.00 0.00 ? 111 ILE C CG2 1  
ATOM 10390  C CD1 . ILE C 3 111 ? -101.052 -52.159 74.806  1.00 0.00 ? 111 ILE C CD1 1  
ATOM 10391  N N   . GLY C 3 112 ? -104.390 -52.612 70.258  1.00 0.00 ? 112 GLY C N   1  
ATOM 10392  C CA  . GLY C 3 112 ? -104.489 -52.373 68.809  1.00 0.00 ? 112 GLY C CA  1  
ATOM 10393  C C   . GLY C 3 112 ? -105.850 -51.792 68.443  1.00 0.00 ? 112 GLY C C   1  
ATOM 10394  O O   . GLY C 3 112 ? -105.966 -50.881 67.623  1.00 0.00 ? 112 GLY C O   1  
ATOM 10395  N N   . THR C 3 113 ? -106.893 -52.351 69.137  1.00 0.00 ? 113 THR C N   1  
ATOM 10396  C CA  . THR C 3 113 ? -108.267 -51.909 68.955  1.00 0.00 ? 113 THR C CA  1  
ATOM 10397  C C   . THR C 3 113 ? -108.463 -50.437 69.372  1.00 0.00 ? 113 THR C C   1  
ATOM 10398  O O   . THR C 3 113 ? -109.256 -49.744 68.727  1.00 0.00 ? 113 THR C O   1  
ATOM 10399  C CB  . THR C 3 113 ? -109.316 -52.882 69.543  1.00 0.00 ? 113 THR C CB  1  
ATOM 10400  O OG1 . THR C 3 113 ? -109.073 -54.230 69.071  1.00 0.00 ? 113 THR C OG1 1  
ATOM 10401  C CG2 . THR C 3 113 ? -110.721 -52.457 69.132  1.00 0.00 ? 113 THR C CG2 1  
ATOM 10402  N N   . ARG C 3 114 ? -107.786 -49.976 70.479  1.00 0.00 ? 114 ARG C N   1  
ATOM 10403  C CA  . ARG C 3 114 ? -107.877 -48.630 71.074  1.00 0.00 ? 114 ARG C CA  1  
ATOM 10404  C C   . ARG C 3 114 ? -107.332 -47.584 70.076  1.00 0.00 ? 114 ARG C C   1  
ATOM 10405  O O   . ARG C 3 114 ? -107.916 -46.513 69.849  1.00 0.00 ? 114 ARG C O   1  
ATOM 10406  C CB  . ARG C 3 114 ? -107.136 -48.592 72.455  1.00 0.00 ? 114 ARG C CB  1  
ATOM 10407  C CG  . ARG C 3 114 ? -107.291 -47.220 73.088  1.00 0.00 ? 114 ARG C CG  1  
ATOM 10408  C CD  . ARG C 3 114 ? -106.533 -47.086 74.408  1.00 0.00 ? 114 ARG C CD  1  
ATOM 10409  N NE  . ARG C 3 114 ? -105.092 -47.496 74.252  1.00 0.00 ? 114 ARG C NE  1  
ATOM 10410  C CZ  . ARG C 3 114 ? -104.024 -46.649 74.054  1.00 0.00 ? 114 ARG C CZ  1  
ATOM 10411  N NH1 . ARG C 3 114 ? -104.256 -45.384 73.706  1.00 0.00 ? 114 ARG C NH1 1  
ATOM 10412  N NH2 . ARG C 3 114 ? -102.780 -47.123 73.969  1.00 0.00 ? 114 ARG C NH2 1  
ATOM 10413  N N   . ASN C 3 115 ? -106.201 -47.970 69.445  1.00 0.00 ? 115 ASN C N   1  
ATOM 10414  C CA  . ASN C 3 115 ? -105.539 -47.123 68.505  1.00 0.00 ? 115 ASN C CA  1  
ATOM 10415  C C   . ASN C 3 115 ? -105.767 -47.576 67.095  1.00 0.00 ? 115 ASN C C   1  
ATOM 10416  O O   . ASN C 3 115 ? -104.889 -47.478 66.232  1.00 0.00 ? 115 ASN C O   1  
ATOM 10417  C CB  . ASN C 3 115 ? -104.023 -47.151 68.784  1.00 0.00 ? 115 ASN C CB  1  
ATOM 10418  C CG  . ASN C 3 115 ? -103.558 -46.893 70.243  1.00 0.00 ? 115 ASN C CG  1  
ATOM 10419  O OD1 . ASN C 3 115 ? -103.223 -47.798 70.974  1.00 0.00 ? 115 ASN C OD1 1  
ATOM 10420  N ND2 . ASN C 3 115 ? -103.446 -45.559 70.582  1.00 0.00 ? 115 ASN C ND2 1  
ATOM 10421  N N   . GLN C 3 116 ? -107.021 -48.052 66.789  1.00 0.00 ? 116 GLN C N   1  
ATOM 10422  C CA  . GLN C 3 116 ? -107.409 -48.461 65.499  1.00 0.00 ? 116 GLN C CA  1  
ATOM 10423  C C   . GLN C 3 116 ? -107.409 -47.284 64.565  1.00 0.00 ? 116 GLN C C   1  
ATOM 10424  O O   . GLN C 3 116 ? -106.867 -47.289 63.482  1.00 0.00 ? 116 GLN C O   1  
ATOM 10425  C CB  . GLN C 3 116 ? -108.812 -49.147 65.503  1.00 0.00 ? 116 GLN C CB  1  
ATOM 10426  C CG  . GLN C 3 116 ? -108.822 -50.209 64.316  1.00 0.00 ? 116 GLN C CG  1  
ATOM 10427  C CD  . GLN C 3 116 ? -107.964 -51.444 64.711  1.00 0.00 ? 116 GLN C CD  1  
ATOM 10428  O OE1 . GLN C 3 116 ? -106.789 -51.567 64.394  1.00 0.00 ? 116 GLN C OE1 1  
ATOM 10429  N NE2 . GLN C 3 116 ? -108.674 -52.465 65.330  1.00 0.00 ? 116 GLN C NE2 1  
ATOM 10430  N N   . ASP C 3 117 ? -107.957 -46.139 65.066  1.00 0.00 ? 117 ASP C N   1  
ATOM 10431  C CA  . ASP C 3 117 ? -108.051 -44.879 64.426  1.00 0.00 ? 117 ASP C CA  1  
ATOM 10432  C C   . ASP C 3 117 ? -106.775 -44.239 64.111  1.00 0.00 ? 117 ASP C C   1  
ATOM 10433  O O   . ASP C 3 117 ? -106.544 -43.741 63.019  1.00 0.00 ? 117 ASP C O   1  
ATOM 10434  C CB  . ASP C 3 117 ? -108.998 -43.997 65.262  1.00 0.00 ? 117 ASP C CB  1  
ATOM 10435  C CG  . ASP C 3 117 ? -110.388 -44.596 65.437  1.00 0.00 ? 117 ASP C CG  1  
ATOM 10436  O OD1 . ASP C 3 117 ? -110.748 -45.373 64.538  1.00 0.00 ? 117 ASP C OD1 1  
ATOM 10437  O OD2 . ASP C 3 117 ? -111.093 -44.410 66.501  1.00 0.00 ? 117 ASP C OD2 1  
ATOM 10438  N N   . ASP C 3 118 ? -105.847 -44.292 65.136  1.00 0.00 ? 118 ASP C N   1  
ATOM 10439  C CA  . ASP C 3 118 ? -104.616 -43.647 65.064  1.00 0.00 ? 118 ASP C CA  1  
ATOM 10440  C C   . ASP C 3 118 ? -103.728 -44.237 63.924  1.00 0.00 ? 118 ASP C C   1  
ATOM 10441  O O   . ASP C 3 118 ? -103.196 -43.490 63.170  1.00 0.00 ? 118 ASP C O   1  
ATOM 10442  C CB  . ASP C 3 118 ? -103.594 -43.819 66.273  1.00 0.00 ? 118 ASP C CB  1  
ATOM 10443  C CG  . ASP C 3 118 ? -104.217 -43.309 67.548  1.00 0.00 ? 118 ASP C CG  1  
ATOM 10444  O OD1 . ASP C 3 118 ? -105.208 -43.900 67.938  1.00 0.00 ? 118 ASP C OD1 1  
ATOM 10445  O OD2 . ASP C 3 118 ? -103.635 -42.401 68.183  1.00 0.00 ? 118 ASP C OD2 1  
ATOM 10446  N N   . ILE C 3 119 ? -103.619 -45.604 63.825  1.00 0.00 ? 119 ILE C N   1  
ATOM 10447  C CA  . ILE C 3 119 ? -102.786 -46.303 62.937  1.00 0.00 ? 119 ILE C CA  1  
ATOM 10448  C C   . ILE C 3 119 ? -103.303 -46.047 61.540  1.00 0.00 ? 119 ILE C C   1  
ATOM 10449  O O   . ILE C 3 119 ? -102.530 -45.784 60.562  1.00 0.00 ? 119 ILE C O   1  
ATOM 10450  C CB  . ILE C 3 119 ? -102.650 -47.810 63.179  1.00 0.00 ? 119 ILE C CB  1  
ATOM 10451  C CG1 . ILE C 3 119 ? -103.914 -48.644 63.162  1.00 0.00 ? 119 ILE C CG1 1  
ATOM 10452  C CG2 . ILE C 3 119 ? -102.016 -48.044 64.597  1.00 0.00 ? 119 ILE C CG2 1  
ATOM 10453  C CD1 . ILE C 3 119 ? -103.680 -50.143 63.414  1.00 0.00 ? 119 ILE C CD1 1  
ATOM 10454  N N   . LEU C 3 120 ? -104.671 -46.090 61.348  1.00 0.00 ? 120 LEU C N   1  
ATOM 10455  C CA  . LEU C 3 120 ? -105.241 -45.888 60.047  1.00 0.00 ? 120 LEU C CA  1  
ATOM 10456  C C   . LEU C 3 120 ? -105.011 -44.495 59.573  1.00 0.00 ? 120 LEU C C   1  
ATOM 10457  O O   . LEU C 3 120 ? -104.784 -44.413 58.370  1.00 0.00 ? 120 LEU C O   1  
ATOM 10458  C CB  . LEU C 3 120 ? -106.740 -46.212 60.182  1.00 0.00 ? 120 LEU C CB  1  
ATOM 10459  C CG  . LEU C 3 120 ? -107.688 -45.652 59.129  1.00 0.00 ? 120 LEU C CG  1  
ATOM 10460  C CD1 . LEU C 3 120 ? -108.957 -46.623 58.987  1.00 0.00 ? 120 LEU C CD1 1  
ATOM 10461  C CD2 . LEU C 3 120 ? -108.273 -44.229 59.541  1.00 0.00 ? 120 LEU C CD2 1  
ATOM 10462  N N   . ASN C 3 121 ? -105.005 -43.450 60.502  1.00 0.00 ? 121 ASN C N   1  
ATOM 10463  C CA  . ASN C 3 121 ? -104.672 -42.080 60.068  1.00 0.00 ? 121 ASN C CA  1  
ATOM 10464  C C   . ASN C 3 121 ? -103.300 -41.985 59.524  1.00 0.00 ? 121 ASN C C   1  
ATOM 10465  O O   . ASN C 3 121 ? -103.057 -41.172 58.621  1.00 0.00 ? 121 ASN C O   1  
ATOM 10466  C CB  . ASN C 3 121 ? -104.867 -41.044 61.175  1.00 0.00 ? 121 ASN C CB  1  
ATOM 10467  C CG  . ASN C 3 121 ? -106.245 -40.863 61.733  1.00 0.00 ? 121 ASN C CG  1  
ATOM 10468  O OD1 . ASN C 3 121 ? -106.448 -40.859 62.953  1.00 0.00 ? 121 ASN C OD1 1  
ATOM 10469  N ND2 . ASN C 3 121 ? -107.231 -40.884 60.836  1.00 0.00 ? 121 ASN C ND2 1  
ATOM 10470  N N   . LYS C 3 122 ? -102.387 -42.679 60.185  1.00 0.00 ? 122 LYS C N   1  
ATOM 10471  C CA  . LYS C 3 122 ? -100.937 -42.575 59.953  1.00 0.00 ? 122 LYS C CA  1  
ATOM 10472  C C   . LYS C 3 122 ? -100.769 -43.147 58.533  1.00 0.00 ? 122 LYS C C   1  
ATOM 10473  O O   . LYS C 3 122 ? -100.039 -42.584 57.704  1.00 0.00 ? 122 LYS C O   1  
ATOM 10474  C CB  . LYS C 3 122 ? -100.222 -43.344 61.051  1.00 0.00 ? 122 LYS C CB  1  
ATOM 10475  C CG  . LYS C 3 122 ? -98.734  -43.762 60.813  1.00 0.00 ? 122 LYS C CG  1  
ATOM 10476  C CD  . LYS C 3 122 ? -98.116  -44.548 61.918  1.00 0.00 ? 122 LYS C CD  1  
ATOM 10477  C CE  . LYS C 3 122 ? -98.333  -46.089 61.832  1.00 0.00 ? 122 LYS C CE  1  
ATOM 10478  N NZ  . LYS C 3 122 ? -97.383  -46.756 62.682  1.00 0.00 ? 122 LYS C NZ  1  
ATOM 10479  N N   . ILE C 3 123 ? -101.443 -44.293 58.338  1.00 0.00 ? 123 ILE C N   1  
ATOM 10480  C CA  . ILE C 3 123 ? -101.349 -45.035 57.125  1.00 0.00 ? 123 ILE C CA  1  
ATOM 10481  C C   . ILE C 3 123 ? -101.945 -44.243 55.970  1.00 0.00 ? 123 ILE C C   1  
ATOM 10482  O O   . ILE C 3 123 ? -101.297 -44.122 54.914  1.00 0.00 ? 123 ILE C O   1  
ATOM 10483  C CB  . ILE C 3 123 ? -102.085 -46.333 57.287  1.00 0.00 ? 123 ILE C CB  1  
ATOM 10484  C CG1 . ILE C 3 123 ? -101.190 -47.242 58.110  1.00 0.00 ? 123 ILE C CG1 1  
ATOM 10485  C CG2 . ILE C 3 123 ? -102.321 -47.030 55.960  1.00 0.00 ? 123 ILE C CG2 1  
ATOM 10486  C CD1 . ILE C 3 123 ? -101.788 -48.634 58.379  1.00 0.00 ? 123 ILE C CD1 1  
ATOM 10487  N N   . ASP C 3 124 ? -103.147 -43.673 56.157  1.00 0.00 ? 124 ASP C N   1  
ATOM 10488  C CA  . ASP C 3 124 ? -103.800 -42.886 55.075  1.00 0.00 ? 124 ASP C CA  1  
ATOM 10489  C C   . ASP C 3 124 ? -102.959 -41.730 54.710  1.00 0.00 ? 124 ASP C C   1  
ATOM 10490  O O   . ASP C 3 124 ? -102.909 -41.362 53.574  1.00 0.00 ? 124 ASP C O   1  
ATOM 10491  C CB  . ASP C 3 124 ? -105.142 -42.320 55.506  1.00 0.00 ? 124 ASP C CB  1  
ATOM 10492  C CG  . ASP C 3 124 ? -106.089 -42.282 54.222  1.00 0.00 ? 124 ASP C CG  1  
ATOM 10493  O OD1 . ASP C 3 124 ? -105.900 -43.147 53.322  1.00 0.00 ? 124 ASP C OD1 1  
ATOM 10494  O OD2 . ASP C 3 124 ? -106.928 -41.368 54.181  1.00 0.00 ? 124 ASP C OD2 1  
ATOM 10495  N N   . LYS C 3 125 ? -102.235 -41.015 55.632  1.00 0.00 ? 125 LYS C N   1  
ATOM 10496  C CA  . LYS C 3 125 ? -101.436 -39.829 55.414  1.00 0.00 ? 125 LYS C CA  1  
ATOM 10497  C C   . LYS C 3 125 ? -100.313 -40.101 54.458  1.00 0.00 ? 125 LYS C C   1  
ATOM 10498  O O   . LYS C 3 125 ? -100.243 -39.441 53.408  1.00 0.00 ? 125 LYS C O   1  
ATOM 10499  C CB  . LYS C 3 125 ? -100.845 -39.264 56.715  1.00 0.00 ? 125 LYS C CB  1  
ATOM 10500  C CG  . LYS C 3 125 ? -100.516 -37.760 56.582  1.00 0.00 ? 125 LYS C CG  1  
ATOM 10501  C CD  . LYS C 3 125 ? -99.797  -37.209 57.827  1.00 0.00 ? 125 LYS C CD  1  
ATOM 10502  C CE  . LYS C 3 125 ? -99.513  -35.708 57.598  1.00 0.00 ? 125 LYS C CE  1  
ATOM 10503  N NZ  . LYS C 3 125 ? -98.790  -35.043 58.749  1.00 0.00 ? 125 LYS C NZ  1  
ATOM 10504  N N   . GLU C 3 126 ? -99.523  -41.218 54.718  1.00 0.00 ? 126 GLU C N   1  
ATOM 10505  C CA  . GLU C 3 126 ? -98.441  -41.727 53.987  1.00 0.00 ? 126 GLU C CA  1  
ATOM 10506  C C   . GLU C 3 126 ? -98.946  -42.178 52.650  1.00 0.00 ? 126 GLU C C   1  
ATOM 10507  O O   . GLU C 3 126 ? -98.230  -41.846 51.710  1.00 0.00 ? 126 GLU C O   1  
ATOM 10508  C CB  . GLU C 3 126 ? -97.688  -42.901 54.714  1.00 0.00 ? 126 GLU C CB  1  
ATOM 10509  C CG  . GLU C 3 126 ? -96.622  -42.357 55.690  1.00 0.00 ? 126 GLU C CG  1  
ATOM 10510  C CD  . GLU C 3 126 ? -97.181  -41.761 56.984  1.00 0.00 ? 126 GLU C CD  1  
ATOM 10511  O OE1 . GLU C 3 126 ? -97.690  -40.608 56.957  1.00 0.00 ? 126 GLU C OE1 1  
ATOM 10512  O OE2 . GLU C 3 126 ? -96.921  -42.471 58.004  1.00 0.00 ? 126 GLU C OE2 1  
ATOM 10513  N N   . ILE C 3 127 ? -100.171 -42.812 52.574  1.00 0.00 ? 127 ILE C N   1  
ATOM 10514  C CA  . ILE C 3 127 ? -100.775 -43.206 51.320  1.00 0.00 ? 127 ILE C CA  1  
ATOM 10515  C C   . ILE C 3 127 ? -101.089 -41.962 50.571  1.00 0.00 ? 127 ILE C C   1  
ATOM 10516  O O   . ILE C 3 127 ? -100.743 -41.969 49.369  1.00 0.00 ? 127 ILE C O   1  
ATOM 10517  C CB  . ILE C 3 127 ? -101.989 -44.141 51.353  1.00 0.00 ? 127 ILE C CB  1  
ATOM 10518  C CG1 . ILE C 3 127 ? -101.729 -45.426 52.102  1.00 0.00 ? 127 ILE C CG1 1  
ATOM 10519  C CG2 . ILE C 3 127 ? -102.511 -44.454 49.935  1.00 0.00 ? 127 ILE C CG2 1  
ATOM 10520  C CD1 . ILE C 3 127 ? -102.934 -46.380 52.148  1.00 0.00 ? 127 ILE C CD1 1  
ATOM 10521  N N   . ASP C 3 128 ? -101.678 -40.928 51.160  1.00 0.00 ? 128 ASP C N   1  
ATOM 10522  C CA  . ASP C 3 128 ? -102.096 -39.774 50.398  1.00 0.00 ? 128 ASP C CA  1  
ATOM 10523  C C   . ASP C 3 128 ? -100.793 -39.121 49.827  1.00 0.00 ? 128 ASP C C   1  
ATOM 10524  O O   . ASP C 3 128 ? -100.839 -38.567 48.743  1.00 0.00 ? 128 ASP C O   1  
ATOM 10525  C CB  . ASP C 3 128 ? -102.831 -38.759 51.224  1.00 0.00 ? 128 ASP C CB  1  
ATOM 10526  C CG  . ASP C 3 128 ? -104.252 -39.193 51.427  1.00 0.00 ? 128 ASP C CG  1  
ATOM 10527  O OD1 . ASP C 3 128 ? -104.825 -39.811 50.493  1.00 0.00 ? 128 ASP C OD1 1  
ATOM 10528  O OD2 . ASP C 3 128 ? -104.820 -38.836 52.513  1.00 0.00 ? 128 ASP C OD2 1  
ATOM 10529  N N   . SER C 3 129 ? -99.669  -39.157 50.566  1.00 0.00 ? 129 SER C N   1  
ATOM 10530  C CA  . SER C 3 129 ? -98.459  -38.494 50.242  1.00 0.00 ? 129 SER C CA  1  
ATOM 10531  C C   . SER C 3 129 ? -97.778  -39.132 49.032  1.00 0.00 ? 129 SER C C   1  
ATOM 10532  O O   . SER C 3 129 ? -96.862  -38.501 48.491  1.00 0.00 ? 129 SER C O   1  
ATOM 10533  C CB  . SER C 3 129 ? -97.350  -38.499 51.290  1.00 0.00 ? 129 SER C CB  1  
ATOM 10534  O OG  . SER C 3 129 ? -97.815  -37.839 52.446  1.00 0.00 ? 129 SER C OG  1  
ATOM 10535  N N   . THR C 3 130 ? -98.187  -40.406 48.725  1.00 0.00 ? 130 THR C N   1  
ATOM 10536  C CA  . THR C 3 130 ? -97.579  -41.318 47.823  1.00 0.00 ? 130 THR C CA  1  
ATOM 10537  C C   . THR C 3 130 ? -98.124  -41.029 46.373  1.00 0.00 ? 130 THR C C   1  
ATOM 10538  O O   . THR C 3 130 ? -99.313  -40.765 46.277  1.00 0.00 ? 130 THR C O   1  
ATOM 10539  C CB  . THR C 3 130 ? -97.961  -42.772 48.129  1.00 0.00 ? 130 THR C CB  1  
ATOM 10540  O OG1 . THR C 3 130 ? -97.542  -43.157 49.433  1.00 0.00 ? 130 THR C OG1 1  
ATOM 10541  C CG2 . THR C 3 130 ? -97.372  -43.695 47.047  1.00 0.00 ? 130 THR C CG2 1  
ATOM 10542  N N   . ASP C 3 131 ? -97.230  -41.206 45.330  1.00 0.00 ? 131 ASP C N   1  
ATOM 10543  C CA  . ASP C 3 131 ? -97.650  -41.187 43.958  1.00 0.00 ? 131 ASP C CA  1  
ATOM 10544  C C   . ASP C 3 131 ? -97.457  -42.572 43.413  1.00 0.00 ? 131 ASP C C   1  
ATOM 10545  O O   . ASP C 3 131 ? -96.346  -43.060 43.425  1.00 0.00 ? 131 ASP C O   1  
ATOM 10546  C CB  . ASP C 3 131 ? -96.904  -40.183 43.110  1.00 0.00 ? 131 ASP C CB  1  
ATOM 10547  C CG  . ASP C 3 131 ? -97.283  -38.729 43.488  1.00 0.00 ? 131 ASP C CG  1  
ATOM 10548  O OD1 . ASP C 3 131 ? -98.517  -38.405 43.696  1.00 0.00 ? 131 ASP C OD1 1  
ATOM 10549  O OD2 . ASP C 3 131 ? -96.313  -37.917 43.607  1.00 0.00 ? 131 ASP C OD2 1  
ATOM 10550  N N   . ASN C 3 132 ? -98.587  -43.124 42.934  1.00 0.00 ? 132 ASN C N   1  
ATOM 10551  C CA  . ASN C 3 132 ? -98.598  -44.510 42.335  1.00 0.00 ? 132 ASN C CA  1  
ATOM 10552  C C   . ASN C 3 132 ? -98.262  -45.605 43.331  1.00 0.00 ? 132 ASN C C   1  
ATOM 10553  O O   . ASN C 3 132 ? -97.255  -46.276 43.207  1.00 0.00 ? 132 ASN C O   1  
ATOM 10554  C CB  . ASN C 3 132 ? -97.764  -44.510 41.024  1.00 0.00 ? 132 ASN C CB  1  
ATOM 10555  C CG  . ASN C 3 132 ? -97.880  -45.788 40.230  1.00 0.00 ? 132 ASN C CG  1  
ATOM 10556  O OD1 . ASN C 3 132 ? -98.861  -46.514 40.373  1.00 0.00 ? 132 ASN C OD1 1  
ATOM 10557  N ND2 . ASN C 3 132 ? -96.923  -46.053 39.245  1.00 0.00 ? 132 ASN C ND2 1  
ATOM 10558  N N   . PHE C 3 133 ? -99.147  -45.795 44.310  1.00 0.00 ? 133 PHE C N   1  
ATOM 10559  C CA  . PHE C 3 133 ? -98.790  -46.645 45.432  1.00 0.00 ? 133 PHE C CA  1  
ATOM 10560  C C   . PHE C 3 133 ? -99.015  -48.080 44.864  1.00 0.00 ? 133 PHE C C   1  
ATOM 10561  O O   . PHE C 3 133 ? -100.144 -48.487 44.468  1.00 0.00 ? 133 PHE C O   1  
ATOM 10562  C CB  . PHE C 3 133 ? -99.765  -46.312 46.618  1.00 0.00 ? 133 PHE C CB  1  
ATOM 10563  C CG  . PHE C 3 133 ? -99.639  -47.120 47.889  1.00 0.00 ? 133 PHE C CG  1  
ATOM 10564  C CD1 . PHE C 3 133 ? -98.366  -47.319 48.500  1.00 0.00 ? 133 PHE C CD1 1  
ATOM 10565  C CD2 . PHE C 3 133 ? -100.792 -47.783 48.352  1.00 0.00 ? 133 PHE C CD2 1  
ATOM 10566  C CE1 . PHE C 3 133 ? -98.300  -48.159 49.567  1.00 0.00 ? 133 PHE C CE1 1  
ATOM 10567  C CE2 . PHE C 3 133 ? -100.658 -48.635 49.464  1.00 0.00 ? 133 PHE C CE2 1  
ATOM 10568  C CZ  . PHE C 3 133 ? -99.387  -48.834 50.083  1.00 0.00 ? 133 PHE C CZ  1  
ATOM 10569  N N   . GLU C 3 134 ? -97.937  -48.816 44.847  1.00 0.00 ? 134 GLU C N   1  
ATOM 10570  C CA  . GLU C 3 134 ? -98.044  -50.186 44.519  1.00 0.00 ? 134 GLU C CA  1  
ATOM 10571  C C   . GLU C 3 134 ? -98.575  -51.130 45.603  1.00 0.00 ? 134 GLU C C   1  
ATOM 10572  O O   . GLU C 3 134 ? -99.419  -51.932 45.395  1.00 0.00 ? 134 GLU C O   1  
ATOM 10573  C CB  . GLU C 3 134 ? -96.714  -50.750 44.203  1.00 0.00 ? 134 GLU C CB  1  
ATOM 10574  C CG  . GLU C 3 134 ? -96.697  -52.143 43.534  1.00 0.00 ? 134 GLU C CG  1  
ATOM 10575  C CD  . GLU C 3 134 ? -95.197  -52.552 43.344  1.00 0.00 ? 134 GLU C CD  1  
ATOM 10576  O OE1 . GLU C 3 134 ? -94.411  -52.522 44.343  1.00 0.00 ? 134 GLU C OE1 1  
ATOM 10577  O OE2 . GLU C 3 134 ? -94.855  -52.982 42.269  1.00 0.00 ? 134 GLU C OE2 1  
ATOM 10578  N N   . GLY C 3 135 ? -98.015  -50.897 46.842  1.00 0.00 ? 135 GLY C N   1  
ATOM 10579  C CA  . GLY C 3 135 ? -98.405  -51.798 47.927  1.00 0.00 ? 135 GLY C CA  1  
ATOM 10580  C C   . GLY C 3 135 ? -97.570  -51.784 49.116  1.00 0.00 ? 135 GLY C C   1  
ATOM 10581  O O   . GLY C 3 135 ? -96.664  -50.945 49.264  1.00 0.00 ? 135 GLY C O   1  
ATOM 10582  N N   . PHE C 3 136 ? -97.789  -52.743 50.062  1.00 0.00 ? 136 PHE C N   1  
ATOM 10583  C CA  . PHE C 3 136 ? -97.163  -52.771 51.280  1.00 0.00 ? 136 PHE C CA  1  
ATOM 10584  C C   . PHE C 3 136 ? -96.256  -53.972 51.474  1.00 0.00 ? 136 PHE C C   1  
ATOM 10585  O O   . PHE C 3 136 ? -96.397  -55.077 50.858  1.00 0.00 ? 136 PHE C O   1  
ATOM 10586  C CB  . PHE C 3 136 ? -98.164  -52.999 52.481  1.00 0.00 ? 136 PHE C CB  1  
ATOM 10587  C CG  . PHE C 3 136 ? -99.152  -51.860 52.690  1.00 0.00 ? 136 PHE C CG  1  
ATOM 10588  C CD1 . PHE C 3 136 ? -100.389 -51.755 52.019  1.00 0.00 ? 136 PHE C CD1 1  
ATOM 10589  C CD2 . PHE C 3 136 ? -98.842  -50.825 53.616  1.00 0.00 ? 136 PHE C CD2 1  
ATOM 10590  C CE1 . PHE C 3 136 ? -101.369 -50.756 52.373  1.00 0.00 ? 136 PHE C CE1 1  
ATOM 10591  C CE2 . PHE C 3 136 ? -99.827  -49.834 53.938  1.00 0.00 ? 136 PHE C CE2 1  
ATOM 10592  C CZ  . PHE C 3 136 ? -101.053 -49.804 53.296  1.00 0.00 ? 136 PHE C CZ  1  
ATOM 10593  N N   . GLN C 3 137 ? -95.250  -53.768 52.314  1.00 0.00 ? 137 GLN C N   1  
ATOM 10594  C CA  . GLN C 3 137 ? -94.299  -54.786 52.703  1.00 0.00 ? 137 GLN C CA  1  
ATOM 10595  C C   . GLN C 3 137 ? -94.506  -54.647 54.202  1.00 0.00 ? 137 GLN C C   1  
ATOM 10596  O O   . GLN C 3 137 ? -94.356  -53.553 54.744  1.00 0.00 ? 137 GLN C O   1  
ATOM 10597  C CB  . GLN C 3 137 ? -92.828  -54.436 52.518  1.00 0.00 ? 137 GLN C CB  1  
ATOM 10598  C CG  . GLN C 3 137 ? -92.488  -54.408 51.009  1.00 0.00 ? 137 GLN C CG  1  
ATOM 10599  C CD  . GLN C 3 137 ? -90.913  -54.322 50.868  1.00 0.00 ? 137 GLN C CD  1  
ATOM 10600  O OE1 . GLN C 3 137 ? -90.323  -53.977 51.844  1.00 0.00 ? 137 GLN C OE1 1  
ATOM 10601  N NE2 . GLN C 3 137 ? -90.280  -54.769 49.693  1.00 0.00 ? 137 GLN C NE2 1  
ATOM 10602  N N   . LEU C 3 138 ? -94.756  -55.833 54.929  1.00 0.00 ? 138 LEU C N   1  
ATOM 10603  C CA  . LEU C 3 138 ? -94.783  -55.788 56.362  1.00 0.00 ? 138 LEU C CA  1  
ATOM 10604  C C   . LEU C 3 138 ? -93.633  -56.522 56.792  1.00 0.00 ? 138 LEU C C   1  
ATOM 10605  O O   . LEU C 3 138 ? -93.320  -57.661 56.394  1.00 0.00 ? 138 LEU C O   1  
ATOM 10606  C CB  . LEU C 3 138 ? -96.246  -56.425 56.654  1.00 0.00 ? 138 LEU C CB  1  
ATOM 10607  C CG  . LEU C 3 138 ? -96.532  -56.656 58.150  1.00 0.00 ? 138 LEU C CG  1  
ATOM 10608  C CD1 . LEU C 3 138 ? -96.926  -55.246 58.854  1.00 0.00 ? 138 LEU C CD1 1  
ATOM 10609  C CD2 . LEU C 3 138 ? -97.706  -57.716 58.332  1.00 0.00 ? 138 LEU C CD2 1  
ATOM 10610  N N   . LEU C 3 139 ? -92.808  -55.869 57.728  1.00 0.00 ? 139 LEU C N   1  
ATOM 10611  C CA  . LEU C 3 139 ? -91.603  -56.378 58.337  1.00 0.00 ? 139 LEU C CA  1  
ATOM 10612  C C   . LEU C 3 139 ? -91.940  -56.585 59.778  1.00 0.00 ? 139 LEU C C   1  
ATOM 10613  O O   . LEU C 3 139 ? -92.418  -55.630 60.427  1.00 0.00 ? 139 LEU C O   1  
ATOM 10614  C CB  . LEU C 3 139 ? -90.436  -55.282 58.243  1.00 0.00 ? 139 LEU C CB  1  
ATOM 10615  C CG  . LEU C 3 139 ? -89.573  -55.195 57.007  1.00 0.00 ? 139 LEU C CG  1  
ATOM 10616  C CD1 . LEU C 3 139 ? -90.260  -54.955 55.646  1.00 0.00 ? 139 LEU C CD1 1  
ATOM 10617  C CD2 . LEU C 3 139 ? -88.380  -54.198 57.164  1.00 0.00 ? 139 LEU C CD2 1  
ATOM 10618  N N   . HIS C 3 140 ? -91.807  -57.820 60.384  1.00 0.00 ? 140 HIS C N   1  
ATOM 10619  C CA  . HIS C 3 140 ? -92.251  -58.065 61.768  1.00 0.00 ? 140 HIS C CA  1  
ATOM 10620  C C   . HIS C 3 140 ? -91.848  -59.298 62.343  1.00 0.00 ? 140 HIS C C   1  
ATOM 10621  O O   . HIS C 3 140 ? -91.123  -60.091 61.720  1.00 0.00 ? 140 HIS C O   1  
ATOM 10622  C CB  . HIS C 3 140 ? -93.785  -57.909 61.890  1.00 0.00 ? 140 HIS C CB  1  
ATOM 10623  C CG  . HIS C 3 140 ? -94.596  -58.894 61.063  1.00 0.00 ? 140 HIS C CG  1  
ATOM 10624  N ND1 . HIS C 3 140 ? -95.673  -59.590 61.593  1.00 0.00 ? 140 HIS C ND1 1  
ATOM 10625  C CD2 . HIS C 3 140 ? -94.585  -59.256 59.733  1.00 0.00 ? 140 HIS C CD2 1  
ATOM 10626  C CE1 . HIS C 3 140 ? -96.200  -60.411 60.612  1.00 0.00 ? 140 HIS C CE1 1  
ATOM 10627  N NE2 . HIS C 3 140 ? -95.601  -60.142 59.423  1.00 0.00 ? 140 HIS C NE2 1  
ATOM 10628  N N   . SER C 3 141 ? -92.216  -59.453 63.607  1.00 0.00 ? 141 SER C N   1  
ATOM 10629  C CA  . SER C 3 141 ? -91.956  -60.527 64.520  1.00 0.00 ? 141 SER C CA  1  
ATOM 10630  C C   . SER C 3 141 ? -93.140  -61.266 65.069  1.00 0.00 ? 141 SER C C   1  
ATOM 10631  O O   . SER C 3 141 ? -94.128  -60.580 65.274  1.00 0.00 ? 141 SER C O   1  
ATOM 10632  C CB  . SER C 3 141 ? -91.079  -60.099 65.742  1.00 0.00 ? 141 SER C CB  1  
ATOM 10633  O OG  . SER C 3 141 ? -90.143  -61.123 66.104  1.00 0.00 ? 141 SER C OG  1  
ATOM 10634  N N   . VAL C 3 142 ? -93.006  -62.586 65.314  1.00 0.00 ? 142 VAL C N   1  
ATOM 10635  C CA  . VAL C 3 142 ? -94.051  -63.373 65.985  1.00 0.00 ? 142 VAL C CA  1  
ATOM 10636  C C   . VAL C 3 142 ? -93.480  -63.743 67.354  1.00 0.00 ? 142 VAL C C   1  
ATOM 10637  O O   . VAL C 3 142 ? -94.109  -64.462 68.132  1.00 0.00 ? 142 VAL C O   1  
ATOM 10638  C CB  . VAL C 3 142 ? -94.431  -64.557 65.088  1.00 0.00 ? 142 VAL C CB  1  
ATOM 10639  C CG1 . VAL C 3 142 ? -95.608  -65.237 65.681  1.00 0.00 ? 142 VAL C CG1 1  
ATOM 10640  C CG2 . VAL C 3 142 ? -94.720  -64.002 63.599  1.00 0.00 ? 142 VAL C CG2 1  
ATOM 10641  N N   . ALA C 3 143 ? -92.332  -63.117 67.740  1.00 0.00 ? 143 ALA C N   1  
ATOM 10642  C CA  . ALA C 3 143 ? -91.666  -63.158 69.044  1.00 0.00 ? 143 ALA C CA  1  
ATOM 10643  C C   . ALA C 3 143 ? -91.673  -61.764 69.513  1.00 0.00 ? 143 ALA C C   1  
ATOM 10644  O O   . ALA C 3 143 ? -90.823  -61.358 70.312  1.00 0.00 ? 143 ALA C O   1  
ATOM 10645  C CB  . ALA C 3 143 ? -90.211  -63.693 68.886  1.00 0.00 ? 143 ALA C CB  1  
ATOM 10646  N N   . GLY C 3 144 ? -92.633  -60.978 69.029  1.00 0.00 ? 144 GLY C N   1  
ATOM 10647  C CA  . GLY C 3 144 ? -92.780  -59.589 69.348  1.00 0.00 ? 144 GLY C CA  1  
ATOM 10648  C C   . GLY C 3 144 ? -94.076  -59.511 70.074  1.00 0.00 ? 144 GLY C C   1  
ATOM 10649  O O   . GLY C 3 144 ? -94.867  -60.434 70.090  1.00 0.00 ? 144 GLY C O   1  
ATOM 10650  N N   . GLY C 3 145 ? -94.244  -58.423 70.822  1.00 0.00 ? 145 GLY C N   1  
ATOM 10651  C CA  . GLY C 3 145 ? -95.502  -58.158 71.449  1.00 0.00 ? 145 GLY C CA  1  
ATOM 10652  C C   . GLY C 3 145 ? -96.406  -57.529 70.494  1.00 0.00 ? 145 GLY C C   1  
ATOM 10653  O O   . GLY C 3 145 ? -97.566  -57.842 70.332  1.00 0.00 ? 145 GLY C O   1  
ATOM 10654  N N   . THR C 3 146 ? -95.756  -56.486 69.907  1.00 0.00 ? 146 THR C N   1  
ATOM 10655  C CA  . THR C 3 146 ? -96.248  -55.459 69.024  1.00 0.00 ? 146 THR C CA  1  
ATOM 10656  C C   . THR C 3 146 ? -96.432  -56.072 67.703  1.00 0.00 ? 146 THR C C   1  
ATOM 10657  O O   . THR C 3 146 ? -97.499  -55.966 67.096  1.00 0.00 ? 146 THR C O   1  
ATOM 10658  C CB  . THR C 3 146 ? -95.383  -54.224 69.055  1.00 0.00 ? 146 THR C CB  1  
ATOM 10659  O OG1 . THR C 3 146 ? -95.208  -53.749 70.424  1.00 0.00 ? 146 THR C OG1 1  
ATOM 10660  C CG2 . THR C 3 146 ? -95.972  -53.074 68.257  1.00 0.00 ? 146 THR C CG2 1  
ATOM 10661  N N   . GLY C 3 147 ? -95.347  -56.768 67.182  1.00 0.00 ? 147 GLY C N   1  
ATOM 10662  C CA  . GLY C 3 147 ? -95.324  -57.297 65.866  1.00 0.00 ? 147 GLY C CA  1  
ATOM 10663  C C   . GLY C 3 147 ? -96.446  -58.330 65.764  1.00 0.00 ? 147 GLY C C   1  
ATOM 10664  O O   . GLY C 3 147 ? -97.190  -58.339 64.761  1.00 0.00 ? 147 GLY C O   1  
ATOM 10665  N N   . SER C 3 148 ? -96.609  -59.170 66.861  1.00 0.00 ? 148 SER C N   1  
ATOM 10666  C CA  . SER C 3 148 ? -97.742  -60.024 66.843  1.00 0.00 ? 148 SER C CA  1  
ATOM 10667  C C   . SER C 3 148 ? -99.114  -59.349 66.990  1.00 0.00 ? 148 SER C C   1  
ATOM 10668  O O   . SER C 3 148 ? -99.948  -59.487 66.085  1.00 0.00 ? 148 SER C O   1  
ATOM 10669  C CB  . SER C 3 148 ? -97.612  -61.129 67.931  1.00 0.00 ? 148 SER C CB  1  
ATOM 10670  O OG  . SER C 3 148 ? -98.247  -62.353 67.569  1.00 0.00 ? 148 SER C OG  1  
ATOM 10671  N N   . GLY C 3 149 ? -99.327  -58.731 68.112  1.00 0.00 ? 149 GLY C N   1  
ATOM 10672  C CA  . GLY C 3 149 ? -100.674 -58.266 68.447  1.00 0.00 ? 149 GLY C CA  1  
ATOM 10673  C C   . GLY C 3 149 ? -101.264 -57.108 67.686  1.00 0.00 ? 149 GLY C C   1  
ATOM 10674  O O   . GLY C 3 149 ? -102.345 -57.157 67.124  1.00 0.00 ? 149 GLY C O   1  
ATOM 10675  N N   . LEU C 3 150 ? -100.458 -56.044 67.642  1.00 0.00 ? 150 LEU C N   1  
ATOM 10676  C CA  . LEU C 3 150 ? -100.685 -54.785 66.938  1.00 0.00 ? 150 LEU C CA  1  
ATOM 10677  C C   . LEU C 3 150 ? -100.687 -55.106 65.446  1.00 0.00 ? 150 LEU C C   1  
ATOM 10678  O O   . LEU C 3 150 ? -101.569 -54.634 64.674  1.00 0.00 ? 150 LEU C O   1  
ATOM 10679  C CB  . LEU C 3 150 ? -99.586  -53.705 67.227  1.00 0.00 ? 150 LEU C CB  1  
ATOM 10680  C CG  . LEU C 3 150 ? -100.157 -52.248 67.281  1.00 0.00 ? 150 LEU C CG  1  
ATOM 10681  C CD1 . LEU C 3 150 ? -100.808 -51.732 66.009  1.00 0.00 ? 150 LEU C CD1 1  
ATOM 10682  C CD2 . LEU C 3 150 ? -101.055 -52.007 68.517  1.00 0.00 ? 150 LEU C CD2 1  
ATOM 10683  N N   . GLY C 3 151 ? -99.756  -56.011 65.094  1.00 0.00 ? 151 GLY C N   1  
ATOM 10684  C CA  . GLY C 3 151 ? -99.618  -56.518 63.749  1.00 0.00 ? 151 GLY C CA  1  
ATOM 10685  C C   . GLY C 3 151 ? -100.891 -57.218 63.260  1.00 0.00 ? 151 GLY C C   1  
ATOM 10686  O O   . GLY C 3 151 ? -101.259 -56.977 62.112  1.00 0.00 ? 151 GLY C O   1  
ATOM 10687  N N   . SER C 3 152 ? -101.556 -58.077 64.140  1.00 0.00 ? 152 SER C N   1  
ATOM 10688  C CA  . SER C 3 152 ? -102.726 -58.794 63.770  1.00 0.00 ? 152 SER C CA  1  
ATOM 10689  C C   . SER C 3 152 ? -103.812 -57.861 63.508  1.00 0.00 ? 152 SER C C   1  
ATOM 10690  O O   . SER C 3 152 ? -104.510 -58.013 62.513  1.00 0.00 ? 152 SER C O   1  
ATOM 10691  C CB  . SER C 3 152 ? -103.045 -59.807 64.888  1.00 0.00 ? 152 SER C CB  1  
ATOM 10692  O OG  . SER C 3 152 ? -102.039 -60.828 64.808  1.00 0.00 ? 152 SER C OG  1  
ATOM 10693  N N   . ASN C 3 153 ? -103.991 -56.776 64.255  1.00 0.00 ? 153 ASN C N   1  
ATOM 10694  C CA  . ASN C 3 153 ? -104.992 -55.819 63.957  1.00 0.00 ? 153 ASN C CA  1  
ATOM 10695  C C   . ASN C 3 153 ? -104.828 -55.101 62.653  1.00 0.00 ? 153 ASN C C   1  
ATOM 10696  O O   . ASN C 3 153 ? -105.817 -54.862 61.979  1.00 0.00 ? 153 ASN C O   1  
ATOM 10697  C CB  . ASN C 3 153 ? -105.166 -54.631 64.934  1.00 0.00 ? 153 ASN C CB  1  
ATOM 10698  C CG  . ASN C 3 153 ? -105.526 -55.009 66.370  1.00 0.00 ? 153 ASN C CG  1  
ATOM 10699  O OD1 . ASN C 3 153 ? -104.651 -55.395 67.149  1.00 0.00 ? 153 ASN C OD1 1  
ATOM 10700  N ND2 . ASN C 3 153 ? -106.793 -54.754 66.755  1.00 0.00 ? 153 ASN C ND2 1  
ATOM 10701  N N   . LEU C 3 154 ? -103.613 -54.665 62.341  1.00 0.00 ? 154 LEU C N   1  
ATOM 10702  C CA  . LEU C 3 154 ? -103.280 -53.876 61.193  1.00 0.00 ? 154 LEU C CA  1  
ATOM 10703  C C   . LEU C 3 154 ? -103.523 -54.714 59.956  1.00 0.00 ? 154 LEU C C   1  
ATOM 10704  O O   . LEU C 3 154 ? -104.031 -54.268 58.950  1.00 0.00 ? 154 LEU C O   1  
ATOM 10705  C CB  . LEU C 3 154 ? -101.844 -53.275 61.457  1.00 0.00 ? 154 LEU C CB  1  
ATOM 10706  C CG  . LEU C 3 154 ? -101.193 -52.603 60.275  1.00 0.00 ? 154 LEU C CG  1  
ATOM 10707  C CD1 . LEU C 3 154 ? -100.228 -51.519 60.725  1.00 0.00 ? 154 LEU C CD1 1  
ATOM 10708  C CD2 . LEU C 3 154 ? -100.463 -53.617 59.308  1.00 0.00 ? 154 LEU C CD2 1  
ATOM 10709  N N   . LEU C 3 155 ? -103.229 -56.049 60.007  1.00 0.00 ? 155 LEU C N   1  
ATOM 10710  C CA  . LEU C 3 155 ? -103.413 -56.990 58.928  1.00 0.00 ? 155 LEU C CA  1  
ATOM 10711  C C   . LEU C 3 155 ? -104.822 -57.095 58.570  1.00 0.00 ? 155 LEU C C   1  
ATOM 10712  O O   . LEU C 3 155 ? -105.127 -57.094 57.402  1.00 0.00 ? 155 LEU C O   1  
ATOM 10713  C CB  . LEU C 3 155 ? -102.892 -58.443 59.378  1.00 0.00 ? 155 LEU C CB  1  
ATOM 10714  C CG  . LEU C 3 155 ? -101.486 -58.725 58.917  1.00 0.00 ? 155 LEU C CG  1  
ATOM 10715  C CD1 . LEU C 3 155 ? -100.770 -59.744 59.930  1.00 0.00 ? 155 LEU C CD1 1  
ATOM 10716  C CD2 . LEU C 3 155 ? -101.294 -59.289 57.472  1.00 0.00 ? 155 LEU C CD2 1  
ATOM 10717  N N   . GLU C 3 156 ? -105.721 -57.133 59.588  1.00 0.00 ? 156 GLU C N   1  
ATOM 10718  C CA  . GLU C 3 156 ? -107.187 -57.159 59.435  1.00 0.00 ? 156 GLU C CA  1  
ATOM 10719  C C   . GLU C 3 156 ? -107.689 -55.905 58.844  1.00 0.00 ? 156 GLU C C   1  
ATOM 10720  O O   . GLU C 3 156 ? -108.582 -55.870 57.991  1.00 0.00 ? 156 GLU C O   1  
ATOM 10721  C CB  . GLU C 3 156 ? -107.969 -57.333 60.800  1.00 0.00 ? 156 GLU C CB  1  
ATOM 10722  C CG  . GLU C 3 156 ? -107.484 -58.703 61.444  1.00 0.00 ? 156 GLU C CG  1  
ATOM 10723  C CD  . GLU C 3 156 ? -108.029 -58.844 62.836  1.00 0.00 ? 156 GLU C CD  1  
ATOM 10724  O OE1 . GLU C 3 156 ? -107.627 -58.048 63.722  1.00 0.00 ? 156 GLU C OE1 1  
ATOM 10725  O OE2 . GLU C 3 156 ? -108.976 -59.691 63.007  1.00 0.00 ? 156 GLU C OE2 1  
ATOM 10726  N N   . ALA C 3 157 ? -107.131 -54.792 59.339  1.00 0.00 ? 157 ALA C N   1  
ATOM 10727  C CA  . ALA C 3 157 ? -107.630 -53.495 58.864  1.00 0.00 ? 157 ALA C CA  1  
ATOM 10728  C C   . ALA C 3 157 ? -107.328 -53.302 57.387  1.00 0.00 ? 157 ALA C C   1  
ATOM 10729  O O   . ALA C 3 157 ? -108.169 -52.888 56.595  1.00 0.00 ? 157 ALA C O   1  
ATOM 10730  C CB  . ALA C 3 157 ? -106.913 -52.320 59.581  1.00 0.00 ? 157 ALA C CB  1  
ATOM 10731  N N   . LEU C 3 158 ? -106.066 -53.710 56.967  1.00 0.00 ? 158 LEU C N   1  
ATOM 10732  C CA  . LEU C 3 158 ? -105.531 -53.583 55.596  1.00 0.00 ? 158 LEU C CA  1  
ATOM 10733  C C   . LEU C 3 158 ? -106.352 -54.392 54.679  1.00 0.00 ? 158 LEU C C   1  
ATOM 10734  O O   . LEU C 3 158 ? -106.683 -54.042 53.565  1.00 0.00 ? 158 LEU C O   1  
ATOM 10735  C CB  . LEU C 3 158 ? -104.055 -53.987 55.473  1.00 0.00 ? 158 LEU C CB  1  
ATOM 10736  C CG  . LEU C 3 158 ? -103.030 -53.056 56.137  1.00 0.00 ? 158 LEU C CG  1  
ATOM 10737  C CD1 . LEU C 3 158 ? -101.671 -53.756 55.959  1.00 0.00 ? 158 LEU C CD1 1  
ATOM 10738  C CD2 . LEU C 3 158 ? -103.059 -51.591 55.730  1.00 0.00 ? 158 LEU C CD2 1  
ATOM 10739  N N   . CYS C 3 159 ? -106.843 -55.620 55.162  1.00 0.00 ? 159 CYS C N   1  
ATOM 10740  C CA  . CYS C 3 159 ? -107.719 -56.550 54.382  1.00 0.00 ? 159 CYS C CA  1  
ATOM 10741  C C   . CYS C 3 159 ? -109.023 -55.931 53.926  1.00 0.00 ? 159 CYS C C   1  
ATOM 10742  O O   . CYS C 3 159 ? -109.468 -56.065 52.741  1.00 0.00 ? 159 CYS C O   1  
ATOM 10743  C CB  . CYS C 3 159 ? -107.930 -57.853 55.169  1.00 0.00 ? 159 CYS C CB  1  
ATOM 10744  S SG  . CYS C 3 159 ? -108.289 -59.350 54.125  1.00 0.00 ? 159 CYS C SG  1  
ATOM 10745  N N   . ASP C 3 160 ? -109.698 -55.344 54.859  1.00 0.00 ? 160 ASP C N   1  
ATOM 10746  C CA  . ASP C 3 160 ? -111.033 -54.736 54.671  1.00 0.00 ? 160 ASP C CA  1  
ATOM 10747  C C   . ASP C 3 160 ? -110.976 -53.558 53.871  1.00 0.00 ? 160 ASP C C   1  
ATOM 10748  O O   . ASP C 3 160 ? -111.741 -53.368 52.955  1.00 0.00 ? 160 ASP C O   1  
ATOM 10749  C CB  . ASP C 3 160 ? -111.733 -54.406 56.040  1.00 0.00 ? 160 ASP C CB  1  
ATOM 10750  C CG  . ASP C 3 160 ? -111.767 -55.676 56.913  1.00 0.00 ? 160 ASP C CG  1  
ATOM 10751  O OD1 . ASP C 3 160 ? -111.449 -56.836 56.577  1.00 0.00 ? 160 ASP C OD1 1  
ATOM 10752  O OD2 . ASP C 3 160 ? -112.005 -55.419 58.096  1.00 0.00 ? 160 ASP C OD2 1  
ATOM 10753  N N   . ARG C 3 161 ? -110.015 -52.639 54.225  1.00 0.00 ? 161 ARG C N   1  
ATOM 10754  C CA  . ARG C 3 161 ? -109.955 -51.317 53.763  1.00 0.00 ? 161 ARG C CA  1  
ATOM 10755  C C   . ARG C 3 161 ? -109.658 -51.171 52.248  1.00 0.00 ? 161 ARG C C   1  
ATOM 10756  O O   . ARG C 3 161 ? -110.343 -50.403 51.483  1.00 0.00 ? 161 ARG C O   1  
ATOM 10757  C CB  . ARG C 3 161 ? -109.080 -50.337 54.650  1.00 0.00 ? 161 ARG C CB  1  
ATOM 10758  C CG  . ARG C 3 161 ? -107.497 -50.376 54.540  1.00 0.00 ? 161 ARG C CG  1  
ATOM 10759  C CD  . ARG C 3 161 ? -106.724 -49.642 55.617  1.00 0.00 ? 161 ARG C CD  1  
ATOM 10760  N NE  . ARG C 3 161 ? -106.725 -48.216 55.200  1.00 0.00 ? 161 ARG C NE  1  
ATOM 10761  C CZ  . ARG C 3 161 ? -106.176 -47.208 56.021  1.00 0.00 ? 161 ARG C CZ  1  
ATOM 10762  N NH1 . ARG C 3 161 ? -105.538 -47.632 57.200  1.00 0.00 ? 161 ARG C NH1 1  
ATOM 10763  N NH2 . ARG C 3 161 ? -106.223 -45.849 55.778  1.00 0.00 ? 161 ARG C NH2 1  
ATOM 10764  N N   . TYR C 3 162 ? -108.612 -51.864 51.784  1.00 0.00 ? 162 TYR C N   1  
ATOM 10765  C CA  . TYR C 3 162 ? -108.195 -51.802 50.473  1.00 0.00 ? 162 TYR C CA  1  
ATOM 10766  C C   . TYR C 3 162 ? -107.935 -53.157 49.944  1.00 0.00 ? 162 TYR C C   1  
ATOM 10767  O O   . TYR C 3 162 ? -107.066 -53.789 50.531  1.00 0.00 ? 162 TYR C O   1  
ATOM 10768  C CB  . TYR C 3 162 ? -106.896 -50.981 50.186  1.00 0.00 ? 162 TYR C CB  1  
ATOM 10769  C CG  . TYR C 3 162 ? -107.072 -49.518 50.646  1.00 0.00 ? 162 TYR C CG  1  
ATOM 10770  C CD1 . TYR C 3 162 ? -108.133 -48.775 50.137  1.00 0.00 ? 162 TYR C CD1 1  
ATOM 10771  C CD2 . TYR C 3 162 ? -106.162 -48.926 51.533  1.00 0.00 ? 162 TYR C CD2 1  
ATOM 10772  C CE1 . TYR C 3 162 ? -108.329 -47.426 50.589  1.00 0.00 ? 162 TYR C CE1 1  
ATOM 10773  C CE2 . TYR C 3 162 ? -106.270 -47.584 51.866  1.00 0.00 ? 162 TYR C CE2 1  
ATOM 10774  C CZ  . TYR C 3 162 ? -107.383 -46.880 51.472  1.00 0.00 ? 162 TYR C CZ  1  
ATOM 10775  O OH  . TYR C 3 162 ? -107.428 -45.486 51.855  1.00 0.00 ? 162 TYR C OH  1  
ATOM 10776  N N   . PRO C 3 163 ? -108.546 -53.687 48.865  1.00 0.00 ? 163 PRO C N   1  
ATOM 10777  C CA  . PRO C 3 163 ? -108.296 -54.999 48.344  1.00 0.00 ? 163 PRO C CA  1  
ATOM 10778  C C   . PRO C 3 163 ? -107.512 -54.937 47.049  1.00 0.00 ? 163 PRO C C   1  
ATOM 10779  O O   . PRO C 3 163 ? -107.052 -55.904 46.512  1.00 0.00 ? 163 PRO C O   1  
ATOM 10780  C CB  . PRO C 3 163 ? -109.730 -55.628 48.176  1.00 0.00 ? 163 PRO C CB  1  
ATOM 10781  C CG  . PRO C 3 163 ? -110.476 -54.333 47.678  1.00 0.00 ? 163 PRO C CG  1  
ATOM 10782  C CD  . PRO C 3 163 ? -109.856 -53.196 48.462  1.00 0.00 ? 163 PRO C CD  1  
ATOM 10783  N N   . LYS C 3 164 ? -107.404 -53.739 46.457  1.00 0.00 ? 164 LYS C N   1  
ATOM 10784  C CA  . LYS C 3 164 ? -106.833 -53.338 45.227  1.00 0.00 ? 164 LYS C CA  1  
ATOM 10785  C C   . LYS C 3 164 ? -105.369 -53.532 45.224  1.00 0.00 ? 164 LYS C C   1  
ATOM 10786  O O   . LYS C 3 164 ? -104.853 -54.071 44.185  1.00 0.00 ? 164 LYS C O   1  
ATOM 10787  C CB  . LYS C 3 164 ? -107.214 -51.883 44.950  1.00 0.00 ? 164 LYS C CB  1  
ATOM 10788  C CG  . LYS C 3 164 ? -108.654 -51.627 44.620  1.00 0.00 ? 164 LYS C CG  1  
ATOM 10789  C CD  . LYS C 3 164 ? -109.053 -50.147 44.809  1.00 0.00 ? 164 LYS C CD  1  
ATOM 10790  C CE  . LYS C 3 164 ? -109.180 -49.552 46.224  1.00 0.00 ? 164 LYS C CE  1  
ATOM 10791  N NZ  . LYS C 3 164 ? -110.275 -50.200 46.888  1.00 0.00 ? 164 LYS C NZ  1  
ATOM 10792  N N   . LYS C 3 165 ? -104.601 -53.148 46.284  1.00 0.00 ? 165 LYS C N   1  
ATOM 10793  C CA  . LYS C 3 165 ? -103.137 -53.139 46.404  1.00 0.00 ? 165 LYS C CA  1  
ATOM 10794  C C   . LYS C 3 165 ? -102.631 -54.404 47.003  1.00 0.00 ? 165 LYS C C   1  
ATOM 10795  O O   . LYS C 3 165 ? -103.344 -55.128 47.762  1.00 0.00 ? 165 LYS C O   1  
ATOM 10796  C CB  . LYS C 3 165 ? -102.579 -51.975 47.243  1.00 0.00 ? 165 LYS C CB  1  
ATOM 10797  C CG  . LYS C 3 165 ? -102.810 -50.587 46.631  1.00 0.00 ? 165 LYS C CG  1  
ATOM 10798  C CD  . LYS C 3 165 ? -104.304 -50.031 46.744  1.00 0.00 ? 165 LYS C CD  1  
ATOM 10799  C CE  . LYS C 3 165 ? -104.459 -48.627 46.143  1.00 0.00 ? 165 LYS C CE  1  
ATOM 10800  N NZ  . LYS C 3 165 ? -105.897 -48.149 46.097  1.00 0.00 ? 165 LYS C NZ  1  
ATOM 10801  N N   . ILE C 3 166 ? -101.308 -54.720 46.631  1.00 0.00 ? 166 ILE C N   1  
ATOM 10802  C CA  . ILE C 3 166 ? -100.668 -55.965 46.996  1.00 0.00 ? 166 ILE C CA  1  
ATOM 10803  C C   . ILE C 3 166 ? -100.085 -55.760 48.346  1.00 0.00 ? 166 ILE C C   1  
ATOM 10804  O O   . ILE C 3 166 ? -99.639  -54.680 48.780  1.00 0.00 ? 166 ILE C O   1  
ATOM 10805  C CB  . ILE C 3 166 ? -99.537  -56.304 45.997  1.00 0.00 ? 166 ILE C CB  1  
ATOM 10806  C CG1 . ILE C 3 166 ? -99.191  -57.851 46.001  1.00 0.00 ? 166 ILE C CG1 1  
ATOM 10807  C CG2 . ILE C 3 166 ? -98.328  -55.331 46.280  1.00 0.00 ? 166 ILE C CG2 1  
ATOM 10808  C CD1 . ILE C 3 166 ? -98.071  -58.247 45.023  1.00 0.00 ? 166 ILE C CD1 1  
ATOM 10809  N N   . LEU C 3 167 ? -100.216 -56.859 49.141  1.00 0.00 ? 167 LEU C N   1  
ATOM 10810  C CA  . LEU C 3 167 ? -99.717  -56.956 50.525  1.00 0.00 ? 167 LEU C CA  1  
ATOM 10811  C C   . LEU C 3 167 ? -98.779  -58.098 50.572  1.00 0.00 ? 167 LEU C C   1  
ATOM 10812  O O   . LEU C 3 167 ? -99.255  -59.229 50.236  1.00 0.00 ? 167 LEU C O   1  
ATOM 10813  C CB  . LEU C 3 167 ? -100.860 -57.242 51.562  1.00 0.00 ? 167 LEU C CB  1  
ATOM 10814  C CG  . LEU C 3 167 ? -100.486 -57.552 53.045  1.00 0.00 ? 167 LEU C CG  1  
ATOM 10815  C CD1 . LEU C 3 167 ? -99.335  -56.606 53.646  1.00 0.00 ? 167 LEU C CD1 1  
ATOM 10816  C CD2 . LEU C 3 167 ? -101.807 -57.623 53.803  1.00 0.00 ? 167 LEU C CD2 1  
ATOM 10817  N N   . THR C 3 168 ? -97.460  -57.830 50.981  1.00 0.00 ? 168 THR C N   1  
ATOM 10818  C CA  . THR C 3 168 ? -96.396  -58.862 51.119  1.00 0.00 ? 168 THR C CA  1  
ATOM 10819  C C   . THR C 3 168 ? -95.945  -58.826 52.593  1.00 0.00 ? 168 THR C C   1  
ATOM 10820  O O   . THR C 3 168 ? -95.992  -57.766 53.278  1.00 0.00 ? 168 THR C O   1  
ATOM 10821  C CB  . THR C 3 168 ? -95.159  -58.597 50.387  1.00 0.00 ? 168 THR C CB  1  
ATOM 10822  O OG1 . THR C 3 168 ? -94.498  -57.349 50.706  1.00 0.00 ? 168 THR C OG1 1  
ATOM 10823  C CG2 . THR C 3 168 ? -95.541  -58.648 48.872  1.00 0.00 ? 168 THR C CG2 1  
ATOM 10824  N N   . THR C 3 169 ? -95.570  -59.975 53.205  1.00 0.00 ? 169 THR C N   1  
ATOM 10825  C CA  . THR C 3 169 ? -95.103  -59.896 54.537  1.00 0.00 ? 169 THR C CA  1  
ATOM 10826  C C   . THR C 3 169 ? -93.836  -60.674 54.463  1.00 0.00 ? 169 THR C C   1  
ATOM 10827  O O   . THR C 3 169 ? -93.669  -61.608 53.702  1.00 0.00 ? 169 THR C O   1  
ATOM 10828  C CB  . THR C 3 169 ? -96.074  -60.437 55.555  1.00 0.00 ? 169 THR C CB  1  
ATOM 10829  O OG1 . THR C 3 169 ? -95.947  -61.827 55.613  1.00 0.00 ? 169 THR C OG1 1  
ATOM 10830  C CG2 . THR C 3 169 ? -97.453  -60.001 55.196  1.00 0.00 ? 169 THR C CG2 1  
ATOM 10831  N N   . TYR C 3 170 ? -92.919  -60.238 55.330  1.00 0.00 ? 170 TYR C N   1  
ATOM 10832  C CA  . TYR C 3 170 ? -91.628  -60.858 55.771  1.00 0.00 ? 170 TYR C CA  1  
ATOM 10833  C C   . TYR C 3 170 ? -91.880  -61.175 57.215  1.00 0.00 ? 170 TYR C C   1  
ATOM 10834  O O   . TYR C 3 170 ? -91.859  -60.261 58.078  1.00 0.00 ? 170 TYR C O   1  
ATOM 10835  C CB  . TYR C 3 170 ? -90.509  -59.788 55.553  1.00 0.00 ? 170 TYR C CB  1  
ATOM 10836  C CG  . TYR C 3 170 ? -90.675  -59.452 54.063  1.00 0.00 ? 170 TYR C CG  1  
ATOM 10837  C CD1 . TYR C 3 170 ? -89.999  -60.314 53.158  1.00 0.00 ? 170 TYR C CD1 1  
ATOM 10838  C CD2 . TYR C 3 170 ? -91.251  -58.225 53.622  1.00 0.00 ? 170 TYR C CD2 1  
ATOM 10839  C CE1 . TYR C 3 170 ? -90.022  -60.020 51.811  1.00 0.00 ? 170 TYR C CE1 1  
ATOM 10840  C CE2 . TYR C 3 170 ? -91.164  -57.933 52.259  1.00 0.00 ? 170 TYR C CE2 1  
ATOM 10841  C CZ  . TYR C 3 170 ? -90.553  -58.808 51.361  1.00 0.00 ? 170 TYR C CZ  1  
ATOM 10842  O OH  . TYR C 3 170 ? -90.588  -58.529 49.980  1.00 0.00 ? 170 TYR C OH  1  
ATOM 10843  N N   . SER C 3 171 ? -92.121  -62.422 57.553  1.00 0.00 ? 171 SER C N   1  
ATOM 10844  C CA  . SER C 3 171 ? -92.476  -62.770 58.937  1.00 0.00 ? 171 SER C CA  1  
ATOM 10845  C C   . SER C 3 171 ? -91.384  -63.554 59.476  1.00 0.00 ? 171 SER C C   1  
ATOM 10846  O O   . SER C 3 171 ? -90.998  -64.580 58.906  1.00 0.00 ? 171 SER C O   1  
ATOM 10847  C CB  . SER C 3 171 ? -93.806  -63.525 58.900  1.00 0.00 ? 171 SER C CB  1  
ATOM 10848  O OG  . SER C 3 171 ? -94.729  -62.993 57.976  1.00 0.00 ? 171 SER C OG  1  
ATOM 10849  N N   . VAL C 3 172 ? -90.821  -63.121 60.683  1.00 0.00 ? 172 VAL C N   1  
ATOM 10850  C CA  . VAL C 3 172 ? -89.752  -63.986 61.320  1.00 0.00 ? 172 VAL C CA  1  
ATOM 10851  C C   . VAL C 3 172 ? -90.296  -64.896 62.251  1.00 0.00 ? 172 VAL C C   1  
ATOM 10852  O O   . VAL C 3 172 ? -91.069  -64.505 63.146  1.00 0.00 ? 172 VAL C O   1  
ATOM 10853  C CB  . VAL C 3 172 ? -88.525  -63.269 61.895  1.00 0.00 ? 172 VAL C CB  1  
ATOM 10854  C CG1 . VAL C 3 172 ? -87.543  -62.694 60.888  1.00 0.00 ? 172 VAL C CG1 1  
ATOM 10855  C CG2 . VAL C 3 172 ? -88.816  -62.285 63.057  1.00 0.00 ? 172 VAL C CG2 1  
ATOM 10856  N N   . PHE C 3 173 ? -90.021  -66.241 62.147  1.00 0.00 ? 173 PHE C N   1  
ATOM 10857  C CA  . PHE C 3 173 ? -90.509  -67.336 62.927  1.00 0.00 ? 173 PHE C CA  1  
ATOM 10858  C C   . PHE C 3 173 ? -89.379  -67.550 63.993  1.00 0.00 ? 173 PHE C C   1  
ATOM 10859  O O   . PHE C 3 173 ? -88.246  -67.353 63.725  1.00 0.00 ? 173 PHE C O   1  
ATOM 10860  C CB  . PHE C 3 173 ? -90.428  -68.690 62.084  1.00 0.00 ? 173 PHE C CB  1  
ATOM 10861  C CG  . PHE C 3 173 ? -90.951  -69.838 62.736  1.00 0.00 ? 173 PHE C CG  1  
ATOM 10862  C CD1 . PHE C 3 173 ? -92.322  -70.136 62.817  1.00 0.00 ? 173 PHE C CD1 1  
ATOM 10863  C CD2 . PHE C 3 173 ? -90.103  -70.737 63.439  1.00 0.00 ? 173 PHE C CD2 1  
ATOM 10864  C CE1 . PHE C 3 173 ? -92.889  -71.300 63.346  1.00 0.00 ? 173 PHE C CE1 1  
ATOM 10865  C CE2 . PHE C 3 173 ? -90.644  -71.926 63.965  1.00 0.00 ? 173 PHE C CE2 1  
ATOM 10866  C CZ  . PHE C 3 173 ? -92.012  -72.184 63.991  1.00 0.00 ? 173 PHE C CZ  1  
ATOM 10867  N N   . PRO C 3 174 ? -89.642  -67.965 65.288  1.00 0.00 ? 174 PRO C N   1  
ATOM 10868  C CA  . PRO C 3 174 ? -88.699  -68.079 66.359  1.00 0.00 ? 174 PRO C CA  1  
ATOM 10869  C C   . PRO C 3 174 ? -87.381  -68.816 66.089  1.00 0.00 ? 174 PRO C C   1  
ATOM 10870  O O   . PRO C 3 174 ? -87.381  -69.580 65.127  1.00 0.00 ? 174 PRO C O   1  
ATOM 10871  C CB  . PRO C 3 174 ? -89.401  -68.666 67.534  1.00 0.00 ? 174 PRO C CB  1  
ATOM 10872  C CG  . PRO C 3 174 ? -90.847  -68.126 67.301  1.00 0.00 ? 174 PRO C CG  1  
ATOM 10873  C CD  . PRO C 3 174 ? -90.977  -68.124 65.849  1.00 0.00 ? 174 PRO C CD  1  
ATOM 10874  N N   . ALA C 3 175 ? -86.315  -68.516 66.911  1.00 0.00 ? 175 ALA C N   1  
ATOM 10875  C CA  . ALA C 3 175 ? -85.069  -69.233 66.715  1.00 0.00 ? 175 ALA C CA  1  
ATOM 10876  C C   . ALA C 3 175 ? -85.242  -70.444 67.510  1.00 0.00 ? 175 ALA C C   1  
ATOM 10877  O O   . ALA C 3 175 ? -85.544  -70.314 68.651  1.00 0.00 ? 175 ALA C O   1  
ATOM 10878  C CB  . ALA C 3 175 ? -83.884  -68.476 67.346  1.00 0.00 ? 175 ALA C CB  1  
ATOM 10879  N N   . ARG C 3 176 ? -84.886  -71.593 66.953  1.00 0.00 ? 176 ARG C N   1  
ATOM 10880  C CA  . ARG C 3 176 ? -84.815  -72.909 67.563  1.00 0.00 ? 176 ARG C CA  1  
ATOM 10881  C C   . ARG C 3 176 ? -86.109  -73.270 68.384  1.00 0.00 ? 176 ARG C C   1  
ATOM 10882  O O   . ARG C 3 176 ? -87.203  -72.871 68.093  1.00 0.00 ? 176 ARG C O   1  
ATOM 10883  C CB  . ARG C 3 176 ? -83.605  -73.127 68.524  1.00 0.00 ? 176 ARG C CB  1  
ATOM 10884  C CG  . ARG C 3 176 ? -82.276  -72.862 67.806  1.00 0.00 ? 176 ARG C CG  1  
ATOM 10885  C CD  . ARG C 3 176 ? -81.987  -73.744 66.621  1.00 0.00 ? 176 ARG C CD  1  
ATOM 10886  N NE  . ARG C 3 176 ? -80.754  -73.194 66.023  1.00 0.00 ? 176 ARG C NE  1  
ATOM 10887  C CZ  . ARG C 3 176 ? -79.971  -73.838 65.148  1.00 0.00 ? 176 ARG C CZ  1  
ATOM 10888  N NH1 . ARG C 3 176 ? -80.387  -74.957 64.446  1.00 0.00 ? 176 ARG C NH1 1  
ATOM 10889  N NH2 . ARG C 3 176 ? -78.763  -73.224 64.824  1.00 0.00 ? 176 ARG C NH2 1  
ATOM 10890  N N   . SER C 3 177 ? -85.957  -74.137 69.418  1.00 0.00 ? 177 SER C N   1  
ATOM 10891  C CA  . SER C 3 177 ? -86.934  -74.740 70.210  1.00 0.00 ? 177 SER C CA  1  
ATOM 10892  C C   . SER C 3 177 ? -87.586  -73.763 71.127  1.00 0.00 ? 177 SER C C   1  
ATOM 10893  O O   . SER C 3 177 ? -86.990  -72.723 71.428  1.00 0.00 ? 177 SER C O   1  
ATOM 10894  C CB  . SER C 3 177 ? -86.284  -75.927 71.009  1.00 0.00 ? 177 SER C CB  1  
ATOM 10895  O OG  . SER C 3 177 ? -85.812  -77.037 70.219  1.00 0.00 ? 177 SER C OG  1  
ATOM 10896  N N   . SER C 3 178 ? -88.859  -74.131 71.483  1.00 0.00 ? 178 SER C N   1  
ATOM 10897  C CA  . SER C 3 178 ? -89.818  -73.433 72.320  1.00 0.00 ? 178 SER C CA  1  
ATOM 10898  C C   . SER C 3 178 ? -89.279  -72.566 73.352  1.00 0.00 ? 178 SER C C   1  
ATOM 10899  O O   . SER C 3 178 ? -88.377  -72.979 74.084  1.00 0.00 ? 178 SER C O   1  
ATOM 10900  C CB  . SER C 3 178 ? -90.806  -74.446 72.868  1.00 0.00 ? 178 SER C CB  1  
ATOM 10901  O OG  . SER C 3 178 ? -91.643  -74.987 71.894  1.00 0.00 ? 178 SER C OG  1  
ATOM 10902  N N   . GLU C 3 179 ? -89.777  -71.296 73.441  1.00 0.00 ? 179 GLU C N   1  
ATOM 10903  C CA  . GLU C 3 179 ? -89.238  -70.402 74.435  1.00 0.00 ? 179 GLU C CA  1  
ATOM 10904  C C   . GLU C 3 179 ? -90.200  -70.337 75.681  1.00 0.00 ? 179 GLU C C   1  
ATOM 10905  O O   . GLU C 3 179 ? -89.733  -70.310 76.797  1.00 0.00 ? 179 GLU C O   1  
ATOM 10906  C CB  . GLU C 3 179 ? -89.073  -68.946 73.969  1.00 0.00 ? 179 GLU C CB  1  
ATOM 10907  C CG  . GLU C 3 179 ? -87.989  -68.725 72.893  1.00 0.00 ? 179 GLU C CG  1  
ATOM 10908  C CD  . GLU C 3 179 ? -88.254  -67.310 72.346  1.00 0.00 ? 179 GLU C CD  1  
ATOM 10909  O OE1 . GLU C 3 179 ? -87.753  -66.413 73.005  1.00 0.00 ? 179 GLU C OE1 1  
ATOM 10910  O OE2 . GLU C 3 179 ? -89.028  -67.179 71.351  1.00 0.00 ? 179 GLU C OE2 1  
ATOM 10911  N N   . VAL C 3 180 ? -91.520  -70.366 75.429  1.00 0.00 ? 180 VAL C N   1  
ATOM 10912  C CA  . VAL C 3 180 ? -92.422  -70.268 76.502  1.00 0.00 ? 180 VAL C CA  1  
ATOM 10913  C C   . VAL C 3 180 ? -93.403  -71.402 76.075  1.00 0.00 ? 180 VAL C C   1  
ATOM 10914  O O   . VAL C 3 180 ? -93.427  -71.875 74.948  1.00 0.00 ? 180 VAL C O   1  
ATOM 10915  C CB  . VAL C 3 180 ? -93.136  -68.871 76.591  1.00 0.00 ? 180 VAL C CB  1  
ATOM 10916  C CG1 . VAL C 3 180 ? -92.158  -67.859 77.220  1.00 0.00 ? 180 VAL C CG1 1  
ATOM 10917  C CG2 . VAL C 3 180 ? -93.593  -68.370 75.266  1.00 0.00 ? 180 VAL C CG2 1  
ATOM 10918  N N   . VAL C 3 181 ? -94.229  -71.865 77.045  1.00 0.00 ? 181 VAL C N   1  
ATOM 10919  C CA  . VAL C 3 181 ? -95.221  -72.921 76.907  1.00 0.00 ? 181 VAL C CA  1  
ATOM 10920  C C   . VAL C 3 181 ? -96.257  -72.358 76.019  1.00 0.00 ? 181 VAL C C   1  
ATOM 10921  O O   . VAL C 3 181 ? -96.755  -73.067 75.162  1.00 0.00 ? 181 VAL C O   1  
ATOM 10922  C CB  . VAL C 3 181 ? -95.742  -73.332 78.297  1.00 0.00 ? 181 VAL C CB  1  
ATOM 10923  C CG1 . VAL C 3 181 ? -94.658  -74.205 78.999  1.00 0.00 ? 181 VAL C CG1 1  
ATOM 10924  C CG2 . VAL C 3 181 ? -96.172  -72.106 79.147  1.00 0.00 ? 181 VAL C CG2 1  
ATOM 10925  N N   . VAL C 3 182 ? -96.733  -71.114 76.235  1.00 0.00 ? 182 VAL C N   1  
ATOM 10926  C CA  . VAL C 3 182 ? -97.859  -70.535 75.465  1.00 0.00 ? 182 VAL C CA  1  
ATOM 10927  C C   . VAL C 3 182 ? -97.449  -70.152 74.035  1.00 0.00 ? 182 VAL C C   1  
ATOM 10928  O O   . VAL C 3 182 ? -98.314  -69.698 73.263  1.00 0.00 ? 182 VAL C O   1  
ATOM 10929  C CB  . VAL C 3 182 ? -98.489  -69.335 76.095  1.00 0.00 ? 182 VAL C CB  1  
ATOM 10930  C CG1 . VAL C 3 182 ? -99.178  -69.784 77.488  1.00 0.00 ? 182 VAL C CG1 1  
ATOM 10931  C CG2 . VAL C 3 182 ? -97.367  -68.327 76.336  1.00 0.00 ? 182 VAL C CG2 1  
ATOM 10932  N N   . GLN C 3 183 ? -96.199  -70.335 73.604  1.00 0.00 ? 183 GLN C N   1  
ATOM 10933  C CA  . GLN C 3 183 ? -95.692  -70.004 72.267  1.00 0.00 ? 183 GLN C CA  1  
ATOM 10934  C C   . GLN C 3 183 ? -96.529  -70.454 71.120  1.00 0.00 ? 183 GLN C C   1  
ATOM 10935  O O   . GLN C 3 183 ? -96.749  -69.660 70.204  1.00 0.00 ? 183 GLN C O   1  
ATOM 10936  C CB  . GLN C 3 183 ? -94.349  -70.798 72.172  1.00 0.00 ? 183 GLN C CB  1  
ATOM 10937  C CG  . GLN C 3 183 ? -93.530  -70.523 70.855  1.00 0.00 ? 183 GLN C CG  1  
ATOM 10938  C CD  . GLN C 3 183 ? -93.369  -69.008 70.476  1.00 0.00 ? 183 GLN C CD  1  
ATOM 10939  O OE1 . GLN C 3 183 ? -94.040  -68.514 69.541  1.00 0.00 ? 183 GLN C OE1 1  
ATOM 10940  N NE2 . GLN C 3 183 ? -92.330  -68.383 71.060  1.00 0.00 ? 183 GLN C NE2 1  
ATOM 10941  N N   . SER C 3 184 ? -97.079  -71.716 71.124  1.00 0.00 ? 184 SER C N   1  
ATOM 10942  C CA  . SER C 3 184 ? -97.946  -72.259 70.030  1.00 0.00 ? 184 SER C CA  1  
ATOM 10943  C C   . SER C 3 184 ? -99.197  -71.486 69.881  1.00 0.00 ? 184 SER C C   1  
ATOM 10944  O O   . SER C 3 184 ? -99.691  -71.225 68.779  1.00 0.00 ? 184 SER C O   1  
ATOM 10945  C CB  . SER C 3 184 ? -98.215  -73.760 70.366  1.00 0.00 ? 184 SER C CB  1  
ATOM 10946  O OG  . SER C 3 184 ? -99.057  -74.042 71.502  1.00 0.00 ? 184 SER C OG  1  
ATOM 10947  N N   . TYR C 3 185 ? -99.825  -71.014 70.977  1.00 0.00 ? 185 TYR C N   1  
ATOM 10948  C CA  . TYR C 3 185 ? -100.989 -70.169 70.996  1.00 0.00 ? 185 TYR C CA  1  
ATOM 10949  C C   . TYR C 3 185 ? -100.695 -68.815 70.383  1.00 0.00 ? 185 TYR C C   1  
ATOM 10950  O O   . TYR C 3 185 ? -101.374 -68.475 69.470  1.00 0.00 ? 185 TYR C O   1  
ATOM 10951  C CB  . TYR C 3 185 ? -101.526 -69.856 72.484  1.00 0.00 ? 185 TYR C CB  1  
ATOM 10952  C CG  . TYR C 3 185 ? -102.991 -69.660 72.635  1.00 0.00 ? 185 TYR C CG  1  
ATOM 10953  C CD1 . TYR C 3 185 ? -103.583 -68.440 72.131  1.00 0.00 ? 185 TYR C CD1 1  
ATOM 10954  C CD2 . TYR C 3 185 ? -103.797 -70.529 73.373  1.00 0.00 ? 185 TYR C CD2 1  
ATOM 10955  C CE1 . TYR C 3 185 ? -104.942 -68.214 72.383  1.00 0.00 ? 185 TYR C CE1 1  
ATOM 10956  C CE2 . TYR C 3 185 ? -105.030 -70.158 73.914  1.00 0.00 ? 185 TYR C CE2 1  
ATOM 10957  C CZ  . TYR C 3 185 ? -105.628 -69.046 73.392  1.00 0.00 ? 185 TYR C CZ  1  
ATOM 10958  O OH  . TYR C 3 185 ? -106.880 -68.659 73.883  1.00 0.00 ? 185 TYR C OH  1  
ATOM 10959  N N   . ASN C 3 186 ? -99.611  -68.108 70.744  1.00 0.00 ? 186 ASN C N   1  
ATOM 10960  C CA  . ASN C 3 186 ? -99.201  -66.871 70.159  1.00 0.00 ? 186 ASN C CA  1  
ATOM 10961  C C   . ASN C 3 186 ? -98.925  -66.931 68.685  1.00 0.00 ? 186 ASN C C   1  
ATOM 10962  O O   . ASN C 3 186 ? -99.384  -66.022 67.872  1.00 0.00 ? 186 ASN C O   1  
ATOM 10963  C CB  . ASN C 3 186 ? -97.844  -66.275 70.806  1.00 0.00 ? 186 ASN C CB  1  
ATOM 10964  C CG  . ASN C 3 186 ? -98.041  -66.030 72.305  1.00 0.00 ? 186 ASN C CG  1  
ATOM 10965  O OD1 . ASN C 3 186 ? -97.607  -66.814 73.120  1.00 0.00 ? 186 ASN C OD1 1  
ATOM 10966  N ND2 . ASN C 3 186 ? -98.821  -64.893 72.656  1.00 0.00 ? 186 ASN C ND2 1  
ATOM 10967  N N   . THR C 3 187 ? -98.215  -67.985 68.268  1.00 0.00 ? 187 THR C N   1  
ATOM 10968  C CA  . THR C 3 187 ? -97.869  -68.327 66.953  1.00 0.00 ? 187 THR C CA  1  
ATOM 10969  C C   . THR C 3 187 ? -99.034  -68.627 66.033  1.00 0.00 ? 187 THR C C   1  
ATOM 10970  O O   . THR C 3 187 ? -99.055  -67.996 64.998  1.00 0.00 ? 187 THR C O   1  
ATOM 10971  C CB  . THR C 3 187 ? -96.904  -69.536 67.020  1.00 0.00 ? 187 THR C CB  1  
ATOM 10972  O OG1 . THR C 3 187 ? -95.675  -69.096 67.504  1.00 0.00 ? 187 THR C OG1 1  
ATOM 10973  C CG2 . THR C 3 187 ? -96.684  -70.108 65.652  1.00 0.00 ? 187 THR C CG2 1  
ATOM 10974  N N   . ILE C 3 188 ? -100.055 -69.464 66.398  1.00 0.00 ? 188 ILE C N   1  
ATOM 10975  C CA  . ILE C 3 188 ? -101.238 -69.772 65.599  1.00 0.00 ? 188 ILE C CA  1  
ATOM 10976  C C   . ILE C 3 188 ? -102.050 -68.543 65.433  1.00 0.00 ? 188 ILE C C   1  
ATOM 10977  O O   . ILE C 3 188 ? -102.554 -68.301 64.329  1.00 0.00 ? 188 ILE C O   1  
ATOM 10978  C CB  . ILE C 3 188 ? -102.035 -71.037 65.995  1.00 0.00 ? 188 ILE C CB  1  
ATOM 10979  C CG1 . ILE C 3 188 ? -102.616 -70.918 67.434  1.00 0.00 ? 188 ILE C CG1 1  
ATOM 10980  C CG2 . ILE C 3 188 ? -101.060 -72.216 65.900  1.00 0.00 ? 188 ILE C CG2 1  
ATOM 10981  C CD1 . ILE C 3 188 ? -103.422 -72.147 67.889  1.00 0.00 ? 188 ILE C CD1 1  
ATOM 10982  N N   . LEU C 3 189 ? -102.239 -67.698 66.521  1.00 0.00 ? 189 LEU C N   1  
ATOM 10983  C CA  . LEU C 3 189 ? -103.042 -66.506 66.431  1.00 0.00 ? 189 LEU C CA  1  
ATOM 10984  C C   . LEU C 3 189 ? -102.499 -65.469 65.391  1.00 0.00 ? 189 LEU C C   1  
ATOM 10985  O O   . LEU C 3 189 ? -103.308 -64.970 64.612  1.00 0.00 ? 189 LEU C O   1  
ATOM 10986  C CB  . LEU C 3 189 ? -103.051 -65.755 67.793  1.00 0.00 ? 189 LEU C CB  1  
ATOM 10987  C CG  . LEU C 3 189 ? -104.398 -65.794 68.529  1.00 0.00 ? 189 LEU C CG  1  
ATOM 10988  C CD1 . LEU C 3 189 ? -105.555 -65.232 67.753  1.00 0.00 ? 189 LEU C CD1 1  
ATOM 10989  C CD2 . LEU C 3 189 ? -104.650 -67.246 68.918  1.00 0.00 ? 189 LEU C CD2 1  
ATOM 10990  N N   . ALA C 3 190 ? -101.190 -65.252 65.352  1.00 0.00 ? 190 ALA C N   1  
ATOM 10991  C CA  . ALA C 3 190 ? -100.609 -64.449 64.358  1.00 0.00 ? 190 ALA C CA  1  
ATOM 10992  C C   . ALA C 3 190 ? -100.733 -65.073 62.999  1.00 0.00 ? 190 ALA C C   1  
ATOM 10993  O O   . ALA C 3 190 ? -101.054 -64.455 61.950  1.00 0.00 ? 190 ALA C O   1  
ATOM 10994  C CB  . ALA C 3 190 ? -99.081  -64.265 64.523  1.00 0.00 ? 190 ALA C CB  1  
ATOM 10995  N N   . LEU C 3 191 ? -100.497 -66.416 62.944  1.00 0.00 ? 191 LEU C N   1  
ATOM 10996  C CA  . LEU C 3 191 ? -100.531 -67.257 61.742  1.00 0.00 ? 191 LEU C CA  1  
ATOM 10997  C C   . LEU C 3 191 ? -101.912 -67.204 61.078  1.00 0.00 ? 191 LEU C C   1  
ATOM 10998  O O   . LEU C 3 191 ? -102.021 -67.197 59.889  1.00 0.00 ? 191 LEU C O   1  
ATOM 10999  C CB  . LEU C 3 191 ? -100.045 -68.699 61.993  1.00 0.00 ? 191 LEU C CB  1  
ATOM 11000  C CG  . LEU C 3 191 ? -99.623  -69.397 60.688  1.00 0.00 ? 191 LEU C CG  1  
ATOM 11001  C CD1 . LEU C 3 191 ? -98.242  -68.934 60.162  1.00 0.00 ? 191 LEU C CD1 1  
ATOM 11002  C CD2 . LEU C 3 191 ? -99.648  -70.915 60.831  1.00 0.00 ? 191 LEU C CD2 1  
ATOM 11003  N N   . ARG C 3 192 ? -102.993 -67.017 61.849  1.00 0.00 ? 192 ARG C N   1  
ATOM 11004  C CA  . ARG C 3 192 ? -104.360 -66.859 61.308  1.00 0.00 ? 192 ARG C CA  1  
ATOM 11005  C C   . ARG C 3 192 ? -104.535 -65.647 60.434  1.00 0.00 ? 192 ARG C C   1  
ATOM 11006  O O   . ARG C 3 192 ? -105.109 -65.631 59.352  1.00 0.00 ? 192 ARG C O   1  
ATOM 11007  C CB  . ARG C 3 192 ? -105.382 -66.851 62.518  1.00 0.00 ? 192 ARG C CB  1  
ATOM 11008  C CG  . ARG C 3 192 ? -106.786 -66.648 62.142  1.00 0.00 ? 192 ARG C CG  1  
ATOM 11009  C CD  . ARG C 3 192 ? -107.821 -67.040 63.261  1.00 0.00 ? 192 ARG C CD  1  
ATOM 11010  N NE  . ARG C 3 192 ? -109.163 -67.277 62.609  1.00 0.00 ? 192 ARG C NE  1  
ATOM 11011  C CZ  . ARG C 3 192 ? -110.301 -67.459 63.360  1.00 0.00 ? 192 ARG C CZ  1  
ATOM 11012  N NH1 . ARG C 3 192 ? -110.244 -67.679 64.710  1.00 0.00 ? 192 ARG C NH1 1  
ATOM 11013  N NH2 . ARG C 3 192 ? -111.478 -67.550 62.671  1.00 0.00 ? 192 ARG C NH2 1  
ATOM 11014  N N   . ARG C 3 193 ? -103.905 -64.545 60.987  1.00 0.00 ? 193 ARG C N   1  
ATOM 11015  C CA  . ARG C 3 193 ? -103.976 -63.348 60.289  1.00 0.00 ? 193 ARG C CA  1  
ATOM 11016  C C   . ARG C 3 193 ? -103.139 -63.416 59.011  1.00 0.00 ? 193 ARG C C   1  
ATOM 11017  O O   . ARG C 3 193 ? -103.576 -62.893 57.991  1.00 0.00 ? 193 ARG C O   1  
ATOM 11018  C CB  . ARG C 3 193 ? -103.512 -62.114 61.082  1.00 0.00 ? 193 ARG C CB  1  
ATOM 11019  C CG  . ARG C 3 193 ? -104.410 -62.025 62.318  1.00 0.00 ? 193 ARG C CG  1  
ATOM 11020  C CD  . ARG C 3 193 ? -105.924 -62.168 62.153  1.00 0.00 ? 193 ARG C CD  1  
ATOM 11021  N NE  . ARG C 3 193 ? -106.501 -61.806 63.457  1.00 0.00 ? 193 ARG C NE  1  
ATOM 11022  C CZ  . ARG C 3 193 ? -106.677 -62.644 64.470  1.00 0.00 ? 193 ARG C CZ  1  
ATOM 11023  N NH1 . ARG C 3 193 ? -106.209 -63.918 64.414  1.00 0.00 ? 193 ARG C NH1 1  
ATOM 11024  N NH2 . ARG C 3 193 ? -107.309 -62.247 65.617  1.00 0.00 ? 193 ARG C NH2 1  
ATOM 11025  N N   . LEU C 3 194 ? -102.008 -64.049 59.146  1.00 0.00 ? 194 LEU C N   1  
ATOM 11026  C CA  . LEU C 3 194 ? -101.153 -64.217 58.015  1.00 0.00 ? 194 LEU C CA  1  
ATOM 11027  C C   . LEU C 3 194 ? -101.750 -65.057 56.927  1.00 0.00 ? 194 LEU C C   1  
ATOM 11028  O O   . LEU C 3 194 ? -101.588 -64.754 55.783  1.00 0.00 ? 194 LEU C O   1  
ATOM 11029  C CB  . LEU C 3 194 ? -99.756  -64.858 58.383  1.00 0.00 ? 194 LEU C CB  1  
ATOM 11030  C CG  . LEU C 3 194 ? -98.820  -63.882 59.029  1.00 0.00 ? 194 LEU C CG  1  
ATOM 11031  C CD1 . LEU C 3 194 ? -97.499  -64.656 59.281  1.00 0.00 ? 194 LEU C CD1 1  
ATOM 11032  C CD2 . LEU C 3 194 ? -98.511  -62.646 58.220  1.00 0.00 ? 194 LEU C CD2 1  
ATOM 11033  N N   . ILE C 3 195 ? -102.451 -66.155 57.221  1.00 0.00 ? 195 ILE C N   1  
ATOM 11034  C CA  . ILE C 3 195 ? -103.109 -66.865 56.089  1.00 0.00 ? 195 ILE C CA  1  
ATOM 11035  C C   . ILE C 3 195 ? -104.223 -66.007 55.489  1.00 0.00 ? 195 ILE C C   1  
ATOM 11036  O O   . ILE C 3 195 ? -104.379 -66.073 54.277  1.00 0.00 ? 195 ILE C O   1  
ATOM 11037  C CB  . ILE C 3 195 ? -103.517