data_5FM1
# 
_entry.id   5FM1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.284 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5FM1         
PDBE  EBI-65418    
WWPDB D_1290065418 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB  5FLZ     unspecified            'CRYO-EM STRUCTURE OF GAMMA-TUSC OLIGOMERS IN A CLOSED CONFORMATION' 
EMDB EMD-1731 'associated EM volume' .                                                                    
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        5FM1 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2015-10-30 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Greenberg, C.H.' 1 
'Kollman, J.'     2 
'Zelter, A.'      3 
'Johnson, R.'     4 
'MacCoss, M.J.'   5 
'Davis, T.N.'     6 
'Agard, D.A.'     7 
'Sali, A.'        8 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure of Gamma-Tubulin Small Complex Based on a Cryo-Em Map, Chemical Cross-Links, and a Remotely Related Structure.' 
J.Struct.Biol. 194 303 ? 2016 JSBIEM US 1047-8477 0803 ? 26968363 10.1016/J.JSB.2016.03.006 
1       'Microtubule Nucleating Gamma-Tusc Assembles Structures with 13-Fold Microtubule-Like Symmetry.'                           
Nature         466 879 ? 2010 NATUAS UK 0028-0836 0006 ? 20631709 10.1038/NATURE09207       
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Greenberg, C.H.' 1  
primary 'Kollman, J.'     2  
primary 'Zelter, A.'      3  
primary 'Johnson, R.'     4  
primary 'Maccoss, M.J.'   5  
primary 'Davis, T.N.'     6  
primary 'Agard, D.A.'     7  
primary 'Sali, A.'        8  
1       'Kollman, J.M.'   9  
1       'Polka, J.K.'     10 
1       'Zelter, A.'      11 
1       'Davis, T.N.'     12 
1       'Agard, D.A.'     13 
# 
_cell.entry_id           5FM1 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5FM1 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'SPINDLE POLE BODY COMPONENT SPC97' 96940.594 1 ? ? ? ? 
2 polymer man 'SPINDLE POLE BODY COMPONENT SPC98' 98336.211 1 ? ? ? ? 
3 polymer man 'TUBULIN GAMMA CHAIN'               52671.188 2 ? ? ? ? 
4 polymer man 'SPINDLE POLE BODY COMPONENT 110'   3762.629  2 ? ? ? 
;CONSTRUCT INCLUDES THE FIRST 220 RESIDUES OF SPC110P IT CANNOT BE UNIQUELY IDENTIFIED WHICH FRAGMENT OF SPC110 IS PRESENT IN THE MAP, THUS A POLY-ALANINE HELIX WAS FITTED.
;
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 GCP2 
2 GCP3 
3 GAMMA-TUBULIN 
4 
;EXTRAGENIC SUPPRESSOR OF CMD1-1 MUTANT PROTEIN 1, NUCLEAR FILAMENT-RELATED PROTEIN 1, SPINDLE POLE BODY SPACER PROTEIN SPC110, SPC110
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MEIKEVDDRAELLRYTNNIPLLGKLVNHQPLWSTNPKLKSFSLEKISAPDQRRVQEALVVKDLLNVLIGLEGTYIRYFND
YEPSDPETPIEFKIAKKMDPSFKTFSRRIVRYGKQYMILTRAYEKWSDTSFGMVLQRFAYEIRRFLEDVYLKTLVERLER
DFNKVPNFSIRELEQIINETEVNKQMELLYNIYEEIFREIEERRTNQSSQEDFNNFMDSMKNESSLHLRLMVAFDTTVYP
VPKGGAILKIFQQKILENLGDRSSVMFLKKLLNNISQDYCTMLYEWLTQGILNDPYQEFMTYDDLEGKTDNIFDTRDRAW
DTQYFIRKDVLLRDCDSEEDKNLLFKMLRTGILLKVVRASLQIPTIPSNSSDITIQEINDFADLMEGSNLELYVDKCYSR
ANEIFLKLFFQGYDLINVLKHLQQIFLGYQSGHNVLKFLTKNMGELTKHYRNDNNANYDKLLQNFELERQSENPNNLMRQ
LLMIQFDTETLPQVLSHYLQIYPEVPENNSANDDSDPLMHANNFKNMNAILFDELSKERTGAYHGSNLELYTPKSAIYHL
KFDINIPYPLNIIISRTCMIKYQIILRYQLVLQYHSRLLDETWMDLNKTPSWKYRGYSHTVKRRIVRATRVLHAKMNHFI
KTIMEYFNQNVIDKEVYSLEKCYRNPTLAVAIQNELEGGLTNIMTNRCLSDLIPLQLQIFDIVYKFCKFIKSMRAKLCQL
DPVLYEKHKSGMMKTLNEGYRTNNGGQEDVGYQEDAALELIQKLIEYISNASSIFRKCLINFTQELSTEKFDFYDSSSVD
AAGIERVLYSIVPPRSASASSQR
;
;MEIKEVDDRAELLRYTNNIPLLGKLVNHQPLWSTNPKLKSFSLEKISAPDQRRVQEALVVKDLLNVLIGLEGTYIRYFND
YEPSDPETPIEFKIAKKMDPSFKTFSRRIVRYGKQYMILTRAYEKWSDTSFGMVLQRFAYEIRRFLEDVYLKTLVERLER
DFNKVPNFSIRELEQIINETEVNKQMELLYNIYEEIFREIEERRTNQSSQEDFNNFMDSMKNESSLHLRLMVAFDTTVYP
VPKGGAILKIFQQKILENLGDRSSVMFLKKLLNNISQDYCTMLYEWLTQGILNDPYQEFMTYDDLEGKTDNIFDTRDRAW
DTQYFIRKDVLLRDCDSEEDKNLLFKMLRTGILLKVVRASLQIPTIPSNSSDITIQEINDFADLMEGSNLELYVDKCYSR
ANEIFLKLFFQGYDLINVLKHLQQIFLGYQSGHNVLKFLTKNMGELTKHYRNDNNANYDKLLQNFELERQSENPNNLMRQ
LLMIQFDTETLPQVLSHYLQIYPEVPENNSANDDSDPLMHANNFKNMNAILFDELSKERTGAYHGSNLELYTPKSAIYHL
KFDINIPYPLNIIISRTCMIKYQIILRYQLVLQYHSRLLDETWMDLNKTPSWKYRGYSHTVKRRIVRATRVLHAKMNHFI
KTIMEYFNQNVIDKEVYSLEKCYRNPTLAVAIQNELEGGLTNIMTNRCLSDLIPLQLQIFDIVYKFCKFIKSMRAKLCQL
DPVLYEKHKSGMMKTLNEGYRTNNGGQEDVGYQEDAALELIQKLIEYISNASSIFRKCLINFTQELSTEKFDFYDSSSVD
AAGIERVLYSIVPPRSASASSQR
;
A   ? 
2 'polypeptide(L)' no no 
;MELEPTLFGIIEALAPQLLSQSHLQTFVSDVVNLLRSSTKSATQLGPLIDFYKLQSLDSPETTIMWHKIEKFLDALFGIQ
NTDDMVKYLSVFQSLLPSNYRAKIVQKSSGLNMENLANHEHLLSPVRAPSIYTEASFENMDRFSERRSMVSSPNRYVPSS
TYSSVTLRQLSNPYYVNTIPEEDILKYVSYTLLATTSALFPFDHEQIQIPSKIPNFESGLLHLIFEAGLLYQSLGYKVEK
FRMLNISPMKKALIIEISEELQNYTAFVNNLVSSGTVVSLKSLYREIYENIIRLRIYCRFTEHLEELSGDTFLIELNIFK
SHGDLTIRKIATNLFNSMISLYYEYLMNWLTKGLLRATYGEFFIAENTDTNGTDDDFIYHIPIEFNQERVPAFIPKELAY
KIFMIGKSYIFLEKYCKEVQWTNEFSKKYHVLYQSNSYRGISTNFFEIINDQYSEIVNHTNQILNQKFHYRDVVFALKNI
LLMGKSDFMDALIEKANDILATPSDSLPNYKLTRVLQEAVQLSSLRHLMNSPRNSSVINGLDARVLDLGHGSVGWDVFTL
DYILYPPLSLVLNVNRPFGRKEYLRIFNFLWRFKKNNYFYQKEMLKSNDIIRSFKKIRGYNPLIRDIINKLSRISILRTQ
FQQFNSKMESYYLNCIIEENFKEMTRKLQRTENKSQNQFDLIRLNNGTIELNGILTPKAEVLTKSSSSKPQKHAIEKTLN
IDELESVHNTFLTNILSHKLFATNTSEISVGDYSGQPYPTSLVLLLNSVYEFVKVYCNLNDIGYEIFIKMNLNDHEASNG
LLGKFNTNLKEIVSQYKNFKDRLYIFRADLKNDGDEELFLLSKSLR
;
;MELEPTLFGIIEALAPQLLSQSHLQTFVSDVVNLLRSSTKSATQLGPLIDFYKLQSLDSPETTIMWHKIEKFLDALFGIQ
NTDDMVKYLSVFQSLLPSNYRAKIVQKSSGLNMENLANHEHLLSPVRAPSIYTEASFENMDRFSERRSMVSSPNRYVPSS
TYSSVTLRQLSNPYYVNTIPEEDILKYVSYTLLATTSALFPFDHEQIQIPSKIPNFESGLLHLIFEAGLLYQSLGYKVEK
FRMLNISPMKKALIIEISEELQNYTAFVNNLVSSGTVVSLKSLYREIYENIIRLRIYCRFTEHLEELSGDTFLIELNIFK
SHGDLTIRKIATNLFNSMISLYYEYLMNWLTKGLLRATYGEFFIAENTDTNGTDDDFIYHIPIEFNQERVPAFIPKELAY
KIFMIGKSYIFLEKYCKEVQWTNEFSKKYHVLYQSNSYRGISTNFFEIINDQYSEIVNHTNQILNQKFHYRDVVFALKNI
LLMGKSDFMDALIEKANDILATPSDSLPNYKLTRVLQEAVQLSSLRHLMNSPRNSSVINGLDARVLDLGHGSVGWDVFTL
DYILYPPLSLVLNVNRPFGRKEYLRIFNFLWRFKKNNYFYQKEMLKSNDIIRSFKKIRGYNPLIRDIINKLSRISILRTQ
FQQFNSKMESYYLNCIIEENFKEMTRKLQRTENKSQNQFDLIRLNNGTIELNGILTPKAEVLTKSSSSKPQKHAIEKTLN
IDELESVHNTFLTNILSHKLFATNTSEISVGDYSGQPYPTSLVLLLNSVYEFVKVYCNLNDIGYEIFIKMNLNDHEASNG
LLGKFNTNLKEIVSQYKNFKDRLYIFRADLKNDGDEELFLLSKSLR
;
B   ? 
3 'polypeptide(L)' no no 
;MGGEIITLQAGQCGNHVGKFLWSQLAKEHAIGTDGLSQLPDSSTERDDDTKPFFRENSRNKFTPRAIMMDSEPSVIADVE
NTFRGFFDPRNTWVASDGASAGNSWANGYDIGTRNQDDILNKIDKEIDSTDNFEGFQLLHSVAGGTGSGLGSNLLEALCD
RYPKKILTTYSVFPARSSEVVVQSYNTILALRRLIEDSDATVVFDNASLLNISGKVFRNPNIDLQHTNQLISTIISSVTN
SIRFPSYMYSSMSSIYSTLIPSPELHFLSPSFTPFTSDYIHDDIAHKGHSSYDVMLDLLDPSNSLVSTAMNNPTYFNVYN
TIIGNVEPRQISRAMTKLQQRIKFPSWSSSAMHVNIGRRSPYLPLQPNENEVSGMMLSNMSTVVNVFENACNTFDKVFAK
GAFLNNYNVGDLFQSMQNVQDEFAESREVVQSLMEDYVAAEQDSYLDDVLVDDENMVGELEEDLDADGDHKLV
;
;MGGEIITLQAGQCGNHVGKFLWSQLAKEHAIGTDGLSQLPDSSTERDDDTKPFFRENSRNKFTPRAIMMDSEPSVIADVE
NTFRGFFDPRNTWVASDGASAGNSWANGYDIGTRNQDDILNKIDKEIDSTDNFEGFQLLHSVAGGTGSGLGSNLLEALCD
RYPKKILTTYSVFPARSSEVVVQSYNTILALRRLIEDSDATVVFDNASLLNISGKVFRNPNIDLQHTNQLISTIISSVTN
SIRFPSYMYSSMSSIYSTLIPSPELHFLSPSFTPFTSDYIHDDIAHKGHSSYDVMLDLLDPSNSLVSTAMNNPTYFNVYN
TIIGNVEPRQISRAMTKLQQRIKFPSWSSSAMHVNIGRRSPYLPLQPNENEVSGMMLSNMSTVVNVFENACNTFDKVFAK
GAFLNNYNVGDLFQSMQNVQDEFAESREVVQSLMEDYVAAEQDSYLDDVLVDDENMVGELEEDLDADGDHKLV
;
C,D ? 
4 'polypeptide(L)' no no 
;(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
;
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX E,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   ILE n 
1 4   LYS n 
1 5   GLU n 
1 6   VAL n 
1 7   ASP n 
1 8   ASP n 
1 9   ARG n 
1 10  ALA n 
1 11  GLU n 
1 12  LEU n 
1 13  LEU n 
1 14  ARG n 
1 15  TYR n 
1 16  THR n 
1 17  ASN n 
1 18  ASN n 
1 19  ILE n 
1 20  PRO n 
1 21  LEU n 
1 22  LEU n 
1 23  GLY n 
1 24  LYS n 
1 25  LEU n 
1 26  VAL n 
1 27  ASN n 
1 28  HIS n 
1 29  GLN n 
1 30  PRO n 
1 31  LEU n 
1 32  TRP n 
1 33  SER n 
1 34  THR n 
1 35  ASN n 
1 36  PRO n 
1 37  LYS n 
1 38  LEU n 
1 39  LYS n 
1 40  SER n 
1 41  PHE n 
1 42  SER n 
1 43  LEU n 
1 44  GLU n 
1 45  LYS n 
1 46  ILE n 
1 47  SER n 
1 48  ALA n 
1 49  PRO n 
1 50  ASP n 
1 51  GLN n 
1 52  ARG n 
1 53  ARG n 
1 54  VAL n 
1 55  GLN n 
1 56  GLU n 
1 57  ALA n 
1 58  LEU n 
1 59  VAL n 
1 60  VAL n 
1 61  LYS n 
1 62  ASP n 
1 63  LEU n 
1 64  LEU n 
1 65  ASN n 
1 66  VAL n 
1 67  LEU n 
1 68  ILE n 
1 69  GLY n 
1 70  LEU n 
1 71  GLU n 
1 72  GLY n 
1 73  THR n 
1 74  TYR n 
1 75  ILE n 
1 76  ARG n 
1 77  TYR n 
1 78  PHE n 
1 79  ASN n 
1 80  ASP n 
1 81  TYR n 
1 82  GLU n 
1 83  PRO n 
1 84  SER n 
1 85  ASP n 
1 86  PRO n 
1 87  GLU n 
1 88  THR n 
1 89  PRO n 
1 90  ILE n 
1 91  GLU n 
1 92  PHE n 
1 93  LYS n 
1 94  ILE n 
1 95  ALA n 
1 96  LYS n 
1 97  LYS n 
1 98  MET n 
1 99  ASP n 
1 100 PRO n 
1 101 SER n 
1 102 PHE n 
1 103 LYS n 
1 104 THR n 
1 105 PHE n 
1 106 SER n 
1 107 ARG n 
1 108 ARG n 
1 109 ILE n 
1 110 VAL n 
1 111 ARG n 
1 112 TYR n 
1 113 GLY n 
1 114 LYS n 
1 115 GLN n 
1 116 TYR n 
1 117 MET n 
1 118 ILE n 
1 119 LEU n 
1 120 THR n 
1 121 ARG n 
1 122 ALA n 
1 123 TYR n 
1 124 GLU n 
1 125 LYS n 
1 126 TRP n 
1 127 SER n 
1 128 ASP n 
1 129 THR n 
1 130 SER n 
1 131 PHE n 
1 132 GLY n 
1 133 MET n 
1 134 VAL n 
1 135 LEU n 
1 136 GLN n 
1 137 ARG n 
1 138 PHE n 
1 139 ALA n 
1 140 TYR n 
1 141 GLU n 
1 142 ILE n 
1 143 ARG n 
1 144 ARG n 
1 145 PHE n 
1 146 LEU n 
1 147 GLU n 
1 148 ASP n 
1 149 VAL n 
1 150 TYR n 
1 151 LEU n 
1 152 LYS n 
1 153 THR n 
1 154 LEU n 
1 155 VAL n 
1 156 GLU n 
1 157 ARG n 
1 158 LEU n 
1 159 GLU n 
1 160 ARG n 
1 161 ASP n 
1 162 PHE n 
1 163 ASN n 
1 164 LYS n 
1 165 VAL n 
1 166 PRO n 
1 167 ASN n 
1 168 PHE n 
1 169 SER n 
1 170 ILE n 
1 171 ARG n 
1 172 GLU n 
1 173 LEU n 
1 174 GLU n 
1 175 GLN n 
1 176 ILE n 
1 177 ILE n 
1 178 ASN n 
1 179 GLU n 
1 180 THR n 
1 181 GLU n 
1 182 VAL n 
1 183 ASN n 
1 184 LYS n 
1 185 GLN n 
1 186 MET n 
1 187 GLU n 
1 188 LEU n 
1 189 LEU n 
1 190 TYR n 
1 191 ASN n 
1 192 ILE n 
1 193 TYR n 
1 194 GLU n 
1 195 GLU n 
1 196 ILE n 
1 197 PHE n 
1 198 ARG n 
1 199 GLU n 
1 200 ILE n 
1 201 GLU n 
1 202 GLU n 
1 203 ARG n 
1 204 ARG n 
1 205 THR n 
1 206 ASN n 
1 207 GLN n 
1 208 SER n 
1 209 SER n 
1 210 GLN n 
1 211 GLU n 
1 212 ASP n 
1 213 PHE n 
1 214 ASN n 
1 215 ASN n 
1 216 PHE n 
1 217 MET n 
1 218 ASP n 
1 219 SER n 
1 220 MET n 
1 221 LYS n 
1 222 ASN n 
1 223 GLU n 
1 224 SER n 
1 225 SER n 
1 226 LEU n 
1 227 HIS n 
1 228 LEU n 
1 229 ARG n 
1 230 LEU n 
1 231 MET n 
1 232 VAL n 
1 233 ALA n 
1 234 PHE n 
1 235 ASP n 
1 236 THR n 
1 237 THR n 
1 238 VAL n 
1 239 TYR n 
1 240 PRO n 
1 241 VAL n 
1 242 PRO n 
1 243 LYS n 
1 244 GLY n 
1 245 GLY n 
1 246 ALA n 
1 247 ILE n 
1 248 LEU n 
1 249 LYS n 
1 250 ILE n 
1 251 PHE n 
1 252 GLN n 
1 253 GLN n 
1 254 LYS n 
1 255 ILE n 
1 256 LEU n 
1 257 GLU n 
1 258 ASN n 
1 259 LEU n 
1 260 GLY n 
1 261 ASP n 
1 262 ARG n 
1 263 SER n 
1 264 SER n 
1 265 VAL n 
1 266 MET n 
1 267 PHE n 
1 268 LEU n 
1 269 LYS n 
1 270 LYS n 
1 271 LEU n 
1 272 LEU n 
1 273 ASN n 
1 274 ASN n 
1 275 ILE n 
1 276 SER n 
1 277 GLN n 
1 278 ASP n 
1 279 TYR n 
1 280 CYS n 
1 281 THR n 
1 282 MET n 
1 283 LEU n 
1 284 TYR n 
1 285 GLU n 
1 286 TRP n 
1 287 LEU n 
1 288 THR n 
1 289 GLN n 
1 290 GLY n 
1 291 ILE n 
1 292 LEU n 
1 293 ASN n 
1 294 ASP n 
1 295 PRO n 
1 296 TYR n 
1 297 GLN n 
1 298 GLU n 
1 299 PHE n 
1 300 MET n 
1 301 THR n 
1 302 TYR n 
1 303 ASP n 
1 304 ASP n 
1 305 LEU n 
1 306 GLU n 
1 307 GLY n 
1 308 LYS n 
1 309 THR n 
1 310 ASP n 
1 311 ASN n 
1 312 ILE n 
1 313 PHE n 
1 314 ASP n 
1 315 THR n 
1 316 ARG n 
1 317 ASP n 
1 318 ARG n 
1 319 ALA n 
1 320 TRP n 
1 321 ASP n 
1 322 THR n 
1 323 GLN n 
1 324 TYR n 
1 325 PHE n 
1 326 ILE n 
1 327 ARG n 
1 328 LYS n 
1 329 ASP n 
1 330 VAL n 
1 331 LEU n 
1 332 LEU n 
1 333 ARG n 
1 334 ASP n 
1 335 CYS n 
1 336 ASP n 
1 337 SER n 
1 338 GLU n 
1 339 GLU n 
1 340 ASP n 
1 341 LYS n 
1 342 ASN n 
1 343 LEU n 
1 344 LEU n 
1 345 PHE n 
1 346 LYS n 
1 347 MET n 
1 348 LEU n 
1 349 ARG n 
1 350 THR n 
1 351 GLY n 
1 352 ILE n 
1 353 LEU n 
1 354 LEU n 
1 355 LYS n 
1 356 VAL n 
1 357 VAL n 
1 358 ARG n 
1 359 ALA n 
1 360 SER n 
1 361 LEU n 
1 362 GLN n 
1 363 ILE n 
1 364 PRO n 
1 365 THR n 
1 366 ILE n 
1 367 PRO n 
1 368 SER n 
1 369 ASN n 
1 370 SER n 
1 371 SER n 
1 372 ASP n 
1 373 ILE n 
1 374 THR n 
1 375 ILE n 
1 376 GLN n 
1 377 GLU n 
1 378 ILE n 
1 379 ASN n 
1 380 ASP n 
1 381 PHE n 
1 382 ALA n 
1 383 ASP n 
1 384 LEU n 
1 385 MET n 
1 386 GLU n 
1 387 GLY n 
1 388 SER n 
1 389 ASN n 
1 390 LEU n 
1 391 GLU n 
1 392 LEU n 
1 393 TYR n 
1 394 VAL n 
1 395 ASP n 
1 396 LYS n 
1 397 CYS n 
1 398 TYR n 
1 399 SER n 
1 400 ARG n 
1 401 ALA n 
1 402 ASN n 
1 403 GLU n 
1 404 ILE n 
1 405 PHE n 
1 406 LEU n 
1 407 LYS n 
1 408 LEU n 
1 409 PHE n 
1 410 PHE n 
1 411 GLN n 
1 412 GLY n 
1 413 TYR n 
1 414 ASP n 
1 415 LEU n 
1 416 ILE n 
1 417 ASN n 
1 418 VAL n 
1 419 LEU n 
1 420 LYS n 
1 421 HIS n 
1 422 LEU n 
1 423 GLN n 
1 424 GLN n 
1 425 ILE n 
1 426 PHE n 
1 427 LEU n 
1 428 GLY n 
1 429 TYR n 
1 430 GLN n 
1 431 SER n 
1 432 GLY n 
1 433 HIS n 
1 434 ASN n 
1 435 VAL n 
1 436 LEU n 
1 437 LYS n 
1 438 PHE n 
1 439 LEU n 
1 440 THR n 
1 441 LYS n 
1 442 ASN n 
1 443 MET n 
1 444 GLY n 
1 445 GLU n 
1 446 LEU n 
1 447 THR n 
1 448 LYS n 
1 449 HIS n 
1 450 TYR n 
1 451 ARG n 
1 452 ASN n 
1 453 ASP n 
1 454 ASN n 
1 455 ASN n 
1 456 ALA n 
1 457 ASN n 
1 458 TYR n 
1 459 ASP n 
1 460 LYS n 
1 461 LEU n 
1 462 LEU n 
1 463 GLN n 
1 464 ASN n 
1 465 PHE n 
1 466 GLU n 
1 467 LEU n 
1 468 GLU n 
1 469 ARG n 
1 470 GLN n 
1 471 SER n 
1 472 GLU n 
1 473 ASN n 
1 474 PRO n 
1 475 ASN n 
1 476 ASN n 
1 477 LEU n 
1 478 MET n 
1 479 ARG n 
1 480 GLN n 
1 481 LEU n 
1 482 LEU n 
1 483 MET n 
1 484 ILE n 
1 485 GLN n 
1 486 PHE n 
1 487 ASP n 
1 488 THR n 
1 489 GLU n 
1 490 THR n 
1 491 LEU n 
1 492 PRO n 
1 493 GLN n 
1 494 VAL n 
1 495 LEU n 
1 496 SER n 
1 497 HIS n 
1 498 TYR n 
1 499 LEU n 
1 500 GLN n 
1 501 ILE n 
1 502 TYR n 
1 503 PRO n 
1 504 GLU n 
1 505 VAL n 
1 506 PRO n 
1 507 GLU n 
1 508 ASN n 
1 509 ASN n 
1 510 SER n 
1 511 ALA n 
1 512 ASN n 
1 513 ASP n 
1 514 ASP n 
1 515 SER n 
1 516 ASP n 
1 517 PRO n 
1 518 LEU n 
1 519 MET n 
1 520 HIS n 
1 521 ALA n 
1 522 ASN n 
1 523 ASN n 
1 524 PHE n 
1 525 LYS n 
1 526 ASN n 
1 527 MET n 
1 528 ASN n 
1 529 ALA n 
1 530 ILE n 
1 531 LEU n 
1 532 PHE n 
1 533 ASP n 
1 534 GLU n 
1 535 LEU n 
1 536 SER n 
1 537 LYS n 
1 538 GLU n 
1 539 ARG n 
1 540 THR n 
1 541 GLY n 
1 542 ALA n 
1 543 TYR n 
1 544 HIS n 
1 545 GLY n 
1 546 SER n 
1 547 ASN n 
1 548 LEU n 
1 549 GLU n 
1 550 LEU n 
1 551 TYR n 
1 552 THR n 
1 553 PRO n 
1 554 LYS n 
1 555 SER n 
1 556 ALA n 
1 557 ILE n 
1 558 TYR n 
1 559 HIS n 
1 560 LEU n 
1 561 LYS n 
1 562 PHE n 
1 563 ASP n 
1 564 ILE n 
1 565 ASN n 
1 566 ILE n 
1 567 PRO n 
1 568 TYR n 
1 569 PRO n 
1 570 LEU n 
1 571 ASN n 
1 572 ILE n 
1 573 ILE n 
1 574 ILE n 
1 575 SER n 
1 576 ARG n 
1 577 THR n 
1 578 CYS n 
1 579 MET n 
1 580 ILE n 
1 581 LYS n 
1 582 TYR n 
1 583 GLN n 
1 584 ILE n 
1 585 ILE n 
1 586 LEU n 
1 587 ARG n 
1 588 TYR n 
1 589 GLN n 
1 590 LEU n 
1 591 VAL n 
1 592 LEU n 
1 593 GLN n 
1 594 TYR n 
1 595 HIS n 
1 596 SER n 
1 597 ARG n 
1 598 LEU n 
1 599 LEU n 
1 600 ASP n 
1 601 GLU n 
1 602 THR n 
1 603 TRP n 
1 604 MET n 
1 605 ASP n 
1 606 LEU n 
1 607 ASN n 
1 608 LYS n 
1 609 THR n 
1 610 PRO n 
1 611 SER n 
1 612 TRP n 
1 613 LYS n 
1 614 TYR n 
1 615 ARG n 
1 616 GLY n 
1 617 TYR n 
1 618 SER n 
1 619 HIS n 
1 620 THR n 
1 621 VAL n 
1 622 LYS n 
1 623 ARG n 
1 624 ARG n 
1 625 ILE n 
1 626 VAL n 
1 627 ARG n 
1 628 ALA n 
1 629 THR n 
1 630 ARG n 
1 631 VAL n 
1 632 LEU n 
1 633 HIS n 
1 634 ALA n 
1 635 LYS n 
1 636 MET n 
1 637 ASN n 
1 638 HIS n 
1 639 PHE n 
1 640 ILE n 
1 641 LYS n 
1 642 THR n 
1 643 ILE n 
1 644 MET n 
1 645 GLU n 
1 646 TYR n 
1 647 PHE n 
1 648 ASN n 
1 649 GLN n 
1 650 ASN n 
1 651 VAL n 
1 652 ILE n 
1 653 ASP n 
1 654 LYS n 
1 655 GLU n 
1 656 VAL n 
1 657 TYR n 
1 658 SER n 
1 659 LEU n 
1 660 GLU n 
1 661 LYS n 
1 662 CYS n 
1 663 TYR n 
1 664 ARG n 
1 665 ASN n 
1 666 PRO n 
1 667 THR n 
1 668 LEU n 
1 669 ALA n 
1 670 VAL n 
1 671 ALA n 
1 672 ILE n 
1 673 GLN n 
1 674 ASN n 
1 675 GLU n 
1 676 LEU n 
1 677 GLU n 
1 678 GLY n 
1 679 GLY n 
1 680 LEU n 
1 681 THR n 
1 682 ASN n 
1 683 ILE n 
1 684 MET n 
1 685 THR n 
1 686 ASN n 
1 687 ARG n 
1 688 CYS n 
1 689 LEU n 
1 690 SER n 
1 691 ASP n 
1 692 LEU n 
1 693 ILE n 
1 694 PRO n 
1 695 LEU n 
1 696 GLN n 
1 697 LEU n 
1 698 GLN n 
1 699 ILE n 
1 700 PHE n 
1 701 ASP n 
1 702 ILE n 
1 703 VAL n 
1 704 TYR n 
1 705 LYS n 
1 706 PHE n 
1 707 CYS n 
1 708 LYS n 
1 709 PHE n 
1 710 ILE n 
1 711 LYS n 
1 712 SER n 
1 713 MET n 
1 714 ARG n 
1 715 ALA n 
1 716 LYS n 
1 717 LEU n 
1 718 CYS n 
1 719 GLN n 
1 720 LEU n 
1 721 ASP n 
1 722 PRO n 
1 723 VAL n 
1 724 LEU n 
1 725 TYR n 
1 726 GLU n 
1 727 LYS n 
1 728 HIS n 
1 729 LYS n 
1 730 SER n 
1 731 GLY n 
1 732 MET n 
1 733 MET n 
1 734 LYS n 
1 735 THR n 
1 736 LEU n 
1 737 ASN n 
1 738 GLU n 
1 739 GLY n 
1 740 TYR n 
1 741 ARG n 
1 742 THR n 
1 743 ASN n 
1 744 ASN n 
1 745 GLY n 
1 746 GLY n 
1 747 GLN n 
1 748 GLU n 
1 749 ASP n 
1 750 VAL n 
1 751 GLY n 
1 752 TYR n 
1 753 GLN n 
1 754 GLU n 
1 755 ASP n 
1 756 ALA n 
1 757 ALA n 
1 758 LEU n 
1 759 GLU n 
1 760 LEU n 
1 761 ILE n 
1 762 GLN n 
1 763 LYS n 
1 764 LEU n 
1 765 ILE n 
1 766 GLU n 
1 767 TYR n 
1 768 ILE n 
1 769 SER n 
1 770 ASN n 
1 771 ALA n 
1 772 SER n 
1 773 SER n 
1 774 ILE n 
1 775 PHE n 
1 776 ARG n 
1 777 LYS n 
1 778 CYS n 
1 779 LEU n 
1 780 ILE n 
1 781 ASN n 
1 782 PHE n 
1 783 THR n 
1 784 GLN n 
1 785 GLU n 
1 786 LEU n 
1 787 SER n 
1 788 THR n 
1 789 GLU n 
1 790 LYS n 
1 791 PHE n 
1 792 ASP n 
1 793 PHE n 
1 794 TYR n 
1 795 ASP n 
1 796 SER n 
1 797 SER n 
1 798 SER n 
1 799 VAL n 
1 800 ASP n 
1 801 ALA n 
1 802 ALA n 
1 803 GLY n 
1 804 ILE n 
1 805 GLU n 
1 806 ARG n 
1 807 VAL n 
1 808 LEU n 
1 809 TYR n 
1 810 SER n 
1 811 ILE n 
1 812 VAL n 
1 813 PRO n 
1 814 PRO n 
1 815 ARG n 
1 816 SER n 
1 817 ALA n 
1 818 SER n 
1 819 ALA n 
1 820 SER n 
1 821 SER n 
1 822 GLN n 
1 823 ARG n 
2 1   MET n 
2 2   GLU n 
2 3   LEU n 
2 4   GLU n 
2 5   PRO n 
2 6   THR n 
2 7   LEU n 
2 8   PHE n 
2 9   GLY n 
2 10  ILE n 
2 11  ILE n 
2 12  GLU n 
2 13  ALA n 
2 14  LEU n 
2 15  ALA n 
2 16  PRO n 
2 17  GLN n 
2 18  LEU n 
2 19  LEU n 
2 20  SER n 
2 21  GLN n 
2 22  SER n 
2 23  HIS n 
2 24  LEU n 
2 25  GLN n 
2 26  THR n 
2 27  PHE n 
2 28  VAL n 
2 29  SER n 
2 30  ASP n 
2 31  VAL n 
2 32  VAL n 
2 33  ASN n 
2 34  LEU n 
2 35  LEU n 
2 36  ARG n 
2 37  SER n 
2 38  SER n 
2 39  THR n 
2 40  LYS n 
2 41  SER n 
2 42  ALA n 
2 43  THR n 
2 44  GLN n 
2 45  LEU n 
2 46  GLY n 
2 47  PRO n 
2 48  LEU n 
2 49  ILE n 
2 50  ASP n 
2 51  PHE n 
2 52  TYR n 
2 53  LYS n 
2 54  LEU n 
2 55  GLN n 
2 56  SER n 
2 57  LEU n 
2 58  ASP n 
2 59  SER n 
2 60  PRO n 
2 61  GLU n 
2 62  THR n 
2 63  THR n 
2 64  ILE n 
2 65  MET n 
2 66  TRP n 
2 67  HIS n 
2 68  LYS n 
2 69  ILE n 
2 70  GLU n 
2 71  LYS n 
2 72  PHE n 
2 73  LEU n 
2 74  ASP n 
2 75  ALA n 
2 76  LEU n 
2 77  PHE n 
2 78  GLY n 
2 79  ILE n 
2 80  GLN n 
2 81  ASN n 
2 82  THR n 
2 83  ASP n 
2 84  ASP n 
2 85  MET n 
2 86  VAL n 
2 87  LYS n 
2 88  TYR n 
2 89  LEU n 
2 90  SER n 
2 91  VAL n 
2 92  PHE n 
2 93  GLN n 
2 94  SER n 
2 95  LEU n 
2 96  LEU n 
2 97  PRO n 
2 98  SER n 
2 99  ASN n 
2 100 TYR n 
2 101 ARG n 
2 102 ALA n 
2 103 LYS n 
2 104 ILE n 
2 105 VAL n 
2 106 GLN n 
2 107 LYS n 
2 108 SER n 
2 109 SER n 
2 110 GLY n 
2 111 LEU n 
2 112 ASN n 
2 113 MET n 
2 114 GLU n 
2 115 ASN n 
2 116 LEU n 
2 117 ALA n 
2 118 ASN n 
2 119 HIS n 
2 120 GLU n 
2 121 HIS n 
2 122 LEU n 
2 123 LEU n 
2 124 SER n 
2 125 PRO n 
2 126 VAL n 
2 127 ARG n 
2 128 ALA n 
2 129 PRO n 
2 130 SER n 
2 131 ILE n 
2 132 TYR n 
2 133 THR n 
2 134 GLU n 
2 135 ALA n 
2 136 SER n 
2 137 PHE n 
2 138 GLU n 
2 139 ASN n 
2 140 MET n 
2 141 ASP n 
2 142 ARG n 
2 143 PHE n 
2 144 SER n 
2 145 GLU n 
2 146 ARG n 
2 147 ARG n 
2 148 SER n 
2 149 MET n 
2 150 VAL n 
2 151 SER n 
2 152 SER n 
2 153 PRO n 
2 154 ASN n 
2 155 ARG n 
2 156 TYR n 
2 157 VAL n 
2 158 PRO n 
2 159 SER n 
2 160 SER n 
2 161 THR n 
2 162 TYR n 
2 163 SER n 
2 164 SER n 
2 165 VAL n 
2 166 THR n 
2 167 LEU n 
2 168 ARG n 
2 169 GLN n 
2 170 LEU n 
2 171 SER n 
2 172 ASN n 
2 173 PRO n 
2 174 TYR n 
2 175 TYR n 
2 176 VAL n 
2 177 ASN n 
2 178 THR n 
2 179 ILE n 
2 180 PRO n 
2 181 GLU n 
2 182 GLU n 
2 183 ASP n 
2 184 ILE n 
2 185 LEU n 
2 186 LYS n 
2 187 TYR n 
2 188 VAL n 
2 189 SER n 
2 190 TYR n 
2 191 THR n 
2 192 LEU n 
2 193 LEU n 
2 194 ALA n 
2 195 THR n 
2 196 THR n 
2 197 SER n 
2 198 ALA n 
2 199 LEU n 
2 200 PHE n 
2 201 PRO n 
2 202 PHE n 
2 203 ASP n 
2 204 HIS n 
2 205 GLU n 
2 206 GLN n 
2 207 ILE n 
2 208 GLN n 
2 209 ILE n 
2 210 PRO n 
2 211 SER n 
2 212 LYS n 
2 213 ILE n 
2 214 PRO n 
2 215 ASN n 
2 216 PHE n 
2 217 GLU n 
2 218 SER n 
2 219 GLY n 
2 220 LEU n 
2 221 LEU n 
2 222 HIS n 
2 223 LEU n 
2 224 ILE n 
2 225 PHE n 
2 226 GLU n 
2 227 ALA n 
2 228 GLY n 
2 229 LEU n 
2 230 LEU n 
2 231 TYR n 
2 232 GLN n 
2 233 SER n 
2 234 LEU n 
2 235 GLY n 
2 236 TYR n 
2 237 LYS n 
2 238 VAL n 
2 239 GLU n 
2 240 LYS n 
2 241 PHE n 
2 242 ARG n 
2 243 MET n 
2 244 LEU n 
2 245 ASN n 
2 246 ILE n 
2 247 SER n 
2 248 PRO n 
2 249 MET n 
2 250 LYS n 
2 251 LYS n 
2 252 ALA n 
2 253 LEU n 
2 254 ILE n 
2 255 ILE n 
2 256 GLU n 
2 257 ILE n 
2 258 SER n 
2 259 GLU n 
2 260 GLU n 
2 261 LEU n 
2 262 GLN n 
2 263 ASN n 
2 264 TYR n 
2 265 THR n 
2 266 ALA n 
2 267 PHE n 
2 268 VAL n 
2 269 ASN n 
2 270 ASN n 
2 271 LEU n 
2 272 VAL n 
2 273 SER n 
2 274 SER n 
2 275 GLY n 
2 276 THR n 
2 277 VAL n 
2 278 VAL n 
2 279 SER n 
2 280 LEU n 
2 281 LYS n 
2 282 SER n 
2 283 LEU n 
2 284 TYR n 
2 285 ARG n 
2 286 GLU n 
2 287 ILE n 
2 288 TYR n 
2 289 GLU n 
2 290 ASN n 
2 291 ILE n 
2 292 ILE n 
2 293 ARG n 
2 294 LEU n 
2 295 ARG n 
2 296 ILE n 
2 297 TYR n 
2 298 CYS n 
2 299 ARG n 
2 300 PHE n 
2 301 THR n 
2 302 GLU n 
2 303 HIS n 
2 304 LEU n 
2 305 GLU n 
2 306 GLU n 
2 307 LEU n 
2 308 SER n 
2 309 GLY n 
2 310 ASP n 
2 311 THR n 
2 312 PHE n 
2 313 LEU n 
2 314 ILE n 
2 315 GLU n 
2 316 LEU n 
2 317 ASN n 
2 318 ILE n 
2 319 PHE n 
2 320 LYS n 
2 321 SER n 
2 322 HIS n 
2 323 GLY n 
2 324 ASP n 
2 325 LEU n 
2 326 THR n 
2 327 ILE n 
2 328 ARG n 
2 329 LYS n 
2 330 ILE n 
2 331 ALA n 
2 332 THR n 
2 333 ASN n 
2 334 LEU n 
2 335 PHE n 
2 336 ASN n 
2 337 SER n 
2 338 MET n 
2 339 ILE n 
2 340 SER n 
2 341 LEU n 
2 342 TYR n 
2 343 TYR n 
2 344 GLU n 
2 345 TYR n 
2 346 LEU n 
2 347 MET n 
2 348 ASN n 
2 349 TRP n 
2 350 LEU n 
2 351 THR n 
2 352 LYS n 
2 353 GLY n 
2 354 LEU n 
2 355 LEU n 
2 356 ARG n 
2 357 ALA n 
2 358 THR n 
2 359 TYR n 
2 360 GLY n 
2 361 GLU n 
2 362 PHE n 
2 363 PHE n 
2 364 ILE n 
2 365 ALA n 
2 366 GLU n 
2 367 ASN n 
2 368 THR n 
2 369 ASP n 
2 370 THR n 
2 371 ASN n 
2 372 GLY n 
2 373 THR n 
2 374 ASP n 
2 375 ASP n 
2 376 ASP n 
2 377 PHE n 
2 378 ILE n 
2 379 TYR n 
2 380 HIS n 
2 381 ILE n 
2 382 PRO n 
2 383 ILE n 
2 384 GLU n 
2 385 PHE n 
2 386 ASN n 
2 387 GLN n 
2 388 GLU n 
2 389 ARG n 
2 390 VAL n 
2 391 PRO n 
2 392 ALA n 
2 393 PHE n 
2 394 ILE n 
2 395 PRO n 
2 396 LYS n 
2 397 GLU n 
2 398 LEU n 
2 399 ALA n 
2 400 TYR n 
2 401 LYS n 
2 402 ILE n 
2 403 PHE n 
2 404 MET n 
2 405 ILE n 
2 406 GLY n 
2 407 LYS n 
2 408 SER n 
2 409 TYR n 
2 410 ILE n 
2 411 PHE n 
2 412 LEU n 
2 413 GLU n 
2 414 LYS n 
2 415 TYR n 
2 416 CYS n 
2 417 LYS n 
2 418 GLU n 
2 419 VAL n 
2 420 GLN n 
2 421 TRP n 
2 422 THR n 
2 423 ASN n 
2 424 GLU n 
2 425 PHE n 
2 426 SER n 
2 427 LYS n 
2 428 LYS n 
2 429 TYR n 
2 430 HIS n 
2 431 VAL n 
2 432 LEU n 
2 433 TYR n 
2 434 GLN n 
2 435 SER n 
2 436 ASN n 
2 437 SER n 
2 438 TYR n 
2 439 ARG n 
2 440 GLY n 
2 441 ILE n 
2 442 SER n 
2 443 THR n 
2 444 ASN n 
2 445 PHE n 
2 446 PHE n 
2 447 GLU n 
2 448 ILE n 
2 449 ILE n 
2 450 ASN n 
2 451 ASP n 
2 452 GLN n 
2 453 TYR n 
2 454 SER n 
2 455 GLU n 
2 456 ILE n 
2 457 VAL n 
2 458 ASN n 
2 459 HIS n 
2 460 THR n 
2 461 ASN n 
2 462 GLN n 
2 463 ILE n 
2 464 LEU n 
2 465 ASN n 
2 466 GLN n 
2 467 LYS n 
2 468 PHE n 
2 469 HIS n 
2 470 TYR n 
2 471 ARG n 
2 472 ASP n 
2 473 VAL n 
2 474 VAL n 
2 475 PHE n 
2 476 ALA n 
2 477 LEU n 
2 478 LYS n 
2 479 ASN n 
2 480 ILE n 
2 481 LEU n 
2 482 LEU n 
2 483 MET n 
2 484 GLY n 
2 485 LYS n 
2 486 SER n 
2 487 ASP n 
2 488 PHE n 
2 489 MET n 
2 490 ASP n 
2 491 ALA n 
2 492 LEU n 
2 493 ILE n 
2 494 GLU n 
2 495 LYS n 
2 496 ALA n 
2 497 ASN n 
2 498 ASP n 
2 499 ILE n 
2 500 LEU n 
2 501 ALA n 
2 502 THR n 
2 503 PRO n 
2 504 SER n 
2 505 ASP n 
2 506 SER n 
2 507 LEU n 
2 508 PRO n 
2 509 ASN n 
2 510 TYR n 
2 511 LYS n 
2 512 LEU n 
2 513 THR n 
2 514 ARG n 
2 515 VAL n 
2 516 LEU n 
2 517 GLN n 
2 518 GLU n 
2 519 ALA n 
2 520 VAL n 
2 521 GLN n 
2 522 LEU n 
2 523 SER n 
2 524 SER n 
2 525 LEU n 
2 526 ARG n 
2 527 HIS n 
2 528 LEU n 
2 529 MET n 
2 530 ASN n 
2 531 SER n 
2 532 PRO n 
2 533 ARG n 
2 534 ASN n 
2 535 SER n 
2 536 SER n 
2 537 VAL n 
2 538 ILE n 
2 539 ASN n 
2 540 GLY n 
2 541 LEU n 
2 542 ASP n 
2 543 ALA n 
2 544 ARG n 
2 545 VAL n 
2 546 LEU n 
2 547 ASP n 
2 548 LEU n 
2 549 GLY n 
2 550 HIS n 
2 551 GLY n 
2 552 SER n 
2 553 VAL n 
2 554 GLY n 
2 555 TRP n 
2 556 ASP n 
2 557 VAL n 
2 558 PHE n 
2 559 THR n 
2 560 LEU n 
2 561 ASP n 
2 562 TYR n 
2 563 ILE n 
2 564 LEU n 
2 565 TYR n 
2 566 PRO n 
2 567 PRO n 
2 568 LEU n 
2 569 SER n 
2 570 LEU n 
2 571 VAL n 
2 572 LEU n 
2 573 ASN n 
2 574 VAL n 
2 575 ASN n 
2 576 ARG n 
2 577 PRO n 
2 578 PHE n 
2 579 GLY n 
2 580 ARG n 
2 581 LYS n 
2 582 GLU n 
2 583 TYR n 
2 584 LEU n 
2 585 ARG n 
2 586 ILE n 
2 587 PHE n 
2 588 ASN n 
2 589 PHE n 
2 590 LEU n 
2 591 TRP n 
2 592 ARG n 
2 593 PHE n 
2 594 LYS n 
2 595 LYS n 
2 596 ASN n 
2 597 ASN n 
2 598 TYR n 
2 599 PHE n 
2 600 TYR n 
2 601 GLN n 
2 602 LYS n 
2 603 GLU n 
2 604 MET n 
2 605 LEU n 
2 606 LYS n 
2 607 SER n 
2 608 ASN n 
2 609 ASP n 
2 610 ILE n 
2 611 ILE n 
2 612 ARG n 
2 613 SER n 
2 614 PHE n 
2 615 LYS n 
2 616 LYS n 
2 617 ILE n 
2 618 ARG n 
2 619 GLY n 
2 620 TYR n 
2 621 ASN n 
2 622 PRO n 
2 623 LEU n 
2 624 ILE n 
2 625 ARG n 
2 626 ASP n 
2 627 ILE n 
2 628 ILE n 
2 629 ASN n 
2 630 LYS n 
2 631 LEU n 
2 632 SER n 
2 633 ARG n 
2 634 ILE n 
2 635 SER n 
2 636 ILE n 
2 637 LEU n 
2 638 ARG n 
2 639 THR n 
2 640 GLN n 
2 641 PHE n 
2 642 GLN n 
2 643 GLN n 
2 644 PHE n 
2 645 ASN n 
2 646 SER n 
2 647 LYS n 
2 648 MET n 
2 649 GLU n 
2 650 SER n 
2 651 TYR n 
2 652 TYR n 
2 653 LEU n 
2 654 ASN n 
2 655 CYS n 
2 656 ILE n 
2 657 ILE n 
2 658 GLU n 
2 659 GLU n 
2 660 ASN n 
2 661 PHE n 
2 662 LYS n 
2 663 GLU n 
2 664 MET n 
2 665 THR n 
2 666 ARG n 
2 667 LYS n 
2 668 LEU n 
2 669 GLN n 
2 670 ARG n 
2 671 THR n 
2 672 GLU n 
2 673 ASN n 
2 674 LYS n 
2 675 SER n 
2 676 GLN n 
2 677 ASN n 
2 678 GLN n 
2 679 PHE n 
2 680 ASP n 
2 681 LEU n 
2 682 ILE n 
2 683 ARG n 
2 684 LEU n 
2 685 ASN n 
2 686 ASN n 
2 687 GLY n 
2 688 THR n 
2 689 ILE n 
2 690 GLU n 
2 691 LEU n 
2 692 ASN n 
2 693 GLY n 
2 694 ILE n 
2 695 LEU n 
2 696 THR n 
2 697 PRO n 
2 698 LYS n 
2 699 ALA n 
2 700 GLU n 
2 701 VAL n 
2 702 LEU n 
2 703 THR n 
2 704 LYS n 
2 705 SER n 
2 706 SER n 
2 707 SER n 
2 708 SER n 
2 709 LYS n 
2 710 PRO n 
2 711 GLN n 
2 712 LYS n 
2 713 HIS n 
2 714 ALA n 
2 715 ILE n 
2 716 GLU n 
2 717 LYS n 
2 718 THR n 
2 719 LEU n 
2 720 ASN n 
2 721 ILE n 
2 722 ASP n 
2 723 GLU n 
2 724 LEU n 
2 725 GLU n 
2 726 SER n 
2 727 VAL n 
2 728 HIS n 
2 729 ASN n 
2 730 THR n 
2 731 PHE n 
2 732 LEU n 
2 733 THR n 
2 734 ASN n 
2 735 ILE n 
2 736 LEU n 
2 737 SER n 
2 738 HIS n 
2 739 LYS n 
2 740 LEU n 
2 741 PHE n 
2 742 ALA n 
2 743 THR n 
2 744 ASN n 
2 745 THR n 
2 746 SER n 
2 747 GLU n 
2 748 ILE n 
2 749 SER n 
2 750 VAL n 
2 751 GLY n 
2 752 ASP n 
2 753 TYR n 
2 754 SER n 
2 755 GLY n 
2 756 GLN n 
2 757 PRO n 
2 758 TYR n 
2 759 PRO n 
2 760 THR n 
2 761 SER n 
2 762 LEU n 
2 763 VAL n 
2 764 LEU n 
2 765 LEU n 
2 766 LEU n 
2 767 ASN n 
2 768 SER n 
2 769 VAL n 
2 770 TYR n 
2 771 GLU n 
2 772 PHE n 
2 773 VAL n 
2 774 LYS n 
2 775 VAL n 
2 776 TYR n 
2 777 CYS n 
2 778 ASN n 
2 779 LEU n 
2 780 ASN n 
2 781 ASP n 
2 782 ILE n 
2 783 GLY n 
2 784 TYR n 
2 785 GLU n 
2 786 ILE n 
2 787 PHE n 
2 788 ILE n 
2 789 LYS n 
2 790 MET n 
2 791 ASN n 
2 792 LEU n 
2 793 ASN n 
2 794 ASP n 
2 795 HIS n 
2 796 GLU n 
2 797 ALA n 
2 798 SER n 
2 799 ASN n 
2 800 GLY n 
2 801 LEU n 
2 802 LEU n 
2 803 GLY n 
2 804 LYS n 
2 805 PHE n 
2 806 ASN n 
2 807 THR n 
2 808 ASN n 
2 809 LEU n 
2 810 LYS n 
2 811 GLU n 
2 812 ILE n 
2 813 VAL n 
2 814 SER n 
2 815 GLN n 
2 816 TYR n 
2 817 LYS n 
2 818 ASN n 
2 819 PHE n 
2 820 LYS n 
2 821 ASP n 
2 822 ARG n 
2 823 LEU n 
2 824 TYR n 
2 825 ILE n 
2 826 PHE n 
2 827 ARG n 
2 828 ALA n 
2 829 ASP n 
2 830 LEU n 
2 831 LYS n 
2 832 ASN n 
2 833 ASP n 
2 834 GLY n 
2 835 ASP n 
2 836 GLU n 
2 837 GLU n 
2 838 LEU n 
2 839 PHE n 
2 840 LEU n 
2 841 LEU n 
2 842 SER n 
2 843 LYS n 
2 844 SER n 
2 845 LEU n 
2 846 ARG n 
3 1   MET n 
3 2   GLY n 
3 3   GLY n 
3 4   GLU n 
3 5   ILE n 
3 6   ILE n 
3 7   THR n 
3 8   LEU n 
3 9   GLN n 
3 10  ALA n 
3 11  GLY n 
3 12  GLN n 
3 13  CYS n 
3 14  GLY n 
3 15  ASN n 
3 16  HIS n 
3 17  VAL n 
3 18  GLY n 
3 19  LYS n 
3 20  PHE n 
3 21  LEU n 
3 22  TRP n 
3 23  SER n 
3 24  GLN n 
3 25  LEU n 
3 26  ALA n 
3 27  LYS n 
3 28  GLU n 
3 29  HIS n 
3 30  ALA n 
3 31  ILE n 
3 32  GLY n 
3 33  THR n 
3 34  ASP n 
3 35  GLY n 
3 36  LEU n 
3 37  SER n 
3 38  GLN n 
3 39  LEU n 
3 40  PRO n 
3 41  ASP n 
3 42  SER n 
3 43  SER n 
3 44  THR n 
3 45  GLU n 
3 46  ARG n 
3 47  ASP n 
3 48  ASP n 
3 49  ASP n 
3 50  THR n 
3 51  LYS n 
3 52  PRO n 
3 53  PHE n 
3 54  PHE n 
3 55  ARG n 
3 56  GLU n 
3 57  ASN n 
3 58  SER n 
3 59  ARG n 
3 60  ASN n 
3 61  LYS n 
3 62  PHE n 
3 63  THR n 
3 64  PRO n 
3 65  ARG n 
3 66  ALA n 
3 67  ILE n 
3 68  MET n 
3 69  MET n 
3 70  ASP n 
3 71  SER n 
3 72  GLU n 
3 73  PRO n 
3 74  SER n 
3 75  VAL n 
3 76  ILE n 
3 77  ALA n 
3 78  ASP n 
3 79  VAL n 
3 80  GLU n 
3 81  ASN n 
3 82  THR n 
3 83  PHE n 
3 84  ARG n 
3 85  GLY n 
3 86  PHE n 
3 87  PHE n 
3 88  ASP n 
3 89  PRO n 
3 90  ARG n 
3 91  ASN n 
3 92  THR n 
3 93  TRP n 
3 94  VAL n 
3 95  ALA n 
3 96  SER n 
3 97  ASP n 
3 98  GLY n 
3 99  ALA n 
3 100 SER n 
3 101 ALA n 
3 102 GLY n 
3 103 ASN n 
3 104 SER n 
3 105 TRP n 
3 106 ALA n 
3 107 ASN n 
3 108 GLY n 
3 109 TYR n 
3 110 ASP n 
3 111 ILE n 
3 112 GLY n 
3 113 THR n 
3 114 ARG n 
3 115 ASN n 
3 116 GLN n 
3 117 ASP n 
3 118 ASP n 
3 119 ILE n 
3 120 LEU n 
3 121 ASN n 
3 122 LYS n 
3 123 ILE n 
3 124 ASP n 
3 125 LYS n 
3 126 GLU n 
3 127 ILE n 
3 128 ASP n 
3 129 SER n 
3 130 THR n 
3 131 ASP n 
3 132 ASN n 
3 133 PHE n 
3 134 GLU n 
3 135 GLY n 
3 136 PHE n 
3 137 GLN n 
3 138 LEU n 
3 139 LEU n 
3 140 HIS n 
3 141 SER n 
3 142 VAL n 
3 143 ALA n 
3 144 GLY n 
3 145 GLY n 
3 146 THR n 
3 147 GLY n 
3 148 SER n 
3 149 GLY n 
3 150 LEU n 
3 151 GLY n 
3 152 SER n 
3 153 ASN n 
3 154 LEU n 
3 155 LEU n 
3 156 GLU n 
3 157 ALA n 
3 158 LEU n 
3 159 CYS n 
3 160 ASP n 
3 161 ARG n 
3 162 TYR n 
3 163 PRO n 
3 164 LYS n 
3 165 LYS n 
3 166 ILE n 
3 167 LEU n 
3 168 THR n 
3 169 THR n 
3 170 TYR n 
3 171 SER n 
3 172 VAL n 
3 173 PHE n 
3 174 PRO n 
3 175 ALA n 
3 176 ARG n 
3 177 SER n 
3 178 SER n 
3 179 GLU n 
3 180 VAL n 
3 181 VAL n 
3 182 VAL n 
3 183 GLN n 
3 184 SER n 
3 185 TYR n 
3 186 ASN n 
3 187 THR n 
3 188 ILE n 
3 189 LEU n 
3 190 ALA n 
3 191 LEU n 
3 192 ARG n 
3 193 ARG n 
3 194 LEU n 
3 195 ILE n 
3 196 GLU n 
3 197 ASP n 
3 198 SER n 
3 199 ASP n 
3 200 ALA n 
3 201 THR n 
3 202 VAL n 
3 203 VAL n 
3 204 PHE n 
3 205 ASP n 
3 206 ASN n 
3 207 ALA n 
3 208 SER n 
3 209 LEU n 
3 210 LEU n 
3 211 ASN n 
3 212 ILE n 
3 213 SER n 
3 214 GLY n 
3 215 LYS n 
3 216 VAL n 
3 217 PHE n 
3 218 ARG n 
3 219 ASN n 
3 220 PRO n 
3 221 ASN n 
3 222 ILE n 
3 223 ASP n 
3 224 LEU n 
3 225 GLN n 
3 226 HIS n 
3 227 THR n 
3 228 ASN n 
3 229 GLN n 
3 230 LEU n 
3 231 ILE n 
3 232 SER n 
3 233 THR n 
3 234 ILE n 
3 235 ILE n 
3 236 SER n 
3 237 SER n 
3 238 VAL n 
3 239 THR n 
3 240 ASN n 
3 241 SER n 
3 242 ILE n 
3 243 ARG n 
3 244 PHE n 
3 245 PRO n 
3 246 SER n 
3 247 TYR n 
3 248 MET n 
3 249 TYR n 
3 250 SER n 
3 251 SER n 
3 252 MET n 
3 253 SER n 
3 254 SER n 
3 255 ILE n 
3 256 TYR n 
3 257 SER n 
3 258 THR n 
3 259 LEU n 
3 260 ILE n 
3 261 PRO n 
3 262 SER n 
3 263 PRO n 
3 264 GLU n 
3 265 LEU n 
3 266 HIS n 
3 267 PHE n 
3 268 LEU n 
3 269 SER n 
3 270 PRO n 
3 271 SER n 
3 272 PHE n 
3 273 THR n 
3 274 PRO n 
3 275 PHE n 
3 276 THR n 
3 277 SER n 
3 278 ASP n 
3 279 TYR n 
3 280 ILE n 
3 281 HIS n 
3 282 ASP n 
3 283 ASP n 
3 284 ILE n 
3 285 ALA n 
3 286 HIS n 
3 287 LYS n 
3 288 GLY n 
3 289 HIS n 
3 290 SER n 
3 291 SER n 
3 292 TYR n 
3 293 ASP n 
3 294 VAL n 
3 295 MET n 
3 296 LEU n 
3 297 ASP n 
3 298 LEU n 
3 299 LEU n 
3 300 ASP n 
3 301 PRO n 
3 302 SER n 
3 303 ASN n 
3 304 SER n 
3 305 LEU n 
3 306 VAL n 
3 307 SER n 
3 308 THR n 
3 309 ALA n 
3 310 MET n 
3 311 ASN n 
3 312 ASN n 
3 313 PRO n 
3 314 THR n 
3 315 TYR n 
3 316 PHE n 
3 317 ASN n 
3 318 VAL n 
3 319 TYR n 
3 320 ASN n 
3 321 THR n 
3 322 ILE n 
3 323 ILE n 
3 324 GLY n 
3 325 ASN n 
3 326 VAL n 
3 327 GLU n 
3 328 PRO n 
3 329 ARG n 
3 330 GLN n 
3 331 ILE n 
3 332 SER n 
3 333 ARG n 
3 334 ALA n 
3 335 MET n 
3 336 THR n 
3 337 LYS n 
3 338 LEU n 
3 339 GLN n 
3 340 GLN n 
3 341 ARG n 
3 342 ILE n 
3 343 LYS n 
3 344 PHE n 
3 345 PRO n 
3 346 SER n 
3 347 TRP n 
3 348 SER n 
3 349 SER n 
3 350 SER n 
3 351 ALA n 
3 352 MET n 
3 353 HIS n 
3 354 VAL n 
3 355 ASN n 
3 356 ILE n 
3 357 GLY n 
3 358 ARG n 
3 359 ARG n 
3 360 SER n 
3 361 PRO n 
3 362 TYR n 
3 363 LEU n 
3 364 PRO n 
3 365 LEU n 
3 366 GLN n 
3 367 PRO n 
3 368 ASN n 
3 369 GLU n 
3 370 ASN n 
3 371 GLU n 
3 372 VAL n 
3 373 SER n 
3 374 GLY n 
3 375 MET n 
3 376 MET n 
3 377 LEU n 
3 378 SER n 
3 379 ASN n 
3 380 MET n 
3 381 SER n 
3 382 THR n 
3 383 VAL n 
3 384 VAL n 
3 385 ASN n 
3 386 VAL n 
3 387 PHE n 
3 388 GLU n 
3 389 ASN n 
3 390 ALA n 
3 391 CYS n 
3 392 ASN n 
3 393 THR n 
3 394 PHE n 
3 395 ASP n 
3 396 LYS n 
3 397 VAL n 
3 398 PHE n 
3 399 ALA n 
3 400 LYS n 
3 401 GLY n 
3 402 ALA n 
3 403 PHE n 
3 404 LEU n 
3 405 ASN n 
3 406 ASN n 
3 407 TYR n 
3 408 ASN n 
3 409 VAL n 
3 410 GLY n 
3 411 ASP n 
3 412 LEU n 
3 413 PHE n 
3 414 GLN n 
3 415 SER n 
3 416 MET n 
3 417 GLN n 
3 418 ASN n 
3 419 VAL n 
3 420 GLN n 
3 421 ASP n 
3 422 GLU n 
3 423 PHE n 
3 424 ALA n 
3 425 GLU n 
3 426 SER n 
3 427 ARG n 
3 428 GLU n 
3 429 VAL n 
3 430 VAL n 
3 431 GLN n 
3 432 SER n 
3 433 LEU n 
3 434 MET n 
3 435 GLU n 
3 436 ASP n 
3 437 TYR n 
3 438 VAL n 
3 439 ALA n 
3 440 ALA n 
3 441 GLU n 
3 442 GLN n 
3 443 ASP n 
3 444 SER n 
3 445 TYR n 
3 446 LEU n 
3 447 ASP n 
3 448 ASP n 
3 449 VAL n 
3 450 LEU n 
3 451 VAL n 
3 452 ASP n 
3 453 ASP n 
3 454 GLU n 
3 455 ASN n 
3 456 MET n 
3 457 VAL n 
3 458 GLY n 
3 459 GLU n 
3 460 LEU n 
3 461 GLU n 
3 462 GLU n 
3 463 ASP n 
3 464 LEU n 
3 465 ASP n 
3 466 ALA n 
3 467 ASP n 
3 468 GLY n 
3 469 ASP n 
3 470 HIS n 
3 471 LYS n 
3 472 LEU n 
3 473 VAL n 
4 1   UNK n 
4 2   UNK n 
4 3   UNK n 
4 4   UNK n 
4 5   UNK n 
4 6   UNK n 
4 7   UNK n 
4 8   UNK n 
4 9   UNK n 
4 10  UNK n 
4 11  UNK n 
4 12  UNK n 
4 13  UNK n 
4 14  UNK n 
4 15  UNK n 
4 16  UNK n 
4 17  UNK n 
4 18  UNK n 
4 19  UNK n 
4 20  UNK n 
4 21  UNK n 
4 22  UNK n 
4 23  UNK n 
4 24  UNK n 
4 25  UNK n 
4 26  UNK n 
4 27  UNK n 
4 28  UNK n 
4 29  UNK n 
4 30  UNK n 
4 31  UNK n 
4 32  UNK n 
4 33  UNK n 
4 34  UNK n 
4 35  UNK n 
4 36  UNK n 
4 37  UNK n 
4 38  UNK n 
4 39  UNK n 
4 40  UNK n 
4 41  UNK n 
4 42  UNK n 
4 43  UNK n 
4 44  UNK n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 
;BAKER'S YEAST
;
? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? 'FALL ARMYWORM' 'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? ? ? ? ? 
? ? BACULOVIRUS ? ? ? PDV45 ? ? 
2 1 sample ? ? ? 
;BAKER'S YEAST
;
? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? 'FALL ARMYWORM' 'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? ? ? ? ? 
? ? BACULOVIRUS ? ? ? PDV45 ? ? 
3 1 sample ? ? ? 
;BAKER'S YEAST
;
? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? 'FALL ARMYWORM' 'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? ? ? ? ? 
? ? BACULOVIRUS ? ? ? PDV45 ? ? 
4 1 sample ? ? ? 
;BAKER'S YEAST
;
? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? 'FALL ARMYWORM' 'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? ? ? ? ? 
? ? BACULOVIRUS ? ? ? PDV45 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP SPC97_YEAST 1 ? ? P38863 ? 
2 UNP SPC98_YEAST 2 ? ? P53540 ? 
3 UNP TBG_YEAST   3 ? ? P53378 ? 
4 PDB 5FM1        4 ? ? 5FM1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5FM1 A 1 ? 823 ? P38863 1 ? 823 ? 1 823 
2 2 5FM1 B 1 ? 846 ? P53540 1 ? 846 ? 1 846 
3 3 5FM1 C 1 ? 473 ? P53378 1 ? 473 ? 1 473 
4 3 5FM1 D 1 ? 473 ? P53378 1 ? 473 ? 1 473 
5 4 5FM1 E 1 ? 44  ? 5FM1   1 ? 44  ? 1 44  
6 4 5FM1 F 1 ? 44  ? 5FM1   1 ? 44  ? 1 44  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
UNK 'L-peptide linking' . UNKNOWN         ? 'C4 H9 N O2'     103.120 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          5FM1 
_exptl.method            'ELECTRON MICROSCOPY' 
_exptl.crystals_number   ? 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 5FM1 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            8.00 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        16938 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               16938 
_refine_hist.d_res_high                       8.00 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  5FM1 
_struct.title                     
'Structure of gamma-tubulin small complex based on a cryo-EM map, chemical cross-links, and a remotely related structure' 
_struct.pdbx_descriptor           
'SPINDLE POLE BODY COMPONENT SPC97, SPINDLE POLE BODY COMPONENT SPC98, TUBULIN GAMMA CHAIN, SPINDLE POLE BODY COMPONENT 110' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        5FM1 
_struct_keywords.pdbx_keywords   'CELL CYCLE' 
_struct_keywords.text            'CELL CYCLE, MICROTUBULE, NUCLEATION, TUBULIN, FILAMENT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLN A 55  ? ILE A 68  ? GLN A 55  ILE A 68  1 ? 14 
HELX_P HELX_P2  2  ASP A 99  ? SER A 127 ? ASP A 99  SER A 127 1 ? 29 
HELX_P HELX_P3  3  GLY A 132 ? VAL A 165 ? GLY A 132 VAL A 165 1 ? 34 
HELX_P HELX_P4  4  SER A 169 ? THR A 205 ? SER A 169 THR A 205 1 ? 37 
HELX_P HELX_P5  5  LYS A 243 ? LEU A 259 ? LYS A 243 LEU A 259 1 ? 17 
HELX_P HELX_P6  6  ASP A 261 ? SER A 276 ? ASP A 261 SER A 276 1 ? 16 
HELX_P HELX_P7  7  SER A 276 ? GLY A 290 ? SER A 276 GLY A 290 1 ? 15 
HELX_P HELX_P8  8  SER A 337 ? SER A 360 ? SER A 337 SER A 360 1 ? 24 
HELX_P HELX_P9  9  ASP A 372 ? ASP A 383 ? ASP A 372 ASP A 383 1 ? 12 
HELX_P HELX_P10 10 GLU A 386 ? GLY A 412 ? GLU A 386 GLY A 412 1 ? 27 
HELX_P HELX_P11 11 ASP A 414 ? PHE A 426 ? ASP A 414 PHE A 426 1 ? 13 
HELX_P HELX_P12 12 GLY A 432 ? LYS A 448 ? GLY A 432 LYS A 448 1 ? 17 
HELX_P HELX_P13 13 ASP A 453 ? ARG A 469 ? ASP A 453 ARG A 469 1 ? 17 
HELX_P HELX_P14 14 ASN A 476 ? LEU A 481 ? ASN A 476 LEU A 481 1 ? 6  
HELX_P HELX_P15 15 SER A 555 ? HIS A 559 ? SER A 555 HIS A 559 1 ? 5  
HELX_P HELX_P16 16 SER A 575 ? LYS A 608 ? SER A 575 LYS A 608 1 ? 34 
HELX_P HELX_P17 17 ARG A 623 ? VAL A 651 ? ARG A 623 VAL A 651 1 ? 29 
HELX_P HELX_P18 18 VAL A 651 ? ASN A 665 ? VAL A 651 ASN A 665 1 ? 15 
HELX_P HELX_P19 19 LEU A 668 ? SER A 690 ? LEU A 668 SER A 690 1 ? 23 
HELX_P HELX_P20 20 LEU A 692 ? SER A 712 ? LEU A 692 SER A 712 1 ? 21 
HELX_P HELX_P21 21 GLU A 754 ? GLU A 785 ? GLU A 754 GLU A 785 1 ? 32 
HELX_P HELX_P22 22 SER A 787 ? VAL A 799 ? SER A 787 VAL A 799 1 ? 13 
HELX_P HELX_P23 23 PRO B 180 ? LEU B 193 ? PRO B 180 LEU B 193 1 ? 14 
HELX_P HELX_P24 24 PRO B 214 ? ARG B 242 ? PRO B 214 ARG B 242 1 ? 29 
HELX_P HELX_P25 25 SER B 247 ? SER B 274 ? SER B 247 SER B 274 1 ? 28 
HELX_P HELX_P26 26 SER B 279 ? ILE B 287 ? SER B 279 ILE B 287 1 ? 9  
HELX_P HELX_P27 27 ILE B 287 ? GLU B 305 ? ILE B 287 GLU B 305 1 ? 19 
HELX_P HELX_P28 28 ASP B 310 ? HIS B 322 ? ASP B 310 HIS B 322 1 ? 13 
HELX_P HELX_P29 29 ASP B 324 ? GLY B 353 ? ASP B 324 GLY B 353 1 ? 30 
HELX_P HELX_P30 30 PRO B 395 ? CYS B 416 ? PRO B 395 CYS B 416 1 ? 22 
HELX_P HELX_P31 31 THR B 422 ? SER B 437 ? THR B 422 SER B 437 1 ? 16 
HELX_P HELX_P32 32 ILE B 441 ? GLN B 466 ? ILE B 441 GLN B 466 1 ? 26 
HELX_P HELX_P33 33 HIS B 469 ? LEU B 482 ? HIS B 469 LEU B 482 1 ? 14 
HELX_P HELX_P34 34 LYS B 485 ? THR B 502 ? LYS B 485 THR B 502 1 ? 18 
HELX_P HELX_P35 35 ASP B 505 ? SER B 523 ? ASP B 505 SER B 523 1 ? 19 
HELX_P HELX_P36 36 PRO B 567 ? VAL B 571 ? PRO B 567 VAL B 571 5 ? 5  
HELX_P HELX_P37 37 PRO B 577 ? ASP B 609 ? PRO B 577 ASP B 609 1 ? 33 
HELX_P HELX_P38 38 ASN B 629 ? ILE B 656 ? ASN B 629 ILE B 656 1 ? 28 
HELX_P HELX_P39 39 ILE B 656 ? THR B 671 ? ILE B 656 THR B 671 1 ? 16 
HELX_P HELX_P40 40 ASN B 720 ? THR B 743 ? ASN B 720 THR B 743 1 ? 24 
HELX_P HELX_P41 41 GLN B 756 ? LEU B 779 ? GLN B 756 LEU B 779 1 ? 24 
HELX_P HELX_P42 42 SER B 798 ? ASP B 833 ? SER B 798 ASP B 833 1 ? 36 
HELX_P HELX_P43 43 ASP B 835 ? ARG B 846 ? ASP B 835 ARG B 846 1 ? 12 
HELX_P HELX_P44 44 GLY C 11  ? HIS C 29  ? GLY C 11  HIS C 29  1 ? 19 
HELX_P HELX_P45 45 SER C 71  ? ASN C 81  ? SER C 71  ASN C 81  1 ? 11 
HELX_P HELX_P46 46 SER C 104 ? ASN C 115 ? SER C 104 ASN C 115 1 ? 12 
HELX_P HELX_P47 47 ASN C 115 ? THR C 130 ? ASN C 115 THR C 130 1 ? 16 
HELX_P HELX_P48 48 GLY C 145 ? TYR C 162 ? GLY C 145 TYR C 162 1 ? 18 
HELX_P HELX_P49 49 VAL C 182 ? SER C 198 ? VAL C 182 SER C 198 1 ? 17 
HELX_P HELX_P50 50 ASN C 206 ? ARG C 218 ? ASN C 206 ARG C 218 1 ? 13 
HELX_P HELX_P51 51 ILE C 222 ? THR C 239 ? ILE C 222 THR C 239 1 ? 18 
HELX_P HELX_P52 52 THR C 239 ? PHE C 244 ? THR C 239 PHE C 244 1 ? 6  
HELX_P HELX_P53 53 SER C 251 ? ILE C 260 ? SER C 251 ILE C 260 1 ? 10 
HELX_P HELX_P54 54 GLY C 288 ? LEU C 298 ? GLY C 288 LEU C 298 1 ? 11 
HELX_P HELX_P55 55 PRO C 328 ? LYS C 343 ? PRO C 328 LYS C 343 1 ? 16 
HELX_P HELX_P56 56 VAL C 383 ? GLY C 401 ? VAL C 383 GLY C 401 1 ? 19 
HELX_P HELX_P57 57 LEU C 404 ? VAL C 409 ? LEU C 404 VAL C 409 1 ? 6  
HELX_P HELX_P58 58 GLY C 410 ? SER C 415 ? GLY C 410 SER C 415 1 ? 6  
HELX_P HELX_P59 59 GLN C 417 ? TYR C 437 ? GLN C 417 TYR C 437 1 ? 21 
HELX_P HELX_P60 60 ALA D 10  ? HIS D 29  ? ALA D 10  HIS D 29  1 ? 20 
HELX_P HELX_P61 61 SER D 71  ? ASN D 81  ? SER D 71  ASN D 81  1 ? 11 
HELX_P HELX_P62 62 THR D 82  ? PHE D 87  ? THR D 82  PHE D 87  5 ? 6  
HELX_P HELX_P63 63 ASP D 88  ? ARG D 90  ? ASP D 88  ARG D 90  5 ? 3  
HELX_P HELX_P64 64 SER D 104 ? ASN D 115 ? SER D 104 ASN D 115 1 ? 12 
HELX_P HELX_P65 65 ASN D 115 ? THR D 130 ? ASN D 115 THR D 130 1 ? 16 
HELX_P HELX_P66 66 GLY D 145 ? TYR D 162 ? GLY D 145 TYR D 162 1 ? 18 
HELX_P HELX_P67 67 VAL D 182 ? SER D 198 ? VAL D 182 SER D 198 1 ? 17 
HELX_P HELX_P68 68 ASN D 206 ? PHE D 217 ? ASN D 206 PHE D 217 1 ? 12 
HELX_P HELX_P69 69 ASP D 223 ? THR D 239 ? ASP D 223 THR D 239 1 ? 17 
HELX_P HELX_P70 70 THR D 239 ? PHE D 244 ? THR D 239 PHE D 244 1 ? 6  
HELX_P HELX_P71 71 SER D 251 ? ILE D 260 ? SER D 251 ILE D 260 1 ? 10 
HELX_P HELX_P72 72 GLY D 288 ? LEU D 298 ? GLY D 288 LEU D 298 1 ? 11 
HELX_P HELX_P73 73 PRO D 328 ? LYS D 343 ? PRO D 328 LYS D 343 1 ? 16 
HELX_P HELX_P74 74 VAL D 383 ? GLY D 401 ? VAL D 383 GLY D 401 1 ? 19 
HELX_P HELX_P75 75 LEU D 404 ? GLY D 410 ? LEU D 404 GLY D 410 1 ? 7  
HELX_P HELX_P76 76 LEU D 412 ? MET D 416 ? LEU D 412 MET D 416 5 ? 5  
HELX_P HELX_P77 77 GLN D 417 ? TYR D 437 ? GLN D 417 TYR D 437 1 ? 21 
HELX_P HELX_P78 78 UNK E 1   ? UNK E 44  ? UNK E 1   UNK E 44  1 ? 44 
HELX_P HELX_P79 79 UNK F 1   ? UNK F 44  ? UNK F 1   UNK F 44  1 ? 44 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  TYR 568 A . ? TYR 568 A PRO 569 A ? PRO 569 A 1  2.02   
2  PRO 566 B . ? PRO 566 B PRO 567 B ? PRO 567 B 1  7.09   
3  THR 273 C . ? THR 273 C PRO 274 C ? PRO 274 C 1  1.11   
4  THR 273 D . ? THR 273 D PRO 274 D ? PRO 274 D 1  -20.94 
5  TYR 568 A . ? TYR 568 A PRO 569 A ? PRO 569 A 2  -11.45 
6  PRO 566 B . ? PRO 566 B PRO 567 B ? PRO 567 B 2  -1.62  
7  THR 273 C . ? THR 273 C PRO 274 C ? PRO 274 C 2  -8.74  
8  THR 273 D . ? THR 273 D PRO 274 D ? PRO 274 D 2  -11.92 
9  TYR 568 A . ? TYR 568 A PRO 569 A ? PRO 569 A 3  -6.58  
10 PRO 566 B . ? PRO 566 B PRO 567 B ? PRO 567 B 3  12.77  
11 THR 273 C . ? THR 273 C PRO 274 C ? PRO 274 C 3  -1.46  
12 THR 273 D . ? THR 273 D PRO 274 D ? PRO 274 D 3  -6.33  
13 TYR 568 A . ? TYR 568 A PRO 569 A ? PRO 569 A 4  -13.74 
14 PRO 566 B . ? PRO 566 B PRO 567 B ? PRO 567 B 4  15.32  
15 THR 273 C . ? THR 273 C PRO 274 C ? PRO 274 C 4  -5.61  
16 THR 273 D . ? THR 273 D PRO 274 D ? PRO 274 D 4  -8.88  
17 TYR 568 A . ? TYR 568 A PRO 569 A ? PRO 569 A 5  7.39   
18 PRO 566 B . ? PRO 566 B PRO 567 B ? PRO 567 B 5  0.62   
19 THR 273 C . ? THR 273 C PRO 274 C ? PRO 274 C 5  -15.72 
20 THR 273 D . ? THR 273 D PRO 274 D ? PRO 274 D 5  -9.84  
21 TYR 568 A . ? TYR 568 A PRO 569 A ? PRO 569 A 6  1.37   
22 PRO 566 B . ? PRO 566 B PRO 567 B ? PRO 567 B 6  9.25   
23 THR 273 C . ? THR 273 C PRO 274 C ? PRO 274 C 6  -1.81  
24 THR 273 D . ? THR 273 D PRO 274 D ? PRO 274 D 6  -4.76  
25 TYR 568 A . ? TYR 568 A PRO 569 A ? PRO 569 A 7  1.45   
26 PRO 566 B . ? PRO 566 B PRO 567 B ? PRO 567 B 7  -0.14  
27 THR 273 C . ? THR 273 C PRO 274 C ? PRO 274 C 7  -27.24 
28 THR 273 D . ? THR 273 D PRO 274 D ? PRO 274 D 7  -11.32 
29 TYR 568 A . ? TYR 568 A PRO 569 A ? PRO 569 A 8  -8.05  
30 PRO 566 B . ? PRO 566 B PRO 567 B ? PRO 567 B 8  11.95  
31 THR 273 C . ? THR 273 C PRO 274 C ? PRO 274 C 8  -12.31 
32 THR 273 D . ? THR 273 D PRO 274 D ? PRO 274 D 8  -4.20  
33 TYR 568 A . ? TYR 568 A PRO 569 A ? PRO 569 A 9  -4.18  
34 THR 273 C . ? THR 273 C PRO 274 C ? PRO 274 C 9  -15.57 
35 THR 273 D . ? THR 273 D PRO 274 D ? PRO 274 D 9  -7.35  
36 TYR 568 A . ? TYR 568 A PRO 569 A ? PRO 569 A 10 -4.07  
37 PRO 566 B . ? PRO 566 B PRO 567 B ? PRO 567 B 10 6.76   
38 THR 273 C . ? THR 273 C PRO 274 C ? PRO 274 C 10 -15.47 
39 THR 273 D . ? THR 273 D PRO 274 D ? PRO 274 D 10 -13.86 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2  ? 
AB ? 2  ? 
AC ? 2  ? 
BA ? 2  ? 
BB ? 2  ? 
CA ? 10 ? 
CB ? 2  ? 
DA ? 10 ? 
DB ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2  ? anti-parallel 
AB 1 2  ? anti-parallel 
AC 1 2  ? anti-parallel 
BA 1 2  ? anti-parallel 
BB 1 2  ? anti-parallel 
CA 1 2  ? parallel      
CA 2 3  ? parallel      
CA 3 4  ? parallel      
CA 4 5  ? parallel      
CA 5 6  ? parallel      
CA 6 7  ? parallel      
CA 7 8  ? anti-parallel 
CA 8 9  ? anti-parallel 
CA 9 10 ? parallel      
CB 1 2  ? anti-parallel 
DA 1 2  ? parallel      
DA 2 3  ? parallel      
DA 3 4  ? parallel      
DA 4 5  ? parallel      
DA 5 6  ? parallel      
DA 6 7  ? parallel      
DA 7 8  ? anti-parallel 
DA 8 9  ? anti-parallel 
DA 9 10 ? parallel      
DB 1 2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  ARG A 76  ? TYR A 77  ? ARG A 76  TYR A 77  
AA 2  PHE A 92  ? LYS A 93  ? PHE A 92  LYS A 93  
AB 1  THR A 301 ? ASP A 303 ? THR A 301 ASP A 303 
AB 2  TYR A 324 ? ILE A 326 ? TYR A 324 ILE A 326 
AC 1  LEU A 482 ? PHE A 486 ? LEU A 482 PHE A 486 
AC 2  LEU A 560 ? ILE A 564 ? LEU A 560 ILE A 564 
BA 1  ILE B 364 ? GLU B 366 ? ILE B 364 GLU B 366 
BA 2  ILE B 383 ? PHE B 385 ? ILE B 383 PHE B 385 
BB 1  LEU B 541 ? VAL B 545 ? LEU B 541 VAL B 545 
BB 2  PHE B 558 ? TYR B 562 ? PHE B 558 TYR B 562 
CA 1  THR C 92  ? VAL C 94  ? THR C 92  VAL C 94  
CA 2  ALA C 66  ? ASP C 70  ? ALA C 66  ASP C 70  
CA 3  GLU C 4   ? ALA C 10  ? GLU C 4   ALA C 10  
CA 4  PHE C 133 ? SER C 141 ? PHE C 133 SER C 141 
CA 5  ILE C 166 ? PHE C 173 ? ILE C 166 PHE C 173 
CA 6  ALA C 200 ? ASP C 205 ? ALA C 200 ASP C 205 
CA 7  PHE C 267 ? THR C 273 ? PHE C 267 THR C 273 
CA 8  SER C 373 ? MET C 380 ? SER C 373 MET C 380 
CA 9  PHE C 316 ? GLY C 324 ? PHE C 316 GLY C 324 
CA 10 ASN C 355 ? SER C 360 ? ASN C 355 SER C 360 
CB 1  PHE C 54  ? ARG C 55  ? PHE C 54  ARG C 55  
CB 2  THR C 63  ? PRO C 64  ? THR C 63  PRO C 64  
DA 1  THR D 92  ? VAL D 94  ? THR D 92  VAL D 94  
DA 2  ALA D 66  ? ASP D 70  ? ALA D 66  ASP D 70  
DA 3  GLU D 4   ? GLN D 9   ? GLU D 4   GLN D 9   
DA 4  PHE D 133 ? SER D 141 ? PHE D 133 SER D 141 
DA 5  ILE D 166 ? PHE D 173 ? ILE D 166 PHE D 173 
DA 6  ALA D 200 ? ASP D 205 ? ALA D 200 ASP D 205 
DA 7  PHE D 267 ? THR D 273 ? PHE D 267 THR D 273 
DA 8  SER D 373 ? MET D 380 ? SER D 373 MET D 380 
DA 9  PHE D 316 ? ASN D 325 ? PHE D 316 ASN D 325 
DA 10 ASN D 355 ? PRO D 361 ? ASN D 355 PRO D 361 
DB 1  PHE D 54  ? ARG D 55  ? PHE D 54  ARG D 55  
DB 2  THR D 63  ? PRO D 64  ? THR D 63  PRO D 64  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2  N ARG A 76  ? N ARG A 76  O LYS A 93  ? O LYS A 93  
AB 1 2  N TYR A 302 ? N TYR A 302 O PHE A 325 ? O PHE A 325 
AC 1 2  N GLN A 485 ? N GLN A 485 O LYS A 561 ? O LYS A 561 
BA 1 2  N ALA B 365 ? N ALA B 365 O GLU B 384 ? O GLU B 384 
BB 1 2  N ARG B 544 ? N ARG B 544 O THR B 559 ? O THR B 559 
CA 1 2  N TRP C 93  ? N TRP C 93  O MET C 68  ? O MET C 68  
CA 2 3  N ILE C 67  ? N ILE C 67  O THR C 7   ? O THR C 7   
CA 3 4  O GLU C 4   ? O GLU C 4   N GLU C 134 ? N GLU C 134 
CA 4 5  N PHE C 136 ? N PHE C 136 O ILE C 166 ? O ILE C 166 
CA 5 6  N THR C 169 ? N THR C 169 O ALA C 200 ? O ALA C 200 
CA 6 7  N VAL C 203 ? N VAL C 203 O LEU C 268 ? O LEU C 268 
CA 7 8  N THR C 273 ? N THR C 273 O GLY C 374 ? O GLY C 374 
CA 8 9  O ASN C 379 ? O ASN C 379 N ASN C 317 ? N ASN C 317 
CA 9 10 N THR C 321 ? N THR C 321 O ILE C 356 ? O ILE C 356 
CB 1 2  N ARG C 55  ? N ARG C 55  O THR C 63  ? O THR C 63  
DA 1 2  N TRP D 93  ? N TRP D 93  O MET D 68  ? O MET D 68  
DA 2 3  N ILE D 67  ? N ILE D 67  O THR D 7   ? O THR D 7   
DA 3 4  O GLU D 4   ? O GLU D 4   N GLU D 134 ? N GLU D 134 
DA 4 5  N PHE D 136 ? N PHE D 136 O ILE D 166 ? O ILE D 166 
DA 5 6  N THR D 169 ? N THR D 169 O ALA D 200 ? O ALA D 200 
DA 6 7  N VAL D 203 ? N VAL D 203 O LEU D 268 ? O LEU D 268 
DA 7 8  N THR D 273 ? N THR D 273 O GLY D 374 ? O GLY D 374 
DA 8 9  O ASN D 379 ? O ASN D 379 N ASN D 317 ? N ASN D 317 
DA 9 10 N THR D 321 ? N THR D 321 O ILE D 356 ? O ILE D 356 
DB 1 2  N ARG D 55  ? N ARG D 55  O THR D 63  ? O THR D 63  
# 
_database_PDB_matrix.entry_id          5FM1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5FM1 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      N N   . GLN A 1 55  ? 28.867  18.746  -66.611 1.00 0.00 ? 55  GLN A N   1  
ATOM 2      C CA  . GLN A 1 55  ? 29.881  19.784  -66.462 1.00 0.00 ? 55  GLN A CA  1  
ATOM 3      C C   . GLN A 1 55  ? 29.614  20.537  -65.138 1.00 0.00 ? 55  GLN A C   1  
ATOM 4      O O   . GLN A 1 55  ? 30.403  20.355  -64.185 1.00 0.00 ? 55  GLN A O   1  
ATOM 5      C CB  . GLN A 1 55  ? 29.873  20.856  -67.590 1.00 0.00 ? 55  GLN A CB  1  
ATOM 6      C CG  . GLN A 1 55  ? 31.077  21.787  -67.432 1.00 0.00 ? 55  GLN A CG  1  
ATOM 7      C CD  . GLN A 1 55  ? 31.348  22.546  -68.808 1.00 0.00 ? 55  GLN A CD  1  
ATOM 8      O OE1 . GLN A 1 55  ? 31.664  21.876  -69.803 1.00 0.00 ? 55  GLN A OE1 1  
ATOM 9      N NE2 . GLN A 1 55  ? 31.049  23.900  -68.790 1.00 0.00 ? 55  GLN A NE2 1  
ATOM 10     N N   . GLU A 1 56  ? 28.497  21.256  -65.114 1.00 0.00 ? 56  GLU A N   1  
ATOM 11     C CA  . GLU A 1 56  ? 28.115  22.119  -64.002 1.00 0.00 ? 56  GLU A CA  1  
ATOM 12     C C   . GLU A 1 56  ? 27.920  21.333  -62.687 1.00 0.00 ? 56  GLU A C   1  
ATOM 13     O O   . GLU A 1 56  ? 28.517  21.768  -61.652 1.00 0.00 ? 56  GLU A O   1  
ATOM 14     C CB  . GLU A 1 56  ? 26.820  22.938  -64.323 1.00 0.00 ? 56  GLU A CB  1  
ATOM 15     C CG  . GLU A 1 56  ? 26.286  23.905  -63.269 1.00 0.00 ? 56  GLU A CG  1  
ATOM 16     C CD  . GLU A 1 56  ? 27.143  25.130  -63.044 1.00 0.00 ? 56  GLU A CD  1  
ATOM 17     O OE1 . GLU A 1 56  ? 27.127  25.984  -64.017 1.00 0.00 ? 56  GLU A OE1 1  
ATOM 18     O OE2 . GLU A 1 56  ? 27.809  25.263  -61.985 1.00 0.00 ? 56  GLU A OE2 1  
ATOM 19     N N   . ALA A 1 57  ? 27.203  20.210  -62.674 1.00 0.00 ? 57  ALA A N   1  
ATOM 20     C CA  . ALA A 1 57  ? 26.971  19.380  -61.480 1.00 0.00 ? 57  ALA A CA  1  
ATOM 21     C C   . ALA A 1 57  ? 28.202  18.763  -60.950 1.00 0.00 ? 57  ALA A C   1  
ATOM 22     O O   . ALA A 1 57  ? 28.462  18.794  -59.742 1.00 0.00 ? 57  ALA A O   1  
ATOM 23     C CB  . ALA A 1 57  ? 26.011  18.244  -61.931 1.00 0.00 ? 57  ALA A CB  1  
ATOM 24     N N   . LEU A 1 58  ? 29.085  18.248  -61.913 1.00 0.00 ? 58  LEU A N   1  
ATOM 25     C CA  . LEU A 1 58  ? 30.371  17.670  -61.530 1.00 0.00 ? 58  LEU A CA  1  
ATOM 26     C C   . LEU A 1 58  ? 31.365  18.645  -60.870 1.00 0.00 ? 58  LEU A C   1  
ATOM 27     O O   . LEU A 1 58  ? 31.921  18.329  -59.815 1.00 0.00 ? 58  LEU A O   1  
ATOM 28     C CB  . LEU A 1 58  ? 31.189  17.056  -62.699 1.00 0.00 ? 58  LEU A CB  1  
ATOM 29     C CG  . LEU A 1 58  ? 30.412  16.016  -63.546 1.00 0.00 ? 58  LEU A CG  1  
ATOM 30     C CD1 . LEU A 1 58  ? 31.403  15.329  -64.475 1.00 0.00 ? 58  LEU A CD1 1  
ATOM 31     C CD2 . LEU A 1 58  ? 29.732  14.903  -62.769 1.00 0.00 ? 58  LEU A CD2 1  
ATOM 32     N N   . VAL A 1 59  ? 31.485  19.862  -61.447 1.00 0.00 ? 59  VAL A N   1  
ATOM 33     C CA  . VAL A 1 59  ? 32.336  20.950  -61.000 1.00 0.00 ? 59  VAL A CA  1  
ATOM 34     C C   . VAL A 1 59  ? 31.890  21.413  -59.620 1.00 0.00 ? 59  VAL A C   1  
ATOM 35     O O   . VAL A 1 59  ? 32.784  21.514  -58.756 1.00 0.00 ? 59  VAL A O   1  
ATOM 36     C CB  . VAL A 1 59  ? 32.375  22.160  -61.949 1.00 0.00 ? 59  VAL A CB  1  
ATOM 37     C CG1 . VAL A 1 59  ? 33.032  23.388  -61.300 1.00 0.00 ? 59  VAL A CG1 1  
ATOM 38     C CG2 . VAL A 1 59  ? 33.177  21.840  -63.283 1.00 0.00 ? 59  VAL A CG2 1  
ATOM 39     N N   . VAL A 1 60  ? 30.539  21.541  -59.423 1.00 0.00 ? 60  VAL A N   1  
ATOM 40     C CA  . VAL A 1 60  ? 30.039  21.919  -58.109 1.00 0.00 ? 60  VAL A CA  1  
ATOM 41     C C   . VAL A 1 60  ? 30.302  20.869  -57.059 1.00 0.00 ? 60  VAL A C   1  
ATOM 42     O O   . VAL A 1 60  ? 30.770  21.219  -55.965 1.00 0.00 ? 60  VAL A O   1  
ATOM 43     C CB  . VAL A 1 60  ? 28.520  22.331  -58.132 1.00 0.00 ? 60  VAL A CB  1  
ATOM 44     C CG1 . VAL A 1 60  ? 28.027  22.738  -56.744 1.00 0.00 ? 60  VAL A CG1 1  
ATOM 45     C CG2 . VAL A 1 60  ? 28.379  23.570  -59.033 1.00 0.00 ? 60  VAL A CG2 1  
ATOM 46     N N   . LYS A 1 61  ? 30.192  19.579  -57.469 1.00 0.00 ? 61  LYS A N   1  
ATOM 47     C CA  . LYS A 1 61  ? 30.536  18.546  -56.598 1.00 0.00 ? 61  LYS A CA  1  
ATOM 48     C C   . LYS A 1 61  ? 31.951  18.449  -56.128 1.00 0.00 ? 61  LYS A C   1  
ATOM 49     O O   . LYS A 1 61  ? 32.073  18.126  -54.972 1.00 0.00 ? 61  LYS A O   1  
ATOM 50     C CB  . LYS A 1 61  ? 30.201  17.188  -57.222 1.00 0.00 ? 61  LYS A CB  1  
ATOM 51     C CG  . LYS A 1 61  ? 30.053  15.932  -56.423 1.00 0.00 ? 61  LYS A CG  1  
ATOM 52     C CD  . LYS A 1 61  ? 29.325  14.725  -57.137 1.00 0.00 ? 61  LYS A CD  1  
ATOM 53     C CE  . LYS A 1 61  ? 29.442  13.489  -56.279 1.00 0.00 ? 61  LYS A CE  1  
ATOM 54     N NZ  . LYS A 1 61  ? 28.552  12.403  -56.825 1.00 0.00 ? 61  LYS A NZ  1  
ATOM 55     N N   . ASP A 1 62  ? 32.953  18.693  -57.022 1.00 0.00 ? 62  ASP A N   1  
ATOM 56     C CA  . ASP A 1 62  ? 34.372  18.604  -56.795 1.00 0.00 ? 62  ASP A CA  1  
ATOM 57     C C   . ASP A 1 62  ? 34.685  19.606  -55.812 1.00 0.00 ? 62  ASP A C   1  
ATOM 58     O O   . ASP A 1 62  ? 35.473  19.403  -54.881 1.00 0.00 ? 62  ASP A O   1  
ATOM 59     C CB  . ASP A 1 62  ? 35.314  18.923  -58.000 1.00 0.00 ? 62  ASP A CB  1  
ATOM 60     C CG  . ASP A 1 62  ? 35.105  17.887  -59.121 1.00 0.00 ? 62  ASP A CG  1  
ATOM 61     O OD1 . ASP A 1 62  ? 35.541  16.722  -58.977 1.00 0.00 ? 62  ASP A OD1 1  
ATOM 62     O OD2 . ASP A 1 62  ? 34.560  18.162  -60.194 1.00 0.00 ? 62  ASP A OD2 1  
ATOM 63     N N   . LEU A 1 63  ? 34.024  20.758  -55.961 1.00 0.00 ? 63  LEU A N   1  
ATOM 64     C CA  . LEU A 1 63  ? 34.185  21.846  -55.090 1.00 0.00 ? 63  LEU A CA  1  
ATOM 65     C C   . LEU A 1 63  ? 33.723  21.595  -53.647 1.00 0.00 ? 63  LEU A C   1  
ATOM 66     O O   . LEU A 1 63  ? 34.406  21.899  -52.683 1.00 0.00 ? 63  LEU A O   1  
ATOM 67     C CB  . LEU A 1 63  ? 33.472  23.100  -55.603 1.00 0.00 ? 63  LEU A CB  1  
ATOM 68     C CG  . LEU A 1 63  ? 33.617  24.432  -54.880 1.00 0.00 ? 63  LEU A CG  1  
ATOM 69     C CD1 . LEU A 1 63  ? 35.067  25.009  -54.854 1.00 0.00 ? 63  LEU A CD1 1  
ATOM 70     C CD2 . LEU A 1 63  ? 32.518  25.371  -55.434 1.00 0.00 ? 63  LEU A CD2 1  
ATOM 71     N N   . LEU A 1 64  ? 32.597  20.936  -53.372 1.00 0.00 ? 64  LEU A N   1  
ATOM 72     C CA  . LEU A 1 64  ? 32.124  20.551  -52.107 1.00 0.00 ? 64  LEU A CA  1  
ATOM 73     C C   . LEU A 1 64  ? 33.076  19.518  -51.420 1.00 0.00 ? 64  LEU A C   1  
ATOM 74     O O   . LEU A 1 64  ? 33.309  19.560  -50.199 1.00 0.00 ? 64  LEU A O   1  
ATOM 75     C CB  . LEU A 1 64  ? 30.744  19.761  -52.294 1.00 0.00 ? 64  LEU A CB  1  
ATOM 76     C CG  . LEU A 1 64  ? 29.534  20.695  -52.741 1.00 0.00 ? 64  LEU A CG  1  
ATOM 77     C CD1 . LEU A 1 64  ? 28.352  19.903  -53.460 1.00 0.00 ? 64  LEU A CD1 1  
ATOM 78     C CD2 . LEU A 1 64  ? 28.898  21.519  -51.581 1.00 0.00 ? 64  LEU A CD2 1  
ATOM 79     N N   . ASN A 1 65  ? 33.566  18.526  -52.181 1.00 0.00 ? 65  ASN A N   1  
ATOM 80     C CA  . ASN A 1 65  ? 34.325  17.434  -51.651 1.00 0.00 ? 65  ASN A CA  1  
ATOM 81     C C   . ASN A 1 65  ? 35.604  17.898  -51.015 1.00 0.00 ? 65  ASN A C   1  
ATOM 82     O O   . ASN A 1 65  ? 36.049  17.375  -50.037 1.00 0.00 ? 65  ASN A O   1  
ATOM 83     C CB  . ASN A 1 65  ? 34.672  16.392  -52.820 1.00 0.00 ? 65  ASN A CB  1  
ATOM 84     C CG  . ASN A 1 65  ? 33.525  15.628  -53.363 1.00 0.00 ? 65  ASN A CG  1  
ATOM 85     O OD1 . ASN A 1 65  ? 32.537  15.494  -52.685 1.00 0.00 ? 65  ASN A OD1 1  
ATOM 86     N ND2 . ASN A 1 65  ? 33.604  15.237  -54.679 1.00 0.00 ? 65  ASN A ND2 1  
ATOM 87     N N   . VAL A 1 66  ? 36.251  18.872  -51.720 1.00 0.00 ? 66  VAL A N   1  
ATOM 88     C CA  . VAL A 1 66  ? 37.533  19.457  -51.482 1.00 0.00 ? 66  VAL A CA  1  
ATOM 89     C C   . VAL A 1 66  ? 37.538  20.183  -50.129 1.00 0.00 ? 66  VAL A C   1  
ATOM 90     O O   . VAL A 1 66  ? 38.536  20.208  -49.467 1.00 0.00 ? 66  VAL A O   1  
ATOM 91     C CB  . VAL A 1 66  ? 37.894  20.416  -52.616 1.00 0.00 ? 66  VAL A CB  1  
ATOM 92     C CG1 . VAL A 1 66  ? 38.879  21.456  -52.242 1.00 0.00 ? 66  VAL A CG1 1  
ATOM 93     C CG2 . VAL A 1 66  ? 38.537  19.524  -53.654 1.00 0.00 ? 66  VAL A CG2 1  
ATOM 94     N N   . LEU A 1 67  ? 36.438  20.867  -49.725 1.00 0.00 ? 67  LEU A N   1  
ATOM 95     C CA  . LEU A 1 67  ? 36.370  21.726  -48.537 1.00 0.00 ? 67  LEU A CA  1  
ATOM 96     C C   . LEU A 1 67  ? 36.620  21.106  -47.170 1.00 0.00 ? 67  LEU A C   1  
ATOM 97     O O   . LEU A 1 67  ? 37.199  21.705  -46.260 1.00 0.00 ? 67  LEU A O   1  
ATOM 98     C CB  . LEU A 1 67  ? 34.991  22.307  -48.434 1.00 0.00 ? 67  LEU A CB  1  
ATOM 99     C CG  . LEU A 1 67  ? 34.797  23.611  -47.601 1.00 0.00 ? 67  LEU A CG  1  
ATOM 100    C CD1 . LEU A 1 67  ? 36.028  24.524  -47.467 1.00 0.00 ? 67  LEU A CD1 1  
ATOM 101    C CD2 . LEU A 1 67  ? 33.562  24.313  -48.212 1.00 0.00 ? 67  LEU A CD2 1  
ATOM 102    N N   . ILE A 1 68  ? 36.240  19.811  -46.978 1.00 0.00 ? 68  ILE A N   1  
ATOM 103    C CA  . ILE A 1 68  ? 36.486  18.987  -45.764 1.00 0.00 ? 68  ILE A CA  1  
ATOM 104    C C   . ILE A 1 68  ? 38.057  18.698  -45.575 1.00 0.00 ? 68  ILE A C   1  
ATOM 105    O O   . ILE A 1 68  ? 38.534  18.382  -44.458 1.00 0.00 ? 68  ILE A O   1  
ATOM 106    C CB  . ILE A 1 68  ? 35.574  17.830  -45.528 1.00 0.00 ? 68  ILE A CB  1  
ATOM 107    C CG1 . ILE A 1 68  ? 35.531  17.489  -44.052 1.00 0.00 ? 68  ILE A CG1 1  
ATOM 108    C CG2 . ILE A 1 68  ? 36.080  16.565  -46.272 1.00 0.00 ? 68  ILE A CG2 1  
ATOM 109    C CD1 . ILE A 1 68  ? 34.613  16.303  -43.709 1.00 0.00 ? 68  ILE A CD1 1  
ATOM 110    N N   . GLY A 1 69  ? 38.908  18.737  -46.636 1.00 0.00 ? 69  GLY A N   1  
ATOM 111    C CA  . GLY A 1 69  ? 40.340  18.489  -46.565 1.00 0.00 ? 69  GLY A CA  1  
ATOM 112    C C   . GLY A 1 69  ? 40.999  19.189  -47.675 1.00 0.00 ? 69  GLY A C   1  
ATOM 113    O O   . GLY A 1 69  ? 41.008  18.675  -48.822 1.00 0.00 ? 69  GLY A O   1  
ATOM 114    N N   . LEU A 1 70  ? 41.645  20.351  -47.419 1.00 0.00 ? 70  LEU A N   1  
ATOM 115    C CA  . LEU A 1 70  ? 42.434  21.046  -48.315 1.00 0.00 ? 70  LEU A CA  1  
ATOM 116    C C   . LEU A 1 70  ? 43.841  20.693  -48.313 1.00 0.00 ? 70  LEU A C   1  
ATOM 117    O O   . LEU A 1 70  ? 44.599  21.307  -49.093 1.00 0.00 ? 70  LEU A O   1  
ATOM 118    C CB  . LEU A 1 70  ? 42.535  22.498  -47.766 1.00 0.00 ? 70  LEU A CB  1  
ATOM 119    C CG  . LEU A 1 70  ? 41.166  23.210  -47.683 1.00 0.00 ? 70  LEU A CG  1  
ATOM 120    C CD1 . LEU A 1 70  ? 41.295  24.722  -47.303 1.00 0.00 ? 70  LEU A CD1 1  
ATOM 121    C CD2 . LEU A 1 70  ? 40.434  23.208  -49.025 1.00 0.00 ? 70  LEU A CD2 1  
ATOM 122    N N   . GLU A 1 71  ? 44.271  19.717  -47.446 1.00 0.00 ? 71  GLU A N   1  
ATOM 123    C CA  . GLU A 1 71  ? 45.626  19.324  -47.293 1.00 0.00 ? 71  GLU A CA  1  
ATOM 124    C C   . GLU A 1 71  ? 45.782  18.068  -48.083 1.00 0.00 ? 71  GLU A C   1  
ATOM 125    O O   . GLU A 1 71  ? 46.779  17.397  -47.936 1.00 0.00 ? 71  GLU A O   1  
ATOM 126    C CB  . GLU A 1 71  ? 45.778  19.040  -45.845 1.00 0.00 ? 71  GLU A CB  1  
ATOM 127    C CG  . GLU A 1 71  ? 45.818  20.382  -45.046 1.00 0.00 ? 71  GLU A CG  1  
ATOM 128    C CD  . GLU A 1 71  ? 46.050  19.994  -43.543 1.00 0.00 ? 71  GLU A CD  1  
ATOM 129    O OE1 . GLU A 1 71  ? 47.236  19.877  -43.168 1.00 0.00 ? 71  GLU A OE1 1  
ATOM 130    O OE2 . GLU A 1 71  ? 45.076  19.863  -42.788 1.00 0.00 ? 71  GLU A OE2 1  
ATOM 131    N N   . GLY A 1 72  ? 44.892  17.672  -49.011 1.00 0.00 ? 72  GLY A N   1  
ATOM 132    C CA  . GLY A 1 72  ? 44.911  16.586  -49.908 1.00 0.00 ? 72  GLY A CA  1  
ATOM 133    C C   . GLY A 1 72  ? 46.102  16.267  -50.854 1.00 0.00 ? 72  GLY A C   1  
ATOM 134    O O   . GLY A 1 72  ? 47.177  16.816  -50.706 1.00 0.00 ? 72  GLY A O   1  
ATOM 135    N N   . THR A 1 73  ? 45.876  15.240  -51.720 1.00 0.00 ? 73  THR A N   1  
ATOM 136    C CA  . THR A 1 73  ? 46.822  14.674  -52.579 1.00 0.00 ? 73  THR A CA  1  
ATOM 137    C C   . THR A 1 73  ? 46.722  15.181  -53.971 1.00 0.00 ? 73  THR A C   1  
ATOM 138    O O   . THR A 1 73  ? 47.313  14.629  -54.844 1.00 0.00 ? 73  THR A O   1  
ATOM 139    C CB  . THR A 1 73  ? 46.733  13.156  -52.508 1.00 0.00 ? 73  THR A CB  1  
ATOM 140    O OG1 . THR A 1 73  ? 47.949  12.516  -52.927 1.00 0.00 ? 73  THR A OG1 1  
ATOM 141    C CG2 . THR A 1 73  ? 45.496  12.625  -53.279 1.00 0.00 ? 73  THR A CG2 1  
ATOM 142    N N   . TYR A 1 74  ? 45.881  16.259  -54.324 1.00 0.00 ? 74  TYR A N   1  
ATOM 143    C CA  . TYR A 1 74  ? 45.732  16.784  -55.673 1.00 0.00 ? 74  TYR A CA  1  
ATOM 144    C C   . TYR A 1 74  ? 45.441  18.207  -55.525 1.00 0.00 ? 74  TYR A C   1  
ATOM 145    O O   . TYR A 1 74  ? 45.706  19.034  -56.360 1.00 0.00 ? 74  TYR A O   1  
ATOM 146    C CB  . TYR A 1 74  ? 44.672  16.041  -56.491 1.00 0.00 ? 74  TYR A CB  1  
ATOM 147    C CG  . TYR A 1 74  ? 44.539  16.517  -57.972 1.00 0.00 ? 74  TYR A CG  1  
ATOM 148    C CD1 . TYR A 1 74  ? 45.482  16.038  -58.818 1.00 0.00 ? 74  TYR A CD1 1  
ATOM 149    C CD2 . TYR A 1 74  ? 43.580  17.419  -58.438 1.00 0.00 ? 74  TYR A CD2 1  
ATOM 150    C CE1 . TYR A 1 74  ? 45.582  16.478  -60.159 1.00 0.00 ? 74  TYR A CE1 1  
ATOM 151    C CE2 . TYR A 1 74  ? 43.641  17.922  -59.679 1.00 0.00 ? 74  TYR A CE2 1  
ATOM 152    C CZ  . TYR A 1 74  ? 44.604  17.457  -60.605 1.00 0.00 ? 74  TYR A CZ  1  
ATOM 153    O OH  . TYR A 1 74  ? 44.696  18.076  -61.910 1.00 0.00 ? 74  TYR A OH  1  
ATOM 154    N N   . ILE A 1 75  ? 44.991  18.574  -54.286 1.00 0.00 ? 75  ILE A N   1  
ATOM 155    C CA  . ILE A 1 75  ? 44.830  19.894  -53.792 1.00 0.00 ? 75  ILE A CA  1  
ATOM 156    C C   . ILE A 1 75  ? 46.063  19.999  -52.955 1.00 0.00 ? 75  ILE A C   1  
ATOM 157    O O   . ILE A 1 75  ? 46.207  19.441  -51.848 1.00 0.00 ? 75  ILE A O   1  
ATOM 158    C CB  . ILE A 1 75  ? 43.612  20.125  -52.957 1.00 0.00 ? 75  ILE A CB  1  
ATOM 159    C CG1 . ILE A 1 75  ? 43.582  21.523  -52.348 1.00 0.00 ? 75  ILE A CG1 1  
ATOM 160    C CG2 . ILE A 1 75  ? 43.196  18.935  -52.059 1.00 0.00 ? 75  ILE A CG2 1  
ATOM 161    C CD1 . ILE A 1 75  ? 42.343  21.804  -51.480 1.00 0.00 ? 75  ILE A CD1 1  
ATOM 162    N N   . ARG A 1 76  ? 47.041  20.721  -53.516 1.00 0.00 ? 76  ARG A N   1  
ATOM 163    C CA  . ARG A 1 76  ? 48.437  20.856  -53.074 1.00 0.00 ? 76  ARG A CA  1  
ATOM 164    C C   . ARG A 1 76  ? 48.574  22.085  -52.189 1.00 0.00 ? 76  ARG A C   1  
ATOM 165    O O   . ARG A 1 76  ? 47.781  22.992  -52.235 1.00 0.00 ? 76  ARG A O   1  
ATOM 166    C CB  . ARG A 1 76  ? 49.467  20.950  -54.188 1.00 0.00 ? 76  ARG A CB  1  
ATOM 167    C CG  . ARG A 1 76  ? 49.241  19.947  -55.387 1.00 0.00 ? 76  ARG A CG  1  
ATOM 168    C CD  . ARG A 1 76  ? 49.152  18.426  -54.994 1.00 0.00 ? 76  ARG A CD  1  
ATOM 169    N NE  . ARG A 1 76  ? 49.150  17.739  -56.290 1.00 0.00 ? 76  ARG A NE  1  
ATOM 170    C CZ  . ARG A 1 76  ? 49.558  16.430  -56.481 1.00 0.00 ? 76  ARG A CZ  1  
ATOM 171    N NH1 . ARG A 1 76  ? 50.221  15.717  -55.523 1.00 0.00 ? 76  ARG A NH1 1  
ATOM 172    N NH2 . ARG A 1 76  ? 49.406  15.914  -57.744 1.00 0.00 ? 76  ARG A NH2 1  
ATOM 173    N N   . TYR A 1 77  ? 49.695  22.043  -51.458 1.00 0.00 ? 77  TYR A N   1  
ATOM 174    C CA  . TYR A 1 77  ? 50.044  23.127  -50.530 1.00 0.00 ? 77  TYR A CA  1  
ATOM 175    C C   . TYR A 1 77  ? 51.292  23.815  -50.871 1.00 0.00 ? 77  TYR A C   1  
ATOM 176    O O   . TYR A 1 77  ? 52.327  23.120  -51.105 1.00 0.00 ? 77  TYR A O   1  
ATOM 177    C CB  . TYR A 1 77  ? 50.214  22.495  -49.107 1.00 0.00 ? 77  TYR A CB  1  
ATOM 178    C CG  . TYR A 1 77  ? 50.780  23.323  -47.949 1.00 0.00 ? 77  TYR A CG  1  
ATOM 179    C CD1 . TYR A 1 77  ? 50.277  24.629  -47.751 1.00 0.00 ? 77  TYR A CD1 1  
ATOM 180    C CD2 . TYR A 1 77  ? 51.677  22.775  -46.987 1.00 0.00 ? 77  TYR A CD2 1  
ATOM 181    C CE1 . TYR A 1 77  ? 50.750  25.435  -46.672 1.00 0.00 ? 77  TYR A CE1 1  
ATOM 182    C CE2 . TYR A 1 77  ? 52.124  23.606  -45.915 1.00 0.00 ? 77  TYR A CE2 1  
ATOM 183    C CZ  . TYR A 1 77  ? 51.645  24.900  -45.730 1.00 0.00 ? 77  TYR A CZ  1  
ATOM 184    O OH  . TYR A 1 77  ? 52.144  25.737  -44.776 1.00 0.00 ? 77  TYR A OH  1  
ATOM 185    N N   . PHE A 1 78  ? 51.229  25.168  -50.915 1.00 0.00 ? 78  PHE A N   1  
ATOM 186    C CA  . PHE A 1 78  ? 52.351  26.063  -51.024 1.00 0.00 ? 78  PHE A CA  1  
ATOM 187    C C   . PHE A 1 78  ? 52.446  26.759  -49.675 1.00 0.00 ? 78  PHE A C   1  
ATOM 188    O O   . PHE A 1 78  ? 51.507  27.114  -48.997 1.00 0.00 ? 78  PHE A O   1  
ATOM 189    C CB  . PHE A 1 78  ? 52.377  27.088  -52.190 1.00 0.00 ? 78  PHE A CB  1  
ATOM 190    C CG  . PHE A 1 78  ? 53.763  27.738  -52.543 1.00 0.00 ? 78  PHE A CG  1  
ATOM 191    C CD1 . PHE A 1 78  ? 54.973  27.059  -52.219 1.00 0.00 ? 78  PHE A CD1 1  
ATOM 192    C CD2 . PHE A 1 78  ? 53.770  29.051  -53.102 1.00 0.00 ? 78  PHE A CD2 1  
ATOM 193    C CE1 . PHE A 1 78  ? 56.180  27.715  -52.587 1.00 0.00 ? 78  PHE A CE1 1  
ATOM 194    C CE2 . PHE A 1 78  ? 54.945  29.686  -53.448 1.00 0.00 ? 78  PHE A CE2 1  
ATOM 195    C CZ  . PHE A 1 78  ? 56.133  28.996  -53.161 1.00 0.00 ? 78  PHE A CZ  1  
ATOM 196    N N   . ASN A 1 79  ? 53.732  26.794  -49.148 1.00 0.00 ? 79  ASN A N   1  
ATOM 197    C CA  . ASN A 1 79  ? 54.154  27.008  -47.793 1.00 0.00 ? 79  ASN A CA  1  
ATOM 198    C C   . ASN A 1 79  ? 53.802  28.426  -47.256 1.00 0.00 ? 79  ASN A C   1  
ATOM 199    O O   . ASN A 1 79  ? 53.396  28.573  -46.099 1.00 0.00 ? 79  ASN A O   1  
ATOM 200    C CB  . ASN A 1 79  ? 55.672  26.628  -47.582 1.00 0.00 ? 79  ASN A CB  1  
ATOM 201    C CG  . ASN A 1 79  ? 56.025  26.295  -46.137 1.00 0.00 ? 79  ASN A CG  1  
ATOM 202    O OD1 . ASN A 1 79  ? 56.483  27.153  -45.337 1.00 0.00 ? 79  ASN A OD1 1  
ATOM 203    N ND2 . ASN A 1 79  ? 55.856  25.013  -45.742 1.00 0.00 ? 79  ASN A ND2 1  
ATOM 204    N N   . ASP A 1 80  ? 54.026  29.473  -48.063 1.00 0.00 ? 80  ASP A N   1  
ATOM 205    C CA  . ASP A 1 80  ? 53.954  30.820  -47.622 1.00 0.00 ? 80  ASP A CA  1  
ATOM 206    C C   . ASP A 1 80  ? 52.594  31.445  -47.592 1.00 0.00 ? 80  ASP A C   1  
ATOM 207    O O   . ASP A 1 80  ? 51.613  30.745  -47.955 1.00 0.00 ? 80  ASP A O   1  
ATOM 208    C CB  . ASP A 1 80  ? 54.768  31.692  -48.553 1.00 0.00 ? 80  ASP A CB  1  
ATOM 209    C CG  . ASP A 1 80  ? 56.192  31.208  -48.764 1.00 0.00 ? 80  ASP A CG  1  
ATOM 210    O OD1 . ASP A 1 80  ? 56.983  31.444  -47.793 1.00 0.00 ? 80  ASP A OD1 1  
ATOM 211    O OD2 . ASP A 1 80  ? 56.415  30.377  -49.722 1.00 0.00 ? 80  ASP A OD2 1  
ATOM 212    N N   . ILE A 1 90  ? 51.462  30.999  -51.353 1.00 0.00 ? 90  ILE A N   1  
ATOM 213    C CA  . ILE A 1 90  ? 50.071  31.207  -51.863 1.00 0.00 ? 90  ILE A CA  1  
ATOM 214    C C   . ILE A 1 90  ? 49.175  30.814  -50.773 1.00 0.00 ? 90  ILE A C   1  
ATOM 215    O O   . ILE A 1 90  ? 48.453  31.657  -50.268 1.00 0.00 ? 90  ILE A O   1  
ATOM 216    C CB  . ILE A 1 90  ? 49.818  30.404  -53.155 1.00 0.00 ? 90  ILE A CB  1  
ATOM 217    C CG1 . ILE A 1 90  ? 50.662  31.075  -54.224 1.00 0.00 ? 90  ILE A CG1 1  
ATOM 218    C CG2 . ILE A 1 90  ? 48.290  30.284  -53.450 1.00 0.00 ? 90  ILE A CG2 1  
ATOM 219    C CD1 . ILE A 1 90  ? 50.554  30.421  -55.612 1.00 0.00 ? 90  ILE A CD1 1  
ATOM 220    N N   . GLU A 1 91  ? 49.225  29.527  -50.448 1.00 0.00 ? 91  GLU A N   1  
ATOM 221    C CA  . GLU A 1 91  ? 48.459  28.702  -49.488 1.00 0.00 ? 91  GLU A CA  1  
ATOM 222    C C   . GLU A 1 91  ? 48.308  27.452  -50.216 1.00 0.00 ? 91  GLU A C   1  
ATOM 223    O O   . GLU A 1 91  ? 49.081  27.185  -51.122 1.00 0.00 ? 91  GLU A O   1  
ATOM 224    C CB  . GLU A 1 91  ? 47.140  29.263  -48.982 1.00 0.00 ? 91  GLU A CB  1  
ATOM 225    C CG  . GLU A 1 91  ? 46.120  29.860  -49.959 1.00 0.00 ? 91  GLU A CG  1  
ATOM 226    C CD  . GLU A 1 91  ? 44.685  29.320  -49.886 1.00 0.00 ? 91  GLU A CD  1  
ATOM 227    O OE1 . GLU A 1 91  ? 44.431  28.434  -49.025 1.00 0.00 ? 91  GLU A OE1 1  
ATOM 228    O OE2 . GLU A 1 91  ? 43.808  29.799  -50.683 1.00 0.00 ? 91  GLU A OE2 1  
ATOM 229    N N   . PHE A 1 92  ? 47.258  26.732  -49.955 1.00 0.00 ? 92  PHE A N   1  
ATOM 230    C CA  . PHE A 1 92  ? 46.785  25.608  -50.684 1.00 0.00 ? 92  PHE A CA  1  
ATOM 231    C C   . PHE A 1 92  ? 46.271  26.125  -52.040 1.00 0.00 ? 92  PHE A C   1  
ATOM 232    O O   . PHE A 1 92  ? 45.631  27.157  -52.128 1.00 0.00 ? 92  PHE A O   1  
ATOM 233    C CB  . PHE A 1 92  ? 45.586  25.012  -49.949 1.00 0.00 ? 92  PHE A CB  1  
ATOM 234    C CG  . PHE A 1 92  ? 45.830  24.640  -48.543 1.00 0.00 ? 92  PHE A CG  1  
ATOM 235    C CD1 . PHE A 1 92  ? 46.731  23.530  -48.341 1.00 0.00 ? 92  PHE A CD1 1  
ATOM 236    C CD2 . PHE A 1 92  ? 45.259  25.278  -47.503 1.00 0.00 ? 92  PHE A CD2 1  
ATOM 237    C CE1 . PHE A 1 92  ? 47.070  23.215  -46.995 1.00 0.00 ? 92  PHE A CE1 1  
ATOM 238    C CE2 . PHE A 1 92  ? 45.486  24.870  -46.174 1.00 0.00 ? 92  PHE A CE2 1  
ATOM 239    C CZ  . PHE A 1 92  ? 46.460  23.921  -45.928 1.00 0.00 ? 92  PHE A CZ  1  
ATOM 240    N N   . LYS A 1 93  ? 46.555  25.351  -53.112 1.00 0.00 ? 93  LYS A N   1  
ATOM 241    C CA  . LYS A 1 93  ? 46.032  25.734  -54.394 1.00 0.00 ? 93  LYS A CA  1  
ATOM 242    C C   . LYS A 1 93  ? 45.595  24.486  -55.047 1.00 0.00 ? 93  LYS A C   1  
ATOM 243    O O   . LYS A 1 93  ? 46.173  23.369  -54.824 1.00 0.00 ? 93  LYS A O   1  
ATOM 244    C CB  . LYS A 1 93  ? 47.165  26.385  -55.202 1.00 0.00 ? 93  LYS A CB  1  
ATOM 245    C CG  . LYS A 1 93  ? 46.841  27.001  -56.562 1.00 0.00 ? 93  LYS A CG  1  
ATOM 246    C CD  . LYS A 1 93  ? 48.012  27.148  -57.458 1.00 0.00 ? 93  LYS A CD  1  
ATOM 247    C CE  . LYS A 1 93  ? 47.631  27.739  -58.876 1.00 0.00 ? 93  LYS A CE  1  
ATOM 248    N NZ  . LYS A 1 93  ? 47.039  26.614  -59.670 1.00 0.00 ? 93  LYS A NZ  1  
ATOM 249    N N   . ILE A 1 94  ? 44.602  24.616  -55.865 1.00 0.00 ? 94  ILE A N   1  
ATOM 250    C CA  . ILE A 1 94  ? 44.057  23.511  -56.650 1.00 0.00 ? 94  ILE A CA  1  
ATOM 251    C C   . ILE A 1 94  ? 43.986  24.213  -57.991 1.00 0.00 ? 94  ILE A C   1  
ATOM 252    O O   . ILE A 1 94  ? 43.736  25.372  -58.024 1.00 0.00 ? 94  ILE A O   1  
ATOM 253    C CB  . ILE A 1 94  ? 42.754  22.860  -56.208 1.00 0.00 ? 94  ILE A CB  1  
ATOM 254    C CG1 . ILE A 1 94  ? 42.433  21.579  -57.087 1.00 0.00 ? 94  ILE A CG1 1  
ATOM 255    C CG2 . ILE A 1 94  ? 41.600  23.894  -56.169 1.00 0.00 ? 94  ILE A CG2 1  
ATOM 256    C CD1 . ILE A 1 94  ? 41.127  20.864  -56.700 1.00 0.00 ? 94  ILE A CD1 1  
ATOM 257    N N   . ALA A 1 95  ? 44.041  23.433  -59.083 1.00 0.00 ? 95  ALA A N   1  
ATOM 258    C CA  . ALA A 1 95  ? 43.865  23.909  -60.482 1.00 0.00 ? 95  ALA A CA  1  
ATOM 259    C C   . ALA A 1 95  ? 42.461  24.382  -60.533 1.00 0.00 ? 95  ALA A C   1  
ATOM 260    O O   . ALA A 1 95  ? 41.527  23.873  -59.982 1.00 0.00 ? 95  ALA A O   1  
ATOM 261    C CB  . ALA A 1 95  ? 44.087  22.740  -61.478 1.00 0.00 ? 95  ALA A CB  1  
ATOM 262    N N   . LYS A 1 96  ? 42.288  25.484  -61.259 1.00 0.00 ? 96  LYS A N   1  
ATOM 263    C CA  . LYS A 1 96  ? 40.994  26.105  -61.388 1.00 0.00 ? 96  LYS A CA  1  
ATOM 264    C C   . LYS A 1 96  ? 40.444  25.789  -62.691 1.00 0.00 ? 96  LYS A C   1  
ATOM 265    O O   . LYS A 1 96  ? 41.222  25.594  -63.580 1.00 0.00 ? 96  LYS A O   1  
ATOM 266    C CB  . LYS A 1 96  ? 41.108  27.592  -61.278 1.00 0.00 ? 96  LYS A CB  1  
ATOM 267    C CG  . LYS A 1 96  ? 41.659  28.055  -59.930 1.00 0.00 ? 96  LYS A CG  1  
ATOM 268    C CD  . LYS A 1 96  ? 41.175  27.334  -58.613 1.00 0.00 ? 96  LYS A CD  1  
ATOM 269    C CE  . LYS A 1 96  ? 41.606  28.274  -57.476 1.00 0.00 ? 96  LYS A CE  1  
ATOM 270    N NZ  . LYS A 1 96  ? 41.443  27.764  -56.036 1.00 0.00 ? 96  LYS A NZ  1  
ATOM 271    N N   . LYS A 1 97  ? 39.066  25.734  -62.811 1.00 0.00 ? 97  LYS A N   1  
ATOM 272    C CA  . LYS A 1 97  ? 38.358  25.258  -63.955 1.00 0.00 ? 97  LYS A CA  1  
ATOM 273    C C   . LYS A 1 97  ? 37.297  26.257  -64.313 1.00 0.00 ? 97  LYS A C   1  
ATOM 274    O O   . LYS A 1 97  ? 37.137  27.275  -63.595 1.00 0.00 ? 97  LYS A O   1  
ATOM 275    C CB  . LYS A 1 97  ? 37.584  23.919  -63.672 1.00 0.00 ? 97  LYS A CB  1  
ATOM 276    C CG  . LYS A 1 97  ? 38.437  22.692  -63.301 1.00 0.00 ? 97  LYS A CG  1  
ATOM 277    C CD  . LYS A 1 97  ? 37.672  21.486  -62.831 1.00 0.00 ? 97  LYS A CD  1  
ATOM 278    C CE  . LYS A 1 97  ? 38.695  20.496  -62.174 1.00 0.00 ? 97  LYS A CE  1  
ATOM 279    N NZ  . LYS A 1 97  ? 38.065  19.364  -61.371 1.00 0.00 ? 97  LYS A NZ  1  
ATOM 280    N N   . MET A 1 98  ? 36.626  26.040  -65.407 1.00 0.00 ? 98  MET A N   1  
ATOM 281    C CA  . MET A 1 98  ? 35.644  26.928  -65.872 1.00 0.00 ? 98  MET A CA  1  
ATOM 282    C C   . MET A 1 98  ? 34.260  26.572  -65.436 1.00 0.00 ? 98  MET A C   1  
ATOM 283    O O   . MET A 1 98  ? 34.076  25.490  -64.828 1.00 0.00 ? 98  MET A O   1  
ATOM 284    C CB  . MET A 1 98  ? 35.576  27.107  -67.451 1.00 0.00 ? 98  MET A CB  1  
ATOM 285    C CG  . MET A 1 98  ? 36.943  27.358  -68.128 1.00 0.00 ? 98  MET A CG  1  
ATOM 286    S SD  . MET A 1 98  ? 37.927  28.837  -67.751 1.00 0.00 ? 98  MET A SD  1  
ATOM 287    C CE  . MET A 1 98  ? 36.901  29.976  -68.663 1.00 0.00 ? 98  MET A CE  1  
ATOM 288    N N   . ASP A 1 99  ? 33.410  27.720  -65.567 1.00 0.00 ? 99  ASP A N   1  
ATOM 289    C CA  . ASP A 1 99  ? 32.088  27.960  -65.184 1.00 0.00 ? 99  ASP A CA  1  
ATOM 290    C C   . ASP A 1 99  ? 32.294  29.297  -64.412 1.00 0.00 ? 99  ASP A C   1  
ATOM 291    O O   . ASP A 1 99  ? 33.263  29.449  -63.609 1.00 0.00 ? 99  ASP A O   1  
ATOM 292    C CB  . ASP A 1 99  ? 31.390  26.882  -64.236 1.00 0.00 ? 99  ASP A CB  1  
ATOM 293    C CG  . ASP A 1 99  ? 31.040  25.544  -64.897 1.00 0.00 ? 99  ASP A CG  1  
ATOM 294    O OD1 . ASP A 1 99  ? 30.493  25.626  -66.031 1.00 0.00 ? 99  ASP A OD1 1  
ATOM 295    O OD2 . ASP A 1 99  ? 31.198  24.445  -64.257 1.00 0.00 ? 99  ASP A OD2 1  
ATOM 296    N N   . PRO A 1 100 ? 31.397  30.347  -64.562 1.00 0.00 ? 100 PRO A N   1  
ATOM 297    C CA  . PRO A 1 100 ? 31.444  31.636  -63.790 1.00 0.00 ? 100 PRO A CA  1  
ATOM 298    C C   . PRO A 1 100 ? 31.243  31.370  -62.320 1.00 0.00 ? 100 PRO A C   1  
ATOM 299    O O   . PRO A 1 100 ? 31.749  32.086  -61.412 1.00 0.00 ? 100 PRO A O   1  
ATOM 300    C CB  . PRO A 1 100 ? 30.294  32.454  -64.465 1.00 0.00 ? 100 PRO A CB  1  
ATOM 301    C CG  . PRO A 1 100 ? 29.380  31.560  -65.188 1.00 0.00 ? 100 PRO A CG  1  
ATOM 302    C CD  . PRO A 1 100 ? 30.298  30.410  -65.577 1.00 0.00 ? 100 PRO A CD  1  
ATOM 303    N N   . SER A 1 101 ? 30.381  30.371  -62.046 1.00 0.00 ? 101 SER A N   1  
ATOM 304    C CA  . SER A 1 101 ? 29.954  30.103  -60.731 1.00 0.00 ? 101 SER A CA  1  
ATOM 305    C C   . SER A 1 101 ? 31.101  29.629  -59.856 1.00 0.00 ? 101 SER A C   1  
ATOM 306    O O   . SER A 1 101 ? 31.304  30.129  -58.752 1.00 0.00 ? 101 SER A O   1  
ATOM 307    C CB  . SER A 1 101 ? 28.845  29.031  -60.597 1.00 0.00 ? 101 SER A CB  1  
ATOM 308    O OG  . SER A 1 101 ? 27.784  29.570  -61.363 1.00 0.00 ? 101 SER A OG  1  
ATOM 309    N N   . PHE A 1 102 ? 31.880  28.687  -60.411 1.00 0.00 ? 102 PHE A N   1  
ATOM 310    C CA  . PHE A 1 102 ? 33.044  28.064  -59.775 1.00 0.00 ? 102 PHE A CA  1  
ATOM 311    C C   . PHE A 1 102 ? 34.199  29.010  -59.450 1.00 0.00 ? 102 PHE A C   1  
ATOM 312    O O   . PHE A 1 102 ? 34.758  29.001  -58.388 1.00 0.00 ? 102 PHE A O   1  
ATOM 313    C CB  . PHE A 1 102 ? 33.599  26.896  -60.592 1.00 0.00 ? 102 PHE A CB  1  
ATOM 314    C CG  . PHE A 1 102 ? 34.720  26.129  -59.965 1.00 0.00 ? 102 PHE A CG  1  
ATOM 315    C CD1 . PHE A 1 102 ? 34.486  25.041  -59.138 1.00 0.00 ? 102 PHE A CD1 1  
ATOM 316    C CD2 . PHE A 1 102 ? 36.071  26.454  -60.291 1.00 0.00 ? 102 PHE A CD2 1  
ATOM 317    C CE1 . PHE A 1 102 ? 35.540  24.223  -58.694 1.00 0.00 ? 102 PHE A CE1 1  
ATOM 318    C CE2 . PHE A 1 102 ? 37.145  25.646  -59.763 1.00 0.00 ? 102 PHE A CE2 1  
ATOM 319    C CZ  . PHE A 1 102 ? 36.898  24.525  -58.996 1.00 0.00 ? 102 PHE A CZ  1  
ATOM 320    N N   . LYS A 1 103 ? 34.592  29.914  -60.441 1.00 0.00 ? 103 LYS A N   1  
ATOM 321    C CA  . LYS A 1 103 ? 35.664  30.781  -60.178 1.00 0.00 ? 103 LYS A CA  1  
ATOM 322    C C   . LYS A 1 103 ? 35.298  31.769  -59.052 1.00 0.00 ? 103 LYS A C   1  
ATOM 323    O O   . LYS A 1 103 ? 36.090  32.072  -58.215 1.00 0.00 ? 103 LYS A O   1  
ATOM 324    C CB  . LYS A 1 103 ? 36.016  31.672  -61.412 1.00 0.00 ? 103 LYS A CB  1  
ATOM 325    C CG  . LYS A 1 103 ? 34.843  32.318  -62.127 1.00 0.00 ? 103 LYS A CG  1  
ATOM 326    C CD  . LYS A 1 103 ? 35.216  33.267  -63.237 1.00 0.00 ? 103 LYS A CD  1  
ATOM 327    C CE  . LYS A 1 103 ? 35.735  34.581  -62.775 1.00 0.00 ? 103 LYS A CE  1  
ATOM 328    N NZ  . LYS A 1 103 ? 34.885  35.341  -61.789 1.00 0.00 ? 103 LYS A NZ  1  
ATOM 329    N N   . THR A 1 104 ? 33.974  32.250  -58.935 1.00 0.00 ? 104 THR A N   1  
ATOM 330    C CA  . THR A 1 104 ? 33.588  33.134  -57.831 1.00 0.00 ? 104 THR A CA  1  
ATOM 331    C C   . THR A 1 104 ? 33.777  32.437  -56.521 1.00 0.00 ? 104 THR A C   1  
ATOM 332    O O   . THR A 1 104 ? 34.213  32.970  -55.525 1.00 0.00 ? 104 THR A O   1  
ATOM 333    C CB  . THR A 1 104 ? 32.106  33.638  -57.975 1.00 0.00 ? 104 THR A CB  1  
ATOM 334    O OG1 . THR A 1 104 ? 31.812  34.178  -59.246 1.00 0.00 ? 104 THR A OG1 1  
ATOM 335    C CG2 . THR A 1 104 ? 31.708  34.623  -56.938 1.00 0.00 ? 104 THR A CG2 1  
ATOM 336    N N   . PHE A 1 105 ? 33.313  31.164  -56.481 1.00 0.00 ? 105 PHE A N   1  
ATOM 337    C CA  . PHE A 1 105 ? 33.299  30.308  -55.312 1.00 0.00 ? 105 PHE A CA  1  
ATOM 338    C C   . PHE A 1 105 ? 34.667  29.954  -54.810 1.00 0.00 ? 105 PHE A C   1  
ATOM 339    O O   . PHE A 1 105 ? 34.944  30.102  -53.585 1.00 0.00 ? 105 PHE A O   1  
ATOM 340    C CB  . PHE A 1 105 ? 32.592  28.962  -55.550 1.00 0.00 ? 105 PHE A CB  1  
ATOM 341    C CG  . PHE A 1 105 ? 31.044  29.177  -55.770 1.00 0.00 ? 105 PHE A CG  1  
ATOM 342    C CD1 . PHE A 1 105 ? 30.301  30.238  -55.099 1.00 0.00 ? 105 PHE A CD1 1  
ATOM 343    C CD2 . PHE A 1 105 ? 30.351  28.321  -56.627 1.00 0.00 ? 105 PHE A CD2 1  
ATOM 344    C CE1 . PHE A 1 105 ? 28.958  30.459  -55.400 1.00 0.00 ? 105 PHE A CE1 1  
ATOM 345    C CE2 . PHE A 1 105 ? 29.021  28.527  -56.882 1.00 0.00 ? 105 PHE A CE2 1  
ATOM 346    C CZ  . PHE A 1 105 ? 28.290  29.638  -56.377 1.00 0.00 ? 105 PHE A CZ  1  
ATOM 347    N N   . SER A 1 106 ? 35.625  29.668  -55.729 1.00 0.00 ? 106 SER A N   1  
ATOM 348    C CA  . SER A 1 106 ? 37.016  29.408  -55.379 1.00 0.00 ? 106 SER A CA  1  
ATOM 349    C C   . SER A 1 106 ? 37.732  30.607  -54.683 1.00 0.00 ? 106 SER A C   1  
ATOM 350    O O   . SER A 1 106 ? 38.470  30.378  -53.727 1.00 0.00 ? 106 SER A O   1  
ATOM 351    C CB  . SER A 1 106 ? 37.961  28.816  -56.431 1.00 0.00 ? 106 SER A CB  1  
ATOM 352    O OG  . SER A 1 106 ? 38.049  29.582  -57.690 1.00 0.00 ? 106 SER A OG  1  
ATOM 353    N N   . ARG A 1 107 ? 37.325  31.867  -55.062 1.00 0.00 ? 107 ARG A N   1  
ATOM 354    C CA  . ARG A 1 107 ? 37.828  33.040  -54.419 1.00 0.00 ? 107 ARG A CA  1  
ATOM 355    C C   . ARG A 1 107 ? 37.384  33.117  -52.951 1.00 0.00 ? 107 ARG A C   1  
ATOM 356    O O   . ARG A 1 107 ? 38.157  33.361  -52.042 1.00 0.00 ? 107 ARG A O   1  
ATOM 357    C CB  . ARG A 1 107 ? 37.351  34.329  -55.179 1.00 0.00 ? 107 ARG A CB  1  
ATOM 358    C CG  . ARG A 1 107 ? 37.996  34.465  -56.549 1.00 0.00 ? 107 ARG A CG  1  
ATOM 359    C CD  . ARG A 1 107 ? 39.566  34.269  -56.542 1.00 0.00 ? 107 ARG A CD  1  
ATOM 360    N NE  . ARG A 1 107 ? 40.199  33.921  -57.847 1.00 0.00 ? 107 ARG A NE  1  
ATOM 361    C CZ  . ARG A 1 107 ? 40.627  32.696  -58.216 1.00 0.00 ? 107 ARG A CZ  1  
ATOM 362    N NH1 . ARG A 1 107 ? 40.535  31.673  -57.342 1.00 0.00 ? 107 ARG A NH1 1  
ATOM 363    N NH2 . ARG A 1 107 ? 41.204  32.545  -59.445 1.00 0.00 ? 107 ARG A NH2 1  
ATOM 364    N N   . ARG A 1 108 ? 36.120  32.829  -52.600 1.00 0.00 ? 108 ARG A N   1  
ATOM 365    C CA  . ARG A 1 108 ? 35.629  32.852  -51.257 1.00 0.00 ? 108 ARG A CA  1  
ATOM 366    C C   . ARG A 1 108 ? 36.367  31.818  -50.409 1.00 0.00 ? 108 ARG A C   1  
ATOM 367    O O   . ARG A 1 108 ? 36.800  32.120  -49.270 1.00 0.00 ? 108 ARG A O   1  
ATOM 368    C CB  . ARG A 1 108 ? 34.158  32.577  -51.227 1.00 0.00 ? 108 ARG A CB  1  
ATOM 369    C CG  . ARG A 1 108 ? 33.336  33.814  -51.811 1.00 0.00 ? 108 ARG A CG  1  
ATOM 370    C CD  . ARG A 1 108 ? 31.869  33.399  -51.965 1.00 0.00 ? 108 ARG A CD  1  
ATOM 371    N NE  . ARG A 1 108 ? 31.045  34.587  -52.392 1.00 0.00 ? 108 ARG A NE  1  
ATOM 372    C CZ  . ARG A 1 108 ? 29.877  34.451  -53.078 1.00 0.00 ? 108 ARG A CZ  1  
ATOM 373    N NH1 . ARG A 1 108 ? 29.333  33.232  -53.409 1.00 0.00 ? 108 ARG A NH1 1  
ATOM 374    N NH2 . ARG A 1 108 ? 29.202  35.532  -53.548 1.00 0.00 ? 108 ARG A NH2 1  
ATOM 375    N N   . ILE A 1 109 ? 36.543  30.615  -51.014 1.00 0.00 ? 109 ILE A N   1  
ATOM 376    C CA  . ILE A 1 109 ? 37.174  29.531  -50.417 1.00 0.00 ? 109 ILE A CA  1  
ATOM 377    C C   . ILE A 1 109 ? 38.636  29.813  -50.028 1.00 0.00 ? 109 ILE A C   1  
ATOM 378    O O   . ILE A 1 109 ? 39.184  29.366  -49.034 1.00 0.00 ? 109 ILE A O   1  
ATOM 379    C CB  . ILE A 1 109 ? 36.888  28.178  -51.081 1.00 0.00 ? 109 ILE A CB  1  
ATOM 380    C CG1 . ILE A 1 109 ? 35.378  27.821  -50.971 1.00 0.00 ? 109 ILE A CG1 1  
ATOM 381    C CG2 . ILE A 1 109 ? 37.692  27.087  -50.371 1.00 0.00 ? 109 ILE A CG2 1  
ATOM 382    C CD1 . ILE A 1 109 ? 35.002  26.475  -51.614 1.00 0.00 ? 109 ILE A CD1 1  
ATOM 383    N N   . VAL A 1 110 ? 39.283  30.579  -50.918 1.00 0.00 ? 110 VAL A N   1  
ATOM 384    C CA  . VAL A 1 110 ? 40.700  30.945  -50.734 1.00 0.00 ? 110 VAL A CA  1  
ATOM 385    C C   . VAL A 1 110 ? 40.996  31.682  -49.453 1.00 0.00 ? 110 VAL A C   1  
ATOM 386    O O   . VAL A 1 110 ? 41.961  31.390  -48.738 1.00 0.00 ? 110 VAL A O   1  
ATOM 387    C CB  . VAL A 1 110 ? 41.306  31.905  -51.901 1.00 0.00 ? 110 VAL A CB  1  
ATOM 388    C CG1 . VAL A 1 110 ? 42.529  32.774  -51.572 1.00 0.00 ? 110 VAL A CG1 1  
ATOM 389    C CG2 . VAL A 1 110 ? 41.599  31.157  -53.247 1.00 0.00 ? 110 VAL A CG2 1  
ATOM 390    N N   . ARG A 1 111 ? 40.133  32.667  -49.137 1.00 0.00 ? 111 ARG A N   1  
ATOM 391    C CA  . ARG A 1 111 ? 40.277  33.490  -47.973 1.00 0.00 ? 111 ARG A CA  1  
ATOM 392    C C   . ARG A 1 111 ? 40.222  32.631  -46.687 1.00 0.00 ? 111 ARG A C   1  
ATOM 393    O O   . ARG A 1 111 ? 41.071  32.849  -45.795 1.00 0.00 ? 111 ARG A O   1  
ATOM 394    C CB  . ARG A 1 111 ? 38.978  34.433  -47.916 1.00 0.00 ? 111 ARG A CB  1  
ATOM 395    C CG  . ARG A 1 111 ? 38.832  35.487  -49.032 1.00 0.00 ? 111 ARG A CG  1  
ATOM 396    C CD  . ARG A 1 111 ? 37.816  36.536  -48.741 1.00 0.00 ? 111 ARG A CD  1  
ATOM 397    N NE  . ARG A 1 111 ? 36.497  35.861  -48.959 1.00 0.00 ? 111 ARG A NE  1  
ATOM 398    C CZ  . ARG A 1 111 ? 35.364  36.164  -48.280 1.00 0.00 ? 111 ARG A CZ  1  
ATOM 399    N NH1 . ARG A 1 111 ? 35.298  37.301  -47.516 1.00 0.00 ? 111 ARG A NH1 1  
ATOM 400    N NH2 . ARG A 1 111 ? 34.185  35.482  -48.410 1.00 0.00 ? 111 ARG A NH2 1  
ATOM 401    N N   . TYR A 1 112 ? 39.245  31.696  -46.653 1.00 0.00 ? 112 TYR A N   1  
ATOM 402    C CA  . TYR A 1 112 ? 38.911  30.801  -45.519 1.00 0.00 ? 112 TYR A CA  1  
ATOM 403    C C   . TYR A 1 112 ? 40.066  29.925  -45.226 1.00 0.00 ? 112 TYR A C   1  
ATOM 404    O O   . TYR A 1 112 ? 40.519  29.737  -44.107 1.00 0.00 ? 112 TYR A O   1  
ATOM 405    C CB  . TYR A 1 112 ? 37.642  30.063  -45.866 1.00 0.00 ? 112 TYR A CB  1  
ATOM 406    C CG  . TYR A 1 112 ? 36.936  29.651  -44.632 1.00 0.00 ? 112 TYR A CG  1  
ATOM 407    C CD1 . TYR A 1 112 ? 37.381  28.513  -43.916 1.00 0.00 ? 112 TYR A CD1 1  
ATOM 408    C CD2 . TYR A 1 112 ? 35.972  30.527  -44.038 1.00 0.00 ? 112 TYR A CD2 1  
ATOM 409    C CE1 . TYR A 1 112 ? 36.943  28.294  -42.613 1.00 0.00 ? 112 TYR A CE1 1  
ATOM 410    C CE2 . TYR A 1 112 ? 35.642  30.308  -42.708 1.00 0.00 ? 112 TYR A CE2 1  
ATOM 411    C CZ  . TYR A 1 112 ? 36.101  29.218  -41.983 1.00 0.00 ? 112 TYR A CZ  1  
ATOM 412    O OH  . TYR A 1 112 ? 35.817  29.053  -40.597 1.00 0.00 ? 112 TYR A OH  1  
ATOM 413    N N   . GLY A 1 113 ? 40.607  29.413  -46.325 1.00 0.00 ? 113 GLY A N   1  
ATOM 414    C CA  . GLY A 1 113 ? 41.719  28.527  -46.401 1.00 0.00 ? 113 GLY A CA  1  
ATOM 415    C C   . GLY A 1 113 ? 43.010  29.107  -45.940 1.00 0.00 ? 113 GLY A C   1  
ATOM 416    O O   . GLY A 1 113 ? 43.802  28.466  -45.273 1.00 0.00 ? 113 GLY A O   1  
ATOM 417    N N   . LYS A 1 114 ? 43.229  30.374  -46.290 1.00 0.00 ? 114 LYS A N   1  
ATOM 418    C CA  . LYS A 1 114 ? 44.423  31.022  -45.903 1.00 0.00 ? 114 LYS A CA  1  
ATOM 419    C C   . LYS A 1 114 ? 44.564  31.181  -44.439 1.00 0.00 ? 114 LYS A C   1  
ATOM 420    O O   . LYS A 1 114 ? 45.625  30.795  -43.896 1.00 0.00 ? 114 LYS A O   1  
ATOM 421    C CB  . LYS A 1 114 ? 44.699  32.274  -46.709 1.00 0.00 ? 114 LYS A CB  1  
ATOM 422    C CG  . LYS A 1 114 ? 46.191  32.595  -46.688 1.00 0.00 ? 114 LYS A CG  1  
ATOM 423    C CD  . LYS A 1 114 ? 46.645  33.695  -47.699 1.00 0.00 ? 114 LYS A CD  1  
ATOM 424    C CE  . LYS A 1 114 ? 46.387  35.176  -47.265 1.00 0.00 ? 114 LYS A CE  1  
ATOM 425    N NZ  . LYS A 1 114 ? 44.998  35.588  -47.461 1.00 0.00 ? 114 LYS A NZ  1  
ATOM 426    N N   . GLN A 1 115 ? 43.446  31.658  -43.765 1.00 0.00 ? 115 GLN A N   1  
ATOM 427    C CA  . GLN A 1 115 ? 43.421  31.817  -42.305 1.00 0.00 ? 115 GLN A CA  1  
ATOM 428    C C   . GLN A 1 115 ? 43.580  30.510  -41.559 1.00 0.00 ? 115 GLN A C   1  
ATOM 429    O O   . GLN A 1 115 ? 44.283  30.451  -40.598 1.00 0.00 ? 115 GLN A O   1  
ATOM 430    C CB  . GLN A 1 115 ? 42.112  32.417  -41.862 1.00 0.00 ? 115 GLN A CB  1  
ATOM 431    C CG  . GLN A 1 115 ? 41.757  33.790  -42.464 1.00 0.00 ? 115 GLN A CG  1  
ATOM 432    C CD  . GLN A 1 115 ? 42.743  34.919  -42.178 1.00 0.00 ? 115 GLN A CD  1  
ATOM 433    O OE1 . GLN A 1 115 ? 43.628  35.280  -43.045 1.00 0.00 ? 115 GLN A OE1 1  
ATOM 434    N NE2 . GLN A 1 115 ? 42.678  35.441  -40.921 1.00 0.00 ? 115 GLN A NE2 1  
ATOM 435    N N   . TYR A 1 116 ? 42.922  29.411  -42.012 1.00 0.00 ? 116 TYR A N   1  
ATOM 436    C CA  . TYR A 1 116 ? 43.036  28.061  -41.381 1.00 0.00 ? 116 TYR A CA  1  
ATOM 437    C C   . TYR A 1 116 ? 44.441  27.579  -41.323 1.00 0.00 ? 116 TYR A C   1  
ATOM 438    O O   . TYR A 1 116 ? 44.846  27.051  -40.328 1.00 0.00 ? 116 TYR A O   1  
ATOM 439    C CB  . TYR A 1 116 ? 42.180  26.977  -42.049 1.00 0.00 ? 116 TYR A CB  1  
ATOM 440    C CG  . TYR A 1 116 ? 42.180  25.605  -41.388 1.00 0.00 ? 116 TYR A CG  1  
ATOM 441    C CD1 . TYR A 1 116 ? 42.021  25.436  -40.042 1.00 0.00 ? 116 TYR A CD1 1  
ATOM 442    C CD2 . TYR A 1 116 ? 42.387  24.434  -42.185 1.00 0.00 ? 116 TYR A CD2 1  
ATOM 443    C CE1 . TYR A 1 116 ? 41.969  24.199  -39.452 1.00 0.00 ? 116 TYR A CE1 1  
ATOM 444    C CE2 . TYR A 1 116 ? 42.465  23.127  -41.595 1.00 0.00 ? 116 TYR A CE2 1  
ATOM 445    C CZ  . TYR A 1 116 ? 42.131  22.999  -40.172 1.00 0.00 ? 116 TYR A CZ  1  
ATOM 446    O OH  . TYR A 1 116 ? 42.112  21.758  -39.592 1.00 0.00 ? 116 TYR A OH  1  
ATOM 447    N N   . MET A 1 117 ? 45.167  27.718  -42.484 1.00 0.00 ? 117 MET A N   1  
ATOM 448    C CA  . MET A 1 117 ? 46.557  27.252  -42.611 1.00 0.00 ? 117 MET A CA  1  
ATOM 449    C C   . MET A 1 117 ? 47.473  28.034  -41.697 1.00 0.00 ? 117 MET A C   1  
ATOM 450    O O   . MET A 1 117 ? 48.281  27.440  -41.001 1.00 0.00 ? 117 MET A O   1  
ATOM 451    C CB  . MET A 1 117 ? 47.117  27.485  -44.121 1.00 0.00 ? 117 MET A CB  1  
ATOM 452    C CG  . MET A 1 117 ? 48.549  27.034  -44.461 1.00 0.00 ? 117 MET A CG  1  
ATOM 453    S SD  . MET A 1 117 ? 49.743  28.381  -44.508 1.00 0.00 ? 117 MET A SD  1  
ATOM 454    C CE  . MET A 1 117 ? 49.065  29.503  -45.634 1.00 0.00 ? 117 MET A CE  1  
ATOM 455    N N   . ILE A 1 118 ? 47.315  29.399  -41.663 1.00 0.00 ? 118 ILE A N   1  
ATOM 456    C CA  . ILE A 1 118 ? 48.136  30.312  -40.872 1.00 0.00 ? 118 ILE A CA  1  
ATOM 457    C C   . ILE A 1 118 ? 47.939  30.074  -39.388 1.00 0.00 ? 118 ILE A C   1  
ATOM 458    O O   . ILE A 1 118 ? 48.858  30.231  -38.627 1.00 0.00 ? 118 ILE A O   1  
ATOM 459    C CB  . ILE A 1 118 ? 47.948  31.873  -41.229 1.00 0.00 ? 118 ILE A CB  1  
ATOM 460    C CG1 . ILE A 1 118 ? 48.358  32.129  -42.675 1.00 0.00 ? 118 ILE A CG1 1  
ATOM 461    C CG2 . ILE A 1 118 ? 48.868  32.783  -40.352 1.00 0.00 ? 118 ILE A CG2 1  
ATOM 462    C CD1 . ILE A 1 118 ? 48.216  33.595  -43.118 1.00 0.00 ? 118 ILE A CD1 1  
ATOM 463    N N   . LEU A 1 119 ? 46.639  29.813  -38.893 1.00 0.00 ? 119 LEU A N   1  
ATOM 464    C CA  . LEU A 1 119 ? 46.398  29.645  -37.476 1.00 0.00 ? 119 LEU A CA  1  
ATOM 465    C C   . LEU A 1 119 ? 47.163  28.454  -36.942 1.00 0.00 ? 119 LEU A C   1  
ATOM 466    O O   . LEU A 1 119 ? 47.937  28.571  -35.958 1.00 0.00 ? 119 LEU A O   1  
ATOM 467    C CB  . LEU A 1 119 ? 44.914  29.425  -37.344 1.00 0.00 ? 119 LEU A CB  1  
ATOM 468    C CG  . LEU A 1 119 ? 44.441  28.686  -36.027 1.00 0.00 ? 119 LEU A CG  1  
ATOM 469    C CD1 . LEU A 1 119 ? 44.586  29.560  -34.761 1.00 0.00 ? 119 LEU A CD1 1  
ATOM 470    C CD2 . LEU A 1 119 ? 42.983  28.220  -36.249 1.00 0.00 ? 119 LEU A CD2 1  
ATOM 471    N N   . THR A 1 120 ? 47.174  27.305  -37.741 1.00 0.00 ? 120 THR A N   1  
ATOM 472    C CA  . THR A 1 120 ? 47.986  26.130  -37.492 1.00 0.00 ? 120 THR A CA  1  
ATOM 473    C C   . THR A 1 120 ? 49.525  26.487  -37.505 1.00 0.00 ? 120 THR A C   1  
ATOM 474    O O   . THR A 1 120 ? 50.196  26.001  -36.588 1.00 0.00 ? 120 THR A O   1  
ATOM 475    C CB  . THR A 1 120 ? 47.642  25.000  -38.583 1.00 0.00 ? 120 THR A CB  1  
ATOM 476    O OG1 . THR A 1 120 ? 46.263  24.786  -38.566 1.00 0.00 ? 120 THR A OG1 1  
ATOM 477    C CG2 . THR A 1 120 ? 48.413  23.739  -38.112 1.00 0.00 ? 120 THR A CG2 1  
ATOM 478    N N   . ARG A 1 121 ? 50.078  27.332  -38.385 1.00 0.00 ? 121 ARG A N   1  
ATOM 479    C CA  . ARG A 1 121 ? 51.523  27.610  -38.288 1.00 0.00 ? 121 ARG A CA  1  
ATOM 480    C C   . ARG A 1 121 ? 52.036  28.278  -37.098 1.00 0.00 ? 121 ARG A C   1  
ATOM 481    O O   . ARG A 1 121 ? 53.036  27.923  -36.490 1.00 0.00 ? 121 ARG A O   1  
ATOM 482    C CB  . ARG A 1 121 ? 52.216  28.482  -39.470 1.00 0.00 ? 121 ARG A CB  1  
ATOM 483    C CG  . ARG A 1 121 ? 51.866  28.023  -40.889 1.00 0.00 ? 121 ARG A CG  1  
ATOM 484    C CD  . ARG A 1 121 ? 52.633  28.776  -41.865 1.00 0.00 ? 121 ARG A CD  1  
ATOM 485    N NE  . ARG A 1 121 ? 52.109  30.222  -41.977 1.00 0.00 ? 121 ARG A NE  1  
ATOM 486    C CZ  . ARG A 1 121 ? 52.444  31.081  -42.931 1.00 0.00 ? 121 ARG A CZ  1  
ATOM 487    N NH1 . ARG A 1 121 ? 53.247  30.640  -43.943 1.00 0.00 ? 121 ARG A NH1 1  
ATOM 488    N NH2 . ARG A 1 121 ? 52.143  32.379  -42.817 1.00 0.00 ? 121 ARG A NH2 1  
ATOM 489    N N   . ALA A 1 122 ? 51.194  29.296  -36.694 1.00 0.00 ? 122 ALA A N   1  
ATOM 490    C CA  . ALA A 1 122 ? 51.394  30.114  -35.578 1.00 0.00 ? 122 ALA A CA  1  
ATOM 491    C C   . ALA A 1 122 ? 51.407  29.394  -34.233 1.00 0.00 ? 122 ALA A C   1  
ATOM 492    O O   . ALA A 1 122 ? 52.181  29.627  -33.352 1.00 0.00 ? 122 ALA A O   1  
ATOM 493    C CB  . ALA A 1 122 ? 50.274  31.232  -35.504 1.00 0.00 ? 122 ALA A CB  1  
ATOM 494    N N   . TYR A 1 123 ? 50.426  28.420  -34.147 1.00 0.00 ? 123 TYR A N   1  
ATOM 495    C CA  . TYR A 1 123 ? 50.133  27.651  -33.001 1.00 0.00 ? 123 TYR A CA  1  
ATOM 496    C C   . TYR A 1 123 ? 51.401  26.801  -32.684 1.00 0.00 ? 123 TYR A C   1  
ATOM 497    O O   . TYR A 1 123 ? 51.723  26.653  -31.515 1.00 0.00 ? 123 TYR A O   1  
ATOM 498    C CB  . TYR A 1 123 ? 48.912  26.695  -33.298 1.00 0.00 ? 123 TYR A CB  1  
ATOM 499    C CG  . TYR A 1 123 ? 48.741  25.615  -32.300 1.00 0.00 ? 123 TYR A CG  1  
ATOM 500    C CD1 . TYR A 1 123 ? 48.041  25.935  -31.121 1.00 0.00 ? 123 TYR A CD1 1  
ATOM 501    C CD2 . TYR A 1 123 ? 49.054  24.248  -32.462 1.00 0.00 ? 123 TYR A CD2 1  
ATOM 502    C CE1 . TYR A 1 123 ? 47.555  24.968  -30.195 1.00 0.00 ? 123 TYR A CE1 1  
ATOM 503    C CE2 . TYR A 1 123 ? 48.616  23.243  -31.571 1.00 0.00 ? 123 TYR A CE2 1  
ATOM 504    C CZ  . TYR A 1 123 ? 47.793  23.556  -30.442 1.00 0.00 ? 123 TYR A CZ  1  
ATOM 505    O OH  . TYR A 1 123 ? 47.159  22.707  -29.658 1.00 0.00 ? 123 TYR A OH  1  
ATOM 506    N N   . GLU A 1 124 ? 52.101  26.148  -33.732 1.00 0.00 ? 124 GLU A N   1  
ATOM 507    C CA  . GLU A 1 124 ? 53.214  25.242  -33.557 1.00 0.00 ? 124 GLU A CA  1  
ATOM 508    C C   . GLU A 1 124 ? 54.359  25.911  -32.876 1.00 0.00 ? 124 GLU A C   1  
ATOM 509    O O   . GLU A 1 124 ? 54.929  25.205  -32.045 1.00 0.00 ? 124 GLU A O   1  
ATOM 510    C CB  . GLU A 1 124 ? 53.770  24.658  -34.884 1.00 0.00 ? 124 GLU A CB  1  
ATOM 511    C CG  . GLU A 1 124 ? 52.698  23.794  -35.587 1.00 0.00 ? 124 GLU A CG  1  
ATOM 512    C CD  . GLU A 1 124 ? 53.088  23.276  -36.972 1.00 0.00 ? 124 GLU A CD  1  
ATOM 513    O OE1 . GLU A 1 124 ? 53.818  23.878  -37.700 1.00 0.00 ? 124 GLU A OE1 1  
ATOM 514    O OE2 . GLU A 1 124 ? 52.436  22.215  -37.250 1.00 0.00 ? 124 GLU A OE2 1  
ATOM 515    N N   . LYS A 1 125 ? 54.564  27.166  -33.273 1.00 0.00 ? 125 LYS A N   1  
ATOM 516    C CA  . LYS A 1 125 ? 55.740  27.979  -32.809 1.00 0.00 ? 125 LYS A CA  1  
ATOM 517    C C   . LYS A 1 125 ? 55.651  28.203  -31.337 1.00 0.00 ? 125 LYS A C   1  
ATOM 518    O O   . LYS A 1 125 ? 56.614  27.888  -30.591 1.00 0.00 ? 125 LYS A O   1  
ATOM 519    C CB  . LYS A 1 125 ? 55.726  29.290  -33.543 1.00 0.00 ? 125 LYS A CB  1  
ATOM 520    C CG  . LYS A 1 125 ? 55.981  29.081  -35.024 1.00 0.00 ? 125 LYS A CG  1  
ATOM 521    C CD  . LYS A 1 125 ? 56.014  30.355  -35.838 1.00 0.00 ? 125 LYS A CD  1  
ATOM 522    C CE  . LYS A 1 125 ? 56.117  30.051  -37.371 1.00 0.00 ? 125 LYS A CE  1  
ATOM 523    N NZ  . LYS A 1 125 ? 56.414  31.247  -38.272 1.00 0.00 ? 125 LYS A NZ  1  
ATOM 524    N N   . TRP A 1 126 ? 54.481  28.623  -30.882 1.00 0.00 ? 126 TRP A N   1  
ATOM 525    C CA  . TRP A 1 126 ? 54.162  28.931  -29.543 1.00 0.00 ? 126 TRP A CA  1  
ATOM 526    C C   . TRP A 1 126 ? 54.110  27.743  -28.632 1.00 0.00 ? 126 TRP A C   1  
ATOM 527    O O   . TRP A 1 126 ? 54.338  27.781  -27.416 1.00 0.00 ? 126 TRP A O   1  
ATOM 528    C CB  . TRP A 1 126 ? 52.941  29.933  -29.506 1.00 0.00 ? 126 TRP A CB  1  
ATOM 529    C CG  . TRP A 1 126 ? 53.295  31.352  -29.972 1.00 0.00 ? 126 TRP A CG  1  
ATOM 530    C CD1 . TRP A 1 126 ? 54.425  31.770  -30.547 1.00 0.00 ? 126 TRP A CD1 1  
ATOM 531    C CD2 . TRP A 1 126 ? 52.565  32.507  -29.596 1.00 0.00 ? 126 TRP A CD2 1  
ATOM 532    N NE1 . TRP A 1 126 ? 54.512  33.165  -30.532 1.00 0.00 ? 126 TRP A NE1 1  
ATOM 533    C CE2 . TRP A 1 126 ? 53.326  33.655  -30.012 1.00 0.00 ? 126 TRP A CE2 1  
ATOM 534    C CE3 . TRP A 1 126 ? 51.326  32.678  -28.967 1.00 0.00 ? 126 TRP A CE3 1  
ATOM 535    C CZ2 . TRP A 1 126 ? 52.905  34.963  -29.818 1.00 0.00 ? 126 TRP A CZ2 1  
ATOM 536    C CZ3 . TRP A 1 126 ? 50.923  34.006  -28.680 1.00 0.00 ? 126 TRP A CZ3 1  
ATOM 537    C CH2 . TRP A 1 126 ? 51.678  35.098  -29.127 1.00 0.00 ? 126 TRP A CH2 1  
ATOM 538    N N   . SER A 1 127 ? 53.739  26.507  -29.185 1.00 0.00 ? 127 SER A N   1  
ATOM 539    C CA  . SER A 1 127 ? 53.613  25.222  -28.429 1.00 0.00 ? 127 SER A CA  1  
ATOM 540    C C   . SER A 1 127 ? 54.885  24.455  -28.488 1.00 0.00 ? 127 SER A C   1  
ATOM 541    O O   . SER A 1 127 ? 55.703  24.593  -29.441 1.00 0.00 ? 127 SER A O   1  
ATOM 542    C CB  . SER A 1 127 ? 52.546  24.294  -28.952 1.00 0.00 ? 127 SER A CB  1  
ATOM 543    O OG  . SER A 1 127 ? 51.243  24.846  -28.664 1.00 0.00 ? 127 SER A OG  1  
ATOM 544    N N   . ASP A 1 128 ? 55.046  23.624  -27.396 1.00 0.00 ? 128 ASP A N   1  
ATOM 545    C CA  . ASP A 1 128 ? 56.124  22.695  -27.164 1.00 0.00 ? 128 ASP A CA  1  
ATOM 546    C C   . ASP A 1 128 ? 57.405  23.420  -26.887 1.00 0.00 ? 128 ASP A C   1  
ATOM 547    O O   . ASP A 1 128 ? 58.457  22.851  -26.973 1.00 0.00 ? 128 ASP A O   1  
ATOM 548    C CB  . ASP A 1 128 ? 56.410  21.718  -28.382 1.00 0.00 ? 128 ASP A CB  1  
ATOM 549    C CG  . ASP A 1 128 ? 55.186  20.913  -28.731 1.00 0.00 ? 128 ASP A CG  1  
ATOM 550    O OD1 . ASP A 1 128 ? 54.703  20.147  -27.886 1.00 0.00 ? 128 ASP A OD1 1  
ATOM 551    O OD2 . ASP A 1 128 ? 54.613  21.165  -29.866 1.00 0.00 ? 128 ASP A OD2 1  
ATOM 552    N N   . THR A 1 129 ? 57.356  24.727  -26.483 1.00 0.00 ? 129 THR A N   1  
ATOM 553    C CA  . THR A 1 129 ? 58.583  25.361  -26.267 1.00 0.00 ? 129 THR A CA  1  
ATOM 554    C C   . THR A 1 129 ? 58.141  26.629  -25.589 1.00 0.00 ? 129 THR A C   1  
ATOM 555    O O   . THR A 1 129 ? 56.988  26.780  -25.307 1.00 0.00 ? 129 THR A O   1  
ATOM 556    C CB  . THR A 1 129 ? 59.514  25.558  -27.468 1.00 0.00 ? 129 THR A CB  1  
ATOM 557    O OG1 . THR A 1 129 ? 60.818  25.986  -27.031 1.00 0.00 ? 129 THR A OG1 1  
ATOM 558    C CG2 . THR A 1 129 ? 58.895  26.492  -28.553 1.00 0.00 ? 129 THR A CG2 1  
ATOM 559    N N   . SER A 1 130 ? 59.061  27.382  -24.995 1.00 0.00 ? 130 SER A N   1  
ATOM 560    C CA  . SER A 1 130 ? 58.783  28.509  -24.063 1.00 0.00 ? 130 SER A CA  1  
ATOM 561    C C   . SER A 1 130 ? 59.573  29.666  -24.727 1.00 0.00 ? 130 SER A C   1  
ATOM 562    O O   . SER A 1 130 ? 60.679  29.446  -25.223 1.00 0.00 ? 130 SER A O   1  
ATOM 563    C CB  . SER A 1 130 ? 59.371  28.235  -22.671 1.00 0.00 ? 130 SER A CB  1  
ATOM 564    O OG  . SER A 1 130 ? 59.011  26.989  -22.156 1.00 0.00 ? 130 SER A OG  1  
ATOM 565    N N   . PHE A 1 131 ? 58.914  30.858  -24.712 1.00 0.00 ? 131 PHE A N   1  
ATOM 566    C CA  . PHE A 1 131 ? 59.381  32.170  -25.054 1.00 0.00 ? 131 PHE A CA  1  
ATOM 567    C C   . PHE A 1 131 ? 58.748  33.072  -24.090 1.00 0.00 ? 131 PHE A C   1  
ATOM 568    O O   . PHE A 1 131 ? 59.178  34.144  -23.666 1.00 0.00 ? 131 PHE A O   1  
ATOM 569    C CB  . PHE A 1 131 ? 58.961  32.669  -26.471 1.00 0.00 ? 131 PHE A CB  1  
ATOM 570    C CG  . PHE A 1 131 ? 59.715  31.959  -27.513 1.00 0.00 ? 131 PHE A CG  1  
ATOM 571    C CD1 . PHE A 1 131 ? 60.923  32.371  -27.987 1.00 0.00 ? 131 PHE A CD1 1  
ATOM 572    C CD2 . PHE A 1 131 ? 58.991  30.973  -28.234 1.00 0.00 ? 131 PHE A CD2 1  
ATOM 573    C CE1 . PHE A 1 131 ? 61.526  31.707  -29.076 1.00 0.00 ? 131 PHE A CE1 1  
ATOM 574    C CE2 . PHE A 1 131 ? 59.638  30.215  -29.229 1.00 0.00 ? 131 PHE A CE2 1  
ATOM 575    C CZ  . PHE A 1 131 ? 60.874  30.577  -29.753 1.00 0.00 ? 131 PHE A CZ  1  
ATOM 576    N N   . GLY A 1 132 ? 57.586  32.730  -23.468 1.00 0.00 ? 132 GLY A N   1  
ATOM 577    C CA  . GLY A 1 132 ? 56.916  33.525  -22.513 1.00 0.00 ? 132 GLY A CA  1  
ATOM 578    C C   . GLY A 1 132 ? 55.960  32.547  -21.966 1.00 0.00 ? 132 GLY A C   1  
ATOM 579    O O   . GLY A 1 132 ? 55.449  31.705  -22.745 1.00 0.00 ? 132 GLY A O   1  
ATOM 580    N N   . MET A 1 133 ? 55.557  32.541  -20.640 1.00 0.00 ? 133 MET A N   1  
ATOM 581    C CA  . MET A 1 133 ? 54.538  31.648  -20.132 1.00 0.00 ? 133 MET A CA  1  
ATOM 582    C C   . MET A 1 133 ? 53.195  31.944  -20.767 1.00 0.00 ? 133 MET A C   1  
ATOM 583    O O   . MET A 1 133 ? 52.412  31.025  -21.136 1.00 0.00 ? 133 MET A O   1  
ATOM 584    C CB  . MET A 1 133 ? 54.442  31.776  -18.560 1.00 0.00 ? 133 MET A CB  1  
ATOM 585    C CG  . MET A 1 133 ? 55.636  31.473  -17.722 1.00 0.00 ? 133 MET A CG  1  
ATOM 586    S SD  . MET A 1 133 ? 55.391  31.666  -15.885 1.00 0.00 ? 133 MET A SD  1  
ATOM 587    C CE  . MET A 1 133 ? 53.794  30.912  -15.545 1.00 0.00 ? 133 MET A CE  1  
ATOM 588    N N   . VAL A 1 134 ? 52.930  33.268  -20.974 1.00 0.00 ? 134 VAL A N   1  
ATOM 589    C CA  . VAL A 1 134 ? 51.732  33.906  -21.479 1.00 0.00 ? 134 VAL A CA  1  
ATOM 590    C C   . VAL A 1 134 ? 51.448  33.495  -22.855 1.00 0.00 ? 134 VAL A C   1  
ATOM 591    O O   . VAL A 1 134 ? 50.310  33.210  -23.126 1.00 0.00 ? 134 VAL A O   1  
ATOM 592    C CB  . VAL A 1 134 ? 51.610  35.422  -21.237 1.00 0.00 ? 134 VAL A CB  1  
ATOM 593    C CG1 . VAL A 1 134 ? 51.340  35.711  -19.742 1.00 0.00 ? 134 VAL A CG1 1  
ATOM 594    C CG2 . VAL A 1 134 ? 52.899  36.126  -21.747 1.00 0.00 ? 134 VAL A CG2 1  
ATOM 595    N N   . LEU A 1 135 ? 52.444  33.408  -23.692 1.00 0.00 ? 135 LEU A N   1  
ATOM 596    C CA  . LEU A 1 135 ? 52.434  33.040  -25.097 1.00 0.00 ? 135 LEU A CA  1  
ATOM 597    C C   . LEU A 1 135 ? 51.951  31.634  -25.244 1.00 0.00 ? 135 LEU A C   1  
ATOM 598    O O   . LEU A 1 135 ? 51.094  31.330  -26.096 1.00 0.00 ? 135 LEU A O   1  
ATOM 599    C CB  . LEU A 1 135 ? 53.794  33.222  -25.865 1.00 0.00 ? 135 LEU A CB  1  
ATOM 600    C CG  . LEU A 1 135 ? 54.483  34.577  -25.521 1.00 0.00 ? 135 LEU A CG  1  
ATOM 601    C CD1 . LEU A 1 135 ? 55.837  34.736  -26.137 1.00 0.00 ? 135 LEU A CD1 1  
ATOM 602    C CD2 . LEU A 1 135 ? 53.490  35.755  -25.849 1.00 0.00 ? 135 LEU A CD2 1  
ATOM 603    N N   . GLN A 1 136 ? 52.388  30.759  -24.368 1.00 0.00 ? 136 GLN A N   1  
ATOM 604    C CA  . GLN A 1 136 ? 51.974  29.345  -24.439 1.00 0.00 ? 136 GLN A CA  1  
ATOM 605    C C   . GLN A 1 136 ? 50.504  29.086  -24.266 1.00 0.00 ? 136 GLN A C   1  
ATOM 606    O O   . GLN A 1 136 ? 49.851  28.447  -25.039 1.00 0.00 ? 136 GLN A O   1  
ATOM 607    C CB  . GLN A 1 136 ? 52.808  28.426  -23.456 1.00 0.00 ? 136 GLN A CB  1  
ATOM 608    C CG  . GLN A 1 136 ? 54.330  28.550  -23.731 1.00 0.00 ? 136 GLN A CG  1  
ATOM 609    C CD  . GLN A 1 136 ? 55.003  27.548  -22.939 1.00 0.00 ? 136 GLN A CD  1  
ATOM 610    O OE1 . GLN A 1 136 ? 54.774  26.357  -23.167 1.00 0.00 ? 136 GLN A OE1 1  
ATOM 611    N NE2 . GLN A 1 136 ? 55.760  28.076  -21.939 1.00 0.00 ? 136 GLN A NE2 1  
ATOM 612    N N   . ARG A 1 137 ? 49.954  29.757  -23.261 1.00 0.00 ? 137 ARG A N   1  
ATOM 613    C CA  . ARG A 1 137 ? 48.527  29.751  -22.833 1.00 0.00 ? 137 ARG A CA  1  
ATOM 614    C C   . ARG A 1 137 ? 47.667  30.362  -23.918 1.00 0.00 ? 137 ARG A C   1  
ATOM 615    O O   . ARG A 1 137 ? 46.552  29.841  -24.141 1.00 0.00 ? 137 ARG A O   1  
ATOM 616    C CB  . ARG A 1 137 ? 48.194  30.588  -21.548 1.00 0.00 ? 137 ARG A CB  1  
ATOM 617    C CG  . ARG A 1 137 ? 48.985  30.132  -20.285 1.00 0.00 ? 137 ARG A CG  1  
ATOM 618    C CD  . ARG A 1 137 ? 48.977  31.117  -19.076 1.00 0.00 ? 137 ARG A CD  1  
ATOM 619    N NE  . ARG A 1 137 ? 49.966  30.470  -18.155 1.00 0.00 ? 137 ARG A NE  1  
ATOM 620    C CZ  . ARG A 1 137 ? 49.800  30.251  -16.791 1.00 0.00 ? 137 ARG A CZ  1  
ATOM 621    N NH1 . ARG A 1 137 ? 48.672  30.610  -16.156 1.00 0.00 ? 137 ARG A NH1 1  
ATOM 622    N NH2 . ARG A 1 137 ? 50.793  29.571  -16.136 1.00 0.00 ? 137 ARG A NH2 1  
ATOM 623    N N   . PHE A 1 138 ? 48.188  31.495  -24.559 1.00 0.00 ? 138 PHE A N   1  
ATOM 624    C CA  . PHE A 1 138 ? 47.386  32.201  -25.540 1.00 0.00 ? 138 PHE A CA  1  
ATOM 625    C C   . PHE A 1 138 ? 47.179  31.203  -26.757 1.00 0.00 ? 138 PHE A C   1  
ATOM 626    O O   . PHE A 1 138 ? 45.960  31.087  -27.162 1.00 0.00 ? 138 PHE A O   1  
ATOM 627    C CB  . PHE A 1 138 ? 48.190  33.372  -26.172 1.00 0.00 ? 138 PHE A CB  1  
ATOM 628    C CG  . PHE A 1 138 ? 47.862  34.626  -25.496 1.00 0.00 ? 138 PHE A CG  1  
ATOM 629    C CD1 . PHE A 1 138 ? 46.556  35.025  -25.353 1.00 0.00 ? 138 PHE A CD1 1  
ATOM 630    C CD2 . PHE A 1 138 ? 48.905  35.462  -25.093 1.00 0.00 ? 138 PHE A CD2 1  
ATOM 631    C CE1 . PHE A 1 138 ? 46.298  36.299  -24.842 1.00 0.00 ? 138 PHE A CE1 1  
ATOM 632    C CE2 . PHE A 1 138 ? 48.653  36.758  -24.678 1.00 0.00 ? 138 PHE A CE2 1  
ATOM 633    C CZ  . PHE A 1 138 ? 47.337  37.195  -24.473 1.00 0.00 ? 138 PHE A CZ  1  
ATOM 634    N N   . ALA A 1 139 ? 48.210  30.533  -27.248 1.00 0.00 ? 139 ALA A N   1  
ATOM 635    C CA  . ALA A 1 139 ? 48.206  29.594  -28.390 1.00 0.00 ? 139 ALA A CA  1  
ATOM 636    C C   . ALA A 1 139 ? 47.375  28.399  -28.222 1.00 0.00 ? 139 ALA A C   1  
ATOM 637    O O   . ALA A 1 139 ? 46.648  28.093  -29.094 1.00 0.00 ? 139 ALA A O   1  
ATOM 638    C CB  . ALA A 1 139 ? 49.574  29.034  -28.729 1.00 0.00 ? 139 ALA A CB  1  
ATOM 639    N N   . TYR A 1 140 ? 47.420  27.787  -26.984 1.00 0.00 ? 140 TYR A N   1  
ATOM 640    C CA  . TYR A 1 140 ? 46.629  26.638  -26.805 1.00 0.00 ? 140 TYR A CA  1  
ATOM 641    C C   . TYR A 1 140 ? 45.114  26.800  -26.861 1.00 0.00 ? 140 TYR A C   1  
ATOM 642    O O   . TYR A 1 140 ? 44.317  26.164  -27.543 1.00 0.00 ? 140 TYR A O   1  
ATOM 643    C CB  . TYR A 1 140 ? 46.987  25.870  -25.508 1.00 0.00 ? 140 TYR A CB  1  
ATOM 644    C CG  . TYR A 1 140 ? 46.137  24.640  -25.127 1.00 0.00 ? 140 TYR A CG  1  
ATOM 645    C CD1 . TYR A 1 140 ? 45.722  23.837  -26.163 1.00 0.00 ? 140 TYR A CD1 1  
ATOM 646    C CD2 . TYR A 1 140 ? 45.660  24.421  -23.818 1.00 0.00 ? 140 TYR A CD2 1  
ATOM 647    C CE1 . TYR A 1 140 ? 44.748  22.864  -26.046 1.00 0.00 ? 140 TYR A CE1 1  
ATOM 648    C CE2 . TYR A 1 140 ? 44.676  23.411  -23.572 1.00 0.00 ? 140 TYR A CE2 1  
ATOM 649    C CZ  . TYR A 1 140 ? 44.226  22.631  -24.695 1.00 0.00 ? 140 TYR A CZ  1  
ATOM 650    O OH  . TYR A 1 140 ? 43.305  21.587  -24.480 1.00 0.00 ? 140 TYR A OH  1  
ATOM 651    N N   . GLU A 1 141 ? 44.709  27.944  -26.170 1.00 0.00 ? 141 GLU A N   1  
ATOM 652    C CA  . GLU A 1 141 ? 43.364  28.451  -26.169 1.00 0.00 ? 141 GLU A CA  1  
ATOM 653    C C   . GLU A 1 141 ? 42.923  28.922  -27.517 1.00 0.00 ? 141 GLU A C   1  
ATOM 654    O O   . GLU A 1 141 ? 41.803  28.554  -27.833 1.00 0.00 ? 141 GLU A O   1  
ATOM 655    C CB  . GLU A 1 141 ? 43.150  29.680  -25.276 1.00 0.00 ? 141 GLU A CB  1  
ATOM 656    C CG  . GLU A 1 141 ? 43.190  29.418  -23.753 1.00 0.00 ? 141 GLU A CG  1  
ATOM 657    C CD  . GLU A 1 141 ? 43.233  30.759  -22.976 1.00 0.00 ? 141 GLU A CD  1  
ATOM 658    O OE1 . GLU A 1 141 ? 44.348  31.383  -22.904 1.00 0.00 ? 141 GLU A OE1 1  
ATOM 659    O OE2 . GLU A 1 141 ? 42.210  31.033  -22.322 1.00 0.00 ? 141 GLU A OE2 1  
ATOM 660    N N   . ILE A 1 142 ? 43.682  29.681  -28.323 1.00 0.00 ? 142 ILE A N   1  
ATOM 661    C CA  . ILE A 1 142 ? 43.219  30.267  -29.532 1.00 0.00 ? 142 ILE A CA  1  
ATOM 662    C C   . ILE A 1 142 ? 42.807  29.209  -30.525 1.00 0.00 ? 142 ILE A C   1  
ATOM 663    O O   . ILE A 1 142 ? 41.741  29.189  -31.107 1.00 0.00 ? 142 ILE A O   1  
ATOM 664    C CB  . ILE A 1 142 ? 44.246  31.213  -30.138 1.00 0.00 ? 142 ILE A CB  1  
ATOM 665    C CG1 . ILE A 1 142 ? 44.366  32.536  -29.278 1.00 0.00 ? 142 ILE A CG1 1  
ATOM 666    C CG2 . ILE A 1 142 ? 43.877  31.420  -31.659 1.00 0.00 ? 142 ILE A CG2 1  
ATOM 667    C CD1 . ILE A 1 142 ? 45.385  33.549  -29.825 1.00 0.00 ? 142 ILE A CD1 1  
ATOM 668    N N   . ARG A 1 143 ? 43.708  28.204  -30.643 1.00 0.00 ? 143 ARG A N   1  
ATOM 669    C CA  . ARG A 1 143 ? 43.566  27.097  -31.545 1.00 0.00 ? 143 ARG A CA  1  
ATOM 670    C C   . ARG A 1 143 ? 42.372  26.263  -31.204 1.00 0.00 ? 143 ARG A C   1  
ATOM 671    O O   . ARG A 1 143 ? 41.625  25.860  -32.120 1.00 0.00 ? 143 ARG A O   1  
ATOM 672    C CB  . ARG A 1 143 ? 44.744  26.156  -31.844 1.00 0.00 ? 143 ARG A CB  1  
ATOM 673    C CG  . ARG A 1 143 ? 44.566  25.285  -33.165 1.00 0.00 ? 143 ARG A CG  1  
ATOM 674    C CD  . ARG A 1 143 ? 45.765  24.417  -33.663 1.00 0.00 ? 143 ARG A CD  1  
ATOM 675    N NE  . ARG A 1 143 ? 45.202  23.482  -34.688 1.00 0.00 ? 143 ARG A NE  1  
ATOM 676    C CZ  . ARG A 1 143 ? 45.714  22.278  -35.031 1.00 0.00 ? 143 ARG A CZ  1  
ATOM 677    N NH1 . ARG A 1 143 ? 46.970  21.857  -34.581 1.00 0.00 ? 143 ARG A NH1 1  
ATOM 678    N NH2 . ARG A 1 143 ? 45.025  21.474  -35.855 1.00 0.00 ? 143 ARG A NH2 1  
ATOM 679    N N   . ARG A 1 144 ? 42.218  26.024  -29.921 1.00 0.00 ? 144 ARG A N   1  
ATOM 680    C CA  . ARG A 1 144 ? 41.196  25.186  -29.534 1.00 0.00 ? 144 ARG A CA  1  
ATOM 681    C C   . ARG A 1 144 ? 39.777  25.582  -29.820 1.00 0.00 ? 144 ARG A C   1  
ATOM 682    O O   . ARG A 1 144 ? 39.064  24.857  -30.488 1.00 0.00 ? 144 ARG A O   1  
ATOM 683    C CB  . ARG A 1 144 ? 41.274  24.997  -27.975 1.00 0.00 ? 144 ARG A CB  1  
ATOM 684    C CG  . ARG A 1 144 ? 40.310  23.920  -27.524 1.00 0.00 ? 144 ARG A CG  1  
ATOM 685    C CD  . ARG A 1 144 ? 40.391  23.626  -26.080 1.00 0.00 ? 144 ARG A CD  1  
ATOM 686    N NE  . ARG A 1 144 ? 40.520  24.876  -25.250 1.00 0.00 ? 144 ARG A NE  1  
ATOM 687    C CZ  . ARG A 1 144 ? 40.982  24.854  -23.923 1.00 0.00 ? 144 ARG A CZ  1  
ATOM 688    N NH1 . ARG A 1 144 ? 41.156  23.641  -23.377 1.00 0.00 ? 144 ARG A NH1 1  
ATOM 689    N NH2 . ARG A 1 144 ? 41.152  26.007  -23.236 1.00 0.00 ? 144 ARG A NH2 1  
ATOM 690    N N   . PHE A 1 145 ? 39.516  26.887  -29.544 1.00 0.00 ? 145 PHE A N   1  
ATOM 691    C CA  . PHE A 1 145 ? 38.235  27.396  -29.888 1.00 0.00 ? 145 PHE A CA  1  
ATOM 692    C C   . PHE A 1 145 ? 38.000  27.448  -31.363 1.00 0.00 ? 145 PHE A C   1  
ATOM 693    O O   . PHE A 1 145 ? 36.952  27.019  -31.825 1.00 0.00 ? 145 PHE A O   1  
ATOM 694    C CB  . PHE A 1 145 ? 38.048  28.766  -29.187 1.00 0.00 ? 145 PHE A CB  1  
ATOM 695    C CG  . PHE A 1 145 ? 38.017  28.754  -27.669 1.00 0.00 ? 145 PHE A CG  1  
ATOM 696    C CD1 . PHE A 1 145 ? 37.123  27.955  -26.940 1.00 0.00 ? 145 PHE A CD1 1  
ATOM 697    C CD2 . PHE A 1 145 ? 38.899  29.593  -26.917 1.00 0.00 ? 145 PHE A CD2 1  
ATOM 698    C CE1 . PHE A 1 145 ? 37.028  27.952  -25.612 1.00 0.00 ? 145 PHE A CE1 1  
ATOM 699    C CE2 . PHE A 1 145 ? 38.894  29.584  -25.524 1.00 0.00 ? 145 PHE A CE2 1  
ATOM 700    C CZ  . PHE A 1 145 ? 37.852  28.798  -24.836 1.00 0.00 ? 145 PHE A CZ  1  
ATOM 701    N N   . LEU A 1 146 ? 38.983  27.957  -32.157 1.00 0.00 ? 146 LEU A N   1  
ATOM 702    C CA  . LEU A 1 146 ? 38.756  28.195  -33.521 1.00 0.00 ? 146 LEU A CA  1  
ATOM 703    C C   . LEU A 1 146 ? 38.470  26.955  -34.351 1.00 0.00 ? 146 LEU A C   1  
ATOM 704    O O   . LEU A 1 146 ? 37.474  26.924  -35.089 1.00 0.00 ? 146 LEU A O   1  
ATOM 705    C CB  . LEU A 1 146 ? 39.975  29.048  -34.077 1.00 0.00 ? 146 LEU A CB  1  
ATOM 706    C CG  . LEU A 1 146 ? 40.073  30.492  -33.555 1.00 0.00 ? 146 LEU A CG  1  
ATOM 707    C CD1 . LEU A 1 146 ? 40.821  31.394  -34.537 1.00 0.00 ? 146 LEU A CD1 1  
ATOM 708    C CD2 . LEU A 1 146 ? 38.808  31.223  -33.024 1.00 0.00 ? 146 LEU A CD2 1  
ATOM 709    N N   . GLU A 1 147 ? 39.232  25.910  -34.049 1.00 0.00 ? 147 GLU A N   1  
ATOM 710    C CA  . GLU A 1 147 ? 39.139  24.613  -34.703 1.00 0.00 ? 147 GLU A CA  1  
ATOM 711    C C   . GLU A 1 147 ? 37.847  23.991  -34.449 1.00 0.00 ? 147 GLU A C   1  
ATOM 712    O O   . GLU A 1 147 ? 37.258  23.481  -35.358 1.00 0.00 ? 147 GLU A O   1  
ATOM 713    C CB  . GLU A 1 147 ? 40.284  23.697  -34.068 1.00 0.00 ? 147 GLU A CB  1  
ATOM 714    C CG  . GLU A 1 147 ? 40.390  22.248  -34.555 1.00 0.00 ? 147 GLU A CG  1  
ATOM 715    C CD  . GLU A 1 147 ? 40.710  22.022  -36.043 1.00 0.00 ? 147 GLU A CD  1  
ATOM 716    O OE1 . GLU A 1 147 ? 39.797  22.333  -36.862 1.00 0.00 ? 147 GLU A OE1 1  
ATOM 717    O OE2 . GLU A 1 147 ? 41.806  21.450  -36.319 1.00 0.00 ? 147 GLU A OE2 1  
ATOM 718    N N   . ASP A 1 148 ? 37.376  24.147  -33.145 1.00 0.00 ? 148 ASP A N   1  
ATOM 719    C CA  . ASP A 1 148 ? 36.184  23.466  -32.684 1.00 0.00 ? 148 ASP A CA  1  
ATOM 720    C C   . ASP A 1 148 ? 34.928  23.906  -33.454 1.00 0.00 ? 148 ASP A C   1  
ATOM 721    O O   . ASP A 1 148 ? 34.197  23.107  -34.025 1.00 0.00 ? 148 ASP A O   1  
ATOM 722    C CB  . ASP A 1 148 ? 35.811  23.742  -31.219 1.00 0.00 ? 148 ASP A CB  1  
ATOM 723    C CG  . ASP A 1 148 ? 36.780  23.052  -30.269 1.00 0.00 ? 148 ASP A CG  1  
ATOM 724    O OD1 . ASP A 1 148 ? 37.497  22.118  -30.761 1.00 0.00 ? 148 ASP A OD1 1  
ATOM 725    O OD2 . ASP A 1 148 ? 36.843  23.383  -29.024 1.00 0.00 ? 148 ASP A OD2 1  
ATOM 726    N N   . VAL A 1 149 ? 34.865  25.249  -33.639 1.00 0.00 ? 149 VAL A N   1  
ATOM 727    C CA  . VAL A 1 149 ? 33.817  25.872  -34.310 1.00 0.00 ? 149 VAL A CA  1  
ATOM 728    C C   . VAL A 1 149 ? 33.769  25.424  -35.752 1.00 0.00 ? 149 VAL A C   1  
ATOM 729    O O   . VAL A 1 149 ? 32.760  24.870  -36.185 1.00 0.00 ? 149 VAL A O   1  
ATOM 730    C CB  . VAL A 1 149 ? 33.917  27.456  -34.215 1.00 0.00 ? 149 VAL A CB  1  
ATOM 731    C CG1 . VAL A 1 149 ? 32.810  28.102  -35.044 1.00 0.00 ? 149 VAL A CG1 1  
ATOM 732    C CG2 . VAL A 1 149 ? 33.750  27.880  -32.731 1.00 0.00 ? 149 VAL A CG2 1  
ATOM 733    N N   . TYR A 1 150 ? 34.897  25.510  -36.430 1.00 0.00 ? 150 TYR A N   1  
ATOM 734    C CA  . TYR A 1 150 ? 35.031  25.291  -37.853 1.00 0.00 ? 150 TYR A CA  1  
ATOM 735    C C   . TYR A 1 150 ? 34.738  23.870  -38.194 1.00 0.00 ? 150 TYR A C   1  
ATOM 736    O O   . TYR A 1 150 ? 33.872  23.684  -39.077 1.00 0.00 ? 150 TYR A O   1  
ATOM 737    C CB  . TYR A 1 150 ? 36.509  25.522  -38.329 1.00 0.00 ? 150 TYR A CB  1  
ATOM 738    C CG  . TYR A 1 150 ? 36.945  24.931  -39.694 1.00 0.00 ? 150 TYR A CG  1  
ATOM 739    C CD1 . TYR A 1 150 ? 36.257  25.104  -40.882 1.00 0.00 ? 150 TYR A CD1 1  
ATOM 740    C CD2 . TYR A 1 150 ? 38.077  24.120  -39.660 1.00 0.00 ? 150 TYR A CD2 1  
ATOM 741    C CE1 . TYR A 1 150 ? 36.722  24.534  -42.095 1.00 0.00 ? 150 TYR A CE1 1  
ATOM 742    C CE2 . TYR A 1 150 ? 38.634  23.595  -40.796 1.00 0.00 ? 150 TYR A CE2 1  
ATOM 743    C CZ  . TYR A 1 150 ? 37.938  23.788  -41.975 1.00 0.00 ? 150 TYR A CZ  1  
ATOM 744    O OH  . TYR A 1 150 ? 38.518  23.309  -43.163 1.00 0.00 ? 150 TYR A OH  1  
ATOM 745    N N   . LEU A 1 151 ? 35.290  22.870  -37.488 1.00 0.00 ? 151 LEU A N   1  
ATOM 746    C CA  . LEU A 1 151 ? 35.045  21.494  -37.819 1.00 0.00 ? 151 LEU A CA  1  
ATOM 747    C C   . LEU A 1 151 ? 33.583  21.222  -37.594 1.00 0.00 ? 151 LEU A C   1  
ATOM 748    O O   . LEU A 1 151 ? 33.001  20.559  -38.441 1.00 0.00 ? 151 LEU A O   1  
ATOM 749    C CB  . LEU A 1 151 ? 35.982  20.445  -37.204 1.00 0.00 ? 151 LEU A CB  1  
ATOM 750    C CG  . LEU A 1 151 ? 36.035  20.278  -35.690 1.00 0.00 ? 151 LEU A CG  1  
ATOM 751    C CD1 . LEU A 1 151 ? 34.992  19.341  -35.148 1.00 0.00 ? 151 LEU A CD1 1  
ATOM 752    C CD2 . LEU A 1 151 ? 37.492  20.025  -35.147 1.00 0.00 ? 151 LEU A CD2 1  
ATOM 753    N N   . LYS A 1 152 ? 32.906  21.687  -36.465 1.00 0.00 ? 152 LYS A N   1  
ATOM 754    C CA  . LYS A 1 152 ? 31.603  21.200  -36.063 1.00 0.00 ? 152 LYS A CA  1  
ATOM 755    C C   . LYS A 1 152 ? 30.608  21.613  -37.133 1.00 0.00 ? 152 LYS A C   1  
ATOM 756    O O   . LYS A 1 152 ? 29.903  20.740  -37.653 1.00 0.00 ? 152 LYS A O   1  
ATOM 757    C CB  . LYS A 1 152 ? 31.068  21.755  -34.727 1.00 0.00 ? 152 LYS A CB  1  
ATOM 758    C CG  . LYS A 1 152 ? 31.742  21.060  -33.544 1.00 0.00 ? 152 LYS A CG  1  
ATOM 759    C CD  . LYS A 1 152 ? 31.676  21.760  -32.142 1.00 0.00 ? 152 LYS A CD  1  
ATOM 760    C CE  . LYS A 1 152 ? 32.606  21.200  -31.121 1.00 0.00 ? 152 LYS A CE  1  
ATOM 761    N NZ  . LYS A 1 152 ? 32.591  19.764  -31.002 1.00 0.00 ? 152 LYS A NZ  1  
ATOM 762    N N   . THR A 1 153 ? 30.622  22.903  -37.554 1.00 0.00 ? 153 THR A N   1  
ATOM 763    C CA  . THR A 1 153 ? 29.655  23.512  -38.463 1.00 0.00 ? 153 THR A CA  1  
ATOM 764    C C   . THR A 1 153 ? 29.835  22.872  -39.884 1.00 0.00 ? 153 THR A C   1  
ATOM 765    O O   . THR A 1 153 ? 28.879  22.485  -40.545 1.00 0.00 ? 153 THR A O   1  
ATOM 766    C CB  . THR A 1 153 ? 29.700  25.040  -38.560 1.00 0.00 ? 153 THR A CB  1  
ATOM 767    O OG1 . THR A 1 153 ? 28.574  25.352  -39.405 1.00 0.00 ? 153 THR A OG1 1  
ATOM 768    C CG2 . THR A 1 153 ? 31.021  25.705  -39.043 1.00 0.00 ? 153 THR A CG2 1  
ATOM 769    N N   . LEU A 1 154 ? 31.149  22.784  -40.237 1.00 0.00 ? 154 LEU A N   1  
ATOM 770    C CA  . LEU A 1 154 ? 31.476  22.396  -41.603 1.00 0.00 ? 154 LEU A CA  1  
ATOM 771    C C   . LEU A 1 154 ? 31.101  20.946  -41.832 1.00 0.00 ? 154 LEU A C   1  
ATOM 772    O O   . LEU A 1 154 ? 30.577  20.580  -42.863 1.00 0.00 ? 154 LEU A O   1  
ATOM 773    C CB  . LEU A 1 154 ? 32.987  22.535  -42.020 1.00 0.00 ? 154 LEU A CB  1  
ATOM 774    C CG  . LEU A 1 154 ? 33.376  21.947  -43.419 1.00 0.00 ? 154 LEU A CG  1  
ATOM 775    C CD1 . LEU A 1 154 ? 32.699  22.827  -44.504 1.00 0.00 ? 154 LEU A CD1 1  
ATOM 776    C CD2 . LEU A 1 154 ? 34.894  22.015  -43.618 1.00 0.00 ? 154 LEU A CD2 1  
ATOM 777    N N   . VAL A 1 155 ? 31.427  20.043  -40.809 1.00 0.00 ? 155 VAL A N   1  
ATOM 778    C CA  . VAL A 1 155 ? 31.375  18.572  -41.053 1.00 0.00 ? 155 VAL A CA  1  
ATOM 779    C C   . VAL A 1 155 ? 29.917  18.246  -41.297 1.00 0.00 ? 155 VAL A C   1  
ATOM 780    O O   . VAL A 1 155 ? 29.495  17.536  -42.196 1.00 0.00 ? 155 VAL A O   1  
ATOM 781    C CB  . VAL A 1 155 ? 31.830  17.540  -39.948 1.00 0.00 ? 155 VAL A CB  1  
ATOM 782    C CG1 . VAL A 1 155 ? 31.606  16.005  -40.324 1.00 0.00 ? 155 VAL A CG1 1  
ATOM 783    C CG2 . VAL A 1 155 ? 33.316  17.723  -39.684 1.00 0.00 ? 155 VAL A CG2 1  
ATOM 784    N N   . GLU A 1 156 ? 29.023  18.866  -40.417 1.00 0.00 ? 156 GLU A N   1  
ATOM 785    C CA  . GLU A 1 156 ? 27.540  18.755  -40.361 1.00 0.00 ? 156 GLU A CA  1  
ATOM 786    C C   . GLU A 1 156 ? 26.876  19.312  -41.581 1.00 0.00 ? 156 GLU A C   1  
ATOM 787    O O   . GLU A 1 156 ? 25.971  18.721  -42.223 1.00 0.00 ? 156 GLU A O   1  
ATOM 788    C CB  . GLU A 1 156 ? 27.007  19.590  -39.159 1.00 0.00 ? 156 GLU A CB  1  
ATOM 789    C CG  . GLU A 1 156 ? 25.462  19.521  -38.832 1.00 0.00 ? 156 GLU A CG  1  
ATOM 790    C CD  . GLU A 1 156 ? 24.553  20.341  -39.793 1.00 0.00 ? 156 GLU A CD  1  
ATOM 791    O OE1 . GLU A 1 156 ? 24.792  21.588  -39.955 1.00 0.00 ? 156 GLU A OE1 1  
ATOM 792    O OE2 . GLU A 1 156 ? 23.629  19.707  -40.366 1.00 0.00 ? 156 GLU A OE2 1  
ATOM 793    N N   . ARG A 1 157 ? 27.335  20.472  -42.065 1.00 0.00 ? 157 ARG A N   1  
ATOM 794    C CA  . ARG A 1 157 ? 26.773  21.154  -43.169 1.00 0.00 ? 157 ARG A CA  1  
ATOM 795    C C   . ARG A 1 157 ? 26.932  20.440  -44.457 1.00 0.00 ? 157 ARG A C   1  
ATOM 796    O O   . ARG A 1 157 ? 25.980  20.251  -45.247 1.00 0.00 ? 157 ARG A O   1  
ATOM 797    C CB  . ARG A 1 157 ? 27.256  22.632  -43.257 1.00 0.00 ? 157 ARG A CB  1  
ATOM 798    C CG  . ARG A 1 157 ? 26.443  23.513  -44.172 1.00 0.00 ? 157 ARG A CG  1  
ATOM 799    C CD  . ARG A 1 157 ? 25.107  23.649  -43.594 1.00 0.00 ? 157 ARG A CD  1  
ATOM 800    N NE  . ARG A 1 157 ? 24.373  24.869  -44.081 1.00 0.00 ? 157 ARG A NE  1  
ATOM 801    C CZ  . ARG A 1 157 ? 23.253  25.249  -43.516 1.00 0.00 ? 157 ARG A CZ  1  
ATOM 802    N NH1 . ARG A 1 157 ? 22.676  24.563  -42.537 1.00 0.00 ? 157 ARG A NH1 1  
ATOM 803    N NH2 . ARG A 1 157 ? 22.656  26.404  -44.037 1.00 0.00 ? 157 ARG A NH2 1  
ATOM 804    N N   . LEU A 1 158 ? 28.209  19.874  -44.650 1.00 0.00 ? 158 LEU A N   1  
ATOM 805    C CA  . LEU A 1 158 ? 28.579  19.066  -45.766 1.00 0.00 ? 158 LEU A CA  1  
ATOM 806    C C   . LEU A 1 158 ? 27.860  17.810  -45.836 1.00 0.00 ? 158 LEU A C   1  
ATOM 807    O O   . LEU A 1 158 ? 27.493  17.443  -46.955 1.00 0.00 ? 158 LEU A O   1  
ATOM 808    C CB  . LEU A 1 158 ? 30.129  18.743  -45.888 1.00 0.00 ? 158 LEU A CB  1  
ATOM 809    C CG  . LEU A 1 158 ? 30.594  18.289  -47.350 1.00 0.00 ? 158 LEU A CG  1  
ATOM 810    C CD1 . LEU A 1 158 ? 30.291  19.336  -48.448 1.00 0.00 ? 158 LEU A CD1 1  
ATOM 811    C CD2 . LEU A 1 158 ? 32.097  17.884  -47.270 1.00 0.00 ? 158 LEU A CD2 1  
ATOM 812    N N   . GLU A 1 159 ? 27.632  17.139  -44.686 1.00 0.00 ? 159 GLU A N   1  
ATOM 813    C CA  . GLU A 1 159 ? 26.981  15.809  -44.630 1.00 0.00 ? 159 GLU A CA  1  
ATOM 814    C C   . GLU A 1 159 ? 25.648  15.938  -45.100 1.00 0.00 ? 159 GLU A C   1  
ATOM 815    O O   . GLU A 1 159 ? 25.143  15.003  -45.736 1.00 0.00 ? 159 GLU A O   1  
ATOM 816    C CB  . GLU A 1 159 ? 27.137  14.998  -43.365 1.00 0.00 ? 159 GLU A CB  1  
ATOM 817    C CG  . GLU A 1 159 ? 26.404  15.394  -42.048 1.00 0.00 ? 159 GLU A CG  1  
ATOM 818    C CD  . GLU A 1 159 ? 26.799  14.424  -40.977 1.00 0.00 ? 159 GLU A CD  1  
ATOM 819    O OE1 . GLU A 1 159 ? 28.060  14.305  -40.788 1.00 0.00 ? 159 GLU A OE1 1  
ATOM 820    O OE2 . GLU A 1 159 ? 25.891  13.850  -40.316 1.00 0.00 ? 159 GLU A OE2 1  
ATOM 821    N N   . ARG A 1 160 ? 24.847  17.081  -44.747 1.00 0.00 ? 160 ARG A N   1  
ATOM 822    C CA  . ARG A 1 160 ? 23.434  17.224  -45.035 1.00 0.00 ? 160 ARG A CA  1  
ATOM 823    C C   . ARG A 1 160 ? 23.250  17.284  -46.558 1.00 0.00 ? 160 ARG A C   1  
ATOM 824    O O   . ARG A 1 160 ? 22.287  16.794  -47.175 1.00 0.00 ? 160 ARG A O   1  
ATOM 825    C CB  . ARG A 1 160 ? 23.040  18.624  -44.439 1.00 0.00 ? 160 ARG A CB  1  
ATOM 826    C CG  . ARG A 1 160 ? 21.583  18.999  -44.531 1.00 0.00 ? 160 ARG A CG  1  
ATOM 827    C CD  . ARG A 1 160 ? 20.999  20.407  -44.184 1.00 0.00 ? 160 ARG A CD  1  
ATOM 828    N NE  . ARG A 1 160 ? 21.939  21.471  -44.731 1.00 0.00 ? 160 ARG A NE  1  
ATOM 829    C CZ  . ARG A 1 160 ? 21.636  22.281  -45.867 1.00 0.00 ? 160 ARG A CZ  1  
ATOM 830    N NH1 . ARG A 1 160 ? 20.499  22.185  -46.551 1.00 0.00 ? 160 ARG A NH1 1  
ATOM 831    N NH2 . ARG A 1 160 ? 22.568  23.165  -46.240 1.00 0.00 ? 160 ARG A NH2 1  
ATOM 832    N N   . ASP A 1 161 ? 24.220  18.051  -47.146 1.00 0.00 ? 161 ASP A N   1  
ATOM 833    C CA  . ASP A 1 161 ? 24.210  18.485  -48.591 1.00 0.00 ? 161 ASP A CA  1  
ATOM 834    C C   . ASP A 1 161 ? 24.345  17.281  -49.435 1.00 0.00 ? 161 ASP A C   1  
ATOM 835    O O   . ASP A 1 161 ? 23.614  17.030  -50.352 1.00 0.00 ? 161 ASP A O   1  
ATOM 836    C CB  . ASP A 1 161 ? 25.409  19.415  -48.884 1.00 0.00 ? 161 ASP A CB  1  
ATOM 837    C CG  . ASP A 1 161 ? 25.099  20.804  -48.453 1.00 0.00 ? 161 ASP A CG  1  
ATOM 838    O OD1 . ASP A 1 161 ? 24.126  21.014  -47.631 1.00 0.00 ? 161 ASP A OD1 1  
ATOM 839    O OD2 . ASP A 1 161 ? 25.792  21.757  -48.869 1.00 0.00 ? 161 ASP A OD2 1  
ATOM 840    N N   . PHE A 1 162 ? 25.251  16.405  -49.033 1.00 0.00 ? 162 PHE A N   1  
ATOM 841    C CA  . PHE A 1 162 ? 25.630  15.145  -49.588 1.00 0.00 ? 162 PHE A CA  1  
ATOM 842    C C   . PHE A 1 162 ? 24.438  14.153  -49.543 1.00 0.00 ? 162 PHE A C   1  
ATOM 843    O O   . PHE A 1 162 ? 24.054  13.559  -50.566 1.00 0.00 ? 162 PHE A O   1  
ATOM 844    C CB  . PHE A 1 162 ? 26.881  14.479  -48.884 1.00 0.00 ? 162 PHE A CB  1  
ATOM 845    C CG  . PHE A 1 162 ? 28.226  15.080  -49.212 1.00 0.00 ? 162 PHE A CG  1  
ATOM 846    C CD1 . PHE A 1 162 ? 28.477  15.953  -50.279 1.00 0.00 ? 162 PHE A CD1 1  
ATOM 847    C CD2 . PHE A 1 162 ? 29.294  14.566  -48.395 1.00 0.00 ? 162 PHE A CD2 1  
ATOM 848    C CE1 . PHE A 1 162 ? 29.769  16.237  -50.589 1.00 0.00 ? 162 PHE A CE1 1  
ATOM 849    C CE2 . PHE A 1 162 ? 30.591  14.913  -48.732 1.00 0.00 ? 162 PHE A CE2 1  
ATOM 850    C CZ  . PHE A 1 162 ? 30.855  15.792  -49.813 1.00 0.00 ? 162 PHE A CZ  1  
ATOM 851    N N   . ASN A 1 163 ? 23.734  14.086  -48.370 1.00 0.00 ? 163 ASN A N   1  
ATOM 852    C CA  . ASN A 1 163 ? 22.599  13.167  -48.053 1.00 0.00 ? 163 ASN A CA  1  
ATOM 853    C C   . ASN A 1 163 ? 21.430  13.414  -49.056 1.00 0.00 ? 163 ASN A C   1  
ATOM 854    O O   . ASN A 1 163 ? 20.874  12.548  -49.695 1.00 0.00 ? 163 ASN A O   1  
ATOM 855    C CB  . ASN A 1 163 ? 22.085  13.245  -46.553 1.00 0.00 ? 163 ASN A CB  1  
ATOM 856    C CG  . ASN A 1 163 ? 21.150  12.010  -46.330 1.00 0.00 ? 163 ASN A CG  1  
ATOM 857    O OD1 . ASN A 1 163 ? 21.503  10.865  -46.580 1.00 0.00 ? 163 ASN A OD1 1  
ATOM 858    N ND2 . ASN A 1 163 ? 19.962  12.356  -45.763 1.00 0.00 ? 163 ASN A ND2 1  
ATOM 859    N N   . LYS A 1 164 ? 21.125  14.690  -49.185 1.00 0.00 ? 164 LYS A N   1  
ATOM 860    C CA  . LYS A 1 164 ? 19.971  15.139  -50.020 1.00 0.00 ? 164 LYS A CA  1  
ATOM 861    C C   . LYS A 1 164 ? 20.237  14.906  -51.440 1.00 0.00 ? 164 LYS A C   1  
ATOM 862    O O   . LYS A 1 164 ? 19.342  14.340  -52.099 1.00 0.00 ? 164 LYS A O   1  
ATOM 863    C CB  . LYS A 1 164 ? 19.633  16.634  -49.812 1.00 0.00 ? 164 LYS A CB  1  
ATOM 864    C CG  . LYS A 1 164 ? 18.212  17.140  -50.190 1.00 0.00 ? 164 LYS A CG  1  
ATOM 865    C CD  . LYS A 1 164 ? 18.055  18.705  -50.190 1.00 0.00 ? 164 LYS A CD  1  
ATOM 866    C CE  . LYS A 1 164 ? 18.376  19.475  -48.878 1.00 0.00 ? 164 LYS A CE  1  
ATOM 867    N NZ  . LYS A 1 164 ? 17.549  19.114  -47.784 1.00 0.00 ? 164 LYS A NZ  1  
ATOM 868    N N   . VAL A 1 165 ? 21.403  15.308  -51.963 1.00 0.00 ? 165 VAL A N   1  
ATOM 869    C CA  . VAL A 1 165 ? 21.712  15.165  -53.386 1.00 0.00 ? 165 VAL A CA  1  
ATOM 870    C C   . VAL A 1 165 ? 23.002  15.947  -53.336 1.00 0.00 ? 165 VAL A C   1  
ATOM 871    O O   . VAL A 1 165 ? 22.931  17.107  -52.997 1.00 0.00 ? 165 VAL A O   1  
ATOM 872    C CB  . VAL A 1 165 ? 20.720  15.564  -54.507 1.00 0.00 ? 165 VAL A CB  1  
ATOM 873    C CG1 . VAL A 1 165 ? 20.333  17.017  -54.559 1.00 0.00 ? 165 VAL A CG1 1  
ATOM 874    C CG2 . VAL A 1 165 ? 21.455  15.101  -55.812 1.00 0.00 ? 165 VAL A CG2 1  
ATOM 875    N N   . PRO A 1 166 ? 24.246  15.405  -53.557 1.00 0.00 ? 166 PRO A N   1  
ATOM 876    C CA  . PRO A 1 166 ? 25.510  16.118  -53.326 1.00 0.00 ? 166 PRO A CA  1  
ATOM 877    C C   . PRO A 1 166 ? 25.875  17.045  -54.559 1.00 0.00 ? 166 PRO A C   1  
ATOM 878    O O   . PRO A 1 166 ? 26.934  16.836  -55.126 1.00 0.00 ? 166 PRO A O   1  
ATOM 879    C CB  . PRO A 1 166 ? 26.491  14.976  -53.204 1.00 0.00 ? 166 PRO A CB  1  
ATOM 880    C CG  . PRO A 1 166 ? 25.997  13.997  -54.312 1.00 0.00 ? 166 PRO A CG  1  
ATOM 881    C CD  . PRO A 1 166 ? 24.467  14.113  -54.159 1.00 0.00 ? 166 PRO A CD  1  
ATOM 882    N N   . ASN A 1 167 ? 25.019  18.094  -54.818 1.00 0.00 ? 167 ASN A N   1  
ATOM 883    C CA  . ASN A 1 167 ? 25.200  19.151  -55.817 1.00 0.00 ? 167 ASN A CA  1  
ATOM 884    C C   . ASN A 1 167 ? 24.606  20.433  -55.276 1.00 0.00 ? 167 ASN A C   1  
ATOM 885    O O   . ASN A 1 167 ? 24.311  21.342  -55.982 1.00 0.00 ? 167 ASN A O   1  
ATOM 886    C CB  . ASN A 1 167 ? 24.534  18.848  -57.153 1.00 0.00 ? 167 ASN A CB  1  
ATOM 887    C CG  . ASN A 1 167 ? 25.230  17.597  -57.677 1.00 0.00 ? 167 ASN A CG  1  
ATOM 888    O OD1 . ASN A 1 167 ? 26.466  17.551  -57.667 1.00 0.00 ? 167 ASN A OD1 1  
ATOM 889    N ND2 . ASN A 1 167 ? 24.429  16.616  -58.199 1.00 0.00 ? 167 ASN A ND2 1  
ATOM 890    N N   . PHE A 1 168 ? 24.248  20.438  -53.939 1.00 0.00 ? 168 PHE A N   1  
ATOM 891    C CA  . PHE A 1 168 ? 23.490  21.471  -53.232 1.00 0.00 ? 168 PHE A CA  1  
ATOM 892    C C   . PHE A 1 168 ? 24.378  22.587  -52.807 1.00 0.00 ? 168 PHE A C   1  
ATOM 893    O O   . PHE A 1 168 ? 25.599  22.399  -52.718 1.00 0.00 ? 168 PHE A O   1  
ATOM 894    C CB  . PHE A 1 168 ? 22.667  20.960  -52.059 1.00 0.00 ? 168 PHE A CB  1  
ATOM 895    C CG  . PHE A 1 168 ? 21.427  21.735  -51.697 1.00 0.00 ? 168 PHE A CG  1  
ATOM 896    C CD1 . PHE A 1 168 ? 20.601  22.301  -52.652 1.00 0.00 ? 168 PHE A CD1 1  
ATOM 897    C CD2 . PHE A 1 168 ? 21.086  21.747  -50.395 1.00 0.00 ? 168 PHE A CD2 1  
ATOM 898    C CE1 . PHE A 1 168 ? 19.525  23.110  -52.234 1.00 0.00 ? 168 PHE A CE1 1  
ATOM 899    C CE2 . PHE A 1 168 ? 19.928  22.413  -49.969 1.00 0.00 ? 168 PHE A CE2 1  
ATOM 900    C CZ  . PHE A 1 168 ? 19.156  23.073  -50.887 1.00 0.00 ? 168 PHE A CZ  1  
ATOM 901    N N   . SER A 1 169 ? 23.739  23.803  -52.691 1.00 0.00 ? 169 SER A N   1  
ATOM 902    C CA  . SER A 1 169 ? 24.340  25.076  -52.574 1.00 0.00 ? 169 SER A CA  1  
ATOM 903    C C   . SER A 1 169 ? 25.443  25.186  -51.507 1.00 0.00 ? 169 SER A C   1  
ATOM 904    O O   . SER A 1 169 ? 25.280  25.140  -50.297 1.00 0.00 ? 169 SER A O   1  
ATOM 905    C CB  . SER A 1 169 ? 23.377  26.268  -52.392 1.00 0.00 ? 169 SER A CB  1  
ATOM 906    O OG  . SER A 1 169 ? 22.182  26.166  -53.193 1.00 0.00 ? 169 SER A OG  1  
ATOM 907    N N   . ILE A 1 170 ? 26.617  25.532  -52.065 1.00 0.00 ? 170 ILE A N   1  
ATOM 908    C CA  . ILE A 1 170 ? 27.881  25.884  -51.472 1.00 0.00 ? 170 ILE A CA  1  
ATOM 909    C C   . ILE A 1 170 ? 27.572  27.168  -50.649 1.00 0.00 ? 170 ILE A C   1  
ATOM 910    O O   . ILE A 1 170 ? 28.155  27.369  -49.552 1.00 0.00 ? 170 ILE A O   1  
ATOM 911    C CB  . ILE A 1 170 ? 29.014  26.079  -52.486 1.00 0.00 ? 170 ILE A CB  1  
ATOM 912    C CG1 . ILE A 1 170 ? 30.399  26.257  -51.788 1.00 0.00 ? 170 ILE A CG1 1  
ATOM 913    C CG2 . ILE A 1 170 ? 28.684  27.329  -53.448 1.00 0.00 ? 170 ILE A CG2 1  
ATOM 914    C CD1 . ILE A 1 170 ? 31.572  26.456  -52.763 1.00 0.00 ? 170 ILE A CD1 1  
ATOM 915    N N   . ARG A 1 171 ? 26.671  28.119  -51.160 1.00 0.00 ? 171 ARG A N   1  
ATOM 916    C CA  . ARG A 1 171 ? 26.477  29.468  -50.716 1.00 0.00 ? 171 ARG A CA  1  
ATOM 917    C C   . ARG A 1 171 ? 26.079  29.479  -49.274 1.00 0.00 ? 171 ARG A C   1  
ATOM 918    O O   . ARG A 1 171 ? 26.644  30.302  -48.518 1.00 0.00 ? 171 ARG A O   1  
ATOM 919    C CB  . ARG A 1 171 ? 25.406  30.230  -51.479 1.00 0.00 ? 171 ARG A CB  1  
ATOM 920    C CG  . ARG A 1 171 ? 25.869  30.444  -52.941 1.00 0.00 ? 171 ARG A CG  1  
ATOM 921    C CD  . ARG A 1 171 ? 24.969  31.419  -53.665 1.00 0.00 ? 171 ARG A CD  1  
ATOM 922    N NE  . ARG A 1 171 ? 25.469  31.695  -55.094 1.00 0.00 ? 171 ARG A NE  1  
ATOM 923    C CZ  . ARG A 1 171 ? 24.833  31.501  -56.304 1.00 0.00 ? 171 ARG A CZ  1  
ATOM 924    N NH1 . ARG A 1 171 ? 23.656  30.819  -56.457 1.00 0.00 ? 171 ARG A NH1 1  
ATOM 925    N NH2 . ARG A 1 171 ? 25.401  31.990  -57.408 1.00 0.00 ? 171 ARG A NH2 1  
ATOM 926    N N   . GLU A 1 172 ? 25.156  28.630  -48.822 1.00 0.00 ? 172 GLU A N   1  
ATOM 927    C CA  . GLU A 1 172 ? 24.659  28.548  -47.456 1.00 0.00 ? 172 GLU A CA  1  
ATOM 928    C C   . GLU A 1 172 ? 25.663  28.117  -46.458 1.00 0.00 ? 172 GLU A C   1  
ATOM 929    O O   . GLU A 1 172 ? 25.799  28.776  -45.404 1.00 0.00 ? 172 GLU A O   1  
ATOM 930    C CB  . GLU A 1 172 ? 23.308  27.789  -47.334 1.00 0.00 ? 172 GLU A CB  1  
ATOM 931    C CG  . GLU A 1 172 ? 23.091  26.436  -48.052 1.00 0.00 ? 172 GLU A CG  1  
ATOM 932    C CD  . GLU A 1 172 ? 21.679  26.041  -47.956 1.00 0.00 ? 172 GLU A CD  1  
ATOM 933    O OE1 . GLU A 1 172 ? 21.002  26.351  -46.930 1.00 0.00 ? 172 GLU A OE1 1  
ATOM 934    O OE2 . GLU A 1 172 ? 21.127  25.376  -48.938 1.00 0.00 ? 172 GLU A OE2 1  
ATOM 935    N N   . LEU A 1 173 ? 26.505  27.161  -46.802 1.00 0.00 ? 173 LEU A N   1  
ATOM 936    C CA  . LEU A 1 173 ? 27.654  26.735  -46.027 1.00 0.00 ? 173 LEU A CA  1  
ATOM 937    C C   . LEU A 1 173 ? 28.578  27.932  -45.949 1.00 0.00 ? 173 LEU A C   1  
ATOM 938    O O   . LEU A 1 173 ? 29.020  28.171  -44.807 1.00 0.00 ? 173 LEU A O   1  
ATOM 939    C CB  . LEU A 1 173 ? 28.246  25.445  -46.710 1.00 0.00 ? 173 LEU A CB  1  
ATOM 940    C CG  . LEU A 1 173 ? 29.643  24.859  -46.211 1.00 0.00 ? 173 LEU A CG  1  
ATOM 941    C CD1 . LEU A 1 173 ? 29.848  23.504  -46.875 1.00 0.00 ? 173 LEU A CD1 1  
ATOM 942    C CD2 . LEU A 1 173 ? 30.823  25.820  -46.463 1.00 0.00 ? 173 LEU A CD2 1  
ATOM 943    N N   . GLU A 1 174 ? 28.802  28.678  -47.038 1.00 0.00 ? 174 GLU A N   1  
ATOM 944    C CA  . GLU A 1 174 ? 29.786  29.821  -46.974 1.00 0.00 ? 174 GLU A CA  1  
ATOM 945    C C   . GLU A 1 174 ? 29.408  30.920  -46.086 1.00 0.00 ? 174 GLU A C   1  
ATOM 946    O O   . GLU A 1 174 ? 30.181  31.359  -45.283 1.00 0.00 ? 174 GLU A O   1  
ATOM 947    C CB  . GLU A 1 174 ? 29.943  30.376  -48.370 1.00 0.00 ? 174 GLU A CB  1  
ATOM 948    C CG  . GLU A 1 174 ? 30.993  29.609  -49.178 1.00 0.00 ? 174 GLU A CG  1  
ATOM 949    C CD  . GLU A 1 174 ? 31.204  30.037  -50.646 1.00 0.00 ? 174 GLU A CD  1  
ATOM 950    O OE1 . GLU A 1 174 ? 30.331  30.878  -51.122 1.00 0.00 ? 174 GLU A OE1 1  
ATOM 951    O OE2 . GLU A 1 174 ? 32.284  29.668  -51.162 1.00 0.00 ? 174 GLU A OE2 1  
ATOM 952    N N   . GLN A 1 175 ? 28.116  31.356  -46.153 1.00 0.00 ? 175 GLN A N   1  
ATOM 953    C CA  . GLN A 1 175 ? 27.689  32.583  -45.374 1.00 0.00 ? 175 GLN A CA  1  
ATOM 954    C C   . GLN A 1 175 ? 27.795  32.395  -43.895 1.00 0.00 ? 175 GLN A C   1  
ATOM 955    O O   . GLN A 1 175 ? 28.346  33.272  -43.218 1.00 0.00 ? 175 GLN A O   1  
ATOM 956    C CB  . GLN A 1 175 ? 26.266  32.953  -45.921 1.00 0.00 ? 175 GLN A CB  1  
ATOM 957    C CG  . GLN A 1 175 ? 25.027  32.114  -45.462 1.00 0.00 ? 175 GLN A CG  1  
ATOM 958    C CD  . GLN A 1 175 ? 23.825  32.859  -45.960 1.00 0.00 ? 175 GLN A CD  1  
ATOM 959    O OE1 . GLN A 1 175 ? 23.263  33.682  -45.236 1.00 0.00 ? 175 GLN A OE1 1  
ATOM 960    N NE2 . GLN A 1 175 ? 23.423  32.436  -47.168 1.00 0.00 ? 175 GLN A NE2 1  
ATOM 961    N N   . ILE A 1 176 ? 27.348  31.203  -43.352 1.00 0.00 ? 176 ILE A N   1  
ATOM 962    C CA  . ILE A 1 176 ? 27.435  31.016  -41.932 1.00 0.00 ? 176 ILE A CA  1  
ATOM 963    C C   . ILE A 1 176 ? 28.916  30.931  -41.428 1.00 0.00 ? 176 ILE A C   1  
ATOM 964    O O   . ILE A 1 176 ? 29.263  31.638  -40.518 1.00 0.00 ? 176 ILE A O   1  
ATOM 965    C CB  . ILE A 1 176 ? 26.625  29.822  -41.450 1.00 0.00 ? 176 ILE A CB  1  
ATOM 966    C CG1 . ILE A 1 176 ? 27.167  28.505  -41.843 1.00 0.00 ? 176 ILE A CG1 1  
ATOM 967    C CG2 . ILE A 1 176 ? 25.149  30.086  -41.874 1.00 0.00 ? 176 ILE A CG2 1  
ATOM 968    C CD1 . ILE A 1 176 ? 26.335  27.311  -41.346 1.00 0.00 ? 176 ILE A CD1 1  
ATOM 969    N N   . ILE A 1 177 ? 29.831  30.180  -42.091 1.00 0.00 ? 177 ILE A N   1  
ATOM 970    C CA  . ILE A 1 177 ? 31.196  30.050  -41.602 1.00 0.00 ? 177 ILE A CA  1  
ATOM 971    C C   . ILE A 1 177 ? 31.876  31.374  -41.646 1.00 0.00 ? 177 ILE A C   1  
ATOM 972    O O   . ILE A 1 177 ? 32.550  31.686  -40.662 1.00 0.00 ? 177 ILE A O   1  
ATOM 973    C CB  . ILE A 1 177 ? 31.976  29.004  -42.333 1.00 0.00 ? 177 ILE A CB  1  
ATOM 974    C CG1 . ILE A 1 177 ? 32.357  29.457  -43.783 1.00 0.00 ? 177 ILE A CG1 1  
ATOM 975    C CG2 . ILE A 1 177 ? 31.280  27.604  -42.356 1.00 0.00 ? 177 ILE A CG2 1  
ATOM 976    C CD1 . ILE A 1 177 ? 33.161  28.413  -44.576 1.00 0.00 ? 177 ILE A CD1 1  
ATOM 977    N N   . ASN A 1 178 ? 31.641  32.265  -42.687 1.00 0.00 ? 178 ASN A N   1  
ATOM 978    C CA  . ASN A 1 178 ? 32.267  33.591  -42.876 1.00 0.00 ? 178 ASN A CA  1  
ATOM 979    C C   . ASN A 1 178 ? 31.946  34.433  -41.753 1.00 0.00 ? 178 ASN A C   1  
ATOM 980    O O   . ASN A 1 178 ? 32.810  35.168  -41.312 1.00 0.00 ? 178 ASN A O   1  
ATOM 981    C CB  . ASN A 1 178 ? 31.745  34.306  -44.187 1.00 0.00 ? 178 ASN A CB  1  
ATOM 982    C CG  . ASN A 1 178 ? 32.442  33.590  -45.349 1.00 0.00 ? 178 ASN A CG  1  
ATOM 983    O OD1 . ASN A 1 178 ? 33.493  32.945  -45.082 1.00 0.00 ? 178 ASN A OD1 1  
ATOM 984    N ND2 . ASN A 1 178 ? 31.805  33.698  -46.555 1.00 0.00 ? 178 ASN A ND2 1  
ATOM 985    N N   . GLU A 1 179 ? 30.671  34.431  -41.260 1.00 0.00 ? 179 GLU A N   1  
ATOM 986    C CA  . GLU A 1 179 ? 30.179  35.265  -40.207 1.00 0.00 ? 179 GLU A CA  1  
ATOM 987    C C   . GLU A 1 179 ? 30.850  34.952  -38.917 1.00 0.00 ? 179 GLU A C   1  
ATOM 988    O O   . GLU A 1 179 ? 31.429  35.848  -38.302 1.00 0.00 ? 179 GLU A O   1  
ATOM 989    C CB  . GLU A 1 179 ? 28.681  35.101  -40.160 1.00 0.00 ? 179 GLU A CB  1  
ATOM 990    C CG  . GLU A 1 179 ? 27.967  36.191  -39.310 1.00 0.00 ? 179 GLU A CG  1  
ATOM 991    C CD  . GLU A 1 179 ? 26.683  35.704  -38.715 1.00 0.00 ? 179 GLU A CD  1  
ATOM 992    O OE1 . GLU A 1 179 ? 25.753  35.419  -39.480 1.00 0.00 ? 179 GLU A OE1 1  
ATOM 993    O OE2 . GLU A 1 179 ? 26.603  35.697  -37.480 1.00 0.00 ? 179 GLU A OE2 1  
ATOM 994    N N   . THR A 1 180 ? 30.958  33.693  -38.570 1.00 0.00 ? 180 THR A N   1  
ATOM 995    C CA  . THR A 1 180 ? 31.433  33.243  -37.324 1.00 0.00 ? 180 THR A CA  1  
ATOM 996    C C   . THR A 1 180 ? 32.927  33.613  -37.205 1.00 0.00 ? 180 THR A C   1  
ATOM 997    O O   . THR A 1 180 ? 33.307  34.384  -36.303 1.00 0.00 ? 180 THR A O   1  
ATOM 998    C CB  . THR A 1 180 ? 31.164  31.823  -37.059 1.00 0.00 ? 180 THR A CB  1  
ATOM 999    O OG1 . THR A 1 180 ? 29.831  31.350  -37.293 1.00 0.00 ? 180 THR A OG1 1  
ATOM 1000   C CG2 . THR A 1 180 ? 31.476  31.502  -35.593 1.00 0.00 ? 180 THR A CG2 1  
ATOM 1001   N N   . GLU A 1 181 ? 33.661  33.325  -38.228 1.00 0.00 ? 181 GLU A N   1  
ATOM 1002   C CA  . GLU A 1 181 ? 35.105  33.511  -38.249 1.00 0.00 ? 181 GLU A CA  1  
ATOM 1003   C C   . GLU A 1 181 ? 35.572  34.926  -38.098 1.00 0.00 ? 181 GLU A C   1  
ATOM 1004   O O   . GLU A 1 181 ? 36.417  35.118  -37.268 1.00 0.00 ? 181 GLU A O   1  
ATOM 1005   C CB  . GLU A 1 181 ? 35.734  32.874  -39.488 1.00 0.00 ? 181 GLU A CB  1  
ATOM 1006   C CG  . GLU A 1 181 ? 37.188  33.196  -39.694 1.00 0.00 ? 181 GLU A CG  1  
ATOM 1007   C CD  . GLU A 1 181 ? 37.863  32.612  -40.895 1.00 0.00 ? 181 GLU A CD  1  
ATOM 1008   O OE1 . GLU A 1 181 ? 37.548  33.073  -42.085 1.00 0.00 ? 181 GLU A OE1 1  
ATOM 1009   O OE2 . GLU A 1 181 ? 38.599  31.628  -40.731 1.00 0.00 ? 181 GLU A OE2 1  
ATOM 1010   N N   . VAL A 1 182 ? 34.994  35.902  -38.857 1.00 0.00 ? 182 VAL A N   1  
ATOM 1011   C CA  . VAL A 1 182 ? 35.604  37.066  -39.365 1.00 0.00 ? 182 VAL A CA  1  
ATOM 1012   C C   . VAL A 1 182 ? 36.146  37.915  -38.161 1.00 0.00 ? 182 VAL A C   1  
ATOM 1013   O O   . VAL A 1 182 ? 37.317  38.288  -38.051 1.00 0.00 ? 182 VAL A O   1  
ATOM 1014   C CB  . VAL A 1 182 ? 34.755  37.842  -40.320 1.00 0.00 ? 182 VAL A CB  1  
ATOM 1015   C CG1 . VAL A 1 182 ? 33.349  38.306  -39.938 1.00 0.00 ? 182 VAL A CG1 1  
ATOM 1016   C CG2 . VAL A 1 182 ? 35.628  38.976  -40.863 1.00 0.00 ? 182 VAL A CG2 1  
ATOM 1017   N N   . ASN A 1 183 ? 35.278  38.089  -37.212 1.00 0.00 ? 183 ASN A N   1  
ATOM 1018   C CA  . ASN A 1 183 ? 35.353  39.055  -36.111 1.00 0.00 ? 183 ASN A CA  1  
ATOM 1019   C C   . ASN A 1 183 ? 36.534  38.607  -35.204 1.00 0.00 ? 183 ASN A C   1  
ATOM 1020   O O   . ASN A 1 183 ? 37.584  39.182  -35.092 1.00 0.00 ? 183 ASN A O   1  
ATOM 1021   C CB  . ASN A 1 183 ? 34.081  39.172  -35.191 1.00 0.00 ? 183 ASN A CB  1  
ATOM 1022   C CG  . ASN A 1 183 ? 33.019  40.090  -35.856 1.00 0.00 ? 183 ASN A CG  1  
ATOM 1023   O OD1 . ASN A 1 183 ? 32.181  39.668  -36.671 1.00 0.00 ? 183 ASN A OD1 1  
ATOM 1024   N ND2 . ASN A 1 183 ? 32.966  41.360  -35.427 1.00 0.00 ? 183 ASN A ND2 1  
ATOM 1025   N N   . LYS A 1 184 ? 36.465  37.272  -34.873 1.00 0.00 ? 184 LYS A N   1  
ATOM 1026   C CA  . LYS A 1 184 ? 37.330  36.582  -33.908 1.00 0.00 ? 184 LYS A CA  1  
ATOM 1027   C C   . LYS A 1 184 ? 38.734  36.522  -34.501 1.00 0.00 ? 184 LYS A C   1  
ATOM 1028   O O   . LYS A 1 184 ? 39.678  37.035  -33.913 1.00 0.00 ? 184 LYS A O   1  
ATOM 1029   C CB  . LYS A 1 184 ? 36.864  35.066  -33.654 1.00 0.00 ? 184 LYS A CB  1  
ATOM 1030   C CG  . LYS A 1 184 ? 35.417  34.850  -33.381 1.00 0.00 ? 184 LYS A CG  1  
ATOM 1031   C CD  . LYS A 1 184 ? 35.060  33.396  -33.152 1.00 0.00 ? 184 LYS A CD  1  
ATOM 1032   C CE  . LYS A 1 184 ? 33.584  33.393  -32.666 1.00 0.00 ? 184 LYS A CE  1  
ATOM 1033   N NZ  . LYS A 1 184 ? 33.152  32.014  -32.218 1.00 0.00 ? 184 LYS A NZ  1  
ATOM 1034   N N   . GLN A 1 185 ? 38.834  35.991  -35.716 1.00 0.00 ? 185 GLN A N   1  
ATOM 1035   C CA  . GLN A 1 185 ? 40.005  35.420  -36.370 1.00 0.00 ? 185 GLN A CA  1  
ATOM 1036   C C   . GLN A 1 185 ? 40.993  36.535  -36.687 1.00 0.00 ? 185 GLN A C   1  
ATOM 1037   O O   . GLN A 1 185 ? 42.139  36.422  -36.269 1.00 0.00 ? 185 GLN A O   1  
ATOM 1038   C CB  . GLN A 1 185 ? 39.588  34.634  -37.572 1.00 0.00 ? 185 GLN A CB  1  
ATOM 1039   C CG  . GLN A 1 185 ? 40.794  33.952  -38.423 1.00 0.00 ? 185 GLN A CG  1  
ATOM 1040   C CD  . GLN A 1 185 ? 41.390  32.718  -37.847 1.00 0.00 ? 185 GLN A CD  1  
ATOM 1041   O OE1 . GLN A 1 185 ? 40.830  31.641  -38.057 1.00 0.00 ? 185 GLN A OE1 1  
ATOM 1042   N NE2 . GLN A 1 185 ? 42.588  32.859  -37.197 1.00 0.00 ? 185 GLN A NE2 1  
ATOM 1043   N N   . MET A 1 186 ? 40.490  37.696  -37.264 1.00 0.00 ? 186 MET A N   1  
ATOM 1044   C CA  . MET A 1 186 ? 41.418  38.703  -37.804 1.00 0.00 ? 186 MET A CA  1  
ATOM 1045   C C   . MET A 1 186 ? 42.269  39.275  -36.767 1.00 0.00 ? 186 MET A C   1  
ATOM 1046   O O   . MET A 1 186 ? 43.459  39.246  -36.898 1.00 0.00 ? 186 MET A O   1  
ATOM 1047   C CB  . MET A 1 186 ? 40.762  39.925  -38.425 1.00 0.00 ? 186 MET A CB  1  
ATOM 1048   C CG  . MET A 1 186 ? 39.961  39.698  -39.748 1.00 0.00 ? 186 MET A CG  1  
ATOM 1049   S SD  . MET A 1 186 ? 40.718  38.398  -40.758 1.00 0.00 ? 186 MET A SD  1  
ATOM 1050   C CE  . MET A 1 186 ? 40.387  39.426  -42.234 1.00 0.00 ? 186 MET A CE  1  
ATOM 1051   N N   . GLU A 1 187 ? 41.552  39.614  -35.655 1.00 0.00 ? 187 GLU A N   1  
ATOM 1052   C CA  . GLU A 1 187 ? 42.124  40.307  -34.544 1.00 0.00 ? 187 GLU A CA  1  
ATOM 1053   C C   . GLU A 1 187 ? 43.125  39.399  -33.846 1.00 0.00 ? 187 GLU A C   1  
ATOM 1054   O O   . GLU A 1 187 ? 44.262  39.849  -33.609 1.00 0.00 ? 187 GLU A O   1  
ATOM 1055   C CB  . GLU A 1 187 ? 41.101  40.924  -33.551 1.00 0.00 ? 187 GLU A CB  1  
ATOM 1056   C CG  . GLU A 1 187 ? 40.377  42.126  -34.155 1.00 0.00 ? 187 GLU A CG  1  
ATOM 1057   C CD  . GLU A 1 187 ? 39.551  42.971  -33.211 1.00 0.00 ? 187 GLU A CD  1  
ATOM 1058   O OE1 . GLU A 1 187 ? 39.869  42.967  -31.997 1.00 0.00 ? 187 GLU A OE1 1  
ATOM 1059   O OE2 . GLU A 1 187 ? 38.580  43.592  -33.658 1.00 0.00 ? 187 GLU A OE2 1  
ATOM 1060   N N   . LEU A 1 188 ? 42.809  38.082  -33.635 1.00 0.00 ? 188 LEU A N   1  
ATOM 1061   C CA  . LEU A 1 188 ? 43.525  37.137  -32.942 1.00 0.00 ? 188 LEU A CA  1  
ATOM 1062   C C   . LEU A 1 188 ? 44.808  36.910  -33.606 1.00 0.00 ? 188 LEU A C   1  
ATOM 1063   O O   . LEU A 1 188 ? 45.875  37.007  -33.042 1.00 0.00 ? 188 LEU A O   1  
ATOM 1064   C CB  . LEU A 1 188 ? 42.756  35.781  -32.806 1.00 0.00 ? 188 LEU A CB  1  
ATOM 1065   C CG  . LEU A 1 188 ? 41.590  35.729  -31.799 1.00 0.00 ? 188 LEU A CG  1  
ATOM 1066   C CD1 . LEU A 1 188 ? 40.651  34.561  -32.010 1.00 0.00 ? 188 LEU A CD1 1  
ATOM 1067   C CD2 . LEU A 1 188 ? 41.963  35.755  -30.325 1.00 0.00 ? 188 LEU A CD2 1  
ATOM 1068   N N   . LEU A 1 189 ? 44.769  36.711  -34.956 1.00 0.00 ? 189 LEU A N   1  
ATOM 1069   C CA  . LEU A 1 189 ? 45.977  36.361  -35.692 1.00 0.00 ? 189 LEU A CA  1  
ATOM 1070   C C   . LEU A 1 189 ? 46.952  37.574  -35.715 1.00 0.00 ? 189 LEU A C   1  
ATOM 1071   O O   . LEU A 1 189 ? 48.160  37.398  -35.564 1.00 0.00 ? 189 LEU A O   1  
ATOM 1072   C CB  . LEU A 1 189 ? 45.397  36.172  -37.092 1.00 0.00 ? 189 LEU A CB  1  
ATOM 1073   C CG  . LEU A 1 189 ? 46.351  35.324  -38.012 1.00 0.00 ? 189 LEU A CG  1  
ATOM 1074   C CD1 . LEU A 1 189 ? 46.699  33.997  -37.346 1.00 0.00 ? 189 LEU A CD1 1  
ATOM 1075   C CD2 . LEU A 1 189 ? 45.692  35.201  -39.361 1.00 0.00 ? 189 LEU A CD2 1  
ATOM 1076   N N   . TYR A 1 190 ? 46.432  38.792  -35.900 1.00 0.00 ? 190 TYR A N   1  
ATOM 1077   C CA  . TYR A 1 190 ? 47.317  40.000  -36.021 1.00 0.00 ? 190 TYR A CA  1  
ATOM 1078   C C   . TYR A 1 190 ? 48.091  40.204  -34.720 1.00 0.00 ? 190 TYR A C   1  
ATOM 1079   O O   . TYR A 1 190 ? 49.259  40.499  -34.708 1.00 0.00 ? 190 TYR A O   1  
ATOM 1080   C CB  . TYR A 1 190 ? 46.614  41.359  -36.331 1.00 0.00 ? 190 TYR A CB  1  
ATOM 1081   C CG  . TYR A 1 190 ? 45.874  41.222  -37.591 1.00 0.00 ? 190 TYR A CG  1  
ATOM 1082   C CD1 . TYR A 1 190 ? 46.317  40.549  -38.740 1.00 0.00 ? 190 TYR A CD1 1  
ATOM 1083   C CD2 . TYR A 1 190 ? 44.696  41.962  -37.765 1.00 0.00 ? 190 TYR A CD2 1  
ATOM 1084   C CE1 . TYR A 1 190 ? 45.537  40.472  -39.891 1.00 0.00 ? 190 TYR A CE1 1  
ATOM 1085   C CE2 . TYR A 1 190 ? 43.909  41.983  -38.939 1.00 0.00 ? 190 TYR A CE2 1  
ATOM 1086   C CZ  . TYR A 1 190 ? 44.373  41.185  -40.011 1.00 0.00 ? 190 TYR A CZ  1  
ATOM 1087   O OH  . TYR A 1 190 ? 43.595  41.129  -41.215 1.00 0.00 ? 190 TYR A OH  1  
ATOM 1088   N N   . ASN A 1 191 ? 47.330  40.025  -33.614 1.00 0.00 ? 191 ASN A N   1  
ATOM 1089   C CA  . ASN A 1 191 ? 47.860  40.311  -32.290 1.00 0.00 ? 191 ASN A CA  1  
ATOM 1090   C C   . ASN A 1 191 ? 49.075  39.448  -31.958 1.00 0.00 ? 191 ASN A C   1  
ATOM 1091   O O   . ASN A 1 191 ? 50.055  39.915  -31.464 1.00 0.00 ? 191 ASN A O   1  
ATOM 1092   C CB  . ASN A 1 191 ? 46.764  40.104  -31.207 1.00 0.00 ? 191 ASN A CB  1  
ATOM 1093   C CG  . ASN A 1 191 ? 45.755  41.302  -31.144 1.00 0.00 ? 191 ASN A CG  1  
ATOM 1094   O OD1 . ASN A 1 191 ? 45.706  42.081  -32.129 1.00 0.00 ? 191 ASN A OD1 1  
ATOM 1095   N ND2 . ASN A 1 191 ? 44.913  41.319  -30.096 1.00 0.00 ? 191 ASN A ND2 1  
ATOM 1096   N N   . ILE A 1 192 ? 48.992  38.121  -32.304 1.00 0.00 ? 192 ILE A N   1  
ATOM 1097   C CA  . ILE A 1 192 ? 50.065  37.166  -32.005 1.00 0.00 ? 192 ILE A CA  1  
ATOM 1098   C C   . ILE A 1 192 ? 51.350  37.502  -32.711 1.00 0.00 ? 192 ILE A C   1  
ATOM 1099   O O   . ILE A 1 192 ? 52.419  37.534  -32.153 1.00 0.00 ? 192 ILE A O   1  
ATOM 1100   C CB  . ILE A 1 192 ? 49.618  35.780  -32.023 1.00 0.00 ? 192 ILE A CB  1  
ATOM 1101   C CG1 . ILE A 1 192 ? 48.985  35.250  -33.310 1.00 0.00 ? 192 ILE A CG1 1  
ATOM 1102   C CG2 . ILE A 1 192 ? 48.484  35.522  -30.941 1.00 0.00 ? 192 ILE A CG2 1  
ATOM 1103   C CD1 . ILE A 1 192 ? 48.545  33.778  -33.234 1.00 0.00 ? 192 ILE A CD1 1  
ATOM 1104   N N   . TYR A 1 193 ? 51.185  37.956  -33.974 1.00 0.00 ? 193 TYR A N   1  
ATOM 1105   C CA  . TYR A 1 193 ? 52.336  38.474  -34.677 1.00 0.00 ? 193 TYR A CA  1  
ATOM 1106   C C   . TYR A 1 193 ? 52.907  39.723  -34.056 1.00 0.00 ? 193 TYR A C   1  
ATOM 1107   O O   . TYR A 1 193 ? 54.141  39.900  -34.122 1.00 0.00 ? 193 TYR A O   1  
ATOM 1108   C CB  . TYR A 1 193 ? 51.895  38.856  -36.094 1.00 0.00 ? 193 TYR A CB  1  
ATOM 1109   C CG  . TYR A 1 193 ? 52.041  37.713  -37.031 1.00 0.00 ? 193 TYR A CG  1  
ATOM 1110   C CD1 . TYR A 1 193 ? 53.241  37.108  -37.456 1.00 0.00 ? 193 TYR A CD1 1  
ATOM 1111   C CD2 . TYR A 1 193 ? 50.893  37.227  -37.529 1.00 0.00 ? 193 TYR A CD2 1  
ATOM 1112   C CE1 . TYR A 1 193 ? 53.239  36.066  -38.353 1.00 0.00 ? 193 TYR A CE1 1  
ATOM 1113   C CE2 . TYR A 1 193 ? 50.824  36.037  -38.333 1.00 0.00 ? 193 TYR A CE2 1  
ATOM 1114   C CZ  . TYR A 1 193 ? 52.001  35.437  -38.726 1.00 0.00 ? 193 TYR A CZ  1  
ATOM 1115   O OH  . TYR A 1 193 ? 52.028  34.410  -39.666 1.00 0.00 ? 193 TYR A OH  1  
ATOM 1116   N N   . GLU A 1 194 ? 52.117  40.697  -33.597 1.00 0.00 ? 194 GLU A N   1  
ATOM 1117   C CA  . GLU A 1 194 ? 52.577  41.975  -33.154 1.00 0.00 ? 194 GLU A CA  1  
ATOM 1118   C C   . GLU A 1 194 ? 53.444  41.680  -31.942 1.00 0.00 ? 194 GLU A C   1  
ATOM 1119   O O   . GLU A 1 194 ? 54.522  42.256  -31.749 1.00 0.00 ? 194 GLU A O   1  
ATOM 1120   C CB  . GLU A 1 194 ? 51.435  42.971  -32.898 1.00 0.00 ? 194 GLU A CB  1  
ATOM 1121   C CG  . GLU A 1 194 ? 50.960  43.528  -34.183 1.00 0.00 ? 194 GLU A CG  1  
ATOM 1122   C CD  . GLU A 1 194 ? 49.793  44.563  -33.927 1.00 0.00 ? 194 GLU A CD  1  
ATOM 1123   O OE1 . GLU A 1 194 ? 50.152  45.732  -33.503 1.00 0.00 ? 194 GLU A OE1 1  
ATOM 1124   O OE2 . GLU A 1 194 ? 48.644  44.153  -34.083 1.00 0.00 ? 194 GLU A OE2 1  
ATOM 1125   N N   . GLU A 1 195 ? 53.032  40.722  -31.039 1.00 0.00 ? 195 GLU A N   1  
ATOM 1126   C CA  . GLU A 1 195 ? 53.698  40.341  -29.815 1.00 0.00 ? 195 GLU A CA  1  
ATOM 1127   C C   . GLU A 1 195 ? 55.051  39.740  -30.215 1.00 0.00 ? 195 GLU A C   1  
ATOM 1128   O O   . GLU A 1 195 ? 56.026  39.999  -29.523 1.00 0.00 ? 195 GLU A O   1  
ATOM 1129   C CB  . GLU A 1 195 ? 52.873  39.213  -28.986 1.00 0.00 ? 195 GLU A CB  1  
ATOM 1130   C CG  . GLU A 1 195 ? 51.624  39.775  -28.474 1.00 0.00 ? 195 GLU A CG  1  
ATOM 1131   C CD  . GLU A 1 195 ? 50.881  38.616  -27.734 1.00 0.00 ? 195 GLU A CD  1  
ATOM 1132   O OE1 . GLU A 1 195 ? 51.393  38.194  -26.650 1.00 0.00 ? 195 GLU A OE1 1  
ATOM 1133   O OE2 . GLU A 1 195 ? 49.777  38.249  -28.224 1.00 0.00 ? 195 GLU A OE2 1  
ATOM 1134   N N   . ILE A 1 196 ? 55.177  38.960  -31.320 1.00 0.00 ? 196 ILE A N   1  
ATOM 1135   C CA  . ILE A 1 196 ? 56.374  38.385  -31.709 1.00 0.00 ? 196 ILE A CA  1  
ATOM 1136   C C   . ILE A 1 196 ? 57.398  39.371  -32.158 1.00 0.00 ? 196 ILE A C   1  
ATOM 1137   O O   . ILE A 1 196 ? 58.518  39.231  -31.778 1.00 0.00 ? 196 ILE A O   1  
ATOM 1138   C CB  . ILE A 1 196 ? 56.168  37.341  -32.860 1.00 0.00 ? 196 ILE A CB  1  
ATOM 1139   C CG1 . ILE A 1 196 ? 55.455  36.085  -32.369 1.00 0.00 ? 196 ILE A CG1 1  
ATOM 1140   C CG2 . ILE A 1 196 ? 57.469  37.000  -33.691 1.00 0.00 ? 196 ILE A CG2 1  
ATOM 1141   C CD1 . ILE A 1 196 ? 55.227  35.025  -33.460 1.00 0.00 ? 196 ILE A CD1 1  
ATOM 1142   N N   . PHE A 1 197 ? 57.060  40.477  -32.989 1.00 0.00 ? 197 PHE A N   1  
ATOM 1143   C CA  . PHE A 1 197 ? 57.918  41.508  -33.499 1.00 0.00 ? 197 PHE A CA  1  
ATOM 1144   C C   . PHE A 1 197 ? 58.508  42.267  -32.439 1.00 0.00 ? 197 PHE A C   1  
ATOM 1145   O O   . PHE A 1 197 ? 59.684  42.668  -32.410 1.00 0.00 ? 197 PHE A O   1  
ATOM 1146   C CB  . PHE A 1 197 ? 57.144  42.434  -34.431 1.00 0.00 ? 197 PHE A CB  1  
ATOM 1147   C CG  . PHE A 1 197 ? 56.380  41.901  -35.611 1.00 0.00 ? 197 PHE A CG  1  
ATOM 1148   C CD1 . PHE A 1 197 ? 56.775  40.836  -36.333 1.00 0.00 ? 197 PHE A CD1 1  
ATOM 1149   C CD2 . PHE A 1 197 ? 55.211  42.636  -36.045 1.00 0.00 ? 197 PHE A CD2 1  
ATOM 1150   C CE1 . PHE A 1 197 ? 56.042  40.368  -37.430 1.00 0.00 ? 197 PHE A CE1 1  
ATOM 1151   C CE2 . PHE A 1 197 ? 54.433  42.115  -37.085 1.00 0.00 ? 197 PHE A CE2 1  
ATOM 1152   C CZ  . PHE A 1 197 ? 54.846  41.031  -37.741 1.00 0.00 ? 197 PHE A CZ  1  
ATOM 1153   N N   . ARG A 1 198 ? 57.660  42.598  -31.415 1.00 0.00 ? 198 ARG A N   1  
ATOM 1154   C CA  . ARG A 1 198 ? 57.974  43.336  -30.256 1.00 0.00 ? 198 ARG A CA  1  
ATOM 1155   C C   . ARG A 1 198 ? 58.945  42.661  -29.364 1.00 0.00 ? 198 ARG A C   1  
ATOM 1156   O O   . ARG A 1 198 ? 59.881  43.320  -28.880 1.00 0.00 ? 198 ARG A O   1  
ATOM 1157   C CB  . ARG A 1 198 ? 56.726  43.651  -29.355 1.00 0.00 ? 198 ARG A CB  1  
ATOM 1158   C CG  . ARG A 1 198 ? 56.916  44.699  -28.197 1.00 0.00 ? 198 ARG A CG  1  
ATOM 1159   C CD  . ARG A 1 198 ? 56.278  44.462  -26.803 1.00 0.00 ? 198 ARG A CD  1  
ATOM 1160   N NE  . ARG A 1 198 ? 57.196  43.429  -26.223 1.00 0.00 ? 198 ARG A NE  1  
ATOM 1161   C CZ  . ARG A 1 198 ? 56.941  42.097  -26.085 1.00 0.00 ? 198 ARG A CZ  1  
ATOM 1162   N NH1 . ARG A 1 198 ? 55.787  41.603  -26.465 1.00 0.00 ? 198 ARG A NH1 1  
ATOM 1163   N NH2 . ARG A 1 198 ? 57.786  41.286  -25.381 1.00 0.00 ? 198 ARG A NH2 1  
ATOM 1164   N N   . GLU A 1 199 ? 58.813  41.292  -29.173 1.00 0.00 ? 199 GLU A N   1  
ATOM 1165   C CA  . GLU A 1 199 ? 59.745  40.467  -28.420 1.00 0.00 ? 199 GLU A CA  1  
ATOM 1166   C C   . GLU A 1 199 ? 61.056  40.492  -29.170 1.00 0.00 ? 199 GLU A C   1  
ATOM 1167   O O   . GLU A 1 199 ? 62.073  40.492  -28.481 1.00 0.00 ? 199 GLU A O   1  
ATOM 1168   C CB  . GLU A 1 199 ? 59.190  38.986  -28.286 1.00 0.00 ? 199 GLU A CB  1  
ATOM 1169   C CG  . GLU A 1 199 ? 58.239  38.638  -27.139 1.00 0.00 ? 199 GLU A CG  1  
ATOM 1170   C CD  . GLU A 1 199 ? 57.837  37.190  -27.485 1.00 0.00 ? 199 GLU A CD  1  
ATOM 1171   O OE1 . GLU A 1 199 ? 58.704  36.350  -27.561 1.00 0.00 ? 199 GLU A OE1 1  
ATOM 1172   O OE2 . GLU A 1 199 ? 56.693  37.062  -28.003 1.00 0.00 ? 199 GLU A OE2 1  
ATOM 1173   N N   . ILE A 1 200 ? 61.142  40.467  -30.512 1.00 0.00 ? 200 ILE A N   1  
ATOM 1174   C CA  . ILE A 1 200 ? 62.387  40.422  -31.322 1.00 0.00 ? 200 ILE A CA  1  
ATOM 1175   C C   . ILE A 1 200 ? 63.201  41.697  -31.058 1.00 0.00 ? 200 ILE A C   1  
ATOM 1176   O O   . ILE A 1 200 ? 64.407  41.710  -30.805 1.00 0.00 ? 200 ILE A O   1  
ATOM 1177   C CB  . ILE A 1 200 ? 62.291  40.143  -32.925 1.00 0.00 ? 200 ILE A CB  1  
ATOM 1178   C CG1 . ILE A 1 200 ? 61.605  38.812  -33.143 1.00 0.00 ? 200 ILE A CG1 1  
ATOM 1179   C CG2 . ILE A 1 200 ? 63.715  40.017  -33.514 1.00 0.00 ? 200 ILE A CG2 1  
ATOM 1180   C CD1 . ILE A 1 200 ? 61.447  38.421  -34.622 1.00 0.00 ? 200 ILE A CD1 1  
ATOM 1181   N N   . GLU A 1 201 ? 62.437  42.772  -31.003 1.00 0.00 ? 201 GLU A N   1  
ATOM 1182   C CA  . GLU A 1 201 ? 62.949  44.120  -30.701 1.00 0.00 ? 201 GLU A CA  1  
ATOM 1183   C C   . GLU A 1 201 ? 63.451  44.223  -29.269 1.00 0.00 ? 201 GLU A C   1  
ATOM 1184   O O   . GLU A 1 201 ? 64.483  44.849  -29.088 1.00 0.00 ? 201 GLU A O   1  
ATOM 1185   C CB  . GLU A 1 201 ? 61.887  45.230  -30.965 1.00 0.00 ? 201 GLU A CB  1  
ATOM 1186   C CG  . GLU A 1 201 ? 62.422  46.684  -30.962 1.00 0.00 ? 201 GLU A CG  1  
ATOM 1187   C CD  . GLU A 1 201 ? 63.738  46.711  -31.769 1.00 0.00 ? 201 GLU A CD  1  
ATOM 1188   O OE1 . GLU A 1 201 ? 63.685  46.729  -33.016 1.00 0.00 ? 201 GLU A OE1 1  
ATOM 1189   O OE2 . GLU A 1 201 ? 64.781  46.821  -31.107 1.00 0.00 ? 201 GLU A OE2 1  
ATOM 1190   N N   . GLU A 1 202 ? 62.679  43.602  -28.267 1.00 0.00 ? 202 GLU A N   1  
ATOM 1191   C CA  . GLU A 1 202 ? 63.075  43.700  -26.920 1.00 0.00 ? 202 GLU A CA  1  
ATOM 1192   C C   . GLU A 1 202 ? 64.394  42.975  -26.675 1.00 0.00 ? 202 GLU A C   1  
ATOM 1193   O O   . GLU A 1 202 ? 65.146  43.502  -25.865 1.00 0.00 ? 202 GLU A O   1  
ATOM 1194   C CB  . GLU A 1 202 ? 62.086  43.036  -25.971 1.00 0.00 ? 202 GLU A CB  1  
ATOM 1195   C CG  . GLU A 1 202 ? 60.798  43.830  -25.631 1.00 0.00 ? 202 GLU A CG  1  
ATOM 1196   C CD  . GLU A 1 202 ? 61.259  45.080  -24.760 1.00 0.00 ? 202 GLU A CD  1  
ATOM 1197   O OE1 . GLU A 1 202 ? 61.571  44.877  -23.574 1.00 0.00 ? 202 GLU A OE1 1  
ATOM 1198   O OE2 . GLU A 1 202 ? 61.265  46.206  -25.342 1.00 0.00 ? 202 GLU A OE2 1  
ATOM 1199   N N   . ARG A 1 203 ? 64.522  41.760  -27.344 1.00 0.00 ? 203 ARG A N   1  
ATOM 1200   C CA  . ARG A 1 203 ? 65.625  40.910  -27.143 1.00 0.00 ? 203 ARG A CA  1  
ATOM 1201   C C   . ARG A 1 203 ? 66.929  41.541  -27.602 1.00 0.00 ? 203 ARG A C   1  
ATOM 1202   O O   . ARG A 1 203 ? 67.966  41.488  -26.953 1.00 0.00 ? 203 ARG A O   1  
ATOM 1203   C CB  . ARG A 1 203 ? 65.715  39.531  -27.814 1.00 0.00 ? 203 ARG A CB  1  
ATOM 1204   C CG  . ARG A 1 203 ? 64.583  38.585  -27.388 1.00 0.00 ? 203 ARG A CG  1  
ATOM 1205   C CD  . ARG A 1 203 ? 64.029  38.649  -25.907 1.00 0.00 ? 203 ARG A CD  1  
ATOM 1206   N NE  . ARG A 1 203 ? 63.079  37.539  -25.689 1.00 0.00 ? 203 ARG A NE  1  
ATOM 1207   C CZ  . ARG A 1 203 ? 61.829  37.663  -25.152 1.00 0.00 ? 203 ARG A CZ  1  
ATOM 1208   N NH1 . ARG A 1 203 ? 61.241  38.875  -24.966 1.00 0.00 ? 203 ARG A NH1 1  
ATOM 1209   N NH2 . ARG A 1 203 ? 61.112  36.546  -24.799 1.00 0.00 ? 203 ARG A NH2 1  
ATOM 1210   N N   . ARG A 1 204 ? 66.887  42.250  -28.776 1.00 0.00 ? 204 ARG A N   1  
ATOM 1211   C CA  . ARG A 1 204 ? 67.951  42.935  -29.373 1.00 0.00 ? 204 ARG A CA  1  
ATOM 1212   C C   . ARG A 1 204 ? 68.375  44.115  -28.386 1.00 0.00 ? 204 ARG A C   1  
ATOM 1213   O O   . ARG A 1 204 ? 69.543  44.237  -28.107 1.00 0.00 ? 204 ARG A O   1  
ATOM 1214   C CB  . ARG A 1 204 ? 67.569  43.488  -30.755 1.00 0.00 ? 204 ARG A CB  1  
ATOM 1215   C CG  . ARG A 1 204 ? 67.768  42.428  -31.808 1.00 0.00 ? 204 ARG A CG  1  
ATOM 1216   C CD  . ARG A 1 204 ? 67.381  42.955  -33.209 1.00 0.00 ? 204 ARG A CD  1  
ATOM 1217   N NE  . ARG A 1 204 ? 65.877  43.297  -33.139 1.00 0.00 ? 204 ARG A NE  1  
ATOM 1218   C CZ  . ARG A 1 204 ? 65.167  43.634  -34.251 1.00 0.00 ? 204 ARG A CZ  1  
ATOM 1219   N NH1 . ARG A 1 204 ? 65.772  43.699  -35.476 1.00 0.00 ? 204 ARG A NH1 1  
ATOM 1220   N NH2 . ARG A 1 204 ? 63.800  43.812  -34.172 1.00 0.00 ? 204 ARG A NH2 1  
ATOM 1221   N N   . THR A 1 205 ? 67.347  44.788  -27.841 1.00 0.00 ? 205 THR A N   1  
ATOM 1222   C CA  . THR A 1 205 ? 67.525  45.866  -26.896 1.00 0.00 ? 205 THR A CA  1  
ATOM 1223   C C   . THR A 1 205 ? 68.032  45.411  -25.556 1.00 0.00 ? 205 THR A C   1  
ATOM 1224   O O   . THR A 1 205 ? 68.247  44.181  -25.390 1.00 0.00 ? 205 THR A O   1  
ATOM 1225   C CB  . THR A 1 205 ? 66.321  46.827  -26.691 1.00 0.00 ? 205 THR A CB  1  
ATOM 1226   O OG1 . THR A 1 205 ? 65.889  47.316  -27.933 1.00 0.00 ? 205 THR A OG1 1  
ATOM 1227   C CG2 . THR A 1 205 ? 66.804  48.086  -25.855 1.00 0.00 ? 205 THR A CG2 1  
ATOM 1228   N N   . LYS A 1 243 ? 60.723  41.934  -21.990 1.00 0.00 ? 243 LYS A N   1  
ATOM 1229   C CA  . LYS A 1 243 ? 60.333  40.559  -21.792 1.00 0.00 ? 243 LYS A CA  1  
ATOM 1230   C C   . LYS A 1 243 ? 58.957  40.450  -21.205 1.00 0.00 ? 243 LYS A C   1  
ATOM 1231   O O   . LYS A 1 243 ? 58.042  40.935  -21.832 1.00 0.00 ? 243 LYS A O   1  
ATOM 1232   C CB  . LYS A 1 243 ? 61.393  39.899  -20.959 1.00 0.00 ? 243 LYS A CB  1  
ATOM 1233   C CG  . LYS A 1 243 ? 62.744  39.971  -21.738 1.00 0.00 ? 243 LYS A CG  1  
ATOM 1234   C CD  . LYS A 1 243 ? 63.857  39.151  -21.011 1.00 0.00 ? 243 LYS A CD  1  
ATOM 1235   C CE  . LYS A 1 243 ? 65.165  39.037  -21.858 1.00 0.00 ? 243 LYS A CE  1  
ATOM 1236   N NZ  . LYS A 1 243 ? 65.922  40.205  -22.096 1.00 0.00 ? 243 LYS A NZ  1  
ATOM 1237   N N   . GLY A 1 244 ? 58.875  40.067  -19.860 1.00 0.00 ? 244 GLY A N   1  
ATOM 1238   C CA  . GLY A 1 244 ? 57.613  39.842  -19.143 1.00 0.00 ? 244 GLY A CA  1  
ATOM 1239   C C   . GLY A 1 244 ? 56.756  41.022  -19.104 1.00 0.00 ? 244 GLY A C   1  
ATOM 1240   O O   . GLY A 1 244 ? 55.585  40.994  -19.470 1.00 0.00 ? 244 GLY A O   1  
ATOM 1241   N N   . GLY A 1 245 ? 57.378  42.087  -18.589 1.00 0.00 ? 245 GLY A N   1  
ATOM 1242   C CA  . GLY A 1 245 ? 56.702  43.309  -18.275 1.00 0.00 ? 245 GLY A CA  1  
ATOM 1243   C C   . GLY A 1 245 ? 56.218  43.996  -19.528 1.00 0.00 ? 245 GLY A C   1  
ATOM 1244   O O   . GLY A 1 245 ? 55.154  44.612  -19.503 1.00 0.00 ? 245 GLY A O   1  
ATOM 1245   N N   . ALA A 1 246 ? 57.020  43.848  -20.583 1.00 0.00 ? 246 ALA A N   1  
ATOM 1246   C CA  . ALA A 1 246 ? 56.825  44.325  -21.959 1.00 0.00 ? 246 ALA A CA  1  
ATOM 1247   C C   . ALA A 1 246 ? 55.629  43.673  -22.557 1.00 0.00 ? 246 ALA A C   1  
ATOM 1248   O O   . ALA A 1 246 ? 54.886  44.363  -23.176 1.00 0.00 ? 246 ALA A O   1  
ATOM 1249   C CB  . ALA A 1 246 ? 58.017  44.061  -22.861 1.00 0.00 ? 246 ALA A CB  1  
ATOM 1250   N N   . ILE A 1 247 ? 55.364  42.322  -22.301 1.00 0.00 ? 247 ILE A N   1  
ATOM 1251   C CA  . ILE A 1 247 ? 54.170  41.635  -22.800 1.00 0.00 ? 247 ILE A CA  1  
ATOM 1252   C C   . ILE A 1 247 ? 52.933  42.160  -22.157 1.00 0.00 ? 247 ILE A C   1  
ATOM 1253   O O   . ILE A 1 247 ? 51.949  42.353  -22.795 1.00 0.00 ? 247 ILE A O   1  
ATOM 1254   C CB  . ILE A 1 247 ? 54.241  40.154  -22.846 1.00 0.00 ? 247 ILE A CB  1  
ATOM 1255   C CG1 . ILE A 1 247 ? 55.509  39.586  -23.466 1.00 0.00 ? 247 ILE A CG1 1  
ATOM 1256   C CG2 . ILE A 1 247 ? 52.881  39.473  -23.240 1.00 0.00 ? 247 ILE A CG2 1  
ATOM 1257   C CD1 . ILE A 1 247 ? 55.557  38.049  -23.501 1.00 0.00 ? 247 ILE A CD1 1  
ATOM 1258   N N   . LEU A 1 248 ? 52.955  42.425  -20.871 1.00 0.00 ? 248 LEU A N   1  
ATOM 1259   C CA  . LEU A 1 248 ? 51.782  42.979  -20.169 1.00 0.00 ? 248 LEU A CA  1  
ATOM 1260   C C   . LEU A 1 248 ? 51.433  44.337  -20.652 1.00 0.00 ? 248 LEU A C   1  
ATOM 1261   O O   . LEU A 1 248 ? 50.230  44.604  -20.827 1.00 0.00 ? 248 LEU A O   1  
ATOM 1262   C CB  . LEU A 1 248 ? 52.195  43.203  -18.706 1.00 0.00 ? 248 LEU A CB  1  
ATOM 1263   C CG  . LEU A 1 248 ? 51.155  43.734  -17.732 1.00 0.00 ? 248 LEU A CG  1  
ATOM 1264   C CD1 . LEU A 1 248 ? 49.919  42.830  -17.607 1.00 0.00 ? 248 LEU A CD1 1  
ATOM 1265   C CD2 . LEU A 1 248 ? 51.620  43.946  -16.254 1.00 0.00 ? 248 LEU A CD2 1  
ATOM 1266   N N   . LYS A 1 249 ? 52.468  45.185  -20.911 1.00 0.00 ? 249 LYS A N   1  
ATOM 1267   C CA  . LYS A 1 249 ? 52.203  46.444  -21.462 1.00 0.00 ? 249 LYS A CA  1  
ATOM 1268   C C   . LYS A 1 249 ? 51.599  46.457  -22.797 1.00 0.00 ? 249 LYS A C   1  
ATOM 1269   O O   . LYS A 1 249 ? 50.650  47.221  -23.032 1.00 0.00 ? 249 LYS A O   1  
ATOM 1270   C CB  . LYS A 1 249 ? 53.520  47.293  -21.465 1.00 0.00 ? 249 LYS A CB  1  
ATOM 1271   C CG  . LYS A 1 249 ? 53.378  48.647  -22.058 1.00 0.00 ? 249 LYS A CG  1  
ATOM 1272   C CD  . LYS A 1 249 ? 52.362  49.630  -21.522 1.00 0.00 ? 249 LYS A CD  1  
ATOM 1273   C CE  . LYS A 1 249 ? 52.347  50.863  -22.411 1.00 0.00 ? 249 LYS A CE  1  
ATOM 1274   N NZ  . LYS A 1 249 ? 51.362  51.854  -21.866 1.00 0.00 ? 249 LYS A NZ  1  
ATOM 1275   N N   . ILE A 1 250 ? 52.112  45.559  -23.685 1.00 0.00 ? 250 ILE A N   1  
ATOM 1276   C CA  . ILE A 1 250 ? 51.526  45.528  -25.022 1.00 0.00 ? 250 ILE A CA  1  
ATOM 1277   C C   . ILE A 1 250 ? 50.068  45.086  -24.993 1.00 0.00 ? 250 ILE A C   1  
ATOM 1278   O O   . ILE A 1 250 ? 49.256  45.676  -25.699 1.00 0.00 ? 250 ILE A O   1  
ATOM 1279   C CB  . ILE A 1 250 ? 52.368  44.858  -26.102 1.00 0.00 ? 250 ILE A CB  1  
ATOM 1280   C CG1 . ILE A 1 250 ? 51.891  45.247  -27.549 1.00 0.00 ? 250 ILE A CG1 1  
ATOM 1281   C CG2 . ILE A 1 250 ? 52.494  43.318  -25.862 1.00 0.00 ? 250 ILE A CG2 1  
ATOM 1282   C CD1 . ILE A 1 250 ? 52.709  44.597  -28.676 1.00 0.00 ? 250 ILE A CD1 1  
ATOM 1283   N N   . PHE A 1 251 ? 49.703  44.019  -24.249 1.00 0.00 ? 251 PHE A N   1  
ATOM 1284   C CA  . PHE A 1 251 ? 48.284  43.586  -24.245 1.00 0.00 ? 251 PHE A CA  1  
ATOM 1285   C C   . PHE A 1 251 ? 47.245  44.498  -23.631 1.00 0.00 ? 251 PHE A C   1  
ATOM 1286   O O   . PHE A 1 251 ? 46.130  44.690  -24.121 1.00 0.00 ? 251 PHE A O   1  
ATOM 1287   C CB  . PHE A 1 251 ? 48.051  42.085  -23.917 1.00 0.00 ? 251 PHE A CB  1  
ATOM 1288   C CG  . PHE A 1 251 ? 48.323  41.605  -22.444 1.00 0.00 ? 251 PHE A CG  1  
ATOM 1289   C CD1 . PHE A 1 251 ? 47.593  42.056  -21.371 1.00 0.00 ? 251 PHE A CD1 1  
ATOM 1290   C CD2 . PHE A 1 251 ? 49.255  40.505  -22.285 1.00 0.00 ? 251 PHE A CD2 1  
ATOM 1291   C CE1 . PHE A 1 251 ? 47.802  41.535  -20.092 1.00 0.00 ? 251 PHE A CE1 1  
ATOM 1292   C CE2 . PHE A 1 251 ? 49.476  40.003  -21.022 1.00 0.00 ? 251 PHE A CE2 1  
ATOM 1293   C CZ  . PHE A 1 251 ? 48.772  40.543  -19.915 1.00 0.00 ? 251 PHE A CZ  1  
ATOM 1294   N N   . GLN A 1 252 ? 47.611  45.254  -22.533 1.00 0.00 ? 252 GLN A N   1  
ATOM 1295   C CA  . GLN A 1 252 ? 46.799  46.308  -22.005 1.00 0.00 ? 252 GLN A CA  1  
ATOM 1296   C C   . GLN A 1 252 ? 46.579  47.447  -22.952 1.00 0.00 ? 252 GLN A C   1  
ATOM 1297   O O   . GLN A 1 252 ? 45.512  48.059  -23.106 1.00 0.00 ? 252 GLN A O   1  
ATOM 1298   C CB  . GLN A 1 252 ? 47.509  46.928  -20.755 1.00 0.00 ? 252 GLN A CB  1  
ATOM 1299   C CG  . GLN A 1 252 ? 47.462  46.107  -19.435 1.00 0.00 ? 252 GLN A CG  1  
ATOM 1300   C CD  . GLN A 1 252 ? 48.387  46.599  -18.355 1.00 0.00 ? 252 GLN A CD  1  
ATOM 1301   O OE1 . GLN A 1 252 ? 48.211  45.977  -17.325 1.00 0.00 ? 252 GLN A OE1 1  
ATOM 1302   N NE2 . GLN A 1 252 ? 49.370  47.534  -18.578 1.00 0.00 ? 252 GLN A NE2 1  
ATOM 1303   N N   . GLN A 1 253 ? 47.660  47.783  -23.673 1.00 0.00 ? 253 GLN A N   1  
ATOM 1304   C CA  . GLN A 1 253 ? 47.647  48.856  -24.733 1.00 0.00 ? 253 GLN A CA  1  
ATOM 1305   C C   . GLN A 1 253 ? 46.718  48.472  -25.870 1.00 0.00 ? 253 GLN A C   1  
ATOM 1306   O O   . GLN A 1 253 ? 45.888  49.265  -26.336 1.00 0.00 ? 253 GLN A O   1  
ATOM 1307   C CB  . GLN A 1 253 ? 49.065  49.162  -25.220 1.00 0.00 ? 253 GLN A CB  1  
ATOM 1308   C CG  . GLN A 1 253 ? 49.121  50.261  -26.258 1.00 0.00 ? 253 GLN A CG  1  
ATOM 1309   C CD  . GLN A 1 253 ? 50.573  50.538  -26.722 1.00 0.00 ? 253 GLN A CD  1  
ATOM 1310   O OE1 . GLN A 1 253 ? 51.236  51.421  -26.231 1.00 0.00 ? 253 GLN A OE1 1  
ATOM 1311   N NE2 . GLN A 1 253 ? 51.026  49.725  -27.781 1.00 0.00 ? 253 GLN A NE2 1  
ATOM 1312   N N   . LYS A 1 254 ? 46.711  47.166  -26.333 1.00 0.00 ? 254 LYS A N   1  
ATOM 1313   C CA  . LYS A 1 254 ? 45.843  46.613  -27.381 1.00 0.00 ? 254 LYS A CA  1  
ATOM 1314   C C   . LYS A 1 254 ? 44.389  46.581  -27.063 1.00 0.00 ? 254 LYS A C   1  
ATOM 1315   O O   . LYS A 1 254 ? 43.655  46.983  -27.931 1.00 0.00 ? 254 LYS A O   1  
ATOM 1316   C CB  . LYS A 1 254 ? 46.152  45.144  -27.697 1.00 0.00 ? 254 LYS A CB  1  
ATOM 1317   C CG  . LYS A 1 254 ? 47.477  44.924  -28.391 1.00 0.00 ? 254 LYS A CG  1  
ATOM 1318   C CD  . LYS A 1 254 ? 47.670  43.521  -28.925 1.00 0.00 ? 254 LYS A CD  1  
ATOM 1319   C CE  . LYS A 1 254 ? 49.015  43.269  -29.518 1.00 0.00 ? 254 LYS A CE  1  
ATOM 1320   N NZ  . LYS A 1 254 ? 49.361  44.402  -30.461 1.00 0.00 ? 254 LYS A NZ  1  
ATOM 1321   N N   . ILE A 1 255 ? 43.959  46.271  -25.811 1.00 0.00 ? 255 ILE A N   1  
ATOM 1322   C CA  . ILE A 1 255 ? 42.562  46.358  -25.411 1.00 0.00 ? 255 ILE A CA  1  
ATOM 1323   C C   . ILE A 1 255 ? 42.026  47.735  -25.438 1.00 0.00 ? 255 ILE A C   1  
ATOM 1324   O O   . ILE A 1 255 ? 40.880  47.996  -25.921 1.00 0.00 ? 255 ILE A O   1  
ATOM 1325   C CB  . ILE A 1 255 ? 42.231  45.898  -23.949 1.00 0.00 ? 255 ILE A CB  1  
ATOM 1326   C CG1 . ILE A 1 255 ? 42.619  44.432  -23.778 1.00 0.00 ? 255 ILE A CG1 1  
ATOM 1327   C CG2 . ILE A 1 255 ? 40.760  46.066  -23.576 1.00 0.00 ? 255 ILE A CG2 1  
ATOM 1328   C CD1 . ILE A 1 255 ? 42.339  43.868  -22.375 1.00 0.00 ? 255 ILE A CD1 1  
ATOM 1329   N N   . LEU A 1 256 ? 42.833  48.731  -25.011 1.00 0.00 ? 256 LEU A N   1  
ATOM 1330   C CA  . LEU A 1 256 ? 42.547  50.168  -25.195 1.00 0.00 ? 256 LEU A CA  1  
ATOM 1331   C C   . LEU A 1 256 ? 42.517  50.567  -26.595 1.00 0.00 ? 256 LEU A C   1  
ATOM 1332   O O   . LEU A 1 256 ? 41.684  51.295  -27.133 1.00 0.00 ? 256 LEU A O   1  
ATOM 1333   C CB  . LEU A 1 256 ? 43.621  51.122  -24.557 1.00 0.00 ? 256 LEU A CB  1  
ATOM 1334   C CG  . LEU A 1 256 ? 43.542  51.050  -23.017 1.00 0.00 ? 256 LEU A CG  1  
ATOM 1335   C CD1 . LEU A 1 256 ? 44.715  51.627  -22.341 1.00 0.00 ? 256 LEU A CD1 1  
ATOM 1336   C CD2 . LEU A 1 256 ? 42.250  51.756  -22.466 1.00 0.00 ? 256 LEU A CD2 1  
ATOM 1337   N N   . GLU A 1 257 ? 43.447  50.095  -27.403 1.00 0.00 ? 257 GLU A N   1  
ATOM 1338   C CA  . GLU A 1 257 ? 43.556  50.478  -28.776 1.00 0.00 ? 257 GLU A CA  1  
ATOM 1339   C C   . GLU A 1 257 ? 42.357  50.109  -29.605 1.00 0.00 ? 257 GLU A C   1  
ATOM 1340   O O   . GLU A 1 257 ? 41.941  50.963  -30.398 1.00 0.00 ? 257 GLU A O   1  
ATOM 1341   C CB  . GLU A 1 257 ? 44.757  49.836  -29.539 1.00 0.00 ? 257 GLU A CB  1  
ATOM 1342   C CG  . GLU A 1 257 ? 45.105  50.614  -30.839 1.00 0.00 ? 257 GLU A CG  1  
ATOM 1343   C CD  . GLU A 1 257 ? 46.545  50.136  -31.276 1.00 0.00 ? 257 GLU A CD  1  
ATOM 1344   O OE1 . GLU A 1 257 ? 47.639  50.351  -30.633 1.00 0.00 ? 257 GLU A OE1 1  
ATOM 1345   O OE2 . GLU A 1 257 ? 46.561  49.547  -32.408 1.00 0.00 ? 257 GLU A OE2 1  
ATOM 1346   N N   . ASN A 1 258 ? 41.883  48.842  -29.487 1.00 0.00 ? 258 ASN A N   1  
ATOM 1347   C CA  . ASN A 1 258 ? 40.827  48.384  -30.368 1.00 0.00 ? 258 ASN A CA  1  
ATOM 1348   C C   . ASN A 1 258 ? 39.484  49.060  -30.099 1.00 0.00 ? 258 ASN A C   1  
ATOM 1349   O O   . ASN A 1 258 ? 38.655  49.269  -30.985 1.00 0.00 ? 258 ASN A O   1  
ATOM 1350   C CB  . ASN A 1 258 ? 40.746  46.902  -30.296 1.00 0.00 ? 258 ASN A CB  1  
ATOM 1351   C CG  . ASN A 1 258 ? 41.983  46.408  -30.977 1.00 0.00 ? 258 ASN A CG  1  
ATOM 1352   O OD1 . ASN A 1 258 ? 42.379  46.937  -32.051 1.00 0.00 ? 258 ASN A OD1 1  
ATOM 1353   N ND2 . ASN A 1 258 ? 42.676  45.388  -30.396 1.00 0.00 ? 258 ASN A ND2 1  
ATOM 1354   N N   . LEU A 1 259 ? 39.308  49.568  -28.845 1.00 0.00 ? 259 LEU A N   1  
ATOM 1355   C CA  . LEU A 1 259 ? 38.093  50.121  -28.425 1.00 0.00 ? 259 LEU A CA  1  
ATOM 1356   C C   . LEU A 1 259 ? 36.946  49.165  -28.652 1.00 0.00 ? 259 LEU A C   1  
ATOM 1357   O O   . LEU A 1 259 ? 36.879  48.054  -28.106 1.00 0.00 ? 259 LEU A O   1  
ATOM 1358   C CB  . LEU A 1 259 ? 37.957  51.563  -28.953 1.00 0.00 ? 259 LEU A CB  1  
ATOM 1359   C CG  . LEU A 1 259 ? 37.548  52.538  -27.873 1.00 0.00 ? 259 LEU A CG  1  
ATOM 1360   C CD1 . LEU A 1 259 ? 38.600  52.643  -26.766 1.00 0.00 ? 259 LEU A CD1 1  
ATOM 1361   C CD2 . LEU A 1 259 ? 37.252  53.955  -28.411 1.00 0.00 ? 259 LEU A CD2 1  
ATOM 1362   N N   . GLY A 1 260 ? 35.968  49.723  -29.421 1.00 0.00 ? 260 GLY A N   1  
ATOM 1363   C CA  . GLY A 1 260 ? 34.707  49.107  -29.817 1.00 0.00 ? 260 GLY A CA  1  
ATOM 1364   C C   . GLY A 1 260 ? 34.916  47.805  -30.684 1.00 0.00 ? 260 GLY A C   1  
ATOM 1365   O O   . GLY A 1 260 ? 36.091  47.583  -30.998 1.00 0.00 ? 260 GLY A O   1  
ATOM 1366   N N   . ASP A 1 261 ? 33.843  47.086  -31.019 1.00 0.00 ? 261 ASP A N   1  
ATOM 1367   C CA  . ASP A 1 261 ? 33.786  45.909  -31.830 1.00 0.00 ? 261 ASP A CA  1  
ATOM 1368   C C   . ASP A 1 261 ? 33.636  44.887  -30.706 1.00 0.00 ? 261 ASP A C   1  
ATOM 1369   O O   . ASP A 1 261 ? 34.652  44.381  -30.260 1.00 0.00 ? 261 ASP A O   1  
ATOM 1370   C CB  . ASP A 1 261 ? 34.836  45.496  -32.866 1.00 0.00 ? 261 ASP A CB  1  
ATOM 1371   C CG  . ASP A 1 261 ? 34.373  44.419  -33.865 1.00 0.00 ? 261 ASP A CG  1  
ATOM 1372   O OD1 . ASP A 1 261 ? 33.234  43.902  -33.683 1.00 0.00 ? 261 ASP A OD1 1  
ATOM 1373   O OD2 . ASP A 1 261 ? 35.220  44.012  -34.729 1.00 0.00 ? 261 ASP A OD2 1  
ATOM 1374   N N   . ARG A 1 262 ? 32.371  44.622  -30.303 1.00 0.00 ? 262 ARG A N   1  
ATOM 1375   C CA  . ARG A 1 262 ? 31.957  43.755  -29.171 1.00 0.00 ? 262 ARG A CA  1  
ATOM 1376   C C   . ARG A 1 262 ? 32.363  42.317  -29.244 1.00 0.00 ? 262 ARG A C   1  
ATOM 1377   O O   . ARG A 1 262 ? 32.857  41.862  -28.200 1.00 0.00 ? 262 ARG A O   1  
ATOM 1378   C CB  . ARG A 1 262 ? 30.380  43.799  -29.095 1.00 0.00 ? 262 ARG A CB  1  
ATOM 1379   C CG  . ARG A 1 262 ? 29.906  45.114  -28.624 1.00 0.00 ? 262 ARG A CG  1  
ATOM 1380   C CD  . ARG A 1 262 ? 28.358  45.333  -28.441 1.00 0.00 ? 262 ARG A CD  1  
ATOM 1381   N NE  . ARG A 1 262 ? 27.640  45.584  -29.722 1.00 0.00 ? 262 ARG A NE  1  
ATOM 1382   C CZ  . ARG A 1 262 ? 27.558  46.807  -30.306 1.00 0.00 ? 262 ARG A CZ  1  
ATOM 1383   N NH1 . ARG A 1 262 ? 28.369  47.795  -29.803 1.00 0.00 ? 262 ARG A NH1 1  
ATOM 1384   N NH2 . ARG A 1 262 ? 26.766  46.994  -31.394 1.00 0.00 ? 262 ARG A NH2 1  
ATOM 1385   N N   . SER A 1 263 ? 32.258  41.559  -30.341 1.00 0.00 ? 263 SER A N   1  
ATOM 1386   C CA  . SER A 1 263 ? 32.526  40.117  -30.400 1.00 0.00 ? 263 SER A CA  1  
ATOM 1387   C C   . SER A 1 263 ? 33.962  39.787  -30.065 1.00 0.00 ? 263 SER A C   1  
ATOM 1388   O O   . SER A 1 263 ? 34.241  39.031  -29.182 1.00 0.00 ? 263 SER A O   1  
ATOM 1389   C CB  . SER A 1 263 ? 32.198  39.424  -31.697 1.00 0.00 ? 263 SER A CB  1  
ATOM 1390   O OG  . SER A 1 263 ? 30.788  39.433  -31.892 1.00 0.00 ? 263 SER A OG  1  
ATOM 1391   N N   . SER A 1 264 ? 34.854  40.588  -30.793 1.00 0.00 ? 264 SER A N   1  
ATOM 1392   C CA  . SER A 1 264 ? 36.244  40.476  -30.679 1.00 0.00 ? 264 SER A CA  1  
ATOM 1393   C C   . SER A 1 264 ? 36.834  40.843  -29.343 1.00 0.00 ? 264 SER A C   1  
ATOM 1394   O O   . SER A 1 264 ? 37.568  40.035  -28.826 1.00 0.00 ? 264 SER A O   1  
ATOM 1395   C CB  . SER A 1 264 ? 36.922  41.456  -31.661 1.00 0.00 ? 264 SER A CB  1  
ATOM 1396   O OG  . SER A 1 264 ? 36.296  41.359  -32.925 1.00 0.00 ? 264 SER A OG  1  
ATOM 1397   N N   . VAL A 1 265 ? 36.492  41.960  -28.742 1.00 0.00 ? 265 VAL A N   1  
ATOM 1398   C CA  . VAL A 1 265 ? 36.934  42.422  -27.445 1.00 0.00 ? 265 VAL A CA  1  
ATOM 1399   C C   . VAL A 1 265 ? 36.572  41.556  -26.233 1.00 0.00 ? 265 VAL A C   1  
ATOM 1400   O O   . VAL A 1 265 ? 37.512  41.221  -25.482 1.00 0.00 ? 265 VAL A O   1  
ATOM 1401   C CB  . VAL A 1 265 ? 36.666  43.925  -27.121 1.00 0.00 ? 265 VAL A CB  1  
ATOM 1402   C CG1 . VAL A 1 265 ? 35.196  44.193  -26.725 1.00 0.00 ? 265 VAL A CG1 1  
ATOM 1403   C CG2 . VAL A 1 265 ? 37.711  44.459  -26.164 1.00 0.00 ? 265 VAL A CG2 1  
ATOM 1404   N N   . MET A 1 266 ? 35.305  41.013  -26.083 1.00 0.00 ? 266 MET A N   1  
ATOM 1405   C CA  . MET A 1 266 ? 34.869  40.099  -25.113 1.00 0.00 ? 266 MET A CA  1  
ATOM 1406   C C   . MET A 1 266 ? 35.630  38.772  -25.209 1.00 0.00 ? 266 MET A C   1  
ATOM 1407   O O   . MET A 1 266 ? 35.961  38.237  -24.195 1.00 0.00 ? 266 MET A O   1  
ATOM 1408   C CB  . MET A 1 266 ? 33.326  39.807  -25.252 1.00 0.00 ? 266 MET A CB  1  
ATOM 1409   C CG  . MET A 1 266 ? 32.452  41.031  -24.897 1.00 0.00 ? 266 MET A CG  1  
ATOM 1410   S SD  . MET A 1 266 ? 32.715  42.229  -23.575 1.00 0.00 ? 266 MET A SD  1  
ATOM 1411   C CE  . MET A 1 266 ? 31.113  43.050  -23.856 1.00 0.00 ? 266 MET A CE  1  
ATOM 1412   N N   . PHE A 1 267 ? 35.872  38.286  -26.475 1.00 0.00 ? 267 PHE A N   1  
ATOM 1413   C CA  . PHE A 1 267 ? 36.686  37.079  -26.706 1.00 0.00 ? 267 PHE A CA  1  
ATOM 1414   C C   . PHE A 1 267 ? 38.084  37.276  -26.220 1.00 0.00 ? 267 PHE A C   1  
ATOM 1415   O O   . PHE A 1 267 ? 38.577  36.464  -25.427 1.00 0.00 ? 267 PHE A O   1  
ATOM 1416   C CB  . PHE A 1 267 ? 36.755  36.730  -28.213 1.00 0.00 ? 267 PHE A CB  1  
ATOM 1417   C CG  . PHE A 1 267 ? 37.184  35.326  -28.501 1.00 0.00 ? 267 PHE A CG  1  
ATOM 1418   C CD1 . PHE A 1 267 ? 38.490  35.000  -28.399 1.00 0.00 ? 267 PHE A CD1 1  
ATOM 1419   C CD2 . PHE A 1 267 ? 36.322  34.410  -29.219 1.00 0.00 ? 267 PHE A CD2 1  
ATOM 1420   C CE1 . PHE A 1 267 ? 39.013  33.755  -28.796 1.00 0.00 ? 267 PHE A CE1 1  
ATOM 1421   C CE2 . PHE A 1 267 ? 36.800  33.168  -29.710 1.00 0.00 ? 267 PHE A CE2 1  
ATOM 1422   C CZ  . PHE A 1 267 ? 38.178  32.851  -29.510 1.00 0.00 ? 267 PHE A CZ  1  
ATOM 1423   N N   . LEU A 1 268 ? 38.696  38.403  -26.584 1.00 0.00 ? 268 LEU A N   1  
ATOM 1424   C CA  . LEU A 1 268 ? 40.044  38.731  -26.182 1.00 0.00 ? 268 LEU A CA  1  
ATOM 1425   C C   . LEU A 1 268 ? 40.191  38.902  -24.614 1.00 0.00 ? 268 LEU A C   1  
ATOM 1426   O O   . LEU A 1 268 ? 41.237  38.500  -24.118 1.00 0.00 ? 268 LEU A O   1  
ATOM 1427   C CB  . LEU A 1 268 ? 40.551  40.043  -26.873 1.00 0.00 ? 268 LEU A CB  1  
ATOM 1428   C CG  . LEU A 1 268 ? 41.035  39.650  -28.377 1.00 0.00 ? 268 LEU A CG  1  
ATOM 1429   C CD1 . LEU A 1 268 ? 41.034  40.802  -29.373 1.00 0.00 ? 268 LEU A CD1 1  
ATOM 1430   C CD2 . LEU A 1 268 ? 42.389  38.996  -28.305 1.00 0.00 ? 268 LEU A CD2 1  
ATOM 1431   N N   . LYS A 1 269 ? 39.181  39.465  -23.952 1.00 0.00 ? 269 LYS A N   1  
ATOM 1432   C CA  . LYS A 1 269 ? 39.080  39.670  -22.517 1.00 0.00 ? 269 LYS A CA  1  
ATOM 1433   C C   . LYS A 1 269 ? 39.134  38.292  -21.823 1.00 0.00 ? 269 LYS A C   1  
ATOM 1434   O O   . LYS A 1 269 ? 39.812  38.148  -20.805 1.00 0.00 ? 269 LYS A O   1  
ATOM 1435   C CB  . LYS A 1 269 ? 37.787  40.394  -22.283 1.00 0.00 ? 269 LYS A CB  1  
ATOM 1436   C CG  . LYS A 1 269 ? 37.670  40.804  -20.822 1.00 0.00 ? 269 LYS A CG  1  
ATOM 1437   C CD  . LYS A 1 269 ? 36.355  41.502  -20.398 1.00 0.00 ? 269 LYS A CD  1  
ATOM 1438   C CE  . LYS A 1 269 ? 35.196  40.492  -20.116 1.00 0.00 ? 269 LYS A CE  1  
ATOM 1439   N NZ  . LYS A 1 269 ? 35.646  39.537  -19.072 1.00 0.00 ? 269 LYS A NZ  1  
ATOM 1440   N N   . LYS A 1 270 ? 38.407  37.281  -22.355 1.00 0.00 ? 270 LYS A N   1  
ATOM 1441   C CA  . LYS A 1 270 ? 38.346  35.960  -21.733 1.00 0.00 ? 270 LYS A CA  1  
ATOM 1442   C C   . LYS A 1 270 ? 39.699  35.276  -21.656 1.00 0.00 ? 270 LYS A C   1  
ATOM 1443   O O   . LYS A 1 270 ? 40.091  34.787  -20.567 1.00 0.00 ? 270 LYS A O   1  
ATOM 1444   C CB  . LYS A 1 270 ? 37.389  35.050  -22.546 1.00 0.00 ? 270 LYS A CB  1  
ATOM 1445   C CG  . LYS A 1 270 ? 37.057  33.719  -21.852 1.00 0.00 ? 270 LYS A CG  1  
ATOM 1446   C CD  . LYS A 1 270 ? 36.135  32.770  -22.581 1.00 0.00 ? 270 LYS A CD  1  
ATOM 1447   C CE  . LYS A 1 270 ? 35.889  31.444  -21.748 1.00 0.00 ? 270 LYS A CE  1  
ATOM 1448   N NZ  . LYS A 1 270 ? 35.044  30.481  -22.404 1.00 0.00 ? 270 LYS A NZ  1  
ATOM 1449   N N   . LEU A 1 271 ? 40.495  35.429  -22.727 1.00 0.00 ? 271 LEU A N   1  
ATOM 1450   C CA  . LEU A 1 271 ? 41.874  35.034  -22.877 1.00 0.00 ? 271 LEU A CA  1  
ATOM 1451   C C   . LEU A 1 271 ? 42.841  35.825  -21.949 1.00 0.00 ? 271 LEU A C   1  
ATOM 1452   O O   . LEU A 1 271 ? 43.686  35.224  -21.314 1.00 0.00 ? 271 LEU A O   1  
ATOM 1453   C CB  . LEU A 1 271 ? 42.454  35.021  -24.296 1.00 0.00 ? 271 LEU A CB  1  
ATOM 1454   C CG  . LEU A 1 271 ? 41.505  34.364  -25.399 1.00 0.00 ? 271 LEU A CG  1  
ATOM 1455   C CD1 . LEU A 1 271 ? 42.297  34.290  -26.696 1.00 0.00 ? 271 LEU A CD1 1  
ATOM 1456   C CD2 . LEU A 1 271 ? 40.886  32.989  -25.030 1.00 0.00 ? 271 LEU A CD2 1  
ATOM 1457   N N   . LEU A 1 272 ? 42.592  37.121  -21.879 1.00 0.00 ? 272 LEU A N   1  
ATOM 1458   C CA  . LEU A 1 272 ? 43.382  38.039  -21.089 1.00 0.00 ? 272 LEU A CA  1  
ATOM 1459   C C   . LEU A 1 272 ? 43.362  37.707  -19.597 1.00 0.00 ? 272 LEU A C   1  
ATOM 1460   O O   . LEU A 1 272 ? 44.388  37.574  -18.951 1.00 0.00 ? 272 LEU A O   1  
ATOM 1461   C CB  . LEU A 1 272 ? 42.993  39.433  -21.411 1.00 0.00 ? 272 LEU A CB  1  
ATOM 1462   C CG  . LEU A 1 272 ? 44.274  40.345  -21.782 1.00 0.00 ? 272 LEU A CG  1  
ATOM 1463   C CD1 . LEU A 1 272 ? 44.735  39.933  -23.196 1.00 0.00 ? 272 LEU A CD1 1  
ATOM 1464   C CD2 . LEU A 1 272 ? 43.954  41.816  -21.798 1.00 0.00 ? 272 LEU A CD2 1  
ATOM 1465   N N   . ASN A 1 273 ? 42.115  37.387  -19.050 1.00 0.00 ? 273 ASN A N   1  
ATOM 1466   C CA  . ASN A 1 273 ? 41.941  37.106  -17.641 1.00 0.00 ? 273 ASN A CA  1  
ATOM 1467   C C   . ASN A 1 273 ? 42.742  35.827  -17.334 1.00 0.00 ? 273 ASN A C   1  
ATOM 1468   O O   . ASN A 1 273 ? 43.410  35.798  -16.295 1.00 0.00 ? 273 ASN A O   1  
ATOM 1469   C CB  . ASN A 1 273 ? 40.519  37.015  -16.972 1.00 0.00 ? 273 ASN A CB  1  
ATOM 1470   C CG  . ASN A 1 273 ? 39.554  36.048  -17.609 1.00 0.00 ? 273 ASN A CG  1  
ATOM 1471   O OD1 . ASN A 1 273 ? 38.733  36.506  -18.414 1.00 0.00 ? 273 ASN A OD1 1  
ATOM 1472   N ND2 . ASN A 1 273 ? 39.555  34.729  -17.205 1.00 0.00 ? 273 ASN A ND2 1  
ATOM 1473   N N   . ASN A 1 274 ? 42.804  34.731  -18.179 1.00 0.00 ? 274 ASN A N   1  
ATOM 1474   C CA  . ASN A 1 274 ? 43.551  33.535  -17.991 1.00 0.00 ? 274 ASN A CA  1  
ATOM 1475   C C   . ASN A 1 274 ? 45.043  33.766  -17.968 1.00 0.00 ? 274 ASN A C   1  
ATOM 1476   O O   . ASN A 1 274 ? 45.686  33.112  -17.147 1.00 0.00 ? 274 ASN A O   1  
ATOM 1477   C CB  . ASN A 1 274 ? 43.251  32.445  -19.029 1.00 0.00 ? 274 ASN A CB  1  
ATOM 1478   C CG  . ASN A 1 274 ? 43.662  31.051  -18.474 1.00 0.00 ? 274 ASN A CG  1  
ATOM 1479   O OD1 . ASN A 1 274 ? 43.835  30.820  -17.265 1.00 0.00 ? 274 ASN A OD1 1  
ATOM 1480   N ND2 . ASN A 1 274 ? 43.707  30.031  -19.413 1.00 0.00 ? 274 ASN A ND2 1  
ATOM 1481   N N   . ILE A 1 275 ? 45.599  34.674  -18.855 1.00 0.00 ? 275 ILE A N   1  
ATOM 1482   C CA  . ILE A 1 275 ? 46.990  35.148  -19.094 1.00 0.00 ? 275 ILE A CA  1  
ATOM 1483   C C   . ILE A 1 275 ? 47.379  35.951  -17.841 1.00 0.00 ? 275 ILE A C   1  
ATOM 1484   O O   . ILE A 1 275 ? 48.530  35.906  -17.440 1.00 0.00 ? 275 ILE A O   1  
ATOM 1485   C CB  . ILE A 1 275 ? 47.122  35.866  -20.412 1.00 0.00 ? 275 ILE A CB  1  
ATOM 1486   C CG1 . ILE A 1 275 ? 47.803  34.958  -21.430 1.00 0.00 ? 275 ILE A CG1 1  
ATOM 1487   C CG2 . ILE A 1 275 ? 47.872  37.210  -20.338 1.00 0.00 ? 275 ILE A CG2 1  
ATOM 1488   C CD1 . ILE A 1 275 ? 47.989  35.598  -22.816 1.00 0.00 ? 275 ILE A CD1 1  
ATOM 1489   N N   . SER A 1 276 ? 46.528  36.738  -17.209 1.00 0.00 ? 276 SER A N   1  
ATOM 1490   C CA  . SER A 1 276 ? 46.904  37.618  -16.085 1.00 0.00 ? 276 SER A CA  1  
ATOM 1491   C C   . SER A 1 276 ? 47.398  36.921  -14.853 1.00 0.00 ? 276 SER A C   1  
ATOM 1492   O O   . SER A 1 276 ? 48.008  37.545  -13.964 1.00 0.00 ? 276 SER A O   1  
ATOM 1493   C CB  . SER A 1 276 ? 45.760  38.583  -15.708 1.00 0.00 ? 276 SER A CB  1  
ATOM 1494   O OG  . SER A 1 276 ? 45.267  39.288  -16.814 1.00 0.00 ? 276 SER A OG  1  
ATOM 1495   N N   . GLN A 1 277 ? 46.994  35.675  -14.677 1.00 0.00 ? 277 GLN A N   1  
ATOM 1496   C CA  . GLN A 1 277 ? 47.152  34.895  -13.476 1.00 0.00 ? 277 GLN A CA  1  
ATOM 1497   C C   . GLN A 1 277 ? 48.565  34.729  -13.027 1.00 0.00 ? 277 GLN A C   1  
ATOM 1498   O O   . GLN A 1 277 ? 48.858  34.662  -11.857 1.00 0.00 ? 277 GLN A O   1  
ATOM 1499   C CB  . GLN A 1 277 ? 46.503  33.473  -13.555 1.00 0.00 ? 277 GLN A CB  1  
ATOM 1500   C CG  . GLN A 1 277 ? 44.962  33.438  -13.689 1.00 0.00 ? 277 GLN A CG  1  
ATOM 1501   C CD  . GLN A 1 277 ? 44.381  33.955  -12.377 1.00 0.00 ? 277 GLN A CD  1  
ATOM 1502   O OE1 . GLN A 1 277 ? 44.244  33.222  -11.388 1.00 0.00 ? 277 GLN A OE1 1  
ATOM 1503   N NE2 . GLN A 1 277 ? 44.080  35.299  -12.382 1.00 0.00 ? 277 GLN A NE2 1  
ATOM 1504   N N   . ASP A 1 278 ? 49.569  34.510  -13.935 1.00 0.00 ? 278 ASP A N   1  
ATOM 1505   C CA  . ASP A 1 278 ? 50.989  34.317  -13.501 1.00 0.00 ? 278 ASP A CA  1  
ATOM 1506   C C   . ASP A 1 278 ? 51.470  35.600  -12.900 1.00 0.00 ? 278 ASP A C   1  
ATOM 1507   O O   . ASP A 1 278 ? 52.086  35.561  -11.879 1.00 0.00 ? 278 ASP A O   1  
ATOM 1508   C CB  . ASP A 1 278 ? 51.956  33.751  -14.574 1.00 0.00 ? 278 ASP A CB  1  
ATOM 1509   C CG  . ASP A 1 278 ? 51.777  34.520  -15.960 1.00 0.00 ? 278 ASP A CG  1  
ATOM 1510   O OD1 . ASP A 1 278 ? 52.338  35.601  -16.211 1.00 0.00 ? 278 ASP A OD1 1  
ATOM 1511   O OD2 . ASP A 1 278 ? 51.065  33.856  -16.745 1.00 0.00 ? 278 ASP A OD2 1  
ATOM 1512   N N   . TYR A 1 279 ? 51.098  36.769  -13.533 1.00 0.00 ? 279 TYR A N   1  
ATOM 1513   C CA  . TYR A 1 279 ? 51.458  38.022  -12.972 1.00 0.00 ? 279 TYR A CA  1  
ATOM 1514   C C   . TYR A 1 279 ? 50.810  38.189  -11.577 1.00 0.00 ? 279 TYR A C   1  
ATOM 1515   O O   . TYR A 1 279 ? 51.466  38.475  -10.579 1.00 0.00 ? 279 TYR A O   1  
ATOM 1516   C CB  . TYR A 1 279 ? 51.073  39.242  -13.805 1.00 0.00 ? 279 TYR A CB  1  
ATOM 1517   C CG  . TYR A 1 279 ? 51.541  39.220  -15.257 1.00 0.00 ? 279 TYR A CG  1  
ATOM 1518   C CD1 . TYR A 1 279 ? 50.782  38.695  -16.293 1.00 0.00 ? 279 TYR A CD1 1  
ATOM 1519   C CD2 . TYR A 1 279 ? 52.716  39.937  -15.594 1.00 0.00 ? 279 TYR A CD2 1  
ATOM 1520   C CE1 . TYR A 1 279 ? 51.302  38.712  -17.636 1.00 0.00 ? 279 TYR A CE1 1  
ATOM 1521   C CE2 . TYR A 1 279 ? 53.183  40.001  -16.931 1.00 0.00 ? 279 TYR A CE2 1  
ATOM 1522   C CZ  . TYR A 1 279 ? 52.400  39.427  -17.977 1.00 0.00 ? 279 TYR A CZ  1  
ATOM 1523   O OH  . TYR A 1 279 ? 52.921  39.543  -19.279 1.00 0.00 ? 279 TYR A OH  1  
ATOM 1524   N N   . CYS A 1 280 ? 49.510  37.847  -11.461 1.00 0.00 ? 280 CYS A N   1  
ATOM 1525   C CA  . CYS A 1 280 ? 48.826  37.865  -10.171 1.00 0.00 ? 280 CYS A CA  1  
ATOM 1526   C C   . CYS A 1 280 ? 49.534  37.009  -9.090  1.00 0.00 ? 280 CYS A C   1  
ATOM 1527   O O   . CYS A 1 280 ? 49.686  37.378  -7.945  1.00 0.00 ? 280 CYS A O   1  
ATOM 1528   C CB  . CYS A 1 280 ? 47.392  37.396  -10.350 1.00 0.00 ? 280 CYS A CB  1  
ATOM 1529   S SG  . CYS A 1 280 ? 46.345  37.552  -8.877  1.00 0.00 ? 280 CYS A SG  1  
ATOM 1530   N N   . THR A 1 281 ? 50.004  35.723  -9.423  1.00 0.00 ? 281 THR A N   1  
ATOM 1531   C CA  . THR A 1 281 ? 50.620  34.815  -8.514  1.00 0.00 ? 281 THR A CA  1  
ATOM 1532   C C   . THR A 1 281 ? 51.959  35.414  -8.028  1.00 0.00 ? 281 THR A C   1  
ATOM 1533   O O   . THR A 1 281 ? 52.380  35.448  -6.854  1.00 0.00 ? 281 THR A O   1  
ATOM 1534   C CB  . THR A 1 281 ? 50.848  33.441  -9.170  1.00 0.00 ? 281 THR A CB  1  
ATOM 1535   O OG1 . THR A 1 281 ? 49.671  32.924  -9.832  1.00 0.00 ? 281 THR A OG1 1  
ATOM 1536   C CG2 . THR A 1 281 ? 51.272  32.468  -8.025  1.00 0.00 ? 281 THR A CG2 1  
ATOM 1537   N N   . MET A 1 282 ? 52.770  36.046  -8.934  1.00 0.00 ? 282 MET A N   1  
ATOM 1538   C CA  . MET A 1 282 ? 53.996  36.676  -8.651  1.00 0.00 ? 282 MET A CA  1  
ATOM 1539   C C   . MET A 1 282 ? 53.749  37.833  -7.756  1.00 0.00 ? 282 MET A C   1  
ATOM 1540   O O   . MET A 1 282 ? 54.410  38.046  -6.753  1.00 0.00 ? 282 MET A O   1  
ATOM 1541   C CB  . MET A 1 282 ? 54.634  37.159  -9.945  1.00 0.00 ? 282 MET A CB  1  
ATOM 1542   C CG  . MET A 1 282 ? 56.125  37.251  -10.205 1.00 0.00 ? 282 MET A CG  1  
ATOM 1543   S SD  . MET A 1 282 ? 57.077  38.053  -8.967  1.00 0.00 ? 282 MET A SD  1  
ATOM 1544   C CE  . MET A 1 282 ? 56.713  39.819  -9.042  1.00 0.00 ? 282 MET A CE  1  
ATOM 1545   N N   . LEU A 1 283 ? 52.709  38.698  -7.993  1.00 0.00 ? 283 LEU A N   1  
ATOM 1546   C CA  . LEU A 1 283 ? 52.470  39.844  -7.161  1.00 0.00 ? 283 LEU A CA  1  
ATOM 1547   C C   . LEU A 1 283 ? 52.060  39.459  -5.734  1.00 0.00 ? 283 LEU A C   1  
ATOM 1548   O O   . LEU A 1 283 ? 52.672  39.946  -4.782  1.00 0.00 ? 283 LEU A O   1  
ATOM 1549   C CB  . LEU A 1 283 ? 51.396  40.742  -7.868  1.00 0.00 ? 283 LEU A CB  1  
ATOM 1550   C CG  . LEU A 1 283 ? 52.020  41.418  -9.171  1.00 0.00 ? 283 LEU A CG  1  
ATOM 1551   C CD1 . LEU A 1 283 ? 50.831  41.812  -10.056 1.00 0.00 ? 283 LEU A CD1 1  
ATOM 1552   C CD2 . LEU A 1 283 ? 52.881  42.656  -8.884  1.00 0.00 ? 283 LEU A CD2 1  
ATOM 1553   N N   . TYR A 1 284 ? 51.144  38.433  -5.582  1.00 0.00 ? 284 TYR A N   1  
ATOM 1554   C CA  . TYR A 1 284 ? 50.815  37.994  -4.304  1.00 0.00 ? 284 TYR A CA  1  
ATOM 1555   C C   . TYR A 1 284 ? 51.995  37.416  -3.576  1.00 0.00 ? 284 TYR A C   1  
ATOM 1556   O O   . TYR A 1 284 ? 52.171  37.793  -2.415  1.00 0.00 ? 284 TYR A O   1  
ATOM 1557   C CB  . TYR A 1 284 ? 49.646  36.959  -4.468  1.00 0.00 ? 284 TYR A CB  1  
ATOM 1558   C CG  . TYR A 1 284 ? 49.219  36.485  -3.108  1.00 0.00 ? 284 TYR A CG  1  
ATOM 1559   C CD1 . TYR A 1 284 ? 48.535  37.419  -2.395  1.00 0.00 ? 284 TYR A CD1 1  
ATOM 1560   C CD2 . TYR A 1 284 ? 49.288  35.138  -2.729  1.00 0.00 ? 284 TYR A CD2 1  
ATOM 1561   C CE1 . TYR A 1 284 ? 48.155  37.046  -1.068  1.00 0.00 ? 284 TYR A CE1 1  
ATOM 1562   C CE2 . TYR A 1 284 ? 48.858  34.763  -1.450  1.00 0.00 ? 284 TYR A CE2 1  
ATOM 1563   C CZ  . TYR A 1 284 ? 48.278  35.723  -0.620  1.00 0.00 ? 284 TYR A CZ  1  
ATOM 1564   O OH  . TYR A 1 284 ? 47.771  35.374  0.681   1.00 0.00 ? 284 TYR A OH  1  
ATOM 1565   N N   . GLU A 1 285 ? 52.831  36.566  -4.175  1.00 0.00 ? 285 GLU A N   1  
ATOM 1566   C CA  . GLU A 1 285 ? 53.949  36.026  -3.522  1.00 0.00 ? 285 GLU A CA  1  
ATOM 1567   C C   . GLU A 1 285 ? 54.937  37.041  -3.057  1.00 0.00 ? 285 GLU A C   1  
ATOM 1568   O O   . GLU A 1 285 ? 55.341  36.980  -1.901  1.00 0.00 ? 285 GLU A O   1  
ATOM 1569   C CB  . GLU A 1 285 ? 54.750  34.900  -4.292  1.00 0.00 ? 285 GLU A CB  1  
ATOM 1570   C CG  . GLU A 1 285 ? 53.960  33.630  -4.519  1.00 0.00 ? 285 GLU A CG  1  
ATOM 1571   C CD  . GLU A 1 285 ? 54.748  32.543  -5.318  1.00 0.00 ? 285 GLU A CD  1  
ATOM 1572   O OE1 . GLU A 1 285 ? 55.722  32.017  -4.727  1.00 0.00 ? 285 GLU A OE1 1  
ATOM 1573   O OE2 . GLU A 1 285 ? 54.333  32.126  -6.428  1.00 0.00 ? 285 GLU A OE2 1  
ATOM 1574   N N   . TRP A 1 286 ? 55.238  37.983  -3.901  1.00 0.00 ? 286 TRP A N   1  
ATOM 1575   C CA  . TRP A 1 286 ? 56.276  39.082  -3.639  1.00 0.00 ? 286 TRP A CA  1  
ATOM 1576   C C   . TRP A 1 286 ? 55.842  40.044  -2.574  1.00 0.00 ? 286 TRP A C   1  
ATOM 1577   O O   . TRP A 1 286 ? 56.465  40.201  -1.500  1.00 0.00 ? 286 TRP A O   1  
ATOM 1578   C CB  . TRP A 1 286 ? 56.623  39.828  -4.904  1.00 0.00 ? 286 TRP A CB  1  
ATOM 1579   C CG  . TRP A 1 286 ? 57.524  41.053  -4.889  1.00 0.00 ? 286 TRP A CG  1  
ATOM 1580   C CD1 . TRP A 1 286 ? 57.399  42.229  -5.591  1.00 0.00 ? 286 TRP A CD1 1  
ATOM 1581   C CD2 . TRP A 1 286 ? 58.722  41.246  -4.014  1.00 0.00 ? 286 TRP A CD2 1  
ATOM 1582   N NE1 . TRP A 1 286 ? 58.368  43.158  -5.267  1.00 0.00 ? 286 TRP A NE1 1  
ATOM 1583   C CE2 . TRP A 1 286 ? 59.218  42.607  -4.311  1.00 0.00 ? 286 TRP A CE2 1  
ATOM 1584   C CE3 . TRP A 1 286 ? 59.415  40.452  -3.085  1.00 0.00 ? 286 TRP A CE3 1  
ATOM 1585   C CZ2 . TRP A 1 286 ? 60.380  43.063  -3.747  1.00 0.00 ? 286 TRP A CZ2 1  
ATOM 1586   C CZ3 . TRP A 1 286 ? 60.498  40.973  -2.407  1.00 0.00 ? 286 TRP A CZ3 1  
ATOM 1587   C CH2 . TRP A 1 286 ? 60.929  42.287  -2.715  1.00 0.00 ? 286 TRP A CH2 1  
ATOM 1588   N N   . LEU A 1 287 ? 54.667  40.637  -2.822  1.00 0.00 ? 287 LEU A N   1  
ATOM 1589   C CA  . LEU A 1 287 ? 54.151  41.653  -1.879  1.00 0.00 ? 287 LEU A CA  1  
ATOM 1590   C C   . LEU A 1 287 ? 53.763  41.061  -0.496  1.00 0.00 ? 287 LEU A C   1  
ATOM 1591   O O   . LEU A 1 287 ? 54.008  41.650  0.544   1.00 0.00 ? 287 LEU A O   1  
ATOM 1592   C CB  . LEU A 1 287 ? 52.899  42.442  -2.439  1.00 0.00 ? 287 LEU A CB  1  
ATOM 1593   C CG  . LEU A 1 287 ? 52.926  42.951  -3.879  1.00 0.00 ? 287 LEU A CG  1  
ATOM 1594   C CD1 . LEU A 1 287 ? 51.888  44.114  -3.888  1.00 0.00 ? 287 LEU A CD1 1  
ATOM 1595   C CD2 . LEU A 1 287 ? 54.322  43.444  -4.301  1.00 0.00 ? 287 LEU A CD2 1  
ATOM 1596   N N   . THR A 1 288 ? 53.073  39.866  -0.405  1.00 0.00 ? 288 THR A N   1  
ATOM 1597   C CA  . THR A 1 288 ? 52.554  39.262  0.837   1.00 0.00 ? 288 THR A CA  1  
ATOM 1598   C C   . THR A 1 288 ? 53.462  38.393  1.578   1.00 0.00 ? 288 THR A C   1  
ATOM 1599   O O   . THR A 1 288 ? 53.397  38.426  2.798   1.00 0.00 ? 288 THR A O   1  
ATOM 1600   C CB  . THR A 1 288 ? 51.126  38.737  0.715   1.00 0.00 ? 288 THR A CB  1  
ATOM 1601   O OG1 . THR A 1 288 ? 50.407  39.465  -0.338  1.00 0.00 ? 288 THR A OG1 1  
ATOM 1602   C CG2 . THR A 1 288 ? 50.390  39.102  2.014   1.00 0.00 ? 288 THR A CG2 1  
ATOM 1603   N N   . GLN A 1 289 ? 54.328  37.647  0.883   1.00 0.00 ? 289 GLN A N   1  
ATOM 1604   C CA  . GLN A 1 289 ? 55.218  36.649  1.546   1.00 0.00 ? 289 GLN A CA  1  
ATOM 1605   C C   . GLN A 1 289 ? 56.638  36.733  1.159   1.00 0.00 ? 289 GLN A C   1  
ATOM 1606   O O   . GLN A 1 289 ? 57.454  35.912  1.470   1.00 0.00 ? 289 GLN A O   1  
ATOM 1607   C CB  . GLN A 1 289 ? 54.864  35.192  1.190   1.00 0.00 ? 289 GLN A CB  1  
ATOM 1608   C CG  . GLN A 1 289 ? 53.452  34.850  1.716   1.00 0.00 ? 289 GLN A CG  1  
ATOM 1609   C CD  . GLN A 1 289 ? 53.225  33.429  1.846   1.00 0.00 ? 289 GLN A CD  1  
ATOM 1610   O OE1 . GLN A 1 289 ? 53.660  32.834  2.847   1.00 0.00 ? 289 GLN A OE1 1  
ATOM 1611   N NE2 . GLN A 1 289 ? 52.320  32.929  1.041   1.00 0.00 ? 289 GLN A NE2 1  
ATOM 1612   N N   . GLY A 1 290 ? 56.972  37.876  0.467   1.00 0.00 ? 290 GLY A N   1  
ATOM 1613   C CA  . GLY A 1 290 ? 58.402  38.122  0.250   1.00 0.00 ? 290 GLY A CA  1  
ATOM 1614   C C   . GLY A 1 290 ? 59.181  37.315  -0.703  1.00 0.00 ? 290 GLY A C   1  
ATOM 1615   O O   . GLY A 1 290 ? 60.400  37.360  -0.587  1.00 0.00 ? 290 GLY A O   1  
ATOM 1616   N N   . ILE A 1 291 ? 58.524  36.540  -1.677  1.00 0.00 ? 291 ILE A N   1  
ATOM 1617   C CA  . ILE A 1 291 ? 59.334  35.698  -2.562  1.00 0.00 ? 291 ILE A CA  1  
ATOM 1618   C C   . ILE A 1 291 ? 59.235  36.286  -3.918  1.00 0.00 ? 291 ILE A C   1  
ATOM 1619   O O   . ILE A 1 291 ? 58.120  36.434  -4.455  1.00 0.00 ? 291 ILE A O   1  
ATOM 1620   C CB  . ILE A 1 291 ? 58.698  34.326  -2.697  1.00 0.00 ? 291 ILE A CB  1  
ATOM 1621   C CG1 . ILE A 1 291 ? 58.164  33.816  -1.324  1.00 0.00 ? 291 ILE A CG1 1  
ATOM 1622   C CG2 . ILE A 1 291 ? 59.697  33.384  -3.374  1.00 0.00 ? 291 ILE A CG2 1  
ATOM 1623   C CD1 . ILE A 1 291 ? 57.504  32.428  -1.384  1.00 0.00 ? 291 ILE A CD1 1  
ATOM 1624   N N   . LEU A 1 292 ? 60.357  36.639  -4.524  1.00 0.00 ? 292 LEU A N   1  
ATOM 1625   C CA  . LEU A 1 292 ? 60.383  37.114  -5.943  1.00 0.00 ? 292 LEU A CA  1  
ATOM 1626   C C   . LEU A 1 292 ? 60.542  35.836  -6.809  1.00 0.00 ? 292 LEU A C   1  
ATOM 1627   O O   . LEU A 1 292 ? 61.405  34.996  -6.464  1.00 0.00 ? 292 LEU A O   1  
ATOM 1628   C CB  . LEU A 1 292 ? 61.564  38.101  -6.136  1.00 0.00 ? 292 LEU A CB  1  
ATOM 1629   C CG  . LEU A 1 292 ? 61.996  38.339  -7.672  1.00 0.00 ? 292 LEU A CG  1  
ATOM 1630   C CD1 . LEU A 1 292 ? 60.849  38.918  -8.573  1.00 0.00 ? 292 LEU A CD1 1  
ATOM 1631   C CD2 . LEU A 1 292 ? 63.249  39.136  -7.713  1.00 0.00 ? 292 LEU A CD2 1  
ATOM 1632   N N   . ASN A 1 293 ? 59.676  35.725  -7.865  1.00 0.00 ? 293 ASN A N   1  
ATOM 1633   C CA  . ASN A 1 293 ? 59.748  34.566  -8.724  1.00 0.00 ? 293 ASN A CA  1  
ATOM 1634   C C   . ASN A 1 293 ? 60.186  35.170  -10.007 1.00 0.00 ? 293 ASN A C   1  
ATOM 1635   O O   . ASN A 1 293 ? 59.795  36.261  -10.227 1.00 0.00 ? 293 ASN A O   1  
ATOM 1636   C CB  . ASN A 1 293 ? 58.384  33.889  -8.757  1.00 0.00 ? 293 ASN A CB  1  
ATOM 1637   C CG  . ASN A 1 293 ? 58.099  33.236  -7.389  1.00 0.00 ? 293 ASN A CG  1  
ATOM 1638   O OD1 . ASN A 1 293 ? 57.437  33.769  -6.542  1.00 0.00 ? 293 ASN A OD1 1  
ATOM 1639   N ND2 . ASN A 1 293 ? 58.543  31.877  -7.410  1.00 0.00 ? 293 ASN A ND2 1  
ATOM 1640   N N   . ASP A 1 294 ? 60.899  34.345  -10.841 1.00 0.00 ? 294 ASP A N   1  
ATOM 1641   C CA  . ASP A 1 294 ? 61.349  34.771  -12.150 1.00 0.00 ? 294 ASP A CA  1  
ATOM 1642   C C   . ASP A 1 294 ? 62.125  33.579  -12.726 1.00 0.00 ? 294 ASP A C   1  
ATOM 1643   O O   . ASP A 1 294 ? 63.317  33.433  -12.388 1.00 0.00 ? 294 ASP A O   1  
ATOM 1644   C CB  . ASP A 1 294 ? 62.236  36.048  -12.168 1.00 0.00 ? 294 ASP A CB  1  
ATOM 1645   C CG  . ASP A 1 294 ? 62.438  36.631  -13.588 1.00 0.00 ? 294 ASP A CG  1  
ATOM 1646   O OD1 . ASP A 1 294 ? 61.540  37.282  -14.133 1.00 0.00 ? 294 ASP A OD1 1  
ATOM 1647   O OD2 . ASP A 1 294 ? 63.579  36.392  -14.100 1.00 0.00 ? 294 ASP A OD2 1  
ATOM 1648   N N   . PRO A 1 295 ? 61.531  32.721  -13.571 1.00 0.00 ? 295 PRO A N   1  
ATOM 1649   C CA  . PRO A 1 295 ? 62.238  31.573  -14.071 1.00 0.00 ? 295 PRO A CA  1  
ATOM 1650   C C   . PRO A 1 295 ? 63.024  32.051  -15.315 1.00 0.00 ? 295 PRO A C   1  
ATOM 1651   O O   . PRO A 1 295 ? 64.108  31.500  -15.499 1.00 0.00 ? 295 PRO A O   1  
ATOM 1652   C CB  . PRO A 1 295 ? 61.131  30.580  -14.413 1.00 0.00 ? 295 PRO A CB  1  
ATOM 1653   C CG  . PRO A 1 295 ? 59.895  31.504  -14.776 1.00 0.00 ? 295 PRO A CG  1  
ATOM 1654   C CD  . PRO A 1 295 ? 60.092  32.726  -13.873 1.00 0.00 ? 295 PRO A CD  1  
ATOM 1655   N N   . TYR A 1 296 ? 62.578  33.037  -16.171 1.00 0.00 ? 296 TYR A N   1  
ATOM 1656   C CA  . TYR A 1 296 ? 63.184  33.519  -17.387 1.00 0.00 ? 296 TYR A CA  1  
ATOM 1657   C C   . TYR A 1 296 ? 62.456  34.761  -17.733 1.00 0.00 ? 296 TYR A C   1  
ATOM 1658   O O   . TYR A 1 296 ? 62.859  35.531  -18.596 1.00 0.00 ? 296 TYR A O   1  
ATOM 1659   C CB  . TYR A 1 296 ? 63.010  32.470  -18.534 1.00 0.00 ? 296 TYR A CB  1  
ATOM 1660   C CG  . TYR A 1 296 ? 61.618  32.038  -18.894 1.00 0.00 ? 296 TYR A CG  1  
ATOM 1661   C CD1 . TYR A 1 296 ? 60.946  32.653  -19.946 1.00 0.00 ? 296 TYR A CD1 1  
ATOM 1662   C CD2 . TYR A 1 296 ? 61.148  30.842  -18.334 1.00 0.00 ? 296 TYR A CD2 1  
ATOM 1663   C CE1 . TYR A 1 296 ? 59.712  32.058  -20.337 1.00 0.00 ? 296 TYR A CE1 1  
ATOM 1664   C CE2 . TYR A 1 296 ? 59.862  30.369  -18.632 1.00 0.00 ? 296 TYR A CE2 1  
ATOM 1665   C CZ  . TYR A 1 296 ? 59.141  30.948  -19.743 1.00 0.00 ? 296 TYR A CZ  1  
ATOM 1666   O OH  . TYR A 1 296 ? 57.818  30.527  -20.111 1.00 0.00 ? 296 TYR A OH  1  
ATOM 1667   N N   . GLN A 1 297 ? 61.287  35.096  -17.040 1.00 0.00 ? 297 GLN A N   1  
ATOM 1668   C CA  . GLN A 1 297 ? 60.460  36.293  -17.182 1.00 0.00 ? 297 GLN A CA  1  
ATOM 1669   C C   . GLN A 1 297 ? 59.176  35.878  -16.443 1.00 0.00 ? 297 GLN A C   1  
ATOM 1670   O O   . GLN A 1 297 ? 58.705  34.816  -16.711 1.00 0.00 ? 297 GLN A O   1  
ATOM 1671   C CB  . GLN A 1 297 ? 60.066  36.692  -18.662 1.00 0.00 ? 297 GLN A CB  1  
ATOM 1672   C CG  . GLN A 1 297 ? 59.335  35.725  -19.484 1.00 0.00 ? 297 GLN A CG  1  
ATOM 1673   C CD  . GLN A 1 297 ? 59.620  36.198  -20.896 1.00 0.00 ? 297 GLN A CD  1  
ATOM 1674   O OE1 . GLN A 1 297 ? 60.763  36.037  -21.417 1.00 0.00 ? 297 GLN A OE1 1  
ATOM 1675   N NE2 . GLN A 1 297 ? 58.702  36.911  -21.578 1.00 0.00 ? 297 GLN A NE2 1  
ATOM 1676   N N   . GLU A 1 298 ? 58.569  36.717  -15.622 1.00 0.00 ? 298 GLU A N   1  
ATOM 1677   C CA  . GLU A 1 298 ? 57.282  36.592  -15.104 1.00 0.00 ? 298 GLU A CA  1  
ATOM 1678   C C   . GLU A 1 298 ? 56.870  37.917  -14.646 1.00 0.00 ? 298 GLU A C   1  
ATOM 1679   O O   . GLU A 1 298 ? 55.681  38.134  -14.361 1.00 0.00 ? 298 GLU A O   1  
ATOM 1680   C CB  . GLU A 1 298 ? 57.154  35.564  -13.930 1.00 0.00 ? 298 GLU A CB  1  
ATOM 1681   C CG  . GLU A 1 298 ? 55.797  34.944  -13.693 1.00 0.00 ? 298 GLU A CG  1  
ATOM 1682   C CD  . GLU A 1 298 ? 55.957  33.689  -12.796 1.00 0.00 ? 298 GLU A CD  1  
ATOM 1683   O OE1 . GLU A 1 298 ? 56.854  33.737  -11.840 1.00 0.00 ? 298 GLU A OE1 1  
ATOM 1684   O OE2 . GLU A 1 298 ? 55.267  32.662  -13.094 1.00 0.00 ? 298 GLU A OE2 1  
ATOM 1685   N N   . PHE A 1 299 ? 57.755  38.999  -14.675 1.00 0.00 ? 299 PHE A N   1  
ATOM 1686   C CA  . PHE A 1 299 ? 57.416  40.330  -14.342 1.00 0.00 ? 299 PHE A CA  1  
ATOM 1687   C C   . PHE A 1 299 ? 58.528  41.093  -14.842 1.00 0.00 ? 299 PHE A C   1  
ATOM 1688   O O   . PHE A 1 299 ? 58.810  40.938  -16.004 1.00 0.00 ? 299 PHE A O   1  
ATOM 1689   C CB  . PHE A 1 299 ? 57.096  40.505  -12.807 1.00 0.00 ? 299 PHE A CB  1  
ATOM 1690   C CG  . PHE A 1 299 ? 56.215  41.641  -12.351 1.00 0.00 ? 299 PHE A CG  1  
ATOM 1691   C CD1 . PHE A 1 299 ? 54.840  41.562  -12.783 1.00 0.00 ? 299 PHE A CD1 1  
ATOM 1692   C CD2 . PHE A 1 299 ? 56.672  42.889  -11.903 1.00 0.00 ? 299 PHE A CD2 1  
ATOM 1693   C CE1 . PHE A 1 299 ? 53.983  42.662  -12.663 1.00 0.00 ? 299 PHE A CE1 1  
ATOM 1694   C CE2 . PHE A 1 299 ? 55.804  43.999  -11.740 1.00 0.00 ? 299 PHE A CE2 1  
ATOM 1695   C CZ  . PHE A 1 299 ? 54.446  43.804  -12.030 1.00 0.00 ? 299 PHE A CZ  1  
ATOM 1696   N N   . MET A 1 300 ? 59.182  41.999  -13.985 1.00 0.00 ? 300 MET A N   1  
ATOM 1697   C CA  . MET A 1 300 ? 60.178  42.898  -14.471 1.00 0.00 ? 300 MET A CA  1  
ATOM 1698   C C   . MET A 1 300 ? 60.865  43.381  -13.201 1.00 0.00 ? 300 MET A C   1  
ATOM 1699   O O   . MET A 1 300 ? 61.517  44.411  -13.178 1.00 0.00 ? 300 MET A O   1  
ATOM 1700   C CB  . MET A 1 300 ? 59.467  44.035  -15.197 1.00 0.00 ? 300 MET A CB  1  
ATOM 1701   C CG  . MET A 1 300 ? 58.384  44.935  -14.616 1.00 0.00 ? 300 MET A CG  1  
ATOM 1702   S SD  . MET A 1 300 ? 59.064  46.342  -13.526 1.00 0.00 ? 300 MET A SD  1  
ATOM 1703   C CE  . MET A 1 300 ? 57.452  47.058  -13.152 1.00 0.00 ? 300 MET A CE  1  
ATOM 1704   N N   . THR A 1 301 ? 60.734  42.691  -12.029 1.00 0.00 ? 301 THR A N   1  
ATOM 1705   C CA  . THR A 1 301 ? 61.415  43.034  -10.781 1.00 0.00 ? 301 THR A CA  1  
ATOM 1706   C C   . THR A 1 301 ? 62.589  42.052  -10.653 1.00 0.00 ? 301 THR A C   1  
ATOM 1707   O O   . THR A 1 301 ? 62.471  40.854  -10.842 1.00 0.00 ? 301 THR A O   1  
ATOM 1708   C CB  . THR A 1 301 ? 60.567  42.950  -9.569  1.00 0.00 ? 301 THR A CB  1  
ATOM 1709   O OG1 . THR A 1 301 ? 59.639  41.838  -9.614  1.00 0.00 ? 301 THR A OG1 1  
ATOM 1710   C CG2 . THR A 1 301 ? 59.794  44.237  -9.446  1.00 0.00 ? 301 THR A CG2 1  
ATOM 1711   N N   . TYR A 1 302 ? 63.816  42.586  -10.277 1.00 0.00 ? 302 TYR A N   1  
ATOM 1712   C CA  . TYR A 1 302 ? 65.004  41.781  -10.026 1.00 0.00 ? 302 TYR A CA  1  
ATOM 1713   C C   . TYR A 1 302 ? 65.633  42.273  -8.740  1.00 0.00 ? 302 TYR A C   1  
ATOM 1714   O O   . TYR A 1 302 ? 65.478  43.421  -8.240  1.00 0.00 ? 302 TYR A O   1  
ATOM 1715   C CB  . TYR A 1 302 ? 66.062  41.794  -11.147 1.00 0.00 ? 302 TYR A CB  1  
ATOM 1716   C CG  . TYR A 1 302 ? 66.915  43.045  -11.325 1.00 0.00 ? 302 TYR A CG  1  
ATOM 1717   C CD1 . TYR A 1 302 ? 66.499  44.373  -11.173 1.00 0.00 ? 302 TYR A CD1 1  
ATOM 1718   C CD2 . TYR A 1 302 ? 68.326  42.868  -11.611 1.00 0.00 ? 302 TYR A CD2 1  
ATOM 1719   C CE1 . TYR A 1 302 ? 67.350  45.480  -11.325 1.00 0.00 ? 302 TYR A CE1 1  
ATOM 1720   C CE2 . TYR A 1 302 ? 69.200  43.925  -11.615 1.00 0.00 ? 302 TYR A CE2 1  
ATOM 1721   C CZ  . TYR A 1 302 ? 68.753  45.255  -11.578 1.00 0.00 ? 302 TYR A CZ  1  
ATOM 1722   O OH  . TYR A 1 302 ? 69.588  46.385  -11.553 1.00 0.00 ? 302 TYR A OH  1  
ATOM 1723   N N   . ASP A 1 303 ? 66.369  41.264  -8.112  1.00 0.00 ? 303 ASP A N   1  
ATOM 1724   C CA  . ASP A 1 303 ? 67.060  41.602  -6.910  1.00 0.00 ? 303 ASP A CA  1  
ATOM 1725   C C   . ASP A 1 303 ? 68.293  42.429  -7.239  1.00 0.00 ? 303 ASP A C   1  
ATOM 1726   O O   . ASP A 1 303 ? 68.889  42.313  -8.330  1.00 0.00 ? 303 ASP A O   1  
ATOM 1727   C CB  . ASP A 1 303 ? 67.469  40.253  -6.224  1.00 0.00 ? 303 ASP A CB  1  
ATOM 1728   C CG  . ASP A 1 303 ? 68.107  40.524  -4.870  1.00 0.00 ? 303 ASP A CG  1  
ATOM 1729   O OD1 . ASP A 1 303 ? 67.682  41.548  -4.233  1.00 0.00 ? 303 ASP A OD1 1  
ATOM 1730   O OD2 . ASP A 1 303 ? 68.914  39.652  -4.386  1.00 0.00 ? 303 ASP A OD2 1  
ATOM 1731   N N   . ASP A 1 304 ? 68.670  43.255  -6.294  1.00 0.00 ? 304 ASP A N   1  
ATOM 1732   C CA  . ASP A 1 304 ? 69.788  44.196  -6.375  1.00 0.00 ? 304 ASP A CA  1  
ATOM 1733   C C   . ASP A 1 304 ? 69.501  45.369  -7.410  1.00 0.00 ? 304 ASP A C   1  
ATOM 1734   O O   . ASP A 1 304 ? 68.398  45.364  -8.019  1.00 0.00 ? 304 ASP A O   1  
ATOM 1735   C CB  . ASP A 1 304 ? 71.185  43.567  -6.602  1.00 0.00 ? 304 ASP A CB  1  
ATOM 1736   C CG  . ASP A 1 304 ? 71.469  42.613  -5.461  1.00 0.00 ? 304 ASP A CG  1  
ATOM 1737   O OD1 . ASP A 1 304 ? 71.397  43.091  -4.269  1.00 0.00 ? 304 ASP A OD1 1  
ATOM 1738   O OD2 . ASP A 1 304 ? 71.767  41.398  -5.690  1.00 0.00 ? 304 ASP A OD2 1  
ATOM 1739   N N   . TRP A 1 320 ? 72.762  41.762  3.722   1.00 0.00 ? 320 TRP A N   1  
ATOM 1740   C CA  . TRP A 1 320 ? 72.045  41.726  5.025   1.00 0.00 ? 320 TRP A CA  1  
ATOM 1741   C C   . TRP A 1 320 ? 70.615  41.709  4.807   1.00 0.00 ? 320 TRP A C   1  
ATOM 1742   O O   . TRP A 1 320 ? 70.012  40.625  4.984   1.00 0.00 ? 320 TRP A O   1  
ATOM 1743   C CB  . TRP A 1 320 ? 72.496  42.855  6.024   1.00 0.00 ? 320 TRP A CB  1  
ATOM 1744   C CG  . TRP A 1 320 ? 73.948  42.847  6.458   1.00 0.00 ? 320 TRP A CG  1  
ATOM 1745   C CD1 . TRP A 1 320 ? 75.035  43.049  5.665   1.00 0.00 ? 320 TRP A CD1 1  
ATOM 1746   C CD2 . TRP A 1 320 ? 74.395  43.088  7.874   1.00 0.00 ? 320 TRP A CD2 1  
ATOM 1747   N NE1 . TRP A 1 320 ? 76.142  43.310  6.455   1.00 0.00 ? 320 TRP A NE1 1  
ATOM 1748   C CE2 . TRP A 1 320 ? 75.793  43.284  7.805   1.00 0.00 ? 320 TRP A CE2 1  
ATOM 1749   C CE3 . TRP A 1 320 ? 73.705  43.136  9.108   1.00 0.00 ? 320 TRP A CE3 1  
ATOM 1750   C CZ2 . TRP A 1 320 ? 76.494  43.556  8.919   1.00 0.00 ? 320 TRP A CZ2 1  
ATOM 1751   C CZ3 . TRP A 1 320 ? 74.466  43.311  10.212  1.00 0.00 ? 320 TRP A CZ3 1  
ATOM 1752   C CH2 . TRP A 1 320 ? 75.826  43.502  10.143  1.00 0.00 ? 320 TRP A CH2 1  
ATOM 1753   N N   . ASP A 1 321 ? 70.115  42.882  4.424   1.00 0.00 ? 321 ASP A N   1  
ATOM 1754   C CA  . ASP A 1 321 ? 68.680  43.230  4.257   1.00 0.00 ? 321 ASP A CA  1  
ATOM 1755   C C   . ASP A 1 321 ? 68.405  43.335  2.779   1.00 0.00 ? 321 ASP A C   1  
ATOM 1756   O O   . ASP A 1 321 ? 67.244  43.290  2.458   1.00 0.00 ? 321 ASP A O   1  
ATOM 1757   C CB  . ASP A 1 321 ? 68.380  44.543  4.938   1.00 0.00 ? 321 ASP A CB  1  
ATOM 1758   C CG  . ASP A 1 321 ? 68.617  44.338  6.407   1.00 0.00 ? 321 ASP A CG  1  
ATOM 1759   O OD1 . ASP A 1 321 ? 67.919  43.629  7.158   1.00 0.00 ? 321 ASP A OD1 1  
ATOM 1760   O OD2 . ASP A 1 321 ? 69.713  44.839  6.793   1.00 0.00 ? 321 ASP A OD2 1  
ATOM 1761   N N   . THR A 1 322 ? 69.467  43.458  1.968   1.00 0.00 ? 322 THR A N   1  
ATOM 1762   C CA  . THR A 1 322 ? 69.459  43.674  0.551   1.00 0.00 ? 322 THR A CA  1  
ATOM 1763   C C   . THR A 1 322 ? 68.453  44.754  0.010   1.00 0.00 ? 322 THR A C   1  
ATOM 1764   O O   . THR A 1 322 ? 67.719  45.415  0.769   1.00 0.00 ? 322 THR A O   1  
ATOM 1765   C CB  . THR A 1 322 ? 69.358  42.389  -0.277  1.00 0.00 ? 322 THR A CB  1  
ATOM 1766   O OG1 . THR A 1 322 ? 68.099  41.772  -0.019  1.00 0.00 ? 322 THR A OG1 1  
ATOM 1767   C CG2 . THR A 1 322 ? 70.449  41.405  0.117   1.00 0.00 ? 322 THR A CG2 1  
ATOM 1768   N N   . GLN A 1 323 ? 68.509  45.016  -1.298  1.00 0.00 ? 323 GLN A N   1  
ATOM 1769   C CA  . GLN A 1 323 ? 67.683  45.981  -2.059  1.00 0.00 ? 323 GLN A CA  1  
ATOM 1770   C C   . GLN A 1 323 ? 67.022  45.287  -3.270  1.00 0.00 ? 323 GLN A C   1  
ATOM 1771   O O   . GLN A 1 323 ? 67.453  44.233  -3.727  1.00 0.00 ? 323 GLN A O   1  
ATOM 1772   C CB  . GLN A 1 323 ? 68.427  47.248  -2.493  1.00 0.00 ? 323 GLN A CB  1  
ATOM 1773   C CG  . GLN A 1 323 ? 68.831  48.240  -1.316  1.00 0.00 ? 323 GLN A CG  1  
ATOM 1774   C CD  . GLN A 1 323 ? 67.632  48.413  -0.400  1.00 0.00 ? 323 GLN A CD  1  
ATOM 1775   O OE1 . GLN A 1 323 ? 66.547  48.676  -0.950  1.00 0.00 ? 323 GLN A OE1 1  
ATOM 1776   N NE2 . GLN A 1 323 ? 67.871  48.271  0.949   1.00 0.00 ? 323 GLN A NE2 1  
ATOM 1777   N N   . TYR A 1 324 ? 65.937  45.913  -3.854  1.00 0.00 ? 324 TYR A N   1  
ATOM 1778   C CA  . TYR A 1 324 ? 65.322  45.372  -5.022  1.00 0.00 ? 324 TYR A CA  1  
ATOM 1779   C C   . TYR A 1 324 ? 65.061  46.565  -5.874  1.00 0.00 ? 324 TYR A C   1  
ATOM 1780   O O   . TYR A 1 324 ? 64.995  47.689  -5.482  1.00 0.00 ? 324 TYR A O   1  
ATOM 1781   C CB  . TYR A 1 324 ? 63.981  44.743  -4.869  1.00 0.00 ? 324 TYR A CB  1  
ATOM 1782   C CG  . TYR A 1 324 ? 63.990  43.358  -4.276  1.00 0.00 ? 324 TYR A CG  1  
ATOM 1783   C CD1 . TYR A 1 324 ? 64.618  43.083  -3.069  1.00 0.00 ? 324 TYR A CD1 1  
ATOM 1784   C CD2 . TYR A 1 324 ? 63.524  42.211  -5.013  1.00 0.00 ? 324 TYR A CD2 1  
ATOM 1785   C CE1 . TYR A 1 324 ? 64.719  41.814  -2.459  1.00 0.00 ? 324 TYR A CE1 1  
ATOM 1786   C CE2 . TYR A 1 324 ? 63.582  40.940  -4.405  1.00 0.00 ? 324 TYR A CE2 1  
ATOM 1787   C CZ  . TYR A 1 324 ? 64.186  40.709  -3.172  1.00 0.00 ? 324 TYR A CZ  1  
ATOM 1788   O OH  . TYR A 1 324 ? 64.374  39.440  -2.570  1.00 0.00 ? 324 TYR A OH  1  
ATOM 1789   N N   . PHE A 1 325 ? 64.952  46.249  -7.235  1.00 0.00 ? 325 PHE A N   1  
ATOM 1790   C CA  . PHE A 1 325 ? 64.691  47.289  -8.219  1.00 0.00 ? 325 PHE A CA  1  
ATOM 1791   C C   . PHE A 1 325 ? 63.984  46.646  -9.456  1.00 0.00 ? 325 PHE A C   1  
ATOM 1792   O O   . PHE A 1 325 ? 63.797  45.446  -9.561  1.00 0.00 ? 325 PHE A O   1  
ATOM 1793   C CB  . PHE A 1 325 ? 66.008  48.063  -8.601  1.00 0.00 ? 325 PHE A CB  1  
ATOM 1794   C CG  . PHE A 1 325 ? 65.857  49.371  -9.383  1.00 0.00 ? 325 PHE A CG  1  
ATOM 1795   C CD1 . PHE A 1 325 ? 64.983  50.502  -9.027  1.00 0.00 ? 325 PHE A CD1 1  
ATOM 1796   C CD2 . PHE A 1 325 ? 66.747  49.654  -10.437 1.00 0.00 ? 325 PHE A CD2 1  
ATOM 1797   C CE1 . PHE A 1 325 ? 64.924  51.641  -9.758  1.00 0.00 ? 325 PHE A CE1 1  
ATOM 1798   C CE2 . PHE A 1 325 ? 66.775  50.875  -11.115 1.00 0.00 ? 325 PHE A CE2 1  
ATOM 1799   C CZ  . PHE A 1 325 ? 65.789  51.837  -10.834 1.00 0.00 ? 325 PHE A CZ  1  
ATOM 1800   N N   . ILE A 1 326 ? 63.530  47.491  -10.366 1.00 0.00 ? 326 ILE A N   1  
ATOM 1801   C CA  . ILE A 1 326 ? 62.689  47.241  -11.526 1.00 0.00 ? 326 ILE A CA  1  
ATOM 1802   C C   . ILE A 1 326 ? 63.700  47.097  -12.659 1.00 0.00 ? 326 ILE A C   1  
ATOM 1803   O O   . ILE A 1 326 ? 64.588  47.887  -12.873 1.00 0.00 ? 326 ILE A O   1  
ATOM 1804   C CB  . ILE A 1 326 ? 61.656  48.319  -11.677 1.00 0.00 ? 326 ILE A CB  1  
ATOM 1805   C CG1 . ILE A 1 326 ? 62.266  49.722  -11.649 1.00 0.00 ? 326 ILE A CG1 1  
ATOM 1806   C CG2 . ILE A 1 326 ? 60.584  47.999  -10.621 1.00 0.00 ? 326 ILE A CG2 1  
ATOM 1807   C CD1 . ILE A 1 326 ? 61.239  50.856  -11.800 1.00 0.00 ? 326 ILE A CD1 1  
ATOM 1808   N N   . ARG A 1 327 ? 63.596  46.079  -13.523 1.00 0.00 ? 327 ARG A N   1  
ATOM 1809   C CA  . ARG A 1 327 ? 64.354  46.088  -14.793 1.00 0.00 ? 327 ARG A CA  1  
ATOM 1810   C C   . ARG A 1 327 ? 63.518  46.913  -15.761 1.00 0.00 ? 327 ARG A C   1  
ATOM 1811   O O   . ARG A 1 327 ? 62.436  46.544  -16.213 1.00 0.00 ? 327 ARG A O   1  
ATOM 1812   C CB  . ARG A 1 327 ? 64.460  44.743  -15.370 1.00 0.00 ? 327 ARG A CB  1  
ATOM 1813   C CG  . ARG A 1 327 ? 65.384  43.926  -14.512 1.00 0.00 ? 327 ARG A CG  1  
ATOM 1814   C CD  . ARG A 1 327 ? 65.640  42.511  -15.048 1.00 0.00 ? 327 ARG A CD  1  
ATOM 1815   N NE  . ARG A 1 327 ? 64.355  41.839  -14.612 1.00 0.00 ? 327 ARG A NE  1  
ATOM 1816   C CZ  . ARG A 1 327 ? 64.134  40.530  -14.564 1.00 0.00 ? 327 ARG A CZ  1  
ATOM 1817   N NH1 . ARG A 1 327 ? 65.057  39.521  -14.780 1.00 0.00 ? 327 ARG A NH1 1  
ATOM 1818   N NH2 . ARG A 1 327 ? 62.823  40.127  -14.268 1.00 0.00 ? 327 ARG A NH2 1  
ATOM 1819   N N   . LYS A 1 328 ? 64.065  48.070  -16.128 1.00 0.00 ? 328 LYS A N   1  
ATOM 1820   C CA  . LYS A 1 328 ? 63.648  49.110  -17.007 1.00 0.00 ? 328 LYS A CA  1  
ATOM 1821   C C   . LYS A 1 328 ? 63.669  48.531  -18.465 1.00 0.00 ? 328 LYS A C   1  
ATOM 1822   O O   . LYS A 1 328 ? 62.826  48.913  -19.303 1.00 0.00 ? 328 LYS A O   1  
ATOM 1823   C CB  . LYS A 1 328 ? 64.525  50.285  -16.830 1.00 0.00 ? 328 LYS A CB  1  
ATOM 1824   C CG  . LYS A 1 328 ? 66.065  50.072  -16.972 1.00 0.00 ? 328 LYS A CG  1  
ATOM 1825   C CD  . LYS A 1 328 ? 66.826  51.390  -16.628 1.00 0.00 ? 328 LYS A CD  1  
ATOM 1826   C CE  . LYS A 1 328 ? 66.657  52.668  -17.528 1.00 0.00 ? 328 LYS A CE  1  
ATOM 1827   N NZ  . LYS A 1 328 ? 66.699  52.347  -18.988 1.00 0.00 ? 328 LYS A NZ  1  
ATOM 1828   N N   . ASP A 1 329 ? 64.700  47.663  -18.751 1.00 0.00 ? 329 ASP A N   1  
ATOM 1829   C CA  . ASP A 1 329 ? 64.890  47.083  -20.059 1.00 0.00 ? 329 ASP A CA  1  
ATOM 1830   C C   . ASP A 1 329 ? 63.772  46.235  -20.417 1.00 0.00 ? 329 ASP A C   1  
ATOM 1831   O O   . ASP A 1 329 ? 63.348  46.254  -21.571 1.00 0.00 ? 329 ASP A O   1  
ATOM 1832   C CB  . ASP A 1 329 ? 66.194  46.264  -20.181 1.00 0.00 ? 329 ASP A CB  1  
ATOM 1833   C CG  . ASP A 1 329 ? 67.410  47.224  -20.091 1.00 0.00 ? 329 ASP A CG  1  
ATOM 1834   O OD1 . ASP A 1 329 ? 67.603  48.003  -21.054 1.00 0.00 ? 329 ASP A OD1 1  
ATOM 1835   O OD2 . ASP A 1 329 ? 68.110  47.190  -19.008 1.00 0.00 ? 329 ASP A OD2 1  
ATOM 1836   N N   . VAL A 1 330 ? 63.217  45.417  -19.431 1.00 0.00 ? 330 VAL A N   1  
ATOM 1837   C CA  . VAL A 1 330 ? 62.121  44.471  -19.566 1.00 0.00 ? 330 VAL A CA  1  
ATOM 1838   C C   . VAL A 1 330 ? 60.857  45.294  -19.740 1.00 0.00 ? 330 VAL A C   1  
ATOM 1839   O O   . VAL A 1 330 ? 59.900  44.815  -20.295 1.00 0.00 ? 330 VAL A O   1  
ATOM 1840   C CB  . VAL A 1 330 ? 62.020  43.573  -18.320 1.00 0.00 ? 330 VAL A CB  1  
ATOM 1841   C CG1 . VAL A 1 330 ? 60.796  42.700  -18.460 1.00 0.00 ? 330 VAL A CG1 1  
ATOM 1842   C CG2 . VAL A 1 330 ? 63.274  42.639  -18.206 1.00 0.00 ? 330 VAL A CG2 1  
ATOM 1843   N N   . LEU A 1 331 ? 60.866  46.582  -19.303 1.00 0.00 ? 331 LEU A N   1  
ATOM 1844   C CA  . LEU A 1 331 ? 59.801  47.563  -19.385 1.00 0.00 ? 331 LEU A CA  1  
ATOM 1845   C C   . LEU A 1 331 ? 58.928  47.548  -18.191 1.00 0.00 ? 331 LEU A C   1  
ATOM 1846   O O   . LEU A 1 331 ? 58.652  46.530  -17.569 1.00 0.00 ? 331 LEU A O   1  
ATOM 1847   C CB  . LEU A 1 331 ? 58.992  47.569  -20.714 1.00 0.00 ? 331 LEU A CB  1  
ATOM 1848   C CG  . LEU A 1 331 ? 59.732  47.729  -22.093 1.00 0.00 ? 331 LEU A CG  1  
ATOM 1849   C CD1 . LEU A 1 331 ? 58.642  48.081  -23.158 1.00 0.00 ? 331 LEU A CD1 1  
ATOM 1850   C CD2 . LEU A 1 331 ? 60.631  48.981  -22.188 1.00 0.00 ? 331 LEU A CD2 1  
ATOM 1851   N N   . LEU A 1 332 ? 58.395  48.728  -17.843 1.00 0.00 ? 332 LEU A N   1  
ATOM 1852   C CA  . LEU A 1 332 ? 57.663  48.891  -16.623 1.00 0.00 ? 332 LEU A CA  1  
ATOM 1853   C C   . LEU A 1 332 ? 56.214  48.423  -16.814 1.00 0.00 ? 332 LEU A C   1  
ATOM 1854   O O   . LEU A 1 332 ? 55.827  47.934  -17.852 1.00 0.00 ? 332 LEU A O   1  
ATOM 1855   C CB  . LEU A 1 332 ? 57.692  50.271  -16.071 1.00 0.00 ? 332 LEU A CB  1  
ATOM 1856   C CG  . LEU A 1 332 ? 59.093  50.920  -15.994 1.00 0.00 ? 332 LEU A CG  1  
ATOM 1857   C CD1 . LEU A 1 332 ? 58.953  52.479  -15.593 1.00 0.00 ? 332 LEU A CD1 1  
ATOM 1858   C CD2 . LEU A 1 332 ? 60.132  50.172  -15.066 1.00 0.00 ? 332 LEU A CD2 1  
ATOM 1859   N N   . ARG A 1 333 ? 55.444  48.490  -15.679 1.00 0.00 ? 333 ARG A N   1  
ATOM 1860   C CA  . ARG A 1 333 ? 54.111  47.963  -15.651 1.00 0.00 ? 333 ARG A CA  1  
ATOM 1861   C C   . ARG A 1 333 ? 53.170  48.707  -16.586 1.00 0.00 ? 333 ARG A C   1  
ATOM 1862   O O   . ARG A 1 333 ? 52.362  48.063  -17.225 1.00 0.00 ? 333 ARG A O   1  
ATOM 1863   C CB  . ARG A 1 333 ? 53.545  47.783  -14.215 1.00 0.00 ? 333 ARG A CB  1  
ATOM 1864   C CG  . ARG A 1 333 ? 52.121  47.196  -14.198 1.00 0.00 ? 333 ARG A CG  1  
ATOM 1865   C CD  . ARG A 1 333 ? 51.640  46.698  -12.846 1.00 0.00 ? 333 ARG A CD  1  
ATOM 1866   N NE  . ARG A 1 333 ? 50.291  46.015  -13.151 1.00 0.00 ? 333 ARG A NE  1  
ATOM 1867   C CZ  . ARG A 1 333 ? 49.762  45.010  -12.425 1.00 0.00 ? 333 ARG A CZ  1  
ATOM 1868   N NH1 . ARG A 1 333 ? 49.962  44.935  -11.088 1.00 0.00 ? 333 ARG A NH1 1  
ATOM 1869   N NH2 . ARG A 1 333 ? 48.970  44.064  -13.028 1.00 0.00 ? 333 ARG A NH2 1  
ATOM 1870   N N   . ASP A 1 334 ? 53.294  50.101  -16.603 1.00 0.00 ? 334 ASP A N   1  
ATOM 1871   C CA  . ASP A 1 334 ? 52.532  50.962  -17.435 1.00 0.00 ? 334 ASP A CA  1  
ATOM 1872   C C   . ASP A 1 334 ? 53.526  52.024  -17.968 1.00 0.00 ? 334 ASP A C   1  
ATOM 1873   O O   . ASP A 1 334 ? 53.034  53.004  -18.486 1.00 0.00 ? 334 ASP A O   1  
ATOM 1874   C CB  . ASP A 1 334 ? 51.429  51.657  -16.626 1.00 0.00 ? 334 ASP A CB  1  
ATOM 1875   C CG  . ASP A 1 334 ? 50.424  50.700  -16.029 1.00 0.00 ? 334 ASP A CG  1  
ATOM 1876   O OD1 . ASP A 1 334 ? 49.734  50.055  -16.870 1.00 0.00 ? 334 ASP A OD1 1  
ATOM 1877   O OD2 . ASP A 1 334 ? 50.221  50.679  -14.785 1.00 0.00 ? 334 ASP A OD2 1  
ATOM 1878   N N   . CYS A 1 335 ? 54.893  51.785  -17.825 1.00 0.00 ? 335 CYS A N   1  
ATOM 1879   C CA  . CYS A 1 335 ? 55.942  52.549  -18.513 1.00 0.00 ? 335 CYS A CA  1  
ATOM 1880   C C   . CYS A 1 335 ? 55.770  54.036  -18.462 1.00 0.00 ? 335 CYS A C   1  
ATOM 1881   O O   . CYS A 1 335 ? 55.580  54.694  -19.486 1.00 0.00 ? 335 CYS A O   1  
ATOM 1882   C CB  . CYS A 1 335 ? 56.062  52.164  -20.064 1.00 0.00 ? 335 CYS A CB  1  
ATOM 1883   S SG  . CYS A 1 335 ? 56.467  50.506  -20.480 1.00 0.00 ? 335 CYS A SG  1  
ATOM 1884   N N   . ASP A 1 336 ? 55.836  54.534  -17.137 1.00 0.00 ? 336 ASP A N   1  
ATOM 1885   C CA  . ASP A 1 336 ? 55.855  55.947  -16.775 1.00 0.00 ? 336 ASP A CA  1  
ATOM 1886   C C   . ASP A 1 336 ? 54.476  56.523  -16.690 1.00 0.00 ? 336 ASP A C   1  
ATOM 1887   O O   . ASP A 1 336 ? 53.758  56.462  -17.655 1.00 0.00 ? 336 ASP A O   1  
ATOM 1888   C CB  . ASP A 1 336 ? 56.657  56.976  -17.657 1.00 0.00 ? 336 ASP A CB  1  
ATOM 1889   C CG  . ASP A 1 336 ? 58.029  56.560  -18.135 1.00 0.00 ? 336 ASP A CG  1  
ATOM 1890   O OD1 . ASP A 1 336 ? 58.825  56.222  -17.172 1.00 0.00 ? 336 ASP A OD1 1  
ATOM 1891   O OD2 . ASP A 1 336 ? 58.369  56.794  -19.336 1.00 0.00 ? 336 ASP A OD2 1  
ATOM 1892   N N   . SER A 1 337 ? 54.252  57.103  -15.517 1.00 0.00 ? 337 SER A N   1  
ATOM 1893   C CA  . SER A 1 337 ? 53.086  57.873  -15.136 1.00 0.00 ? 337 SER A CA  1  
ATOM 1894   C C   . SER A 1 337 ? 53.230  57.949  -13.596 1.00 0.00 ? 337 SER A C   1  
ATOM 1895   O O   . SER A 1 337 ? 53.900  57.082  -12.991 1.00 0.00 ? 337 SER A O   1  
ATOM 1896   C CB  . SER A 1 337 ? 51.670  57.287  -15.557 1.00 0.00 ? 337 SER A CB  1  
ATOM 1897   O OG  . SER A 1 337 ? 50.583  58.149  -15.194 1.00 0.00 ? 337 SER A OG  1  
ATOM 1898   N N   . GLU A 1 338 ? 52.743  59.072  -13.022 1.00 0.00 ? 338 GLU A N   1  
ATOM 1899   C CA  . GLU A 1 338 ? 52.940  59.379  -11.597 1.00 0.00 ? 338 GLU A CA  1  
ATOM 1900   C C   . GLU A 1 338 ? 52.375  58.484  -10.631 1.00 0.00 ? 338 GLU A C   1  
ATOM 1901   O O   . GLU A 1 338 ? 53.126  58.057  -9.778  1.00 0.00 ? 338 GLU A O   1  
ATOM 1902   C CB  . GLU A 1 338 ? 52.756  60.868  -11.232 1.00 0.00 ? 338 GLU A CB  1  
ATOM 1903   C CG  . GLU A 1 338 ? 53.228  61.187  -9.770  1.00 0.00 ? 338 GLU A CG  1  
ATOM 1904   C CD  . GLU A 1 338 ? 54.695  61.209  -9.520  1.00 0.00 ? 338 GLU A CD  1  
ATOM 1905   O OE1 . GLU A 1 338 ? 55.180  62.292  -9.912  1.00 0.00 ? 338 GLU A OE1 1  
ATOM 1906   O OE2 . GLU A 1 338 ? 55.293  60.308  -8.985  1.00 0.00 ? 338 GLU A OE2 1  
ATOM 1907   N N   . GLU A 1 339 ? 51.150  57.968  -10.975 1.00 0.00 ? 339 GLU A N   1  
ATOM 1908   C CA  . GLU A 1 339 ? 50.485  56.902  -10.378 1.00 0.00 ? 339 GLU A CA  1  
ATOM 1909   C C   . GLU A 1 339 ? 51.258  55.577  -10.482 1.00 0.00 ? 339 GLU A C   1  
ATOM 1910   O O   . GLU A 1 339 ? 51.408  54.860  -9.501  1.00 0.00 ? 339 GLU A O   1  
ATOM 1911   C CB  . GLU A 1 339 ? 49.178  56.723  -11.069 1.00 0.00 ? 339 GLU A CB  1  
ATOM 1912   C CG  . GLU A 1 339 ? 48.261  57.975  -10.754 1.00 0.00 ? 339 GLU A CG  1  
ATOM 1913   C CD  . GLU A 1 339 ? 46.781  57.712  -11.227 1.00 0.00 ? 339 GLU A CD  1  
ATOM 1914   O OE1 . GLU A 1 339 ? 46.483  56.630  -11.696 1.00 0.00 ? 339 GLU A OE1 1  
ATOM 1915   O OE2 . GLU A 1 339 ? 45.880  58.519  -10.976 1.00 0.00 ? 339 GLU A OE2 1  
ATOM 1916   N N   . ASP A 1 340 ? 51.812  55.313  -11.712 1.00 0.00 ? 340 ASP A N   1  
ATOM 1917   C CA  . ASP A 1 340 ? 52.618  54.106  -11.945 1.00 0.00 ? 340 ASP A CA  1  
ATOM 1918   C C   . ASP A 1 340 ? 53.866  54.068  -11.045 1.00 0.00 ? 340 ASP A C   1  
ATOM 1919   O O   . ASP A 1 340 ? 54.109  53.035  -10.409 1.00 0.00 ? 340 ASP A O   1  
ATOM 1920   C CB  . ASP A 1 340 ? 52.987  53.920  -13.428 1.00 0.00 ? 340 ASP A CB  1  
ATOM 1921   C CG  . ASP A 1 340 ? 53.555  52.552  -13.684 1.00 0.00 ? 340 ASP A CG  1  
ATOM 1922   O OD1 . ASP A 1 340 ? 52.943  51.480  -13.428 1.00 0.00 ? 340 ASP A OD1 1  
ATOM 1923   O OD2 . ASP A 1 340 ? 54.674  52.544  -14.206 1.00 0.00 ? 340 ASP A OD2 1  
ATOM 1924   N N   . LYS A 1 341 ? 54.604  55.133  -10.963 1.00 0.00 ? 341 LYS A N   1  
ATOM 1925   C CA  . LYS A 1 341 ? 55.807  55.327  -10.216 1.00 0.00 ? 341 LYS A CA  1  
ATOM 1926   C C   . LYS A 1 341 ? 55.600  55.205  -8.736  1.00 0.00 ? 341 LYS A C   1  
ATOM 1927   O O   . LYS A 1 341 ? 56.335  54.533  -8.046  1.00 0.00 ? 341 LYS A O   1  
ATOM 1928   C CB  . LYS A 1 341 ? 56.584  56.539  -10.569 1.00 0.00 ? 341 LYS A CB  1  
ATOM 1929   C CG  . LYS A 1 341 ? 57.118  56.401  -12.032 1.00 0.00 ? 341 LYS A CG  1  
ATOM 1930   C CD  . LYS A 1 341 ? 57.625  57.739  -12.593 1.00 0.00 ? 341 LYS A CD  1  
ATOM 1931   C CE  . LYS A 1 341 ? 58.258  57.581  -14.016 1.00 0.00 ? 341 LYS A CE  1  
ATOM 1932   N NZ  . LYS A 1 341 ? 58.959  58.865  -14.441 1.00 0.00 ? 341 LYS A NZ  1  
ATOM 1933   N N   . ASN A 1 342 ? 54.521  55.801  -8.134  1.00 0.00 ? 342 ASN A N   1  
ATOM 1934   C CA  . ASN A 1 342 ? 54.351  55.685  -6.738  1.00 0.00 ? 342 ASN A CA  1  
ATOM 1935   C C   . ASN A 1 342 ? 54.105  54.162  -6.343  1.00 0.00 ? 342 ASN A C   1  
ATOM 1936   O O   . ASN A 1 342 ? 54.565  53.655  -5.312  1.00 0.00 ? 342 ASN A O   1  
ATOM 1937   C CB  . ASN A 1 342 ? 53.421  56.790  -6.022  1.00 0.00 ? 342 ASN A CB  1  
ATOM 1938   C CG  . ASN A 1 342 ? 51.843  56.644  -6.147  1.00 0.00 ? 342 ASN A CG  1  
ATOM 1939   O OD1 . ASN A 1 342 ? 51.163  57.208  -6.965  1.00 0.00 ? 342 ASN A OD1 1  
ATOM 1940   N ND2 . ASN A 1 342 ? 51.347  55.695  -5.320  1.00 0.00 ? 342 ASN A ND2 1  
ATOM 1941   N N   . LEU A 1 343 ? 53.304  53.510  -7.164  1.00 0.00 ? 343 LEU A N   1  
ATOM 1942   C CA  . LEU A 1 343 ? 52.805  52.144  -6.987  1.00 0.00 ? 343 LEU A CA  1  
ATOM 1943   C C   . LEU A 1 343 ? 53.906  51.167  -6.999  1.00 0.00 ? 343 LEU A C   1  
ATOM 1944   O O   . LEU A 1 343 ? 53.932  50.289  -6.183  1.00 0.00 ? 343 LEU A O   1  
ATOM 1945   C CB  . LEU A 1 343 ? 51.782  51.929  -8.073  1.00 0.00 ? 343 LEU A CB  1  
ATOM 1946   C CG  . LEU A 1 343 ? 51.202  50.509  -8.311  1.00 0.00 ? 343 LEU A CG  1  
ATOM 1947   C CD1 . LEU A 1 343 ? 50.203  50.042  -7.248  1.00 0.00 ? 343 LEU A CD1 1  
ATOM 1948   C CD2 . LEU A 1 343 ? 50.588  50.486  -9.732  1.00 0.00 ? 343 LEU A CD2 1  
ATOM 1949   N N   . LEU A 1 344 ? 54.896  51.374  -7.916  1.00 0.00 ? 344 LEU A N   1  
ATOM 1950   C CA  . LEU A 1 344 ? 56.077  50.540  -7.965  1.00 0.00 ? 344 LEU A CA  1  
ATOM 1951   C C   . LEU A 1 344 ? 56.926  50.694  -6.775  1.00 0.00 ? 344 LEU A C   1  
ATOM 1952   O O   . LEU A 1 344 ? 57.454  49.666  -6.277  1.00 0.00 ? 344 LEU A O   1  
ATOM 1953   C CB  . LEU A 1 344 ? 56.937  50.946  -9.154  1.00 0.00 ? 344 LEU A CB  1  
ATOM 1954   C CG  . LEU A 1 344 ? 56.674  50.504  -10.631 1.00 0.00 ? 344 LEU A CG  1  
ATOM 1955   C CD1 . LEU A 1 344 ? 55.304  49.931  -11.092 1.00 0.00 ? 344 LEU A CD1 1  
ATOM 1956   C CD2 . LEU A 1 344 ? 57.104  51.643  -11.548 1.00 0.00 ? 344 LEU A CD2 1  
ATOM 1957   N N   . PHE A 1 345 ? 57.080  51.975  -6.247  1.00 0.00 ? 345 PHE A N   1  
ATOM 1958   C CA  . PHE A 1 345 ? 57.893  52.233  -5.103  1.00 0.00 ? 345 PHE A CA  1  
ATOM 1959   C C   . PHE A 1 345 ? 57.370  51.581  -3.827  1.00 0.00 ? 345 PHE A C   1  
ATOM 1960   O O   . PHE A 1 345 ? 58.196  50.962  -3.142  1.00 0.00 ? 345 PHE A O   1  
ATOM 1961   C CB  . PHE A 1 345 ? 57.770  53.789  -4.877  1.00 0.00 ? 345 PHE A CB  1  
ATOM 1962   C CG  . PHE A 1 345 ? 58.340  54.361  -3.611  1.00 0.00 ? 345 PHE A CG  1  
ATOM 1963   C CD1 . PHE A 1 345 ? 59.730  54.272  -3.300  1.00 0.00 ? 345 PHE A CD1 1  
ATOM 1964   C CD2 . PHE A 1 345 ? 57.496  54.974  -2.697  1.00 0.00 ? 345 PHE A CD2 1  
ATOM 1965   C CE1 . PHE A 1 345 ? 60.239  54.761  -2.025  1.00 0.00 ? 345 PHE A CE1 1  
ATOM 1966   C CE2 . PHE A 1 345 ? 57.954  55.475  -1.477  1.00 0.00 ? 345 PHE A CE2 1  
ATOM 1967   C CZ  . PHE A 1 345 ? 59.347  55.469  -1.206  1.00 0.00 ? 345 PHE A CZ  1  
ATOM 1968   N N   . LYS A 1 346 ? 56.035  51.615  -3.691  1.00 0.00 ? 346 LYS A N   1  
ATOM 1969   C CA  . LYS A 1 346 ? 55.226  50.990  -2.698  1.00 0.00 ? 346 LYS A CA  1  
ATOM 1970   C C   . LYS A 1 346 ? 55.327  49.451  -2.768  1.00 0.00 ? 346 LYS A C   1  
ATOM 1971   O O   . LYS A 1 346 ? 55.461  48.933  -1.675  1.00 0.00 ? 346 LYS A O   1  
ATOM 1972   C CB  . LYS A 1 346 ? 53.679  51.461  -2.747  1.00 0.00 ? 346 LYS A CB  1  
ATOM 1973   C CG  . LYS A 1 346 ? 53.429  52.781  -2.063  1.00 0.00 ? 346 LYS A CG  1  
ATOM 1974   C CD  . LYS A 1 346 ? 51.986  53.296  -1.928  1.00 0.00 ? 346 LYS A CD  1  
ATOM 1975   C CE  . LYS A 1 346 ? 51.079  52.295  -1.235  1.00 0.00 ? 346 LYS A CE  1  
ATOM 1976   N NZ  . LYS A 1 346 ? 51.337  52.197  0.202   1.00 0.00 ? 346 LYS A NZ  1  
ATOM 1977   N N   . MET A 1 347 ? 55.344  48.803  -3.910  1.00 0.00 ? 347 MET A N   1  
ATOM 1978   C CA  . MET A 1 347 ? 55.515  47.388  -4.113  1.00 0.00 ? 347 MET A CA  1  
ATOM 1979   C C   . MET A 1 347 ? 56.895  46.826  -3.664  1.00 0.00 ? 347 MET A C   1  
ATOM 1980   O O   . MET A 1 347 ? 56.987  45.832  -2.942  1.00 0.00 ? 347 MET A O   1  
ATOM 1981   C CB  . MET A 1 347 ? 55.433  46.952  -5.644  1.00 0.00 ? 347 MET A CB  1  
ATOM 1982   C CG  . MET A 1 347 ? 54.035  46.875  -6.148  1.00 0.00 ? 347 MET A CG  1  
ATOM 1983   S SD  . MET A 1 347 ? 53.891  46.171  -7.825  1.00 0.00 ? 347 MET A SD  1  
ATOM 1984   C CE  . MET A 1 347 ? 52.110  46.464  -7.825  1.00 0.00 ? 347 MET A CE  1  
ATOM 1985   N N   . LEU A 1 348 ? 57.956  47.694  -3.974  1.00 0.00 ? 348 LEU A N   1  
ATOM 1986   C CA  . LEU A 1 348 ? 59.329  47.350  -3.598  1.00 0.00 ? 348 LEU A CA  1  
ATOM 1987   C C   . LEU A 1 348 ? 59.434  47.374  -2.091  1.00 0.00 ? 348 LEU A C   1  
ATOM 1988   O O   . LEU A 1 348 ? 60.045  46.455  -1.457  1.00 0.00 ? 348 LEU A O   1  
ATOM 1989   C CB  . LEU A 1 348 ? 60.359  48.311  -4.332  1.00 0.00 ? 348 LEU A CB  1  
ATOM 1990   C CG  . LEU A 1 348 ? 60.619  48.093  -5.909  1.00 0.00 ? 348 LEU A CG  1  
ATOM 1991   C CD1 . LEU A 1 348 ? 61.272  49.322  -6.632  1.00 0.00 ? 348 LEU A CD1 1  
ATOM 1992   C CD2 . LEU A 1 348 ? 61.322  46.759  -6.163  1.00 0.00 ? 348 LEU A CD2 1  
ATOM 1993   N N   . ARG A 1 349 ? 58.852  48.402  -1.455  1.00 0.00 ? 349 ARG A N   1  
ATOM 1994   C CA  . ARG A 1 349 ? 58.924  48.549  -0.013  1.00 0.00 ? 349 ARG A CA  1  
ATOM 1995   C C   . ARG A 1 349 ? 58.247  47.483  0.821   1.00 0.00 ? 349 ARG A C   1  
ATOM 1996   O O   . ARG A 1 349 ? 58.847  46.973  1.780   1.00 0.00 ? 349 ARG A O   1  
ATOM 1997   C CB  . ARG A 1 349 ? 58.424  49.956  0.378   1.00 0.00 ? 349 ARG A CB  1  
ATOM 1998   C CG  . ARG A 1 349 ? 59.394  51.093  0.036   1.00 0.00 ? 349 ARG A CG  1  
ATOM 1999   C CD  . ARG A 1 349 ? 60.476  51.258  1.071   1.00 0.00 ? 349 ARG A CD  1  
ATOM 2000   N NE  . ARG A 1 349 ? 61.523  52.141  0.465   1.00 0.00 ? 349 ARG A NE  1  
ATOM 2001   C CZ  . ARG A 1 349 ? 62.328  51.650  -0.513  1.00 0.00 ? 349 ARG A CZ  1  
ATOM 2002   N NH1 . ARG A 1 349 ? 62.162  50.436  -1.093  1.00 0.00 ? 349 ARG A NH1 1  
ATOM 2003   N NH2 . ARG A 1 349 ? 63.325  52.529  -0.998  1.00 0.00 ? 349 ARG A NH2 1  
ATOM 2004   N N   . THR A 1 350 ? 57.012  47.031  0.424   1.00 0.00 ? 350 THR A N   1  
ATOM 2005   C CA  . THR A 1 350 ? 56.274  45.971  1.071   1.00 0.00 ? 350 THR A CA  1  
ATOM 2006   C C   . THR A 1 350 ? 56.978  44.658  0.996   1.00 0.00 ? 350 THR A C   1  
ATOM 2007   O O   . THR A 1 350 ? 57.089  43.959  2.065   1.00 0.00 ? 350 THR A O   1  
ATOM 2008   C CB  . THR A 1 350 ? 54.802  45.867  0.630   1.00 0.00 ? 350 THR A CB  1  
ATOM 2009   O OG1 . THR A 1 350 ? 54.082  44.869  1.347   1.00 0.00 ? 350 THR A OG1 1  
ATOM 2010   C CG2 . THR A 1 350 ? 54.728  45.547  -0.888  1.00 0.00 ? 350 THR A CG2 1  
ATOM 2011   N N   . GLY A 1 351 ? 57.573  44.292  -0.189  1.00 0.00 ? 351 GLY A N   1  
ATOM 2012   C CA  . GLY A 1 351 ? 58.305  43.113  -0.437  1.00 0.00 ? 351 GLY A CA  1  
ATOM 2013   C C   . GLY A 1 351 ? 59.598  42.965  0.327   1.00 0.00 ? 351 GLY A C   1  
ATOM 2014   O O   . GLY A 1 351 ? 59.950  41.912  0.832   1.00 0.00 ? 351 GLY A O   1  
ATOM 2015   N N   . ILE A 1 352 ? 60.397  44.077  0.527   1.00 0.00 ? 352 ILE A N   1  
ATOM 2016   C CA  . ILE A 1 352 ? 61.602  44.078  1.283   1.00 0.00 ? 352 ILE A CA  1  
ATOM 2017   C C   . ILE A 1 352 ? 61.393  43.791  2.757   1.00 0.00 ? 352 ILE A C   1  
ATOM 2018   O O   . ILE A 1 352 ? 62.174  43.113  3.360   1.00 0.00 ? 352 ILE A O   1  
ATOM 2019   C CB  . ILE A 1 352 ? 62.719  45.160  0.939   1.00 0.00 ? 352 ILE A CB  1  
ATOM 2020   C CG1 . ILE A 1 352 ? 62.286  46.565  1.420   1.00 0.00 ? 352 ILE A CG1 1  
ATOM 2021   C CG2 . ILE A 1 352 ? 63.042  45.091  -0.588  1.00 0.00 ? 352 ILE A CG2 1  
ATOM 2022   C CD1 . ILE A 1 352 ? 63.311  47.672  1.126   1.00 0.00 ? 352 ILE A CD1 1  
ATOM 2023   N N   . LEU A 1 353 ? 60.257  44.373  3.336   1.00 0.00 ? 353 LEU A N   1  
ATOM 2024   C CA  . LEU A 1 353 ? 59.971  44.166  4.731   1.00 0.00 ? 353 LEU A CA  1  
ATOM 2025   C C   . LEU A 1 353 ? 59.750  42.748  4.977   1.00 0.00 ? 353 LEU A C   1  
ATOM 2026   O O   . LEU A 1 353 ? 60.209  42.210  6.002   1.00 0.00 ? 353 LEU A O   1  
ATOM 2027   C CB  . LEU A 1 353 ? 58.700  44.995  5.117   1.00 0.00 ? 353 LEU A CB  1  
ATOM 2028   C CG  . LEU A 1 353 ? 59.025  46.347  5.784   1.00 0.00 ? 353 LEU A CG  1  
ATOM 2029   C CD1 . LEU A 1 353 ? 59.701  47.366  4.901   1.00 0.00 ? 353 LEU A CD1 1  
ATOM 2030   C CD2 . LEU A 1 353 ? 57.670  46.950  6.324   1.00 0.00 ? 353 LEU A CD2 1  
ATOM 2031   N N   . LEU A 1 354 ? 58.987  42.076  4.104   1.00 0.00 ? 354 LEU A N   1  
ATOM 2032   C CA  . LEU A 1 354 ? 58.638  40.700  4.261   1.00 0.00 ? 354 LEU A CA  1  
ATOM 2033   C C   . LEU A 1 354 ? 59.716  39.651  4.184   1.00 0.00 ? 354 LEU A C   1  
ATOM 2034   O O   . LEU A 1 354 ? 59.840  38.774  5.020   1.00 0.00 ? 354 LEU A O   1  
ATOM 2035   C CB  . LEU A 1 354 ? 57.528  40.204  3.256   1.00 0.00 ? 354 LEU A CB  1  
ATOM 2036   C CG  . LEU A 1 354 ? 56.283  39.516  3.867   1.00 0.00 ? 354 LEU A CG  1  
ATOM 2037   C CD1 . LEU A 1 354 ? 56.689  38.362  4.807   1.00 0.00 ? 354 LEU A CD1 1  
ATOM 2038   C CD2 . LEU A 1 354 ? 55.495  40.590  4.579   1.00 0.00 ? 354 LEU A CD2 1  
ATOM 2039   N N   . LYS A 1 355 ? 60.586  39.905  3.188   1.00 0.00 ? 355 LYS A N   1  
ATOM 2040   C CA  . LYS A 1 355 ? 61.777  39.106  3.016   1.00 0.00 ? 355 LYS A CA  1  
ATOM 2041   C C   . LYS A 1 355 ? 62.765  39.198  4.186   1.00 0.00 ? 355 LYS A C   1  
ATOM 2042   O O   . LYS A 1 355 ? 63.273  38.183  4.559   1.00 0.00 ? 355 LYS A O   1  
ATOM 2043   C CB  . LYS A 1 355 ? 62.558  39.627  1.774   1.00 0.00 ? 355 LYS A CB  1  
ATOM 2044   C CG  . LYS A 1 355 ? 63.779  38.820  1.399   1.00 0.00 ? 355 LYS A CG  1  
ATOM 2045   C CD  . LYS A 1 355 ? 65.058  39.624  1.518   1.00 0.00 ? 355 LYS A CD  1  
ATOM 2046   C CE  . LYS A 1 355 ? 66.359  38.880  1.258   1.00 0.00 ? 355 LYS A CE  1  
ATOM 2047   N NZ  . LYS A 1 355 ? 66.440  37.686  2.203   1.00 0.00 ? 355 LYS A NZ  1  
ATOM 2048   N N   . VAL A 1 356 ? 62.987  40.370  4.817   1.00 0.00 ? 356 VAL A N   1  
ATOM 2049   C CA  . VAL A 1 356 ? 63.891  40.437  5.925   1.00 0.00 ? 356 VAL A CA  1  
ATOM 2050   C C   . VAL A 1 356 ? 63.391  39.627  7.205   1.00 0.00 ? 356 VAL A C   1  
ATOM 2051   O O   . VAL A 1 356 ? 64.172  38.982  7.846   1.00 0.00 ? 356 VAL A O   1  
ATOM 2052   C CB  . VAL A 1 356 ? 64.315  41.876  6.290   1.00 0.00 ? 356 VAL A CB  1  
ATOM 2053   C CG1 . VAL A 1 356 ? 65.290  41.915  7.508   1.00 0.00 ? 356 VAL A CG1 1  
ATOM 2054   C CG2 . VAL A 1 356 ? 65.073  42.478  5.064   1.00 0.00 ? 356 VAL A CG2 1  
ATOM 2055   N N   . VAL A 1 357 ? 62.079  39.726  7.420   1.00 0.00 ? 357 VAL A N   1  
ATOM 2056   C CA  . VAL A 1 357 ? 61.289  39.051  8.411   1.00 0.00 ? 357 VAL A CA  1  
ATOM 2057   C C   . VAL A 1 357 ? 61.279  37.533  8.135   1.00 0.00 ? 357 VAL A C   1  
ATOM 2058   O O   . VAL A 1 357 ? 61.355  36.791  9.064   1.00 0.00 ? 357 VAL A O   1  
ATOM 2059   C CB  . VAL A 1 357 ? 59.871  39.614  8.506   1.00 0.00 ? 357 VAL A CB  1  
ATOM 2060   C CG1 . VAL A 1 357 ? 58.939  38.636  9.301   1.00 0.00 ? 357 VAL A CG1 1  
ATOM 2061   C CG2 . VAL A 1 357 ? 60.047  40.904  9.289   1.00 0.00 ? 357 VAL A CG2 1  
ATOM 2062   N N   . ARG A 1 358 ? 61.219  37.100  6.819   1.00 0.00 ? 358 ARG A N   1  
ATOM 2063   C CA  . ARG A 1 358 ? 61.249  35.665  6.478   1.00 0.00 ? 358 ARG A CA  1  
ATOM 2064   C C   . ARG A 1 358 ? 62.577  35.131  6.817   1.00 0.00 ? 358 ARG A C   1  
ATOM 2065   O O   . ARG A 1 358 ? 62.702  33.988  7.298   1.00 0.00 ? 358 ARG A O   1  
ATOM 2066   C CB  . ARG A 1 358 ? 60.900  35.381  5.021   1.00 0.00 ? 358 ARG A CB  1  
ATOM 2067   C CG  . ARG A 1 358 ? 59.413  35.582  4.616   1.00 0.00 ? 358 ARG A CG  1  
ATOM 2068   C CD  . ARG A 1 358 ? 58.451  34.477  5.212   1.00 0.00 ? 358 ARG A CD  1  
ATOM 2069   N NE  . ARG A 1 358 ? 58.800  33.184  4.579   1.00 0.00 ? 358 ARG A NE  1  
ATOM 2070   C CZ  . ARG A 1 358 ? 57.904  32.448  3.861   1.00 0.00 ? 358 ARG A CZ  1  
ATOM 2071   N NH1 . ARG A 1 358 ? 56.733  32.972  3.459   1.00 0.00 ? 358 ARG A NH1 1  
ATOM 2072   N NH2 . ARG A 1 358 ? 58.211  31.171  3.394   1.00 0.00 ? 358 ARG A NH2 1  
ATOM 2073   N N   . ALA A 1 359 ? 63.594  35.910  6.652   1.00 0.00 ? 359 ALA A N   1  
ATOM 2074   C CA  . ALA A 1 359 ? 64.966  35.562  6.978   1.00 0.00 ? 359 ALA A CA  1  
ATOM 2075   C C   . ALA A 1 359 ? 65.290  35.327  8.336   1.00 0.00 ? 359 ALA A C   1  
ATOM 2076   O O   . ALA A 1 359 ? 66.144  34.440  8.577   1.00 0.00 ? 359 ALA A O   1  
ATOM 2077   C CB  . ALA A 1 359 ? 65.816  36.663  6.302   1.00 0.00 ? 359 ALA A CB  1  
ATOM 2078   N N   . SER A 1 360 ? 64.593  36.044  9.253   1.00 0.00 ? 360 SER A N   1  
ATOM 2079   C CA  . SER A 1 360 ? 64.620  36.023  10.746  1.00 0.00 ? 360 SER A CA  1  
ATOM 2080   C C   . SER A 1 360 ? 64.209  34.725  11.400  1.00 0.00 ? 360 SER A C   1  
ATOM 2081   O O   . SER A 1 360 ? 64.220  34.667  12.618  1.00 0.00 ? 360 SER A O   1  
ATOM 2082   C CB  . SER A 1 360 ? 63.740  37.190  11.250  1.00 0.00 ? 360 SER A CB  1  
ATOM 2083   O OG  . SER A 1 360 ? 64.126  38.410  10.638  1.00 0.00 ? 360 SER A OG  1  
ATOM 2084   N N   . LEU A 1 361 ? 63.993  33.655  10.575  1.00 0.00 ? 361 LEU A N   1  
ATOM 2085   C CA  . LEU A 1 361 ? 63.604  32.285  10.837  1.00 0.00 ? 361 LEU A CA  1  
ATOM 2086   C C   . LEU A 1 361 ? 62.188  32.268  11.351  1.00 0.00 ? 361 LEU A C   1  
ATOM 2087   O O   . LEU A 1 361 ? 61.357  33.087  11.010  1.00 0.00 ? 361 LEU A O   1  
ATOM 2088   C CB  . LEU A 1 361 ? 64.584  31.443  11.736  1.00 0.00 ? 361 LEU A CB  1  
ATOM 2089   C CG  . LEU A 1 361 ? 66.043  31.444  11.198  1.00 0.00 ? 361 LEU A CG  1  
ATOM 2090   C CD1 . LEU A 1 361 ? 66.147  31.159  9.693   1.00 0.00 ? 361 LEU A CD1 1  
ATOM 2091   C CD2 . LEU A 1 361 ? 66.930  32.604  11.602  1.00 0.00 ? 361 LEU A CD2 1  
ATOM 2092   N N   . GLN A 1 362 ? 61.919  31.237  12.294  1.00 0.00 ? 362 GLN A N   1  
ATOM 2093   C CA  . GLN A 1 362 ? 60.652  30.852  12.984  1.00 0.00 ? 362 GLN A CA  1  
ATOM 2094   C C   . GLN A 1 362 ? 60.357  31.721  14.110  1.00 0.00 ? 362 GLN A C   1  
ATOM 2095   O O   . GLN A 1 362 ? 59.562  31.341  14.934  1.00 0.00 ? 362 GLN A O   1  
ATOM 2096   C CB  . GLN A 1 362 ? 60.664  29.365  13.499  1.00 0.00 ? 362 GLN A CB  1  
ATOM 2097   C CG  . GLN A 1 362 ? 61.011  28.321  12.403  1.00 0.00 ? 362 GLN A CG  1  
ATOM 2098   C CD  . GLN A 1 362 ? 59.998  28.478  11.211  1.00 0.00 ? 362 GLN A CD  1  
ATOM 2099   O OE1 . GLN A 1 362 ? 60.287  29.311  10.344  1.00 0.00 ? 362 GLN A OE1 1  
ATOM 2100   N NE2 . GLN A 1 362 ? 58.821  27.800  11.268  1.00 0.00 ? 362 GLN A NE2 1  
ATOM 2101   N N   . ILE A 1 363 ? 60.867  32.955  14.084  1.00 0.00 ? 363 ILE A N   1  
ATOM 2102   C CA  . ILE A 1 363 ? 60.525  33.991  15.001  1.00 0.00 ? 363 ILE A CA  1  
ATOM 2103   C C   . ILE A 1 363 ? 59.358  34.650  14.240  1.00 0.00 ? 363 ILE A C   1  
ATOM 2104   O O   . ILE A 1 363 ? 59.592  34.953  13.062  1.00 0.00 ? 363 ILE A O   1  
ATOM 2105   C CB  . ILE A 1 363 ? 61.706  34.930  15.239  1.00 0.00 ? 363 ILE A CB  1  
ATOM 2106   C CG1 . ILE A 1 363 ? 62.971  34.227  15.849  1.00 0.00 ? 363 ILE A CG1 1  
ATOM 2107   C CG2 . ILE A 1 363 ? 61.282  36.050  16.193  1.00 0.00 ? 363 ILE A CG2 1  
ATOM 2108   C CD1 . ILE A 1 363 ? 64.161  35.172  16.089  1.00 0.00 ? 363 ILE A CD1 1  
ATOM 2109   N N   . PRO A 1 364 ? 58.143  34.919  14.870  1.00 0.00 ? 364 PRO A N   1  
ATOM 2110   C CA  . PRO A 1 364 ? 56.918  35.471  14.254  1.00 0.00 ? 364 PRO A CA  1  
ATOM 2111   C C   . PRO A 1 364 ? 57.054  36.040  12.828  1.00 0.00 ? 364 PRO A C   1  
ATOM 2112   O O   . PRO A 1 364 ? 57.376  37.181  12.538  1.00 0.00 ? 364 PRO A O   1  
ATOM 2113   C CB  . PRO A 1 364 ? 56.447  36.518  15.215  1.00 0.00 ? 364 PRO A CB  1  
ATOM 2114   C CG  . PRO A 1 364 ? 56.621  35.812  16.586  1.00 0.00 ? 364 PRO A CG  1  
ATOM 2115   C CD  . PRO A 1 364 ? 57.802  34.841  16.304  1.00 0.00 ? 364 PRO A CD  1  
ATOM 2116   N N   . THR A 1 365 ? 56.646  35.220  11.812  1.00 0.00 ? 365 THR A N   1  
ATOM 2117   C CA  . THR A 1 365 ? 56.547  35.582  10.349  1.00 0.00 ? 365 THR A CA  1  
ATOM 2118   C C   . THR A 1 365 ? 55.243  35.155  9.708   1.00 0.00 ? 365 THR A C   1  
ATOM 2119   O O   . THR A 1 365 ? 54.561  34.369  10.253  1.00 0.00 ? 365 THR A O   1  
ATOM 2120   C CB  . THR A 1 365 ? 57.797  34.972  9.648   1.00 0.00 ? 365 THR A CB  1  
ATOM 2121   O OG1 . THR A 1 365 ? 57.951  35.355  8.300   1.00 0.00 ? 365 THR A OG1 1  
ATOM 2122   C CG2 . THR A 1 365 ? 57.968  33.412  9.705   1.00 0.00 ? 365 THR A CG2 1  
ATOM 2123   N N   . ILE A 1 366 ? 54.883  35.738  8.535   1.00 0.00 ? 366 ILE A N   1  
ATOM 2124   C CA  . ILE A 1 366 ? 53.784  35.543  7.745   1.00 0.00 ? 366 ILE A CA  1  
ATOM 2125   C C   . ILE A 1 366 ? 52.695  36.384  8.278   1.00 0.00 ? 366 ILE A C   1  
ATOM 2126   O O   . ILE A 1 366 ? 52.492  36.270  9.469   1.00 0.00 ? 366 ILE A O   1  
ATOM 2127   C CB  . ILE A 1 366 ? 53.490  34.120  7.367   1.00 0.00 ? 366 ILE A CB  1  
ATOM 2128   C CG1 . ILE A 1 366 ? 54.656  33.455  6.653   1.00 0.00 ? 366 ILE A CG1 1  
ATOM 2129   C CG2 . ILE A 1 366 ? 52.200  33.872  6.638   1.00 0.00 ? 366 ILE A CG2 1  
ATOM 2130   C CD1 . ILE A 1 366 ? 54.394  31.994  6.248   1.00 0.00 ? 366 ILE A CD1 1  
ATOM 2131   N N   . PRO A 1 367 ? 52.032  37.322  7.553   1.00 0.00 ? 367 PRO A N   1  
ATOM 2132   C CA  . PRO A 1 367 ? 50.965  38.119  8.071   1.00 0.00 ? 367 PRO A CA  1  
ATOM 2133   C C   . PRO A 1 367 ? 49.939  37.198  8.584   1.00 0.00 ? 367 PRO A C   1  
ATOM 2134   O O   . PRO A 1 367 ? 49.629  36.171  7.895   1.00 0.00 ? 367 PRO A O   1  
ATOM 2135   C CB  . PRO A 1 367 ? 50.434  38.960  6.909   1.00 0.00 ? 367 PRO A CB  1  
ATOM 2136   C CG  . PRO A 1 367 ? 51.679  39.061  6.009   1.00 0.00 ? 367 PRO A CG  1  
ATOM 2137   C CD  . PRO A 1 367 ? 52.329  37.653  6.154   1.00 0.00 ? 367 PRO A CD  1  
ATOM 2138   N N   . SER A 1 368 ? 49.382  37.599  9.701   1.00 0.00 ? 368 SER A N   1  
ATOM 2139   C CA  . SER A 1 368 ? 48.294  36.906  10.351  1.00 0.00 ? 368 SER A CA  1  
ATOM 2140   C C   . SER A 1 368 ? 47.040  37.609  10.239  1.00 0.00 ? 368 SER A C   1  
ATOM 2141   O O   . SER A 1 368 ? 46.045  37.165  10.881  1.00 0.00 ? 368 SER A O   1  
ATOM 2142   C CB  . SER A 1 368 ? 48.619  36.556  11.827  1.00 0.00 ? 368 SER A CB  1  
ATOM 2143   O OG  . SER A 1 368 ? 49.888  35.980  11.850  1.00 0.00 ? 368 SER A OG  1  
ATOM 2144   N N   . ASN A 1 369 ? 47.051  38.624  9.347   1.00 0.00 ? 369 ASN A N   1  
ATOM 2145   C CA  . ASN A 1 369 ? 45.764  39.184  8.872   1.00 0.00 ? 369 ASN A CA  1  
ATOM 2146   C C   . ASN A 1 369 ? 45.470  38.586  7.528   1.00 0.00 ? 369 ASN A C   1  
ATOM 2147   O O   . ASN A 1 369 ? 46.314  37.977  6.838   1.00 0.00 ? 369 ASN A O   1  
ATOM 2148   C CB  . ASN A 1 369 ? 45.834  40.708  8.549   1.00 0.00 ? 369 ASN A CB  1  
ATOM 2149   C CG  . ASN A 1 369 ? 45.624  41.413  9.894   1.00 0.00 ? 369 ASN A CG  1  
ATOM 2150   O OD1 . ASN A 1 369 ? 46.237  41.065  10.879  1.00 0.00 ? 369 ASN A OD1 1  
ATOM 2151   N ND2 . ASN A 1 369 ? 44.800  42.562  9.790   1.00 0.00 ? 369 ASN A ND2 1  
ATOM 2152   N N   . SER A 1 370 ? 44.236  38.736  7.119   1.00 0.00 ? 370 SER A N   1  
ATOM 2153   C CA  . SER A 1 370 ? 43.655  38.181  5.900   1.00 0.00 ? 370 SER A CA  1  
ATOM 2154   C C   . SER A 1 370 ? 44.311  38.581  4.586   1.00 0.00 ? 370 SER A C   1  
ATOM 2155   O O   . SER A 1 370 ? 44.878  39.619  4.509   1.00 0.00 ? 370 SER A O   1  
ATOM 2156   C CB  . SER A 1 370 ? 42.193  38.455  5.718   1.00 0.00 ? 370 SER A CB  1  
ATOM 2157   O OG  . SER A 1 370 ? 42.011  39.878  5.838   1.00 0.00 ? 370 SER A OG  1  
ATOM 2158   N N   . SER A 1 371 ? 44.245  37.606  3.631   1.00 0.00 ? 371 SER A N   1  
ATOM 2159   C CA  . SER A 1 371 ? 44.769  37.660  2.247   1.00 0.00 ? 371 SER A CA  1  
ATOM 2160   C C   . SER A 1 371 ? 44.102  38.641  1.343   1.00 0.00 ? 371 SER A C   1  
ATOM 2161   O O   . SER A 1 371 ? 43.012  39.075  1.706   1.00 0.00 ? 371 SER A O   1  
ATOM 2162   C CB  . SER A 1 371 ? 44.503  36.252  1.605   1.00 0.00 ? 371 SER A CB  1  
ATOM 2163   O OG  . SER A 1 371 ? 44.971  35.160  2.393   1.00 0.00 ? 371 SER A OG  1  
ATOM 2164   N N   . ASP A 1 372 ? 44.803  38.973  0.285   1.00 0.00 ? 372 ASP A N   1  
ATOM 2165   C CA  . ASP A 1 372 ? 44.333  39.890  -0.718  1.00 0.00 ? 372 ASP A CA  1  
ATOM 2166   C C   . ASP A 1 372 ? 44.448  39.264  -2.098  1.00 0.00 ? 372 ASP A C   1  
ATOM 2167   O O   . ASP A 1 372 ? 44.341  39.989  -3.083  1.00 0.00 ? 372 ASP A O   1  
ATOM 2168   C CB  . ASP A 1 372 ? 45.224  41.173  -0.831  1.00 0.00 ? 372 ASP A CB  1  
ATOM 2169   C CG  . ASP A 1 372 ? 45.440  41.797  0.514   1.00 0.00 ? 372 ASP A CG  1  
ATOM 2170   O OD1 . ASP A 1 372 ? 44.412  42.206  1.115   1.00 0.00 ? 372 ASP A OD1 1  
ATOM 2171   O OD2 . ASP A 1 372 ? 46.613  41.747  0.947   1.00 0.00 ? 372 ASP A OD2 1  
ATOM 2172   N N   . ILE A 1 373 ? 44.520  37.958  -2.223  1.00 0.00 ? 373 ILE A N   1  
ATOM 2173   C CA  . ILE A 1 373 ? 44.549  37.325  -3.518  1.00 0.00 ? 373 ILE A CA  1  
ATOM 2174   C C   . ILE A 1 373 ? 43.223  37.597  -4.254  1.00 0.00 ? 373 ILE A C   1  
ATOM 2175   O O   . ILE A 1 373 ? 43.103  37.865  -5.453  1.00 0.00 ? 373 ILE A O   1  
ATOM 2176   C CB  . ILE A 1 373 ? 44.805  35.844  -3.360  1.00 0.00 ? 373 ILE A CB  1  
ATOM 2177   C CG1 . ILE A 1 373 ? 44.980  34.956  -4.625  1.00 0.00 ? 373 ILE A CG1 1  
ATOM 2178   C CG2 . ILE A 1 373 ? 43.770  35.115  -2.459  1.00 0.00 ? 373 ILE A CG2 1  
ATOM 2179   C CD1 . ILE A 1 373 ? 45.234  33.470  -4.320  1.00 0.00 ? 373 ILE A CD1 1  
ATOM 2180   N N   . THR A 1 374 ? 42.107  37.502  -3.489  1.00 0.00 ? 374 THR A N   1  
ATOM 2181   C CA  . THR A 1 374 ? 40.700  37.565  -3.823  1.00 0.00 ? 374 THR A CA  1  
ATOM 2182   C C   . THR A 1 374 ? 40.444  39.049  -4.414  1.00 0.00 ? 374 THR A C   1  
ATOM 2183   O O   . THR A 1 374 ? 39.860  39.202  -5.469  1.00 0.00 ? 374 THR A O   1  
ATOM 2184   C CB  . THR A 1 374 ? 39.842  37.304  -2.572  1.00 0.00 ? 374 THR A CB  1  
ATOM 2185   O OG1 . THR A 1 374 ? 38.468  37.543  -2.873  1.00 0.00 ? 374 THR A OG1 1  
ATOM 2186   C CG2 . THR A 1 374 ? 40.308  38.182  -1.358  1.00 0.00 ? 374 THR A CG2 1  
ATOM 2187   N N   . ILE A 1 375 ? 40.990  40.091  -3.842  1.00 0.00 ? 375 ILE A N   1  
ATOM 2188   C CA  . ILE A 1 375 ? 41.003  41.502  -4.239  1.00 0.00 ? 375 ILE A CA  1  
ATOM 2189   C C   . ILE A 1 375 ? 41.785  41.720  -5.544  1.00 0.00 ? 375 ILE A C   1  
ATOM 2190   O O   . ILE A 1 375 ? 41.191  42.420  -6.389  1.00 0.00 ? 375 ILE A O   1  
ATOM 2191   C CB  . ILE A 1 375 ? 41.722  42.384  -3.229  1.00 0.00 ? 375 ILE A CB  1  
ATOM 2192   C CG1 . ILE A 1 375 ? 41.099  42.205  -1.820  1.00 0.00 ? 375 ILE A CG1 1  
ATOM 2193   C CG2 . ILE A 1 375 ? 41.604  43.926  -3.502  1.00 0.00 ? 375 ILE A CG2 1  
ATOM 2194   C CD1 . ILE A 1 375 ? 41.763  43.061  -0.727  1.00 0.00 ? 375 ILE A CD1 1  
ATOM 2195   N N   . GLN A 1 376 ? 42.979  41.106  -5.769  1.00 0.00 ? 376 GLN A N   1  
ATOM 2196   C CA  . GLN A 1 376 ? 43.829  41.122  -6.950  1.00 0.00 ? 376 GLN A CA  1  
ATOM 2197   C C   . GLN A 1 376 ? 43.202  40.478  -8.163  1.00 0.00 ? 376 GLN A C   1  
ATOM 2198   O O   . GLN A 1 376 ? 43.307  41.047  -9.259  1.00 0.00 ? 376 GLN A O   1  
ATOM 2199   C CB  . GLN A 1 376 ? 45.180  40.490  -6.656  1.00 0.00 ? 376 GLN A CB  1  
ATOM 2200   C CG  . GLN A 1 376 ? 46.341  40.622  -7.706  1.00 0.00 ? 376 GLN A CG  1  
ATOM 2201   C CD  . GLN A 1 376 ? 46.868  42.056  -7.929  1.00 0.00 ? 376 GLN A CD  1  
ATOM 2202   O OE1 . GLN A 1 376 ? 46.270  43.068  -7.513  1.00 0.00 ? 376 GLN A OE1 1  
ATOM 2203   N NE2 . GLN A 1 376 ? 48.044  41.994  -8.613  1.00 0.00 ? 376 GLN A NE2 1  
ATOM 2204   N N   . GLU A 1 377 ? 42.531  39.326  -7.974  1.00 0.00 ? 377 GLU A N   1  
ATOM 2205   C CA  . GLU A 1 377 ? 41.869  38.482  -8.947  1.00 0.00 ? 377 GLU A CA  1  
ATOM 2206   C C   . GLU A 1 377 ? 40.734  39.229  -9.506  1.00 0.00 ? 377 GLU A C   1  
ATOM 2207   O O   . GLU A 1 377 ? 40.656  39.106  -10.726 1.00 0.00 ? 377 GLU A O   1  
ATOM 2208   C CB  . GLU A 1 377 ? 41.230  37.230  -8.242  1.00 0.00 ? 377 GLU A CB  1  
ATOM 2209   C CG  . GLU A 1 377 ? 42.229  36.020  -8.061  1.00 0.00 ? 377 GLU A CG  1  
ATOM 2210   C CD  . GLU A 1 377 ? 41.577  34.825  -7.524  1.00 0.00 ? 377 GLU A CD  1  
ATOM 2211   O OE1 . GLU A 1 377 ? 40.939  34.196  -8.405  1.00 0.00 ? 377 GLU A OE1 1  
ATOM 2212   O OE2 . GLU A 1 377 ? 41.831  34.394  -6.333  1.00 0.00 ? 377 GLU A OE2 1  
ATOM 2213   N N   . ILE A 1 378 ? 39.926  40.016  -8.707  1.00 0.00 ? 378 ILE A N   1  
ATOM 2214   C CA  . ILE A 1 378 ? 38.820  40.814  -9.185  1.00 0.00 ? 378 ILE A CA  1  
ATOM 2215   C C   . ILE A 1 378 ? 39.394  41.951  -10.070 1.00 0.00 ? 378 ILE A C   1  
ATOM 2216   O O   . ILE A 1 378 ? 38.812  42.310  -11.115 1.00 0.00 ? 378 ILE A O   1  
ATOM 2217   C CB  . ILE A 1 378 ? 37.978  41.313  -7.960  1.00 0.00 ? 378 ILE A CB  1  
ATOM 2218   C CG1 . ILE A 1 378 ? 37.339  40.174  -7.131  1.00 0.00 ? 378 ILE A CG1 1  
ATOM 2219   C CG2 . ILE A 1 378 ? 36.841  42.271  -8.553  1.00 0.00 ? 378 ILE A CG2 1  
ATOM 2220   C CD1 . ILE A 1 378 ? 36.512  40.660  -5.928  1.00 0.00 ? 378 ILE A CD1 1  
ATOM 2221   N N   . ASN A 1 379 ? 40.603  42.553  -9.707  1.00 0.00 ? 379 ASN A N   1  
ATOM 2222   C CA  . ASN A 1 379 ? 41.275  43.532  -10.595 1.00 0.00 ? 379 ASN A CA  1  
ATOM 2223   C C   . ASN A 1 379 ? 41.642  42.851  -11.980 1.00 0.00 ? 379 ASN A C   1  
ATOM 2224   O O   . ASN A 1 379 ? 41.465  43.493  -12.980 1.00 0.00 ? 379 ASN A O   1  
ATOM 2225   C CB  . ASN A 1 379 ? 42.660  44.109  -10.118 1.00 0.00 ? 379 ASN A CB  1  
ATOM 2226   C CG  . ASN A 1 379 ? 42.518  44.977  -8.853  1.00 0.00 ? 379 ASN A CG  1  
ATOM 2227   O OD1 . ASN A 1 379 ? 41.402  45.131  -8.245  1.00 0.00 ? 379 ASN A OD1 1  
ATOM 2228   N ND2 . ASN A 1 379 ? 43.622  45.612  -8.397  1.00 0.00 ? 379 ASN A ND2 1  
ATOM 2229   N N   . ASP A 1 380 ? 42.131  41.547  -12.056 1.00 0.00 ? 380 ASP A N   1  
ATOM 2230   C CA  . ASP A 1 380 ? 42.500  40.959  -13.358 1.00 0.00 ? 380 ASP A CA  1  
ATOM 2231   C C   . ASP A 1 380 ? 41.263  40.829  -14.281 1.00 0.00 ? 380 ASP A C   1  
ATOM 2232   O O   . ASP A 1 380 ? 41.374  41.013  -15.462 1.00 0.00 ? 380 ASP A O   1  
ATOM 2233   C CB  . ASP A 1 380 ? 43.142  39.583  -13.090 1.00 0.00 ? 380 ASP A CB  1  
ATOM 2234   C CG  . ASP A 1 380 ? 44.457  39.714  -12.255 1.00 0.00 ? 380 ASP A CG  1  
ATOM 2235   O OD1 . ASP A 1 380 ? 45.292  40.541  -12.676 1.00 0.00 ? 380 ASP A OD1 1  
ATOM 2236   O OD2 . ASP A 1 380 ? 44.612  38.949  -11.330 1.00 0.00 ? 380 ASP A OD2 1  
ATOM 2237   N N   . PHE A 1 381 ? 40.037  40.409  -13.711 1.00 0.00 ? 381 PHE A N   1  
ATOM 2238   C CA  . PHE A 1 381 ? 38.742  40.148  -14.370 1.00 0.00 ? 381 PHE A CA  1  
ATOM 2239   C C   . PHE A 1 381 ? 38.128  41.428  -14.946 1.00 0.00 ? 381 PHE A C   1  
ATOM 2240   O O   . PHE A 1 381 ? 37.696  41.404  -16.109 1.00 0.00 ? 381 PHE A O   1  
ATOM 2241   C CB  . PHE A 1 381 ? 37.681  39.565  -13.456 1.00 0.00 ? 381 PHE A CB  1  
ATOM 2242   C CG  . PHE A 1 381 ? 38.119  38.342  -12.669 1.00 0.00 ? 381 PHE A CG  1  
ATOM 2243   C CD1 . PHE A 1 381 ? 39.105  37.419  -13.161 1.00 0.00 ? 381 PHE A CD1 1  
ATOM 2244   C CD2 . PHE A 1 381 ? 37.487  38.049  -11.489 1.00 0.00 ? 381 PHE A CD2 1  
ATOM 2245   C CE1 . PHE A 1 381 ? 39.474  36.281  -12.409 1.00 0.00 ? 381 PHE A CE1 1  
ATOM 2246   C CE2 . PHE A 1 381 ? 38.044  36.937  -10.665 1.00 0.00 ? 381 PHE A CE2 1  
ATOM 2247   C CZ  . PHE A 1 381 ? 38.999  36.096  -11.107 1.00 0.00 ? 381 PHE A CZ  1  
ATOM 2248   N N   . ALA A 1 382 ? 38.393  42.529  -14.230 1.00 0.00 ? 382 ALA A N   1  
ATOM 2249   C CA  . ALA A 1 382 ? 38.119  43.864  -14.701 1.00 0.00 ? 382 ALA A CA  1  
ATOM 2250   C C   . ALA A 1 382 ? 38.855  44.137  -16.028 1.00 0.00 ? 382 ALA A C   1  
ATOM 2251   O O   . ALA A 1 382 ? 38.232  44.598  -16.979 1.00 0.00 ? 382 ALA A O   1  
ATOM 2252   C CB  . ALA A 1 382 ? 38.381  45.009  -13.659 1.00 0.00 ? 382 ALA A CB  1  
ATOM 2253   N N   . ASP A 1 383 ? 40.235  43.763  -16.096 1.00 0.00 ? 383 ASP A N   1  
ATOM 2254   C CA  . ASP A 1 383 ? 41.053  44.040  -17.310 1.00 0.00 ? 383 ASP A CA  1  
ATOM 2255   C C   . ASP A 1 383 ? 41.059  45.528  -17.564 1.00 0.00 ? 383 ASP A C   1  
ATOM 2256   O O   . ASP A 1 383 ? 40.691  46.021  -18.652 1.00 0.00 ? 383 ASP A O   1  
ATOM 2257   C CB  . ASP A 1 383 ? 40.728  43.262  -18.575 1.00 0.00 ? 383 ASP A CB  1  
ATOM 2258   C CG  . ASP A 1 383 ? 41.038  41.793  -18.357 1.00 0.00 ? 383 ASP A CG  1  
ATOM 2259   O OD1 . ASP A 1 383 ? 42.207  41.478  -18.599 1.00 0.00 ? 383 ASP A OD1 1  
ATOM 2260   O OD2 . ASP A 1 383 ? 40.122  41.020  -17.889 1.00 0.00 ? 383 ASP A OD2 1  
ATOM 2261   N N   . LEU A 1 384 ? 41.492  46.223  -16.494 1.00 0.00 ? 384 LEU A N   1  
ATOM 2262   C CA  . LEU A 1 384 ? 41.795  47.635  -16.647 1.00 0.00 ? 384 LEU A CA  1  
ATOM 2263   C C   . LEU A 1 384 ? 43.214  47.744  -16.074 1.00 0.00 ? 384 LEU A C   1  
ATOM 2264   O O   . LEU A 1 384 ? 43.788  46.724  -15.741 1.00 0.00 ? 384 LEU A O   1  
ATOM 2265   C CB  . LEU A 1 384 ? 40.895  48.557  -15.732 1.00 0.00 ? 384 LEU A CB  1  
ATOM 2266   C CG  . LEU A 1 384 ? 39.398  48.221  -15.841 1.00 0.00 ? 384 LEU A CG  1  
ATOM 2267   C CD1 . LEU A 1 384 ? 38.610  48.903  -14.726 1.00 0.00 ? 384 LEU A CD1 1  
ATOM 2268   C CD2 . LEU A 1 384 ? 38.780  48.797  -17.170 1.00 0.00 ? 384 LEU A CD2 1  
ATOM 2269   N N   . MET A 1 385 ? 43.754  48.973  -15.989 1.00 0.00 ? 385 MET A N   1  
ATOM 2270   C CA  . MET A 1 385 ? 45.025  49.315  -15.485 1.00 0.00 ? 385 MET A CA  1  
ATOM 2271   C C   . MET A 1 385 ? 44.844  50.526  -14.537 1.00 0.00 ? 385 MET A C   1  
ATOM 2272   O O   . MET A 1 385 ? 45.792  51.292  -14.189 1.00 0.00 ? 385 MET A O   1  
ATOM 2273   C CB  . MET A 1 385 ? 45.950  49.530  -16.716 1.00 0.00 ? 385 MET A CB  1  
ATOM 2274   C CG  . MET A 1 385 ? 45.413  50.436  -17.852 1.00 0.00 ? 385 MET A CG  1  
ATOM 2275   S SD  . MET A 1 385 ? 46.629  50.779  -19.211 1.00 0.00 ? 385 MET A SD  1  
ATOM 2276   C CE  . MET A 1 385 ? 47.115  52.327  -18.480 1.00 0.00 ? 385 MET A CE  1  
ATOM 2277   N N   . GLU A 1 386 ? 43.558  50.793  -14.152 1.00 0.00 ? 386 GLU A N   1  
ATOM 2278   C CA  . GLU A 1 386 ? 43.196  51.936  -13.314 1.00 0.00 ? 386 GLU A CA  1  
ATOM 2279   C C   . GLU A 1 386 ? 43.858  52.062  -11.960 1.00 0.00 ? 386 GLU A C   1  
ATOM 2280   O O   . GLU A 1 386 ? 44.164  51.088  -11.304 1.00 0.00 ? 386 GLU A O   1  
ATOM 2281   C CB  . GLU A 1 386 ? 41.656  52.031  -13.281 1.00 0.00 ? 386 GLU A CB  1  
ATOM 2282   C CG  . GLU A 1 386 ? 41.072  53.402  -12.792 1.00 0.00 ? 386 GLU A CG  1  
ATOM 2283   C CD  . GLU A 1 386 ? 39.534  53.381  -13.005 1.00 0.00 ? 386 GLU A CD  1  
ATOM 2284   O OE1 . GLU A 1 386 ? 38.841  52.695  -12.234 1.00 0.00 ? 386 GLU A OE1 1  
ATOM 2285   O OE2 . GLU A 1 386 ? 39.060  54.079  -13.965 1.00 0.00 ? 386 GLU A OE2 1  
ATOM 2286   N N   . GLY A 1 387 ? 44.200  53.309  -11.610 1.00 0.00 ? 387 GLY A N   1  
ATOM 2287   C CA  . GLY A 1 387 ? 45.061  53.613  -10.457 1.00 0.00 ? 387 GLY A CA  1  
ATOM 2288   C C   . GLY A 1 387 ? 44.455  53.217  -9.130  1.00 0.00 ? 387 GLY A C   1  
ATOM 2289   O O   . GLY A 1 387 ? 45.197  52.749  -8.269  1.00 0.00 ? 387 GLY A O   1  
ATOM 2290   N N   . SER A 1 388 ? 43.078  53.503  -8.951  1.00 0.00 ? 388 SER A N   1  
ATOM 2291   C CA  . SER A 1 388 ? 42.376  53.323  -7.729  1.00 0.00 ? 388 SER A CA  1  
ATOM 2292   C C   . SER A 1 388 ? 42.299  51.894  -7.209  1.00 0.00 ? 388 SER A C   1  
ATOM 2293   O O   . SER A 1 388 ? 42.619  51.629  -6.083  1.00 0.00 ? 388 SER A O   1  
ATOM 2294   C CB  . SER A 1 388 ? 40.931  53.919  -7.698  1.00 0.00 ? 388 SER A CB  1  
ATOM 2295   O OG  . SER A 1 388 ? 40.879  55.296  -8.027  1.00 0.00 ? 388 SER A OG  1  
ATOM 2296   N N   . ASN A 1 389 ? 42.002  50.868  -8.123  1.00 0.00 ? 389 ASN A N   1  
ATOM 2297   C CA  . ASN A 1 389 ? 42.013  49.471  -7.792  1.00 0.00 ? 389 ASN A CA  1  
ATOM 2298   C C   . ASN A 1 389 ? 43.391  48.928  -7.367  1.00 0.00 ? 389 ASN A C   1  
ATOM 2299   O O   . ASN A 1 389 ? 43.552  48.216  -6.391  1.00 0.00 ? 389 ASN A O   1  
ATOM 2300   C CB  . ASN A 1 389 ? 41.549  48.521  -9.061  1.00 0.00 ? 389 ASN A CB  1  
ATOM 2301   C CG  . ASN A 1 389 ? 40.170  48.847  -9.498  1.00 0.00 ? 389 ASN A CG  1  
ATOM 2302   O OD1 . ASN A 1 389 ? 40.005  49.084  -10.679 1.00 0.00 ? 389 ASN A OD1 1  
ATOM 2303   N ND2 . ASN A 1 389 ? 39.130  48.707  -8.622  1.00 0.00 ? 389 ASN A ND2 1  
ATOM 2304   N N   . LEU A 1 390 ? 44.416  49.318  -8.114  1.00 0.00 ? 390 LEU A N   1  
ATOM 2305   C CA  . LEU A 1 390 ? 45.782  48.918  -8.020  1.00 0.00 ? 390 LEU A CA  1  
ATOM 2306   C C   . LEU A 1 390 ? 46.300  49.444  -6.714  1.00 0.00 ? 390 LEU A C   1  
ATOM 2307   O O   . LEU A 1 390 ? 46.955  48.696  -5.947  1.00 0.00 ? 390 LEU A O   1  
ATOM 2308   C CB  . LEU A 1 390 ? 46.687  49.500  -9.133  1.00 0.00 ? 390 LEU A CB  1  
ATOM 2309   C CG  . LEU A 1 390 ? 46.337  48.699  -10.431 1.00 0.00 ? 390 LEU A CG  1  
ATOM 2310   C CD1 . LEU A 1 390 ? 47.056  49.429  -11.588 1.00 0.00 ? 390 LEU A CD1 1  
ATOM 2311   C CD2 . LEU A 1 390 ? 46.633  47.175  -10.491 1.00 0.00 ? 390 LEU A CD2 1  
ATOM 2312   N N   . GLU A 1 391 ? 45.944  50.690  -6.340  1.00 0.00 ? 391 GLU A N   1  
ATOM 2313   C CA  . GLU A 1 391 ? 46.346  51.361  -5.156  1.00 0.00 ? 391 GLU A CA  1  
ATOM 2314   C C   . GLU A 1 391 ? 45.775  50.717  -3.935  1.00 0.00 ? 391 GLU A C   1  
ATOM 2315   O O   . GLU A 1 391 ? 46.486  50.502  -2.950  1.00 0.00 ? 391 GLU A O   1  
ATOM 2316   C CB  . GLU A 1 391 ? 45.892  52.852  -5.161  1.00 0.00 ? 391 GLU A CB  1  
ATOM 2317   C CG  . GLU A 1 391 ? 46.192  53.606  -3.785  1.00 0.00 ? 391 GLU A CG  1  
ATOM 2318   C CD  . GLU A 1 391 ? 47.691  53.620  -3.389  1.00 0.00 ? 391 GLU A CD  1  
ATOM 2319   O OE1 . GLU A 1 391 ? 48.469  54.107  -4.228  1.00 0.00 ? 391 GLU A OE1 1  
ATOM 2320   O OE2 . GLU A 1 391 ? 47.967  53.159  -2.272  1.00 0.00 ? 391 GLU A OE2 1  
ATOM 2321   N N   . LEU A 1 392 ? 44.513  50.247  -4.025  1.00 0.00 ? 392 LEU A N   1  
ATOM 2322   C CA  . LEU A 1 392 ? 43.798  49.472  -3.020  1.00 0.00 ? 392 LEU A CA  1  
ATOM 2323   C C   . LEU A 1 392 ? 44.554  48.186  -2.731  1.00 0.00 ? 392 LEU A C   1  
ATOM 2324   O O   . LEU A 1 392 ? 44.741  47.814  -1.541  1.00 0.00 ? 392 LEU A O   1  
ATOM 2325   C CB  . LEU A 1 392 ? 42.311  49.089  -3.334  1.00 0.00 ? 392 LEU A CB  1  
ATOM 2326   C CG  . LEU A 1 392 ? 41.339  50.354  -3.372  1.00 0.00 ? 392 LEU A CG  1  
ATOM 2327   C CD1 . LEU A 1 392 ? 39.981  49.973  -3.863  1.00 0.00 ? 392 LEU A CD1 1  
ATOM 2328   C CD2 . LEU A 1 392 ? 41.314  50.980  -1.991  1.00 0.00 ? 392 LEU A CD2 1  
ATOM 2329   N N   . TYR A 1 393 ? 45.076  47.467  -3.749  1.00 0.00 ? 393 TYR A N   1  
ATOM 2330   C CA  . TYR A 1 393 ? 45.810  46.279  -3.528  1.00 0.00 ? 393 TYR A CA  1  
ATOM 2331   C C   . TYR A 1 393 ? 47.065  46.555  -2.769  1.00 0.00 ? 393 TYR A C   1  
ATOM 2332   O O   . TYR A 1 393 ? 47.379  45.847  -1.817  1.00 0.00 ? 393 TYR A O   1  
ATOM 2333   C CB  . TYR A 1 393 ? 46.119  45.503  -4.844  1.00 0.00 ? 393 TYR A CB  1  
ATOM 2334   C CG  . TYR A 1 393 ? 47.049  44.304  -4.645  1.00 0.00 ? 393 TYR A CG  1  
ATOM 2335   C CD1 . TYR A 1 393 ? 46.557  43.224  -3.932  1.00 0.00 ? 393 TYR A CD1 1  
ATOM 2336   C CD2 . TYR A 1 393 ? 48.301  44.266  -5.309  1.00 0.00 ? 393 TYR A CD2 1  
ATOM 2337   C CE1 . TYR A 1 393 ? 47.342  42.062  -3.948  1.00 0.00 ? 393 TYR A CE1 1  
ATOM 2338   C CE2 . TYR A 1 393 ? 48.998  43.070  -5.284  1.00 0.00 ? 393 TYR A CE2 1  
ATOM 2339   C CZ  . TYR A 1 393 ? 48.617  42.042  -4.525  1.00 0.00 ? 393 TYR A CZ  1  
ATOM 2340   O OH  . TYR A 1 393 ? 49.402  40.885  -4.399  1.00 0.00 ? 393 TYR A OH  1  
ATOM 2341   N N   . VAL A 1 394 ? 47.865  47.563  -3.136  1.00 0.00 ? 394 VAL A N   1  
ATOM 2342   C CA  . VAL A 1 394 ? 49.160  47.720  -2.467  1.00 0.00 ? 394 VAL A CA  1  
ATOM 2343   C C   . VAL A 1 394 ? 48.969  48.111  -0.986  1.00 0.00 ? 394 VAL A C   1  
ATOM 2344   O O   . VAL A 1 394 ? 49.648  47.547  -0.124  1.00 0.00 ? 394 VAL A O   1  
ATOM 2345   C CB  . VAL A 1 394 ? 50.162  48.558  -3.190  1.00 0.00 ? 394 VAL A CB  1  
ATOM 2346   C CG1 . VAL A 1 394 ? 50.774  47.986  -4.484  1.00 0.00 ? 394 VAL A CG1 1  
ATOM 2347   C CG2 . VAL A 1 394 ? 49.638  49.979  -3.528  1.00 0.00 ? 394 VAL A CG2 1  
ATOM 2348   N N   . ASP A 1 395 ? 47.969  49.077  -0.693  1.00 0.00 ? 395 ASP A N   1  
ATOM 2349   C CA  . ASP A 1 395 ? 47.854  49.572  0.717   1.00 0.00 ? 395 ASP A CA  1  
ATOM 2350   C C   . ASP A 1 395 ? 47.494  48.451  1.682   1.00 0.00 ? 395 ASP A C   1  
ATOM 2351   O O   . ASP A 1 395 ? 48.111  48.454  2.779   1.00 0.00 ? 395 ASP A O   1  
ATOM 2352   C CB  . ASP A 1 395 ? 46.932  50.798  0.938   1.00 0.00 ? 395 ASP A CB  1  
ATOM 2353   C CG  . ASP A 1 395 ? 45.582  50.700  0.155   1.00 0.00 ? 395 ASP A CG  1  
ATOM 2354   O OD1 . ASP A 1 395 ? 44.701  49.871  0.538   1.00 0.00 ? 395 ASP A OD1 1  
ATOM 2355   O OD2 . ASP A 1 395 ? 45.291  51.556  -0.686  1.00 0.00 ? 395 ASP A OD2 1  
ATOM 2356   N N   . LYS A 1 396 ? 46.697  47.446  1.358   1.00 0.00 ? 396 LYS A N   1  
ATOM 2357   C CA  . LYS A 1 396 ? 46.354  46.252  2.107   1.00 0.00 ? 396 LYS A CA  1  
ATOM 2358   C C   . LYS A 1 396 ? 47.562  45.376  2.313   1.00 0.00 ? 396 LYS A C   1  
ATOM 2359   O O   . LYS A 1 396 ? 47.744  44.837  3.420   1.00 0.00 ? 396 LYS A O   1  
ATOM 2360   C CB  . LYS A 1 396 ? 45.142  45.493  1.594   1.00 0.00 ? 396 LYS A CB  1  
ATOM 2361   C CG  . LYS A 1 396 ? 43.813  46.262  1.287   1.00 0.00 ? 396 LYS A CG  1  
ATOM 2362   C CD  . LYS A 1 396 ? 42.701  45.364  0.844   1.00 0.00 ? 396 LYS A CD  1  
ATOM 2363   C CE  . LYS A 1 396 ? 41.416  46.189  0.678   1.00 0.00 ? 396 LYS A CE  1  
ATOM 2364   N NZ  . LYS A 1 396 ? 41.516  47.071  -0.529  1.00 0.00 ? 396 LYS A NZ  1  
ATOM 2365   N N   . CYS A 1 397 ? 48.368  45.136  1.256   1.00 0.00 ? 397 CYS A N   1  
ATOM 2366   C CA  . CYS A 1 397 ? 49.543  44.259  1.289   1.00 0.00 ? 397 CYS A CA  1  
ATOM 2367   C C   . CYS A 1 397 ? 50.602  44.839  2.212   1.00 0.00 ? 397 CYS A C   1  
ATOM 2368   O O   . CYS A 1 397 ? 51.310  44.152  2.959   1.00 0.00 ? 397 CYS A O   1  
ATOM 2369   C CB  . CYS A 1 397 ? 50.163  43.947  -0.076  1.00 0.00 ? 397 CYS A CB  1  
ATOM 2370   S SG  . CYS A 1 397 ? 49.293  42.767  -1.045  1.00 0.00 ? 397 CYS A SG  1  
ATOM 2371   N N   . TYR A 1 398 ? 50.690  46.194  2.118   1.00 0.00 ? 398 TYR A N   1  
ATOM 2372   C CA  . TYR A 1 398 ? 51.586  47.091  2.801   1.00 0.00 ? 398 TYR A CA  1  
ATOM 2373   C C   . TYR A 1 398 ? 51.282  46.970  4.261   1.00 0.00 ? 398 TYR A C   1  
ATOM 2374   O O   . TYR A 1 398 ? 52.185  46.751  5.031   1.00 0.00 ? 398 TYR A O   1  
ATOM 2375   C CB  . TYR A 1 398 ? 51.320  48.599  2.379   1.00 0.00 ? 398 TYR A CB  1  
ATOM 2376   C CG  . TYR A 1 398 ? 52.456  49.526  2.773   1.00 0.00 ? 398 TYR A CG  1  
ATOM 2377   C CD1 . TYR A 1 398 ? 53.794  49.148  2.562   1.00 0.00 ? 398 TYR A CD1 1  
ATOM 2378   C CD2 . TYR A 1 398 ? 52.293  50.727  3.346   1.00 0.00 ? 398 TYR A CD2 1  
ATOM 2379   C CE1 . TYR A 1 398 ? 54.869  50.084  2.798   1.00 0.00 ? 398 TYR A CE1 1  
ATOM 2380   C CE2 . TYR A 1 398 ? 53.317  51.625  3.640   1.00 0.00 ? 398 TYR A CE2 1  
ATOM 2381   C CZ  . TYR A 1 398 ? 54.636  51.313  3.399   1.00 0.00 ? 398 TYR A CZ  1  
ATOM 2382   O OH  . TYR A 1 398 ? 55.670  52.107  3.915   1.00 0.00 ? 398 TYR A OH  1  
ATOM 2383   N N   . SER A 1 399 ? 49.979  47.073  4.652   1.00 0.00 ? 399 SER A N   1  
ATOM 2384   C CA  . SER A 1 399 ? 49.645  47.044  6.059   1.00 0.00 ? 399 SER A CA  1  
ATOM 2385   C C   . SER A 1 399 ? 50.027  45.834  6.734   1.00 0.00 ? 399 SER A C   1  
ATOM 2386   O O   . SER A 1 399 ? 50.565  45.812  7.837   1.00 0.00 ? 399 SER A O   1  
ATOM 2387   C CB  . SER A 1 399 ? 48.101  47.166  6.378   1.00 0.00 ? 399 SER A CB  1  
ATOM 2388   O OG  . SER A 1 399 ? 47.612  48.307  5.702   1.00 0.00 ? 399 SER A OG  1  
ATOM 2389   N N   . ARG A 1 400 ? 49.746  44.664  6.052   1.00 0.00 ? 400 ARG A N   1  
ATOM 2390   C CA  . ARG A 1 400 ? 49.899  43.279  6.518   1.00 0.00 ? 400 ARG A CA  1  
ATOM 2391   C C   . ARG A 1 400 ? 51.389  43.099  6.816   1.00 0.00 ? 400 ARG A C   1  
ATOM 2392   O O   . ARG A 1 400 ? 51.875  42.608  7.896   1.00 0.00 ? 400 ARG A O   1  
ATOM 2393   C CB  . ARG A 1 400 ? 49.504  42.247  5.424   1.00 0.00 ? 400 ARG A CB  1  
ATOM 2394   C CG  . ARG A 1 400 ? 48.021  41.770  5.387   1.00 0.00 ? 400 ARG A CG  1  
ATOM 2395   C CD  . ARG A 1 400 ? 47.013  42.809  5.737   1.00 0.00 ? 400 ARG A CD  1  
ATOM 2396   N NE  . ARG A 1 400 ? 45.663  42.481  5.240   1.00 0.00 ? 400 ARG A NE  1  
ATOM 2397   C CZ  . ARG A 1 400 ? 44.703  43.398  4.899   1.00 0.00 ? 400 ARG A CZ  1  
ATOM 2398   N NH1 . ARG A 1 400 ? 44.743  44.592  5.388   1.00 0.00 ? 400 ARG A NH1 1  
ATOM 2399   N NH2 . ARG A 1 400 ? 43.694  42.995  4.043   1.00 0.00 ? 400 ARG A NH2 1  
ATOM 2400   N N   . ALA A 1 401 ? 52.259  43.548  5.854   1.00 0.00 ? 401 ALA A N   1  
ATOM 2401   C CA  . ALA A 1 401 ? 53.683  43.544  5.806   1.00 0.00 ? 401 ALA A CA  1  
ATOM 2402   C C   . ALA A 1 401 ? 54.180  44.455  6.947   1.00 0.00 ? 401 ALA A C   1  
ATOM 2403   O O   . ALA A 1 401 ? 55.252  44.115  7.524   1.00 0.00 ? 401 ALA A O   1  
ATOM 2404   C CB  . ALA A 1 401 ? 54.333  44.090  4.559   1.00 0.00 ? 401 ALA A CB  1  
ATOM 2405   N N   . ASN A 1 402 ? 53.594  45.645  7.292   1.00 0.00 ? 402 ASN A N   1  
ATOM 2406   C CA  . ASN A 1 402 ? 53.971  46.605  8.280   1.00 0.00 ? 402 ASN A CA  1  
ATOM 2407   C C   . ASN A 1 402 ? 53.765  46.023  9.657   1.00 0.00 ? 402 ASN A C   1  
ATOM 2408   O O   . ASN A 1 402 ? 54.676  46.097  10.418  1.00 0.00 ? 402 ASN A O   1  
ATOM 2409   C CB  . ASN A 1 402 ? 53.269  47.948  8.154   1.00 0.00 ? 402 ASN A CB  1  
ATOM 2410   C CG  . ASN A 1 402 ? 53.651  48.709  6.903   1.00 0.00 ? 402 ASN A CG  1  
ATOM 2411   O OD1 . ASN A 1 402 ? 52.733  49.317  6.298   1.00 0.00 ? 402 ASN A OD1 1  
ATOM 2412   N ND2 . ASN A 1 402 ? 54.916  48.607  6.424   1.00 0.00 ? 402 ASN A ND2 1  
ATOM 2413   N N   . GLU A 1 403 ? 52.611  45.443  9.916   1.00 0.00 ? 403 GLU A N   1  
ATOM 2414   C CA  . GLU A 1 403 ? 52.258  44.856  11.177  1.00 0.00 ? 403 GLU A CA  1  
ATOM 2415   C C   . GLU A 1 403 ? 53.118  43.635  11.529  1.00 0.00 ? 403 GLU A C   1  
ATOM 2416   O O   . GLU A 1 403 ? 53.565  43.603  12.666  1.00 0.00 ? 403 GLU A O   1  
ATOM 2417   C CB  . GLU A 1 403 ? 50.747  44.633  11.483  1.00 0.00 ? 403 GLU A CB  1  
ATOM 2418   C CG  . GLU A 1 403 ? 50.119  43.471  10.712  1.00 0.00 ? 403 GLU A CG  1  
ATOM 2419   C CD  . GLU A 1 403 ? 48.724  43.194  11.165  1.00 0.00 ? 403 GLU A CD  1  
ATOM 2420   O OE1 . GLU A 1 403 ? 47.808  43.929  10.741  1.00 0.00 ? 403 GLU A OE1 1  
ATOM 2421   O OE2 . GLU A 1 403 ? 48.560  42.208  11.904  1.00 0.00 ? 403 GLU A OE2 1  
ATOM 2422   N N   . ILE A 1 404 ? 53.385  42.687  10.570  1.00 0.00 ? 404 ILE A N   1  
ATOM 2423   C CA  . ILE A 1 404 ? 54.238  41.596  10.839  1.00 0.00 ? 404 ILE A CA  1  
ATOM 2424   C C   . ILE A 1 404 ? 55.671  41.930  11.108  1.00 0.00 ? 404 ILE A C   1  
ATOM 2425   O O   . ILE A 1 404 ? 56.352  41.309  11.940  1.00 0.00 ? 404 ILE A O   1  
ATOM 2426   C CB  . ILE A 1 404 ? 54.221  40.507  9.818   1.00 0.00 ? 404 ILE A CB  1  
ATOM 2427   C CG1 . ILE A 1 404 ? 54.681  39.093  10.330  1.00 0.00 ? 404 ILE A CG1 1  
ATOM 2428   C CG2 . ILE A 1 404 ? 54.849  40.856  8.476   1.00 0.00 ? 404 ILE A CG2 1  
ATOM 2429   C CD1 . ILE A 1 404 ? 54.651  37.996  9.253   1.00 0.00 ? 404 ILE A CD1 1  
ATOM 2430   N N   . PHE A 1 405 ? 56.156  43.004  10.411  1.00 0.00 ? 405 PHE A N   1  
ATOM 2431   C CA  . PHE A 1 405 ? 57.418  43.601  10.460  1.00 0.00 ? 405 PHE A CA  1  
ATOM 2432   C C   . PHE A 1 405 ? 57.654  44.124  11.890  1.00 0.00 ? 405 PHE A C   1  
ATOM 2433   O O   . PHE A 1 405 ? 58.735  43.839  12.536  1.00 0.00 ? 405 PHE A O   1  
ATOM 2434   C CB  . PHE A 1 405 ? 57.643  44.802  9.386   1.00 0.00 ? 405 PHE A CB  1  
ATOM 2435   C CG  . PHE A 1 405 ? 59.061  45.257  9.368   1.00 0.00 ? 405 PHE A CG  1  
ATOM 2436   C CD1 . PHE A 1 405 ? 59.956  44.328  8.739   1.00 0.00 ? 405 PHE A CD1 1  
ATOM 2437   C CD2 . PHE A 1 405 ? 59.507  46.551  9.627   1.00 0.00 ? 405 PHE A CD2 1  
ATOM 2438   C CE1 . PHE A 1 405 ? 61.219  44.764  8.383   1.00 0.00 ? 405 PHE A CE1 1  
ATOM 2439   C CE2 . PHE A 1 405 ? 60.799  47.009  9.244   1.00 0.00 ? 405 PHE A CE2 1  
ATOM 2440   C CZ  . PHE A 1 405 ? 61.653  46.108  8.586   1.00 0.00 ? 405 PHE A CZ  1  
ATOM 2441   N N   . LEU A 1 406 ? 56.590  44.806  12.360  1.00 0.00 ? 406 LEU A N   1  
ATOM 2442   C CA  . LEU A 1 406 ? 56.619  45.380  13.697  1.00 0.00 ? 406 LEU A CA  1  
ATOM 2443   C C   . LEU A 1 406 ? 56.741  44.344  14.738  1.00 0.00 ? 406 LEU A C   1  
ATOM 2444   O O   . LEU A 1 406 ? 57.606  44.403  15.646  1.00 0.00 ? 406 LEU A O   1  
ATOM 2445   C CB  . LEU A 1 406 ? 55.362  46.280  13.869  1.00 0.00 ? 406 LEU A CB  1  
ATOM 2446   C CG  . LEU A 1 406 ? 55.343  47.218  15.135  1.00 0.00 ? 406 LEU A CG  1  
ATOM 2447   C CD1 . LEU A 1 406 ? 55.923  48.614  14.838  1.00 0.00 ? 406 LEU A CD1 1  
ATOM 2448   C CD2 . LEU A 1 406 ? 53.878  47.337  15.722  1.00 0.00 ? 406 LEU A CD2 1  
ATOM 2449   N N   . LYS A 1 407 ? 55.897  43.330  14.558  1.00 0.00 ? 407 LYS A N   1  
ATOM 2450   C CA  . LYS A 1 407 ? 55.795  42.206  15.503  1.00 0.00 ? 407 LYS A CA  1  
ATOM 2451   C C   . LYS A 1 407 ? 57.156  41.482  15.595  1.00 0.00 ? 407 LYS A C   1  
ATOM 2452   O O   . LYS A 1 407 ? 57.506  41.285  16.760  1.00 0.00 ? 407 LYS A O   1  
ATOM 2453   C CB  . LYS A 1 407 ? 54.866  41.032  15.190  1.00 0.00 ? 407 LYS A CB  1  
ATOM 2454   C CG  . LYS A 1 407 ? 53.424  41.477  15.436  1.00 0.00 ? 407 LYS A CG  1  
ATOM 2455   C CD  . LYS A 1 407 ? 52.576  40.287  15.120  1.00 0.00 ? 407 LYS A CD  1  
ATOM 2456   C CE  . LYS A 1 407 ? 51.086  40.638  15.121  1.00 0.00 ? 407 LYS A CE  1  
ATOM 2457   N NZ  . LYS A 1 407 ? 50.761  41.787  14.134  1.00 0.00 ? 407 LYS A NZ  1  
ATOM 2458   N N   . LEU A 1 408 ? 57.880  41.240  14.465  1.00 0.00 ? 408 LEU A N   1  
ATOM 2459   C CA  . LEU A 1 408 ? 59.157  40.579  14.432  1.00 0.00 ? 408 LEU A CA  1  
ATOM 2460   C C   . LEU A 1 408 ? 60.090  41.317  15.300  1.00 0.00 ? 408 LEU A C   1  
ATOM 2461   O O   . LEU A 1 408 ? 60.855  40.650  15.994  1.00 0.00 ? 408 LEU A O   1  
ATOM 2462   C CB  . LEU A 1 408 ? 59.672  40.419  13.004  1.00 0.00 ? 408 LEU A CB  1  
ATOM 2463   C CG  . LEU A 1 408 ? 60.995  39.605  12.802  1.00 0.00 ? 408 LEU A CG  1  
ATOM 2464   C CD1 . LEU A 1 408 ? 62.262  40.466  12.941  1.00 0.00 ? 408 LEU A CD1 1  
ATOM 2465   C CD2 . LEU A 1 408 ? 61.030  38.322  13.680  1.00 0.00 ? 408 LEU A CD2 1  
ATOM 2466   N N   . PHE A 1 409 ? 60.122  42.592  15.182  1.00 0.00 ? 409 PHE A N   1  
ATOM 2467   C CA  . PHE A 1 409 ? 61.075  43.454  15.769  1.00 0.00 ? 409 PHE A CA  1  
ATOM 2468   C C   . PHE A 1 409 ? 60.884  43.586  17.243  1.00 0.00 ? 409 PHE A C   1  
ATOM 2469   O O   . PHE A 1 409 ? 61.868  43.455  17.968  1.00 0.00 ? 409 PHE A O   1  
ATOM 2470   C CB  . PHE A 1 409 ? 60.869  44.905  15.113  1.00 0.00 ? 409 PHE A CB  1  
ATOM 2471   C CG  . PHE A 1 409 ? 61.619  45.055  13.822  1.00 0.00 ? 409 PHE A CG  1  
ATOM 2472   C CD1 . PHE A 1 409 ? 62.504  44.081  13.213  1.00 0.00 ? 409 PHE A CD1 1  
ATOM 2473   C CD2 . PHE A 1 409 ? 61.533  46.303  13.195  1.00 0.00 ? 409 PHE A CD2 1  
ATOM 2474   C CE1 . PHE A 1 409 ? 63.224  44.436  12.033  1.00 0.00 ? 409 PHE A CE1 1  
ATOM 2475   C CE2 . PHE A 1 409 ? 62.328  46.640  12.073  1.00 0.00 ? 409 PHE A CE2 1  
ATOM 2476   C CZ  . PHE A 1 409 ? 63.119  45.687  11.489  1.00 0.00 ? 409 PHE A CZ  1  
ATOM 2477   N N   . PHE A 1 410 ? 59.648  43.898  17.704  1.00 0.00 ? 410 PHE A N   1  
ATOM 2478   C CA  . PHE A 1 410 ? 59.232  44.213  19.047  1.00 0.00 ? 410 PHE A CA  1  
ATOM 2479   C C   . PHE A 1 410 ? 59.385  42.955  19.872  1.00 0.00 ? 410 PHE A C   1  
ATOM 2480   O O   . PHE A 1 410 ? 59.991  43.070  20.959  1.00 0.00 ? 410 PHE A O   1  
ATOM 2481   C CB  . PHE A 1 410 ? 57.763  44.703  19.155  1.00 0.00 ? 410 PHE A CB  1  
ATOM 2482   C CG  . PHE A 1 410 ? 57.536  46.163  18.674  1.00 0.00 ? 410 PHE A CG  1  
ATOM 2483   C CD1 . PHE A 1 410 ? 58.454  46.964  17.950  1.00 0.00 ? 410 PHE A CD1 1  
ATOM 2484   C CD2 . PHE A 1 410 ? 56.404  46.808  19.222  1.00 0.00 ? 410 PHE A CD2 1  
ATOM 2485   C CE1 . PHE A 1 410 ? 58.118  48.265  17.639  1.00 0.00 ? 410 PHE A CE1 1  
ATOM 2486   C CE2 . PHE A 1 410 ? 56.074  48.124  18.889  1.00 0.00 ? 410 PHE A CE2 1  
ATOM 2487   C CZ  . PHE A 1 410 ? 56.993  48.879  18.115  1.00 0.00 ? 410 PHE A CZ  1  
ATOM 2488   N N   . GLN A 1 411 ? 58.780  41.864  19.429  1.00 0.00 ? 411 GLN A N   1  
ATOM 2489   C CA  . GLN A 1 411 ? 58.677  40.633  20.273  1.00 0.00 ? 411 GLN A CA  1  
ATOM 2490   C C   . GLN A 1 411 ? 60.017  40.008  20.256  1.00 0.00 ? 411 GLN A C   1  
ATOM 2491   O O   . GLN A 1 411 ? 60.491  39.622  21.298  1.00 0.00 ? 411 GLN A O   1  
ATOM 2492   C CB  . GLN A 1 411 ? 57.544  39.687  19.896  1.00 0.00 ? 411 GLN A CB  1  
ATOM 2493   C CG  . GLN A 1 411 ? 56.159  40.048  20.535  1.00 0.00 ? 411 GLN A CG  1  
ATOM 2494   C CD  . GLN A 1 411 ? 55.284  40.935  19.511  1.00 0.00 ? 411 GLN A CD  1  
ATOM 2495   O OE1 . GLN A 1 411 ? 54.297  40.384  19.036  1.00 0.00 ? 411 GLN A OE1 1  
ATOM 2496   N NE2 . GLN A 1 411 ? 55.664  42.224  19.333  1.00 0.00 ? 411 GLN A NE2 1  
ATOM 2497   N N   . GLY A 1 412 ? 60.583  39.728  19.013  1.00 0.00 ? 412 GLY A N   1  
ATOM 2498   C CA  . GLY A 1 412 ? 61.762  38.787  18.916  1.00 0.00 ? 412 GLY A CA  1  
ATOM 2499   C C   . GLY A 1 412 ? 63.082  39.310  19.308  1.00 0.00 ? 412 GLY A C   1  
ATOM 2500   O O   . GLY A 1 412 ? 63.755  38.597  20.008  1.00 0.00 ? 412 GLY A O   1  
ATOM 2501   N N   . TYR A 1 413 ? 63.511  40.530  18.772  1.00 0.00 ? 413 TYR A N   1  
ATOM 2502   C CA  . TYR A 1 413 ? 64.802  41.096  18.977  1.00 0.00 ? 413 TYR A CA  1  
ATOM 2503   C C   . TYR A 1 413 ? 64.766  42.124  20.116  1.00 0.00 ? 413 TYR A C   1  
ATOM 2504   O O   . TYR A 1 413 ? 65.823  42.386  20.685  1.00 0.00 ? 413 TYR A O   1  
ATOM 2505   C CB  . TYR A 1 413 ? 65.518  41.698  17.691  1.00 0.00 ? 413 TYR A CB  1  
ATOM 2506   C CG  . TYR A 1 413 ? 65.982  40.592  16.923  1.00 0.00 ? 413 TYR A CG  1  
ATOM 2507   C CD1 . TYR A 1 413 ? 67.110  39.885  17.248  1.00 0.00 ? 413 TYR A CD1 1  
ATOM 2508   C CD2 . TYR A 1 413 ? 65.096  40.014  15.959  1.00 0.00 ? 413 TYR A CD2 1  
ATOM 2509   C CE1 . TYR A 1 413 ? 67.533  38.775  16.459  1.00 0.00 ? 413 TYR A CE1 1  
ATOM 2510   C CE2 . TYR A 1 413 ? 65.532  38.962  15.076  1.00 0.00 ? 413 TYR A CE2 1  
ATOM 2511   C CZ  . TYR A 1 413 ? 66.709  38.254  15.439  1.00 0.00 ? 413 TYR A CZ  1  
ATOM 2512   O OH  . TYR A 1 413 ? 67.206  37.244  14.642  1.00 0.00 ? 413 TYR A OH  1  
ATOM 2513   N N   . ASP A 1 414 ? 63.568  42.768  20.324  1.00 0.00 ? 414 ASP A N   1  
ATOM 2514   C CA  . ASP A 1 414 ? 63.512  43.949  21.138  1.00 0.00 ? 414 ASP A CA  1  
ATOM 2515   C C   . ASP A 1 414 ? 64.248  45.094  20.446  1.00 0.00 ? 414 ASP A C   1  
ATOM 2516   O O   . ASP A 1 414 ? 65.121  45.672  21.070  1.00 0.00 ? 414 ASP A O   1  
ATOM 2517   C CB  . ASP A 1 414 ? 63.912  43.741  22.631  1.00 0.00 ? 414 ASP A CB  1  
ATOM 2518   C CG  . ASP A 1 414 ? 63.161  42.656  23.277  1.00 0.00 ? 414 ASP A CG  1  
ATOM 2519   O OD1 . ASP A 1 414 ? 61.916  42.713  23.423  1.00 0.00 ? 414 ASP A OD1 1  
ATOM 2520   O OD2 . ASP A 1 414 ? 63.849  41.758  23.793  1.00 0.00 ? 414 ASP A OD2 1  
ATOM 2521   N N   . LEU A 1 415 ? 63.885  45.495  19.220  1.00 0.00 ? 415 LEU A N   1  
ATOM 2522   C CA  . LEU A 1 415 ? 64.376  46.559  18.352  1.00 0.00 ? 415 LEU A CA  1  
ATOM 2523   C C   . LEU A 1 415 ? 64.279  47.864  19.011  1.00 0.00 ? 415 LEU A C   1  
ATOM 2524   O O   . LEU A 1 415 ? 65.305  48.581  19.029  1.00 0.00 ? 415 LEU A O   1  
ATOM 2525   C CB  . LEU A 1 415 ? 63.538  46.621  17.113  1.00 0.00 ? 415 LEU A CB  1  
ATOM 2526   C CG  . LEU A 1 415 ? 64.126  47.199  15.833  1.00 0.00 ? 415 LEU A CG  1  
ATOM 2527   C CD1 . LEU A 1 415 ? 64.588  48.643  15.895  1.00 0.00 ? 415 LEU A CD1 1  
ATOM 2528   C CD2 . LEU A 1 415 ? 65.324  46.310  15.310  1.00 0.00 ? 415 LEU A CD2 1  
ATOM 2529   N N   . ILE A 1 416 ? 63.142  48.182  19.593  1.00 0.00 ? 416 ILE A N   1  
ATOM 2530   C CA  . ILE A 1 416 ? 62.875  49.491  20.159  1.00 0.00 ? 416 ILE A CA  1  
ATOM 2531   C C   . ILE A 1 416 ? 63.811  49.899  21.311  1.00 0.00 ? 416 ILE A C   1  
ATOM 2532   O O   . ILE A 1 416 ? 64.283  51.004  21.351  1.00 0.00 ? 416 ILE A O   1  
ATOM 2533   C CB  . ILE A 1 416 ? 61.366  49.488  20.564  1.00 0.00 ? 416 ILE A CB  1  
ATOM 2534   C CG1 . ILE A 1 416 ? 61.025  48.388  21.601  1.00 0.00 ? 416 ILE A CG1 1  
ATOM 2535   C CG2 . ILE A 1 416 ? 60.552  49.321  19.301  1.00 0.00 ? 416 ILE A CG2 1  
ATOM 2536   C CD1 . ILE A 1 416 ? 59.546  48.358  22.020  1.00 0.00 ? 416 ILE A CD1 1  
ATOM 2537   N N   . ASN A 1 417 ? 64.104  48.955  22.166  1.00 0.00 ? 417 ASN A N   1  
ATOM 2538   C CA  . ASN A 1 417 ? 65.093  49.259  23.189  1.00 0.00 ? 417 ASN A CA  1  
ATOM 2539   C C   . ASN A 1 417 ? 66.463  49.534  22.643  1.00 0.00 ? 417 ASN A C   1  
ATOM 2540   O O   . ASN A 1 417 ? 67.147  50.480  23.032  1.00 0.00 ? 417 ASN A O   1  
ATOM 2541   C CB  . ASN A 1 417 ? 65.190  48.130  24.252  1.00 0.00 ? 417 ASN A CB  1  
ATOM 2542   C CG  . ASN A 1 417 ? 63.847  47.715  24.884  1.00 0.00 ? 417 ASN A CG  1  
ATOM 2543   O OD1 . ASN A 1 417 ? 63.065  47.037  24.262  1.00 0.00 ? 417 ASN A OD1 1  
ATOM 2544   N ND2 . ASN A 1 417 ? 63.545  48.248  26.070  1.00 0.00 ? 417 ASN A ND2 1  
ATOM 2545   N N   . VAL A 1 418 ? 66.867  48.770  21.621  1.00 0.00 ? 418 VAL A N   1  
ATOM 2546   C CA  . VAL A 1 418 ? 68.133  48.912  20.910  1.00 0.00 ? 418 VAL A CA  1  
ATOM 2547   C C   . VAL A 1 418 ? 68.151  50.238  20.214  1.00 0.00 ? 418 VAL A C   1  
ATOM 2548   O O   . VAL A 1 418 ? 69.232  50.866  20.190  1.00 0.00 ? 418 VAL A O   1  
ATOM 2549   C CB  . VAL A 1 418 ? 68.294  47.734  19.860  1.00 0.00 ? 418 VAL A CB  1  
ATOM 2550   C CG1 . VAL A 1 418 ? 69.480  47.851  18.798  1.00 0.00 ? 418 VAL A CG1 1  
ATOM 2551   C CG2 . VAL A 1 418 ? 68.499  46.501  20.718  1.00 0.00 ? 418 VAL A CG2 1  
ATOM 2552   N N   . LEU A 1 419 ? 67.025  50.701  19.679  1.00 0.00 ? 419 LEU A N   1  
ATOM 2553   C CA  . LEU A 1 419 ? 66.807  51.985  18.962  1.00 0.00 ? 419 LEU A CA  1  
ATOM 2554   C C   . LEU A 1 419 ? 67.071  53.148  19.843  1.00 0.00 ? 419 LEU A C   1  
ATOM 2555   O O   . LEU A 1 419 ? 67.837  54.064  19.483  1.00 0.00 ? 419 LEU A O   1  
ATOM 2556   C CB  . LEU A 1 419 ? 65.391  52.074  18.294  1.00 0.00 ? 419 LEU A CB  1  
ATOM 2557   C CG  . LEU A 1 419 ? 65.031  53.296  17.403  1.00 0.00 ? 419 LEU A CG  1  
ATOM 2558   C CD1 . LEU A 1 419 ? 65.892  53.074  16.110  1.00 0.00 ? 419 LEU A CD1 1  
ATOM 2559   C CD2 . LEU A 1 419 ? 63.495  53.265  16.982  1.00 0.00 ? 419 LEU A CD2 1  
ATOM 2560   N N   . LYS A 1 420 ? 66.573  52.997  21.081  1.00 0.00 ? 420 LYS A N   1  
ATOM 2561   C CA  . LYS A 1 420 ? 66.768  54.002  22.101  1.00 0.00 ? 420 LYS A CA  1  
ATOM 2562   C C   . LYS A 1 420 ? 68.221  54.209  22.441  1.00 0.00 ? 420 LYS A C   1  
ATOM 2563   O O   . LYS A 1 420 ? 68.643  55.360  22.547  1.00 0.00 ? 420 LYS A O   1  
ATOM 2564   C CB  . LYS A 1 420 ? 65.800  53.785  23.368  1.00 0.00 ? 420 LYS A CB  1  
ATOM 2565   C CG  . LYS A 1 420 ? 64.323  54.106  23.014  1.00 0.00 ? 420 LYS A CG  1  
ATOM 2566   C CD  . LYS A 1 420 ? 63.389  53.984  24.228  1.00 0.00 ? 420 LYS A CD  1  
ATOM 2567   C CE  . LYS A 1 420 ? 62.765  52.625  24.468  1.00 0.00 ? 420 LYS A CE  1  
ATOM 2568   N NZ  . LYS A 1 420 ? 62.042  52.062  23.305  1.00 0.00 ? 420 LYS A NZ  1  
ATOM 2569   N N   . HIS A 1 421 ? 69.016  53.125  22.552  1.00 0.00 ? 421 HIS A N   1  
ATOM 2570   C CA  . HIS A 1 421 ? 70.408  53.026  22.846  1.00 0.00 ? 421 HIS A CA  1  
ATOM 2571   C C   . HIS A 1 421 ? 71.261  53.662  21.788  1.00 0.00 ? 421 HIS A C   1  
ATOM 2572   O O   . HIS A 1 421 ? 72.305  54.318  22.046  1.00 0.00 ? 421 HIS A O   1  
ATOM 2573   C CB  . HIS A 1 421 ? 70.777  51.556  23.006  1.00 0.00 ? 421 HIS A CB  1  
ATOM 2574   C CG  . HIS A 1 421 ? 69.899  50.786  23.895  1.00 0.00 ? 421 HIS A CG  1  
ATOM 2575   N ND1 . HIS A 1 421 ? 69.853  49.379  23.821  1.00 0.00 ? 421 HIS A ND1 1  
ATOM 2576   C CD2 . HIS A 1 421 ? 69.086  51.092  24.936  1.00 0.00 ? 421 HIS A CD2 1  
ATOM 2577   C CE1 . HIS A 1 421 ? 69.007  48.910  24.778  1.00 0.00 ? 421 HIS A CE1 1  
ATOM 2578   N NE2 . HIS A 1 421 ? 68.524  49.917  25.507  1.00 0.00 ? 421 HIS A NE2 1  
ATOM 2579   N N   . LEU A 1 422 ? 70.814  53.518  20.507  1.00 0.00 ? 422 LEU A N   1  
ATOM 2580   C CA  . LEU A 1 422 ? 71.480  54.077  19.348  1.00 0.00 ? 422 LEU A CA  1  
ATOM 2581   C C   . LEU A 1 422 ? 71.460  55.529  19.386  1.00 0.00 ? 422 LEU A C   1  
ATOM 2582   O O   . LEU A 1 422 ? 72.520  56.139  19.285  1.00 0.00 ? 422 LEU A O   1  
ATOM 2583   C CB  . LEU A 1 422 ? 70.797  53.585  18.072  1.00 0.00 ? 422 LEU A CB  1  
ATOM 2584   C CG  . LEU A 1 422 ? 71.301  53.949  16.568  1.00 0.00 ? 422 LEU A CG  1  
ATOM 2585   C CD1 . LEU A 1 422 ? 71.555  55.490  16.234  1.00 0.00 ? 422 LEU A CD1 1  
ATOM 2586   C CD2 . LEU A 1 422 ? 72.544  53.121  16.187  1.00 0.00 ? 422 LEU A CD2 1  
ATOM 2587   N N   . GLN A 1 423 ? 70.318  56.156  19.727  1.00 0.00 ? 423 GLN A N   1  
ATOM 2588   C CA  . GLN A 1 423 ? 70.287  57.588  19.916  1.00 0.00 ? 423 GLN A CA  1  
ATOM 2589   C C   . GLN A 1 423 ? 71.132  58.082  21.103  1.00 0.00 ? 423 GLN A C   1  
ATOM 2590   O O   . GLN A 1 423 ? 71.830  59.096  20.972  1.00 0.00 ? 423 GLN A O   1  
ATOM 2591   C CB  . GLN A 1 423 ? 68.830  57.927  20.233  1.00 0.00 ? 423 GLN A CB  1  
ATOM 2592   C CG  . GLN A 1 423 ? 67.821  57.449  19.132  1.00 0.00 ? 423 GLN A CG  1  
ATOM 2593   C CD  . GLN A 1 423 ? 66.398  57.586  19.527  1.00 0.00 ? 423 GLN A CD  1  
ATOM 2594   O OE1 . GLN A 1 423 ? 65.724  56.654  19.958  1.00 0.00 ? 423 GLN A OE1 1  
ATOM 2595   N NE2 . GLN A 1 423 ? 65.921  58.905  19.501  1.00 0.00 ? 423 GLN A NE2 1  
ATOM 2596   N N   . GLN A 1 424 ? 71.095  57.313  22.215  1.00 0.00 ? 424 GLN A N   1  
ATOM 2597   C CA  . GLN A 1 424 ? 71.786  57.647  23.418  1.00 0.00 ? 424 GLN A CA  1  
ATOM 2598   C C   . GLN A 1 424 ? 73.346  57.714  23.314  1.00 0.00 ? 424 GLN A C   1  
ATOM 2599   O O   . GLN A 1 424 ? 74.008  58.719  23.604  1.00 0.00 ? 424 GLN A O   1  
ATOM 2600   C CB  . GLN A 1 424 ? 71.412  56.619  24.556  1.00 0.00 ? 424 GLN A CB  1  
ATOM 2601   C CG  . GLN A 1 424 ? 69.979  56.937  25.089  1.00 0.00 ? 424 GLN A CG  1  
ATOM 2602   C CD  . GLN A 1 424 ? 69.441  55.912  26.065  1.00 0.00 ? 424 GLN A CD  1  
ATOM 2603   O OE1 . GLN A 1 424 ? 69.704  56.196  27.257  1.00 0.00 ? 424 GLN A OE1 1  
ATOM 2604   N NE2 . GLN A 1 424 ? 68.759  54.839  25.638  1.00 0.00 ? 424 GLN A NE2 1  
ATOM 2605   N N   . ILE A 1 425 ? 73.952  56.575  22.841  1.00 0.00 ? 425 ILE A N   1  
ATOM 2606   C CA  . ILE A 1 425 ? 75.338  56.541  22.690  1.00 0.00 ? 425 ILE A CA  1  
ATOM 2607   C C   . ILE A 1 425 ? 75.849  57.245  21.481  1.00 0.00 ? 425 ILE A C   1  
ATOM 2608   O O   . ILE A 1 425 ? 76.718  58.083  21.609  1.00 0.00 ? 425 ILE A O   1  
ATOM 2609   C CB  . ILE A 1 425 ? 75.735  55.085  22.669  1.00 0.00 ? 425 ILE A CB  1  
ATOM 2610   C CG1 . ILE A 1 425 ? 75.129  54.313  23.868  1.00 0.00 ? 425 ILE A CG1 1  
ATOM 2611   C CG2 . ILE A 1 425 ? 77.297  54.886  22.652  1.00 0.00 ? 425 ILE A CG2 1  
ATOM 2612   C CD1 . ILE A 1 425 ? 75.499  52.820  23.903  1.00 0.00 ? 425 ILE A CD1 1  
ATOM 2613   N N   . PHE A 1 426 ? 75.353  56.808  20.319  1.00 0.00 ? 426 PHE A N   1  
ATOM 2614   C CA  . PHE A 1 426 ? 75.909  57.142  18.990  1.00 0.00 ? 426 PHE A CA  1  
ATOM 2615   C C   . PHE A 1 426 ? 75.750  58.579  18.634  1.00 0.00 ? 426 PHE A C   1  
ATOM 2616   O O   . PHE A 1 426 ? 76.696  59.215  18.196  1.00 0.00 ? 426 PHE A O   1  
ATOM 2617   C CB  . PHE A 1 426 ? 75.564  56.071  17.892  1.00 0.00 ? 426 PHE A CB  1  
ATOM 2618   C CG  . PHE A 1 426 ? 76.282  56.104  16.556  1.00 0.00 ? 426 PHE A CG  1  
ATOM 2619   C CD1 . PHE A 1 426 ? 77.651  56.361  16.514  1.00 0.00 ? 426 PHE A CD1 1  
ATOM 2620   C CD2 . PHE A 1 426 ? 75.572  55.936  15.347  1.00 0.00 ? 426 PHE A CD2 1  
ATOM 2621   C CE1 . PHE A 1 426 ? 78.333  56.349  15.248  1.00 0.00 ? 426 PHE A CE1 1  
ATOM 2622   C CE2 . PHE A 1 426 ? 76.254  55.894  14.112  1.00 0.00 ? 426 PHE A CE2 1  
ATOM 2623   C CZ  . PHE A 1 426 ? 77.584  56.126  14.055  1.00 0.00 ? 426 PHE A CZ  1  
ATOM 2624   N N   . LEU A 1 427 ? 74.539  59.111  18.834  1.00 0.00 ? 427 LEU A N   1  
ATOM 2625   C CA  . LEU A 1 427 ? 74.213  60.512  18.520  1.00 0.00 ? 427 LEU A CA  1  
ATOM 2626   C C   . LEU A 1 427 ? 74.875  61.569  19.419  1.00 0.00 ? 427 LEU A C   1  
ATOM 2627   O O   . LEU A 1 427 ? 75.187  62.680  18.951  1.00 0.00 ? 427 LEU A O   1  
ATOM 2628   C CB  . LEU A 1 427 ? 72.638  60.861  18.538  1.00 0.00 ? 427 LEU A CB  1  
ATOM 2629   C CG  . LEU A 1 427 ? 72.126  61.464  17.211  1.00 0.00 ? 427 LEU A CG  1  
ATOM 2630   C CD1 . LEU A 1 427 ? 70.571  61.373  16.936  1.00 0.00 ? 427 LEU A CD1 1  
ATOM 2631   C CD2 . LEU A 1 427 ? 72.675  62.868  16.895  1.00 0.00 ? 427 LEU A CD2 1  
ATOM 2632   N N   . GLY A 1 428 ? 75.123  61.185  20.715  1.00 0.00 ? 428 GLY A N   1  
ATOM 2633   C CA  . GLY A 1 428 ? 76.029  61.916  21.576  1.00 0.00 ? 428 GLY A CA  1  
ATOM 2634   C C   . GLY A 1 428 ? 75.205  62.488  22.544  1.00 0.00 ? 428 GLY A C   1  
ATOM 2635   O O   . GLY A 1 428 ? 75.544  63.530  23.009  1.00 0.00 ? 428 GLY A O   1  
ATOM 2636   N N   . TYR A 1 429 ? 74.026  61.941  22.875  1.00 0.00 ? 429 TYR A N   1  
ATOM 2637   C CA  . TYR A 1 429 ? 73.015  62.408  23.793  1.00 0.00 ? 429 TYR A CA  1  
ATOM 2638   C C   . TYR A 1 429 ? 73.257  62.224  25.257  1.00 0.00 ? 429 TYR A C   1  
ATOM 2639   O O   . TYR A 1 429 ? 72.913  63.085  26.045  1.00 0.00 ? 429 TYR A O   1  
ATOM 2640   C CB  . TYR A 1 429 ? 71.749  61.607  23.481  1.00 0.00 ? 429 TYR A CB  1  
ATOM 2641   C CG  . TYR A 1 429 ? 70.487  62.078  24.285  1.00 0.00 ? 429 TYR A CG  1  
ATOM 2642   C CD1 . TYR A 1 429 ? 70.180  63.405  24.459  1.00 0.00 ? 429 TYR A CD1 1  
ATOM 2643   C CD2 . TYR A 1 429 ? 69.661  61.068  24.795  1.00 0.00 ? 429 TYR A CD2 1  
ATOM 2644   C CE1 . TYR A 1 429 ? 69.156  63.673  25.410  1.00 0.00 ? 429 TYR A CE1 1  
ATOM 2645   C CE2 . TYR A 1 429 ? 68.658  61.346  25.715  1.00 0.00 ? 429 TYR A CE2 1  
ATOM 2646   C CZ  . TYR A 1 429 ? 68.369  62.669  26.070  1.00 0.00 ? 429 TYR A CZ  1  
ATOM 2647   O OH  . TYR A 1 429 ? 67.519  62.955  27.116  1.00 0.00 ? 429 TYR A OH  1  
ATOM 2648   N N   . GLN A 1 430 ? 73.829  61.081  25.689  1.00 0.00 ? 430 GLN A N   1  
ATOM 2649   C CA  . GLN A 1 430 ? 73.956  60.860  27.098  1.00 0.00 ? 430 GLN A CA  1  
ATOM 2650   C C   . GLN A 1 430 ? 74.971  59.843  27.583  1.00 0.00 ? 430 GLN A C   1  
ATOM 2651   O O   . GLN A 1 430 ? 74.995  59.459  28.752  1.00 0.00 ? 430 GLN A O   1  
ATOM 2652   C CB  . GLN A 1 430 ? 72.638  60.472  27.748  1.00 0.00 ? 430 GLN A CB  1  
ATOM 2653   C CG  . GLN A 1 430 ? 71.785  59.272  27.241  1.00 0.00 ? 430 GLN A CG  1  
ATOM 2654   C CD  . GLN A 1 430 ? 72.214  58.077  28.034  1.00 0.00 ? 430 GLN A CD  1  
ATOM 2655   O OE1 . GLN A 1 430 ? 73.026  57.210  27.679  1.00 0.00 ? 430 GLN A OE1 1  
ATOM 2656   N NE2 . GLN A 1 430 ? 71.663  57.959  29.272  1.00 0.00 ? 430 GLN A NE2 1  
ATOM 2657   N N   . SER A 1 431 ? 75.974  59.472  26.686  1.00 0.00 ? 431 SER A N   1  
ATOM 2658   C CA  . SER A 1 431 ? 77.008  58.486  26.967  1.00 0.00 ? 431 SER A CA  1  
ATOM 2659   C C   . SER A 1 431 ? 78.018  59.009  27.917  1.00 0.00 ? 431 SER A C   1  
ATOM 2660   O O   . SER A 1 431 ? 78.677  58.358  28.725  1.00 0.00 ? 431 SER A O   1  
ATOM 2661   C CB  . SER A 1 431 ? 77.769  57.988  25.730  1.00 0.00 ? 431 SER A CB  1  
ATOM 2662   O OG  . SER A 1 431 ? 78.358  58.963  24.899  1.00 0.00 ? 431 SER A OG  1  
ATOM 2663   N N   . GLY A 1 432 ? 78.058  60.378  27.939  1.00 0.00 ? 432 GLY A N   1  
ATOM 2664   C CA  . GLY A 1 432 ? 78.514  61.275  28.960  1.00 0.00 ? 432 GLY A CA  1  
ATOM 2665   C C   . GLY A 1 432 ? 79.760  60.893  29.710  1.00 0.00 ? 432 GLY A C   1  
ATOM 2666   O O   . GLY A 1 432 ? 80.861  61.313  29.381  1.00 0.00 ? 432 GLY A O   1  
ATOM 2667   N N   . HIS A 1 433 ? 79.594  60.215  30.860  1.00 0.00 ? 433 HIS A N   1  
ATOM 2668   C CA  . HIS A 1 433 ? 80.662  59.944  31.851  1.00 0.00 ? 433 HIS A CA  1  
ATOM 2669   C C   . HIS A 1 433 ? 81.759  59.098  31.237  1.00 0.00 ? 433 HIS A C   1  
ATOM 2670   O O   . HIS A 1 433 ? 82.940  59.330  31.472  1.00 0.00 ? 433 HIS A O   1  
ATOM 2671   C CB  . HIS A 1 433 ? 80.109  59.157  33.068  1.00 0.00 ? 433 HIS A CB  1  
ATOM 2672   C CG  . HIS A 1 433 ? 79.228  57.928  32.785  1.00 0.00 ? 433 HIS A CG  1  
ATOM 2673   N ND1 . HIS A 1 433 ? 78.091  57.854  32.065  1.00 0.00 ? 433 HIS A ND1 1  
ATOM 2674   C CD2 . HIS A 1 433 ? 79.449  56.675  33.325  1.00 0.00 ? 433 HIS A CD2 1  
ATOM 2675   C CE1 . HIS A 1 433 ? 77.736  56.533  32.084  1.00 0.00 ? 433 HIS A CE1 1  
ATOM 2676   N NE2 . HIS A 1 433 ? 78.506  55.824  32.817  1.00 0.00 ? 433 HIS A NE2 1  
ATOM 2677   N N   . ASN A 1 434 ? 81.342  58.095  30.412  1.00 0.00 ? 434 ASN A N   1  
ATOM 2678   C CA  . ASN A 1 434 ? 82.265  57.199  29.732  1.00 0.00 ? 434 ASN A CA  1  
ATOM 2679   C C   . ASN A 1 434 ? 83.168  57.925  28.711  1.00 0.00 ? 434 ASN A C   1  
ATOM 2680   O O   . ASN A 1 434 ? 84.393  57.551  28.673  1.00 0.00 ? 434 ASN A O   1  
ATOM 2681   C CB  . ASN A 1 434 ? 81.591  56.078  28.889  1.00 0.00 ? 434 ASN A CB  1  
ATOM 2682   C CG  . ASN A 1 434 ? 80.710  55.132  29.780  1.00 0.00 ? 434 ASN A CG  1  
ATOM 2683   O OD1 . ASN A 1 434 ? 81.259  54.575  30.793  1.00 0.00 ? 434 ASN A OD1 1  
ATOM 2684   N ND2 . ASN A 1 434 ? 79.422  54.883  29.417  1.00 0.00 ? 434 ASN A ND2 1  
ATOM 2685   N N   . VAL A 1 435 ? 82.602  58.905  28.032  1.00 0.00 ? 435 VAL A N   1  
ATOM 2686   C CA  . VAL A 1 435 ? 83.274  59.761  27.176  1.00 0.00 ? 435 VAL A CA  1  
ATOM 2687   C C   . VAL A 1 435 ? 84.285  60.589  28.003  1.00 0.00 ? 435 VAL A C   1  
ATOM 2688   O O   . VAL A 1 435 ? 85.432  60.851  27.618  1.00 0.00 ? 435 VAL A O   1  
ATOM 2689   C CB  . VAL A 1 435 ? 82.481  60.653  26.300  1.00 0.00 ? 435 VAL A CB  1  
ATOM 2690   C CG1 . VAL A 1 435 ? 83.366  61.336  25.191  1.00 0.00 ? 435 VAL A CG1 1  
ATOM 2691   C CG2 . VAL A 1 435 ? 81.349  59.829  25.638  1.00 0.00 ? 435 VAL A CG2 1  
ATOM 2692   N N   . LEU A 1 436 ? 83.829  61.026  29.203  1.00 0.00 ? 436 LEU A N   1  
ATOM 2693   C CA  . LEU A 1 436 ? 84.704  61.772  30.073  1.00 0.00 ? 436 LEU A CA  1  
ATOM 2694   C C   . LEU A 1 436 ? 85.918  61.018  30.548  1.00 0.00 ? 436 LEU A C   1  
ATOM 2695   O O   . LEU A 1 436 ? 87.025  61.553  30.619  1.00 0.00 ? 436 LEU A O   1  
ATOM 2696   C CB  . LEU A 1 436 ? 84.036  62.449  31.333  1.00 0.00 ? 436 LEU A CB  1  
ATOM 2697   C CG  . LEU A 1 436 ? 82.910  63.452  30.980  1.00 0.00 ? 436 LEU A CG  1  
ATOM 2698   C CD1 . LEU A 1 436 ? 82.234  64.095  32.218  1.00 0.00 ? 436 LEU A CD1 1  
ATOM 2699   C CD2 . LEU A 1 436 ? 83.423  64.539  30.070  1.00 0.00 ? 436 LEU A CD2 1  
ATOM 2700   N N   . LYS A 1 437 ? 85.721  59.746  30.932  1.00 0.00 ? 437 LYS A N   1  
ATOM 2701   C CA  . LYS A 1 437 ? 86.731  58.822  31.407  1.00 0.00 ? 437 LYS A CA  1  
ATOM 2702   C C   . LYS A 1 437 ? 87.749  58.535  30.323  1.00 0.00 ? 437 LYS A C   1  
ATOM 2703   O O   . LYS A 1 437 ? 88.965  58.617  30.555  1.00 0.00 ? 437 LYS A O   1  
ATOM 2704   C CB  . LYS A 1 437 ? 86.153  57.497  31.836  1.00 0.00 ? 437 LYS A CB  1  
ATOM 2705   C CG  . LYS A 1 437 ? 85.663  57.558  33.268  1.00 0.00 ? 437 LYS A CG  1  
ATOM 2706   C CD  . LYS A 1 437 ? 85.317  56.193  33.921  1.00 0.00 ? 437 LYS A CD  1  
ATOM 2707   C CE  . LYS A 1 437 ? 84.175  55.420  33.210  1.00 0.00 ? 437 LYS A CE  1  
ATOM 2708   N NZ  . LYS A 1 437 ? 82.804  56.009  33.285  1.00 0.00 ? 437 LYS A NZ  1  
ATOM 2709   N N   . PHE A 1 438 ? 87.294  58.397  29.074  1.00 0.00 ? 438 PHE A N   1  
ATOM 2710   C CA  . PHE A 1 438 ? 88.076  58.223  27.905  1.00 0.00 ? 438 PHE A CA  1  
ATOM 2711   C C   . PHE A 1 438 ? 88.981  59.348  27.654  1.00 0.00 ? 438 PHE A C   1  
ATOM 2712   O O   . PHE A 1 438 ? 90.133  59.129  27.495  1.00 0.00 ? 438 PHE A O   1  
ATOM 2713   C CB  . PHE A 1 438 ? 87.206  57.962  26.664  1.00 0.00 ? 438 PHE A CB  1  
ATOM 2714   C CG  . PHE A 1 438 ? 88.027  57.653  25.416  1.00 0.00 ? 438 PHE A CG  1  
ATOM 2715   C CD1 . PHE A 1 438 ? 88.872  56.512  25.313  1.00 0.00 ? 438 PHE A CD1 1  
ATOM 2716   C CD2 . PHE A 1 438 ? 87.833  58.339  24.143  1.00 0.00 ? 438 PHE A CD2 1  
ATOM 2717   C CE1 . PHE A 1 438 ? 89.298  56.102  24.076  1.00 0.00 ? 438 PHE A CE1 1  
ATOM 2718   C CE2 . PHE A 1 438 ? 88.355  57.924  22.906  1.00 0.00 ? 438 PHE A CE2 1  
ATOM 2719   C CZ  . PHE A 1 438 ? 89.033  56.727  22.903  1.00 0.00 ? 438 PHE A CZ  1  
ATOM 2720   N N   . LEU A 1 439 ? 88.447  60.590  27.770  1.00 0.00 ? 439 LEU A N   1  
ATOM 2721   C CA  . LEU A 1 439 ? 89.245  61.803  27.627  1.00 0.00 ? 439 LEU A CA  1  
ATOM 2722   C C   . LEU A 1 439 ? 90.375  62.039  28.605  1.00 0.00 ? 439 LEU A C   1  
ATOM 2723   O O   . LEU A 1 439 ? 91.501  62.346  28.233  1.00 0.00 ? 439 LEU A O   1  
ATOM 2724   C CB  . LEU A 1 439 ? 88.303  63.075  27.598  1.00 0.00 ? 439 LEU A CB  1  
ATOM 2725   C CG  . LEU A 1 439 ? 87.435  62.937  26.293  1.00 0.00 ? 439 LEU A CG  1  
ATOM 2726   C CD1 . LEU A 1 439 ? 86.210  63.933  26.404  1.00 0.00 ? 439 LEU A CD1 1  
ATOM 2727   C CD2 . LEU A 1 439 ? 88.236  63.200  25.048  1.00 0.00 ? 439 LEU A CD2 1  
ATOM 2728   N N   . THR A 1 440 ? 90.092  61.766  29.942  1.00 0.00 ? 440 THR A N   1  
ATOM 2729   C CA  . THR A 1 440 ? 90.957  61.922  31.097  1.00 0.00 ? 440 THR A CA  1  
ATOM 2730   C C   . THR A 1 440 ? 92.127  61.001  30.912  1.00 0.00 ? 440 THR A C   1  
ATOM 2731   O O   . THR A 1 440 ? 93.285  61.374  31.124  1.00 0.00 ? 440 THR A O   1  
ATOM 2732   C CB  . THR A 1 440 ? 90.408  61.563  32.484  1.00 0.00 ? 440 THR A CB  1  
ATOM 2733   O OG1 . THR A 1 440 ? 89.102  62.063  32.762  1.00 0.00 ? 440 THR A OG1 1  
ATOM 2734   C CG2 . THR A 1 440 ? 91.345  62.110  33.560  1.00 0.00 ? 440 THR A CG2 1  
ATOM 2735   N N   . LYS A 1 441 ? 91.895  59.721  30.595  1.00 0.00 ? 441 LYS A N   1  
ATOM 2736   C CA  . LYS A 1 441 ? 92.925  58.744  30.464  1.00 0.00 ? 441 LYS A CA  1  
ATOM 2737   C C   . LYS A 1 441 ? 93.796  59.030  29.312  1.00 0.00 ? 441 LYS A C   1  
ATOM 2738   O O   . LYS A 1 441 ? 94.977  58.764  29.353  1.00 0.00 ? 441 LYS A O   1  
ATOM 2739   C CB  . LYS A 1 441 ? 92.325  57.338  30.248  1.00 0.00 ? 441 LYS A CB  1  
ATOM 2740   C CG  . LYS A 1 441 ? 91.461  56.920  31.429  1.00 0.00 ? 441 LYS A CG  1  
ATOM 2741   C CD  . LYS A 1 441 ? 90.893  55.545  31.255  1.00 0.00 ? 441 LYS A CD  1  
ATOM 2742   C CE  . LYS A 1 441 ? 90.023  55.286  30.013  1.00 0.00 ? 441 LYS A CE  1  
ATOM 2743   N NZ  . LYS A 1 441 ? 89.650  53.927  29.851  1.00 0.00 ? 441 LYS A NZ  1  
ATOM 2744   N N   . ASN A 1 442 ? 93.175  59.473  28.226  1.00 0.00 ? 442 ASN A N   1  
ATOM 2745   C CA  . ASN A 1 442 ? 93.835  59.779  26.916  1.00 0.00 ? 442 ASN A CA  1  
ATOM 2746   C C   . ASN A 1 442 ? 94.643  61.009  26.843  1.00 0.00 ? 442 ASN A C   1  
ATOM 2747   O O   . ASN A 1 442 ? 95.354  61.253  25.893  1.00 0.00 ? 442 ASN A O   1  
ATOM 2748   C CB  . ASN A 1 442 ? 92.815  60.025  25.744  1.00 0.00 ? 442 ASN A CB  1  
ATOM 2749   C CG  . ASN A 1 442 ? 91.921  58.798  25.378  1.00 0.00 ? 442 ASN A CG  1  
ATOM 2750   O OD1 . ASN A 1 442 ? 92.137  57.687  25.890  1.00 0.00 ? 442 ASN A OD1 1  
ATOM 2751   N ND2 . ASN A 1 442 ? 90.929  59.075  24.495  1.00 0.00 ? 442 ASN A ND2 1  
ATOM 2752   N N   . MET A 1 443 ? 94.385  61.949  27.830  1.00 0.00 ? 443 MET A N   1  
ATOM 2753   C CA  . MET A 1 443 ? 94.669  63.380  27.754  1.00 0.00 ? 443 MET A CA  1  
ATOM 2754   C C   . MET A 1 443 ? 96.064  63.747  27.373  1.00 0.00 ? 443 MET A C   1  
ATOM 2755   O O   . MET A 1 443 ? 96.230  64.630  26.542  1.00 0.00 ? 443 MET A O   1  
ATOM 2756   C CB  . MET A 1 443 ? 94.323  64.010  29.111  1.00 0.00 ? 443 MET A CB  1  
ATOM 2757   C CG  . MET A 1 443 ? 94.328  65.530  29.210  1.00 0.00 ? 443 MET A CG  1  
ATOM 2758   S SD  . MET A 1 443 ? 94.157  66.214  30.873  1.00 0.00 ? 443 MET A SD  1  
ATOM 2759   C CE  . MET A 1 443 ? 95.788  66.197  31.444  1.00 0.00 ? 443 MET A CE  1  
ATOM 2760   N N   . GLY A 1 444 ? 97.151  63.070  27.886  1.00 0.00 ? 444 GLY A N   1  
ATOM 2761   C CA  . GLY A 1 444 ? 98.557  63.268  27.631  1.00 0.00 ? 444 GLY A CA  1  
ATOM 2762   C C   . GLY A 1 444 ? 98.919  62.991  26.194  1.00 0.00 ? 444 GLY A C   1  
ATOM 2763   O O   . GLY A 1 444 ? 99.667  63.723  25.533  1.00 0.00 ? 444 GLY A O   1  
ATOM 2764   N N   . GLU A 1 445 ? 98.295  61.889  25.634  1.00 0.00 ? 445 GLU A N   1  
ATOM 2765   C CA  . GLU A 1 445 ? 98.484  61.363  24.276  1.00 0.00 ? 445 GLU A CA  1  
ATOM 2766   C C   . GLU A 1 445 ? 97.881  62.264  23.170  1.00 0.00 ? 445 GLU A C   1  
ATOM 2767   O O   . GLU A 1 445 ? 98.410  62.241  22.083  1.00 0.00 ? 445 GLU A O   1  
ATOM 2768   C CB  . GLU A 1 445 ? 97.793  59.963  24.131  1.00 0.00 ? 445 GLU A CB  1  
ATOM 2769   C CG  . GLU A 1 445 ? 98.339  58.966  25.154  1.00 0.00 ? 445 GLU A CG  1  
ATOM 2770   C CD  . GLU A 1 445 ? 97.869  57.614  24.719  1.00 0.00 ? 445 GLU A CD  1  
ATOM 2771   O OE1 . GLU A 1 445 ? 96.655  57.405  24.706  1.00 0.00 ? 445 GLU A OE1 1  
ATOM 2772   O OE2 . GLU A 1 445 ? 98.783  56.757  24.403  1.00 0.00 ? 445 GLU A OE2 1  
ATOM 2773   N N   . LEU A 1 446 ? 96.720  62.887  23.509  1.00 0.00 ? 446 LEU A N   1  
ATOM 2774   C CA  . LEU A 1 446 ? 95.891  63.678  22.655  1.00 0.00 ? 446 LEU A CA  1  
ATOM 2775   C C   . LEU A 1 446 ? 96.543  65.018  22.477  1.00 0.00 ? 446 LEU A C   1  
ATOM 2776   O O   . LEU A 1 446 ? 96.436  65.541  21.365  1.00 0.00 ? 446 LEU A O   1  
ATOM 2777   C CB  . LEU A 1 446 ? 94.460  63.979  23.161  1.00 0.00 ? 446 LEU A CB  1  
ATOM 2778   C CG  . LEU A 1 446 ? 93.566  62.739  23.237  1.00 0.00 ? 446 LEU A CG  1  
ATOM 2779   C CD1 . LEU A 1 446 ? 92.278  62.984  24.014  1.00 0.00 ? 446 LEU A CD1 1  
ATOM 2780   C CD2 . LEU A 1 446 ? 93.121  62.114  21.790  1.00 0.00 ? 446 LEU A CD2 1  
ATOM 2781   N N   . THR A 1 447 ? 97.345  65.538  23.463  1.00 0.00 ? 447 THR A N   1  
ATOM 2782   C CA  . THR A 1 447 ? 98.116  66.844  23.434  1.00 0.00 ? 447 THR A CA  1  
ATOM 2783   C C   . THR A 1 447 ? 99.064  66.804  22.256  1.00 0.00 ? 447 THR A C   1  
ATOM 2784   O O   . THR A 1 447 ? 99.248  67.836  21.622  1.00 0.00 ? 447 THR A O   1  
ATOM 2785   C CB  . THR A 1 447 ? 98.943  67.105  24.688  1.00 0.00 ? 447 THR A CB  1  
ATOM 2786   O OG1 . THR A 1 447 ? 98.139  66.881  25.822  1.00 0.00 ? 447 THR A OG1 1  
ATOM 2787   C CG2 . THR A 1 447 ? 99.493  68.519  24.685  1.00 0.00 ? 447 THR A CG2 1  
ATOM 2788   N N   . LYS A 1 448 ? 99.655  65.646  21.990  1.00 0.00 ? 448 LYS A N   1  
ATOM 2789   C CA  . LYS A 1 448 ? 100.699 65.412  20.941  1.00 0.00 ? 448 LYS A CA  1  
ATOM 2790   C C   . LYS A 1 448 ? 99.978  65.148  19.709  1.00 0.00 ? 448 LYS A C   1  
ATOM 2791   O O   . LYS A 1 448 ? 98.932  64.446  19.724  1.00 0.00 ? 448 LYS A O   1  
ATOM 2792   C CB  . LYS A 1 448 ? 101.520 64.140  21.184  1.00 0.00 ? 448 LYS A CB  1  
ATOM 2793   C CG  . LYS A 1 448 ? 102.099 64.168  22.591  1.00 0.00 ? 448 LYS A CG  1  
ATOM 2794   C CD  . LYS A 1 448 ? 103.080 63.023  22.879  1.00 0.00 ? 448 LYS A CD  1  
ATOM 2795   C CE  . LYS A 1 448 ? 103.453 62.818  24.319  1.00 0.00 ? 448 LYS A CE  1  
ATOM 2796   N NZ  . LYS A 1 448 ? 104.569 61.857  24.588  1.00 0.00 ? 448 LYS A NZ  1  
ATOM 2797   N N   . HIS A 1 449 ? 100.552 65.686  18.572  1.00 0.00 ? 449 HIS A N   1  
ATOM 2798   C CA  . HIS A 1 449 ? 100.150 65.527  17.138  1.00 0.00 ? 449 HIS A CA  1  
ATOM 2799   C C   . HIS A 1 449 ? 99.736  64.138  16.871  1.00 0.00 ? 449 HIS A C   1  
ATOM 2800   O O   . HIS A 1 449 ? 98.599  63.690  16.855  1.00 0.00 ? 449 HIS A O   1  
ATOM 2801   C CB  . HIS A 1 449 ? 101.251 65.890  16.082  1.00 0.00 ? 449 HIS A CB  1  
ATOM 2802   C CG  . HIS A 1 449 ? 102.672 65.518  16.395  1.00 0.00 ? 449 HIS A CG  1  
ATOM 2803   N ND1 . HIS A 1 449 ? 103.384 66.200  17.388  1.00 0.00 ? 449 HIS A ND1 1  
ATOM 2804   C CD2 . HIS A 1 449 ? 103.499 64.558  15.880  1.00 0.00 ? 449 HIS A CD2 1  
ATOM 2805   C CE1 . HIS A 1 449 ? 104.599 65.637  17.385  1.00 0.00 ? 449 HIS A CE1 1  
ATOM 2806   N NE2 . HIS A 1 449 ? 104.723 64.638  16.484  1.00 0.00 ? 449 HIS A NE2 1  
ATOM 2807   N N   . TYR A 1 450 ? 100.744 63.234  16.756  1.00 0.00 ? 450 TYR A N   1  
ATOM 2808   C CA  . TYR A 1 450 ? 100.478 61.879  16.645  1.00 0.00 ? 450 TYR A CA  1  
ATOM 2809   C C   . TYR A 1 450 ? 101.716 61.060  16.969  1.00 0.00 ? 450 TYR A C   1  
ATOM 2810   O O   . TYR A 1 450 ? 102.851 61.589  16.955  1.00 0.00 ? 450 TYR A O   1  
ATOM 2811   C CB  . TYR A 1 450 ? 99.866  61.370  15.303  1.00 0.00 ? 450 TYR A CB  1  
ATOM 2812   C CG  . TYR A 1 450 ? 98.818  60.337  15.579  1.00 0.00 ? 450 TYR A CG  1  
ATOM 2813   C CD1 . TYR A 1 450 ? 97.534  60.775  16.026  1.00 0.00 ? 450 TYR A CD1 1  
ATOM 2814   C CD2 . TYR A 1 450 ? 99.052  58.980  15.407  1.00 0.00 ? 450 TYR A CD2 1  
ATOM 2815   C CE1 . TYR A 1 450 ? 96.569  59.835  16.479  1.00 0.00 ? 450 TYR A CE1 1  
ATOM 2816   C CE2 . TYR A 1 450 ? 98.069  58.044  15.682  1.00 0.00 ? 450 TYR A CE2 1  
ATOM 2817   C CZ  . TYR A 1 450 ? 96.839  58.485  16.206  1.00 0.00 ? 450 TYR A CZ  1  
ATOM 2818   O OH  . TYR A 1 450 ? 95.828  57.554  16.406  1.00 0.00 ? 450 TYR A OH  1  
ATOM 2819   N N   . ARG A 1 451 ? 101.521 59.780  17.310  1.00 0.00 ? 451 ARG A N   1  
ATOM 2820   C CA  . ARG A 1 451 ? 102.600 58.906  17.521  1.00 0.00 ? 451 ARG A CA  1  
ATOM 2821   C C   . ARG A 1 451 ? 102.010 57.586  17.231  1.00 0.00 ? 451 ARG A C   1  
ATOM 2822   O O   . ARG A 1 451 ? 100.775 57.372  17.271  1.00 0.00 ? 451 ARG A O   1  
ATOM 2823   C CB  . ARG A 1 451 ? 102.927 58.810  19.044  1.00 0.00 ? 451 ARG A CB  1  
ATOM 2824   C CG  . ARG A 1 451 ? 103.473 60.116  19.633  1.00 0.00 ? 451 ARG A CG  1  
ATOM 2825   C CD  . ARG A 1 451 ? 104.023 59.997  21.064  1.00 0.00 ? 451 ARG A CD  1  
ATOM 2826   N NE  . ARG A 1 451 ? 102.850 59.532  21.949  1.00 0.00 ? 451 ARG A NE  1  
ATOM 2827   C CZ  . ARG A 1 451 ? 103.071 59.141  23.222  1.00 0.00 ? 451 ARG A CZ  1  
ATOM 2828   N NH1 . ARG A 1 451 ? 104.334 58.848  23.643  1.00 0.00 ? 451 ARG A NH1 1  
ATOM 2829   N NH2 . ARG A 1 451 ? 102.062 58.924  24.050  1.00 0.00 ? 451 ARG A NH2 1  
ATOM 2830   N N   . ASN A 1 452 ? 102.883 56.620  16.848  1.00 0.00 ? 452 ASN A N   1  
ATOM 2831   C CA  . ASN A 1 452 ? 102.671 55.309  16.404  1.00 0.00 ? 452 ASN A CA  1  
ATOM 2832   C C   . ASN A 1 452 ? 101.948 54.428  17.424  1.00 0.00 ? 452 ASN A C   1  
ATOM 2833   O O   . ASN A 1 452 ? 101.089 53.645  17.107  1.00 0.00 ? 452 ASN A O   1  
ATOM 2834   C CB  . ASN A 1 452 ? 103.969 54.603  15.969  1.00 0.00 ? 452 ASN A CB  1  
ATOM 2835   C CG  . ASN A 1 452 ? 104.850 55.553  15.055  1.00 0.00 ? 452 ASN A CG  1  
ATOM 2836   O OD1 . ASN A 1 452 ? 105.897 56.124  15.485  1.00 0.00 ? 452 ASN A OD1 1  
ATOM 2837   N ND2 . ASN A 1 452 ? 104.334 55.703  13.821  1.00 0.00 ? 452 ASN A ND2 1  
ATOM 2838   N N   . ASP A 1 453 ? 102.303 54.595  18.693  1.00 0.00 ? 453 ASP A N   1  
ATOM 2839   C CA  . ASP A 1 453 ? 101.746 53.864  19.718  1.00 0.00 ? 453 ASP A CA  1  
ATOM 2840   C C   . ASP A 1 453 ? 100.297 54.225  20.069  1.00 0.00 ? 453 ASP A C   1  
ATOM 2841   O O   . ASP A 1 453 ? 99.478  53.465  20.565  1.00 0.00 ? 453 ASP A O   1  
ATOM 2842   C CB  . ASP A 1 453 ? 102.630 53.856  20.960  1.00 0.00 ? 453 ASP A CB  1  
ATOM 2843   C CG  . ASP A 1 453 ? 102.791 55.267  21.516  1.00 0.00 ? 453 ASP A CG  1  
ATOM 2844   O OD1 . ASP A 1 453 ? 103.469 56.158  20.901  1.00 0.00 ? 453 ASP A OD1 1  
ATOM 2845   O OD2 . ASP A 1 453 ? 102.110 55.485  22.570  1.00 0.00 ? 453 ASP A OD2 1  
ATOM 2846   N N   . ASN A 1 454 ? 99.905  55.527  19.787  1.00 0.00 ? 454 ASN A N   1  
ATOM 2847   C CA  . ASN A 1 454 ? 98.670  56.174  20.173  1.00 0.00 ? 454 ASN A CA  1  
ATOM 2848   C C   . ASN A 1 454 ? 97.352  55.403  19.810  1.00 0.00 ? 454 ASN A C   1  
ATOM 2849   O O   . ASN A 1 454 ? 96.535  55.157  20.712  1.00 0.00 ? 454 ASN A O   1  
ATOM 2850   C CB  . ASN A 1 454 ? 98.445  57.591  19.596  1.00 0.00 ? 454 ASN A CB  1  
ATOM 2851   C CG  . ASN A 1 454 ? 99.285  58.680  20.199  1.00 0.00 ? 454 ASN A CG  1  
ATOM 2852   O OD1 . ASN A 1 454 ? 99.263  59.773  19.565  1.00 0.00 ? 454 ASN A OD1 1  
ATOM 2853   N ND2 . ASN A 1 454 ? 99.923  58.499  21.395  1.00 0.00 ? 454 ASN A ND2 1  
ATOM 2854   N N   . ASN A 1 455 ? 97.223  54.971  18.582  1.00 0.00 ? 455 ASN A N   1  
ATOM 2855   C CA  . ASN A 1 455 ? 96.064  54.247  18.068  1.00 0.00 ? 455 ASN A CA  1  
ATOM 2856   C C   . ASN A 1 455 ? 95.715  52.971  18.788  1.00 0.00 ? 455 ASN A C   1  
ATOM 2857   O O   . ASN A 1 455 ? 94.589  52.746  19.169  1.00 0.00 ? 455 ASN A O   1  
ATOM 2858   C CB  . ASN A 1 455 ? 96.313  53.910  16.529  1.00 0.00 ? 455 ASN A CB  1  
ATOM 2859   C CG  . ASN A 1 455 ? 97.762  53.449  16.109  1.00 0.00 ? 455 ASN A CG  1  
ATOM 2860   O OD1 . ASN A 1 455 ? 97.881  52.238  16.191  1.00 0.00 ? 455 ASN A OD1 1  
ATOM 2861   N ND2 . ASN A 1 455 ? 98.675  54.387  15.733  1.00 0.00 ? 455 ASN A ND2 1  
ATOM 2862   N N   . ALA A 1 456 ? 96.766  52.164  19.089  1.00 0.00 ? 456 ALA A N   1  
ATOM 2863   C CA  . ALA A 1 456 ? 96.638  50.976  19.899  1.00 0.00 ? 456 ALA A CA  1  
ATOM 2864   C C   . ALA A 1 456 ? 96.231  51.208  21.280  1.00 0.00 ? 456 ALA A C   1  
ATOM 2865   O O   . ALA A 1 456 ? 95.269  50.552  21.767  1.00 0.00 ? 456 ALA A O   1  
ATOM 2866   C CB  . ALA A 1 456 ? 97.981  50.327  19.947  1.00 0.00 ? 456 ALA A CB  1  
ATOM 2867   N N   . ASN A 1 457 ? 96.812  52.245  21.949  1.00 0.00 ? 457 ASN A N   1  
ATOM 2868   C CA  . ASN A 1 457 ? 96.485  52.638  23.301  1.00 0.00 ? 457 ASN A CA  1  
ATOM 2869   C C   . ASN A 1 457 ? 95.080  53.102  23.365  1.00 0.00 ? 457 ASN A C   1  
ATOM 2870   O O   . ASN A 1 457 ? 94.378  52.652  24.280  1.00 0.00 ? 457 ASN A O   1  
ATOM 2871   C CB  . ASN A 1 457 ? 97.495  53.700  23.880  1.00 0.00 ? 457 ASN A CB  1  
ATOM 2872   C CG  . ASN A 1 457 ? 98.896  53.199  23.877  1.00 0.00 ? 457 ASN A CG  1  
ATOM 2873   O OD1 . ASN A 1 457 ? 99.233  52.023  23.558  1.00 0.00 ? 457 ASN A OD1 1  
ATOM 2874   N ND2 . ASN A 1 457 ? 99.792  54.055  24.496  1.00 0.00 ? 457 ASN A ND2 1  
ATOM 2875   N N   . TYR A 1 458 ? 94.598  53.887  22.422  1.00 0.00 ? 458 TYR A N   1  
ATOM 2876   C CA  . TYR A 1 458 ? 93.225  54.354  22.341  1.00 0.00 ? 458 TYR A CA  1  
ATOM 2877   C C   . TYR A 1 458 ? 92.271  53.126  22.113  1.00 0.00 ? 458 TYR A C   1  
ATOM 2878   O O   . TYR A 1 458 ? 91.214  53.178  22.753  1.00 0.00 ? 458 TYR A O   1  
ATOM 2879   C CB  . TYR A 1 458 ? 92.942  55.413  21.199  1.00 0.00 ? 458 TYR A CB  1  
ATOM 2880   C CG  . TYR A 1 458 ? 93.639  56.732  21.228  1.00 0.00 ? 458 TYR A CG  1  
ATOM 2881   C CD1 . TYR A 1 458 ? 93.905  57.413  22.469  1.00 0.00 ? 458 TYR A CD1 1  
ATOM 2882   C CD2 . TYR A 1 458 ? 94.213  57.171  20.016  1.00 0.00 ? 458 TYR A CD2 1  
ATOM 2883   C CE1 . TYR A 1 458 ? 94.614  58.595  22.452  1.00 0.00 ? 458 TYR A CE1 1  
ATOM 2884   C CE2 . TYR A 1 458 ? 94.860  58.391  19.993  1.00 0.00 ? 458 TYR A CE2 1  
ATOM 2885   C CZ  . TYR A 1 458 ? 95.150  59.038  21.225  1.00 0.00 ? 458 TYR A CZ  1  
ATOM 2886   O OH  . TYR A 1 458 ? 95.937  60.209  21.084  1.00 0.00 ? 458 TYR A OH  1  
ATOM 2887   N N   . ASP A 1 459 ? 92.596  52.105  21.255  1.00 0.00 ? 459 ASP A N   1  
ATOM 2888   C CA  . ASP A 1 459 ? 91.641  51.087  20.986  1.00 0.00 ? 459 ASP A CA  1  
ATOM 2889   C C   . ASP A 1 459 ? 91.416  50.333  22.299  1.00 0.00 ? 459 ASP A C   1  
ATOM 2890   O O   . ASP A 1 459 ? 90.272  49.856  22.564  1.00 0.00 ? 459 ASP A O   1  
ATOM 2891   C CB  . ASP A 1 459 ? 92.189  50.184  19.801  1.00 0.00 ? 459 ASP A CB  1  
ATOM 2892   C CG  . ASP A 1 459 ? 91.269  48.981  19.540  1.00 0.00 ? 459 ASP A CG  1  
ATOM 2893   O OD1 . ASP A 1 459 ? 90.250  49.063  18.717  1.00 0.00 ? 459 ASP A OD1 1  
ATOM 2894   O OD2 . ASP A 1 459 ? 91.631  47.869  19.938  1.00 0.00 ? 459 ASP A OD2 1  
ATOM 2895   N N   . LYS A 1 460 ? 92.575  50.056  23.075  1.00 0.00 ? 460 LYS A N   1  
ATOM 2896   C CA  . LYS A 1 460 ? 92.503  49.275  24.230  1.00 0.00 ? 460 LYS A CA  1  
ATOM 2897   C C   . LYS A 1 460 ? 91.699  49.978  25.309  1.00 0.00 ? 460 LYS A C   1  
ATOM 2898   O O   . LYS A 1 460 ? 90.808  49.496  25.978  1.00 0.00 ? 460 LYS A O   1  
ATOM 2899   C CB  . LYS A 1 460 ? 93.918  49.001  24.805  1.00 0.00 ? 460 LYS A CB  1  
ATOM 2900   C CG  . LYS A 1 460 ? 93.934  48.418  26.211  1.00 0.00 ? 460 LYS A CG  1  
ATOM 2901   C CD  . LYS A 1 460 ? 93.350  47.003  26.269  1.00 0.00 ? 460 LYS A CD  1  
ATOM 2902   C CE  . LYS A 1 460 ? 93.508  46.174  27.527  1.00 0.00 ? 460 LYS A CE  1  
ATOM 2903   N NZ  . LYS A 1 460 ? 94.899  45.732  27.598  1.00 0.00 ? 460 LYS A NZ  1  
ATOM 2904   N N   . LEU A 1 461 ? 92.030  51.290  25.412  1.00 0.00 ? 461 LEU A N   1  
ATOM 2905   C CA  . LEU A 1 461 ? 91.317  52.118  26.324  1.00 0.00 ? 461 LEU A CA  1  
ATOM 2906   C C   . LEU A 1 461 ? 89.841  52.287  26.068  1.00 0.00 ? 461 LEU A C   1  
ATOM 2907   O O   . LEU A 1 461 ? 89.106  52.346  27.020  1.00 0.00 ? 461 LEU A O   1  
ATOM 2908   C CB  . LEU A 1 461 ? 91.882  53.630  26.285  1.00 0.00 ? 461 LEU A CB  1  
ATOM 2909   C CG  . LEU A 1 461 ? 93.241  53.798  26.972  1.00 0.00 ? 461 LEU A CG  1  
ATOM 2910   C CD1 . LEU A 1 461 ? 93.962  55.086  26.448  1.00 0.00 ? 461 LEU A CD1 1  
ATOM 2911   C CD2 . LEU A 1 461 ? 93.030  53.740  28.449  1.00 0.00 ? 461 LEU A CD2 1  
ATOM 2912   N N   . LEU A 1 462 ? 89.512  52.386  24.782  1.00 0.00 ? 462 LEU A N   1  
ATOM 2913   C CA  . LEU A 1 462 ? 88.108  52.608  24.308  1.00 0.00 ? 462 LEU A CA  1  
ATOM 2914   C C   . LEU A 1 462 ? 87.287  51.450  24.715  1.00 0.00 ? 462 LEU A C   1  
ATOM 2915   O O   . LEU A 1 462 ? 86.211  51.659  25.266  1.00 0.00 ? 462 LEU A O   1  
ATOM 2916   C CB  . LEU A 1 462 ? 88.052  52.780  22.762  1.00 0.00 ? 462 LEU A CB  1  
ATOM 2917   C CG  . LEU A 1 462 ? 86.667  53.173  22.134  1.00 0.00 ? 462 LEU A CG  1  
ATOM 2918   C CD1 . LEU A 1 462 ? 86.676  54.652  21.834  1.00 0.00 ? 462 LEU A CD1 1  
ATOM 2919   C CD2 . LEU A 1 462 ? 86.324  52.442  20.765  1.00 0.00 ? 462 LEU A CD2 1  
ATOM 2920   N N   . GLN A 1 463 ? 87.896  50.240  24.482  1.00 0.00 ? 463 GLN A N   1  
ATOM 2921   C CA  . GLN A 1 463 ? 87.294  48.975  24.769  1.00 0.00 ? 463 GLN A CA  1  
ATOM 2922   C C   . GLN A 1 463 ? 87.131  48.845  26.280  1.00 0.00 ? 463 GLN A C   1  
ATOM 2923   O O   . GLN A 1 463 ? 86.136  48.308  26.759  1.00 0.00 ? 463 GLN A O   1  
ATOM 2924   C CB  . GLN A 1 463 ? 88.210  47.762  24.317  1.00 0.00 ? 463 GLN A CB  1  
ATOM 2925   C CG  . GLN A 1 463 ? 87.644  47.119  22.921  1.00 0.00 ? 463 GLN A CG  1  
ATOM 2926   C CD  . GLN A 1 463 ? 87.930  47.945  21.639  1.00 0.00 ? 463 GLN A CD  1  
ATOM 2927   O OE1 . GLN A 1 463 ? 87.488  49.081  21.489  1.00 0.00 ? 463 GLN A OE1 1  
ATOM 2928   N NE2 . GLN A 1 463 ? 88.670  47.299  20.695  1.00 0.00 ? 463 GLN A NE2 1  
ATOM 2929   N N   . ASN A 1 464 ? 88.174  49.340  27.002  1.00 0.00 ? 464 ASN A N   1  
ATOM 2930   C CA  . ASN A 1 464 ? 88.310  49.190  28.424  1.00 0.00 ? 464 ASN A CA  1  
ATOM 2931   C C   . ASN A 1 464 ? 87.266  49.868  29.216  1.00 0.00 ? 464 ASN A C   1  
ATOM 2932   O O   . ASN A 1 464 ? 86.694  49.243  30.162  1.00 0.00 ? 464 ASN A O   1  
ATOM 2933   C CB  . ASN A 1 464 ? 89.681  49.832  28.957  1.00 0.00 ? 464 ASN A CB  1  
ATOM 2934   C CG  . ASN A 1 464 ? 90.030  49.361  30.403  1.00 0.00 ? 464 ASN A CG  1  
ATOM 2935   O OD1 . ASN A 1 464 ? 90.691  48.325  30.500  1.00 0.00 ? 464 ASN A OD1 1  
ATOM 2936   N ND2 . ASN A 1 464 ? 89.497  50.063  31.414  1.00 0.00 ? 464 ASN A ND2 1  
ATOM 2937   N N   . PHE A 1 465 ? 86.823  51.102  28.813  1.00 0.00 ? 465 PHE A N   1  
ATOM 2938   C CA  . PHE A 1 465 ? 85.752  51.750  29.531  1.00 0.00 ? 465 PHE A CA  1  
ATOM 2939   C C   . PHE A 1 465 ? 84.395  51.113  29.439  1.00 0.00 ? 465 PHE A C   1  
ATOM 2940   O O   . PHE A 1 465 ? 83.552  51.028  30.356  1.00 0.00 ? 465 PHE A O   1  
ATOM 2941   C CB  . PHE A 1 465 ? 85.682  53.343  29.250  1.00 0.00 ? 465 PHE A CB  1  
ATOM 2942   C CG  . PHE A 1 465 ? 85.042  53.650  27.804  1.00 0.00 ? 465 PHE A CG  1  
ATOM 2943   C CD1 . PHE A 1 465 ? 83.700  53.515  27.464  1.00 0.00 ? 465 PHE A CD1 1  
ATOM 2944   C CD2 . PHE A 1 465 ? 85.947  54.357  26.935  1.00 0.00 ? 465 PHE A CD2 1  
ATOM 2945   C CE1 . PHE A 1 465 ? 83.236  53.972  26.244  1.00 0.00 ? 465 PHE A CE1 1  
ATOM 2946   C CE2 . PHE A 1 465 ? 85.474  54.856  25.724  1.00 0.00 ? 465 PHE A CE2 1  
ATOM 2947   C CZ  . PHE A 1 465 ? 84.084  54.737  25.452  1.00 0.00 ? 465 PHE A CZ  1  
ATOM 2948   N N   . GLU A 1 466 ? 84.091  50.579  28.259  1.00 0.00 ? 466 GLU A N   1  
ATOM 2949   C CA  . GLU A 1 466 ? 82.879  49.824  28.000  1.00 0.00 ? 466 GLU A CA  1  
ATOM 2950   C C   . GLU A 1 466 ? 82.811  48.616  28.896  1.00 0.00 ? 466 GLU A C   1  
ATOM 2951   O O   . GLU A 1 466 ? 81.695  48.256  29.349  1.00 0.00 ? 466 GLU A O   1  
ATOM 2952   C CB  . GLU A 1 466 ? 82.910  49.329  26.490  1.00 0.00 ? 466 GLU A CB  1  
ATOM 2953   C CG  . GLU A 1 466 ? 82.918  50.570  25.592  1.00 0.00 ? 466 GLU A CG  1  
ATOM 2954   C CD  . GLU A 1 466 ? 83.229  50.246  24.145  1.00 0.00 ? 466 GLU A CD  1  
ATOM 2955   O OE1 . GLU A 1 466 ? 84.084  49.415  23.803  1.00 0.00 ? 466 GLU A OE1 1  
ATOM 2956   O OE2 . GLU A 1 466 ? 82.592  50.974  23.280  1.00 0.00 ? 466 GLU A OE2 1  
ATOM 2957   N N   . LEU A 1 467 ? 83.944  47.865  29.082  1.00 0.00 ? 467 LEU A N   1  
ATOM 2958   C CA  . LEU A 1 467 ? 83.890  46.652  29.862  1.00 0.00 ? 467 LEU A CA  1  
ATOM 2959   C C   . LEU A 1 467 ? 83.571  46.987  31.307  1.00 0.00 ? 467 LEU A C   1  
ATOM 2960   O O   . LEU A 1 467 ? 82.942  46.208  32.020  1.00 0.00 ? 467 LEU A O   1  
ATOM 2961   C CB  . LEU A 1 467 ? 85.181  45.788  29.947  1.00 0.00 ? 467 LEU A CB  1  
ATOM 2962   C CG  . LEU A 1 467 ? 85.888  45.628  28.502  1.00 0.00 ? 467 LEU A CG  1  
ATOM 2963   C CD1 . LEU A 1 467 ? 87.079  44.657  28.674  1.00 0.00 ? 467 LEU A CD1 1  
ATOM 2964   C CD2 . LEU A 1 467 ? 84.888  45.058  27.446  1.00 0.00 ? 467 LEU A CD2 1  
ATOM 2965   N N   . GLU A 1 468 ? 84.272  48.004  31.846  1.00 0.00 ? 468 GLU A N   1  
ATOM 2966   C CA  . GLU A 1 468 ? 84.347  48.229  33.222  1.00 0.00 ? 468 GLU A CA  1  
ATOM 2967   C C   . GLU A 1 468 ? 83.062  48.545  33.944  1.00 0.00 ? 468 GLU A C   1  
ATOM 2968   O O   . GLU A 1 468 ? 82.883  48.244  35.127  1.00 0.00 ? 468 GLU A O   1  
ATOM 2969   C CB  . GLU A 1 468 ? 85.423  49.390  33.449  1.00 0.00 ? 468 GLU A CB  1  
ATOM 2970   C CG  . GLU A 1 468 ? 85.644  49.885  34.881  1.00 0.00 ? 468 GLU A CG  1  
ATOM 2971   C CD  . GLU A 1 468 ? 86.690  51.016  34.956  1.00 0.00 ? 468 GLU A CD  1  
ATOM 2972   O OE1 . GLU A 1 468 ? 87.890  50.652  34.815  1.00 0.00 ? 468 GLU A OE1 1  
ATOM 2973   O OE2 . GLU A 1 468 ? 86.305  52.240  34.950  1.00 0.00 ? 468 GLU A OE2 1  
ATOM 2974   N N   . ARG A 1 469 ? 82.101  49.290  33.267  1.00 0.00 ? 469 ARG A N   1  
ATOM 2975   C CA  . ARG A 1 469 ? 80.842  49.720  33.808  1.00 0.00 ? 469 ARG A CA  1  
ATOM 2976   C C   . ARG A 1 469 ? 79.888  48.537  33.790  1.00 0.00 ? 469 ARG A C   1  
ATOM 2977   O O   . ARG A 1 469 ? 78.812  48.564  34.358  1.00 0.00 ? 469 ARG A O   1  
ATOM 2978   C CB  . ARG A 1 469 ? 80.198  50.825  33.120  1.00 0.00 ? 469 ARG A CB  1  
ATOM 2979   C CG  . ARG A 1 469 ? 81.067  52.141  33.425  1.00 0.00 ? 469 ARG A CG  1  
ATOM 2980   C CD  . ARG A 1 469 ? 81.131  52.621  34.882  1.00 0.00 ? 469 ARG A CD  1  
ATOM 2981   N NE  . ARG A 1 469 ? 79.767  52.569  35.513  1.00 0.00 ? 469 ARG A NE  1  
ATOM 2982   C CZ  . ARG A 1 469 ? 79.604  53.043  36.760  1.00 0.00 ? 469 ARG A CZ  1  
ATOM 2983   N NH1 . ARG A 1 469 ? 80.563  53.876  37.290  1.00 0.00 ? 469 ARG A NH1 1  
ATOM 2984   N NH2 . ARG A 1 469 ? 78.471  52.817  37.477  1.00 0.00 ? 469 ARG A NH2 1  
ATOM 2985   N N   . GLN A 1 470 ? 80.248  47.478  33.020  1.00 0.00 ? 470 GLN A N   1  
ATOM 2986   C CA  . GLN A 1 470 ? 79.598  46.265  32.786  1.00 0.00 ? 470 GLN A CA  1  
ATOM 2987   C C   . GLN A 1 470 ? 78.341  46.412  31.958  1.00 0.00 ? 470 GLN A C   1  
ATOM 2988   O O   . GLN A 1 470 ? 78.264  47.400  31.171  1.00 0.00 ? 470 GLN A O   1  
ATOM 2989   C CB  . GLN A 1 470 ? 79.494  45.259  34.050  1.00 0.00 ? 470 GLN A CB  1  
ATOM 2990   C CG  . GLN A 1 470 ? 80.751  45.393  34.900  1.00 0.00 ? 470 GLN A CG  1  
ATOM 2991   C CD  . GLN A 1 470 ? 80.781  44.215  35.911  1.00 0.00 ? 470 GLN A CD  1  
ATOM 2992   O OE1 . GLN A 1 470 ? 81.569  43.279  35.959  1.00 0.00 ? 470 GLN A OE1 1  
ATOM 2993   N NE2 . GLN A 1 470 ? 79.747  44.288  36.819  1.00 0.00 ? 470 GLN A NE2 1  
ATOM 2994   N N   . SER A 1 471 ? 77.362  45.535  32.207  1.00 0.00 ? 471 SER A N   1  
ATOM 2995   C CA  . SER A 1 471 ? 76.026  45.590  31.695  1.00 0.00 ? 471 SER A CA  1  
ATOM 2996   C C   . SER A 1 471 ? 75.116  46.506  32.460  1.00 0.00 ? 471 SER A C   1  
ATOM 2997   O O   . SER A 1 471 ? 75.194  46.783  33.667  1.00 0.00 ? 471 SER A O   1  
ATOM 2998   C CB  . SER A 1 471 ? 75.394  44.219  31.727  1.00 0.00 ? 471 SER A CB  1  
ATOM 2999   O OG  . SER A 1 471 ? 74.552  43.932  30.645  1.00 0.00 ? 471 SER A OG  1  
ATOM 3000   N N   . GLU A 1 472 ? 74.175  47.046  31.704  1.00 0.00 ? 472 GLU A N   1  
ATOM 3001   C CA  . GLU A 1 472 ? 73.183  47.950  32.164  1.00 0.00 ? 472 GLU A CA  1  
ATOM 3002   C C   . GLU A 1 472 ? 72.117  48.078  31.182  1.00 0.00 ? 472 GLU A C   1  
ATOM 3003   O O   . GLU A 1 472 ? 71.096  48.688  31.581  1.00 0.00 ? 472 GLU A O   1  
ATOM 3004   C CB  . GLU A 1 472 ? 73.719  49.443  32.360  1.00 0.00 ? 472 GLU A CB  1  
ATOM 3005   C CG  . GLU A 1 472 ? 74.240  50.161  31.074  1.00 0.00 ? 472 GLU A CG  1  
ATOM 3006   C CD  . GLU A 1 472 ? 74.654  51.661  31.297  1.00 0.00 ? 472 GLU A CD  1  
ATOM 3007   O OE1 . GLU A 1 472 ? 74.470  52.109  32.428  1.00 0.00 ? 472 GLU A OE1 1  
ATOM 3008   O OE2 . GLU A 1 472 ? 75.319  52.237  30.443  1.00 0.00 ? 472 GLU A OE2 1  
ATOM 3009   N N   . ASN A 1 473 ? 72.143  47.395  30.035  1.00 0.00 ? 473 ASN A N   1  
ATOM 3010   C CA  . ASN A 1 473 ? 71.188  47.508  28.931  1.00 0.00 ? 473 ASN A CA  1  
ATOM 3011   C C   . ASN A 1 473 ? 71.021  46.026  28.524  1.00 0.00 ? 473 ASN A C   1  
ATOM 3012   O O   . ASN A 1 473 ? 72.073  45.409  28.547  1.00 0.00 ? 473 ASN A O   1  
ATOM 3013   C CB  . ASN A 1 473 ? 71.486  48.354  27.622  1.00 0.00 ? 473 ASN A CB  1  
ATOM 3014   C CG  . ASN A 1 473 ? 71.761  49.842  27.880  1.00 0.00 ? 473 ASN A CG  1  
ATOM 3015   O OD1 . ASN A 1 473 ? 72.824  50.384  27.670  1.00 0.00 ? 473 ASN A OD1 1  
ATOM 3016   N ND2 . ASN A 1 473 ? 70.636  50.455  28.356  1.00 0.00 ? 473 ASN A ND2 1  
ATOM 3017   N N   . PRO A 1 474 ? 69.892  45.390  28.099  1.00 0.00 ? 474 PRO A N   1  
ATOM 3018   C CA  . PRO A 1 474 ? 69.857  44.005  27.719  1.00 0.00 ? 474 PRO A CA  1  
ATOM 3019   C C   . PRO A 1 474 ? 70.725  43.617  26.522  1.00 0.00 ? 474 PRO A C   1  
ATOM 3020   O O   . PRO A 1 474 ? 71.122  42.455  26.413  1.00 0.00 ? 474 PRO A O   1  
ATOM 3021   C CB  . PRO A 1 474 ? 68.342  43.712  27.456  1.00 0.00 ? 474 PRO A CB  1  
ATOM 3022   C CG  . PRO A 1 474 ? 67.739  45.085  27.117  1.00 0.00 ? 474 PRO A CG  1  
ATOM 3023   C CD  . PRO A 1 474 ? 68.615  46.005  28.001  1.00 0.00 ? 474 PRO A CD  1  
ATOM 3024   N N   . ASN A 1 475 ? 70.924  44.664  25.674  1.00 0.00 ? 475 ASN A N   1  
ATOM 3025   C CA  . ASN A 1 475 ? 71.642  44.567  24.455  1.00 0.00 ? 475 ASN A CA  1  
ATOM 3026   C C   . ASN A 1 475 ? 72.847  45.570  24.598  1.00 0.00 ? 475 ASN A C   1  
ATOM 3027   O O   . ASN A 1 475 ? 72.620  46.752  24.873  1.00 0.00 ? 475 ASN A O   1  
ATOM 3028   C CB  . ASN A 1 475 ? 70.817  45.186  23.324  1.00 0.00 ? 475 ASN A CB  1  
ATOM 3029   C CG  . ASN A 1 475 ? 69.690  44.209  22.983  1.00 0.00 ? 475 ASN A CG  1  
ATOM 3030   O OD1 . ASN A 1 475 ? 68.682  44.201  23.703  1.00 0.00 ? 475 ASN A OD1 1  
ATOM 3031   N ND2 . ASN A 1 475 ? 69.842  43.417  21.846  1.00 0.00 ? 475 ASN A ND2 1  
ATOM 3032   N N   . ASN A 1 476 ? 74.082  45.078  24.413  1.00 0.00 ? 476 ASN A N   1  
ATOM 3033   C CA  . ASN A 1 476 ? 75.272  45.774  24.457  1.00 0.00 ? 476 ASN A CA  1  
ATOM 3034   C C   . ASN A 1 476 ? 75.822  45.726  23.015  1.00 0.00 ? 476 ASN A C   1  
ATOM 3035   O O   . ASN A 1 476 ? 76.975  45.443  22.824  1.00 0.00 ? 476 ASN A O   1  
ATOM 3036   C CB  . ASN A 1 476 ? 76.378  45.215  25.311  1.00 0.00 ? 476 ASN A CB  1  
ATOM 3037   C CG  . ASN A 1 476 ? 76.194  45.257  26.872  1.00 0.00 ? 476 ASN A CG  1  
ATOM 3038   O OD1 . ASN A 1 476 ? 76.255  46.352  27.372  1.00 0.00 ? 476 ASN A OD1 1  
ATOM 3039   N ND2 . ASN A 1 476 ? 75.928  44.120  27.559  1.00 0.00 ? 476 ASN A ND2 1  
ATOM 3040   N N   . LEU A 1 477 ? 74.937  45.939  21.989  1.00 0.00 ? 477 LEU A N   1  
ATOM 3041   C CA  . LEU A 1 477 ? 75.298  46.081  20.556  1.00 0.00 ? 477 LEU A CA  1  
ATOM 3042   C C   . LEU A 1 477 ? 76.112  47.287  20.364  1.00 0.00 ? 477 LEU A C   1  
ATOM 3043   O O   . LEU A 1 477 ? 77.040  47.242  19.614  1.00 0.00 ? 477 LEU A O   1  
ATOM 3044   C CB  . LEU A 1 477 ? 74.084  46.152  19.694  1.00 0.00 ? 477 LEU A CB  1  
ATOM 3045   C CG  . LEU A 1 477 ? 73.169  44.870  19.823  1.00 0.00 ? 477 LEU A CG  1  
ATOM 3046   C CD1 . LEU A 1 477 ? 71.682  45.047  19.509  1.00 0.00 ? 477 LEU A CD1 1  
ATOM 3047   C CD2 . LEU A 1 477 ? 73.765  43.586  19.093  1.00 0.00 ? 477 LEU A CD2 1  
ATOM 3048   N N   . MET A 1 478 ? 75.698  48.289  21.139  1.00 0.00 ? 478 MET A N   1  
ATOM 3049   C CA  . MET A 1 478 ? 76.389  49.592  21.077  1.00 0.00 ? 478 MET A CA  1  
ATOM 3050   C C   . MET A 1 478 ? 77.850  49.529  21.556  1.00 0.00 ? 478 MET A C   1  
ATOM 3051   O O   . MET A 1 478 ? 78.716  50.122  20.952  1.00 0.00 ? 478 MET A O   1  
ATOM 3052   C CB  . MET A 1 478 ? 75.634  50.721  21.822  1.00 0.00 ? 478 MET A CB  1  
ATOM 3053   C CG  . MET A 1 478 ? 74.324  51.078  21.108  1.00 0.00 ? 478 MET A CG  1  
ATOM 3054   S SD  . MET A 1 478 ? 74.516  51.744  19.405  1.00 0.00 ? 478 MET A SD  1  
ATOM 3055   C CE  . MET A 1 478 ? 73.362  50.658  18.623  1.00 0.00 ? 478 MET A CE  1  
ATOM 3056   N N   . ARG A 1 479 ? 78.069  48.861  22.738  1.00 0.00 ? 479 ARG A N   1  
ATOM 3057   C CA  . ARG A 1 479 ? 79.319  48.812  23.475  1.00 0.00 ? 479 ARG A CA  1  
ATOM 3058   C C   . ARG A 1 479 ? 80.263  48.100  22.586  1.00 0.00 ? 479 ARG A C   1  
ATOM 3059   O O   . ARG A 1 479 ? 81.360  48.610  22.230  1.00 0.00 ? 479 ARG A O   1  
ATOM 3060   C CB  . ARG A 1 479 ? 79.178  47.934  24.774  1.00 0.00 ? 479 ARG A CB  1  
ATOM 3061   C CG  . ARG A 1 479 ? 78.223  48.533  25.810  1.00 0.00 ? 479 ARG A CG  1  
ATOM 3062   C CD  . ARG A 1 479 ? 78.624  49.913  26.357  1.00 0.00 ? 479 ARG A CD  1  
ATOM 3063   N NE  . ARG A 1 479 ? 78.309  50.070  27.773  1.00 0.00 ? 479 ARG A NE  1  
ATOM 3064   C CZ  . ARG A 1 479 ? 78.825  51.067  28.572  1.00 0.00 ? 479 ARG A CZ  1  
ATOM 3065   N NH1 . ARG A 1 479 ? 79.739  51.994  28.064  1.00 0.00 ? 479 ARG A NH1 1  
ATOM 3066   N NH2 . ARG A 1 479 ? 78.355  51.029  29.831  1.00 0.00 ? 479 ARG A NH2 1  
ATOM 3067   N N   . GLN A 1 480 ? 79.998  46.910  22.064  1.00 0.00 ? 480 GLN A N   1  
ATOM 3068   C CA  . GLN A 1 480 ? 80.896  46.067  21.246  1.00 0.00 ? 480 GLN A CA  1  
ATOM 3069   C C   . GLN A 1 480 ? 81.222  46.491  19.868  1.00 0.00 ? 480 GLN A C   1  
ATOM 3070   O O   . GLN A 1 480 ? 82.396  46.548  19.475  1.00 0.00 ? 480 GLN A O   1  
ATOM 3071   C CB  . GLN A 1 480 ? 80.218  44.709  21.132  1.00 0.00 ? 480 GLN A CB  1  
ATOM 3072   C CG  . GLN A 1 480 ? 80.784  43.679  20.132  1.00 0.00 ? 480 GLN A CG  1  
ATOM 3073   C CD  . GLN A 1 480 ? 79.893  42.347  20.074  1.00 0.00 ? 480 GLN A CD  1  
ATOM 3074   O OE1 . GLN A 1 480 ? 78.752  42.403  20.467  1.00 0.00 ? 480 GLN A OE1 1  
ATOM 3075   N NE2 . GLN A 1 480 ? 80.530  41.295  19.471  1.00 0.00 ? 480 GLN A NE2 1  
ATOM 3076   N N   . LEU A 1 481 ? 80.157  46.839  19.062  1.00 0.00 ? 481 LEU A N   1  
ATOM 3077   C CA  . LEU A 1 481 ? 80.183  47.079  17.592  1.00 0.00 ? 481 LEU A CA  1  
ATOM 3078   C C   . LEU A 1 481 ? 80.725  48.395  17.268  1.00 0.00 ? 481 LEU A C   1  
ATOM 3079   O O   . LEU A 1 481 ? 81.320  48.629  16.229  1.00 0.00 ? 481 LEU A O   1  
ATOM 3080   C CB  . LEU A 1 481 ? 78.764  47.070  16.924  1.00 0.00 ? 481 LEU A CB  1  
ATOM 3081   C CG  . LEU A 1 481 ? 78.017  45.755  17.030  1.00 0.00 ? 481 LEU A CG  1  
ATOM 3082   C CD1 . LEU A 1 481 ? 76.607  45.954  16.316  1.00 0.00 ? 481 LEU A CD1 1  
ATOM 3083   C CD2 . LEU A 1 481 ? 78.739  44.559  16.442  1.00 0.00 ? 481 LEU A CD2 1  
ATOM 3084   N N   . LEU A 1 482 ? 80.589  49.318  18.269  1.00 0.00 ? 482 LEU A N   1  
ATOM 3085   C CA  . LEU A 1 482 ? 81.239  50.604  18.226  1.00 0.00 ? 482 LEU A CA  1  
ATOM 3086   C C   . LEU A 1 482 ? 82.696  50.459  18.306  1.00 0.00 ? 482 LEU A C   1  
ATOM 3087   O O   . LEU A 1 482 ? 83.300  49.817  19.114  1.00 0.00 ? 482 LEU A O   1  
ATOM 3088   C CB  . LEU A 1 482 ? 80.699  51.530  19.371  1.00 0.00 ? 482 LEU A CB  1  
ATOM 3089   C CG  . LEU A 1 482 ? 81.107  53.017  19.250  1.00 0.00 ? 482 LEU A CG  1  
ATOM 3090   C CD1 . LEU A 1 482 ? 80.535  53.577  17.949  1.00 0.00 ? 482 LEU A CD1 1  
ATOM 3091   C CD2 . LEU A 1 482 ? 80.613  53.956  20.437  1.00 0.00 ? 482 LEU A CD2 1  
ATOM 3092   N N   . MET A 1 483 ? 83.301  51.126  17.322  1.00 0.00 ? 483 MET A N   1  
ATOM 3093   C CA  . MET A 1 483 ? 84.773  51.120  17.077  1.00 0.00 ? 483 MET A CA  1  
ATOM 3094   C C   . MET A 1 483 ? 85.240  52.476  16.799  1.00 0.00 ? 483 MET A C   1  
ATOM 3095   O O   . MET A 1 483 ? 84.538  53.368  16.447  1.00 0.00 ? 483 MET A O   1  
ATOM 3096   C CB  . MET A 1 483 ? 85.181  50.160  15.944  1.00 0.00 ? 483 MET A CB  1  
ATOM 3097   C CG  . MET A 1 483 ? 85.285  48.654  16.464  1.00 0.00 ? 483 MET A CG  1  
ATOM 3098   S SD  . MET A 1 483 ? 86.576  48.281  17.741  1.00 0.00 ? 483 MET A SD  1  
ATOM 3099   C CE  . MET A 1 483 ? 87.862  48.673  16.568  1.00 0.00 ? 483 MET A CE  1  
ATOM 3100   N N   . ILE A 1 484 ? 86.547  52.644  16.993  1.00 0.00 ? 484 ILE A N   1  
ATOM 3101   C CA  . ILE A 1 484 ? 87.192  53.879  16.804  1.00 0.00 ? 484 ILE A CA  1  
ATOM 3102   C C   . ILE A 1 484 ? 87.981  53.676  15.605  1.00 0.00 ? 484 ILE A C   1  
ATOM 3103   O O   . ILE A 1 484 ? 88.554  52.627  15.372  1.00 0.00 ? 484 ILE A O   1  
ATOM 3104   C CB  . ILE A 1 484 ? 88.032  54.256  17.985  1.00 0.00 ? 484 ILE A CB  1  
ATOM 3105   C CG1 . ILE A 1 484 ? 88.572  55.722  17.881  1.00 0.00 ? 484 ILE A CG1 1  
ATOM 3106   C CG2 . ILE A 1 484 ? 89.139  53.266  18.352  1.00 0.00 ? 484 ILE A CG2 1  
ATOM 3107   C CD1 . ILE A 1 484 ? 89.441  56.157  19.073  1.00 0.00 ? 484 ILE A CD1 1  
ATOM 3108   N N   . GLN A 1 485 ? 87.914  54.735  14.738  1.00 0.00 ? 485 GLN A N   1  
ATOM 3109   C CA  . GLN A 1 485 ? 88.420  54.730  13.442  1.00 0.00 ? 485 GLN A CA  1  
ATOM 3110   C C   . GLN A 1 485 ? 89.514  55.751  13.457  1.00 0.00 ? 485 GLN A C   1  
ATOM 3111   O O   . GLN A 1 485 ? 89.535  56.714  14.249  1.00 0.00 ? 485 GLN A O   1  
ATOM 3112   C CB  . GLN A 1 485 ? 87.295  55.068  12.538  1.00 0.00 ? 485 GLN A CB  1  
ATOM 3113   C CG  . GLN A 1 485 ? 87.661  55.065  11.045  1.00 0.00 ? 485 GLN A CG  1  
ATOM 3114   C CD  . GLN A 1 485 ? 87.999  53.623  10.506  1.00 0.00 ? 485 GLN A CD  1  
ATOM 3115   O OE1 . GLN A 1 485 ? 87.264  53.060  9.702   1.00 0.00 ? 485 GLN A OE1 1  
ATOM 3116   N NE2 . GLN A 1 485 ? 89.160  53.051  10.881  1.00 0.00 ? 485 GLN A NE2 1  
ATOM 3117   N N   . PHE A 1 486 ? 90.605  55.677  12.564  1.00 0.00 ? 486 PHE A N   1  
ATOM 3118   C CA  . PHE A 1 486 ? 91.623  56.704  12.476  1.00 0.00 ? 486 PHE A CA  1  
ATOM 3119   C C   . PHE A 1 486 ? 91.707  57.059  11.070  1.00 0.00 ? 486 PHE A C   1  
ATOM 3120   O O   . PHE A 1 486 ? 91.736  56.211  10.196  1.00 0.00 ? 486 PHE A O   1  
ATOM 3121   C CB  . PHE A 1 486 ? 92.958  56.274  13.066  1.00 0.00 ? 486 PHE A CB  1  
ATOM 3122   C CG  . PHE A 1 486 ? 92.933  55.921  14.505  1.00 0.00 ? 486 PHE A CG  1  
ATOM 3123   C CD1 . PHE A 1 486 ? 92.836  56.956  15.459  1.00 0.00 ? 486 PHE A CD1 1  
ATOM 3124   C CD2 . PHE A 1 486 ? 93.021  54.570  14.953  1.00 0.00 ? 486 PHE A CD2 1  
ATOM 3125   C CE1 . PHE A 1 486 ? 92.523  56.648  16.776  1.00 0.00 ? 486 PHE A CE1 1  
ATOM 3126   C CE2 . PHE A 1 486 ? 92.890  54.240  16.345  1.00 0.00 ? 486 PHE A CE2 1  
ATOM 3127   C CZ  . PHE A 1 486 ? 92.518  55.259  17.198  1.00 0.00 ? 486 PHE A CZ  1  
ATOM 3128   N N   . ASP A 1 487 ? 91.786  58.374  10.732  1.00 0.00 ? 487 ASP A N   1  
ATOM 3129   C CA  . ASP A 1 487 ? 91.987  58.905  9.413   1.00 0.00 ? 487 ASP A CA  1  
ATOM 3130   C C   . ASP A 1 487 ? 93.334  58.583  8.899   1.00 0.00 ? 487 ASP A C   1  
ATOM 3131   O O   . ASP A 1 487 ? 93.550  58.023  7.822   1.00 0.00 ? 487 ASP A O   1  
ATOM 3132   C CB  . ASP A 1 487 ? 91.713  60.421  9.249   1.00 0.00 ? 487 ASP A CB  1  
ATOM 3133   C CG  . ASP A 1 487 ? 90.261  60.809  9.730   1.00 0.00 ? 487 ASP A CG  1  
ATOM 3134   O OD1 . ASP A 1 487 ? 89.315  60.548  8.931   1.00 0.00 ? 487 ASP A OD1 1  
ATOM 3135   O OD2 . ASP A 1 487 ? 90.052  61.288  10.902  1.00 0.00 ? 487 ASP A OD2 1  
ATOM 3136   N N   . THR A 1 488 ? 94.309  58.782  9.776   1.00 0.00 ? 488 THR A N   1  
ATOM 3137   C CA  . THR A 1 488 ? 95.689  58.513  9.423   1.00 0.00 ? 488 THR A CA  1  
ATOM 3138   C C   . THR A 1 488 ? 96.276  57.741  10.609  1.00 0.00 ? 488 THR A C   1  
ATOM 3139   O O   . THR A 1 488 ? 95.909  57.956  11.754  1.00 0.00 ? 488 THR A O   1  
ATOM 3140   C CB  . THR A 1 488 ? 96.506  59.774  9.190   1.00 0.00 ? 488 THR A CB  1  
ATOM 3141   O OG1 . THR A 1 488 ? 97.823  59.367  8.696   1.00 0.00 ? 488 THR A OG1 1  
ATOM 3142   C CG2 . THR A 1 488 ? 96.772  60.648  10.410  1.00 0.00 ? 488 THR A CG2 1  
ATOM 3143   N N   . GLU A 1 489 ? 97.220  56.827  10.326  1.00 0.00 ? 489 GLU A N   1  
ATOM 3144   C CA  . GLU A 1 489 ? 97.871  55.944  11.287  1.00 0.00 ? 489 GLU A CA  1  
ATOM 3145   C C   . GLU A 1 489 ? 96.961  54.836  11.862  1.00 0.00 ? 489 GLU A C   1  
ATOM 3146   O O   . GLU A 1 489 ? 96.968  54.507  13.092  1.00 0.00 ? 489 GLU A O   1  
ATOM 3147   C CB  . GLU A 1 489 ? 98.798  56.601  12.315  1.00 0.00 ? 489 GLU A CB  1  
ATOM 3148   C CG  . GLU A 1 489 ? 99.997  57.372  11.667  1.00 0.00 ? 489 GLU A CG  1  
ATOM 3149   C CD  . GLU A 1 489 ? 101.118 57.847  12.657  1.00 0.00 ? 489 GLU A CD  1  
ATOM 3150   O OE1 . GLU A 1 489 ? 101.609 56.959  13.414  1.00 0.00 ? 489 GLU A OE1 1  
ATOM 3151   O OE2 . GLU A 1 489 ? 101.523 59.036  12.466  1.00 0.00 ? 489 GLU A OE2 1  
ATOM 3152   N N   . THR A 1 490 ? 96.053  54.260  11.051  1.00 0.00 ? 490 THR A N   1  
ATOM 3153   C CA  . THR A 1 490 ? 95.075  53.276  11.524  1.00 0.00 ? 490 THR A CA  1  
ATOM 3154   C C   . THR A 1 490 ? 95.627  51.912  11.911  1.00 0.00 ? 490 THR A C   1  
ATOM 3155   O O   . THR A 1 490 ? 96.868  51.723  11.800  1.00 0.00 ? 490 THR A O   1  
ATOM 3156   C CB  . THR A 1 490 ? 93.816  53.234  10.660  1.00 0.00 ? 490 THR A CB  1  
ATOM 3157   O OG1 . THR A 1 490 ? 92.818  52.377  11.206  1.00 0.00 ? 490 THR A OG1 1  
ATOM 3158   C CG2 . THR A 1 490 ? 94.047  52.912  9.233   1.00 0.00 ? 490 THR A CG2 1  
ATOM 3159   N N   . LYS A 1 554 ? 94.914  68.026  11.505  1.00 0.00 ? 554 LYS A N   1  
ATOM 3160   C CA  . LYS A 1 554 ? 95.696  68.909  12.462  1.00 0.00 ? 554 LYS A CA  1  
ATOM 3161   C C   . LYS A 1 554 ? 96.242  68.016  13.586  1.00 0.00 ? 554 LYS A C   1  
ATOM 3162   O O   . LYS A 1 554 ? 97.196  67.281  13.310  1.00 0.00 ? 554 LYS A O   1  
ATOM 3163   C CB  . LYS A 1 554 ? 94.845  70.052  12.936  1.00 0.00 ? 554 LYS A CB  1  
ATOM 3164   C CG  . LYS A 1 554 ? 94.446  71.063  11.841  1.00 0.00 ? 554 LYS A CG  1  
ATOM 3165   C CD  . LYS A 1 554 ? 93.659  72.264  12.400  1.00 0.00 ? 554 LYS A CD  1  
ATOM 3166   C CE  . LYS A 1 554 ? 93.439  73.306  11.273  1.00 0.00 ? 554 LYS A CE  1  
ATOM 3167   N NZ  . LYS A 1 554 ? 94.543  74.280  11.215  1.00 0.00 ? 554 LYS A NZ  1  
ATOM 3168   N N   . SER A 1 555 ? 95.688  68.167  14.870  1.00 0.00 ? 555 SER A N   1  
ATOM 3169   C CA  . SER A 1 555 ? 96.236  67.379  16.008  1.00 0.00 ? 555 SER A CA  1  
ATOM 3170   C C   . SER A 1 555 ? 95.580  65.941  16.170  1.00 0.00 ? 555 SER A C   1  
ATOM 3171   O O   . SER A 1 555 ? 95.005  65.517  15.235  1.00 0.00 ? 555 SER A O   1  
ATOM 3172   C CB  . SER A 1 555 ? 96.167  68.066  17.358  1.00 0.00 ? 555 SER A CB  1  
ATOM 3173   O OG  . SER A 1 555 ? 94.946  68.681  17.679  1.00 0.00 ? 555 SER A OG  1  
ATOM 3174   N N   . ALA A 1 556 ? 95.808  65.233  17.294  1.00 0.00 ? 556 ALA A N   1  
ATOM 3175   C CA  . ALA A 1 556 ? 95.266  63.920  17.457  1.00 0.00 ? 556 ALA A CA  1  
ATOM 3176   C C   . ALA A 1 556 ? 93.745  63.958  17.516  1.00 0.00 ? 556 ALA A C   1  
ATOM 3177   O O   . ALA A 1 556 ? 93.163  63.072  16.894  1.00 0.00 ? 556 ALA A O   1  
ATOM 3178   C CB  . ALA A 1 556 ? 95.857  63.111  18.615  1.00 0.00 ? 556 ALA A CB  1  
ATOM 3179   N N   . ILE A 1 557 ? 93.121  64.958  18.248  1.00 0.00 ? 557 ILE A N   1  
ATOM 3180   C CA  . ILE A 1 557 ? 91.699  65.045  18.472  1.00 0.00 ? 557 ILE A CA  1  
ATOM 3181   C C   . ILE A 1 557 ? 90.918  65.143  17.193  1.00 0.00 ? 557 ILE A C   1  
ATOM 3182   O O   . ILE A 1 557 ? 89.903  64.460  17.067  1.00 0.00 ? 557 ILE A O   1  
ATOM 3183   C CB  . ILE A 1 557 ? 91.329  66.125  19.417  1.00 0.00 ? 557 ILE A CB  1  
ATOM 3184   C CG1 . ILE A 1 557 ? 91.595  67.598  19.137  1.00 0.00 ? 557 ILE A CG1 1  
ATOM 3185   C CG2 . ILE A 1 557 ? 92.140  65.732  20.734  1.00 0.00 ? 557 ILE A CG2 1  
ATOM 3186   C CD1 . ILE A 1 557 ? 91.127  68.544  20.256  1.00 0.00 ? 557 ILE A CD1 1  
ATOM 3187   N N   . TYR A 1 558 ? 91.412  65.894  16.211  1.00 0.00 ? 558 TYR A N   1  
ATOM 3188   C CA  . TYR A 1 558 ? 90.750  66.035  14.922  1.00 0.00 ? 558 TYR A CA  1  
ATOM 3189   C C   . TYR A 1 558 ? 90.685  64.641  14.218  1.00 0.00 ? 558 TYR A C   1  
ATOM 3190   O O   . TYR A 1 558 ? 89.660  64.281  13.655  1.00 0.00 ? 558 TYR A O   1  
ATOM 3191   C CB  . TYR A 1 558 ? 91.663  66.955  14.158  1.00 0.00 ? 558 TYR A CB  1  
ATOM 3192   C CG  . TYR A 1 558 ? 90.964  67.702  13.006  1.00 0.00 ? 558 TYR A CG  1  
ATOM 3193   C CD1 . TYR A 1 558 ? 90.808  67.191  11.717  1.00 0.00 ? 558 TYR A CD1 1  
ATOM 3194   C CD2 . TYR A 1 558 ? 90.597  69.072  13.252  1.00 0.00 ? 558 TYR A CD2 1  
ATOM 3195   C CE1 . TYR A 1 558 ? 90.275  67.941  10.683  1.00 0.00 ? 558 TYR A CE1 1  
ATOM 3196   C CE2 . TYR A 1 558 ? 90.104  69.860  12.233  1.00 0.00 ? 558 TYR A CE2 1  
ATOM 3197   C CZ  . TYR A 1 558 ? 89.929  69.247  10.981  1.00 0.00 ? 558 TYR A CZ  1  
ATOM 3198   O OH  . TYR A 1 558 ? 89.247  69.954  10.037  1.00 0.00 ? 558 TYR A OH  1  
ATOM 3199   N N   . HIS A 1 559 ? 91.803  63.814  14.276  1.00 0.00 ? 559 HIS A N   1  
ATOM 3200   C CA  . HIS A 1 559 ? 91.893  62.508  13.627  1.00 0.00 ? 559 HIS A CA  1  
ATOM 3201   C C   . HIS A 1 559 ? 91.029  61.392  14.186  1.00 0.00 ? 559 HIS A C   1  
ATOM 3202   O O   . HIS A 1 559 ? 90.720  60.458  13.454  1.00 0.00 ? 559 HIS A O   1  
ATOM 3203   C CB  . HIS A 1 559 ? 93.338  61.913  13.641  1.00 0.00 ? 559 HIS A CB  1  
ATOM 3204   C CG  . HIS A 1 559 ? 94.380  62.747  13.008  1.00 0.00 ? 559 HIS A CG  1  
ATOM 3205   N ND1 . HIS A 1 559 ? 95.755  62.416  13.129  1.00 0.00 ? 559 HIS A ND1 1  
ATOM 3206   C CD2 . HIS A 1 559 ? 94.290  64.022  12.509  1.00 0.00 ? 559 HIS A CD2 1  
ATOM 3207   C CE1 . HIS A 1 559 ? 96.412  63.576  12.671  1.00 0.00 ? 559 HIS A CE1 1  
ATOM 3208   N NE2 . HIS A 1 559 ? 95.600  64.517  12.287  1.00 0.00 ? 559 HIS A NE2 1  
ATOM 3209   N N   . LEU A 1 560 ? 90.492  61.474  15.429  1.00 0.00 ? 560 LEU A N   1  
ATOM 3210   C CA  . LEU A 1 560 ? 89.651  60.468  16.045  1.00 0.00 ? 560 LEU A CA  1  
ATOM 3211   C C   . LEU A 1 560 ? 88.346  60.415  15.310  1.00 0.00 ? 560 LEU A C   1  
ATOM 3212   O O   . LEU A 1 560 ? 87.993  61.456  14.801  1.00 0.00 ? 560 LEU A O   1  
ATOM 3213   C CB  . LEU A 1 560 ? 89.330  60.742  17.559  1.00 0.00 ? 560 LEU A CB  1  
ATOM 3214   C CG  . LEU A 1 560 ? 90.364  60.159  18.561  1.00 0.00 ? 560 LEU A CG  1  
ATOM 3215   C CD1 . LEU A 1 560 ? 91.762  60.503  18.147  1.00 0.00 ? 560 LEU A CD1 1  
ATOM 3216   C CD2 . LEU A 1 560 ? 89.975  60.617  20.019  1.00 0.00 ? 560 LEU A CD2 1  
ATOM 3217   N N   . LYS A 1 561 ? 87.695  59.256  15.063  1.00 0.00 ? 561 LYS A N   1  
ATOM 3218   C CA  . LYS A 1 561 ? 86.568  59.115  14.155  1.00 0.00 ? 561 LYS A CA  1  
ATOM 3219   C C   . LYS A 1 561 ? 85.841  57.921  14.666  1.00 0.00 ? 561 LYS A C   1  
ATOM 3220   O O   . LYS A 1 561 ? 86.454  57.179  15.424  1.00 0.00 ? 561 LYS A O   1  
ATOM 3221   C CB  . LYS A 1 561 ? 87.158  58.921  12.705  1.00 0.00 ? 561 LYS A CB  1  
ATOM 3222   C CG  . LYS A 1 561 ? 86.179  58.878  11.503  1.00 0.00 ? 561 LYS A CG  1  
ATOM 3223   C CD  . LYS A 1 561 ? 86.777  58.798  10.126  1.00 0.00 ? 561 LYS A CD  1  
ATOM 3224   C CE  . LYS A 1 561 ? 85.698  58.509  9.038   1.00 0.00 ? 561 LYS A CE  1  
ATOM 3225   N NZ  . LYS A 1 561 ? 84.857  59.737  8.986   1.00 0.00 ? 561 LYS A NZ  1  
ATOM 3226   N N   . PHE A 1 562 ? 84.496  57.647  14.350  1.00 0.00 ? 562 PHE A N   1  
ATOM 3227   C CA  . PHE A 1 562 ? 83.803  56.459  14.817  1.00 0.00 ? 562 PHE A CA  1  
ATOM 3228   C C   . PHE A 1 562 ? 83.306  55.653  13.657  1.00 0.00 ? 562 PHE A C   1  
ATOM 3229   O O   . PHE A 1 562 ? 82.769  56.244  12.747  1.00 0.00 ? 562 PHE A O   1  
ATOM 3230   C CB  . PHE A 1 562 ? 82.708  56.857  15.761  1.00 0.00 ? 562 PHE A CB  1  
ATOM 3231   C CG  . PHE A 1 562 ? 83.351  57.597  16.954  1.00 0.00 ? 562 PHE A CG  1  
ATOM 3232   C CD1 . PHE A 1 562 ? 84.029  56.826  17.913  1.00 0.00 ? 562 PHE A CD1 1  
ATOM 3233   C CD2 . PHE A 1 562 ? 83.378  58.977  17.096  1.00 0.00 ? 562 PHE A CD2 1  
ATOM 3234   C CE1 . PHE A 1 562 ? 84.703  57.475  18.956  1.00 0.00 ? 562 PHE A CE1 1  
ATOM 3235   C CE2 . PHE A 1 562 ? 84.079  59.650  18.147  1.00 0.00 ? 562 PHE A CE2 1  
ATOM 3236   C CZ  . PHE A 1 562 ? 84.827  58.845  19.072  1.00 0.00 ? 562 PHE A CZ  1  
ATOM 3237   N N   . ASP A 1 563 ? 83.422  54.349  13.846  1.00 0.00 ? 563 ASP A N   1  
ATOM 3238   C CA  . ASP A 1 563 ? 82.774  53.464  12.873  1.00 0.00 ? 563 ASP A CA  1  
ATOM 3239   C C   . ASP A 1 563 ? 81.865  52.587  13.756  1.00 0.00 ? 563 ASP A C   1  
ATOM 3240   O O   . ASP A 1 563 ? 82.206  52.091  14.854  1.00 0.00 ? 563 ASP A O   1  
ATOM 3241   C CB  . ASP A 1 563 ? 83.706  52.621  11.914  1.00 0.00 ? 563 ASP A CB  1  
ATOM 3242   C CG  . ASP A 1 563 ? 84.559  51.581  12.678  1.00 0.00 ? 563 ASP A CG  1  
ATOM 3243   O OD1 . ASP A 1 563 ? 85.501  52.003  13.407  1.00 0.00 ? 563 ASP A OD1 1  
ATOM 3244   O OD2 . ASP A 1 563 ? 84.381  50.351  12.411  1.00 0.00 ? 563 ASP A OD2 1  
ATOM 3245   N N   . ILE A 1 564 ? 80.642  52.258  13.347  1.00 0.00 ? 564 ILE A N   1  
ATOM 3246   C CA  . ILE A 1 564 ? 79.690  51.372  13.993  1.00 0.00 ? 564 ILE A CA  1  
ATOM 3247   C C   . ILE A 1 564 ? 79.577  50.303  12.977  1.00 0.00 ? 564 ILE A C   1  
ATOM 3248   O O   . ILE A 1 564 ? 79.540  50.499  11.780  1.00 0.00 ? 564 ILE A O   1  
ATOM 3249   C CB  . ILE A 1 564 ? 78.357  51.968  14.480  1.00 0.00 ? 564 ILE A CB  1  
ATOM 3250   C CG1 . ILE A 1 564 ? 77.645  50.985  15.420  1.00 0.00 ? 564 ILE A CG1 1  
ATOM 3251   C CG2 . ILE A 1 564 ? 77.445  52.550  13.487  1.00 0.00 ? 564 ILE A CG2 1  
ATOM 3252   C CD1 . ILE A 1 564 ? 76.298  51.495  15.960  1.00 0.00 ? 564 ILE A CD1 1  
ATOM 3253   N N   . ASN A 1 565 ? 79.633  49.025  13.415  1.00 0.00 ? 565 ASN A N   1  
ATOM 3254   C CA  . ASN A 1 565 ? 79.609  47.909  12.522  1.00 0.00 ? 565 ASN A CA  1  
ATOM 3255   C C   . ASN A 1 565 ? 78.176  47.622  12.033  1.00 0.00 ? 565 ASN A C   1  
ATOM 3256   O O   . ASN A 1 565 ? 78.029  47.022  10.994  1.00 0.00 ? 565 ASN A O   1  
ATOM 3257   C CB  . ASN A 1 565 ? 80.395  46.697  13.150  1.00 0.00 ? 565 ASN A CB  1  
ATOM 3258   C CG  . ASN A 1 565 ? 81.890  46.956  13.575  1.00 0.00 ? 565 ASN A CG  1  
ATOM 3259   O OD1 . ASN A 1 565 ? 82.400  46.161  14.342  1.00 0.00 ? 565 ASN A OD1 1  
ATOM 3260   N ND2 . ASN A 1 565 ? 82.520  48.083  13.155  1.00 0.00 ? 565 ASN A ND2 1  
ATOM 3261   N N   . ILE A 1 566 ? 77.166  48.108  12.799  1.00 0.00 ? 566 ILE A N   1  
ATOM 3262   C CA  . ILE A 1 566 ? 75.716  48.077  12.700  1.00 0.00 ? 566 ILE A CA  1  
ATOM 3263   C C   . ILE A 1 566 ? 75.034  46.762  13.210  1.00 0.00 ? 566 ILE A C   1  
ATOM 3264   O O   . ILE A 1 566 ? 75.647  45.719  12.921  1.00 0.00 ? 566 ILE A O   1  
ATOM 3265   C CB  . ILE A 1 566 ? 75.088  48.600  11.389  1.00 0.00 ? 566 ILE A CB  1  
ATOM 3266   C CG1 . ILE A 1 566 ? 73.808  49.409  11.565  1.00 0.00 ? 566 ILE A CG1 1  
ATOM 3267   C CG2 . ILE A 1 566 ? 74.852  47.569  10.239  1.00 0.00 ? 566 ILE A CG2 1  
ATOM 3268   C CD1 . ILE A 1 566 ? 73.200  49.918  10.247  1.00 0.00 ? 566 ILE A CD1 1  
ATOM 3269   N N   . PRO A 1 567 ? 73.915  46.740  14.003  1.00 0.00 ? 567 PRO A N   1  
ATOM 3270   C CA  . PRO A 1 567 ? 73.308  45.468  14.320  1.00 0.00 ? 567 PRO A CA  1  
ATOM 3271   C C   . PRO A 1 567 ? 72.417  44.917  13.168  1.00 0.00 ? 567 PRO A C   1  
ATOM 3272   O O   . PRO A 1 567 ? 72.100  45.616  12.196  1.00 0.00 ? 567 PRO A O   1  
ATOM 3273   C CB  . PRO A 1 567 ? 72.361  45.774  15.509  1.00 0.00 ? 567 PRO A CB  1  
ATOM 3274   C CG  . PRO A 1 567 ? 72.085  47.306  15.528  1.00 0.00 ? 567 PRO A CG  1  
ATOM 3275   C CD  . PRO A 1 567 ? 73.244  47.909  14.761  1.00 0.00 ? 567 PRO A CD  1  
ATOM 3276   N N   . TYR A 1 568 ? 71.977  43.631  13.272  1.00 0.00 ? 568 TYR A N   1  
ATOM 3277   C CA  . TYR A 1 568 ? 70.945  42.952  12.481  1.00 0.00 ? 568 TYR A CA  1  
ATOM 3278   C C   . TYR A 1 568 ? 69.654  42.751  13.349  1.00 0.00 ? 568 TYR A C   1  
ATOM 3279   O O   . TYR A 1 568 ? 69.856  42.364  14.527  1.00 0.00 ? 568 TYR A O   1  
ATOM 3280   C CB  . TYR A 1 568 ? 71.472  41.585  12.066  1.00 0.00 ? 568 TYR A CB  1  
ATOM 3281   C CG  . TYR A 1 568 ? 70.534  40.849  11.132  1.00 0.00 ? 568 TYR A CG  1  
ATOM 3282   C CD1 . TYR A 1 568 ? 70.410  41.368  9.849   1.00 0.00 ? 568 TYR A CD1 1  
ATOM 3283   C CD2 . TYR A 1 568 ? 69.961  39.606  11.440  1.00 0.00 ? 568 TYR A CD2 1  
ATOM 3284   C CE1 . TYR A 1 568 ? 69.682  40.606  8.881   1.00 0.00 ? 568 TYR A CE1 1  
ATOM 3285   C CE2 . TYR A 1 568 ? 69.178  38.908  10.496  1.00 0.00 ? 568 TYR A CE2 1  
ATOM 3286   C CZ  . TYR A 1 568 ? 69.088  39.366  9.222   1.00 0.00 ? 568 TYR A CZ  1  
ATOM 3287   O OH  . TYR A 1 568 ? 68.482  38.633  8.219   1.00 0.00 ? 568 TYR A OH  1  
ATOM 3288   N N   . PRO A 1 569 ? 68.397  42.897  12.977  1.00 0.00 ? 569 PRO A N   1  
ATOM 3289   C CA  . PRO A 1 569 ? 67.938  43.252  11.609  1.00 0.00 ? 569 PRO A CA  1  
ATOM 3290   C C   . PRO A 1 569 ? 67.541  44.773  11.633  1.00 0.00 ? 569 PRO A C   1  
ATOM 3291   O O   . PRO A 1 569 ? 66.498  45.215  12.106  1.00 0.00 ? 569 PRO A O   1  
ATOM 3292   C CB  . PRO A 1 569 ? 66.721  42.328  11.455  1.00 0.00 ? 569 PRO A CB  1  
ATOM 3293   C CG  . PRO A 1 569 ? 66.120  42.246  12.931  1.00 0.00 ? 569 PRO A CG  1  
ATOM 3294   C CD  . PRO A 1 569 ? 67.316  42.460  13.845  1.00 0.00 ? 569 PRO A CD  1  
ATOM 3295   N N   . LEU A 1 570 ? 68.501  45.570  11.100  1.00 0.00 ? 570 LEU A N   1  
ATOM 3296   C CA  . LEU A 1 570 ? 68.430  47.031  11.273  1.00 0.00 ? 570 LEU A CA  1  
ATOM 3297   C C   . LEU A 1 570 ? 69.575  47.716  10.504  1.00 0.00 ? 570 LEU A C   1  
ATOM 3298   O O   . LEU A 1 570 ? 70.562  48.102  11.042  1.00 0.00 ? 570 LEU A O   1  
ATOM 3299   C CB  . LEU A 1 570 ? 68.457  47.568  12.760  1.00 0.00 ? 570 LEU A CB  1  
ATOM 3300   C CG  . LEU A 1 570 ? 68.047  49.037  13.084  1.00 0.00 ? 570 LEU A CG  1  
ATOM 3301   C CD1 . LEU A 1 570 ? 66.586  49.276  12.703  1.00 0.00 ? 570 LEU A CD1 1  
ATOM 3302   C CD2 . LEU A 1 570 ? 68.501  49.584  14.558  1.00 0.00 ? 570 LEU A CD2 1  
ATOM 3303   N N   . ASN A 1 571 ? 69.394  47.963  9.151   1.00 0.00 ? 571 ASN A N   1  
ATOM 3304   C CA  . ASN A 1 571 ? 70.330  48.545  8.257   1.00 0.00 ? 571 ASN A CA  1  
ATOM 3305   C C   . ASN A 1 571 ? 69.609  48.380  6.917   1.00 0.00 ? 571 ASN A C   1  
ATOM 3306   O O   . ASN A 1 571 ? 70.262  47.984  5.941   1.00 0.00 ? 571 ASN A O   1  
ATOM 3307   C CB  . ASN A 1 571 ? 71.856  48.033  8.235   1.00 0.00 ? 571 ASN A CB  1  
ATOM 3308   C CG  . ASN A 1 571 ? 72.081  46.594  7.981   1.00 0.00 ? 571 ASN A CG  1  
ATOM 3309   O OD1 . ASN A 1 571 ? 72.613  46.165  6.946   1.00 0.00 ? 571 ASN A OD1 1  
ATOM 3310   N ND2 . ASN A 1 571 ? 71.721  45.784  9.007   1.00 0.00 ? 571 ASN A ND2 1  
ATOM 3311   N N   . ILE A 1 572 ? 68.312  48.699  6.798   1.00 0.00 ? 572 ILE A N   1  
ATOM 3312   C CA  . ILE A 1 572 ? 67.396  48.599  5.679   1.00 0.00 ? 572 ILE A CA  1  
ATOM 3313   C C   . ILE A 1 572 ? 67.146  49.931  4.973   1.00 0.00 ? 572 ILE A C   1  
ATOM 3314   O O   . ILE A 1 572 ? 66.295  50.157  4.062   1.00 0.00 ? 572 ILE A O   1  
ATOM 3315   C CB  . ILE A 1 572 ? 65.998  48.084  6.105   1.00 0.00 ? 572 ILE A CB  1  
ATOM 3316   C CG1 . ILE A 1 572 ? 65.017  47.779  4.970   1.00 0.00 ? 572 ILE A CG1 1  
ATOM 3317   C CG2 . ILE A 1 572 ? 65.401  49.008  7.172   1.00 0.00 ? 572 ILE A CG2 1  
ATOM 3318   C CD1 . ILE A 1 572 ? 63.646  47.272  5.445   1.00 0.00 ? 572 ILE A CD1 1  
ATOM 3319   N N   . ILE A 1 573 ? 67.892  50.933  5.416   1.00 0.00 ? 573 ILE A N   1  
ATOM 3320   C CA  . ILE A 1 573 ? 67.987  52.228  4.769   1.00 0.00 ? 573 ILE A CA  1  
ATOM 3321   C C   . ILE A 1 573 ? 69.415  52.703  5.079   1.00 0.00 ? 573 ILE A C   1  
ATOM 3322   O O   . ILE A 1 573 ? 69.789  53.645  4.416   1.00 0.00 ? 573 ILE A O   1  
ATOM 3323   C CB  . ILE A 1 573 ? 66.929  53.323  5.122   1.00 0.00 ? 573 ILE A CB  1  
ATOM 3324   C CG1 . ILE A 1 573 ? 66.978  54.618  4.198   1.00 0.00 ? 573 ILE A CG1 1  
ATOM 3325   C CG2 . ILE A 1 573 ? 67.014  53.789  6.569   1.00 0.00 ? 573 ILE A CG2 1  
ATOM 3326   C CD1 . ILE A 1 573 ? 65.931  55.687  4.558   1.00 0.00 ? 573 ILE A CD1 1  
ATOM 3327   N N   . ILE A 1 574 ? 70.191  52.025  5.929   1.00 0.00 ? 574 ILE A N   1  
ATOM 3328   C CA  . ILE A 1 574 ? 71.524  52.478  6.213   1.00 0.00 ? 574 ILE A CA  1  
ATOM 3329   C C   . ILE A 1 574 ? 72.488  52.454  5.009   1.00 0.00 ? 574 ILE A C   1  
ATOM 3330   O O   . ILE A 1 574 ? 72.624  51.458  4.226   1.00 0.00 ? 574 ILE A O   1  
ATOM 3331   C CB  . ILE A 1 574 ? 72.050  51.816  7.524   1.00 0.00 ? 574 ILE A CB  1  
ATOM 3332   C CG1 . ILE A 1 574 ? 71.419  52.549  8.755   1.00 0.00 ? 574 ILE A CG1 1  
ATOM 3333   C CG2 . ILE A 1 574 ? 73.625  51.850  7.696   1.00 0.00 ? 574 ILE A CG2 1  
ATOM 3334   C CD1 . ILE A 1 574 ? 71.863  51.986  10.116  1.00 0.00 ? 574 ILE A CD1 1  
ATOM 3335   N N   . SER A 1 575 ? 73.115  53.637  4.861   1.00 0.00 ? 575 SER A N   1  
ATOM 3336   C CA  . SER A 1 575 ? 73.907  53.986  3.749   1.00 0.00 ? 575 SER A CA  1  
ATOM 3337   C C   . SER A 1 575 ? 75.102  54.516  4.278   1.00 0.00 ? 575 SER A C   1  
ATOM 3338   O O   . SER A 1 575 ? 75.278  54.547  5.481   1.00 0.00 ? 575 SER A O   1  
ATOM 3339   C CB  . SER A 1 575 ? 73.225  55.129  2.912   1.00 0.00 ? 575 SER A CB  1  
ATOM 3340   O OG  . SER A 1 575 ? 73.028  56.384  3.538   1.00 0.00 ? 575 SER A OG  1  
ATOM 3341   N N   . ARG A 1 576 ? 76.103  54.782  3.371   1.00 0.00 ? 576 ARG A N   1  
ATOM 3342   C CA  . ARG A 1 576 ? 77.395  55.141  3.838   1.00 0.00 ? 576 ARG A CA  1  
ATOM 3343   C C   . ARG A 1 576 ? 77.416  56.484  4.603   1.00 0.00 ? 576 ARG A C   1  
ATOM 3344   O O   . ARG A 1 576 ? 78.240  56.679  5.427   1.00 0.00 ? 576 ARG A O   1  
ATOM 3345   C CB  . ARG A 1 576 ? 78.386  55.094  2.638   1.00 0.00 ? 576 ARG A CB  1  
ATOM 3346   C CG  . ARG A 1 576 ? 78.445  56.306  1.708   1.00 0.00 ? 576 ARG A CG  1  
ATOM 3347   C CD  . ARG A 1 576 ? 77.247  56.228  0.709   1.00 0.00 ? 576 ARG A CD  1  
ATOM 3348   N NE  . ARG A 1 576 ? 77.334  57.549  -0.048  1.00 0.00 ? 576 ARG A NE  1  
ATOM 3349   C CZ  . ARG A 1 576 ? 76.719  57.848  -1.212  1.00 0.00 ? 576 ARG A CZ  1  
ATOM 3350   N NH1 . ARG A 1 576 ? 75.817  56.999  -1.704  1.00 0.00 ? 576 ARG A NH1 1  
ATOM 3351   N NH2 . ARG A 1 576 ? 76.901  59.040  -1.831  1.00 0.00 ? 576 ARG A NH2 1  
ATOM 3352   N N   . THR A 1 577 ? 76.594  57.451  4.183   1.00 0.00 ? 577 THR A N   1  
ATOM 3353   C CA  . THR A 1 577 ? 76.554  58.773  4.541   1.00 0.00 ? 577 THR A CA  1  
ATOM 3354   C C   . THR A 1 577 ? 76.219  59.020  5.984   1.00 0.00 ? 577 THR A C   1  
ATOM 3355   O O   . THR A 1 577 ? 76.758  59.909  6.639   1.00 0.00 ? 577 THR A O   1  
ATOM 3356   C CB  . THR A 1 577 ? 75.702  59.648  3.476   1.00 0.00 ? 577 THR A CB  1  
ATOM 3357   O OG1 . THR A 1 577 ? 75.994  61.010  3.590   1.00 0.00 ? 577 THR A OG1 1  
ATOM 3358   C CG2 . THR A 1 577 ? 74.174  59.563  3.666   1.00 0.00 ? 577 THR A CG2 1  
ATOM 3359   N N   . CYS A 1 578 ? 75.214  58.195  6.517   1.00 0.00 ? 578 CYS A N   1  
ATOM 3360   C CA  . CYS A 1 578 ? 74.667  58.373  7.818   1.00 0.00 ? 578 CYS A CA  1  
ATOM 3361   C C   . CYS A 1 578 ? 75.660  58.256  8.992   1.00 0.00 ? 578 CYS A C   1  
ATOM 3362   O O   . CYS A 1 578 ? 75.692  59.167  9.794   1.00 0.00 ? 578 CYS A O   1  
ATOM 3363   C CB  . CYS A 1 578 ? 73.386  57.574  8.157   1.00 0.00 ? 578 CYS A CB  1  
ATOM 3364   S SG  . CYS A 1 578 ? 73.744  55.856  8.077   1.00 0.00 ? 578 CYS A SG  1  
ATOM 3365   N N   . MET A 1 579 ? 76.565  57.224  8.934   1.00 0.00 ? 579 MET A N   1  
ATOM 3366   C CA  . MET A 1 579 ? 77.651  56.996  9.868   1.00 0.00 ? 579 MET A CA  1  
ATOM 3367   C C   . MET A 1 579 ? 78.622  58.089  9.878   1.00 0.00 ? 579 MET A C   1  
ATOM 3368   O O   . MET A 1 579 ? 79.122  58.476  10.922  1.00 0.00 ? 579 MET A O   1  
ATOM 3369   C CB  . MET A 1 579 ? 78.427  55.747  9.451   1.00 0.00 ? 579 MET A CB  1  
ATOM 3370   C CG  . MET A 1 579 ? 79.436  55.198  10.477  1.00 0.00 ? 579 MET A CG  1  
ATOM 3371   S SD  . MET A 1 579 ? 80.389  53.729  9.948   1.00 0.00 ? 579 MET A SD  1  
ATOM 3372   C CE  . MET A 1 579 ? 81.345  54.456  8.526   1.00 0.00 ? 579 MET A CE  1  
ATOM 3373   N N   . ILE A 1 580 ? 78.902  58.682  8.656   1.00 0.00 ? 580 ILE A N   1  
ATOM 3374   C CA  . ILE A 1 580 ? 79.795  59.781  8.530   1.00 0.00 ? 580 ILE A CA  1  
ATOM 3375   C C   . ILE A 1 580 ? 79.250  60.953  9.252   1.00 0.00 ? 580 ILE A C   1  
ATOM 3376   O O   . ILE A 1 580 ? 79.952  61.700  9.926   1.00 0.00 ? 580 ILE A O   1  
ATOM 3377   C CB  . ILE A 1 580 ? 80.062  60.147  7.117   1.00 0.00 ? 580 ILE A CB  1  
ATOM 3378   C CG1 . ILE A 1 580 ? 80.730  58.979  6.358   1.00 0.00 ? 580 ILE A CG1 1  
ATOM 3379   C CG2 . ILE A 1 580 ? 81.044  61.342  7.093   1.00 0.00 ? 580 ILE A CG2 1  
ATOM 3380   C CD1 . ILE A 1 580 ? 81.039  59.284  4.882   1.00 0.00 ? 580 ILE A CD1 1  
ATOM 3381   N N   . LYS A 1 581 ? 77.945  61.229  9.085   1.00 0.00 ? 581 LYS A N   1  
ATOM 3382   C CA  . LYS A 1 581 ? 77.215  62.345  9.654   1.00 0.00 ? 581 LYS A CA  1  
ATOM 3383   C C   . LYS A 1 581 ? 77.125  62.319  11.207  1.00 0.00 ? 581 LYS A C   1  
ATOM 3384   O O   . LYS A 1 581 ? 77.417  63.314  11.921  1.00 0.00 ? 581 LYS A O   1  
ATOM 3385   C CB  . LYS A 1 581 ? 75.822  62.561  9.067   1.00 0.00 ? 581 LYS A CB  1  
ATOM 3386   C CG  . LYS A 1 581 ? 75.853  63.112  7.612   1.00 0.00 ? 581 LYS A CG  1  
ATOM 3387   C CD  . LYS A 1 581 ? 76.242  64.572  7.488   1.00 0.00 ? 581 LYS A CD  1  
ATOM 3388   C CE  . LYS A 1 581 ? 76.386  65.055  6.051   1.00 0.00 ? 581 LYS A CE  1  
ATOM 3389   N NZ  . LYS A 1 581 ? 75.012  64.801  5.451   1.00 0.00 ? 581 LYS A NZ  1  
ATOM 3390   N N   . TYR A 1 582 ? 76.734  61.101  11.852  1.00 0.00 ? 582 TYR A N   1  
ATOM 3391   C CA  . TYR A 1 582 ? 76.670  60.865  13.297  1.00 0.00 ? 582 TYR A CA  1  
ATOM 3392   C C   . TYR A 1 582 ? 78.055  61.104  13.927  1.00 0.00 ? 582 TYR A C   1  
ATOM 3393   O O   . TYR A 1 582 ? 78.245  61.704  15.002  1.00 0.00 ? 582 TYR A O   1  
ATOM 3394   C CB  . TYR A 1 582 ? 76.187  59.444  13.662  1.00 0.00 ? 582 TYR A CB  1  
ATOM 3395   C CG  . TYR A 1 582 ? 74.813  59.198  13.302  1.00 0.00 ? 582 TYR A CG  1  
ATOM 3396   C CD1 . TYR A 1 582 ? 73.733  59.732  14.083  1.00 0.00 ? 582 TYR A CD1 1  
ATOM 3397   C CD2 . TYR A 1 582 ? 74.462  58.122  12.531  1.00 0.00 ? 582 TYR A CD2 1  
ATOM 3398   C CE1 . TYR A 1 582 ? 72.361  59.291  13.921  1.00 0.00 ? 582 TYR A CE1 1  
ATOM 3399   C CE2 . TYR A 1 582 ? 73.144  57.694  12.300  1.00 0.00 ? 582 TYR A CE2 1  
ATOM 3400   C CZ  . TYR A 1 582 ? 72.159  58.227  13.063  1.00 0.00 ? 582 TYR A CZ  1  
ATOM 3401   O OH  . TYR A 1 582 ? 70.835  57.726  12.971  1.00 0.00 ? 582 TYR A OH  1  
ATOM 3402   N N   . GLN A 1 583 ? 79.103  60.731  13.179  1.00 0.00 ? 583 GLN A N   1  
ATOM 3403   C CA  . GLN A 1 583 ? 80.512  60.974  13.481  1.00 0.00 ? 583 GLN A CA  1  
ATOM 3404   C C   . GLN A 1 583 ? 80.945  62.415  13.587  1.00 0.00 ? 583 GLN A C   1  
ATOM 3405   O O   . GLN A 1 583 ? 81.696  62.729  14.498  1.00 0.00 ? 583 GLN A O   1  
ATOM 3406   C CB  . GLN A 1 583 ? 81.514  60.323  12.493  1.00 0.00 ? 583 GLN A CB  1  
ATOM 3407   C CG  . GLN A 1 583 ? 83.007  60.334  12.845  1.00 0.00 ? 583 GLN A CG  1  
ATOM 3408   C CD  . GLN A 1 583 ? 83.679  61.677  12.829  1.00 0.00 ? 583 GLN A CD  1  
ATOM 3409   O OE1 . GLN A 1 583 ? 84.323  62.160  13.753  1.00 0.00 ? 583 GLN A OE1 1  
ATOM 3410   N NE2 . GLN A 1 583 ? 83.715  62.343  11.632  1.00 0.00 ? 583 GLN A NE2 1  
ATOM 3411   N N   . ILE A 1 584 ? 80.508  63.320  12.716  1.00 0.00 ? 584 ILE A N   1  
ATOM 3412   C CA  . ILE A 1 584 ? 80.835  64.761  12.737  1.00 0.00 ? 584 ILE A CA  1  
ATOM 3413   C C   . ILE A 1 584 ? 80.233  65.444  13.930  1.00 0.00 ? 584 ILE A C   1  
ATOM 3414   O O   . ILE A 1 584 ? 80.870  66.276  14.559  1.00 0.00 ? 584 ILE A O   1  
ATOM 3415   C CB  . ILE A 1 584 ? 80.608  65.544  11.445  1.00 0.00 ? 584 ILE A CB  1  
ATOM 3416   C CG1 . ILE A 1 584 ? 79.177  65.849  10.938  1.00 0.00 ? 584 ILE A CG1 1  
ATOM 3417   C CG2 . ILE A 1 584 ? 81.519  64.937  10.375  1.00 0.00 ? 584 ILE A CG2 1  
ATOM 3418   C CD1 . ILE A 1 584 ? 79.133  66.646  9.623   1.00 0.00 ? 584 ILE A CD1 1  
ATOM 3419   N N   . ILE A 1 585 ? 78.951  65.122  14.316  1.00 0.00 ? 585 ILE A N   1  
ATOM 3420   C CA  . ILE A 1 585 ? 78.266  65.671  15.523  1.00 0.00 ? 585 ILE A CA  1  
ATOM 3421   C C   . ILE A 1 585 ? 79.043  65.213  16.731  1.00 0.00 ? 585 ILE A C   1  
ATOM 3422   O O   . ILE A 1 585 ? 79.390  66.011  17.610  1.00 0.00 ? 585 ILE A O   1  
ATOM 3423   C CB  . ILE A 1 585 ? 76.866  65.172  15.689  1.00 0.00 ? 585 ILE A CB  1  
ATOM 3424   C CG1 . ILE A 1 585 ? 75.972  65.717  14.541  1.00 0.00 ? 585 ILE A CG1 1  
ATOM 3425   C CG2 . ILE A 1 585 ? 76.355  65.540  17.071  1.00 0.00 ? 585 ILE A CG2 1  
ATOM 3426   C CD1 . ILE A 1 585 ? 74.504  65.262  14.617  1.00 0.00 ? 585 ILE A CD1 1  
ATOM 3427   N N   . LEU A 1 586 ? 79.545  63.943  16.802  1.00 0.00 ? 586 LEU A N   1  
ATOM 3428   C CA  . LEU A 1 586 ? 80.453  63.459  17.833  1.00 0.00 ? 586 LEU A CA  1  
ATOM 3429   C C   . LEU A 1 586 ? 81.738  64.187  17.933  1.00 0.00 ? 586 LEU A C   1  
ATOM 3430   O O   . LEU A 1 586 ? 82.180  64.326  19.041  1.00 0.00 ? 586 LEU A O   1  
ATOM 3431   C CB  . LEU A 1 586 ? 80.748  61.956  17.585  1.00 0.00 ? 586 LEU A CB  1  
ATOM 3432   C CG  . LEU A 1 586 ? 79.729  60.964  18.097  1.00 0.00 ? 586 LEU A CG  1  
ATOM 3433   C CD1 . LEU A 1 586 ? 79.768  59.605  17.469  1.00 0.00 ? 586 LEU A CD1 1  
ATOM 3434   C CD2 . LEU A 1 586 ? 79.828  60.794  19.625  1.00 0.00 ? 586 LEU A CD2 1  
ATOM 3435   N N   . ARG A 1 587 ? 82.335  64.509  16.783  1.00 0.00 ? 587 ARG A N   1  
ATOM 3436   C CA  . ARG A 1 587 ? 83.633  65.129  16.789  1.00 0.00 ? 587 ARG A CA  1  
ATOM 3437   C C   . ARG A 1 587 ? 83.747  66.523  17.359  1.00 0.00 ? 587 ARG A C   1  
ATOM 3438   O O   . ARG A 1 587 ? 84.676  66.834  18.127  1.00 0.00 ? 587 ARG A O   1  
ATOM 3439   C CB  . ARG A 1 587 ? 84.239  65.212  15.302  1.00 0.00 ? 587 ARG A CB  1  
ATOM 3440   C CG  . ARG A 1 587 ? 85.704  65.519  15.224  1.00 0.00 ? 587 ARG A CG  1  
ATOM 3441   C CD  . ARG A 1 587 ? 86.251  65.653  13.819  1.00 0.00 ? 587 ARG A CD  1  
ATOM 3442   N NE  . ARG A 1 587 ? 86.230  64.357  13.112  1.00 0.00 ? 587 ARG A NE  1  
ATOM 3443   C CZ  . ARG A 1 587 ? 87.046  63.944  12.085  1.00 0.00 ? 587 ARG A CZ  1  
ATOM 3444   N NH1 . ARG A 1 587 ? 87.603  64.847  11.196  1.00 0.00 ? 587 ARG A NH1 1  
ATOM 3445   N NH2 . ARG A 1 587 ? 87.151  62.624  11.842  1.00 0.00 ? 587 ARG A NH2 1  
ATOM 3446   N N   . TYR A 1 588 ? 82.713  67.377  16.995  1.00 0.00 ? 588 TYR A N   1  
ATOM 3447   C CA  . TYR A 1 588 ? 82.553  68.760  17.503  1.00 0.00 ? 588 TYR A CA  1  
ATOM 3448   C C   . TYR A 1 588 ? 82.249  68.774  19.001  1.00 0.00 ? 588 TYR A C   1  
ATOM 3449   O O   . TYR A 1 588 ? 82.926  69.507  19.696  1.00 0.00 ? 588 TYR A O   1  
ATOM 3450   C CB  . TYR A 1 588 ? 81.515  69.594  16.672  1.00 0.00 ? 588 TYR A CB  1  
ATOM 3451   C CG  . TYR A 1 588 ? 82.126  69.887  15.341  1.00 0.00 ? 588 TYR A CG  1  
ATOM 3452   C CD1 . TYR A 1 588 ? 83.288  70.661  15.203  1.00 0.00 ? 588 TYR A CD1 1  
ATOM 3453   C CD2 . TYR A 1 588 ? 81.513  69.394  14.172  1.00 0.00 ? 588 TYR A CD2 1  
ATOM 3454   C CE1 . TYR A 1 588 ? 83.831  71.017  13.924  1.00 0.00 ? 588 TYR A CE1 1  
ATOM 3455   C CE2 . TYR A 1 588 ? 82.007  69.664  12.924  1.00 0.00 ? 588 TYR A CE2 1  
ATOM 3456   C CZ  . TYR A 1 588 ? 83.222  70.432  12.770  1.00 0.00 ? 588 TYR A CZ  1  
ATOM 3457   O OH  . TYR A 1 588 ? 83.656  70.782  11.477  1.00 0.00 ? 588 TYR A OH  1  
ATOM 3458   N N   . GLN A 1 589 ? 81.301  67.901  19.529  1.00 0.00 ? 589 GLN A N   1  
ATOM 3459   C CA  . GLN A 1 589 ? 81.067  67.851  20.902  1.00 0.00 ? 589 GLN A CA  1  
ATOM 3460   C C   . GLN A 1 589 ? 82.320  67.395  21.634  1.00 0.00 ? 589 GLN A C   1  
ATOM 3461   O O   . GLN A 1 589 ? 82.614  67.886  22.675  1.00 0.00 ? 589 GLN A O   1  
ATOM 3462   C CB  . GLN A 1 589 ? 79.891  66.901  21.214  1.00 0.00 ? 589 GLN A CB  1  
ATOM 3463   C CG  . GLN A 1 589 ? 79.284  67.072  22.645  1.00 0.00 ? 589 GLN A CG  1  
ATOM 3464   C CD  . GLN A 1 589 ? 78.347  65.862  22.889  1.00 0.00 ? 589 GLN A CD  1  
ATOM 3465   O OE1 . GLN A 1 589 ? 77.242  66.029  23.400  1.00 0.00 ? 589 GLN A OE1 1  
ATOM 3466   N NE2 . GLN A 1 589 ? 78.879  64.594  22.593  1.00 0.00 ? 589 GLN A NE2 1  
ATOM 3467   N N   . LEU A 1 590 ? 83.004  66.374  21.018  1.00 0.00 ? 590 LEU A N   1  
ATOM 3468   C CA  . LEU A 1 590 ? 84.108  65.726  21.660  1.00 0.00 ? 590 LEU A CA  1  
ATOM 3469   C C   . LEU A 1 590 ? 85.293  66.671  21.960  1.00 0.00 ? 590 LEU A C   1  
ATOM 3470   O O   . LEU A 1 590 ? 85.895  66.629  23.032  1.00 0.00 ? 590 LEU A O   1  
ATOM 3471   C CB  . LEU A 1 590 ? 84.554  64.507  20.871  1.00 0.00 ? 590 LEU A CB  1  
ATOM 3472   C CG  . LEU A 1 590 ? 85.751  63.641  21.325  1.00 0.00 ? 590 LEU A CG  1  
ATOM 3473   C CD1 . LEU A 1 590 ? 87.149  64.221  21.421  1.00 0.00 ? 590 LEU A CD1 1  
ATOM 3474   C CD2 . LEU A 1 590 ? 85.498  62.623  22.478  1.00 0.00 ? 590 LEU A CD2 1  
ATOM 3475   N N   . VAL A 1 591 ? 85.667  67.589  21.088  1.00 0.00 ? 591 VAL A N   1  
ATOM 3476   C CA  . VAL A 1 591 ? 86.789  68.535  21.322  1.00 0.00 ? 591 VAL A CA  1  
ATOM 3477   C C   . VAL A 1 591 ? 86.468  69.422  22.472  1.00 0.00 ? 591 VAL A C   1  
ATOM 3478   O O   . VAL A 1 591 ? 87.386  69.756  23.293  1.00 0.00 ? 591 VAL A O   1  
ATOM 3479   C CB  . VAL A 1 591 ? 87.346  69.185  20.045  1.00 0.00 ? 591 VAL A CB  1  
ATOM 3480   C CG1 . VAL A 1 591 ? 87.844  68.155  19.039  1.00 0.00 ? 591 VAL A CG1 1  
ATOM 3481   C CG2 . VAL A 1 591 ? 86.232  70.076  19.418  1.00 0.00 ? 591 VAL A CG2 1  
ATOM 3482   N N   . LEU A 1 592 ? 85.163  69.952  22.677  1.00 0.00 ? 592 LEU A N   1  
ATOM 3483   C CA  . LEU A 1 592 ? 84.741  70.846  23.719  1.00 0.00 ? 592 LEU A CA  1  
ATOM 3484   C C   . LEU A 1 592 ? 84.847  70.166  25.058  1.00 0.00 ? 592 LEU A C   1  
ATOM 3485   O O   . LEU A 1 592 ? 85.360  70.766  25.956  1.00 0.00 ? 592 LEU A O   1  
ATOM 3486   C CB  . LEU A 1 592 ? 83.269  71.234  23.531  1.00 0.00 ? 592 LEU A CB  1  
ATOM 3487   C CG  . LEU A 1 592 ? 83.114  72.128  22.264  1.00 0.00 ? 592 LEU A CG  1  
ATOM 3488   C CD1 . LEU A 1 592 ? 81.673  72.164  21.776  1.00 0.00 ? 592 LEU A CD1 1  
ATOM 3489   C CD2 . LEU A 1 592 ? 83.608  73.578  22.646  1.00 0.00 ? 592 LEU A CD2 1  
ATOM 3490   N N   . GLN A 1 593 ? 84.412  68.901  25.194  1.00 0.00 ? 593 GLN A N   1  
ATOM 3491   C CA  . GLN A 1 593 ? 84.389  68.157  26.428  1.00 0.00 ? 593 GLN A CA  1  
ATOM 3492   C C   . GLN A 1 593 ? 85.888  67.927  26.934  1.00 0.00 ? 593 GLN A C   1  
ATOM 3493   O O   . GLN A 1 593 ? 86.151  67.911  28.139  1.00 0.00 ? 593 GLN A O   1  
ATOM 3494   C CB  . GLN A 1 593 ? 83.932  66.719  26.186  1.00 0.00 ? 593 GLN A CB  1  
ATOM 3495   C CG  . GLN A 1 593 ? 82.461  66.480  25.661  1.00 0.00 ? 593 GLN A CG  1  
ATOM 3496   C CD  . GLN A 1 593 ? 82.485  64.928  25.376  1.00 0.00 ? 593 GLN A CD  1  
ATOM 3497   O OE1 . GLN A 1 593 ? 82.851  64.151  26.255  1.00 0.00 ? 593 GLN A OE1 1  
ATOM 3498   N NE2 . GLN A 1 593 ? 82.126  64.494  24.141  1.00 0.00 ? 593 GLN A NE2 1  
ATOM 3499   N N   . TYR A 1 594 ? 86.814  67.656  25.963  1.00 0.00 ? 594 TYR A N   1  
ATOM 3500   C CA  . TYR A 1 594 ? 88.238  67.331  26.161  1.00 0.00 ? 594 TYR A CA  1  
ATOM 3501   C C   . TYR A 1 594 ? 88.911  68.569  26.753  1.00 0.00 ? 594 TYR A C   1  
ATOM 3502   O O   . TYR A 1 594 ? 89.632  68.488  27.739  1.00 0.00 ? 594 TYR A O   1  
ATOM 3503   C CB  . TYR A 1 594 ? 88.937  66.963  24.739  1.00 0.00 ? 594 TYR A CB  1  
ATOM 3504   C CG  . TYR A 1 594 ? 90.502  66.912  24.791  1.00 0.00 ? 594 TYR A CG  1  
ATOM 3505   C CD1 . TYR A 1 594 ? 91.094  66.027  25.740  1.00 0.00 ? 594 TYR A CD1 1  
ATOM 3506   C CD2 . TYR A 1 594 ? 91.368  67.811  24.137  1.00 0.00 ? 594 TYR A CD2 1  
ATOM 3507   C CE1 . TYR A 1 594 ? 92.444  66.028  25.968  1.00 0.00 ? 594 TYR A CE1 1  
ATOM 3508   C CE2 . TYR A 1 594 ? 92.755  67.920  24.409  1.00 0.00 ? 594 TYR A CE2 1  
ATOM 3509   C CZ  . TYR A 1 594 ? 93.277  66.968  25.289  1.00 0.00 ? 594 TYR A CZ  1  
ATOM 3510   O OH  . TYR A 1 594 ? 94.689  66.940  25.493  1.00 0.00 ? 594 TYR A OH  1  
ATOM 3511   N N   . HIS A 1 595 ? 88.623  69.814  26.236  1.00 0.00 ? 595 HIS A N   1  
ATOM 3512   C CA  . HIS A 1 595 ? 89.147  71.079  26.681  1.00 0.00 ? 595 HIS A CA  1  
ATOM 3513   C C   . HIS A 1 595 ? 88.683  71.358  28.128  1.00 0.00 ? 595 HIS A C   1  
ATOM 3514   O O   . HIS A 1 595 ? 89.481  71.806  28.942  1.00 0.00 ? 595 HIS A O   1  
ATOM 3515   C CB  . HIS A 1 595 ? 88.651  72.136  25.606  1.00 0.00 ? 595 HIS A CB  1  
ATOM 3516   C CG  . HIS A 1 595 ? 89.429  73.406  25.447  1.00 0.00 ? 595 HIS A CG  1  
ATOM 3517   N ND1 . HIS A 1 595 ? 89.199  74.491  26.221  1.00 0.00 ? 595 HIS A ND1 1  
ATOM 3518   C CD2 . HIS A 1 595 ? 90.508  73.703  24.651  1.00 0.00 ? 595 HIS A CD2 1  
ATOM 3519   C CE1 . HIS A 1 595 ? 90.103  75.440  25.814  1.00 0.00 ? 595 HIS A CE1 1  
ATOM 3520   N NE2 . HIS A 1 595 ? 90.929  75.017  24.897  1.00 0.00 ? 595 HIS A NE2 1  
ATOM 3521   N N   . SER A 1 596 ? 87.486  71.015  28.431  1.00 0.00 ? 596 SER A N   1  
ATOM 3522   C CA  . SER A 1 596 ? 86.978  71.087  29.765  1.00 0.00 ? 596 SER A CA  1  
ATOM 3523   C C   . SER A 1 596 ? 87.645  70.222  30.858  1.00 0.00 ? 596 SER A C   1  
ATOM 3524   O O   . SER A 1 596 ? 87.848  70.694  31.950  1.00 0.00 ? 596 SER A O   1  
ATOM 3525   C CB  . SER A 1 596 ? 85.472  70.824  29.914  1.00 0.00 ? 596 SER A CB  1  
ATOM 3526   O OG  . SER A 1 596 ? 84.729  71.740  29.134  1.00 0.00 ? 596 SER A OG  1  
ATOM 3527   N N   . ARG A 1 597 ? 87.983  68.978  30.466  1.00 0.00 ? 597 ARG A N   1  
ATOM 3528   C CA  . ARG A 1 597 ? 88.662  67.978  31.333  1.00 0.00 ? 597 ARG A CA  1  
ATOM 3529   C C   . ARG A 1 597 ? 90.069  68.469  31.680  1.00 0.00 ? 597 ARG A C   1  
ATOM 3530   O O   . ARG A 1 597 ? 90.446  68.329  32.860  1.00 0.00 ? 597 ARG A O   1  
ATOM 3531   C CB  . ARG A 1 597 ? 88.726  66.556  30.649  1.00 0.00 ? 597 ARG A CB  1  
ATOM 3532   C CG  . ARG A 1 597 ? 89.305  65.427  31.518  1.00 0.00 ? 597 ARG A CG  1  
ATOM 3533   C CD  . ARG A 1 597 ? 88.843  65.363  32.976  1.00 0.00 ? 597 ARG A CD  1  
ATOM 3534   N NE  . ARG A 1 597 ? 87.370  65.378  32.857  1.00 0.00 ? 597 ARG A NE  1  
ATOM 3535   C CZ  . ARG A 1 597 ? 86.584  65.302  33.945  1.00 0.00 ? 597 ARG A CZ  1  
ATOM 3536   N NH1 . ARG A 1 597 ? 87.129  65.169  35.190  1.00 0.00 ? 597 ARG A NH1 1  
ATOM 3537   N NH2 . ARG A 1 597 ? 85.222  65.406  33.783  1.00 0.00 ? 597 ARG A NH2 1  
ATOM 3538   N N   . LEU A 1 598 ? 90.814  69.008  30.685  1.00 0.00 ? 598 LEU A N   1  
ATOM 3539   C CA  . LEU A 1 598 ? 92.146  69.472  30.829  1.00 0.00 ? 598 LEU A CA  1  
ATOM 3540   C C   . LEU A 1 598 ? 92.191  70.660  31.696  1.00 0.00 ? 598 LEU A C   1  
ATOM 3541   O O   . LEU A 1 598 ? 93.058  70.819  32.564  1.00 0.00 ? 598 LEU A O   1  
ATOM 3542   C CB  . LEU A 1 598 ? 92.700  69.799  29.439  1.00 0.00 ? 598 LEU A CB  1  
ATOM 3543   C CG  . LEU A 1 598 ? 94.006  70.536  29.443  1.00 0.00 ? 598 LEU A CG  1  
ATOM 3544   C CD1 . LEU A 1 598 ? 95.186  69.684  29.919  1.00 0.00 ? 598 LEU A CD1 1  
ATOM 3545   C CD2 . LEU A 1 598 ? 94.273  71.177  28.021  1.00 0.00 ? 598 LEU A CD2 1  
ATOM 3546   N N   . LEU A 1 599 ? 91.170  71.545  31.548  1.00 0.00 ? 599 LEU A N   1  
ATOM 3547   C CA  . LEU A 1 599 ? 91.003  72.818  32.277  1.00 0.00 ? 599 LEU A CA  1  
ATOM 3548   C C   . LEU A 1 599 ? 90.791  72.534  33.709  1.00 0.00 ? 599 LEU A C   1  
ATOM 3549   O O   . LEU A 1 599 ? 91.446  73.116  34.581  1.00 0.00 ? 599 LEU A O   1  
ATOM 3550   C CB  . LEU A 1 599 ? 89.796  73.662  31.701  1.00 0.00 ? 599 LEU A CB  1  
ATOM 3551   C CG  . LEU A 1 599 ? 90.002  74.773  30.618  1.00 0.00 ? 599 LEU A CG  1  
ATOM 3552   C CD1 . LEU A 1 599 ? 91.230  74.498  29.714  1.00 0.00 ? 599 LEU A CD1 1  
ATOM 3553   C CD2 . LEU A 1 599 ? 88.727  74.980  29.845  1.00 0.00 ? 599 LEU A CD2 1  
ATOM 3554   N N   . ASP A 1 600 ? 89.979  71.528  34.006  1.00 0.00 ? 600 ASP A N   1  
ATOM 3555   C CA  . ASP A 1 600 ? 89.750  71.086  35.388  1.00 0.00 ? 600 ASP A CA  1  
ATOM 3556   C C   . ASP A 1 600 ? 90.972  70.570  36.091  1.00 0.00 ? 600 ASP A C   1  
ATOM 3557   O O   . ASP A 1 600 ? 91.120  70.797  37.263  1.00 0.00 ? 600 ASP A O   1  
ATOM 3558   C CB  . ASP A 1 600 ? 88.773  69.856  35.493  1.00 0.00 ? 600 ASP A CB  1  
ATOM 3559   C CG  . ASP A 1 600 ? 87.397  70.288  35.157  1.00 0.00 ? 600 ASP A CG  1  
ATOM 3560   O OD1 . ASP A 1 600 ? 87.121  71.512  35.076  1.00 0.00 ? 600 ASP A OD1 1  
ATOM 3561   O OD2 . ASP A 1 600 ? 86.652  69.284  34.817  1.00 0.00 ? 600 ASP A OD2 1  
ATOM 3562   N N   . GLU A 1 601 ? 91.827  69.850  35.374  1.00 0.00 ? 601 GLU A N   1  
ATOM 3563   C CA  . GLU A 1 601 ? 93.022  69.197  35.781  1.00 0.00 ? 601 GLU A CA  1  
ATOM 3564   C C   . GLU A 1 601 ? 94.053  70.170  36.229  1.00 0.00 ? 601 GLU A C   1  
ATOM 3565   O O   . GLU A 1 601 ? 94.683  69.930  37.247  1.00 0.00 ? 601 GLU A O   1  
ATOM 3566   C CB  . GLU A 1 601 ? 93.559  68.292  34.693  1.00 0.00 ? 601 GLU A CB  1  
ATOM 3567   C CG  . GLU A 1 601 ? 94.702  67.410  35.126  1.00 0.00 ? 601 GLU A CG  1  
ATOM 3568   C CD  . GLU A 1 601 ? 94.153  66.388  36.214  1.00 0.00 ? 601 GLU A CD  1  
ATOM 3569   O OE1 . GLU A 1 601 ? 93.049  65.948  35.905  1.00 0.00 ? 601 GLU A OE1 1  
ATOM 3570   O OE2 . GLU A 1 601 ? 94.873  66.166  37.191  1.00 0.00 ? 601 GLU A OE2 1  
ATOM 3571   N N   . THR A 1 602 ? 94.140  71.346  35.473  1.00 0.00 ? 602 THR A N   1  
ATOM 3572   C CA  . THR A 1 602 ? 95.061  72.485  35.636  1.00 0.00 ? 602 THR A CA  1  
ATOM 3573   C C   . THR A 1 602 ? 94.813  73.129  36.912  1.00 0.00 ? 602 THR A C   1  
ATOM 3574   O O   . THR A 1 602 ? 95.722  73.407  37.643  1.00 0.00 ? 602 THR A O   1  
ATOM 3575   C CB  . THR A 1 602 ? 94.896  73.479  34.494  1.00 0.00 ? 602 THR A CB  1  
ATOM 3576   O OG1 . THR A 1 602 ? 95.102  72.871  33.256  1.00 0.00 ? 602 THR A OG1 1  
ATOM 3577   C CG2 . THR A 1 602 ? 96.031  74.523  34.781  1.00 0.00 ? 602 THR A CG2 1  
ATOM 3578   N N   . TRP A 1 603 ? 93.480  73.314  37.332  1.00 0.00 ? 603 TRP A N   1  
ATOM 3579   C CA  . TRP A 1 603 ? 93.115  73.920  38.630  1.00 0.00 ? 603 TRP A CA  1  
ATOM 3580   C C   . TRP A 1 603 ? 93.538  73.109  39.791  1.00 0.00 ? 603 TRP A C   1  
ATOM 3581   O O   . TRP A 1 603 ? 94.090  73.646  40.778  1.00 0.00 ? 603 TRP A O   1  
ATOM 3582   C CB  . TRP A 1 603 ? 91.632  74.299  38.750  1.00 0.00 ? 603 TRP A CB  1  
ATOM 3583   C CG  . TRP A 1 603 ? 90.907  74.696  37.485  1.00 0.00 ? 603 TRP A CG  1  
ATOM 3584   C CD1 . TRP A 1 603 ? 89.626  74.321  37.127  1.00 0.00 ? 603 TRP A CD1 1  
ATOM 3585   C CD2 . TRP A 1 603 ? 91.453  75.510  36.410  1.00 0.00 ? 603 TRP A CD2 1  
ATOM 3586   N NE1 . TRP A 1 603 ? 89.350  74.857  35.858  1.00 0.00 ? 603 TRP A NE1 1  
ATOM 3587   C CE2 . TRP A 1 603 ? 90.442  75.633  35.429  1.00 0.00 ? 603 TRP A CE2 1  
ATOM 3588   C CE3 . TRP A 1 603 ? 92.726  76.168  36.278  1.00 0.00 ? 603 TRP A CE3 1  
ATOM 3589   C CZ2 . TRP A 1 603 ? 90.747  76.251  34.203  1.00 0.00 ? 603 TRP A CZ2 1  
ATOM 3590   C CZ3 . TRP A 1 603 ? 92.993  76.750  35.019  1.00 0.00 ? 603 TRP A CZ3 1  
ATOM 3591   C CH2 . TRP A 1 603 ? 91.989  76.795  34.009  1.00 0.00 ? 603 TRP A CH2 1  
ATOM 3592   N N   . MET A 1 604 ? 93.335  71.778  39.622  1.00 0.00 ? 604 MET A N   1  
ATOM 3593   C CA  . MET A 1 604 ? 93.544  70.818  40.694  1.00 0.00 ? 604 MET A CA  1  
ATOM 3594   C C   . MET A 1 604 ? 95.002  70.819  41.086  1.00 0.00 ? 604 MET A C   1  
ATOM 3595   O O   . MET A 1 604 ? 95.282  70.819  42.313  1.00 0.00 ? 604 MET A O   1  
ATOM 3596   C CB  . MET A 1 604 ? 93.218  69.369  40.192  1.00 0.00 ? 604 MET A CB  1  
ATOM 3597   C CG  . MET A 1 604 ? 91.745  69.053  40.108  1.00 0.00 ? 604 MET A CG  1  
ATOM 3598   S SD  . MET A 1 604 ? 90.756  69.589  41.562  1.00 0.00 ? 604 MET A SD  1  
ATOM 3599   C CE  . MET A 1 604 ? 89.653  70.595  40.495  1.00 0.00 ? 604 MET A CE  1  
ATOM 3600   N N   . ASP A 1 605 ? 95.904  70.936  40.106  1.00 0.00 ? 605 ASP A N   1  
ATOM 3601   C CA  . ASP A 1 605 ? 97.346  70.956  40.364  1.00 0.00 ? 605 ASP A CA  1  
ATOM 3602   C C   . ASP A 1 605 ? 97.807  72.126  41.225  1.00 0.00 ? 605 ASP A C   1  
ATOM 3603   O O   . ASP A 1 605 ? 98.701  72.041  42.089  1.00 0.00 ? 605 ASP A O   1  
ATOM 3604   C CB  . ASP A 1 605 ? 98.085  71.039  39.039  1.00 0.00 ? 605 ASP A CB  1  
ATOM 3605   C CG  . ASP A 1 605 ? 97.794  69.958  38.134  1.00 0.00 ? 605 ASP A CG  1  
ATOM 3606   O OD1 . ASP A 1 605 ? 97.904  68.755  38.536  1.00 0.00 ? 605 ASP A OD1 1  
ATOM 3607   O OD2 . ASP A 1 605 ? 97.457  70.209  36.963  1.00 0.00 ? 605 ASP A OD2 1  
ATOM 3608   N N   . LEU A 1 606 ? 97.202  73.353  41.008  1.00 0.00 ? 606 LEU A N   1  
ATOM 3609   C CA  . LEU A 1 606 ? 97.708  74.577  41.591  1.00 0.00 ? 606 LEU A CA  1  
ATOM 3610   C C   . LEU A 1 606 ? 97.519  74.621  43.125  1.00 0.00 ? 606 LEU A C   1  
ATOM 3611   O O   . LEU A 1 606 ? 98.328  75.261  43.820  1.00 0.00 ? 606 LEU A O   1  
ATOM 3612   C CB  . LEU A 1 606 ? 96.820  75.757  41.093  1.00 0.00 ? 606 LEU A CB  1  
ATOM 3613   C CG  . LEU A 1 606 ? 97.247  77.105  41.621  1.00 0.00 ? 606 LEU A CG  1  
ATOM 3614   C CD1 . LEU A 1 606 ? 98.289  77.725  40.712  1.00 0.00 ? 606 LEU A CD1 1  
ATOM 3615   C CD2 . LEU A 1 606 ? 96.011  78.024  41.713  1.00 0.00 ? 606 LEU A CD2 1  
ATOM 3616   N N   . ASN A 1 607 ? 96.493  73.953  43.745  1.00 0.00 ? 607 ASN A N   1  
ATOM 3617   C CA  . ASN A 1 607 ? 96.147  73.855  45.121  1.00 0.00 ? 607 ASN A CA  1  
ATOM 3618   C C   . ASN A 1 607 ? 97.179  73.193  45.951  1.00 0.00 ? 607 ASN A C   1  
ATOM 3619   O O   . ASN A 1 607 ? 97.373  73.580  47.074  1.00 0.00 ? 607 ASN A O   1  
ATOM 3620   C CB  . ASN A 1 607 ? 94.798  73.119  45.451  1.00 0.00 ? 607 ASN A CB  1  
ATOM 3621   C CG  . ASN A 1 607 ? 93.484  73.503  44.745  1.00 0.00 ? 607 ASN A CG  1  
ATOM 3622   O OD1 . ASN A 1 607 ? 93.085  74.707  44.732  1.00 0.00 ? 607 ASN A OD1 1  
ATOM 3623   N ND2 . ASN A 1 607 ? 92.898  72.507  44.091  1.00 0.00 ? 607 ASN A ND2 1  
ATOM 3624   N N   . LYS A 1 608 ? 97.792  72.104  45.384  1.00 0.00 ? 608 LYS A N   1  
ATOM 3625   C CA  . LYS A 1 608 ? 98.724  71.199  46.112  1.00 0.00 ? 608 LYS A CA  1  
ATOM 3626   C C   . LYS A 1 608 ? 100.079 71.880  46.302  1.00 0.00 ? 608 LYS A C   1  
ATOM 3627   O O   . LYS A 1 608 ? 100.305 72.970  45.838  1.00 0.00 ? 608 LYS A O   1  
ATOM 3628   C CB  . LYS A 1 608 ? 98.869  69.760  45.554  1.00 0.00 ? 608 LYS A CB  1  
ATOM 3629   C CG  . LYS A 1 608 ? 99.032  69.655  43.964  1.00 0.00 ? 608 LYS A CG  1  
ATOM 3630   C CD  . LYS A 1 608 ? 99.449  68.244  43.562  1.00 0.00 ? 608 LYS A CD  1  
ATOM 3631   C CE  . LYS A 1 608 ? 99.384  67.974  42.024  1.00 0.00 ? 608 LYS A CE  1  
ATOM 3632   N NZ  . LYS A 1 608 ? 99.796  66.647  41.662  1.00 0.00 ? 608 LYS A NZ  1  
ATOM 3633   N N   . THR A 1 609 ? 100.942 71.286  47.228  1.00 0.00 ? 609 THR A N   1  
ATOM 3634   C CA  . THR A 1 609 ? 102.131 71.917  47.810  1.00 0.00 ? 609 THR A CA  1  
ATOM 3635   C C   . THR A 1 609 ? 103.317 72.381  46.926  1.00 0.00 ? 609 THR A C   1  
ATOM 3636   O O   . THR A 1 609 ? 103.906 73.450  47.264  1.00 0.00 ? 609 THR A O   1  
ATOM 3637   C CB  . THR A 1 609 ? 102.585 71.036  48.967  1.00 0.00 ? 609 THR A CB  1  
ATOM 3638   O OG1 . THR A 1 609 ? 101.611 71.017  50.069  1.00 0.00 ? 609 THR A OG1 1  
ATOM 3639   C CG2 . THR A 1 609 ? 103.894 71.488  49.623  1.00 0.00 ? 609 THR A CG2 1  
ATOM 3640   N N   . PRO A 1 610 ? 103.702 71.736  45.807  1.00 0.00 ? 610 PRO A N   1  
ATOM 3641   C CA  . PRO A 1 610 ? 104.793 72.174  45.034  1.00 0.00 ? 610 PRO A CA  1  
ATOM 3642   C C   . PRO A 1 610 ? 104.529 73.458  44.301  1.00 0.00 ? 610 PRO A C   1  
ATOM 3643   O O   . PRO A 1 610 ? 105.460 74.153  43.932  1.00 0.00 ? 610 PRO A O   1  
ATOM 3644   C CB  . PRO A 1 610 ? 105.176 70.975  44.144  1.00 0.00 ? 610 PRO A CB  1  
ATOM 3645   C CG  . PRO A 1 610 ? 103.881 70.121  44.011  1.00 0.00 ? 610 PRO A CG  1  
ATOM 3646   C CD  . PRO A 1 610 ? 103.271 70.388  45.418  1.00 0.00 ? 610 PRO A CD  1  
ATOM 3647   N N   . SER A 1 611 ? 103.280 73.871  44.079  1.00 0.00 ? 611 SER A N   1  
ATOM 3648   C CA  . SER A 1 611 ? 102.997 75.225  43.524  1.00 0.00 ? 611 SER A CA  1  
ATOM 3649   C C   . SER A 1 611 ? 103.439 76.368  44.421  1.00 0.00 ? 611 SER A C   1  
ATOM 3650   O O   . SER A 1 611 ? 104.114 77.308  43.957  1.00 0.00 ? 611 SER A O   1  
ATOM 3651   C CB  . SER A 1 611 ? 101.458 75.204  43.282  1.00 0.00 ? 611 SER A CB  1  
ATOM 3652   O OG  . SER A 1 611 ? 100.971 76.363  42.594  1.00 0.00 ? 611 SER A OG  1  
ATOM 3653   N N   . TRP A 1 612 ? 103.070 76.279  45.705  1.00 0.00 ? 612 TRP A N   1  
ATOM 3654   C CA  . TRP A 1 612 ? 103.239 77.285  46.741  1.00 0.00 ? 612 TRP A CA  1  
ATOM 3655   C C   . TRP A 1 612 ? 102.784 78.690  46.217  1.00 0.00 ? 612 TRP A C   1  
ATOM 3656   O O   . TRP A 1 612 ? 101.963 78.940  45.321  1.00 0.00 ? 612 TRP A O   1  
ATOM 3657   C CB  . TRP A 1 612 ? 104.620 77.442  47.374  1.00 0.00 ? 612 TRP A CB  1  
ATOM 3658   C CG  . TRP A 1 612 ? 105.077 76.218  48.207  1.00 0.00 ? 612 TRP A CG  1  
ATOM 3659   C CD1 . TRP A 1 612 ? 104.491 75.735  49.350  1.00 0.00 ? 612 TRP A CD1 1  
ATOM 3660   C CD2 . TRP A 1 612 ? 106.218 75.353  47.929  1.00 0.00 ? 612 TRP A CD2 1  
ATOM 3661   N NE1 . TRP A 1 612 ? 105.288 74.823  49.923  1.00 0.00 ? 612 TRP A NE1 1  
ATOM 3662   C CE2 . TRP A 1 612 ? 106.250 74.437  49.031  1.00 0.00 ? 612 TRP A CE2 1  
ATOM 3663   C CE3 . TRP A 1 612 ? 107.184 75.286  46.880  1.00 0.00 ? 612 TRP A CE3 1  
ATOM 3664   C CZ2 . TRP A 1 612 ? 107.292 73.526  49.167  1.00 0.00 ? 612 TRP A CZ2 1  
ATOM 3665   C CZ3 . TRP A 1 612 ? 108.159 74.226  46.968  1.00 0.00 ? 612 TRP A CZ3 1  
ATOM 3666   C CH2 . TRP A 1 612 ? 108.226 73.385  48.093  1.00 0.00 ? 612 TRP A CH2 1  
ATOM 3667   N N   . LYS A 1 613 ? 103.481 79.786  46.693  1.00 0.00 ? 613 LYS A N   1  
ATOM 3668   C CA  . LYS A 1 613 ? 103.547 81.184  46.317  1.00 0.00 ? 613 LYS A CA  1  
ATOM 3669   C C   . LYS A 1 613 ? 102.183 81.782  46.343  1.00 0.00 ? 613 LYS A C   1  
ATOM 3670   O O   . LYS A 1 613 ? 101.820 82.437  45.309  1.00 0.00 ? 613 LYS A O   1  
ATOM 3671   C CB  . LYS A 1 613 ? 104.267 81.450  45.012  1.00 0.00 ? 613 LYS A CB  1  
ATOM 3672   C CG  . LYS A 1 613 ? 105.506 80.569  44.912  1.00 0.00 ? 613 LYS A CG  1  
ATOM 3673   C CD  . LYS A 1 613 ? 106.634 80.899  45.997  1.00 0.00 ? 613 LYS A CD  1  
ATOM 3674   C CE  . LYS A 1 613 ? 107.877 79.961  46.010  1.00 0.00 ? 613 LYS A CE  1  
ATOM 3675   N NZ  . LYS A 1 613 ? 108.401 79.783  44.574  1.00 0.00 ? 613 LYS A NZ  1  
ATOM 3676   N N   . TYR A 1 614 ? 101.431 81.577  47.399  1.00 0.00 ? 614 TYR A N   1  
ATOM 3677   C CA  . TYR A 1 614 ? 100.154 82.143  47.420  1.00 0.00 ? 614 TYR A CA  1  
ATOM 3678   C C   . TYR A 1 614 ? 100.266 83.551  47.964  1.00 0.00 ? 614 TYR A C   1  
ATOM 3679   O O   . TYR A 1 614 ? 101.408 83.970  48.290  1.00 0.00 ? 614 TYR A O   1  
ATOM 3680   C CB  . TYR A 1 614 ? 99.238  81.343  48.391  1.00 0.00 ? 614 TYR A CB  1  
ATOM 3681   C CG  . TYR A 1 614 ? 99.367  79.874  48.006  1.00 0.00 ? 614 TYR A CG  1  
ATOM 3682   C CD1 . TYR A 1 614 ? 98.550  79.561  46.912  1.00 0.00 ? 614 TYR A CD1 1  
ATOM 3683   C CD2 . TYR A 1 614 ? 100.117 78.888  48.676  1.00 0.00 ? 614 TYR A CD2 1  
ATOM 3684   C CE1 . TYR A 1 614 ? 98.459  78.221  46.498  1.00 0.00 ? 614 TYR A CE1 1  
ATOM 3685   C CE2 . TYR A 1 614 ? 100.035 77.555  48.234  1.00 0.00 ? 614 TYR A CE2 1  
ATOM 3686   C CZ  . TYR A 1 614 ? 99.134  77.213  47.182  1.00 0.00 ? 614 TYR A CZ  1  
ATOM 3687   O OH  . TYR A 1 614 ? 99.216  75.985  46.532  1.00 0.00 ? 614 TYR A OH  1  
ATOM 3688   N N   . ARG A 1 623 ? 101.813 85.588  45.106  1.00 0.00 ? 623 ARG A N   1  
ATOM 3689   C CA  . ARG A 1 623 ? 102.537 85.915  43.838  1.00 0.00 ? 623 ARG A CA  1  
ATOM 3690   C C   . ARG A 1 623 ? 101.613 86.031  42.740  1.00 0.00 ? 623 ARG A C   1  
ATOM 3691   O O   . ARG A 1 623 ? 100.430 85.697  42.894  1.00 0.00 ? 623 ARG A O   1  
ATOM 3692   C CB  . ARG A 1 623 ? 103.708 84.867  43.460  1.00 0.00 ? 623 ARG A CB  1  
ATOM 3693   C CG  . ARG A 1 623 ? 104.803 85.272  42.430  1.00 0.00 ? 623 ARG A CG  1  
ATOM 3694   C CD  . ARG A 1 623 ? 105.881 84.193  42.293  1.00 0.00 ? 623 ARG A CD  1  
ATOM 3695   N NE  . ARG A 1 623 ? 107.037 84.635  41.455  1.00 0.00 ? 623 ARG A NE  1  
ATOM 3696   C CZ  . ARG A 1 623 ? 106.981 84.724  40.109  1.00 0.00 ? 623 ARG A CZ  1  
ATOM 3697   N NH1 . ARG A 1 623 ? 105.948 84.124  39.435  1.00 0.00 ? 623 ARG A NH1 1  
ATOM 3698   N NH2 . ARG A 1 623 ? 108.028 85.235  39.395  1.00 0.00 ? 623 ARG A NH2 1  
ATOM 3699   N N   . ARG A 1 624 ? 101.984 86.641  41.569  1.00 0.00 ? 624 ARG A N   1  
ATOM 3700   C CA  . ARG A 1 624 ? 101.216 86.998  40.466  1.00 0.00 ? 624 ARG A CA  1  
ATOM 3701   C C   . ARG A 1 624 ? 100.752 85.722  39.787  1.00 0.00 ? 624 ARG A C   1  
ATOM 3702   O O   . ARG A 1 624 ? 99.610  85.669  39.290  1.00 0.00 ? 624 ARG A O   1  
ATOM 3703   C CB  . ARG A 1 624 ? 102.040 87.776  39.439  1.00 0.00 ? 624 ARG A CB  1  
ATOM 3704   C CG  . ARG A 1 624 ? 102.372 89.201  39.879  1.00 0.00 ? 624 ARG A CG  1  
ATOM 3705   C CD  . ARG A 1 624 ? 103.090 90.038  38.797  1.00 0.00 ? 624 ARG A CD  1  
ATOM 3706   N NE  . ARG A 1 624 ? 102.592 89.705  37.410  1.00 0.00 ? 624 ARG A NE  1  
ATOM 3707   C CZ  . ARG A 1 624 ? 102.890 90.326  36.264  1.00 0.00 ? 624 ARG A CZ  1  
ATOM 3708   N NH1 . ARG A 1 624 ? 103.503 91.483  36.319  1.00 0.00 ? 624 ARG A NH1 1  
ATOM 3709   N NH2 . ARG A 1 624 ? 102.539 89.788  35.030  1.00 0.00 ? 624 ARG A NH2 1  
ATOM 3710   N N   . ILE A 1 625 ? 101.551 84.578  39.768  1.00 0.00 ? 625 ILE A N   1  
ATOM 3711   C CA  . ILE A 1 625 ? 101.158 83.365  39.014  1.00 0.00 ? 625 ILE A CA  1  
ATOM 3712   C C   . ILE A 1 625 ? 99.849  82.833  39.478  1.00 0.00 ? 625 ILE A C   1  
ATOM 3713   O O   . ILE A 1 625 ? 99.040  82.422  38.646  1.00 0.00 ? 625 ILE A O   1  
ATOM 3714   C CB  . ILE A 1 625 ? 102.312 82.263  38.995  1.00 0.00 ? 625 ILE A CB  1  
ATOM 3715   C CG1 . ILE A 1 625 ? 102.071 81.332  37.701  1.00 0.00 ? 625 ILE A CG1 1  
ATOM 3716   C CG2 . ILE A 1 625 ? 102.321 81.422  40.285  1.00 0.00 ? 625 ILE A CG2 1  
ATOM 3717   C CD1 . ILE A 1 625 ? 103.107 80.209  37.535  1.00 0.00 ? 625 ILE A CD1 1  
ATOM 3718   N N   . VAL A 1 626 ? 99.653  82.790  40.828  1.00 0.00 ? 626 VAL A N   1  
ATOM 3719   C CA  . VAL A 1 626 ? 98.430  82.173  41.450  1.00 0.00 ? 626 VAL A CA  1  
ATOM 3720   C C   . VAL A 1 626 ? 97.104  82.840  41.064  1.00 0.00 ? 626 VAL A C   1  
ATOM 3721   O O   . VAL A 1 626 ? 96.062  82.202  40.846  1.00 0.00 ? 626 VAL A O   1  
ATOM 3722   C CB  . VAL A 1 626 ? 98.636  81.931  42.940  1.00 0.00 ? 626 VAL A CB  1  
ATOM 3723   C CG1 . VAL A 1 626 ? 99.724  80.841  43.151  1.00 0.00 ? 626 VAL A CG1 1  
ATOM 3724   C CG2 . VAL A 1 626 ? 98.869  83.212  43.750  1.00 0.00 ? 626 VAL A CG2 1  
ATOM 3725   N N   . ARG A 1 627 ? 97.221  84.223  41.048  1.00 0.00 ? 627 ARG A N   1  
ATOM 3726   C CA  . ARG A 1 627 ? 96.127  85.151  40.751  1.00 0.00 ? 627 ARG A CA  1  
ATOM 3727   C C   . ARG A 1 627 ? 95.601  85.108  39.357  1.00 0.00 ? 627 ARG A C   1  
ATOM 3728   O O   . ARG A 1 627 ? 94.372  85.052  39.195  1.00 0.00 ? 627 ARG A O   1  
ATOM 3729   C CB  . ARG A 1 627 ? 96.434  86.588  41.137  1.00 0.00 ? 627 ARG A CB  1  
ATOM 3730   C CG  . ARG A 1 627 ? 96.726  86.911  42.612  1.00 0.00 ? 627 ARG A CG  1  
ATOM 3731   C CD  . ARG A 1 627 ? 96.735  88.374  43.006  1.00 0.00 ? 627 ARG A CD  1  
ATOM 3732   N NE  . ARG A 1 627 ? 97.870  88.992  42.253  1.00 0.00 ? 627 ARG A NE  1  
ATOM 3733   C CZ  . ARG A 1 627 ? 98.169  90.361  42.332  1.00 0.00 ? 627 ARG A CZ  1  
ATOM 3734   N NH1 . ARG A 1 627 ? 97.174  91.235  42.643  1.00 0.00 ? 627 ARG A NH1 1  
ATOM 3735   N NH2 . ARG A 1 627 ? 99.408  90.814  42.084  1.00 0.00 ? 627 ARG A NH2 1  
ATOM 3736   N N   . ALA A 1 628 ? 96.529  84.919  38.353  1.00 0.00 ? 628 ALA A N   1  
ATOM 3737   C CA  . ALA A 1 628 ? 96.332  84.642  36.911  1.00 0.00 ? 628 ALA A CA  1  
ATOM 3738   C C   . ALA A 1 628 ? 95.695  83.306  36.692  1.00 0.00 ? 628 ALA A C   1  
ATOM 3739   O O   . ALA A 1 628 ? 94.733  83.304  35.951  1.00 0.00 ? 628 ALA A O   1  
ATOM 3740   C CB  . ALA A 1 628 ? 97.717  84.693  36.176  1.00 0.00 ? 628 ALA A CB  1  
ATOM 3741   N N   . THR A 1 629 ? 96.150  82.243  37.424  1.00 0.00 ? 629 THR A N   1  
ATOM 3742   C CA  . THR A 1 629 ? 95.514  80.979  37.218  1.00 0.00 ? 629 THR A CA  1  
ATOM 3743   C C   . THR A 1 629 ? 94.054  81.087  37.580  1.00 0.00 ? 629 THR A C   1  
ATOM 3744   O O   . THR A 1 629 ? 93.186  80.596  36.875  1.00 0.00 ? 629 THR A O   1  
ATOM 3745   C CB  . THR A 1 629 ? 96.134  79.917  38.031  1.00 0.00 ? 629 THR A CB  1  
ATOM 3746   O OG1 . THR A 1 629 ? 97.541  79.927  37.919  1.00 0.00 ? 629 THR A OG1 1  
ATOM 3747   C CG2 . THR A 1 629 ? 95.662  78.517  37.549  1.00 0.00 ? 629 THR A CG2 1  
ATOM 3748   N N   . ARG A 1 630 ? 93.730  81.825  38.672  1.00 0.00 ? 630 ARG A N   1  
ATOM 3749   C CA  . ARG A 1 630 ? 92.344  81.966  39.107  1.00 0.00 ? 630 ARG A CA  1  
ATOM 3750   C C   . ARG A 1 630 ? 91.494  82.679  38.128  1.00 0.00 ? 630 ARG A C   1  
ATOM 3751   O O   . ARG A 1 630 ? 90.373  82.263  37.796  1.00 0.00 ? 630 ARG A O   1  
ATOM 3752   C CB  . ARG A 1 630 ? 92.182  82.657  40.467  1.00 0.00 ? 630 ARG A CB  1  
ATOM 3753   C CG  . ARG A 1 630 ? 92.929  82.173  41.741  1.00 0.00 ? 630 ARG A CG  1  
ATOM 3754   C CD  . ARG A 1 630 ? 93.057  80.602  41.922  1.00 0.00 ? 630 ARG A CD  1  
ATOM 3755   N NE  . ARG A 1 630 ? 91.699  80.053  41.854  1.00 0.00 ? 630 ARG A NE  1  
ATOM 3756   C CZ  . ARG A 1 630 ? 91.357  78.788  42.195  1.00 0.00 ? 630 ARG A CZ  1  
ATOM 3757   N NH1 . ARG A 1 630 ? 92.363  77.946  42.510  1.00 0.00 ? 630 ARG A NH1 1  
ATOM 3758   N NH2 . ARG A 1 630 ? 90.042  78.379  42.133  1.00 0.00 ? 630 ARG A NH2 1  
ATOM 3759   N N   . VAL A 1 631 ? 91.980  83.823  37.548  1.00 0.00 ? 631 VAL A N   1  
ATOM 3760   C CA  . VAL A 1 631 ? 91.257  84.707  36.658  1.00 0.00 ? 631 VAL A CA  1  
ATOM 3761   C C   . VAL A 1 631 ? 90.945  84.020  35.300  1.00 0.00 ? 631 VAL A C   1  
ATOM 3762   O O   . VAL A 1 631 ? 89.802  84.007  34.891  1.00 0.00 ? 631 VAL A O   1  
ATOM 3763   C CB  . VAL A 1 631 ? 92.258  85.901  36.468  1.00 0.00 ? 631 VAL A CB  1  
ATOM 3764   C CG1 . VAL A 1 631 ? 91.872  86.778  35.289  1.00 0.00 ? 631 VAL A CG1 1  
ATOM 3765   C CG2 . VAL A 1 631 ? 92.058  86.801  37.678  1.00 0.00 ? 631 VAL A CG2 1  
ATOM 3766   N N   . LEU A 1 632 ? 91.969  83.369  34.743  1.00 0.00 ? 632 LEU A N   1  
ATOM 3767   C CA  . LEU A 1 632 ? 91.952  82.679  33.480  1.00 0.00 ? 632 LEU A CA  1  
ATOM 3768   C C   . LEU A 1 632 ? 90.958  81.519  33.597  1.00 0.00 ? 632 LEU A C   1  
ATOM 3769   O O   . LEU A 1 632 ? 90.144  81.210  32.710  1.00 0.00 ? 632 LEU A O   1  
ATOM 3770   C CB  . LEU A 1 632 ? 93.366  82.052  33.132  1.00 0.00 ? 632 LEU A CB  1  
ATOM 3771   C CG  . LEU A 1 632 ? 94.477  83.036  32.755  1.00 0.00 ? 632 LEU A CG  1  
ATOM 3772   C CD1 . LEU A 1 632 ? 95.822  82.341  32.782  1.00 0.00 ? 632 LEU A CD1 1  
ATOM 3773   C CD2 . LEU A 1 632 ? 94.173  83.712  31.394  1.00 0.00 ? 632 LEU A CD2 1  
ATOM 3774   N N   . HIS A 1 633 ? 90.971  80.842  34.755  1.00 0.00 ? 633 HIS A N   1  
ATOM 3775   C CA  . HIS A 1 633 ? 90.100  79.684  34.938  1.00 0.00 ? 633 HIS A CA  1  
ATOM 3776   C C   . HIS A 1 633 ? 88.647  80.091  34.823  1.00 0.00 ? 633 HIS A C   1  
ATOM 3777   O O   . HIS A 1 633 ? 87.863  79.436  34.164  1.00 0.00 ? 633 HIS A O   1  
ATOM 3778   C CB  . HIS A 1 633 ? 90.541  79.086  36.303  1.00 0.00 ? 633 HIS A CB  1  
ATOM 3779   C CG  . HIS A 1 633 ? 89.530  78.665  37.264  1.00 0.00 ? 633 HIS A CG  1  
ATOM 3780   N ND1 . HIS A 1 633 ? 88.373  78.010  36.977  1.00 0.00 ? 633 HIS A ND1 1  
ATOM 3781   C CD2 . HIS A 1 633 ? 89.443  78.906  38.583  1.00 0.00 ? 633 HIS A CD2 1  
ATOM 3782   C CE1 . HIS A 1 633 ? 87.721  77.774  38.130  1.00 0.00 ? 633 HIS A CE1 1  
ATOM 3783   N NE2 . HIS A 1 633 ? 88.270  78.370  39.095  1.00 0.00 ? 633 HIS A NE2 1  
ATOM 3784   N N   . ALA A 1 634 ? 88.239  81.197  35.467  1.00 0.00 ? 634 ALA A N   1  
ATOM 3785   C CA  . ALA A 1 634 ? 86.863  81.515  35.411  1.00 0.00 ? 634 ALA A CA  1  
ATOM 3786   C C   . ALA A 1 634 ? 86.299  81.793  34.025  1.00 0.00 ? 634 ALA A C   1  
ATOM 3787   O O   . ALA A 1 634 ? 85.268  81.231  33.683  1.00 0.00 ? 634 ALA A O   1  
ATOM 3788   C CB  . ALA A 1 634 ? 86.559  82.729  36.333  1.00 0.00 ? 634 ALA A CB  1  
ATOM 3789   N N   . LYS A 1 635 ? 87.085  82.624  33.288  1.00 0.00 ? 635 LYS A N   1  
ATOM 3790   C CA  . LYS A 1 635 ? 86.653  82.903  31.958  1.00 0.00 ? 635 LYS A CA  1  
ATOM 3791   C C   . LYS A 1 635 ? 86.557  81.752  30.972  1.00 0.00 ? 635 LYS A C   1  
ATOM 3792   O O   . LYS A 1 635 ? 85.599  81.588  30.191  1.00 0.00 ? 635 LYS A O   1  
ATOM 3793   C CB  . LYS A 1 635 ? 87.517  84.057  31.298  1.00 0.00 ? 635 LYS A CB  1  
ATOM 3794   C CG  . LYS A 1 635 ? 87.566  85.355  32.162  1.00 0.00 ? 635 LYS A CG  1  
ATOM 3795   C CD  . LYS A 1 635 ? 88.587  86.342  31.651  1.00 0.00 ? 635 LYS A CD  1  
ATOM 3796   C CE  . LYS A 1 635 ? 88.659  87.735  32.354  1.00 0.00 ? 635 LYS A CE  1  
ATOM 3797   N NZ  . LYS A 1 635 ? 88.628  87.544  33.773  1.00 0.00 ? 635 LYS A NZ  1  
ATOM 3798   N N   . MET A 1 636 ? 87.601  80.917  31.010  1.00 0.00 ? 636 MET A N   1  
ATOM 3799   C CA  . MET A 1 636 ? 87.674  79.783  30.132  1.00 0.00 ? 636 MET A CA  1  
ATOM 3800   C C   . MET A 1 636 ? 86.631  78.729  30.186  1.00 0.00 ? 636 MET A C   1  
ATOM 3801   O O   . MET A 1 636 ? 86.159  78.228  29.152  1.00 0.00 ? 636 MET A O   1  
ATOM 3802   C CB  . MET A 1 636 ? 88.938  78.948  30.149  1.00 0.00 ? 636 MET A CB  1  
ATOM 3803   C CG  . MET A 1 636 ? 90.327  79.724  29.964  1.00 0.00 ? 636 MET A CG  1  
ATOM 3804   S SD  . MET A 1 636 ? 91.690  78.823  30.734  1.00 0.00 ? 636 MET A SD  1  
ATOM 3805   C CE  . MET A 1 636 ? 92.948  79.765  29.823  1.00 0.00 ? 636 MET A CE  1  
ATOM 3806   N N   . ASN A 1 637 ? 86.230  78.381  31.442  1.00 0.00 ? 637 ASN A N   1  
ATOM 3807   C CA  . ASN A 1 637 ? 85.232  77.433  31.792  1.00 0.00 ? 637 ASN A CA  1  
ATOM 3808   C C   . ASN A 1 637 ? 83.833  77.838  31.415  1.00 0.00 ? 637 ASN A C   1  
ATOM 3809   O O   . ASN A 1 637 ? 83.038  76.983  30.957  1.00 0.00 ? 637 ASN A O   1  
ATOM 3810   C CB  . ASN A 1 637 ? 85.269  77.246  33.295  1.00 0.00 ? 637 ASN A CB  1  
ATOM 3811   C CG  . ASN A 1 637 ? 86.345  76.258  33.736  1.00 0.00 ? 637 ASN A CG  1  
ATOM 3812   O OD1 . ASN A 1 637 ? 87.492  76.617  34.139  1.00 0.00 ? 637 ASN A OD1 1  
ATOM 3813   N ND2 . ASN A 1 637 ? 86.064  74.933  33.485  1.00 0.00 ? 637 ASN A ND2 1  
ATOM 3814   N N   . HIS A 1 638 ? 83.534  79.124  31.641  1.00 0.00 ? 638 HIS A N   1  
ATOM 3815   C CA  . HIS A 1 638 ? 82.212  79.592  31.271  1.00 0.00 ? 638 HIS A CA  1  
ATOM 3816   C C   . HIS A 1 638 ? 82.015  79.570  29.707  1.00 0.00 ? 638 HIS A C   1  
ATOM 3817   O O   . HIS A 1 638 ? 80.982  79.043  29.244  1.00 0.00 ? 638 HIS A O   1  
ATOM 3818   C CB  . HIS A 1 638 ? 81.916  81.121  31.565  1.00 0.00 ? 638 HIS A CB  1  
ATOM 3819   C CG  . HIS A 1 638 ? 80.745  81.768  30.840  1.00 0.00 ? 638 HIS A CG  1  
ATOM 3820   N ND1 . HIS A 1 638 ? 79.431  81.370  30.882  1.00 0.00 ? 638 HIS A ND1 1  
ATOM 3821   C CD2 . HIS A 1 638 ? 80.765  82.665  29.793  1.00 0.00 ? 638 HIS A CD2 1  
ATOM 3822   C CE1 . HIS A 1 638 ? 78.738  82.166  30.002  1.00 0.00 ? 638 HIS A CE1 1  
ATOM 3823   N NE2 . HIS A 1 638 ? 79.506  82.931  29.285  1.00 0.00 ? 638 HIS A NE2 1  
ATOM 3824   N N   . PHE A 1 639 ? 83.017  80.102  28.973  1.00 0.00 ? 639 PHE A N   1  
ATOM 3825   C CA  . PHE A 1 639 ? 82.808  80.143  27.495  1.00 0.00 ? 639 PHE A CA  1  
ATOM 3826   C C   . PHE A 1 639 ? 82.620  78.762  26.870  1.00 0.00 ? 639 PHE A C   1  
ATOM 3827   O O   . PHE A 1 639 ? 81.750  78.450  26.095  1.00 0.00 ? 639 PHE A O   1  
ATOM 3828   C CB  . PHE A 1 639 ? 83.913  80.954  26.732  1.00 0.00 ? 639 PHE A CB  1  
ATOM 3829   C CG  . PHE A 1 639 ? 83.899  82.373  27.056  1.00 0.00 ? 639 PHE A CG  1  
ATOM 3830   C CD1 . PHE A 1 639 ? 82.675  83.103  26.755  1.00 0.00 ? 639 PHE A CD1 1  
ATOM 3831   C CD2 . PHE A 1 639 ? 85.061  83.127  27.456  1.00 0.00 ? 639 PHE A CD2 1  
ATOM 3832   C CE1 . PHE A 1 639 ? 82.625  84.436  27.030  1.00 0.00 ? 639 PHE A CE1 1  
ATOM 3833   C CE2 . PHE A 1 639 ? 84.928  84.424  27.721  1.00 0.00 ? 639 PHE A CE2 1  
ATOM 3834   C CZ  . PHE A 1 639 ? 83.726  85.161  27.523  1.00 0.00 ? 639 PHE A CZ  1  
ATOM 3835   N N   . ILE A 1 640 ? 83.466  77.803  27.301  1.00 0.00 ? 640 ILE A N   1  
ATOM 3836   C CA  . ILE A 1 640 ? 83.397  76.394  26.794  1.00 0.00 ? 640 ILE A CA  1  
ATOM 3837   C C   . ILE A 1 640 ? 82.090  75.827  27.197  1.00 0.00 ? 640 ILE A C   1  
ATOM 3838   O O   . ILE A 1 640 ? 81.406  75.171  26.341  1.00 0.00 ? 640 ILE A O   1  
ATOM 3839   C CB  . ILE A 1 640 ? 84.530  75.612  27.272  1.00 0.00 ? 640 ILE A CB  1  
ATOM 3840   C CG1 . ILE A 1 640 ? 85.835  76.238  26.808  1.00 0.00 ? 640 ILE A CG1 1  
ATOM 3841   C CG2 . ILE A 1 640 ? 84.441  74.136  26.820  1.00 0.00 ? 640 ILE A CG2 1  
ATOM 3842   C CD1 . ILE A 1 640 ? 87.093  75.480  27.265  1.00 0.00 ? 640 ILE A CD1 1  
ATOM 3843   N N   . LYS A 1 641 ? 81.658  76.079  28.436  1.00 0.00 ? 641 LYS A N   1  
ATOM 3844   C CA  . LYS A 1 641 ? 80.411  75.527  28.897  1.00 0.00 ? 641 LYS A CA  1  
ATOM 3845   C C   . LYS A 1 641 ? 79.233  76.069  28.135  1.00 0.00 ? 641 LYS A C   1  
ATOM 3846   O O   . LYS A 1 641 ? 78.352  75.241  27.920  1.00 0.00 ? 641 LYS A O   1  
ATOM 3847   C CB  . LYS A 1 641 ? 80.117  75.594  30.426  1.00 0.00 ? 641 LYS A CB  1  
ATOM 3848   C CG  . LYS A 1 641 ? 79.062  74.466  30.877  1.00 0.00 ? 641 LYS A CG  1  
ATOM 3849   C CD  . LYS A 1 641 ? 78.716  74.514  32.323  1.00 0.00 ? 641 LYS A CD  1  
ATOM 3850   C CE  . LYS A 1 641 ? 79.513  73.628  33.238  1.00 0.00 ? 641 LYS A CE  1  
ATOM 3851   N NZ  . LYS A 1 641 ? 79.100  72.187  33.042  1.00 0.00 ? 641 LYS A NZ  1  
ATOM 3852   N N   . THR A 1 642 ? 79.201  77.328  27.748  1.00 0.00 ? 642 THR A N   1  
ATOM 3853   C CA  . THR A 1 642 ? 78.112  77.893  26.959  1.00 0.00 ? 642 THR A CA  1  
ATOM 3854   C C   . THR A 1 642 ? 78.031  77.300  25.514  1.00 0.00 ? 642 THR A C   1  
ATOM 3855   O O   . THR A 1 642 ? 76.962  76.928  25.010  1.00 0.00 ? 642 THR A O   1  
ATOM 3856   C CB  . THR A 1 642 ? 78.059  79.389  26.963  1.00 0.00 ? 642 THR A CB  1  
ATOM 3857   O OG1 . THR A 1 642 ? 79.318  79.916  26.786  1.00 0.00 ? 642 THR A OG1 1  
ATOM 3858   C CG2 . THR A 1 642 ? 77.489  79.851  28.306  1.00 0.00 ? 642 THR A CG2 1  
ATOM 3859   N N   . ILE A 1 643 ? 79.235  77.076  24.845  1.00 0.00 ? 643 ILE A N   1  
ATOM 3860   C CA  . ILE A 1 643 ? 79.378  76.440  23.522  1.00 0.00 ? 643 ILE A CA  1  
ATOM 3861   C C   . ILE A 1 643 ? 78.835  75.072  23.595  1.00 0.00 ? 643 ILE A C   1  
ATOM 3862   O O   . ILE A 1 643 ? 77.971  74.634  22.842  1.00 0.00 ? 643 ILE A O   1  
ATOM 3863   C CB  . ILE A 1 643 ? 80.800  76.570  23.086  1.00 0.00 ? 643 ILE A CB  1  
ATOM 3864   C CG1 . ILE A 1 643 ? 81.238  78.043  22.862  1.00 0.00 ? 643 ILE A CG1 1  
ATOM 3865   C CG2 . ILE A 1 643 ? 81.088  75.711  21.791  1.00 0.00 ? 643 ILE A CG2 1  
ATOM 3866   C CD1 . ILE A 1 643 ? 82.701  78.201  22.412  1.00 0.00 ? 643 ILE A CD1 1  
ATOM 3867   N N   . MET A 1 644 ? 79.190  74.322  24.636  1.00 0.00 ? 644 MET A N   1  
ATOM 3868   C CA  . MET A 1 644 ? 78.725  72.962  24.975  1.00 0.00 ? 644 MET A CA  1  
ATOM 3869   C C   . MET A 1 644 ? 77.236  72.911  25.250  1.00 0.00 ? 644 MET A C   1  
ATOM 3870   O O   . MET A 1 644 ? 76.521  72.019  24.802  1.00 0.00 ? 644 MET A O   1  
ATOM 3871   C CB  . MET A 1 644 ? 79.411  72.220  26.199  1.00 0.00 ? 644 MET A CB  1  
ATOM 3872   C CG  . MET A 1 644 ? 79.123  70.759  26.403  1.00 0.00 ? 644 MET A CG  1  
ATOM 3873   S SD  . MET A 1 644 ? 80.397  69.881  27.365  1.00 0.00 ? 644 MET A SD  1  
ATOM 3874   C CE  . MET A 1 644 ? 80.525  70.989  28.807  1.00 0.00 ? 644 MET A CE  1  
ATOM 3875   N N   . GLU A 1 645 ? 76.672  73.902  25.966  1.00 0.00 ? 645 GLU A N   1  
ATOM 3876   C CA  . GLU A 1 645 ? 75.277  73.948  26.326  1.00 0.00 ? 645 GLU A CA  1  
ATOM 3877   C C   . GLU A 1 645 ? 74.415  73.959  25.059  1.00 0.00 ? 645 GLU A C   1  
ATOM 3878   O O   . GLU A 1 645 ? 73.547  73.130  24.879  1.00 0.00 ? 645 GLU A O   1  
ATOM 3879   C CB  . GLU A 1 645 ? 74.791  75.195  27.096  1.00 0.00 ? 645 GLU A CB  1  
ATOM 3880   C CG  . GLU A 1 645 ? 73.232  75.120  27.355  1.00 0.00 ? 645 GLU A CG  1  
ATOM 3881   C CD  . GLU A 1 645 ? 72.642  76.490  27.498  1.00 0.00 ? 645 GLU A CD  1  
ATOM 3882   O OE1 . GLU A 1 645 ? 73.364  77.211  28.185  1.00 0.00 ? 645 GLU A OE1 1  
ATOM 3883   O OE2 . GLU A 1 645 ? 71.468  76.716  27.127  1.00 0.00 ? 645 GLU A OE2 1  
ATOM 3884   N N   . TYR A 1 646 ? 74.723  74.846  24.088  1.00 0.00 ? 646 TYR A N   1  
ATOM 3885   C CA  . TYR A 1 646 ? 74.109  75.025  22.813  1.00 0.00 ? 646 TYR A CA  1  
ATOM 3886   C C   . TYR A 1 646 ? 74.269  73.962  21.862  1.00 0.00 ? 646 TYR A C   1  
ATOM 3887   O O   . TYR A 1 646 ? 73.327  73.588  21.141  1.00 0.00 ? 646 TYR A O   1  
ATOM 3888   C CB  . TYR A 1 646 ? 74.381  76.416  22.157  1.00 0.00 ? 646 TYR A CB  1  
ATOM 3889   C CG  . TYR A 1 646 ? 74.020  77.540  23.095  1.00 0.00 ? 646 TYR A CG  1  
ATOM 3890   C CD1 . TYR A 1 646 ? 72.725  77.671  23.639  1.00 0.00 ? 646 TYR A CD1 1  
ATOM 3891   C CD2 . TYR A 1 646 ? 74.971  78.527  23.275  1.00 0.00 ? 646 TYR A CD2 1  
ATOM 3892   C CE1 . TYR A 1 646 ? 72.404  78.759  24.475  1.00 0.00 ? 646 TYR A CE1 1  
ATOM 3893   C CE2 . TYR A 1 646 ? 74.592  79.584  24.122  1.00 0.00 ? 646 TYR A CE2 1  
ATOM 3894   C CZ  . TYR A 1 646 ? 73.322  79.707  24.687  1.00 0.00 ? 646 TYR A CZ  1  
ATOM 3895   O OH  . TYR A 1 646 ? 73.119  80.738  25.630  1.00 0.00 ? 646 TYR A OH  1  
ATOM 3896   N N   . PHE A 1 647 ? 75.553  73.424  21.830  1.00 0.00 ? 647 PHE A N   1  
ATOM 3897   C CA  . PHE A 1 647 ? 75.802  72.307  20.965  1.00 0.00 ? 647 PHE A CA  1  
ATOM 3898   C C   . PHE A 1 647 ? 74.842  71.059  21.298  1.00 0.00 ? 647 PHE A C   1  
ATOM 3899   O O   . PHE A 1 647 ? 74.338  70.341  20.435  1.00 0.00 ? 647 PHE A O   1  
ATOM 3900   C CB  . PHE A 1 647 ? 77.304  71.818  20.992  1.00 0.00 ? 647 PHE A CB  1  
ATOM 3901   C CG  . PHE A 1 647 ? 77.638  71.031  19.712  1.00 0.00 ? 647 PHE A CG  1  
ATOM 3902   C CD1 . PHE A 1 647 ? 77.858  71.844  18.527  1.00 0.00 ? 647 PHE A CD1 1  
ATOM 3903   C CD2 . PHE A 1 647 ? 77.457  69.593  19.525  1.00 0.00 ? 647 PHE A CD2 1  
ATOM 3904   C CE1 . PHE A 1 647 ? 77.939  71.260  17.252  1.00 0.00 ? 647 PHE A CE1 1  
ATOM 3905   C CE2 . PHE A 1 647 ? 77.664  69.056  18.277  1.00 0.00 ? 647 PHE A CE2 1  
ATOM 3906   C CZ  . PHE A 1 647 ? 77.843  69.883  17.131  1.00 0.00 ? 647 PHE A CZ  1  
ATOM 3907   N N   . ASN A 1 648 ? 74.699  70.755  22.588  1.00 0.00 ? 648 ASN A N   1  
ATOM 3908   C CA  . ASN A 1 648 ? 73.989  69.612  23.202  1.00 0.00 ? 648 ASN A CA  1  
ATOM 3909   C C   . ASN A 1 648 ? 72.505  69.850  22.892  1.00 0.00 ? 648 ASN A C   1  
ATOM 3910   O O   . ASN A 1 648 ? 71.804  69.019  22.384  1.00 0.00 ? 648 ASN A O   1  
ATOM 3911   C CB  . ASN A 1 648 ? 74.074  69.640  24.773  1.00 0.00 ? 648 ASN A CB  1  
ATOM 3912   C CG  . ASN A 1 648 ? 75.449  69.139  25.300  1.00 0.00 ? 648 ASN A CG  1  
ATOM 3913   O OD1 . ASN A 1 648 ? 75.450  68.780  26.418  1.00 0.00 ? 648 ASN A OD1 1  
ATOM 3914   N ND2 . ASN A 1 648 ? 76.503  69.129  24.494  1.00 0.00 ? 648 ASN A ND2 1  
ATOM 3915   N N   . GLN A 1 649 ? 72.071  71.080  23.263  1.00 0.00 ? 649 GLN A N   1  
ATOM 3916   C CA  . GLN A 1 649 ? 70.714  71.520  23.290  1.00 0.00 ? 649 GLN A CA  1  
ATOM 3917   C C   . GLN A 1 649 ? 70.037  71.694  21.928  1.00 0.00 ? 649 GLN A C   1  
ATOM 3918   O O   . GLN A 1 649 ? 69.021  71.050  21.657  1.00 0.00 ? 649 GLN A O   1  
ATOM 3919   C CB  . GLN A 1 649 ? 70.645  72.908  24.035  1.00 0.00 ? 649 GLN A CB  1  
ATOM 3920   C CG  . GLN A 1 649 ? 69.184  73.221  24.257  1.00 0.00 ? 649 GLN A CG  1  
ATOM 3921   C CD  . GLN A 1 649 ? 69.126  74.298  25.284  1.00 0.00 ? 649 GLN A CD  1  
ATOM 3922   O OE1 . GLN A 1 649 ? 69.718  75.343  25.023  1.00 0.00 ? 649 GLN A OE1 1  
ATOM 3923   N NE2 . GLN A 1 649 ? 68.316  74.140  26.330  1.00 0.00 ? 649 GLN A NE2 1  
ATOM 3924   N N   . ASN A 1 650 ? 70.681  72.566  21.048  1.00 0.00 ? 650 ASN A N   1  
ATOM 3925   C CA  . ASN A 1 650 ? 70.053  72.909  19.752  1.00 0.00 ? 650 ASN A CA  1  
ATOM 3926   C C   . ASN A 1 650 ? 70.131  71.791  18.833  1.00 0.00 ? 650 ASN A C   1  
ATOM 3927   O O   . ASN A 1 650 ? 69.371  71.834  17.899  1.00 0.00 ? 650 ASN A O   1  
ATOM 3928   C CB  . ASN A 1 650 ? 70.806  74.082  19.054  1.00 0.00 ? 650 ASN A CB  1  
ATOM 3929   C CG  . ASN A 1 650 ? 70.310  75.463  19.581  1.00 0.00 ? 650 ASN A CG  1  
ATOM 3930   O OD1 . ASN A 1 650 ? 69.325  75.974  19.116  1.00 0.00 ? 650 ASN A OD1 1  
ATOM 3931   N ND2 . ASN A 1 650 ? 71.140  76.003  20.525  1.00 0.00 ? 650 ASN A ND2 1  
ATOM 3932   N N   . VAL A 1 651 ? 71.040  70.827  18.996  1.00 0.00 ? 651 VAL A N   1  
ATOM 3933   C CA  . VAL A 1 651 ? 71.311  69.782  18.050  1.00 0.00 ? 651 VAL A CA  1  
ATOM 3934   C C   . VAL A 1 651 ? 70.789  68.393  18.563  1.00 0.00 ? 651 VAL A C   1  
ATOM 3935   O O   . VAL A 1 651 ? 69.742  67.919  18.274  1.00 0.00 ? 651 VAL A O   1  
ATOM 3936   C CB  . VAL A 1 651 ? 72.801  69.626  17.692  1.00 0.00 ? 651 VAL A CB  1  
ATOM 3937   C CG1 . VAL A 1 651 ? 73.092  68.732  16.387  1.00 0.00 ? 651 VAL A CG1 1  
ATOM 3938   C CG2 . VAL A 1 651 ? 73.219  71.086  17.467  1.00 0.00 ? 651 VAL A CG2 1  
ATOM 3939   N N   . ILE A 1 652 ? 71.634  67.754  19.417  1.00 0.00 ? 652 ILE A N   1  
ATOM 3940   C CA  . ILE A 1 652 ? 71.496  66.388  19.803  1.00 0.00 ? 652 ILE A CA  1  
ATOM 3941   C C   . ILE A 1 652 ? 70.226  66.086  20.517  1.00 0.00 ? 652 ILE A C   1  
ATOM 3942   O O   . ILE A 1 652 ? 69.425  65.221  20.068  1.00 0.00 ? 652 ILE A O   1  
ATOM 3943   C CB  . ILE A 1 652 ? 72.726  66.037  20.583  1.00 0.00 ? 652 ILE A CB  1  
ATOM 3944   C CG1 . ILE A 1 652 ? 73.945  65.839  19.596  1.00 0.00 ? 652 ILE A CG1 1  
ATOM 3945   C CG2 . ILE A 1 652 ? 72.607  64.702  21.346  1.00 0.00 ? 652 ILE A CG2 1  
ATOM 3946   C CD1 . ILE A 1 652 ? 75.266  65.473  20.296  1.00 0.00 ? 652 ILE A CD1 1  
ATOM 3947   N N   . ASP A 1 653 ? 69.921  66.895  21.600  1.00 0.00 ? 653 ASP A N   1  
ATOM 3948   C CA  . ASP A 1 653 ? 68.798  66.699  22.437  1.00 0.00 ? 653 ASP A CA  1  
ATOM 3949   C C   . ASP A 1 653 ? 67.502  66.987  21.686  1.00 0.00 ? 653 ASP A C   1  
ATOM 3950   O O   . ASP A 1 653 ? 66.518  66.254  21.820  1.00 0.00 ? 653 ASP A O   1  
ATOM 3951   C CB  . ASP A 1 653 ? 69.061  67.583  23.645  1.00 0.00 ? 653 ASP A CB  1  
ATOM 3952   C CG  . ASP A 1 653 ? 67.955  67.465  24.801  1.00 0.00 ? 653 ASP A CG  1  
ATOM 3953   O OD1 . ASP A 1 653 ? 66.868  66.899  24.656  1.00 0.00 ? 653 ASP A OD1 1  
ATOM 3954   O OD2 . ASP A 1 653 ? 68.372  67.924  25.883  1.00 0.00 ? 653 ASP A OD2 1  
ATOM 3955   N N   . LYS A 1 654 ? 67.485  68.006  20.799  1.00 0.00 ? 654 LYS A N   1  
ATOM 3956   C CA  . LYS A 1 654 ? 66.346  68.480  19.993  1.00 0.00 ? 654 LYS A CA  1  
ATOM 3957   C C   . LYS A 1 654 ? 65.871  67.438  18.943  1.00 0.00 ? 654 LYS A C   1  
ATOM 3958   O O   . LYS A 1 654 ? 64.713  67.147  18.803  1.00 0.00 ? 654 LYS A O   1  
ATOM 3959   C CB  . LYS A 1 654 ? 66.806  69.777  19.318  1.00 0.00 ? 654 LYS A CB  1  
ATOM 3960   C CG  . LYS A 1 654 ? 65.699  70.524  18.595  1.00 0.00 ? 654 LYS A CG  1  
ATOM 3961   C CD  . LYS A 1 654 ? 65.983  71.997  18.178  1.00 0.00 ? 654 LYS A CD  1  
ATOM 3962   C CE  . LYS A 1 654 ? 64.770  72.785  17.582  1.00 0.00 ? 654 LYS A CE  1  
ATOM 3963   N NZ  . LYS A 1 654 ? 65.057  74.264  17.367  1.00 0.00 ? 654 LYS A NZ  1  
ATOM 3964   N N   . GLU A 1 655 ? 66.853  66.886  18.201  1.00 0.00 ? 655 GLU A N   1  
ATOM 3965   C CA  . GLU A 1 655 ? 66.735  65.851  17.219  1.00 0.00 ? 655 GLU A CA  1  
ATOM 3966   C C   . GLU A 1 655 ? 66.249  64.477  17.761  1.00 0.00 ? 655 GLU A C   1  
ATOM 3967   O O   . GLU A 1 655 ? 65.289  63.938  17.246  1.00 0.00 ? 655 GLU A O   1  
ATOM 3968   C CB  . GLU A 1 655 ? 68.113  65.555  16.549  1.00 0.00 ? 655 GLU A CB  1  
ATOM 3969   C CG  . GLU A 1 655 ? 68.601  66.650  15.635  1.00 0.00 ? 655 GLU A CG  1  
ATOM 3970   C CD  . GLU A 1 655 ? 70.029  66.303  15.144  1.00 0.00 ? 655 GLU A CD  1  
ATOM 3971   O OE1 . GLU A 1 655 ? 70.923  66.235  16.030  1.00 0.00 ? 655 GLU A OE1 1  
ATOM 3972   O OE2 . GLU A 1 655 ? 70.238  66.313  13.934  1.00 0.00 ? 655 GLU A OE2 1  
ATOM 3973   N N   . VAL A 1 656 ? 66.835  64.015  18.910  1.00 0.00 ? 656 VAL A N   1  
ATOM 3974   C CA  . VAL A 1 656 ? 66.447  62.727  19.496  1.00 0.00 ? 656 VAL A CA  1  
ATOM 3975   C C   . VAL A 1 656 ? 64.987  62.782  19.934  1.00 0.00 ? 656 VAL A C   1  
ATOM 3976   O O   . VAL A 1 656 ? 64.246  61.762  19.839  1.00 0.00 ? 656 VAL A O   1  
ATOM 3977   C CB  . VAL A 1 656 ? 67.267  62.104  20.702  1.00 0.00 ? 656 VAL A CB  1  
ATOM 3978   C CG1 . VAL A 1 656 ? 68.658  61.685  20.256  1.00 0.00 ? 656 VAL A CG1 1  
ATOM 3979   C CG2 . VAL A 1 656 ? 67.263  63.148  21.909  1.00 0.00 ? 656 VAL A CG2 1  
ATOM 3980   N N   . TYR A 1 657 ? 64.473  63.963  20.474  1.00 0.00 ? 657 TYR A N   1  
ATOM 3981   C CA  . TYR A 1 657 ? 63.070  64.029  20.880  1.00 0.00 ? 657 TYR A CA  1  
ATOM 3982   C C   . TYR A 1 657 ? 62.189  63.775  19.669  1.00 0.00 ? 657 TYR A C   1  
ATOM 3983   O O   . TYR A 1 657 ? 61.211  62.944  19.738  1.00 0.00 ? 657 TYR A O   1  
ATOM 3984   C CB  . TYR A 1 657 ? 62.644  65.427  21.522  1.00 0.00 ? 657 TYR A CB  1  
ATOM 3985   C CG  . TYR A 1 657 ? 62.771  65.498  23.082  1.00 0.00 ? 657 TYR A CG  1  
ATOM 3986   C CD1 . TYR A 1 657 ? 64.017  65.130  23.685  1.00 0.00 ? 657 TYR A CD1 1  
ATOM 3987   C CD2 . TYR A 1 657 ? 61.627  65.648  23.980  1.00 0.00 ? 657 TYR A CD2 1  
ATOM 3988   C CE1 . TYR A 1 657 ? 64.127  65.047  25.074  1.00 0.00 ? 657 TYR A CE1 1  
ATOM 3989   C CE2 . TYR A 1 657 ? 61.693  65.446  25.360  1.00 0.00 ? 657 TYR A CE2 1  
ATOM 3990   C CZ  . TYR A 1 657 ? 62.994  65.208  25.911  1.00 0.00 ? 657 TYR A CZ  1  
ATOM 3991   O OH  . TYR A 1 657 ? 63.054  65.091  27.324  1.00 0.00 ? 657 TYR A OH  1  
ATOM 3992   N N   . SER A 1 658 ? 62.498  64.427  18.501  1.00 0.00 ? 658 SER A N   1  
ATOM 3993   C CA  . SER A 1 658 ? 61.755  64.244  17.346  1.00 0.00 ? 658 SER A CA  1  
ATOM 3994   C C   . SER A 1 658 ? 61.776  62.864  16.732  1.00 0.00 ? 658 SER A C   1  
ATOM 3995   O O   . SER A 1 658 ? 60.734  62.378  16.240  1.00 0.00 ? 658 SER A O   1  
ATOM 3996   C CB  . SER A 1 658 ? 62.306  65.224  16.247  1.00 0.00 ? 658 SER A CB  1  
ATOM 3997   O OG  . SER A 1 658 ? 62.540  66.576  16.731  1.00 0.00 ? 658 SER A OG  1  
ATOM 3998   N N   . LEU A 1 659 ? 62.929  62.054  16.693  1.00 0.00 ? 659 LEU A N   1  
ATOM 3999   C CA  . LEU A 1 659 ? 63.091  60.728  16.159  1.00 0.00 ? 659 LEU A CA  1  
ATOM 4000   C C   . LEU A 1 659 ? 62.269  59.746  16.874  1.00 0.00 ? 659 LEU A C   1  
ATOM 4001   O O   . LEU A 1 659 ? 61.536  59.008  16.240  1.00 0.00 ? 659 LEU A O   1  
ATOM 4002   C CB  . LEU A 1 659 ? 64.531  60.139  16.183  1.00 0.00 ? 659 LEU A CB  1  
ATOM 4003   C CG  . LEU A 1 659 ? 65.721  60.923  15.627  1.00 0.00 ? 659 LEU A CG  1  
ATOM 4004   C CD1 . LEU A 1 659 ? 66.910  59.991  15.388  1.00 0.00 ? 659 LEU A CD1 1  
ATOM 4005   C CD2 . LEU A 1 659 ? 65.476  61.646  14.312  1.00 0.00 ? 659 LEU A CD2 1  
ATOM 4006   N N   . GLU A 1 660 ? 62.221  59.751  18.201  1.00 0.00 ? 660 GLU A N   1  
ATOM 4007   C CA  . GLU A 1 660 ? 61.362  58.837  18.988  1.00 0.00 ? 660 GLU A CA  1  
ATOM 4008   C C   . GLU A 1 660 ? 59.919  59.053  18.768  1.00 0.00 ? 660 GLU A C   1  
ATOM 4009   O O   . GLU A 1 660 ? 59.126  58.071  18.647  1.00 0.00 ? 660 GLU A O   1  
ATOM 4010   C CB  . GLU A 1 660 ? 61.666  58.756  20.570  1.00 0.00 ? 660 GLU A CB  1  
ATOM 4011   C CG  . GLU A 1 660 ? 60.847  57.657  21.300  1.00 0.00 ? 660 GLU A CG  1  
ATOM 4012   C CD  . GLU A 1 660 ? 61.568  56.285  21.466  1.00 0.00 ? 660 GLU A CD  1  
ATOM 4013   O OE1 . GLU A 1 660 ? 62.716  56.172  21.030  1.00 0.00 ? 660 GLU A OE1 1  
ATOM 4014   O OE2 . GLU A 1 660 ? 60.922  55.354  21.987  1.00 0.00 ? 660 GLU A OE2 1  
ATOM 4015   N N   . LYS A 1 661 ? 59.511  60.345  18.630  1.00 0.00 ? 661 LYS A N   1  
ATOM 4016   C CA  . LYS A 1 661 ? 58.082  60.658  18.327  1.00 0.00 ? 661 LYS A CA  1  
ATOM 4017   C C   . LYS A 1 661 ? 57.691  60.100  16.953  1.00 0.00 ? 661 LYS A C   1  
ATOM 4018   O O   . LYS A 1 661 ? 56.611  59.525  16.886  1.00 0.00 ? 661 LYS A O   1  
ATOM 4019   C CB  . LYS A 1 661 ? 57.748  62.170  18.447  1.00 0.00 ? 661 LYS A CB  1  
ATOM 4020   C CG  . LYS A 1 661 ? 56.266  62.350  18.597  1.00 0.00 ? 661 LYS A CG  1  
ATOM 4021   C CD  . LYS A 1 661 ? 55.980  63.858  18.631  1.00 0.00 ? 661 LYS A CD  1  
ATOM 4022   C CE  . LYS A 1 661 ? 54.407  63.958  18.768  1.00 0.00 ? 661 LYS A CE  1  
ATOM 4023   N NZ  . LYS A 1 661 ? 54.034  65.348  18.525  1.00 0.00 ? 661 LYS A NZ  1  
ATOM 4024   N N   . CYS A 1 662 ? 58.522  60.319  15.828  1.00 0.00 ? 662 CYS A N   1  
ATOM 4025   C CA  . CYS A 1 662 ? 58.107  59.941  14.507  1.00 0.00 ? 662 CYS A CA  1  
ATOM 4026   C C   . CYS A 1 662 ? 58.000  58.410  14.500  1.00 0.00 ? 662 CYS A C   1  
ATOM 4027   O O   . CYS A 1 662 ? 57.049  57.839  14.001  1.00 0.00 ? 662 CYS A O   1  
ATOM 4028   C CB  . CYS A 1 662 ? 59.104  60.424  13.417  1.00 0.00 ? 662 CYS A CB  1  
ATOM 4029   S SG  . CYS A 1 662 ? 58.279  60.171  11.781  1.00 0.00 ? 662 CYS A SG  1  
ATOM 4030   N N   . TYR A 1 663 ? 58.897  57.725  15.185  1.00 0.00 ? 663 TYR A N   1  
ATOM 4031   C CA  . TYR A 1 663 ? 58.856  56.252  15.256  1.00 0.00 ? 663 TYR A CA  1  
ATOM 4032   C C   . TYR A 1 663 ? 57.601  55.678  15.945  1.00 0.00 ? 663 TYR A C   1  
ATOM 4033   O O   . TYR A 1 663 ? 57.062  54.577  15.622  1.00 0.00 ? 663 TYR A O   1  
ATOM 4034   C CB  . TYR A 1 663 ? 60.035  55.778  16.021  1.00 0.00 ? 663 TYR A CB  1  
ATOM 4035   C CG  . TYR A 1 663 ? 60.188  54.307  15.887  1.00 0.00 ? 663 TYR A CG  1  
ATOM 4036   C CD1 . TYR A 1 663 ? 60.613  53.707  14.692  1.00 0.00 ? 663 TYR A CD1 1  
ATOM 4037   C CD2 . TYR A 1 663 ? 59.914  53.400  16.900  1.00 0.00 ? 663 TYR A CD2 1  
ATOM 4038   C CE1 . TYR A 1 663 ? 60.669  52.345  14.499  1.00 0.00 ? 663 TYR A CE1 1  
ATOM 4039   C CE2 . TYR A 1 663 ? 60.130  52.051  16.841  1.00 0.00 ? 663 TYR A CE2 1  
ATOM 4040   C CZ  . TYR A 1 663 ? 60.447  51.478  15.622  1.00 0.00 ? 663 TYR A CZ  1  
ATOM 4041   O OH  . TYR A 1 663 ? 60.461  50.079  15.558  1.00 0.00 ? 663 TYR A OH  1  
ATOM 4042   N N   . ARG A 1 664 ? 57.150  56.343  17.096  1.00 0.00 ? 664 ARG A N   1  
ATOM 4043   C CA  . ARG A 1 664 ? 56.058  55.722  17.944  1.00 0.00 ? 664 ARG A CA  1  
ATOM 4044   C C   . ARG A 1 664 ? 54.639  55.599  17.378  1.00 0.00 ? 664 ARG A C   1  
ATOM 4045   O O   . ARG A 1 664 ? 53.958  54.618  17.653  1.00 0.00 ? 664 ARG A O   1  
ATOM 4046   C CB  . ARG A 1 664 ? 56.138  56.552  19.260  1.00 0.00 ? 664 ARG A CB  1  
ATOM 4047   C CG  . ARG A 1 664 ? 55.412  56.004  20.541  1.00 0.00 ? 664 ARG A CG  1  
ATOM 4048   C CD  . ARG A 1 664 ? 56.291  55.025  21.352  1.00 0.00 ? 664 ARG A CD  1  
ATOM 4049   N NE  . ARG A 1 664 ? 56.463  53.732  20.610  1.00 0.00 ? 664 ARG A NE  1  
ATOM 4050   C CZ  . ARG A 1 664 ? 57.621  52.972  20.683  1.00 0.00 ? 664 ARG A CZ  1  
ATOM 4051   N NH1 . ARG A 1 664 ? 58.496  53.230  21.698  1.00 0.00 ? 664 ARG A NH1 1  
ATOM 4052   N NH2 . ARG A 1 664 ? 57.821  51.881  19.852  1.00 0.00 ? 664 ARG A NH2 1  
ATOM 4053   N N   . ASN A 1 665 ? 54.156  56.704  16.685  1.00 0.00 ? 665 ASN A N   1  
ATOM 4054   C CA  . ASN A 1 665 ? 52.800  56.942  16.316  1.00 0.00 ? 665 ASN A CA  1  
ATOM 4055   C C   . ASN A 1 665 ? 52.274  55.908  15.218  1.00 0.00 ? 665 ASN A C   1  
ATOM 4056   O O   . ASN A 1 665 ? 51.317  55.223  15.508  1.00 0.00 ? 665 ASN A O   1  
ATOM 4057   C CB  . ASN A 1 665 ? 52.604  58.433  15.966  1.00 0.00 ? 665 ASN A CB  1  
ATOM 4058   C CG  . ASN A 1 665 ? 52.507  59.200  17.279  1.00 0.00 ? 665 ASN A CG  1  
ATOM 4059   O OD1 . ASN A 1 665 ? 53.524  59.809  17.622  1.00 0.00 ? 665 ASN A OD1 1  
ATOM 4060   N ND2 . ASN A 1 665 ? 51.412  59.055  18.086  1.00 0.00 ? 665 ASN A ND2 1  
ATOM 4061   N N   . PRO A 1 666 ? 52.968  55.687  14.071  1.00 0.00 ? 666 PRO A N   1  
ATOM 4062   C CA  . PRO A 1 666 ? 52.571  54.686  13.092  1.00 0.00 ? 666 PRO A CA  1  
ATOM 4063   C C   . PRO A 1 666 ? 53.341  53.406  13.256  1.00 0.00 ? 666 PRO A C   1  
ATOM 4064   O O   . PRO A 1 666 ? 54.045  53.273  14.270  1.00 0.00 ? 666 PRO A O   1  
ATOM 4065   C CB  . PRO A 1 666 ? 52.892  55.386  11.801  1.00 0.00 ? 666 PRO A CB  1  
ATOM 4066   C CG  . PRO A 1 666 ? 54.230  56.108  12.147  1.00 0.00 ? 666 PRO A CG  1  
ATOM 4067   C CD  . PRO A 1 666 ? 54.041  56.548  13.617  1.00 0.00 ? 666 PRO A CD  1  
ATOM 4068   N N   . THR A 1 667 ? 53.240  52.482  12.253  1.00 0.00 ? 667 THR A N   1  
ATOM 4069   C CA  . THR A 1 667 ? 54.090  51.313  12.220  1.00 0.00 ? 667 THR A CA  1  
ATOM 4070   C C   . THR A 1 667 ? 54.903  51.290  10.937  1.00 0.00 ? 667 THR A C   1  
ATOM 4071   O O   . THR A 1 667 ? 55.578  50.267  10.645  1.00 0.00 ? 667 THR A O   1  
ATOM 4072   C CB  . THR A 1 667 ? 53.326  49.956  12.302  1.00 0.00 ? 667 THR A CB  1  
ATOM 4073   O OG1 . THR A 1 667 ? 52.359  49.876  11.220  1.00 0.00 ? 667 THR A OG1 1  
ATOM 4074   C CG2 . THR A 1 667 ? 52.618  50.040  13.665  1.00 0.00 ? 667 THR A CG2 1  
ATOM 4075   N N   . LEU A 1 668 ? 54.780  52.349  10.133  1.00 0.00 ? 668 LEU A N   1  
ATOM 4076   C CA  . LEU A 1 668 ? 55.293  52.498  8.773   1.00 0.00 ? 668 LEU A CA  1  
ATOM 4077   C C   . LEU A 1 668 ? 56.803  52.501  8.736   1.00 0.00 ? 668 LEU A C   1  
ATOM 4078   O O   . LEU A 1 668 ? 57.429  53.194  9.510   1.00 0.00 ? 668 LEU A O   1  
ATOM 4079   C CB  . LEU A 1 668 ? 54.780  53.763  8.098   1.00 0.00 ? 668 LEU A CB  1  
ATOM 4080   C CG  . LEU A 1 668 ? 53.225  53.898  8.048   1.00 0.00 ? 668 LEU A CG  1  
ATOM 4081   C CD1 . LEU A 1 668 ? 52.590  55.263  7.576   1.00 0.00 ? 668 LEU A CD1 1  
ATOM 4082   C CD2 . LEU A 1 668 ? 52.606  52.651  7.368   1.00 0.00 ? 668 LEU A CD2 1  
ATOM 4083   N N   . ALA A 1 669 ? 57.424  51.720  7.757   1.00 0.00 ? 669 ALA A N   1  
ATOM 4084   C CA  . ALA A 1 669 ? 58.837  51.556  7.413   1.00 0.00 ? 669 ALA A CA  1  
ATOM 4085   C C   . ALA A 1 669 ? 59.390  52.869  6.890   1.00 0.00 ? 669 ALA A C   1  
ATOM 4086   O O   . ALA A 1 669 ? 60.488  53.259  7.245   1.00 0.00 ? 669 ALA A O   1  
ATOM 4087   C CB  . ALA A 1 669 ? 59.023  50.533  6.275   1.00 0.00 ? 669 ALA A CB  1  
ATOM 4088   N N   . VAL A 1 670 ? 58.523  53.555  6.111   1.00 0.00 ? 670 VAL A N   1  
ATOM 4089   C CA  . VAL A 1 670 ? 58.804  54.855  5.440   1.00 0.00 ? 670 VAL A CA  1  
ATOM 4090   C C   . VAL A 1 670 ? 59.104  55.924  6.394   1.00 0.00 ? 670 VAL A C   1  
ATOM 4091   O O   . VAL A 1 670 ? 59.983  56.769  6.163   1.00 0.00 ? 670 VAL A O   1  
ATOM 4092   C CB  . VAL A 1 670 ? 57.738  55.240  4.373   1.00 0.00 ? 670 VAL A CB  1  
ATOM 4093   C CG1 . VAL A 1 670 ? 56.772  56.351  4.850   1.00 0.00 ? 670 VAL A CG1 1  
ATOM 4094   C CG2 . VAL A 1 670 ? 58.488  55.693  3.087   1.00 0.00 ? 670 VAL A CG2 1  
ATOM 4095   N N   . ALA A 1 671 ? 58.360  55.870  7.556   1.00 0.00 ? 671 ALA A N   1  
ATOM 4096   C CA  . ALA A 1 671 ? 58.526  56.822  8.655   1.00 0.00 ? 671 ALA A CA  1  
ATOM 4097   C C   . ALA A 1 671 ? 59.926  56.763  9.182   1.00 0.00 ? 671 ALA A C   1  
ATOM 4098   O O   . ALA A 1 671 ? 60.444  57.775  9.506   1.00 0.00 ? 671 ALA A O   1  
ATOM 4099   C CB  . ALA A 1 671 ? 57.533  56.573  9.853   1.00 0.00 ? 671 ALA A CB  1  
ATOM 4100   N N   . ILE A 1 672 ? 60.545  55.512  9.211   1.00 0.00 ? 672 ILE A N   1  
ATOM 4101   C CA  . ILE A 1 672 ? 61.942  55.366  9.718   1.00 0.00 ? 672 ILE A CA  1  
ATOM 4102   C C   . ILE A 1 672 ? 62.901  56.061  8.860   1.00 0.00 ? 672 ILE A C   1  
ATOM 4103   O O   . ILE A 1 672 ? 63.706  56.883  9.310   1.00 0.00 ? 672 ILE A O   1  
ATOM 4104   C CB  . ILE A 1 672 ? 62.363  53.893  9.845   1.00 0.00 ? 672 ILE A CB  1  
ATOM 4105   C CG1 . ILE A 1 672 ? 61.370  53.049  10.573  1.00 0.00 ? 672 ILE A CG1 1  
ATOM 4106   C CG2 . ILE A 1 672 ? 63.796  53.697  10.422  1.00 0.00 ? 672 ILE A CG2 1  
ATOM 4107   C CD1 . ILE A 1 672 ? 61.779  51.573  10.707  1.00 0.00 ? 672 ILE A CD1 1  
ATOM 4108   N N   . GLN A 1 673 ? 62.806  55.800  7.531   1.00 0.00 ? 673 GLN A N   1  
ATOM 4109   C CA  . GLN A 1 673 ? 63.670  56.401  6.563   1.00 0.00 ? 673 GLN A CA  1  
ATOM 4110   C C   . GLN A 1 673 ? 63.553  57.903  6.536   1.00 0.00 ? 673 GLN A C   1  
ATOM 4111   O O   . GLN A 1 673 ? 64.590  58.573  6.505   1.00 0.00 ? 673 GLN A O   1  
ATOM 4112   C CB  . GLN A 1 673 ? 63.482  55.913  5.056   1.00 0.00 ? 673 GLN A CB  1  
ATOM 4113   C CG  . GLN A 1 673 ? 63.238  54.338  4.994   1.00 0.00 ? 673 GLN A CG  1  
ATOM 4114   C CD  . GLN A 1 673 ? 62.862  53.880  3.617   1.00 0.00 ? 673 GLN A CD  1  
ATOM 4115   O OE1 . GLN A 1 673 ? 62.826  54.608  2.633   1.00 0.00 ? 673 GLN A OE1 1  
ATOM 4116   N NE2 . GLN A 1 673 ? 62.569  52.540  3.508   1.00 0.00 ? 673 GLN A NE2 1  
ATOM 4117   N N   . ASN A 1 674 ? 62.328  58.479  6.651   1.00 0.00 ? 674 ASN A N   1  
ATOM 4118   C CA  . ASN A 1 674 ? 62.036  59.913  6.602   1.00 0.00 ? 674 ASN A CA  1  
ATOM 4119   C C   . ASN A 1 674 ? 62.736  60.584  7.777   1.00 0.00 ? 674 ASN A C   1  
ATOM 4120   O O   . ASN A 1 674 ? 63.450  61.576  7.735   1.00 0.00 ? 674 ASN A O   1  
ATOM 4121   C CB  . ASN A 1 674 ? 60.462  60.267  6.841   1.00 0.00 ? 674 ASN A CB  1  
ATOM 4122   C CG  . ASN A 1 674 ? 59.606  59.815  5.695   1.00 0.00 ? 674 ASN A CG  1  
ATOM 4123   O OD1 . ASN A 1 674 ? 59.983  59.462  4.594   1.00 0.00 ? 674 ASN A OD1 1  
ATOM 4124   N ND2 . ASN A 1 674 ? 58.272  59.805  6.047   1.00 0.00 ? 674 ASN A ND2 1  
ATOM 4125   N N   . GLU A 1 675 ? 62.582  60.004  9.031   1.00 0.00 ? 675 GLU A N   1  
ATOM 4126   C CA  . GLU A 1 675 ? 63.154  60.592  10.290  1.00 0.00 ? 675 GLU A CA  1  
ATOM 4127   C C   . GLU A 1 675 ? 64.658  60.570  10.221  1.00 0.00 ? 675 GLU A C   1  
ATOM 4128   O O   . GLU A 1 675 ? 65.249  61.574  10.622  1.00 0.00 ? 675 GLU A O   1  
ATOM 4129   C CB  . GLU A 1 675 ? 62.662  59.948  11.680  1.00 0.00 ? 675 GLU A CB  1  
ATOM 4130   C CG  . GLU A 1 675 ? 63.257  58.565  12.179  1.00 0.00 ? 675 GLU A CG  1  
ATOM 4131   C CD  . GLU A 1 675 ? 62.529  57.839  13.279  1.00 0.00 ? 675 GLU A CD  1  
ATOM 4132   O OE1 . GLU A 1 675 ? 61.279  57.664  13.016  1.00 0.00 ? 675 GLU A OE1 1  
ATOM 4133   O OE2 . GLU A 1 675 ? 63.132  57.435  14.292  1.00 0.00 ? 675 GLU A OE2 1  
ATOM 4134   N N   . LEU A 1 676 ? 65.330  59.468  9.670   1.00 0.00 ? 676 LEU A N   1  
ATOM 4135   C CA  . LEU A 1 676 ? 66.765  59.463  9.568   1.00 0.00 ? 676 LEU A CA  1  
ATOM 4136   C C   . LEU A 1 676 ? 67.309  60.583  8.674   1.00 0.00 ? 676 LEU A C   1  
ATOM 4137   O O   . LEU A 1 676 ? 68.313  61.161  9.110   1.00 0.00 ? 676 LEU A O   1  
ATOM 4138   C CB  . LEU A 1 676 ? 67.271  58.125  8.881   1.00 0.00 ? 676 LEU A CB  1  
ATOM 4139   C CG  . LEU A 1 676 ? 68.782  57.885  8.593   1.00 0.00 ? 676 LEU A CG  1  
ATOM 4140   C CD1 . LEU A 1 676 ? 69.304  56.909  9.692   1.00 0.00 ? 676 LEU A CD1 1  
ATOM 4141   C CD2 . LEU A 1 676 ? 68.805  57.121  7.251   1.00 0.00 ? 676 LEU A CD2 1  
ATOM 4142   N N   . GLU A 1 677 ? 66.625  60.846  7.525   1.00 0.00 ? 677 GLU A N   1  
ATOM 4143   C CA  . GLU A 1 677 ? 66.890  61.829  6.467   1.00 0.00 ? 677 GLU A CA  1  
ATOM 4144   C C   . GLU A 1 677 ? 66.824  63.187  6.999   1.00 0.00 ? 677 GLU A C   1  
ATOM 4145   O O   . GLU A 1 677 ? 67.733  64.021  6.710   1.00 0.00 ? 677 GLU A O   1  
ATOM 4146   C CB  . GLU A 1 677 ? 65.992  61.717  5.224   1.00 0.00 ? 677 GLU A CB  1  
ATOM 4147   C CG  . GLU A 1 677 ? 66.490  62.608  4.051   1.00 0.00 ? 677 GLU A CG  1  
ATOM 4148   C CD  . GLU A 1 677 ? 67.998  62.471  3.671   1.00 0.00 ? 677 GLU A CD  1  
ATOM 4149   O OE1 . GLU A 1 677 ? 68.998  62.907  4.330   1.00 0.00 ? 677 GLU A OE1 1  
ATOM 4150   O OE2 . GLU A 1 677 ? 68.280  61.842  2.581   1.00 0.00 ? 677 GLU A OE2 1  
ATOM 4151   N N   . GLY A 1 678 ? 65.814  63.409  7.836   1.00 0.00 ? 678 GLY A N   1  
ATOM 4152   C CA  . GLY A 1 678 ? 65.648  64.707  8.429   1.00 0.00 ? 678 GLY A CA  1  
ATOM 4153   C C   . GLY A 1 678 ? 66.714  65.071  9.332   1.00 0.00 ? 678 GLY A C   1  
ATOM 4154   O O   . GLY A 1 678 ? 67.167  66.232  9.320   1.00 0.00 ? 678 GLY A O   1  
ATOM 4155   N N   . GLY A 1 679 ? 67.099  64.103  10.130  1.00 0.00 ? 679 GLY A N   1  
ATOM 4156   C CA  . GLY A 1 679 ? 68.124  64.191  11.115  1.00 0.00 ? 679 GLY A CA  1  
ATOM 4157   C C   . GLY A 1 679 ? 69.430  64.480  10.308  1.00 0.00 ? 679 GLY A C   1  
ATOM 4158   O O   . GLY A 1 679 ? 70.085  65.413  10.749  1.00 0.00 ? 679 GLY A O   1  
ATOM 4159   N N   . LEU A 1 680 ? 69.763  63.854  9.160   1.00 0.00 ? 680 LEU A N   1  
ATOM 4160   C CA  . LEU A 1 680 ? 70.982  64.077  8.432   1.00 0.00 ? 680 LEU A CA  1  
ATOM 4161   C C   . LEU A 1 680 ? 71.123  65.480  7.814   1.00 0.00 ? 680 LEU A C   1  
ATOM 4162   O O   . LEU A 1 680 ? 72.215  66.021  7.912   1.00 0.00 ? 680 LEU A O   1  
ATOM 4163   C CB  . LEU A 1 680 ? 71.268  63.111  7.331   1.00 0.00 ? 680 LEU A CB  1  
ATOM 4164   C CG  . LEU A 1 680 ? 71.108  61.577  7.681   1.00 0.00 ? 680 LEU A CG  1  
ATOM 4165   C CD1 . LEU A 1 680 ? 71.615  60.663  6.536   1.00 0.00 ? 680 LEU A CD1 1  
ATOM 4166   C CD2 . LEU A 1 680 ? 71.879  61.138  9.003   1.00 0.00 ? 680 LEU A CD2 1  
ATOM 4167   N N   . THR A 1 681 ? 69.962  65.990  7.284   1.00 0.00 ? 681 THR A N   1  
ATOM 4168   C CA  . THR A 1 681 ? 69.949  67.354  6.757   1.00 0.00 ? 681 THR A CA  1  
ATOM 4169   C C   . THR A 1 681 ? 70.219  68.405  7.847   1.00 0.00 ? 681 THR A C   1  
ATOM 4170   O O   . THR A 1 681 ? 70.992  69.365  7.661   1.00 0.00 ? 681 THR A O   1  
ATOM 4171   C CB  . THR A 1 681 ? 68.713  67.749  6.055   1.00 0.00 ? 681 THR A CB  1  
ATOM 4172   O OG1 . THR A 1 681 ? 68.594  66.719  5.029   1.00 0.00 ? 681 THR A OG1 1  
ATOM 4173   C CG2 . THR A 1 681 ? 68.822  69.113  5.333   1.00 0.00 ? 681 THR A CG2 1  
ATOM 4174   N N   . ASN A 1 682 ? 69.625  68.185  9.069   1.00 0.00 ? 682 ASN A N   1  
ATOM 4175   C CA  . ASN A 1 682 ? 69.925  69.111  10.167  1.00 0.00 ? 682 ASN A CA  1  
ATOM 4176   C C   . ASN A 1 682 ? 71.454  69.040  10.509  1.00 0.00 ? 682 ASN A C   1  
ATOM 4177   O O   . ASN A 1 682 ? 72.052  70.051  10.768  1.00 0.00 ? 682 ASN A O   1  
ATOM 4178   C CB  . ASN A 1 682 ? 69.121  68.752  11.443  1.00 0.00 ? 682 ASN A CB  1  
ATOM 4179   C CG  . ASN A 1 682 ? 69.181  70.092  12.219  1.00 0.00 ? 682 ASN A CG  1  
ATOM 4180   O OD1 . ASN A 1 682 ? 68.250  70.909  11.935  1.00 0.00 ? 682 ASN A OD1 1  
ATOM 4181   N ND2 . ASN A 1 682 ? 70.081  70.308  13.207  1.00 0.00 ? 682 ASN A ND2 1  
ATOM 4182   N N   . ILE A 1 683 ? 72.056  67.787  10.423  1.00 0.00 ? 683 ILE A N   1  
ATOM 4183   C CA  . ILE A 1 683 ? 73.498  67.491  10.669  1.00 0.00 ? 683 ILE A CA  1  
ATOM 4184   C C   . ILE A 1 683 ? 74.347  68.349  9.664   1.00 0.00 ? 683 ILE A C   1  
ATOM 4185   O O   . ILE A 1 683 ? 75.409  68.848  10.026  1.00 0.00 ? 683 ILE A O   1  
ATOM 4186   C CB  . ILE A 1 683 ? 73.835  66.052  10.806  1.00 0.00 ? 683 ILE A CB  1  
ATOM 4187   C CG1 . ILE A 1 683 ? 73.245  65.367  12.056  1.00 0.00 ? 683 ILE A CG1 1  
ATOM 4188   C CG2 . ILE A 1 683 ? 75.406  65.807  10.829  1.00 0.00 ? 683 ILE A CG2 1  
ATOM 4189   C CD1 . ILE A 1 683 ? 73.604  63.877  12.183  1.00 0.00 ? 683 ILE A CD1 1  
ATOM 4190   N N   . MET A 1 684 ? 73.859  68.414  8.382   1.00 0.00 ? 684 MET A N   1  
ATOM 4191   C CA  . MET A 1 684 ? 74.503  68.967  7.296   1.00 0.00 ? 684 MET A CA  1  
ATOM 4192   C C   . MET A 1 684 ? 74.709  70.436  7.408   1.00 0.00 ? 684 MET A C   1  
ATOM 4193   O O   . MET A 1 684 ? 75.833  70.871  7.316   1.00 0.00 ? 684 MET A O   1  
ATOM 4194   C CB  . MET A 1 684 ? 73.760  68.688  5.966   1.00 0.00 ? 684 MET A CB  1  
ATOM 4195   C CG  . MET A 1 684 ? 74.428  69.027  4.606   1.00 0.00 ? 684 MET A CG  1  
ATOM 4196   S SD  . MET A 1 684 ? 76.210  68.691  4.707   1.00 0.00 ? 684 MET A SD  1  
ATOM 4197   C CE  . MET A 1 684 ? 76.602  68.980  2.958   1.00 0.00 ? 684 MET A CE  1  
ATOM 4198   N N   . THR A 1 685 ? 73.647  71.140  7.883   1.00 0.00 ? 685 THR A N   1  
ATOM 4199   C CA  . THR A 1 685 ? 73.664  72.531  8.271   1.00 0.00 ? 685 THR A CA  1  
ATOM 4200   C C   . THR A 1 685 ? 74.636  72.697  9.418   1.00 0.00 ? 685 THR A C   1  
ATOM 4201   O O   . THR A 1 685 ? 75.468  73.616  9.351   1.00 0.00 ? 685 THR A O   1  
ATOM 4202   C CB  . THR A 1 685 ? 72.304  73.209  8.467   1.00 0.00 ? 685 THR A CB  1  
ATOM 4203   O OG1 . THR A 1 685 ? 71.609  73.008  9.667   1.00 0.00 ? 685 THR A OG1 1  
ATOM 4204   C CG2 . THR A 1 685 ? 71.373  72.885  7.203   1.00 0.00 ? 685 THR A CG2 1  
ATOM 4205   N N   . ASN A 1 686 ? 74.620  71.809  10.484  1.00 0.00 ? 686 ASN A N   1  
ATOM 4206   C CA  . ASN A 1 686 ? 75.682  71.887  11.577  1.00 0.00 ? 686 ASN A CA  1  
ATOM 4207   C C   . ASN A 1 686 ? 77.128  71.688  11.084  1.00 0.00 ? 686 ASN A C   1  
ATOM 4208   O O   . ASN A 1 686 ? 77.979  72.475  11.488  1.00 0.00 ? 686 ASN A O   1  
ATOM 4209   C CB  . ASN A 1 686 ? 75.435  70.972  12.743  1.00 0.00 ? 686 ASN A CB  1  
ATOM 4210   C CG  . ASN A 1 686 ? 74.188  71.340  13.471  1.00 0.00 ? 686 ASN A CG  1  
ATOM 4211   O OD1 . ASN A 1 686 ? 73.216  70.599  13.604  1.00 0.00 ? 686 ASN A OD1 1  
ATOM 4212   N ND2 . ASN A 1 686 ? 74.169  72.575  14.049  1.00 0.00 ? 686 ASN A ND2 1  
ATOM 4213   N N   . ARG A 1 687 ? 77.410  70.727  10.136  1.00 0.00 ? 687 ARG A N   1  
ATOM 4214   C CA  . ARG A 1 687 ? 78.708  70.495  9.530   1.00 0.00 ? 687 ARG A CA  1  
ATOM 4215   C C   . ARG A 1 687 ? 79.305  71.635  8.774   1.00 0.00 ? 687 ARG A C   1  
ATOM 4216   O O   . ARG A 1 687 ? 80.498  71.984  8.921   1.00 0.00 ? 687 ARG A O   1  
ATOM 4217   C CB  . ARG A 1 687 ? 78.655  69.358  8.494   1.00 0.00 ? 687 ARG A CB  1  
ATOM 4218   C CG  . ARG A 1 687 ? 80.046  68.717  8.120   1.00 0.00 ? 687 ARG A CG  1  
ATOM 4219   C CD  . ARG A 1 687 ? 79.931  67.944  6.812   1.00 0.00 ? 687 ARG A CD  1  
ATOM 4220   N NE  . ARG A 1 687 ? 79.900  69.064  5.719   1.00 0.00 ? 687 ARG A NE  1  
ATOM 4221   C CZ  . ARG A 1 687 ? 79.735  68.824  4.416   1.00 0.00 ? 687 ARG A CZ  1  
ATOM 4222   N NH1 . ARG A 1 687 ? 79.775  67.537  3.933   1.00 0.00 ? 687 ARG A NH1 1  
ATOM 4223   N NH2 . ARG A 1 687 ? 79.524  69.885  3.577   1.00 0.00 ? 687 ARG A NH2 1  
ATOM 4224   N N   . CYS A 1 688 ? 78.460  72.330  7.921   1.00 0.00 ? 688 CYS A N   1  
ATOM 4225   C CA  . CYS A 1 688 ? 78.837  73.467  7.158   1.00 0.00 ? 688 CYS A CA  1  
ATOM 4226   C C   . CYS A 1 688 ? 79.180  74.628  8.082   1.00 0.00 ? 688 CYS A C   1  
ATOM 4227   O O   . CYS A 1 688 ? 80.262  75.192  7.860   1.00 0.00 ? 688 CYS A O   1  
ATOM 4228   C CB  . CYS A 1 688 ? 77.727  73.949  6.148   1.00 0.00 ? 688 CYS A CB  1  
ATOM 4229   S SG  . CYS A 1 688 ? 77.441  72.868  4.676   1.00 0.00 ? 688 CYS A SG  1  
ATOM 4230   N N   . LEU A 1 689 ? 78.318  74.883  9.124   1.00 0.00 ? 689 LEU A N   1  
ATOM 4231   C CA  . LEU A 1 689 ? 78.357  75.950  10.085  1.00 0.00 ? 689 LEU A CA  1  
ATOM 4232   C C   . LEU A 1 689 ? 79.660  75.815  10.994  1.00 0.00 ? 689 LEU A C   1  
ATOM 4233   O O   . LEU A 1 689 ? 80.247  76.838  11.236  1.00 0.00 ? 689 LEU A O   1  
ATOM 4234   C CB  . LEU A 1 689 ? 77.083  75.902  10.903  1.00 0.00 ? 689 LEU A CB  1  
ATOM 4235   C CG  . LEU A 1 689 ? 76.974  76.915  12.031  1.00 0.00 ? 689 LEU A CG  1  
ATOM 4236   C CD1 . LEU A 1 689 ? 75.600  77.607  12.072  1.00 0.00 ? 689 LEU A CD1 1  
ATOM 4237   C CD2 . LEU A 1 689 ? 77.337  76.240  13.348  1.00 0.00 ? 689 LEU A CD2 1  
ATOM 4238   N N   . SER A 1 690 ? 80.018  74.625  11.511  1.00 0.00 ? 690 SER A N   1  
ATOM 4239   C CA  . SER A 1 690 ? 80.962  74.510  12.587  1.00 0.00 ? 690 SER A CA  1  
ATOM 4240   C C   . SER A 1 690 ? 82.383  74.536  12.111  1.00 0.00 ? 690 SER A C   1  
ATOM 4241   O O   . SER A 1 690 ? 82.713  74.003  11.069  1.00 0.00 ? 690 SER A O   1  
ATOM 4242   C CB  . SER A 1 690 ? 80.747  73.160  13.358  1.00 0.00 ? 690 SER A CB  1  
ATOM 4243   O OG  . SER A 1 690 ? 79.478  73.348  13.983  1.00 0.00 ? 690 SER A OG  1  
ATOM 4244   N N   . ASP A 1 691 ? 83.357  75.028  12.892  1.00 0.00 ? 691 ASP A N   1  
ATOM 4245   C CA  . ASP A 1 691 ? 84.787  75.037  12.615  1.00 0.00 ? 691 ASP A CA  1  
ATOM 4246   C C   . ASP A 1 691 ? 85.405  75.626  13.813  1.00 0.00 ? 691 ASP A C   1  
ATOM 4247   O O   . ASP A 1 691 ? 86.331  76.484  13.761  1.00 0.00 ? 691 ASP A O   1  
ATOM 4248   C CB  . ASP A 1 691 ? 85.269  75.892  11.347  1.00 0.00 ? 691 ASP A CB  1  
ATOM 4249   C CG  . ASP A 1 691 ? 86.709  75.728  10.972  1.00 0.00 ? 691 ASP A CG  1  
ATOM 4250   O OD1 . ASP A 1 691 ? 87.274  74.602  11.151  1.00 0.00 ? 691 ASP A OD1 1  
ATOM 4251   O OD2 . ASP A 1 691 ? 87.358  76.736  10.691  1.00 0.00 ? 691 ASP A OD2 1  
ATOM 4252   N N   . LEU A 1 692 ? 84.901  75.043  14.894  1.00 0.00 ? 692 LEU A N   1  
ATOM 4253   C CA  . LEU A 1 692 ? 85.236  75.267  16.281  1.00 0.00 ? 692 LEU A CA  1  
ATOM 4254   C C   . LEU A 1 692 ? 86.681  74.844  16.612  1.00 0.00 ? 692 LEU A C   1  
ATOM 4255   O O   . LEU A 1 692 ? 87.276  75.439  17.494  1.00 0.00 ? 692 LEU A O   1  
ATOM 4256   C CB  . LEU A 1 692 ? 84.219  74.420  17.110  1.00 0.00 ? 692 LEU A CB  1  
ATOM 4257   C CG  . LEU A 1 692 ? 82.752  74.611  16.745  1.00 0.00 ? 692 LEU A CG  1  
ATOM 4258   C CD1 . LEU A 1 692 ? 81.823  73.769  17.739  1.00 0.00 ? 692 LEU A CD1 1  
ATOM 4259   C CD2 . LEU A 1 692 ? 82.196  76.032  16.537  1.00 0.00 ? 692 LEU A CD2 1  
ATOM 4260   N N   . ILE A 1 693 ? 87.145  73.685  16.048  1.00 0.00 ? 693 ILE A N   1  
ATOM 4261   C CA  . ILE A 1 693 ? 88.326  72.888  16.398  1.00 0.00 ? 693 ILE A CA  1  
ATOM 4262   C C   . ILE A 1 693 ? 89.613  73.627  16.174  1.00 0.00 ? 693 ILE A C   1  
ATOM 4263   O O   . ILE A 1 693 ? 90.516  73.500  17.025  1.00 0.00 ? 693 ILE A O   1  
ATOM 4264   C CB  . ILE A 1 693 ? 88.326  71.510  15.699  1.00 0.00 ? 693 ILE A CB  1  
ATOM 4265   C CG1 . ILE A 1 693 ? 86.860  71.012  15.414  1.00 0.00 ? 693 ILE A CG1 1  
ATOM 4266   C CG2 . ILE A 1 693 ? 89.176  70.535  16.532  1.00 0.00 ? 693 ILE A CG2 1  
ATOM 4267   C CD1 . ILE A 1 693 ? 86.788  69.643  14.717  1.00 0.00 ? 693 ILE A CD1 1  
ATOM 4268   N N   . PRO A 1 694 ? 89.897  74.446  15.175  1.00 0.00 ? 694 PRO A N   1  
ATOM 4269   C CA  . PRO A 1 694 ? 91.170  75.103  15.046  1.00 0.00 ? 694 PRO A CA  1  
ATOM 4270   C C   . PRO A 1 694 ? 91.511  76.116  16.185  1.00 0.00 ? 694 PRO A C   1  
ATOM 4271   O O   . PRO A 1 694 ? 92.717  76.146  16.563  1.00 0.00 ? 694 PRO A O   1  
ATOM 4272   C CB  . PRO A 1 694 ? 91.171  75.750  13.637  1.00 0.00 ? 694 PRO A CB  1  
ATOM 4273   C CG  . PRO A 1 694 ? 89.758  75.676  13.116  1.00 0.00 ? 694 PRO A CG  1  
ATOM 4274   C CD  . PRO A 1 694 ? 89.240  74.433  13.859  1.00 0.00 ? 694 PRO A CD  1  
ATOM 4275   N N   . LEU A 1 695 ? 90.512  76.992  16.739  1.00 0.00 ? 695 LEU A N   1  
ATOM 4276   C CA  . LEU A 1 695 ? 90.784  77.914  17.798  1.00 0.00 ? 695 LEU A CA  1  
ATOM 4277   C C   . LEU A 1 695 ? 91.076  77.310  19.120  1.00 0.00 ? 695 LEU A C   1  
ATOM 4278   O O   . LEU A 1 695 ? 92.081  77.697  19.792  1.00 0.00 ? 695 LEU A O   1  
ATOM 4279   C CB  . LEU A 1 695 ? 89.483  78.781  18.023  1.00 0.00 ? 695 LEU A CB  1  
ATOM 4280   C CG  . LEU A 1 695 ? 89.706  80.069  18.963  1.00 0.00 ? 695 LEU A CG  1  
ATOM 4281   C CD1 . LEU A 1 695 ? 90.535  81.244  18.428  1.00 0.00 ? 695 LEU A CD1 1  
ATOM 4282   C CD2 . LEU A 1 695 ? 88.277  80.555  19.328  1.00 0.00 ? 695 LEU A CD2 1  
ATOM 4283   N N   . GLN A 1 696 ? 90.275  76.262  19.424  1.00 0.00 ? 696 GLN A N   1  
ATOM 4284   C CA  . GLN A 1 696 ? 90.414  75.448  20.634  1.00 0.00 ? 696 GLN A CA  1  
ATOM 4285   C C   . GLN A 1 696 ? 91.686  74.735  20.687  1.00 0.00 ? 696 GLN A C   1  
ATOM 4286   O O   . GLN A 1 696 ? 92.214  74.712  21.816  1.00 0.00 ? 696 GLN A O   1  
ATOM 4287   C CB  . GLN A 1 696 ? 89.470  74.266  20.781  1.00 0.00 ? 696 GLN A CB  1  
ATOM 4288   C CG  . GLN A 1 696 ? 88.016  74.798  20.885  1.00 0.00 ? 696 GLN A CG  1  
ATOM 4289   C CD  . GLN A 1 696 ? 86.970  73.696  20.790  1.00 0.00 ? 696 GLN A CD  1  
ATOM 4290   O OE1 . GLN A 1 696 ? 86.208  73.644  19.809  1.00 0.00 ? 696 GLN A OE1 1  
ATOM 4291   N NE2 . GLN A 1 696 ? 87.040  72.791  21.780  1.00 0.00 ? 696 GLN A NE2 1  
ATOM 4292   N N   . LEU A 1 697 ? 92.213  74.199  19.540  1.00 0.00 ? 697 LEU A N   1  
ATOM 4293   C CA  . LEU A 1 697 ? 93.493  73.448  19.510  1.00 0.00 ? 697 LEU A CA  1  
ATOM 4294   C C   . LEU A 1 697 ? 94.672  74.394  19.930  1.00 0.00 ? 697 LEU A C   1  
ATOM 4295   O O   . LEU A 1 697 ? 95.530  74.004  20.742  1.00 0.00 ? 697 LEU A O   1  
ATOM 4296   C CB  . LEU A 1 697 ? 93.765  73.115  18.011  1.00 0.00 ? 697 LEU A CB  1  
ATOM 4297   C CG  . LEU A 1 697 ? 95.075  72.278  17.702  1.00 0.00 ? 697 LEU A CG  1  
ATOM 4298   C CD1 . LEU A 1 697 ? 94.812  71.478  16.458  1.00 0.00 ? 697 LEU A CD1 1  
ATOM 4299   C CD2 . LEU A 1 697 ? 96.372  73.037  17.577  1.00 0.00 ? 697 LEU A CD2 1  
ATOM 4300   N N   . GLN A 1 698 ? 94.676  75.631  19.469  1.00 0.00 ? 698 GLN A N   1  
ATOM 4301   C CA  . GLN A 1 698 ? 95.619  76.577  19.845  1.00 0.00 ? 698 GLN A CA  1  
ATOM 4302   C C   . GLN A 1 698 ? 95.547  76.973  21.353  1.00 0.00 ? 698 GLN A C   1  
ATOM 4303   O O   . GLN A 1 698 ? 96.609  76.916  22.039  1.00 0.00 ? 698 GLN A O   1  
ATOM 4304   C CB  . GLN A 1 698 ? 95.550  77.808  18.931  1.00 0.00 ? 698 GLN A CB  1  
ATOM 4305   C CG  . GLN A 1 698 ? 95.935  77.472  17.490  1.00 0.00 ? 698 GLN A CG  1  
ATOM 4306   C CD  . GLN A 1 698 ? 95.733  78.800  16.779  1.00 0.00 ? 698 GLN A CD  1  
ATOM 4307   O OE1 . GLN A 1 698 ? 96.693  79.553  16.445  1.00 0.00 ? 698 GLN A OE1 1  
ATOM 4308   N NE2 . GLN A 1 698 ? 94.425  79.179  16.635  1.00 0.00 ? 698 GLN A NE2 1  
ATOM 4309   N N   . ILE A 1 699 ? 94.310  77.206  21.906  1.00 0.00 ? 699 ILE A N   1  
ATOM 4310   C CA  . ILE A 1 699 ? 94.260  77.418  23.318  1.00 0.00 ? 699 ILE A CA  1  
ATOM 4311   C C   . ILE A 1 699 ? 94.791  76.242  24.173  1.00 0.00 ? 699 ILE A C   1  
ATOM 4312   O O   . ILE A 1 699 ? 95.539  76.472  25.146  1.00 0.00 ? 699 ILE A O   1  
ATOM 4313   C CB  . ILE A 1 699 ? 92.856  77.844  23.740  1.00 0.00 ? 699 ILE A CB  1  
ATOM 4314   C CG1 . ILE A 1 699 ? 92.392  79.177  23.113  1.00 0.00 ? 699 ILE A CG1 1  
ATOM 4315   C CG2 . ILE A 1 699 ? 92.749  78.014  25.243  1.00 0.00 ? 699 ILE A CG2 1  
ATOM 4316   C CD1 . ILE A 1 699 ? 90.978  79.611  23.535  1.00 0.00 ? 699 ILE A CD1 1  
ATOM 4317   N N   . PHE A 1 700 ? 94.518  74.933  23.864  1.00 0.00 ? 700 PHE A N   1  
ATOM 4318   C CA  . PHE A 1 700 ? 94.907  73.773  24.641  1.00 0.00 ? 700 PHE A CA  1  
ATOM 4319   C C   . PHE A 1 700 ? 96.385  73.737  24.756  1.00 0.00 ? 700 PHE A C   1  
ATOM 4320   O O   . PHE A 1 700 ? 96.917  73.434  25.843  1.00 0.00 ? 700 PHE A O   1  
ATOM 4321   C CB  . PHE A 1 700 ? 94.307  72.308  24.293  1.00 0.00 ? 700 PHE A CB  1  
ATOM 4322   C CG  . PHE A 1 700 ? 95.031  71.499  23.198  1.00 0.00 ? 700 PHE A CG  1  
ATOM 4323   C CD1 . PHE A 1 700 ? 96.291  71.029  23.249  1.00 0.00 ? 700 PHE A CD1 1  
ATOM 4324   C CD2 . PHE A 1 700 ? 94.205  71.059  22.144  1.00 0.00 ? 700 PHE A CD2 1  
ATOM 4325   C CE1 . PHE A 1 700 ? 96.813  70.233  22.192  1.00 0.00 ? 700 PHE A CE1 1  
ATOM 4326   C CE2 . PHE A 1 700 ? 94.632  70.129  21.142  1.00 0.00 ? 700 PHE A CE2 1  
ATOM 4327   C CZ  . PHE A 1 700 ? 96.007  69.842  21.165  1.00 0.00 ? 700 PHE A CZ  1  
ATOM 4328   N N   . ASP A 1 701 ? 97.166  74.027  23.658  1.00 0.00 ? 701 ASP A N   1  
ATOM 4329   C CA  . ASP A 1 701 ? 98.641  73.928  23.714  1.00 0.00 ? 701 ASP A CA  1  
ATOM 4330   C C   . ASP A 1 701 ? 99.171  74.901  24.622  1.00 0.00 ? 701 ASP A C   1  
ATOM 4331   O O   . ASP A 1 701 ? 100.091 74.550  25.380  1.00 0.00 ? 701 ASP A O   1  
ATOM 4332   C CB  . ASP A 1 701 ? 99.416  74.176  22.351  1.00 0.00 ? 701 ASP A CB  1  
ATOM 4333   C CG  . ASP A 1 701 ? 98.921  73.223  21.287  1.00 0.00 ? 701 ASP A CG  1  
ATOM 4334   O OD1 . ASP A 1 701 ? 99.091  71.948  21.498  1.00 0.00 ? 701 ASP A OD1 1  
ATOM 4335   O OD2 . ASP A 1 701 ? 98.468  73.777  20.268  1.00 0.00 ? 701 ASP A OD2 1  
ATOM 4336   N N   . ILE A 1 702 ? 98.688  76.150  24.634  1.00 0.00 ? 702 ILE A N   1  
ATOM 4337   C CA  . ILE A 1 702 ? 99.217  77.178  25.585  1.00 0.00 ? 702 ILE A CA  1  
ATOM 4338   C C   . ILE A 1 702 ? 98.973  76.819  27.090  1.00 0.00 ? 702 ILE A C   1  
ATOM 4339   O O   . ILE A 1 702 ? 99.785  76.966  27.977  1.00 0.00 ? 702 ILE A O   1  
ATOM 4340   C CB  . ILE A 1 702 ? 98.539  78.523  25.383  1.00 0.00 ? 702 ILE A CB  1  
ATOM 4341   C CG1 . ILE A 1 702 ? 98.597  79.043  23.882  1.00 0.00 ? 702 ILE A CG1 1  
ATOM 4342   C CG2 . ILE A 1 702 ? 99.077  79.589  26.323  1.00 0.00 ? 702 ILE A CG2 1  
ATOM 4343   C CD1 . ILE A 1 702 ? 97.913  80.403  23.662  1.00 0.00 ? 702 ILE A CD1 1  
ATOM 4344   N N   . VAL A 1 703 ? 97.748  76.303  27.345  1.00 0.00 ? 703 VAL A N   1  
ATOM 4345   C CA  . VAL A 1 703 ? 97.285  75.884  28.647  1.00 0.00 ? 703 VAL A CA  1  
ATOM 4346   C C   . VAL A 1 703 ? 98.128  74.791  29.273  1.00 0.00 ? 703 VAL A C   1  
ATOM 4347   O O   . VAL A 1 703 ? 98.473  74.932  30.460  1.00 0.00 ? 703 VAL A O   1  
ATOM 4348   C CB  . VAL A 1 703 ? 95.774  75.706  28.652  1.00 0.00 ? 703 VAL A CB  1  
ATOM 4349   C CG1 . VAL A 1 703 ? 95.290  74.719  29.738  1.00 0.00 ? 703 VAL A CG1 1  
ATOM 4350   C CG2 . VAL A 1 703 ? 95.070  77.076  28.678  1.00 0.00 ? 703 VAL A CG2 1  
ATOM 4351   N N   . TYR A 1 704 ? 98.537  73.758  28.452  1.00 0.00 ? 704 TYR A N   1  
ATOM 4352   C CA  . TYR A 1 704 ? 99.377  72.679  28.834  1.00 0.00 ? 704 TYR A CA  1  
ATOM 4353   C C   . TYR A 1 704 ? 100.752 73.192  29.207  1.00 0.00 ? 704 TYR A C   1  
ATOM 4354   O O   . TYR A 1 704 ? 101.279 72.848  30.245  1.00 0.00 ? 704 TYR A O   1  
ATOM 4355   C CB  . TYR A 1 704 ? 99.555  71.649  27.604  1.00 0.00 ? 704 TYR A CB  1  
ATOM 4356   C CG  . TYR A 1 704 ? 99.803  70.239  28.037  1.00 0.00 ? 704 TYR A CG  1  
ATOM 4357   C CD1 . TYR A 1 704 ? 98.669  69.429  28.158  1.00 0.00 ? 704 TYR A CD1 1  
ATOM 4358   C CD2 . TYR A 1 704 ? 101.152 69.797  28.151  1.00 0.00 ? 704 TYR A CD2 1  
ATOM 4359   C CE1 . TYR A 1 704 ? 98.908  68.075  28.600  1.00 0.00 ? 704 TYR A CE1 1  
ATOM 4360   C CE2 . TYR A 1 704 ? 101.344 68.454  28.527  1.00 0.00 ? 704 TYR A CE2 1  
ATOM 4361   C CZ  . TYR A 1 704 ? 100.239 67.608  28.791  1.00 0.00 ? 704 TYR A CZ  1  
ATOM 4362   O OH  . TYR A 1 704 ? 100.571 66.314  29.329  1.00 0.00 ? 704 TYR A OH  1  
ATOM 4363   N N   . LYS A 1 705 ? 101.301 74.222  28.470  1.00 0.00 ? 705 LYS A N   1  
ATOM 4364   C CA  . LYS A 1 705 ? 102.551 74.925  28.929  1.00 0.00 ? 705 LYS A CA  1  
ATOM 4365   C C   . LYS A 1 705 ? 102.432 75.675  30.263  1.00 0.00 ? 705 LYS A C   1  
ATOM 4366   O O   . LYS A 1 705 ? 103.338 75.530  31.105  1.00 0.00 ? 705 LYS A O   1  
ATOM 4367   C CB  . LYS A 1 705 ? 103.022 75.962  27.844  1.00 0.00 ? 705 LYS A CB  1  
ATOM 4368   C CG  . LYS A 1 705 ? 103.141 75.363  26.436  1.00 0.00 ? 705 LYS A CG  1  
ATOM 4369   C CD  . LYS A 1 705 ? 103.332 76.424  25.343  1.00 0.00 ? 705 LYS A CD  1  
ATOM 4370   C CE  . LYS A 1 705 ? 103.500 75.724  23.993  1.00 0.00 ? 705 LYS A CE  1  
ATOM 4371   N NZ  . LYS A 1 705 ? 103.594 76.641  22.807  1.00 0.00 ? 705 LYS A NZ  1  
ATOM 4372   N N   . PHE A 1 706 ? 101.281 76.340  30.461  1.00 0.00 ? 706 PHE A N   1  
ATOM 4373   C CA  . PHE A 1 706 ? 100.908 77.020  31.673  1.00 0.00 ? 706 PHE A CA  1  
ATOM 4374   C C   . PHE A 1 706 ? 100.837 76.039  32.838  1.00 0.00 ? 706 PHE A C   1  
ATOM 4375   O O   . PHE A 1 706 ? 101.416 76.309  33.883  1.00 0.00 ? 706 PHE A O   1  
ATOM 4376   C CB  . PHE A 1 706 ? 99.579  77.709  31.443  1.00 0.00 ? 706 PHE A CB  1  
ATOM 4377   C CG  . PHE A 1 706 ? 99.548  78.965  32.289  1.00 0.00 ? 706 PHE A CG  1  
ATOM 4378   C CD1 . PHE A 1 706 ? 100.500 79.975  32.104  1.00 0.00 ? 706 PHE A CD1 1  
ATOM 4379   C CD2 . PHE A 1 706 ? 98.752  79.053  33.418  1.00 0.00 ? 706 PHE A CD2 1  
ATOM 4380   C CE1 . PHE A 1 706 ? 100.773 80.940  33.032  1.00 0.00 ? 706 PHE A CE1 1  
ATOM 4381   C CE2 . PHE A 1 706 ? 99.001  79.998  34.420  1.00 0.00 ? 706 PHE A CE2 1  
ATOM 4382   C CZ  . PHE A 1 706 ? 100.109 80.943  34.211  1.00 0.00 ? 706 PHE A CZ  1  
ATOM 4383   N N   . CYS A 1 707 ? 100.222 74.846  32.639  1.00 0.00 ? 707 CYS A N   1  
ATOM 4384   C CA  . CYS A 1 707 ? 100.019 73.732  33.547  1.00 0.00 ? 707 CYS A CA  1  
ATOM 4385   C C   . CYS A 1 707 ? 101.358 73.171  34.046  1.00 0.00 ? 707 CYS A C   1  
ATOM 4386   O O   . CYS A 1 707 ? 101.550 72.941  35.231  1.00 0.00 ? 707 CYS A O   1  
ATOM 4387   C CB  . CYS A 1 707 ? 99.244  72.590  32.771  1.00 0.00 ? 707 CYS A CB  1  
ATOM 4388   S SG  . CYS A 1 707 ? 98.506  71.409  33.963  1.00 0.00 ? 707 CYS A SG  1  
ATOM 4389   N N   . LYS A 1 708 ? 102.344 72.980  33.123  1.00 0.00 ? 708 LYS A N   1  
ATOM 4390   C CA  . LYS A 1 708 ? 103.605 72.467  33.422  1.00 0.00 ? 708 LYS A CA  1  
ATOM 4391   C C   . LYS A 1 708 ? 104.278 73.480  34.352  1.00 0.00 ? 708 LYS A C   1  
ATOM 4392   O O   . LYS A 1 708 ? 104.894 73.171  35.329  1.00 0.00 ? 708 LYS A O   1  
ATOM 4393   C CB  . LYS A 1 708 ? 104.536 72.099  32.209  1.00 0.00 ? 708 LYS A CB  1  
ATOM 4394   C CG  . LYS A 1 708 ? 104.062 70.901  31.384  1.00 0.00 ? 708 LYS A CG  1  
ATOM 4395   C CD  . LYS A 1 708 ? 105.047 70.549  30.261  1.00 0.00 ? 708 LYS A CD  1  
ATOM 4396   C CE  . LYS A 1 708 ? 105.066 71.305  28.980  1.00 0.00 ? 708 LYS A CE  1  
ATOM 4397   N NZ  . LYS A 1 708 ? 106.325 71.083  28.268  1.00 0.00 ? 708 LYS A NZ  1  
ATOM 4398   N N   . PHE A 1 709 ? 104.170 74.826  34.013  1.00 0.00 ? 709 PHE A N   1  
ATOM 4399   C CA  . PHE A 1 709 ? 104.843 75.864  34.772  1.00 0.00 ? 709 PHE A CA  1  
ATOM 4400   C C   . PHE A 1 709 ? 104.345 75.950  36.152  1.00 0.00 ? 709 PHE A C   1  
ATOM 4401   O O   . PHE A 1 709 ? 105.128 75.898  37.122  1.00 0.00 ? 709 PHE A O   1  
ATOM 4402   C CB  . PHE A 1 709 ? 104.874 77.264  34.127  1.00 0.00 ? 709 PHE A CB  1  
ATOM 4403   C CG  . PHE A 1 709 ? 105.917 77.477  33.035  1.00 0.00 ? 709 PHE A CG  1  
ATOM 4404   C CD1 . PHE A 1 709 ? 106.323 76.500  32.152  1.00 0.00 ? 709 PHE A CD1 1  
ATOM 4405   C CD2 . PHE A 1 709 ? 106.349 78.793  32.864  1.00 0.00 ? 709 PHE A CD2 1  
ATOM 4406   C CE1 . PHE A 1 709 ? 107.068 76.801  31.060  1.00 0.00 ? 709 PHE A CE1 1  
ATOM 4407   C CE2 . PHE A 1 709 ? 107.177 79.090  31.775  1.00 0.00 ? 709 PHE A CE2 1  
ATOM 4408   C CZ  . PHE A 1 709 ? 107.551 78.108  30.867  1.00 0.00 ? 709 PHE A CZ  1  
ATOM 4409   N N   . ILE A 1 710 ? 102.963 75.986  36.325  1.00 0.00 ? 710 ILE A N   1  
ATOM 4410   C CA  . ILE A 1 710 ? 102.355 76.244  37.590  1.00 0.00 ? 710 ILE A CA  1  
ATOM 4411   C C   . ILE A 1 710 ? 102.699 75.139  38.627  1.00 0.00 ? 710 ILE A C   1  
ATOM 4412   O O   . ILE A 1 710 ? 103.022 75.516  39.757  1.00 0.00 ? 710 ILE A O   1  
ATOM 4413   C CB  . ILE A 1 710 ? 100.836 76.510  37.698  1.00 0.00 ? 710 ILE A CB  1  
ATOM 4414   C CG1 . ILE A 1 710 ? 99.927  75.376  37.070  1.00 0.00 ? 710 ILE A CG1 1  
ATOM 4415   C CG2 . ILE A 1 710 ? 100.386 77.803  37.019  1.00 0.00 ? 710 ILE A CG2 1  
ATOM 4416   C CD1 . ILE A 1 710 ? 98.417  75.647  37.182  1.00 0.00 ? 710 ILE A CD1 1  
ATOM 4417   N N   . LYS A 1 711 ? 102.666 73.851  38.236  1.00 0.00 ? 711 LYS A N   1  
ATOM 4418   C CA  . LYS A 1 711 ? 102.864 72.794  39.181  1.00 0.00 ? 711 LYS A CA  1  
ATOM 4419   C C   . LYS A 1 711 ? 104.205 72.765  39.847  1.00 0.00 ? 711 LYS A C   1  
ATOM 4420   O O   . LYS A 1 711 ? 104.268 72.160  40.925  1.00 0.00 ? 711 LYS A O   1  
ATOM 4421   C CB  . LYS A 1 711 ? 102.486 71.363  38.760  1.00 0.00 ? 711 LYS A CB  1  
ATOM 4422   C CG  . LYS A 1 711 ? 103.233 70.865  37.508  1.00 0.00 ? 711 LYS A CG  1  
ATOM 4423   C CD  . LYS A 1 711 ? 102.994 69.336  37.114  1.00 0.00 ? 711 LYS A CD  1  
ATOM 4424   C CE  . LYS A 1 711 ? 101.570 69.055  36.641  1.00 0.00 ? 711 LYS A CE  1  
ATOM 4425   N NZ  . LYS A 1 711 ? 101.278 69.911  35.520  1.00 0.00 ? 711 LYS A NZ  1  
ATOM 4426   N N   . SER A 1 712 ? 105.232 73.399  39.233  1.00 0.00 ? 712 SER A N   1  
ATOM 4427   C CA  . SER A 1 712 ? 106.587 73.378  39.666  1.00 0.00 ? 712 SER A CA  1  
ATOM 4428   C C   . SER A 1 712 ? 106.790 74.598  40.516  1.00 0.00 ? 712 SER A C   1  
ATOM 4429   O O   . SER A 1 712 ? 105.942 75.489  40.566  1.00 0.00 ? 712 SER A O   1  
ATOM 4430   C CB  . SER A 1 712 ? 107.528 73.433  38.448  1.00 0.00 ? 712 SER A CB  1  
ATOM 4431   O OG  . SER A 1 712 ? 107.350 72.258  37.584  1.00 0.00 ? 712 SER A OG  1  
ATOM 4432   N N   . MET A 1 713 ? 107.932 74.687  41.196  1.00 0.00 ? 713 MET A N   1  
ATOM 4433   C CA  . MET A 1 713 ? 108.206 75.782  42.149  1.00 0.00 ? 713 MET A CA  1  
ATOM 4434   C C   . MET A 1 713 ? 108.729 76.923  41.228  1.00 0.00 ? 713 MET A C   1  
ATOM 4435   O O   . MET A 1 713 ? 109.316 76.676  40.186  1.00 0.00 ? 713 MET A O   1  
ATOM 4436   C CB  . MET A 1 713 ? 109.160 75.396  43.337  1.00 0.00 ? 713 MET A CB  1  
ATOM 4437   C CG  . MET A 1 713 ? 110.564 74.925  42.973  1.00 0.00 ? 713 MET A CG  1  
ATOM 4438   S SD  . MET A 1 713 ? 111.879 76.210  42.839  1.00 0.00 ? 713 MET A SD  1  
ATOM 4439   C CE  . MET A 1 713 ? 111.588 77.075  44.405  1.00 0.00 ? 713 MET A CE  1  
ATOM 4440   N N   . ARG A 1 714 ? 108.426 78.172  41.616  1.00 0.00 ? 714 ARG A N   1  
ATOM 4441   C CA  . ARG A 1 714 ? 108.660 79.323  40.744  1.00 0.00 ? 714 ARG A CA  1  
ATOM 4442   C C   . ARG A 1 714 ? 109.599 80.322  41.444  1.00 0.00 ? 714 ARG A C   1  
ATOM 4443   O O   . ARG A 1 714 ? 110.014 80.034  42.599  1.00 0.00 ? 714 ARG A O   1  
ATOM 4444   C CB  . ARG A 1 714 ? 107.338 80.118  40.409  1.00 0.00 ? 714 ARG A CB  1  
ATOM 4445   C CG  . ARG A 1 714 ? 106.116 79.305  39.867  1.00 0.00 ? 714 ARG A CG  1  
ATOM 4446   C CD  . ARG A 1 714 ? 106.431 78.454  38.605  1.00 0.00 ? 714 ARG A CD  1  
ATOM 4447   N NE  . ARG A 1 714 ? 106.984 79.308  37.534  1.00 0.00 ? 714 ARG A NE  1  
ATOM 4448   C CZ  . ARG A 1 714 ? 107.730 78.791  36.542  1.00 0.00 ? 714 ARG A CZ  1  
ATOM 4449   N NH1 . ARG A 1 714 ? 108.163 77.478  36.552  1.00 0.00 ? 714 ARG A NH1 1  
ATOM 4450   N NH2 . ARG A 1 714 ? 108.011 79.671  35.521  1.00 0.00 ? 714 ARG A NH2 1  
ATOM 4451   N N   . GLU A 1 754 ? 111.361 84.726  39.366  1.00 0.00 ? 754 GLU A N   1  
ATOM 4452   C CA  . GLU A 1 754 ? 111.740 84.585  37.994  1.00 0.00 ? 754 GLU A CA  1  
ATOM 4453   C C   . GLU A 1 754 ? 110.874 85.316  36.984  1.00 0.00 ? 754 GLU A C   1  
ATOM 4454   O O   . GLU A 1 754 ? 109.678 85.483  36.991  1.00 0.00 ? 754 GLU A O   1  
ATOM 4455   C CB  . GLU A 1 754 ? 111.902 83.119  37.476  1.00 0.00 ? 754 GLU A CB  1  
ATOM 4456   C CG  . GLU A 1 754 ? 110.681 82.312  37.555  1.00 0.00 ? 754 GLU A CG  1  
ATOM 4457   C CD  . GLU A 1 754 ? 110.963 80.932  37.052  1.00 0.00 ? 754 GLU A CD  1  
ATOM 4458   O OE1 . GLU A 1 754 ? 111.331 80.727  35.886  1.00 0.00 ? 754 GLU A OE1 1  
ATOM 4459   O OE2 . GLU A 1 754 ? 110.843 80.032  37.912  1.00 0.00 ? 754 GLU A OE2 1  
ATOM 4460   N N   . ASP A 1 755 ? 111.642 85.832  35.970  1.00 0.00 ? 755 ASP A N   1  
ATOM 4461   C CA  . ASP A 1 755 ? 111.231 86.551  34.809  1.00 0.00 ? 755 ASP A CA  1  
ATOM 4462   C C   . ASP A 1 755 ? 110.319 85.729  33.920  1.00 0.00 ? 755 ASP A C   1  
ATOM 4463   O O   . ASP A 1 755 ? 109.321 86.239  33.375  1.00 0.00 ? 755 ASP A O   1  
ATOM 4464   C CB  . ASP A 1 755 ? 112.543 86.965  33.968  1.00 0.00 ? 755 ASP A CB  1  
ATOM 4465   C CG  . ASP A 1 755 ? 113.456 87.868  34.801  1.00 0.00 ? 755 ASP A CG  1  
ATOM 4466   O OD1 . ASP A 1 755 ? 113.035 89.028  35.129  1.00 0.00 ? 755 ASP A OD1 1  
ATOM 4467   O OD2 . ASP A 1 755 ? 114.587 87.453  35.296  1.00 0.00 ? 755 ASP A OD2 1  
ATOM 4468   N N   . ALA A 1 756 ? 110.655 84.467  33.758  1.00 0.00 ? 756 ALA A N   1  
ATOM 4469   C CA  . ALA A 1 756 ? 109.933 83.581  32.813  1.00 0.00 ? 756 ALA A CA  1  
ATOM 4470   C C   . ALA A 1 756 ? 108.482 83.339  33.101  1.00 0.00 ? 756 ALA A C   1  
ATOM 4471   O O   . ALA A 1 756 ? 107.604 83.336  32.255  1.00 0.00 ? 756 ALA A O   1  
ATOM 4472   C CB  . ALA A 1 756 ? 110.762 82.232  32.742  1.00 0.00 ? 756 ALA A CB  1  
ATOM 4473   N N   . ALA A 1 757 ? 108.166 83.149  34.383  1.00 0.00 ? 757 ALA A N   1  
ATOM 4474   C CA  . ALA A 1 757 ? 106.823 82.899  34.879  1.00 0.00 ? 757 ALA A CA  1  
ATOM 4475   C C   . ALA A 1 757 ? 105.947 84.115  34.509  1.00 0.00 ? 757 ALA A C   1  
ATOM 4476   O O   . ALA A 1 757 ? 104.864 83.843  34.056  1.00 0.00 ? 757 ALA A O   1  
ATOM 4477   C CB  . ALA A 1 757 ? 106.763 82.920  36.350  1.00 0.00 ? 757 ALA A CB  1  
ATOM 4478   N N   . LEU A 1 758 ? 106.492 85.340  34.676  1.00 0.00 ? 758 LEU A N   1  
ATOM 4479   C CA  . LEU A 1 758 ? 105.887 86.605  34.397  1.00 0.00 ? 758 LEU A CA  1  
ATOM 4480   C C   . LEU A 1 758 ? 105.601 86.795  32.901  1.00 0.00 ? 758 LEU A C   1  
ATOM 4481   O O   . LEU A 1 758 ? 104.575 87.370  32.551  1.00 0.00 ? 758 LEU A O   1  
ATOM 4482   C CB  . LEU A 1 758 ? 106.727 87.768  34.972  1.00 0.00 ? 758 LEU A CB  1  
ATOM 4483   C CG  . LEU A 1 758 ? 107.120 87.488  36.528  1.00 0.00 ? 758 LEU A CG  1  
ATOM 4484   C CD1 . LEU A 1 758 ? 108.152 88.547  36.939  1.00 0.00 ? 758 LEU A CD1 1  
ATOM 4485   C CD2 . LEU A 1 758 ? 105.964 87.371  37.492  1.00 0.00 ? 758 LEU A CD2 1  
ATOM 4486   N N   . GLU A 1 759 ? 106.489 86.358  32.042  1.00 0.00 ? 759 GLU A N   1  
ATOM 4487   C CA  . GLU A 1 759 ? 106.429 86.495  30.618  1.00 0.00 ? 759 GLU A CA  1  
ATOM 4488   C C   . GLU A 1 759 ? 105.226 85.770  30.023  1.00 0.00 ? 759 GLU A C   1  
ATOM 4489   O O   . GLU A 1 759 ? 104.349 86.230  29.336  1.00 0.00 ? 759 GLU A O   1  
ATOM 4490   C CB  . GLU A 1 759 ? 107.700 85.891  29.983  1.00 0.00 ? 759 GLU A CB  1  
ATOM 4491   C CG  . GLU A 1 759 ? 107.568 85.852  28.452  1.00 0.00 ? 759 GLU A CG  1  
ATOM 4492   C CD  . GLU A 1 759 ? 108.894 85.582  27.751  1.00 0.00 ? 759 GLU A CD  1  
ATOM 4493   O OE1 . GLU A 1 759 ? 109.719 86.575  27.668  1.00 0.00 ? 759 GLU A OE1 1  
ATOM 4494   O OE2 . GLU A 1 759 ? 109.243 84.397  27.541  1.00 0.00 ? 759 GLU A OE2 1  
ATOM 4495   N N   . LEU A 1 760 ? 105.091 84.508  30.531  1.00 0.00 ? 760 LEU A N   1  
ATOM 4496   C CA  . LEU A 1 760 ? 103.957 83.587  30.178  1.00 0.00 ? 760 LEU A CA  1  
ATOM 4497   C C   . LEU A 1 760 ? 102.618 84.087  30.655  1.00 0.00 ? 760 LEU A C   1  
ATOM 4498   O O   . LEU A 1 760 ? 101.640 84.129  29.942  1.00 0.00 ? 760 LEU A O   1  
ATOM 4499   C CB  . LEU A 1 760 ? 103.956 82.085  30.692  1.00 0.00 ? 760 LEU A CB  1  
ATOM 4500   C CG  . LEU A 1 760 ? 104.639 81.144  29.728  1.00 0.00 ? 760 LEU A CG  1  
ATOM 4501   C CD1 . LEU A 1 760 ? 103.813 80.821  28.484  1.00 0.00 ? 760 LEU A CD1 1  
ATOM 4502   C CD2 . LEU A 1 760 ? 106.043 81.529  29.396  1.00 0.00 ? 760 LEU A CD2 1  
ATOM 4503   N N   . ILE A 1 761 ? 102.680 84.628  31.917  1.00 0.00 ? 761 ILE A N   1  
ATOM 4504   C CA  . ILE A 1 761 ? 101.560 85.183  32.618  1.00 0.00 ? 761 ILE A CA  1  
ATOM 4505   C C   . ILE A 1 761 ? 100.918 86.325  31.851  1.00 0.00 ? 761 ILE A C   1  
ATOM 4506   O O   . ILE A 1 761 ? 99.712  86.336  31.649  1.00 0.00 ? 761 ILE A O   1  
ATOM 4507   C CB  . ILE A 1 761 ? 101.823 85.628  34.039  1.00 0.00 ? 761 ILE A CB  1  
ATOM 4508   C CG1 . ILE A 1 761 ? 102.089 84.468  35.015  1.00 0.00 ? 761 ILE A CG1 1  
ATOM 4509   C CG2 . ILE A 1 761 ? 100.505 86.392  34.495  1.00 0.00 ? 761 ILE A CG2 1  
ATOM 4510   C CD1 . ILE A 1 761 ? 102.358 84.914  36.462  1.00 0.00 ? 761 ILE A CD1 1  
ATOM 4511   N N   . GLN A 1 762 ? 101.764 87.187  31.284  1.00 0.00 ? 762 GLN A N   1  
ATOM 4512   C CA  . GLN A 1 762 ? 101.370 88.297  30.462  1.00 0.00 ? 762 GLN A CA  1  
ATOM 4513   C C   . GLN A 1 762 ? 100.818 87.930  29.118  1.00 0.00 ? 762 GLN A C   1  
ATOM 4514   O O   . GLN A 1 762 ? 99.820  88.495  28.719  1.00 0.00 ? 762 GLN A O   1  
ATOM 4515   C CB  . GLN A 1 762 ? 102.590 89.278  30.137  1.00 0.00 ? 762 GLN A CB  1  
ATOM 4516   C CG  . GLN A 1 762 ? 102.937 90.167  31.358  1.00 0.00 ? 762 GLN A CG  1  
ATOM 4517   C CD  . GLN A 1 762 ? 104.172 91.047  31.080  1.00 0.00 ? 762 GLN A CD  1  
ATOM 4518   O OE1 . GLN A 1 762 ? 105.182 90.446  30.678  1.00 0.00 ? 762 GLN A OE1 1  
ATOM 4519   N NE2 . GLN A 1 762 ? 104.069 92.314  31.297  1.00 0.00 ? 762 GLN A NE2 1  
ATOM 4520   N N   . LYS A 1 763 ? 101.364 86.876  28.449  1.00 0.00 ? 763 LYS A N   1  
ATOM 4521   C CA  . LYS A 1 763 ? 100.957 86.285  27.154  1.00 0.00 ? 763 LYS A CA  1  
ATOM 4522   C C   . LYS A 1 763 ? 99.602  85.741  27.308  1.00 0.00 ? 763 LYS A C   1  
ATOM 4523   O O   . LYS A 1 763 ? 98.801  85.953  26.434  1.00 0.00 ? 763 LYS A O   1  
ATOM 4524   C CB  . LYS A 1 763 ? 101.831 85.062  26.649  1.00 0.00 ? 763 LYS A CB  1  
ATOM 4525   C CG  . LYS A 1 763 ? 101.257 84.300  25.386  1.00 0.00 ? 763 LYS A CG  1  
ATOM 4526   C CD  . LYS A 1 763 ? 102.204 83.195  24.909  1.00 0.00 ? 763 LYS A CD  1  
ATOM 4527   C CE  . LYS A 1 763 ? 101.449 82.088  24.154  1.00 0.00 ? 763 LYS A CE  1  
ATOM 4528   N NZ  . LYS A 1 763 ? 100.912 82.650  22.955  1.00 0.00 ? 763 LYS A NZ  1  
ATOM 4529   N N   . LEU A 1 764 ? 99.323  85.084  28.465  1.00 0.00 ? 764 LEU A N   1  
ATOM 4530   C CA  . LEU A 1 764 ? 98.057  84.329  28.719  1.00 0.00 ? 764 LEU A CA  1  
ATOM 4531   C C   . LEU A 1 764 ? 96.839  85.178  28.719  1.00 0.00 ? 764 LEU A C   1  
ATOM 4532   O O   . LEU A 1 764 ? 95.808  84.841  28.155  1.00 0.00 ? 764 LEU A O   1  
ATOM 4533   C CB  . LEU A 1 764 ? 98.282  83.561  30.093  1.00 0.00 ? 764 LEU A CB  1  
ATOM 4534   C CG  . LEU A 1 764 ? 98.408  82.002  29.868  1.00 0.00 ? 764 LEU A CG  1  
ATOM 4535   C CD1 . LEU A 1 764 ? 97.144  81.270  29.208  1.00 0.00 ? 764 LEU A CD1 1  
ATOM 4536   C CD2 . LEU A 1 764 ? 99.599  81.641  28.995  1.00 0.00 ? 764 LEU A CD2 1  
ATOM 4537   N N   . ILE A 1 765 ? 96.961  86.402  29.347  1.00 0.00 ? 765 ILE A N   1  
ATOM 4538   C CA  . ILE A 1 765 ? 95.912  87.422  29.443  1.00 0.00 ? 765 ILE A CA  1  
ATOM 4539   C C   . ILE A 1 765 ? 95.619  87.995  28.083  1.00 0.00 ? 765 ILE A C   1  
ATOM 4540   O O   . ILE A 1 765 ? 94.441  88.218  27.762  1.00 0.00 ? 765 ILE A O   1  
ATOM 4541   C CB  . ILE A 1 765 ? 96.319  88.563  30.394  1.00 0.00 ? 765 ILE A CB  1  
ATOM 4542   C CG1 . ILE A 1 765 ? 96.130  88.115  31.853  1.00 0.00 ? 765 ILE A CG1 1  
ATOM 4543   C CG2 . ILE A 1 765 ? 95.541  89.855  30.218  1.00 0.00 ? 765 ILE A CG2 1  
ATOM 4544   C CD1 . ILE A 1 765 ? 96.508  89.183  32.892  1.00 0.00 ? 765 ILE A CD1 1  
ATOM 4545   N N   . GLU A 1 766 ? 96.707  88.199  27.257  1.00 0.00 ? 766 GLU A N   1  
ATOM 4546   C CA  . GLU A 1 766 ? 96.552  88.710  25.855  1.00 0.00 ? 766 GLU A CA  1  
ATOM 4547   C C   . GLU A 1 766 ? 95.800  87.679  25.012  1.00 0.00 ? 766 GLU A C   1  
ATOM 4548   O O   . GLU A 1 766 ? 94.916  88.102  24.299  1.00 0.00 ? 766 GLU A O   1  
ATOM 4549   C CB  . GLU A 1 766 ? 97.949  89.028  25.183  1.00 0.00 ? 766 GLU A CB  1  
ATOM 4550   C CG  . GLU A 1 766 ? 97.971  90.093  24.008  1.00 0.00 ? 766 GLU A CG  1  
ATOM 4551   C CD  . GLU A 1 766 ? 99.403  90.092  23.390  1.00 0.00 ? 766 GLU A CD  1  
ATOM 4552   O OE1 . GLU A 1 766 ? 100.328 89.610  24.099  1.00 0.00 ? 766 GLU A OE1 1  
ATOM 4553   O OE2 . GLU A 1 766 ? 99.588  90.697  22.309  1.00 0.00 ? 766 GLU A OE2 1  
ATOM 4554   N N   . TYR A 1 767 ? 96.133  86.366  25.187  1.00 0.00 ? 767 TYR A N   1  
ATOM 4555   C CA  . TYR A 1 767 ? 95.487  85.358  24.455  1.00 0.00 ? 767 TYR A CA  1  
ATOM 4556   C C   . TYR A 1 767 ? 93.987  85.324  24.769  1.00 0.00 ? 767 TYR A C   1  
ATOM 4557   O O   . TYR A 1 767 ? 93.132  85.291  23.851  1.00 0.00 ? 767 TYR A O   1  
ATOM 4558   C CB  . TYR A 1 767 ? 96.145  83.963  24.765  1.00 0.00 ? 767 TYR A CB  1  
ATOM 4559   C CG  . TYR A 1 767 ? 95.984  83.016  23.624  1.00 0.00 ? 767 TYR A CG  1  
ATOM 4560   C CD1 . TYR A 1 767 ? 94.699  82.484  23.266  1.00 0.00 ? 767 TYR A CD1 1  
ATOM 4561   C CD2 . TYR A 1 767 ? 97.072  82.776  22.751  1.00 0.00 ? 767 TYR A CD2 1  
ATOM 4562   C CE1 . TYR A 1 767 ? 94.501  81.836  22.060  1.00 0.00 ? 767 TYR A CE1 1  
ATOM 4563   C CE2 . TYR A 1 767 ? 96.881  82.057  21.545  1.00 0.00 ? 767 TYR A CE2 1  
ATOM 4564   C CZ  . TYR A 1 767 ? 95.604  81.601  21.225  1.00 0.00 ? 767 TYR A CZ  1  
ATOM 4565   O OH  . TYR A 1 767 ? 95.403  80.923  20.023  1.00 0.00 ? 767 TYR A OH  1  
ATOM 4566   N N   . ILE A 1 768 ? 93.691  85.341  26.066  1.00 0.00 ? 768 ILE A N   1  
ATOM 4567   C CA  . ILE A 1 768 ? 92.370  85.238  26.620  1.00 0.00 ? 768 ILE A CA  1  
ATOM 4568   C C   . ILE A 1 768 ? 91.443  86.409  26.179  1.00 0.00 ? 768 ILE A C   1  
ATOM 4569   O O   . ILE A 1 768 ? 90.315  86.150  25.816  1.00 0.00 ? 768 ILE A O   1  
ATOM 4570   C CB  . ILE A 1 768 ? 92.360  84.956  28.103  1.00 0.00 ? 768 ILE A CB  1  
ATOM 4571   C CG1 . ILE A 1 768 ? 91.456  83.696  28.434  1.00 0.00 ? 768 ILE A CG1 1  
ATOM 4572   C CG2 . ILE A 1 768 ? 91.912  86.173  29.019  1.00 0.00 ? 768 ILE A CG2 1  
ATOM 4573   C CD1 . ILE A 1 768 ? 91.395  83.344  29.930  1.00 0.00 ? 768 ILE A CD1 1  
ATOM 4574   N N   . SER A 1 769 ? 91.949  87.669  26.132  1.00 0.00 ? 769 SER A N   1  
ATOM 4575   C CA  . SER A 1 769 ? 91.128  88.763  25.761  1.00 0.00 ? 769 SER A CA  1  
ATOM 4576   C C   . SER A 1 769 ? 90.530  88.741  24.424  1.00 0.00 ? 769 SER A C   1  
ATOM 4577   O O   . SER A 1 769 ? 89.309  88.887  24.289  1.00 0.00 ? 769 SER A O   1  
ATOM 4578   C CB  . SER A 1 769 ? 91.858  90.149  25.717  1.00 0.00 ? 769 SER A CB  1  
ATOM 4579   O OG  . SER A 1 769 ? 92.704  90.333  26.848  1.00 0.00 ? 769 SER A OG  1  
ATOM 4580   N N   . ASN A 1 770 ? 91.434  88.332  23.469  1.00 0.00 ? 770 ASN A N   1  
ATOM 4581   C CA  . ASN A 1 770 ? 91.211  88.065  22.116  1.00 0.00 ? 770 ASN A CA  1  
ATOM 4582   C C   . ASN A 1 770 ? 90.223  86.888  22.024  1.00 0.00 ? 770 ASN A C   1  
ATOM 4583   O O   . ASN A 1 770 ? 89.286  87.070  21.269  1.00 0.00 ? 770 ASN A O   1  
ATOM 4584   C CB  . ASN A 1 770 ? 92.489  87.664  21.338  1.00 0.00 ? 770 ASN A CB  1  
ATOM 4585   C CG  . ASN A 1 770 ? 93.643  88.610  21.575  1.00 0.00 ? 770 ASN A CG  1  
ATOM 4586   O OD1 . ASN A 1 770 ? 93.578  89.785  21.815  1.00 0.00 ? 770 ASN A OD1 1  
ATOM 4587   N ND2 . ASN A 1 770 ? 94.857  88.037  21.237  1.00 0.00 ? 770 ASN A ND2 1  
ATOM 4588   N N   . ALA A 1 771 ? 90.490  85.791  22.832  1.00 0.00 ? 771 ALA A N   1  
ATOM 4589   C CA  . ALA A 1 771 ? 89.541  84.693  22.752  1.00 0.00 ? 771 ALA A CA  1  
ATOM 4590   C C   . ALA A 1 771 ? 88.097  85.037  23.202  1.00 0.00 ? 771 ALA A C   1  
ATOM 4591   O O   . ALA A 1 771 ? 87.113  84.528  22.677  1.00 0.00 ? 771 ALA A O   1  
ATOM 4592   C CB  . ALA A 1 771 ? 89.956  83.484  23.713  1.00 0.00 ? 771 ALA A CB  1  
ATOM 4593   N N   . SER A 1 772 ? 88.018  85.911  24.268  1.00 0.00 ? 772 SER A N   1  
ATOM 4594   C CA  . SER A 1 772 ? 86.747  86.253  24.883  1.00 0.00 ? 772 SER A CA  1  
ATOM 4595   C C   . SER A 1 772 ? 85.781  86.944  23.920  1.00 0.00 ? 772 SER A C   1  
ATOM 4596   O O   . SER A 1 772 ? 84.587  86.625  23.849  1.00 0.00 ? 772 SER A O   1  
ATOM 4597   C CB  . SER A 1 772 ? 86.832  87.308  26.089  1.00 0.00 ? 772 SER A CB  1  
ATOM 4598   O OG  . SER A 1 772 ? 87.664  86.727  27.084  1.00 0.00 ? 772 SER A OG  1  
ATOM 4599   N N   . SER A 1 773 ? 86.344  87.846  23.111  1.00 0.00 ? 773 SER A N   1  
ATOM 4600   C CA  . SER A 1 773 ? 85.500  88.526  22.176  1.00 0.00 ? 773 SER A CA  1  
ATOM 4601   C C   . SER A 1 773 ? 84.951  87.595  21.086  1.00 0.00 ? 773 SER A C   1  
ATOM 4602   O O   . SER A 1 773 ? 83.778  87.741  20.720  1.00 0.00 ? 773 SER A O   1  
ATOM 4603   C CB  . SER A 1 773 ? 86.294  89.568  21.371  1.00 0.00 ? 773 SER A CB  1  
ATOM 4604   O OG  . SER A 1 773 ? 86.662  90.680  22.241  1.00 0.00 ? 773 SER A OG  1  
ATOM 4605   N N   . ILE A 1 774 ? 85.776  86.627  20.602  1.00 0.00 ? 774 ILE A N   1  
ATOM 4606   C CA  . ILE A 1 774 ? 85.435  85.641  19.560  1.00 0.00 ? 774 ILE A CA  1  
ATOM 4607   C C   . ILE A 1 774 ? 84.262  84.731  20.080  1.00 0.00 ? 774 ILE A C   1  
ATOM 4608   O O   . ILE A 1 774 ? 83.339  84.468  19.329  1.00 0.00 ? 774 ILE A O   1  
ATOM 4609   C CB  . ILE A 1 774 ? 86.613  84.833  19.160  1.00 0.00 ? 774 ILE A CB  1  
ATOM 4610   C CG1 . ILE A 1 774 ? 87.816  85.691  18.599  1.00 0.00 ? 774 ILE A CG1 1  
ATOM 4611   C CG2 . ILE A 1 774 ? 86.224  83.775  18.117  1.00 0.00 ? 774 ILE A CG2 1  
ATOM 4612   C CD1 . ILE A 1 774 ? 89.040  84.858  18.183  1.00 0.00 ? 774 ILE A CD1 1  
ATOM 4613   N N   . PHE A 1 775 ? 84.450  84.301  21.329  1.00 0.00 ? 775 PHE A N   1  
ATOM 4614   C CA  . PHE A 1 775 ? 83.534  83.370  21.995  1.00 0.00 ? 775 PHE A CA  1  
ATOM 4615   C C   . PHE A 1 775 ? 82.153  84.022  22.087  1.00 0.00 ? 775 PHE A C   1  
ATOM 4616   O O   . PHE A 1 775 ? 81.161  83.365  21.889  1.00 0.00 ? 775 PHE A O   1  
ATOM 4617   C CB  . PHE A 1 775 ? 84.118  82.917  23.343  1.00 0.00 ? 775 PHE A CB  1  
ATOM 4618   C CG  . PHE A 1 775 ? 85.223  81.860  23.139  1.00 0.00 ? 775 PHE A CG  1  
ATOM 4619   C CD1 . PHE A 1 775 ? 85.385  80.895  22.123  1.00 0.00 ? 775 PHE A CD1 1  
ATOM 4620   C CD2 . PHE A 1 775 ? 86.162  81.789  24.267  1.00 0.00 ? 775 PHE A CD2 1  
ATOM 4621   C CE1 . PHE A 1 775 ? 86.467  79.978  22.141  1.00 0.00 ? 775 PHE A CE1 1  
ATOM 4622   C CE2 . PHE A 1 775 ? 87.187  80.889  24.201  1.00 0.00 ? 775 PHE A CE2 1  
ATOM 4623   C CZ  . PHE A 1 775 ? 87.422  80.010  23.127  1.00 0.00 ? 775 PHE A CZ  1  
ATOM 4624   N N   . ARG A 1 776 ? 82.160  85.323  22.462  1.00 0.00 ? 776 ARG A N   1  
ATOM 4625   C CA  . ARG A 1 776 ? 80.965  85.990  22.717  1.00 0.00 ? 776 ARG A CA  1  
ATOM 4626   C C   . ARG A 1 776 ? 80.109  86.077  21.451  1.00 0.00 ? 776 ARG A C   1  
ATOM 4627   O O   . ARG A 1 776 ? 78.959  85.690  21.505  1.00 0.00 ? 776 ARG A O   1  
ATOM 4628   C CB  . ARG A 1 776 ? 81.199  87.361  23.366  1.00 0.00 ? 776 ARG A CB  1  
ATOM 4629   C CG  . ARG A 1 776 ? 81.416  87.352  24.917  1.00 0.00 ? 776 ARG A CG  1  
ATOM 4630   C CD  . ARG A 1 776 ? 81.737  88.727  25.585  1.00 0.00 ? 776 ARG A CD  1  
ATOM 4631   N NE  . ARG A 1 776 ? 83.058  89.335  25.290  1.00 0.00 ? 776 ARG A NE  1  
ATOM 4632   C CZ  . ARG A 1 776 ? 83.628  90.304  26.088  1.00 0.00 ? 776 ARG A CZ  1  
ATOM 4633   N NH1 . ARG A 1 776 ? 82.916  90.678  27.177  1.00 0.00 ? 776 ARG A NH1 1  
ATOM 4634   N NH2 . ARG A 1 776 ? 84.835  90.887  25.767  1.00 0.00 ? 776 ARG A NH2 1  
ATOM 4635   N N   . LYS A 1 777 ? 80.751  86.361  20.322  1.00 0.00 ? 777 LYS A N   1  
ATOM 4636   C CA  . LYS A 1 777 ? 80.136  86.383  18.980  1.00 0.00 ? 777 LYS A CA  1  
ATOM 4637   C C   . LYS A 1 777 ? 79.627  84.999  18.652  1.00 0.00 ? 777 LYS A C   1  
ATOM 4638   O O   . LYS A 1 777 ? 78.503  84.862  18.068  1.00 0.00 ? 777 LYS A O   1  
ATOM 4639   C CB  . LYS A 1 777 ? 81.130  86.833  17.943  1.00 0.00 ? 777 LYS A CB  1  
ATOM 4640   C CG  . LYS A 1 777 ? 80.816  86.611  16.458  1.00 0.00 ? 777 LYS A CG  1  
ATOM 4641   C CD  . LYS A 1 777 ? 81.458  87.653  15.486  1.00 0.00 ? 777 LYS A CD  1  
ATOM 4642   C CE  . LYS A 1 777 ? 80.866  89.095  15.614  1.00 0.00 ? 777 LYS A CE  1  
ATOM 4643   N NZ  . LYS A 1 777 ? 81.002  89.965  14.410  1.00 0.00 ? 777 LYS A NZ  1  
ATOM 4644   N N   . CYS A 1 778 ? 80.352  83.943  18.960  1.00 0.00 ? 778 CYS A N   1  
ATOM 4645   C CA  . CYS A 1 778 ? 80.072  82.533  18.565  1.00 0.00 ? 778 CYS A CA  1  
ATOM 4646   C C   . CYS A 1 778 ? 78.816  82.035  19.145  1.00 0.00 ? 778 CYS A C   1  
ATOM 4647   O O   . CYS A 1 778 ? 78.126  81.268  18.471  1.00 0.00 ? 778 CYS A O   1  
ATOM 4648   C CB  . CYS A 1 778 ? 81.285  81.701  19.068  1.00 0.00 ? 778 CYS A CB  1  
ATOM 4649   S SG  . CYS A 1 778 ? 81.347  80.095  18.297  1.00 0.00 ? 778 CYS A SG  1  
ATOM 4650   N N   . LEU A 1 779 ? 78.388  82.375  20.421  1.00 0.00 ? 779 LEU A N   1  
ATOM 4651   C CA  . LEU A 1 779 ? 77.231  81.875  21.150  1.00 0.00 ? 779 LEU A CA  1  
ATOM 4652   C C   . LEU A 1 779 ? 75.937  82.207  20.446  1.00 0.00 ? 779 LEU A C   1  
ATOM 4653   O O   . LEU A 1 779 ? 74.986  81.474  20.400  1.00 0.00 ? 779 LEU A O   1  
ATOM 4654   C CB  . LEU A 1 779 ? 77.101  82.597  22.542  1.00 0.00 ? 779 LEU A CB  1  
ATOM 4655   C CG  . LEU A 1 779 ? 78.334  82.468  23.460  1.00 0.00 ? 779 LEU A CG  1  
ATOM 4656   C CD1 . LEU A 1 779 ? 77.984  83.115  24.782  1.00 0.00 ? 779 LEU A CD1 1  
ATOM 4657   C CD2 . LEU A 1 779 ? 78.743  80.992  23.657  1.00 0.00 ? 779 LEU A CD2 1  
ATOM 4658   N N   . ILE A 1 780 ? 75.826  83.449  19.782  1.00 0.00 ? 780 ILE A N   1  
ATOM 4659   C CA  . ILE A 1 780 ? 74.757  84.016  19.040  1.00 0.00 ? 780 ILE A CA  1  
ATOM 4660   C C   . ILE A 1 780 ? 74.423  83.185  17.822  1.00 0.00 ? 780 ILE A C   1  
ATOM 4661   O O   . ILE A 1 780 ? 73.245  82.963  17.623  1.00 0.00 ? 780 ILE A O   1  
ATOM 4662   C CB  . ILE A 1 780 ? 75.070  85.425  18.562  1.00 0.00 ? 780 ILE A CB  1  
ATOM 4663   C CG1 . ILE A 1 780 ? 75.734  86.282  19.659  1.00 0.00 ? 780 ILE A CG1 1  
ATOM 4664   C CG2 . ILE A 1 780 ? 73.746  86.031  18.079  1.00 0.00 ? 780 ILE A CG2 1  
ATOM 4665   C CD1 . ILE A 1 780 ? 76.069  87.717  19.217  1.00 0.00 ? 780 ILE A CD1 1  
ATOM 4666   N N   . ASN A 1 781 ? 75.438  82.625  17.092  1.00 0.00 ? 781 ASN A N   1  
ATOM 4667   C CA  . ASN A 1 781 ? 75.281  81.783  15.892  1.00 0.00 ? 781 ASN A CA  1  
ATOM 4668   C C   . ASN A 1 781 ? 74.529  80.441  16.062  1.00 0.00 ? 781 ASN A C   1  
ATOM 4669   O O   . ASN A 1 781 ? 73.788  80.064  15.121  1.00 0.00 ? 781 ASN A O   1  
ATOM 4670   C CB  . ASN A 1 781 ? 76.657  81.347  15.255  1.00 0.00 ? 781 ASN A CB  1  
ATOM 4671   C CG  . ASN A 1 781 ? 77.122  82.638  14.528  1.00 0.00 ? 781 ASN A CG  1  
ATOM 4672   O OD1 . ASN A 1 781 ? 77.816  83.484  15.064  1.00 0.00 ? 781 ASN A OD1 1  
ATOM 4673   N ND2 . ASN A 1 781 ? 76.625  82.660  13.225  1.00 0.00 ? 781 ASN A ND2 1  
ATOM 4674   N N   . PHE A 1 782 ? 74.729  79.736  17.188  1.00 0.00 ? 782 PHE A N   1  
ATOM 4675   C CA  . PHE A 1 782 ? 73.999  78.405  17.280  1.00 0.00 ? 782 PHE A CA  1  
ATOM 4676   C C   . PHE A 1 782 ? 72.468  78.604  17.314  1.00 0.00 ? 782 PHE A C   1  
ATOM 4677   O O   . PHE A 1 782 ? 71.842  77.764  16.664  1.00 0.00 ? 782 PHE A O   1  
ATOM 4678   C CB  . PHE A 1 782 ? 74.436  77.568  18.597  1.00 0.00 ? 782 PHE A CB  1  
ATOM 4679   C CG  . PHE A 1 782 ? 75.923  77.422  18.702  1.00 0.00 ? 782 PHE A CG  1  
ATOM 4680   C CD1 . PHE A 1 782 ? 76.647  76.593  17.815  1.00 0.00 ? 782 PHE A CD1 1  
ATOM 4681   C CD2 . PHE A 1 782 ? 76.629  78.183  19.671  1.00 0.00 ? 782 PHE A CD2 1  
ATOM 4682   C CE1 . PHE A 1 782 ? 78.080  76.495  17.875  1.00 0.00 ? 782 PHE A CE1 1  
ATOM 4683   C CE2 . PHE A 1 782 ? 78.025  78.122  19.667  1.00 0.00 ? 782 PHE A CE2 1  
ATOM 4684   C CZ  . PHE A 1 782 ? 78.788  77.296  18.819  1.00 0.00 ? 782 PHE A CZ  1  
ATOM 4685   N N   . THR A 1 783 ? 72.057  79.652  18.021  1.00 0.00 ? 783 THR A N   1  
ATOM 4686   C CA  . THR A 1 783 ? 70.614  79.923  18.035  1.00 0.00 ? 783 THR A CA  1  
ATOM 4687   C C   . THR A 1 783 ? 70.048  80.391  16.703  1.00 0.00 ? 783 THR A C   1  
ATOM 4688   O O   . THR A 1 783 ? 68.927  79.997  16.307  1.00 0.00 ? 783 THR A O   1  
ATOM 4689   C CB  . THR A 1 783 ? 70.362  80.975  19.078  1.00 0.00 ? 783 THR A CB  1  
ATOM 4690   O OG1 . THR A 1 783 ? 71.067  80.733  20.335  1.00 0.00 ? 783 THR A OG1 1  
ATOM 4691   C CG2 . THR A 1 783 ? 68.835  81.025  19.309  1.00 0.00 ? 783 THR A CG2 1  
ATOM 4692   N N   . GLN A 1 784 ? 70.832  81.344  16.051  1.00 0.00 ? 784 GLN A N   1  
ATOM 4693   C CA  . GLN A 1 784 ? 70.449  82.042  14.778  1.00 0.00 ? 784 GLN A CA  1  
ATOM 4694   C C   . GLN A 1 784 ? 70.497  81.230  13.454  1.00 0.00 ? 784 GLN A C   1  
ATOM 4695   O O   . GLN A 1 784 ? 69.732  81.520  12.560  1.00 0.00 ? 784 GLN A O   1  
ATOM 4696   C CB  . GLN A 1 784 ? 71.388  83.218  14.426  1.00 0.00 ? 784 GLN A CB  1  
ATOM 4697   C CG  . GLN A 1 784 ? 71.452  84.433  15.365  1.00 0.00 ? 784 GLN A CG  1  
ATOM 4698   C CD  . GLN A 1 784 ? 70.090  85.109  15.354  1.00 0.00 ? 784 GLN A CD  1  
ATOM 4699   O OE1 . GLN A 1 784 ? 69.435  85.267  14.365  1.00 0.00 ? 784 GLN A OE1 1  
ATOM 4700   N NE2 . GLN A 1 784 ? 69.699  85.676  16.488  1.00 0.00 ? 784 GLN A NE2 1  
ATOM 4701   N N   . GLU A 1 785 ? 71.353  80.289  13.240  1.00 0.00 ? 785 GLU A N   1  
ATOM 4702   C CA  . GLU A 1 785 ? 71.647  79.621  12.038  1.00 0.00 ? 785 GLU A CA  1  
ATOM 4703   C C   . GLU A 1 785 ? 71.957  80.555  10.891  1.00 0.00 ? 785 GLU A C   1  
ATOM 4704   O O   . GLU A 1 785 ? 71.474  80.313  9.817   1.00 0.00 ? 785 GLU A O   1  
ATOM 4705   C CB  . GLU A 1 785 ? 70.692  78.432  11.635  1.00 0.00 ? 785 GLU A CB  1  
ATOM 4706   C CG  . GLU A 1 785 ? 70.590  77.366  12.775  1.00 0.00 ? 785 GLU A CG  1  
ATOM 4707   C CD  . GLU A 1 785 ? 71.812  76.459  12.903  1.00 0.00 ? 785 GLU A CD  1  
ATOM 4708   O OE1 . GLU A 1 785 ? 72.741  76.885  13.697  1.00 0.00 ? 785 GLU A OE1 1  
ATOM 4709   O OE2 . GLU A 1 785 ? 71.705  75.290  12.452  1.00 0.00 ? 785 GLU A OE2 1  
ATOM 4710   N N   . LEU A 1 786 ? 72.827  81.629  11.045  1.00 0.00 ? 786 LEU A N   1  
ATOM 4711   C CA  . LEU A 1 786 ? 73.351  82.543  10.122  1.00 0.00 ? 786 LEU A CA  1  
ATOM 4712   C C   . LEU A 1 786 ? 74.851  82.272  9.975   1.00 0.00 ? 786 LEU A C   1  
ATOM 4713   O O   . LEU A 1 786 ? 75.490  81.758  10.869  1.00 0.00 ? 786 LEU A O   1  
ATOM 4714   C CB  . LEU A 1 786 ? 73.000  83.981  10.669  1.00 0.00 ? 786 LEU A CB  1  
ATOM 4715   C CG  . LEU A 1 786 ? 73.732  85.141  9.963   1.00 0.00 ? 786 LEU A CG  1  
ATOM 4716   C CD1 . LEU A 1 786 ? 73.485  85.342  8.466   1.00 0.00 ? 786 LEU A CD1 1  
ATOM 4717   C CD2 . LEU A 1 786 ? 73.557  86.446  10.757  1.00 0.00 ? 786 LEU A CD2 1  
ATOM 4718   N N   . SER A 1 787 ? 75.371  82.480  8.757   1.00 0.00 ? 787 SER A N   1  
ATOM 4719   C CA  . SER A 1 787 ? 76.769  82.121  8.471   1.00 0.00 ? 787 SER A CA  1  
ATOM 4720   C C   . SER A 1 787 ? 77.736  83.281  8.290   1.00 0.00 ? 787 SER A C   1  
ATOM 4721   O O   . SER A 1 787 ? 78.913  83.133  8.032   1.00 0.00 ? 787 SER A O   1  
ATOM 4722   C CB  . SER A 1 787 ? 76.828  81.435  7.119   1.00 0.00 ? 787 SER A CB  1  
ATOM 4723   O OG  . SER A 1 787 ? 76.168  82.128  6.087   1.00 0.00 ? 787 SER A OG  1  
ATOM 4724   N N   . THR A 1 788 ? 77.209  84.560  8.379   1.00 0.00 ? 788 THR A N   1  
ATOM 4725   C CA  . THR A 1 788 ? 78.026  85.705  8.106   1.00 0.00 ? 788 THR A CA  1  
ATOM 4726   C C   . THR A 1 788 ? 78.954  85.992  9.324   1.00 0.00 ? 788 THR A C   1  
ATOM 4727   O O   . THR A 1 788 ? 80.135  86.257  9.120   1.00 0.00 ? 788 THR A O   1  
ATOM 4728   C CB  . THR A 1 788 ? 77.029  86.846  7.871   1.00 0.00 ? 788 THR A CB  1  
ATOM 4729   O OG1 . THR A 1 788 ? 76.141  86.535  6.827   1.00 0.00 ? 788 THR A OG1 1  
ATOM 4730   C CG2 . THR A 1 788 ? 77.733  88.172  7.580   1.00 0.00 ? 788 THR A CG2 1  
ATOM 4731   N N   . GLU A 1 789 ? 78.380  85.944  10.622  1.00 0.00 ? 789 GLU A N   1  
ATOM 4732   C CA  . GLU A 1 789 ? 79.062  86.148  11.882  1.00 0.00 ? 789 GLU A CA  1  
ATOM 4733   C C   . GLU A 1 789 ? 80.094  85.074  12.046  1.00 0.00 ? 789 GLU A C   1  
ATOM 4734   O O   . GLU A 1 789 ? 81.157  85.294  12.590  1.00 0.00 ? 789 GLU A O   1  
ATOM 4735   C CB  . GLU A 1 789 ? 78.005  85.883  13.037  1.00 0.00 ? 789 GLU A CB  1  
ATOM 4736   C CG  . GLU A 1 789 ? 76.933  87.029  13.098  1.00 0.00 ? 789 GLU A CG  1  
ATOM 4737   C CD  . GLU A 1 789 ? 75.741  86.830  14.115  1.00 0.00 ? 789 GLU A CD  1  
ATOM 4738   O OE1 . GLU A 1 789 ? 75.121  85.759  13.965  1.00 0.00 ? 789 GLU A OE1 1  
ATOM 4739   O OE2 . GLU A 1 789 ? 75.428  87.722  14.916  1.00 0.00 ? 789 GLU A OE2 1  
ATOM 4740   N N   . LYS A 1 790 ? 79.697  83.912  11.590  1.00 0.00 ? 790 LYS A N   1  
ATOM 4741   C CA  . LYS A 1 790 ? 80.453  82.689  11.626  1.00 0.00 ? 790 LYS A CA  1  
ATOM 4742   C C   . LYS A 1 790 ? 81.679  82.816  10.775  1.00 0.00 ? 790 LYS A C   1  
ATOM 4743   O O   . LYS A 1 790 ? 82.753  82.245  11.125  1.00 0.00 ? 790 LYS A O   1  
ATOM 4744   C CB  . LYS A 1 790 ? 79.570  81.459  11.150  1.00 0.00 ? 790 LYS A CB  1  
ATOM 4745   C CG  . LYS A 1 790 ? 79.936  80.144  11.839  1.00 0.00 ? 790 LYS A CG  1  
ATOM 4746   C CD  . LYS A 1 790 ? 79.572  80.063  13.318  1.00 0.00 ? 790 LYS A CD  1  
ATOM 4747   C CE  . LYS A 1 790 ? 80.120  78.828  14.105  1.00 0.00 ? 790 LYS A CE  1  
ATOM 4748   N NZ  . LYS A 1 790 ? 81.634  78.671  14.065  1.00 0.00 ? 790 LYS A NZ  1  
ATOM 4749   N N   . PHE A 1 791 ? 81.572  83.497  9.576   1.00 0.00 ? 791 PHE A N   1  
ATOM 4750   C CA  . PHE A 1 791 ? 82.577  83.671  8.564   1.00 0.00 ? 791 PHE A CA  1  
ATOM 4751   C C   . PHE A 1 791 ? 83.769  84.417  9.219   1.00 0.00 ? 791 PHE A C   1  
ATOM 4752   O O   . PHE A 1 791 ? 84.859  83.950  9.132   1.00 0.00 ? 791 PHE A O   1  
ATOM 4753   C CB  . PHE A 1 791 ? 82.009  84.496  7.385   1.00 0.00 ? 791 PHE A CB  1  
ATOM 4754   C CG  . PHE A 1 791 ? 82.871  84.357  6.139   1.00 0.00 ? 791 PHE A CG  1  
ATOM 4755   C CD1 . PHE A 1 791 ? 82.836  83.068  5.559   1.00 0.00 ? 791 PHE A CD1 1  
ATOM 4756   C CD2 . PHE A 1 791 ? 83.594  85.385  5.515   1.00 0.00 ? 791 PHE A CD2 1  
ATOM 4757   C CE1 . PHE A 1 791 ? 83.501  82.938  4.256   1.00 0.00 ? 791 PHE A CE1 1  
ATOM 4758   C CE2 . PHE A 1 791 ? 84.162  85.175  4.255   1.00 0.00 ? 791 PHE A CE2 1  
ATOM 4759   C CZ  . PHE A 1 791 ? 84.112  83.952  3.545   1.00 0.00 ? 791 PHE A CZ  1  
ATOM 4760   N N   . ASP A 1 792 ? 83.476  85.478  10.065  1.00 0.00 ? 792 ASP A N   1  
ATOM 4761   C CA  . ASP A 1 792 ? 84.451  86.227  10.923  1.00 0.00 ? 792 ASP A CA  1  
ATOM 4762   C C   . ASP A 1 792 ? 85.160  85.285  11.875  1.00 0.00 ? 792 ASP A C   1  
ATOM 4763   O O   . ASP A 1 792 ? 86.392  85.454  12.046  1.00 0.00 ? 792 ASP A O   1  
ATOM 4764   C CB  . ASP A 1 792 ? 83.789  87.328  11.899  1.00 0.00 ? 792 ASP A CB  1  
ATOM 4765   C CG  . ASP A 1 792 ? 82.913  88.363  11.140  1.00 0.00 ? 792 ASP A CG  1  
ATOM 4766   O OD1 . ASP A 1 792 ? 83.263  88.706  9.972   1.00 0.00 ? 792 ASP A OD1 1  
ATOM 4767   O OD2 . ASP A 1 792 ? 81.798  88.573  11.630  1.00 0.00 ? 792 ASP A OD2 1  
ATOM 4768   N N   . PHE A 1 793 ? 84.381  84.360  12.454  1.00 0.00 ? 793 PHE A N   1  
ATOM 4769   C CA  . PHE A 1 793 ? 84.809  83.344  13.408  1.00 0.00 ? 793 PHE A CA  1  
ATOM 4770   C C   . PHE A 1 793 ? 85.818  82.403  12.753  1.00 0.00 ? 793 PHE A C   1  
ATOM 4771   O O   . PHE A 1 793 ? 86.861  82.108  13.384  1.00 0.00 ? 793 PHE A O   1  
ATOM 4772   C CB  . PHE A 1 793 ? 83.639  82.697  14.208  1.00 0.00 ? 793 PHE A CB  1  
ATOM 4773   C CG  . PHE A 1 793 ? 84.002  81.457  14.935  1.00 0.00 ? 793 PHE A CG  1  
ATOM 4774   C CD1 . PHE A 1 793 ? 84.156  80.219  14.333  1.00 0.00 ? 793 PHE A CD1 1  
ATOM 4775   C CD2 . PHE A 1 793 ? 84.213  81.521  16.305  1.00 0.00 ? 793 PHE A CD2 1  
ATOM 4776   C CE1 . PHE A 1 793 ? 84.760  79.126  15.016  1.00 0.00 ? 793 PHE A CE1 1  
ATOM 4777   C CE2 . PHE A 1 793 ? 84.653  80.445  17.039  1.00 0.00 ? 793 PHE A CE2 1  
ATOM 4778   C CZ  . PHE A 1 793 ? 84.938  79.195  16.405  1.00 0.00 ? 793 PHE A CZ  1  
ATOM 4779   N N   . TYR A 1 794 ? 85.615  81.948  11.458  1.00 0.00 ? 794 TYR A N   1  
ATOM 4780   C CA  . TYR A 1 794 ? 86.537  81.099  10.727  1.00 0.00 ? 794 TYR A CA  1  
ATOM 4781   C C   . TYR A 1 794 ? 87.878  81.727  10.589  1.00 0.00 ? 794 TYR A C   1  
ATOM 4782   O O   . TYR A 1 794 ? 88.855  81.073  10.868  1.00 0.00 ? 794 TYR A O   1  
ATOM 4783   C CB  . TYR A 1 794 ? 86.069  80.759  9.267   1.00 0.00 ? 794 TYR A CB  1  
ATOM 4784   C CG  . TYR A 1 794 ? 84.696  80.089  9.075   1.00 0.00 ? 794 TYR A CG  1  
ATOM 4785   C CD1 . TYR A 1 794 ? 84.147  79.273  10.047  1.00 0.00 ? 794 TYR A CD1 1  
ATOM 4786   C CD2 . TYR A 1 794 ? 84.073  80.170  7.791   1.00 0.00 ? 794 TYR A CD2 1  
ATOM 4787   C CE1 . TYR A 1 794 ? 82.971  78.621  9.745   1.00 0.00 ? 794 TYR A CE1 1  
ATOM 4788   C CE2 . TYR A 1 794 ? 82.895  79.574  7.504   1.00 0.00 ? 794 TYR A CE2 1  
ATOM 4789   C CZ  . TYR A 1 794 ? 82.338  78.839  8.536   1.00 0.00 ? 794 TYR A CZ  1  
ATOM 4790   O OH  . TYR A 1 794 ? 81.114  78.115  8.294   1.00 0.00 ? 794 TYR A OH  1  
ATOM 4791   N N   . ASP A 1 795 ? 87.900  83.048  10.189  1.00 0.00 ? 795 ASP A N   1  
ATOM 4792   C CA  . ASP A 1 795 ? 89.188  83.733  10.034  1.00 0.00 ? 795 ASP A CA  1  
ATOM 4793   C C   . ASP A 1 795 ? 89.917  83.840  11.392  1.00 0.00 ? 795 ASP A C   1  
ATOM 4794   O O   . ASP A 1 795 ? 91.137  83.669  11.477  1.00 0.00 ? 795 ASP A O   1  
ATOM 4795   C CB  . ASP A 1 795 ? 89.161  85.027  9.157   1.00 0.00 ? 795 ASP A CB  1  
ATOM 4796   C CG  . ASP A 1 795 ? 88.039  85.978  9.434   1.00 0.00 ? 795 ASP A CG  1  
ATOM 4797   O OD1 . ASP A 1 795 ? 86.918  85.712  8.940   1.00 0.00 ? 795 ASP A OD1 1  
ATOM 4798   O OD2 . ASP A 1 795 ? 88.243  86.990  10.158  1.00 0.00 ? 795 ASP A OD2 1  
ATOM 4799   N N   . SER A 1 796 ? 89.207  84.076  12.537  1.00 0.00 ? 796 SER A N   1  
ATOM 4800   C CA  . SER A 1 796 ? 89.795  84.133  13.876  1.00 0.00 ? 796 SER A CA  1  
ATOM 4801   C C   . SER A 1 796 ? 90.460  82.908  14.343  1.00 0.00 ? 796 SER A C   1  
ATOM 4802   O O   . SER A 1 796 ? 91.536  82.910  14.906  1.00 0.00 ? 796 SER A O   1  
ATOM 4803   C CB  . SER A 1 796 ? 88.958  84.888  14.932  1.00 0.00 ? 796 SER A CB  1  
ATOM 4804   O OG  . SER A 1 796 ? 87.763  84.144  15.173  1.00 0.00 ? 796 SER A OG  1  
ATOM 4805   N N   . SER A 1 797 ? 89.748  81.767  14.141  1.00 0.00 ? 797 SER A N   1  
ATOM 4806   C CA  . SER A 1 797 ? 90.066  80.451  14.622  1.00 0.00 ? 797 SER A CA  1  
ATOM 4807   C C   . SER A 1 797 ? 91.342  79.891  14.022  1.00 0.00 ? 797 SER A C   1  
ATOM 4808   O O   . SER A 1 797 ? 92.149  79.324  14.737  1.00 0.00 ? 797 SER A O   1  
ATOM 4809   C CB  . SER A 1 797 ? 88.807  79.521  14.519  1.00 0.00 ? 797 SER A CB  1  
ATOM 4810   O OG  . SER A 1 797 ? 88.239  79.435  13.205  1.00 0.00 ? 797 SER A OG  1  
ATOM 4811   N N   . SER A 1 798 ? 91.591  80.094  12.703  1.00 0.00 ? 798 SER A N   1  
ATOM 4812   C CA  . SER A 1 798 ? 92.677  79.630  11.943  1.00 0.00 ? 798 SER A CA  1  
ATOM 4813   C C   . SER A 1 798 ? 94.006  80.099  12.567  1.00 0.00 ? 798 SER A C   1  
ATOM 4814   O O   . SER A 1 798 ? 94.862  79.293  12.974  1.00 0.00 ? 798 SER A O   1  
ATOM 4815   C CB  . SER A 1 798 ? 92.628  80.003  10.502  1.00 0.00 ? 798 SER A CB  1  
ATOM 4816   O OG  . SER A 1 798 ? 91.574  79.288  9.900   1.00 0.00 ? 798 SER A OG  1  
ATOM 4817   N N   . VAL A 1 799 ? 94.127  81.437  12.605  1.00 0.00 ? 799 VAL A N   1  
ATOM 4818   C CA  . VAL A 1 799 ? 95.342  82.073  13.188  1.00 0.00 ? 799 VAL A CA  1  
ATOM 4819   C C   . VAL A 1 799 ? 94.782  83.342  13.855  1.00 0.00 ? 799 VAL A C   1  
ATOM 4820   O O   . VAL A 1 799 ? 94.151  84.176  13.114  1.00 0.00 ? 799 VAL A O   1  
ATOM 4821   C CB  . VAL A 1 799 ? 96.465  82.396  12.199  1.00 0.00 ? 799 VAL A CB  1  
ATOM 4822   C CG1 . VAL A 1 799 ? 97.401  81.161  12.055  1.00 0.00 ? 799 VAL A CG1 1  
ATOM 4823   C CG2 . VAL A 1 799 ? 95.891  82.879  10.826  1.00 0.00 ? 799 VAL A CG2 1  
ATOM 4824   N N   . ASP A 1 800 ? 95.053  83.579  15.209  1.00 0.00 ? 800 ASP A N   1  
ATOM 4825   C CA  . ASP A 1 800 ? 94.763  84.765  15.888  1.00 0.00 ? 800 ASP A CA  1  
ATOM 4826   C C   . ASP A 1 800 ? 95.785  85.780  15.436  1.00 0.00 ? 800 ASP A C   1  
ATOM 4827   O O   . ASP A 1 800 ? 96.650  85.414  14.596  1.00 0.00 ? 800 ASP A O   1  
ATOM 4828   C CB  . ASP A 1 800 ? 94.782  84.498  17.341  1.00 0.00 ? 800 ASP A CB  1  
ATOM 4829   C CG  . ASP A 1 800 ? 93.482  83.874  17.704  1.00 0.00 ? 800 ASP A CG  1  
ATOM 4830   O OD1 . ASP A 1 800 ? 92.430  84.576  17.510  1.00 0.00 ? 800 ASP A OD1 1  
ATOM 4831   O OD2 . ASP A 1 800 ? 93.480  82.630  18.169  1.00 0.00 ? 800 ASP A OD2 1  
ATOM 4832   N N   . PRO B 2 180 ? 34.602  -0.067  -49.095 1.00 0.00 ? 180 PRO B N   1  
ATOM 4833   C CA  . PRO B 2 180 ? 33.988  0.947   -48.228 1.00 0.00 ? 180 PRO B CA  1  
ATOM 4834   C C   . PRO B 2 180 ? 35.058  1.714   -47.481 1.00 0.00 ? 180 PRO B C   1  
ATOM 4835   O O   . PRO B 2 180 ? 36.171  1.286   -47.326 1.00 0.00 ? 180 PRO B O   1  
ATOM 4836   C CB  . PRO B 2 180 ? 32.910  0.217   -47.378 1.00 0.00 ? 180 PRO B CB  1  
ATOM 4837   C CG  . PRO B 2 180 ? 32.382  -0.841  -48.291 1.00 0.00 ? 180 PRO B CG  1  
ATOM 4838   C CD  . PRO B 2 180 ? 33.729  -1.292  -48.958 1.00 0.00 ? 180 PRO B CD  1  
ATOM 4839   N N   . GLU B 2 181 ? 34.556  2.814   -46.864 1.00 0.00 ? 181 GLU B N   1  
ATOM 4840   C CA  . GLU B 2 181 ? 35.289  3.641   -45.919 1.00 0.00 ? 181 GLU B CA  1  
ATOM 4841   C C   . GLU B 2 181 ? 35.715  2.936   -44.641 1.00 0.00 ? 181 GLU B C   1  
ATOM 4842   O O   . GLU B 2 181 ? 36.585  3.402   -43.893 1.00 0.00 ? 181 GLU B O   1  
ATOM 4843   C CB  . GLU B 2 181 ? 34.515  4.888   -45.561 1.00 0.00 ? 181 GLU B CB  1  
ATOM 4844   C CG  . GLU B 2 181 ? 34.387  5.925   -46.693 1.00 0.00 ? 181 GLU B CG  1  
ATOM 4845   C CD  . GLU B 2 181 ? 33.306  5.591   -47.683 1.00 0.00 ? 181 GLU B CD  1  
ATOM 4846   O OE1 . GLU B 2 181 ? 32.467  4.677   -47.379 1.00 0.00 ? 181 GLU B OE1 1  
ATOM 4847   O OE2 . GLU B 2 181 ? 33.421  6.079   -48.851 1.00 0.00 ? 181 GLU B OE2 1  
ATOM 4848   N N   . GLU B 2 182 ? 35.000  1.801   -44.305 1.00 0.00 ? 182 GLU B N   1  
ATOM 4849   C CA  . GLU B 2 182 ? 35.180  1.020   -43.149 1.00 0.00 ? 182 GLU B CA  1  
ATOM 4850   C C   . GLU B 2 182 ? 36.539  0.473   -43.122 1.00 0.00 ? 182 GLU B C   1  
ATOM 4851   O O   . GLU B 2 182 ? 37.241  0.527   -42.145 1.00 0.00 ? 182 GLU B O   1  
ATOM 4852   C CB  . GLU B 2 182 ? 34.245  -0.240  -43.108 1.00 0.00 ? 182 GLU B CB  1  
ATOM 4853   C CG  . GLU B 2 182 ? 34.559  -1.423  -42.160 1.00 0.00 ? 182 GLU B CG  1  
ATOM 4854   C CD  . GLU B 2 182 ? 34.324  -1.106  -40.703 1.00 0.00 ? 182 GLU B CD  1  
ATOM 4855   O OE1 . GLU B 2 182 ? 35.113  -0.427  -40.022 1.00 0.00 ? 182 GLU B OE1 1  
ATOM 4856   O OE2 . GLU B 2 182 ? 33.284  -1.678  -40.212 1.00 0.00 ? 182 GLU B OE2 1  
ATOM 4857   N N   . ASP B 2 183 ? 37.051  0.064   -44.298 1.00 0.00 ? 183 ASP B N   1  
ATOM 4858   C CA  . ASP B 2 183 ? 38.411  -0.350  -44.478 1.00 0.00 ? 183 ASP B CA  1  
ATOM 4859   C C   . ASP B 2 183 ? 39.379  0.760   -44.171 1.00 0.00 ? 183 ASP B C   1  
ATOM 4860   O O   . ASP B 2 183 ? 40.431  0.525   -43.551 1.00 0.00 ? 183 ASP B O   1  
ATOM 4861   C CB  . ASP B 2 183 ? 38.654  -0.922  -45.898 1.00 0.00 ? 183 ASP B CB  1  
ATOM 4862   C CG  . ASP B 2 183 ? 37.917  -2.264  -46.057 1.00 0.00 ? 183 ASP B CG  1  
ATOM 4863   O OD1 . ASP B 2 183 ? 38.214  -3.292  -45.365 1.00 0.00 ? 183 ASP B OD1 1  
ATOM 4864   O OD2 . ASP B 2 183 ? 37.003  -2.332  -46.922 1.00 0.00 ? 183 ASP B OD2 1  
ATOM 4865   N N   . ILE B 2 184 ? 39.131  1.982   -44.582 1.00 0.00 ? 184 ILE B N   1  
ATOM 4866   C CA  . ILE B 2 184 ? 40.034  3.071   -44.319 1.00 0.00 ? 184 ILE B CA  1  
ATOM 4867   C C   . ILE B 2 184 ? 40.223  3.415   -42.833 1.00 0.00 ? 184 ILE B C   1  
ATOM 4868   O O   . ILE B 2 184 ? 41.325  3.639   -42.367 1.00 0.00 ? 184 ILE B O   1  
ATOM 4869   C CB  . ILE B 2 184 ? 39.572  4.376   -45.124 1.00 0.00 ? 184 ILE B CB  1  
ATOM 4870   C CG1 . ILE B 2 184 ? 39.329  4.065   -46.623 1.00 0.00 ? 184 ILE B CG1 1  
ATOM 4871   C CG2 . ILE B 2 184 ? 40.671  5.505   -44.963 1.00 0.00 ? 184 ILE B CG2 1  
ATOM 4872   C CD1 . ILE B 2 184 ? 38.882  5.281   -47.452 1.00 0.00 ? 184 ILE B CD1 1  
ATOM 4873   N N   . LEU B 2 185 ? 39.076  3.366   -42.104 1.00 0.00 ? 185 LEU B N   1  
ATOM 4874   C CA  . LEU B 2 185 ? 38.964  3.603   -40.663 1.00 0.00 ? 185 LEU B CA  1  
ATOM 4875   C C   . LEU B 2 185 ? 39.772  2.559   -39.902 1.00 0.00 ? 185 LEU B C   1  
ATOM 4876   O O   . LEU B 2 185 ? 40.357  2.906   -38.898 1.00 0.00 ? 185 LEU B O   1  
ATOM 4877   C CB  . LEU B 2 185 ? 37.456  3.605   -40.174 1.00 0.00 ? 185 LEU B CB  1  
ATOM 4878   C CG  . LEU B 2 185 ? 37.346  3.992   -38.670 1.00 0.00 ? 185 LEU B CG  1  
ATOM 4879   C CD1 . LEU B 2 185 ? 37.860  5.441   -38.366 1.00 0.00 ? 185 LEU B CD1 1  
ATOM 4880   C CD2 . LEU B 2 185 ? 35.911  3.827   -38.164 1.00 0.00 ? 185 LEU B CD2 1  
ATOM 4881   N N   . LYS B 2 186 ? 39.693  1.295   -40.335 1.00 0.00 ? 186 LYS B N   1  
ATOM 4882   C CA  . LYS B 2 186 ? 40.294  0.189   -39.687 1.00 0.00 ? 186 LYS B CA  1  
ATOM 4883   C C   . LYS B 2 186 ? 41.782  0.290   -39.604 1.00 0.00 ? 186 LYS B C   1  
ATOM 4884   O O   . LYS B 2 186 ? 42.394  0.012   -38.557 1.00 0.00 ? 186 LYS B O   1  
ATOM 4885   C CB  . LYS B 2 186 ? 40.026  -1.145  -40.413 1.00 0.00 ? 186 LYS B CB  1  
ATOM 4886   C CG  . LYS B 2 186 ? 38.633  -1.861  -40.309 1.00 0.00 ? 186 LYS B CG  1  
ATOM 4887   C CD  . LYS B 2 186 ? 38.870  -3.421  -40.718 1.00 0.00 ? 186 LYS B CD  1  
ATOM 4888   C CE  . LYS B 2 186 ? 37.743  -4.300  -40.233 1.00 0.00 ? 186 LYS B CE  1  
ATOM 4889   N NZ  . LYS B 2 186 ? 36.478  -3.828  -40.855 1.00 0.00 ? 186 LYS B NZ  1  
ATOM 4890   N N   . TYR B 2 187 ? 42.481  0.697   -40.719 1.00 0.00 ? 187 TYR B N   1  
ATOM 4891   C CA  . TYR B 2 187 ? 43.939  0.775   -40.652 1.00 0.00 ? 187 TYR B CA  1  
ATOM 4892   C C   . TYR B 2 187 ? 44.464  1.854   -39.636 1.00 0.00 ? 187 TYR B C   1  
ATOM 4893   O O   . TYR B 2 187 ? 45.492  1.790   -38.993 1.00 0.00 ? 187 TYR B O   1  
ATOM 4894   C CB  . TYR B 2 187 ? 44.606  1.119   -42.025 1.00 0.00 ? 187 TYR B CB  1  
ATOM 4895   C CG  . TYR B 2 187 ? 44.096  0.349   -43.164 1.00 0.00 ? 187 TYR B CG  1  
ATOM 4896   C CD1 . TYR B 2 187 ? 44.126  -1.099  -43.134 1.00 0.00 ? 187 TYR B CD1 1  
ATOM 4897   C CD2 . TYR B 2 187 ? 43.486  0.958   -44.220 1.00 0.00 ? 187 TYR B CD2 1  
ATOM 4898   C CE1 . TYR B 2 187 ? 43.558  -1.806  -44.178 1.00 0.00 ? 187 TYR B CE1 1  
ATOM 4899   C CE2 . TYR B 2 187 ? 42.803  0.249   -45.220 1.00 0.00 ? 187 TYR B CE2 1  
ATOM 4900   C CZ  . TYR B 2 187 ? 42.798  -1.147  -45.155 1.00 0.00 ? 187 TYR B CZ  1  
ATOM 4901   O OH  . TYR B 2 187 ? 42.117  -1.952  -46.134 1.00 0.00 ? 187 TYR B OH  1  
ATOM 4902   N N   . VAL B 2 188 ? 43.722  2.918   -39.662 1.00 0.00 ? 188 VAL B N   1  
ATOM 4903   C CA  . VAL B 2 188 ? 43.940  4.168   -38.997 1.00 0.00 ? 188 VAL B CA  1  
ATOM 4904   C C   . VAL B 2 188 ? 43.857  3.857   -37.549 1.00 0.00 ? 188 VAL B C   1  
ATOM 4905   O O   . VAL B 2 188 ? 44.642  4.393   -36.780 1.00 0.00 ? 188 VAL B O   1  
ATOM 4906   C CB  . VAL B 2 188 ? 43.006  5.317   -39.399 1.00 0.00 ? 188 VAL B CB  1  
ATOM 4907   C CG1 . VAL B 2 188 ? 42.292  6.077   -38.160 1.00 0.00 ? 188 VAL B CG1 1  
ATOM 4908   C CG2 . VAL B 2 188 ? 43.609  6.251   -40.537 1.00 0.00 ? 188 VAL B CG2 1  
ATOM 4909   N N   . SER B 2 189 ? 42.897  2.982   -37.231 1.00 0.00 ? 189 SER B N   1  
ATOM 4910   C CA  . SER B 2 189 ? 42.725  2.441   -35.829 1.00 0.00 ? 189 SER B CA  1  
ATOM 4911   C C   . SER B 2 189 ? 43.842  1.639   -35.343 1.00 0.00 ? 189 SER B C   1  
ATOM 4912   O O   . SER B 2 189 ? 44.196  1.801   -34.177 1.00 0.00 ? 189 SER B O   1  
ATOM 4913   C CB  . SER B 2 189 ? 41.463  1.667   -35.670 1.00 0.00 ? 189 SER B CB  1  
ATOM 4914   O OG  . SER B 2 189 ? 40.383  2.533   -35.964 1.00 0.00 ? 189 SER B OG  1  
ATOM 4915   N N   . TYR B 2 190 ? 44.474  0.804   -36.267 1.00 0.00 ? 190 TYR B N   1  
ATOM 4916   C CA  . TYR B 2 190 ? 45.562  -0.040  -35.928 1.00 0.00 ? 190 TYR B CA  1  
ATOM 4917   C C   . TYR B 2 190 ? 46.721  0.818   -35.483 1.00 0.00 ? 190 TYR B C   1  
ATOM 4918   O O   . TYR B 2 190 ? 47.331  0.589   -34.463 1.00 0.00 ? 190 TYR B O   1  
ATOM 4919   C CB  . TYR B 2 190 ? 46.091  -0.831  -37.133 1.00 0.00 ? 190 TYR B CB  1  
ATOM 4920   C CG  . TYR B 2 190 ? 45.027  -1.711  -37.836 1.00 0.00 ? 190 TYR B CG  1  
ATOM 4921   C CD1 . TYR B 2 190 ? 43.753  -2.114  -37.313 1.00 0.00 ? 190 TYR B CD1 1  
ATOM 4922   C CD2 . TYR B 2 190 ? 45.272  -2.223  -39.137 1.00 0.00 ? 190 TYR B CD2 1  
ATOM 4923   C CE1 . TYR B 2 190 ? 42.828  -2.850  -38.034 1.00 0.00 ? 190 TYR B CE1 1  
ATOM 4924   C CE2 . TYR B 2 190 ? 44.341  -2.884  -39.895 1.00 0.00 ? 190 TYR B CE2 1  
ATOM 4925   C CZ  . TYR B 2 190 ? 43.182  -3.322  -39.390 1.00 0.00 ? 190 TYR B CZ  1  
ATOM 4926   O OH  . TYR B 2 190 ? 42.347  -4.322  -40.031 1.00 0.00 ? 190 TYR B OH  1  
ATOM 4927   N N   . THR B 2 191 ? 46.959  1.881   -36.294 1.00 0.00 ? 191 THR B N   1  
ATOM 4928   C CA  . THR B 2 191 ? 48.057  2.837   -36.063 1.00 0.00 ? 191 THR B CA  1  
ATOM 4929   C C   . THR B 2 191 ? 47.886  3.564   -34.797 1.00 0.00 ? 191 THR B C   1  
ATOM 4930   O O   . THR B 2 191 ? 48.781  3.663   -33.920 1.00 0.00 ? 191 THR B O   1  
ATOM 4931   C CB  . THR B 2 191 ? 48.367  3.905   -37.187 1.00 0.00 ? 191 THR B CB  1  
ATOM 4932   O OG1 . THR B 2 191 ? 47.166  4.510   -37.483 1.00 0.00 ? 191 THR B OG1 1  
ATOM 4933   C CG2 . THR B 2 191 ? 48.911  3.200   -38.381 1.00 0.00 ? 191 THR B CG2 1  
ATOM 4934   N N   . LEU B 2 192 ? 46.644  4.028   -34.466 1.00 0.00 ? 192 LEU B N   1  
ATOM 4935   C CA  . LEU B 2 192 ? 46.342  4.564   -33.131 1.00 0.00 ? 192 LEU B CA  1  
ATOM 4936   C C   . LEU B 2 192 ? 46.554  3.583   -31.918 1.00 0.00 ? 192 LEU B C   1  
ATOM 4937   O O   . LEU B 2 192 ? 46.819  4.119   -30.837 1.00 0.00 ? 192 LEU B O   1  
ATOM 4938   C CB  . LEU B 2 192 ? 44.891  5.095   -32.982 1.00 0.00 ? 192 LEU B CB  1  
ATOM 4939   C CG  . LEU B 2 192 ? 44.574  6.255   -33.980 1.00 0.00 ? 192 LEU B CG  1  
ATOM 4940   C CD1 . LEU B 2 192 ? 43.014  6.437   -34.036 1.00 0.00 ? 192 LEU B CD1 1  
ATOM 4941   C CD2 . LEU B 2 192 ? 45.299  7.599   -33.718 1.00 0.00 ? 192 LEU B CD2 1  
ATOM 4942   N N   . LEU B 2 193 ? 46.442  2.260   -32.043 1.00 0.00 ? 193 LEU B N   1  
ATOM 4943   C CA  . LEU B 2 193 ? 46.647  1.155   -31.123 1.00 0.00 ? 193 LEU B CA  1  
ATOM 4944   C C   . LEU B 2 193 ? 48.093  0.885   -30.791 1.00 0.00 ? 193 LEU B C   1  
ATOM 4945   O O   . LEU B 2 193 ? 48.437  0.167   -29.853 1.00 0.00 ? 193 LEU B O   1  
ATOM 4946   C CB  . LEU B 2 193 ? 45.988  -0.186  -31.530 1.00 0.00 ? 193 LEU B CB  1  
ATOM 4947   C CG  . LEU B 2 193 ? 44.428  -0.144  -31.322 1.00 0.00 ? 193 LEU B CG  1  
ATOM 4948   C CD1 . LEU B 2 193 ? 43.661  -1.219  -32.145 1.00 0.00 ? 193 LEU B CD1 1  
ATOM 4949   C CD2 . LEU B 2 193 ? 44.025  -0.047  -29.862 1.00 0.00 ? 193 LEU B CD2 1  
ATOM 4950   N N   . ALA B 2 194 ? 49.054  1.468   -31.590 1.00 0.00 ? 194 ALA B N   1  
ATOM 4951   C CA  . ALA B 2 194 ? 50.455  1.289   -31.582 1.00 0.00 ? 194 ALA B CA  1  
ATOM 4952   C C   . ALA B 2 194 ? 50.707  -0.107  -32.185 1.00 0.00 ? 194 ALA B C   1  
ATOM 4953   O O   . ALA B 2 194 ? 51.512  -0.886  -31.632 1.00 0.00 ? 194 ALA B O   1  
ATOM 4954   C CB  . ALA B 2 194 ? 51.292  1.538   -30.279 1.00 0.00 ? 194 ALA B CB  1  
ATOM 4955   N N   . THR B 2 195 ? 50.116  -0.401  -33.361 1.00 0.00 ? 195 THR B N   1  
ATOM 4956   C CA  . THR B 2 195 ? 50.386  -1.573  -34.250 1.00 0.00 ? 195 THR B CA  1  
ATOM 4957   C C   . THR B 2 195 ? 50.547  -0.875  -35.582 1.00 0.00 ? 195 THR B C   1  
ATOM 4958   O O   . THR B 2 195 ? 49.736  -0.093  -36.012 1.00 0.00 ? 195 THR B O   1  
ATOM 4959   C CB  . THR B 2 195 ? 49.193  -2.561  -34.272 1.00 0.00 ? 195 THR B CB  1  
ATOM 4960   O OG1 . THR B 2 195 ? 49.120  -3.107  -32.988 1.00 0.00 ? 195 THR B OG1 1  
ATOM 4961   C CG2 . THR B 2 195 ? 49.550  -3.763  -35.227 1.00 0.00 ? 195 THR B CG2 1  
ATOM 4962   N N   . THR B 2 196 ? 51.697  -1.212  -36.280 1.00 0.00 ? 196 THR B N   1  
ATOM 4963   C CA  . THR B 2 196 ? 52.085  -0.585  -37.566 1.00 0.00 ? 196 THR B CA  1  
ATOM 4964   C C   . THR B 2 196 ? 51.290  -1.246  -38.615 1.00 0.00 ? 196 THR B C   1  
ATOM 4965   O O   . THR B 2 196 ? 51.107  -2.467  -38.611 1.00 0.00 ? 196 THR B O   1  
ATOM 4966   C CB  . THR B 2 196 ? 53.507  -0.768  -38.029 1.00 0.00 ? 196 THR B CB  1  
ATOM 4967   O OG1 . THR B 2 196 ? 54.032  -2.069  -37.778 1.00 0.00 ? 196 THR B OG1 1  
ATOM 4968   C CG2 . THR B 2 196 ? 54.333  0.307   -37.280 1.00 0.00 ? 196 THR B CG2 1  
ATOM 4969   N N   . SER B 2 197 ? 50.691  -0.457  -39.505 1.00 0.00 ? 197 SER B N   1  
ATOM 4970   C CA  . SER B 2 197 ? 49.811  -0.899  -40.603 1.00 0.00 ? 197 SER B CA  1  
ATOM 4971   C C   . SER B 2 197 ? 50.647  -1.112  -41.819 1.00 0.00 ? 197 SER B C   1  
ATOM 4972   O O   . SER B 2 197 ? 51.518  -0.325  -42.122 1.00 0.00 ? 197 SER B O   1  
ATOM 4973   C CB  . SER B 2 197 ? 48.761  0.136   -41.017 1.00 0.00 ? 197 SER B CB  1  
ATOM 4974   O OG  . SER B 2 197 ? 47.855  0.230   -39.985 1.00 0.00 ? 197 SER B OG  1  
ATOM 4975   N N   . ALA B 2 198 ? 50.392  -2.183  -42.605 1.00 0.00 ? 198 ALA B N   1  
ATOM 4976   C CA  . ALA B 2 198 ? 51.075  -2.415  -43.846 1.00 0.00 ? 198 ALA B CA  1  
ATOM 4977   C C   . ALA B 2 198 ? 50.669  -1.405  -44.903 1.00 0.00 ? 198 ALA B C   1  
ATOM 4978   O O   . ALA B 2 198 ? 51.391  -1.144  -45.865 1.00 0.00 ? 198 ALA B O   1  
ATOM 4979   C CB  . ALA B 2 198 ? 50.752  -3.807  -44.470 1.00 0.00 ? 198 ALA B CB  1  
ATOM 4980   N N   . LEU B 2 199 ? 49.511  -0.798  -44.811 1.00 0.00 ? 199 LEU B N   1  
ATOM 4981   C CA  . LEU B 2 199 ? 48.923  -0.014  -45.879 1.00 0.00 ? 199 LEU B CA  1  
ATOM 4982   C C   . LEU B 2 199 ? 48.881  1.455   -45.674 1.00 0.00 ? 199 LEU B C   1  
ATOM 4983   O O   . LEU B 2 199 ? 48.189  2.206   -46.373 1.00 0.00 ? 199 LEU B O   1  
ATOM 4984   C CB  . LEU B 2 199 ? 47.504  -0.527  -46.074 1.00 0.00 ? 199 LEU B CB  1  
ATOM 4985   C CG  . LEU B 2 199 ? 47.505  -1.801  -46.969 1.00 0.00 ? 199 LEU B CG  1  
ATOM 4986   C CD1 . LEU B 2 199 ? 46.212  -2.655  -46.805 1.00 0.00 ? 199 LEU B CD1 1  
ATOM 4987   C CD2 . LEU B 2 199 ? 47.734  -1.363  -48.432 1.00 0.00 ? 199 LEU B CD2 1  
ATOM 4988   N N   . PHE B 2 200 ? 49.828  1.911   -44.884 1.00 0.00 ? 200 PHE B N   1  
ATOM 4989   C CA  . PHE B 2 200 ? 50.276  3.304   -44.912 1.00 0.00 ? 200 PHE B CA  1  
ATOM 4990   C C   . PHE B 2 200 ? 51.711  3.300   -44.711 1.00 0.00 ? 200 PHE B C   1  
ATOM 4991   O O   . PHE B 2 200 ? 52.116  2.698   -43.718 1.00 0.00 ? 200 PHE B O   1  
ATOM 4992   C CB  . PHE B 2 200 ? 49.600  4.344   -43.963 1.00 0.00 ? 200 PHE B CB  1  
ATOM 4993   C CG  . PHE B 2 200 ? 48.076  4.466   -44.171 1.00 0.00 ? 200 PHE B CG  1  
ATOM 4994   C CD1 . PHE B 2 200 ? 47.504  4.787   -45.393 1.00 0.00 ? 200 PHE B CD1 1  
ATOM 4995   C CD2 . PHE B 2 200 ? 47.247  4.183   -43.053 1.00 0.00 ? 200 PHE B CD2 1  
ATOM 4996   C CE1 . PHE B 2 200 ? 46.150  4.793   -45.560 1.00 0.00 ? 200 PHE B CE1 1  
ATOM 4997   C CE2 . PHE B 2 200 ? 45.825  4.323   -43.208 1.00 0.00 ? 200 PHE B CE2 1  
ATOM 4998   C CZ  . PHE B 2 200 ? 45.303  4.541   -44.485 1.00 0.00 ? 200 PHE B CZ  1  
ATOM 4999   N N   . PRO B 2 201 ? 52.564  3.886   -45.508 1.00 0.00 ? 201 PRO B N   1  
ATOM 5000   C CA  . PRO B 2 201 ? 54.013  3.831   -45.345 1.00 0.00 ? 201 PRO B CA  1  
ATOM 5001   C C   . PRO B 2 201 ? 54.506  4.550   -44.103 1.00 0.00 ? 201 PRO B C   1  
ATOM 5002   O O   . PRO B 2 201 ? 53.904  5.508   -43.726 1.00 0.00 ? 201 PRO B O   1  
ATOM 5003   C CB  . PRO B 2 201 ? 54.565  4.459   -46.582 1.00 0.00 ? 201 PRO B CB  1  
ATOM 5004   C CG  . PRO B 2 201 ? 53.433  5.326   -47.090 1.00 0.00 ? 201 PRO B CG  1  
ATOM 5005   C CD  . PRO B 2 201 ? 52.230  4.434   -46.800 1.00 0.00 ? 201 PRO B CD  1  
ATOM 5006   N N   . PHE B 2 202 ? 55.580  4.126   -43.395 1.00 0.00 ? 202 PHE B N   1  
ATOM 5007   C CA  . PHE B 2 202 ? 56.072  4.659   -42.184 1.00 0.00 ? 202 PHE B CA  1  
ATOM 5008   C C   . PHE B 2 202 ? 57.395  5.209   -42.640 1.00 0.00 ? 202 PHE B C   1  
ATOM 5009   O O   . PHE B 2 202 ? 58.226  4.407   -43.034 1.00 0.00 ? 202 PHE B O   1  
ATOM 5010   C CB  . PHE B 2 202 ? 56.259  3.575   -41.143 1.00 0.00 ? 202 PHE B CB  1  
ATOM 5011   C CG  . PHE B 2 202 ? 54.986  3.445   -40.336 1.00 0.00 ? 202 PHE B CG  1  
ATOM 5012   C CD1 . PHE B 2 202 ? 54.795  4.279   -39.239 1.00 0.00 ? 202 PHE B CD1 1  
ATOM 5013   C CD2 . PHE B 2 202 ? 53.956  2.544   -40.641 1.00 0.00 ? 202 PHE B CD2 1  
ATOM 5014   C CE1 . PHE B 2 202 ? 53.563  4.394   -38.549 1.00 0.00 ? 202 PHE B CE1 1  
ATOM 5015   C CE2 . PHE B 2 202 ? 52.749  2.588   -39.942 1.00 0.00 ? 202 PHE B CE2 1  
ATOM 5016   C CZ  . PHE B 2 202 ? 52.544  3.539   -38.928 1.00 0.00 ? 202 PHE B CZ  1  
ATOM 5017   N N   . ASP B 2 203 ? 57.647  6.522   -42.474 1.00 0.00 ? 203 ASP B N   1  
ATOM 5018   C CA  . ASP B 2 203 ? 58.925  7.063   -42.655 1.00 0.00 ? 203 ASP B CA  1  
ATOM 5019   C C   . ASP B 2 203 ? 59.347  7.400   -41.244 1.00 0.00 ? 203 ASP B C   1  
ATOM 5020   O O   . ASP B 2 203 ? 60.175  6.734   -40.637 1.00 0.00 ? 203 ASP B O   1  
ATOM 5021   C CB  . ASP B 2 203 ? 58.993  8.407   -43.444 1.00 0.00 ? 203 ASP B CB  1  
ATOM 5022   C CG  . ASP B 2 203 ? 58.886  8.305   -44.985 1.00 0.00 ? 203 ASP B CG  1  
ATOM 5023   O OD1 . ASP B 2 203 ? 58.599  7.236   -45.540 1.00 0.00 ? 203 ASP B OD1 1  
ATOM 5024   O OD2 . ASP B 2 203 ? 59.164  9.344   -45.628 1.00 0.00 ? 203 ASP B OD2 1  
ATOM 5025   N N   . HIS B 2 204 ? 58.792  8.473   -40.570 1.00 0.00 ? 204 HIS B N   1  
ATOM 5026   C CA  . HIS B 2 204 ? 59.094  8.833   -39.207 1.00 0.00 ? 204 HIS B CA  1  
ATOM 5027   C C   . HIS B 2 204 ? 58.018  9.855   -38.750 1.00 0.00 ? 204 HIS B C   1  
ATOM 5028   O O   . HIS B 2 204 ? 58.080  10.044  -37.543 1.00 0.00 ? 204 HIS B O   1  
ATOM 5029   C CB  . HIS B 2 204 ? 60.505  9.445   -39.025 1.00 0.00 ? 204 HIS B CB  1  
ATOM 5030   C CG  . HIS B 2 204 ? 60.853  9.959   -37.628 1.00 0.00 ? 204 HIS B CG  1  
ATOM 5031   N ND1 . HIS B 2 204 ? 60.951  9.155   -36.534 1.00 0.00 ? 204 HIS B ND1 1  
ATOM 5032   C CD2 . HIS B 2 204 ? 61.197  11.251  -37.236 1.00 0.00 ? 204 HIS B CD2 1  
ATOM 5033   C CE1 . HIS B 2 204 ? 61.473  9.900   -35.509 1.00 0.00 ? 204 HIS B CE1 1  
ATOM 5034   N NE2 . HIS B 2 204 ? 61.590  11.208  -35.885 1.00 0.00 ? 204 HIS B NE2 1  
ATOM 5035   N N   . GLU B 2 205 ? 57.101  10.462  -39.581 1.00 0.00 ? 205 GLU B N   1  
ATOM 5036   C CA  . GLU B 2 205 ? 56.179  11.488  -39.117 1.00 0.00 ? 205 GLU B CA  1  
ATOM 5037   C C   . GLU B 2 205 ? 54.953  11.578  -39.985 1.00 0.00 ? 205 GLU B C   1  
ATOM 5038   O O   . GLU B 2 205 ? 53.970  12.140  -39.537 1.00 0.00 ? 205 GLU B O   1  
ATOM 5039   C CB  . GLU B 2 205 ? 56.929  12.854  -39.132 1.00 0.00 ? 205 GLU B CB  1  
ATOM 5040   C CG  . GLU B 2 205 ? 57.976  13.012  -37.956 1.00 0.00 ? 205 GLU B CG  1  
ATOM 5041   C CD  . GLU B 2 205 ? 57.310  13.158  -36.587 1.00 0.00 ? 205 GLU B CD  1  
ATOM 5042   O OE1 . GLU B 2 205 ? 56.399  14.041  -36.436 1.00 0.00 ? 205 GLU B OE1 1  
ATOM 5043   O OE2 . GLU B 2 205 ? 57.728  12.431  -35.665 1.00 0.00 ? 205 GLU B OE2 1  
ATOM 5044   N N   . GLN B 2 206 ? 54.983  11.021  -41.269 1.00 0.00 ? 206 GLN B N   1  
ATOM 5045   C CA  . GLN B 2 206 ? 53.899  11.105  -42.124 1.00 0.00 ? 206 GLN B CA  1  
ATOM 5046   C C   . GLN B 2 206 ? 53.950  10.127  -43.244 1.00 0.00 ? 206 GLN B C   1  
ATOM 5047   O O   . GLN B 2 206 ? 55.056  9.676   -43.623 1.00 0.00 ? 206 GLN B O   1  
ATOM 5048   C CB  . GLN B 2 206 ? 53.649  12.534  -42.703 1.00 0.00 ? 206 GLN B CB  1  
ATOM 5049   C CG  . GLN B 2 206 ? 54.888  13.179  -43.438 1.00 0.00 ? 206 GLN B CG  1  
ATOM 5050   C CD  . GLN B 2 206 ? 54.717  14.708  -43.501 1.00 0.00 ? 206 GLN B CD  1  
ATOM 5051   O OE1 . GLN B 2 206 ? 54.433  15.226  -44.574 1.00 0.00 ? 206 GLN B OE1 1  
ATOM 5052   N NE2 . GLN B 2 206 ? 55.033  15.407  -42.357 1.00 0.00 ? 206 GLN B NE2 1  
ATOM 5053   N N   . ILE B 2 207 ? 52.706  10.001  -43.764 1.00 0.00 ? 207 ILE B N   1  
ATOM 5054   C CA  . ILE B 2 207 ? 52.289  9.343   -44.990 1.00 0.00 ? 207 ILE B CA  1  
ATOM 5055   C C   . ILE B 2 207 ? 52.978  9.909   -46.209 1.00 0.00 ? 207 ILE B C   1  
ATOM 5056   O O   . ILE B 2 207 ? 53.389  11.061  -46.154 1.00 0.00 ? 207 ILE B O   1  
ATOM 5057   C CB  . ILE B 2 207 ? 50.813  9.285   -45.176 1.00 0.00 ? 207 ILE B CB  1  
ATOM 5058   C CG1 . ILE B 2 207 ? 50.210  10.684  -45.492 1.00 0.00 ? 207 ILE B CG1 1  
ATOM 5059   C CG2 . ILE B 2 207 ? 50.202  8.642   -43.868 1.00 0.00 ? 207 ILE B CG2 1  
ATOM 5060   C CD1 . ILE B 2 207 ? 48.685  10.679  -45.693 1.00 0.00 ? 207 ILE B CD1 1  
ATOM 5061   N N   . GLN B 2 208 ? 53.214  9.053   -47.223 1.00 0.00 ? 208 GLN B N   1  
ATOM 5062   C CA  . GLN B 2 208 ? 53.997  9.463   -48.358 1.00 0.00 ? 208 GLN B CA  1  
ATOM 5063   C C   . GLN B 2 208 ? 53.208  8.757   -49.490 1.00 0.00 ? 208 GLN B C   1  
ATOM 5064   O O   . GLN B 2 208 ? 53.751  8.251   -50.442 1.00 0.00 ? 208 GLN B O   1  
ATOM 5065   C CB  . GLN B 2 208 ? 55.460  8.984   -48.331 1.00 0.00 ? 208 GLN B CB  1  
ATOM 5066   C CG  . GLN B 2 208 ? 56.456  9.637   -47.306 1.00 0.00 ? 208 GLN B CG  1  
ATOM 5067   C CD  . GLN B 2 208 ? 56.614  11.043  -47.775 1.00 0.00 ? 208 GLN B CD  1  
ATOM 5068   O OE1 . GLN B 2 208 ? 56.252  11.469  -48.845 1.00 0.00 ? 208 GLN B OE1 1  
ATOM 5069   N NE2 . GLN B 2 208 ? 57.041  11.899  -46.805 1.00 0.00 ? 208 GLN B NE2 1  
ATOM 5070   N N   . ILE B 2 209 ? 51.889  8.571   -49.269 1.00 0.00 ? 209 ILE B N   1  
ATOM 5071   C CA  . ILE B 2 209 ? 50.930  7.853   -50.032 1.00 0.00 ? 209 ILE B CA  1  
ATOM 5072   C C   . ILE B 2 209 ? 50.687  8.593   -51.376 1.00 0.00 ? 209 ILE B C   1  
ATOM 5073   O O   . ILE B 2 209 ? 50.401  9.809   -51.382 1.00 0.00 ? 209 ILE B O   1  
ATOM 5074   C CB  . ILE B 2 209 ? 49.629  7.616   -49.221 1.00 0.00 ? 209 ILE B CB  1  
ATOM 5075   C CG1 . ILE B 2 209 ? 48.667  6.540   -49.659 1.00 0.00 ? 209 ILE B CG1 1  
ATOM 5076   C CG2 . ILE B 2 209 ? 48.918  9.009   -49.039 1.00 0.00 ? 209 ILE B CG2 1  
ATOM 5077   C CD1 . ILE B 2 209 ? 47.420  6.412   -48.768 1.00 0.00 ? 209 ILE B CD1 1  
ATOM 5078   N N   . PRO B 2 210 ? 50.922  8.036   -52.562 1.00 0.00 ? 210 PRO B N   1  
ATOM 5079   C CA  . PRO B 2 210 ? 50.779  8.754   -53.917 1.00 0.00 ? 210 PRO B CA  1  
ATOM 5080   C C   . PRO B 2 210 ? 49.367  9.038   -54.162 1.00 0.00 ? 210 PRO B C   1  
ATOM 5081   O O   . PRO B 2 210 ? 48.438  8.599   -53.486 1.00 0.00 ? 210 PRO B O   1  
ATOM 5082   C CB  . PRO B 2 210 ? 51.220  7.734   -54.915 1.00 0.00 ? 210 PRO B CB  1  
ATOM 5083   C CG  . PRO B 2 210 ? 52.340  6.991   -54.165 1.00 0.00 ? 210 PRO B CG  1  
ATOM 5084   C CD  . PRO B 2 210 ? 51.832  6.876   -52.764 1.00 0.00 ? 210 PRO B CD  1  
ATOM 5085   N N   . SER B 2 211 ? 49.186  9.815   -55.283 1.00 0.00 ? 211 SER B N   1  
ATOM 5086   C CA  . SER B 2 211 ? 47.948  10.115  -55.852 1.00 0.00 ? 211 SER B CA  1  
ATOM 5087   C C   . SER B 2 211 ? 47.454  8.889   -56.577 1.00 0.00 ? 211 SER B C   1  
ATOM 5088   O O   . SER B 2 211 ? 48.198  8.322   -57.360 1.00 0.00 ? 211 SER B O   1  
ATOM 5089   C CB  . SER B 2 211 ? 48.028  11.339  -56.751 1.00 0.00 ? 211 SER B CB  1  
ATOM 5090   O OG  . SER B 2 211 ? 46.736  11.855  -56.896 1.00 0.00 ? 211 SER B OG  1  
ATOM 5091   N N   . LYS B 2 212 ? 46.226  8.433   -56.237 1.00 0.00 ? 212 LYS B N   1  
ATOM 5092   C CA  . LYS B 2 212 ? 45.703  7.107   -56.595 1.00 0.00 ? 212 LYS B CA  1  
ATOM 5093   C C   . LYS B 2 212 ? 44.532  6.880   -55.701 1.00 0.00 ? 212 LYS B C   1  
ATOM 5094   O O   . LYS B 2 212 ? 43.970  5.780   -55.775 1.00 0.00 ? 212 LYS B O   1  
ATOM 5095   C CB  . LYS B 2 212 ? 46.681  5.944   -56.525 1.00 0.00 ? 212 LYS B CB  1  
ATOM 5096   C CG  . LYS B 2 212 ? 47.242  5.686   -55.064 1.00 0.00 ? 212 LYS B CG  1  
ATOM 5097   C CD  . LYS B 2 212 ? 47.847  4.236   -54.868 1.00 0.00 ? 212 LYS B CD  1  
ATOM 5098   C CE  . LYS B 2 212 ? 48.726  4.203   -53.579 1.00 0.00 ? 212 LYS B CE  1  
ATOM 5099   N NZ  . LYS B 2 212 ? 47.894  4.335   -52.344 1.00 0.00 ? 212 LYS B NZ  1  
ATOM 5100   N N   . ILE B 2 213 ? 44.230  7.861   -54.819 1.00 0.00 ? 213 ILE B N   1  
ATOM 5101   C CA  . ILE B 2 213 ? 43.228  7.749   -53.724 1.00 0.00 ? 213 ILE B CA  1  
ATOM 5102   C C   . ILE B 2 213 ? 42.751  9.189   -53.564 1.00 0.00 ? 213 ILE B C   1  
ATOM 5103   O O   . ILE B 2 213 ? 43.467  10.075  -53.990 1.00 0.00 ? 213 ILE B O   1  
ATOM 5104   C CB  . ILE B 2 213 ? 43.723  7.326   -52.365 1.00 0.00 ? 213 ILE B CB  1  
ATOM 5105   C CG1 . ILE B 2 213 ? 45.080  7.976   -52.003 1.00 0.00 ? 213 ILE B CG1 1  
ATOM 5106   C CG2 . ILE B 2 213 ? 43.704  5.807   -52.275 1.00 0.00 ? 213 ILE B CG2 1  
ATOM 5107   C CD1 . ILE B 2 213 ? 45.622  7.570   -50.622 1.00 0.00 ? 213 ILE B CD1 1  
ATOM 5108   N N   . PRO B 2 214 ? 41.598  9.455   -53.019 1.00 0.00 ? 214 PRO B N   1  
ATOM 5109   C CA  . PRO B 2 214 ? 41.000  10.787  -52.899 1.00 0.00 ? 214 PRO B CA  1  
ATOM 5110   C C   . PRO B 2 214 ? 41.807  11.720  -52.129 1.00 0.00 ? 214 PRO B C   1  
ATOM 5111   O O   . PRO B 2 214 ? 42.263  11.320  -51.100 1.00 0.00 ? 214 PRO B O   1  
ATOM 5112   C CB  . PRO B 2 214 ? 39.617  10.579  -52.299 1.00 0.00 ? 214 PRO B CB  1  
ATOM 5113   C CG  . PRO B 2 214 ? 39.243  9.095   -52.579 1.00 0.00 ? 214 PRO B CG  1  
ATOM 5114   C CD  . PRO B 2 214 ? 40.619  8.441   -52.660 1.00 0.00 ? 214 PRO B CD  1  
ATOM 5115   N N   . ASN B 2 215 ? 42.003  13.029  -52.726 1.00 0.00 ? 215 ASN B N   1  
ATOM 5116   C CA  . ASN B 2 215 ? 42.952  14.088  -52.223 1.00 0.00 ? 215 ASN B CA  1  
ATOM 5117   C C   . ASN B 2 215 ? 42.570  14.453  -50.823 1.00 0.00 ? 215 ASN B C   1  
ATOM 5118   O O   . ASN B 2 215 ? 43.367  14.578  -49.874 1.00 0.00 ? 215 ASN B O   1  
ATOM 5119   C CB  . ASN B 2 215 ? 43.005  15.323  -53.140 1.00 0.00 ? 215 ASN B CB  1  
ATOM 5120   C CG  . ASN B 2 215 ? 43.060  14.955  -54.603 1.00 0.00 ? 215 ASN B CG  1  
ATOM 5121   O OD1 . ASN B 2 215 ? 42.290  15.508  -55.421 1.00 0.00 ? 215 ASN B OD1 1  
ATOM 5122   N ND2 . ASN B 2 215 ? 44.023  14.051  -54.914 1.00 0.00 ? 215 ASN B ND2 1  
ATOM 5123   N N   . PHE B 2 216 ? 41.206  14.590  -50.730 1.00 0.00 ? 216 PHE B N   1  
ATOM 5124   C CA  . PHE B 2 216 ? 40.470  15.087  -49.673 1.00 0.00 ? 216 PHE B CA  1  
ATOM 5125   C C   . PHE B 2 216 ? 40.752  14.219  -48.450 1.00 0.00 ? 216 PHE B C   1  
ATOM 5126   O O   . PHE B 2 216 ? 41.135  14.710  -47.388 1.00 0.00 ? 216 PHE B O   1  
ATOM 5127   C CB  . PHE B 2 216 ? 38.946  14.983  -49.930 1.00 0.00 ? 216 PHE B CB  1  
ATOM 5128   C CG  . PHE B 2 216 ? 38.734  15.480  -51.355 1.00 0.00 ? 216 PHE B CG  1  
ATOM 5129   C CD1 . PHE B 2 216 ? 39.148  16.771  -51.768 1.00 0.00 ? 216 PHE B CD1 1  
ATOM 5130   C CD2 . PHE B 2 216 ? 38.272  14.604  -52.329 1.00 0.00 ? 216 PHE B CD2 1  
ATOM 5131   C CE1 . PHE B 2 216 ? 38.994  17.129  -53.108 1.00 0.00 ? 216 PHE B CE1 1  
ATOM 5132   C CE2 . PHE B 2 216 ? 37.975  14.957  -53.602 1.00 0.00 ? 216 PHE B CE2 1  
ATOM 5133   C CZ  . PHE B 2 216 ? 38.366  16.228  -54.021 1.00 0.00 ? 216 PHE B CZ  1  
ATOM 5134   N N   . GLU B 2 217 ? 40.627  12.814  -48.616 1.00 0.00 ? 217 GLU B N   1  
ATOM 5135   C CA  . GLU B 2 217 ? 40.840  11.759  -47.612 1.00 0.00 ? 217 GLU B CA  1  
ATOM 5136   C C   . GLU B 2 217 ? 42.303  11.715  -47.339 1.00 0.00 ? 217 GLU B C   1  
ATOM 5137   O O   . GLU B 2 217 ? 42.627  11.466  -46.152 1.00 0.00 ? 217 GLU B O   1  
ATOM 5138   C CB  . GLU B 2 217 ? 40.255  10.396  -48.162 1.00 0.00 ? 217 GLU B CB  1  
ATOM 5139   C CG  . GLU B 2 217 ? 40.568  9.079   -47.321 1.00 0.00 ? 217 GLU B CG  1  
ATOM 5140   C CD  . GLU B 2 217 ? 40.199  7.885   -48.134 1.00 0.00 ? 217 GLU B CD  1  
ATOM 5141   O OE1 . GLU B 2 217 ? 39.057  7.764   -48.724 1.00 0.00 ? 217 GLU B OE1 1  
ATOM 5142   O OE2 . GLU B 2 217 ? 41.083  7.019   -48.232 1.00 0.00 ? 217 GLU B OE2 1  
ATOM 5143   N N   . SER B 2 218 ? 43.233  11.941  -48.311 1.00 0.00 ? 218 SER B N   1  
ATOM 5144   C CA  . SER B 2 218 ? 44.666  11.827  -48.072 1.00 0.00 ? 218 SER B CA  1  
ATOM 5145   C C   . SER B 2 218 ? 45.102  12.873  -47.049 1.00 0.00 ? 218 SER B C   1  
ATOM 5146   O O   . SER B 2 218 ? 45.825  12.529  -46.165 1.00 0.00 ? 218 SER B O   1  
ATOM 5147   C CB  . SER B 2 218 ? 45.495  12.011  -49.330 1.00 0.00 ? 218 SER B CB  1  
ATOM 5148   O OG  . SER B 2 218 ? 46.936  11.845  -49.192 1.00 0.00 ? 218 SER B OG  1  
ATOM 5149   N N   . GLY B 2 219 ? 44.546  14.085  -47.162 1.00 0.00 ? 219 GLY B N   1  
ATOM 5150   C CA  . GLY B 2 219 ? 44.867  15.198  -46.289 1.00 0.00 ? 219 GLY B CA  1  
ATOM 5151   C C   . GLY B 2 219 ? 44.493  14.926  -44.863 1.00 0.00 ? 219 GLY B C   1  
ATOM 5152   O O   . GLY B 2 219 ? 45.213  15.276  -43.932 1.00 0.00 ? 219 GLY B O   1  
ATOM 5153   N N   . LEU B 2 220 ? 43.340  14.361  -44.684 1.00 0.00 ? 220 LEU B N   1  
ATOM 5154   C CA  . LEU B 2 220 ? 42.750  14.015  -43.433 1.00 0.00 ? 220 LEU B CA  1  
ATOM 5155   C C   . LEU B 2 220 ? 43.558  12.928  -42.731 1.00 0.00 ? 220 LEU B C   1  
ATOM 5156   O O   . LEU B 2 220 ? 43.896  12.920  -41.537 1.00 0.00 ? 220 LEU B O   1  
ATOM 5157   C CB  . LEU B 2 220 ? 41.332  13.561  -43.547 1.00 0.00 ? 220 LEU B CB  1  
ATOM 5158   C CG  . LEU B 2 220 ? 40.405  14.677  -44.086 1.00 0.00 ? 220 LEU B CG  1  
ATOM 5159   C CD1 . LEU B 2 220 ? 38.934  14.253  -44.127 1.00 0.00 ? 220 LEU B CD1 1  
ATOM 5160   C CD2 . LEU B 2 220 ? 40.489  16.006  -43.341 1.00 0.00 ? 220 LEU B CD2 1  
ATOM 5161   N N   . LEU B 2 221 ? 43.992  11.960  -43.593 1.00 0.00 ? 221 LEU B N   1  
ATOM 5162   C CA  . LEU B 2 221 ? 44.867  10.886  -43.353 1.00 0.00 ? 221 LEU B CA  1  
ATOM 5163   C C   . LEU B 2 221 ? 46.272  11.359  -42.908 1.00 0.00 ? 221 LEU B C   1  
ATOM 5164   O O   . LEU B 2 221 ? 46.889  10.691  -42.080 1.00 0.00 ? 221 LEU B O   1  
ATOM 5165   C CB  . LEU B 2 221 ? 44.780  9.938   -44.600 1.00 0.00 ? 221 LEU B CB  1  
ATOM 5166   C CG  . LEU B 2 221 ? 45.855  8.851   -44.687 1.00 0.00 ? 221 LEU B CG  1  
ATOM 5167   C CD1 . LEU B 2 221 ? 45.501  7.730   -43.706 1.00 0.00 ? 221 LEU B CD1 1  
ATOM 5168   C CD2 . LEU B 2 221 ? 45.970  8.274   -46.114 1.00 0.00 ? 221 LEU B CD2 1  
ATOM 5169   N N   . HIS B 2 222 ? 46.753  12.546  -43.438 1.00 0.00 ? 222 HIS B N   1  
ATOM 5170   C CA  . HIS B 2 222 ? 48.011  13.156  -43.042 1.00 0.00 ? 222 HIS B CA  1  
ATOM 5171   C C   . HIS B 2 222 ? 48.046  13.556  -41.607 1.00 0.00 ? 222 HIS B C   1  
ATOM 5172   O O   . HIS B 2 222 ? 48.970  13.198  -40.870 1.00 0.00 ? 222 HIS B O   1  
ATOM 5173   C CB  . HIS B 2 222 ? 48.374  14.311  -44.032 1.00 0.00 ? 222 HIS B CB  1  
ATOM 5174   C CG  . HIS B 2 222 ? 49.632  15.060  -43.690 1.00 0.00 ? 222 HIS B CG  1  
ATOM 5175   N ND1 . HIS B 2 222 ? 49.591  16.143  -42.829 1.00 0.00 ? 222 HIS B ND1 1  
ATOM 5176   C CD2 . HIS B 2 222 ? 50.805  15.137  -44.363 1.00 0.00 ? 222 HIS B CD2 1  
ATOM 5177   C CE1 . HIS B 2 222 ? 50.735  16.855  -43.076 1.00 0.00 ? 222 HIS B CE1 1  
ATOM 5178   N NE2 . HIS B 2 222 ? 51.515  16.225  -43.937 1.00 0.00 ? 222 HIS B NE2 1  
ATOM 5179   N N   . LEU B 2 223 ? 46.899  14.212  -41.253 1.00 0.00 ? 223 LEU B N   1  
ATOM 5180   C CA  . LEU B 2 223 ? 46.714  14.619  -39.852 1.00 0.00 ? 223 LEU B CA  1  
ATOM 5181   C C   . LEU B 2 223 ? 46.616  13.464  -38.924 1.00 0.00 ? 223 LEU B C   1  
ATOM 5182   O O   . LEU B 2 223 ? 47.220  13.454  -37.807 1.00 0.00 ? 223 LEU B O   1  
ATOM 5183   C CB  . LEU B 2 223 ? 45.472  15.495  -39.638 1.00 0.00 ? 223 LEU B CB  1  
ATOM 5184   C CG  . LEU B 2 223 ? 45.492  16.789  -40.373 1.00 0.00 ? 223 LEU B CG  1  
ATOM 5185   C CD1 . LEU B 2 223 ? 44.109  17.341  -40.904 1.00 0.00 ? 223 LEU B CD1 1  
ATOM 5186   C CD2 . LEU B 2 223 ? 46.169  18.014  -39.642 1.00 0.00 ? 223 LEU B CD2 1  
ATOM 5187   N N   . ILE B 2 224 ? 45.896  12.377  -39.336 1.00 0.00 ? 224 ILE B N   1  
ATOM 5188   C CA  . ILE B 2 224 ? 45.795  11.242  -38.377 1.00 0.00 ? 224 ILE B CA  1  
ATOM 5189   C C   . ILE B 2 224 ? 47.144  10.586  -37.998 1.00 0.00 ? 224 ILE B C   1  
ATOM 5190   O O   . ILE B 2 224 ? 47.354  10.104  -36.861 1.00 0.00 ? 224 ILE B O   1  
ATOM 5191   C CB  . ILE B 2 224 ? 44.821  10.155  -38.924 1.00 0.00 ? 224 ILE B CB  1  
ATOM 5192   C CG1 . ILE B 2 224 ? 43.404  10.642  -38.991 1.00 0.00 ? 224 ILE B CG1 1  
ATOM 5193   C CG2 . ILE B 2 224 ? 44.939  8.901   -38.083 1.00 0.00 ? 224 ILE B CG2 1  
ATOM 5194   C CD1 . ILE B 2 224 ? 42.407  9.600   -39.526 1.00 0.00 ? 224 ILE B CD1 1  
ATOM 5195   N N   . PHE B 2 225 ? 48.010  10.480  -38.990 1.00 0.00 ? 225 PHE B N   1  
ATOM 5196   C CA  . PHE B 2 225 ? 49.244  9.761   -38.827 1.00 0.00 ? 225 PHE B CA  1  
ATOM 5197   C C   . PHE B 2 225 ? 50.114  10.452  -37.798 1.00 0.00 ? 225 PHE B C   1  
ATOM 5198   O O   . PHE B 2 225 ? 50.788  9.724   -37.082 1.00 0.00 ? 225 PHE B O   1  
ATOM 5199   C CB  . PHE B 2 225 ? 49.953  9.754   -40.167 1.00 0.00 ? 225 PHE B CB  1  
ATOM 5200   C CG  . PHE B 2 225 ? 50.843  8.533   -40.334 1.00 0.00 ? 225 PHE B CG  1  
ATOM 5201   C CD1 . PHE B 2 225 ? 50.329  7.292   -40.866 1.00 0.00 ? 225 PHE B CD1 1  
ATOM 5202   C CD2 . PHE B 2 225 ? 52.193  8.571   -40.008 1.00 0.00 ? 225 PHE B CD2 1  
ATOM 5203   C CE1 . PHE B 2 225 ? 51.162  6.216   -41.117 1.00 0.00 ? 225 PHE B CE1 1  
ATOM 5204   C CE2 . PHE B 2 225 ? 53.046  7.527   -40.380 1.00 0.00 ? 225 PHE B CE2 1  
ATOM 5205   C CZ  . PHE B 2 225 ? 52.522  6.332   -40.892 1.00 0.00 ? 225 PHE B CZ  1  
ATOM 5206   N N   . GLU B 2 226 ? 50.133  11.805  -37.742 1.00 0.00 ? 226 GLU B N   1  
ATOM 5207   C CA  . GLU B 2 226 ? 50.976  12.622  -36.784 1.00 0.00 ? 226 GLU B CA  1  
ATOM 5208   C C   . GLU B 2 226 ? 50.656  12.301  -35.421 1.00 0.00 ? 226 GLU B C   1  
ATOM 5209   O O   . GLU B 2 226 ? 51.507  11.882  -34.643 1.00 0.00 ? 226 GLU B O   1  
ATOM 5210   C CB  . GLU B 2 226 ? 50.783  14.132  -36.959 1.00 0.00 ? 226 GLU B CB  1  
ATOM 5211   C CG  . GLU B 2 226 ? 51.514  15.145  -36.072 1.00 0.00 ? 226 GLU B CG  1  
ATOM 5212   C CD  . GLU B 2 226 ? 53.051  15.085  -36.397 1.00 0.00 ? 226 GLU B CD  1  
ATOM 5213   O OE1 . GLU B 2 226 ? 53.382  14.789  -37.546 1.00 0.00 ? 226 GLU B OE1 1  
ATOM 5214   O OE2 . GLU B 2 226 ? 53.800  15.305  -35.428 1.00 0.00 ? 226 GLU B OE2 1  
ATOM 5215   N N   . ALA B 2 227 ? 49.294  12.262  -35.083 1.00 0.00 ? 227 ALA B N   1  
ATOM 5216   C CA  . ALA B 2 227 ? 48.851  11.841  -33.812 1.00 0.00 ? 227 ALA B CA  1  
ATOM 5217   C C   . ALA B 2 227 ? 49.166  10.427  -33.388 1.00 0.00 ? 227 ALA B C   1  
ATOM 5218   O O   . ALA B 2 227 ? 49.591  10.190  -32.314 1.00 0.00 ? 227 ALA B O   1  
ATOM 5219   C CB  . ALA B 2 227 ? 47.390  12.006  -33.664 1.00 0.00 ? 227 ALA B CB  1  
ATOM 5220   N N   . GLY B 2 228 ? 48.954  9.553   -34.423 1.00 0.00 ? 228 GLY B N   1  
ATOM 5221   C CA  . GLY B 2 228 ? 49.120  8.046   -34.203 1.00 0.00 ? 228 GLY B CA  1  
ATOM 5222   C C   . GLY B 2 228 ? 50.493  7.665   -33.991 1.00 0.00 ? 228 GLY B C   1  
ATOM 5223   O O   . GLY B 2 228 ? 50.669  6.776   -33.171 1.00 0.00 ? 228 GLY B O   1  
ATOM 5224   N N   . LEU B 2 229 ? 51.506  8.412   -34.735 1.00 0.00 ? 229 LEU B N   1  
ATOM 5225   C CA  . LEU B 2 229 ? 53.001  8.275   -34.740 1.00 0.00 ? 229 LEU B CA  1  
ATOM 5226   C C   . LEU B 2 229 ? 53.428  8.633   -33.335 1.00 0.00 ? 229 LEU B C   1  
ATOM 5227   O O   . LEU B 2 229 ? 54.329  7.967   -32.781 1.00 0.00 ? 229 LEU B O   1  
ATOM 5228   C CB  . LEU B 2 229 ? 53.658  9.216   -35.807 1.00 0.00 ? 229 LEU B CB  1  
ATOM 5229   C CG  . LEU B 2 229 ? 55.252  9.053   -35.904 1.00 0.00 ? 229 LEU B CG  1  
ATOM 5230   C CD1 . LEU B 2 229 ? 56.135  9.787   -34.846 1.00 0.00 ? 229 LEU B CD1 1  
ATOM 5231   C CD2 . LEU B 2 229 ? 55.764  7.645   -36.162 1.00 0.00 ? 229 LEU B CD2 1  
ATOM 5232   N N   . LEU B 2 230 ? 52.884  9.702   -32.725 1.00 0.00 ? 230 LEU B N   1  
ATOM 5233   C CA  . LEU B 2 230 ? 53.324  10.215  -31.440 1.00 0.00 ? 230 LEU B CA  1  
ATOM 5234   C C   . LEU B 2 230 ? 53.098  9.201   -30.356 1.00 0.00 ? 230 LEU B C   1  
ATOM 5235   O O   . LEU B 2 230 ? 54.047  8.875   -29.681 1.00 0.00 ? 230 LEU B O   1  
ATOM 5236   C CB  . LEU B 2 230 ? 52.499  11.480  -31.002 1.00 0.00 ? 230 LEU B CB  1  
ATOM 5237   C CG  . LEU B 2 230 ? 53.124  12.761  -31.545 1.00 0.00 ? 230 LEU B CG  1  
ATOM 5238   C CD1 . LEU B 2 230 ? 52.290  13.970  -31.125 1.00 0.00 ? 230 LEU B CD1 1  
ATOM 5239   C CD2 . LEU B 2 230 ? 54.577  13.103  -31.176 1.00 0.00 ? 230 LEU B CD2 1  
ATOM 5240   N N   . TYR B 2 231 ? 51.869  8.546   -30.336 1.00 0.00 ? 231 TYR B N   1  
ATOM 5241   C CA  . TYR B 2 231 ? 51.490  7.521   -29.444 1.00 0.00 ? 231 TYR B CA  1  
ATOM 5242   C C   . TYR B 2 231 ? 52.435  6.255   -29.526 1.00 0.00 ? 231 TYR B C   1  
ATOM 5243   O O   . TYR B 2 231 ? 52.724  5.599   -28.495 1.00 0.00 ? 231 TYR B O   1  
ATOM 5244   C CB  . TYR B 2 231 ? 50.008  7.168   -29.771 1.00 0.00 ? 231 TYR B CB  1  
ATOM 5245   C CG  . TYR B 2 231 ? 49.523  6.082   -28.863 1.00 0.00 ? 231 TYR B CG  1  
ATOM 5246   C CD1 . TYR B 2 231 ? 48.968  6.457   -27.634 1.00 0.00 ? 231 TYR B CD1 1  
ATOM 5247   C CD2 . TYR B 2 231 ? 49.495  4.693   -29.202 1.00 0.00 ? 231 TYR B CD2 1  
ATOM 5248   C CE1 . TYR B 2 231 ? 48.483  5.532   -26.761 1.00 0.00 ? 231 TYR B CE1 1  
ATOM 5249   C CE2 . TYR B 2 231 ? 49.111  3.757   -28.298 1.00 0.00 ? 231 TYR B CE2 1  
ATOM 5250   C CZ  . TYR B 2 231 ? 48.547  4.217   -27.067 1.00 0.00 ? 231 TYR B CZ  1  
ATOM 5251   O OH  . TYR B 2 231 ? 48.184  3.281   -26.144 1.00 0.00 ? 231 TYR B OH  1  
ATOM 5252   N N   . GLN B 2 232 ? 52.742  5.897   -30.752 1.00 0.00 ? 232 GLN B N   1  
ATOM 5253   C CA  . GLN B 2 232 ? 53.461  4.616   -30.962 1.00 0.00 ? 232 GLN B CA  1  
ATOM 5254   C C   . GLN B 2 232 ? 54.872  4.767   -30.387 1.00 0.00 ? 232 GLN B C   1  
ATOM 5255   O O   . GLN B 2 232 ? 55.343  3.885   -29.665 1.00 0.00 ? 232 GLN B O   1  
ATOM 5256   C CB  . GLN B 2 232 ? 53.567  4.416   -32.494 1.00 0.00 ? 232 GLN B CB  1  
ATOM 5257   C CG  . GLN B 2 232 ? 52.378  3.705   -33.178 1.00 0.00 ? 232 GLN B CG  1  
ATOM 5258   C CD  . GLN B 2 232 ? 52.536  3.707   -34.767 1.00 0.00 ? 232 GLN B CD  1  
ATOM 5259   O OE1 . GLN B 2 232 ? 52.004  4.627   -35.346 1.00 0.00 ? 232 GLN B OE1 1  
ATOM 5260   N NE2 . GLN B 2 232 ? 53.288  2.714   -35.359 1.00 0.00 ? 232 GLN B NE2 1  
ATOM 5261   N N   . SER B 2 233 ? 55.443  5.998   -30.683 1.00 0.00 ? 233 SER B N   1  
ATOM 5262   C CA  . SER B 2 233 ? 56.820  6.287   -30.364 1.00 0.00 ? 233 SER B CA  1  
ATOM 5263   C C   . SER B 2 233 ? 56.957  6.264   -28.829 1.00 0.00 ? 233 SER B C   1  
ATOM 5264   O O   . SER B 2 233 ? 57.901  5.636   -28.394 1.00 0.00 ? 233 SER B O   1  
ATOM 5265   C CB  . SER B 2 233 ? 57.378  7.637   -30.840 1.00 0.00 ? 233 SER B CB  1  
ATOM 5266   O OG  . SER B 2 233 ? 57.388  7.502   -32.291 1.00 0.00 ? 233 SER B OG  1  
ATOM 5267   N N   . LEU B 2 234 ? 55.957  6.914   -28.082 1.00 0.00 ? 234 LEU B N   1  
ATOM 5268   C CA  . LEU B 2 234 ? 55.906  7.008   -26.583 1.00 0.00 ? 234 LEU B CA  1  
ATOM 5269   C C   . LEU B 2 234 ? 55.760  5.687   -25.999 1.00 0.00 ? 234 LEU B C   1  
ATOM 5270   O O   . LEU B 2 234 ? 56.484  5.354   -25.045 1.00 0.00 ? 234 LEU B O   1  
ATOM 5271   C CB  . LEU B 2 234 ? 54.873  8.006   -26.095 1.00 0.00 ? 234 LEU B CB  1  
ATOM 5272   C CG  . LEU B 2 234 ? 54.983  8.430   -24.665 1.00 0.00 ? 234 LEU B CG  1  
ATOM 5273   C CD1 . LEU B 2 234 ? 56.220  9.244   -24.368 1.00 0.00 ? 234 LEU B CD1 1  
ATOM 5274   C CD2 . LEU B 2 234 ? 53.764  9.277   -24.243 1.00 0.00 ? 234 LEU B CD2 1  
ATOM 5275   N N   . GLY B 2 235 ? 54.871  4.840   -26.596 1.00 0.00 ? 235 GLY B N   1  
ATOM 5276   C CA  . GLY B 2 235 ? 54.574  3.466   -26.151 1.00 0.00 ? 235 GLY B CA  1  
ATOM 5277   C C   . GLY B 2 235 ? 55.794  2.567   -26.196 1.00 0.00 ? 235 GLY B C   1  
ATOM 5278   O O   . GLY B 2 235 ? 56.096  1.811   -25.300 1.00 0.00 ? 235 GLY B O   1  
ATOM 5279   N N   . TYR B 2 236 ? 56.672  2.687   -27.264 1.00 0.00 ? 236 TYR B N   1  
ATOM 5280   C CA  . TYR B 2 236 ? 57.950  2.042   -27.408 1.00 0.00 ? 236 TYR B CA  1  
ATOM 5281   C C   . TYR B 2 236 ? 58.900  2.474   -26.330 1.00 0.00 ? 236 TYR B C   1  
ATOM 5282   O O   . TYR B 2 236 ? 59.573  1.675   -25.665 1.00 0.00 ? 236 TYR B O   1  
ATOM 5283   C CB  . TYR B 2 236 ? 58.757  2.325   -28.762 1.00 0.00 ? 236 TYR B CB  1  
ATOM 5284   C CG  . TYR B 2 236 ? 57.995  1.975   -29.956 1.00 0.00 ? 236 TYR B CG  1  
ATOM 5285   C CD1 . TYR B 2 236 ? 57.083  0.932   -30.008 1.00 0.00 ? 236 TYR B CD1 1  
ATOM 5286   C CD2 . TYR B 2 236 ? 58.279  2.748   -31.151 1.00 0.00 ? 236 TYR B CD2 1  
ATOM 5287   C CE1 . TYR B 2 236 ? 56.405  0.614   -31.209 1.00 0.00 ? 236 TYR B CE1 1  
ATOM 5288   C CE2 . TYR B 2 236 ? 57.577  2.440   -32.302 1.00 0.00 ? 236 TYR B CE2 1  
ATOM 5289   C CZ  . TYR B 2 236 ? 56.666  1.383   -32.384 1.00 0.00 ? 236 TYR B CZ  1  
ATOM 5290   O OH  . TYR B 2 236 ? 55.836  1.103   -33.525 1.00 0.00 ? 236 TYR B OH  1  
ATOM 5291   N N   . LYS B 2 237 ? 58.983  3.770   -25.988 1.00 0.00 ? 237 LYS B N   1  
ATOM 5292   C CA  . LYS B 2 237 ? 59.872  4.263   -24.951 1.00 0.00 ? 237 LYS B CA  1  
ATOM 5293   C C   . LYS B 2 237 ? 59.572  3.729   -23.560 1.00 0.00 ? 237 LYS B C   1  
ATOM 5294   O O   . LYS B 2 237 ? 60.471  3.262   -22.883 1.00 0.00 ? 237 LYS B O   1  
ATOM 5295   C CB  . LYS B 2 237 ? 60.032  5.831   -24.926 1.00 0.00 ? 237 LYS B CB  1  
ATOM 5296   C CG  . LYS B 2 237 ? 60.424  6.411   -26.264 1.00 0.00 ? 237 LYS B CG  1  
ATOM 5297   C CD  . LYS B 2 237 ? 60.819  7.899   -26.275 1.00 0.00 ? 237 LYS B CD  1  
ATOM 5298   C CE  . LYS B 2 237 ? 61.397  8.367   -27.666 1.00 0.00 ? 237 LYS B CE  1  
ATOM 5299   N NZ  . LYS B 2 237 ? 61.748  9.861   -27.540 1.00 0.00 ? 237 LYS B NZ  1  
ATOM 5300   N N   . VAL B 2 238 ? 58.276  3.736   -23.144 1.00 0.00 ? 238 VAL B N   1  
ATOM 5301   C CA  . VAL B 2 238 ? 57.834  3.314   -21.856 1.00 0.00 ? 238 VAL B CA  1  
ATOM 5302   C C   . VAL B 2 238 ? 58.156  1.831   -21.634 1.00 0.00 ? 238 VAL B C   1  
ATOM 5303   O O   . VAL B 2 238 ? 58.635  1.415   -20.620 1.00 0.00 ? 238 VAL B O   1  
ATOM 5304   C CB  . VAL B 2 238 ? 56.447  3.602   -21.306 1.00 0.00 ? 238 VAL B CB  1  
ATOM 5305   C CG1 . VAL B 2 238 ? 56.331  5.106   -21.047 1.00 0.00 ? 238 VAL B CG1 1  
ATOM 5306   C CG2 . VAL B 2 238 ? 55.333  3.065   -22.239 1.00 0.00 ? 238 VAL B CG2 1  
ATOM 5307   N N   . GLU B 2 239 ? 57.894  1.007   -22.691 1.00 0.00 ? 239 GLU B N   1  
ATOM 5308   C CA  . GLU B 2 239 ? 58.117  -0.468  -22.735 1.00 0.00 ? 239 GLU B CA  1  
ATOM 5309   C C   . GLU B 2 239 ? 59.555  -0.881  -22.612 1.00 0.00 ? 239 GLU B C   1  
ATOM 5310   O O   . GLU B 2 239 ? 59.974  -1.770  -21.827 1.00 0.00 ? 239 GLU B O   1  
ATOM 5311   C CB  . GLU B 2 239 ? 57.495  -1.096  -24.006 1.00 0.00 ? 239 GLU B CB  1  
ATOM 5312   C CG  . GLU B 2 239 ? 57.397  -2.674  -24.049 1.00 0.00 ? 239 GLU B CG  1  
ATOM 5313   C CD  . GLU B 2 239 ? 56.664  -3.253  -22.831 1.00 0.00 ? 239 GLU B CD  1  
ATOM 5314   O OE1 . GLU B 2 239 ? 57.353  -3.439  -21.784 1.00 0.00 ? 239 GLU B OE1 1  
ATOM 5315   O OE2 . GLU B 2 239 ? 55.418  -3.593  -22.913 1.00 0.00 ? 239 GLU B OE2 1  
ATOM 5316   N N   . LYS B 2 240 ? 60.413  -0.176  -23.292 1.00 0.00 ? 240 LYS B N   1  
ATOM 5317   C CA  . LYS B 2 240 ? 61.834  -0.397  -23.235 1.00 0.00 ? 240 LYS B CA  1  
ATOM 5318   C C   . LYS B 2 240 ? 62.500  -0.039  -21.848 1.00 0.00 ? 240 LYS B C   1  
ATOM 5319   O O   . LYS B 2 240 ? 63.362  -0.687  -21.314 1.00 0.00 ? 240 LYS B O   1  
ATOM 5320   C CB  . LYS B 2 240 ? 62.643  0.420   -24.283 1.00 0.00 ? 240 LYS B CB  1  
ATOM 5321   C CG  . LYS B 2 240 ? 62.725  -0.360  -25.618 1.00 0.00 ? 240 LYS B CG  1  
ATOM 5322   C CD  . LYS B 2 240 ? 62.792  0.493   -26.838 1.00 0.00 ? 240 LYS B CD  1  
ATOM 5323   C CE  . LYS B 2 240 ? 64.132  1.280   -26.890 1.00 0.00 ? 240 LYS B CE  1  
ATOM 5324   N NZ  . LYS B 2 240 ? 65.333  0.487   -27.106 1.00 0.00 ? 240 LYS B NZ  1  
ATOM 5325   N N   . PHE B 2 241 ? 62.075  1.121   -21.261 1.00 0.00 ? 241 PHE B N   1  
ATOM 5326   C CA  . PHE B 2 241 ? 62.643  1.641   -20.049 1.00 0.00 ? 241 PHE B CA  1  
ATOM 5327   C C   . PHE B 2 241 ? 62.186  0.741   -18.962 1.00 0.00 ? 241 PHE B C   1  
ATOM 5328   O O   . PHE B 2 241 ? 62.919  0.547   -17.967 1.00 0.00 ? 241 PHE B O   1  
ATOM 5329   C CB  . PHE B 2 241 ? 62.254  3.050   -19.745 1.00 0.00 ? 241 PHE B CB  1  
ATOM 5330   C CG  . PHE B 2 241 ? 62.718  4.004   -20.817 1.00 0.00 ? 241 PHE B CG  1  
ATOM 5331   C CD1 . PHE B 2 241 ? 63.843  3.846   -21.645 1.00 0.00 ? 241 PHE B CD1 1  
ATOM 5332   C CD2 . PHE B 2 241 ? 62.047  5.217   -20.962 1.00 0.00 ? 241 PHE B CD2 1  
ATOM 5333   C CE1 . PHE B 2 241 ? 64.374  4.848   -22.401 1.00 0.00 ? 241 PHE B CE1 1  
ATOM 5334   C CE2 . PHE B 2 241 ? 62.505  6.275   -21.850 1.00 0.00 ? 241 PHE B CE2 1  
ATOM 5335   C CZ  . PHE B 2 241 ? 63.736  6.060   -22.511 1.00 0.00 ? 241 PHE B CZ  1  
ATOM 5336   N N   . ARG B 2 242 ? 61.030  0.059   -19.085 1.00 0.00 ? 242 ARG B N   1  
ATOM 5337   C CA  . ARG B 2 242 ? 60.512  -1.012  -18.251 1.00 0.00 ? 242 ARG B CA  1  
ATOM 5338   C C   . ARG B 2 242 ? 61.413  -2.227  -18.521 1.00 0.00 ? 242 ARG B C   1  
ATOM 5339   O O   . ARG B 2 242 ? 61.400  -2.844  -19.573 1.00 0.00 ? 242 ARG B O   1  
ATOM 5340   C CB  . ARG B 2 242 ? 58.986  -1.384  -18.492 1.00 0.00 ? 242 ARG B CB  1  
ATOM 5341   C CG  . ARG B 2 242 ? 58.551  -2.603  -17.641 1.00 0.00 ? 242 ARG B CG  1  
ATOM 5342   C CD  . ARG B 2 242 ? 57.028  -2.751  -17.488 1.00 0.00 ? 242 ARG B CD  1  
ATOM 5343   N NE  . ARG B 2 242 ? 56.777  -4.161  -17.113 1.00 0.00 ? 242 ARG B NE  1  
ATOM 5344   C CZ  . ARG B 2 242 ? 55.518  -4.459  -16.641 1.00 0.00 ? 242 ARG B CZ  1  
ATOM 5345   N NH1 . ARG B 2 242 ? 54.551  -3.501  -16.646 1.00 0.00 ? 242 ARG B NH1 1  
ATOM 5346   N NH2 . ARG B 2 242 ? 55.308  -5.727  -16.276 1.00 0.00 ? 242 ARG B NH2 1  
ATOM 5347   N N   . MET B 2 243 ? 62.256  -2.640  -17.521 1.00 0.00 ? 243 MET B N   1  
ATOM 5348   C CA  . MET B 2 243 ? 63.036  -3.825  -17.520 1.00 0.00 ? 243 MET B CA  1  
ATOM 5349   C C   . MET B 2 243 ? 63.542  -3.997  -16.119 1.00 0.00 ? 243 MET B C   1  
ATOM 5350   O O   . MET B 2 243 ? 64.410  -4.795  -15.806 1.00 0.00 ? 243 MET B O   1  
ATOM 5351   C CB  . MET B 2 243 ? 64.201  -3.807  -18.514 1.00 0.00 ? 243 MET B CB  1  
ATOM 5352   C CG  . MET B 2 243 ? 65.176  -2.586  -18.308 1.00 0.00 ? 243 MET B CG  1  
ATOM 5353   S SD  . MET B 2 243 ? 66.551  -2.976  -19.389 1.00 0.00 ? 243 MET B SD  1  
ATOM 5354   C CE  . MET B 2 243 ? 65.767  -2.219  -20.895 1.00 0.00 ? 243 MET B CE  1  
ATOM 5355   N N   . LEU B 2 244 ? 62.987  -3.119  -15.195 1.00 0.00 ? 244 LEU B N   1  
ATOM 5356   C CA  . LEU B 2 244 ? 63.262  -3.003  -13.750 1.00 0.00 ? 244 LEU B CA  1  
ATOM 5357   C C   . LEU B 2 244 ? 64.743  -2.714  -13.470 1.00 0.00 ? 244 LEU B C   1  
ATOM 5358   O O   . LEU B 2 244 ? 65.574  -2.567  -14.405 1.00 0.00 ? 244 LEU B O   1  
ATOM 5359   C CB  . LEU B 2 244 ? 62.828  -4.273  -12.999 1.00 0.00 ? 244 LEU B CB  1  
ATOM 5360   C CG  . LEU B 2 244 ? 61.400  -4.752  -13.255 1.00 0.00 ? 244 LEU B CG  1  
ATOM 5361   C CD1 . LEU B 2 244 ? 61.033  -6.086  -12.606 1.00 0.00 ? 244 LEU B CD1 1  
ATOM 5362   C CD2 . LEU B 2 244 ? 60.421  -3.632  -12.869 1.00 0.00 ? 244 LEU B CD2 1  
ATOM 5363   N N   . ASN B 2 245 ? 65.112  -2.619  -12.098 1.00 0.00 ? 245 ASN B N   1  
ATOM 5364   C CA  . ASN B 2 245 ? 66.480  -2.520  -11.597 1.00 0.00 ? 245 ASN B CA  1  
ATOM 5365   C C   . ASN B 2 245 ? 67.043  -1.256  -12.195 1.00 0.00 ? 245 ASN B C   1  
ATOM 5366   O O   . ASN B 2 245 ? 68.020  -1.237  -12.941 1.00 0.00 ? 245 ASN B O   1  
ATOM 5367   C CB  . ASN B 2 245 ? 67.513  -3.612  -11.835 1.00 0.00 ? 245 ASN B CB  1  
ATOM 5368   C CG  . ASN B 2 245 ? 67.212  -4.932  -11.138 1.00 0.00 ? 245 ASN B CG  1  
ATOM 5369   O OD1 . ASN B 2 245 ? 67.905  -5.517  -10.325 1.00 0.00 ? 245 ASN B OD1 1  
ATOM 5370   N ND2 . ASN B 2 245 ? 66.102  -5.468  -11.703 1.00 0.00 ? 245 ASN B ND2 1  
ATOM 5371   N N   . ILE B 2 246 ? 66.362  -0.095  -11.776 1.00 0.00 ? 246 ILE B N   1  
ATOM 5372   C CA  . ILE B 2 246 ? 66.610  1.282   -12.189 1.00 0.00 ? 246 ILE B CA  1  
ATOM 5373   C C   . ILE B 2 246 ? 66.243  2.053   -10.888 1.00 0.00 ? 246 ILE B C   1  
ATOM 5374   O O   . ILE B 2 246 ? 65.991  1.491   -9.860  1.00 0.00 ? 246 ILE B O   1  
ATOM 5375   C CB  . ILE B 2 246 ? 65.698  1.848   -13.323 1.00 0.00 ? 246 ILE B CB  1  
ATOM 5376   C CG1 . ILE B 2 246 ? 64.319  1.201   -13.324 1.00 0.00 ? 246 ILE B CG1 1  
ATOM 5377   C CG2 . ILE B 2 246 ? 66.466  1.748   -14.671 1.00 0.00 ? 246 ILE B CG2 1  
ATOM 5378   C CD1 . ILE B 2 246 ? 63.381  1.725   -14.424 1.00 0.00 ? 246 ILE B CD1 1  
ATOM 5379   N N   . SER B 2 247 ? 66.252  3.390   -11.078 1.00 0.00 ? 247 SER B N   1  
ATOM 5380   C CA  . SER B 2 247 ? 65.711  4.257   -10.138 1.00 0.00 ? 247 SER B CA  1  
ATOM 5381   C C   . SER B 2 247 ? 64.229  4.016   -9.933  1.00 0.00 ? 247 SER B C   1  
ATOM 5382   O O   . SER B 2 247 ? 63.493  3.845   -10.944 1.00 0.00 ? 247 SER B O   1  
ATOM 5383   C CB  . SER B 2 247 ? 65.989  5.738   -10.458 1.00 0.00 ? 247 SER B CB  1  
ATOM 5384   O OG  . SER B 2 247 ? 66.011  6.482   -9.244  1.00 0.00 ? 247 SER B OG  1  
ATOM 5385   N N   . PRO B 2 248 ? 63.668  3.990   -8.738  1.00 0.00 ? 248 PRO B N   1  
ATOM 5386   C CA  . PRO B 2 248 ? 62.178  3.937   -8.577  1.00 0.00 ? 248 PRO B CA  1  
ATOM 5387   C C   . PRO B 2 248 ? 61.514  5.177   -9.043  1.00 0.00 ? 248 PRO B C   1  
ATOM 5388   O O   . PRO B 2 248 ? 60.344  5.224   -9.217  1.00 0.00 ? 248 PRO B O   1  
ATOM 5389   C CB  . PRO B 2 248 ? 61.996  3.681   -7.042  1.00 0.00 ? 248 PRO B CB  1  
ATOM 5390   C CG  . PRO B 2 248 ? 63.153  2.714   -6.718  1.00 0.00 ? 248 PRO B CG  1  
ATOM 5391   C CD  . PRO B 2 248 ? 64.305  3.319   -7.557  1.00 0.00 ? 248 PRO B CD  1  
ATOM 5392   N N   . MET B 2 249 ? 62.264  6.266   -9.102  1.00 0.00 ? 249 MET B N   1  
ATOM 5393   C CA  . MET B 2 249 ? 61.874  7.553   -9.453  1.00 0.00 ? 249 MET B CA  1  
ATOM 5394   C C   . MET B 2 249 ? 61.528  7.573   -10.911 1.00 0.00 ? 249 MET B C   1  
ATOM 5395   O O   . MET B 2 249 ? 60.500  8.126   -11.262 1.00 0.00 ? 249 MET B O   1  
ATOM 5396   C CB  . MET B 2 249 ? 63.030  8.547   -9.023  1.00 0.00 ? 249 MET B CB  1  
ATOM 5397   C CG  . MET B 2 249 ? 63.143  8.548   -7.472  1.00 0.00 ? 249 MET B CG  1  
ATOM 5398   S SD  . MET B 2 249 ? 64.536  9.555   -6.855  1.00 0.00 ? 249 MET B SD  1  
ATOM 5399   C CE  . MET B 2 249 ? 63.981  11.143  -7.447  1.00 0.00 ? 249 MET B CE  1  
ATOM 5400   N N   . LYS B 2 250 ? 62.328  6.838   -11.767 1.00 0.00 ? 250 LYS B N   1  
ATOM 5401   C CA  . LYS B 2 250 ? 62.043  6.459   -13.152 1.00 0.00 ? 250 LYS B CA  1  
ATOM 5402   C C   . LYS B 2 250 ? 60.817  5.542   -13.248 1.00 0.00 ? 250 LYS B C   1  
ATOM 5403   O O   . LYS B 2 250 ? 59.955  5.772   -14.096 1.00 0.00 ? 250 LYS B O   1  
ATOM 5404   C CB  . LYS B 2 250 ? 63.225  5.653   -13.774 1.00 0.00 ? 250 LYS B CB  1  
ATOM 5405   C CG  . LYS B 2 250 ? 63.297  5.801   -15.283 1.00 0.00 ? 250 LYS B CG  1  
ATOM 5406   C CD  . LYS B 2 250 ? 64.760  5.464   -15.868 1.00 0.00 ? 250 LYS B CD  1  
ATOM 5407   C CE  . LYS B 2 250 ? 64.833  5.200   -17.372 1.00 0.00 ? 250 LYS B CE  1  
ATOM 5408   N NZ  . LYS B 2 250 ? 64.417  6.370   -18.160 1.00 0.00 ? 250 LYS B NZ  1  
ATOM 5409   N N   . LYS B 2 251 ? 60.686  4.449   -12.363 1.00 0.00 ? 251 LYS B N   1  
ATOM 5410   C CA  . LYS B 2 251 ? 59.664  3.451   -12.349 1.00 0.00 ? 251 LYS B CA  1  
ATOM 5411   C C   . LYS B 2 251 ? 58.351  4.095   -12.157 1.00 0.00 ? 251 LYS B C   1  
ATOM 5412   O O   . LYS B 2 251 ? 57.348  3.727   -12.679 1.00 0.00 ? 251 LYS B O   1  
ATOM 5413   C CB  . LYS B 2 251 ? 59.799  2.349   -11.221 1.00 0.00 ? 251 LYS B CB  1  
ATOM 5414   C CG  . LYS B 2 251 ? 58.816  1.183   -11.198 1.00 0.00 ? 251 LYS B CG  1  
ATOM 5415   C CD  . LYS B 2 251 ? 58.740  0.291   -12.448 1.00 0.00 ? 251 LYS B CD  1  
ATOM 5416   C CE  . LYS B 2 251 ? 60.072  -0.084  -12.974 1.00 0.00 ? 251 LYS B CE  1  
ATOM 5417   N NZ  . LYS B 2 251 ? 60.923  -0.626  -11.904 1.00 0.00 ? 251 LYS B NZ  1  
ATOM 5418   N N   . ALA B 2 252 ? 58.302  5.124   -11.217 1.00 0.00 ? 252 ALA B N   1  
ATOM 5419   C CA  . ALA B 2 252 ? 57.126  5.836   -10.838 1.00 0.00 ? 252 ALA B CA  1  
ATOM 5420   C C   . ALA B 2 252 ? 56.555  6.682   -12.047 1.00 0.00 ? 252 ALA B C   1  
ATOM 5421   O O   . ALA B 2 252 ? 55.348  6.674   -12.260 1.00 0.00 ? 252 ALA B O   1  
ATOM 5422   C CB  . ALA B 2 252 ? 57.421  6.707   -9.607  1.00 0.00 ? 252 ALA B CB  1  
ATOM 5423   N N   . LEU B 2 253 ? 57.396  7.289   -12.906 1.00 0.00 ? 253 LEU B N   1  
ATOM 5424   C CA  . LEU B 2 253 ? 57.086  7.939   -14.176 1.00 0.00 ? 253 LEU B CA  1  
ATOM 5425   C C   . LEU B 2 253 ? 56.527  6.980   -15.185 1.00 0.00 ? 253 LEU B C   1  
ATOM 5426   O O   . LEU B 2 253 ? 55.487  7.246   -15.802 1.00 0.00 ? 253 LEU B O   1  
ATOM 5427   C CB  . LEU B 2 253 ? 58.300  8.487   -14.850 1.00 0.00 ? 253 LEU B CB  1  
ATOM 5428   C CG  . LEU B 2 253 ? 59.091  9.384   -13.921 1.00 0.00 ? 253 LEU B CG  1  
ATOM 5429   C CD1 . LEU B 2 253 ? 60.421  9.829   -14.556 1.00 0.00 ? 253 LEU B CD1 1  
ATOM 5430   C CD2 . LEU B 2 253 ? 58.340  10.559  -13.237 1.00 0.00 ? 253 LEU B CD2 1  
ATOM 5431   N N   . ILE B 2 254 ? 57.222  5.758   -15.373 1.00 0.00 ? 254 ILE B N   1  
ATOM 5432   C CA  . ILE B 2 254 ? 56.793  4.734   -16.309 1.00 0.00 ? 254 ILE B CA  1  
ATOM 5433   C C   . ILE B 2 254 ? 55.440  4.187   -16.008 1.00 0.00 ? 254 ILE B C   1  
ATOM 5434   O O   . ILE B 2 254 ? 54.650  4.051   -16.913 1.00 0.00 ? 254 ILE B O   1  
ATOM 5435   C CB  . ILE B 2 254 ? 57.738  3.438   -16.330 1.00 0.00 ? 254 ILE B CB  1  
ATOM 5436   C CG1 . ILE B 2 254 ? 59.193  3.723   -16.911 1.00 0.00 ? 254 ILE B CG1 1  
ATOM 5437   C CG2 . ILE B 2 254 ? 57.211  2.255   -17.134 1.00 0.00 ? 254 ILE B CG2 1  
ATOM 5438   C CD1 . ILE B 2 254 ? 60.111  2.489   -16.938 1.00 0.00 ? 254 ILE B CD1 1  
ATOM 5439   N N   . ILE B 2 255 ? 55.180  4.018   -14.681 1.00 0.00 ? 255 ILE B N   1  
ATOM 5440   C CA  . ILE B 2 255 ? 53.850  3.638   -14.154 1.00 0.00 ? 255 ILE B CA  1  
ATOM 5441   C C   . ILE B 2 255 ? 52.804  4.628   -14.450 1.00 0.00 ? 255 ILE B C   1  
ATOM 5442   O O   . ILE B 2 255 ? 51.692  4.345   -14.810 1.00 0.00 ? 255 ILE B O   1  
ATOM 5443   C CB  . ILE B 2 255 ? 53.999  3.345   -12.662 1.00 0.00 ? 255 ILE B CB  1  
ATOM 5444   C CG1 . ILE B 2 255 ? 54.894  2.102   -12.390 1.00 0.00 ? 255 ILE B CG1 1  
ATOM 5445   C CG2 . ILE B 2 255 ? 52.576  3.172   -11.982 1.00 0.00 ? 255 ILE B CG2 1  
ATOM 5446   C CD1 . ILE B 2 255 ? 55.071  1.770   -10.899 1.00 0.00 ? 255 ILE B CD1 1  
ATOM 5447   N N   . GLU B 2 256 ? 53.035  5.977   -14.285 1.00 0.00 ? 256 GLU B N   1  
ATOM 5448   C CA  . GLU B 2 256 ? 52.071  7.018   -14.504 1.00 0.00 ? 256 GLU B CA  1  
ATOM 5449   C C   . GLU B 2 256 ? 51.759  7.174   -15.985 1.00 0.00 ? 256 GLU B C   1  
ATOM 5450   O O   . GLU B 2 256 ? 50.619  7.460   -16.299 1.00 0.00 ? 256 GLU B O   1  
ATOM 5451   C CB  . GLU B 2 256 ? 52.448  8.427   -14.046 1.00 0.00 ? 256 GLU B CB  1  
ATOM 5452   C CG  . GLU B 2 256 ? 52.506  8.605   -12.508 1.00 0.00 ? 256 GLU B CG  1  
ATOM 5453   C CD  . GLU B 2 256 ? 51.151  8.695   -11.822 1.00 0.00 ? 256 GLU B CD  1  
ATOM 5454   O OE1 . GLU B 2 256 ? 50.139  8.140   -12.300 1.00 0.00 ? 256 GLU B OE1 1  
ATOM 5455   O OE2 . GLU B 2 256 ? 51.129  9.274   -10.711 1.00 0.00 ? 256 GLU B OE2 1  
ATOM 5456   N N   . ILE B 2 257 ? 52.804  7.009   -16.779 1.00 0.00 ? 257 ILE B N   1  
ATOM 5457   C CA  . ILE B 2 257 ? 52.720  7.118   -18.222 1.00 0.00 ? 257 ILE B CA  1  
ATOM 5458   C C   . ILE B 2 257 ? 51.878  6.102   -18.872 1.00 0.00 ? 257 ILE B C   1  
ATOM 5459   O O   . ILE B 2 257 ? 50.891  6.373   -19.586 1.00 0.00 ? 257 ILE B O   1  
ATOM 5460   C CB  . ILE B 2 257 ? 54.056  7.368   -19.024 1.00 0.00 ? 257 ILE B CB  1  
ATOM 5461   C CG1 . ILE B 2 257 ? 54.916  8.687   -18.706 1.00 0.00 ? 257 ILE B CG1 1  
ATOM 5462   C CG2 . ILE B 2 257 ? 53.658  7.617   -20.507 1.00 0.00 ? 257 ILE B CG2 1  
ATOM 5463   C CD1 . ILE B 2 257 ? 56.195  8.821   -19.550 1.00 0.00 ? 257 ILE B CD1 1  
ATOM 5464   N N   . SER B 2 258 ? 52.063  4.805   -18.460 1.00 0.00 ? 258 SER B N   1  
ATOM 5465   C CA  . SER B 2 258 ? 51.357  3.631   -18.797 1.00 0.00 ? 258 SER B CA  1  
ATOM 5466   C C   . SER B 2 258 ? 49.884  3.567   -18.477 1.00 0.00 ? 258 SER B C   1  
ATOM 5467   O O   . SER B 2 258 ? 48.983  3.239   -19.283 1.00 0.00 ? 258 SER B O   1  
ATOM 5468   C CB  . SER B 2 258 ? 51.980  2.249   -18.272 1.00 0.00 ? 258 SER B CB  1  
ATOM 5469   O OG  . SER B 2 258 ? 52.235  2.289   -16.806 1.00 0.00 ? 258 SER B OG  1  
ATOM 5470   N N   . GLU B 2 259 ? 49.582  4.141   -17.294 1.00 0.00 ? 259 GLU B N   1  
ATOM 5471   C CA  . GLU B 2 259 ? 48.222  4.334   -16.920 1.00 0.00 ? 259 GLU B CA  1  
ATOM 5472   C C   . GLU B 2 259 ? 47.473  5.405   -17.763 1.00 0.00 ? 259 GLU B C   1  
ATOM 5473   O O   . GLU B 2 259 ? 46.301  5.198   -18.106 1.00 0.00 ? 259 GLU B O   1  
ATOM 5474   C CB  . GLU B 2 259 ? 48.166  4.738   -15.443 1.00 0.00 ? 259 GLU B CB  1  
ATOM 5475   C CG  . GLU B 2 259 ? 48.430  3.744   -14.340 1.00 0.00 ? 259 GLU B CG  1  
ATOM 5476   C CD  . GLU B 2 259 ? 48.589  4.492   -12.985 1.00 0.00 ? 259 GLU B CD  1  
ATOM 5477   O OE1 . GLU B 2 259 ? 47.849  5.378   -12.552 1.00 0.00 ? 259 GLU B OE1 1  
ATOM 5478   O OE2 . GLU B 2 259 ? 49.471  3.988   -12.266 1.00 0.00 ? 259 GLU B OE2 1  
ATOM 5479   N N   . GLU B 2 260 ? 48.148  6.524   -18.138 1.00 0.00 ? 260 GLU B N   1  
ATOM 5480   C CA  . GLU B 2 260 ? 47.628  7.562   -18.957 1.00 0.00 ? 260 GLU B CA  1  
ATOM 5481   C C   . GLU B 2 260 ? 47.369  7.133   -20.414 1.00 0.00 ? 260 GLU B C   1  
ATOM 5482   O O   . GLU B 2 260 ? 46.444  7.600   -21.065 1.00 0.00 ? 260 GLU B O   1  
ATOM 5483   C CB  . GLU B 2 260 ? 48.499  8.827   -18.906 1.00 0.00 ? 260 GLU B CB  1  
ATOM 5484   C CG  . GLU B 2 260 ? 48.288  9.669   -17.551 1.00 0.00 ? 260 GLU B CG  1  
ATOM 5485   C CD  . GLU B 2 260 ? 46.935  10.432  -17.530 1.00 0.00 ? 260 GLU B CD  1  
ATOM 5486   O OE1 . GLU B 2 260 ? 46.655  11.166  -18.472 1.00 0.00 ? 260 GLU B OE1 1  
ATOM 5487   O OE2 . GLU B 2 260 ? 46.125  10.242  -16.511 1.00 0.00 ? 260 GLU B OE2 1  
ATOM 5488   N N   . LEU B 2 261 ? 48.238  6.184   -20.883 1.00 0.00 ? 261 LEU B N   1  
ATOM 5489   C CA  . LEU B 2 261 ? 48.091  5.612   -22.244 1.00 0.00 ? 261 LEU B CA  1  
ATOM 5490   C C   . LEU B 2 261 ? 46.897  4.741   -22.360 1.00 0.00 ? 261 LEU B C   1  
ATOM 5491   O O   . LEU B 2 261 ? 46.284  4.669   -23.398 1.00 0.00 ? 261 LEU B O   1  
ATOM 5492   C CB  . LEU B 2 261 ? 49.345  4.716   -22.678 1.00 0.00 ? 261 LEU B CB  1  
ATOM 5493   C CG  . LEU B 2 261 ? 50.710  5.531   -22.772 1.00 0.00 ? 261 LEU B CG  1  
ATOM 5494   C CD1 . LEU B 2 261 ? 51.965  4.701   -23.102 1.00 0.00 ? 261 LEU B CD1 1  
ATOM 5495   C CD2 . LEU B 2 261 ? 50.570  6.742   -23.610 1.00 0.00 ? 261 LEU B CD2 1  
ATOM 5496   N N   . GLN B 2 262 ? 46.478  4.168   -21.227 1.00 0.00 ? 262 GLN B N   1  
ATOM 5497   C CA  . GLN B 2 262 ? 45.313  3.302   -21.198 1.00 0.00 ? 262 GLN B CA  1  
ATOM 5498   C C   . GLN B 2 262 ? 44.052  3.992   -21.757 1.00 0.00 ? 262 GLN B C   1  
ATOM 5499   O O   . GLN B 2 262 ? 43.225  3.361   -22.386 1.00 0.00 ? 262 GLN B O   1  
ATOM 5500   C CB  . GLN B 2 262 ? 44.968  2.559   -19.832 1.00 0.00 ? 262 GLN B CB  1  
ATOM 5501   C CG  . GLN B 2 262 ? 43.945  1.495   -19.862 1.00 0.00 ? 262 GLN B CG  1  
ATOM 5502   C CD  . GLN B 2 262 ? 44.021  0.398   -21.000 1.00 0.00 ? 262 GLN B CD  1  
ATOM 5503   O OE1 . GLN B 2 262 ? 44.979  0.196   -21.779 1.00 0.00 ? 262 GLN B OE1 1  
ATOM 5504   N NE2 . GLN B 2 262 ? 42.900  -0.438  -20.984 1.00 0.00 ? 262 GLN B NE2 1  
ATOM 5505   N N   . ASN B 2 263 ? 43.842  5.257   -21.425 1.00 0.00 ? 263 ASN B N   1  
ATOM 5506   C CA  . ASN B 2 263 ? 42.740  6.045   -21.732 1.00 0.00 ? 263 ASN B CA  1  
ATOM 5507   C C   . ASN B 2 263 ? 42.568  6.176   -23.257 1.00 0.00 ? 263 ASN B C   1  
ATOM 5508   O O   . ASN B 2 263 ? 41.508  6.072   -23.863 1.00 0.00 ? 263 ASN B O   1  
ATOM 5509   C CB  . ASN B 2 263 ? 42.843  7.466   -21.177 1.00 0.00 ? 263 ASN B CB  1  
ATOM 5510   C CG  . ASN B 2 263 ? 42.734  7.643   -19.666 1.00 0.00 ? 263 ASN B CG  1  
ATOM 5511   O OD1 . ASN B 2 263 ? 41.673  7.821   -19.081 1.00 0.00 ? 263 ASN B OD1 1  
ATOM 5512   N ND2 . ASN B 2 263 ? 43.942  7.537   -19.037 1.00 0.00 ? 263 ASN B ND2 1  
ATOM 5513   N N   . TYR B 2 264 ? 43.729  6.330   -23.957 1.00 0.00 ? 264 TYR B N   1  
ATOM 5514   C CA  . TYR B 2 264 ? 43.788  6.406   -25.349 1.00 0.00 ? 264 TYR B CA  1  
ATOM 5515   C C   . TYR B 2 264 ? 43.190  5.148   -26.006 1.00 0.00 ? 264 TYR B C   1  
ATOM 5516   O O   . TYR B 2 264 ? 42.422  5.210   -26.984 1.00 0.00 ? 264 TYR B O   1  
ATOM 5517   C CB  . TYR B 2 264 ? 45.240  6.651   -25.821 1.00 0.00 ? 264 TYR B CB  1  
ATOM 5518   C CG  . TYR B 2 264 ? 45.340  7.383   -27.108 1.00 0.00 ? 264 TYR B CG  1  
ATOM 5519   C CD1 . TYR B 2 264 ? 44.978  6.764   -28.319 1.00 0.00 ? 264 TYR B CD1 1  
ATOM 5520   C CD2 . TYR B 2 264 ? 46.048  8.575   -27.176 1.00 0.00 ? 264 TYR B CD2 1  
ATOM 5521   C CE1 . TYR B 2 264 ? 45.254  7.367   -29.545 1.00 0.00 ? 264 TYR B CE1 1  
ATOM 5522   C CE2 . TYR B 2 264 ? 46.294  9.167   -28.397 1.00 0.00 ? 264 TYR B CE2 1  
ATOM 5523   C CZ  . TYR B 2 264 ? 45.884  8.602   -29.572 1.00 0.00 ? 264 TYR B CZ  1  
ATOM 5524   O OH  . TYR B 2 264 ? 46.484  9.236   -30.698 1.00 0.00 ? 264 TYR B OH  1  
ATOM 5525   N N   . THR B 2 265 ? 43.631  4.000   -25.487 1.00 0.00 ? 265 THR B N   1  
ATOM 5526   C CA  . THR B 2 265 ? 43.224  2.744   -26.084 1.00 0.00 ? 265 THR B CA  1  
ATOM 5527   C C   . THR B 2 265 ? 41.668  2.517   -26.009 1.00 0.00 ? 265 THR B C   1  
ATOM 5528   O O   . THR B 2 265 ? 41.052  2.097   -27.013 1.00 0.00 ? 265 THR B O   1  
ATOM 5529   C CB  . THR B 2 265 ? 43.898  1.575   -25.431 1.00 0.00 ? 265 THR B CB  1  
ATOM 5530   O OG1 . THR B 2 265 ? 45.306  1.778   -25.487 1.00 0.00 ? 265 THR B OG1 1  
ATOM 5531   C CG2 . THR B 2 265 ? 43.611  0.257   -26.105 1.00 0.00 ? 265 THR B CG2 1  
ATOM 5532   N N   . ALA B 2 266 ? 41.030  2.927   -24.850 1.00 0.00 ? 266 ALA B N   1  
ATOM 5533   C CA  . ALA B 2 266 ? 39.610  2.943   -24.573 1.00 0.00 ? 266 ALA B CA  1  
ATOM 5534   C C   . ALA B 2 266 ? 38.861  3.825   -25.506 1.00 0.00 ? 266 ALA B C   1  
ATOM 5535   O O   . ALA B 2 266 ? 37.787  3.516   -25.980 1.00 0.00 ? 266 ALA B O   1  
ATOM 5536   C CB  . ALA B 2 266 ? 39.278  3.478   -23.153 1.00 0.00 ? 266 ALA B CB  1  
ATOM 5537   N N   . PHE B 2 267 ? 39.430  5.010   -25.885 1.00 0.00 ? 267 PHE B N   1  
ATOM 5538   C CA  . PHE B 2 267 ? 38.899  5.981   -26.819 1.00 0.00 ? 267 PHE B CA  1  
ATOM 5539   C C   . PHE B 2 267 ? 38.731  5.506   -28.241 1.00 0.00 ? 267 PHE B C   1  
ATOM 5540   O O   . PHE B 2 267 ? 37.722  5.811   -28.954 1.00 0.00 ? 267 PHE B O   1  
ATOM 5541   C CB  . PHE B 2 267 ? 39.700  7.317   -26.969 1.00 0.00 ? 267 PHE B CB  1  
ATOM 5542   C CG  . PHE B 2 267 ? 39.745  8.011   -25.621 1.00 0.00 ? 267 PHE B CG  1  
ATOM 5543   C CD1 . PHE B 2 267 ? 38.734  7.992   -24.630 1.00 0.00 ? 267 PHE B CD1 1  
ATOM 5544   C CD2 . PHE B 2 267 ? 40.955  8.706   -25.344 1.00 0.00 ? 267 PHE B CD2 1  
ATOM 5545   C CE1 . PHE B 2 267 ? 38.959  8.667   -23.405 1.00 0.00 ? 267 PHE B CE1 1  
ATOM 5546   C CE2 . PHE B 2 267 ? 41.094  9.498   -24.136 1.00 0.00 ? 267 PHE B CE2 1  
ATOM 5547   C CZ  . PHE B 2 267 ? 40.124  9.404   -23.148 1.00 0.00 ? 267 PHE B CZ  1  
ATOM 5548   N N   . VAL B 2 268 ? 39.805  4.745   -28.768 1.00 0.00 ? 268 VAL B N   1  
ATOM 5549   C CA  . VAL B 2 268 ? 39.908  4.184   -30.104 1.00 0.00 ? 268 VAL B CA  1  
ATOM 5550   C C   . VAL B 2 268 ? 38.692  3.212   -30.115 1.00 0.00 ? 268 VAL B C   1  
ATOM 5551   O O   . VAL B 2 268 ? 38.001  3.171   -31.114 1.00 0.00 ? 268 VAL B O   1  
ATOM 5552   C CB  . VAL B 2 268 ? 41.221  3.437   -30.307 1.00 0.00 ? 268 VAL B CB  1  
ATOM 5553   C CG1 . VAL B 2 268 ? 41.341  2.808   -31.681 1.00 0.00 ? 268 VAL B CG1 1  
ATOM 5554   C CG2 . VAL B 2 268 ? 42.322  4.499   -30.124 1.00 0.00 ? 268 VAL B CG2 1  
ATOM 5555   N N   . ASN B 2 269 ? 38.555  2.494   -28.964 1.00 0.00 ? 269 ASN B N   1  
ATOM 5556   C CA  . ASN B 2 269 ? 37.479  1.495   -28.916 1.00 0.00 ? 269 ASN B CA  1  
ATOM 5557   C C   . ASN B 2 269 ? 36.092  2.136   -29.041 1.00 0.00 ? 269 ASN B C   1  
ATOM 5558   O O   . ASN B 2 269 ? 35.254  1.601   -29.785 1.00 0.00 ? 269 ASN B O   1  
ATOM 5559   C CB  . ASN B 2 269 ? 37.637  0.633   -27.619 1.00 0.00 ? 269 ASN B CB  1  
ATOM 5560   C CG  . ASN B 2 269 ? 36.532  -0.437  -27.562 1.00 0.00 ? 269 ASN B CG  1  
ATOM 5561   O OD1 . ASN B 2 269 ? 36.654  -1.492  -28.217 1.00 0.00 ? 269 ASN B OD1 1  
ATOM 5562   N ND2 . ASN B 2 269 ? 35.447  -0.297  -26.631 1.00 0.00 ? 269 ASN B ND2 1  
ATOM 5563   N N   . ASN B 2 270 ? 35.810  3.282   -28.416 1.00 0.00 ? 270 ASN B N   1  
ATOM 5564   C CA  . ASN B 2 270 ? 34.516  4.010   -28.558 1.00 0.00 ? 270 ASN B CA  1  
ATOM 5565   C C   . ASN B 2 270 ? 34.255  4.484   -29.946 1.00 0.00 ? 270 ASN B C   1  
ATOM 5566   O O   . ASN B 2 270 ? 33.149  4.267   -30.423 1.00 0.00 ? 270 ASN B O   1  
ATOM 5567   C CB  . ASN B 2 270 ? 34.278  5.201   -27.595 1.00 0.00 ? 270 ASN B CB  1  
ATOM 5568   C CG  . ASN B 2 270 ? 33.888  4.729   -26.210 1.00 0.00 ? 270 ASN B CG  1  
ATOM 5569   O OD1 . ASN B 2 270 ? 32.976  3.823   -26.061 1.00 0.00 ? 270 ASN B OD1 1  
ATOM 5570   N ND2 . ASN B 2 270 ? 34.796  5.163   -25.179 1.00 0.00 ? 270 ASN B ND2 1  
ATOM 5571   N N   . LEU B 2 271 ? 35.313  4.992   -30.595 1.00 0.00 ? 271 LEU B N   1  
ATOM 5572   C CA  . LEU B 2 271 ? 35.196  5.395   -31.923 1.00 0.00 ? 271 LEU B CA  1  
ATOM 5573   C C   . LEU B 2 271 ? 34.913  4.288   -32.842 1.00 0.00 ? 271 LEU B C   1  
ATOM 5574   O O   . LEU B 2 271 ? 34.036  4.489   -33.735 1.00 0.00 ? 271 LEU B O   1  
ATOM 5575   C CB  . LEU B 2 271 ? 36.531  6.040   -32.247 1.00 0.00 ? 271 LEU B CB  1  
ATOM 5576   C CG  . LEU B 2 271 ? 36.677  7.402   -31.536 1.00 0.00 ? 271 LEU B CG  1  
ATOM 5577   C CD1 . LEU B 2 271 ? 38.192  7.745   -31.544 1.00 0.00 ? 271 LEU B CD1 1  
ATOM 5578   C CD2 . LEU B 2 271 ? 35.914  8.569   -32.313 1.00 0.00 ? 271 LEU B CD2 1  
ATOM 5579   N N   . VAL B 2 272 ? 35.564  3.131   -32.742 1.00 0.00 ? 272 VAL B N   1  
ATOM 5580   C CA  . VAL B 2 272 ? 35.188  2.023   -33.733 1.00 0.00 ? 272 VAL B CA  1  
ATOM 5581   C C   . VAL B 2 272 ? 33.807  1.520   -33.568 1.00 0.00 ? 272 VAL B C   1  
ATOM 5582   O O   . VAL B 2 272 ? 33.155  1.357   -34.601 1.00 0.00 ? 272 VAL B O   1  
ATOM 5583   C CB  . VAL B 2 272 ? 36.286  0.846   -33.793 1.00 0.00 ? 272 VAL B CB  1  
ATOM 5584   C CG1 . VAL B 2 272 ? 37.602  1.428   -34.437 1.00 0.00 ? 272 VAL B CG1 1  
ATOM 5585   C CG2 . VAL B 2 272 ? 36.521  0.272   -32.409 1.00 0.00 ? 272 VAL B CG2 1  
ATOM 5586   N N   . SER B 2 273 ? 33.336  1.314   -32.316 1.00 0.00 ? 273 SER B N   1  
ATOM 5587   C CA  . SER B 2 273 ? 32.074  0.784   -31.883 1.00 0.00 ? 273 SER B CA  1  
ATOM 5588   C C   . SER B 2 273 ? 30.807  1.495   -32.258 1.00 0.00 ? 273 SER B C   1  
ATOM 5589   O O   . SER B 2 273 ? 29.822  0.898   -32.646 1.00 0.00 ? 273 SER B O   1  
ATOM 5590   C CB  . SER B 2 273 ? 32.123  0.753   -30.346 1.00 0.00 ? 273 SER B CB  1  
ATOM 5591   O OG  . SER B 2 273 ? 33.183  -0.157  -29.954 1.00 0.00 ? 273 SER B OG  1  
ATOM 5592   N N   . SER B 2 274 ? 30.869  2.836   -32.161 1.00 0.00 ? 274 SER B N   1  
ATOM 5593   C CA  . SER B 2 274 ? 29.761  3.681   -32.453 1.00 0.00 ? 274 SER B CA  1  
ATOM 5594   C C   . SER B 2 274 ? 30.259  4.763   -33.408 1.00 0.00 ? 274 SER B C   1  
ATOM 5595   O O   . SER B 2 274 ? 29.762  5.874   -33.437 1.00 0.00 ? 274 SER B O   1  
ATOM 5596   C CB  . SER B 2 274 ? 29.226  4.231   -31.008 1.00 0.00 ? 274 SER B CB  1  
ATOM 5597   O OG  . SER B 2 274 ? 28.895  3.028   -30.199 1.00 0.00 ? 274 SER B OG  1  
ATOM 5598   N N   . GLY B 2 275 ? 31.200  4.388   -34.344 1.00 0.00 ? 275 GLY B N   1  
ATOM 5599   C CA  . GLY B 2 275 ? 31.539  5.198   -35.439 1.00 0.00 ? 275 GLY B CA  1  
ATOM 5600   C C   . GLY B 2 275 ? 32.194  4.441   -36.533 1.00 0.00 ? 275 GLY B C   1  
ATOM 5601   O O   . GLY B 2 275 ? 33.283  4.799   -36.982 1.00 0.00 ? 275 GLY B O   1  
ATOM 5602   N N   . THR B 2 276 ? 31.537  3.311   -36.939 1.00 0.00 ? 276 THR B N   1  
ATOM 5603   C CA  . THR B 2 276 ? 31.926  2.334   -37.993 1.00 0.00 ? 276 THR B CA  1  
ATOM 5604   C C   . THR B 2 276 ? 32.276  3.011   -39.373 1.00 0.00 ? 276 THR B C   1  
ATOM 5605   O O   . THR B 2 276 ? 33.283  2.681   -40.001 1.00 0.00 ? 276 THR B O   1  
ATOM 5606   C CB  . THR B 2 276 ? 30.934  1.213   -38.293 1.00 0.00 ? 276 THR B CB  1  
ATOM 5607   O OG1 . THR B 2 276 ? 29.642  1.799   -38.343 1.00 0.00 ? 276 THR B OG1 1  
ATOM 5608   C CG2 . THR B 2 276 ? 30.936  0.352   -37.057 1.00 0.00 ? 276 THR B CG2 1  
ATOM 5609   N N   . VAL B 2 277 ? 31.422  3.982   -39.766 1.00 0.00 ? 277 VAL B N   1  
ATOM 5610   C CA  . VAL B 2 277 ? 31.721  4.790   -40.953 1.00 0.00 ? 277 VAL B CA  1  
ATOM 5611   C C   . VAL B 2 277 ? 31.710  6.185   -40.429 1.00 0.00 ? 277 VAL B C   1  
ATOM 5612   O O   . VAL B 2 277 ? 30.705  6.761   -40.102 1.00 0.00 ? 277 VAL B O   1  
ATOM 5613   C CB  . VAL B 2 277 ? 30.689  4.854   -42.080 1.00 0.00 ? 277 VAL B CB  1  
ATOM 5614   C CG1 . VAL B 2 277 ? 31.052  5.885   -43.172 1.00 0.00 ? 277 VAL B CG1 1  
ATOM 5615   C CG2 . VAL B 2 277 ? 30.606  3.493   -42.786 1.00 0.00 ? 277 VAL B CG2 1  
ATOM 5616   N N   . VAL B 2 278 ? 32.939  6.755   -40.186 1.00 0.00 ? 278 VAL B N   1  
ATOM 5617   C CA  . VAL B 2 278 ? 33.119  7.978   -39.458 1.00 0.00 ? 278 VAL B CA  1  
ATOM 5618   C C   . VAL B 2 278 ? 34.217  8.693   -40.207 1.00 0.00 ? 278 VAL B C   1  
ATOM 5619   O O   . VAL B 2 278 ? 35.113  8.100   -40.824 1.00 0.00 ? 278 VAL B O   1  
ATOM 5620   C CB  . VAL B 2 278 ? 33.431  7.866   -37.938 1.00 0.00 ? 278 VAL B CB  1  
ATOM 5621   C CG1 . VAL B 2 278 ? 34.882  7.467   -37.822 1.00 0.00 ? 278 VAL B CG1 1  
ATOM 5622   C CG2 . VAL B 2 278 ? 33.040  9.158   -37.144 1.00 0.00 ? 278 VAL B CG2 1  
ATOM 5623   N N   . SER B 2 279 ? 34.142  9.995   -40.162 1.00 0.00 ? 279 SER B N   1  
ATOM 5624   C CA  . SER B 2 279 ? 34.994  10.934  -40.895 1.00 0.00 ? 279 SER B CA  1  
ATOM 5625   C C   . SER B 2 279 ? 36.267  11.094  -40.126 1.00 0.00 ? 279 SER B C   1  
ATOM 5626   O O   . SER B 2 279 ? 36.288  11.223  -38.916 1.00 0.00 ? 279 SER B O   1  
ATOM 5627   C CB  . SER B 2 279 ? 34.346  12.311  -41.090 1.00 0.00 ? 279 SER B CB  1  
ATOM 5628   O OG  . SER B 2 279 ? 33.130  12.300  -41.758 1.00 0.00 ? 279 SER B OG  1  
ATOM 5629   N N   . LEU B 2 280 ? 37.357  11.071  -40.924 1.00 0.00 ? 280 LEU B N   1  
ATOM 5630   C CA  . LEU B 2 280 ? 38.705  11.279  -40.499 1.00 0.00 ? 280 LEU B CA  1  
ATOM 5631   C C   . LEU B 2 280 ? 39.024  12.662  -39.921 1.00 0.00 ? 280 LEU B C   1  
ATOM 5632   O O   . LEU B 2 280 ? 39.742  12.710  -38.880 1.00 0.00 ? 280 LEU B O   1  
ATOM 5633   C CB  . LEU B 2 280 ? 39.676  11.080  -41.697 1.00 0.00 ? 280 LEU B CB  1  
ATOM 5634   C CG  . LEU B 2 280 ? 39.705  9.737   -42.452 1.00 0.00 ? 280 LEU B CG  1  
ATOM 5635   C CD1 . LEU B 2 280 ? 40.883  9.634   -43.470 1.00 0.00 ? 280 LEU B CD1 1  
ATOM 5636   C CD2 . LEU B 2 280 ? 39.850  8.393   -41.590 1.00 0.00 ? 280 LEU B CD2 1  
ATOM 5637   N N   . LYS B 2 281 ? 38.415  13.764  -40.420 1.00 0.00 ? 281 LYS B N   1  
ATOM 5638   C CA  . LYS B 2 281 ? 38.539  15.109  -39.953 1.00 0.00 ? 281 LYS B CA  1  
ATOM 5639   C C   . LYS B 2 281 ? 37.978  15.202  -38.554 1.00 0.00 ? 281 LYS B C   1  
ATOM 5640   O O   . LYS B 2 281 ? 38.610  15.688  -37.606 1.00 0.00 ? 281 LYS B O   1  
ATOM 5641   C CB  . LYS B 2 281 ? 37.785  16.162  -40.863 1.00 0.00 ? 281 LYS B CB  1  
ATOM 5642   C CG  . LYS B 2 281 ? 38.489  17.520  -40.893 1.00 0.00 ? 281 LYS B CG  1  
ATOM 5643   C CD  . LYS B 2 281 ? 37.955  18.397  -42.052 1.00 0.00 ? 281 LYS B CD  1  
ATOM 5644   C CE  . LYS B 2 281 ? 38.695  19.749  -42.441 1.00 0.00 ? 281 LYS B CE  1  
ATOM 5645   N NZ  . LYS B 2 281 ? 38.361  20.208  -43.837 1.00 0.00 ? 281 LYS B NZ  1  
ATOM 5646   N N   . SER B 2 282 ? 36.836  14.601  -38.441 1.00 0.00 ? 282 SER B N   1  
ATOM 5647   C CA  . SER B 2 282 ? 35.998  14.422  -37.219 1.00 0.00 ? 282 SER B CA  1  
ATOM 5648   C C   . SER B 2 282 ? 36.745  13.552  -36.226 1.00 0.00 ? 282 SER B C   1  
ATOM 5649   O O   . SER B 2 282 ? 36.752  13.931  -35.086 1.00 0.00 ? 282 SER B O   1  
ATOM 5650   C CB  . SER B 2 282 ? 34.563  13.884  -37.374 1.00 0.00 ? 282 SER B CB  1  
ATOM 5651   O OG  . SER B 2 282 ? 33.853  14.701  -38.338 1.00 0.00 ? 282 SER B OG  1  
ATOM 5652   N N   . LEU B 2 283 ? 37.435  12.492  -36.621 1.00 0.00 ? 283 LEU B N   1  
ATOM 5653   C CA  . LEU B 2 283 ? 38.168  11.472  -35.884 1.00 0.00 ? 283 LEU B CA  1  
ATOM 5654   C C   . LEU B 2 283 ? 39.307  12.179  -35.117 1.00 0.00 ? 283 LEU B C   1  
ATOM 5655   O O   . LEU B 2 283 ? 39.602  11.895  -33.943 1.00 0.00 ? 283 LEU B O   1  
ATOM 5656   C CB  . LEU B 2 283 ? 38.857  10.432  -36.887 1.00 0.00 ? 283 LEU B CB  1  
ATOM 5657   C CG  . LEU B 2 283 ? 39.302  9.129   -36.140 1.00 0.00 ? 283 LEU B CG  1  
ATOM 5658   C CD1 . LEU B 2 283 ? 40.623  9.209   -35.276 1.00 0.00 ? 283 LEU B CD1 1  
ATOM 5659   C CD2 . LEU B 2 283 ? 38.159  8.308   -35.365 1.00 0.00 ? 283 LEU B CD2 1  
ATOM 5660   N N   . TYR B 2 284 ? 39.973  13.163  -35.902 1.00 0.00 ? 284 TYR B N   1  
ATOM 5661   C CA  . TYR B 2 284 ? 41.072  13.947  -35.558 1.00 0.00 ? 284 TYR B CA  1  
ATOM 5662   C C   . TYR B 2 284 ? 40.708  14.896  -34.448 1.00 0.00 ? 284 TYR B C   1  
ATOM 5663   O O   . TYR B 2 284 ? 41.496  14.967  -33.435 1.00 0.00 ? 284 TYR B O   1  
ATOM 5664   C CB  . TYR B 2 284 ? 41.766  14.756  -36.740 1.00 0.00 ? 284 TYR B CB  1  
ATOM 5665   C CG  . TYR B 2 284 ? 42.935  15.679  -36.263 1.00 0.00 ? 284 TYR B CG  1  
ATOM 5666   C CD1 . TYR B 2 284 ? 42.670  16.974  -35.807 1.00 0.00 ? 284 TYR B CD1 1  
ATOM 5667   C CD2 . TYR B 2 284 ? 44.292  15.225  -36.296 1.00 0.00 ? 284 TYR B CD2 1  
ATOM 5668   C CE1 . TYR B 2 284 ? 43.696  17.829  -35.453 1.00 0.00 ? 284 TYR B CE1 1  
ATOM 5669   C CE2 . TYR B 2 284 ? 45.307  16.047  -35.844 1.00 0.00 ? 284 TYR B CE2 1  
ATOM 5670   C CZ  . TYR B 2 284 ? 44.998  17.373  -35.511 1.00 0.00 ? 284 TYR B CZ  1  
ATOM 5671   O OH  . TYR B 2 284 ? 46.038  18.278  -35.069 1.00 0.00 ? 284 TYR B OH  1  
ATOM 5672   N N   . ARG B 2 285 ? 39.502  15.584  -34.597 1.00 0.00 ? 285 ARG B N   1  
ATOM 5673   C CA  . ARG B 2 285 ? 38.992  16.563  -33.607 1.00 0.00 ? 285 ARG B CA  1  
ATOM 5674   C C   . ARG B 2 285 ? 38.672  15.834  -32.269 1.00 0.00 ? 285 ARG B C   1  
ATOM 5675   O O   . ARG B 2 285 ? 38.893  16.374  -31.216 1.00 0.00 ? 285 ARG B O   1  
ATOM 5676   C CB  . ARG B 2 285 ? 37.802  17.352  -34.229 1.00 0.00 ? 285 ARG B CB  1  
ATOM 5677   C CG  . ARG B 2 285 ? 37.126  18.396  -33.402 1.00 0.00 ? 285 ARG B CG  1  
ATOM 5678   C CD  . ARG B 2 285 ? 35.964  17.964  -32.488 1.00 0.00 ? 285 ARG B CD  1  
ATOM 5679   N NE  . ARG B 2 285 ? 34.820  17.352  -33.317 1.00 0.00 ? 285 ARG B NE  1  
ATOM 5680   C CZ  . ARG B 2 285 ? 33.826  16.697  -32.654 1.00 0.00 ? 285 ARG B CZ  1  
ATOM 5681   N NH1 . ARG B 2 285 ? 33.760  16.608  -31.283 1.00 0.00 ? 285 ARG B NH1 1  
ATOM 5682   N NH2 . ARG B 2 285 ? 32.820  16.050  -33.310 1.00 0.00 ? 285 ARG B NH2 1  
ATOM 5683   N N   . GLU B 2 286 ? 38.061  14.598  -32.347 1.00 0.00 ? 286 GLU B N   1  
ATOM 5684   C CA  . GLU B 2 286 ? 37.568  13.950  -31.165 1.00 0.00 ? 286 GLU B CA  1  
ATOM 5685   C C   . GLU B 2 286 ? 38.733  13.565  -30.224 1.00 0.00 ? 286 GLU B C   1  
ATOM 5686   O O   . GLU B 2 286 ? 38.542  13.575  -29.042 1.00 0.00 ? 286 GLU B O   1  
ATOM 5687   C CB  . GLU B 2 286 ? 36.622  12.722  -31.565 1.00 0.00 ? 286 GLU B CB  1  
ATOM 5688   C CG  . GLU B 2 286 ? 35.331  13.132  -32.240 1.00 0.00 ? 286 GLU B CG  1  
ATOM 5689   C CD  . GLU B 2 286 ? 34.834  11.919  -33.084 1.00 0.00 ? 286 GLU B CD  1  
ATOM 5690   O OE1 . GLU B 2 286 ? 35.638  11.381  -33.969 1.00 0.00 ? 286 GLU B OE1 1  
ATOM 5691   O OE2 . GLU B 2 286 ? 33.686  11.526  -32.791 1.00 0.00 ? 286 GLU B OE2 1  
ATOM 5692   N N   . ILE B 2 287 ? 39.864  13.190  -30.837 1.00 0.00 ? 287 ILE B N   1  
ATOM 5693   C CA  . ILE B 2 287 ? 40.979  12.706  -30.036 1.00 0.00 ? 287 ILE B CA  1  
ATOM 5694   C C   . ILE B 2 287 ? 41.944  13.857  -29.984 1.00 0.00 ? 287 ILE B C   1  
ATOM 5695   O O   . ILE B 2 287 ? 43.160  13.599  -29.997 1.00 0.00 ? 287 ILE B O   1  
ATOM 5696   C CB  . ILE B 2 287 ? 41.506  11.447  -30.718 1.00 0.00 ? 287 ILE B CB  1  
ATOM 5697   C CG1 . ILE B 2 287 ? 42.399  10.550  -29.826 1.00 0.00 ? 287 ILE B CG1 1  
ATOM 5698   C CG2 . ILE B 2 287 ? 42.240  11.655  -32.071 1.00 0.00 ? 287 ILE B CG2 1  
ATOM 5699   C CD1 . ILE B 2 287 ? 42.921  9.286   -30.530 1.00 0.00 ? 287 ILE B CD1 1  
ATOM 5700   N N   . TYR B 2 288 ? 41.496  15.110  -29.828 1.00 0.00 ? 288 TYR B N   1  
ATOM 5701   C CA  . TYR B 2 288 ? 42.372  16.245  -29.756 1.00 0.00 ? 288 TYR B CA  1  
ATOM 5702   C C   . TYR B 2 288 ? 43.238  16.359  -28.488 1.00 0.00 ? 288 TYR B C   1  
ATOM 5703   O O   . TYR B 2 288 ? 44.377  16.691  -28.583 1.00 0.00 ? 288 TYR B O   1  
ATOM 5704   C CB  . TYR B 2 288 ? 41.600  17.617  -29.838 1.00 0.00 ? 288 TYR B CB  1  
ATOM 5705   C CG  . TYR B 2 288 ? 42.463  18.702  -30.310 1.00 0.00 ? 288 TYR B CG  1  
ATOM 5706   C CD1 . TYR B 2 288 ? 43.051  18.550  -31.562 1.00 0.00 ? 288 TYR B CD1 1  
ATOM 5707   C CD2 . TYR B 2 288 ? 42.716  19.824  -29.578 1.00 0.00 ? 288 TYR B CD2 1  
ATOM 5708   C CE1 . TYR B 2 288 ? 44.027  19.453  -32.032 1.00 0.00 ? 288 TYR B CE1 1  
ATOM 5709   C CE2 . TYR B 2 288 ? 43.500  20.894  -30.070 1.00 0.00 ? 288 TYR B CE2 1  
ATOM 5710   C CZ  . TYR B 2 288 ? 44.215  20.679  -31.294 1.00 0.00 ? 288 TYR B CZ  1  
ATOM 5711   O OH  . TYR B 2 288 ? 44.892  21.822  -31.798 1.00 0.00 ? 288 TYR B OH  1  
ATOM 5712   N N   . GLU B 2 289 ? 42.587  16.098  -27.320 1.00 0.00 ? 289 GLU B N   1  
ATOM 5713   C CA  . GLU B 2 289 ? 43.232  16.332  -26.045 1.00 0.00 ? 289 GLU B CA  1  
ATOM 5714   C C   . GLU B 2 289 ? 44.429  15.575  -25.751 1.00 0.00 ? 289 GLU B C   1  
ATOM 5715   O O   . GLU B 2 289 ? 45.384  16.057  -25.181 1.00 0.00 ? 289 GLU B O   1  
ATOM 5716   C CB  . GLU B 2 289 ? 42.188  16.014  -24.950 1.00 0.00 ? 289 GLU B CB  1  
ATOM 5717   C CG  . GLU B 2 289 ? 42.492  16.587  -23.538 1.00 0.00 ? 289 GLU B CG  1  
ATOM 5718   C CD  . GLU B 2 289 ? 42.604  18.136  -23.594 1.00 0.00 ? 289 GLU B CD  1  
ATOM 5719   O OE1 . GLU B 2 289 ? 42.162  18.832  -24.581 1.00 0.00 ? 289 GLU B OE1 1  
ATOM 5720   O OE2 . GLU B 2 289 ? 43.026  18.712  -22.538 1.00 0.00 ? 289 GLU B OE2 1  
ATOM 5721   N N   . ASN B 2 290 ? 44.333  14.300  -26.234 1.00 0.00 ? 290 ASN B N   1  
ATOM 5722   C CA  . ASN B 2 290 ? 45.387  13.276  -26.139 1.00 0.00 ? 290 ASN B CA  1  
ATOM 5723   C C   . ASN B 2 290 ? 46.633  13.612  -26.839 1.00 0.00 ? 290 ASN B C   1  
ATOM 5724   O O   . ASN B 2 290 ? 47.731  13.401  -26.316 1.00 0.00 ? 290 ASN B O   1  
ATOM 5725   C CB  . ASN B 2 290 ? 44.683  11.951  -26.667 1.00 0.00 ? 290 ASN B CB  1  
ATOM 5726   C CG  . ASN B 2 290 ? 43.544  11.564  -25.652 1.00 0.00 ? 290 ASN B CG  1  
ATOM 5727   O OD1 . ASN B 2 290 ? 43.907  10.914  -24.668 1.00 0.00 ? 290 ASN B OD1 1  
ATOM 5728   N ND2 . ASN B 2 290 ? 42.264  11.874  -25.944 1.00 0.00 ? 290 ASN B ND2 1  
ATOM 5729   N N   . ILE B 2 291 ? 46.577  14.374  -27.965 1.00 0.00 ? 291 ILE B N   1  
ATOM 5730   C CA  . ILE B 2 291 ? 47.732  14.962  -28.735 1.00 0.00 ? 291 ILE B CA  1  
ATOM 5731   C C   . ILE B 2 291 ? 48.502  15.950  -27.985 1.00 0.00 ? 291 ILE B C   1  
ATOM 5732   O O   . ILE B 2 291 ? 49.716  15.905  -28.141 1.00 0.00 ? 291 ILE B O   1  
ATOM 5733   C CB  . ILE B 2 291 ? 47.360  15.618  -30.074 1.00 0.00 ? 291 ILE B CB  1  
ATOM 5734   C CG1 . ILE B 2 291 ? 46.374  14.665  -30.914 1.00 0.00 ? 291 ILE B CG1 1  
ATOM 5735   C CG2 . ILE B 2 291 ? 48.643  15.991  -30.970 1.00 0.00 ? 291 ILE B CG2 1  
ATOM 5736   C CD1 . ILE B 2 291 ? 45.948  15.244  -32.274 1.00 0.00 ? 291 ILE B CD1 1  
ATOM 5737   N N   . ILE B 2 292 ? 47.886  16.782  -27.216 1.00 0.00 ? 292 ILE B N   1  
ATOM 5738   C CA  . ILE B 2 292 ? 48.399  17.892  -26.423 1.00 0.00 ? 292 ILE B CA  1  
ATOM 5739   C C   . ILE B 2 292 ? 49.205  17.148  -25.327 1.00 0.00 ? 292 ILE B C   1  
ATOM 5740   O O   . ILE B 2 292 ? 50.349  17.489  -25.128 1.00 0.00 ? 292 ILE B O   1  
ATOM 5741   C CB  . ILE B 2 292 ? 47.318  18.669  -25.786 1.00 0.00 ? 292 ILE B CB  1  
ATOM 5742   C CG1 . ILE B 2 292 ? 46.467  19.150  -26.954 1.00 0.00 ? 292 ILE B CG1 1  
ATOM 5743   C CG2 . ILE B 2 292 ? 47.863  19.698  -24.785 1.00 0.00 ? 292 ILE B CG2 1  
ATOM 5744   C CD1 . ILE B 2 292 ? 45.253  19.999  -26.539 1.00 0.00 ? 292 ILE B CD1 1  
ATOM 5745   N N   . ARG B 2 293 ? 48.609  16.109  -24.752 1.00 0.00 ? 293 ARG B N   1  
ATOM 5746   C CA  . ARG B 2 293 ? 49.244  15.412  -23.626 1.00 0.00 ? 293 ARG B CA  1  
ATOM 5747   C C   . ARG B 2 293 ? 50.512  14.650  -24.044 1.00 0.00 ? 293 ARG B C   1  
ATOM 5748   O O   . ARG B 2 293 ? 51.593  14.729  -23.449 1.00 0.00 ? 293 ARG B O   1  
ATOM 5749   C CB  . ARG B 2 293 ? 48.185  14.346  -23.122 1.00 0.00 ? 293 ARG B CB  1  
ATOM 5750   C CG  . ARG B 2 293 ? 48.716  13.524  -21.918 1.00 0.00 ? 293 ARG B CG  1  
ATOM 5751   C CD  . ARG B 2 293 ? 47.486  12.732  -21.216 1.00 0.00 ? 293 ARG B CD  1  
ATOM 5752   N NE  . ARG B 2 293 ? 47.002  11.767  -22.191 1.00 0.00 ? 293 ARG B NE  1  
ATOM 5753   C CZ  . ARG B 2 293 ? 47.675  10.677  -22.735 1.00 0.00 ? 293 ARG B CZ  1  
ATOM 5754   N NH1 . ARG B 2 293 ? 48.756  10.120  -22.057 1.00 0.00 ? 293 ARG B NH1 1  
ATOM 5755   N NH2 . ARG B 2 293 ? 47.163  10.129  -23.877 1.00 0.00 ? 293 ARG B NH2 1  
ATOM 5756   N N   . LEU B 2 294 ? 50.491  13.896  -25.199 1.00 0.00 ? 294 LEU B N   1  
ATOM 5757   C CA  . LEU B 2 294 ? 51.566  13.021  -25.661 1.00 0.00 ? 294 LEU B CA  1  
ATOM 5758   C C   . LEU B 2 294 ? 52.749  13.833  -25.903 1.00 0.00 ? 294 LEU B C   1  
ATOM 5759   O O   . LEU B 2 294 ? 53.850  13.410  -25.662 1.00 0.00 ? 294 LEU B O   1  
ATOM 5760   C CB  . LEU B 2 294 ? 51.243  12.481  -27.037 1.00 0.00 ? 294 LEU B CB  1  
ATOM 5761   C CG  . LEU B 2 294 ? 50.291  11.279  -27.000 1.00 0.00 ? 294 LEU B CG  1  
ATOM 5762   C CD1 . LEU B 2 294 ? 49.792  10.820  -28.394 1.00 0.00 ? 294 LEU B CD1 1  
ATOM 5763   C CD2 . LEU B 2 294 ? 51.064  10.073  -26.402 1.00 0.00 ? 294 LEU B CD2 1  
ATOM 5764   N N   . ARG B 2 295 ? 52.607  15.046  -26.498 1.00 0.00 ? 295 ARG B N   1  
ATOM 5765   C CA  . ARG B 2 295 ? 53.712  15.784  -27.038 1.00 0.00 ? 295 ARG B CA  1  
ATOM 5766   C C   . ARG B 2 295 ? 54.678  16.214  -25.996 1.00 0.00 ? 295 ARG B C   1  
ATOM 5767   O O   . ARG B 2 295 ? 55.869  16.146  -26.155 1.00 0.00 ? 295 ARG B O   1  
ATOM 5768   C CB  . ARG B 2 295 ? 53.167  16.970  -27.914 1.00 0.00 ? 295 ARG B CB  1  
ATOM 5769   C CG  . ARG B 2 295 ? 54.118  17.483  -28.993 1.00 0.00 ? 295 ARG B CG  1  
ATOM 5770   C CD  . ARG B 2 295 ? 53.592  18.694  -29.941 1.00 0.00 ? 295 ARG B CD  1  
ATOM 5771   N NE  . ARG B 2 295 ? 54.575  19.096  -31.032 1.00 0.00 ? 295 ARG B NE  1  
ATOM 5772   C CZ  . ARG B 2 295 ? 55.482  20.107  -31.011 1.00 0.00 ? 295 ARG B CZ  1  
ATOM 5773   N NH1 . ARG B 2 295 ? 55.534  21.044  -30.046 1.00 0.00 ? 295 ARG B NH1 1  
ATOM 5774   N NH2 . ARG B 2 295 ? 56.333  20.289  -32.037 1.00 0.00 ? 295 ARG B NH2 1  
ATOM 5775   N N   . ILE B 2 296 ? 54.060  16.704  -24.950 1.00 0.00 ? 296 ILE B N   1  
ATOM 5776   C CA  . ILE B 2 296 ? 54.798  17.192  -23.776 1.00 0.00 ? 296 ILE B CA  1  
ATOM 5777   C C   . ILE B 2 296 ? 55.600  16.047  -23.191 1.00 0.00 ? 296 ILE B C   1  
ATOM 5778   O O   . ILE B 2 296 ? 56.792  16.234  -22.932 1.00 0.00 ? 296 ILE B O   1  
ATOM 5779   C CB  . ILE B 2 296 ? 53.945  17.914  -22.806 1.00 0.00 ? 296 ILE B CB  1  
ATOM 5780   C CG1 . ILE B 2 296 ? 54.734  18.482  -21.579 1.00 0.00 ? 296 ILE B CG1 1  
ATOM 5781   C CG2 . ILE B 2 296 ? 52.673  17.143  -22.416 1.00 0.00 ? 296 ILE B CG2 1  
ATOM 5782   C CD1 . ILE B 2 296 ? 53.858  19.235  -20.563 1.00 0.00 ? 296 ILE B CD1 1  
ATOM 5783   N N   . TYR B 2 297 ? 55.022  14.832  -23.047 1.00 0.00 ? 297 TYR B N   1  
ATOM 5784   C CA  . TYR B 2 297 ? 55.659  13.631  -22.571 1.00 0.00 ? 297 TYR B CA  1  
ATOM 5785   C C   . TYR B 2 297 ? 56.807  13.181  -23.348 1.00 0.00 ? 297 TYR B C   1  
ATOM 5786   O O   . TYR B 2 297 ? 57.816  12.712  -22.791 1.00 0.00 ? 297 TYR B O   1  
ATOM 5787   C CB  . TYR B 2 297 ? 54.618  12.420  -22.540 1.00 0.00 ? 297 TYR B CB  1  
ATOM 5788   C CG  . TYR B 2 297 ? 53.626  12.523  -21.403 1.00 0.00 ? 297 TYR B CG  1  
ATOM 5789   C CD1 . TYR B 2 297 ? 54.198  12.541  -20.109 1.00 0.00 ? 297 TYR B CD1 1  
ATOM 5790   C CD2 . TYR B 2 297 ? 52.333  11.986  -21.556 1.00 0.00 ? 297 TYR B CD2 1  
ATOM 5791   C CE1 . TYR B 2 297 ? 53.510  12.276  -18.942 1.00 0.00 ? 297 TYR B CE1 1  
ATOM 5792   C CE2 . TYR B 2 297 ? 51.547  11.758  -20.358 1.00 0.00 ? 297 TYR B CE2 1  
ATOM 5793   C CZ  . TYR B 2 297 ? 52.209  11.810  -19.062 1.00 0.00 ? 297 TYR B CZ  1  
ATOM 5794   O OH  . TYR B 2 297 ? 51.577  11.507  -17.849 1.00 0.00 ? 297 TYR B OH  1  
ATOM 5795   N N   . CYS B 2 298 ? 56.800  13.310  -24.672 1.00 0.00 ? 298 CYS B N   1  
ATOM 5796   C CA  . CYS B 2 298 ? 57.864  12.951  -25.539 1.00 0.00 ? 298 CYS B CA  1  
ATOM 5797   C C   . CYS B 2 298 ? 59.163  13.812  -25.278 1.00 0.00 ? 298 CYS B C   1  
ATOM 5798   O O   . CYS B 2 298 ? 60.292  13.278  -25.319 1.00 0.00 ? 298 CYS B O   1  
ATOM 5799   C CB  . CYS B 2 298 ? 57.431  13.036  -27.039 1.00 0.00 ? 298 CYS B CB  1  
ATOM 5800   S SG  . CYS B 2 298 ? 56.153  11.870  -27.561 1.00 0.00 ? 298 CYS B SG  1  
ATOM 5801   N N   . ARG B 2 299 ? 58.967  15.090  -24.888 1.00 0.00 ? 299 ARG B N   1  
ATOM 5802   C CA  . ARG B 2 299 ? 60.143  15.884  -24.468 1.00 0.00 ? 299 ARG B CA  1  
ATOM 5803   C C   . ARG B 2 299 ? 60.852  15.267  -23.246 1.00 0.00 ? 299 ARG B C   1  
ATOM 5804   O O   . ARG B 2 299 ? 62.064  15.243  -23.169 1.00 0.00 ? 299 ARG B O   1  
ATOM 5805   C CB  . ARG B 2 299 ? 59.691  17.346  -24.209 1.00 0.00 ? 299 ARG B CB  1  
ATOM 5806   C CG  . ARG B 2 299 ? 59.097  18.029  -25.459 1.00 0.00 ? 299 ARG B CG  1  
ATOM 5807   C CD  . ARG B 2 299 ? 58.210  19.197  -25.067 1.00 0.00 ? 299 ARG B CD  1  
ATOM 5808   N NE  . ARG B 2 299 ? 57.633  19.880  -26.258 1.00 0.00 ? 299 ARG B NE  1  
ATOM 5809   C CZ  . ARG B 2 299 ? 58.244  21.013  -26.737 1.00 0.00 ? 299 ARG B CZ  1  
ATOM 5810   N NH1 . ARG B 2 299 ? 59.538  21.346  -26.431 1.00 0.00 ? 299 ARG B NH1 1  
ATOM 5811   N NH2 . ARG B 2 299 ? 57.538  21.831  -27.573 1.00 0.00 ? 299 ARG B NH2 1  
ATOM 5812   N N   . PHE B 2 300 ? 59.994  14.809  -22.304 1.00 0.00 ? 300 PHE B N   1  
ATOM 5813   C CA  . PHE B 2 300 ? 60.393  14.242  -21.013 1.00 0.00 ? 300 PHE B CA  1  
ATOM 5814   C C   . PHE B 2 300 ? 61.193  13.007  -21.020 1.00 0.00 ? 300 PHE B C   1  
ATOM 5815   O O   . PHE B 2 300 ? 62.242  12.916  -20.408 1.00 0.00 ? 300 PHE B O   1  
ATOM 5816   C CB  . PHE B 2 300 ? 59.268  14.010  -19.954 1.00 0.00 ? 300 PHE B CB  1  
ATOM 5817   C CG  . PHE B 2 300 ? 59.527  13.852  -18.525 1.00 0.00 ? 300 PHE B CG  1  
ATOM 5818   C CD1 . PHE B 2 300 ? 60.513  14.745  -17.919 1.00 0.00 ? 300 PHE B CD1 1  
ATOM 5819   C CD2 . PHE B 2 300 ? 58.911  12.868  -17.665 1.00 0.00 ? 300 PHE B CD2 1  
ATOM 5820   C CE1 . PHE B 2 300 ? 60.817  14.622  -16.542 1.00 0.00 ? 300 PHE B CE1 1  
ATOM 5821   C CE2 . PHE B 2 300 ? 59.229  12.840  -16.233 1.00 0.00 ? 300 PHE B CE2 1  
ATOM 5822   C CZ  . PHE B 2 300 ? 60.121  13.763  -15.668 1.00 0.00 ? 300 PHE B CZ  1  
ATOM 5823   N N   . THR B 2 301 ? 60.748  12.027  -21.859 1.00 0.00 ? 301 THR B N   1  
ATOM 5824   C CA  . THR B 2 301 ? 61.352  10.704  -22.097 1.00 0.00 ? 301 THR B CA  1  
ATOM 5825   C C   . THR B 2 301 ? 62.754  10.864  -22.676 1.00 0.00 ? 301 THR B C   1  
ATOM 5826   O O   . THR B 2 301 ? 63.733  10.166  -22.349 1.00 0.00 ? 301 THR B O   1  
ATOM 5827   C CB  . THR B 2 301 ? 60.550  9.878   -23.025 1.00 0.00 ? 301 THR B CB  1  
ATOM 5828   O OG1 . THR B 2 301 ? 59.890  10.608  -24.044 1.00 0.00 ? 301 THR B OG1 1  
ATOM 5829   C CG2 . THR B 2 301 ? 59.510  9.060   -22.251 1.00 0.00 ? 301 THR B CG2 1  
ATOM 5830   N N   . GLU B 2 302 ? 62.929  11.888  -23.529 1.00 0.00 ? 302 GLU B N   1  
ATOM 5831   C CA  . GLU B 2 302 ? 64.189  12.308  -24.137 1.00 0.00 ? 302 GLU B CA  1  
ATOM 5832   C C   . GLU B 2 302 ? 65.174  12.807  -23.063 1.00 0.00 ? 302 GLU B C   1  
ATOM 5833   O O   . GLU B 2 302 ? 66.299  12.329  -22.992 1.00 0.00 ? 302 GLU B O   1  
ATOM 5834   C CB  . GLU B 2 302 ? 64.020  13.432  -25.079 1.00 0.00 ? 302 GLU B CB  1  
ATOM 5835   C CG  . GLU B 2 302 ? 63.265  13.006  -26.397 1.00 0.00 ? 302 GLU B CG  1  
ATOM 5836   C CD  . GLU B 2 302 ? 62.832  14.206  -27.289 1.00 0.00 ? 302 GLU B CD  1  
ATOM 5837   O OE1 . GLU B 2 302 ? 63.545  15.296  -27.385 1.00 0.00 ? 302 GLU B OE1 1  
ATOM 5838   O OE2 . GLU B 2 302 ? 61.770  14.043  -27.906 1.00 0.00 ? 302 GLU B OE2 1  
ATOM 5839   N N   . HIS B 2 303 ? 64.758  13.667  -22.176 1.00 0.00 ? 303 HIS B N   1  
ATOM 5840   C CA  . HIS B 2 303 ? 65.557  14.106  -21.130 1.00 0.00 ? 303 HIS B CA  1  
ATOM 5841   C C   . HIS B 2 303 ? 65.902  13.011  -20.056 1.00 0.00 ? 303 HIS B C   1  
ATOM 5842   O O   . HIS B 2 303 ? 66.956  13.027  -19.519 1.00 0.00 ? 303 HIS B O   1  
ATOM 5843   C CB  . HIS B 2 303 ? 64.872  15.308  -20.347 1.00 0.00 ? 303 HIS B CB  1  
ATOM 5844   C CG  . HIS B 2 303 ? 64.889  16.624  -21.144 1.00 0.00 ? 303 HIS B CG  1  
ATOM 5845   N ND1 . HIS B 2 303 ? 64.192  16.995  -22.245 1.00 0.00 ? 303 HIS B ND1 1  
ATOM 5846   C CD2 . HIS B 2 303 ? 65.516  17.788  -20.678 1.00 0.00 ? 303 HIS B CD2 1  
ATOM 5847   C CE1 . HIS B 2 303 ? 64.273  18.370  -22.371 1.00 0.00 ? 303 HIS B CE1 1  
ATOM 5848   N NE2 . HIS B 2 303 ? 65.150  18.841  -21.463 1.00 0.00 ? 303 HIS B NE2 1  
ATOM 5849   N N   . LEU B 2 304 ? 65.001  12.006  -19.870 1.00 0.00 ? 304 LEU B N   1  
ATOM 5850   C CA  . LEU B 2 304 ? 65.195  10.824  -19.002 1.00 0.00 ? 304 LEU B CA  1  
ATOM 5851   C C   . LEU B 2 304 ? 66.390  10.065  -19.361 1.00 0.00 ? 304 LEU B C   1  
ATOM 5852   O O   . LEU B 2 304 ? 67.060  9.450   -18.508 1.00 0.00 ? 304 LEU B O   1  
ATOM 5853   C CB  . LEU B 2 304 ? 63.936  9.873   -18.865 1.00 0.00 ? 304 LEU B CB  1  
ATOM 5854   C CG  . LEU B 2 304 ? 62.567  10.283  -18.269 1.00 0.00 ? 304 LEU B CG  1  
ATOM 5855   C CD1 . LEU B 2 304 ? 61.537  9.106   -18.298 1.00 0.00 ? 304 LEU B CD1 1  
ATOM 5856   C CD2 . LEU B 2 304 ? 62.744  10.976  -16.921 1.00 0.00 ? 304 LEU B CD2 1  
ATOM 5857   N N   . GLU B 2 305 ? 66.746  10.031  -20.712 1.00 0.00 ? 305 GLU B N   1  
ATOM 5858   C CA  . GLU B 2 305 ? 67.962  9.326   -21.250 1.00 0.00 ? 305 GLU B CA  1  
ATOM 5859   C C   . GLU B 2 305 ? 69.324  9.809   -20.689 1.00 0.00 ? 305 GLU B C   1  
ATOM 5860   O O   . GLU B 2 305 ? 70.213  9.027   -20.520 1.00 0.00 ? 305 GLU B O   1  
ATOM 5861   C CB  . GLU B 2 305 ? 67.973  9.401   -22.783 1.00 0.00 ? 305 GLU B CB  1  
ATOM 5862   C CG  . GLU B 2 305 ? 66.745  8.735   -23.306 1.00 0.00 ? 305 GLU B CG  1  
ATOM 5863   C CD  . GLU B 2 305 ? 66.854  8.421   -24.831 1.00 0.00 ? 305 GLU B CD  1  
ATOM 5864   O OE1 . GLU B 2 305 ? 67.860  7.807   -25.290 1.00 0.00 ? 305 GLU B OE1 1  
ATOM 5865   O OE2 . GLU B 2 305 ? 65.905  8.747   -25.594 1.00 0.00 ? 305 GLU B OE2 1  
ATOM 5866   N N   . GLU B 2 306 ? 69.430  11.189  -20.489 1.00 0.00 ? 306 GLU B N   1  
ATOM 5867   C CA  . GLU B 2 306 ? 70.675  11.758  -20.164 1.00 0.00 ? 306 GLU B CA  1  
ATOM 5868   C C   . GLU B 2 306 ? 71.192  11.464  -18.835 1.00 0.00 ? 306 GLU B C   1  
ATOM 5869   O O   . GLU B 2 306 ? 72.413  11.286  -18.687 1.00 0.00 ? 306 GLU B O   1  
ATOM 5870   C CB  . GLU B 2 306 ? 70.471  13.276  -20.148 1.00 0.00 ? 306 GLU B CB  1  
ATOM 5871   C CG  . GLU B 2 306 ? 69.852  14.028  -21.328 1.00 0.00 ? 306 GLU B CG  1  
ATOM 5872   C CD  . GLU B 2 306 ? 70.096  15.570  -21.027 1.00 0.00 ? 306 GLU B CD  1  
ATOM 5873   O OE1 . GLU B 2 306 ? 71.264  16.005  -21.244 1.00 0.00 ? 306 GLU B OE1 1  
ATOM 5874   O OE2 . GLU B 2 306 ? 69.134  16.281  -20.546 1.00 0.00 ? 306 GLU B OE2 1  
ATOM 5875   N N   . LEU B 2 307 ? 70.283  11.441  -17.804 1.00 0.00 ? 307 LEU B N   1  
ATOM 5876   C CA  . LEU B 2 307 ? 70.702  11.567  -16.454 1.00 0.00 ? 307 LEU B CA  1  
ATOM 5877   C C   . LEU B 2 307 ? 69.874  10.510  -15.768 1.00 0.00 ? 307 LEU B C   1  
ATOM 5878   O O   . LEU B 2 307 ? 69.036  9.817   -16.423 1.00 0.00 ? 307 LEU B O   1  
ATOM 5879   C CB  . LEU B 2 307 ? 70.427  12.939  -15.903 1.00 0.00 ? 307 LEU B CB  1  
ATOM 5880   C CG  . LEU B 2 307 ? 71.317  14.111  -16.525 1.00 0.00 ? 307 LEU B CG  1  
ATOM 5881   C CD1 . LEU B 2 307 ? 70.753  15.468  -16.205 1.00 0.00 ? 307 LEU B CD1 1  
ATOM 5882   C CD2 . LEU B 2 307 ? 72.649  14.193  -15.838 1.00 0.00 ? 307 LEU B CD2 1  
ATOM 5883   N N   . SER B 2 308 ? 70.124  10.262  -14.408 1.00 0.00 ? 308 SER B N   1  
ATOM 5884   C CA  . SER B 2 308 ? 69.495  9.171   -13.744 1.00 0.00 ? 308 SER B CA  1  
ATOM 5885   C C   . SER B 2 308 ? 69.191  9.725   -12.378 1.00 0.00 ? 308 SER B C   1  
ATOM 5886   O O   . SER B 2 308 ? 70.079  10.346  -11.782 1.00 0.00 ? 308 SER B O   1  
ATOM 5887   C CB  . SER B 2 308 ? 70.340  7.916   -13.599 1.00 0.00 ? 308 SER B CB  1  
ATOM 5888   O OG  . SER B 2 308 ? 69.503  6.850   -13.102 1.00 0.00 ? 308 SER B OG  1  
ATOM 5889   N N   . GLY B 2 309 ? 67.995  9.420   -11.812 1.00 0.00 ? 309 GLY B N   1  
ATOM 5890   C CA  . GLY B 2 309 ? 67.684  9.610   -10.426 1.00 0.00 ? 309 GLY B CA  1  
ATOM 5891   C C   . GLY B 2 309 ? 67.053  10.972  -10.245 1.00 0.00 ? 309 GLY B C   1  
ATOM 5892   O O   . GLY B 2 309 ? 66.059  11.293  -10.906 1.00 0.00 ? 309 GLY B O   1  
ATOM 5893   N N   . ASP B 2 310 ? 67.611  11.745  -9.246  1.00 0.00 ? 310 ASP B N   1  
ATOM 5894   C CA  . ASP B 2 310 ? 67.193  13.010  -8.627  1.00 0.00 ? 310 ASP B CA  1  
ATOM 5895   C C   . ASP B 2 310 ? 67.268  14.188  -9.528  1.00 0.00 ? 310 ASP B C   1  
ATOM 5896   O O   . ASP B 2 310 ? 66.705  15.237  -9.271  1.00 0.00 ? 310 ASP B O   1  
ATOM 5897   C CB  . ASP B 2 310 ? 68.051  13.333  -7.357  1.00 0.00 ? 310 ASP B CB  1  
ATOM 5898   C CG  . ASP B 2 310 ? 67.860  12.198  -6.406  1.00 0.00 ? 310 ASP B CG  1  
ATOM 5899   O OD1 . ASP B 2 310 ? 66.757  12.000  -5.881  1.00 0.00 ? 310 ASP B OD1 1  
ATOM 5900   O OD2 . ASP B 2 310 ? 68.870  11.482  -6.056  1.00 0.00 ? 310 ASP B OD2 1  
ATOM 5901   N N   . THR B 2 311 ? 67.976  13.957  -10.651 1.00 0.00 ? 311 THR B N   1  
ATOM 5902   C CA  . THR B 2 311 ? 68.070  14.811  -11.791 1.00 0.00 ? 311 THR B CA  1  
ATOM 5903   C C   . THR B 2 311 ? 66.734  15.056  -12.442 1.00 0.00 ? 311 THR B C   1  
ATOM 5904   O O   . THR B 2 311 ? 66.543  16.179  -12.926 1.00 0.00 ? 311 THR B O   1  
ATOM 5905   C CB  . THR B 2 311 ? 69.010  14.125  -12.783 1.00 0.00 ? 311 THR B CB  1  
ATOM 5906   O OG1 . THR B 2 311 ? 68.471  12.841  -13.015 1.00 0.00 ? 311 THR B OG1 1  
ATOM 5907   C CG2 . THR B 2 311 ? 70.463  14.115  -12.179 1.00 0.00 ? 311 THR B CG2 1  
ATOM 5908   N N   . PHE B 2 312 ? 65.780  14.049  -12.482 1.00 0.00 ? 312 PHE B N   1  
ATOM 5909   C CA  . PHE B 2 312 ? 64.492  14.148  -12.992 1.00 0.00 ? 312 PHE B CA  1  
ATOM 5910   C C   . PHE B 2 312 ? 63.687  15.250  -12.343 1.00 0.00 ? 312 PHE B C   1  
ATOM 5911   O O   . PHE B 2 312 ? 62.967  15.873  -13.104 1.00 0.00 ? 312 PHE B O   1  
ATOM 5912   C CB  . PHE B 2 312 ? 63.612  12.798  -12.865 1.00 0.00 ? 312 PHE B CB  1  
ATOM 5913   C CG  . PHE B 2 312 ? 64.212  11.656  -13.671 1.00 0.00 ? 312 PHE B CG  1  
ATOM 5914   C CD1 . PHE B 2 312 ? 65.139  11.777  -14.662 1.00 0.00 ? 312 PHE B CD1 1  
ATOM 5915   C CD2 . PHE B 2 312 ? 63.978  10.348  -13.244 1.00 0.00 ? 312 PHE B CD2 1  
ATOM 5916   C CE1 . PHE B 2 312 ? 65.907  10.681  -15.161 1.00 0.00 ? 312 PHE B CE1 1  
ATOM 5917   C CE2 . PHE B 2 312 ? 64.676  9.254   -13.744 1.00 0.00 ? 312 PHE B CE2 1  
ATOM 5918   C CZ  . PHE B 2 312 ? 65.598  9.405   -14.765 1.00 0.00 ? 312 PHE B CZ  1  
ATOM 5919   N N   . LEU B 2 313 ? 63.818  15.495  -11.039 1.00 0.00 ? 313 LEU B N   1  
ATOM 5920   C CA  . LEU B 2 313 ? 63.088  16.489  -10.269 1.00 0.00 ? 313 LEU B CA  1  
ATOM 5921   C C   . LEU B 2 313 ? 63.387  17.908  -10.757 1.00 0.00 ? 313 LEU B C   1  
ATOM 5922   O O   . LEU B 2 313 ? 62.445  18.681  -10.800 1.00 0.00 ? 313 LEU B O   1  
ATOM 5923   C CB  . LEU B 2 313 ? 63.519  16.407  -8.766  1.00 0.00 ? 313 LEU B CB  1  
ATOM 5924   C CG  . LEU B 2 313 ? 63.323  15.054  -8.166  1.00 0.00 ? 313 LEU B CG  1  
ATOM 5925   C CD1 . LEU B 2 313 ? 64.095  14.861  -6.855  1.00 0.00 ? 313 LEU B CD1 1  
ATOM 5926   C CD2 . LEU B 2 313 ? 61.799  14.763  -8.003  1.00 0.00 ? 313 LEU B CD2 1  
ATOM 5927   N N   . ILE B 2 314 ? 64.700  18.169  -11.164 1.00 0.00 ? 314 ILE B N   1  
ATOM 5928   C CA  . ILE B 2 314 ? 65.201  19.379  -11.746 1.00 0.00 ? 314 ILE B CA  1  
ATOM 5929   C C   . ILE B 2 314 ? 64.517  19.537  -13.123 1.00 0.00 ? 314 ILE B C   1  
ATOM 5930   O O   . ILE B 2 314 ? 64.035  20.659  -13.462 1.00 0.00 ? 314 ILE B O   1  
ATOM 5931   C CB  . ILE B 2 314 ? 66.720  19.232  -11.992 1.00 0.00 ? 314 ILE B CB  1  
ATOM 5932   C CG1 . ILE B 2 314 ? 67.503  18.561  -10.834 1.00 0.00 ? 314 ILE B CG1 1  
ATOM 5933   C CG2 . ILE B 2 314 ? 67.142  20.740  -12.088 1.00 0.00 ? 314 ILE B CG2 1  
ATOM 5934   C CD1 . ILE B 2 314 ? 69.013  18.422  -11.094 1.00 0.00 ? 314 ILE B CD1 1  
ATOM 5935   N N   . GLU B 2 315 ? 64.465  18.474  -13.925 1.00 0.00 ? 315 GLU B N   1  
ATOM 5936   C CA  . GLU B 2 315 ? 63.935  18.422  -15.332 1.00 0.00 ? 315 GLU B CA  1  
ATOM 5937   C C   . GLU B 2 315 ? 62.478  18.777  -15.303 1.00 0.00 ? 315 GLU B C   1  
ATOM 5938   O O   . GLU B 2 315 ? 61.967  19.608  -15.977 1.00 0.00 ? 315 GLU B O   1  
ATOM 5939   C CB  . GLU B 2 315 ? 63.967  17.048  -16.100 1.00 0.00 ? 315 GLU B CB  1  
ATOM 5940   C CG  . GLU B 2 315 ? 65.427  16.747  -16.495 1.00 0.00 ? 315 GLU B CG  1  
ATOM 5941   C CD  . GLU B 2 315 ? 65.466  15.243  -16.759 1.00 0.00 ? 315 GLU B CD  1  
ATOM 5942   O OE1 . GLU B 2 315 ? 64.437  14.720  -17.308 1.00 0.00 ? 315 GLU B OE1 1  
ATOM 5943   O OE2 . GLU B 2 315 ? 66.546  14.670  -16.466 1.00 0.00 ? 315 GLU B OE2 1  
ATOM 5944   N N   . LEU B 2 316 ? 61.870  18.147  -14.249 1.00 0.00 ? 316 LEU B N   1  
ATOM 5945   C CA  . LEU B 2 316 ? 60.512  18.340  -13.877 1.00 0.00 ? 316 LEU B CA  1  
ATOM 5946   C C   . LEU B 2 316 ? 60.187  19.840  -13.452 1.00 0.00 ? 316 LEU B C   1  
ATOM 5947   O O   . LEU B 2 316 ? 59.162  20.394  -13.875 1.00 0.00 ? 316 LEU B O   1  
ATOM 5948   C CB  . LEU B 2 316 ? 60.118  17.347  -12.765 1.00 0.00 ? 316 LEU B CB  1  
ATOM 5949   C CG  . LEU B 2 316 ? 58.653  17.080  -12.569 1.00 0.00 ? 316 LEU B CG  1  
ATOM 5950   C CD1 . LEU B 2 316 ? 57.818  18.207  -11.959 1.00 0.00 ? 316 LEU B CD1 1  
ATOM 5951   C CD2 . LEU B 2 316 ? 58.009  16.403  -13.763 1.00 0.00 ? 316 LEU B CD2 1  
ATOM 5952   N N   . ASN B 2 317 ? 61.098  20.500  -12.674 1.00 0.00 ? 317 ASN B N   1  
ATOM 5953   C CA  . ASN B 2 317 ? 61.004  21.885  -12.093 1.00 0.00 ? 317 ASN B CA  1  
ATOM 5954   C C   . ASN B 2 317 ? 61.030  22.891  -13.213 1.00 0.00 ? 317 ASN B C   1  
ATOM 5955   O O   . ASN B 2 317 ? 60.151  23.732  -13.234 1.00 0.00 ? 317 ASN B O   1  
ATOM 5956   C CB  . ASN B 2 317 ? 62.177  22.065  -11.094 1.00 0.00 ? 317 ASN B CB  1  
ATOM 5957   C CG  . ASN B 2 317 ? 62.097  23.354  -10.171 1.00 0.00 ? 317 ASN B CG  1  
ATOM 5958   O OD1 . ASN B 2 317 ? 61.048  23.995  -10.217 1.00 0.00 ? 317 ASN B OD1 1  
ATOM 5959   N ND2 . ASN B 2 317 ? 63.214  23.710  -9.438  1.00 0.00 ? 317 ASN B ND2 1  
ATOM 5960   N N   . ILE B 2 318 ? 61.966  22.776  -14.198 1.00 0.00 ? 318 ILE B N   1  
ATOM 5961   C CA  . ILE B 2 318 ? 62.068  23.699  -15.373 1.00 0.00 ? 318 ILE B CA  1  
ATOM 5962   C C   . ILE B 2 318 ? 60.840  23.561  -16.182 1.00 0.00 ? 318 ILE B C   1  
ATOM 5963   O O   . ILE B 2 318 ? 60.369  24.574  -16.704 1.00 0.00 ? 318 ILE B O   1  
ATOM 5964   C CB  . ILE B 2 318 ? 63.319  23.239  -16.154 1.00 0.00 ? 318 ILE B CB  1  
ATOM 5965   C CG1 . ILE B 2 318 ? 64.692  23.510  -15.567 1.00 0.00 ? 318 ILE B CG1 1  
ATOM 5966   C CG2 . ILE B 2 318 ? 63.127  23.738  -17.637 1.00 0.00 ? 318 ILE B CG2 1  
ATOM 5967   C CD1 . ILE B 2 318 ? 65.857  23.006  -16.436 1.00 0.00 ? 318 ILE B CD1 1  
ATOM 5968   N N   . PHE B 2 319 ? 60.316  22.375  -16.473 1.00 0.00 ? 319 PHE B N   1  
ATOM 5969   C CA  . PHE B 2 319 ? 59.121  22.164  -17.293 1.00 0.00 ? 319 PHE B CA  1  
ATOM 5970   C C   . PHE B 2 319 ? 57.858  22.838  -16.689 1.00 0.00 ? 319 PHE B C   1  
ATOM 5971   O O   . PHE B 2 319 ? 57.076  23.379  -17.465 1.00 0.00 ? 319 PHE B O   1  
ATOM 5972   C CB  . PHE B 2 319 ? 58.626  20.709  -17.533 1.00 0.00 ? 319 PHE B CB  1  
ATOM 5973   C CG  . PHE B 2 319 ? 59.367  19.874  -18.470 1.00 0.00 ? 319 PHE B CG  1  
ATOM 5974   C CD1 . PHE B 2 319 ? 60.532  20.274  -19.145 1.00 0.00 ? 319 PHE B CD1 1  
ATOM 5975   C CD2 . PHE B 2 319 ? 58.869  18.584  -18.736 1.00 0.00 ? 319 PHE B CD2 1  
ATOM 5976   C CE1 . PHE B 2 319 ? 61.123  19.347  -20.067 1.00 0.00 ? 319 PHE B CE1 1  
ATOM 5977   C CE2 . PHE B 2 319 ? 59.469  17.797  -19.726 1.00 0.00 ? 319 PHE B CE2 1  
ATOM 5978   C CZ  . PHE B 2 319 ? 60.617  18.132  -20.380 1.00 0.00 ? 319 PHE B CZ  1  
ATOM 5979   N N   . LYS B 2 320 ? 57.692  22.755  -15.328 1.00 0.00 ? 320 LYS B N   1  
ATOM 5980   C CA  . LYS B 2 320 ? 56.533  23.340  -14.551 1.00 0.00 ? 320 LYS B CA  1  
ATOM 5981   C C   . LYS B 2 320 ? 56.544  24.887  -14.762 1.00 0.00 ? 320 LYS B C   1  
ATOM 5982   O O   . LYS B 2 320 ? 55.451  25.510  -14.884 1.00 0.00 ? 320 LYS B O   1  
ATOM 5983   C CB  . LYS B 2 320 ? 56.544  23.107  -13.052 1.00 0.00 ? 320 LYS B CB  1  
ATOM 5984   C CG  . LYS B 2 320 ? 55.337  23.645  -12.213 1.00 0.00 ? 320 LYS B CG  1  
ATOM 5985   C CD  . LYS B 2 320 ? 55.667  24.114  -10.827 1.00 0.00 ? 320 LYS B CD  1  
ATOM 5986   C CE  . LYS B 2 320 ? 54.510  24.445  -9.939  1.00 0.00 ? 320 LYS B CE  1  
ATOM 5987   N NZ  . LYS B 2 320 ? 54.698  24.666  -8.481  1.00 0.00 ? 320 LYS B NZ  1  
ATOM 5988   N N   . SER B 2 321 ? 57.788  25.489  -14.919 1.00 0.00 ? 321 SER B N   1  
ATOM 5989   C CA  . SER B 2 321 ? 57.992  26.899  -15.076 1.00 0.00 ? 321 SER B CA  1  
ATOM 5990   C C   . SER B 2 321 ? 57.332  27.385  -16.364 1.00 0.00 ? 321 SER B C   1  
ATOM 5991   O O   . SER B 2 321 ? 56.729  28.443  -16.332 1.00 0.00 ? 321 SER B O   1  
ATOM 5992   C CB  . SER B 2 321 ? 59.490  27.315  -15.067 1.00 0.00 ? 321 SER B CB  1  
ATOM 5993   O OG  . SER B 2 321 ? 60.127  26.801  -13.857 1.00 0.00 ? 321 SER B OG  1  
ATOM 5994   N N   . HIS B 2 322 ? 57.321  26.622  -17.440 1.00 0.00 ? 322 HIS B N   1  
ATOM 5995   C CA  . HIS B 2 322 ? 56.632  27.025  -18.611 1.00 0.00 ? 322 HIS B CA  1  
ATOM 5996   C C   . HIS B 2 322 ? 55.132  27.051  -18.466 1.00 0.00 ? 322 HIS B C   1  
ATOM 5997   O O   . HIS B 2 322 ? 54.554  26.118  -17.938 1.00 0.00 ? 322 HIS B O   1  
ATOM 5998   C CB  . HIS B 2 322 ? 56.881  26.149  -19.810 1.00 0.00 ? 322 HIS B CB  1  
ATOM 5999   C CG  . HIS B 2 322 ? 58.326  26.130  -20.209 1.00 0.00 ? 322 HIS B CG  1  
ATOM 6000   N ND1 . HIS B 2 322 ? 59.105  27.292  -20.337 1.00 0.00 ? 322 HIS B ND1 1  
ATOM 6001   C CD2 . HIS B 2 322 ? 59.223  25.057  -20.363 1.00 0.00 ? 322 HIS B CD2 1  
ATOM 6002   C CE1 . HIS B 2 322 ? 60.373  26.859  -20.540 1.00 0.00 ? 322 HIS B CE1 1  
ATOM 6003   N NE2 . HIS B 2 322 ? 60.515  25.571  -20.577 1.00 0.00 ? 322 HIS B NE2 1  
ATOM 6004   N N   . GLY B 2 323 ? 54.489  28.072  -19.049 1.00 0.00 ? 323 GLY B N   1  
ATOM 6005   C CA  . GLY B 2 323 ? 53.055  28.363  -18.971 1.00 0.00 ? 323 GLY B CA  1  
ATOM 6006   C C   . GLY B 2 323 ? 52.162  27.283  -19.539 1.00 0.00 ? 323 GLY B C   1  
ATOM 6007   O O   . GLY B 2 323 ? 52.746  26.352  -20.111 1.00 0.00 ? 323 GLY B O   1  
ATOM 6008   N N   . ASP B 2 324 ? 50.826  27.435  -19.514 1.00 0.00 ? 324 ASP B N   1  
ATOM 6009   C CA  . ASP B 2 324 ? 49.813  26.510  -19.890 1.00 0.00 ? 324 ASP B CA  1  
ATOM 6010   C C   . ASP B 2 324 ? 49.382  25.605  -18.753 1.00 0.00 ? 324 ASP B C   1  
ATOM 6011   O O   . ASP B 2 324 ? 50.190  24.868  -18.234 1.00 0.00 ? 324 ASP B O   1  
ATOM 6012   C CB  . ASP B 2 324 ? 50.048  25.552  -21.061 1.00 0.00 ? 324 ASP B CB  1  
ATOM 6013   C CG  . ASP B 2 324 ? 50.397  26.357  -22.332 1.00 0.00 ? 324 ASP B CG  1  
ATOM 6014   O OD1 . ASP B 2 324 ? 49.735  27.392  -22.633 1.00 0.00 ? 324 ASP B OD1 1  
ATOM 6015   O OD2 . ASP B 2 324 ? 51.393  25.999  -23.082 1.00 0.00 ? 324 ASP B OD2 1  
ATOM 6016   N N   . LEU B 2 325 ? 48.058  25.581  -18.506 1.00 0.00 ? 325 LEU B N   1  
ATOM 6017   C CA  . LEU B 2 325 ? 47.336  24.890  -17.386 1.00 0.00 ? 325 LEU B CA  1  
ATOM 6018   C C   . LEU B 2 325 ? 47.733  23.442  -17.448 1.00 0.00 ? 325 LEU B C   1  
ATOM 6019   O O   . LEU B 2 325 ? 47.978  22.799  -16.364 1.00 0.00 ? 325 LEU B O   1  
ATOM 6020   C CB  . LEU B 2 325 ? 45.800  25.047  -17.412 1.00 0.00 ? 325 LEU B CB  1  
ATOM 6021   C CG  . LEU B 2 325 ? 45.011  24.720  -18.746 1.00 0.00 ? 325 LEU B CG  1  
ATOM 6022   C CD1 . LEU B 2 325 ? 43.635  24.082  -18.383 1.00 0.00 ? 325 LEU B CD1 1  
ATOM 6023   C CD2 . LEU B 2 325 ? 44.904  25.922  -19.726 1.00 0.00 ? 325 LEU B CD2 1  
ATOM 6024   N N   . THR B 2 326 ? 47.810  22.810  -18.648 1.00 0.00 ? 326 THR B N   1  
ATOM 6025   C CA  . THR B 2 326 ? 48.129  21.407  -18.775 1.00 0.00 ? 326 THR B CA  1  
ATOM 6026   C C   . THR B 2 326 ? 49.522  20.967  -18.302 1.00 0.00 ? 326 THR B C   1  
ATOM 6027   O O   . THR B 2 326 ? 49.716  19.903  -17.736 1.00 0.00 ? 326 THR B O   1  
ATOM 6028   C CB  . THR B 2 326 ? 47.934  20.960  -20.206 1.00 0.00 ? 326 THR B CB  1  
ATOM 6029   O OG1 . THR B 2 326 ? 48.799  21.599  -21.132 1.00 0.00 ? 326 THR B OG1 1  
ATOM 6030   C CG2 . THR B 2 326 ? 46.470  21.126  -20.713 1.00 0.00 ? 326 THR B CG2 1  
ATOM 6031   N N   . ILE B 2 327 ? 50.541  21.761  -18.709 1.00 0.00 ? 327 ILE B N   1  
ATOM 6032   C CA  . ILE B 2 327 ? 51.938  21.300  -18.591 1.00 0.00 ? 327 ILE B CA  1  
ATOM 6033   C C   . ILE B 2 327 ? 52.307  21.177  -17.146 1.00 0.00 ? 327 ILE B C   1  
ATOM 6034   O O   . ILE B 2 327 ? 52.867  20.169  -16.703 1.00 0.00 ? 327 ILE B O   1  
ATOM 6035   C CB  . ILE B 2 327 ? 52.853  22.271  -19.313 1.00 0.00 ? 327 ILE B CB  1  
ATOM 6036   C CG1 . ILE B 2 327 ? 52.326  22.511  -20.757 1.00 0.00 ? 327 ILE B CG1 1  
ATOM 6037   C CG2 . ILE B 2 327 ? 54.346  21.835  -19.099 1.00 0.00 ? 327 ILE B CG2 1  
ATOM 6038   C CD1 . ILE B 2 327 ? 53.182  23.485  -21.584 1.00 0.00 ? 327 ILE B CD1 1  
ATOM 6039   N N   . ARG B 2 328 ? 51.942  22.138  -16.361 1.00 0.00 ? 328 ARG B N   1  
ATOM 6040   C CA  . ARG B 2 328 ? 52.120  22.193  -14.965 1.00 0.00 ? 328 ARG B CA  1  
ATOM 6041   C C   . ARG B 2 328 ? 51.454  21.043  -14.259 1.00 0.00 ? 328 ARG B C   1  
ATOM 6042   O O   . ARG B 2 328 ? 52.050  20.414  -13.367 1.00 0.00 ? 328 ARG B O   1  
ATOM 6043   C CB  . ARG B 2 328 ? 51.603  23.543  -14.361 1.00 0.00 ? 328 ARG B CB  1  
ATOM 6044   C CG  . ARG B 2 328 ? 52.086  24.852  -15.042 1.00 0.00 ? 328 ARG B CG  1  
ATOM 6045   C CD  . ARG B 2 328 ? 51.300  26.121  -14.456 1.00 0.00 ? 328 ARG B CD  1  
ATOM 6046   N NE  . ARG B 2 328 ? 52.123  27.225  -14.888 1.00 0.00 ? 328 ARG B NE  1  
ATOM 6047   C CZ  . ARG B 2 328 ? 52.331  28.399  -14.280 1.00 0.00 ? 328 ARG B CZ  1  
ATOM 6048   N NH1 . ARG B 2 328 ? 51.627  28.706  -13.127 1.00 0.00 ? 328 ARG B NH1 1  
ATOM 6049   N NH2 . ARG B 2 328 ? 53.370  29.169  -14.661 1.00 0.00 ? 328 ARG B NH2 1  
ATOM 6050   N N   . LYS B 2 329 ? 50.155  20.674  -14.673 1.00 0.00 ? 329 LYS B N   1  
ATOM 6051   C CA  . LYS B 2 329 ? 49.385  19.629  -14.137 1.00 0.00 ? 329 LYS B CA  1  
ATOM 6052   C C   . LYS B 2 329 ? 50.004  18.292  -14.354 1.00 0.00 ? 329 LYS B C   1  
ATOM 6053   O O   . LYS B 2 329 ? 50.093  17.571  -13.319 1.00 0.00 ? 329 LYS B O   1  
ATOM 6054   C CB  . LYS B 2 329 ? 47.955  19.571  -14.839 1.00 0.00 ? 329 LYS B CB  1  
ATOM 6055   C CG  . LYS B 2 329 ? 46.878  18.656  -14.171 1.00 0.00 ? 329 LYS B CG  1  
ATOM 6056   C CD  . LYS B 2 329 ? 46.378  19.061  -12.841 1.00 0.00 ? 329 LYS B CD  1  
ATOM 6057   C CE  . LYS B 2 329 ? 45.150  18.377  -12.208 1.00 0.00 ? 329 LYS B CE  1  
ATOM 6058   N NZ  . LYS B 2 329 ? 44.123  18.366  -13.294 1.00 0.00 ? 329 LYS B NZ  1  
ATOM 6059   N N   . ILE B 2 330 ? 50.469  18.087  -15.591 1.00 0.00 ? 330 ILE B N   1  
ATOM 6060   C CA  . ILE B 2 330 ? 51.129  16.868  -15.947 1.00 0.00 ? 330 ILE B CA  1  
ATOM 6061   C C   . ILE B 2 330 ? 52.420  16.733  -15.170 1.00 0.00 ? 330 ILE B C   1  
ATOM 6062   O O   . ILE B 2 330 ? 52.628  15.665  -14.591 1.00 0.00 ? 330 ILE B O   1  
ATOM 6063   C CB  . ILE B 2 330 ? 51.493  16.719  -17.401 1.00 0.00 ? 330 ILE B CB  1  
ATOM 6064   C CG1 . ILE B 2 330 ? 50.253  16.263  -18.143 1.00 0.00 ? 330 ILE B CG1 1  
ATOM 6065   C CG2 . ILE B 2 330 ? 52.650  15.697  -17.594 1.00 0.00 ? 330 ILE B CG2 1  
ATOM 6066   C CD1 . ILE B 2 330 ? 50.463  16.063  -19.654 1.00 0.00 ? 330 ILE B CD1 1  
ATOM 6067   N N   . ALA B 2 331 ? 53.197  17.795  -15.038 1.00 0.00 ? 331 ALA B N   1  
ATOM 6068   C CA  . ALA B 2 331 ? 54.372  17.808  -14.240 1.00 0.00 ? 331 ALA B CA  1  
ATOM 6069   C C   . ALA B 2 331 ? 54.117  17.539  -12.758 1.00 0.00 ? 331 ALA B C   1  
ATOM 6070   O O   . ALA B 2 331 ? 54.906  16.711  -12.238 1.00 0.00 ? 331 ALA B O   1  
ATOM 6071   C CB  . ALA B 2 331 ? 55.236  19.095  -14.477 1.00 0.00 ? 331 ALA B CB  1  
ATOM 6072   N N   . THR B 2 332 ? 53.097  18.072  -12.120 1.00 0.00 ? 332 THR B N   1  
ATOM 6073   C CA  . THR B 2 332 ? 52.741  17.809  -10.757 1.00 0.00 ? 332 THR B CA  1  
ATOM 6074   C C   . THR B 2 332 ? 52.359  16.454  -10.461 1.00 0.00 ? 332 THR B C   1  
ATOM 6075   O O   . THR B 2 332 ? 52.815  15.907  -9.428  1.00 0.00 ? 332 THR B O   1  
ATOM 6076   C CB  . THR B 2 332 ? 51.559  18.648  -10.254 1.00 0.00 ? 332 THR B CB  1  
ATOM 6077   O OG1 . THR B 2 332 ? 51.824  20.007  -10.409 1.00 0.00 ? 332 THR B OG1 1  
ATOM 6078   C CG2 . THR B 2 332 ? 51.168  18.587  -8.707  1.00 0.00 ? 332 THR B CG2 1  
ATOM 6079   N N   . ASN B 2 333 ? 51.606  15.716  -11.324 1.00 0.00 ? 333 ASN B N   1  
ATOM 6080   C CA  . ASN B 2 333 ? 51.315  14.343  -11.140 1.00 0.00 ? 333 ASN B CA  1  
ATOM 6081   C C   . ASN B 2 333 ? 52.485  13.296  -11.093 1.00 0.00 ? 333 ASN B C   1  
ATOM 6082   O O   . ASN B 2 333 ? 52.590  12.370  -10.238 1.00 0.00 ? 333 ASN B O   1  
ATOM 6083   C CB  . ASN B 2 333 ? 50.203  14.006  -12.162 1.00 0.00 ? 333 ASN B CB  1  
ATOM 6084   C CG  . ASN B 2 333 ? 49.528  12.633  -11.998 1.00 0.00 ? 333 ASN B CG  1  
ATOM 6085   O OD1 . ASN B 2 333 ? 48.464  12.437  -11.377 1.00 0.00 ? 333 ASN B OD1 1  
ATOM 6086   N ND2 . ASN B 2 333 ? 50.195  11.642  -12.650 1.00 0.00 ? 333 ASN B ND2 1  
ATOM 6087   N N   . LEU B 2 334 ? 53.439  13.604  -11.989 1.00 0.00 ? 334 LEU B N   1  
ATOM 6088   C CA  . LEU B 2 334 ? 54.782  12.862  -11.966 1.00 0.00 ? 334 LEU B CA  1  
ATOM 6089   C C   . LEU B 2 334 ? 55.498  13.143  -10.616 1.00 0.00 ? 334 LEU B C   1  
ATOM 6090   O O   . LEU B 2 334 ? 56.137  12.268  -10.054 1.00 0.00 ? 334 LEU B O   1  
ATOM 6091   C CB  . LEU B 2 334 ? 55.600  13.373  -13.145 1.00 0.00 ? 334 LEU B CB  1  
ATOM 6092   C CG  . LEU B 2 334 ? 55.300  12.670  -14.465 1.00 0.00 ? 334 LEU B CG  1  
ATOM 6093   C CD1 . LEU B 2 334 ? 53.776  12.254  -14.810 1.00 0.00 ? 334 LEU B CD1 1  
ATOM 6094   C CD2 . LEU B 2 334 ? 55.816  13.439  -15.755 1.00 0.00 ? 334 LEU B CD2 1  
ATOM 6095   N N   . PHE B 2 335 ? 55.422  14.423  -10.156 1.00 0.00 ? 335 PHE B N   1  
ATOM 6096   C CA  . PHE B 2 335 ? 56.052  14.855  -9.006  1.00 0.00 ? 335 PHE B CA  1  
ATOM 6097   C C   . PHE B 2 335 ? 55.577  14.149  -7.744  1.00 0.00 ? 335 PHE B C   1  
ATOM 6098   O O   . PHE B 2 335 ? 56.417  13.718  -6.979  1.00 0.00 ? 335 PHE B O   1  
ATOM 6099   C CB  . PHE B 2 335 ? 56.073  16.438  -8.844  1.00 0.00 ? 335 PHE B CB  1  
ATOM 6100   C CG  . PHE B 2 335 ? 57.179  16.941  -7.921  1.00 0.00 ? 335 PHE B CG  1  
ATOM 6101   C CD1 . PHE B 2 335 ? 58.470  17.069  -8.496  1.00 0.00 ? 335 PHE B CD1 1  
ATOM 6102   C CD2 . PHE B 2 335 ? 56.829  17.488  -6.697  1.00 0.00 ? 335 PHE B CD2 1  
ATOM 6103   C CE1 . PHE B 2 335 ? 59.455  17.765  -7.789  1.00 0.00 ? 335 PHE B CE1 1  
ATOM 6104   C CE2 . PHE B 2 335 ? 57.852  18.003  -5.924  1.00 0.00 ? 335 PHE B CE2 1  
ATOM 6105   C CZ  . PHE B 2 335 ? 59.126  18.095  -6.478  1.00 0.00 ? 335 PHE B CZ  1  
ATOM 6106   N N   . ASN B 2 336 ? 54.211  14.034  -7.554  1.00 0.00 ? 336 ASN B N   1  
ATOM 6107   C CA  . ASN B 2 336 ? 53.632  13.447  -6.343  1.00 0.00 ? 336 ASN B CA  1  
ATOM 6108   C C   . ASN B 2 336 ? 54.169  12.095  -6.212  1.00 0.00 ? 336 ASN B C   1  
ATOM 6109   O O   . ASN B 2 336 ? 54.579  11.756  -5.088  1.00 0.00 ? 336 ASN B O   1  
ATOM 6110   C CB  . ASN B 2 336 ? 52.094  13.395  -6.517  1.00 0.00 ? 336 ASN B CB  1  
ATOM 6111   C CG  . ASN B 2 336 ? 51.551  14.773  -6.395  1.00 0.00 ? 336 ASN B CG  1  
ATOM 6112   O OD1 . ASN B 2 336 ? 52.197  15.651  -5.777  1.00 0.00 ? 336 ASN B OD1 1  
ATOM 6113   N ND2 . ASN B 2 336 ? 50.315  14.981  -6.861  1.00 0.00 ? 336 ASN B ND2 1  
ATOM 6114   N N   . SER B 2 337 ? 54.306  11.292  -7.334  1.00 0.00 ? 337 SER B N   1  
ATOM 6115   C CA  . SER B 2 337 ? 54.902  10.038  -7.241  1.00 0.00 ? 337 SER B CA  1  
ATOM 6116   C C   . SER B 2 337 ? 56.425  9.915   -6.875  1.00 0.00 ? 337 SER B C   1  
ATOM 6117   O O   . SER B 2 337 ? 56.788  9.148   -5.981  1.00 0.00 ? 337 SER B O   1  
ATOM 6118   C CB  . SER B 2 337 ? 54.573  9.114   -8.458  1.00 0.00 ? 337 SER B CB  1  
ATOM 6119   O OG  . SER B 2 337 ? 54.987  9.632   -9.716  1.00 0.00 ? 337 SER B OG  1  
ATOM 6120   N N   . MET B 2 338 ? 57.284  10.788  -7.447  1.00 0.00 ? 338 MET B N   1  
ATOM 6121   C CA  . MET B 2 338 ? 58.632  10.791  -7.153  1.00 0.00 ? 338 MET B CA  1  
ATOM 6122   C C   . MET B 2 338 ? 58.988  11.211  -5.752  1.00 0.00 ? 338 MET B C   1  
ATOM 6123   O O   . MET B 2 338 ? 59.844  10.589  -5.113  1.00 0.00 ? 338 MET B O   1  
ATOM 6124   C CB  . MET B 2 338 ? 59.329  11.836  -7.986  1.00 0.00 ? 338 MET B CB  1  
ATOM 6125   C CG  . MET B 2 338 ? 59.558  11.282  -9.434  1.00 0.00 ? 338 MET B CG  1  
ATOM 6126   S SD  . MET B 2 338 ? 60.664  12.080  -10.530 1.00 0.00 ? 338 MET B SD  1  
ATOM 6127   C CE  . MET B 2 338 ? 59.613  13.481  -11.070 1.00 0.00 ? 338 MET B CE  1  
ATOM 6128   N N   . ILE B 2 339 ? 58.331  12.277  -5.226  1.00 0.00 ? 339 ILE B N   1  
ATOM 6129   C CA  . ILE B 2 339 ? 58.548  12.846  -3.960  1.00 0.00 ? 339 ILE B CA  1  
ATOM 6130   C C   . ILE B 2 339 ? 58.236  11.879  -2.803  1.00 0.00 ? 339 ILE B C   1  
ATOM 6131   O O   . ILE B 2 339 ? 58.920  11.916  -1.736  1.00 0.00 ? 339 ILE B O   1  
ATOM 6132   C CB  . ILE B 2 339 ? 57.972  14.313  -3.781  1.00 0.00 ? 339 ILE B CB  1  
ATOM 6133   C CG1 . ILE B 2 339 ? 58.713  15.153  -2.716  1.00 0.00 ? 339 ILE B CG1 1  
ATOM 6134   C CG2 . ILE B 2 339 ? 56.442  14.221  -3.475  1.00 0.00 ? 339 ILE B CG2 1  
ATOM 6135   C CD1 . ILE B 2 339 ? 58.157  16.576  -2.540  1.00 0.00 ? 339 ILE B CD1 1  
ATOM 6136   N N   . SER B 2 340 ? 57.196  10.996  -3.033  1.00 0.00 ? 340 SER B N   1  
ATOM 6137   C CA  . SER B 2 340 ? 56.889  10.001  -2.025  1.00 0.00 ? 340 SER B CA  1  
ATOM 6138   C C   . SER B 2 340 ? 58.060  9.077   -1.654  1.00 0.00 ? 340 SER B C   1  
ATOM 6139   O O   . SER B 2 340 ? 58.353  8.708   -0.536  1.00 0.00 ? 340 SER B O   1  
ATOM 6140   C CB  . SER B 2 340 ? 55.776  8.999   -2.427  1.00 0.00 ? 340 SER B CB  1  
ATOM 6141   O OG  . SER B 2 340 ? 54.642  9.729   -2.857  1.00 0.00 ? 340 SER B OG  1  
ATOM 6142   N N   . LEU B 2 341 ? 58.811  8.775   -2.741  1.00 0.00 ? 341 LEU B N   1  
ATOM 6143   C CA  . LEU B 2 341 ? 60.027  8.067   -2.722  1.00 0.00 ? 341 LEU B CA  1  
ATOM 6144   C C   . LEU B 2 341 ? 61.167  8.791   -1.988  1.00 0.00 ? 341 LEU B C   1  
ATOM 6145   O O   . LEU B 2 341 ? 61.892  8.175   -1.176  1.00 0.00 ? 341 LEU B O   1  
ATOM 6146   C CB  . LEU B 2 341 ? 60.476  7.650   -4.126  1.00 0.00 ? 341 LEU B CB  1  
ATOM 6147   C CG  . LEU B 2 341 ? 59.344  7.193   -5.020  1.00 0.00 ? 341 LEU B CG  1  
ATOM 6148   C CD1 . LEU B 2 341 ? 59.914  6.910   -6.418  1.00 0.00 ? 341 LEU B CD1 1  
ATOM 6149   C CD2 . LEU B 2 341 ? 58.727  5.907   -4.487  1.00 0.00 ? 341 LEU B CD2 1  
ATOM 6150   N N   . TYR B 2 342 ? 61.342  10.130  -2.199  1.00 0.00 ? 342 TYR B N   1  
ATOM 6151   C CA  . TYR B 2 342 ? 62.387  10.920  -1.517  1.00 0.00 ? 342 TYR B CA  1  
ATOM 6152   C C   . TYR B 2 342 ? 62.214  10.943  -0.052  1.00 0.00 ? 342 TYR B C   1  
ATOM 6153   O O   . TYR B 2 342 ? 63.143  10.736  0.745   1.00 0.00 ? 342 TYR B O   1  
ATOM 6154   C CB  . TYR B 2 342 ? 62.461  12.308  -2.249  1.00 0.00 ? 342 TYR B CB  1  
ATOM 6155   C CG  . TYR B 2 342 ? 63.304  13.296  -1.467  1.00 0.00 ? 342 TYR B CG  1  
ATOM 6156   C CD1 . TYR B 2 342 ? 64.735  13.302  -1.631  1.00 0.00 ? 342 TYR B CD1 1  
ATOM 6157   C CD2 . TYR B 2 342 ? 62.743  14.099  -0.484  1.00 0.00 ? 342 TYR B CD2 1  
ATOM 6158   C CE1 . TYR B 2 342 ? 65.493  14.021  -0.687  1.00 0.00 ? 342 TYR B CE1 1  
ATOM 6159   C CE2 . TYR B 2 342 ? 63.559  14.819  0.371   1.00 0.00 ? 342 TYR B CE2 1  
ATOM 6160   C CZ  . TYR B 2 342 ? 64.939  14.825  0.281   1.00 0.00 ? 342 TYR B CZ  1  
ATOM 6161   O OH  . TYR B 2 342 ? 65.816  15.441  1.188   1.00 0.00 ? 342 TYR B OH  1  
ATOM 6162   N N   . TYR B 2 343 ? 60.968  11.123  0.366   1.00 0.00 ? 343 TYR B N   1  
ATOM 6163   C CA  . TYR B 2 343 ? 60.543  11.228  1.737   1.00 0.00 ? 343 TYR B CA  1  
ATOM 6164   C C   . TYR B 2 343 ? 60.882  9.973   2.551   1.00 0.00 ? 343 TYR B C   1  
ATOM 6165   O O   . TYR B 2 343 ? 61.443  10.069  3.671   1.00 0.00 ? 343 TYR B O   1  
ATOM 6166   C CB  . TYR B 2 343 ? 59.058  11.594  1.898   1.00 0.00 ? 343 TYR B CB  1  
ATOM 6167   C CG  . TYR B 2 343 ? 58.843  13.066  1.378   1.00 0.00 ? 343 TYR B CG  1  
ATOM 6168   C CD1 . TYR B 2 343 ? 59.679  14.175  1.718   1.00 0.00 ? 343 TYR B CD1 1  
ATOM 6169   C CD2 . TYR B 2 343 ? 57.628  13.252  0.650   1.00 0.00 ? 343 TYR B CD2 1  
ATOM 6170   C CE1 . TYR B 2 343 ? 59.172  15.420  1.414   1.00 0.00 ? 343 TYR B CE1 1  
ATOM 6171   C CE2 . TYR B 2 343 ? 57.168  14.487  0.306   1.00 0.00 ? 343 TYR B CE2 1  
ATOM 6172   C CZ  . TYR B 2 343 ? 57.964  15.570  0.728   1.00 0.00 ? 343 TYR B CZ  1  
ATOM 6173   O OH  . TYR B 2 343 ? 57.460  16.852  0.375   1.00 0.00 ? 343 TYR B OH  1  
ATOM 6174   N N   . GLU B 2 344 ? 60.672  8.840   1.892   1.00 0.00 ? 344 GLU B N   1  
ATOM 6175   C CA  . GLU B 2 344 ? 61.097  7.527   2.385   1.00 0.00 ? 344 GLU B CA  1  
ATOM 6176   C C   . GLU B 2 344 ? 62.566  7.369   2.576   1.00 0.00 ? 344 GLU B C   1  
ATOM 6177   O O   . GLU B 2 344 ? 63.100  6.898   3.596   1.00 0.00 ? 344 GLU B O   1  
ATOM 6178   C CB  . GLU B 2 344 ? 60.507  6.403   1.538   1.00 0.00 ? 344 GLU B CB  1  
ATOM 6179   C CG  . GLU B 2 344 ? 60.892  5.004   1.993   1.00 0.00 ? 344 GLU B CG  1  
ATOM 6180   C CD  . GLU B 2 344 ? 60.366  4.738   3.513   1.00 0.00 ? 344 GLU B CD  1  
ATOM 6181   O OE1 . GLU B 2 344 ? 59.128  4.807   3.752   1.00 0.00 ? 344 GLU B OE1 1  
ATOM 6182   O OE2 . GLU B 2 344 ? 61.281  4.515   4.333   1.00 0.00 ? 344 GLU B OE2 1  
ATOM 6183   N N   . TYR B 2 345 ? 63.411  7.804   1.558   1.00 0.00 ? 345 TYR B N   1  
ATOM 6184   C CA  . TYR B 2 345 ? 64.854  7.690   1.510   1.00 0.00 ? 345 TYR B CA  1  
ATOM 6185   C C   . TYR B 2 345 ? 65.455  8.533   2.582   1.00 0.00 ? 345 TYR B C   1  
ATOM 6186   O O   . TYR B 2 345 ? 66.332  8.110   3.276   1.00 0.00 ? 345 TYR B O   1  
ATOM 6187   C CB  . TYR B 2 345 ? 65.400  8.276   0.150   1.00 0.00 ? 345 TYR B CB  1  
ATOM 6188   C CG  . TYR B 2 345 ? 64.896  7.435   -1.035  1.00 0.00 ? 345 TYR B CG  1  
ATOM 6189   C CD1 . TYR B 2 345 ? 64.670  6.036   -0.884  1.00 0.00 ? 345 TYR B CD1 1  
ATOM 6190   C CD2 . TYR B 2 345 ? 64.721  8.069   -2.308  1.00 0.00 ? 345 TYR B CD2 1  
ATOM 6191   C CE1 . TYR B 2 345 ? 64.140  5.327   -1.926  1.00 0.00 ? 345 TYR B CE1 1  
ATOM 6192   C CE2 . TYR B 2 345 ? 64.192  7.367   -3.383  1.00 0.00 ? 345 TYR B CE2 1  
ATOM 6193   C CZ  . TYR B 2 345 ? 63.892  5.971   -3.152  1.00 0.00 ? 345 TYR B CZ  1  
ATOM 6194   O OH  . TYR B 2 345 ? 63.664  5.138   -4.241  1.00 0.00 ? 345 TYR B OH  1  
ATOM 6195   N N   . LEU B 2 346 ? 64.921  9.756   2.781   1.00 0.00 ? 346 LEU B N   1  
ATOM 6196   C CA  . LEU B 2 346 ? 65.231  10.704  3.788   1.00 0.00 ? 346 LEU B CA  1  
ATOM 6197   C C   . LEU B 2 346 ? 64.934  10.052  5.159   1.00 0.00 ? 346 LEU B C   1  
ATOM 6198   O O   . LEU B 2 346 ? 65.795  10.246  6.049   1.00 0.00 ? 346 LEU B O   1  
ATOM 6199   C CB  . LEU B 2 346 ? 64.421  12.015  3.549   1.00 0.00 ? 346 LEU B CB  1  
ATOM 6200   C CG  . LEU B 2 346 ? 64.450  12.997  4.772   1.00 0.00 ? 346 LEU B CG  1  
ATOM 6201   C CD1 . LEU B 2 346 ? 65.839  13.605  4.934   1.00 0.00 ? 346 LEU B CD1 1  
ATOM 6202   C CD2 . LEU B 2 346 ? 63.387  14.178  4.606   1.00 0.00 ? 346 LEU B CD2 1  
ATOM 6203   N N   . MET B 2 347 ? 63.813  9.369   5.339   1.00 0.00 ? 347 MET B N   1  
ATOM 6204   C CA  . MET B 2 347 ? 63.429  8.810   6.650   1.00 0.00 ? 347 MET B CA  1  
ATOM 6205   C C   . MET B 2 347 ? 64.404  7.688   7.055   1.00 0.00 ? 347 MET B C   1  
ATOM 6206   O O   . MET B 2 347 ? 64.778  7.587   8.244   1.00 0.00 ? 347 MET B O   1  
ATOM 6207   C CB  . MET B 2 347 ? 61.961  8.189   6.452   1.00 0.00 ? 347 MET B CB  1  
ATOM 6208   C CG  . MET B 2 347 ? 61.471  7.106   7.523   1.00 0.00 ? 347 MET B CG  1  
ATOM 6209   S SD  . MET B 2 347 ? 61.244  7.710   9.198   1.00 0.00 ? 347 MET B SD  1  
ATOM 6210   C CE  . MET B 2 347 ? 61.409  6.093   10.061  1.00 0.00 ? 347 MET B CE  1  
ATOM 6211   N N   . ASN B 2 348 ? 64.814  6.854   6.097   1.00 0.00 ? 348 ASN B N   1  
ATOM 6212   C CA  . ASN B 2 348 ? 65.823  5.794   6.308   1.00 0.00 ? 348 ASN B CA  1  
ATOM 6213   C C   . ASN B 2 348 ? 67.191  6.568   6.740   1.00 0.00 ? 348 ASN B C   1  
ATOM 6214   O O   . ASN B 2 348 ? 67.929  6.061   7.679   1.00 0.00 ? 348 ASN B O   1  
ATOM 6215   C CB  . ASN B 2 348 ? 66.134  4.831   5.104   1.00 0.00 ? 348 ASN B CB  1  
ATOM 6216   C CG  . ASN B 2 348 ? 64.826  4.118   4.594   1.00 0.00 ? 348 ASN B CG  1  
ATOM 6217   O OD1 . ASN B 2 348 ? 64.454  4.246   3.430   1.00 0.00 ? 348 ASN B OD1 1  
ATOM 6218   N ND2 . ASN B 2 348 ? 64.060  3.406   5.457   1.00 0.00 ? 348 ASN B ND2 1  
ATOM 6219   N N   . TRP B 2 349 ? 67.492  7.655   6.047   1.00 0.00 ? 349 TRP B N   1  
ATOM 6220   C CA  . TRP B 2 349 ? 68.768  8.278   6.169   1.00 0.00 ? 349 TRP B CA  1  
ATOM 6221   C C   . TRP B 2 349 ? 68.912  8.876   7.598   1.00 0.00 ? 349 TRP B C   1  
ATOM 6222   O O   . TRP B 2 349 ? 69.871  8.535   8.364   1.00 0.00 ? 349 TRP B O   1  
ATOM 6223   C CB  . TRP B 2 349 ? 68.974  9.393   5.090   1.00 0.00 ? 349 TRP B CB  1  
ATOM 6224   C CG  . TRP B 2 349 ? 70.052  10.464  5.330   1.00 0.00 ? 349 TRP B CG  1  
ATOM 6225   C CD1 . TRP B 2 349 ? 69.809  11.798  5.468   1.00 0.00 ? 349 TRP B CD1 1  
ATOM 6226   C CD2 . TRP B 2 349 ? 71.489  10.257  5.527   1.00 0.00 ? 349 TRP B CD2 1  
ATOM 6227   N NE1 . TRP B 2 349 ? 71.000  12.465  5.761   1.00 0.00 ? 349 TRP B NE1 1  
ATOM 6228   C CE2 . TRP B 2 349 ? 72.050  11.568  5.651   1.00 0.00 ? 349 TRP B CE2 1  
ATOM 6229   C CE3 . TRP B 2 349 ? 72.309  9.104   5.354   1.00 0.00 ? 349 TRP B CE3 1  
ATOM 6230   C CZ2 . TRP B 2 349 ? 73.459  11.721  5.824   1.00 0.00 ? 349 TRP B CZ2 1  
ATOM 6231   C CZ3 . TRP B 2 349 ? 73.660  9.290   5.420   1.00 0.00 ? 349 TRP B CZ3 1  
ATOM 6232   C CH2 . TRP B 2 349 ? 74.184  10.602  5.605   1.00 0.00 ? 349 TRP B CH2 1  
ATOM 6233   N N   . LEU B 2 350 ? 67.938  9.740   7.926   1.00 0.00 ? 350 LEU B N   1  
ATOM 6234   C CA  . LEU B 2 350 ? 67.937  10.429  9.192   1.00 0.00 ? 350 LEU B CA  1  
ATOM 6235   C C   . LEU B 2 350 ? 67.765  9.465   10.385  1.00 0.00 ? 350 LEU B C   1  
ATOM 6236   O O   . LEU B 2 350 ? 68.356  9.651   11.436  1.00 0.00 ? 350 LEU B O   1  
ATOM 6237   C CB  . LEU B 2 350 ? 66.781  11.558  9.245   1.00 0.00 ? 350 LEU B CB  1  
ATOM 6238   C CG  . LEU B 2 350 ? 66.924  12.771  10.215  1.00 0.00 ? 350 LEU B CG  1  
ATOM 6239   C CD1 . LEU B 2 350 ? 66.244  14.012  9.673   1.00 0.00 ? 350 LEU B CD1 1  
ATOM 6240   C CD2 . LEU B 2 350 ? 66.406  12.458  11.647  1.00 0.00 ? 350 LEU B CD2 1  
ATOM 6241   N N   . THR B 2 351 ? 66.839  8.448   10.343  1.00 0.00 ? 351 THR B N   1  
ATOM 6242   C CA  . THR B 2 351 ? 66.531  7.692   11.474  1.00 0.00 ? 351 THR B CA  1  
ATOM 6243   C C   . THR B 2 351 ? 67.534  6.557   11.758  1.00 0.00 ? 351 THR B C   1  
ATOM 6244   O O   . THR B 2 351 ? 67.731  6.308   12.926  1.00 0.00 ? 351 THR B O   1  
ATOM 6245   C CB  . THR B 2 351 ? 65.141  7.079   11.360  1.00 0.00 ? 351 THR B CB  1  
ATOM 6246   O OG1 . THR B 2 351 ? 64.127  8.118   11.238  1.00 0.00 ? 351 THR B OG1 1  
ATOM 6247   C CG2 . THR B 2 351 ? 64.710  6.008   12.437  1.00 0.00 ? 351 THR B CG2 1  
ATOM 6248   N N   . LYS B 2 352 ? 68.134  5.873   10.710  1.00 0.00 ? 352 LYS B N   1  
ATOM 6249   C CA  . LYS B 2 352 ? 68.920  4.685   10.996  1.00 0.00 ? 352 LYS B CA  1  
ATOM 6250   C C   . LYS B 2 352 ? 70.234  4.762   10.278  1.00 0.00 ? 352 LYS B C   1  
ATOM 6251   O O   . LYS B 2 352 ? 70.943  3.742   10.117  1.00 0.00 ? 352 LYS B O   1  
ATOM 6252   C CB  . LYS B 2 352 ? 68.251  3.437   10.341  1.00 0.00 ? 352 LYS B CB  1  
ATOM 6253   C CG  . LYS B 2 352 ? 66.862  3.170   10.828  1.00 0.00 ? 352 LYS B CG  1  
ATOM 6254   C CD  . LYS B 2 352 ? 66.259  2.012   10.052  1.00 0.00 ? 352 LYS B CD  1  
ATOM 6255   C CE  . LYS B 2 352 ? 64.838  1.785   10.394  1.00 0.00 ? 352 LYS B CE  1  
ATOM 6256   N NZ  . LYS B 2 352 ? 63.976  2.928   10.179  1.00 0.00 ? 352 LYS B NZ  1  
ATOM 6257   N N   . GLY B 2 353 ? 70.649  5.956   9.828   1.00 0.00 ? 353 GLY B N   1  
ATOM 6258   C CA  . GLY B 2 353 ? 71.886  6.181   9.248   1.00 0.00 ? 353 GLY B CA  1  
ATOM 6259   C C   . GLY B 2 353 ? 71.894  5.678   7.870   1.00 0.00 ? 353 GLY B C   1  
ATOM 6260   O O   . GLY B 2 353 ? 70.924  5.094   7.376   1.00 0.00 ? 353 GLY B O   1  
ATOM 6261   N N   . LEU B 2 354 ? 73.047  5.881   7.172   1.00 0.00 ? 354 LEU B N   1  
ATOM 6262   C CA  . LEU B 2 354 ? 73.364  5.511   5.772   1.00 0.00 ? 354 LEU B CA  1  
ATOM 6263   C C   . LEU B 2 354 ? 72.360  4.841   4.872   1.00 0.00 ? 354 LEU B C   1  
ATOM 6264   O O   . LEU B 2 354 ? 72.018  3.682   4.985   1.00 0.00 ? 354 LEU B O   1  
ATOM 6265   C CB  . LEU B 2 354 ? 74.619  4.708   5.691   1.00 0.00 ? 354 LEU B CB  1  
ATOM 6266   C CG  . LEU B 2 354 ? 75.431  4.687   4.279   1.00 0.00 ? 354 LEU B CG  1  
ATOM 6267   C CD1 . LEU B 2 354 ? 76.188  5.968   4.021   1.00 0.00 ? 354 LEU B CD1 1  
ATOM 6268   C CD2 . LEU B 2 354 ? 76.395  3.515   4.083   1.00 0.00 ? 354 LEU B CD2 1  
ATOM 6269   N N   . LEU B 2 355 ? 71.860  5.708   3.891   1.00 0.00 ? 355 LEU B N   1  
ATOM 6270   C CA  . LEU B 2 355 ? 71.003  5.351   2.806   1.00 0.00 ? 355 LEU B CA  1  
ATOM 6271   C C   . LEU B 2 355 ? 71.836  5.799   1.597   1.00 0.00 ? 355 LEU B C   1  
ATOM 6272   O O   . LEU B 2 355 ? 71.877  7.004   1.287   1.00 0.00 ? 355 LEU B O   1  
ATOM 6273   C CB  . LEU B 2 355 ? 69.553  6.026   2.780   1.00 0.00 ? 355 LEU B CB  1  
ATOM 6274   C CG  . LEU B 2 355 ? 68.537  5.558   1.640   1.00 0.00 ? 355 LEU B CG  1  
ATOM 6275   C CD1 . LEU B 2 355 ? 68.877  6.310   0.323   1.00 0.00 ? 355 LEU B CD1 1  
ATOM 6276   C CD2 . LEU B 2 355 ? 68.511  3.998   1.475   1.00 0.00 ? 355 LEU B CD2 1  
ATOM 6277   N N   . ARG B 2 356 ? 72.503  4.903   0.827   1.00 0.00 ? 356 ARG B N   1  
ATOM 6278   C CA  . ARG B 2 356 ? 73.275  5.251   -0.334  1.00 0.00 ? 356 ARG B CA  1  
ATOM 6279   C C   . ARG B 2 356 ? 72.331  5.348   -1.468  1.00 0.00 ? 356 ARG B C   1  
ATOM 6280   O O   . ARG B 2 356 ? 71.274  4.732   -1.583  1.00 0.00 ? 356 ARG B O   1  
ATOM 6281   C CB  . ARG B 2 356 ? 74.418  4.239   -0.453  1.00 0.00 ? 356 ARG B CB  1  
ATOM 6282   C CG  . ARG B 2 356 ? 75.346  4.528   -1.612  1.00 0.00 ? 356 ARG B CG  1  
ATOM 6283   C CD  . ARG B 2 356 ? 76.217  5.870   -1.499  1.00 0.00 ? 356 ARG B CD  1  
ATOM 6284   N NE  . ARG B 2 356 ? 77.359  5.843   -2.479  1.00 0.00 ? 356 ARG B NE  1  
ATOM 6285   C CZ  . ARG B 2 356 ? 77.273  6.415   -3.757  1.00 0.00 ? 356 ARG B CZ  1  
ATOM 6286   N NH1 . ARG B 2 356 ? 76.015  6.627   -4.282  1.00 0.00 ? 356 ARG B NH1 1  
ATOM 6287   N NH2 . ARG B 2 356 ? 78.461  6.841   -4.301  1.00 0.00 ? 356 ARG B NH2 1  
ATOM 6288   N N   . ALA B 2 357 ? 72.647  6.317   -2.350  1.00 0.00 ? 357 ALA B N   1  
ATOM 6289   C CA  . ALA B 2 357 ? 71.900  6.803   -3.519  1.00 0.00 ? 357 ALA B CA  1  
ATOM 6290   C C   . ALA B 2 357 ? 71.737  5.686   -4.464  1.00 0.00 ? 357 ALA B C   1  
ATOM 6291   O O   . ALA B 2 357 ? 70.632  5.348   -4.893  1.00 0.00 ? 357 ALA B O   1  
ATOM 6292   C CB  . ALA B 2 357 ? 72.724  7.928   -4.233  1.00 0.00 ? 357 ALA B CB  1  
ATOM 6293   N N   . THR B 2 358 ? 72.800  4.926   -4.798  1.00 0.00 ? 358 THR B N   1  
ATOM 6294   C CA  . THR B 2 358 ? 72.807  3.745   -5.705  1.00 0.00 ? 358 THR B CA  1  
ATOM 6295   C C   . THR B 2 358 ? 72.732  4.262   -7.121  1.00 0.00 ? 358 THR B C   1  
ATOM 6296   O O   . THR B 2 358 ? 73.713  4.319   -7.818  1.00 0.00 ? 358 THR B O   1  
ATOM 6297   C CB  . THR B 2 358 ? 71.858  2.585   -5.337  1.00 0.00 ? 358 THR B CB  1  
ATOM 6298   O OG1 . THR B 2 358 ? 71.759  2.422   -3.923  1.00 0.00 ? 358 THR B OG1 1  
ATOM 6299   C CG2 . THR B 2 358 ? 72.371  1.230   -6.064  1.00 0.00 ? 358 THR B CG2 1  
ATOM 6300   N N   . TYR B 2 359 ? 71.508  4.617   -7.508  1.00 0.00 ? 359 TYR B N   1  
ATOM 6301   C CA  . TYR B 2 359 ? 71.177  5.106   -8.856  1.00 0.00 ? 359 TYR B CA  1  
ATOM 6302   C C   . TYR B 2 359 ? 70.809  6.539   -8.707  1.00 0.00 ? 359 TYR B C   1  
ATOM 6303   O O   . TYR B 2 359 ? 70.422  7.144   -9.746  1.00 0.00 ? 359 TYR B O   1  
ATOM 6304   C CB  . TYR B 2 359 ? 69.919  4.384   -9.477  1.00 0.00 ? 359 TYR B CB  1  
ATOM 6305   C CG  . TYR B 2 359 ? 70.037  2.877   -9.641  1.00 0.00 ? 359 TYR B CG  1  
ATOM 6306   C CD1 . TYR B 2 359 ? 69.623  2.044   -8.559  1.00 0.00 ? 359 TYR B CD1 1  
ATOM 6307   C CD2 . TYR B 2 359 ? 70.324  2.331   -10.926 1.00 0.00 ? 359 TYR B CD2 1  
ATOM 6308   C CE1 . TYR B 2 359 ? 69.726  0.641   -8.759  1.00 0.00 ? 359 TYR B CE1 1  
ATOM 6309   C CE2 . TYR B 2 359 ? 70.304  0.954   -11.067 1.00 0.00 ? 359 TYR B CE2 1  
ATOM 6310   C CZ  . TYR B 2 359 ? 70.013  0.049   -10.006 1.00 0.00 ? 359 TYR B CZ  1  
ATOM 6311   O OH  . TYR B 2 359 ? 69.966  -1.377  -10.204 1.00 0.00 ? 359 TYR B OH  1  
ATOM 6312   N N   . GLY B 2 360 ? 70.808  7.131   -7.537  1.00 0.00 ? 360 GLY B N   1  
ATOM 6313   C CA  . GLY B 2 360 ? 70.479  8.454   -7.275  1.00 0.00 ? 360 GLY B CA  1  
ATOM 6314   C C   . GLY B 2 360 ? 69.166  8.462   -6.745  1.00 0.00 ? 360 GLY B C   1  
ATOM 6315   O O   . GLY B 2 360 ? 68.138  8.588   -7.454  1.00 0.00 ? 360 GLY B O   1  
ATOM 6316   N N   . GLU B 2 361 ? 69.128  8.334   -5.386  1.00 0.00 ? 361 GLU B N   1  
ATOM 6317   C CA  . GLU B 2 361 ? 67.944  8.446   -4.606  1.00 0.00 ? 361 GLU B CA  1  
ATOM 6318   C C   . GLU B 2 361 ? 68.099  9.391   -3.523  1.00 0.00 ? 361 GLU B C   1  
ATOM 6319   O O   . GLU B 2 361 ? 67.182  9.815   -2.805  1.00 0.00 ? 361 GLU B O   1  
ATOM 6320   C CB  . GLU B 2 361 ? 67.722  7.096   -3.905  1.00 0.00 ? 361 GLU B CB  1  
ATOM 6321   C CG  . GLU B 2 361 ? 67.479  5.857   -4.843  1.00 0.00 ? 361 GLU B CG  1  
ATOM 6322   C CD  . GLU B 2 361 ? 67.712  4.573   -4.064  1.00 0.00 ? 361 GLU B CD  1  
ATOM 6323   O OE1 . GLU B 2 361 ? 67.201  4.447   -2.885  1.00 0.00 ? 361 GLU B OE1 1  
ATOM 6324   O OE2 . GLU B 2 361 ? 68.351  3.590   -4.556  1.00 0.00 ? 361 GLU B OE2 1  
ATOM 6325   N N   . PHE B 2 362 ? 69.333  9.817   -3.371  1.00 0.00 ? 362 PHE B N   1  
ATOM 6326   C CA  . PHE B 2 362 ? 69.761  10.693  -2.265  1.00 0.00 ? 362 PHE B CA  1  
ATOM 6327   C C   . PHE B 2 362 ? 71.002  11.392  -2.675  1.00 0.00 ? 362 PHE B C   1  
ATOM 6328   O O   . PHE B 2 362 ? 71.478  11.082  -3.766  1.00 0.00 ? 362 PHE B O   1  
ATOM 6329   C CB  . PHE B 2 362 ? 69.949  9.837   -0.952  1.00 0.00 ? 362 PHE B CB  1  
ATOM 6330   C CG  . PHE B 2 362 ? 69.455  10.676  0.301   1.00 0.00 ? 362 PHE B CG  1  
ATOM 6331   C CD1 . PHE B 2 362 ? 68.095  11.144  0.415   1.00 0.00 ? 362 PHE B CD1 1  
ATOM 6332   C CD2 . PHE B 2 362 ? 70.355  10.933  1.333   1.00 0.00 ? 362 PHE B CD2 1  
ATOM 6333   C CE1 . PHE B 2 362 ? 67.769  11.973  1.522   1.00 0.00 ? 362 PHE B CE1 1  
ATOM 6334   C CE2 . PHE B 2 362 ? 69.951  11.756  2.395   1.00 0.00 ? 362 PHE B CE2 1  
ATOM 6335   C CZ  . PHE B 2 362 ? 68.709  12.294  2.475   1.00 0.00 ? 362 PHE B CZ  1  
ATOM 6336   N N   . PHE B 2 363 ? 71.497  12.316  -1.780  1.00 0.00 ? 363 PHE B N   1  
ATOM 6337   C CA  . PHE B 2 363 ? 72.692  13.192  -1.871  1.00 0.00 ? 363 PHE B CA  1  
ATOM 6338   C C   . PHE B 2 363 ? 73.801  12.554  -1.075  1.00 0.00 ? 363 PHE B C   1  
ATOM 6339   O O   . PHE B 2 363 ? 74.463  13.334  -0.383  1.00 0.00 ? 363 PHE B O   1  
ATOM 6340   C CB  . PHE B 2 363 ? 72.349  14.594  -1.428  1.00 0.00 ? 363 PHE B CB  1  
ATOM 6341   C CG  . PHE B 2 363 ? 71.536  14.755  -0.169  1.00 0.00 ? 363 PHE B CG  1  
ATOM 6342   C CD1 . PHE B 2 363 ? 72.078  14.676  1.076   1.00 0.00 ? 363 PHE B CD1 1  
ATOM 6343   C CD2 . PHE B 2 363 ? 70.231  15.237  -0.338  1.00 0.00 ? 363 PHE B CD2 1  
ATOM 6344   C CE1 . PHE B 2 363 ? 71.369  15.056  2.188   1.00 0.00 ? 363 PHE B CE1 1  
ATOM 6345   C CE2 . PHE B 2 363 ? 69.489  15.594  0.798   1.00 0.00 ? 363 PHE B CE2 1  
ATOM 6346   C CZ  . PHE B 2 363 ? 70.082  15.481  2.110   1.00 0.00 ? 363 PHE B CZ  1  
ATOM 6347   N N   . ILE B 2 364 ? 74.055  11.188  -1.092  1.00 0.00 ? 364 ILE B N   1  
ATOM 6348   C CA  . ILE B 2 364 ? 75.201  10.655  -0.464  1.00 0.00 ? 364 ILE B CA  1  
ATOM 6349   C C   . ILE B 2 364 ? 76.151  10.367  -1.620  1.00 0.00 ? 364 ILE B C   1  
ATOM 6350   O O   . ILE B 2 364 ? 75.757  9.703   -2.609  1.00 0.00 ? 364 ILE B O   1  
ATOM 6351   C CB  . ILE B 2 364 ? 75.018  9.314   0.369   1.00 0.00 ? 364 ILE B CB  1  
ATOM 6352   C CG1 . ILE B 2 364 ? 73.841  9.605   1.368   1.00 0.00 ? 364 ILE B CG1 1  
ATOM 6353   C CG2 . ILE B 2 364 ? 76.303  8.994   1.145   1.00 0.00 ? 364 ILE B CG2 1  
ATOM 6354   C CD1 . ILE B 2 364 ? 73.490  8.422   2.286   1.00 0.00 ? 364 ILE B CD1 1  
ATOM 6355   N N   . ALA B 2 365 ? 77.434  10.742  -1.484  1.00 0.00 ? 365 ALA B N   1  
ATOM 6356   C CA  . ALA B 2 365 ? 78.514  10.430  -2.446  1.00 0.00 ? 365 ALA B CA  1  
ATOM 6357   C C   . ALA B 2 365 ? 79.613  9.874   -1.670  1.00 0.00 ? 365 ALA B C   1  
ATOM 6358   O O   . ALA B 2 365 ? 79.770  10.189  -0.497  1.00 0.00 ? 365 ALA B O   1  
ATOM 6359   C CB  . ALA B 2 365 ? 78.893  11.629  -3.395  1.00 0.00 ? 365 ALA B CB  1  
ATOM 6360   N N   . GLU B 2 366 ? 80.297  8.934   -2.336  1.00 0.00 ? 366 GLU B N   1  
ATOM 6361   C CA  . GLU B 2 366 ? 81.417  8.200   -1.752  1.00 0.00 ? 366 GLU B CA  1  
ATOM 6362   C C   . GLU B 2 366 ? 82.700  9.060   -1.747  1.00 0.00 ? 366 GLU B C   1  
ATOM 6363   O O   . GLU B 2 366 ? 82.943  9.783   -2.668  1.00 0.00 ? 366 GLU B O   1  
ATOM 6364   C CB  . GLU B 2 366 ? 81.600  6.876   -2.499  1.00 0.00 ? 366 GLU B CB  1  
ATOM 6365   C CG  . GLU B 2 366 ? 82.300  5.833   -1.650  1.00 0.00 ? 366 GLU B CG  1  
ATOM 6366   C CD  . GLU B 2 366 ? 82.210  4.537   -2.316  1.00 0.00 ? 366 GLU B CD  1  
ATOM 6367   O OE1 . GLU B 2 366 ? 81.178  3.856   -1.929  1.00 0.00 ? 366 GLU B OE1 1  
ATOM 6368   O OE2 . GLU B 2 366 ? 83.116  4.120   -3.023  1.00 0.00 ? 366 GLU B OE2 1  
ATOM 6369   N N   . ASN B 2 367 ? 83.516  8.845   -0.685  1.00 0.00 ? 367 ASN B N   1  
ATOM 6370   C CA  . ASN B 2 367 ? 84.753  9.566   -0.549  1.00 0.00 ? 367 ASN B CA  1  
ATOM 6371   C C   . ASN B 2 367 ? 84.398  11.106  -0.286  1.00 0.00 ? 367 ASN B C   1  
ATOM 6372   O O   . ASN B 2 367 ? 83.182  11.433  -0.241  1.00 0.00 ? 367 ASN B O   1  
ATOM 6373   C CB  . ASN B 2 367 ? 85.877  9.315   -1.609  1.00 0.00 ? 367 ASN B CB  1  
ATOM 6374   C CG  . ASN B 2 367 ? 86.144  7.765   -1.514  1.00 0.00 ? 367 ASN B CG  1  
ATOM 6375   O OD1 . ASN B 2 367 ? 85.540  6.928   -2.215  1.00 0.00 ? 367 ASN B OD1 1  
ATOM 6376   N ND2 . ASN B 2 367 ? 87.310  7.485   -0.797  1.00 0.00 ? 367 ASN B ND2 1  
ATOM 6377   N N   . TYR B 2 379 ? 84.233  1.604   6.886   1.00 0.00 ? 379 TYR B N   1  
ATOM 6378   C CA  . TYR B 2 379 ? 85.166  1.461   8.120   1.00 0.00 ? 379 TYR B CA  1  
ATOM 6379   C C   . TYR B 2 379 ? 85.749  2.801   8.450   1.00 0.00 ? 379 TYR B C   1  
ATOM 6380   O O   . TYR B 2 379 ? 85.588  3.345   9.525   1.00 0.00 ? 379 TYR B O   1  
ATOM 6381   C CB  . TYR B 2 379 ? 86.289  0.360   7.877   1.00 0.00 ? 379 TYR B CB  1  
ATOM 6382   C CG  . TYR B 2 379 ? 87.014  0.146   9.151   1.00 0.00 ? 379 TYR B CG  1  
ATOM 6383   C CD1 . TYR B 2 379 ? 86.317  -0.421  10.218  1.00 0.00 ? 379 TYR B CD1 1  
ATOM 6384   C CD2 . TYR B 2 379 ? 88.363  0.450   9.310   1.00 0.00 ? 379 TYR B CD2 1  
ATOM 6385   C CE1 . TYR B 2 379 ? 86.826  -0.384  11.443  1.00 0.00 ? 379 TYR B CE1 1  
ATOM 6386   C CE2 . TYR B 2 379 ? 88.969  0.409   10.587  1.00 0.00 ? 379 TYR B CE2 1  
ATOM 6387   C CZ  . TYR B 2 379 ? 88.182  -0.056  11.660  1.00 0.00 ? 379 TYR B CZ  1  
ATOM 6388   O OH  . TYR B 2 379 ? 88.631  -0.033  13.005  1.00 0.00 ? 379 TYR B OH  1  
ATOM 6389   N N   . HIS B 2 380 ? 86.545  3.303   7.481   1.00 0.00 ? 380 HIS B N   1  
ATOM 6390   C CA  . HIS B 2 380 ? 87.322  4.524   7.537   1.00 0.00 ? 380 HIS B CA  1  
ATOM 6391   C C   . HIS B 2 380 ? 86.985  5.392   6.324   1.00 0.00 ? 380 HIS B C   1  
ATOM 6392   O O   . HIS B 2 380 ? 87.633  6.462   6.149   1.00 0.00 ? 380 HIS B O   1  
ATOM 6393   C CB  . HIS B 2 380 ? 88.804  4.114   7.456   1.00 0.00 ? 380 HIS B CB  1  
ATOM 6394   C CG  . HIS B 2 380 ? 89.777  5.314   7.697   1.00 0.00 ? 380 HIS B CG  1  
ATOM 6395   N ND1 . HIS B 2 380 ? 89.587  6.307   8.577   1.00 0.00 ? 380 HIS B ND1 1  
ATOM 6396   C CD2 . HIS B 2 380 ? 90.868  5.652   6.933   1.00 0.00 ? 380 HIS B CD2 1  
ATOM 6397   C CE1 . HIS B 2 380 ? 90.566  7.229   8.374   1.00 0.00 ? 380 HIS B CE1 1  
ATOM 6398   N NE2 . HIS B 2 380 ? 91.391  6.818   7.385   1.00 0.00 ? 380 HIS B NE2 1  
ATOM 6399   N N   . ILE B 2 381 ? 86.073  4.937   5.430   1.00 0.00 ? 381 ILE B N   1  
ATOM 6400   C CA  . ILE B 2 381 ? 85.750  5.643   4.189   1.00 0.00 ? 381 ILE B CA  1  
ATOM 6401   C C   . ILE B 2 381 ? 84.605  6.570   4.516   1.00 0.00 ? 381 ILE B C   1  
ATOM 6402   O O   . ILE B 2 381 ? 83.678  6.066   5.062   1.00 0.00 ? 381 ILE B O   1  
ATOM 6403   C CB  . ILE B 2 381 ? 85.328  4.714   3.039   1.00 0.00 ? 381 ILE B CB  1  
ATOM 6404   C CG1 . ILE B 2 381 ? 86.443  3.682   2.733   1.00 0.00 ? 381 ILE B CG1 1  
ATOM 6405   C CG2 . ILE B 2 381 ? 84.911  5.485   1.723   1.00 0.00 ? 381 ILE B CG2 1  
ATOM 6406   C CD1 . ILE B 2 381 ? 86.102  2.710   1.591   1.00 0.00 ? 381 ILE B CD1 1  
ATOM 6407   N N   . PRO B 2 382 ? 84.695  7.897   4.253   1.00 0.00 ? 382 PRO B N   1  
ATOM 6408   C CA  . PRO B 2 382 ? 83.626  8.842   4.513   1.00 0.00 ? 382 PRO B CA  1  
ATOM 6409   C C   . PRO B 2 382 ? 82.641  8.945   3.395   1.00 0.00 ? 382 PRO B C   1  
ATOM 6410   O O   . PRO B 2 382 ? 82.811  8.336   2.330   1.00 0.00 ? 382 PRO B O   1  
ATOM 6411   C CB  . PRO B 2 382 ? 84.481  10.194  4.620   1.00 0.00 ? 382 PRO B CB  1  
ATOM 6412   C CG  . PRO B 2 382 ? 85.468  10.065  3.552   1.00 0.00 ? 382 PRO B CG  1  
ATOM 6413   C CD  . PRO B 2 382 ? 85.855  8.596   3.602   1.00 0.00 ? 382 PRO B CD  1  
ATOM 6414   N N   . ILE B 2 383 ? 81.675  9.794   3.624   1.00 0.00 ? 383 ILE B N   1  
ATOM 6415   C CA  . ILE B 2 383 ? 80.689  10.219  2.612   1.00 0.00 ? 383 ILE B CA  1  
ATOM 6416   C C   . ILE B 2 383 ? 80.762  11.671  2.636   1.00 0.00 ? 383 ILE B C   1  
ATOM 6417   O O   . ILE B 2 383 ? 81.431  12.272  3.510   1.00 0.00 ? 383 ILE B O   1  
ATOM 6418   C CB  . ILE B 2 383 ? 79.319  9.553   2.843   1.00 0.00 ? 383 ILE B CB  1  
ATOM 6419   C CG1 . ILE B 2 383 ? 78.738  9.763   4.353   1.00 0.00 ? 383 ILE B CG1 1  
ATOM 6420   C CG2 . ILE B 2 383 ? 79.358  8.040   2.398   1.00 0.00 ? 383 ILE B CG2 1  
ATOM 6421   C CD1 . ILE B 2 383 ? 77.370  9.103   4.597   1.00 0.00 ? 383 ILE B CD1 1  
ATOM 6422   N N   . GLU B 2 384 ? 80.072  12.275  1.609   1.00 0.00 ? 384 GLU B N   1  
ATOM 6423   C CA  . GLU B 2 384 ? 80.039  13.667  1.400   1.00 0.00 ? 384 GLU B CA  1  
ATOM 6424   C C   . GLU B 2 384 ? 78.667  13.994  0.632   1.00 0.00 ? 384 GLU B C   1  
ATOM 6425   O O   . GLU B 2 384 ? 77.809  13.124  0.356   1.00 0.00 ? 384 GLU B O   1  
ATOM 6426   C CB  . GLU B 2 384 ? 81.286  14.167  0.522   1.00 0.00 ? 384 GLU B CB  1  
ATOM 6427   C CG  . GLU B 2 384 ? 81.710  15.667  0.895   1.00 0.00 ? 384 GLU B CG  1  
ATOM 6428   C CD  . GLU B 2 384 ? 82.300  15.655  2.315   1.00 0.00 ? 384 GLU B CD  1  
ATOM 6429   O OE1 . GLU B 2 384 ? 83.414  15.035  2.467   1.00 0.00 ? 384 GLU B OE1 1  
ATOM 6430   O OE2 . GLU B 2 384 ? 81.719  16.205  3.304   1.00 0.00 ? 384 GLU B OE2 1  
ATOM 6431   N N   . PHE B 2 385 ? 78.475  15.313  0.558   1.00 0.00 ? 385 PHE B N   1  
ATOM 6432   C CA  . PHE B 2 385 ? 77.306  16.030  0.163   1.00 0.00 ? 385 PHE B CA  1  
ATOM 6433   C C   . PHE B 2 385 ? 77.248  16.320  -1.244  1.00 0.00 ? 385 PHE B C   1  
ATOM 6434   O O   . PHE B 2 385 ? 78.306  16.658  -1.822  1.00 0.00 ? 385 PHE B O   1  
ATOM 6435   C CB  . PHE B 2 385 ? 77.172  17.278  1.069   1.00 0.00 ? 385 PHE B CB  1  
ATOM 6436   C CG  . PHE B 2 385 ? 75.986  18.093  0.711   1.00 0.00 ? 385 PHE B CG  1  
ATOM 6437   C CD1 . PHE B 2 385 ? 74.698  17.529  0.789   1.00 0.00 ? 385 PHE B CD1 1  
ATOM 6438   C CD2 . PHE B 2 385 ? 76.202  19.364  0.251   1.00 0.00 ? 385 PHE B CD2 1  
ATOM 6439   C CE1 . PHE B 2 385 ? 73.627  18.318  0.309   1.00 0.00 ? 385 PHE B CE1 1  
ATOM 6440   C CE2 . PHE B 2 385 ? 75.101  20.188  -0.113  1.00 0.00 ? 385 PHE B CE2 1  
ATOM 6441   C CZ  . PHE B 2 385 ? 73.822  19.650  -0.166  1.00 0.00 ? 385 PHE B CZ  1  
ATOM 6442   N N   . ASN B 2 386 ? 76.081  16.072  -1.958  1.00 0.00 ? 386 ASN B N   1  
ATOM 6443   C CA  . ASN B 2 386 ? 75.849  16.507  -3.291  1.00 0.00 ? 386 ASN B CA  1  
ATOM 6444   C C   . ASN B 2 386 ? 74.914  17.671  -3.448  1.00 0.00 ? 386 ASN B C   1  
ATOM 6445   O O   . ASN B 2 386 ? 73.714  17.521  -3.510  1.00 0.00 ? 386 ASN B O   1  
ATOM 6446   C CB  . ASN B 2 386 ? 75.152  15.384  -4.051  1.00 0.00 ? 386 ASN B CB  1  
ATOM 6447   C CG  . ASN B 2 386 ? 76.088  14.211  -4.378  1.00 0.00 ? 386 ASN B CG  1  
ATOM 6448   O OD1 . ASN B 2 386 ? 75.847  13.134  -3.751  1.00 0.00 ? 386 ASN B OD1 1  
ATOM 6449   N ND2 . ASN B 2 386 ? 76.996  14.387  -5.376  1.00 0.00 ? 386 ASN B ND2 1  
ATOM 6450   N N   . GLN B 2 387 ? 75.492  18.815  -3.604  1.00 0.00 ? 387 GLN B N   1  
ATOM 6451   C CA  . GLN B 2 387 ? 74.694  20.034  -3.764  1.00 0.00 ? 387 GLN B CA  1  
ATOM 6452   C C   . GLN B 2 387 ? 73.903  20.076  -5.015  1.00 0.00 ? 387 GLN B C   1  
ATOM 6453   O O   . GLN B 2 387 ? 72.763  20.524  -5.062  1.00 0.00 ? 387 GLN B O   1  
ATOM 6454   C CB  . GLN B 2 387 ? 75.457  21.333  -3.606  1.00 0.00 ? 387 GLN B CB  1  
ATOM 6455   C CG  . GLN B 2 387 ? 76.571  21.676  -4.589  1.00 0.00 ? 387 GLN B CG  1  
ATOM 6456   C CD  . GLN B 2 387 ? 77.285  23.002  -4.107  1.00 0.00 ? 387 GLN B CD  1  
ATOM 6457   O OE1 . GLN B 2 387 ? 78.190  23.047  -3.266  1.00 0.00 ? 387 GLN B OE1 1  
ATOM 6458   N NE2 . GLN B 2 387 ? 76.670  24.126  -4.607  1.00 0.00 ? 387 GLN B NE2 1  
ATOM 6459   N N   . GLU B 2 388 ? 74.403  19.578  -6.165  1.00 0.00 ? 388 GLU B N   1  
ATOM 6460   C CA  . GLU B 2 388 ? 73.910  19.587  -7.443  1.00 0.00 ? 388 GLU B CA  1  
ATOM 6461   C C   . GLU B 2 388 ? 72.583  18.885  -7.643  1.00 0.00 ? 388 GLU B C   1  
ATOM 6462   O O   . GLU B 2 388 ? 71.797  19.330  -8.460  1.00 0.00 ? 388 GLU B O   1  
ATOM 6463   C CB  . GLU B 2 388 ? 74.853  19.204  -8.611  1.00 0.00 ? 388 GLU B CB  1  
ATOM 6464   C CG  . GLU B 2 388 ? 75.394  17.788  -8.460  1.00 0.00 ? 388 GLU B CG  1  
ATOM 6465   C CD  . GLU B 2 388 ? 76.604  17.523  -9.372  1.00 0.00 ? 388 GLU B CD  1  
ATOM 6466   O OE1 . GLU B 2 388 ? 77.757  18.000  -9.032  1.00 0.00 ? 388 GLU B OE1 1  
ATOM 6467   O OE2 . GLU B 2 388 ? 76.488  16.826  -10.415 1.00 0.00 ? 388 GLU B OE2 1  
ATOM 6468   N N   . ARG B 2 389 ? 72.368  17.738  -6.945  1.00 0.00 ? 389 ARG B N   1  
ATOM 6469   C CA  . ARG B 2 389 ? 71.153  16.940  -7.208  1.00 0.00 ? 389 ARG B CA  1  
ATOM 6470   C C   . ARG B 2 389 ? 69.797  17.410  -6.813  1.00 0.00 ? 389 ARG B C   1  
ATOM 6471   O O   . ARG B 2 389 ? 68.821  17.173  -7.510  1.00 0.00 ? 389 ARG B O   1  
ATOM 6472   C CB  . ARG B 2 389 ? 71.327  15.535  -6.668  1.00 0.00 ? 389 ARG B CB  1  
ATOM 6473   C CG  . ARG B 2 389 ? 71.357  15.375  -5.073  1.00 0.00 ? 389 ARG B CG  1  
ATOM 6474   C CD  . ARG B 2 389 ? 70.244  14.434  -4.558  1.00 0.00 ? 389 ARG B CD  1  
ATOM 6475   N NE  . ARG B 2 389 ? 68.886  15.219  -4.559  1.00 0.00 ? 389 ARG B NE  1  
ATOM 6476   C CZ  . ARG B 2 389 ? 67.765  14.851  -3.831  1.00 0.00 ? 389 ARG B CZ  1  
ATOM 6477   N NH1 . ARG B 2 389 ? 67.815  13.592  -3.183  1.00 0.00 ? 389 ARG B NH1 1  
ATOM 6478   N NH2 . ARG B 2 389 ? 66.657  15.649  -3.863  1.00 0.00 ? 389 ARG B NH2 1  
ATOM 6479   N N   . VAL B 2 390 ? 69.704  18.164  -5.703  1.00 0.00 ? 390 VAL B N   1  
ATOM 6480   C CA  . VAL B 2 390 ? 68.486  18.698  -5.116  1.00 0.00 ? 390 VAL B CA  1  
ATOM 6481   C C   . VAL B 2 390 ? 67.821  19.684  -6.088  1.00 0.00 ? 390 VAL B C   1  
ATOM 6482   O O   . VAL B 2 390 ? 68.501  20.554  -6.612  1.00 0.00 ? 390 VAL B O   1  
ATOM 6483   C CB  . VAL B 2 390 ? 68.644  19.337  -3.792  1.00 0.00 ? 390 VAL B CB  1  
ATOM 6484   C CG1 . VAL B 2 390 ? 69.322  18.380  -2.828  1.00 0.00 ? 390 VAL B CG1 1  
ATOM 6485   C CG2 . VAL B 2 390 ? 69.435  20.606  -3.845  1.00 0.00 ? 390 VAL B CG2 1  
ATOM 6486   N N   . PRO B 2 391 ? 66.437  19.661  -6.362  1.00 0.00 ? 391 PRO B N   1  
ATOM 6487   C CA  . PRO B 2 391 ? 65.903  20.726  -7.257  1.00 0.00 ? 391 PRO B CA  1  
ATOM 6488   C C   . PRO B 2 391 ? 65.777  21.983  -6.448  1.00 0.00 ? 391 PRO B C   1  
ATOM 6489   O O   . PRO B 2 391 ? 66.258  22.002  -5.341  1.00 0.00 ? 391 PRO B O   1  
ATOM 6490   C CB  . PRO B 2 391 ? 64.484  20.251  -7.580  1.00 0.00 ? 391 PRO B CB  1  
ATOM 6491   C CG  . PRO B 2 391 ? 64.114  19.364  -6.390  1.00 0.00 ? 391 PRO B CG  1  
ATOM 6492   C CD  . PRO B 2 391 ? 65.436  18.742  -5.966  1.00 0.00 ? 391 PRO B CD  1  
ATOM 6493   N N   . ALA B 2 392 ? 65.163  23.057  -6.915  1.00 0.00 ? 392 ALA B N   1  
ATOM 6494   C CA  . ALA B 2 392 ? 65.145  24.314  -6.173  1.00 0.00 ? 392 ALA B CA  1  
ATOM 6495   C C   . ALA B 2 392 ? 64.262  24.310  -5.069  1.00 0.00 ? 392 ALA B C   1  
ATOM 6496   O O   . ALA B 2 392 ? 64.325  25.161  -4.235  1.00 0.00 ? 392 ALA B O   1  
ATOM 6497   C CB  . ALA B 2 392 ? 64.773  25.537  -7.057  1.00 0.00 ? 392 ALA B CB  1  
ATOM 6498   N N   . PHE B 2 393 ? 63.332  23.262  -5.062  1.00 0.00 ? 393 PHE B N   1  
ATOM 6499   C CA  . PHE B 2 393 ? 62.247  23.096  -4.069  1.00 0.00 ? 393 PHE B CA  1  
ATOM 6500   C C   . PHE B 2 393 ? 62.778  22.685  -2.730  1.00 0.00 ? 393 PHE B C   1  
ATOM 6501   O O   . PHE B 2 393 ? 62.257  23.019  -1.669  1.00 0.00 ? 393 PHE B O   1  
ATOM 6502   C CB  . PHE B 2 393 ? 61.314  21.967  -4.506  1.00 0.00 ? 393 PHE B CB  1  
ATOM 6503   C CG  . PHE B 2 393 ? 60.604  22.255  -5.830  1.00 0.00 ? 393 PHE B CG  1  
ATOM 6504   C CD1 . PHE B 2 393 ? 59.627  23.206  -5.980  1.00 0.00 ? 393 PHE B CD1 1  
ATOM 6505   C CD2 . PHE B 2 393 ? 60.852  21.397  -6.940  1.00 0.00 ? 393 PHE B CD2 1  
ATOM 6506   C CE1 . PHE B 2 393 ? 58.925  23.365  -7.176  1.00 0.00 ? 393 PHE B CE1 1  
ATOM 6507   C CE2 . PHE B 2 393 ? 60.070  21.492  -8.092  1.00 0.00 ? 393 PHE B CE2 1  
ATOM 6508   C CZ  . PHE B 2 393 ? 59.174  22.576  -8.248  1.00 0.00 ? 393 PHE B CZ  1  
ATOM 6509   N N   . ILE B 2 394 ? 63.972  22.067  -2.682  1.00 0.00 ? 394 ILE B N   1  
ATOM 6510   C CA  . ILE B 2 394 ? 64.701  21.892  -1.492  1.00 0.00 ? 394 ILE B CA  1  
ATOM 6511   C C   . ILE B 2 394 ? 65.883  22.748  -1.738  1.00 0.00 ? 394 ILE B C   1  
ATOM 6512   O O   . ILE B 2 394 ? 66.724  22.422  -2.558  1.00 0.00 ? 394 ILE B O   1  
ATOM 6513   C CB  . ILE B 2 394 ? 65.134  20.417  -1.425  1.00 0.00 ? 394 ILE B CB  1  
ATOM 6514   C CG1 . ILE B 2 394 ? 63.981  19.409  -1.545  1.00 0.00 ? 394 ILE B CG1 1  
ATOM 6515   C CG2 . ILE B 2 394 ? 65.945  20.213  -0.101  1.00 0.00 ? 394 ILE B CG2 1  
ATOM 6516   C CD1 . ILE B 2 394 ? 64.424  17.938  -1.477  1.00 0.00 ? 394 ILE B CD1 1  
ATOM 6517   N N   . PRO B 2 395 ? 66.218  23.811  -0.938  1.00 0.00 ? 395 PRO B N   1  
ATOM 6518   C CA  . PRO B 2 395 ? 67.437  24.530  -1.123  1.00 0.00 ? 395 PRO B CA  1  
ATOM 6519   C C   . PRO B 2 395 ? 68.649  23.673  -0.861  1.00 0.00 ? 395 PRO B C   1  
ATOM 6520   O O   . PRO B 2 395 ? 68.530  22.787  -0.022  1.00 0.00 ? 395 PRO B O   1  
ATOM 6521   C CB  . PRO B 2 395 ? 67.372  25.599  -0.011  1.00 0.00 ? 395 PRO B CB  1  
ATOM 6522   C CG  . PRO B 2 395 ? 65.894  25.891  -0.023  1.00 0.00 ? 395 PRO B CG  1  
ATOM 6523   C CD  . PRO B 2 395 ? 65.306  24.432  -0.007  1.00 0.00 ? 395 PRO B CD  1  
ATOM 6524   N N   . LYS B 2 396 ? 69.786  24.017  -1.464  1.00 0.00 ? 396 LYS B N   1  
ATOM 6525   C CA  . LYS B 2 396 ? 71.070  23.388  -1.213  1.00 0.00 ? 396 LYS B CA  1  
ATOM 6526   C C   . LYS B 2 396 ? 71.541  23.547  0.171   1.00 0.00 ? 396 LYS B C   1  
ATOM 6527   O O   . LYS B 2 396 ? 72.002  22.590  0.756   1.00 0.00 ? 396 LYS B O   1  
ATOM 6528   C CB  . LYS B 2 396 ? 72.096  24.070  -2.211  1.00 0.00 ? 396 LYS B CB  1  
ATOM 6529   C CG  . LYS B 2 396 ? 71.835  23.816  -3.657  1.00 0.00 ? 396 LYS B CG  1  
ATOM 6530   C CD  . LYS B 2 396 ? 72.447  24.903  -4.470  1.00 0.00 ? 396 LYS B CD  1  
ATOM 6531   C CE  . LYS B 2 396 ? 72.824  24.506  -5.886  1.00 0.00 ? 396 LYS B CE  1  
ATOM 6532   N NZ  . LYS B 2 396 ? 71.641  24.102  -6.676  1.00 0.00 ? 396 LYS B NZ  1  
ATOM 6533   N N   . GLU B 2 397 ? 71.290  24.750  0.835   1.00 0.00 ? 397 GLU B N   1  
ATOM 6534   C CA  . GLU B 2 397 ? 71.578  24.929  2.213   1.00 0.00 ? 397 GLU B CA  1  
ATOM 6535   C C   . GLU B 2 397 ? 70.809  24.001  3.139   1.00 0.00 ? 397 GLU B C   1  
ATOM 6536   O O   . GLU B 2 397 ? 71.303  23.410  4.103   1.00 0.00 ? 397 GLU B O   1  
ATOM 6537   C CB  . GLU B 2 397 ? 71.352  26.469  2.654   1.00 0.00 ? 397 GLU B CB  1  
ATOM 6538   C CG  . GLU B 2 397 ? 72.153  27.477  1.822   1.00 0.00 ? 397 GLU B CG  1  
ATOM 6539   C CD  . GLU B 2 397 ? 73.643  27.079  1.901   1.00 0.00 ? 397 GLU B CD  1  
ATOM 6540   O OE1 . GLU B 2 397 ? 74.170  27.006  3.027   1.00 0.00 ? 397 GLU B OE1 1  
ATOM 6541   O OE2 . GLU B 2 397 ? 74.231  26.931  0.822   1.00 0.00 ? 397 GLU B OE2 1  
ATOM 6542   N N   . LEU B 2 398 ? 69.476  23.768  2.826   1.00 0.00 ? 398 LEU B N   1  
ATOM 6543   C CA  . LEU B 2 398 ? 68.563  22.940  3.645   1.00 0.00 ? 398 LEU B CA  1  
ATOM 6544   C C   . LEU B 2 398 ? 69.071  21.493  3.606   1.00 0.00 ? 398 LEU B C   1  
ATOM 6545   O O   . LEU B 2 398 ? 69.141  20.854  4.658   1.00 0.00 ? 398 LEU B O   1  
ATOM 6546   C CB  . LEU B 2 398 ? 67.137  23.064  3.105   1.00 0.00 ? 398 LEU B CB  1  
ATOM 6547   C CG  . LEU B 2 398 ? 66.069  22.216  3.808   1.00 0.00 ? 398 LEU B CG  1  
ATOM 6548   C CD1 . LEU B 2 398 ? 66.004  22.449  5.298   1.00 0.00 ? 398 LEU B CD1 1  
ATOM 6549   C CD2 . LEU B 2 398 ? 64.643  22.231  3.184   1.00 0.00 ? 398 LEU B CD2 1  
ATOM 6550   N N   . ALA B 2 399 ? 69.460  21.037  2.466   1.00 0.00 ? 399 ALA B N   1  
ATOM 6551   C CA  . ALA B 2 399 ? 69.924  19.695  2.162   1.00 0.00 ? 399 ALA B CA  1  
ATOM 6552   C C   . ALA B 2 399 ? 71.213  19.341  2.911   1.00 0.00 ? 399 ALA B C   1  
ATOM 6553   O O   . ALA B 2 399 ? 71.293  18.260  3.450   1.00 0.00 ? 399 ALA B O   1  
ATOM 6554   C CB  . ALA B 2 399 ? 70.296  19.591  0.768   1.00 0.00 ? 399 ALA B CB  1  
ATOM 6555   N N   . TYR B 2 400 ? 72.108  20.365  2.958   1.00 0.00 ? 400 TYR B N   1  
ATOM 6556   C CA  . TYR B 2 400 ? 73.370  20.289  3.674   1.00 0.00 ? 400 TYR B CA  1  
ATOM 6557   C C   . TYR B 2 400 ? 73.210  20.046  5.158   1.00 0.00 ? 400 TYR B C   1  
ATOM 6558   O O   . TYR B 2 400 ? 73.944  19.295  5.804   1.00 0.00 ? 400 TYR B O   1  
ATOM 6559   C CB  . TYR B 2 400 ? 74.190  21.563  3.494   1.00 0.00 ? 400 TYR B CB  1  
ATOM 6560   C CG  . TYR B 2 400 ? 75.684  21.724  3.920   1.00 0.00 ? 400 TYR B CG  1  
ATOM 6561   C CD1 . TYR B 2 400 ? 76.376  20.546  4.140   1.00 0.00 ? 400 TYR B CD1 1  
ATOM 6562   C CD2 . TYR B 2 400 ? 76.186  22.947  4.184   1.00 0.00 ? 400 TYR B CD2 1  
ATOM 6563   C CE1 . TYR B 2 400 ? 77.720  20.702  4.510   1.00 0.00 ? 400 TYR B CE1 1  
ATOM 6564   C CE2 . TYR B 2 400 ? 77.494  23.092  4.646   1.00 0.00 ? 400 TYR B CE2 1  
ATOM 6565   C CZ  . TYR B 2 400 ? 78.331  21.924  4.751   1.00 0.00 ? 400 TYR B CZ  1  
ATOM 6566   O OH  . TYR B 2 400 ? 79.653  22.002  5.174   1.00 0.00 ? 400 TYR B OH  1  
ATOM 6567   N N   . LYS B 2 401 ? 72.249  20.724  5.821   1.00 0.00 ? 401 LYS B N   1  
ATOM 6568   C CA  . LYS B 2 401 ? 71.921  20.694  7.232   1.00 0.00 ? 401 LYS B CA  1  
ATOM 6569   C C   . LYS B 2 401 ? 71.492  19.303  7.565   1.00 0.00 ? 401 LYS B C   1  
ATOM 6570   O O   . LYS B 2 401 ? 71.884  18.761  8.605   1.00 0.00 ? 401 LYS B O   1  
ATOM 6571   C CB  . LYS B 2 401 ? 70.754  21.638  7.592   1.00 0.00 ? 401 LYS B CB  1  
ATOM 6572   C CG  . LYS B 2 401 ? 71.172  23.072  7.642   1.00 0.00 ? 401 LYS B CG  1  
ATOM 6573   C CD  . LYS B 2 401 ? 70.167  23.983  8.422   1.00 0.00 ? 401 LYS B CD  1  
ATOM 6574   C CE  . LYS B 2 401 ? 68.755  23.922  7.796   1.00 0.00 ? 401 LYS B CE  1  
ATOM 6575   N NZ  . LYS B 2 401 ? 67.824  24.618  8.733   1.00 0.00 ? 401 LYS B NZ  1  
ATOM 6576   N N   . ILE B 2 402 ? 70.700  18.721  6.598   1.00 0.00 ? 402 ILE B N   1  
ATOM 6577   C CA  . ILE B 2 402 ? 70.150  17.326  6.675   1.00 0.00 ? 402 ILE B CA  1  
ATOM 6578   C C   . ILE B 2 402 ? 71.339  16.339  6.630   1.00 0.00 ? 402 ILE B C   1  
ATOM 6579   O O   . ILE B 2 402 ? 71.312  15.372  7.342   1.00 0.00 ? 402 ILE B O   1  
ATOM 6580   C CB  . ILE B 2 402 ? 69.048  17.055  5.619   1.00 0.00 ? 402 ILE B CB  1  
ATOM 6581   C CG1 . ILE B 2 402 ? 67.799  18.026  5.812   1.00 0.00 ? 402 ILE B CG1 1  
ATOM 6582   C CG2 . ILE B 2 402 ? 68.635  15.546  5.559   1.00 0.00 ? 402 ILE B CG2 1  
ATOM 6583   C CD1 . ILE B 2 402 ? 66.669  17.806  4.792   1.00 0.00 ? 402 ILE B CD1 1  
ATOM 6584   N N   . PHE B 2 403 ? 72.301  16.588  5.775   1.00 0.00 ? 403 PHE B N   1  
ATOM 6585   C CA  . PHE B 2 403 ? 73.552  15.831  5.577   1.00 0.00 ? 403 PHE B CA  1  
ATOM 6586   C C   . PHE B 2 403 ? 74.340  15.882  6.859   1.00 0.00 ? 403 PHE B C   1  
ATOM 6587   O O   . PHE B 2 403 ? 74.834  14.842  7.329   1.00 0.00 ? 403 PHE B O   1  
ATOM 6588   C CB  . PHE B 2 403 ? 74.395  16.268  4.310   1.00 0.00 ? 403 PHE B CB  1  
ATOM 6589   C CG  . PHE B 2 403 ? 75.587  15.347  4.139   1.00 0.00 ? 403 PHE B CG  1  
ATOM 6590   C CD1 . PHE B 2 403 ? 75.565  14.126  3.489   1.00 0.00 ? 403 PHE B CD1 1  
ATOM 6591   C CD2 . PHE B 2 403 ? 76.805  15.695  4.847   1.00 0.00 ? 403 PHE B CD2 1  
ATOM 6592   C CE1 . PHE B 2 403 ? 76.669  13.335  3.418   1.00 0.00 ? 403 PHE B CE1 1  
ATOM 6593   C CE2 . PHE B 2 403 ? 77.949  14.868  4.722   1.00 0.00 ? 403 PHE B CE2 1  
ATOM 6594   C CZ  . PHE B 2 403 ? 77.843  13.672  4.040   1.00 0.00 ? 403 PHE B CZ  1  
ATOM 6595   N N   . MET B 2 404 ? 74.434  17.057  7.521   1.00 0.00 ? 404 MET B N   1  
ATOM 6596   C CA  . MET B 2 404 ? 75.143  17.276  8.705   1.00 0.00 ? 404 MET B CA  1  
ATOM 6597   C C   . MET B 2 404 ? 74.628  16.517  9.916   1.00 0.00 ? 404 MET B C   1  
ATOM 6598   O O   . MET B 2 404 ? 75.381  15.873  10.636  1.00 0.00 ? 404 MET B O   1  
ATOM 6599   C CB  . MET B 2 404 ? 75.310  18.830  8.932   1.00 0.00 ? 404 MET B CB  1  
ATOM 6600   C CG  . MET B 2 404 ? 76.333  19.203  10.008  1.00 0.00 ? 404 MET B CG  1  
ATOM 6601   S SD  . MET B 2 404 ? 75.788  18.905  11.763  1.00 0.00 ? 404 MET B SD  1  
ATOM 6602   C CE  . MET B 2 404 ? 77.222  19.497  12.581  1.00 0.00 ? 404 MET B CE  1  
ATOM 6603   N N   . ILE B 2 405 ? 73.295  16.552  10.066  1.00 0.00 ? 405 ILE B N   1  
ATOM 6604   C CA  . ILE B 2 405 ? 72.612  15.861  11.144  1.00 0.00 ? 405 ILE B CA  1  
ATOM 6605   C C   . ILE B 2 405 ? 72.755  14.372  11.094  1.00 0.00 ? 405 ILE B C   1  
ATOM 6606   O O   . ILE B 2 405 ? 72.943  13.723  12.082  1.00 0.00 ? 405 ILE B O   1  
ATOM 6607   C CB  . ILE B 2 405 ? 71.224  16.483  11.435  1.00 0.00 ? 405 ILE B CB  1  
ATOM 6608   C CG1 . ILE B 2 405 ? 70.808  16.239  12.937  1.00 0.00 ? 405 ILE B CG1 1  
ATOM 6609   C CG2 . ILE B 2 405 ? 70.147  16.097  10.450  1.00 0.00 ? 405 ILE B CG2 1  
ATOM 6610   C CD1 . ILE B 2 405 ? 69.437  16.827  13.312  1.00 0.00 ? 405 ILE B CD1 1  
ATOM 6611   N N   . GLY B 2 406 ? 72.615  13.881  9.810   1.00 0.00 ? 406 GLY B N   1  
ATOM 6612   C CA  . GLY B 2 406 ? 72.614  12.506  9.419   1.00 0.00 ? 406 GLY B CA  1  
ATOM 6613   C C   . GLY B 2 406 ? 73.995  11.921  9.757   1.00 0.00 ? 406 GLY B C   1  
ATOM 6614   O O   . GLY B 2 406 ? 74.163  10.821  10.216  1.00 0.00 ? 406 GLY B O   1  
ATOM 6615   N N   . LYS B 2 407 ? 75.006  12.762  9.442   1.00 0.00 ? 407 LYS B N   1  
ATOM 6616   C CA  . LYS B 2 407 ? 76.415  12.409  9.619   1.00 0.00 ? 407 LYS B CA  1  
ATOM 6617   C C   . LYS B 2 407 ? 76.707  12.151  11.067  1.00 0.00 ? 407 LYS B C   1  
ATOM 6618   O O   . LYS B 2 407 ? 77.386  11.204  11.386  1.00 0.00 ? 407 LYS B O   1  
ATOM 6619   C CB  . LYS B 2 407 ? 77.386  13.506  9.051   1.00 0.00 ? 407 LYS B CB  1  
ATOM 6620   C CG  . LYS B 2 407 ? 78.722  12.903  8.709   1.00 0.00 ? 407 LYS B CG  1  
ATOM 6621   C CD  . LYS B 2 407 ? 79.694  13.878  8.041   1.00 0.00 ? 407 LYS B CD  1  
ATOM 6622   C CE  . LYS B 2 407 ? 79.942  15.285  8.595   1.00 0.00 ? 407 LYS B CE  1  
ATOM 6623   N NZ  . LYS B 2 407 ? 80.709  16.141  7.720   1.00 0.00 ? 407 LYS B NZ  1  
ATOM 6624   N N   . SER B 2 408 ? 76.109  12.989  11.971  1.00 0.00 ? 408 SER B N   1  
ATOM 6625   C CA  . SER B 2 408 ? 76.218  12.916  13.396  1.00 0.00 ? 408 SER B CA  1  
ATOM 6626   C C   . SER B 2 408 ? 75.580  11.610  13.905  1.00 0.00 ? 408 SER B C   1  
ATOM 6627   O O   . SER B 2 408 ? 76.081  11.006  14.857  1.00 0.00 ? 408 SER B O   1  
ATOM 6628   C CB  . SER B 2 408 ? 75.400  13.897  14.199  1.00 0.00 ? 408 SER B CB  1  
ATOM 6629   O OG  . SER B 2 408 ? 75.873  15.183  13.858  1.00 0.00 ? 408 SER B OG  1  
ATOM 6630   N N   . TYR B 2 409 ? 74.382  11.177  13.368  1.00 0.00 ? 409 TYR B N   1  
ATOM 6631   C CA  . TYR B 2 409 ? 73.666  9.937   13.767  1.00 0.00 ? 409 TYR B CA  1  
ATOM 6632   C C   . TYR B 2 409 ? 74.538  8.778   13.435  1.00 0.00 ? 409 TYR B C   1  
ATOM 6633   O O   . TYR B 2 409 ? 74.604  7.859   14.268  1.00 0.00 ? 409 TYR B O   1  
ATOM 6634   C CB  . TYR B 2 409 ? 72.288  9.795   13.114  1.00 0.00 ? 409 TYR B CB  1  
ATOM 6635   C CG  . TYR B 2 409 ? 71.550  8.637   13.818  1.00 0.00 ? 409 TYR B CG  1  
ATOM 6636   C CD1 . TYR B 2 409 ? 70.876  8.923   15.054  1.00 0.00 ? 409 TYR B CD1 1  
ATOM 6637   C CD2 . TYR B 2 409 ? 71.431  7.309   13.347  1.00 0.00 ? 409 TYR B CD2 1  
ATOM 6638   C CE1 . TYR B 2 409 ? 70.106  7.942   15.763  1.00 0.00 ? 409 TYR B CE1 1  
ATOM 6639   C CE2 . TYR B 2 409 ? 70.629  6.390   13.987  1.00 0.00 ? 409 TYR B CE2 1  
ATOM 6640   C CZ  . TYR B 2 409 ? 70.051  6.658   15.225  1.00 0.00 ? 409 TYR B CZ  1  
ATOM 6641   O OH  . TYR B 2 409 ? 69.397  5.668   15.931  1.00 0.00 ? 409 TYR B OH  1  
ATOM 6642   N N   . ILE B 2 410 ? 75.226  8.727   12.282  1.00 0.00 ? 410 ILE B N   1  
ATOM 6643   C CA  . ILE B 2 410 ? 76.122  7.611   11.887  1.00 0.00 ? 410 ILE B CA  1  
ATOM 6644   C C   . ILE B 2 410 ? 77.255  7.569   12.871  1.00 0.00 ? 410 ILE B C   1  
ATOM 6645   O O   . ILE B 2 410 ? 77.520  6.459   13.322  1.00 0.00 ? 410 ILE B O   1  
ATOM 6646   C CB  . ILE B 2 410 ? 76.716  7.867   10.501  1.00 0.00 ? 410 ILE B CB  1  
ATOM 6647   C CG1 . ILE B 2 410 ? 75.595  7.704   9.488   1.00 0.00 ? 410 ILE B CG1 1  
ATOM 6648   C CG2 . ILE B 2 410 ? 77.888  6.855   10.264  1.00 0.00 ? 410 ILE B CG2 1  
ATOM 6649   C CD1 . ILE B 2 410 ? 76.029  7.930   8.030   1.00 0.00 ? 410 ILE B CD1 1  
ATOM 6650   N N   . PHE B 2 411 ? 77.873  8.701   13.335  1.00 0.00 ? 411 PHE B N   1  
ATOM 6651   C CA  . PHE B 2 411 ? 78.915  8.821   14.284  1.00 0.00 ? 411 PHE B CA  1  
ATOM 6652   C C   . PHE B 2 411 ? 78.424  8.319   15.663  1.00 0.00 ? 411 PHE B C   1  
ATOM 6653   O O   . PHE B 2 411 ? 79.228  7.647   16.284  1.00 0.00 ? 411 PHE B O   1  
ATOM 6654   C CB  . PHE B 2 411 ? 79.521  10.241  14.680  1.00 0.00 ? 411 PHE B CB  1  
ATOM 6655   C CG  . PHE B 2 411 ? 80.214  10.859  13.457  1.00 0.00 ? 411 PHE B CG  1  
ATOM 6656   C CD1 . PHE B 2 411 ? 81.130  10.127  12.724  1.00 0.00 ? 411 PHE B CD1 1  
ATOM 6657   C CD2 . PHE B 2 411 ? 80.157  12.223  13.186  1.00 0.00 ? 411 PHE B CD2 1  
ATOM 6658   C CE1 . PHE B 2 411 ? 81.893  10.642  11.677  1.00 0.00 ? 411 PHE B CE1 1  
ATOM 6659   C CE2 . PHE B 2 411 ? 80.959  12.806  12.152  1.00 0.00 ? 411 PHE B CE2 1  
ATOM 6660   C CZ  . PHE B 2 411 ? 81.848  12.038  11.402  1.00 0.00 ? 411 PHE B CZ  1  
ATOM 6661   N N   . LEU B 2 412 ? 77.174  8.536   16.113  1.00 0.00 ? 412 LEU B N   1  
ATOM 6662   C CA  . LEU B 2 412 ? 76.642  7.993   17.362  1.00 0.00 ? 412 LEU B CA  1  
ATOM 6663   C C   . LEU B 2 412 ? 76.563  6.441   17.409  1.00 0.00 ? 412 LEU B C   1  
ATOM 6664   O O   . LEU B 2 412 ? 77.009  5.869   18.447  1.00 0.00 ? 412 LEU B O   1  
ATOM 6665   C CB  . LEU B 2 412 ? 75.257  8.596   17.629  1.00 0.00 ? 412 LEU B CB  1  
ATOM 6666   C CG  . LEU B 2 412 ? 75.201  10.162  17.935  1.00 0.00 ? 412 LEU B CG  1  
ATOM 6667   C CD1 . LEU B 2 412 ? 73.855  10.709  18.570  1.00 0.00 ? 412 LEU B CD1 1  
ATOM 6668   C CD2 . LEU B 2 412 ? 76.458  10.691  18.689  1.00 0.00 ? 412 LEU B CD2 1  
ATOM 6669   N N   . GLU B 2 413 ? 76.159  5.735   16.343  1.00 0.00 ? 413 GLU B N   1  
ATOM 6670   C CA  . GLU B 2 413 ? 76.140  4.344   16.124  1.00 0.00 ? 413 GLU B CA  1  
ATOM 6671   C C   . GLU B 2 413 ? 77.589  3.731   16.050  1.00 0.00 ? 413 GLU B C   1  
ATOM 6672   O O   . GLU B 2 413 ? 77.799  2.653   16.613  1.00 0.00 ? 413 GLU B O   1  
ATOM 6673   C CB  . GLU B 2 413 ? 75.384  3.974   14.787  1.00 0.00 ? 413 GLU B CB  1  
ATOM 6674   C CG  . GLU B 2 413 ? 73.843  4.260   14.795  1.00 0.00 ? 413 GLU B CG  1  
ATOM 6675   C CD  . GLU B 2 413 ? 73.014  3.600   15.868  1.00 0.00 ? 413 GLU B CD  1  
ATOM 6676   O OE1 . GLU B 2 413 ? 73.017  2.359   15.935  1.00 0.00 ? 413 GLU B OE1 1  
ATOM 6677   O OE2 . GLU B 2 413 ? 72.343  4.304   16.646  1.00 0.00 ? 413 GLU B OE2 1  
ATOM 6678   N N   . LYS B 2 414 ? 78.580  4.380   15.467  1.00 0.00 ? 414 LYS B N   1  
ATOM 6679   C CA  . LYS B 2 414 ? 79.967  3.932   15.464  1.00 0.00 ? 414 LYS B CA  1  
ATOM 6680   C C   . LYS B 2 414 ? 80.589  3.938   16.770  1.00 0.00 ? 414 LYS B C   1  
ATOM 6681   O O   . LYS B 2 414 ? 81.369  3.015   17.038  1.00 0.00 ? 414 LYS B O   1  
ATOM 6682   C CB  . LYS B 2 414 ? 80.830  4.705   14.488  1.00 0.00 ? 414 LYS B CB  1  
ATOM 6683   C CG  . LYS B 2 414 ? 82.141  4.085   14.081  1.00 0.00 ? 414 LYS B CG  1  
ATOM 6684   C CD  . LYS B 2 414 ? 83.170  5.087   13.541  1.00 0.00 ? 414 LYS B CD  1  
ATOM 6685   C CE  . LYS B 2 414 ? 84.553  4.448   13.245  1.00 0.00 ? 414 LYS B CE  1  
ATOM 6686   N NZ  . LYS B 2 414 ? 85.107  3.626   14.386  1.00 0.00 ? 414 LYS B NZ  1  
ATOM 6687   N N   . TYR B 2 415 ? 80.210  4.908   17.655  1.00 0.00 ? 415 TYR B N   1  
ATOM 6688   C CA  . TYR B 2 415 ? 80.730  5.007   19.014  1.00 0.00 ? 415 TYR B CA  1  
ATOM 6689   C C   . TYR B 2 415 ? 80.468  3.729   19.789  1.00 0.00 ? 415 TYR B C   1  
ATOM 6690   O O   . TYR B 2 415 ? 81.255  3.216   20.507  1.00 0.00 ? 415 TYR B O   1  
ATOM 6691   C CB  . TYR B 2 415 ? 80.193  6.195   19.841  1.00 0.00 ? 415 TYR B CB  1  
ATOM 6692   C CG  . TYR B 2 415 ? 80.766  6.299   21.249  1.00 0.00 ? 415 TYR B CG  1  
ATOM 6693   C CD1 . TYR B 2 415 ? 82.098  6.169   21.579  1.00 0.00 ? 415 TYR B CD1 1  
ATOM 6694   C CD2 . TYR B 2 415 ? 79.832  6.276   22.265  1.00 0.00 ? 415 TYR B CD2 1  
ATOM 6695   C CE1 . TYR B 2 415 ? 82.538  5.953   22.916  1.00 0.00 ? 415 TYR B CE1 1  
ATOM 6696   C CE2 . TYR B 2 415 ? 80.267  6.215   23.590  1.00 0.00 ? 415 TYR B CE2 1  
ATOM 6697   C CZ  . TYR B 2 415 ? 81.622  6.100   23.907  1.00 0.00 ? 415 TYR B CZ  1  
ATOM 6698   O OH  . TYR B 2 415 ? 82.067  5.805   25.180  1.00 0.00 ? 415 TYR B OH  1  
ATOM 6699   N N   . CYS B 2 416 ? 79.164  3.300   19.639  1.00 0.00 ? 416 CYS B N   1  
ATOM 6700   C CA  . CYS B 2 416 ? 78.652  2.042   20.187  1.00 0.00 ? 416 CYS B CA  1  
ATOM 6701   C C   . CYS B 2 416 ? 77.170  2.241   19.924  1.00 0.00 ? 416 CYS B C   1  
ATOM 6702   O O   . CYS B 2 416 ? 76.565  3.258   20.367  1.00 0.00 ? 416 CYS B O   1  
ATOM 6703   C CB  . CYS B 2 416 ? 78.757  1.792   21.692  1.00 0.00 ? 416 CYS B CB  1  
ATOM 6704   S SG  . CYS B 2 416 ? 78.016  0.253   22.257  1.00 0.00 ? 416 CYS B SG  1  
ATOM 6705   N N   . LYS B 2 417 ? 76.522  1.297   19.119  1.00 0.00 ? 417 LYS B N   1  
ATOM 6706   C CA  . LYS B 2 417 ? 75.180  1.259   18.502  1.00 0.00 ? 417 LYS B CA  1  
ATOM 6707   C C   . LYS B 2 417 ? 74.132  1.561   19.512  1.00 0.00 ? 417 LYS B C   1  
ATOM 6708   O O   . LYS B 2 417 ? 73.972  0.964   20.562  1.00 0.00 ? 417 LYS B O   1  
ATOM 6709   C CB  . LYS B 2 417 ? 74.854  -0.106  17.832  1.00 0.00 ? 417 LYS B CB  1  
ATOM 6710   C CG  . LYS B 2 417 ? 75.658  -0.394  16.555  1.00 0.00 ? 417 LYS B CG  1  
ATOM 6711   C CD  . LYS B 2 417 ? 75.103  -1.631  15.858  1.00 0.00 ? 417 LYS B CD  1  
ATOM 6712   C CE  . LYS B 2 417 ? 75.833  -1.970  14.507  1.00 0.00 ? 417 LYS B CE  1  
ATOM 6713   N NZ  . LYS B 2 417 ? 75.374  -3.197  13.801  1.00 0.00 ? 417 LYS B NZ  1  
ATOM 6714   N N   . GLU B 2 418 ? 73.302  2.514   19.191  1.00 0.00 ? 418 GLU B N   1  
ATOM 6715   C CA  . GLU B 2 418 ? 72.259  2.984   19.998  1.00 0.00 ? 418 GLU B CA  1  
ATOM 6716   C C   . GLU B 2 418 ? 70.996  2.406   19.552  1.00 0.00 ? 418 GLU B C   1  
ATOM 6717   O O   . GLU B 2 418 ? 70.879  2.190   18.370  1.00 0.00 ? 418 GLU B O   1  
ATOM 6718   C CB  . GLU B 2 418 ? 72.044  4.477   19.893  1.00 0.00 ? 418 GLU B CB  1  
ATOM 6719   C CG  . GLU B 2 418 ? 73.408  5.180   20.014  1.00 0.00 ? 418 GLU B CG  1  
ATOM 6720   C CD  . GLU B 2 418 ? 73.049  6.669   19.676  1.00 0.00 ? 418 GLU B CD  1  
ATOM 6721   O OE1 . GLU B 2 418 ? 72.598  7.031   18.551  1.00 0.00 ? 418 GLU B OE1 1  
ATOM 6722   O OE2 . GLU B 2 418 ? 73.334  7.459   20.599  1.00 0.00 ? 418 GLU B OE2 1  
ATOM 6723   N N   . VAL B 2 419 ? 70.105  2.095   20.545  1.00 0.00 ? 419 VAL B N   1  
ATOM 6724   C CA  . VAL B 2 419 ? 68.828  1.524   20.378  1.00 0.00 ? 419 VAL B CA  1  
ATOM 6725   C C   . VAL B 2 419 ? 67.837  2.624   19.880  1.00 0.00 ? 419 VAL B C   1  
ATOM 6726   O O   . VAL B 2 419 ? 67.970  3.788   20.316  1.00 0.00 ? 419 VAL B O   1  
ATOM 6727   C CB  . VAL B 2 419 ? 68.193  0.866   21.585  1.00 0.00 ? 419 VAL B CB  1  
ATOM 6728   C CG1 . VAL B 2 419 ? 69.129  -0.263  21.938  1.00 0.00 ? 419 VAL B CG1 1  
ATOM 6729   C CG2 . VAL B 2 419 ? 68.038  1.791   22.817  1.00 0.00 ? 419 VAL B CG2 1  
ATOM 6730   N N   . GLN B 2 420 ? 66.943  2.245   18.874  1.00 0.00 ? 420 GLN B N   1  
ATOM 6731   C CA  . GLN B 2 420 ? 65.996  3.109   18.209  1.00 0.00 ? 420 GLN B CA  1  
ATOM 6732   C C   . GLN B 2 420 ? 65.082  3.861   19.187  1.00 0.00 ? 420 GLN B C   1  
ATOM 6733   O O   . GLN B 2 420 ? 64.142  3.342   19.855  1.00 0.00 ? 420 GLN B O   1  
ATOM 6734   C CB  . GLN B 2 420 ? 65.112  2.367   17.165  1.00 0.00 ? 420 GLN B CB  1  
ATOM 6735   C CG  . GLN B 2 420 ? 65.950  1.578   16.008  1.00 0.00 ? 420 GLN B CG  1  
ATOM 6736   C CD  . GLN B 2 420 ? 66.907  2.478   15.226  1.00 0.00 ? 420 GLN B CD  1  
ATOM 6737   O OE1 . GLN B 2 420 ? 68.171  2.331   15.119  1.00 0.00 ? 420 GLN B OE1 1  
ATOM 6738   N NE2 . GLN B 2 420 ? 66.317  3.511   14.536  1.00 0.00 ? 420 GLN B NE2 1  
ATOM 6739   N N   . TRP B 2 421 ? 65.340  5.159   19.441  1.00 0.00 ? 421 TRP B N   1  
ATOM 6740   C CA  . TRP B 2 421 ? 64.687  5.960   20.476  1.00 0.00 ? 421 TRP B CA  1  
ATOM 6741   C C   . TRP B 2 421 ? 63.436  6.629   19.924  1.00 0.00 ? 421 TRP B C   1  
ATOM 6742   O O   . TRP B 2 421 ? 62.810  6.113   19.042  1.00 0.00 ? 421 TRP B O   1  
ATOM 6743   C CB  . TRP B 2 421 ? 65.601  7.074   21.065  1.00 0.00 ? 421 TRP B CB  1  
ATOM 6744   C CG  . TRP B 2 421 ? 66.765  6.448   21.930  1.00 0.00 ? 421 TRP B CG  1  
ATOM 6745   C CD1 . TRP B 2 421 ? 66.708  5.366   22.832  1.00 0.00 ? 421 TRP B CD1 1  
ATOM 6746   C CD2 . TRP B 2 421 ? 68.069  7.064   22.079  1.00 0.00 ? 421 TRP B CD2 1  
ATOM 6747   N NE1 . TRP B 2 421 ? 67.944  5.167   23.402  1.00 0.00 ? 421 TRP B NE1 1  
ATOM 6748   C CE2 . TRP B 2 421 ? 68.781  6.181   22.942  1.00 0.00 ? 421 TRP B CE2 1  
ATOM 6749   C CE3 . TRP B 2 421 ? 68.701  8.210   21.477  1.00 0.00 ? 421 TRP B CE3 1  
ATOM 6750   C CZ2 . TRP B 2 421 ? 70.087  6.473   23.247  1.00 0.00 ? 421 TRP B CZ2 1  
ATOM 6751   C CZ3 . TRP B 2 421 ? 70.055  8.429   21.802  1.00 0.00 ? 421 TRP B CZ3 1  
ATOM 6752   C CH2 . TRP B 2 421 ? 70.715  7.666   22.727  1.00 0.00 ? 421 TRP B CH2 1  
ATOM 6753   N N   . THR B 2 422 ? 63.078  7.742   20.574  1.00 0.00 ? 422 THR B N   1  
ATOM 6754   C CA  . THR B 2 422 ? 61.841  8.512   20.308  1.00 0.00 ? 422 THR B CA  1  
ATOM 6755   C C   . THR B 2 422 ? 61.831  9.267   19.026  1.00 0.00 ? 422 THR B C   1  
ATOM 6756   O O   . THR B 2 422 ? 60.718  9.609   18.496  1.00 0.00 ? 422 THR B O   1  
ATOM 6757   C CB  . THR B 2 422 ? 61.674  9.606   21.416  1.00 0.00 ? 422 THR B CB  1  
ATOM 6758   O OG1 . THR B 2 422 ? 62.786  10.402  21.649  1.00 0.00 ? 422 THR B OG1 1  
ATOM 6759   C CG2 . THR B 2 422 ? 61.240  8.944   22.712  1.00 0.00 ? 422 THR B CG2 1  
ATOM 6760   N N   . ASN B 2 423 ? 63.024  9.526   18.453  1.00 0.00 ? 423 ASN B N   1  
ATOM 6761   C CA  . ASN B 2 423 ? 63.229  10.115  17.192  1.00 0.00 ? 423 ASN B CA  1  
ATOM 6762   C C   . ASN B 2 423 ? 62.583  9.344   16.062  1.00 0.00 ? 423 ASN B C   1  
ATOM 6763   O O   . ASN B 2 423 ? 62.135  10.057  15.157  1.00 0.00 ? 423 ASN B O   1  
ATOM 6764   C CB  . ASN B 2 423 ? 64.774  10.336  17.017  1.00 0.00 ? 423 ASN B CB  1  
ATOM 6765   C CG  . ASN B 2 423 ? 65.714  9.139   16.991  1.00 0.00 ? 423 ASN B CG  1  
ATOM 6766   O OD1 . ASN B 2 423 ? 65.885  8.519   15.961  1.00 0.00 ? 423 ASN B OD1 1  
ATOM 6767   N ND2 . ASN B 2 423 ? 66.458  8.856   18.130  1.00 0.00 ? 423 ASN B ND2 1  
ATOM 6768   N N   . GLU B 2 424 ? 62.575  8.021   16.037  1.00 0.00 ? 424 GLU B N   1  
ATOM 6769   C CA  . GLU B 2 424 ? 62.005  7.343   14.934  1.00 0.00 ? 424 GLU B CA  1  
ATOM 6770   C C   . GLU B 2 424 ? 60.446  7.614   14.794  1.00 0.00 ? 424 GLU B C   1  
ATOM 6771   O O   . GLU B 2 424 ? 60.008  7.889   13.660  1.00 0.00 ? 424 GLU B O   1  
ATOM 6772   C CB  . GLU B 2 424 ? 62.223  5.822   15.192  1.00 0.00 ? 424 GLU B CB  1  
ATOM 6773   C CG  . GLU B 2 424 ? 61.463  4.908   14.254  1.00 0.00 ? 424 GLU B CG  1  
ATOM 6774   C CD  . GLU B 2 424 ? 62.115  3.516   14.220  1.00 0.00 ? 424 GLU B CD  1  
ATOM 6775   O OE1 . GLU B 2 424 ? 61.838  2.711   15.128  1.00 0.00 ? 424 GLU B OE1 1  
ATOM 6776   O OE2 . GLU B 2 424 ? 62.843  3.172   13.240  1.00 0.00 ? 424 GLU B OE2 1  
ATOM 6777   N N   . PHE B 2 425 ? 59.715  7.611   15.932  1.00 0.00 ? 425 PHE B N   1  
ATOM 6778   C CA  . PHE B 2 425 ? 58.306  7.871   15.697  1.00 0.00 ? 425 PHE B CA  1  
ATOM 6779   C C   . PHE B 2 425 ? 58.075  9.363   15.211  1.00 0.00 ? 425 PHE B C   1  
ATOM 6780   O O   . PHE B 2 425 ? 57.288  9.599   14.356  1.00 0.00 ? 425 PHE B O   1  
ATOM 6781   C CB  . PHE B 2 425 ? 57.354  7.466   16.852  1.00 0.00 ? 425 PHE B CB  1  
ATOM 6782   C CG  . PHE B 2 425 ? 57.728  7.875   18.247  1.00 0.00 ? 425 PHE B CG  1  
ATOM 6783   C CD1 . PHE B 2 425 ? 57.574  9.224   18.647  1.00 0.00 ? 425 PHE B CD1 1  
ATOM 6784   C CD2 . PHE B 2 425 ? 58.108  6.880   19.248  1.00 0.00 ? 425 PHE B CD2 1  
ATOM 6785   C CE1 . PHE B 2 425 ? 57.908  9.631   19.932  1.00 0.00 ? 425 PHE B CE1 1  
ATOM 6786   C CE2 . PHE B 2 425 ? 58.142  7.281   20.603  1.00 0.00 ? 425 PHE B CE2 1  
ATOM 6787   C CZ  . PHE B 2 425 ? 58.224  8.624   20.884  1.00 0.00 ? 425 PHE B CZ  1  
ATOM 6788   N N   . SER B 2 426 ? 58.786  10.364  15.784  1.00 0.00 ? 426 SER B N   1  
ATOM 6789   C CA  . SER B 2 426 ? 58.525  11.762  15.460  1.00 0.00 ? 426 SER B CA  1  
ATOM 6790   C C   . SER B 2 426 ? 58.842  12.078  13.987  1.00 0.00 ? 426 SER B C   1  
ATOM 6791   O O   . SER B 2 426 ? 58.050  12.699  13.263  1.00 0.00 ? 426 SER B O   1  
ATOM 6792   C CB  . SER B 2 426 ? 59.106  12.752  16.469  1.00 0.00 ? 426 SER B CB  1  
ATOM 6793   O OG  . SER B 2 426 ? 60.517  12.741  16.653  1.00 0.00 ? 426 SER B OG  1  
ATOM 6794   N N   . LYS B 2 427 ? 60.001  11.557  13.401  1.00 0.00 ? 427 LYS B N   1  
ATOM 6795   C CA  . LYS B 2 427 ? 60.424  11.525  11.994  1.00 0.00 ? 427 LYS B CA  1  
ATOM 6796   C C   . LYS B 2 427 ? 59.486  10.733  11.084  1.00 0.00 ? 427 LYS B C   1  
ATOM 6797   O O   . LYS B 2 427 ? 59.249  11.215  10.045  1.00 0.00 ? 427 LYS B O   1  
ATOM 6798   C CB  . LYS B 2 427 ? 61.793  10.876  11.793  1.00 0.00 ? 427 LYS B CB  1  
ATOM 6799   C CG  . LYS B 2 427 ? 62.441  11.017  10.403  1.00 0.00 ? 427 LYS B CG  1  
ATOM 6800   C CD  . LYS B 2 427 ? 62.288  12.487  9.923   1.00 0.00 ? 427 LYS B CD  1  
ATOM 6801   C CE  . LYS B 2 427 ? 62.764  12.470  8.500   1.00 0.00 ? 427 LYS B CE  1  
ATOM 6802   N NZ  . LYS B 2 427 ? 62.722  13.914  8.145   1.00 0.00 ? 427 LYS B NZ  1  
ATOM 6803   N N   . LYS B 2 428 ? 58.946  9.625   11.535  1.00 0.00 ? 428 LYS B N   1  
ATOM 6804   C CA  . LYS B 2 428 ? 57.938  8.907   10.845  1.00 0.00 ? 428 LYS B CA  1  
ATOM 6805   C C   . LYS B 2 428 ? 56.643  9.687   10.676  1.00 0.00 ? 428 LYS B C   1  
ATOM 6806   O O   . LYS B 2 428 ? 56.062  9.664   9.564   1.00 0.00 ? 428 LYS B O   1  
ATOM 6807   C CB  . LYS B 2 428 ? 57.714  7.517   11.508  1.00 0.00 ? 428 LYS B CB  1  
ATOM 6808   C CG  . LYS B 2 428 ? 56.688  6.609   10.765  1.00 0.00 ? 428 LYS B CG  1  
ATOM 6809   C CD  . LYS B 2 428 ? 56.395  5.281   11.507  1.00 0.00 ? 428 LYS B CD  1  
ATOM 6810   C CE  . LYS B 2 428 ? 55.645  5.385   12.863  1.00 0.00 ? 428 LYS B CE  1  
ATOM 6811   N NZ  . LYS B 2 428 ? 54.207  5.722   12.758  1.00 0.00 ? 428 LYS B NZ  1  
ATOM 6812   N N   . TYR B 2 429 ? 56.213  10.445  11.668  1.00 0.00 ? 429 TYR B N   1  
ATOM 6813   C CA  . TYR B 2 429 ? 54.996  11.237  11.596  1.00 0.00 ? 429 TYR B CA  1  
ATOM 6814   C C   . TYR B 2 429 ? 55.245  12.243  10.538  1.00 0.00 ? 429 TYR B C   1  
ATOM 6815   O O   . TYR B 2 429 ? 54.397  12.563  9.721   1.00 0.00 ? 429 TYR B O   1  
ATOM 6816   C CB  . TYR B 2 429 ? 54.618  12.065  12.889  1.00 0.00 ? 429 TYR B CB  1  
ATOM 6817   C CG  . TYR B 2 429 ? 54.139  11.089  13.979  1.00 0.00 ? 429 TYR B CG  1  
ATOM 6818   C CD1 . TYR B 2 429 ? 53.305  9.985   13.837  1.00 0.00 ? 429 TYR B CD1 1  
ATOM 6819   C CD2 . TYR B 2 429 ? 54.482  11.405  15.343  1.00 0.00 ? 429 TYR B CD2 1  
ATOM 6820   C CE1 . TYR B 2 429 ? 52.883  9.202   14.902  1.00 0.00 ? 429 TYR B CE1 1  
ATOM 6821   C CE2 . TYR B 2 429 ? 54.107  10.722  16.443  1.00 0.00 ? 429 TYR B CE2 1  
ATOM 6822   C CZ  . TYR B 2 429 ? 53.209  9.583   16.230  1.00 0.00 ? 429 TYR B CZ  1  
ATOM 6823   O OH  . TYR B 2 429 ? 52.750  8.835   17.360  1.00 0.00 ? 429 TYR B OH  1  
ATOM 6824   N N   . HIS B 2 430 ? 56.467  12.846  10.594  1.00 0.00 ? 430 HIS B N   1  
ATOM 6825   C CA  . HIS B 2 430 ? 56.827  13.988  9.776   1.00 0.00 ? 430 HIS B CA  1  
ATOM 6826   C C   . HIS B 2 430 ? 56.803  13.734  8.294   1.00 0.00 ? 430 HIS B C   1  
ATOM 6827   O O   . HIS B 2 430 ? 56.339  14.584  7.525   1.00 0.00 ? 430 HIS B O   1  
ATOM 6828   C CB  . HIS B 2 430 ? 58.162  14.551  10.128  1.00 0.00 ? 430 HIS B CB  1  
ATOM 6829   C CG  . HIS B 2 430 ? 58.279  15.026  11.555  1.00 0.00 ? 430 HIS B CG  1  
ATOM 6830   N ND1 . HIS B 2 430 ? 57.204  15.686  12.143  1.00 0.00 ? 430 HIS B ND1 1  
ATOM 6831   C CD2 . HIS B 2 430 ? 59.272  14.974  12.485  1.00 0.00 ? 430 HIS B CD2 1  
ATOM 6832   C CE1 . HIS B 2 430 ? 57.589  15.905  13.417  1.00 0.00 ? 430 HIS B CE1 1  
ATOM 6833   N NE2 . HIS B 2 430 ? 58.870  15.592  13.641  1.00 0.00 ? 430 HIS B NE2 1  
ATOM 6834   N N   . VAL B 2 431 ? 57.312  12.516  7.928   1.00 0.00 ? 431 VAL B N   1  
ATOM 6835   C CA  . VAL B 2 431 ? 57.236  12.078  6.556   1.00 0.00 ? 431 VAL B CA  1  
ATOM 6836   C C   . VAL B 2 431 ? 55.848  11.855  6.057   1.00 0.00 ? 431 VAL B C   1  
ATOM 6837   O O   . VAL B 2 431 ? 55.495  12.192  4.939   1.00 0.00 ? 431 VAL B O   1  
ATOM 6838   C CB  . VAL B 2 431 ? 58.187  10.804  6.400   1.00 0.00 ? 431 VAL B CB  1  
ATOM 6839   C CG1 . VAL B 2 431 ? 57.796  9.937   5.181   1.00 0.00 ? 431 VAL B CG1 1  
ATOM 6840   C CG2 . VAL B 2 431 ? 59.631  11.373  6.304   1.00 0.00 ? 431 VAL B CG2 1  
ATOM 6841   N N   . LEU B 2 432 ? 54.959  11.314  6.898   1.00 0.00 ? 432 LEU B N   1  
ATOM 6842   C CA  . LEU B 2 432 ? 53.561  11.256  6.515   1.00 0.00 ? 432 LEU B CA  1  
ATOM 6843   C C   . LEU B 2 432 ? 52.948  12.602  6.301   1.00 0.00 ? 432 LEU B C   1  
ATOM 6844   O O   . LEU B 2 432 ? 52.207  12.743  5.402   1.00 0.00 ? 432 LEU B O   1  
ATOM 6845   C CB  . LEU B 2 432 ? 52.670  10.409  7.505   1.00 0.00 ? 432 LEU B CB  1  
ATOM 6846   C CG  . LEU B 2 432 ? 52.971  8.911   7.567   1.00 0.00 ? 432 LEU B CG  1  
ATOM 6847   C CD1 . LEU B 2 432 ? 52.083  8.292   8.660   1.00 0.00 ? 432 LEU B CD1 1  
ATOM 6848   C CD2 . LEU B 2 432 ? 52.760  8.268   6.163   1.00 0.00 ? 432 LEU B CD2 1  
ATOM 6849   N N   . TYR B 2 433 ? 53.305  13.695  7.065   1.00 0.00 ? 433 TYR B N   1  
ATOM 6850   C CA  . TYR B 2 433 ? 52.817  15.108  6.916   1.00 0.00 ? 433 TYR B CA  1  
ATOM 6851   C C   . TYR B 2 433 ? 53.220  15.650  5.611   1.00 0.00 ? 433 TYR B C   1  
ATOM 6852   O O   . TYR B 2 433 ? 52.411  16.347  4.930   1.00 0.00 ? 433 TYR B O   1  
ATOM 6853   C CB  . TYR B 2 433 ? 53.356  16.049  8.011   1.00 0.00 ? 433 TYR B CB  1  
ATOM 6854   C CG  . TYR B 2 433 ? 53.036  15.702  9.459   1.00 0.00 ? 433 TYR B CG  1  
ATOM 6855   C CD1 . TYR B 2 433 ? 52.199  14.657  9.935   1.00 0.00 ? 433 TYR B CD1 1  
ATOM 6856   C CD2 . TYR B 2 433 ? 53.761  16.480  10.480  1.00 0.00 ? 433 TYR B CD2 1  
ATOM 6857   C CE1 . TYR B 2 433 ? 52.106  14.344  11.242  1.00 0.00 ? 433 TYR B CE1 1  
ATOM 6858   C CE2 . TYR B 2 433 ? 53.570  16.212  11.798  1.00 0.00 ? 433 TYR B CE2 1  
ATOM 6859   C CZ  . TYR B 2 433 ? 52.776  15.182  12.209  1.00 0.00 ? 433 TYR B CZ  1  
ATOM 6860   O OH  . TYR B 2 433 ? 52.370  15.125  13.578  1.00 0.00 ? 433 TYR B OH  1  
ATOM 6861   N N   . GLN B 2 434 ? 54.465  15.422  5.234   1.00 0.00 ? 434 GLN B N   1  
ATOM 6862   C CA  . GLN B 2 434 ? 55.185  15.899  4.065   1.00 0.00 ? 434 GLN B CA  1  
ATOM 6863   C C   . GLN B 2 434 ? 54.496  15.273  2.869   1.00 0.00 ? 434 GLN B C   1  
ATOM 6864   O O   . GLN B 2 434 ? 54.369  16.001  1.909   1.00 0.00 ? 434 GLN B O   1  
ATOM 6865   C CB  . GLN B 2 434 ? 56.671  15.452  4.160   1.00 0.00 ? 434 GLN B CB  1  
ATOM 6866   C CG  . GLN B 2 434 ? 57.457  16.413  5.146   1.00 0.00 ? 434 GLN B CG  1  
ATOM 6867   C CD  . GLN B 2 434 ? 59.009  16.112  5.173   1.00 0.00 ? 434 GLN B CD  1  
ATOM 6868   O OE1 . GLN B 2 434 ? 59.749  16.829  4.417   1.00 0.00 ? 434 GLN B OE1 1  
ATOM 6869   N NE2 . GLN B 2 434 ? 59.431  15.278  6.159   1.00 0.00 ? 434 GLN B NE2 1  
ATOM 6870   N N   . SER B 2 435 ? 54.092  14.025  2.949   1.00 0.00 ? 435 SER B N   1  
ATOM 6871   C CA  . SER B 2 435 ? 53.426  13.356  1.851   1.00 0.00 ? 435 SER B CA  1  
ATOM 6872   C C   . SER B 2 435 ? 52.087  14.000  1.435   1.00 0.00 ? 435 SER B C   1  
ATOM 6873   O O   . SER B 2 435 ? 51.694  13.961  0.261   1.00 0.00 ? 435 SER B O   1  
ATOM 6874   C CB  . SER B 2 435 ? 53.033  11.900  2.017   1.00 0.00 ? 435 SER B CB  1  
ATOM 6875   O OG  . SER B 2 435 ? 54.259  11.128  2.110   1.00 0.00 ? 435 SER B OG  1  
ATOM 6876   N N   . ASN B 2 436 ? 51.351  14.699  2.374   1.00 0.00 ? 436 ASN B N   1  
ATOM 6877   C CA  . ASN B 2 436 ? 50.080  15.382  2.041   1.00 0.00 ? 436 ASN B CA  1  
ATOM 6878   C C   . ASN B 2 436 ? 50.338  16.543  1.172   1.00 0.00 ? 436 ASN B C   1  
ATOM 6879   O O   . ASN B 2 436 ? 49.636  16.732  0.209   1.00 0.00 ? 436 ASN B O   1  
ATOM 6880   C CB  . ASN B 2 436 ? 49.407  15.896  3.292   1.00 0.00 ? 436 ASN B CB  1  
ATOM 6881   C CG  . ASN B 2 436 ? 49.074  14.789  4.217   1.00 0.00 ? 436 ASN B CG  1  
ATOM 6882   O OD1 . ASN B 2 436 ? 49.782  14.629  5.226   1.00 0.00 ? 436 ASN B OD1 1  
ATOM 6883   N ND2 . ASN B 2 436 ? 47.939  14.029  3.873   1.00 0.00 ? 436 ASN B ND2 1  
ATOM 6884   N N   . SER B 2 437 ? 51.480  17.191  1.397   1.00 0.00 ? 437 SER B N   1  
ATOM 6885   C CA  . SER B 2 437 ? 51.912  18.271  0.487   1.00 0.00 ? 437 SER B CA  1  
ATOM 6886   C C   . SER B 2 437 ? 52.223  17.636  -0.918  1.00 0.00 ? 437 SER B C   1  
ATOM 6887   O O   . SER B 2 437 ? 52.851  16.600  -1.030  1.00 0.00 ? 437 SER B O   1  
ATOM 6888   C CB  . SER B 2 437 ? 53.216  18.986  0.939   1.00 0.00 ? 437 SER B CB  1  
ATOM 6889   O OG  . SER B 2 437 ? 52.921  19.935  1.984   1.00 0.00 ? 437 SER B OG  1  
ATOM 6890   N N   . TYR B 2 438 ? 51.807  18.348  -1.938  1.00 0.00 ? 438 TYR B N   1  
ATOM 6891   C CA  . TYR B 2 438 ? 51.928  17.949  -3.278  1.00 0.00 ? 438 TYR B CA  1  
ATOM 6892   C C   . TYR B 2 438 ? 53.295  18.254  -3.757  1.00 0.00 ? 438 TYR B C   1  
ATOM 6893   O O   . TYR B 2 438 ? 53.874  17.580  -4.591  1.00 0.00 ? 438 TYR B O   1  
ATOM 6894   C CB  . TYR B 2 438 ? 50.829  18.584  -4.149  1.00 0.00 ? 438 TYR B CB  1  
ATOM 6895   C CG  . TYR B 2 438 ? 51.007  20.158  -4.273  1.00 0.00 ? 438 TYR B CG  1  
ATOM 6896   C CD1 . TYR B 2 438 ? 50.762  21.082  -3.197  1.00 0.00 ? 438 TYR B CD1 1  
ATOM 6897   C CD2 . TYR B 2 438 ? 51.312  20.734  -5.508  1.00 0.00 ? 438 TYR B CD2 1  
ATOM 6898   C CE1 . TYR B 2 438 ? 50.953  22.441  -3.318  1.00 0.00 ? 438 TYR B CE1 1  
ATOM 6899   C CE2 . TYR B 2 438 ? 51.398  22.122  -5.650  1.00 0.00 ? 438 TYR B CE2 1  
ATOM 6900   C CZ  . TYR B 2 438 ? 51.278  22.946  -4.593  1.00 0.00 ? 438 TYR B CZ  1  
ATOM 6901   O OH  . TYR B 2 438 ? 51.467  24.344  -4.824  1.00 0.00 ? 438 TYR B OH  1  
ATOM 6902   N N   . ARG B 2 439 ? 53.879  19.310  -3.209  1.00 0.00 ? 439 ARG B N   1  
ATOM 6903   C CA  . ARG B 2 439 ? 55.197  19.726  -3.644  1.00 0.00 ? 439 ARG B CA  1  
ATOM 6904   C C   . ARG B 2 439 ? 55.666  20.400  -2.386  1.00 0.00 ? 439 ARG B C   1  
ATOM 6905   O O   . ARG B 2 439 ? 54.917  21.246  -1.893  1.00 0.00 ? 439 ARG B O   1  
ATOM 6906   C CB  . ARG B 2 439 ? 55.266  20.871  -4.782  1.00 0.00 ? 439 ARG B CB  1  
ATOM 6907   C CG  . ARG B 2 439 ? 54.937  20.369  -6.141  1.00 0.00 ? 439 ARG B CG  1  
ATOM 6908   C CD  . ARG B 2 439 ? 54.828  21.495  -7.217  1.00 0.00 ? 439 ARG B CD  1  
ATOM 6909   N NE  . ARG B 2 439 ? 54.399  20.850  -8.548  1.00 0.00 ? 439 ARG B NE  1  
ATOM 6910   C CZ  . ARG B 2 439 ? 55.357  20.540  -9.459  1.00 0.00 ? 439 ARG B CZ  1  
ATOM 6911   N NH1 . ARG B 2 439 ? 56.635  20.293  -8.998  1.00 0.00 ? 439 ARG B NH1 1  
ATOM 6912   N NH2 . ARG B 2 439 ? 55.099  20.482  -10.786 1.00 0.00 ? 439 ARG B NH2 1  
ATOM 6913   N N   . GLY B 2 440 ? 56.858  20.052  -1.862  1.00 0.00 ? 440 GLY B N   1  
ATOM 6914   C CA  . GLY B 2 440 ? 57.360  20.623  -0.600  1.00 0.00 ? 440 GLY B CA  1  
ATOM 6915   C C   . GLY B 2 440 ? 57.518  22.107  -0.673  1.00 0.00 ? 440 GLY B C   1  
ATOM 6916   O O   . GLY B 2 440 ? 57.879  22.739  -1.681  1.00 0.00 ? 440 GLY B O   1  
ATOM 6917   N N   . ILE B 2 441 ? 57.057  22.666  0.472   1.00 0.00 ? 441 ILE B N   1  
ATOM 6918   C CA  . ILE B 2 441 ? 57.017  24.041  0.755   1.00 0.00 ? 441 ILE B CA  1  
ATOM 6919   C C   . ILE B 2 441 ? 58.148  24.270  1.740   1.00 0.00 ? 441 ILE B C   1  
ATOM 6920   O O   . ILE B 2 441 ? 58.415  23.337  2.427   1.00 0.00 ? 441 ILE B O   1  
ATOM 6921   C CB  . ILE B 2 441 ? 55.742  24.683  1.385   1.00 0.00 ? 441 ILE B CB  1  
ATOM 6922   C CG1 . ILE B 2 441 ? 54.549  24.194  0.493   1.00 0.00 ? 441 ILE B CG1 1  
ATOM 6923   C CG2 . ILE B 2 441 ? 55.895  26.194  1.436   1.00 0.00 ? 441 ILE B CG2 1  
ATOM 6924   C CD1 . ILE B 2 441 ? 53.174  24.717  0.942   1.00 0.00 ? 441 ILE B CD1 1  
ATOM 6925   N N   . SER B 2 442 ? 58.951  25.377  1.546   1.00 0.00 ? 442 SER B N   1  
ATOM 6926   C CA  . SER B 2 442 ? 60.153  25.514  2.249   1.00 0.00 ? 442 SER B CA  1  
ATOM 6927   C C   . SER B 2 442 ? 59.955  25.623  3.742   1.00 0.00 ? 442 SER B C   1  
ATOM 6928   O O   . SER B 2 442 ? 60.753  25.020  4.478   1.00 0.00 ? 442 SER B O   1  
ATOM 6929   C CB  . SER B 2 442 ? 60.933  26.737  1.648   1.00 0.00 ? 442 SER B CB  1  
ATOM 6930   O OG  . SER B 2 442 ? 61.126  26.662  0.271   1.00 0.00 ? 442 SER B OG  1  
ATOM 6931   N N   . THR B 2 443 ? 58.939  26.355  4.235   1.00 0.00 ? 443 THR B N   1  
ATOM 6932   C CA  . THR B 2 443 ? 58.622  26.628  5.580   1.00 0.00 ? 443 THR B CA  1  
ATOM 6933   C C   . THR B 2 443 ? 58.290  25.407  6.414   1.00 0.00 ? 443 THR B C   1  
ATOM 6934   O O   . THR B 2 443 ? 58.842  25.151  7.461   1.00 0.00 ? 443 THR B O   1  
ATOM 6935   C CB  . THR B 2 443 ? 57.555  27.690  5.678   1.00 0.00 ? 443 THR B CB  1  
ATOM 6936   O OG1 . THR B 2 443 ? 56.340  27.369  5.054   1.00 0.00 ? 443 THR B OG1 1  
ATOM 6937   C CG2 . THR B 2 443 ? 58.022  29.007  5.022   1.00 0.00 ? 443 THR B CG2 1  
ATOM 6938   N N   . ASN B 2 444 ? 57.403  24.486  5.843   1.00 0.00 ? 444 ASN B N   1  
ATOM 6939   C CA  . ASN B 2 444 ? 57.113  23.296  6.498   1.00 0.00 ? 444 ASN B CA  1  
ATOM 6940   C C   . ASN B 2 444 ? 58.234  22.314  6.637   1.00 0.00 ? 444 ASN B C   1  
ATOM 6941   O O   . ASN B 2 444 ? 58.453  21.806  7.735   1.00 0.00 ? 444 ASN B O   1  
ATOM 6942   C CB  . ASN B 2 444 ? 55.876  22.560  5.870   1.00 0.00 ? 444 ASN B CB  1  
ATOM 6943   C CG  . ASN B 2 444 ? 55.403  21.367  6.665   1.00 0.00 ? 444 ASN B CG  1  
ATOM 6944   O OD1 . ASN B 2 444 ? 54.990  20.358  6.084   1.00 0.00 ? 444 ASN B OD1 1  
ATOM 6945   N ND2 . ASN B 2 444 ? 55.528  21.417  7.993   1.00 0.00 ? 444 ASN B ND2 1  
ATOM 6946   N N   . PHE B 2 445 ? 59.080  22.162  5.605   1.00 0.00 ? 445 PHE B N   1  
ATOM 6947   C CA  . PHE B 2 445 ? 60.260  21.333  5.538   1.00 0.00 ? 445 PHE B CA  1  
ATOM 6948   C C   . PHE B 2 445 ? 61.210  21.919  6.628   1.00 0.00 ? 445 PHE B C   1  
ATOM 6949   O O   . PHE B 2 445 ? 61.818  21.172  7.383   1.00 0.00 ? 445 PHE B O   1  
ATOM 6950   C CB  . PHE B 2 445 ? 60.852  21.341  4.100   1.00 0.00 ? 445 PHE B CB  1  
ATOM 6951   C CG  . PHE B 2 445 ? 61.683  20.104  3.764   1.00 0.00 ? 445 PHE B CG  1  
ATOM 6952   C CD1 . PHE B 2 445 ? 62.516  19.356  4.707   1.00 0.00 ? 445 PHE B CD1 1  
ATOM 6953   C CD2 . PHE B 2 445 ? 61.627  19.634  2.440   1.00 0.00 ? 445 PHE B CD2 1  
ATOM 6954   C CE1 . PHE B 2 445 ? 63.246  18.275  4.233   1.00 0.00 ? 445 PHE B CE1 1  
ATOM 6955   C CE2 . PHE B 2 445 ? 62.304  18.513  2.041   1.00 0.00 ? 445 PHE B CE2 1  
ATOM 6956   C CZ  . PHE B 2 445 ? 63.088  17.827  2.937   1.00 0.00 ? 445 PHE B CZ  1  
ATOM 6957   N N   . PHE B 2 446 ? 61.363  23.254  6.710   1.00 0.00 ? 446 PHE B N   1  
ATOM 6958   C CA  . PHE B 2 446 ? 62.324  23.767  7.718   1.00 0.00 ? 446 PHE B CA  1  
ATOM 6959   C C   . PHE B 2 446 ? 61.996  23.474  9.170   1.00 0.00 ? 446 PHE B C   1  
ATOM 6960   O O   . PHE B 2 446 ? 62.866  22.982  9.912   1.00 0.00 ? 446 PHE B O   1  
ATOM 6961   C CB  . PHE B 2 446 ? 62.328  25.381  7.652   1.00 0.00 ? 446 PHE B CB  1  
ATOM 6962   C CG  . PHE B 2 446 ? 63.007  25.966  6.450   1.00 0.00 ? 446 PHE B CG  1  
ATOM 6963   C CD1 . PHE B 2 446 ? 64.346  25.644  6.350   1.00 0.00 ? 446 PHE B CD1 1  
ATOM 6964   C CD2 . PHE B 2 446 ? 62.622  27.005  5.507   1.00 0.00 ? 446 PHE B CD2 1  
ATOM 6965   C CE1 . PHE B 2 446 ? 65.198  26.127  5.284   1.00 0.00 ? 446 PHE B CE1 1  
ATOM 6966   C CE2 . PHE B 2 446 ? 63.505  27.535  4.554   1.00 0.00 ? 446 PHE B CE2 1  
ATOM 6967   C CZ  . PHE B 2 446 ? 64.706  27.008  4.362   1.00 0.00 ? 446 PHE B CZ  1  
ATOM 6968   N N   . GLU B 2 447 ? 60.711  23.640  9.608   1.00 0.00 ? 447 GLU B N   1  
ATOM 6969   C CA  . GLU B 2 447 ? 60.177  23.452  10.949  1.00 0.00 ? 447 GLU B CA  1  
ATOM 6970   C C   . GLU B 2 447 ? 60.398  21.946  11.400  1.00 0.00 ? 447 GLU B C   1  
ATOM 6971   O O   . GLU B 2 447 ? 60.869  21.671  12.506  1.00 0.00 ? 447 GLU B O   1  
ATOM 6972   C CB  . GLU B 2 447 ? 58.709  23.972  11.109  1.00 0.00 ? 447 GLU B CB  1  
ATOM 6973   C CG  . GLU B 2 447 ? 58.618  25.505  11.130  1.00 0.00 ? 447 GLU B CG  1  
ATOM 6974   C CD  . GLU B 2 447 ? 57.177  25.911  10.950  1.00 0.00 ? 447 GLU B CD  1  
ATOM 6975   O OE1 . GLU B 2 447 ? 56.224  25.177  11.500  1.00 0.00 ? 447 GLU B OE1 1  
ATOM 6976   O OE2 . GLU B 2 447 ? 56.985  26.976  10.256  1.00 0.00 ? 447 GLU B OE2 1  
ATOM 6977   N N   . ILE B 2 448 ? 60.160  20.952  10.415  1.00 0.00 ? 448 ILE B N   1  
ATOM 6978   C CA  . ILE B 2 448 ? 60.346  19.599  10.671  1.00 0.00 ? 448 ILE B CA  1  
ATOM 6979   C C   . ILE B 2 448 ? 61.875  19.317  10.873  1.00 0.00 ? 448 ILE B C   1  
ATOM 6980   O O   . ILE B 2 448 ? 62.277  18.638  11.817  1.00 0.00 ? 448 ILE B O   1  
ATOM 6981   C CB  . ILE B 2 448 ? 59.807  18.669  9.675   1.00 0.00 ? 448 ILE B CB  1  
ATOM 6982   C CG1 . ILE B 2 448 ? 58.240  18.892  9.607   1.00 0.00 ? 448 ILE B CG1 1  
ATOM 6983   C CG2 . ILE B 2 448 ? 60.198  17.263  10.059  1.00 0.00 ? 448 ILE B CG2 1  
ATOM 6984   C CD1 . ILE B 2 448 ? 57.520  17.982  8.598   1.00 0.00 ? 448 ILE B CD1 1  
ATOM 6985   N N   . ILE B 2 449 ? 62.800  19.920  10.050  1.00 0.00 ? 449 ILE B N   1  
ATOM 6986   C CA  . ILE B 2 449 ? 64.241  19.789  10.242  1.00 0.00 ? 449 ILE B CA  1  
ATOM 6987   C C   . ILE B 2 449 ? 64.714  20.368  11.489  1.00 0.00 ? 449 ILE B C   1  
ATOM 6988   O O   . ILE B 2 449 ? 65.498  19.685  12.076  1.00 0.00 ? 449 ILE B O   1  
ATOM 6989   C CB  . ILE B 2 449 ? 65.087  20.099  9.058   1.00 0.00 ? 449 ILE B CB  1  
ATOM 6990   C CG1 . ILE B 2 449 ? 64.877  19.079  7.900   1.00 0.00 ? 449 ILE B CG1 1  
ATOM 6991   C CG2 . ILE B 2 449 ? 66.571  20.314  9.193   1.00 0.00 ? 449 ILE B CG2 1  
ATOM 6992   C CD1 . ILE B 2 449 ? 65.732  19.360  6.653   1.00 0.00 ? 449 ILE B CD1 1  
ATOM 6993   N N   . ASN B 2 450 ? 64.243  21.589  11.898  1.00 0.00 ? 450 ASN B N   1  
ATOM 6994   C CA  . ASN B 2 450 ? 64.719  22.311  13.073  1.00 0.00 ? 450 ASN B CA  1  
ATOM 6995   C C   . ASN B 2 450 ? 64.363  21.398  14.279  1.00 0.00 ? 450 ASN B C   1  
ATOM 6996   O O   . ASN B 2 450 ? 65.146  21.264  15.214  1.00 0.00 ? 450 ASN B O   1  
ATOM 6997   C CB  . ASN B 2 450 ? 63.893  23.664  13.233  1.00 0.00 ? 450 ASN B CB  1  
ATOM 6998   C CG  . ASN B 2 450 ? 64.451  24.757  12.273  1.00 0.00 ? 450 ASN B CG  1  
ATOM 6999   O OD1 . ASN B 2 450 ? 65.278  24.470  11.365  1.00 0.00 ? 450 ASN B OD1 1  
ATOM 7000   N ND2 . ASN B 2 450 ? 63.816  25.944  12.327  1.00 0.00 ? 450 ASN B ND2 1  
ATOM 7001   N N   . ASP B 2 451 ? 63.167  20.714  14.242  1.00 0.00 ? 451 ASP B N   1  
ATOM 7002   C CA  . ASP B 2 451 ? 62.856  19.752  15.350  1.00 0.00 ? 451 ASP B CA  1  
ATOM 7003   C C   . ASP B 2 451 ? 63.826  18.553  15.428  1.00 0.00 ? 451 ASP B C   1  
ATOM 7004   O O   . ASP B 2 451 ? 64.375  18.228  16.480  1.00 0.00 ? 451 ASP B O   1  
ATOM 7005   C CB  . ASP B 2 451 ? 61.441  19.215  15.213  1.00 0.00 ? 451 ASP B CB  1  
ATOM 7006   C CG  . ASP B 2 451 ? 60.264  20.190  15.380  1.00 0.00 ? 451 ASP B CG  1  
ATOM 7007   O OD1 . ASP B 2 451 ? 60.413  21.388  15.613  1.00 0.00 ? 451 ASP B OD1 1  
ATOM 7008   O OD2 . ASP B 2 451 ? 59.200  19.606  15.062  1.00 0.00 ? 451 ASP B OD2 1  
ATOM 7009   N N   . GLN B 2 452 ? 64.175  17.926  14.242  1.00 0.00 ? 452 GLN B N   1  
ATOM 7010   C CA  . GLN B 2 452 ? 65.037  16.735  14.158  1.00 0.00 ? 452 GLN B CA  1  
ATOM 7011   C C   . GLN B 2 452 ? 66.423  17.096  14.572  1.00 0.00 ? 452 GLN B C   1  
ATOM 7012   O O   . GLN B 2 452 ? 67.074  16.376  15.312  1.00 0.00 ? 452 GLN B O   1  
ATOM 7013   C CB  . GLN B 2 452 ? 65.105  16.044  12.760  1.00 0.00 ? 452 GLN B CB  1  
ATOM 7014   C CG  . GLN B 2 452 ? 63.927  15.211  12.327  1.00 0.00 ? 452 GLN B CG  1  
ATOM 7015   C CD  . GLN B 2 452 ? 63.306  14.331  13.454  1.00 0.00 ? 452 GLN B CD  1  
ATOM 7016   O OE1 . GLN B 2 452 ? 62.308  14.695  14.042  1.00 0.00 ? 452 GLN B OE1 1  
ATOM 7017   N NE2 . GLN B 2 452 ? 64.108  13.256  13.869  1.00 0.00 ? 452 GLN B NE2 1  
ATOM 7018   N N   . TYR B 2 453 ? 66.858  18.297  14.166  1.00 0.00 ? 453 TYR B N   1  
ATOM 7019   C CA  . TYR B 2 453 ? 68.157  18.807  14.380  1.00 0.00 ? 453 TYR B CA  1  
ATOM 7020   C C   . TYR B 2 453 ? 68.360  18.968  15.876  1.00 0.00 ? 453 TYR B C   1  
ATOM 7021   O O   . TYR B 2 453 ? 69.425  18.576  16.380  1.00 0.00 ? 453 TYR B O   1  
ATOM 7022   C CB  . TYR B 2 453 ? 68.264  20.149  13.680  1.00 0.00 ? 453 TYR B CB  1  
ATOM 7023   C CG  . TYR B 2 453 ? 69.729  20.510  13.414  1.00 0.00 ? 453 TYR B CG  1  
ATOM 7024   C CD1 . TYR B 2 453 ? 70.564  20.925  14.507  1.00 0.00 ? 453 TYR B CD1 1  
ATOM 7025   C CD2 . TYR B 2 453 ? 70.272  20.416  12.122  1.00 0.00 ? 453 TYR B CD2 1  
ATOM 7026   C CE1 . TYR B 2 453 ? 71.849  21.330  14.263  1.00 0.00 ? 453 TYR B CE1 1  
ATOM 7027   C CE2 . TYR B 2 453 ? 71.608  20.735  11.943  1.00 0.00 ? 453 TYR B CE2 1  
ATOM 7028   C CZ  . TYR B 2 453 ? 72.362  21.239  12.984  1.00 0.00 ? 453 TYR B CZ  1  
ATOM 7029   O OH  . TYR B 2 453 ? 73.732  21.429  12.762  1.00 0.00 ? 453 TYR B OH  1  
ATOM 7030   N N   . SER B 2 454 ? 67.352  19.490  16.652  1.00 0.00 ? 454 SER B N   1  
ATOM 7031   C CA  . SER B 2 454 ? 67.477  19.710  18.071  1.00 0.00 ? 454 SER B CA  1  
ATOM 7032   C C   . SER B 2 454 ? 67.605  18.384  18.770  1.00 0.00 ? 454 SER B C   1  
ATOM 7033   O O   . SER B 2 454 ? 68.410  18.186  19.640  1.00 0.00 ? 454 SER B O   1  
ATOM 7034   C CB  . SER B 2 454 ? 66.233  20.450  18.663  1.00 0.00 ? 454 SER B CB  1  
ATOM 7035   O OG  . SER B 2 454 ? 66.195  21.724  18.065  1.00 0.00 ? 454 SER B OG  1  
ATOM 7036   N N   . GLU B 2 455 ? 66.772  17.350  18.344  1.00 0.00 ? 455 GLU B N   1  
ATOM 7037   C CA  . GLU B 2 455 ? 66.832  16.032  18.959  1.00 0.00 ? 455 GLU B CA  1  
ATOM 7038   C C   . GLU B 2 455 ? 68.155  15.283  18.774  1.00 0.00 ? 455 GLU B C   1  
ATOM 7039   O O   . GLU B 2 455 ? 68.626  14.785  19.786  1.00 0.00 ? 455 GLU B O   1  
ATOM 7040   C CB  . GLU B 2 455 ? 65.657  15.148  18.381  1.00 0.00 ? 455 GLU B CB  1  
ATOM 7041   C CG  . GLU B 2 455 ? 65.440  13.804  19.108  1.00 0.00 ? 455 GLU B CG  1  
ATOM 7042   C CD  . GLU B 2 455 ? 64.067  13.274  19.027  1.00 0.00 ? 455 GLU B CD  1  
ATOM 7043   O OE1 . GLU B 2 455 ? 63.450  13.390  17.950  1.00 0.00 ? 455 GLU B OE1 1  
ATOM 7044   O OE2 . GLU B 2 455 ? 63.547  12.741  20.099  1.00 0.00 ? 455 GLU B OE2 1  
ATOM 7045   N N   . ILE B 2 456 ? 68.772  15.237  17.541  1.00 0.00 ? 456 ILE B N   1  
ATOM 7046   C CA  . ILE B 2 456 ? 70.050  14.639  17.331  1.00 0.00 ? 456 ILE B CA  1  
ATOM 7047   C C   . ILE B 2 456 ? 71.122  15.355  18.053  1.00 0.00 ? 456 ILE B C   1  
ATOM 7048   O O   . ILE B 2 456 ? 71.998  14.681  18.576  1.00 0.00 ? 456 ILE B O   1  
ATOM 7049   C CB  . ILE B 2 456 ? 70.325  14.368  15.911  1.00 0.00 ? 456 ILE B CB  1  
ATOM 7050   C CG1 . ILE B 2 456 ? 69.172  13.571  15.240  1.00 0.00 ? 456 ILE B CG1 1  
ATOM 7051   C CG2 . ILE B 2 456 ? 71.620  13.526  15.798  1.00 0.00 ? 456 ILE B CG2 1  
ATOM 7052   C CD1 . ILE B 2 456 ? 69.407  13.259  13.752  1.00 0.00 ? 456 ILE B CD1 1  
ATOM 7053   N N   . VAL B 2 457 ? 71.099  16.734  18.082  1.00 0.00 ? 457 VAL B N   1  
ATOM 7054   C CA  . VAL B 2 457 ? 72.141  17.538  18.641  1.00 0.00 ? 457 VAL B CA  1  
ATOM 7055   C C   . VAL B 2 457 ? 72.284  17.361  20.192  1.00 0.00 ? 457 VAL B C   1  
ATOM 7056   O O   . VAL B 2 457 ? 73.357  17.219  20.805  1.00 0.00 ? 457 VAL B O   1  
ATOM 7057   C CB  . VAL B 2 457 ? 72.273  19.028  18.343  1.00 0.00 ? 457 VAL B CB  1  
ATOM 7058   C CG1 . VAL B 2 457 ? 72.527  19.135  16.816  1.00 0.00 ? 457 VAL B CG1 1  
ATOM 7059   C CG2 . VAL B 2 457 ? 71.051  19.858  18.893  1.00 0.00 ? 457 VAL B CG2 1  
ATOM 7060   N N   . ASN B 2 458 ? 71.010  17.325  20.778  1.00 0.00 ? 458 ASN B N   1  
ATOM 7061   C CA  . ASN B 2 458 ? 70.939  17.110  22.210  1.00 0.00 ? 458 ASN B CA  1  
ATOM 7062   C C   . ASN B 2 458 ? 71.484  15.755  22.539  1.00 0.00 ? 458 ASN B C   1  
ATOM 7063   O O   . ASN B 2 458 ? 72.350  15.633  23.363  1.00 0.00 ? 458 ASN B O   1  
ATOM 7064   C CB  . ASN B 2 458 ? 69.558  17.267  22.881  1.00 0.00 ? 458 ASN B CB  1  
ATOM 7065   C CG  . ASN B 2 458 ? 68.980  18.665  22.705  1.00 0.00 ? 458 ASN B CG  1  
ATOM 7066   O OD1 . ASN B 2 458 ? 69.691  19.532  22.173  1.00 0.00 ? 458 ASN B OD1 1  
ATOM 7067   N ND2 . ASN B 2 458 ? 67.702  18.893  23.170  1.00 0.00 ? 458 ASN B ND2 1  
ATOM 7068   N N   . HIS B 2 459 ? 71.155  14.730  21.766  1.00 0.00 ? 459 HIS B N   1  
ATOM 7069   C CA  . HIS B 2 459 ? 71.677  13.434  21.977  1.00 0.00 ? 459 HIS B CA  1  
ATOM 7070   C C   . HIS B 2 459 ? 73.227  13.291  21.748  1.00 0.00 ? 459 HIS B C   1  
ATOM 7071   O O   . HIS B 2 459 ? 73.912  12.498  22.417  1.00 0.00 ? 459 HIS B O   1  
ATOM 7072   C CB  . HIS B 2 459 ? 70.974  12.318  21.185  1.00 0.00 ? 459 HIS B CB  1  
ATOM 7073   C CG  . HIS B 2 459 ? 69.549  12.135  21.334  1.00 0.00 ? 459 HIS B CG  1  
ATOM 7074   N ND1 . HIS B 2 459 ? 69.024  12.024  22.604  1.00 0.00 ? 459 HIS B ND1 1  
ATOM 7075   C CD2 . HIS B 2 459 ? 68.551  11.778  20.471  1.00 0.00 ? 459 HIS B CD2 1  
ATOM 7076   C CE1 . HIS B 2 459 ? 67.742  11.655  22.449  1.00 0.00 ? 459 HIS B CE1 1  
ATOM 7077   N NE2 . HIS B 2 459 ? 67.396  11.561  21.173  1.00 0.00 ? 459 HIS B NE2 1  
ATOM 7078   N N   . THR B 2 460 ? 73.751  14.033  20.751  1.00 0.00 ? 460 THR B N   1  
ATOM 7079   C CA  . THR B 2 460 ? 75.143  14.051  20.374  1.00 0.00 ? 460 THR B CA  1  
ATOM 7080   C C   . THR B 2 460 ? 76.059  14.641  21.428  1.00 0.00 ? 460 THR B C   1  
ATOM 7081   O O   . THR B 2 460 ? 77.040  13.940  21.751  1.00 0.00 ? 460 THR B O   1  
ATOM 7082   C CB  . THR B 2 460 ? 75.485  14.770  19.084  1.00 0.00 ? 460 THR B CB  1  
ATOM 7083   O OG1 . THR B 2 460 ? 74.831  14.098  18.024  1.00 0.00 ? 460 THR B OG1 1  
ATOM 7084   C CG2 . THR B 2 460 ? 76.939  14.610  18.610  1.00 0.00 ? 460 THR B CG2 1  
ATOM 7085   N N   . ASN B 2 461 ? 75.606  15.762  22.071  1.00 0.00 ? 461 ASN B N   1  
ATOM 7086   C CA  . ASN B 2 461 ? 76.269  16.286  23.252  1.00 0.00 ? 461 ASN B CA  1  
ATOM 7087   C C   . ASN B 2 461 ? 76.331  15.268  24.368  1.00 0.00 ? 461 ASN B C   1  
ATOM 7088   O O   . ASN B 2 461 ? 77.442  15.098  24.776  1.00 0.00 ? 461 ASN B O   1  
ATOM 7089   C CB  . ASN B 2 461 ? 75.651  17.582  23.647  1.00 0.00 ? 461 ASN B CB  1  
ATOM 7090   C CG  . ASN B 2 461 ? 76.614  18.450  24.524  1.00 0.00 ? 461 ASN B CG  1  
ATOM 7091   O OD1 . ASN B 2 461 ? 77.657  18.848  23.930  1.00 0.00 ? 461 ASN B OD1 1  
ATOM 7092   N ND2 . ASN B 2 461 ? 76.257  18.723  25.773  1.00 0.00 ? 461 ASN B ND2 1  
ATOM 7093   N N   . GLN B 2 462 ? 75.239  14.530  24.802  1.00 0.00 ? 462 GLN B N   1  
ATOM 7094   C CA  . GLN B 2 462 ? 75.404  13.619  25.906  1.00 0.00 ? 462 GLN B CA  1  
ATOM 7095   C C   . GLN B 2 462 ? 76.374  12.527  25.553  1.00 0.00 ? 462 GLN B C   1  
ATOM 7096   O O   . GLN B 2 462 ? 77.154  12.125  26.409  1.00 0.00 ? 462 GLN B O   1  
ATOM 7097   C CB  . GLN B 2 462 ? 74.038  12.966  26.238  1.00 0.00 ? 462 GLN B CB  1  
ATOM 7098   C CG  . GLN B 2 462 ? 72.905  13.963  26.543  1.00 0.00 ? 462 GLN B CG  1  
ATOM 7099   C CD  . GLN B 2 462 ? 73.182  14.903  27.701  1.00 0.00 ? 462 GLN B CD  1  
ATOM 7100   O OE1 . GLN B 2 462 ? 73.748  14.424  28.627  1.00 0.00 ? 462 GLN B OE1 1  
ATOM 7101   N NE2 . GLN B 2 462 ? 72.829  16.245  27.580  1.00 0.00 ? 462 GLN B NE2 1  
ATOM 7102   N N   . ILE B 2 463 ? 76.262  11.949  24.290  1.00 0.00 ? 463 ILE B N   1  
ATOM 7103   C CA  . ILE B 2 463 ? 76.946  10.708  23.975  1.00 0.00 ? 463 ILE B CA  1  
ATOM 7104   C C   . ILE B 2 463 ? 78.375  11.053  24.158  1.00 0.00 ? 463 ILE B C   1  
ATOM 7105   O O   . ILE B 2 463 ? 79.180  10.343  24.697  1.00 0.00 ? 463 ILE B O   1  
ATOM 7106   C CB  . ILE B 2 463 ? 76.587  10.229  22.564  1.00 0.00 ? 463 ILE B CB  1  
ATOM 7107   C CG1 . ILE B 2 463 ? 75.248  9.551   22.309  1.00 0.00 ? 463 ILE B CG1 1  
ATOM 7108   C CG2 . ILE B 2 463 ? 77.636  9.251   21.979  1.00 0.00 ? 463 ILE B CG2 1  
ATOM 7109   C CD1 . ILE B 2 463 ? 75.028  9.125   20.847  1.00 0.00 ? 463 ILE B CD1 1  
ATOM 7110   N N   . LEU B 2 464 ? 78.818  12.203  23.651  1.00 0.00 ? 464 LEU B N   1  
ATOM 7111   C CA  . LEU B 2 464 ? 80.191  12.594  23.656  1.00 0.00 ? 464 LEU B CA  1  
ATOM 7112   C C   . LEU B 2 464 ? 80.558  12.894  25.111  1.00 0.00 ? 464 LEU B C   1  
ATOM 7113   O O   . LEU B 2 464 ? 81.524  12.422  25.702  1.00 0.00 ? 464 LEU B O   1  
ATOM 7114   C CB  . LEU B 2 464 ? 80.315  13.945  22.898  1.00 0.00 ? 464 LEU B CB  1  
ATOM 7115   C CG  . LEU B 2 464 ? 80.729  13.741  21.364  1.00 0.00 ? 464 LEU B CG  1  
ATOM 7116   C CD1 . LEU B 2 464 ? 80.035  12.622  20.517  1.00 0.00 ? 464 LEU B CD1 1  
ATOM 7117   C CD2 . LEU B 2 464 ? 80.526  15.131  20.664  1.00 0.00 ? 464 LEU B CD2 1  
ATOM 7118   N N   . ASN B 2 465 ? 79.770  13.800  25.696  1.00 0.00 ? 465 ASN B N   1  
ATOM 7119   C CA  . ASN B 2 465 ? 80.196  14.401  26.906  1.00 0.00 ? 465 ASN B CA  1  
ATOM 7120   C C   . ASN B 2 465 ? 80.104  13.458  28.190  1.00 0.00 ? 465 ASN B C   1  
ATOM 7121   O O   . ASN B 2 465 ? 81.123  13.404  28.939  1.00 0.00 ? 465 ASN B O   1  
ATOM 7122   C CB  . ASN B 2 465 ? 79.396  15.735  27.262  1.00 0.00 ? 465 ASN B CB  1  
ATOM 7123   C CG  . ASN B 2 465 ? 79.768  16.941  26.257  1.00 0.00 ? 465 ASN B CG  1  
ATOM 7124   O OD1 . ASN B 2 465 ? 80.557  16.750  25.344  1.00 0.00 ? 465 ASN B OD1 1  
ATOM 7125   N ND2 . ASN B 2 465 ? 79.220  18.139  26.554  1.00 0.00 ? 465 ASN B ND2 1  
ATOM 7126   N N   . GLN B 2 466 ? 78.990  12.807  28.447  1.00 0.00 ? 466 GLN B N   1  
ATOM 7127   C CA  . GLN B 2 466 ? 78.868  11.986  29.640  1.00 0.00 ? 466 GLN B CA  1  
ATOM 7128   C C   . GLN B 2 466 ? 79.707  10.716  29.485  1.00 0.00 ? 466 GLN B C   1  
ATOM 7129   O O   . GLN B 2 466 ? 80.451  10.367  30.367  1.00 0.00 ? 466 GLN B O   1  
ATOM 7130   C CB  . GLN B 2 466 ? 77.455  11.551  29.852  1.00 0.00 ? 466 GLN B CB  1  
ATOM 7131   C CG  . GLN B 2 466 ? 76.438  12.695  29.820  1.00 0.00 ? 466 GLN B CG  1  
ATOM 7132   C CD  . GLN B 2 466 ? 76.494  13.776  30.921  1.00 0.00 ? 466 GLN B CD  1  
ATOM 7133   O OE1 . GLN B 2 466 ? 77.216  13.548  31.881  1.00 0.00 ? 466 GLN B OE1 1  
ATOM 7134   N NE2 . GLN B 2 466 ? 75.624  14.802  30.878  1.00 0.00 ? 466 GLN B NE2 1  
ATOM 7135   N N   . LYS B 2 467 ? 79.397  9.937   28.405  1.00 0.00 ? 467 LYS B N   1  
ATOM 7136   C CA  . LYS B 2 467 ? 79.853  8.564   28.351  1.00 0.00 ? 467 LYS B CA  1  
ATOM 7137   C C   . LYS B 2 467 ? 81.216  8.506   27.923  1.00 0.00 ? 467 LYS B C   1  
ATOM 7138   O O   . LYS B 2 467 ? 81.988  7.794   28.559  1.00 0.00 ? 467 LYS B O   1  
ATOM 7139   C CB  . LYS B 2 467 ? 79.077  7.601   27.350  1.00 0.00 ? 467 LYS B CB  1  
ATOM 7140   C CG  . LYS B 2 467 ? 77.577  7.694   27.632  1.00 0.00 ? 467 LYS B CG  1  
ATOM 7141   C CD  . LYS B 2 467 ? 76.668  7.227   26.474  1.00 0.00 ? 467 LYS B CD  1  
ATOM 7142   C CE  . LYS B 2 467 ? 75.234  7.598   26.792  1.00 0.00 ? 467 LYS B CE  1  
ATOM 7143   N NZ  . LYS B 2 467 ? 75.110  9.030   27.225  1.00 0.00 ? 467 LYS B NZ  1  
ATOM 7144   N N   . PHE B 2 468 ? 81.562  9.216   26.899  1.00 0.00 ? 468 PHE B N   1  
ATOM 7145   C CA  . PHE B 2 468 ? 82.812  9.205   26.359  1.00 0.00 ? 468 PHE B CA  1  
ATOM 7146   C C   . PHE B 2 468 ? 83.786  10.002  27.157  1.00 0.00 ? 468 PHE B C   1  
ATOM 7147   O O   . PHE B 2 468 ? 84.957  9.726   27.171  1.00 0.00 ? 468 PHE B O   1  
ATOM 7148   C CB  . PHE B 2 468 ? 82.785  9.642   24.860  1.00 0.00 ? 468 PHE B CB  1  
ATOM 7149   C CG  . PHE B 2 468 ? 84.144  9.407   24.172  1.00 0.00 ? 468 PHE B CG  1  
ATOM 7150   C CD1 . PHE B 2 468 ? 84.922  8.257   24.409  1.00 0.00 ? 468 PHE B CD1 1  
ATOM 7151   C CD2 . PHE B 2 468 ? 84.696  10.398  23.398  1.00 0.00 ? 468 PHE B CD2 1  
ATOM 7152   C CE1 . PHE B 2 468 ? 86.154  8.073   23.787  1.00 0.00 ? 468 PHE B CE1 1  
ATOM 7153   C CE2 . PHE B 2 468 ? 85.976  10.266  22.825  1.00 0.00 ? 468 PHE B CE2 1  
ATOM 7154   C CZ  . PHE B 2 468 ? 86.708  9.104   23.043  1.00 0.00 ? 468 PHE B CZ  1  
ATOM 7155   N N   . HIS B 2 469 ? 83.260  11.019  27.929  1.00 0.00 ? 469 HIS B N   1  
ATOM 7156   C CA  . HIS B 2 469 ? 83.958  11.927  28.739  1.00 0.00 ? 469 HIS B CA  1  
ATOM 7157   C C   . HIS B 2 469 ? 84.831  12.697  27.792  1.00 0.00 ? 469 HIS B C   1  
ATOM 7158   O O   . HIS B 2 469 ? 86.067  12.734  28.042  1.00 0.00 ? 469 HIS B O   1  
ATOM 7159   C CB  . HIS B 2 469 ? 84.930  11.279  29.839  1.00 0.00 ? 469 HIS B CB  1  
ATOM 7160   C CG  . HIS B 2 469 ? 84.233  10.236  30.725  1.00 0.00 ? 469 HIS B CG  1  
ATOM 7161   N ND1 . HIS B 2 469 ? 83.353  10.639  31.656  1.00 0.00 ? 469 HIS B ND1 1  
ATOM 7162   C CD2 . HIS B 2 469 ? 84.286  8.864   30.791  1.00 0.00 ? 469 HIS B CD2 1  
ATOM 7163   C CE1 . HIS B 2 469 ? 82.813  9.539   32.266  1.00 0.00 ? 469 HIS B CE1 1  
ATOM 7164   N NE2 . HIS B 2 469 ? 83.324  8.451   31.713  1.00 0.00 ? 469 HIS B NE2 1  
ATOM 7165   N N   . TYR B 2 470 ? 84.285  13.266  26.622  1.00 0.00 ? 470 TYR B N   1  
ATOM 7166   C CA  . TYR B 2 470 ? 84.971  13.916  25.481  1.00 0.00 ? 470 TYR B CA  1  
ATOM 7167   C C   . TYR B 2 470 ? 85.750  15.086  25.822  1.00 0.00 ? 470 TYR B C   1  
ATOM 7168   O O   . TYR B 2 470 ? 86.908  15.113  25.407  1.00 0.00 ? 470 TYR B O   1  
ATOM 7169   C CB  . TYR B 2 470 ? 84.007  14.183  24.292  1.00 0.00 ? 470 TYR B CB  1  
ATOM 7170   C CG  . TYR B 2 470 ? 84.650  14.619  22.909  1.00 0.00 ? 470 TYR B CG  1  
ATOM 7171   C CD1 . TYR B 2 470 ? 85.751  13.966  22.434  1.00 0.00 ? 470 TYR B CD1 1  
ATOM 7172   C CD2 . TYR B 2 470 ? 84.027  15.493  21.970  1.00 0.00 ? 470 TYR B CD2 1  
ATOM 7173   C CE1 . TYR B 2 470 ? 86.329  14.381  21.235  1.00 0.00 ? 470 TYR B CE1 1  
ATOM 7174   C CE2 . TYR B 2 470 ? 84.594  15.972  20.792  1.00 0.00 ? 470 TYR B CE2 1  
ATOM 7175   C CZ  . TYR B 2 470 ? 85.811  15.434  20.465  1.00 0.00 ? 470 TYR B CZ  1  
ATOM 7176   O OH  . TYR B 2 470 ? 86.345  15.723  19.232  1.00 0.00 ? 470 TYR B OH  1  
ATOM 7177   N N   . ARG B 2 471 ? 85.210  15.985  26.646  1.00 0.00 ? 471 ARG B N   1  
ATOM 7178   C CA  . ARG B 2 471 ? 85.996  17.159  27.099  1.00 0.00 ? 471 ARG B CA  1  
ATOM 7179   C C   . ARG B 2 471 ? 87.225  16.755  27.849  1.00 0.00 ? 471 ARG B C   1  
ATOM 7180   O O   . ARG B 2 471 ? 88.266  17.348  27.630  1.00 0.00 ? 471 ARG B O   1  
ATOM 7181   C CB  . ARG B 2 471 ? 85.160  18.210  27.967  1.00 0.00 ? 471 ARG B CB  1  
ATOM 7182   C CG  . ARG B 2 471 ? 84.392  17.667  29.188  1.00 0.00 ? 471 ARG B CG  1  
ATOM 7183   C CD  . ARG B 2 471 ? 82.933  17.221  29.005  1.00 0.00 ? 471 ARG B CD  1  
ATOM 7184   N NE  . ARG B 2 471 ? 82.554  16.459  30.249  1.00 0.00 ? 471 ARG B NE  1  
ATOM 7185   C CZ  . ARG B 2 471 ? 81.453  16.552  31.044  1.00 0.00 ? 471 ARG B CZ  1  
ATOM 7186   N NH1 . ARG B 2 471 ? 80.590  17.530  30.693  1.00 0.00 ? 471 ARG B NH1 1  
ATOM 7187   N NH2 . ARG B 2 471 ? 81.197  15.595  31.861  1.00 0.00 ? 471 ARG B NH2 1  
ATOM 7188   N N   . ASP B 2 472 ? 87.212  15.745  28.707  1.00 0.00 ? 472 ASP B N   1  
ATOM 7189   C CA  . ASP B 2 472 ? 88.314  15.315  29.466  1.00 0.00 ? 472 ASP B CA  1  
ATOM 7190   C C   . ASP B 2 472 ? 89.376  14.753  28.554  1.00 0.00 ? 472 ASP B C   1  
ATOM 7191   O O   . ASP B 2 472 ? 90.554  15.074  28.736  1.00 0.00 ? 472 ASP B O   1  
ATOM 7192   C CB  . ASP B 2 472 ? 87.862  14.281  30.560  1.00 0.00 ? 472 ASP B CB  1  
ATOM 7193   C CG  . ASP B 2 472 ? 86.934  14.977  31.511  1.00 0.00 ? 472 ASP B CG  1  
ATOM 7194   O OD1 . ASP B 2 472 ? 86.929  16.251  31.631  1.00 0.00 ? 472 ASP B OD1 1  
ATOM 7195   O OD2 . ASP B 2 472 ? 86.171  14.301  32.259  1.00 0.00 ? 472 ASP B OD2 1  
ATOM 7196   N N   . VAL B 2 473 ? 88.895  13.922  27.627  1.00 0.00 ? 473 VAL B N   1  
ATOM 7197   C CA  . VAL B 2 473 ? 89.869  13.212  26.834  1.00 0.00 ? 473 VAL B CA  1  
ATOM 7198   C C   . VAL B 2 473 ? 90.643  14.094  25.922  1.00 0.00 ? 473 VAL B C   1  
ATOM 7199   O O   . VAL B 2 473 ? 91.843  13.920  25.786  1.00 0.00 ? 473 VAL B O   1  
ATOM 7200   C CB  . VAL B 2 473 ? 89.406  11.875  26.056  1.00 0.00 ? 473 VAL B CB  1  
ATOM 7201   C CG1 . VAL B 2 473 ? 89.021  10.901  27.197  1.00 0.00 ? 473 VAL B CG1 1  
ATOM 7202   C CG2 . VAL B 2 473 ? 88.143  11.941  25.202  1.00 0.00 ? 473 VAL B CG2 1  
ATOM 7203   N N   . VAL B 2 474 ? 89.946  15.128  25.335  1.00 0.00 ? 474 VAL B N   1  
ATOM 7204   C CA  . VAL B 2 474 ? 90.678  16.112  24.486  1.00 0.00 ? 474 VAL B CA  1  
ATOM 7205   C C   . VAL B 2 474 ? 91.847  16.919  25.257  1.00 0.00 ? 474 VAL B C   1  
ATOM 7206   O O   . VAL B 2 474 ? 92.963  17.084  24.717  1.00 0.00 ? 474 VAL B O   1  
ATOM 7207   C CB  . VAL B 2 474 ? 89.701  17.053  23.778  1.00 0.00 ? 474 VAL B CB  1  
ATOM 7208   C CG1 . VAL B 2 474 ? 90.372  18.248  23.032  1.00 0.00 ? 474 VAL B CG1 1  
ATOM 7209   C CG2 . VAL B 2 474 ? 88.904  16.088  22.802  1.00 0.00 ? 474 VAL B CG2 1  
ATOM 7210   N N   . PHE B 2 475 ? 91.482  17.318  26.507  1.00 0.00 ? 475 PHE B N   1  
ATOM 7211   C CA  . PHE B 2 475 ? 92.441  18.028  27.335  1.00 0.00 ? 475 PHE B CA  1  
ATOM 7212   C C   . PHE B 2 475 ? 93.657  17.258  27.773  1.00 0.00 ? 475 PHE B C   1  
ATOM 7213   O O   . PHE B 2 475 ? 94.862  17.673  27.668  1.00 0.00 ? 475 PHE B O   1  
ATOM 7214   C CB  . PHE B 2 475 ? 91.746  18.659  28.539  1.00 0.00 ? 475 PHE B CB  1  
ATOM 7215   C CG  . PHE B 2 475 ? 92.357  19.925  29.155  1.00 0.00 ? 475 PHE B CG  1  
ATOM 7216   C CD1 . PHE B 2 475 ? 92.043  21.176  28.677  1.00 0.00 ? 475 PHE B CD1 1  
ATOM 7217   C CD2 . PHE B 2 475 ? 93.181  19.776  30.291  1.00 0.00 ? 475 PHE B CD2 1  
ATOM 7218   C CE1 . PHE B 2 475 ? 92.644  22.345  29.243  1.00 0.00 ? 475 PHE B CE1 1  
ATOM 7219   C CE2 . PHE B 2 475 ? 93.768  20.941  30.854  1.00 0.00 ? 475 PHE B CE2 1  
ATOM 7220   C CZ  . PHE B 2 475 ? 93.481  22.200  30.349  1.00 0.00 ? 475 PHE B CZ  1  
ATOM 7221   N N   . ALA B 2 476 ? 93.362  16.012  28.137  1.00 0.00 ? 476 ALA B N   1  
ATOM 7222   C CA  . ALA B 2 476 ? 94.138  14.894  28.512  1.00 0.00 ? 476 ALA B CA  1  
ATOM 7223   C C   . ALA B 2 476 ? 95.005  14.533  27.377  1.00 0.00 ? 476 ALA B C   1  
ATOM 7224   O O   . ALA B 2 476 ? 96.183  14.297  27.649  1.00 0.00 ? 476 ALA B O   1  
ATOM 7225   C CB  . ALA B 2 476 ? 93.303  13.729  29.063  1.00 0.00 ? 476 ALA B CB  1  
ATOM 7226   N N   . LEU B 2 477 ? 94.427  14.532  26.120  1.00 0.00 ? 477 LEU B N   1  
ATOM 7227   C CA  . LEU B 2 477 ? 95.205  14.287  24.903  1.00 0.00 ? 477 LEU B CA  1  
ATOM 7228   C C   . LEU B 2 477 ? 96.229  15.316  24.583  1.00 0.00 ? 477 LEU B C   1  
ATOM 7229   O O   . LEU B 2 477 ? 97.374  14.998  24.287  1.00 0.00 ? 477 LEU B O   1  
ATOM 7230   C CB  . LEU B 2 477 ? 94.334  14.036  23.635  1.00 0.00 ? 477 LEU B CB  1  
ATOM 7231   C CG  . LEU B 2 477 ? 95.096  13.398  22.403  1.00 0.00 ? 477 LEU B CG  1  
ATOM 7232   C CD1 . LEU B 2 477 ? 95.551  11.962  22.820  1.00 0.00 ? 477 LEU B CD1 1  
ATOM 7233   C CD2 . LEU B 2 477 ? 94.301  13.503  21.053  1.00 0.00 ? 477 LEU B CD2 1  
ATOM 7234   N N   . LYS B 2 478 ? 95.915  16.564  24.792  1.00 0.00 ? 478 LYS B N   1  
ATOM 7235   C CA  . LYS B 2 478 ? 96.829  17.674  24.637  1.00 0.00 ? 478 LYS B CA  1  
ATOM 7236   C C   . LYS B 2 478 ? 97.990  17.541  25.586  1.00 0.00 ? 478 LYS B C   1  
ATOM 7237   O O   . LYS B 2 478 ? 99.147  17.663  25.176  1.00 0.00 ? 478 LYS B O   1  
ATOM 7238   C CB  . LYS B 2 478 ? 96.102  19.028  24.801  1.00 0.00 ? 478 LYS B CB  1  
ATOM 7239   C CG  . LYS B 2 478 ? 97.018  20.349  24.876  1.00 0.00 ? 478 LYS B CG  1  
ATOM 7240   C CD  . LYS B 2 478 ? 97.255  20.890  26.296  1.00 0.00 ? 478 LYS B CD  1  
ATOM 7241   C CE  . LYS B 2 478 ? 95.949  21.362  26.957  1.00 0.00 ? 478 LYS B CE  1  
ATOM 7242   N NZ  . LYS B 2 478 ? 96.154  21.542  28.375  1.00 0.00 ? 478 LYS B NZ  1  
ATOM 7243   N N   . ASN B 2 479 ? 97.737  17.193  26.869  1.00 0.00 ? 479 ASN B N   1  
ATOM 7244   C CA  . ASN B 2 479 ? 98.731  17.121  27.878  1.00 0.00 ? 479 ASN B CA  1  
ATOM 7245   C C   . ASN B 2 479 ? 99.712  16.054  27.522  1.00 0.00 ? 479 ASN B C   1  
ATOM 7246   O O   . ASN B 2 479 ? 100.877 16.213  27.729  1.00 0.00 ? 479 ASN B O   1  
ATOM 7247   C CB  . ASN B 2 479 ? 98.038  16.817  29.187  1.00 0.00 ? 479 ASN B CB  1  
ATOM 7248   C CG  . ASN B 2 479 ? 97.064  17.825  29.806  1.00 0.00 ? 479 ASN B CG  1  
ATOM 7249   O OD1 . ASN B 2 479 ? 97.147  19.056  29.720  1.00 0.00 ? 479 ASN B OD1 1  
ATOM 7250   N ND2 . ASN B 2 479 ? 96.064  17.288  30.554  1.00 0.00 ? 479 ASN B ND2 1  
ATOM 7251   N N   . ILE B 2 480 ? 99.232  14.815  27.073  1.00 0.00 ? 480 ILE B N   1  
ATOM 7252   C CA  . ILE B 2 480 ? 100.156 13.757  26.856  1.00 0.00 ? 480 ILE B CA  1  
ATOM 7253   C C   . ILE B 2 480 ? 100.913 13.726  25.518  1.00 0.00 ? 480 ILE B C   1  
ATOM 7254   O O   . ILE B 2 480 ? 102.119 13.720  25.457  1.00 0.00 ? 480 ILE B O   1  
ATOM 7255   C CB  . ILE B 2 480 ? 99.544  12.363  27.048  1.00 0.00 ? 480 ILE B CB  1  
ATOM 7256   C CG1 . ILE B 2 480 ? 98.716  12.349  28.425  1.00 0.00 ? 480 ILE B CG1 1  
ATOM 7257   C CG2 . ILE B 2 480 ? 100.697 11.366  27.071  1.00 0.00 ? 480 ILE B CG2 1  
ATOM 7258   C CD1 . ILE B 2 480 ? 98.046  11.001  28.741  1.00 0.00 ? 480 ILE B CD1 1  
ATOM 7259   N N   . LEU B 2 481 ? 100.131 13.740  24.400  1.00 0.00 ? 481 LEU B N   1  
ATOM 7260   C CA  . LEU B 2 481 ? 100.632 13.596  23.035  1.00 0.00 ? 481 LEU B CA  1  
ATOM 7261   C C   . LEU B 2 481 ? 101.452 14.711  22.505  1.00 0.00 ? 481 LEU B C   1  
ATOM 7262   O O   . LEU B 2 481 ? 102.461 14.551  21.873  1.00 0.00 ? 481 LEU B O   1  
ATOM 7263   C CB  . LEU B 2 481 ? 99.451  13.484  22.073  1.00 0.00 ? 481 LEU B CB  1  
ATOM 7264   C CG  . LEU B 2 481 ? 99.739  13.224  20.581  1.00 0.00 ? 481 LEU B CG  1  
ATOM 7265   C CD1 . LEU B 2 481 ? 100.410 11.816  20.325  1.00 0.00 ? 481 LEU B CD1 1  
ATOM 7266   C CD2 . LEU B 2 481 ? 98.371  13.267  19.902  1.00 0.00 ? 481 LEU B CD2 1  
ATOM 7267   N N   . LEU B 2 482 ? 100.994 15.975  22.731  1.00 0.00 ? 482 LEU B N   1  
ATOM 7268   C CA  . LEU B 2 482 ? 101.499 17.275  22.226  1.00 0.00 ? 482 LEU B CA  1  
ATOM 7269   C C   . LEU B 2 482 ? 102.299 17.945  23.328  1.00 0.00 ? 482 LEU B C   1  
ATOM 7270   O O   . LEU B 2 482 ? 102.674 19.107  23.138  1.00 0.00 ? 482 LEU B O   1  
ATOM 7271   C CB  . LEU B 2 482 ? 100.354 18.293  21.835  1.00 0.00 ? 482 LEU B CB  1  
ATOM 7272   C CG  . LEU B 2 482 ? 100.082 18.423  20.323  1.00 0.00 ? 482 LEU B CG  1  
ATOM 7273   C CD1 . LEU B 2 482 ? 98.737  19.021  19.977  1.00 0.00 ? 482 LEU B CD1 1  
ATOM 7274   C CD2 . LEU B 2 482 ? 101.231 19.103  19.521  1.00 0.00 ? 482 LEU B CD2 1  
ATOM 7275   N N   . MET B 2 483 ? 102.590 17.255  24.443  1.00 0.00 ? 483 MET B N   1  
ATOM 7276   C CA  . MET B 2 483 ? 103.491 17.723  25.577  1.00 0.00 ? 483 MET B CA  1  
ATOM 7277   C C   . MET B 2 483 ? 102.889 18.922  26.260  1.00 0.00 ? 483 MET B C   1  
ATOM 7278   O O   . MET B 2 483 ? 103.625 19.848  26.573  1.00 0.00 ? 483 MET B O   1  
ATOM 7279   C CB  . MET B 2 483 ? 104.994 17.964  25.285  1.00 0.00 ? 483 MET B CB  1  
ATOM 7280   C CG  . MET B 2 483 ? 105.669 16.816  24.615  1.00 0.00 ? 483 MET B CG  1  
ATOM 7281   S SD  . MET B 2 483 ? 107.200 17.265  23.730  1.00 0.00 ? 483 MET B SD  1  
ATOM 7282   C CE  . MET B 2 483 ? 108.149 18.186  24.974  1.00 0.00 ? 483 MET B CE  1  
ATOM 7283   N N   . GLY B 2 484 ? 101.565 18.954  26.363  1.00 0.00 ? 484 GLY B N   1  
ATOM 7284   C CA  . GLY B 2 484 ? 100.840 20.126  26.820  1.00 0.00 ? 484 GLY B CA  1  
ATOM 7285   C C   . GLY B 2 484 ? 100.883 20.262  28.325  1.00 0.00 ? 484 GLY B C   1  
ATOM 7286   O O   . GLY B 2 484 ? 100.320 21.305  28.752  1.00 0.00 ? 484 GLY B O   1  
ATOM 7287   N N   . LYS B 2 485 ? 101.519 19.291  29.065  1.00 0.00 ? 485 LYS B N   1  
ATOM 7288   C CA  . LYS B 2 485 ? 101.773 19.323  30.446  1.00 0.00 ? 485 LYS B CA  1  
ATOM 7289   C C   . LYS B 2 485 ? 103.212 19.169  30.612  1.00 0.00 ? 485 LYS B C   1  
ATOM 7290   O O   . LYS B 2 485 ? 103.761 18.066  30.326  1.00 0.00 ? 485 LYS B O   1  
ATOM 7291   C CB  . LYS B 2 485 ? 101.011 18.265  31.323  1.00 0.00 ? 485 LYS B CB  1  
ATOM 7292   C CG  . LYS B 2 485 ? 101.399 18.373  32.756  1.00 0.00 ? 485 LYS B CG  1  
ATOM 7293   C CD  . LYS B 2 485 ? 100.599 17.534  33.784  1.00 0.00 ? 485 LYS B CD  1  
ATOM 7294   C CE  . LYS B 2 485 ? 99.057  17.659  33.671  1.00 0.00 ? 485 LYS B CE  1  
ATOM 7295   N NZ  . LYS B 2 485 ? 98.406  16.535  32.853  1.00 0.00 ? 485 LYS B NZ  1  
ATOM 7296   N N   . SER B 2 486 ? 103.832 20.180  31.193  1.00 0.00 ? 486 SER B N   1  
ATOM 7297   C CA  . SER B 2 486 ? 105.261 20.269  31.521  1.00 0.00 ? 486 SER B CA  1  
ATOM 7298   C C   . SER B 2 486 ? 105.701 19.251  32.591  1.00 0.00 ? 486 SER B C   1  
ATOM 7299   O O   . SER B 2 486 ? 106.738 18.655  32.502  1.00 0.00 ? 486 SER B O   1  
ATOM 7300   C CB  . SER B 2 486 ? 105.577 21.659  32.138  1.00 0.00 ? 486 SER B CB  1  
ATOM 7301   O OG  . SER B 2 486 ? 105.640 22.657  31.156  1.00 0.00 ? 486 SER B OG  1  
ATOM 7302   N N   . ASP B 2 487 ? 104.871 19.063  33.617  1.00 0.00 ? 487 ASP B N   1  
ATOM 7303   C CA  . ASP B 2 487 ? 105.038 18.212  34.875  1.00 0.00 ? 487 ASP B CA  1  
ATOM 7304   C C   . ASP B 2 487 ? 105.190 16.757  34.511  1.00 0.00 ? 487 ASP B C   1  
ATOM 7305   O O   . ASP B 2 487 ? 106.098 16.054  34.974  1.00 0.00 ? 487 ASP B O   1  
ATOM 7306   C CB  . ASP B 2 487 ? 103.818 18.284  35.876  1.00 0.00 ? 487 ASP B CB  1  
ATOM 7307   C CG  . ASP B 2 487 ? 104.094 17.476  37.129  1.00 0.00 ? 487 ASP B CG  1  
ATOM 7308   O OD1 . ASP B 2 487 ? 105.009 17.936  37.850  1.00 0.00 ? 487 ASP B OD1 1  
ATOM 7309   O OD2 . ASP B 2 487 ? 103.418 16.473  37.366  1.00 0.00 ? 487 ASP B OD2 1  
ATOM 7310   N N   . PHE B 2 488 ? 104.284 16.395  33.541  1.00 0.00 ? 488 PHE B N   1  
ATOM 7311   C CA  . PHE B 2 488 ? 104.234 15.115  32.916  1.00 0.00 ? 488 PHE B CA  1  
ATOM 7312   C C   . PHE B 2 488 ? 105.473 14.841  32.207  1.00 0.00 ? 488 PHE B C   1  
ATOM 7313   O O   . PHE B 2 488 ? 105.960 13.727  32.434  1.00 0.00 ? 488 PHE B O   1  
ATOM 7314   C CB  . PHE B 2 488 ? 103.047 15.077  31.935  1.00 0.00 ? 488 PHE B CB  1  
ATOM 7315   C CG  . PHE B 2 488 ? 103.078 13.894  30.988  1.00 0.00 ? 488 PHE B CG  1  
ATOM 7316   C CD1 . PHE B 2 488 ? 102.724 12.588  31.361  1.00 0.00 ? 488 PHE B CD1 1  
ATOM 7317   C CD2 . PHE B 2 488 ? 103.417 14.099  29.643  1.00 0.00 ? 488 PHE B CD2 1  
ATOM 7318   C CE1 . PHE B 2 488 ? 103.016 11.476  30.473  1.00 0.00 ? 488 PHE B CE1 1  
ATOM 7319   C CE2 . PHE B 2 488 ? 103.712 13.070  28.775  1.00 0.00 ? 488 PHE B CE2 1  
ATOM 7320   C CZ  . PHE B 2 488 ? 103.592 11.752  29.190  1.00 0.00 ? 488 PHE B CZ  1  
ATOM 7321   N N   . MET B 2 489 ? 106.016 15.806  31.429  1.00 0.00 ? 489 MET B N   1  
ATOM 7322   C CA  . MET B 2 489 ? 107.294 15.645  30.741  1.00 0.00 ? 489 MET B CA  1  
ATOM 7323   C C   . MET B 2 489 ? 108.471 15.537  31.671  1.00 0.00 ? 489 MET B C   1  
ATOM 7324   O O   . MET B 2 489 ? 109.322 14.749  31.463  1.00 0.00 ? 489 MET B O   1  
ATOM 7325   C CB  . MET B 2 489 ? 107.612 16.793  29.706  1.00 0.00 ? 489 MET B CB  1  
ATOM 7326   C CG  . MET B 2 489 ? 106.609 16.777  28.507  1.00 0.00 ? 489 MET B CG  1  
ATOM 7327   S SD  . MET B 2 489 ? 106.738 15.241  27.539  1.00 0.00 ? 489 MET B SD  1  
ATOM 7328   C CE  . MET B 2 489 ? 108.495 14.876  27.402  1.00 0.00 ? 489 MET B CE  1  
ATOM 7329   N N   . ASP B 2 490 ? 108.501 16.286  32.758  1.00 0.00 ? 490 ASP B N   1  
ATOM 7330   C CA  . ASP B 2 490 ? 109.535 16.206  33.788  1.00 0.00 ? 490 ASP B CA  1  
ATOM 7331   C C   . ASP B 2 490 ? 109.649 14.869  34.467  1.00 0.00 ? 490 ASP B C   1  
ATOM 7332   O O   . ASP B 2 490 ? 110.736 14.296  34.614  1.00 0.00 ? 490 ASP B O   1  
ATOM 7333   C CB  . ASP B 2 490 ? 109.425 17.335  34.934  1.00 0.00 ? 490 ASP B CB  1  
ATOM 7334   C CG  . ASP B 2 490 ? 109.609 18.796  34.410  1.00 0.00 ? 490 ASP B CG  1  
ATOM 7335   O OD1 . ASP B 2 490 ? 110.751 19.034  34.076  1.00 0.00 ? 490 ASP B OD1 1  
ATOM 7336   O OD2 . ASP B 2 490 ? 108.563 19.441  34.277  1.00 0.00 ? 490 ASP B OD2 1  
ATOM 7337   N N   . ALA B 2 491 ? 108.504 14.257  34.920  1.00 0.00 ? 491 ALA B N   1  
ATOM 7338   C CA  . ALA B 2 491 ? 108.469 12.897  35.497  1.00 0.00 ? 491 ALA B CA  1  
ATOM 7339   C C   . ALA B 2 491 ? 108.878 11.857  34.497  1.00 0.00 ? 491 ALA B C   1  
ATOM 7340   O O   . ALA B 2 491 ? 109.705 10.967  34.718  1.00 0.00 ? 491 ALA B O   1  
ATOM 7341   C CB  . ALA B 2 491 ? 107.081 12.544  35.969  1.00 0.00 ? 491 ALA B CB  1  
ATOM 7342   N N   . LEU B 2 492 ? 108.432 11.948  33.241  1.00 0.00 ? 492 LEU B N   1  
ATOM 7343   C CA  . LEU B 2 492 ? 108.831 11.034  32.238  1.00 0.00 ? 492 LEU B CA  1  
ATOM 7344   C C   . LEU B 2 492 ? 110.295 11.053  31.926  1.00 0.00 ? 492 LEU B C   1  
ATOM 7345   O O   . LEU B 2 492 ? 110.851 9.979   31.833  1.00 0.00 ? 492 LEU B O   1  
ATOM 7346   C CB  . LEU B 2 492 ? 108.077 11.348  30.881  1.00 0.00 ? 492 LEU B CB  1  
ATOM 7347   C CG  . LEU B 2 492 ? 108.229 10.408  29.672  1.00 0.00 ? 492 LEU B CG  1  
ATOM 7348   C CD1 . LEU B 2 492 ? 106.953 10.360  28.834  1.00 0.00 ? 492 LEU B CD1 1  
ATOM 7349   C CD2 . LEU B 2 492 ? 109.522 10.508  28.858  1.00 0.00 ? 492 LEU B CD2 1  
ATOM 7350   N N   . ILE B 2 493 ? 110.953 12.254  31.732  1.00 0.00 ? 493 ILE B N   1  
ATOM 7351   C CA  . ILE B 2 493 ? 112.370 12.308  31.325  1.00 0.00 ? 493 ILE B CA  1  
ATOM 7352   C C   . ILE B 2 493 ? 113.235 11.719  32.375  1.00 0.00 ? 493 ILE B C   1  
ATOM 7353   O O   . ILE B 2 493 ? 114.204 11.046  32.079  1.00 0.00 ? 493 ILE B O   1  
ATOM 7354   C CB  . ILE B 2 493 ? 112.762 13.557  30.660  1.00 0.00 ? 493 ILE B CB  1  
ATOM 7355   C CG1 . ILE B 2 493 ? 112.576 14.734  31.636  1.00 0.00 ? 493 ILE B CG1 1  
ATOM 7356   C CG2 . ILE B 2 493 ? 112.026 13.805  29.326  1.00 0.00 ? 493 ILE B CG2 1  
ATOM 7357   C CD1 . ILE B 2 493 ? 112.957 16.103  31.048  1.00 0.00 ? 493 ILE B CD1 1  
ATOM 7358   N N   . GLU B 2 494 ? 112.779 12.021  33.707  1.00 0.00 ? 494 GLU B N   1  
ATOM 7359   C CA  . GLU B 2 494 ? 113.398 11.586  34.907  1.00 0.00 ? 494 GLU B CA  1  
ATOM 7360   C C   . GLU B 2 494 ? 113.420 10.035  35.041  1.00 0.00 ? 494 GLU B C   1  
ATOM 7361   O O   . GLU B 2 494 ? 114.566 9.527   35.205  1.00 0.00 ? 494 GLU B O   1  
ATOM 7362   C CB  . GLU B 2 494 ? 112.573 12.075  36.195  1.00 0.00 ? 494 GLU B CB  1  
ATOM 7363   C CG  . GLU B 2 494 ? 113.071 13.548  36.489  1.00 0.00 ? 494 GLU B CG  1  
ATOM 7364   C CD  . GLU B 2 494 ? 112.407 13.887  37.807  1.00 0.00 ? 494 GLU B CD  1  
ATOM 7365   O OE1 . GLU B 2 494 ? 112.884 13.400  38.925  1.00 0.00 ? 494 GLU B OE1 1  
ATOM 7366   O OE2 . GLU B 2 494 ? 111.360 14.560  37.737  1.00 0.00 ? 494 GLU B OE2 1  
ATOM 7367   N N   . LYS B 2 495 ? 112.330 9.329   34.787  1.00 0.00 ? 495 LYS B N   1  
ATOM 7368   C CA  . LYS B 2 495 ? 112.315 7.852   34.798  1.00 0.00 ? 495 LYS B CA  1  
ATOM 7369   C C   . LYS B 2 495 ? 113.038 7.222   33.646  1.00 0.00 ? 495 LYS B C   1  
ATOM 7370   O O   . LYS B 2 495 ? 113.792 6.254   33.794  1.00 0.00 ? 495 LYS B O   1  
ATOM 7371   C CB  . LYS B 2 495 ? 110.906 7.178   34.790  1.00 0.00 ? 495 LYS B CB  1  
ATOM 7372   C CG  . LYS B 2 495 ? 110.277 7.412   36.164  1.00 0.00 ? 495 LYS B CG  1  
ATOM 7373   C CD  . LYS B 2 495 ? 108.832 6.878   36.304  1.00 0.00 ? 495 LYS B CD  1  
ATOM 7374   C CE  . LYS B 2 495 ? 107.641 7.577   35.607  1.00 0.00 ? 495 LYS B CE  1  
ATOM 7375   N NZ  . LYS B 2 495 ? 107.689 9.077   35.759  1.00 0.00 ? 495 LYS B NZ  1  
ATOM 7376   N N   . ALA B 2 496 ? 112.766 7.826   32.513  1.00 0.00 ? 496 ALA B N   1  
ATOM 7377   C CA  . ALA B 2 496 ? 113.206 7.363   31.218  1.00 0.00 ? 496 ALA B CA  1  
ATOM 7378   C C   . ALA B 2 496 ? 114.666 7.411   31.059  1.00 0.00 ? 496 ALA B C   1  
ATOM 7379   O O   . ALA B 2 496 ? 115.151 6.673   30.269  1.00 0.00 ? 496 ALA B O   1  
ATOM 7380   C CB  . ALA B 2 496 ? 112.510 8.081   30.051  1.00 0.00 ? 496 ALA B CB  1  
ATOM 7381   N N   . ASN B 2 497 ? 115.409 8.325   31.765  1.00 0.00 ? 497 ASN B N   1  
ATOM 7382   C CA  . ASN B 2 497 ? 116.786 8.784   31.590  1.00 0.00 ? 497 ASN B CA  1  
ATOM 7383   C C   . ASN B 2 497 ? 117.732 7.656   31.459  1.00 0.00 ? 497 ASN B C   1  
ATOM 7384   O O   . ASN B 2 497 ? 118.474 7.734   30.474  1.00 0.00 ? 497 ASN B O   1  
ATOM 7385   C CB  . ASN B 2 497 ? 117.372 9.464   32.919  1.00 0.00 ? 497 ASN B CB  1  
ATOM 7386   C CG  . ASN B 2 497 ? 118.879 9.820   32.881  1.00 0.00 ? 497 ASN B CG  1  
ATOM 7387   O OD1 . ASN B 2 497 ? 119.428 10.409  31.980  1.00 0.00 ? 497 ASN B OD1 1  
ATOM 7388   N ND2 . ASN B 2 497 ? 119.544 9.506   34.040  1.00 0.00 ? 497 ASN B ND2 1  
ATOM 7389   N N   . ASP B 2 498 ? 117.683 6.629   32.314  1.00 0.00 ? 498 ASP B N   1  
ATOM 7390   C CA  . ASP B 2 498 ? 118.660 5.490   32.326  1.00 0.00 ? 498 ASP B CA  1  
ATOM 7391   C C   . ASP B 2 498 ? 118.604 4.649   31.059  1.00 0.00 ? 498 ASP B C   1  
ATOM 7392   O O   . ASP B 2 498 ? 119.574 4.249   30.460  1.00 0.00 ? 498 ASP B O   1  
ATOM 7393   C CB  . ASP B 2 498 ? 118.392 4.593   33.500  1.00 0.00 ? 498 ASP B CB  1  
ATOM 7394   C CG  . ASP B 2 498 ? 118.455 5.309   34.845  1.00 0.00 ? 498 ASP B CG  1  
ATOM 7395   O OD1 . ASP B 2 498 ? 119.488 5.902   35.170  1.00 0.00 ? 498 ASP B OD1 1  
ATOM 7396   O OD2 . ASP B 2 498 ? 117.442 5.302   35.581  1.00 0.00 ? 498 ASP B OD2 1  
ATOM 7397   N N   . ILE B 2 499 ? 117.297 4.423   30.698  1.00 0.00 ? 499 ILE B N   1  
ATOM 7398   C CA  . ILE B 2 499 ? 116.876 3.559   29.613  1.00 0.00 ? 499 ILE B CA  1  
ATOM 7399   C C   . ILE B 2 499 ? 117.217 4.137   28.233  1.00 0.00 ? 499 ILE B C   1  
ATOM 7400   O O   . ILE B 2 499 ? 117.664 3.436   27.349  1.00 0.00 ? 499 ILE B O   1  
ATOM 7401   C CB  . ILE B 2 499 ? 115.343 3.274   29.732  1.00 0.00 ? 499 ILE B CB  1  
ATOM 7402   C CG1 . ILE B 2 499 ? 114.799 3.227   31.170  1.00 0.00 ? 499 ILE B CG1 1  
ATOM 7403   C CG2 . ILE B 2 499 ? 114.986 1.974   28.905  1.00 0.00 ? 499 ILE B CG2 1  
ATOM 7404   C CD1 . ILE B 2 499 ? 113.290 2.945   31.261  1.00 0.00 ? 499 ILE B CD1 1  
ATOM 7405   N N   . LEU B 2 500 ? 117.014 5.444   28.130  1.00 0.00 ? 500 LEU B N   1  
ATOM 7406   C CA  . LEU B 2 500 ? 117.324 6.288   26.990  1.00 0.00 ? 500 LEU B CA  1  
ATOM 7407   C C   . LEU B 2 500 ? 118.730 6.642   26.811  1.00 0.00 ? 500 LEU B C   1  
ATOM 7408   O O   . LEU B 2 500 ? 119.171 6.873   25.673  1.00 0.00 ? 500 LEU B O   1  
ATOM 7409   C CB  . LEU B 2 500 ? 116.527 7.582   27.124  1.00 0.00 ? 500 LEU B CB  1  
ATOM 7410   C CG  . LEU B 2 500 ? 115.029 7.494   26.786  1.00 0.00 ? 500 LEU B CG  1  
ATOM 7411   C CD1 . LEU B 2 500 ? 114.353 8.857   26.994  1.00 0.00 ? 500 LEU B CD1 1  
ATOM 7412   C CD2 . LEU B 2 500 ? 114.639 7.045   25.350  1.00 0.00 ? 500 LEU B CD2 1  
ATOM 7413   N N   . ALA B 2 501 ? 119.567 6.663   27.923  1.00 0.00 ? 501 ALA B N   1  
ATOM 7414   C CA  . ALA B 2 501 ? 120.978 7.009   27.825  1.00 0.00 ? 501 ALA B CA  1  
ATOM 7415   C C   . ALA B 2 501 ? 121.607 5.982   26.903  1.00 0.00 ? 501 ALA B C   1  
ATOM 7416   O O   . ALA B 2 501 ? 122.473 6.432   26.108  1.00 0.00 ? 501 ALA B O   1  
ATOM 7417   C CB  . ALA B 2 501 ? 121.609 7.074   29.245  1.00 0.00 ? 501 ALA B CB  1  
ATOM 7418   N N   . THR B 2 502 ? 121.270 4.667   26.946  1.00 0.00 ? 502 THR B N   1  
ATOM 7419   C CA  . THR B 2 502 ? 121.909 3.623   26.138  1.00 0.00 ? 502 THR B CA  1  
ATOM 7420   C C   . THR B 2 502 ? 121.117 3.474   24.890  1.00 0.00 ? 502 THR B C   1  
ATOM 7421   O O   . THR B 2 502 ? 119.979 3.869   24.961  1.00 0.00 ? 502 THR B O   1  
ATOM 7422   C CB  . THR B 2 502 ? 122.056 2.278   26.884  1.00 0.00 ? 502 THR B CB  1  
ATOM 7423   O OG1 . THR B 2 502 ? 120.972 2.077   27.768  1.00 0.00 ? 502 THR B OG1 1  
ATOM 7424   C CG2 . THR B 2 502 ? 123.269 2.463   27.797  1.00 0.00 ? 502 THR B CG2 1  
ATOM 7425   N N   . PRO B 2 503 ? 121.526 2.920   23.748  1.00 0.00 ? 503 PRO B N   1  
ATOM 7426   C CA  . PRO B 2 503 ? 120.684 2.589   22.541  1.00 0.00 ? 503 PRO B CA  1  
ATOM 7427   C C   . PRO B 2 503 ? 119.322 1.930   22.903  1.00 0.00 ? 503 PRO B C   1  
ATOM 7428   O O   . PRO B 2 503 ? 119.175 1.233   23.904  1.00 0.00 ? 503 PRO B O   1  
ATOM 7429   C CB  . PRO B 2 503 ? 121.451 1.532   21.794  1.00 0.00 ? 503 PRO B CB  1  
ATOM 7430   C CG  . PRO B 2 503 ? 122.886 1.870   22.088  1.00 0.00 ? 503 PRO B CG  1  
ATOM 7431   C CD  . PRO B 2 503 ? 122.871 2.573   23.417  1.00 0.00 ? 503 PRO B CD  1  
ATOM 7432   N N   . SER B 2 504 ? 118.292 2.097   22.048  1.00 0.00 ? 504 SER B N   1  
ATOM 7433   C CA  . SER B 2 504 ? 116.940 1.542   22.320  1.00 0.00 ? 504 SER B CA  1  
ATOM 7434   C C   . SER B 2 504 ? 116.750 0.358   21.421  1.00 0.00 ? 504 SER B C   1  
ATOM 7435   O O   . SER B 2 504 ? 117.058 0.438   20.233  1.00 0.00 ? 504 SER B O   1  
ATOM 7436   C CB  . SER B 2 504 ? 115.718 2.479   22.100  1.00 0.00 ? 504 SER B CB  1  
ATOM 7437   O OG  . SER B 2 504 ? 115.980 3.466   21.225  1.00 0.00 ? 504 SER B OG  1  
ATOM 7438   N N   . ASP B 2 505 ? 116.421 -0.749  22.031  1.00 0.00 ? 505 ASP B N   1  
ATOM 7439   C CA  . ASP B 2 505 ? 116.188 -1.999  21.333  1.00 0.00 ? 505 ASP B CA  1  
ATOM 7440   C C   . ASP B 2 505 ? 114.870 -2.560  21.810  1.00 0.00 ? 505 ASP B C   1  
ATOM 7441   O O   . ASP B 2 505 ? 114.075 -1.771  22.329  1.00 0.00 ? 505 ASP B O   1  
ATOM 7442   C CB  . ASP B 2 505 ? 117.333 -3.101  21.533  1.00 0.00 ? 505 ASP B CB  1  
ATOM 7443   C CG  . ASP B 2 505 ? 118.598 -2.594  20.864  1.00 0.00 ? 505 ASP B CG  1  
ATOM 7444   O OD1 . ASP B 2 505 ? 118.517 -2.233  19.680  1.00 0.00 ? 505 ASP B OD1 1  
ATOM 7445   O OD2 . ASP B 2 505 ? 119.672 -2.585  21.518  1.00 0.00 ? 505 ASP B OD2 1  
ATOM 7446   N N   . SER B 2 506 ? 114.603 -3.894  21.626  1.00 0.00 ? 506 SER B N   1  
ATOM 7447   C CA  . SER B 2 506 ? 113.397 -4.686  21.990  1.00 0.00 ? 506 SER B CA  1  
ATOM 7448   C C   . SER B 2 506 ? 112.935 -4.432  23.371  1.00 0.00 ? 506 SER B C   1  
ATOM 7449   O O   . SER B 2 506 ? 111.782 -4.098  23.533  1.00 0.00 ? 506 SER B O   1  
ATOM 7450   C CB  . SER B 2 506 ? 113.455 -6.187  21.711  1.00 0.00 ? 506 SER B CB  1  
ATOM 7451   O OG  . SER B 2 506 ? 113.691 -6.403  20.369  1.00 0.00 ? 506 SER B OG  1  
ATOM 7452   N N   . LEU B 2 507 ? 113.851 -4.669  24.340  1.00 0.00 ? 507 LEU B N   1  
ATOM 7453   C CA  . LEU B 2 507 ? 113.530 -4.490  25.739  1.00 0.00 ? 507 LEU B CA  1  
ATOM 7454   C C   . LEU B 2 507 ? 113.271 -3.065  26.143  1.00 0.00 ? 507 LEU B C   1  
ATOM 7455   O O   . LEU B 2 507 ? 112.229 -2.889  26.723  1.00 0.00 ? 507 LEU B O   1  
ATOM 7456   C CB  . LEU B 2 507 ? 114.470 -5.209  26.737  1.00 0.00 ? 507 LEU B CB  1  
ATOM 7457   C CG  . LEU B 2 507 ? 114.894 -6.605  26.316  1.00 0.00 ? 507 LEU B CG  1  
ATOM 7458   C CD1 . LEU B 2 507 ? 115.938 -7.299  27.247  1.00 0.00 ? 507 LEU B CD1 1  
ATOM 7459   C CD2 . LEU B 2 507 ? 113.723 -7.597  26.172  1.00 0.00 ? 507 LEU B CD2 1  
ATOM 7460   N N   . PRO B 2 508 ? 113.962 -2.030  25.647  1.00 0.00 ? 508 PRO B N   1  
ATOM 7461   C CA  . PRO B 2 508 ? 113.643 -0.634  25.916  1.00 0.00 ? 508 PRO B CA  1  
ATOM 7462   C C   . PRO B 2 508 ? 112.248 -0.230  25.621  1.00 0.00 ? 508 PRO B C   1  
ATOM 7463   O O   . PRO B 2 508 ? 111.768 0.484   26.481  1.00 0.00 ? 508 PRO B O   1  
ATOM 7464   C CB  . PRO B 2 508 ? 114.795 0.167   25.365  1.00 0.00 ? 508 PRO B CB  1  
ATOM 7465   C CG  . PRO B 2 508 ? 115.981 -0.732  25.738  1.00 0.00 ? 508 PRO B CG  1  
ATOM 7466   C CD  . PRO B 2 508 ? 115.454 -2.119  25.410  1.00 0.00 ? 508 PRO B CD  1  
ATOM 7467   N N   . ASN B 2 509 ? 111.571 -0.664  24.541  1.00 0.00 ? 509 ASN B N   1  
ATOM 7468   C CA  . ASN B 2 509 ? 110.215 -0.222  24.102  1.00 0.00 ? 509 ASN B CA  1  
ATOM 7469   C C   . ASN B 2 509 ? 109.198 -0.498  25.182  1.00 0.00 ? 509 ASN B C   1  
ATOM 7470   O O   . ASN B 2 509 ? 108.400 0.316   25.532  1.00 0.00 ? 509 ASN B O   1  
ATOM 7471   C CB  . ASN B 2 509 ? 109.810 -1.036  22.806  1.00 0.00 ? 509 ASN B CB  1  
ATOM 7472   C CG  . ASN B 2 509 ? 108.608 -0.347  22.104  1.00 0.00 ? 509 ASN B CG  1  
ATOM 7473   O OD1 . ASN B 2 509 ? 108.906 0.690   21.517  1.00 0.00 ? 509 ASN B OD1 1  
ATOM 7474   N ND2 . ASN B 2 509 ? 107.333 -0.830  22.243  1.00 0.00 ? 509 ASN B ND2 1  
ATOM 7475   N N   . TYR B 2 510 ? 109.330 -1.736  25.736  1.00 0.00 ? 510 TYR B N   1  
ATOM 7476   C CA  . TYR B 2 510 ? 108.421 -2.141  26.728  1.00 0.00 ? 510 TYR B CA  1  
ATOM 7477   C C   . TYR B 2 510 ? 108.569 -1.320  27.979  1.00 0.00 ? 510 TYR B C   1  
ATOM 7478   O O   . TYR B 2 510 ? 107.583 -0.868  28.600  1.00 0.00 ? 510 TYR B O   1  
ATOM 7479   C CB  . TYR B 2 510 ? 108.624 -3.659  26.900  1.00 0.00 ? 510 TYR B CB  1  
ATOM 7480   C CG  . TYR B 2 510 ? 108.750 -4.473  25.585  1.00 0.00 ? 510 TYR B CG  1  
ATOM 7481   C CD1 . TYR B 2 510 ? 107.924 -4.284  24.456  1.00 0.00 ? 510 TYR B CD1 1  
ATOM 7482   C CD2 . TYR B 2 510 ? 109.736 -5.454  25.490  1.00 0.00 ? 510 TYR B CD2 1  
ATOM 7483   C CE1 . TYR B 2 510 ? 107.832 -5.109  23.437  1.00 0.00 ? 510 TYR B CE1 1  
ATOM 7484   C CE2 . TYR B 2 510 ? 109.723 -6.298  24.418  1.00 0.00 ? 510 TYR B CE2 1  
ATOM 7485   C CZ  . TYR B 2 510 ? 108.805 -6.106  23.354  1.00 0.00 ? 510 TYR B CZ  1  
ATOM 7486   O OH  . TYR B 2 510 ? 108.892 -6.970  22.255  1.00 0.00 ? 510 TYR B OH  1  
ATOM 7487   N N   . LYS B 2 511 ? 109.879 -1.115  28.379  1.00 0.00 ? 511 LYS B N   1  
ATOM 7488   C CA  . LYS B 2 511 ? 110.234 -0.431  29.560  1.00 0.00 ? 511 LYS B CA  1  
ATOM 7489   C C   . LYS B 2 511 ? 109.775 1.034   29.454  1.00 0.00 ? 511 LYS B C   1  
ATOM 7490   O O   . LYS B 2 511 ? 109.269 1.630   30.444  1.00 0.00 ? 511 LYS B O   1  
ATOM 7491   C CB  . LYS B 2 511 ? 111.763 -0.576  29.748  1.00 0.00 ? 511 LYS B CB  1  
ATOM 7492   C CG  . LYS B 2 511 ? 112.127 -2.019  30.168  1.00 0.00 ? 511 LYS B CG  1  
ATOM 7493   C CD  . LYS B 2 511 ? 113.631 -2.236  30.408  1.00 0.00 ? 511 LYS B CD  1  
ATOM 7494   C CE  . LYS B 2 511 ? 113.916 -3.564  31.169  1.00 0.00 ? 511 LYS B CE  1  
ATOM 7495   N NZ  . LYS B 2 511 ? 113.577 -4.738  30.301  1.00 0.00 ? 511 LYS B NZ  1  
ATOM 7496   N N   . LEU B 2 512 ? 109.960 1.609   28.250  1.00 0.00 ? 512 LEU B N   1  
ATOM 7497   C CA  . LEU B 2 512 ? 109.528 2.979   28.026  1.00 0.00 ? 512 LEU B CA  1  
ATOM 7498   C C   . LEU B 2 512 ? 108.064 3.127   28.107  1.00 0.00 ? 512 LEU B C   1  
ATOM 7499   O O   . LEU B 2 512 ? 107.599 4.140   28.614  1.00 0.00 ? 512 LEU B O   1  
ATOM 7500   C CB  . LEU B 2 512 ? 110.017 3.405   26.626  1.00 0.00 ? 512 LEU B CB  1  
ATOM 7501   C CG  . LEU B 2 512 ? 111.479 3.685   26.651  1.00 0.00 ? 512 LEU B CG  1  
ATOM 7502   C CD1 . LEU B 2 512 ? 112.011 3.586   25.190  1.00 0.00 ? 512 LEU B CD1 1  
ATOM 7503   C CD2 . LEU B 2 512 ? 111.770 5.129   27.053  1.00 0.00 ? 512 LEU B CD2 1  
ATOM 7504   N N   . THR B 2 513 ? 107.242 2.181   27.615  1.00 0.00 ? 513 THR B N   1  
ATOM 7505   C CA  . THR B 2 513 ? 105.762 2.297   27.674  1.00 0.00 ? 513 THR B CA  1  
ATOM 7506   C C   . THR B 2 513 ? 105.384 2.245   29.139  1.00 0.00 ? 513 THR B C   1  
ATOM 7507   O O   . THR B 2 513 ? 104.452 2.973   29.447  1.00 0.00 ? 513 THR B O   1  
ATOM 7508   C CB  . THR B 2 513 ? 105.122 1.165   26.897  1.00 0.00 ? 513 THR B CB  1  
ATOM 7509   O OG1 . THR B 2 513 ? 105.418 1.358   25.529  1.00 0.00 ? 513 THR B OG1 1  
ATOM 7510   C CG2 . THR B 2 513 ? 103.560 1.202   27.027  1.00 0.00 ? 513 THR B CG2 1  
ATOM 7511   N N   . ARG B 2 514 ? 106.123 1.395   29.979  1.00 0.00 ? 514 ARG B N   1  
ATOM 7512   C CA  . ARG B 2 514 ? 105.735 1.396   31.410  1.00 0.00 ? 514 ARG B CA  1  
ATOM 7513   C C   . ARG B 2 514 ? 105.998 2.702   32.076  1.00 0.00 ? 514 ARG B C   1  
ATOM 7514   O O   . ARG B 2 514 ? 105.214 3.246   32.802  1.00 0.00 ? 514 ARG B O   1  
ATOM 7515   C CB  . ARG B 2 514 ? 106.383 0.251   32.141  1.00 0.00 ? 514 ARG B CB  1  
ATOM 7516   C CG  . ARG B 2 514 ? 105.821 -1.175  31.849  1.00 0.00 ? 514 ARG B CG  1  
ATOM 7517   C CD  . ARG B 2 514 ? 106.448 -2.338  32.659  1.00 0.00 ? 514 ARG B CD  1  
ATOM 7518   N NE  . ARG B 2 514 ? 107.631 -2.861  31.894  1.00 0.00 ? 514 ARG B NE  1  
ATOM 7519   C CZ  . ARG B 2 514 ? 107.638 -3.559  30.728  1.00 0.00 ? 514 ARG B CZ  1  
ATOM 7520   N NH1 . ARG B 2 514 ? 106.494 -4.042  30.133  1.00 0.00 ? 514 ARG B NH1 1  
ATOM 7521   N NH2 . ARG B 2 514 ? 108.856 -3.839  30.230  1.00 0.00 ? 514 ARG B NH2 1  
ATOM 7522   N N   . VAL B 2 515 ? 107.164 3.289   31.817  1.00 0.00 ? 515 VAL B N   1  
ATOM 7523   C CA  . VAL B 2 515 ? 107.451 4.579   32.414  1.00 0.00 ? 515 VAL B CA  1  
ATOM 7524   C C   . VAL B 2 515 ? 106.467 5.705   31.961  1.00 0.00 ? 515 VAL B C   1  
ATOM 7525   O O   . VAL B 2 515 ? 106.052 6.517   32.781  1.00 0.00 ? 515 VAL B O   1  
ATOM 7526   C CB  . VAL B 2 515 ? 108.898 5.093   32.430  1.00 0.00 ? 515 VAL B CB  1  
ATOM 7527   C CG1 . VAL B 2 515 ? 109.718 3.996   32.994  1.00 0.00 ? 515 VAL B CG1 1  
ATOM 7528   C CG2 . VAL B 2 515 ? 109.384 5.402   30.979  1.00 0.00 ? 515 VAL B CG2 1  
ATOM 7529   N N   . LEU B 2 516 ? 106.030 5.682   30.689  1.00 0.00 ? 516 LEU B N   1  
ATOM 7530   C CA  . LEU B 2 516 ? 105.040 6.580   30.106  1.00 0.00 ? 516 LEU B CA  1  
ATOM 7531   C C   . LEU B 2 516 ? 103.755 6.377   30.790  1.00 0.00 ? 516 LEU B C   1  
ATOM 7532   O O   . LEU B 2 516 ? 103.153 7.370   31.121  1.00 0.00 ? 516 LEU B O   1  
ATOM 7533   C CB  . LEU B 2 516 ? 104.834 6.270   28.586  1.00 0.00 ? 516 LEU B CB  1  
ATOM 7534   C CG  . LEU B 2 516 ? 103.707 6.949   27.790  1.00 0.00 ? 516 LEU B CG  1  
ATOM 7535   C CD1 . LEU B 2 516 ? 102.243 6.402   27.967  1.00 0.00 ? 516 LEU B CD1 1  
ATOM 7536   C CD2 . LEU B 2 516 ? 103.665 8.537   27.840  1.00 0.00 ? 516 LEU B CD2 1  
ATOM 7537   N N   . GLN B 2 517 ? 103.297 5.130   30.986  1.00 0.00 ? 517 GLN B N   1  
ATOM 7538   C CA  . GLN B 2 517 ? 102.088 4.895   31.691  1.00 0.00 ? 517 GLN B CA  1  
ATOM 7539   C C   . GLN B 2 517 ? 102.088 5.301   33.200  1.00 0.00 ? 517 GLN B C   1  
ATOM 7540   O O   . GLN B 2 517 ? 101.148 5.915   33.732  1.00 0.00 ? 517 GLN B O   1  
ATOM 7541   C CB  . GLN B 2 517 ? 101.703 3.440   31.603  1.00 0.00 ? 517 GLN B CB  1  
ATOM 7542   C CG  . GLN B 2 517 ? 101.186 3.120   30.113  1.00 0.00 ? 517 GLN B CG  1  
ATOM 7543   C CD  . GLN B 2 517 ? 100.652 1.658   30.052  1.00 0.00 ? 517 GLN B CD  1  
ATOM 7544   O OE1 . GLN B 2 517 ? 101.305 0.653   30.365  1.00 0.00 ? 517 GLN B OE1 1  
ATOM 7545   N NE2 . GLN B 2 517 ? 99.354  1.527   29.695  1.00 0.00 ? 517 GLN B NE2 1  
ATOM 7546   N N   . GLU B 2 518 ? 103.181 4.975   33.898  1.00 0.00 ? 518 GLU B N   1  
ATOM 7547   C CA  . GLU B 2 518 ? 103.376 5.262   35.361  1.00 0.00 ? 518 GLU B CA  1  
ATOM 7548   C C   . GLU B 2 518 ? 103.383 6.794   35.678  1.00 0.00 ? 518 GLU B C   1  
ATOM 7549   O O   . GLU B 2 518 ? 102.877 7.270   36.695  1.00 0.00 ? 518 GLU B O   1  
ATOM 7550   C CB  . GLU B 2 518 ? 104.721 4.641   35.960  1.00 0.00 ? 518 GLU B CB  1  
ATOM 7551   C CG  . GLU B 2 518 ? 104.849 4.795   37.418  1.00 0.00 ? 518 GLU B CG  1  
ATOM 7552   C CD  . GLU B 2 518 ? 103.806 4.074   38.196  1.00 0.00 ? 518 GLU B CD  1  
ATOM 7553   O OE1 . GLU B 2 518 ? 103.525 2.905   37.851  1.00 0.00 ? 518 GLU B OE1 1  
ATOM 7554   O OE2 . GLU B 2 518 ? 103.201 4.697   39.076  1.00 0.00 ? 518 GLU B OE2 1  
ATOM 7555   N N   . ALA B 2 519 ? 103.961 7.548   34.712  1.00 0.00 ? 519 ALA B N   1  
ATOM 7556   C CA  . ALA B 2 519 ? 104.202 8.966   34.733  1.00 0.00 ? 519 ALA B CA  1  
ATOM 7557   C C   . ALA B 2 519 ? 102.843 9.685   34.793  1.00 0.00 ? 519 ALA B C   1  
ATOM 7558   O O   . ALA B 2 519 ? 102.673 10.630  35.497  1.00 0.00 ? 519 ALA B O   1  
ATOM 7559   C CB  . ALA B 2 519 ? 104.854 9.392   33.415  1.00 0.00 ? 519 ALA B CB  1  
ATOM 7560   N N   . VAL B 2 520 ? 101.784 9.279   34.031  1.00 0.00 ? 520 VAL B N   1  
ATOM 7561   C CA  . VAL B 2 520 ? 100.520 9.957   33.997  1.00 0.00 ? 520 VAL B CA  1  
ATOM 7562   C C   . VAL B 2 520 ? 99.855  9.857   35.361  1.00 0.00 ? 520 VAL B C   1  
ATOM 7563   O O   . VAL B 2 520 ? 99.405  10.868  35.839  1.00 0.00 ? 520 VAL B O   1  
ATOM 7564   C CB  . VAL B 2 520 ? 99.635  9.190   32.941  1.00 0.00 ? 520 VAL B CB  1  
ATOM 7565   C CG1 . VAL B 2 520 ? 98.306  9.926   32.841  1.00 0.00 ? 520 VAL B CG1 1  
ATOM 7566   C CG2 . VAL B 2 520 ? 100.278 8.997   31.557  1.00 0.00 ? 520 VAL B CG2 1  
ATOM 7567   N N   . GLN B 2 521 ? 99.948  8.604   36.013  1.00 0.00 ? 521 GLN B N   1  
ATOM 7568   C CA  . GLN B 2 521 ? 99.491  8.387   37.366  1.00 0.00 ? 521 GLN B CA  1  
ATOM 7569   C C   . GLN B 2 521 ? 100.277 9.233   38.362  1.00 0.00 ? 521 GLN B C   1  
ATOM 7570   O O   . GLN B 2 521 ? 99.669  9.944   39.148  1.00 0.00 ? 521 GLN B O   1  
ATOM 7571   C CB  . GLN B 2 521 ? 99.537  6.919   37.910  1.00 0.00 ? 521 GLN B CB  1  
ATOM 7572   C CG  . GLN B 2 521 ? 98.722  5.954   37.041  1.00 0.00 ? 521 GLN B CG  1  
ATOM 7573   C CD  . GLN B 2 521 ? 98.843  4.521   37.511  1.00 0.00 ? 521 GLN B CD  1  
ATOM 7574   O OE1 . GLN B 2 521 ? 99.708  4.216   38.392  1.00 0.00 ? 521 GLN B OE1 1  
ATOM 7575   N NE2 . GLN B 2 521 ? 97.915  3.682   37.031  1.00 0.00 ? 521 GLN B NE2 1  
ATOM 7576   N N   . LEU B 2 522 ? 101.591 9.316   38.263  1.00 0.00 ? 522 LEU B N   1  
ATOM 7577   C CA  . LEU B 2 522 ? 102.350 10.127  39.182  1.00 0.00 ? 522 LEU B CA  1  
ATOM 7578   C C   . LEU B 2 522 ? 102.108 11.605  39.144  1.00 0.00 ? 522 LEU B C   1  
ATOM 7579   O O   . LEU B 2 522 ? 102.021 12.287  40.156  1.00 0.00 ? 522 LEU B O   1  
ATOM 7580   C CB  . LEU B 2 522 ? 103.865 9.926   38.814  1.00 0.00 ? 522 LEU B CB  1  
ATOM 7581   C CG  . LEU B 2 522 ? 104.921 10.201  39.887  1.00 0.00 ? 522 LEU B CG  1  
ATOM 7582   C CD1 . LEU B 2 522 ? 104.738 9.372   41.157  1.00 0.00 ? 522 LEU B CD1 1  
ATOM 7583   C CD2 . LEU B 2 522 ? 106.284 9.878   39.204  1.00 0.00 ? 522 LEU B CD2 1  
ATOM 7584   N N   . SER B 2 523 ? 101.911 12.171  37.896  1.00 0.00 ? 523 SER B N   1  
ATOM 7585   C CA  . SER B 2 523 ? 101.582 13.571  37.639  1.00 0.00 ? 523 SER B CA  1  
ATOM 7586   C C   . SER B 2 523 ? 100.163 13.992  37.991  1.00 0.00 ? 523 SER B C   1  
ATOM 7587   O O   . SER B 2 523 ? 99.889  15.147  37.975  1.00 0.00 ? 523 SER B O   1  
ATOM 7588   C CB  . SER B 2 523 ? 101.769 13.929  36.206  1.00 0.00 ? 523 SER B CB  1  
ATOM 7589   O OG  . SER B 2 523 ? 102.973 13.438  35.729  1.00 0.00 ? 523 SER B OG  1  
ATOM 7590   N N   . SER B 2 524 ? 99.227  12.992  38.350  1.00 0.00 ? 524 SER B N   1  
ATOM 7591   C CA  . SER B 2 524 ? 97.879  13.149  38.809  1.00 0.00 ? 524 SER B CA  1  
ATOM 7592   C C   . SER B 2 524 ? 96.966  13.499  37.673  1.00 0.00 ? 524 SER B C   1  
ATOM 7593   O O   . SER B 2 524 ? 96.436  14.564  37.567  1.00 0.00 ? 524 SER B O   1  
ATOM 7594   C CB  . SER B 2 524 ? 97.725  13.952  40.150  1.00 0.00 ? 524 SER B CB  1  
ATOM 7595   O OG  . SER B 2 524 ? 98.519  13.402  41.155  1.00 0.00 ? 524 SER B OG  1  
ATOM 7596   N N   . LEU B 2 525 ? 96.843  12.471  36.783  1.00 0.00 ? 525 LEU B N   1  
ATOM 7597   C CA  . LEU B 2 525 ? 96.038  12.609  35.566  1.00 0.00 ? 525 LEU B CA  1  
ATOM 7598   C C   . LEU B 2 525 ? 95.455  11.210  35.253  1.00 0.00 ? 525 LEU B C   1  
ATOM 7599   O O   . LEU B 2 525 ? 94.885  10.965  34.198  1.00 0.00 ? 525 LEU B O   1  
ATOM 7600   C CB  . LEU B 2 525 ? 96.828  13.164  34.380  1.00 0.00 ? 525 LEU B CB  1  
ATOM 7601   C CG  . LEU B 2 525 ? 96.116  13.939  33.295  1.00 0.00 ? 525 LEU B CG  1  
ATOM 7602   C CD1 . LEU B 2 525 ? 95.449  13.024  32.176  1.00 0.00 ? 525 LEU B CD1 1  
ATOM 7603   C CD2 . LEU B 2 525 ? 95.018  14.905  33.850  1.00 0.00 ? 525 LEU B CD2 1  
ATOM 7604   N N   . ARG B 2 526 ? 95.566  10.312  36.273  1.00 0.00 ? 526 ARG B N   1  
ATOM 7605   C CA  . ARG B 2 526 ? 94.972  8.961   36.166  1.00 0.00 ? 526 ARG B CA  1  
ATOM 7606   C C   . ARG B 2 526 ? 95.061  8.376   37.587  1.00 0.00 ? 526 ARG B C   1  
ATOM 7607   O O   . ARG B 2 526 ? 95.136  7.155   37.732  1.00 0.00 ? 526 ARG B O   1  
ATOM 7608   C CB  . ARG B 2 526 ? 95.820  8.031   35.249  1.00 0.00 ? 526 ARG B CB  1  
ATOM 7609   C CG  . ARG B 2 526 ? 95.081  6.731   34.857  1.00 0.00 ? 526 ARG B CG  1  
ATOM 7610   C CD  . ARG B 2 526 ? 96.009  5.651   34.277  1.00 0.00 ? 526 ARG B CD  1  
ATOM 7611   N NE  . ARG B 2 526 ? 96.813  6.153   33.126  1.00 0.00 ? 526 ARG B NE  1  
ATOM 7612   C CZ  . ARG B 2 526 ? 97.817  5.394   32.675  1.00 0.00 ? 526 ARG B CZ  1  
ATOM 7613   N NH1 . ARG B 2 526 ? 98.317  4.285   33.284  1.00 0.00 ? 526 ARG B NH1 1  
ATOM 7614   N NH2 . ARG B 2 526 ? 98.291  5.686   31.394  1.00 0.00 ? 526 ARG B NH2 1  
ATOM 7615   N N   . HIS B 2 527 ? 95.171  9.279   38.594  1.00 0.00 ? 527 HIS B N   1  
ATOM 7616   C CA  . HIS B 2 527 ? 95.422  8.884   39.937  1.00 0.00 ? 527 HIS B CA  1  
ATOM 7617   C C   . HIS B 2 527 ? 94.173  8.448   40.587  1.00 0.00 ? 527 HIS B C   1  
ATOM 7618   O O   . HIS B 2 527 ? 94.054  7.371   41.217  1.00 0.00 ? 527 HIS B O   1  
ATOM 7619   C CB  . HIS B 2 527 ? 96.024  10.061  40.787  1.00 0.00 ? 527 HIS B CB  1  
ATOM 7620   C CG  . HIS B 2 527 ? 96.780  9.667   41.993  1.00 0.00 ? 527 HIS B CG  1  
ATOM 7621   N ND1 . HIS B 2 527 ? 97.145  10.479  43.052  1.00 0.00 ? 527 HIS B ND1 1  
ATOM 7622   C CD2 . HIS B 2 527 ? 97.428  8.492   42.213  1.00 0.00 ? 527 HIS B CD2 1  
ATOM 7623   C CE1 . HIS B 2 527 ? 97.994  9.710   43.847  1.00 0.00 ? 527 HIS B CE1 1  
ATOM 7624   N NE2 . HIS B 2 527 ? 98.146  8.493   43.368  1.00 0.00 ? 527 HIS B NE2 1  
ATOM 7625   N N   . LEU B 2 528 ? 93.081  9.182   40.357  1.00 0.00 ? 528 LEU B N   1  
ATOM 7626   C CA  . LEU B 2 528 ? 91.730  8.808   40.797  1.00 0.00 ? 528 LEU B CA  1  
ATOM 7627   C C   . LEU B 2 528 ? 90.827  8.832   39.608  1.00 0.00 ? 528 LEU B C   1  
ATOM 7628   O O   . LEU B 2 528 ? 91.309  8.826   38.510  1.00 0.00 ? 528 LEU B O   1  
ATOM 7629   C CB  . LEU B 2 528 ? 91.052  9.687   41.839  1.00 0.00 ? 528 LEU B CB  1  
ATOM 7630   C CG  . LEU B 2 528 ? 91.991  9.856   43.061  1.00 0.00 ? 528 LEU B CG  1  
ATOM 7631   C CD1 . LEU B 2 528 ? 91.421  10.964  44.007  1.00 0.00 ? 528 LEU B CD1 1  
ATOM 7632   C CD2 . LEU B 2 528 ? 92.261  8.605   43.892  1.00 0.00 ? 528 LEU B CD2 1  
ATOM 7633   N N   . MET B 2 529 ? 89.470  8.832   39.851  1.00 0.00 ? 529 MET B N   1  
ATOM 7634   C CA  . MET B 2 529 ? 88.448  8.824   38.814  1.00 0.00 ? 529 MET B CA  1  
ATOM 7635   C C   . MET B 2 529 ? 87.880  10.126  38.523  1.00 0.00 ? 529 MET B C   1  
ATOM 7636   O O   . MET B 2 529 ? 86.991  10.216  37.656  1.00 0.00 ? 529 MET B O   1  
ATOM 7637   C CB  . MET B 2 529 ? 87.232  7.882   39.079  1.00 0.00 ? 529 MET B CB  1  
ATOM 7638   C CG  . MET B 2 529 ? 87.657  6.389   39.403  1.00 0.00 ? 529 MET B CG  1  
ATOM 7639   S SD  . MET B 2 529 ? 88.028  5.424   37.994  1.00 0.00 ? 529 MET B SD  1  
ATOM 7640   C CE  . MET B 2 529 ? 87.859  3.791   38.680  1.00 0.00 ? 529 MET B CE  1  
ATOM 7641   N N   . ASN B 2 530 ? 88.381  11.169  39.114  1.00 0.00 ? 530 ASN B N   1  
ATOM 7642   C CA  . ASN B 2 530 ? 87.949  12.501  38.831  1.00 0.00 ? 530 ASN B CA  1  
ATOM 7643   C C   . ASN B 2 530 ? 88.644  12.857  37.553  1.00 0.00 ? 530 ASN B C   1  
ATOM 7644   O O   . ASN B 2 530 ? 88.018  13.481  36.686  1.00 0.00 ? 530 ASN B O   1  
ATOM 7645   C CB  . ASN B 2 530 ? 88.434  13.515  39.929  1.00 0.00 ? 530 ASN B CB  1  
ATOM 7646   C CG  . ASN B 2 530 ? 87.570  13.469  41.258  1.00 0.00 ? 530 ASN B CG  1  
ATOM 7647   O OD1 . ASN B 2 530 ? 88.007  12.775  42.202  1.00 0.00 ? 530 ASN B OD1 1  
ATOM 7648   N ND2 . ASN B 2 530 ? 86.360  14.072  41.306  1.00 0.00 ? 530 ASN B ND2 1  
ATOM 7649   N N   . SER B 2 531 ? 89.948  12.363  37.412  1.00 0.00 ? 531 SER B N   1  
ATOM 7650   C CA  . SER B 2 531 ? 90.788  12.459  36.304  1.00 0.00 ? 531 SER B CA  1  
ATOM 7651   C C   . SER B 2 531 ? 90.504  11.448  35.294  1.00 0.00 ? 531 SER B C   1  
ATOM 7652   O O   . SER B 2 531 ? 89.842  10.511  35.804  1.00 0.00 ? 531 SER B O   1  
ATOM 7653   C CB  . SER B 2 531 ? 92.249  12.169  36.691  1.00 0.00 ? 531 SER B CB  1  
ATOM 7654   O OG  . SER B 2 531 ? 92.658  12.865  37.823  1.00 0.00 ? 531 SER B OG  1  
ATOM 7655   N N   . PRO B 2 532 ? 90.996  11.442  34.050  1.00 0.00 ? 532 PRO B N   1  
ATOM 7656   C CA  . PRO B 2 532 ? 90.775  10.366  33.080  1.00 0.00 ? 532 PRO B CA  1  
ATOM 7657   C C   . PRO B 2 532 ? 91.345  9.047   33.623  1.00 0.00 ? 532 PRO B C   1  
ATOM 7658   O O   . PRO B 2 532 ? 92.527  8.989   33.940  1.00 0.00 ? 532 PRO B O   1  
ATOM 7659   C CB  . PRO B 2 532 ? 91.354  10.850  31.783  1.00 0.00 ? 532 PRO B CB  1  
ATOM 7660   C CG  . PRO B 2 532 ? 91.324  12.390  31.819  1.00 0.00 ? 532 PRO B CG  1  
ATOM 7661   C CD  . PRO B 2 532 ? 91.493  12.601  33.357  1.00 0.00 ? 532 PRO B CD  1  
ATOM 7662   N N   . ARG B 2 533 ? 90.474  8.053   33.800  1.00 0.00 ? 533 ARG B N   1  
ATOM 7663   C CA  . ARG B 2 533 ? 90.723  6.708   34.171  1.00 0.00 ? 533 ARG B CA  1  
ATOM 7664   C C   . ARG B 2 533 ? 89.544  5.897   33.772  1.00 0.00 ? 533 ARG B C   1  
ATOM 7665   O O   . ARG B 2 533 ? 89.581  4.671   33.675  1.00 0.00 ? 533 ARG B O   1  
ATOM 7666   C CB  . ARG B 2 533 ? 90.997  6.531   35.729  1.00 0.00 ? 533 ARG B CB  1  
ATOM 7667   C CG  . ARG B 2 533 ? 91.617  5.114   36.025  1.00 0.00 ? 533 ARG B CG  1  
ATOM 7668   C CD  . ARG B 2 533 ? 92.087  5.056   37.509  1.00 0.00 ? 533 ARG B CD  1  
ATOM 7669   N NE  . ARG B 2 533 ? 92.810  3.788   37.665  1.00 0.00 ? 533 ARG B NE  1  
ATOM 7670   C CZ  . ARG B 2 533 ? 93.622  3.516   38.741  1.00 0.00 ? 533 ARG B CZ  1  
ATOM 7671   N NH1 . ARG B 2 533 ? 93.889  4.587   39.622  1.00 0.00 ? 533 ARG B NH1 1  
ATOM 7672   N NH2 . ARG B 2 533 ? 94.282  2.294   38.833  1.00 0.00 ? 533 ARG B NH2 1  
ATOM 7673   N N   . ASN B 2 534 ? 88.405  6.642   33.528  1.00 0.00 ? 534 ASN B N   1  
ATOM 7674   C CA  . ASN B 2 534 ? 87.127  6.065   33.109  1.00 0.00 ? 534 ASN B CA  1  
ATOM 7675   C C   . ASN B 2 534 ? 87.119  5.826   31.551  1.00 0.00 ? 534 ASN B C   1  
ATOM 7676   O O   . ASN B 2 534 ? 86.192  5.350   30.934  1.00 0.00 ? 534 ASN B O   1  
ATOM 7677   C CB  . ASN B 2 534 ? 85.929  6.988   33.391  1.00 0.00 ? 534 ASN B CB  1  
ATOM 7678   C CG  . ASN B 2 534 ? 85.959  7.310   34.923  1.00 0.00 ? 534 ASN B CG  1  
ATOM 7679   O OD1 . ASN B 2 534 ? 86.178  6.401   35.773  1.00 0.00 ? 534 ASN B OD1 1  
ATOM 7680   N ND2 . ASN B 2 534 ? 85.720  8.612   35.268  1.00 0.00 ? 534 ASN B ND2 1  
ATOM 7681   N N   . SER B 2 535 ? 88.214  6.338   30.918  1.00 0.00 ? 535 SER B N   1  
ATOM 7682   C CA  . SER B 2 535 ? 88.331  6.378   29.510  1.00 0.00 ? 535 SER B CA  1  
ATOM 7683   C C   . SER B 2 535 ? 89.620  5.612   29.283  1.00 0.00 ? 535 SER B C   1  
ATOM 7684   O O   . SER B 2 535 ? 90.436  5.482   30.199  1.00 0.00 ? 535 SER B O   1  
ATOM 7685   C CB  . SER B 2 535 ? 88.455  7.814   28.953  1.00 0.00 ? 535 SER B CB  1  
ATOM 7686   O OG  . SER B 2 535 ? 87.471  8.789   29.365  1.00 0.00 ? 535 SER B OG  1  
ATOM 7687   N N   . SER B 2 536 ? 89.849  5.006   28.066  1.00 0.00 ? 536 SER B N   1  
ATOM 7688   C CA  . SER B 2 536 ? 91.069  4.346   27.745  1.00 0.00 ? 536 SER B CA  1  
ATOM 7689   C C   . SER B 2 536 ? 91.900  5.080   26.795  1.00 0.00 ? 536 SER B C   1  
ATOM 7690   O O   . SER B 2 536 ? 92.911  4.538   26.376  1.00 0.00 ? 536 SER B O   1  
ATOM 7691   C CB  . SER B 2 536 ? 90.644  2.939   27.059  1.00 0.00 ? 536 SER B CB  1  
ATOM 7692   O OG  . SER B 2 536 ? 90.023  2.158   28.078  1.00 0.00 ? 536 SER B OG  1  
ATOM 7693   N N   . VAL B 2 537 ? 91.462  6.359   26.498  1.00 0.00 ? 537 VAL B N   1  
ATOM 7694   C CA  . VAL B 2 537 ? 92.255  7.210   25.678  1.00 0.00 ? 537 VAL B CA  1  
ATOM 7695   C C   . VAL B 2 537 ? 93.705  7.453   26.064  1.00 0.00 ? 537 VAL B C   1  
ATOM 7696   O O   . VAL B 2 537 ? 94.581  7.557   25.196  1.00 0.00 ? 537 VAL B O   1  
ATOM 7697   C CB  . VAL B 2 537 ? 91.539  8.587   25.547  1.00 0.00 ? 537 VAL B CB  1  
ATOM 7698   C CG1 . VAL B 2 537 ? 92.441  9.656   24.873  1.00 0.00 ? 537 VAL B CG1 1  
ATOM 7699   C CG2 . VAL B 2 537 ? 90.234  8.371   24.776  1.00 0.00 ? 537 VAL B CG2 1  
ATOM 7700   N N   . ILE B 2 538 ? 93.994  7.515   27.371  1.00 0.00 ? 538 ILE B N   1  
ATOM 7701   C CA  . ILE B 2 538 ? 95.240  7.838   28.027  1.00 0.00 ? 538 ILE B CA  1  
ATOM 7702   C C   . ILE B 2 538 ? 95.977  6.622   28.490  1.00 0.00 ? 538 ILE B C   1  
ATOM 7703   O O   . ILE B 2 538 ? 97.101  6.786   28.964  1.00 0.00 ? 538 ILE B O   1  
ATOM 7704   C CB  . ILE B 2 538 ? 95.011  8.791   29.282  1.00 0.00 ? 538 ILE B CB  1  
ATOM 7705   C CG1 . ILE B 2 538 ? 94.496  8.164   30.564  1.00 0.00 ? 538 ILE B CG1 1  
ATOM 7706   C CG2 . ILE B 2 538 ? 94.181  9.965   28.880  1.00 0.00 ? 538 ILE B CG2 1  
ATOM 7707   C CD1 . ILE B 2 538 ? 94.307  9.162   31.719  1.00 0.00 ? 538 ILE B CD1 1  
ATOM 7708   N N   . ASN B 2 539 ? 95.476  5.395   28.201  1.00 0.00 ? 539 ASN B N   1  
ATOM 7709   C CA  . ASN B 2 539 ? 96.195  4.137   28.377  1.00 0.00 ? 539 ASN B CA  1  
ATOM 7710   C C   . ASN B 2 539 ? 96.316  3.625   26.904  1.00 0.00 ? 539 ASN B C   1  
ATOM 7711   O O   . ASN B 2 539 ? 96.981  2.656   26.552  1.00 0.00 ? 539 ASN B O   1  
ATOM 7712   C CB  . ASN B 2 539 ? 95.338  3.102   29.122  1.00 0.00 ? 539 ASN B CB  1  
ATOM 7713   C CG  . ASN B 2 539 ? 95.055  3.632   30.547  1.00 0.00 ? 539 ASN B CG  1  
ATOM 7714   O OD1 . ASN B 2 539 ? 95.700  3.187   31.507  1.00 0.00 ? 539 ASN B OD1 1  
ATOM 7715   N ND2 . ASN B 2 539 ? 93.976  4.477   30.720  1.00 0.00 ? 539 ASN B ND2 1  
ATOM 7716   N N   . GLY B 2 540 ? 95.668  4.352   26.034  1.00 0.00 ? 540 GLY B N   1  
ATOM 7717   C CA  . GLY B 2 540 ? 95.586  4.219   24.610  1.00 0.00 ? 540 GLY B CA  1  
ATOM 7718   C C   . GLY B 2 540 ? 96.840  4.697   23.975  1.00 0.00 ? 540 GLY B C   1  
ATOM 7719   O O   . GLY B 2 540 ? 96.962  4.549   22.789  1.00 0.00 ? 540 GLY B O   1  
ATOM 7720   N N   . LEU B 2 541 ? 97.718  5.305   24.704  1.00 0.00 ? 541 LEU B N   1  
ATOM 7721   C CA  . LEU B 2 541 ? 99.022  5.844   24.210  1.00 0.00 ? 541 LEU B CA  1  
ATOM 7722   C C   . LEU B 2 541 ? 100.159 4.846   24.569  1.00 0.00 ? 541 LEU B C   1  
ATOM 7723   O O   . LEU B 2 541 ? 100.092 4.247   25.643  1.00 0.00 ? 541 LEU B O   1  
ATOM 7724   C CB  . LEU B 2 541 ? 99.504  7.299   24.638  1.00 0.00 ? 541 LEU B CB  1  
ATOM 7725   C CG  . LEU B 2 541 ? 98.812  8.549   23.976  1.00 0.00 ? 541 LEU B CG  1  
ATOM 7726   C CD1 . LEU B 2 541 ? 97.622  9.051   24.822  1.00 0.00 ? 541 LEU B CD1 1  
ATOM 7727   C CD2 . LEU B 2 541 ? 99.893  9.585   23.671  1.00 0.00 ? 541 LEU B CD2 1  
ATOM 7728   N N   . ASP B 2 542 ? 101.046 4.620   23.592  1.00 0.00 ? 542 ASP B N   1  
ATOM 7729   C CA  . ASP B 2 542 ? 102.118 3.610   23.618  1.00 0.00 ? 542 ASP B CA  1  
ATOM 7730   C C   . ASP B 2 542 ? 103.294 4.439   23.110  1.00 0.00 ? 542 ASP B C   1  
ATOM 7731   O O   . ASP B 2 542 ? 103.167 5.308   22.235  1.00 0.00 ? 542 ASP B O   1  
ATOM 7732   C CB  . ASP B 2 542 ? 101.879 2.390   22.772  1.00 0.00 ? 542 ASP B CB  1  
ATOM 7733   C CG  . ASP B 2 542 ? 100.708 1.523   23.230  1.00 0.00 ? 542 ASP B CG  1  
ATOM 7734   O OD1 . ASP B 2 542 ? 100.840 0.918   24.348  1.00 0.00 ? 542 ASP B OD1 1  
ATOM 7735   O OD2 . ASP B 2 542 ? 99.601  1.574   22.586  1.00 0.00 ? 542 ASP B OD2 1  
ATOM 7736   N N   . ALA B 2 543 ? 104.528 4.110   23.609  1.00 0.00 ? 543 ALA B N   1  
ATOM 7737   C CA  . ALA B 2 543 ? 105.742 4.746   23.176  1.00 0.00 ? 543 ALA B CA  1  
ATOM 7738   C C   . ALA B 2 543 ? 106.291 3.847   22.084  1.00 0.00 ? 543 ALA B C   1  
ATOM 7739   O O   . ALA B 2 543 ? 106.290 2.640   22.174  1.00 0.00 ? 543 ALA B O   1  
ATOM 7740   C CB  . ALA B 2 543 ? 106.865 4.800   24.178  1.00 0.00 ? 543 ALA B CB  1  
ATOM 7741   N N   . ARG B 2 544 ? 106.836 4.483   21.027  1.00 0.00 ? 544 ARG B N   1  
ATOM 7742   C CA  . ARG B 2 544 ? 107.425 3.873   19.909  1.00 0.00 ? 544 ARG B CA  1  
ATOM 7743   C C   . ARG B 2 544 ? 108.886 4.262   19.923  1.00 0.00 ? 544 ARG B C   1  
ATOM 7744   O O   . ARG B 2 544 ? 109.281 5.366   20.316  1.00 0.00 ? 544 ARG B O   1  
ATOM 7745   C CB  . ARG B 2 544 ? 106.791 4.251   18.531  1.00 0.00 ? 544 ARG B CB  1  
ATOM 7746   C CG  . ARG B 2 544 ? 105.298 3.774   18.316  1.00 0.00 ? 544 ARG B CG  1  
ATOM 7747   C CD  . ARG B 2 544 ? 105.054 2.243   18.279  1.00 0.00 ? 544 ARG B CD  1  
ATOM 7748   N NE  . ARG B 2 544 ? 105.822 1.708   17.145  1.00 0.00 ? 544 ARG B NE  1  
ATOM 7749   C CZ  . ARG B 2 544 ? 106.921 0.926   17.129  1.00 0.00 ? 544 ARG B CZ  1  
ATOM 7750   N NH1 . ARG B 2 544 ? 107.279 0.367   18.273  1.00 0.00 ? 544 ARG B NH1 1  
ATOM 7751   N NH2 . ARG B 2 544 ? 107.636 0.592   16.000  1.00 0.00 ? 544 ARG B NH2 1  
ATOM 7752   N N   . VAL B 2 545 ? 109.679 3.334   19.399  1.00 0.00 ? 545 VAL B N   1  
ATOM 7753   C CA  . VAL B 2 545 ? 111.062 3.657   19.254  1.00 0.00 ? 545 VAL B CA  1  
ATOM 7754   C C   . VAL B 2 545 ? 111.195 3.379   17.748  1.00 0.00 ? 545 VAL B C   1  
ATOM 7755   O O   . VAL B 2 545 ? 110.714 2.379   17.254  1.00 0.00 ? 545 VAL B O   1  
ATOM 7756   C CB  . VAL B 2 545 ? 112.131 2.803   20.028  1.00 0.00 ? 545 VAL B CB  1  
ATOM 7757   C CG1 . VAL B 2 545 ? 111.891 3.189   21.484  1.00 0.00 ? 545 VAL B CG1 1  
ATOM 7758   C CG2 . VAL B 2 545 ? 111.880 1.298   19.976  1.00 0.00 ? 545 VAL B CG2 1  
ATOM 7759   N N   . LEU B 2 546 ? 111.805 4.277   16.951  1.00 0.00 ? 546 LEU B N   1  
ATOM 7760   C CA  . LEU B 2 546 ? 111.894 4.104   15.518  1.00 0.00 ? 546 LEU B CA  1  
ATOM 7761   C C   . LEU B 2 546 ? 113.413 4.167   15.270  1.00 0.00 ? 546 LEU B C   1  
ATOM 7762   O O   . LEU B 2 546 ? 114.176 3.222   15.556  1.00 0.00 ? 546 LEU B O   1  
ATOM 7763   C CB  . LEU B 2 546 ? 111.149 5.299   14.720  1.00 0.00 ? 546 LEU B CB  1  
ATOM 7764   C CG  . LEU B 2 546 ? 109.701 5.466   15.275  1.00 0.00 ? 546 LEU B CG  1  
ATOM 7765   C CD1 . LEU B 2 546 ? 109.117 6.831   14.815  1.00 0.00 ? 546 LEU B CD1 1  
ATOM 7766   C CD2 . LEU B 2 546 ? 108.837 4.198   14.976  1.00 0.00 ? 546 LEU B CD2 1  
ATOM 7767   N N   . ASP B 2 547 ? 113.957 5.254   14.644  1.00 0.00 ? 547 ASP B N   1  
ATOM 7768   C CA  . ASP B 2 547 ? 115.388 5.281   14.288  1.00 0.00 ? 547 ASP B CA  1  
ATOM 7769   C C   . ASP B 2 547 ? 115.666 6.647   13.775  1.00 0.00 ? 547 ASP B C   1  
ATOM 7770   O O   . ASP B 2 547 ? 116.463 6.919   12.887  1.00 0.00 ? 547 ASP B O   1  
ATOM 7771   C CB  . ASP B 2 547 ? 115.880 4.221   13.183  1.00 0.00 ? 547 ASP B CB  1  
ATOM 7772   C CG  . ASP B 2 547 ? 114.905 4.183   11.951  1.00 0.00 ? 547 ASP B CG  1  
ATOM 7773   O OD1 . ASP B 2 547 ? 114.973 5.029   11.048  1.00 0.00 ? 547 ASP B OD1 1  
ATOM 7774   O OD2 . ASP B 2 547 ? 114.108 3.194   11.919  1.00 0.00 ? 547 ASP B OD2 1  
ATOM 7775   N N   . LEU B 2 548 ? 114.907 7.657   14.412  1.00 0.00 ? 548 LEU B N   1  
ATOM 7776   C CA  . LEU B 2 548 ? 115.140 9.041   14.172  1.00 0.00 ? 548 LEU B CA  1  
ATOM 7777   C C   . LEU B 2 548 ? 116.442 9.459   14.788  1.00 0.00 ? 548 LEU B C   1  
ATOM 7778   O O   . LEU B 2 548 ? 116.872 8.834   15.729  1.00 0.00 ? 548 LEU B O   1  
ATOM 7779   C CB  . LEU B 2 548 ? 114.062 9.953   14.840  1.00 0.00 ? 548 LEU B CB  1  
ATOM 7780   C CG  . LEU B 2 548 ? 112.858 10.071  13.885  1.00 0.00 ? 548 LEU B CG  1  
ATOM 7781   C CD1 . LEU B 2 548 ? 111.613 10.414  14.781  1.00 0.00 ? 548 LEU B CD1 1  
ATOM 7782   C CD2 . LEU B 2 548 ? 112.997 11.025  12.737  1.00 0.00 ? 548 LEU B CD2 1  
ATOM 7783   N N   . GLY B 2 549 ? 117.070 10.456  14.099  1.00 0.00 ? 549 GLY B N   1  
ATOM 7784   C CA  . GLY B 2 549 ? 118.354 10.919  14.325  1.00 0.00 ? 549 GLY B CA  1  
ATOM 7785   C C   . GLY B 2 549 ? 119.367 9.765   14.574  1.00 0.00 ? 549 GLY B C   1  
ATOM 7786   O O   . GLY B 2 549 ? 119.590 8.889   13.772  1.00 0.00 ? 549 GLY B O   1  
ATOM 7787   N N   . HIS B 2 550 ? 120.129 9.909   15.715  1.00 0.00 ? 550 HIS B N   1  
ATOM 7788   C CA  . HIS B 2 550 ? 121.205 9.007   16.049  1.00 0.00 ? 550 HIS B CA  1  
ATOM 7789   C C   . HIS B 2 550 ? 120.692 7.730   16.762  1.00 0.00 ? 550 HIS B C   1  
ATOM 7790   O O   . HIS B 2 550 ? 119.932 7.724   17.671  1.00 0.00 ? 550 HIS B O   1  
ATOM 7791   C CB  . HIS B 2 550 ? 122.177 9.689   16.943  1.00 0.00 ? 550 HIS B CB  1  
ATOM 7792   C CG  . HIS B 2 550 ? 122.755 11.098  16.506  1.00 0.00 ? 550 HIS B CG  1  
ATOM 7793   N ND1 . HIS B 2 550 ? 124.087 11.464  16.488  1.00 0.00 ? 550 HIS B ND1 1  
ATOM 7794   C CD2 . HIS B 2 550 ? 122.110 12.241  16.304  1.00 0.00 ? 550 HIS B CD2 1  
ATOM 7795   C CE1 . HIS B 2 550 ? 124.179 12.800  16.195  1.00 0.00 ? 550 HIS B CE1 1  
ATOM 7796   N NE2 . HIS B 2 550 ? 122.979 13.334  16.095  1.00 0.00 ? 550 HIS B NE2 1  
ATOM 7797   N N   . GLY B 2 551 ? 121.178 6.503   16.301  1.00 0.00 ? 551 GLY B N   1  
ATOM 7798   C CA  . GLY B 2 551 ? 120.904 5.233   16.858  1.00 0.00 ? 551 GLY B CA  1  
ATOM 7799   C C   . GLY B 2 551 ? 121.984 4.921   17.831  1.00 0.00 ? 551 GLY B C   1  
ATOM 7800   O O   . GLY B 2 551 ? 122.007 3.890   18.442  1.00 0.00 ? 551 GLY B O   1  
ATOM 7801   N N   . SER B 2 552 ? 122.875 5.912   18.017  1.00 0.00 ? 552 SER B N   1  
ATOM 7802   C CA  . SER B 2 552 ? 123.957 5.823   18.975  1.00 0.00 ? 552 SER B CA  1  
ATOM 7803   C C   . SER B 2 552 ? 123.442 6.166   20.352  1.00 0.00 ? 552 SER B C   1  
ATOM 7804   O O   . SER B 2 552 ? 124.138 5.854   21.326  1.00 0.00 ? 552 SER B O   1  
ATOM 7805   C CB  . SER B 2 552 ? 125.177 6.708   18.679  1.00 0.00 ? 552 SER B CB  1  
ATOM 7806   O OG  . SER B 2 552 ? 125.588 6.329   17.369  1.00 0.00 ? 552 SER B OG  1  
ATOM 7807   N N   . VAL B 2 553 ? 122.217 6.759   20.503  1.00 0.00 ? 553 VAL B N   1  
ATOM 7808   C CA  . VAL B 2 553 ? 121.591 6.989   21.722  1.00 0.00 ? 553 VAL B CA  1  
ATOM 7809   C C   . VAL B 2 553 ? 120.171 6.769   21.447  1.00 0.00 ? 553 VAL B C   1  
ATOM 7810   O O   . VAL B 2 553 ? 119.733 6.768   20.297  1.00 0.00 ? 553 VAL B O   1  
ATOM 7811   C CB  . VAL B 2 553 ? 121.672 8.364   22.271  1.00 0.00 ? 553 VAL B CB  1  
ATOM 7812   C CG1 . VAL B 2 553 ? 123.153 8.677   22.685  1.00 0.00 ? 553 VAL B CG1 1  
ATOM 7813   C CG2 . VAL B 2 553 ? 121.277 9.462   21.285  1.00 0.00 ? 553 VAL B CG2 1  
ATOM 7814   N N   . GLY B 2 554 ? 119.469 6.516   22.590  1.00 0.00 ? 554 GLY B N   1  
ATOM 7815   C CA  . GLY B 2 554 ? 118.066 6.133   22.656  1.00 0.00 ? 554 GLY B CA  1  
ATOM 7816   C C   . GLY B 2 554 ? 117.322 7.431   22.716  1.00 0.00 ? 554 GLY B C   1  
ATOM 7817   O O   . GLY B 2 554 ? 116.107 7.483   22.412  1.00 0.00 ? 554 GLY B O   1  
ATOM 7818   N N   . TRP B 2 555 ? 118.052 8.509   23.063  1.00 0.00 ? 555 TRP B N   1  
ATOM 7819   C CA  . TRP B 2 555 ? 117.303 9.719   23.211  1.00 0.00 ? 555 TRP B CA  1  
ATOM 7820   C C   . TRP B 2 555 ? 116.558 10.278  22.005  1.00 0.00 ? 555 TRP B C   1  
ATOM 7821   O O   . TRP B 2 555 ? 115.396 10.604  22.090  1.00 0.00 ? 555 TRP B O   1  
ATOM 7822   C CB  . TRP B 2 555 ? 118.274 10.817  23.706  1.00 0.00 ? 555 TRP B CB  1  
ATOM 7823   C CG  . TRP B 2 555 ? 118.726 10.755  25.137  1.00 0.00 ? 555 TRP B CG  1  
ATOM 7824   C CD1 . TRP B 2 555 ? 119.850 10.244  25.614  1.00 0.00 ? 555 TRP B CD1 1  
ATOM 7825   C CD2 . TRP B 2 555 ? 117.962 11.120  26.318  1.00 0.00 ? 555 TRP B CD2 1  
ATOM 7826   N NE1 . TRP B 2 555 ? 119.920 10.298  26.976  1.00 0.00 ? 555 TRP B NE1 1  
ATOM 7827   C CE2 . TRP B 2 555 ? 118.755 10.818  27.449  1.00 0.00 ? 555 TRP B CE2 1  
ATOM 7828   C CE3 . TRP B 2 555 ? 116.755 11.740  26.476  1.00 0.00 ? 555 TRP B CE3 1  
ATOM 7829   C CZ2 . TRP B 2 555 ? 118.218 11.002  28.727  1.00 0.00 ? 555 TRP B CZ2 1  
ATOM 7830   C CZ3 . TRP B 2 555 ? 116.235 11.874  27.702  1.00 0.00 ? 555 TRP B CZ3 1  
ATOM 7831   C CH2 . TRP B 2 555 ? 116.928 11.556  28.858  1.00 0.00 ? 555 TRP B CH2 1  
ATOM 7832   N N   . ASP B 2 556 ? 117.209 10.295  20.878  1.00 0.00 ? 556 ASP B N   1  
ATOM 7833   C CA  . ASP B 2 556 ? 116.551 10.745  19.663  1.00 0.00 ? 556 ASP B CA  1  
ATOM 7834   C C   . ASP B 2 556 ? 115.430 9.902   19.198  1.00 0.00 ? 556 ASP B C   1  
ATOM 7835   O O   . ASP B 2 556 ? 114.498 10.406  18.503  1.00 0.00 ? 556 ASP B O   1  
ATOM 7836   C CB  . ASP B 2 556 ? 117.570 10.901  18.460  1.00 0.00 ? 556 ASP B CB  1  
ATOM 7837   C CG  . ASP B 2 556 ? 118.695 11.942  18.693  1.00 0.00 ? 556 ASP B CG  1  
ATOM 7838   O OD1 . ASP B 2 556 ? 118.307 13.128  18.660  1.00 0.00 ? 556 ASP B OD1 1  
ATOM 7839   O OD2 . ASP B 2 556 ? 119.858 11.552  18.901  1.00 0.00 ? 556 ASP B OD2 1  
ATOM 7840   N N   . VAL B 2 557 ? 115.616 8.562   19.354  1.00 0.00 ? 557 VAL B N   1  
ATOM 7841   C CA  . VAL B 2 557 ? 114.827 7.544   18.738  1.00 0.00 ? 557 VAL B CA  1  
ATOM 7842   C C   . VAL B 2 557 ? 113.380 7.494   19.315  1.00 0.00 ? 557 VAL B C   1  
ATOM 7843   O O   . VAL B 2 557 ? 112.440 7.126   18.634  1.00 0.00 ? 557 VAL B O   1  
ATOM 7844   C CB  . VAL B 2 557 ? 115.526 6.228   18.883  1.00 0.00 ? 557 VAL B CB  1  
ATOM 7845   C CG1 . VAL B 2 557 ? 114.635 5.024   18.446  1.00 0.00 ? 557 VAL B CG1 1  
ATOM 7846   C CG2 . VAL B 2 557 ? 116.906 6.263   18.105  1.00 0.00 ? 557 VAL B CG2 1  
ATOM 7847   N N   . PHE B 2 558 ? 113.201 8.014   20.577  1.00 0.00 ? 558 PHE B N   1  
ATOM 7848   C CA  . PHE B 2 558 ? 111.893 7.965   21.270  1.00 0.00 ? 558 PHE B CA  1  
ATOM 7849   C C   . PHE B 2 558 ? 110.905 8.872   20.542  1.00 0.00 ? 558 PHE B C   1  
ATOM 7850   O O   . PHE B 2 558 ? 111.181 9.990   20.105  1.00 0.00 ? 558 PHE B O   1  
ATOM 7851   C CB  . PHE B 2 558 ? 112.132 8.321   22.780  1.00 0.00 ? 558 PHE B CB  1  
ATOM 7852   C CG  . PHE B 2 558 ? 110.850 8.396   23.659  1.00 0.00 ? 558 PHE B CG  1  
ATOM 7853   C CD1 . PHE B 2 558 ? 110.147 9.652   23.590  1.00 0.00 ? 558 PHE B CD1 1  
ATOM 7854   C CD2 . PHE B 2 558 ? 110.276 7.304   24.302  1.00 0.00 ? 558 PHE B CD2 1  
ATOM 7855   C CE1 . PHE B 2 558 ? 108.960 9.750   24.268  1.00 0.00 ? 558 PHE B CE1 1  
ATOM 7856   C CE2 . PHE B 2 558 ? 109.114 7.466   25.099  1.00 0.00 ? 558 PHE B CE2 1  
ATOM 7857   C CZ  . PHE B 2 558 ? 108.485 8.691   25.072  1.00 0.00 ? 558 PHE B CZ  1  
ATOM 7858   N N   . THR B 2 559 ? 109.628 8.403   20.442  1.00 0.00 ? 559 THR B N   1  
ATOM 7859   C CA  . THR B 2 559 ? 108.503 9.095   19.890  1.00 0.00 ? 559 THR B CA  1  
ATOM 7860   C C   . THR B 2 559 ? 107.359 8.536   20.732  1.00 0.00 ? 559 THR B C   1  
ATOM 7861   O O   . THR B 2 559 ? 107.489 7.480   21.318  1.00 0.00 ? 559 THR B O   1  
ATOM 7862   C CB  . THR B 2 559 ? 108.248 8.780   18.408  1.00 0.00 ? 559 THR B CB  1  
ATOM 7863   O OG1 . THR B 2 559 ? 108.593 7.407   18.137  1.00 0.00 ? 559 THR B OG1 1  
ATOM 7864   C CG2 . THR B 2 559 ? 109.106 9.733   17.522  1.00 0.00 ? 559 THR B CG2 1  
ATOM 7865   N N   . LEU B 2 560 ? 106.126 9.201   20.762  1.00 0.00 ? 560 LEU B N   1  
ATOM 7866   C CA  . LEU B 2 560 ? 104.912 8.694   21.318  1.00 0.00 ? 560 LEU B CA  1  
ATOM 7867   C C   . LEU B 2 560 ? 104.016 8.569   20.170  1.00 0.00 ? 560 LEU B C   1  
ATOM 7868   O O   . LEU B 2 560 ? 104.041 9.341   19.240  1.00 0.00 ? 560 LEU B O   1  
ATOM 7869   C CB  . LEU B 2 560 ? 104.233 9.661   22.292  1.00 0.00 ? 560 LEU B CB  1  
ATOM 7870   C CG  . LEU B 2 560 ? 104.779 9.581   23.739  1.00 0.00 ? 560 LEU B CG  1  
ATOM 7871   C CD1 . LEU B 2 560 ? 104.217 10.690  24.684  1.00 0.00 ? 560 LEU B CD1 1  
ATOM 7872   C CD2 . LEU B 2 560 ? 104.551 8.220   24.443  1.00 0.00 ? 560 LEU B CD2 1  
ATOM 7873   N N   . ASP B 2 561 ? 103.204 7.532   20.254  1.00 0.00 ? 561 ASP B N   1  
ATOM 7874   C CA  . ASP B 2 561 ? 102.204 7.271   19.235  1.00 0.00 ? 561 ASP B CA  1  
ATOM 7875   C C   . ASP B 2 561 ? 100.840 7.112   19.959  1.00 0.00 ? 561 ASP B C   1  
ATOM 7876   O O   . ASP B 2 561 ? 100.735 6.516   21.034  1.00 0.00 ? 561 ASP B O   1  
ATOM 7877   C CB  . ASP B 2 561 ? 102.558 6.016   18.428  1.00 0.00 ? 561 ASP B CB  1  
ATOM 7878   C CG  . ASP B 2 561 ? 101.555 5.754   17.329  1.00 0.00 ? 561 ASP B CG  1  
ATOM 7879   O OD1 . ASP B 2 561 ? 101.617 6.571   16.336  1.00 0.00 ? 561 ASP B OD1 1  
ATOM 7880   O OD2 . ASP B 2 561 ? 100.717 4.791   17.361  1.00 0.00 ? 561 ASP B OD2 1  
ATOM 7881   N N   . TYR B 2 562 ? 99.802  7.683   19.355  1.00 0.00 ? 562 TYR B N   1  
ATOM 7882   C CA  . TYR B 2 562 ? 98.404  7.666   19.872  1.00 0.00 ? 562 TYR B CA  1  
ATOM 7883   C C   . TYR B 2 562 ? 97.608  6.928   18.783  1.00 0.00 ? 562 TYR B C   1  
ATOM 7884   O O   . TYR B 2 562 ? 97.655  7.285   17.605  1.00 0.00 ? 562 TYR B O   1  
ATOM 7885   C CB  . TYR B 2 562 ? 97.740  9.069   20.006  1.00 0.00 ? 562 TYR B CB  1  
ATOM 7886   C CG  . TYR B 2 562 ? 96.303  9.017   20.426  1.00 0.00 ? 562 TYR B CG  1  
ATOM 7887   C CD1 . TYR B 2 562 ? 95.816  8.282   21.549  1.00 0.00 ? 562 TYR B CD1 1  
ATOM 7888   C CD2 . TYR B 2 562 ? 95.374  9.784   19.756  1.00 0.00 ? 562 TYR B CD2 1  
ATOM 7889   C CE1 . TYR B 2 562 ? 94.428  8.260   21.820  1.00 0.00 ? 562 TYR B CE1 1  
ATOM 7890   C CE2 . TYR B 2 562 ? 94.029  9.826   20.066  1.00 0.00 ? 562 TYR B CE2 1  
ATOM 7891   C CZ  . TYR B 2 562 ? 93.588  9.003   21.071  1.00 0.00 ? 562 TYR B CZ  1  
ATOM 7892   O OH  . TYR B 2 562 ? 92.189  8.853   21.244  1.00 0.00 ? 562 TYR B OH  1  
ATOM 7893   N N   . ILE B 2 563 ? 96.789  5.936   19.264  1.00 0.00 ? 563 ILE B N   1  
ATOM 7894   C CA  . ILE B 2 563 ? 95.936  5.149   18.453  1.00 0.00 ? 563 ILE B CA  1  
ATOM 7895   C C   . ILE B 2 563 ? 94.522  5.518   18.834  1.00 0.00 ? 563 ILE B C   1  
ATOM 7896   O O   . ILE B 2 563 ? 94.059  5.287   19.988  1.00 0.00 ? 563 ILE B O   1  
ATOM 7897   C CB  . ILE B 2 563 ? 96.181  3.661   18.520  1.00 0.00 ? 563 ILE B CB  1  
ATOM 7898   C CG1 . ILE B 2 563 ? 95.164  2.796   17.652  1.00 0.00 ? 563 ILE B CG1 1  
ATOM 7899   C CG2 . ILE B 2 563 ? 96.436  3.055   19.948  1.00 0.00 ? 563 ILE B CG2 1  
ATOM 7900   C CD1 . ILE B 2 563 ? 95.413  1.280   17.720  1.00 0.00 ? 563 ILE B CD1 1  
ATOM 7901   N N   . LEU B 2 564 ? 93.835  6.072   17.839  1.00 0.00 ? 564 LEU B N   1  
ATOM 7902   C CA  . LEU B 2 564 ? 92.490  6.660   17.819  1.00 0.00 ? 564 LEU B CA  1  
ATOM 7903   C C   . LEU B 2 564 ? 91.480  5.579   18.048  1.00 0.00 ? 564 LEU B C   1  
ATOM 7904   O O   . LEU B 2 564 ? 91.778  4.438   17.739  1.00 0.00 ? 564 LEU B O   1  
ATOM 7905   C CB  . LEU B 2 564 ? 92.033  7.427   16.529  1.00 0.00 ? 564 LEU B CB  1  
ATOM 7906   C CG  . LEU B 2 564 ? 92.854  8.649   16.259  1.00 0.00 ? 564 LEU B CG  1  
ATOM 7907   C CD1 . LEU B 2 564 ? 94.125  8.465   15.402  1.00 0.00 ? 564 LEU B CD1 1  
ATOM 7908   C CD2 . LEU B 2 564 ? 92.115  9.766   15.614  1.00 0.00 ? 564 LEU B CD2 1  
ATOM 7909   N N   . TYR B 2 565 ? 90.294  5.994   18.692  1.00 0.00 ? 565 TYR B N   1  
ATOM 7910   C CA  . TYR B 2 565 ? 89.198  5.173   19.122  1.00 0.00 ? 565 TYR B CA  1  
ATOM 7911   C C   . TYR B 2 565 ? 87.896  5.657   18.591  1.00 0.00 ? 565 TYR B C   1  
ATOM 7912   O O   . TYR B 2 565 ? 87.815  6.834   18.260  1.00 0.00 ? 565 TYR B O   1  
ATOM 7913   C CB  . TYR B 2 565 ? 89.011  5.215   20.715  1.00 0.00 ? 565 TYR B CB  1  
ATOM 7914   C CG  . TYR B 2 565 ? 90.080  4.415   21.361  1.00 0.00 ? 565 TYR B CG  1  
ATOM 7915   C CD1 . TYR B 2 565 ? 90.148  3.048   21.084  1.00 0.00 ? 565 TYR B CD1 1  
ATOM 7916   C CD2 . TYR B 2 565 ? 90.911  5.017   22.336  1.00 0.00 ? 565 TYR B CD2 1  
ATOM 7917   C CE1 . TYR B 2 565 ? 91.090  2.322   21.767  1.00 0.00 ? 565 TYR B CE1 1  
ATOM 7918   C CE2 . TYR B 2 565 ? 91.905  4.287   22.995  1.00 0.00 ? 565 TYR B CE2 1  
ATOM 7919   C CZ  . TYR B 2 565 ? 91.989  2.971   22.647  1.00 0.00 ? 565 TYR B CZ  1  
ATOM 7920   O OH  . TYR B 2 565 ? 93.016  2.233   23.195  1.00 0.00 ? 565 TYR B OH  1  
ATOM 7921   N N   . PRO B 2 566 ? 86.859  4.846   18.414  1.00 0.00 ? 566 PRO B N   1  
ATOM 7922   C CA  . PRO B 2 566 ? 85.605  5.313   17.789  1.00 0.00 ? 566 PRO B CA  1  
ATOM 7923   C C   . PRO B 2 566 ? 84.994  6.557   18.419  1.00 0.00 ? 566 PRO B C   1  
ATOM 7924   O O   . PRO B 2 566 ? 85.261  6.601   19.616  1.00 0.00 ? 566 PRO B O   1  
ATOM 7925   C CB  . PRO B 2 566 ? 84.663  4.170   17.853  1.00 0.00 ? 566 PRO B CB  1  
ATOM 7926   C CG  . PRO B 2 566 ? 85.488  2.923   17.796  1.00 0.00 ? 566 PRO B CG  1  
ATOM 7927   C CD  . PRO B 2 566 ? 86.771  3.370   18.566  1.00 0.00 ? 566 PRO B CD  1  
ATOM 7928   N N   . PRO B 2 567 ? 84.395  7.614   17.888  1.00 0.00 ? 567 PRO B N   1  
ATOM 7929   C CA  . PRO B 2 567 ? 84.085  7.669   16.466  1.00 0.00 ? 567 PRO B CA  1  
ATOM 7930   C C   . PRO B 2 567 ? 85.093  8.375   15.723  1.00 0.00 ? 567 PRO B C   1  
ATOM 7931   O O   . PRO B 2 567 ? 84.999  8.343   14.453  1.00 0.00 ? 567 PRO B O   1  
ATOM 7932   C CB  . PRO B 2 567 ? 82.691  8.416   16.447  1.00 0.00 ? 567 PRO B CB  1  
ATOM 7933   C CG  . PRO B 2 567 ? 82.700  9.340   17.651  1.00 0.00 ? 567 PRO B CG  1  
ATOM 7934   C CD  . PRO B 2 567 ? 83.581  8.463   18.682  1.00 0.00 ? 567 PRO B CD  1  
ATOM 7935   N N   . LEU B 2 568 ? 86.217  8.893   16.361  1.00 0.00 ? 568 LEU B N   1  
ATOM 7936   C CA  . LEU B 2 568 ? 87.263  9.595   15.711  1.00 0.00 ? 568 LEU B CA  1  
ATOM 7937   C C   . LEU B 2 568 ? 87.992  8.829   14.731  1.00 0.00 ? 568 LEU B C   1  
ATOM 7938   O O   . LEU B 2 568 ? 88.428  9.387   13.738  1.00 0.00 ? 568 LEU B O   1  
ATOM 7939   C CB  . LEU B 2 568 ? 88.298  10.086  16.723  1.00 0.00 ? 568 LEU B CB  1  
ATOM 7940   C CG  . LEU B 2 568 ? 87.704  11.006  17.874  1.00 0.00 ? 568 LEU B CG  1  
ATOM 7941   C CD1 . LEU B 2 568 ? 87.519  10.183  19.191  1.00 0.00 ? 568 LEU B CD1 1  
ATOM 7942   C CD2 . LEU B 2 568 ? 88.676  12.141  18.295  1.00 0.00 ? 568 LEU B CD2 1  
ATOM 7943   N N   . SER B 2 569 ? 88.087  7.471   14.867  1.00 0.00 ? 569 SER B N   1  
ATOM 7944   C CA  . SER B 2 569 ? 88.740  6.647   13.901  1.00 0.00 ? 569 SER B CA  1  
ATOM 7945   C C   . SER B 2 569 ? 88.188  6.686   12.501  1.00 0.00 ? 569 SER B C   1  
ATOM 7946   O O   . SER B 2 569 ? 88.956  6.371   11.574  1.00 0.00 ? 569 SER B O   1  
ATOM 7947   C CB  . SER B 2 569 ? 88.563  5.170   14.316  1.00 0.00 ? 569 SER B CB  1  
ATOM 7948   O OG  . SER B 2 569 ? 88.916  4.889   15.624  1.00 0.00 ? 569 SER B OG  1  
ATOM 7949   N N   . LEU B 2 570 ? 86.891  7.114   12.271  1.00 0.00 ? 570 LEU B N   1  
ATOM 7950   C CA  . LEU B 2 570 ? 86.372  7.373   10.903  1.00 0.00 ? 570 LEU B CA  1  
ATOM 7951   C C   . LEU B 2 570 ? 87.117  8.467   10.228  1.00 0.00 ? 570 LEU B C   1  
ATOM 7952   O O   . LEU B 2 570 ? 87.451  8.360   9.047   1.00 0.00 ? 570 LEU B O   1  
ATOM 7953   C CB  . LEU B 2 570 ? 84.836  7.555   10.759  1.00 0.00 ? 570 LEU B CB  1  
ATOM 7954   C CG  . LEU B 2 570 ? 84.143  7.928   9.424   1.00 0.00 ? 570 LEU B CG  1  
ATOM 7955   C CD1 . LEU B 2 570 ? 84.389  9.429   8.914   1.00 0.00 ? 570 LEU B CD1 1  
ATOM 7956   C CD2 . LEU B 2 570 ? 84.322  6.892   8.276   1.00 0.00 ? 570 LEU B CD2 1  
ATOM 7957   N N   . VAL B 2 571 ? 87.457  9.584   10.935  1.00 0.00 ? 571 VAL B N   1  
ATOM 7958   C CA  . VAL B 2 571 ? 88.296  10.690  10.548  1.00 0.00 ? 571 VAL B CA  1  
ATOM 7959   C C   . VAL B 2 571 ? 89.718  10.322  10.230  1.00 0.00 ? 571 VAL B C   1  
ATOM 7960   O O   . VAL B 2 571 ? 90.258  10.897  9.314   1.00 0.00 ? 571 VAL B O   1  
ATOM 7961   C CB  . VAL B 2 571 ? 88.122  11.834  11.589  1.00 0.00 ? 571 VAL B CB  1  
ATOM 7962   C CG1 . VAL B 2 571 ? 88.447  13.167  10.763  1.00 0.00 ? 571 VAL B CG1 1  
ATOM 7963   C CG2 . VAL B 2 571 ? 86.735  11.867  12.290  1.00 0.00 ? 571 VAL B CG2 1  
ATOM 7964   N N   . LEU B 2 572 ? 90.399  9.466   11.029  1.00 0.00 ? 572 LEU B N   1  
ATOM 7965   C CA  . LEU B 2 572 ? 91.838  9.419   10.924  1.00 0.00 ? 572 LEU B CA  1  
ATOM 7966   C C   . LEU B 2 572 ? 92.150  8.148   11.638  1.00 0.00 ? 572 LEU B C   1  
ATOM 7967   O O   . LEU B 2 572 ? 91.519  7.616   12.518  1.00 0.00 ? 572 LEU B O   1  
ATOM 7968   C CB  . LEU B 2 572 ? 92.450  10.633  11.640  1.00 0.00 ? 572 LEU B CB  1  
ATOM 7969   C CG  . LEU B 2 572 ? 93.987  10.872  11.405  1.00 0.00 ? 572 LEU B CG  1  
ATOM 7970   C CD1 . LEU B 2 572 ? 94.190  11.224  9.925   1.00 0.00 ? 572 LEU B CD1 1  
ATOM 7971   C CD2 . LEU B 2 572 ? 94.524  11.944  12.357  1.00 0.00 ? 572 LEU B CD2 1  
ATOM 7972   N N   . ASN B 2 573 ? 93.248  7.566   11.105  1.00 0.00 ? 573 ASN B N   1  
ATOM 7973   C CA  . ASN B 2 573 ? 93.514  6.199   11.271  1.00 0.00 ? 573 ASN B CA  1  
ATOM 7974   C C   . ASN B 2 573 ? 94.946  5.996   10.841  1.00 0.00 ? 573 ASN B C   1  
ATOM 7975   O O   . ASN B 2 573 ? 95.613  6.925   10.391  1.00 0.00 ? 573 ASN B O   1  
ATOM 7976   C CB  . ASN B 2 573 ? 92.601  5.344   10.398  1.00 0.00 ? 573 ASN B CB  1  
ATOM 7977   C CG  . ASN B 2 573 ? 92.459  3.914   10.828  1.00 0.00 ? 573 ASN B CG  1  
ATOM 7978   O OD1 . ASN B 2 573 ? 92.798  2.978   10.049  1.00 0.00 ? 573 ASN B OD1 1  
ATOM 7979   N ND2 . ASN B 2 573 ? 91.822  3.644   11.990  1.00 0.00 ? 573 ASN B ND2 1  
ATOM 7980   N N   . VAL B 2 574 ? 95.486  4.818   11.046  1.00 0.00 ? 574 VAL B N   1  
ATOM 7981   C CA  . VAL B 2 574 ? 96.863  4.360   10.952  1.00 0.00 ? 574 VAL B CA  1  
ATOM 7982   C C   . VAL B 2 574 ? 97.047  4.004   9.485   1.00 0.00 ? 574 VAL B C   1  
ATOM 7983   O O   . VAL B 2 574 ? 98.115  3.845   8.970   1.00 0.00 ? 574 VAL B O   1  
ATOM 7984   C CB  . VAL B 2 574 ? 97.215  3.185   11.864  1.00 0.00 ? 574 VAL B CB  1  
ATOM 7985   C CG1 . VAL B 2 574 ? 97.543  3.723   13.361  1.00 0.00 ? 574 VAL B CG1 1  
ATOM 7986   C CG2 . VAL B 2 574 ? 96.080  2.122   11.905  1.00 0.00 ? 574 VAL B CG2 1  
ATOM 7987   N N   . ASN B 2 575 ? 95.998  3.987   8.685   1.00 0.00 ? 575 ASN B N   1  
ATOM 7988   C CA  . ASN B 2 575 ? 95.988  3.696   7.314   1.00 0.00 ? 575 ASN B CA  1  
ATOM 7989   C C   . ASN B 2 575 ? 95.567  4.990   6.752   1.00 0.00 ? 575 ASN B C   1  
ATOM 7990   O O   . ASN B 2 575 ? 94.540  5.489   7.244   1.00 0.00 ? 575 ASN B O   1  
ATOM 7991   C CB  . ASN B 2 575 ? 95.012  2.628   6.837   1.00 0.00 ? 575 ASN B CB  1  
ATOM 7992   C CG  . ASN B 2 575 ? 95.285  2.123   5.447   1.00 0.00 ? 575 ASN B CG  1  
ATOM 7993   O OD1 . ASN B 2 575 ? 96.376  1.604   5.237   1.00 0.00 ? 575 ASN B OD1 1  
ATOM 7994   N ND2 . ASN B 2 575 ? 94.227  2.306   4.625   1.00 0.00 ? 575 ASN B ND2 1  
ATOM 7995   N N   . ARG B 2 576 ? 96.407  5.639   5.864   1.00 0.00 ? 576 ARG B N   1  
ATOM 7996   C CA  . ARG B 2 576 ? 96.339  6.958   5.426   1.00 0.00 ? 576 ARG B CA  1  
ATOM 7997   C C   . ARG B 2 576 ? 96.529  7.930   6.608   1.00 0.00 ? 576 ARG B C   1  
ATOM 7998   O O   . ARG B 2 576 ? 95.526  8.451   7.169   1.00 0.00 ? 576 ARG B O   1  
ATOM 7999   C CB  . ARG B 2 576 ? 95.051  7.345   4.759   1.00 0.00 ? 576 ARG B CB  1  
ATOM 8000   C CG  . ARG B 2 576 ? 94.694  6.495   3.530   1.00 0.00 ? 576 ARG B CG  1  
ATOM 8001   C CD  . ARG B 2 576 ? 93.538  7.028   2.730   1.00 0.00 ? 576 ARG B CD  1  
ATOM 8002   N NE  . ARG B 2 576 ? 92.351  7.109   3.681   1.00 0.00 ? 576 ARG B NE  1  
ATOM 8003   C CZ  . ARG B 2 576 ? 91.214  7.819   3.384   1.00 0.00 ? 576 ARG B CZ  1  
ATOM 8004   N NH1 . ARG B 2 576 ? 91.028  8.242   2.088   1.00 0.00 ? 576 ARG B NH1 1  
ATOM 8005   N NH2 . ARG B 2 576 ? 90.288  8.189   4.346   1.00 0.00 ? 576 ARG B NH2 1  
ATOM 8006   N N   . PRO B 2 577 ? 97.762  8.119   7.116   1.00 0.00 ? 577 PRO B N   1  
ATOM 8007   C CA  . PRO B 2 577 ? 97.940  8.755   8.348   1.00 0.00 ? 577 PRO B CA  1  
ATOM 8008   C C   . PRO B 2 577 ? 98.567  10.142  8.167   1.00 0.00 ? 577 PRO B C   1  
ATOM 8009   O O   . PRO B 2 577 ? 99.665  10.442  8.700   1.00 0.00 ? 577 PRO B O   1  
ATOM 8010   C CB  . PRO B 2 577 ? 98.777  7.722   9.060   1.00 0.00 ? 577 PRO B CB  1  
ATOM 8011   C CG  . PRO B 2 577 ? 99.700  7.076   8.028   1.00 0.00 ? 577 PRO B CG  1  
ATOM 8012   C CD  . PRO B 2 577 ? 98.968  7.423   6.725   1.00 0.00 ? 577 PRO B CD  1  
ATOM 8013   N N   . PHE B 2 578 ? 97.866  11.045  7.403   1.00 0.00 ? 578 PHE B N   1  
ATOM 8014   C CA  . PHE B 2 578 ? 98.419  12.345  7.204   1.00 0.00 ? 578 PHE B CA  1  
ATOM 8015   C C   . PHE B 2 578 ? 98.475  13.166  8.502   1.00 0.00 ? 578 PHE B C   1  
ATOM 8016   O O   . PHE B 2 578 ? 99.480  13.736  8.791   1.00 0.00 ? 578 PHE B O   1  
ATOM 8017   C CB  . PHE B 2 578 ? 97.673  13.180  6.137   1.00 0.00 ? 578 PHE B CB  1  
ATOM 8018   C CG  . PHE B 2 578 ? 97.318  12.310  4.899   1.00 0.00 ? 578 PHE B CG  1  
ATOM 8019   C CD1 . PHE B 2 578 ? 98.207  11.588  4.103   1.00 0.00 ? 578 PHE B CD1 1  
ATOM 8020   C CD2 . PHE B 2 578 ? 95.876  12.259  4.532   1.00 0.00 ? 578 PHE B CD2 1  
ATOM 8021   C CE1 . PHE B 2 578 ? 97.797  10.805  3.004   1.00 0.00 ? 578 PHE B CE1 1  
ATOM 8022   C CE2 . PHE B 2 578 ? 95.447  11.455  3.470   1.00 0.00 ? 578 PHE B CE2 1  
ATOM 8023   C CZ  . PHE B 2 578 ? 96.351  10.815  2.617   1.00 0.00 ? 578 PHE B CZ  1  
ATOM 8024   N N   . GLY B 2 579 ? 97.388  13.221  9.331   1.00 0.00 ? 579 GLY B N   1  
ATOM 8025   C CA  . GLY B 2 579 ? 97.298  13.963  10.553  1.00 0.00 ? 579 GLY B CA  1  
ATOM 8026   C C   . GLY B 2 579 ? 98.236  13.385  11.505  1.00 0.00 ? 579 GLY B C   1  
ATOM 8027   O O   . GLY B 2 579 ? 98.864  14.072  12.280  1.00 0.00 ? 579 GLY B O   1  
ATOM 8028   N N   . ARG B 2 580 ? 98.319  11.989  11.537  1.00 0.00 ? 580 ARG B N   1  
ATOM 8029   C CA  . ARG B 2 580 ? 99.193  11.307  12.530  1.00 0.00 ? 580 ARG B CA  1  
ATOM 8030   C C   . ARG B 2 580 ? 100.692 11.719  12.245  1.00 0.00 ? 580 ARG B C   1  
ATOM 8031   O O   . ARG B 2 580 ? 101.478 11.823  13.166  1.00 0.00 ? 580 ARG B O   1  
ATOM 8032   C CB  . ARG B 2 580 ? 99.076  9.727   12.473  1.00 0.00 ? 580 ARG B CB  1  
ATOM 8033   C CG  . ARG B 2 580 ? 97.749  9.098   13.074  1.00 0.00 ? 580 ARG B CG  1  
ATOM 8034   C CD  . ARG B 2 580 ? 97.856  8.674   14.510  1.00 0.00 ? 580 ARG B CD  1  
ATOM 8035   N NE  . ARG B 2 580 ? 97.595  9.897   15.349  1.00 0.00 ? 580 ARG B NE  1  
ATOM 8036   C CZ  . ARG B 2 580 ? 98.409  10.486  16.222  1.00 0.00 ? 580 ARG B CZ  1  
ATOM 8037   N NH1 . ARG B 2 580 ? 99.712  10.019  16.384  1.00 0.00 ? 580 ARG B NH1 1  
ATOM 8038   N NH2 . ARG B 2 580 ? 98.058  11.506  17.003  1.00 0.00 ? 580 ARG B NH2 1  
ATOM 8039   N N   . LYS B 2 581 ? 101.040 11.882  10.943  1.00 0.00 ? 581 LYS B N   1  
ATOM 8040   C CA  . LYS B 2 581 ? 102.371 12.298  10.594  1.00 0.00 ? 581 LYS B CA  1  
ATOM 8041   C C   . LYS B 2 581 ? 102.768 13.656  11.101  1.00 0.00 ? 581 LYS B C   1  
ATOM 8042   O O   . LYS B 2 581 ? 103.856 13.862  11.564  1.00 0.00 ? 581 LYS B O   1  
ATOM 8043   C CB  . LYS B 2 581 ? 102.523 12.276  9.086   1.00 0.00 ? 581 LYS B CB  1  
ATOM 8044   C CG  . LYS B 2 581 ? 102.860 10.890  8.583   1.00 0.00 ? 581 LYS B CG  1  
ATOM 8045   C CD  . LYS B 2 581 ? 102.667 10.769  7.068   1.00 0.00 ? 581 LYS B CD  1  
ATOM 8046   C CE  . LYS B 2 581 ? 102.996 9.459   6.349   1.00 0.00 ? 581 LYS B CE  1  
ATOM 8047   N NZ  . LYS B 2 581 ? 102.607 9.620   4.917   1.00 0.00 ? 581 LYS B NZ  1  
ATOM 8048   N N   . GLU B 2 582 ? 101.843 14.597  11.023  1.00 0.00 ? 582 GLU B N   1  
ATOM 8049   C CA  . GLU B 2 582 ? 102.017 15.962  11.485  1.00 0.00 ? 582 GLU B CA  1  
ATOM 8050   C C   . GLU B 2 582 ? 102.345 15.999  12.943  1.00 0.00 ? 582 GLU B C   1  
ATOM 8051   O O   . GLU B 2 582 ? 103.237 16.701  13.378  1.00 0.00 ? 582 GLU B O   1  
ATOM 8052   C CB  . GLU B 2 582 ? 100.742 16.837  11.224  1.00 0.00 ? 582 GLU B CB  1  
ATOM 8053   C CG  . GLU B 2 582 ? 100.389 17.117  9.750   1.00 0.00 ? 582 GLU B CG  1  
ATOM 8054   C CD  . GLU B 2 582 ? 99.026  17.614  9.478   1.00 0.00 ? 582 GLU B CD  1  
ATOM 8055   O OE1 . GLU B 2 582 ? 98.639  18.580  10.199  1.00 0.00 ? 582 GLU B OE1 1  
ATOM 8056   O OE2 . GLU B 2 582 ? 98.326  17.198  8.510   1.00 0.00 ? 582 GLU B OE2 1  
ATOM 8057   N N   . TYR B 2 583 ? 101.546 15.260  13.732  1.00 0.00 ? 583 TYR B N   1  
ATOM 8058   C CA  . TYR B 2 583 ? 101.694 15.287  15.212  1.00 0.00 ? 583 TYR B CA  1  
ATOM 8059   C C   . TYR B 2 583 ? 103.095 14.815  15.596  1.00 0.00 ? 583 TYR B C   1  
ATOM 8060   O O   . TYR B 2 583 ? 103.802 15.467  16.357  1.00 0.00 ? 583 TYR B O   1  
ATOM 8061   C CB  . TYR B 2 583 ? 100.684 14.265  15.845  1.00 0.00 ? 583 TYR B CB  1  
ATOM 8062   C CG  . TYR B 2 583 ? 99.371  14.953  16.194  1.00 0.00 ? 583 TYR B CG  1  
ATOM 8063   C CD1 . TYR B 2 583 ? 99.312  15.840  17.313  1.00 0.00 ? 583 TYR B CD1 1  
ATOM 8064   C CD2 . TYR B 2 583 ? 98.179  14.644  15.573  1.00 0.00 ? 583 TYR B CD2 1  
ATOM 8065   C CE1 . TYR B 2 583 ? 98.092  16.278  17.780  1.00 0.00 ? 583 TYR B CE1 1  
ATOM 8066   C CE2 . TYR B 2 583 ? 96.933  15.220  15.934  1.00 0.00 ? 583 TYR B CE2 1  
ATOM 8067   C CZ  . TYR B 2 583 ? 96.896  16.038  17.092  1.00 0.00 ? 583 TYR B CZ  1  
ATOM 8068   O OH  . TYR B 2 583 ? 95.646  16.540  17.536  1.00 0.00 ? 583 TYR B OH  1  
ATOM 8069   N N   . LEU B 2 584 ? 103.623 13.785  14.915  1.00 0.00 ? 584 LEU B N   1  
ATOM 8070   C CA  . LEU B 2 584 ? 104.946 13.235  15.098  1.00 0.00 ? 584 LEU B CA  1  
ATOM 8071   C C   . LEU B 2 584 ? 106.137 14.230  14.928  1.00 0.00 ? 584 LEU B C   1  
ATOM 8072   O O   . LEU B 2 584 ? 107.006 14.253  15.779  1.00 0.00 ? 584 LEU B O   1  
ATOM 8073   C CB  . LEU B 2 584 ? 105.147 11.998  14.243  1.00 0.00 ? 584 LEU B CB  1  
ATOM 8074   C CG  . LEU B 2 584 ? 104.266 10.757  14.576  1.00 0.00 ? 584 LEU B CG  1  
ATOM 8075   C CD1 . LEU B 2 584 ? 104.350 9.774   13.425  1.00 0.00 ? 584 LEU B CD1 1  
ATOM 8076   C CD2 . LEU B 2 584 ? 104.548 10.131  15.934  1.00 0.00 ? 584 LEU B CD2 1  
ATOM 8077   N N   . ARG B 2 585 ? 106.050 15.131  13.945  1.00 0.00 ? 585 ARG B N   1  
ATOM 8078   C CA  . ARG B 2 585 ? 106.993 16.169  13.663  1.00 0.00 ? 585 ARG B CA  1  
ATOM 8079   C C   . ARG B 2 585 ? 107.072 17.200  14.764  1.00 0.00 ? 585 ARG B C   1  
ATOM 8080   O O   . ARG B 2 585 ? 108.113 17.646  15.106  1.00 0.00 ? 585 ARG B O   1  
ATOM 8081   C CB  . ARG B 2 585 ? 106.552 16.874  12.351  1.00 0.00 ? 585 ARG B CB  1  
ATOM 8082   C CG  . ARG B 2 585 ? 106.717 15.885  11.229  1.00 0.00 ? 585 ARG B CG  1  
ATOM 8083   C CD  . ARG B 2 585 ? 106.506 16.546  9.860   1.00 0.00 ? 585 ARG B CD  1  
ATOM 8084   N NE  . ARG B 2 585 ? 105.038 16.906  9.707   1.00 0.00 ? 585 ARG B NE  1  
ATOM 8085   C CZ  . ARG B 2 585 ? 104.574 17.316  8.478   1.00 0.00 ? 585 ARG B CZ  1  
ATOM 8086   N NH1 . ARG B 2 585 ? 105.394 17.677  7.452   1.00 0.00 ? 585 ARG B NH1 1  
ATOM 8087   N NH2 . ARG B 2 585 ? 103.262 17.498  8.375   1.00 0.00 ? 585 ARG B NH2 1  
ATOM 8088   N N   . ILE B 2 586 ? 105.891 17.602  15.244  1.00 0.00 ? 586 ILE B N   1  
ATOM 8089   C CA  . ILE B 2 586 ? 105.899 18.572  16.213  1.00 0.00 ? 586 ILE B CA  1  
ATOM 8090   C C   . ILE B 2 586 ? 106.544 18.112  17.522  1.00 0.00 ? 586 ILE B C   1  
ATOM 8091   O O   . ILE B 2 586 ? 107.298 18.813  18.145  1.00 0.00 ? 586 ILE B O   1  
ATOM 8092   C CB  . ILE B 2 586 ? 104.514 19.120  16.335  1.00 0.00 ? 586 ILE B CB  1  
ATOM 8093   C CG1 . ILE B 2 586 ? 103.871 19.480  14.970  1.00 0.00 ? 586 ILE B CG1 1  
ATOM 8094   C CG2 . ILE B 2 586 ? 104.501 20.284  17.321  1.00 0.00 ? 586 ILE B CG2 1  
ATOM 8095   C CD1 . ILE B 2 586 ? 102.445 20.046  15.078  1.00 0.00 ? 586 ILE B CD1 1  
ATOM 8096   N N   . PHE B 2 587 ? 106.251 16.852  17.901  1.00 0.00 ? 587 PHE B N   1  
ATOM 8097   C CA  . PHE B 2 587 ? 106.614 16.118  19.095  1.00 0.00 ? 587 PHE B CA  1  
ATOM 8098   C C   . PHE B 2 587 ? 108.100 16.045  19.208  1.00 0.00 ? 587 PHE B C   1  
ATOM 8099   O O   . PHE B 2 587 ? 108.576 16.352  20.326  1.00 0.00 ? 587 PHE B O   1  
ATOM 8100   C CB  . PHE B 2 587 ? 105.864 14.674  19.218  1.00 0.00 ? 587 PHE B CB  1  
ATOM 8101   C CG  . PHE B 2 587 ? 106.281 14.017  20.621  1.00 0.00 ? 587 PHE B CG  1  
ATOM 8102   C CD1 . PHE B 2 587 ? 105.711 14.484  21.841  1.00 0.00 ? 587 PHE B CD1 1  
ATOM 8103   C CD2 . PHE B 2 587 ? 107.156 12.953  20.657  1.00 0.00 ? 587 PHE B CD2 1  
ATOM 8104   C CE1 . PHE B 2 587 ? 105.953 13.849  23.030  1.00 0.00 ? 587 PHE B CE1 1  
ATOM 8105   C CE2 . PHE B 2 587 ? 107.560 12.376  21.932  1.00 0.00 ? 587 PHE B CE2 1  
ATOM 8106   C CZ  . PHE B 2 587 ? 106.890 12.810  23.068  1.00 0.00 ? 587 PHE B CZ  1  
ATOM 8107   N N   . ASN B 2 588 ? 108.804 15.721  18.097  1.00 0.00 ? 588 ASN B N   1  
ATOM 8108   C CA  . ASN B 2 588 ? 110.249 15.779  18.122  1.00 0.00 ? 588 ASN B CA  1  
ATOM 8109   C C   . ASN B 2 588 ? 110.851 17.120  18.410  1.00 0.00 ? 588 ASN B C   1  
ATOM 8110   O O   . ASN B 2 588 ? 111.865 17.156  19.117  1.00 0.00 ? 588 ASN B O   1  
ATOM 8111   C CB  . ASN B 2 588 ? 110.969 15.254  16.860  1.00 0.00 ? 588 ASN B CB  1  
ATOM 8112   C CG  . ASN B 2 588 ? 110.600 13.781  16.653  1.00 0.00 ? 588 ASN B CG  1  
ATOM 8113   O OD1 . ASN B 2 588 ? 110.150 13.406  15.548  1.00 0.00 ? 588 ASN B OD1 1  
ATOM 8114   N ND2 . ASN B 2 588 ? 110.712 12.926  17.680  1.00 0.00 ? 588 ASN B ND2 1  
ATOM 8115   N N   . PHE B 2 589 ? 110.265 18.153  17.858  1.00 0.00 ? 589 PHE B N   1  
ATOM 8116   C CA  . PHE B 2 589 ? 110.876 19.470  17.998  1.00 0.00 ? 589 PHE B CA  1  
ATOM 8117   C C   . PHE B 2 589 ? 110.856 19.946  19.407  1.00 0.00 ? 589 PHE B C   1  
ATOM 8118   O O   . PHE B 2 589 ? 111.815 20.445  20.042  1.00 0.00 ? 589 PHE B O   1  
ATOM 8119   C CB  . PHE B 2 589 ? 110.027 20.487  17.149  1.00 0.00 ? 589 PHE B CB  1  
ATOM 8120   C CG  . PHE B 2 589 ? 109.802 20.151  15.723  1.00 0.00 ? 589 PHE B CG  1  
ATOM 8121   C CD1 . PHE B 2 589 ? 110.753 19.323  14.998  1.00 0.00 ? 589 PHE B CD1 1  
ATOM 8122   C CD2 . PHE B 2 589 ? 108.742 20.801  15.064  1.00 0.00 ? 589 PHE B CD2 1  
ATOM 8123   C CE1 . PHE B 2 589 ? 110.626 19.199  13.596  1.00 0.00 ? 589 PHE B CE1 1  
ATOM 8124   C CE2 . PHE B 2 589 ? 108.690 20.653  13.653  1.00 0.00 ? 589 PHE B CE2 1  
ATOM 8125   C CZ  . PHE B 2 589 ? 109.556 19.827  12.930  1.00 0.00 ? 589 PHE B CZ  1  
ATOM 8126   N N   . LEU B 2 590 ? 109.647 19.760  20.068  1.00 0.00 ? 590 LEU B N   1  
ATOM 8127   C CA  . LEU B 2 590 ? 109.482 20.115  21.444  1.00 0.00 ? 590 LEU B CA  1  
ATOM 8128   C C   . LEU B 2 590 ? 110.384 19.344  22.396  1.00 0.00 ? 590 LEU B C   1  
ATOM 8129   O O   . LEU B 2 590 ? 111.119 19.838  23.255  1.00 0.00 ? 590 LEU B O   1  
ATOM 8130   C CB  . LEU B 2 590 ? 107.998 19.936  21.827  1.00 0.00 ? 590 LEU B CB  1  
ATOM 8131   C CG  . LEU B 2 590 ? 107.053 20.923  21.120  1.00 0.00 ? 590 LEU B CG  1  
ATOM 8132   C CD1 . LEU B 2 590 ? 105.626 20.454  21.250  1.00 0.00 ? 590 LEU B CD1 1  
ATOM 8133   C CD2 . LEU B 2 590 ? 107.207 22.368  21.609  1.00 0.00 ? 590 LEU B CD2 1  
ATOM 8134   N N   . TRP B 2 591 ? 110.413 18.025  22.144  1.00 0.00 ? 591 TRP B N   1  
ATOM 8135   C CA  . TRP B 2 591 ? 111.156 17.009  22.886  1.00 0.00 ? 591 TRP B CA  1  
ATOM 8136   C C   . TRP B 2 591 ? 112.658 17.212  22.835  1.00 0.00 ? 591 TRP B C   1  
ATOM 8137   O O   . TRP B 2 591 ? 113.289 17.008  23.863  1.00 0.00 ? 591 TRP B O   1  
ATOM 8138   C CB  . TRP B 2 591 ? 110.854 15.574  22.311  1.00 0.00 ? 591 TRP B CB  1  
ATOM 8139   C CG  . TRP B 2 591 ? 110.893 14.458  23.371  1.00 0.00 ? 591 TRP B CG  1  
ATOM 8140   C CD1 . TRP B 2 591 ? 109.909 13.998  24.105  1.00 0.00 ? 591 TRP B CD1 1  
ATOM 8141   C CD2 . TRP B 2 591 ? 112.072 13.677  23.612  1.00 0.00 ? 591 TRP B CD2 1  
ATOM 8142   N NE1 . TRP B 2 591 ? 110.312 12.896  24.862  1.00 0.00 ? 591 TRP B NE1 1  
ATOM 8143   C CE2 . TRP B 2 591 ? 111.583 12.642  24.494  1.00 0.00 ? 591 TRP B CE2 1  
ATOM 8144   C CE3 . TRP B 2 591 ? 113.374 13.836  23.235  1.00 0.00 ? 591 TRP B CE3 1  
ATOM 8145   C CZ2 . TRP B 2 591 ? 112.520 11.716  24.993  1.00 0.00 ? 591 TRP B CZ2 1  
ATOM 8146   C CZ3 . TRP B 2 591 ? 114.191 12.818  23.682  1.00 0.00 ? 591 TRP B CZ3 1  
ATOM 8147   C CH2 . TRP B 2 591 ? 113.784 11.749  24.488  1.00 0.00 ? 591 TRP B CH2 1  
ATOM 8148   N N   . ARG B 2 592 ? 113.197 17.635  21.616  1.00 0.00 ? 592 ARG B N   1  
ATOM 8149   C CA  . ARG B 2 592 ? 114.640 17.888  21.428  1.00 0.00 ? 592 ARG B CA  1  
ATOM 8150   C C   . ARG B 2 592 ? 115.037 19.039  22.384  1.00 0.00 ? 592 ARG B C   1  
ATOM 8151   O O   . ARG B 2 592 ? 116.054 18.928  23.075  1.00 0.00 ? 592 ARG B O   1  
ATOM 8152   C CB  . ARG B 2 592 ? 114.962 18.290  19.980  1.00 0.00 ? 592 ARG B CB  1  
ATOM 8153   C CG  . ARG B 2 592 ? 116.452 18.163  19.386  1.00 0.00 ? 592 ARG B CG  1  
ATOM 8154   C CD  . ARG B 2 592 ? 117.041 16.739  19.309  1.00 0.00 ? 592 ARG B CD  1  
ATOM 8155   N NE  . ARG B 2 592 ? 116.352 15.868  18.325  1.00 0.00 ? 592 ARG B NE  1  
ATOM 8156   C CZ  . ARG B 2 592 ? 115.527 14.773  18.647  1.00 0.00 ? 592 ARG B CZ  1  
ATOM 8157   N NH1 . ARG B 2 592 ? 115.150 14.528  19.895  1.00 0.00 ? 592 ARG B NH1 1  
ATOM 8158   N NH2 . ARG B 2 592 ? 115.072 14.063  17.608  1.00 0.00 ? 592 ARG B NH2 1  
ATOM 8159   N N   . PHE B 2 593 ? 114.188 20.126  22.480  1.00 0.00 ? 593 PHE B N   1  
ATOM 8160   C CA  . PHE B 2 593 ? 114.556 21.221  23.407  1.00 0.00 ? 593 PHE B CA  1  
ATOM 8161   C C   . PHE B 2 593 ? 114.569 20.775  24.815  1.00 0.00 ? 593 PHE B C   1  
ATOM 8162   O O   . PHE B 2 593 ? 115.563 21.148  25.504  1.00 0.00 ? 593 PHE B O   1  
ATOM 8163   C CB  . PHE B 2 593 ? 113.552 22.419  23.155  1.00 0.00 ? 593 PHE B CB  1  
ATOM 8164   C CG  . PHE B 2 593 ? 113.458 22.915  21.697  1.00 0.00 ? 593 PHE B CG  1  
ATOM 8165   C CD1 . PHE B 2 593 ? 114.610 23.229  20.943  1.00 0.00 ? 593 PHE B CD1 1  
ATOM 8166   C CD2 . PHE B 2 593 ? 112.154 23.243  21.210  1.00 0.00 ? 593 PHE B CD2 1  
ATOM 8167   C CE1 . PHE B 2 593 ? 114.463 23.728  19.596  1.00 0.00 ? 593 PHE B CE1 1  
ATOM 8168   C CE2 . PHE B 2 593 ? 112.023 23.608  19.836  1.00 0.00 ? 593 PHE B CE2 1  
ATOM 8169   C CZ  . PHE B 2 593 ? 113.195 23.761  19.101  1.00 0.00 ? 593 PHE B CZ  1  
ATOM 8170   N N   . LYS B 2 594 ? 113.600 19.930  25.199  1.00 0.00 ? 594 LYS B N   1  
ATOM 8171   C CA  . LYS B 2 594 ? 113.374 19.316  26.439  1.00 0.00 ? 594 LYS B CA  1  
ATOM 8172   C C   . LYS B 2 594 ? 114.498 18.391  26.819  1.00 0.00 ? 594 LYS B C   1  
ATOM 8173   O O   . LYS B 2 594 ? 114.776 18.210  28.025  1.00 0.00 ? 594 LYS B O   1  
ATOM 8174   C CB  . LYS B 2 594 ? 112.029 18.605  26.690  1.00 0.00 ? 594 LYS B CB  1  
ATOM 8175   C CG  . LYS B 2 594 ? 110.929 19.691  26.853  1.00 0.00 ? 594 LYS B CG  1  
ATOM 8176   C CD  . LYS B 2 594 ? 110.739 20.380  28.225  1.00 0.00 ? 594 LYS B CD  1  
ATOM 8177   C CE  . LYS B 2 594 ? 110.002 19.488  29.239  1.00 0.00 ? 594 LYS B CE  1  
ATOM 8178   N NZ  . LYS B 2 594 ? 109.844 20.134  30.542  1.00 0.00 ? 594 LYS B NZ  1  
ATOM 8179   N N   . LYS B 2 595 ? 115.070 17.650  25.869  1.00 0.00 ? 595 LYS B N   1  
ATOM 8180   C CA  . LYS B 2 595 ? 116.188 16.692  26.021  1.00 0.00 ? 595 LYS B CA  1  
ATOM 8181   C C   . LYS B 2 595 ? 117.464 17.398  26.479  1.00 0.00 ? 595 LYS B C   1  
ATOM 8182   O O   . LYS B 2 595 ? 118.017 16.993  27.523  1.00 0.00 ? 595 LYS B O   1  
ATOM 8183   C CB  . LYS B 2 595 ? 116.334 15.969  24.632  1.00 0.00 ? 595 LYS B CB  1  
ATOM 8184   C CG  . LYS B 2 595 ? 117.544 15.059  24.405  1.00 0.00 ? 595 LYS B CG  1  
ATOM 8185   C CD  . LYS B 2 595 ? 117.714 14.691  22.947  1.00 0.00 ? 595 LYS B CD  1  
ATOM 8186   C CE  . LYS B 2 595 ? 119.133 14.366  22.560  1.00 0.00 ? 595 LYS B CE  1  
ATOM 8187   N NZ  . LYS B 2 595 ? 119.334 14.571  21.152  1.00 0.00 ? 595 LYS B NZ  1  
ATOM 8188   N N   . ASN B 2 596 ? 117.834 18.559  25.756  1.00 0.00 ? 596 ASN B N   1  
ATOM 8189   C CA  . ASN B 2 596 ? 118.960 19.333  26.152  1.00 0.00 ? 596 ASN B CA  1  
ATOM 8190   C C   . ASN B 2 596 ? 118.663 19.892  27.524  1.00 0.00 ? 596 ASN B C   1  
ATOM 8191   O O   . ASN B 2 596 ? 119.627 20.056  28.345  1.00 0.00 ? 596 ASN B O   1  
ATOM 8192   C CB  . ASN B 2 596 ? 119.242 20.524  25.203  1.00 0.00 ? 596 ASN B CB  1  
ATOM 8193   C CG  . ASN B 2 596 ? 119.956 20.095  23.922  1.00 0.00 ? 596 ASN B CG  1  
ATOM 8194   O OD1 . ASN B 2 596 ? 119.601 19.052  23.399  1.00 0.00 ? 596 ASN B OD1 1  
ATOM 8195   N ND2 . ASN B 2 596 ? 121.075 20.866  23.539  1.00 0.00 ? 596 ASN B ND2 1  
ATOM 8196   N N   . ASN B 2 597 ? 117.349 20.284  27.748  1.00 0.00 ? 597 ASN B N   1  
ATOM 8197   C CA  . ASN B 2 597 ? 116.942 20.928  29.006  1.00 0.00 ? 597 ASN B CA  1  
ATOM 8198   C C   . ASN B 2 597 ? 117.183 20.056  30.207  1.00 0.00 ? 597 ASN B C   1  
ATOM 8199   O O   . ASN B 2 597 ? 117.612 20.532  31.268  1.00 0.00 ? 597 ASN B O   1  
ATOM 8200   C CB  . ASN B 2 597 ? 115.446 21.459  28.956  1.00 0.00 ? 597 ASN B CB  1  
ATOM 8201   C CG  . ASN B 2 597 ? 115.112 22.443  30.085  1.00 0.00 ? 597 ASN B CG  1  
ATOM 8202   O OD1 . ASN B 2 597 ? 115.562 23.583  30.092  1.00 0.00 ? 597 ASN B OD1 1  
ATOM 8203   N ND2 . ASN B 2 597 ? 114.252 22.095  31.072  1.00 0.00 ? 597 ASN B ND2 1  
ATOM 8204   N N   . TYR B 2 598 ? 116.846 18.717  30.067  1.00 0.00 ? 598 TYR B N   1  
ATOM 8205   C CA  . TYR B 2 598 ? 116.940 17.690  31.065  1.00 0.00 ? 598 TYR B CA  1  
ATOM 8206   C C   . TYR B 2 598 ? 118.363 17.503  31.483  1.00 0.00 ? 598 TYR B C   1  
ATOM 8207   O O   . TYR B 2 598 ? 118.690 17.418  32.668  1.00 0.00 ? 598 TYR B O   1  
ATOM 8208   C CB  . TYR B 2 598 ? 116.289 16.445  30.647  1.00 0.00 ? 598 TYR B CB  1  
ATOM 8209   C CG  . TYR B 2 598 ? 116.385 15.464  31.809  1.00 0.00 ? 598 TYR B CG  1  
ATOM 8210   C CD1 . TYR B 2 598 ? 115.979 15.886  33.136  1.00 0.00 ? 598 TYR B CD1 1  
ATOM 8211   C CD2 . TYR B 2 598 ? 116.981 14.198  31.517  1.00 0.00 ? 598 TYR B CD2 1  
ATOM 8212   C CE1 . TYR B 2 598 ? 116.210 14.936  34.167  1.00 0.00 ? 598 TYR B CE1 1  
ATOM 8213   C CE2 . TYR B 2 598 ? 117.216 13.406  32.638  1.00 0.00 ? 598 TYR B CE2 1  
ATOM 8214   C CZ  . TYR B 2 598 ? 116.870 13.759  33.979  1.00 0.00 ? 598 TYR B CZ  1  
ATOM 8215   O OH  . TYR B 2 598 ? 117.253 12.892  35.005  1.00 0.00 ? 598 TYR B OH  1  
ATOM 8216   N N   . PHE B 2 599 ? 119.264 17.464  30.494  1.00 0.00 ? 599 PHE B N   1  
ATOM 8217   C CA  . PHE B 2 599 ? 120.613 17.265  30.706  1.00 0.00 ? 599 PHE B CA  1  
ATOM 8218   C C   . PHE B 2 599 ? 121.145 18.391  31.444  1.00 0.00 ? 599 PHE B C   1  
ATOM 8219   O O   . PHE B 2 599 ? 121.914 18.288  32.376  1.00 0.00 ? 599 PHE B O   1  
ATOM 8220   C CB  . PHE B 2 599 ? 121.495 17.172  29.522  1.00 0.00 ? 599 PHE B CB  1  
ATOM 8221   C CG  . PHE B 2 599 ? 121.092 16.115  28.545  1.00 0.00 ? 599 PHE B CG  1  
ATOM 8222   C CD1 . PHE B 2 599 ? 120.829 14.756  28.927  1.00 0.00 ? 599 PHE B CD1 1  
ATOM 8223   C CD2 . PHE B 2 599 ? 121.147 16.372  27.132  1.00 0.00 ? 599 PHE B CD2 1  
ATOM 8224   C CE1 . PHE B 2 599 ? 120.820 13.679  28.016  1.00 0.00 ? 599 PHE B CE1 1  
ATOM 8225   C CE2 . PHE B 2 599 ? 120.891 15.289  26.227  1.00 0.00 ? 599 PHE B CE2 1  
ATOM 8226   C CZ  . PHE B 2 599 ? 120.787 13.970  26.671  1.00 0.00 ? 599 PHE B CZ  1  
ATOM 8227   N N   . TYR B 2 600 ? 120.690 19.625  31.098  1.00 0.00 ? 600 TYR B N   1  
ATOM 8228   C CA  . TYR B 2 600 ? 121.136 20.764  31.865  1.00 0.00 ? 600 TYR B CA  1  
ATOM 8229   C C   . TYR B 2 600 ? 120.784 20.736  33.265  1.00 0.00 ? 600 TYR B C   1  
ATOM 8230   O O   . TYR B 2 600 ? 121.592 20.916  34.122  1.00 0.00 ? 600 TYR B O   1  
ATOM 8231   C CB  . TYR B 2 600 ? 120.714 22.180  31.321  1.00 0.00 ? 600 TYR B CB  1  
ATOM 8232   C CG  . TYR B 2 600 ? 121.272 22.443  29.839  1.00 0.00 ? 600 TYR B CG  1  
ATOM 8233   C CD1 . TYR B 2 600 ? 122.612 22.405  29.529  1.00 0.00 ? 600 TYR B CD1 1  
ATOM 8234   C CD2 . TYR B 2 600 ? 120.320 22.758  28.852  1.00 0.00 ? 600 TYR B CD2 1  
ATOM 8235   C CE1 . TYR B 2 600 ? 122.940 22.789  28.266  1.00 0.00 ? 600 TYR B CE1 1  
ATOM 8236   C CE2 . TYR B 2 600 ? 120.688 22.981  27.523  1.00 0.00 ? 600 TYR B CE2 1  
ATOM 8237   C CZ  . TYR B 2 600 ? 122.045 22.945  27.214  1.00 0.00 ? 600 TYR B CZ  1  
ATOM 8238   O OH  . TYR B 2 600 ? 122.439 23.208  25.933  1.00 0.00 ? 600 TYR B OH  1  
ATOM 8239   N N   . GLN B 2 601 ? 119.454 20.414  33.508  1.00 0.00 ? 601 GLN B N   1  
ATOM 8240   C CA  . GLN B 2 601 ? 119.069 20.438  34.954  1.00 0.00 ? 601 GLN B CA  1  
ATOM 8241   C C   . GLN B 2 601 ? 119.752 19.481  35.824  1.00 0.00 ? 601 GLN B C   1  
ATOM 8242   O O   . GLN B 2 601 ? 120.237 19.913  36.869  1.00 0.00 ? 601 GLN B O   1  
ATOM 8243   C CB  . GLN B 2 601 ? 117.572 20.378  35.232  1.00 0.00 ? 601 GLN B CB  1  
ATOM 8244   C CG  . GLN B 2 601 ? 116.809 19.257  34.606  1.00 0.00 ? 601 GLN B CG  1  
ATOM 8245   C CD  . GLN B 2 601 ? 115.311 19.459  34.734  1.00 0.00 ? 601 GLN B CD  1  
ATOM 8246   O OE1 . GLN B 2 601 ? 114.718 20.132  33.910  1.00 0.00 ? 601 GLN B OE1 1  
ATOM 8247   N NE2 . GLN B 2 601 ? 114.675 18.852  35.808  1.00 0.00 ? 601 GLN B NE2 1  
ATOM 8248   N N   . LYS B 2 602 ? 119.952 18.237  35.419  1.00 0.00 ? 602 LYS B N   1  
ATOM 8249   C CA  . LYS B 2 602 ? 120.650 17.327  36.242  1.00 0.00 ? 602 LYS B CA  1  
ATOM 8250   C C   . LYS B 2 602 ? 122.154 17.650  36.445  1.00 0.00 ? 602 LYS B C   1  
ATOM 8251   O O   . LYS B 2 602 ? 122.680 17.471  37.549  1.00 0.00 ? 602 LYS B O   1  
ATOM 8252   C CB  . LYS B 2 602 ? 120.456 15.881  35.842  1.00 0.00 ? 602 LYS B CB  1  
ATOM 8253   C CG  . LYS B 2 602 ? 120.660 15.417  34.359  1.00 0.00 ? 602 LYS B CG  1  
ATOM 8254   C CD  . LYS B 2 602 ? 121.080 13.949  34.162  1.00 0.00 ? 602 LYS B CD  1  
ATOM 8255   C CE  . LYS B 2 602 ? 121.487 13.577  32.765  1.00 0.00 ? 602 LYS B CE  1  
ATOM 8256   N NZ  . LYS B 2 602 ? 122.673 14.329  32.233  1.00 0.00 ? 602 LYS B NZ  1  
ATOM 8257   N N   . GLU B 2 603 ? 122.826 18.144  35.349  1.00 0.00 ? 603 GLU B N   1  
ATOM 8258   C CA  . GLU B 2 603 ? 124.233 18.469  35.370  1.00 0.00 ? 603 GLU B CA  1  
ATOM 8259   C C   . GLU B 2 603 ? 124.620 19.529  36.307  1.00 0.00 ? 603 GLU B C   1  
ATOM 8260   O O   . GLU B 2 603 ? 125.575 19.445  37.042  1.00 0.00 ? 603 GLU B O   1  
ATOM 8261   C CB  . GLU B 2 603 ? 124.820 18.665  33.961  1.00 0.00 ? 603 GLU B CB  1  
ATOM 8262   C CG  . GLU B 2 603 ? 124.899 17.408  33.124  1.00 0.00 ? 603 GLU B CG  1  
ATOM 8263   C CD  . GLU B 2 603 ? 125.461 16.196  33.867  1.00 0.00 ? 603 GLU B CD  1  
ATOM 8264   O OE1 . GLU B 2 603 ? 126.697 16.148  34.152  1.00 0.00 ? 603 GLU B OE1 1  
ATOM 8265   O OE2 . GLU B 2 603 ? 124.652 15.268  34.204  1.00 0.00 ? 603 GLU B OE2 1  
ATOM 8266   N N   . MET B 2 604 ? 123.794 20.593  36.263  1.00 0.00 ? 604 MET B N   1  
ATOM 8267   C CA  . MET B 2 604 ? 123.930 21.717  37.167  1.00 0.00 ? 604 MET B CA  1  
ATOM 8268   C C   . MET B 2 604 ? 123.593 21.230  38.556  1.00 0.00 ? 604 MET B C   1  
ATOM 8269   O O   . MET B 2 604 ? 124.278 21.581  39.493  1.00 0.00 ? 604 MET B O   1  
ATOM 8270   C CB  . MET B 2 604 ? 123.020 22.872  36.808  1.00 0.00 ? 604 MET B CB  1  
ATOM 8271   C CG  . MET B 2 604 ? 123.567 23.788  35.683  1.00 0.00 ? 604 MET B CG  1  
ATOM 8272   S SD  . MET B 2 604 ? 124.116 22.981  34.162  1.00 0.00 ? 604 MET B SD  1  
ATOM 8273   C CE  . MET B 2 604 ? 123.513 24.230  32.956  1.00 0.00 ? 604 MET B CE  1  
ATOM 8274   N N   . LEU B 2 605 ? 122.475 20.395  38.732  1.00 0.00 ? 605 LEU B N   1  
ATOM 8275   C CA  . LEU B 2 605 ? 122.031 20.087  40.033  1.00 0.00 ? 605 LEU B CA  1  
ATOM 8276   C C   . LEU B 2 605 ? 123.076 19.383  40.832  1.00 0.00 ? 605 LEU B C   1  
ATOM 8277   O O   . LEU B 2 605 ? 123.227 19.658  42.060  1.00 0.00 ? 605 LEU B O   1  
ATOM 8278   C CB  . LEU B 2 605 ? 120.784 19.229  39.989  1.00 0.00 ? 605 LEU B CB  1  
ATOM 8279   C CG  . LEU B 2 605 ? 120.160 18.532  41.278  1.00 0.00 ? 605 LEU B CG  1  
ATOM 8280   C CD1 . LEU B 2 605 ? 120.791 17.153  41.643  1.00 0.00 ? 605 LEU B CD1 1  
ATOM 8281   C CD2 . LEU B 2 605 ? 120.074 19.478  42.530  1.00 0.00 ? 605 LEU B CD2 1  
ATOM 8282   N N   . LYS B 2 606 ? 123.811 18.442  40.204  1.00 0.00 ? 606 LYS B N   1  
ATOM 8283   C CA  . LYS B 2 606 ? 124.859 17.731  40.928  1.00 0.00 ? 606 LYS B CA  1  
ATOM 8284   C C   . LYS B 2 606 ? 125.921 18.649  41.536  1.00 0.00 ? 606 LYS B C   1  
ATOM 8285   O O   . LYS B 2 606 ? 126.285 18.427  42.663  1.00 0.00 ? 606 LYS B O   1  
ATOM 8286   C CB  . LYS B 2 606 ? 125.628 16.765  39.992  1.00 0.00 ? 606 LYS B CB  1  
ATOM 8287   C CG  . LYS B 2 606 ? 124.718 15.658  39.499  1.00 0.00 ? 606 LYS B CG  1  
ATOM 8288   C CD  . LYS B 2 606 ? 125.173 15.140  38.055  1.00 0.00 ? 606 LYS B CD  1  
ATOM 8289   C CE  . LYS B 2 606 ? 124.228 14.100  37.371  1.00 0.00 ? 606 LYS B CE  1  
ATOM 8290   N NZ  . LYS B 2 606 ? 123.899 12.966  38.302  1.00 0.00 ? 606 LYS B NZ  1  
ATOM 8291   N N   . SER B 2 607 ? 126.325 19.637  40.816  1.00 0.00 ? 607 SER B N   1  
ATOM 8292   C CA  . SER B 2 607 ? 127.334 20.570  41.224  1.00 0.00 ? 607 SER B CA  1  
ATOM 8293   C C   . SER B 2 607 ? 126.885 21.498  42.344  1.00 0.00 ? 607 SER B C   1  
ATOM 8294   O O   . SER B 2 607 ? 127.726 21.903  43.172  1.00 0.00 ? 607 SER B O   1  
ATOM 8295   C CB  . SER B 2 607 ? 127.915 21.341  39.996  1.00 0.00 ? 607 SER B CB  1  
ATOM 8296   O OG  . SER B 2 607 ? 128.610 20.532  39.025  1.00 0.00 ? 607 SER B OG  1  
ATOM 8297   N N   . ASN B 2 608 ? 125.600 21.850  42.457  1.00 0.00 ? 608 ASN B N   1  
ATOM 8298   C CA  . ASN B 2 608 ? 124.956 22.725  43.425  1.00 0.00 ? 608 ASN B CA  1  
ATOM 8299   C C   . ASN B 2 608 ? 124.981 22.062  44.764  1.00 0.00 ? 608 ASN B C   1  
ATOM 8300   O O   . ASN B 2 608 ? 125.282 22.714  45.805  1.00 0.00 ? 608 ASN B O   1  
ATOM 8301   C CB  . ASN B 2 608 ? 123.604 23.272  43.089  1.00 0.00 ? 608 ASN B CB  1  
ATOM 8302   C CG  . ASN B 2 608 ? 123.473 23.995  41.710  1.00 0.00 ? 608 ASN B CG  1  
ATOM 8303   O OD1 . ASN B 2 608 ? 124.084 25.053  41.548  1.00 0.00 ? 608 ASN B OD1 1  
ATOM 8304   N ND2 . ASN B 2 608 ? 122.638 23.501  40.832  1.00 0.00 ? 608 ASN B ND2 1  
ATOM 8305   N N   . ASP B 2 609 ? 124.892 20.712  44.726  1.00 0.00 ? 609 ASP B N   1  
ATOM 8306   C CA  . ASP B 2 609 ? 124.903 19.954  45.971  1.00 0.00 ? 609 ASP B CA  1  
ATOM 8307   C C   . ASP B 2 609 ? 126.269 19.912  46.521  1.00 0.00 ? 609 ASP B C   1  
ATOM 8308   O O   . ASP B 2 609 ? 127.270 19.749  45.822  1.00 0.00 ? 609 ASP B O   1  
ATOM 8309   C CB  . ASP B 2 609 ? 124.403 18.502  45.902  1.00 0.00 ? 609 ASP B CB  1  
ATOM 8310   C CG  . ASP B 2 609 ? 122.998 18.387  45.245  1.00 0.00 ? 609 ASP B CG  1  
ATOM 8311   O OD1 . ASP B 2 609 ? 122.013 18.644  45.984  1.00 0.00 ? 609 ASP B OD1 1  
ATOM 8312   O OD2 . ASP B 2 609 ? 122.981 17.821  44.116  1.00 0.00 ? 609 ASP B OD2 1  
ATOM 8313   N N   . ILE B 2 610 ? 126.254 20.158  47.879  1.00 0.00 ? 610 ILE B N   1  
ATOM 8314   C CA  . ILE B 2 610 ? 127.488 20.175  48.642  1.00 0.00 ? 610 ILE B CA  1  
ATOM 8315   C C   . ILE B 2 610 ? 128.161 18.877  48.723  1.00 0.00 ? 610 ILE B C   1  
ATOM 8316   O O   . ILE B 2 610 ? 127.524 17.827  48.589  1.00 0.00 ? 610 ILE B O   1  
ATOM 8317   C CB  . ILE B 2 610 ? 127.271 20.790  50.052  1.00 0.00 ? 610 ILE B CB  1  
ATOM 8318   C CG1 . ILE B 2 610 ? 126.287 19.932  50.810  1.00 0.00 ? 610 ILE B CG1 1  
ATOM 8319   C CG2 . ILE B 2 610 ? 126.788 22.268  49.864  1.00 0.00 ? 610 ILE B CG2 1  
ATOM 8320   C CD1 . ILE B 2 610 ? 125.982 20.433  52.232  1.00 0.00 ? 610 ILE B CD1 1  
ATOM 8321   N N   . ILE B 2 611 ? 129.497 18.924  48.920  1.00 0.00 ? 611 ILE B N   1  
ATOM 8322   C CA  . ILE B 2 611 ? 130.328 17.698  48.892  1.00 0.00 ? 611 ILE B CA  1  
ATOM 8323   C C   . ILE B 2 611 ? 130.527 17.194  47.480  1.00 0.00 ? 611 ILE B C   1  
ATOM 8324   O O   . ILE B 2 611 ? 130.026 16.098  47.181  1.00 0.00 ? 611 ILE B O   1  
ATOM 8325   C CB  . ILE B 2 611 ? 130.121 16.702  50.007  1.00 0.00 ? 611 ILE B CB  1  
ATOM 8326   C CG1 . ILE B 2 611 ? 129.874 17.501  51.296  1.00 0.00 ? 611 ILE B CG1 1  
ATOM 8327   C CG2 . ILE B 2 611 ? 131.454 15.869  50.227  1.00 0.00 ? 611 ILE B CG2 1  
ATOM 8328   C CD1 . ILE B 2 611 ? 129.642 16.628  52.541  1.00 0.00 ? 611 ILE B CD1 1  
ATOM 8329   N N   . ARG B 2 612 ? 131.303 17.818  46.552  1.00 0.00 ? 612 ARG B N   1  
ATOM 8330   C CA  . ARG B 2 612 ? 131.555 17.144  45.222  1.00 0.00 ? 612 ARG B CA  1  
ATOM 8331   C C   . ARG B 2 612 ? 132.895 17.682  44.734  1.00 0.00 ? 612 ARG B C   1  
ATOM 8332   O O   . ARG B 2 612 ? 133.498 18.516  45.461  1.00 0.00 ? 612 ARG B O   1  
ATOM 8333   C CB  . ARG B 2 612 ? 130.497 17.445  44.173  1.00 0.00 ? 612 ARG B CB  1  
ATOM 8334   C CG  . ARG B 2 612 ? 130.647 16.418  43.031  1.00 0.00 ? 612 ARG B CG  1  
ATOM 8335   C CD  . ARG B 2 612 ? 129.764 16.815  41.891  1.00 0.00 ? 612 ARG B CD  1  
ATOM 8336   N NE  . ARG B 2 612 ? 129.787 15.768  40.811  1.00 0.00 ? 612 ARG B NE  1  
ATOM 8337   C CZ  . ARG B 2 612 ? 129.625 15.997  39.493  1.00 0.00 ? 612 ARG B CZ  1  
ATOM 8338   N NH1 . ARG B 2 612 ? 129.816 17.210  38.934  1.00 0.00 ? 612 ARG B NH1 1  
ATOM 8339   N NH2 . ARG B 2 612 ? 129.317 14.892  38.706  1.00 0.00 ? 612 ARG B NH2 1  
ATOM 8340   N N   . ILE B 2 628 ? 136.246 30.363  47.494  1.00 0.00 ? 628 ILE B N   1  
ATOM 8341   C CA  . ILE B 2 628 ? 136.633 31.699  47.005  1.00 0.00 ? 628 ILE B CA  1  
ATOM 8342   C C   . ILE B 2 628 ? 135.970 32.077  45.726  1.00 0.00 ? 628 ILE B C   1  
ATOM 8343   O O   . ILE B 2 628 ? 134.876 31.565  45.453  1.00 0.00 ? 628 ILE B O   1  
ATOM 8344   C CB  . ILE B 2 628 ? 138.163 31.792  46.970  1.00 0.00 ? 628 ILE B CB  1  
ATOM 8345   C CG1 . ILE B 2 628 ? 138.730 30.773  45.977  1.00 0.00 ? 628 ILE B CG1 1  
ATOM 8346   C CG2 . ILE B 2 628 ? 138.650 31.652  48.459  1.00 0.00 ? 628 ILE B CG2 1  
ATOM 8347   C CD1 . ILE B 2 628 ? 140.264 30.788  45.869  1.00 0.00 ? 628 ILE B CD1 1  
ATOM 8348   N N   . ASN B 2 629 ? 136.556 33.099  45.001  1.00 0.00 ? 629 ASN B N   1  
ATOM 8349   C CA  . ASN B 2 629 ? 136.045 33.713  43.783  1.00 0.00 ? 629 ASN B CA  1  
ATOM 8350   C C   . ASN B 2 629 ? 136.014 32.767  42.624  1.00 0.00 ? 629 ASN B C   1  
ATOM 8351   O O   . ASN B 2 629 ? 135.168 32.834  41.764  1.00 0.00 ? 629 ASN B O   1  
ATOM 8352   C CB  . ASN B 2 629 ? 136.962 34.872  43.147  1.00 0.00 ? 629 ASN B CB  1  
ATOM 8353   C CG  . ASN B 2 629 ? 136.976 36.146  43.949  1.00 0.00 ? 629 ASN B CG  1  
ATOM 8354   O OD1 . ASN B 2 629 ? 136.609 36.202  45.102  1.00 0.00 ? 629 ASN B OD1 1  
ATOM 8355   N ND2 . ASN B 2 629 ? 137.458 37.225  43.282  1.00 0.00 ? 629 ASN B ND2 1  
ATOM 8356   N N   . LYS B 2 630 ? 136.870 31.725  42.495  1.00 0.00 ? 630 LYS B N   1  
ATOM 8357   C CA  . LYS B 2 630 ? 136.729 30.730  41.373  1.00 0.00 ? 630 LYS B CA  1  
ATOM 8358   C C   . LYS B 2 630 ? 135.340 30.050  41.485  1.00 0.00 ? 630 LYS B C   1  
ATOM 8359   O O   . LYS B 2 630 ? 134.566 30.003  40.511  1.00 0.00 ? 630 LYS B O   1  
ATOM 8360   C CB  . LYS B 2 630 ? 137.914 29.741  41.486  1.00 0.00 ? 630 LYS B CB  1  
ATOM 8361   C CG  . LYS B 2 630 ? 139.263 30.362  41.185  1.00 0.00 ? 630 LYS B CG  1  
ATOM 8362   C CD  . LYS B 2 630 ? 140.452 29.352  41.126  1.00 0.00 ? 630 LYS B CD  1  
ATOM 8363   C CE  . LYS B 2 630 ? 141.752 30.111  41.270  1.00 0.00 ? 630 LYS B CE  1  
ATOM 8364   N NZ  . LYS B 2 630 ? 142.827 29.187  40.843  1.00 0.00 ? 630 LYS B NZ  1  
ATOM 8365   N N   . LEU B 2 631 ? 134.982 29.702  42.761  1.00 0.00 ? 631 LEU B N   1  
ATOM 8366   C CA  . LEU B 2 631 ? 133.758 29.169  43.181  1.00 0.00 ? 631 LEU B CA  1  
ATOM 8367   C C   . LEU B 2 631 ? 132.737 30.263  43.017  1.00 0.00 ? 631 LEU B C   1  
ATOM 8368   O O   . LEU B 2 631 ? 133.136 31.399  42.970  1.00 0.00 ? 631 LEU B O   1  
ATOM 8369   C CB  . LEU B 2 631 ? 133.822 28.649  44.659  1.00 0.00 ? 631 LEU B CB  1  
ATOM 8370   C CG  . LEU B 2 631 ? 134.417 27.230  44.852  1.00 0.00 ? 631 LEU B CG  1  
ATOM 8371   C CD1 . LEU B 2 631 ? 133.754 26.084  44.217  1.00 0.00 ? 631 LEU B CD1 1  
ATOM 8372   C CD2 . LEU B 2 631 ? 135.931 27.230  44.453  1.00 0.00 ? 631 LEU B CD2 1  
ATOM 8373   N N   . SER B 2 632 ? 131.375 29.885  42.928  1.00 0.00 ? 632 SER B N   1  
ATOM 8374   C CA  . SER B 2 632 ? 130.319 30.850  42.888  1.00 0.00 ? 632 SER B CA  1  
ATOM 8375   C C   . SER B 2 632 ? 130.113 31.577  41.553  1.00 0.00 ? 632 SER B C   1  
ATOM 8376   O O   . SER B 2 632 ? 128.942 31.810  41.196  1.00 0.00 ? 632 SER B O   1  
ATOM 8377   C CB  . SER B 2 632 ? 130.436 31.690  44.140  1.00 0.00 ? 632 SER B CB  1  
ATOM 8378   O OG  . SER B 2 632 ? 130.723 30.995  45.392  1.00 0.00 ? 632 SER B OG  1  
ATOM 8379   N N   . ARG B 2 633 ? 131.249 31.967  40.838  1.00 0.00 ? 633 ARG B N   1  
ATOM 8380   C CA  . ARG B 2 633 ? 131.330 32.498  39.511  1.00 0.00 ? 633 ARG B CA  1  
ATOM 8381   C C   . ARG B 2 633 ? 130.989 31.376  38.534  1.00 0.00 ? 633 ARG B C   1  
ATOM 8382   O O   . ARG B 2 633 ? 130.069 31.601  37.687  1.00 0.00 ? 633 ARG B O   1  
ATOM 8383   C CB  . ARG B 2 633 ? 132.765 32.942  39.167  1.00 0.00 ? 633 ARG B CB  1  
ATOM 8384   C CG  . ARG B 2 633 ? 133.137 32.889  37.703  1.00 0.00 ? 633 ARG B CG  1  
ATOM 8385   C CD  . ARG B 2 633 ? 134.425 33.724  37.413  1.00 0.00 ? 633 ARG B CD  1  
ATOM 8386   N NE  . ARG B 2 633 ? 135.558 33.364  38.331  1.00 0.00 ? 633 ARG B NE  1  
ATOM 8387   C CZ  . ARG B 2 633 ? 136.640 34.172  38.578  1.00 0.00 ? 633 ARG B CZ  1  
ATOM 8388   N NH1 . ARG B 2 633 ? 136.853 35.416  38.033  1.00 0.00 ? 633 ARG B NH1 1  
ATOM 8389   N NH2 . ARG B 2 633 ? 137.464 33.763  39.562  1.00 0.00 ? 633 ARG B NH2 1  
ATOM 8390   N N   . ILE B 2 634 ? 131.527 30.181  38.713  1.00 0.00 ? 634 ILE B N   1  
ATOM 8391   C CA  . ILE B 2 634 ? 131.180 29.005  37.934  1.00 0.00 ? 634 ILE B CA  1  
ATOM 8392   C C   . ILE B 2 634 ? 129.665 28.656  38.178  1.00 0.00 ? 634 ILE B C   1  
ATOM 8393   O O   . ILE B 2 634 ? 128.902 28.386  37.237  1.00 0.00 ? 634 ILE B O   1  
ATOM 8394   C CB  . ILE B 2 634 ? 132.264 27.845  38.019  1.00 0.00 ? 634 ILE B CB  1  
ATOM 8395   C CG1 . ILE B 2 634 ? 132.175 26.789  36.907  1.00 0.00 ? 634 ILE B CG1 1  
ATOM 8396   C CG2 . ILE B 2 634 ? 132.276 27.208  39.394  1.00 0.00 ? 634 ILE B CG2 1  
ATOM 8397   C CD1 . ILE B 2 634 ? 133.233 25.678  37.010  1.00 0.00 ? 634 ILE B CD1 1  
ATOM 8398   N N   . SER B 2 635 ? 129.248 28.807  39.490  1.00 0.00 ? 635 SER B N   1  
ATOM 8399   C CA  . SER B 2 635 ? 127.915 28.509  39.898  1.00 0.00 ? 635 SER B CA  1  
ATOM 8400   C C   . SER B 2 635 ? 126.791 29.433  39.301  1.00 0.00 ? 635 SER B C   1  
ATOM 8401   O O   . SER B 2 635 ? 125.769 28.914  38.845  1.00 0.00 ? 635 SER B O   1  
ATOM 8402   C CB  . SER B 2 635 ? 127.660 28.561  41.398  1.00 0.00 ? 635 SER B CB  1  
ATOM 8403   O OG  . SER B 2 635 ? 128.577 27.776  42.147  1.00 0.00 ? 635 SER B OG  1  
ATOM 8404   N N   . ILE B 2 636 ? 127.002 30.772  39.270  1.00 0.00 ? 636 ILE B N   1  
ATOM 8405   C CA  . ILE B 2 636 ? 125.954 31.588  38.728  1.00 0.00 ? 636 ILE B CA  1  
ATOM 8406   C C   . ILE B 2 636 ? 125.739 31.360  37.242  1.00 0.00 ? 636 ILE B C   1  
ATOM 8407   O O   . ILE B 2 636 ? 124.638 31.235  36.719  1.00 0.00 ? 636 ILE B O   1  
ATOM 8408   C CB  . ILE B 2 636 ? 126.027 33.070  39.146  1.00 0.00 ? 636 ILE B CB  1  
ATOM 8409   C CG1 . ILE B 2 636 ? 124.817 33.904  38.919  1.00 0.00 ? 636 ILE B CG1 1  
ATOM 8410   C CG2 . ILE B 2 636 ? 127.393 33.673  38.640  1.00 0.00 ? 636 ILE B CG2 1  
ATOM 8411   C CD1 . ILE B 2 636 ? 124.972 35.369  39.363  1.00 0.00 ? 636 ILE B CD1 1  
ATOM 8412   N N   . LEU B 2 637 ? 126.850 31.237  36.435  1.00 0.00 ? 637 LEU B N   1  
ATOM 8413   C CA  . LEU B 2 637 ? 126.817 31.155  35.011  1.00 0.00 ? 637 LEU B CA  1  
ATOM 8414   C C   . LEU B 2 637 ? 126.032 29.920  34.617  1.00 0.00 ? 637 LEU B C   1  
ATOM 8415   O O   . LEU B 2 637 ? 125.119 29.988  33.813  1.00 0.00 ? 637 LEU B O   1  
ATOM 8416   C CB  . LEU B 2 637 ? 128.235 31.132  34.544  1.00 0.00 ? 637 LEU B CB  1  
ATOM 8417   C CG  . LEU B 2 637 ? 128.779 32.517  34.180  1.00 0.00 ? 637 LEU B CG  1  
ATOM 8418   C CD1 . LEU B 2 637 ? 128.014 33.108  32.924  1.00 0.00 ? 637 LEU B CD1 1  
ATOM 8419   C CD2 . LEU B 2 637 ? 128.839 33.609  35.231  1.00 0.00 ? 637 LEU B CD2 1  
ATOM 8420   N N   . ARG B 2 638 ? 126.336 28.765  35.282  1.00 0.00 ? 638 ARG B N   1  
ATOM 8421   C CA  . ARG B 2 638 ? 125.660 27.520  34.990  1.00 0.00 ? 638 ARG B CA  1  
ATOM 8422   C C   . ARG B 2 638 ? 124.164 27.511  35.284  1.00 0.00 ? 638 ARG B C   1  
ATOM 8423   O O   . ARG B 2 638 ? 123.348 27.011  34.495  1.00 0.00 ? 638 ARG B O   1  
ATOM 8424   C CB  . ARG B 2 638 ? 126.275 26.343  35.703  1.00 0.00 ? 638 ARG B CB  1  
ATOM 8425   C CG  . ARG B 2 638 ? 126.174 26.316  37.217  1.00 0.00 ? 638 ARG B CG  1  
ATOM 8426   C CD  . ARG B 2 638 ? 126.670 24.954  37.827  1.00 0.00 ? 638 ARG B CD  1  
ATOM 8427   N NE  . ARG B 2 638 ? 126.317 25.051  39.293  1.00 0.00 ? 638 ARG B NE  1  
ATOM 8428   C CZ  . ARG B 2 638 ? 127.368 25.141  40.217  1.00 0.00 ? 638 ARG B CZ  1  
ATOM 8429   N NH1 . ARG B 2 638 ? 128.664 25.271  39.875  1.00 0.00 ? 638 ARG B NH1 1  
ATOM 8430   N NH2 . ARG B 2 638 ? 127.058 25.091  41.580  1.00 0.00 ? 638 ARG B NH2 1  
ATOM 8431   N N   . THR B 2 639 ? 123.802 28.114  36.442  1.00 0.00 ? 639 THR B N   1  
ATOM 8432   C CA  . THR B 2 639 ? 122.455 28.218  36.900  1.00 0.00 ? 639 THR B CA  1  
ATOM 8433   C C   . THR B 2 639 ? 121.681 29.156  35.965  1.00 0.00 ? 639 THR B C   1  
ATOM 8434   O O   . THR B 2 639 ? 120.548 28.858  35.789  1.00 0.00 ? 639 THR B O   1  
ATOM 8435   C CB  . THR B 2 639 ? 122.163 28.531  38.382  1.00 0.00 ? 639 THR B CB  1  
ATOM 8436   O OG1 . THR B 2 639 ? 122.902 29.631  38.816  1.00 0.00 ? 639 THR B OG1 1  
ATOM 8437   C CG2 . THR B 2 639 ? 122.523 27.365  39.220  1.00 0.00 ? 639 THR B CG2 1  
ATOM 8438   N N   . GLN B 2 640 ? 122.277 30.268  35.487  1.00 0.00 ? 640 GLN B N   1  
ATOM 8439   C CA  . GLN B 2 640 ? 121.704 31.346  34.704  1.00 0.00 ? 640 GLN B CA  1  
ATOM 8440   C C   . GLN B 2 640 ? 121.226 30.707  33.485  1.00 0.00 ? 640 GLN B C   1  
ATOM 8441   O O   . GLN B 2 640 ? 120.095 30.892  33.105  1.00 0.00 ? 640 GLN B O   1  
ATOM 8442   C CB  . GLN B 2 640 ? 122.691 32.480  34.232  1.00 0.00 ? 640 GLN B CB  1  
ATOM 8443   C CG  . GLN B 2 640 ? 123.100 33.573  35.286  1.00 0.00 ? 640 GLN B CG  1  
ATOM 8444   C CD  . GLN B 2 640 ? 123.854 34.730  34.576  1.00 0.00 ? 640 GLN B CD  1  
ATOM 8445   O OE1 . GLN B 2 640 ? 123.170 35.455  33.850  1.00 0.00 ? 640 GLN B OE1 1  
ATOM 8446   N NE2 . GLN B 2 640 ? 125.158 34.844  34.778  1.00 0.00 ? 640 GLN B NE2 1  
ATOM 8447   N N   . PHE B 2 641 ? 122.051 29.891  32.814  1.00 0.00 ? 641 PHE B N   1  
ATOM 8448   C CA  . PHE B 2 641 ? 121.689 29.262  31.554  1.00 0.00 ? 641 PHE B CA  1  
ATOM 8449   C C   . PHE B 2 641 ? 120.565 28.282  31.691  1.00 0.00 ? 641 PHE B C   1  
ATOM 8450   O O   . PHE B 2 641 ? 119.723 28.198  30.766  1.00 0.00 ? 641 PHE B O   1  
ATOM 8451   C CB  . PHE B 2 641 ? 122.905 28.498  30.925  1.00 0.00 ? 641 PHE B CB  1  
ATOM 8452   C CG  . PHE B 2 641 ? 123.499 29.411  29.897  1.00 0.00 ? 641 PHE B CG  1  
ATOM 8453   C CD1 . PHE B 2 641 ? 122.726 29.467  28.687  1.00 0.00 ? 641 PHE B CD1 1  
ATOM 8454   C CD2 . PHE B 2 641 ? 124.703 30.150  30.111  1.00 0.00 ? 641 PHE B CD2 1  
ATOM 8455   C CE1 . PHE B 2 641 ? 123.168 30.361  27.720  1.00 0.00 ? 641 PHE B CE1 1  
ATOM 8456   C CE2 . PHE B 2 641 ? 125.180 30.906  29.045  1.00 0.00 ? 641 PHE B CE2 1  
ATOM 8457   C CZ  . PHE B 2 641 ? 124.382 31.033  27.903  1.00 0.00 ? 641 PHE B CZ  1  
ATOM 8458   N N   . GLN B 2 642 ? 120.489 27.490  32.809  1.00 0.00 ? 642 GLN B N   1  
ATOM 8459   C CA  . GLN B 2 642 ? 119.403 26.499  33.000  1.00 0.00 ? 642 GLN B CA  1  
ATOM 8460   C C   . GLN B 2 642 ? 118.085 27.279  33.155  1.00 0.00 ? 642 GLN B C   1  
ATOM 8461   O O   . GLN B 2 642 ? 117.051 26.791  32.728  1.00 0.00 ? 642 GLN B O   1  
ATOM 8462   C CB  . GLN B 2 642 ? 119.667 25.678  34.219  1.00 0.00 ? 642 GLN B CB  1  
ATOM 8463   C CG  . GLN B 2 642 ? 118.617 24.684  34.706  1.00 0.00 ? 642 GLN B CG  1  
ATOM 8464   C CD  . GLN B 2 642 ? 117.752 23.965  33.613  1.00 0.00 ? 642 GLN B CD  1  
ATOM 8465   O OE1 . GLN B 2 642 ? 118.249 23.809  32.481  1.00 0.00 ? 642 GLN B OE1 1  
ATOM 8466   N NE2 . GLN B 2 642 ? 116.562 23.528  33.990  1.00 0.00 ? 642 GLN B NE2 1  
ATOM 8467   N N   . GLN B 2 643 ? 118.120 28.470  33.788  1.00 0.00 ? 643 GLN B N   1  
ATOM 8468   C CA  . GLN B 2 643 ? 116.946 29.243  34.058  1.00 0.00 ? 643 GLN B CA  1  
ATOM 8469   C C   . GLN B 2 643 ? 116.298 29.733  32.742  1.00 0.00 ? 643 GLN B C   1  
ATOM 8470   O O   . GLN B 2 643 ? 115.046 29.684  32.596  1.00 0.00 ? 643 GLN B O   1  
ATOM 8471   C CB  . GLN B 2 643 ? 117.190 30.527  34.926  1.00 0.00 ? 643 GLN B CB  1  
ATOM 8472   C CG  . GLN B 2 643 ? 117.573 30.266  36.393  1.00 0.00 ? 643 GLN B CG  1  
ATOM 8473   C CD  . GLN B 2 643 ? 118.441 31.436  36.856  1.00 0.00 ? 643 GLN B CD  1  
ATOM 8474   O OE1 . GLN B 2 643 ? 118.442 32.435  36.104  1.00 0.00 ? 643 GLN B OE1 1  
ATOM 8475   N NE2 . GLN B 2 643 ? 119.213 31.464  37.943  1.00 0.00 ? 643 GLN B NE2 1  
ATOM 8476   N N   . PHE B 2 644 ? 117.244 30.166  31.902  1.00 0.00 ? 644 PHE B N   1  
ATOM 8477   C CA  . PHE B 2 644 ? 116.971 30.761  30.603  1.00 0.00 ? 644 PHE B CA  1  
ATOM 8478   C C   . PHE B 2 644 ? 116.265 29.773  29.752  1.00 0.00 ? 644 PHE B C   1  
ATOM 8479   O O   . PHE B 2 644 ? 115.145 30.064  29.386  1.00 0.00 ? 644 PHE B O   1  
ATOM 8480   C CB  . PHE B 2 644 ? 118.270 31.090  29.802  1.00 0.00 ? 644 PHE B CB  1  
ATOM 8481   C CG  . PHE B 2 644 ? 119.192 32.147  30.313  1.00 0.00 ? 644 PHE B CG  1  
ATOM 8482   C CD1 . PHE B 2 644 ? 118.814 33.027  31.370  1.00 0.00 ? 644 PHE B CD1 1  
ATOM 8483   C CD2 . PHE B 2 644 ? 120.523 32.273  29.865  1.00 0.00 ? 644 PHE B CD2 1  
ATOM 8484   C CE1 . PHE B 2 644 ? 119.674 34.045  31.848  1.00 0.00 ? 644 PHE B CE1 1  
ATOM 8485   C CE2 . PHE B 2 644 ? 121.383 33.280  30.399  1.00 0.00 ? 644 PHE B CE2 1  
ATOM 8486   C CZ  . PHE B 2 644 ? 120.970 34.110  31.396  1.00 0.00 ? 644 PHE B CZ  1  
ATOM 8487   N N   . ASN B 2 645 ? 116.785 28.499  29.633  1.00 0.00 ? 645 ASN B N   1  
ATOM 8488   C CA  . ASN B 2 645 ? 116.133 27.456  28.895  1.00 0.00 ? 645 ASN B CA  1  
ATOM 8489   C C   . ASN B 2 645 ? 114.753 27.125  29.462  1.00 0.00 ? 645 ASN B C   1  
ATOM 8490   O O   . ASN B 2 645 ? 113.817 26.947  28.710  1.00 0.00 ? 645 ASN B O   1  
ATOM 8491   C CB  . ASN B 2 645 ? 116.909 26.136  28.842  1.00 0.00 ? 645 ASN B CB  1  
ATOM 8492   C CG  . ASN B 2 645 ? 118.242 26.445  28.219  1.00 0.00 ? 645 ASN B CG  1  
ATOM 8493   O OD1 . ASN B 2 645 ? 118.277 27.086  27.156  1.00 0.00 ? 645 ASN B OD1 1  
ATOM 8494   N ND2 . ASN B 2 645 ? 119.395 25.985  28.761  1.00 0.00 ? 645 ASN B ND2 1  
ATOM 8495   N N   . SER B 2 646 ? 114.530 27.043  30.793  1.00 0.00 ? 646 SER B N   1  
ATOM 8496   C CA  . SER B 2 646 ? 113.254 26.713  31.406  1.00 0.00 ? 646 SER B CA  1  
ATOM 8497   C C   . SER B 2 646 ? 112.146 27.726  31.093  1.00 0.00 ? 646 SER B C   1  
ATOM 8498   O O   . SER B 2 646 ? 111.036 27.267  30.806  1.00 0.00 ? 646 SER B O   1  
ATOM 8499   C CB  . SER B 2 646 ? 113.228 26.664  32.985  1.00 0.00 ? 646 SER B CB  1  
ATOM 8500   O OG  . SER B 2 646 ? 114.308 26.032  33.583  1.00 0.00 ? 646 SER B OG  1  
ATOM 8501   N N   . LYS B 2 647 ? 112.375 29.129  31.029  1.00 0.00 ? 647 LYS B N   1  
ATOM 8502   C CA  . LYS B 2 647 ? 111.444 30.132  30.734  1.00 0.00 ? 647 LYS B CA  1  
ATOM 8503   C C   . LYS B 2 647 ? 111.014 30.003  29.335  1.00 0.00 ? 647 LYS B C   1  
ATOM 8504   O O   . LYS B 2 647 ? 109.777 30.081  29.108  1.00 0.00 ? 647 LYS B O   1  
ATOM 8505   C CB  . LYS B 2 647 ? 112.065 31.567  30.849  1.00 0.00 ? 647 LYS B CB  1  
ATOM 8506   C CG  . LYS B 2 647 ? 112.301 32.206  32.246  1.00 0.00 ? 647 LYS B CG  1  
ATOM 8507   C CD  . LYS B 2 647 ? 113.065 33.569  32.114  1.00 0.00 ? 647 LYS B CD  1  
ATOM 8508   C CE  . LYS B 2 647 ? 114.615 33.434  32.052  1.00 0.00 ? 647 LYS B CE  1  
ATOM 8509   N NZ  . LYS B 2 647 ? 115.336 34.788  32.003  1.00 0.00 ? 647 LYS B NZ  1  
ATOM 8510   N N   . MET B 2 648 ? 111.933 29.750  28.405  1.00 0.00 ? 648 MET B N   1  
ATOM 8511   C CA  . MET B 2 648 ? 111.571 29.606  26.999  1.00 0.00 ? 648 MET B CA  1  
ATOM 8512   C C   . MET B 2 648 ? 110.602 28.423  26.744  1.00 0.00 ? 648 MET B C   1  
ATOM 8513   O O   . MET B 2 648 ? 109.634 28.560  26.018  1.00 0.00 ? 648 MET B O   1  
ATOM 8514   C CB  . MET B 2 648 ? 112.855 29.537  26.080  1.00 0.00 ? 648 MET B CB  1  
ATOM 8515   C CG  . MET B 2 648 ? 112.504 29.798  24.620  1.00 0.00 ? 648 MET B CG  1  
ATOM 8516   S SD  . MET B 2 648 ? 113.973 30.024  23.575  1.00 0.00 ? 648 MET B SD  1  
ATOM 8517   C CE  . MET B 2 648 ? 114.809 31.475  24.214  1.00 0.00 ? 648 MET B CE  1  
ATOM 8518   N N   . GLU B 2 649 ? 110.911 27.318  27.376  1.00 0.00 ? 649 GLU B N   1  
ATOM 8519   C CA  . GLU B 2 649 ? 110.165 26.064  27.300  1.00 0.00 ? 649 GLU B CA  1  
ATOM 8520   C C   . GLU B 2 649 ? 108.798 26.196  27.874  1.00 0.00 ? 649 GLU B C   1  
ATOM 8521   O O   . GLU B 2 649 ? 107.845 25.619  27.371  1.00 0.00 ? 649 GLU B O   1  
ATOM 8522   C CB  . GLU B 2 649 ? 111.004 24.821  27.901  1.00 0.00 ? 649 GLU B CB  1  
ATOM 8523   C CG  . GLU B 2 649 ? 112.260 24.532  27.096  1.00 0.00 ? 649 GLU B CG  1  
ATOM 8524   C CD  . GLU B 2 649 ? 111.718 24.036  25.786  1.00 0.00 ? 649 GLU B CD  1  
ATOM 8525   O OE1 . GLU B 2 649 ? 111.257 22.848  25.630  1.00 0.00 ? 649 GLU B OE1 1  
ATOM 8526   O OE2 . GLU B 2 649 ? 111.817 24.847  24.832  1.00 0.00 ? 649 GLU B OE2 1  
ATOM 8527   N N   . SER B 2 650 ? 108.714 26.960  28.989  1.00 0.00 ? 650 SER B N   1  
ATOM 8528   C CA  . SER B 2 650 ? 107.470 27.237  29.718  1.00 0.00 ? 650 SER B CA  1  
ATOM 8529   C C   . SER B 2 650 ? 106.516 27.967  28.798  1.00 0.00 ? 650 SER B C   1  
ATOM 8530   O O   . SER B 2 650 ? 105.348 27.623  28.767  1.00 0.00 ? 650 SER B O   1  
ATOM 8531   C CB  . SER B 2 650 ? 107.731 27.960  31.041  1.00 0.00 ? 650 SER B CB  1  
ATOM 8532   O OG  . SER B 2 650 ? 108.354 27.025  31.980  1.00 0.00 ? 650 SER B OG  1  
ATOM 8533   N N   . TYR B 2 651 ? 106.992 29.059  28.137  1.00 0.00 ? 651 TYR B N   1  
ATOM 8534   C CA  . TYR B 2 651 ? 106.097 29.926  27.397  1.00 0.00 ? 651 TYR B CA  1  
ATOM 8535   C C   . TYR B 2 651 ? 105.575 29.184  26.199  1.00 0.00 ? 651 TYR B C   1  
ATOM 8536   O O   . TYR B 2 651 ? 104.372 29.303  25.866  1.00 0.00 ? 651 TYR B O   1  
ATOM 8537   C CB  . TYR B 2 651 ? 106.765 31.244  26.825  1.00 0.00 ? 651 TYR B CB  1  
ATOM 8538   C CG  . TYR B 2 651 ? 107.500 32.045  27.881  1.00 0.00 ? 651 TYR B CG  1  
ATOM 8539   C CD1 . TYR B 2 651 ? 107.126 32.019  29.220  1.00 0.00 ? 651 TYR B CD1 1  
ATOM 8540   C CD2 . TYR B 2 651 ? 108.584 32.827  27.465  1.00 0.00 ? 651 TYR B CD2 1  
ATOM 8541   C CE1 . TYR B 2 651 ? 107.904 32.627  30.181  1.00 0.00 ? 651 TYR B CE1 1  
ATOM 8542   C CE2 . TYR B 2 651 ? 109.269 33.585  28.440  1.00 0.00 ? 651 TYR B CE2 1  
ATOM 8543   C CZ  . TYR B 2 651 ? 108.946 33.485  29.784  1.00 0.00 ? 651 TYR B CZ  1  
ATOM 8544   O OH  . TYR B 2 651 ? 109.694 34.198  30.725  1.00 0.00 ? 651 TYR B OH  1  
ATOM 8545   N N   . TYR B 2 652 ? 106.375 28.387  25.429  1.00 0.00 ? 652 TYR B N   1  
ATOM 8546   C CA  . TYR B 2 652 ? 105.855 27.697  24.219  1.00 0.00 ? 652 TYR B CA  1  
ATOM 8547   C C   . TYR B 2 652 ? 104.764 26.750  24.590  1.00 0.00 ? 652 TYR B C   1  
ATOM 8548   O O   . TYR B 2 652 ? 103.728 26.709  23.918  1.00 0.00 ? 652 TYR B O   1  
ATOM 8549   C CB  . TYR B 2 652 ? 106.974 26.896  23.600  1.00 0.00 ? 652 TYR B CB  1  
ATOM 8550   C CG  . TYR B 2 652 ? 108.169 27.710  23.228  1.00 0.00 ? 652 TYR B CG  1  
ATOM 8551   C CD1 . TYR B 2 652 ? 108.110 29.051  22.711  1.00 0.00 ? 652 TYR B CD1 1  
ATOM 8552   C CD2 . TYR B 2 652 ? 109.391 26.980  23.076  1.00 0.00 ? 652 TYR B CD2 1  
ATOM 8553   C CE1 . TYR B 2 652 ? 109.147 29.614  22.092  1.00 0.00 ? 652 TYR B CE1 1  
ATOM 8554   C CE2 . TYR B 2 652 ? 110.457 27.568  22.336  1.00 0.00 ? 652 TYR B CE2 1  
ATOM 8555   C CZ  . TYR B 2 652 ? 110.326 28.851  21.860  1.00 0.00 ? 652 TYR B CZ  1  
ATOM 8556   O OH  . TYR B 2 652 ? 111.362 29.507  21.119  1.00 0.00 ? 652 TYR B OH  1  
ATOM 8557   N N   . LEU B 2 653 ? 104.909 25.935  25.692  1.00 0.00 ? 653 LEU B N   1  
ATOM 8558   C CA  . LEU B 2 653 ? 103.915 24.927  26.090  1.00 0.00 ? 653 LEU B CA  1  
ATOM 8559   C C   . LEU B 2 653 ? 102.642 25.573  26.583  1.00 0.00 ? 653 LEU B C   1  
ATOM 8560   O O   . LEU B 2 653 ? 101.591 25.216  26.151  1.00 0.00 ? 653 LEU B O   1  
ATOM 8561   C CB  . LEU B 2 653 ? 104.434 23.885  27.046  1.00 0.00 ? 653 LEU B CB  1  
ATOM 8562   C CG  . LEU B 2 653 ? 105.725 23.220  26.488  1.00 0.00 ? 653 LEU B CG  1  
ATOM 8563   C CD1 . LEU B 2 653 ? 106.497 22.290  27.554  1.00 0.00 ? 653 LEU B CD1 1  
ATOM 8564   C CD2 . LEU B 2 653 ? 105.554 22.397  25.123  1.00 0.00 ? 653 LEU B CD2 1  
ATOM 8565   N N   . ASN B 2 654 ? 102.874 26.511  27.485  1.00 0.00 ? 654 ASN B N   1  
ATOM 8566   C CA  . ASN B 2 654 ? 101.785 27.146  28.167  1.00 0.00 ? 654 ASN B CA  1  
ATOM 8567   C C   . ASN B 2 654 ? 100.985 28.118  27.313  1.00 0.00 ? 654 ASN B C   1  
ATOM 8568   O O   . ASN B 2 654 ? 99.725  28.096  27.267  1.00 0.00 ? 654 ASN B O   1  
ATOM 8569   C CB  . ASN B 2 654 ? 102.301 27.831  29.436  1.00 0.00 ? 654 ASN B CB  1  
ATOM 8570   C CG  . ASN B 2 654 ? 103.040 26.965  30.411  1.00 0.00 ? 654 ASN B CG  1  
ATOM 8571   O OD1 . ASN B 2 654 ? 103.101 25.744  30.381  1.00 0.00 ? 654 ASN B OD1 1  
ATOM 8572   N ND2 . ASN B 2 654 ? 103.546 27.706  31.426  1.00 0.00 ? 654 ASN B ND2 1  
ATOM 8573   N N   . CYS B 2 655 ? 101.733 29.081  26.763  1.00 0.00 ? 655 CYS B N   1  
ATOM 8574   C CA  . CYS B 2 655 ? 101.174 30.270  26.135  1.00 0.00 ? 655 CYS B CA  1  
ATOM 8575   C C   . CYS B 2 655 ? 100.517 29.948  24.805  1.00 0.00 ? 655 CYS B C   1  
ATOM 8576   O O   . CYS B 2 655 ? 99.474  30.502  24.459  1.00 0.00 ? 655 CYS B O   1  
ATOM 8577   C CB  . CYS B 2 655 ? 102.222 31.413  25.940  1.00 0.00 ? 655 CYS B CB  1  
ATOM 8578   S SG  . CYS B 2 655 ? 101.472 33.067  25.600  1.00 0.00 ? 655 CYS B SG  1  
ATOM 8579   N N   . ILE B 2 656 ? 101.160 29.093  23.914  1.00 0.00 ? 656 ILE B N   1  
ATOM 8580   C CA  . ILE B 2 656 ? 100.583 28.653  22.652  1.00 0.00 ? 656 ILE B CA  1  
ATOM 8581   C C   . ILE B 2 656 ? 99.744  27.381  22.717  1.00 0.00 ? 656 ILE B C   1  
ATOM 8582   O O   . ILE B 2 656 ? 98.557  27.506  22.443  1.00 0.00 ? 656 ILE B O   1  
ATOM 8583   C CB  . ILE B 2 656 ? 101.599 28.575  21.531  1.00 0.00 ? 656 ILE B CB  1  
ATOM 8584   C CG1 . ILE B 2 656 ? 102.679 29.750  21.504  1.00 0.00 ? 656 ILE B CG1 1  
ATOM 8585   C CG2 . ILE B 2 656 ? 100.763 28.522  20.167  1.00 0.00 ? 656 ILE B CG2 1  
ATOM 8586   C CD1 . ILE B 2 656 ? 103.696 29.642  20.355  1.00 0.00 ? 656 ILE B CD1 1  
ATOM 8587   N N   . ILE B 2 657 ? 100.329 26.213  23.124  1.00 0.00 ? 657 ILE B N   1  
ATOM 8588   C CA  . ILE B 2 657 ? 99.610  24.963  22.880  1.00 0.00 ? 657 ILE B CA  1  
ATOM 8589   C C   . ILE B 2 657 ? 98.361  24.926  23.799  1.00 0.00 ? 657 ILE B C   1  
ATOM 8590   O O   . ILE B 2 657 ? 97.242  24.644  23.340  1.00 0.00 ? 657 ILE B O   1  
ATOM 8591   C CB  . ILE B 2 657 ? 100.484 23.668  23.107  1.00 0.00 ? 657 ILE B CB  1  
ATOM 8592   C CG1 . ILE B 2 657 ? 101.900 23.725  22.522  1.00 0.00 ? 657 ILE B CG1 1  
ATOM 8593   C CG2 . ILE B 2 657 ? 99.604  22.425  22.849  1.00 0.00 ? 657 ILE B CG2 1  
ATOM 8594   C CD1 . ILE B 2 657 ? 102.728 22.451  22.758  1.00 0.00 ? 657 ILE B CD1 1  
ATOM 8595   N N   . GLU B 2 658 ? 98.548  25.199  25.094  1.00 0.00 ? 658 GLU B N   1  
ATOM 8596   C CA  . GLU B 2 658 ? 97.541  25.002  26.090  1.00 0.00 ? 658 GLU B CA  1  
ATOM 8597   C C   . GLU B 2 658 ? 96.328  25.958  25.870  1.00 0.00 ? 658 GLU B C   1  
ATOM 8598   O O   . GLU B 2 658 ? 95.211  25.465  25.957  1.00 0.00 ? 658 GLU B O   1  
ATOM 8599   C CB  . GLU B 2 658 ? 97.939  25.316  27.545  1.00 0.00 ? 658 GLU B CB  1  
ATOM 8600   C CG  . GLU B 2 658 ? 98.755  24.149  28.091  1.00 0.00 ? 658 GLU B CG  1  
ATOM 8601   C CD  . GLU B 2 658 ? 99.033  24.221  29.648  1.00 0.00 ? 658 GLU B CD  1  
ATOM 8602   O OE1 . GLU B 2 658 ? 99.789  25.129  30.079  1.00 0.00 ? 658 GLU B OE1 1  
ATOM 8603   O OE2 . GLU B 2 658 ? 98.438  23.346  30.345  1.00 0.00 ? 658 GLU B OE2 1  
ATOM 8604   N N   . GLU B 2 659 ? 96.589  27.210  25.566  1.00 0.00 ? 659 GLU B N   1  
ATOM 8605   C CA  . GLU B 2 659 ? 95.646  28.250  25.264  1.00 0.00 ? 659 GLU B CA  1  
ATOM 8606   C C   . GLU B 2 659 ? 94.841  28.020  23.994  1.00 0.00 ? 659 GLU B C   1  
ATOM 8607   O O   . GLU B 2 659 ? 93.626  28.042  24.060  1.00 0.00 ? 659 GLU B O   1  
ATOM 8608   C CB  . GLU B 2 659 ? 96.338  29.670  25.184  1.00 0.00 ? 659 GLU B CB  1  
ATOM 8609   C CG  . GLU B 2 659 ? 96.312  30.396  26.542  1.00 0.00 ? 659 GLU B CG  1  
ATOM 8610   C CD  . GLU B 2 659 ? 96.732  31.908  26.472  1.00 0.00 ? 659 GLU B CD  1  
ATOM 8611   O OE1 . GLU B 2 659 ? 95.862  32.722  26.246  1.00 0.00 ? 659 GLU B OE1 1  
ATOM 8612   O OE2 . GLU B 2 659 ? 97.941  32.244  26.609  1.00 0.00 ? 659 GLU B OE2 1  
ATOM 8613   N N   . ASN B 2 660 ? 95.369  27.591  22.857  1.00 0.00 ? 660 ASN B N   1  
ATOM 8614   C CA  . ASN B 2 660 ? 94.640  27.346  21.649  1.00 0.00 ? 660 ASN B CA  1  
ATOM 8615   C C   . ASN B 2 660 ? 93.719  26.109  21.786  1.00 0.00 ? 660 ASN B C   1  
ATOM 8616   O O   . ASN B 2 660 ? 92.549  26.047  21.380  1.00 0.00 ? 660 ASN B O   1  
ATOM 8617   C CB  . ASN B 2 660 ? 95.592  26.956  20.514  1.00 0.00 ? 660 ASN B CB  1  
ATOM 8618   C CG  . ASN B 2 660 ? 96.050  28.277  20.030  1.00 0.00 ? 660 ASN B CG  1  
ATOM 8619   O OD1 . ASN B 2 660 ? 97.042  28.901  20.482  1.00 0.00 ? 660 ASN B OD1 1  
ATOM 8620   N ND2 . ASN B 2 660 ? 95.336  28.856  18.948  1.00 0.00 ? 660 ASN B ND2 1  
ATOM 8621   N N   . PHE B 2 661 ? 94.217  25.081  22.443  1.00 0.00 ? 661 PHE B N   1  
ATOM 8622   C CA  . PHE B 2 661 ? 93.592  23.790  22.723  1.00 0.00 ? 661 PHE B CA  1  
ATOM 8623   C C   . PHE B 2 661 ? 92.364  23.881  23.598  1.00 0.00 ? 661 PHE B C   1  
ATOM 8624   O O   . PHE B 2 661 ? 91.413  23.219  23.413  1.00 0.00 ? 661 PHE B O   1  
ATOM 8625   C CB  . PHE B 2 661 ? 94.475  22.660  23.289  1.00 0.00 ? 661 PHE B CB  1  
ATOM 8626   C CG  . PHE B 2 661 ? 94.975  21.784  22.250  1.00 0.00 ? 661 PHE B CG  1  
ATOM 8627   C CD1 . PHE B 2 661 ? 96.005  22.224  21.390  1.00 0.00 ? 661 PHE B CD1 1  
ATOM 8628   C CD2 . PHE B 2 661 ? 94.333  20.572  22.006  1.00 0.00 ? 661 PHE B CD2 1  
ATOM 8629   C CE1 . PHE B 2 661 ? 96.437  21.352  20.340  1.00 0.00 ? 661 PHE B CE1 1  
ATOM 8630   C CE2 . PHE B 2 661 ? 94.774  19.730  20.974  1.00 0.00 ? 661 PHE B CE2 1  
ATOM 8631   C CZ  . PHE B 2 661 ? 95.830  20.097  20.131  1.00 0.00 ? 661 PHE B CZ  1  
ATOM 8632   N N   . LYS B 2 662 ? 92.444  24.756  24.638  1.00 0.00 ? 662 LYS B N   1  
ATOM 8633   C CA  . LYS B 2 662 ? 91.456  25.028  25.612  1.00 0.00 ? 662 LYS B CA  1  
ATOM 8634   C C   . LYS B 2 662 ? 90.198  25.565  24.881  1.00 0.00 ? 662 LYS B C   1  
ATOM 8635   O O   . LYS B 2 662 ? 89.113  25.149  25.240  1.00 0.00 ? 662 LYS B O   1  
ATOM 8636   C CB  . LYS B 2 662 ? 91.896  26.013  26.760  1.00 0.00 ? 662 LYS B CB  1  
ATOM 8637   C CG  . LYS B 2 662 ? 90.906  26.243  27.925  1.00 0.00 ? 662 LYS B CG  1  
ATOM 8638   C CD  . LYS B 2 662 ? 91.318  26.901  29.253  1.00 0.00 ? 662 LYS B CD  1  
ATOM 8639   C CE  . LYS B 2 662 ? 90.089  27.221  30.114  1.00 0.00 ? 662 LYS B CE  1  
ATOM 8640   N NZ  . LYS B 2 662 ? 89.103  26.031  30.218  1.00 0.00 ? 662 LYS B NZ  1  
ATOM 8641   N N   . GLU B 2 663 ? 90.365  26.451  23.936  1.00 0.00 ? 663 GLU B N   1  
ATOM 8642   C CA  . GLU B 2 663 ? 89.262  27.024  23.132  1.00 0.00 ? 663 GLU B CA  1  
ATOM 8643   C C   . GLU B 2 663 ? 88.570  25.909  22.264  1.00 0.00 ? 663 GLU B C   1  
ATOM 8644   O O   . GLU B 2 663 ? 87.343  25.944  22.151  1.00 0.00 ? 663 GLU B O   1  
ATOM 8645   C CB  . GLU B 2 663 ? 89.800  28.082  22.073  1.00 0.00 ? 663 GLU B CB  1  
ATOM 8646   C CG  . GLU B 2 663 ? 90.528  29.213  22.764  1.00 0.00 ? 663 GLU B CG  1  
ATOM 8647   C CD  . GLU B 2 663 ? 91.176  30.233  21.727  1.00 0.00 ? 663 GLU B CD  1  
ATOM 8648   O OE1 . GLU B 2 663 ? 90.478  30.703  20.806  1.00 0.00 ? 663 GLU B OE1 1  
ATOM 8649   O OE2 . GLU B 2 663 ? 92.380  30.620  21.942  1.00 0.00 ? 663 GLU B OE2 1  
ATOM 8650   N N   . MET B 2 664 ? 89.459  24.983  21.711  1.00 0.00 ? 664 MET B N   1  
ATOM 8651   C CA  . MET B 2 664 ? 88.937  23.858  20.851  1.00 0.00 ? 664 MET B CA  1  
ATOM 8652   C C   . MET B 2 664 ? 87.965  22.939  21.670  1.00 0.00 ? 664 MET B C   1  
ATOM 8653   O O   . MET B 2 664 ? 86.869  22.636  21.227  1.00 0.00 ? 664 MET B O   1  
ATOM 8654   C CB  . MET B 2 664 ? 90.009  23.018  20.184  1.00 0.00 ? 664 MET B CB  1  
ATOM 8655   C CG  . MET B 2 664 ? 90.871  23.802  19.168  1.00 0.00 ? 664 MET B CG  1  
ATOM 8656   S SD  . MET B 2 664 ? 92.484  23.147  18.736  1.00 0.00 ? 664 MET B SD  1  
ATOM 8657   C CE  . MET B 2 664 ? 93.281  24.752  18.348  1.00 0.00 ? 664 MET B CE  1  
ATOM 8658   N N   . THR B 2 665 ? 88.395  22.633  22.930  1.00 0.00 ? 665 THR B N   1  
ATOM 8659   C CA  . THR B 2 665 ? 87.576  21.831  23.897  1.00 0.00 ? 665 THR B CA  1  
ATOM 8660   C C   . THR B 2 665 ? 86.290  22.593  24.324  1.00 0.00 ? 665 THR B C   1  
ATOM 8661   O O   . THR B 2 665 ? 85.214  21.993  24.533  1.00 0.00 ? 665 THR B O   1  
ATOM 8662   C CB  . THR B 2 665 ? 88.368  21.517  25.126  1.00 0.00 ? 665 THR B CB  1  
ATOM 8663   O OG1 . THR B 2 665 ? 89.483  20.676  24.738  1.00 0.00 ? 665 THR B OG1 1  
ATOM 8664   C CG2 . THR B 2 665 ? 87.488  20.727  26.107  1.00 0.00 ? 665 THR B CG2 1  
ATOM 8665   N N   . ARG B 2 666 ? 86.510  23.888  24.565  1.00 0.00 ? 666 ARG B N   1  
ATOM 8666   C CA  . ARG B 2 666 ? 85.506  24.727  25.120  1.00 0.00 ? 666 ARG B CA  1  
ATOM 8667   C C   . ARG B 2 666 ? 84.334  24.794  24.146  1.00 0.00 ? 666 ARG B C   1  
ATOM 8668   O O   . ARG B 2 666 ? 83.154  24.637  24.537  1.00 0.00 ? 666 ARG B O   1  
ATOM 8669   C CB  . ARG B 2 666 ? 85.933  26.204  25.387  1.00 0.00 ? 666 ARG B CB  1  
ATOM 8670   C CG  . ARG B 2 666 ? 84.883  27.179  25.935  1.00 0.00 ? 666 ARG B CG  1  
ATOM 8671   C CD  . ARG B 2 666 ? 84.236  26.712  27.218  1.00 0.00 ? 666 ARG B CD  1  
ATOM 8672   N NE  . ARG B 2 666 ? 83.158  27.685  27.562  1.00 0.00 ? 666 ARG B NE  1  
ATOM 8673   C CZ  . ARG B 2 666 ? 82.139  27.475  28.416  1.00 0.00 ? 666 ARG B CZ  1  
ATOM 8674   N NH1 . ARG B 2 666 ? 82.106  26.335  29.178  1.00 0.00 ? 666 ARG B NH1 1  
ATOM 8675   N NH2 . ARG B 2 666 ? 81.207  28.474  28.610  1.00 0.00 ? 666 ARG B NH2 1  
ATOM 8676   N N   . LYS B 2 667 ? 84.554  24.963  22.803  1.00 0.00 ? 667 LYS B N   1  
ATOM 8677   C CA  . LYS B 2 667 ? 83.480  24.966  21.828  1.00 0.00 ? 667 LYS B CA  1  
ATOM 8678   C C   . LYS B 2 667 ? 82.694  23.720  21.779  1.00 0.00 ? 667 LYS B C   1  
ATOM 8679   O O   . LYS B 2 667 ? 81.486  23.777  21.761  1.00 0.00 ? 667 LYS B O   1  
ATOM 8680   C CB  . LYS B 2 667 ? 83.974  25.398  20.415  1.00 0.00 ? 667 LYS B CB  1  
ATOM 8681   C CG  . LYS B 2 667 ? 84.437  26.839  20.416  1.00 0.00 ? 667 LYS B CG  1  
ATOM 8682   C CD  . LYS B 2 667 ? 85.042  27.200  19.079  1.00 0.00 ? 667 LYS B CD  1  
ATOM 8683   C CE  . LYS B 2 667 ? 86.419  26.577  18.723  1.00 0.00 ? 667 LYS B CE  1  
ATOM 8684   N NZ  . LYS B 2 667 ? 87.003  26.983  17.388  1.00 0.00 ? 667 LYS B NZ  1  
ATOM 8685   N N   . LEU B 2 668 ? 83.419  22.602  21.841  1.00 0.00 ? 668 LEU B N   1  
ATOM 8686   C CA  . LEU B 2 668 ? 82.886  21.220  21.736  1.00 0.00 ? 668 LEU B CA  1  
ATOM 8687   C C   . LEU B 2 668 ? 82.008  20.835  22.835  1.00 0.00 ? 668 LEU B C   1  
ATOM 8688   O O   . LEU B 2 668 ? 80.941  20.337  22.560  1.00 0.00 ? 668 LEU B O   1  
ATOM 8689   C CB  . LEU B 2 668 ? 84.170  20.264  21.738  1.00 0.00 ? 668 LEU B CB  1  
ATOM 8690   C CG  . LEU B 2 668 ? 84.972  20.177  20.477  1.00 0.00 ? 668 LEU B CG  1  
ATOM 8691   C CD1 . LEU B 2 668 ? 86.149  19.298  20.784  1.00 0.00 ? 668 LEU B CD1 1  
ATOM 8692   C CD2 . LEU B 2 668 ? 84.202  19.494  19.293  1.00 0.00 ? 668 LEU B CD2 1  
ATOM 8693   N N   . GLN B 2 669 ? 82.332  21.110  24.082  1.00 0.00 ? 669 GLN B N   1  
ATOM 8694   C CA  . GLN B 2 669 ? 81.550  20.854  25.199  1.00 0.00 ? 669 GLN B CA  1  
ATOM 8695   C C   . GLN B 2 669 ? 80.374  21.765  25.159  1.00 0.00 ? 669 GLN B C   1  
ATOM 8696   O O   . GLN B 2 669 ? 79.262  21.356  25.452  1.00 0.00 ? 669 GLN B O   1  
ATOM 8697   C CB  . GLN B 2 669 ? 82.289  20.875  26.541  1.00 0.00 ? 669 GLN B CB  1  
ATOM 8698   C CG  . GLN B 2 669 ? 82.800  22.241  27.076  1.00 0.00 ? 669 GLN B CG  1  
ATOM 8699   C CD  . GLN B 2 669 ? 83.716  22.068  28.344  1.00 0.00 ? 669 GLN B CD  1  
ATOM 8700   O OE1 . GLN B 2 669 ? 83.694  21.055  29.101  1.00 0.00 ? 669 GLN B OE1 1  
ATOM 8701   N NE2 . GLN B 2 669 ? 84.369  23.223  28.622  1.00 0.00 ? 669 GLN B NE2 1  
ATOM 8702   N N   . ARG B 2 670 ? 80.551  23.070  24.805  1.00 0.00 ? 670 ARG B N   1  
ATOM 8703   C CA  . ARG B 2 670 ? 79.514  24.029  24.891  1.00 0.00 ? 670 ARG B CA  1  
ATOM 8704   C C   . ARG B 2 670 ? 78.278  23.773  24.014  1.00 0.00 ? 670 ARG B C   1  
ATOM 8705   O O   . ARG B 2 670 ? 77.133  23.927  24.470  1.00 0.00 ? 670 ARG B O   1  
ATOM 8706   C CB  . ARG B 2 670 ? 80.045  25.404  24.605  1.00 0.00 ? 670 ARG B CB  1  
ATOM 8707   C CG  . ARG B 2 670 ? 78.969  26.454  24.762  1.00 0.00 ? 670 ARG B CG  1  
ATOM 8708   C CD  . ARG B 2 670 ? 79.605  27.872  24.489  1.00 0.00 ? 670 ARG B CD  1  
ATOM 8709   N NE  . ARG B 2 670 ? 80.411  27.872  23.172  1.00 0.00 ? 670 ARG B NE  1  
ATOM 8710   C CZ  . ARG B 2 670 ? 79.838  28.292  22.049  1.00 0.00 ? 670 ARG B CZ  1  
ATOM 8711   N NH1 . ARG B 2 670 ? 78.523  28.707  22.002  1.00 0.00 ? 670 ARG B NH1 1  
ATOM 8712   N NH2 . ARG B 2 670 ? 80.549  28.431  20.841  1.00 0.00 ? 670 ARG B NH2 1  
ATOM 8713   N N   . THR B 2 671 ? 78.555  23.423  22.752  1.00 0.00 ? 671 THR B N   1  
ATOM 8714   C CA  . THR B 2 671 ? 77.533  23.203  21.765  1.00 0.00 ? 671 THR B CA  1  
ATOM 8715   C C   . THR B 2 671 ? 77.156  21.733  21.760  1.00 0.00 ? 671 THR B C   1  
ATOM 8716   O O   . THR B 2 671 ? 77.750  20.967  22.565  1.00 0.00 ? 671 THR B O   1  
ATOM 8717   C CB  . THR B 2 671 ? 77.986  23.748  20.362  1.00 0.00 ? 671 THR B CB  1  
ATOM 8718   O OG1 . THR B 2 671 ? 78.400  25.090  20.357  1.00 0.00 ? 671 THR B OG1 1  
ATOM 8719   C CG2 . THR B 2 671 ? 76.720  23.715  19.499  1.00 0.00 ? 671 THR B CG2 1  
ATOM 8720   N N   . LEU B 2 719 ? 78.250  20.436  17.256  1.00 0.00 ? 719 LEU B N   1  
ATOM 8721   C CA  . LEU B 2 719 ? 79.629  20.159  16.684  1.00 0.00 ? 719 LEU B CA  1  
ATOM 8722   C C   . LEU B 2 719 ? 79.961  18.639  16.752  1.00 0.00 ? 719 LEU B C   1  
ATOM 8723   O O   . LEU B 2 719 ? 79.221  17.781  17.313  1.00 0.00 ? 719 LEU B O   1  
ATOM 8724   C CB  . LEU B 2 719 ? 80.697  20.845  17.600  1.00 0.00 ? 719 LEU B CB  1  
ATOM 8725   C CG  . LEU B 2 719 ? 80.635  22.439  17.589  1.00 0.00 ? 719 LEU B CG  1  
ATOM 8726   C CD1 . LEU B 2 719 ? 81.642  22.993  18.639  1.00 0.00 ? 719 LEU B CD1 1  
ATOM 8727   C CD2 . LEU B 2 719 ? 80.889  22.986  16.185  1.00 0.00 ? 719 LEU B CD2 1  
ATOM 8728   N N   . ASN B 2 720 ? 81.085  18.236  16.123  1.00 0.00 ? 720 ASN B N   1  
ATOM 8729   C CA  . ASN B 2 720 ? 81.397  16.831  16.043  1.00 0.00 ? 720 ASN B CA  1  
ATOM 8730   C C   . ASN B 2 720 ? 82.851  16.711  16.059  1.00 0.00 ? 720 ASN B C   1  
ATOM 8731   O O   . ASN B 2 720 ? 83.576  17.705  16.134  1.00 0.00 ? 720 ASN B O   1  
ATOM 8732   C CB  . ASN B 2 720 ? 80.841  16.195  14.722  1.00 0.00 ? 720 ASN B CB  1  
ATOM 8733   C CG  . ASN B 2 720 ? 79.307  16.075  14.880  1.00 0.00 ? 720 ASN B CG  1  
ATOM 8734   O OD1 . ASN B 2 720 ? 78.660  16.982  14.300  1.00 0.00 ? 720 ASN B OD1 1  
ATOM 8735   N ND2 . ASN B 2 720 ? 78.769  15.048  15.500  1.00 0.00 ? 720 ASN B ND2 1  
ATOM 8736   N N   . ILE B 2 721 ? 83.373  15.450  16.010  1.00 0.00 ? 721 ILE B N   1  
ATOM 8737   C CA  . ILE B 2 721 ? 84.737  15.081  16.000  1.00 0.00 ? 721 ILE B CA  1  
ATOM 8738   C C   . ILE B 2 721 ? 85.568  15.528  14.810  1.00 0.00 ? 721 ILE B C   1  
ATOM 8739   O O   . ILE B 2 721 ? 86.730  15.905  14.945  1.00 0.00 ? 721 ILE B O   1  
ATOM 8740   C CB  . ILE B 2 721 ? 84.895  13.627  16.394  1.00 0.00 ? 721 ILE B CB  1  
ATOM 8741   C CG1 . ILE B 2 721 ? 84.710  12.668  15.249  1.00 0.00 ? 721 ILE B CG1 1  
ATOM 8742   C CG2 . ILE B 2 721 ? 84.054  13.390  17.596  1.00 0.00 ? 721 ILE B CG2 1  
ATOM 8743   C CD1 . ILE B 2 721 ? 84.868  11.188  15.638  1.00 0.00 ? 721 ILE B CD1 1  
ATOM 8744   N N   . ASP B 2 722 ? 84.886  15.436  13.600  1.00 0.00 ? 722 ASP B N   1  
ATOM 8745   C CA  . ASP B 2 722 ? 85.384  15.739  12.330  1.00 0.00 ? 722 ASP B CA  1  
ATOM 8746   C C   . ASP B 2 722 ? 85.873  17.260  12.272  1.00 0.00 ? 722 ASP B C   1  
ATOM 8747   O O   . ASP B 2 722 ? 86.958  17.561  11.798  1.00 0.00 ? 722 ASP B O   1  
ATOM 8748   C CB  . ASP B 2 722 ? 84.325  15.478  11.185  1.00 0.00 ? 722 ASP B CB  1  
ATOM 8749   C CG  . ASP B 2 722 ? 84.983  15.600  9.830   1.00 0.00 ? 722 ASP B CG  1  
ATOM 8750   O OD1 . ASP B 2 722 ? 85.546  14.614  9.348   1.00 0.00 ? 722 ASP B OD1 1  
ATOM 8751   O OD2 . ASP B 2 722 ? 84.907  16.758  9.278   1.00 0.00 ? 722 ASP B OD2 1  
ATOM 8752   N N   . GLU B 2 723 ? 85.141  18.226  12.934  1.00 0.00 ? 723 GLU B N   1  
ATOM 8753   C CA  . GLU B 2 723 ? 85.501  19.626  13.047  1.00 0.00 ? 723 GLU B CA  1  
ATOM 8754   C C   . GLU B 2 723 ? 86.765  19.800  13.869  1.00 0.00 ? 723 GLU B C   1  
ATOM 8755   O O   . GLU B 2 723 ? 87.490  20.679  13.558  1.00 0.00 ? 723 GLU B O   1  
ATOM 8756   C CB  . GLU B 2 723 ? 84.377  20.480  13.753  1.00 0.00 ? 723 GLU B CB  1  
ATOM 8757   C CG  . GLU B 2 723 ? 83.153  20.871  12.783  1.00 0.00 ? 723 GLU B CG  1  
ATOM 8758   C CD  . GLU B 2 723 ? 82.512  19.676  12.166  1.00 0.00 ? 723 GLU B CD  1  
ATOM 8759   O OE1 . GLU B 2 723 ? 82.147  18.676  12.815  1.00 0.00 ? 723 GLU B OE1 1  
ATOM 8760   O OE2 . GLU B 2 723 ? 82.286  19.842  10.926  1.00 0.00 ? 723 GLU B OE2 1  
ATOM 8761   N N   . LEU B 2 724 ? 87.007  18.983  14.958  1.00 0.00 ? 724 LEU B N   1  
ATOM 8762   C CA  . LEU B 2 724 ? 88.167  19.080  15.800  1.00 0.00 ? 724 LEU B CA  1  
ATOM 8763   C C   . LEU B 2 724 ? 89.435  18.716  15.045  1.00 0.00 ? 724 LEU B C   1  
ATOM 8764   O O   . LEU B 2 724 ? 90.377  19.418  15.056  1.00 0.00 ? 724 LEU B O   1  
ATOM 8765   C CB  . LEU B 2 724 ? 87.969  18.139  17.008  1.00 0.00 ? 724 LEU B CB  1  
ATOM 8766   C CG  . LEU B 2 724 ? 89.197  18.119  17.986  1.00 0.00 ? 724 LEU B CG  1  
ATOM 8767   C CD1 . LEU B 2 724 ? 89.428  19.534  18.510  1.00 0.00 ? 724 LEU B CD1 1  
ATOM 8768   C CD2 . LEU B 2 724 ? 89.087  17.149  19.176  1.00 0.00 ? 724 LEU B CD2 1  
ATOM 8769   N N   . GLU B 2 725 ? 89.413  17.649  14.324  1.00 0.00 ? 725 GLU B N   1  
ATOM 8770   C CA  . GLU B 2 725 ? 90.648  17.230  13.591  1.00 0.00 ? 725 GLU B CA  1  
ATOM 8771   C C   . GLU B 2 725 ? 91.135  18.194  12.568  1.00 0.00 ? 725 GLU B C   1  
ATOM 8772   O O   . GLU B 2 725 ? 92.358  18.446  12.373  1.00 0.00 ? 725 GLU B O   1  
ATOM 8773   C CB  . GLU B 2 725 ? 90.422  15.856  12.912  1.00 0.00 ? 725 GLU B CB  1  
ATOM 8774   C CG  . GLU B 2 725 ? 90.706  14.603  13.869  1.00 0.00 ? 725 GLU B CG  1  
ATOM 8775   C CD  . GLU B 2 725 ? 89.624  14.419  15.051  1.00 0.00 ? 725 GLU B CD  1  
ATOM 8776   O OE1 . GLU B 2 725 ? 88.644  13.623  14.786  1.00 0.00 ? 725 GLU B OE1 1  
ATOM 8777   O OE2 . GLU B 2 725 ? 89.887  14.876  16.164  1.00 0.00 ? 725 GLU B OE2 1  
ATOM 8778   N N   . SER B 2 726 ? 90.102  18.804  11.849  1.00 0.00 ? 726 SER B N   1  
ATOM 8779   C CA  . SER B 2 726 ? 90.263  19.797  10.790  1.00 0.00 ? 726 SER B CA  1  
ATOM 8780   C C   . SER B 2 726 ? 90.945  21.008  11.339  1.00 0.00 ? 726 SER B C   1  
ATOM 8781   O O   . SER B 2 726 ? 91.964  21.498  10.817  1.00 0.00 ? 726 SER B O   1  
ATOM 8782   C CB  . SER B 2 726 ? 88.952  20.226  10.138  1.00 0.00 ? 726 SER B CB  1  
ATOM 8783   O OG  . SER B 2 726 ? 88.239  19.189  9.460   1.00 0.00 ? 726 SER B OG  1  
ATOM 8784   N N   . VAL B 2 727 ? 90.418  21.515  12.509  1.00 0.00 ? 727 VAL B N   1  
ATOM 8785   C CA  . VAL B 2 727 ? 90.995  22.648  13.271  1.00 0.00 ? 727 VAL B CA  1  
ATOM 8786   C C   . VAL B 2 727 ? 92.351  22.274  13.757  1.00 0.00 ? 727 VAL B C   1  
ATOM 8787   O O   . VAL B 2 727 ? 93.287  23.118  13.702  1.00 0.00 ? 727 VAL B O   1  
ATOM 8788   C CB  . VAL B 2 727 ? 90.034  23.172  14.295  1.00 0.00 ? 727 VAL B CB  1  
ATOM 8789   C CG1 . VAL B 2 727 ? 90.550  24.341  15.187  1.00 0.00 ? 727 VAL B CG1 1  
ATOM 8790   C CG2 . VAL B 2 727 ? 88.786  23.750  13.493  1.00 0.00 ? 727 VAL B CG2 1  
ATOM 8791   N N   . HIS B 2 728 ? 92.584  21.024  14.213  1.00 0.00 ? 728 HIS B N   1  
ATOM 8792   C CA  . HIS B 2 728 ? 93.874  20.535  14.768  1.00 0.00 ? 728 HIS B CA  1  
ATOM 8793   C C   . HIS B 2 728 ? 95.051  20.619  13.751  1.00 0.00 ? 728 HIS B C   1  
ATOM 8794   O O   . HIS B 2 728 ? 96.275  20.874  14.003  1.00 0.00 ? 728 HIS B O   1  
ATOM 8795   C CB  . HIS B 2 728 ? 93.844  19.007  15.184  1.00 0.00 ? 728 HIS B CB  1  
ATOM 8796   C CG  . HIS B 2 728 ? 93.261  18.534  16.460  1.00 0.00 ? 728 HIS B CG  1  
ATOM 8797   N ND1 . HIS B 2 728 ? 93.049  19.127  17.654  1.00 0.00 ? 728 HIS B ND1 1  
ATOM 8798   C CD2 . HIS B 2 728 ? 93.040  17.205  16.692  1.00 0.00 ? 728 HIS B CD2 1  
ATOM 8799   C CE1 . HIS B 2 728 ? 92.588  18.195  18.513  1.00 0.00 ? 728 HIS B CE1 1  
ATOM 8800   N NE2 . HIS B 2 728 ? 92.596  17.031  17.991  1.00 0.00 ? 728 HIS B NE2 1  
ATOM 8801   N N   . ASN B 2 729 ? 94.687  20.236  12.518  1.00 0.00 ? 729 ASN B N   1  
ATOM 8802   C CA  . ASN B 2 729 ? 95.668  20.146  11.407  1.00 0.00 ? 729 ASN B CA  1  
ATOM 8803   C C   . ASN B 2 729 ? 96.289  21.488  11.103  1.00 0.00 ? 729 ASN B C   1  
ATOM 8804   O O   . ASN B 2 729 ? 97.477  21.544  10.862  1.00 0.00 ? 729 ASN B O   1  
ATOM 8805   C CB  . ASN B 2 729 ? 95.223  19.535  10.068  1.00 0.00 ? 729 ASN B CB  1  
ATOM 8806   C CG  . ASN B 2 729 ? 94.851  18.097  10.219  1.00 0.00 ? 729 ASN B CG  1  
ATOM 8807   O OD1 . ASN B 2 729 ? 95.051  17.444  11.262  1.00 0.00 ? 729 ASN B OD1 1  
ATOM 8808   N ND2 . ASN B 2 729 ? 94.225  17.570  9.118   1.00 0.00 ? 729 ASN B ND2 1  
ATOM 8809   N N   . THR B 2 730 ? 95.481  22.523  11.114  1.00 0.00 ? 730 THR B N   1  
ATOM 8810   C CA  . THR B 2 730 ? 95.699  23.956  10.865  1.00 0.00 ? 730 THR B CA  1  
ATOM 8811   C C   . THR B 2 730 ? 96.586  24.474  11.945  1.00 0.00 ? 730 THR B C   1  
ATOM 8812   O O   . THR B 2 730 ? 97.566  25.151  11.668  1.00 0.00 ? 730 THR B O   1  
ATOM 8813   C CB  . THR B 2 730 ? 94.439  24.802  10.855  1.00 0.00 ? 730 THR B CB  1  
ATOM 8814   O OG1 . THR B 2 730 ? 93.425  24.292  10.016  1.00 0.00 ? 730 THR B OG1 1  
ATOM 8815   C CG2 . THR B 2 730 ? 94.845  26.236  10.458  1.00 0.00 ? 730 THR B CG2 1  
ATOM 8816   N N   . PHE B 2 731 ? 96.315  24.045  13.220  1.00 0.00 ? 731 PHE B N   1  
ATOM 8817   C CA  . PHE B 2 731 ? 97.190  24.322  14.362  1.00 0.00 ? 731 PHE B CA  1  
ATOM 8818   C C   . PHE B 2 731 ? 98.575  23.776  14.188  1.00 0.00 ? 731 PHE B C   1  
ATOM 8819   O O   . PHE B 2 731 ? 99.526  24.506  14.401  1.00 0.00 ? 731 PHE B O   1  
ATOM 8820   C CB  . PHE B 2 731 ? 96.485  23.755  15.643  1.00 0.00 ? 731 PHE B CB  1  
ATOM 8821   C CG  . PHE B 2 731 ? 97.222  24.237  16.884  1.00 0.00 ? 731 PHE B CG  1  
ATOM 8822   C CD1 . PHE B 2 731 ? 97.237  25.667  17.102  1.00 0.00 ? 731 PHE B CD1 1  
ATOM 8823   C CD2 . PHE B 2 731 ? 98.016  23.455  17.734  1.00 0.00 ? 731 PHE B CD2 1  
ATOM 8824   C CE1 . PHE B 2 731 ? 98.098  26.198  18.102  1.00 0.00 ? 731 PHE B CE1 1  
ATOM 8825   C CE2 . PHE B 2 731 ? 98.727  23.984  18.827  1.00 0.00 ? 731 PHE B CE2 1  
ATOM 8826   C CZ  . PHE B 2 731 ? 98.828  25.397  19.005  1.00 0.00 ? 731 PHE B CZ  1  
ATOM 8827   N N   . LEU B 2 732 ? 98.723  22.485  13.762  1.00 0.00 ? 732 LEU B N   1  
ATOM 8828   C CA  . LEU B 2 732 ? 99.988  21.795  13.661  1.00 0.00 ? 732 LEU B CA  1  
ATOM 8829   C C   . LEU B 2 732 ? 100.869 22.485  12.626  1.00 0.00 ? 732 LEU B C   1  
ATOM 8830   O O   . LEU B 2 732 ? 102.108 22.532  12.817  1.00 0.00 ? 732 LEU B O   1  
ATOM 8831   C CB  . LEU B 2 732 ? 99.790  20.332  13.299  1.00 0.00 ? 732 LEU B CB  1  
ATOM 8832   C CG  . LEU B 2 732 ? 99.225  19.505  14.443  1.00 0.00 ? 732 LEU B CG  1  
ATOM 8833   C CD1 . LEU B 2 732 ? 98.674  18.133  13.958  1.00 0.00 ? 732 LEU B CD1 1  
ATOM 8834   C CD2 . LEU B 2 732 ? 100.292 19.171  15.494  1.00 0.00 ? 732 LEU B CD2 1  
ATOM 8835   N N   . THR B 2 733 ? 100.241 22.854  11.542  1.00 0.00 ? 733 THR B N   1  
ATOM 8836   C CA  . THR B 2 733 ? 101.020 23.397  10.395  1.00 0.00 ? 733 THR B CA  1  
ATOM 8837   C C   . THR B 2 733 ? 101.671 24.612  10.754  1.00 0.00 ? 733 THR B C   1  
ATOM 8838   O O   . THR B 2 733 ? 102.850 24.860  10.387  1.00 0.00 ? 733 THR B O   1  
ATOM 8839   C CB  . THR B 2 733 ? 100.096 23.664  9.254   1.00 0.00 ? 733 THR B CB  1  
ATOM 8840   O OG1 . THR B 2 733 ? 99.499  22.430  8.842   1.00 0.00 ? 733 THR B OG1 1  
ATOM 8841   C CG2 . THR B 2 733 ? 100.760 24.276  7.993   1.00 0.00 ? 733 THR B CG2 1  
ATOM 8842   N N   . ASN B 2 734 ? 101.019 25.507  11.526  1.00 0.00 ? 734 ASN B N   1  
ATOM 8843   C CA  . ASN B 2 734 ? 101.492 26.794  11.985  1.00 0.00 ? 734 ASN B CA  1  
ATOM 8844   C C   . ASN B 2 734 ? 102.748 26.620  12.830  1.00 0.00 ? 734 ASN B C   1  
ATOM 8845   O O   . ASN B 2 734 ? 103.690 27.363  12.639  1.00 0.00 ? 734 ASN B O   1  
ATOM 8846   C CB  . ASN B 2 734 ? 100.367 27.441  12.897  1.00 0.00 ? 734 ASN B CB  1  
ATOM 8847   C CG  . ASN B 2 734 ? 99.187  28.026  12.037  1.00 0.00 ? 734 ASN B CG  1  
ATOM 8848   O OD1 . ASN B 2 734 ? 99.404  28.174  10.817  1.00 0.00 ? 734 ASN B OD1 1  
ATOM 8849   N ND2 . ASN B 2 734 ? 98.049  28.383  12.606  1.00 0.00 ? 734 ASN B ND2 1  
ATOM 8850   N N   . ILE B 2 735 ? 102.706 25.571  13.725  1.00 0.00 ? 735 ILE B N   1  
ATOM 8851   C CA  . ILE B 2 735 ? 103.751 25.197  14.644  1.00 0.00 ? 735 ILE B CA  1  
ATOM 8852   C C   . ILE B 2 735 ? 105.019 24.765  13.895  1.00 0.00 ? 735 ILE B C   1  
ATOM 8853   O O   . ILE B 2 735 ? 106.168 25.009  14.288  1.00 0.00 ? 735 ILE B O   1  
ATOM 8854   C CB  . ILE B 2 735 ? 103.375 24.163  15.728  1.00 0.00 ? 735 ILE B CB  1  
ATOM 8855   C CG1 . ILE B 2 735 ? 102.254 24.691  16.698  1.00 0.00 ? 735 ILE B CG1 1  
ATOM 8856   C CG2 . ILE B 2 735 ? 104.590 23.804  16.620  1.00 0.00 ? 735 ILE B CG2 1  
ATOM 8857   C CD1 . ILE B 2 735 ? 101.850 23.690  17.794  1.00 0.00 ? 735 ILE B CD1 1  
ATOM 8858   N N   . LEU B 2 736 ? 104.866 24.053  12.750  1.00 0.00 ? 736 LEU B N   1  
ATOM 8859   C CA  . LEU B 2 736 ? 105.918 23.605  11.881  1.00 0.00 ? 736 LEU B CA  1  
ATOM 8860   C C   . LEU B 2 736 ? 106.580 24.761  11.276  1.00 0.00 ? 736 LEU B C   1  
ATOM 8861   O O   . LEU B 2 736 ? 107.848 24.832  11.197  1.00 0.00 ? 736 LEU B O   1  
ATOM 8862   C CB  . LEU B 2 736 ? 105.376 22.732  10.698  1.00 0.00 ? 736 LEU B CB  1  
ATOM 8863   C CG  . LEU B 2 736 ? 106.346 22.154  9.627   1.00 0.00 ? 736 LEU B CG  1  
ATOM 8864   C CD1 . LEU B 2 736 ? 107.462 21.324  10.337  1.00 0.00 ? 736 LEU B CD1 1  
ATOM 8865   C CD2 . LEU B 2 736 ? 105.563 21.282  8.607   1.00 0.00 ? 736 LEU B CD2 1  
ATOM 8866   N N   . SER B 2 737 ? 105.744 25.754  10.809  1.00 0.00 ? 737 SER B N   1  
ATOM 8867   C CA  . SER B 2 737 ? 106.257 26.935  10.146  1.00 0.00 ? 737 SER B CA  1  
ATOM 8868   C C   . SER B 2 737 ? 107.169 27.721  11.057  1.00 0.00 ? 737 SER B C   1  
ATOM 8869   O O   . SER B 2 737 ? 108.235 28.115  10.701  1.00 0.00 ? 737 SER B O   1  
ATOM 8870   C CB  . SER B 2 737 ? 105.214 27.913  9.659   1.00 0.00 ? 737 SER B CB  1  
ATOM 8871   O OG  . SER B 2 737 ? 104.446 27.349  8.563   1.00 0.00 ? 737 SER B OG  1  
ATOM 8872   N N   . HIS B 2 738 ? 106.601 27.797  12.302  1.00 0.00 ? 738 HIS B N   1  
ATOM 8873   C CA  . HIS B 2 738 ? 107.184 28.530  13.378  1.00 0.00 ? 738 HIS B CA  1  
ATOM 8874   C C   . HIS B 2 738 ? 108.523 27.994  13.738  1.00 0.00 ? 738 HIS B C   1  
ATOM 8875   O O   . HIS B 2 738 ? 109.438 28.726  14.068  1.00 0.00 ? 738 HIS B O   1  
ATOM 8876   C CB  . HIS B 2 738 ? 106.286 28.713  14.616  1.00 0.00 ? 738 HIS B CB  1  
ATOM 8877   C CG  . HIS B 2 738 ? 105.054 29.593  14.303  1.00 0.00 ? 738 HIS B CG  1  
ATOM 8878   N ND1 . HIS B 2 738 ? 105.088 30.730  13.533  1.00 0.00 ? 738 HIS B ND1 1  
ATOM 8879   C CD2 . HIS B 2 738 ? 103.811 29.453  14.750  1.00 0.00 ? 738 HIS B CD2 1  
ATOM 8880   C CE1 . HIS B 2 738 ? 103.785 31.171  13.554  1.00 0.00 ? 738 HIS B CE1 1  
ATOM 8881   N NE2 . HIS B 2 738 ? 103.002 30.432  14.264  1.00 0.00 ? 738 HIS B NE2 1  
ATOM 8882   N N   . LYS B 2 739 ? 108.601 26.641  13.685  1.00 0.00 ? 739 LYS B N   1  
ATOM 8883   C CA  . LYS B 2 739 ? 109.843 25.875  14.171  1.00 0.00 ? 739 LYS B CA  1  
ATOM 8884   C C   . LYS B 2 739 ? 111.050 26.228  13.384  1.00 0.00 ? 739 LYS B C   1  
ATOM 8885   O O   . LYS B 2 739 ? 112.120 26.476  13.839  1.00 0.00 ? 739 LYS B O   1  
ATOM 8886   C CB  . LYS B 2 739 ? 109.627 24.388  14.194  1.00 0.00 ? 739 LYS B CB  1  
ATOM 8887   C CG  . LYS B 2 739 ? 110.622 23.616  15.041  1.00 0.00 ? 739 LYS B CG  1  
ATOM 8888   C CD  . LYS B 2 739 ? 111.963 23.105  14.448  1.00 0.00 ? 739 LYS B CD  1  
ATOM 8889   C CE  . LYS B 2 739 ? 112.937 22.627  15.551  1.00 0.00 ? 739 LYS B CE  1  
ATOM 8890   N NZ  . LYS B 2 739 ? 114.270 22.268  14.992  1.00 0.00 ? 739 LYS B NZ  1  
ATOM 8891   N N   . LEU B 2 740 ? 110.896 26.234  12.058  1.00 0.00 ? 740 LEU B N   1  
ATOM 8892   C CA  . LEU B 2 740 ? 111.919 26.463  11.091  1.00 0.00 ? 740 LEU B CA  1  
ATOM 8893   C C   . LEU B 2 740 ? 112.409 27.919  11.173  1.00 0.00 ? 740 LEU B C   1  
ATOM 8894   O O   . LEU B 2 740 ? 113.625 28.159  11.142  1.00 0.00 ? 740 LEU B O   1  
ATOM 8895   C CB  . LEU B 2 740 ? 111.492 26.167  9.589   1.00 0.00 ? 740 LEU B CB  1  
ATOM 8896   C CG  . LEU B 2 740 ? 112.533 25.882  8.507   1.00 0.00 ? 740 LEU B CG  1  
ATOM 8897   C CD1 . LEU B 2 740 ? 113.114 24.434  8.600   1.00 0.00 ? 740 LEU B CD1 1  
ATOM 8898   C CD2 . LEU B 2 740 ? 111.825 26.104  7.177   1.00 0.00 ? 740 LEU B CD2 1  
ATOM 8899   N N   . PHE B 2 741 ? 111.479 28.923  11.236  1.00 0.00 ? 741 PHE B N   1  
ATOM 8900   C CA  . PHE B 2 741 ? 111.973 30.321  11.236  1.00 0.00 ? 741 PHE B CA  1  
ATOM 8901   C C   . PHE B 2 741 ? 112.668 30.714  12.508  1.00 0.00 ? 741 PHE B C   1  
ATOM 8902   O O   . PHE B 2 741 ? 113.807 31.232  12.579  1.00 0.00 ? 741 PHE B O   1  
ATOM 8903   C CB  . PHE B 2 741 ? 110.884 31.380  10.974  1.00 0.00 ? 741 PHE B CB  1  
ATOM 8904   C CG  . PHE B 2 741 ? 110.551 31.412  9.519   1.00 0.00 ? 741 PHE B CG  1  
ATOM 8905   C CD1 . PHE B 2 741 ? 111.454 31.926  8.561   1.00 0.00 ? 741 PHE B CD1 1  
ATOM 8906   C CD2 . PHE B 2 741 ? 109.362 30.804  9.101   1.00 0.00 ? 741 PHE B CD2 1  
ATOM 8907   C CE1 . PHE B 2 741 ? 111.049 32.013  7.207   1.00 0.00 ? 741 PHE B CE1 1  
ATOM 8908   C CE2 . PHE B 2 741 ? 108.996 30.853  7.792   1.00 0.00 ? 741 PHE B CE2 1  
ATOM 8909   C CZ  . PHE B 2 741 ? 109.844 31.356  6.748   1.00 0.00 ? 741 PHE B CZ  1  
ATOM 8910   N N   . ALA B 2 742 ? 112.011 30.583  13.698  1.00 0.00 ? 742 ALA B N   1  
ATOM 8911   C CA  . ALA B 2 742 ? 112.651 30.961  14.951  1.00 0.00 ? 742 ALA B CA  1  
ATOM 8912   C C   . ALA B 2 742 ? 113.634 29.920  15.523  1.00 0.00 ? 742 ALA B C   1  
ATOM 8913   O O   . ALA B 2 742 ? 114.703 30.360  15.832  1.00 0.00 ? 742 ALA B O   1  
ATOM 8914   C CB  . ALA B 2 742 ? 111.563 31.161  16.037  1.00 0.00 ? 742 ALA B CB  1  
ATOM 8915   N N   . THR B 2 743 ? 113.357 28.591  15.676  1.00 0.00 ? 743 THR B N   1  
ATOM 8916   C CA  . THR B 2 743 ? 114.185 27.595  16.354  1.00 0.00 ? 743 THR B CA  1  
ATOM 8917   C C   . THR B 2 743 ? 114.646 26.637  15.238  1.00 0.00 ? 743 THR B C   1  
ATOM 8918   O O   . THR B 2 743 ? 114.259 26.870  14.062  1.00 0.00 ? 743 THR B O   1  
ATOM 8919   C CB  . THR B 2 743 ? 113.452 26.873  17.425  1.00 0.00 ? 743 THR B CB  1  
ATOM 8920   O OG1 . THR B 2 743 ? 112.119 26.546  17.026  1.00 0.00 ? 743 THR B OG1 1  
ATOM 8921   C CG2 . THR B 2 743 ? 113.416 27.906  18.596  1.00 0.00 ? 743 THR B CG2 1  
ATOM 8922   N N   . GLN B 2 756 ? 116.538 29.392  13.562  1.00 0.00 ? 756 GLN B N   1  
ATOM 8923   C CA  . GLN B 2 756 ? 117.727 28.484  13.551  1.00 0.00 ? 756 GLN B CA  1  
ATOM 8924   C C   . GLN B 2 756 ? 118.852 28.976  14.355  1.00 0.00 ? 756 GLN B C   1  
ATOM 8925   O O   . GLN B 2 756 ? 119.666 28.118  14.645  1.00 0.00 ? 756 GLN B O   1  
ATOM 8926   C CB  . GLN B 2 756 ? 118.164 28.342  12.080  1.00 0.00 ? 756 GLN B CB  1  
ATOM 8927   C CG  . GLN B 2 756 ? 117.135 27.930  11.008  1.00 0.00 ? 756 GLN B CG  1  
ATOM 8928   C CD  . GLN B 2 756 ? 116.902 26.437  10.961  1.00 0.00 ? 756 GLN B CD  1  
ATOM 8929   O OE1 . GLN B 2 756 ? 115.834 25.986  10.443  1.00 0.00 ? 756 GLN B OE1 1  
ATOM 8930   N NE2 . GLN B 2 756 ? 117.895 25.671  11.403  1.00 0.00 ? 756 GLN B NE2 1  
ATOM 8931   N N   . PRO B 2 757 ? 118.871 30.281  14.827  1.00 0.00 ? 757 PRO B N   1  
ATOM 8932   C CA  . PRO B 2 757 ? 119.943 30.658  15.750  1.00 0.00 ? 757 PRO B CA  1  
ATOM 8933   C C   . PRO B 2 757 ? 119.915 30.036  17.131  1.00 0.00 ? 757 PRO B C   1  
ATOM 8934   O O   . PRO B 2 757 ? 120.956 29.748  17.717  1.00 0.00 ? 757 PRO B O   1  
ATOM 8935   C CB  . PRO B 2 757 ? 119.758 32.215  15.807  1.00 0.00 ? 757 PRO B CB  1  
ATOM 8936   C CG  . PRO B 2 757 ? 119.606 32.498  14.396  1.00 0.00 ? 757 PRO B CG  1  
ATOM 8937   C CD  . PRO B 2 757 ? 118.591 31.409  13.943  1.00 0.00 ? 757 PRO B CD  1  
ATOM 8938   N N   . TYR B 2 758 ? 118.749 29.819  17.773  1.00 0.00 ? 758 TYR B N   1  
ATOM 8939   C CA  . TYR B 2 758 ? 118.704 29.223  19.061  1.00 0.00 ? 758 TYR B CA  1  
ATOM 8940   C C   . TYR B 2 758 ? 119.154 27.774  19.090  1.00 0.00 ? 758 TYR B C   1  
ATOM 8941   O O   . TYR B 2 758 ? 119.963 27.604  20.039  1.00 0.00 ? 758 TYR B O   1  
ATOM 8942   C CB  . TYR B 2 758 ? 117.252 29.412  19.613  1.00 0.00 ? 758 TYR B CB  1  
ATOM 8943   C CG  . TYR B 2 758 ? 116.959 28.723  20.891  1.00 0.00 ? 758 TYR B CG  1  
ATOM 8944   C CD1 . TYR B 2 758 ? 117.367 29.249  22.100  1.00 0.00 ? 758 TYR B CD1 1  
ATOM 8945   C CD2 . TYR B 2 758 ? 116.273 27.519  20.827  1.00 0.00 ? 758 TYR B CD2 1  
ATOM 8946   C CE1 . TYR B 2 758 ? 117.065 28.572  23.307  1.00 0.00 ? 758 TYR B CE1 1  
ATOM 8947   C CE2 . TYR B 2 758 ? 115.849 26.948  22.004  1.00 0.00 ? 758 TYR B CE2 1  
ATOM 8948   C CZ  . TYR B 2 758 ? 116.324 27.423  23.245  1.00 0.00 ? 758 TYR B CZ  1  
ATOM 8949   O OH  . TYR B 2 758 ? 116.088 26.715  24.378  1.00 0.00 ? 758 TYR B OH  1  
ATOM 8950   N N   . PRO B 2 759 ? 118.844 26.698  18.382  1.00 0.00 ? 759 PRO B N   1  
ATOM 8951   C CA  . PRO B 2 759 ? 119.432 25.370  18.526  1.00 0.00 ? 759 PRO B CA  1  
ATOM 8952   C C   . PRO B 2 759 ? 120.930 25.426  18.243  1.00 0.00 ? 759 PRO B C   1  
ATOM 8953   O O   . PRO B 2 759 ? 121.604 24.618  18.747  1.00 0.00 ? 759 PRO B O   1  
ATOM 8954   C CB  . PRO B 2 759 ? 118.620 24.423  17.656  1.00 0.00 ? 759 PRO B CB  1  
ATOM 8955   C CG  . PRO B 2 759 ? 118.194 25.364  16.579  1.00 0.00 ? 759 PRO B CG  1  
ATOM 8956   C CD  . PRO B 2 759 ? 117.880 26.678  17.305  1.00 0.00 ? 759 PRO B CD  1  
ATOM 8957   N N   . THR B 2 760 ? 121.532 26.416  17.375  1.00 0.00 ? 760 THR B N   1  
ATOM 8958   C CA  . THR B 2 760 ? 122.990 26.450  17.065  1.00 0.00 ? 760 THR B CA  1  
ATOM 8959   C C   . THR B 2 760 ? 123.724 26.793  18.335  1.00 0.00 ? 760 THR B C   1  
ATOM 8960   O O   . THR B 2 760 ? 124.652 26.116  18.771  1.00 0.00 ? 760 THR B O   1  
ATOM 8961   C CB  . THR B 2 760 ? 123.387 27.447  15.981  1.00 0.00 ? 760 THR B CB  1  
ATOM 8962   O OG1 . THR B 2 760 ? 122.733 27.175  14.782  1.00 0.00 ? 760 THR B OG1 1  
ATOM 8963   C CG2 . THR B 2 760 ? 124.924 27.503  15.643  1.00 0.00 ? 760 THR B CG2 1  
ATOM 8964   N N   . SER B 2 761 ? 123.210 27.794  19.058  1.00 0.00 ? 761 SER B N   1  
ATOM 8965   C CA  . SER B 2 761 ? 123.735 28.220  20.338  1.00 0.00 ? 761 SER B CA  1  
ATOM 8966   C C   . SER B 2 761 ? 123.578 27.092  21.378  1.00 0.00 ? 761 SER B C   1  
ATOM 8967   O O   . SER B 2 761 ? 124.503 26.737  22.089  1.00 0.00 ? 761 SER B O   1  
ATOM 8968   C CB  . SER B 2 761 ? 122.968 29.483  20.789  1.00 0.00 ? 761 SER B CB  1  
ATOM 8969   O OG  . SER B 2 761 ? 123.542 30.061  21.994  1.00 0.00 ? 761 SER B OG  1  
ATOM 8970   N N   . LEU B 2 762 ? 122.396 26.458  21.394  1.00 0.00 ? 762 LEU B N   1  
ATOM 8971   C CA  . LEU B 2 762 ? 122.112 25.442  22.379  1.00 0.00 ? 762 LEU B CA  1  
ATOM 8972   C C   . LEU B 2 762 ? 122.919 24.116  22.371  1.00 0.00 ? 762 LEU B C   1  
ATOM 8973   O O   . LEU B 2 762 ? 123.386 23.591  23.343  1.00 0.00 ? 762 LEU B O   1  
ATOM 8974   C CB  . LEU B 2 762 ? 120.623 24.933  22.251  1.00 0.00 ? 762 LEU B CB  1  
ATOM 8975   C CG  . LEU B 2 762 ? 119.871 24.509  23.586  1.00 0.00 ? 762 LEU B CG  1  
ATOM 8976   C CD1 . LEU B 2 762 ? 119.947 25.724  24.604  1.00 0.00 ? 762 LEU B CD1 1  
ATOM 8977   C CD2 . LEU B 2 762 ? 118.444 24.042  23.196  1.00 0.00 ? 762 LEU B CD2 1  
ATOM 8978   N N   . VAL B 2 763 ? 123.216 23.617  21.159  1.00 0.00 ? 763 VAL B N   1  
ATOM 8979   C CA  . VAL B 2 763 ? 124.047 22.433  21.081  1.00 0.00 ? 763 VAL B CA  1  
ATOM 8980   C C   . VAL B 2 763 ? 125.424 22.678  21.596  1.00 0.00 ? 763 VAL B C   1  
ATOM 8981   O O   . VAL B 2 763 ? 126.002 21.866  22.301  1.00 0.00 ? 763 VAL B O   1  
ATOM 8982   C CB  . VAL B 2 763 ? 124.072 21.676  19.757  1.00 0.00 ? 763 VAL B CB  1  
ATOM 8983   C CG1 . VAL B 2 763 ? 122.630 21.173  19.490  1.00 0.00 ? 763 VAL B CG1 1  
ATOM 8984   C CG2 . VAL B 2 763 ? 124.544 22.629  18.611  1.00 0.00 ? 763 VAL B CG2 1  
ATOM 8985   N N   . LEU B 2 764 ? 125.981 23.880  21.271  1.00 0.00 ? 764 LEU B N   1  
ATOM 8986   C CA  . LEU B 2 764 ? 127.271 24.298  21.808  1.00 0.00 ? 764 LEU B CA  1  
ATOM 8987   C C   . LEU B 2 764 ? 127.373 24.483  23.300  1.00 0.00 ? 764 LEU B C   1  
ATOM 8988   O O   . LEU B 2 764 ? 128.432 24.167  23.924  1.00 0.00 ? 764 LEU B O   1  
ATOM 8989   C CB  . LEU B 2 764 ? 127.719 25.563  21.069  1.00 0.00 ? 764 LEU B CB  1  
ATOM 8990   C CG  . LEU B 2 764 ? 127.819 25.361  19.548  1.00 0.00 ? 764 LEU B CG  1  
ATOM 8991   C CD1 . LEU B 2 764 ? 127.856 26.677  18.678  1.00 0.00 ? 764 LEU B CD1 1  
ATOM 8992   C CD2 . LEU B 2 764 ? 128.957 24.406  19.154  1.00 0.00 ? 764 LEU B CD2 1  
ATOM 8993   N N   . LEU B 2 765 ? 126.320 25.056  23.910  1.00 0.00 ? 765 LEU B N   1  
ATOM 8994   C CA  . LEU B 2 765 ? 126.216 25.275  25.316  1.00 0.00 ? 765 LEU B CA  1  
ATOM 8995   C C   . LEU B 2 765 ? 126.255 23.916  25.995  1.00 0.00 ? 765 LEU B C   1  
ATOM 8996   O O   . LEU B 2 765 ? 126.948 23.814  26.950  1.00 0.00 ? 765 LEU B O   1  
ATOM 8997   C CB  . LEU B 2 765 ? 124.929 26.105  25.630  1.00 0.00 ? 765 LEU B CB  1  
ATOM 8998   C CG  . LEU B 2 765 ? 124.644 26.083  27.153  1.00 0.00 ? 765 LEU B CG  1  
ATOM 8999   C CD1 . LEU B 2 765 ? 125.565 27.051  27.966  1.00 0.00 ? 765 LEU B CD1 1  
ATOM 9000   C CD2 . LEU B 2 765 ? 123.142 26.489  27.449  1.00 0.00 ? 765 LEU B CD2 1  
ATOM 9001   N N   . LEU B 2 766 ? 125.563 22.886  25.441  1.00 0.00 ? 766 LEU B N   1  
ATOM 9002   C CA  . LEU B 2 766 ? 125.475 21.561  25.972  1.00 0.00 ? 766 LEU B CA  1  
ATOM 9003   C C   . LEU B 2 766 ? 126.819 20.886  26.020  1.00 0.00 ? 766 LEU B C   1  
ATOM 9004   O O   . LEU B 2 766 ? 127.128 20.218  27.007  1.00 0.00 ? 766 LEU B O   1  
ATOM 9005   C CB  . LEU B 2 766 ? 124.626 20.646  25.128  1.00 0.00 ? 766 LEU B CB  1  
ATOM 9006   C CG  . LEU B 2 766 ? 124.230 19.165  25.634  1.00 0.00 ? 766 LEU B CG  1  
ATOM 9007   C CD1 . LEU B 2 766 ? 123.513 19.233  26.994  1.00 0.00 ? 766 LEU B CD1 1  
ATOM 9008   C CD2 . LEU B 2 766 ? 123.510 18.301  24.497  1.00 0.00 ? 766 LEU B CD2 1  
ATOM 9009   N N   . ASN B 2 767 ? 127.734 21.127  25.025  1.00 0.00 ? 767 ASN B N   1  
ATOM 9010   C CA  . ASN B 2 767 ? 129.103 20.654  25.025  1.00 0.00 ? 767 ASN B CA  1  
ATOM 9011   C C   . ASN B 2 767 ? 129.852 21.274  26.227  1.00 0.00 ? 767 ASN B C   1  
ATOM 9012   O O   . ASN B 2 767 ? 130.503 20.473  26.880  1.00 0.00 ? 767 ASN B O   1  
ATOM 9013   C CB  . ASN B 2 767 ? 129.829 20.984  23.646  1.00 0.00 ? 767 ASN B CB  1  
ATOM 9014   C CG  . ASN B 2 767 ? 129.121 20.538  22.320  1.00 0.00 ? 767 ASN B CG  1  
ATOM 9015   O OD1 . ASN B 2 767 ? 129.234 21.145  21.246  1.00 0.00 ? 767 ASN B OD1 1  
ATOM 9016   N ND2 . ASN B 2 767 ? 128.512 19.304  22.404  1.00 0.00 ? 767 ASN B ND2 1  
ATOM 9017   N N   . SER B 2 768 ? 129.690 22.627  26.466  1.00 0.00 ? 768 SER B N   1  
ATOM 9018   C CA  . SER B 2 768 ? 130.314 23.401  27.536  1.00 0.00 ? 768 SER B CA  1  
ATOM 9019   C C   . SER B 2 768 ? 129.960 22.890  28.899  1.00 0.00 ? 768 SER B C   1  
ATOM 9020   O O   . SER B 2 768 ? 130.890 22.728  29.700  1.00 0.00 ? 768 SER B O   1  
ATOM 9021   C CB  . SER B 2 768 ? 129.742 24.837  27.500  1.00 0.00 ? 768 SER B CB  1  
ATOM 9022   O OG  . SER B 2 768 ? 129.770 25.351  26.144  1.00 0.00 ? 768 SER B OG  1  
ATOM 9023   N N   . VAL B 2 769 ? 128.702 22.533  29.156  1.00 0.00 ? 769 VAL B N   1  
ATOM 9024   C CA  . VAL B 2 769 ? 128.263 21.964  30.458  1.00 0.00 ? 769 VAL B CA  1  
ATOM 9025   C C   . VAL B 2 769 ? 128.953 20.654  30.699  1.00 0.00 ? 769 VAL B C   1  
ATOM 9026   O O   . VAL B 2 769 ? 129.495 20.455  31.767  1.00 0.00 ? 769 VAL B O   1  
ATOM 9027   C CB  . VAL B 2 769 ? 126.797 21.909  30.634  1.00 0.00 ? 769 VAL B CB  1  
ATOM 9028   C CG1 . VAL B 2 769 ? 126.224 21.184  31.828  1.00 0.00 ? 769 VAL B CG1 1  
ATOM 9029   C CG2 . VAL B 2 769 ? 126.253 23.385  30.671  1.00 0.00 ? 769 VAL B CG2 1  
ATOM 9030   N N   . TYR B 2 770 ? 129.132 19.766  29.665  1.00 0.00 ? 770 TYR B N   1  
ATOM 9031   C CA  . TYR B 2 770 ? 129.869 18.494  29.811  1.00 0.00 ? 770 TYR B CA  1  
ATOM 9032   C C   . TYR B 2 770 ? 131.309 18.678  30.149  1.00 0.00 ? 770 TYR B C   1  
ATOM 9033   O O   . TYR B 2 770 ? 131.883 18.021  31.025  1.00 0.00 ? 770 TYR B O   1  
ATOM 9034   C CB  . TYR B 2 770 ? 129.700 17.565  28.677  1.00 0.00 ? 770 TYR B CB  1  
ATOM 9035   C CG  . TYR B 2 770 ? 128.308 17.106  28.616  1.00 0.00 ? 770 TYR B CG  1  
ATOM 9036   C CD1 . TYR B 2 770 ? 127.772 16.444  29.755  1.00 0.00 ? 770 TYR B CD1 1  
ATOM 9037   C CD2 . TYR B 2 770 ? 127.649 17.088  27.342  1.00 0.00 ? 770 TYR B CD2 1  
ATOM 9038   C CE1 . TYR B 2 770 ? 126.494 15.879  29.692  1.00 0.00 ? 770 TYR B CE1 1  
ATOM 9039   C CE2 . TYR B 2 770 ? 126.350 16.528  27.359  1.00 0.00 ? 770 TYR B CE2 1  
ATOM 9040   C CZ  . TYR B 2 770 ? 125.784 15.931  28.486  1.00 0.00 ? 770 TYR B CZ  1  
ATOM 9041   O OH  . TYR B 2 770 ? 124.477 15.297  28.496  1.00 0.00 ? 770 TYR B OH  1  
ATOM 9042   N N   . GLU B 2 771 ? 131.970 19.739  29.499  1.00 0.00 ? 771 GLU B N   1  
ATOM 9043   C CA  . GLU B 2 771 ? 133.296 20.085  29.751  1.00 0.00 ? 771 GLU B CA  1  
ATOM 9044   C C   . GLU B 2 771 ? 133.469 20.497  31.206  1.00 0.00 ? 771 GLU B C   1  
ATOM 9045   O O   . GLU B 2 771 ? 134.360 20.022  31.829  1.00 0.00 ? 771 GLU B O   1  
ATOM 9046   C CB  . GLU B 2 771 ? 133.734 21.225  28.982  1.00 0.00 ? 771 GLU B CB  1  
ATOM 9047   C CG  . GLU B 2 771 ? 134.076 20.853  27.567  1.00 0.00 ? 771 GLU B CG  1  
ATOM 9048   C CD  . GLU B 2 771 ? 134.730 22.021  26.832  1.00 0.00 ? 771 GLU B CD  1  
ATOM 9049   O OE1 . GLU B 2 771 ? 135.859 22.407  27.248  1.00 0.00 ? 771 GLU B OE1 1  
ATOM 9050   O OE2 . GLU B 2 771 ? 134.171 22.398  25.807  1.00 0.00 ? 771 GLU B OE2 1  
ATOM 9051   N N   . PHE B 2 772 ? 132.584 21.344  31.733  1.00 0.00 ? 772 PHE B N   1  
ATOM 9052   C CA  . PHE B 2 772 ? 132.616 21.866  33.110  1.00 0.00 ? 772 PHE B CA  1  
ATOM 9053   C C   . PHE B 2 772 ? 132.449 20.766  34.121  1.00 0.00 ? 772 PHE B C   1  
ATOM 9054   O O   . PHE B 2 772 ? 133.269 20.621  35.020  1.00 0.00 ? 772 PHE B O   1  
ATOM 9055   C CB  . PHE B 2 772 ? 131.391 22.852  33.219  1.00 0.00 ? 772 PHE B CB  1  
ATOM 9056   C CG  . PHE B 2 772 ? 130.638 23.001  34.570  1.00 0.00 ? 772 PHE B CG  1  
ATOM 9057   C CD1 . PHE B 2 772 ? 131.396 23.327  35.725  1.00 0.00 ? 772 PHE B CD1 1  
ATOM 9058   C CD2 . PHE B 2 772 ? 129.264 22.996  34.645  1.00 0.00 ? 772 PHE B CD2 1  
ATOM 9059   C CE1 . PHE B 2 772 ? 130.785 23.316  36.968  1.00 0.00 ? 772 PHE B CE1 1  
ATOM 9060   C CE2 . PHE B 2 772 ? 128.647 22.903  35.882  1.00 0.00 ? 772 PHE B CE2 1  
ATOM 9061   C CZ  . PHE B 2 772 ? 129.397 23.075  37.042  1.00 0.00 ? 772 PHE B CZ  1  
ATOM 9062   N N   . VAL B 2 773 ? 131.417 19.798  33.995  1.00 0.00 ? 773 VAL B N   1  
ATOM 9063   C CA  . VAL B 2 773 ? 131.230 18.737  34.932  1.00 0.00 ? 773 VAL B CA  1  
ATOM 9064   C C   . VAL B 2 773 ? 132.437 17.809  34.990  1.00 0.00 ? 773 VAL B C   1  
ATOM 9065   O O   . VAL B 2 773 ? 132.810 17.350  36.081  1.00 0.00 ? 773 VAL B O   1  
ATOM 9066   C CB  . VAL B 2 773 ? 129.849 18.080  34.652  1.00 0.00 ? 773 VAL B CB  1  
ATOM 9067   C CG1 . VAL B 2 773 ? 129.713 16.610  35.240  1.00 0.00 ? 773 VAL B CG1 1  
ATOM 9068   C CG2 . VAL B 2 773 ? 128.871 19.098  35.286  1.00 0.00 ? 773 VAL B CG2 1  
ATOM 9069   N N   . LYS B 2 774 ? 133.094 17.486  33.821  1.00 0.00 ? 774 LYS B N   1  
ATOM 9070   C CA  . LYS B 2 774 ? 134.112 16.528  33.757  1.00 0.00 ? 774 LYS B CA  1  
ATOM 9071   C C   . LYS B 2 774 ? 135.280 16.958  34.629  1.00 0.00 ? 774 LYS B C   1  
ATOM 9072   O O   . LYS B 2 774 ? 135.822 16.226  35.422  1.00 0.00 ? 774 LYS B O   1  
ATOM 9073   C CB  . LYS B 2 774 ? 134.524 16.411  32.297  1.00 0.00 ? 774 LYS B CB  1  
ATOM 9074   C CG  . LYS B 2 774 ? 135.680 15.418  31.907  1.00 0.00 ? 774 LYS B CG  1  
ATOM 9075   C CD  . LYS B 2 774 ? 136.279 15.561  30.492  1.00 0.00 ? 774 LYS B CD  1  
ATOM 9076   C CE  . LYS B 2 774 ? 135.525 14.891  29.404  1.00 0.00 ? 774 LYS B CE  1  
ATOM 9077   N NZ  . LYS B 2 774 ? 134.586 15.790  28.618  1.00 0.00 ? 774 LYS B NZ  1  
ATOM 9078   N N   . VAL B 2 775 ? 135.599 18.272  34.504  1.00 0.00 ? 775 VAL B N   1  
ATOM 9079   C CA  . VAL B 2 775 ? 136.617 19.002  35.278  1.00 0.00 ? 775 VAL B CA  1  
ATOM 9080   C C   . VAL B 2 775 ? 136.257 19.001  36.735  1.00 0.00 ? 775 VAL B C   1  
ATOM 9081   O O   . VAL B 2 775 ? 137.101 18.923  37.710  1.00 0.00 ? 775 VAL B O   1  
ATOM 9082   C CB  . VAL B 2 775 ? 137.048 20.387  34.698  1.00 0.00 ? 775 VAL B CB  1  
ATOM 9083   C CG1 . VAL B 2 775 ? 138.250 20.943  35.544  1.00 0.00 ? 775 VAL B CG1 1  
ATOM 9084   C CG2 . VAL B 2 775 ? 137.607 20.118  33.276  1.00 0.00 ? 775 VAL B CG2 1  
ATOM 9085   N N   . TYR B 2 776 ? 134.957 19.300  36.987  1.00 0.00 ? 776 TYR B N   1  
ATOM 9086   C CA  . TYR B 2 776 ? 134.430 19.525  38.314  1.00 0.00 ? 776 TYR B CA  1  
ATOM 9087   C C   . TYR B 2 776 ? 134.511 18.322  39.219  1.00 0.00 ? 776 TYR B C   1  
ATOM 9088   O O   . TYR B 2 776 ? 134.647 18.543  40.471  1.00 0.00 ? 776 TYR B O   1  
ATOM 9089   C CB  . TYR B 2 776 ? 132.988 20.119  38.287  1.00 0.00 ? 776 TYR B CB  1  
ATOM 9090   C CG  . TYR B 2 776 ? 132.534 20.835  39.523  1.00 0.00 ? 776 TYR B CG  1  
ATOM 9091   C CD1 . TYR B 2 776 ? 132.921 22.186  39.778  1.00 0.00 ? 776 TYR B CD1 1  
ATOM 9092   C CD2 . TYR B 2 776 ? 131.832 20.174  40.521  1.00 0.00 ? 776 TYR B CD2 1  
ATOM 9093   C CE1 . TYR B 2 776 ? 132.859 22.644  41.111  1.00 0.00 ? 776 TYR B CE1 1  
ATOM 9094   C CE2 . TYR B 2 776 ? 131.703 20.675  41.867  1.00 0.00 ? 776 TYR B CE2 1  
ATOM 9095   C CZ  . TYR B 2 776 ? 132.117 21.975  42.133  1.00 0.00 ? 776 TYR B CZ  1  
ATOM 9096   O OH  . TYR B 2 776 ? 131.885 22.519  43.395  1.00 0.00 ? 776 TYR B OH  1  
ATOM 9097   N N   . CYS B 2 777 ? 134.266 17.170  38.678  1.00 0.00 ? 777 CYS B N   1  
ATOM 9098   C CA  . CYS B 2 777 ? 134.167 15.935  39.426  1.00 0.00 ? 777 CYS B CA  1  
ATOM 9099   C C   . CYS B 2 777 ? 135.489 15.615  40.067  1.00 0.00 ? 777 CYS B C   1  
ATOM 9100   O O   . CYS B 2 777 ? 135.492 15.073  41.170  1.00 0.00 ? 777 CYS B O   1  
ATOM 9101   C CB  . CYS B 2 777 ? 133.681 14.743  38.569  1.00 0.00 ? 777 CYS B CB  1  
ATOM 9102   S SG  . CYS B 2 777 ? 132.931 13.452  39.621  1.00 0.00 ? 777 CYS B SG  1  
ATOM 9103   N N   . ASN B 2 778 ? 136.586 15.912  39.293  1.00 0.00 ? 778 ASN B N   1  
ATOM 9104   C CA  . ASN B 2 778 ? 137.955 15.606  39.579  1.00 0.00 ? 778 ASN B CA  1  
ATOM 9105   C C   . ASN B 2 778 ? 138.374 16.339  40.850  1.00 0.00 ? 778 ASN B C   1  
ATOM 9106   O O   . ASN B 2 778 ? 139.094 15.847  41.679  1.00 0.00 ? 778 ASN B O   1  
ATOM 9107   C CB  . ASN B 2 778 ? 138.930 16.047  38.467  1.00 0.00 ? 778 ASN B CB  1  
ATOM 9108   C CG  . ASN B 2 778 ? 138.727 15.070  37.306  1.00 0.00 ? 778 ASN B CG  1  
ATOM 9109   O OD1 . ASN B 2 778 ? 138.768 13.856  37.418  1.00 0.00 ? 778 ASN B OD1 1  
ATOM 9110   N ND2 . ASN B 2 778 ? 138.605 15.641  36.136  1.00 0.00 ? 778 ASN B ND2 1  
ATOM 9111   N N   . LEU B 2 779 ? 137.866 17.608  41.042  1.00 0.00 ? 779 LEU B N   1  
ATOM 9112   C CA  . LEU B 2 779 ? 138.285 18.458  42.225  1.00 0.00 ? 779 LEU B CA  1  
ATOM 9113   C C   . LEU B 2 779 ? 137.906 17.861  43.561  1.00 0.00 ? 779 LEU B C   1  
ATOM 9114   O O   . LEU B 2 779 ? 137.005 17.094  43.836  1.00 0.00 ? 779 LEU B O   1  
ATOM 9115   C CB  . LEU B 2 779 ? 137.596 19.829  42.115  1.00 0.00 ? 779 LEU B CB  1  
ATOM 9116   C CG  . LEU B 2 779 ? 137.640 20.562  40.778  1.00 0.00 ? 779 LEU B CG  1  
ATOM 9117   C CD1 . LEU B 2 779 ? 136.906 21.939  40.877  1.00 0.00 ? 779 LEU B CD1 1  
ATOM 9118   C CD2 . LEU B 2 779 ? 139.066 20.944  40.296  1.00 0.00 ? 779 LEU B CD2 1  
ATOM 9119   N N   . ASN B 2 780 ? 138.756 18.231  44.531  1.00 0.00 ? 780 ASN B N   1  
ATOM 9120   C CA  . ASN B 2 780 ? 138.710 17.804  45.916  1.00 0.00 ? 780 ASN B CA  1  
ATOM 9121   C C   . ASN B 2 780 ? 137.614 18.654  46.604  1.00 0.00 ? 780 ASN B C   1  
ATOM 9122   O O   . ASN B 2 780 ? 136.998 19.502  45.905  1.00 0.00 ? 780 ASN B O   1  
ATOM 9123   C CB  . ASN B 2 780 ? 140.117 17.795  46.708  1.00 0.00 ? 780 ASN B CB  1  
ATOM 9124   C CG  . ASN B 2 780 ? 140.013 17.580  48.229  1.00 0.00 ? 780 ASN B CG  1  
ATOM 9125   O OD1 . ASN B 2 780 ? 140.543 18.405  48.999  1.00 0.00 ? 780 ASN B OD1 1  
ATOM 9126   N ND2 . ASN B 2 780 ? 139.228 16.544  48.638  1.00 0.00 ? 780 ASN B ND2 1  
ATOM 9127   N N   . SER B 2 798 ? 146.242 17.653  43.443  1.00 0.00 ? 798 SER B N   1  
ATOM 9128   C CA  . SER B 2 798 ? 146.618 18.695  44.438  1.00 0.00 ? 798 SER B CA  1  
ATOM 9129   C C   . SER B 2 798 ? 146.803 19.940  43.582  1.00 0.00 ? 798 SER B C   1  
ATOM 9130   O O   . SER B 2 798 ? 145.867 20.604  43.251  1.00 0.00 ? 798 SER B O   1  
ATOM 9131   C CB  . SER B 2 798 ? 147.830 18.233  45.334  1.00 0.00 ? 798 SER B CB  1  
ATOM 9132   O OG  . SER B 2 798 ? 148.980 17.809  44.537  1.00 0.00 ? 798 SER B OG  1  
ATOM 9133   N N   . ASN B 2 799 ? 148.046 20.129  43.146  1.00 0.00 ? 799 ASN B N   1  
ATOM 9134   C CA  . ASN B 2 799 ? 148.458 21.151  42.244  1.00 0.00 ? 799 ASN B CA  1  
ATOM 9135   C C   . ASN B 2 799 ? 147.820 21.031  40.917  1.00 0.00 ? 799 ASN B C   1  
ATOM 9136   O O   . ASN B 2 799 ? 147.375 21.978  40.324  1.00 0.00 ? 799 ASN B O   1  
ATOM 9137   C CB  . ASN B 2 799 ? 149.984 21.096  42.126  1.00 0.00 ? 799 ASN B CB  1  
ATOM 9138   C CG  . ASN B 2 799 ? 150.763 21.583  43.390  1.00 0.00 ? 799 ASN B CG  1  
ATOM 9139   O OD1 . ASN B 2 799 ? 150.911 20.704  44.255  1.00 0.00 ? 799 ASN B OD1 1  
ATOM 9140   N ND2 . ASN B 2 799 ? 151.242 22.864  43.379  1.00 0.00 ? 799 ASN B ND2 1  
ATOM 9141   N N   . GLY B 2 800 ? 147.711 19.776  40.403  1.00 0.00 ? 800 GLY B N   1  
ATOM 9142   C CA  . GLY B 2 800 ? 147.217 19.451  39.106  1.00 0.00 ? 800 GLY B CA  1  
ATOM 9143   C C   . GLY B 2 800 ? 145.733 19.878  38.973  1.00 0.00 ? 800 GLY B C   1  
ATOM 9144   O O   . GLY B 2 800 ? 145.262 20.361  37.928  1.00 0.00 ? 800 GLY B O   1  
ATOM 9145   N N   . LEU B 2 801 ? 144.976 19.583  40.055  1.00 0.00 ? 801 LEU B N   1  
ATOM 9146   C CA  . LEU B 2 801 ? 143.520 19.787  40.131  1.00 0.00 ? 801 LEU B CA  1  
ATOM 9147   C C   . LEU B 2 801 ? 143.296 21.255  40.021  1.00 0.00 ? 801 LEU B C   1  
ATOM 9148   O O   . LEU B 2 801 ? 142.390 21.693  39.286  1.00 0.00 ? 801 LEU B O   1  
ATOM 9149   C CB  . LEU B 2 801 ? 142.896 19.292  41.451  1.00 0.00 ? 801 LEU B CB  1  
ATOM 9150   C CG  . LEU B 2 801 ? 143.069 17.766  41.885  1.00 0.00 ? 801 LEU B CG  1  
ATOM 9151   C CD1 . LEU B 2 801 ? 142.481 17.556  43.290  1.00 0.00 ? 801 LEU B CD1 1  
ATOM 9152   C CD2 . LEU B 2 801 ? 142.419 16.873  40.846  1.00 0.00 ? 801 LEU B CD2 1  
ATOM 9153   N N   . LEU B 2 802 ? 144.155 22.129  40.669  1.00 0.00 ? 802 LEU B N   1  
ATOM 9154   C CA  . LEU B 2 802 ? 144.101 23.610  40.557  1.00 0.00 ? 802 LEU B CA  1  
ATOM 9155   C C   . LEU B 2 802 ? 144.384 24.134  39.169  1.00 0.00 ? 802 LEU B C   1  
ATOM 9156   O O   . LEU B 2 802 ? 143.655 25.040  38.702  1.00 0.00 ? 802 LEU B O   1  
ATOM 9157   C CB  . LEU B 2 802 ? 145.126 24.254  41.558  1.00 0.00 ? 802 LEU B CB  1  
ATOM 9158   C CG  . LEU B 2 802 ? 144.956 25.766  41.792  1.00 0.00 ? 802 LEU B CG  1  
ATOM 9159   C CD1 . LEU B 2 802 ? 143.689 25.937  42.676  1.00 0.00 ? 802 LEU B CD1 1  
ATOM 9160   C CD2 . LEU B 2 802 ? 146.283 26.327  42.350  1.00 0.00 ? 802 LEU B CD2 1  
ATOM 9161   N N   . GLY B 2 803 ? 145.384 23.591  38.467  1.00 0.00 ? 803 GLY B N   1  
ATOM 9162   C CA  . GLY B 2 803 ? 145.780 24.041  37.131  1.00 0.00 ? 803 GLY B CA  1  
ATOM 9163   C C   . GLY B 2 803 ? 144.673 23.809  36.096  1.00 0.00 ? 803 GLY B C   1  
ATOM 9164   O O   . GLY B 2 803 ? 144.416 24.714  35.272  1.00 0.00 ? 803 GLY B O   1  
ATOM 9165   N N   . LYS B 2 804 ? 144.001 22.643  36.185  1.00 0.00 ? 804 LYS B N   1  
ATOM 9166   C CA  . LYS B 2 804 ? 142.905 22.282  35.325  1.00 0.00 ? 804 LYS B CA  1  
ATOM 9167   C C   . LYS B 2 804 ? 141.768 23.214  35.520  1.00 0.00 ? 804 LYS B C   1  
ATOM 9168   O O   . LYS B 2 804 ? 141.122 23.573  34.520  1.00 0.00 ? 804 LYS B O   1  
ATOM 9169   C CB  . LYS B 2 804 ? 142.462 20.808  35.527  1.00 0.00 ? 804 LYS B CB  1  
ATOM 9170   C CG  . LYS B 2 804 ? 143.398 19.693  34.990  1.00 0.00 ? 804 LYS B CG  1  
ATOM 9171   C CD  . LYS B 2 804 ? 142.650 18.404  34.645  1.00 0.00 ? 804 LYS B CD  1  
ATOM 9172   C CE  . LYS B 2 804 ? 143.513 17.193  34.288  1.00 0.00 ? 804 LYS B CE  1  
ATOM 9173   N NZ  . LYS B 2 804 ? 142.769 16.134  33.541  1.00 0.00 ? 804 LYS B NZ  1  
ATOM 9174   N N   . PHE B 2 805 ? 141.521 23.572  36.775  1.00 0.00 ? 805 PHE B N   1  
ATOM 9175   C CA  . PHE B 2 805 ? 140.434 24.402  37.184  1.00 0.00 ? 805 PHE B CA  1  
ATOM 9176   C C   . PHE B 2 805 ? 140.582 25.818  36.549  1.00 0.00 ? 805 PHE B C   1  
ATOM 9177   O O   . PHE B 2 805 ? 139.545 26.293  36.113  1.00 0.00 ? 805 PHE B O   1  
ATOM 9178   C CB  . PHE B 2 805 ? 140.384 24.505  38.673  1.00 0.00 ? 805 PHE B CB  1  
ATOM 9179   C CG  . PHE B 2 805 ? 139.088 24.952  39.265  1.00 0.00 ? 805 PHE B CG  1  
ATOM 9180   C CD1 . PHE B 2 805 ? 137.860 25.057  38.572  1.00 0.00 ? 805 PHE B CD1 1  
ATOM 9181   C CD2 . PHE B 2 805 ? 139.093 25.130  40.652  1.00 0.00 ? 805 PHE B CD2 1  
ATOM 9182   C CE1 . PHE B 2 805 ? 136.667 25.482  39.264  1.00 0.00 ? 805 PHE B CE1 1  
ATOM 9183   C CE2 . PHE B 2 805 ? 137.921 25.610  41.332  1.00 0.00 ? 805 PHE B CE2 1  
ATOM 9184   C CZ  . PHE B 2 805 ? 136.709 25.745  40.643  1.00 0.00 ? 805 PHE B CZ  1  
ATOM 9185   N N   . ASN B 2 806 ? 141.832 26.393  36.562  1.00 0.00 ? 806 ASN B N   1  
ATOM 9186   C CA  . ASN B 2 806 ? 142.083 27.719  35.971  1.00 0.00 ? 806 ASN B CA  1  
ATOM 9187   C C   . ASN B 2 806 ? 141.829 27.759  34.434  1.00 0.00 ? 806 ASN B C   1  
ATOM 9188   O O   . ASN B 2 806 ? 141.176 28.691  33.983  1.00 0.00 ? 806 ASN B O   1  
ATOM 9189   C CB  . ASN B 2 806 ? 143.455 28.321  36.175  1.00 0.00 ? 806 ASN B CB  1  
ATOM 9190   C CG  . ASN B 2 806 ? 143.661 28.680  37.648  1.00 0.00 ? 806 ASN B CG  1  
ATOM 9191   O OD1 . ASN B 2 806 ? 142.901 29.529  38.144  1.00 0.00 ? 806 ASN B OD1 1  
ATOM 9192   N ND2 . ASN B 2 806 ? 144.762 28.163  38.304  1.00 0.00 ? 806 ASN B ND2 1  
ATOM 9193   N N   . THR B 2 807 ? 142.235 26.712  33.715  1.00 0.00 ? 807 THR B N   1  
ATOM 9194   C CA  . THR B 2 807 ? 141.925 26.571  32.304  1.00 0.00 ? 807 THR B CA  1  
ATOM 9195   C C   . THR B 2 807 ? 140.460 26.397  32.022  1.00 0.00 ? 807 THR B C   1  
ATOM 9196   O O   . THR B 2 807 ? 139.916 27.080  31.122  1.00 0.00 ? 807 THR B O   1  
ATOM 9197   C CB  . THR B 2 807 ? 142.733 25.377  31.805  1.00 0.00 ? 807 THR B CB  1  
ATOM 9198   O OG1 . THR B 2 807 ? 144.109 25.331  32.115  1.00 0.00 ? 807 THR B OG1 1  
ATOM 9199   C CG2 . THR B 2 807 ? 142.622 25.312  30.269  1.00 0.00 ? 807 THR B CG2 1  
ATOM 9200   N N   . ASN B 2 808 ? 139.769 25.527  32.850  1.00 0.00 ? 808 ASN B N   1  
ATOM 9201   C CA  . ASN B 2 808 ? 138.372 25.293  32.658  1.00 0.00 ? 808 ASN B CA  1  
ATOM 9202   C C   . ASN B 2 808 ? 137.582 26.570  32.864  1.00 0.00 ? 808 ASN B C   1  
ATOM 9203   O O   . ASN B 2 808 ? 136.666 26.822  32.067  1.00 0.00 ? 808 ASN B O   1  
ATOM 9204   C CB  . ASN B 2 808 ? 137.766 24.139  33.563  1.00 0.00 ? 808 ASN B CB  1  
ATOM 9205   C CG  . ASN B 2 808 ? 136.350 23.748  33.121  1.00 0.00 ? 808 ASN B CG  1  
ATOM 9206   O OD1 . ASN B 2 808 ? 136.093 23.172  32.028  1.00 0.00 ? 808 ASN B OD1 1  
ATOM 9207   N ND2 . ASN B 2 808 ? 135.286 24.159  33.991  1.00 0.00 ? 808 ASN B ND2 1  
ATOM 9208   N N   . LEU B 2 809 ? 137.962 27.342  33.901  1.00 0.00 ? 809 LEU B N   1  
ATOM 9209   C CA  . LEU B 2 809 ? 137.209 28.568  34.211  1.00 0.00 ? 809 LEU B CA  1  
ATOM 9210   C C   . LEU B 2 809 ? 137.298 29.604  33.132  1.00 0.00 ? 809 LEU B C   1  
ATOM 9211   O O   . LEU B 2 809 ? 136.358 30.233  32.824  1.00 0.00 ? 809 LEU B O   1  
ATOM 9212   C CB  . LEU B 2 809 ? 137.742 29.298  35.443  1.00 0.00 ? 809 LEU B CB  1  
ATOM 9213   C CG  . LEU B 2 809 ? 137.240 28.576  36.726  1.00 0.00 ? 809 LEU B CG  1  
ATOM 9214   C CD1 . LEU B 2 809 ? 138.261 28.664  37.934  1.00 0.00 ? 809 LEU B CD1 1  
ATOM 9215   C CD2 . LEU B 2 809 ? 135.799 28.826  37.034  1.00 0.00 ? 809 LEU B CD2 1  
ATOM 9216   N N   . LYS B 2 810 ? 138.471 29.867  32.503  1.00 0.00 ? 810 LYS B N   1  
ATOM 9217   C CA  . LYS B 2 810 ? 138.569 30.815  31.370  1.00 0.00 ? 810 LYS B CA  1  
ATOM 9218   C C   . LYS B 2 810 ? 137.822 30.427  30.141  1.00 0.00 ? 810 LYS B C   1  
ATOM 9219   O O   . LYS B 2 810 ? 137.161 31.302  29.595  1.00 0.00 ? 810 LYS B O   1  
ATOM 9220   C CB  . LYS B 2 810 ? 140.027 31.056  30.892  1.00 0.00 ? 810 LYS B CB  1  
ATOM 9221   C CG  . LYS B 2 810 ? 140.785 31.679  32.021  1.00 0.00 ? 810 LYS B CG  1  
ATOM 9222   C CD  . LYS B 2 810 ? 142.316 31.754  31.792  1.00 0.00 ? 810 LYS B CD  1  
ATOM 9223   C CE  . LYS B 2 810 ? 143.149 32.363  32.910  1.00 0.00 ? 810 LYS B CE  1  
ATOM 9224   N NZ  . LYS B 2 810 ? 142.866 31.731  34.262  1.00 0.00 ? 810 LYS B NZ  1  
ATOM 9225   N N   . GLU B 2 811 ? 137.883 29.158  29.698  1.00 0.00 ? 811 GLU B N   1  
ATOM 9226   C CA  . GLU B 2 811 ? 137.235 28.734  28.470  1.00 0.00 ? 811 GLU B CA  1  
ATOM 9227   C C   . GLU B 2 811 ? 135.672 28.795  28.572  1.00 0.00 ? 811 GLU B C   1  
ATOM 9228   O O   . GLU B 2 811 ? 134.981 29.251  27.644  1.00 0.00 ? 811 GLU B O   1  
ATOM 9229   C CB  . GLU B 2 811 ? 137.758 27.402  27.880  1.00 0.00 ? 811 GLU B CB  1  
ATOM 9230   C CG  . GLU B 2 811 ? 137.316 26.094  28.603  1.00 0.00 ? 811 GLU B CG  1  
ATOM 9231   C CD  . GLU B 2 811 ? 138.325 24.940  28.265  1.00 0.00 ? 811 GLU B CD  1  
ATOM 9232   O OE1 . GLU B 2 811 ? 138.348 24.469  27.065  1.00 0.00 ? 811 GLU B OE1 1  
ATOM 9233   O OE2 . GLU B 2 811 ? 139.111 24.545  29.207  1.00 0.00 ? 811 GLU B OE2 1  
ATOM 9234   N N   . ILE B 2 812 ? 135.211 28.383  29.719  1.00 0.00 ? 812 ILE B N   1  
ATOM 9235   C CA  . ILE B 2 812 ? 133.787 28.279  30.074  1.00 0.00 ? 812 ILE B CA  1  
ATOM 9236   C C   . ILE B 2 812 ? 133.014 29.540  30.120  1.00 0.00 ? 812 ILE B C   1  
ATOM 9237   O O   . ILE B 2 812 ? 131.919 29.624  29.545  1.00 0.00 ? 812 ILE B O   1  
ATOM 9238   C CB  . ILE B 2 812 ? 133.548 27.513  31.325  1.00 0.00 ? 812 ILE B CB  1  
ATOM 9239   C CG1 . ILE B 2 812 ? 133.870 26.000  31.157  1.00 0.00 ? 812 ILE B CG1 1  
ATOM 9240   C CG2 . ILE B 2 812 ? 132.135 27.614  31.878  1.00 0.00 ? 812 ILE B CG2 1  
ATOM 9241   C CD1 . ILE B 2 812 ? 133.638 25.164  32.427  1.00 0.00 ? 812 ILE B CD1 1  
ATOM 9242   N N   . VAL B 2 813 ? 133.748 30.652  30.716  1.00 0.00 ? 813 VAL B N   1  
ATOM 9243   C CA  . VAL B 2 813 ? 133.147 31.948  30.633  1.00 0.00 ? 813 VAL B CA  1  
ATOM 9244   C C   . VAL B 2 813 ? 133.034 32.363  29.166  1.00 0.00 ? 813 VAL B C   1  
ATOM 9245   O O   . VAL B 2 813 ? 132.065 33.095  28.872  1.00 0.00 ? 813 VAL B O   1  
ATOM 9246   C CB  . VAL B 2 813 ? 133.990 32.889  31.514  1.00 0.00 ? 813 VAL B CB  1  
ATOM 9247   C CG1 . VAL B 2 813 ? 133.602 34.431  31.280  1.00 0.00 ? 813 VAL B CG1 1  
ATOM 9248   C CG2 . VAL B 2 813 ? 133.775 32.451  32.958  1.00 0.00 ? 813 VAL B CG2 1  
ATOM 9249   N N   . SER B 2 814 ? 134.089 32.068  28.353  1.00 0.00 ? 814 SER B N   1  
ATOM 9250   C CA  . SER B 2 814 ? 134.114 32.658  26.962  1.00 0.00 ? 814 SER B CA  1  
ATOM 9251   C C   . SER B 2 814 ? 133.049 32.157  26.070  1.00 0.00 ? 814 SER B C   1  
ATOM 9252   O O   . SER B 2 814 ? 132.366 32.862  25.365  1.00 0.00 ? 814 SER B O   1  
ATOM 9253   C CB  . SER B 2 814 ? 135.400 32.457  26.211  1.00 0.00 ? 814 SER B CB  1  
ATOM 9254   O OG  . SER B 2 814 ? 136.468 32.937  26.954  1.00 0.00 ? 814 SER B OG  1  
ATOM 9255   N N   . GLN B 2 815 ? 132.806 30.872  26.158  1.00 0.00 ? 815 GLN B N   1  
ATOM 9256   C CA  . GLN B 2 815 ? 131.803 30.212  25.386  1.00 0.00 ? 815 GLN B CA  1  
ATOM 9257   C C   . GLN B 2 815 ? 130.462 30.743  25.844  1.00 0.00 ? 815 GLN B C   1  
ATOM 9258   O O   . GLN B 2 815 ? 129.610 31.022  25.059  1.00 0.00 ? 815 GLN B O   1  
ATOM 9259   C CB  . GLN B 2 815 ? 131.903 28.730  25.531  1.00 0.00 ? 815 GLN B CB  1  
ATOM 9260   C CG  . GLN B 2 815 ? 133.147 28.051  25.003  1.00 0.00 ? 815 GLN B CG  1  
ATOM 9261   C CD  . GLN B 2 815 ? 133.038 26.579  25.391  1.00 0.00 ? 815 GLN B CD  1  
ATOM 9262   O OE1 . GLN B 2 815 ? 132.824 25.694  24.479  1.00 0.00 ? 815 GLN B OE1 1  
ATOM 9263   N NE2 . GLN B 2 815 ? 133.026 26.303  26.697  1.00 0.00 ? 815 GLN B NE2 1  
ATOM 9264   N N   . TYR B 2 816 ? 130.240 30.935  27.168  1.00 0.00 ? 816 TYR B N   1  
ATOM 9265   C CA  . TYR B 2 816 ? 129.026 31.353  27.749  1.00 0.00 ? 816 TYR B CA  1  
ATOM 9266   C C   . TYR B 2 816 ? 128.718 32.757  27.274  1.00 0.00 ? 816 TYR B C   1  
ATOM 9267   O O   . TYR B 2 816 ? 127.538 33.060  27.001  1.00 0.00 ? 816 TYR B O   1  
ATOM 9268   C CB  . TYR B 2 816 ? 129.018 31.382  29.296  1.00 0.00 ? 816 TYR B CB  1  
ATOM 9269   C CG  . TYR B 2 816 ? 128.758 29.978  29.867  1.00 0.00 ? 816 TYR B CG  1  
ATOM 9270   C CD1 . TYR B 2 816 ? 128.394 28.773  29.187  1.00 0.00 ? 816 TYR B CD1 1  
ATOM 9271   C CD2 . TYR B 2 816 ? 129.003 29.920  31.252  1.00 0.00 ? 816 TYR B CD2 1  
ATOM 9272   C CE1 . TYR B 2 816 ? 128.300 27.573  29.901  1.00 0.00 ? 816 TYR B CE1 1  
ATOM 9273   C CE2 . TYR B 2 816 ? 128.925 28.728  32.025  1.00 0.00 ? 816 TYR B CE2 1  
ATOM 9274   C CZ  . TYR B 2 816 ? 128.462 27.634  31.300  1.00 0.00 ? 816 TYR B CZ  1  
ATOM 9275   O OH  . TYR B 2 816 ? 128.406 26.473  32.132  1.00 0.00 ? 816 TYR B OH  1  
ATOM 9276   N N   . LYS B 2 817 ? 129.724 33.650  27.229  1.00 0.00 ? 817 LYS B N   1  
ATOM 9277   C CA  . LYS B 2 817 ? 129.475 35.024  26.871  1.00 0.00 ? 817 LYS B CA  1  
ATOM 9278   C C   . LYS B 2 817 ? 128.944 35.177  25.436  1.00 0.00 ? 817 LYS B C   1  
ATOM 9279   O O   . LYS B 2 817 ? 128.025 35.949  25.238  1.00 0.00 ? 817 LYS B O   1  
ATOM 9280   C CB  . LYS B 2 817 ? 130.754 35.977  26.877  1.00 0.00 ? 817 LYS B CB  1  
ATOM 9281   C CG  . LYS B 2 817 ? 130.500 37.500  27.081  1.00 0.00 ? 817 LYS B CG  1  
ATOM 9282   C CD  . LYS B 2 817 ? 129.945 37.745  28.497  1.00 0.00 ? 817 LYS B CD  1  
ATOM 9283   C CE  . LYS B 2 817 ? 129.207 39.086  28.661  1.00 0.00 ? 817 LYS B CE  1  
ATOM 9284   N NZ  . LYS B 2 817 ? 130.047 40.261  28.360  1.00 0.00 ? 817 LYS B NZ  1  
ATOM 9285   N N   . ASN B 2 818 ? 129.513 34.361  24.516  1.00 0.00 ? 818 ASN B N   1  
ATOM 9286   C CA  . ASN B 2 818 ? 129.127 34.305  23.106  1.00 0.00 ? 818 ASN B CA  1  
ATOM 9287   C C   . ASN B 2 818 ? 127.697 33.833  22.976  1.00 0.00 ? 818 ASN B C   1  
ATOM 9288   O O   . ASN B 2 818 ? 126.911 34.318  22.151  1.00 0.00 ? 818 ASN B O   1  
ATOM 9289   C CB  . ASN B 2 818 ? 130.266 33.528  22.317  1.00 0.00 ? 818 ASN B CB  1  
ATOM 9290   C CG  . ASN B 2 818 ? 130.093 33.374  20.788  1.00 0.00 ? 818 ASN B CG  1  
ATOM 9291   O OD1 . ASN B 2 818 ? 129.516 34.318  20.243  1.00 0.00 ? 818 ASN B OD1 1  
ATOM 9292   N ND2 . ASN B 2 818 ? 130.430 32.169  20.161  1.00 0.00 ? 818 ASN B ND2 1  
ATOM 9293   N N   . PHE B 2 819 ? 127.310 32.810  23.773  1.00 0.00 ? 819 PHE B N   1  
ATOM 9294   C CA  . PHE B 2 819 ? 126.008 32.231  23.673  1.00 0.00 ? 819 PHE B CA  1  
ATOM 9295   C C   . PHE B 2 819 ? 124.923 33.176  24.021  1.00 0.00 ? 819 PHE B C   1  
ATOM 9296   O O   . PHE B 2 819 ? 123.868 33.210  23.468  1.00 0.00 ? 819 PHE B O   1  
ATOM 9297   C CB  . PHE B 2 819 ? 125.806 30.905  24.546  1.00 0.00 ? 819 PHE B CB  1  
ATOM 9298   C CG  . PHE B 2 819 ? 126.768 29.836  23.954  1.00 0.00 ? 819 PHE B CG  1  
ATOM 9299   C CD1 . PHE B 2 819 ? 126.977 29.794  22.574  1.00 0.00 ? 819 PHE B CD1 1  
ATOM 9300   C CD2 . PHE B 2 819 ? 127.394 28.946  24.829  1.00 0.00 ? 819 PHE B CD2 1  
ATOM 9301   C CE1 . PHE B 2 819 ? 127.979 28.990  22.095  1.00 0.00 ? 819 PHE B CE1 1  
ATOM 9302   C CE2 . PHE B 2 819 ? 128.364 28.051  24.345  1.00 0.00 ? 819 PHE B CE2 1  
ATOM 9303   C CZ  . PHE B 2 819 ? 128.678 28.145  22.980  1.00 0.00 ? 819 PHE B CZ  1  
ATOM 9304   N N   . LYS B 2 820 ? 125.273 33.959  25.124  1.00 0.00 ? 820 LYS B N   1  
ATOM 9305   C CA  . LYS B 2 820 ? 124.431 34.906  25.692  1.00 0.00 ? 820 LYS B CA  1  
ATOM 9306   C C   . LYS B 2 820 ? 124.147 36.039  24.725  1.00 0.00 ? 820 LYS B C   1  
ATOM 9307   O O   . LYS B 2 820 ? 123.032 36.529  24.695  1.00 0.00 ? 820 LYS B O   1  
ATOM 9308   C CB  . LYS B 2 820 ? 125.007 35.496  26.951  1.00 0.00 ? 820 LYS B CB  1  
ATOM 9309   C CG  . LYS B 2 820 ? 124.676 34.814  28.354  1.00 0.00 ? 820 LYS B CG  1  
ATOM 9310   C CD  . LYS B 2 820 ? 125.671 35.220  29.404  1.00 0.00 ? 820 LYS B CD  1  
ATOM 9311   C CE  . LYS B 2 820 ? 125.179 35.251  30.841  1.00 0.00 ? 820 LYS B CE  1  
ATOM 9312   N NZ  . LYS B 2 820 ? 124.804 33.797  31.181  1.00 0.00 ? 820 LYS B NZ  1  
ATOM 9313   N N   . ASP B 2 821 ? 125.078 36.468  23.954  1.00 0.00 ? 821 ASP B N   1  
ATOM 9314   C CA  . ASP B 2 821 ? 124.935 37.516  23.032  1.00 0.00 ? 821 ASP B CA  1  
ATOM 9315   C C   . ASP B 2 821 ? 123.934 37.185  21.905  1.00 0.00 ? 821 ASP B C   1  
ATOM 9316   O O   . ASP B 2 821 ? 123.079 37.989  21.557  1.00 0.00 ? 821 ASP B O   1  
ATOM 9317   C CB  . ASP B 2 821 ? 126.253 38.007  22.370  1.00 0.00 ? 821 ASP B CB  1  
ATOM 9318   C CG  . ASP B 2 821 ? 127.252 38.553  23.367  1.00 0.00 ? 821 ASP B CG  1  
ATOM 9319   O OD1 . ASP B 2 821 ? 126.848 38.720  24.546  1.00 0.00 ? 821 ASP B OD1 1  
ATOM 9320   O OD2 . ASP B 2 821 ? 128.459 38.735  23.001  1.00 0.00 ? 821 ASP B OD2 1  
ATOM 9321   N N   . ARG B 2 822 ? 124.002 35.939  21.363  1.00 0.00 ? 822 ARG B N   1  
ATOM 9322   C CA  . ARG B 2 822 ? 123.117 35.314  20.462  1.00 0.00 ? 822 ARG B CA  1  
ATOM 9323   C C   . ARG B 2 822 ? 121.745 35.119  21.097  1.00 0.00 ? 822 ARG B C   1  
ATOM 9324   O O   . ARG B 2 822 ? 120.685 35.241  20.483  1.00 0.00 ? 822 ARG B O   1  
ATOM 9325   C CB  . ARG B 2 822 ? 123.758 33.984  19.987  1.00 0.00 ? 822 ARG B CB  1  
ATOM 9326   C CG  . ARG B 2 822 ? 123.204 33.546  18.642  1.00 0.00 ? 822 ARG B CG  1  
ATOM 9327   C CD  . ARG B 2 822 ? 123.893 34.280  17.503  1.00 0.00 ? 822 ARG B CD  1  
ATOM 9328   N NE  . ARG B 2 822 ? 123.155 34.006  16.203  1.00 0.00 ? 822 ARG B NE  1  
ATOM 9329   C CZ  . ARG B 2 822 ? 123.761 34.318  14.989  1.00 0.00 ? 822 ARG B CZ  1  
ATOM 9330   N NH1 . ARG B 2 822 ? 124.980 34.944  14.886  1.00 0.00 ? 822 ARG B NH1 1  
ATOM 9331   N NH2 . ARG B 2 822 ? 123.053 34.167  13.822  1.00 0.00 ? 822 ARG B NH2 1  
ATOM 9332   N N   . LEU B 2 823 ? 121.713 34.748  22.432  1.00 0.00 ? 823 LEU B N   1  
ATOM 9333   C CA  . LEU B 2 823 ? 120.480 34.518  23.087  1.00 0.00 ? 823 LEU B CA  1  
ATOM 9334   C C   . LEU B 2 823 ? 119.598 35.784  23.177  1.00 0.00 ? 823 LEU B C   1  
ATOM 9335   O O   . LEU B 2 823 ? 118.395 35.719  23.014  1.00 0.00 ? 823 LEU B O   1  
ATOM 9336   C CB  . LEU B 2 823 ? 120.663 33.997  24.517  1.00 0.00 ? 823 LEU B CB  1  
ATOM 9337   C CG  . LEU B 2 823 ? 119.400 33.727  25.303  1.00 0.00 ? 823 LEU B CG  1  
ATOM 9338   C CD1 . LEU B 2 823 ? 118.555 32.522  24.714  1.00 0.00 ? 823 LEU B CD1 1  
ATOM 9339   C CD2 . LEU B 2 823 ? 119.810 33.390  26.680  1.00 0.00 ? 823 LEU B CD2 1  
ATOM 9340   N N   . TYR B 2 824 ? 120.302 36.925  23.415  1.00 0.00 ? 824 TYR B N   1  
ATOM 9341   C CA  . TYR B 2 824 ? 119.697 38.232  23.541  1.00 0.00 ? 824 TYR B CA  1  
ATOM 9342   C C   . TYR B 2 824 ? 119.042 38.660  22.274  1.00 0.00 ? 824 TYR B C   1  
ATOM 9343   O O   . TYR B 2 824 ? 117.920 39.133  22.426  1.00 0.00 ? 824 TYR B O   1  
ATOM 9344   C CB  . TYR B 2 824 ? 120.640 39.276  24.114  1.00 0.00 ? 824 TYR B CB  1  
ATOM 9345   C CG  . TYR B 2 824 ? 121.049 38.946  25.581  1.00 0.00 ? 824 TYR B CG  1  
ATOM 9346   C CD1 . TYR B 2 824 ? 120.162 38.472  26.565  1.00 0.00 ? 824 TYR B CD1 1  
ATOM 9347   C CD2 . TYR B 2 824 ? 122.443 39.024  25.870  1.00 0.00 ? 824 TYR B CD2 1  
ATOM 9348   C CE1 . TYR B 2 824 ? 120.728 38.038  27.795  1.00 0.00 ? 824 TYR B CE1 1  
ATOM 9349   C CE2 . TYR B 2 824 ? 122.948 38.674  27.137  1.00 0.00 ? 824 TYR B CE2 1  
ATOM 9350   C CZ  . TYR B 2 824 ? 122.100 38.142  28.124  1.00 0.00 ? 824 TYR B CZ  1  
ATOM 9351   O OH  . TYR B 2 824 ? 122.577 37.664  29.382  1.00 0.00 ? 824 TYR B OH  1  
ATOM 9352   N N   . ILE B 2 825 ? 119.732 38.425  21.068  1.00 0.00 ? 825 ILE B N   1  
ATOM 9353   C CA  . ILE B 2 825 ? 119.087 38.778  19.846  1.00 0.00 ? 825 ILE B CA  1  
ATOM 9354   C C   . ILE B 2 825 ? 117.826 37.904  19.605  1.00 0.00 ? 825 ILE B C   1  
ATOM 9355   O O   . ILE B 2 825 ? 116.841 38.448  19.114  1.00 0.00 ? 825 ILE B O   1  
ATOM 9356   C CB  . ILE B 2 825 ? 120.071 38.837  18.667  1.00 0.00 ? 825 ILE B CB  1  
ATOM 9357   C CG1 . ILE B 2 825 ? 120.717 37.500  18.301  1.00 0.00 ? 825 ILE B CG1 1  
ATOM 9358   C CG2 . ILE B 2 825 ? 121.263 39.772  19.038  1.00 0.00 ? 825 ILE B CG2 1  
ATOM 9359   C CD1 . ILE B 2 825 ? 121.698 37.579  17.119  1.00 0.00 ? 825 ILE B CD1 1  
ATOM 9360   N N   . PHE B 2 826 ? 117.828 36.572  19.946  1.00 0.00 ? 826 PHE B N   1  
ATOM 9361   C CA  . PHE B 2 826 ? 116.714 35.753  19.718  1.00 0.00 ? 826 PHE B CA  1  
ATOM 9362   C C   . PHE B 2 826 ? 115.516 36.206  20.571  1.00 0.00 ? 826 PHE B C   1  
ATOM 9363   O O   . PHE B 2 826 ? 114.385 36.261  20.089  1.00 0.00 ? 826 PHE B O   1  
ATOM 9364   C CB  . PHE B 2 826 ? 117.085 34.342  20.089  1.00 0.00 ? 826 PHE B CB  1  
ATOM 9365   C CG  . PHE B 2 826 ? 116.003 33.346  19.693  1.00 0.00 ? 826 PHE B CG  1  
ATOM 9366   C CD1 . PHE B 2 826 ? 115.418 33.448  18.445  1.00 0.00 ? 826 PHE B CD1 1  
ATOM 9367   C CD2 . PHE B 2 826 ? 115.601 32.440  20.643  1.00 0.00 ? 826 PHE B CD2 1  
ATOM 9368   C CE1 . PHE B 2 826 ? 114.363 32.622  18.145  1.00 0.00 ? 826 PHE B CE1 1  
ATOM 9369   C CE2 . PHE B 2 826 ? 114.541 31.520  20.270  1.00 0.00 ? 826 PHE B CE2 1  
ATOM 9370   C CZ  . PHE B 2 826 ? 113.949 31.616  19.051  1.00 0.00 ? 826 PHE B CZ  1  
ATOM 9371   N N   . ARG B 2 827 ? 115.769 36.626  21.825  1.00 0.00 ? 827 ARG B N   1  
ATOM 9372   C CA  . ARG B 2 827 ? 114.831 37.141  22.872  1.00 0.00 ? 827 ARG B CA  1  
ATOM 9373   C C   . ARG B 2 827 ? 114.192 38.412  22.356  1.00 0.00 ? 827 ARG B C   1  
ATOM 9374   O O   . ARG B 2 827 ? 112.981 38.590  22.527  1.00 0.00 ? 827 ARG B O   1  
ATOM 9375   C CB  . ARG B 2 827 ? 115.612 37.544  24.151  1.00 0.00 ? 827 ARG B CB  1  
ATOM 9376   C CG  . ARG B 2 827 ? 115.777 36.363  25.100  1.00 0.00 ? 827 ARG B CG  1  
ATOM 9377   C CD  . ARG B 2 827 ? 116.370 36.762  26.465  1.00 0.00 ? 827 ARG B CD  1  
ATOM 9378   N NE  . ARG B 2 827 ? 116.399 35.472  27.271  1.00 0.00 ? 827 ARG B NE  1  
ATOM 9379   C CZ  . ARG B 2 827 ? 115.368 34.991  28.038  1.00 0.00 ? 827 ARG B CZ  1  
ATOM 9380   N NH1 . ARG B 2 827 ? 114.181 35.586  28.162  1.00 0.00 ? 827 ARG B NH1 1  
ATOM 9381   N NH2 . ARG B 2 827 ? 115.504 33.687  28.566  1.00 0.00 ? 827 ARG B NH2 1  
ATOM 9382   N N   . ALA B 2 828 ? 114.985 39.342  21.694  1.00 0.00 ? 828 ALA B N   1  
ATOM 9383   C CA  . ALA B 2 828 ? 114.476 40.514  21.150  1.00 0.00 ? 828 ALA B CA  1  
ATOM 9384   C C   . ALA B 2 828 ? 113.428 40.314  20.058  1.00 0.00 ? 828 ALA B C   1  
ATOM 9385   O O   . ALA B 2 828 ? 112.397 40.944  20.104  1.00 0.00 ? 828 ALA B O   1  
ATOM 9386   C CB  . ALA B 2 828 ? 115.601 41.373  20.579  1.00 0.00 ? 828 ALA B CB  1  
ATOM 9387   N N   . ASP B 2 829 ? 113.643 39.329  19.220  1.00 0.00 ? 829 ASP B N   1  
ATOM 9388   C CA  . ASP B 2 829 ? 112.707 38.794  18.266  1.00 0.00 ? 829 ASP B CA  1  
ATOM 9389   C C   . ASP B 2 829 ? 111.544 38.207  18.911  1.00 0.00 ? 829 ASP B C   1  
ATOM 9390   O O   . ASP B 2 829 ? 110.475 38.375  18.378  1.00 0.00 ? 829 ASP B O   1  
ATOM 9391   C CB  . ASP B 2 829 ? 113.479 37.831  17.362  1.00 0.00 ? 829 ASP B CB  1  
ATOM 9392   C CG  . ASP B 2 829 ? 112.568 37.131  16.407  1.00 0.00 ? 829 ASP B CG  1  
ATOM 9393   O OD1 . ASP B 2 829 ? 112.283 37.742  15.348  1.00 0.00 ? 829 ASP B OD1 1  
ATOM 9394   O OD2 . ASP B 2 829 ? 112.212 35.951  16.605  1.00 0.00 ? 829 ASP B OD2 1  
ATOM 9395   N N   . LEU B 2 830 ? 111.684 37.487  20.019  1.00 0.00 ? 830 LEU B N   1  
ATOM 9396   C CA  . LEU B 2 830 ? 110.538 36.833  20.657  1.00 0.00 ? 830 LEU B CA  1  
ATOM 9397   C C   . LEU B 2 830 ? 109.492 37.937  21.169  1.00 0.00 ? 830 LEU B C   1  
ATOM 9398   O O   . LEU B 2 830 ? 108.276 37.819  21.019  1.00 0.00 ? 830 LEU B O   1  
ATOM 9399   C CB  . LEU B 2 830 ? 110.971 35.866  21.779  1.00 0.00 ? 830 LEU B CB  1  
ATOM 9400   C CG  . LEU B 2 830 ? 111.790 34.663  21.282  1.00 0.00 ? 830 LEU B CG  1  
ATOM 9401   C CD1 . LEU B 2 830 ? 112.469 33.740  22.390  1.00 0.00 ? 830 LEU B CD1 1  
ATOM 9402   C CD2 . LEU B 2 830 ? 110.983 33.658  20.436  1.00 0.00 ? 830 LEU B CD2 1  
ATOM 9403   N N   . LYS B 2 831 ? 110.048 39.058  21.754  1.00 0.00 ? 831 LYS B N   1  
ATOM 9404   C CA  . LYS B 2 831 ? 109.307 40.120  22.237  1.00 0.00 ? 831 LYS B CA  1  
ATOM 9405   C C   . LYS B 2 831 ? 108.526 40.839  21.118  1.00 0.00 ? 831 LYS B C   1  
ATOM 9406   O O   . LYS B 2 831 ? 107.332 41.139  21.324  1.00 0.00 ? 831 LYS B O   1  
ATOM 9407   C CB  . LYS B 2 831 ? 110.121 41.141  23.135  1.00 0.00 ? 831 LYS B CB  1  
ATOM 9408   C CG  . LYS B 2 831 ? 109.269 42.100  23.958  1.00 0.00 ? 831 LYS B CG  1  
ATOM 9409   C CD  . LYS B 2 831 ? 108.517 41.382  25.106  1.00 0.00 ? 831 LYS B CD  1  
ATOM 9410   C CE  . LYS B 2 831 ? 107.861 42.374  26.114  1.00 0.00 ? 831 LYS B CE  1  
ATOM 9411   N NZ  . LYS B 2 831 ? 106.618 42.832  25.442  1.00 0.00 ? 831 LYS B NZ  1  
ATOM 9412   N N   . ASN B 2 832 ? 109.212 41.033  19.946  1.00 0.00 ? 832 ASN B N   1  
ATOM 9413   C CA  . ASN B 2 832 ? 108.667 41.732  18.825  1.00 0.00 ? 832 ASN B CA  1  
ATOM 9414   C C   . ASN B 2 832 ? 107.597 40.941  18.074  1.00 0.00 ? 832 ASN B C   1  
ATOM 9415   O O   . ASN B 2 832 ? 106.710 41.492  17.425  1.00 0.00 ? 832 ASN B O   1  
ATOM 9416   C CB  . ASN B 2 832 ? 109.777 42.135  17.720  1.00 0.00 ? 832 ASN B CB  1  
ATOM 9417   C CG  . ASN B 2 832 ? 110.825 43.160  18.323  1.00 0.00 ? 832 ASN B CG  1  
ATOM 9418   O OD1 . ASN B 2 832 ? 110.777 43.593  19.472  1.00 0.00 ? 832 ASN B OD1 1  
ATOM 9419   N ND2 . ASN B 2 832 ? 111.689 43.615  17.422  1.00 0.00 ? 832 ASN B ND2 1  
ATOM 9420   N N   . ASP B 2 833 ? 107.640 39.568  18.143  1.00 0.00 ? 833 ASP B N   1  
ATOM 9421   C CA  . ASP B 2 833 ? 106.871 38.630  17.317  1.00 0.00 ? 833 ASP B CA  1  
ATOM 9422   C C   . ASP B 2 833 ? 107.195 38.780  15.858  1.00 0.00 ? 833 ASP B C   1  
ATOM 9423   O O   . ASP B 2 833 ? 106.266 38.540  15.042  1.00 0.00 ? 833 ASP B O   1  
ATOM 9424   C CB  . ASP B 2 833 ? 105.358 38.694  17.552  1.00 0.00 ? 833 ASP B CB  1  
ATOM 9425   C CG  . ASP B 2 833 ? 105.176 38.280  19.025  1.00 0.00 ? 833 ASP B CG  1  
ATOM 9426   O OD1 . ASP B 2 833 ? 105.669 37.130  19.342  1.00 0.00 ? 833 ASP B OD1 1  
ATOM 9427   O OD2 . ASP B 2 833 ? 104.556 39.050  19.866  1.00 0.00 ? 833 ASP B OD2 1  
ATOM 9428   N N   . GLY B 2 834 ? 108.427 39.196  15.505  1.00 0.00 ? 834 GLY B N   1  
ATOM 9429   C CA  . GLY B 2 834 ? 108.807 39.394  14.175  1.00 0.00 ? 834 GLY B CA  1  
ATOM 9430   C C   . GLY B 2 834 ? 109.757 40.532  14.262  1.00 0.00 ? 834 GLY B C   1  
ATOM 9431   O O   . GLY B 2 834 ? 109.388 41.682  14.356  1.00 0.00 ? 834 GLY B O   1  
ATOM 9432   N N   . ASP B 2 835 ? 111.017 40.144  14.024  1.00 0.00 ? 835 ASP B N   1  
ATOM 9433   C CA  . ASP B 2 835 ? 112.102 41.076  13.756  1.00 0.00 ? 835 ASP B CA  1  
ATOM 9434   C C   . ASP B 2 835 ? 112.762 40.565  12.574  1.00 0.00 ? 835 ASP B C   1  
ATOM 9435   O O   . ASP B 2 835 ? 112.908 39.389  12.353  1.00 0.00 ? 835 ASP B O   1  
ATOM 9436   C CB  . ASP B 2 835 ? 113.005 41.158  14.986  1.00 0.00 ? 835 ASP B CB  1  
ATOM 9437   C CG  . ASP B 2 835 ? 113.952 42.402  15.090  1.00 0.00 ? 835 ASP B CG  1  
ATOM 9438   O OD1 . ASP B 2 835 ? 113.977 43.258  14.141  1.00 0.00 ? 835 ASP B OD1 1  
ATOM 9439   O OD2 . ASP B 2 835 ? 114.653 42.425  16.081  1.00 0.00 ? 835 ASP B OD2 1  
ATOM 9440   N N   . GLU B 2 836 ? 113.168 41.474  11.730  1.00 0.00 ? 836 GLU B N   1  
ATOM 9441   C CA  . GLU B 2 836 ? 113.736 41.203  10.468  1.00 0.00 ? 836 GLU B CA  1  
ATOM 9442   C C   . GLU B 2 836 ? 115.061 40.505  10.566  1.00 0.00 ? 836 GLU B C   1  
ATOM 9443   O O   . GLU B 2 836 ? 115.275 39.559  9.766   1.00 0.00 ? 836 GLU B O   1  
ATOM 9444   C CB  . GLU B 2 836 ? 114.025 42.579  9.786   1.00 0.00 ? 836 GLU B CB  1  
ATOM 9445   C CG  . GLU B 2 836 ? 114.556 42.486  8.309   1.00 0.00 ? 836 GLU B CG  1  
ATOM 9446   C CD  . GLU B 2 836 ? 113.507 42.052  7.373   1.00 0.00 ? 836 GLU B CD  1  
ATOM 9447   O OE1 . GLU B 2 836 ? 112.542 42.853  7.217   1.00 0.00 ? 836 GLU B OE1 1  
ATOM 9448   O OE2 . GLU B 2 836 ? 113.534 40.885  6.903   1.00 0.00 ? 836 GLU B OE2 1  
ATOM 9449   N N   . GLU B 2 837 ? 115.869 40.933  11.526  1.00 0.00 ? 837 GLU B N   1  
ATOM 9450   C CA  . GLU B 2 837 ? 117.172 40.356  11.616  1.00 0.00 ? 837 GLU B CA  1  
ATOM 9451   C C   . GLU B 2 837 ? 117.295 38.859  11.838  1.00 0.00 ? 837 GLU B C   1  
ATOM 9452   O O   . GLU B 2 837 ? 118.108 38.157  11.185  1.00 0.00 ? 837 GLU B O   1  
ATOM 9453   C CB  . GLU B 2 837 ? 118.158 41.093  12.521  1.00 0.00 ? 837 GLU B CB  1  
ATOM 9454   C CG  . GLU B 2 837 ? 117.653 41.305  14.048  1.00 0.00 ? 837 GLU B CG  1  
ATOM 9455   C CD  . GLU B 2 837 ? 118.058 40.195  14.862  1.00 0.00 ? 837 GLU B CD  1  
ATOM 9456   O OE1 . GLU B 2 837 ? 119.296 39.864  14.985  1.00 0.00 ? 837 GLU B OE1 1  
ATOM 9457   O OE2 . GLU B 2 837 ? 117.122 39.578  15.454  1.00 0.00 ? 837 GLU B OE2 1  
ATOM 9458   N N   . LEU B 2 838 ? 116.424 38.306  12.685  1.00 0.00 ? 838 LEU B N   1  
ATOM 9459   C CA  . LEU B 2 838 ? 116.351 36.883  12.981  1.00 0.00 ? 838 LEU B CA  1  
ATOM 9460   C C   . LEU B 2 838 ? 115.968 36.107  11.779  1.00 0.00 ? 838 LEU B C   1  
ATOM 9461   O O   . LEU B 2 838 ? 116.457 35.060  11.408  1.00 0.00 ? 838 LEU B O   1  
ATOM 9462   C CB  . LEU B 2 838 ? 115.348 36.601  14.128  1.00 0.00 ? 838 LEU B CB  1  
ATOM 9463   C CG  . LEU B 2 838 ? 115.778 35.530  15.155  1.00 0.00 ? 838 LEU B CG  1  
ATOM 9464   C CD1 . LEU B 2 838 ? 115.751 34.110  14.564  1.00 0.00 ? 838 LEU B CD1 1  
ATOM 9465   C CD2 . LEU B 2 838 ? 117.085 35.824  15.773  1.00 0.00 ? 838 LEU B CD2 1  
ATOM 9466   N N   . PHE B 2 839 ? 115.063 36.708  11.013  1.00 0.00 ? 839 PHE B N   1  
ATOM 9467   C CA  . PHE B 2 839 ? 114.554 36.163  9.809   1.00 0.00 ? 839 PHE B CA  1  
ATOM 9468   C C   . PHE B 2 839 ? 115.650 35.955  8.823   1.00 0.00 ? 839 PHE B C   1  
ATOM 9469   O O   . PHE B 2 839 ? 115.814 34.834  8.300   1.00 0.00 ? 839 PHE B O   1  
ATOM 9470   C CB  . PHE B 2 839 ? 113.317 36.795  9.219   1.00 0.00 ? 839 PHE B CB  1  
ATOM 9471   C CG  . PHE B 2 839 ? 111.998 36.859  10.000  1.00 0.00 ? 839 PHE B CG  1  
ATOM 9472   C CD1 . PHE B 2 839 ? 111.495 35.669  10.595  1.00 0.00 ? 839 PHE B CD1 1  
ATOM 9473   C CD2 . PHE B 2 839 ? 111.203 37.999  10.094  1.00 0.00 ? 839 PHE B CD2 1  
ATOM 9474   C CE1 . PHE B 2 839 ? 110.230 35.665  11.209  1.00 0.00 ? 839 PHE B CE1 1  
ATOM 9475   C CE2 . PHE B 2 839 ? 110.002 38.055  10.780  1.00 0.00 ? 839 PHE B CE2 1  
ATOM 9476   C CZ  . PHE B 2 839 ? 109.487 36.850  11.319  1.00 0.00 ? 839 PHE B CZ  1  
ATOM 9477   N N   . LEU B 2 840 ? 116.592 36.924  8.665   1.00 0.00 ? 840 LEU B N   1  
ATOM 9478   C CA  . LEU B 2 840 ? 117.786 36.811  7.793   1.00 0.00 ? 840 LEU B CA  1  
ATOM 9479   C C   . LEU B 2 840 ? 118.777 35.660  8.161   1.00 0.00 ? 840 LEU B C   1  
ATOM 9480   O O   . LEU B 2 840 ? 119.264 35.000  7.247   1.00 0.00 ? 840 LEU B O   1  
ATOM 9481   C CB  . LEU B 2 840 ? 118.698 38.125  7.666   1.00 0.00 ? 840 LEU B CB  1  
ATOM 9482   C CG  . LEU B 2 840 ? 117.947 39.183  6.892   1.00 0.00 ? 840 LEU B CG  1  
ATOM 9483   C CD1 . LEU B 2 840 ? 118.466 40.610  6.940   1.00 0.00 ? 840 LEU B CD1 1  
ATOM 9484   C CD2 . LEU B 2 840 ? 117.806 38.675  5.422   1.00 0.00 ? 840 LEU B CD2 1  
ATOM 9485   N N   . LEU B 2 841 ? 119.008 35.569  9.535   1.00 0.00 ? 841 LEU B N   1  
ATOM 9486   C CA  . LEU B 2 841 ? 119.892 34.627  10.099  1.00 0.00 ? 841 LEU B CA  1  
ATOM 9487   C C   . LEU B 2 841 ? 119.505 33.250  9.919   1.00 0.00 ? 841 LEU B C   1  
ATOM 9488   O O   . LEU B 2 841 ? 120.319 32.386  9.579   1.00 0.00 ? 841 LEU B O   1  
ATOM 9489   C CB  . LEU B 2 841 ? 119.958 34.992  11.655  1.00 0.00 ? 841 LEU B CB  1  
ATOM 9490   C CG  . LEU B 2 841 ? 120.646 36.316  12.083  1.00 0.00 ? 841 LEU B CG  1  
ATOM 9491   C CD1 . LEU B 2 841 ? 120.426 36.683  13.586  1.00 0.00 ? 841 LEU B CD1 1  
ATOM 9492   C CD2 . LEU B 2 841 ? 122.151 36.454  11.701  1.00 0.00 ? 841 LEU B CD2 1  
ATOM 9493   N N   . SER B 2 842 ? 118.155 33.080  10.056  1.00 0.00 ? 842 SER B N   1  
ATOM 9494   C CA  . SER B 2 842 ? 117.520 31.801  9.727   1.00 0.00 ? 842 SER B CA  1  
ATOM 9495   C C   . SER B 2 842 ? 117.642 31.439  8.261   1.00 0.00 ? 842 SER B C   1  
ATOM 9496   O O   . SER B 2 842 ? 117.913 30.269  8.043   1.00 0.00 ? 842 SER B O   1  
ATOM 9497   C CB  . SER B 2 842 ? 116.022 31.871  10.103  1.00 0.00 ? 842 SER B CB  1  
ATOM 9498   O OG  . SER B 2 842 ? 115.390 30.609  9.927   1.00 0.00 ? 842 SER B OG  1  
ATOM 9499   N N   . LYS B 2 843 ? 117.579 32.376  7.312   1.00 0.00 ? 843 LYS B N   1  
ATOM 9500   C CA  . LYS B 2 843 ? 117.850 32.178  5.886   1.00 0.00 ? 843 LYS B CA  1  
ATOM 9501   C C   . LYS B 2 843 ? 119.342 31.721  5.603   1.00 0.00 ? 843 LYS B C   1  
ATOM 9502   O O   . LYS B 2 843 ? 119.711 30.732  4.925   1.00 0.00 ? 843 LYS B O   1  
ATOM 9503   C CB  . LYS B 2 843 ? 117.520 33.411  5.007   1.00 0.00 ? 843 LYS B CB  1  
ATOM 9504   C CG  . LYS B 2 843 ? 115.973 33.598  4.905   1.00 0.00 ? 843 LYS B CG  1  
ATOM 9505   C CD  . LYS B 2 843 ? 115.556 35.085  4.962   1.00 0.00 ? 843 LYS B CD  1  
ATOM 9506   C CE  . LYS B 2 843 ? 114.100 35.201  4.515   1.00 0.00 ? 843 LYS B CE  1  
ATOM 9507   N NZ  . LYS B 2 843 ? 113.695 36.627  4.515   1.00 0.00 ? 843 LYS B NZ  1  
ATOM 9508   N N   . SER B 2 844 ? 120.294 32.412  6.283   1.00 0.00 ? 844 SER B N   1  
ATOM 9509   C CA  . SER B 2 844 ? 121.719 32.096  6.123   1.00 0.00 ? 844 SER B CA  1  
ATOM 9510   C C   . SER B 2 844 ? 122.119 30.736  6.490   1.00 0.00 ? 844 SER B C   1  
ATOM 9511   O O   . SER B 2 844 ? 122.747 30.066  5.661   1.00 0.00 ? 844 SER B O   1  
ATOM 9512   C CB  . SER B 2 844 ? 122.686 33.069  6.899   1.00 0.00 ? 844 SER B CB  1  
ATOM 9513   O OG  . SER B 2 844 ? 122.424 34.483  6.720   1.00 0.00 ? 844 SER B OG  1  
ATOM 9514   N N   . LEU B 2 845 ? 121.650 30.262  7.679   1.00 0.00 ? 845 LEU B N   1  
ATOM 9515   C CA  . LEU B 2 845 ? 121.869 28.931  8.141   1.00 0.00 ? 845 LEU B CA  1  
ATOM 9516   C C   . LEU B 2 845 ? 121.311 27.796  7.244   1.00 0.00 ? 845 LEU B C   1  
ATOM 9517   O O   . LEU B 2 845 ? 122.011 26.807  7.008   1.00 0.00 ? 845 LEU B O   1  
ATOM 9518   C CB  . LEU B 2 845 ? 121.351 28.820  9.596   1.00 0.00 ? 845 LEU B CB  1  
ATOM 9519   C CG  . LEU B 2 845 ? 122.276 29.571  10.642  1.00 0.00 ? 845 LEU B CG  1  
ATOM 9520   C CD1 . LEU B 2 845 ? 121.553 29.772  12.052  1.00 0.00 ? 845 LEU B CD1 1  
ATOM 9521   C CD2 . LEU B 2 845 ? 123.572 28.812  10.853  1.00 0.00 ? 845 LEU B CD2 1  
ATOM 9522   N N   . ARG B 2 846 ? 120.041 27.996  6.701   1.00 0.00 ? 846 ARG B N   1  
ATOM 9523   C CA  . ARG B 2 846 ? 119.359 27.032  5.764   1.00 0.00 ? 846 ARG B CA  1  
ATOM 9524   C C   . ARG B 2 846 ? 119.809 27.309  4.290   1.00 0.00 ? 846 ARG B C   1  
ATOM 9525   O O   . ARG B 2 846 ? 120.631 28.242  4.088   1.00 0.00 ? 846 ARG B O   1  
ATOM 9526   C CB  . ARG B 2 846 ? 117.838 26.990  5.829   1.00 0.00 ? 846 ARG B CB  1  
ATOM 9527   C CG  . ARG B 2 846 ? 117.278 26.961  7.244   1.00 0.00 ? 846 ARG B CG  1  
ATOM 9528   C CD  . ARG B 2 846 ? 115.752 27.296  7.251   1.00 0.00 ? 846 ARG B CD  1  
ATOM 9529   N NE  . ARG B 2 846 ? 115.562 28.772  7.095   1.00 0.00 ? 846 ARG B NE  1  
ATOM 9530   C CZ  . ARG B 2 846 ? 114.517 29.421  6.532   1.00 0.00 ? 846 ARG B CZ  1  
ATOM 9531   N NH1 . ARG B 2 846 ? 113.550 28.775  5.831   1.00 0.00 ? 846 ARG B NH1 1  
ATOM 9532   N NH2 . ARG B 2 846 ? 114.400 30.787  6.730   1.00 0.00 ? 846 ARG B NH2 1  
ATOM 9533   N N   . MET C 3 1   ? 74.615  60.099  37.325  1.00 0.00 ? 1   MET C N   1  
ATOM 9534   C CA  . MET C 3 1   ? 75.615  59.764  36.349  1.00 0.00 ? 1   MET C CA  1  
ATOM 9535   C C   . MET C 3 1   ? 76.652  58.774  36.888  1.00 0.00 ? 1   MET C C   1  
ATOM 9536   O O   . MET C 3 1   ? 76.580  58.235  37.978  1.00 0.00 ? 1   MET C O   1  
ATOM 9537   C CB  . MET C 3 1   ? 76.344  61.097  35.915  1.00 0.00 ? 1   MET C CB  1  
ATOM 9538   C CG  . MET C 3 1   ? 77.031  61.904  37.060  1.00 0.00 ? 1   MET C CG  1  
ATOM 9539   S SD  . MET C 3 1   ? 77.759  63.448  36.423  1.00 0.00 ? 1   MET C SD  1  
ATOM 9540   C CE  . MET C 3 1   ? 79.255  62.843  35.580  1.00 0.00 ? 1   MET C CE  1  
ATOM 9541   N N   . GLY C 3 2   ? 77.728  58.581  36.093  1.00 0.00 ? 2   GLY C N   1  
ATOM 9542   C CA  . GLY C 3 2   ? 78.848  57.676  36.450  1.00 0.00 ? 2   GLY C CA  1  
ATOM 9543   C C   . GLY C 3 2   ? 79.908  58.421  37.266  1.00 0.00 ? 2   GLY C C   1  
ATOM 9544   O O   . GLY C 3 2   ? 80.865  57.780  37.714  1.00 0.00 ? 2   GLY C O   1  
ATOM 9545   N N   . GLY C 3 3   ? 79.628  59.711  37.528  1.00 0.00 ? 3   GLY C N   1  
ATOM 9546   C CA  . GLY C 3 3   ? 80.432  60.484  38.451  1.00 0.00 ? 3   GLY C CA  1  
ATOM 9547   C C   . GLY C 3 3   ? 79.737  60.424  39.768  1.00 0.00 ? 3   GLY C C   1  
ATOM 9548   O O   . GLY C 3 3   ? 78.819  61.187  39.999  1.00 0.00 ? 3   GLY C O   1  
ATOM 9549   N N   . GLU C 3 4   ? 80.280  59.674  40.725  1.00 0.00 ? 4   GLU C N   1  
ATOM 9550   C CA  . GLU C 3 4   ? 79.831  59.509  42.113  1.00 0.00 ? 4   GLU C CA  1  
ATOM 9551   C C   . GLU C 3 4   ? 80.095  60.698  42.945  1.00 0.00 ? 4   GLU C C   1  
ATOM 9552   O O   . GLU C 3 4   ? 81.089  61.378  42.718  1.00 0.00 ? 4   GLU C O   1  
ATOM 9553   C CB  . GLU C 3 4   ? 80.279  58.264  42.845  1.00 0.00 ? 4   GLU C CB  1  
ATOM 9554   C CG  . GLU C 3 4   ? 79.492  56.999  42.319  1.00 0.00 ? 4   GLU C CG  1  
ATOM 9555   C CD  . GLU C 3 4   ? 79.846  56.799  40.831  1.00 0.00 ? 4   GLU C CD  1  
ATOM 9556   O OE1 . GLU C 3 4   ? 81.029  56.359  40.675  1.00 0.00 ? 4   GLU C OE1 1  
ATOM 9557   O OE2 . GLU C 3 4   ? 79.017  57.021  39.966  1.00 0.00 ? 4   GLU C OE2 1  
ATOM 9558   N N   . ILE C 3 5   ? 79.201  60.928  43.940  1.00 0.00 ? 5   ILE C N   1  
ATOM 9559   C CA  . ILE C 3 5   ? 79.211  61.936  44.961  1.00 0.00 ? 5   ILE C CA  1  
ATOM 9560   C C   . ILE C 3 5   ? 79.050  61.115  46.240  1.00 0.00 ? 5   ILE C C   1  
ATOM 9561   O O   . ILE C 3 5   ? 78.187  60.279  46.301  1.00 0.00 ? 5   ILE C O   1  
ATOM 9562   C CB  . ILE C 3 5   ? 78.072  62.848  44.857  1.00 0.00 ? 5   ILE C CB  1  
ATOM 9563   C CG1 . ILE C 3 5   ? 78.008  63.469  43.388  1.00 0.00 ? 5   ILE C CG1 1  
ATOM 9564   C CG2 . ILE C 3 5   ? 78.199  63.905  45.939  1.00 0.00 ? 5   ILE C CG2 1  
ATOM 9565   C CD1 . ILE C 3 5   ? 76.840  64.447  43.169  1.00 0.00 ? 5   ILE C CD1 1  
ATOM 9566   N N   . ILE C 3 6   ? 79.906  61.377  47.282  1.00 0.00 ? 6   ILE C N   1  
ATOM 9567   C CA  . ILE C 3 6   ? 79.806  60.686  48.563  1.00 0.00 ? 6   ILE C CA  1  
ATOM 9568   C C   . ILE C 3 6   ? 79.361  61.734  49.474  1.00 0.00 ? 6   ILE C C   1  
ATOM 9569   O O   . ILE C 3 6   ? 79.878  62.859  49.488  1.00 0.00 ? 6   ILE C O   1  
ATOM 9570   C CB  . ILE C 3 6   ? 81.145  60.119  49.058  1.00 0.00 ? 6   ILE C CB  1  
ATOM 9571   C CG1 . ILE C 3 6   ? 81.715  59.017  48.102  1.00 0.00 ? 6   ILE C CG1 1  
ATOM 9572   C CG2 . ILE C 3 6   ? 81.028  59.667  50.502  1.00 0.00 ? 6   ILE C CG2 1  
ATOM 9573   C CD1 . ILE C 3 6   ? 83.057  58.421  48.561  1.00 0.00 ? 6   ILE C CD1 1  
ATOM 9574   N N   . THR C 3 7   ? 78.302  61.361  50.273  1.00 0.00 ? 7   THR C N   1  
ATOM 9575   C CA  . THR C 3 7   ? 77.657  62.275  51.166  1.00 0.00 ? 7   THR C CA  1  
ATOM 9576   C C   . THR C 3 7   ? 78.061  62.055  52.592  1.00 0.00 ? 7   THR C C   1  
ATOM 9577   O O   . THR C 3 7   ? 78.120  60.889  53.072  1.00 0.00 ? 7   THR C O   1  
ATOM 9578   C CB  . THR C 3 7   ? 76.087  62.210  51.005  1.00 0.00 ? 7   THR C CB  1  
ATOM 9579   O OG1 . THR C 3 7   ? 75.722  62.404  49.620  1.00 0.00 ? 7   THR C OG1 1  
ATOM 9580   C CG2 . THR C 3 7   ? 75.458  63.366  51.848  1.00 0.00 ? 7   THR C CG2 1  
ATOM 9581   N N   . LEU C 3 8   ? 78.377  63.198  53.315  1.00 0.00 ? 8   LEU C N   1  
ATOM 9582   C CA  . LEU C 3 8   ? 78.834  63.241  54.701  1.00 0.00 ? 8   LEU C CA  1  
ATOM 9583   C C   . LEU C 3 8   ? 77.739  63.943  55.451  1.00 0.00 ? 8   LEU C C   1  
ATOM 9584   O O   . LEU C 3 8   ? 77.451  65.039  55.118  1.00 0.00 ? 8   LEU C O   1  
ATOM 9585   C CB  . LEU C 3 8   ? 80.224  64.033  54.758  1.00 0.00 ? 8   LEU C CB  1  
ATOM 9586   C CG  . LEU C 3 8   ? 81.407  63.507  53.795  1.00 0.00 ? 8   LEU C CG  1  
ATOM 9587   C CD1 . LEU C 3 8   ? 82.528  64.548  53.717  1.00 0.00 ? 8   LEU C CD1 1  
ATOM 9588   C CD2 . LEU C 3 8   ? 82.089  62.232  54.204  1.00 0.00 ? 8   LEU C CD2 1  
ATOM 9589   N N   . GLN C 3 9   ? 77.220  63.314  56.551  1.00 0.00 ? 9   GLN C N   1  
ATOM 9590   C CA  . GLN C 3 9   ? 76.287  63.982  57.401  1.00 0.00 ? 9   GLN C CA  1  
ATOM 9591   C C   . GLN C 3 9   ? 76.755  64.223  58.827  1.00 0.00 ? 9   GLN C C   1  
ATOM 9592   O O   . GLN C 3 9   ? 77.254  63.315  59.466  1.00 0.00 ? 9   GLN C O   1  
ATOM 9593   C CB  . GLN C 3 9   ? 74.958  63.215  57.252  1.00 0.00 ? 9   GLN C CB  1  
ATOM 9594   C CG  . GLN C 3 9   ? 74.403  63.376  55.854  1.00 0.00 ? 9   GLN C CG  1  
ATOM 9595   C CD  . GLN C 3 9   ? 73.443  62.212  55.636  1.00 0.00 ? 9   GLN C CD  1  
ATOM 9596   O OE1 . GLN C 3 9   ? 72.811  61.715  56.554  1.00 0.00 ? 9   GLN C OE1 1  
ATOM 9597   N NE2 . GLN C 3 9   ? 73.206  61.862  54.282  1.00 0.00 ? 9   GLN C NE2 1  
ATOM 9598   N N   . ALA C 3 10  ? 76.785  65.459  59.361  1.00 0.00 ? 10  ALA C N   1  
ATOM 9599   C CA  . ALA C 3 10  ? 77.491  65.722  60.571  1.00 0.00 ? 10  ALA C CA  1  
ATOM 9600   C C   . ALA C 3 10  ? 76.412  66.507  61.341  1.00 0.00 ? 10  ALA C C   1  
ATOM 9601   O O   . ALA C 3 10  ? 75.676  67.277  60.756  1.00 0.00 ? 10  ALA C O   1  
ATOM 9602   C CB  . ALA C 3 10  ? 78.751  66.660  60.551  1.00 0.00 ? 10  ALA C CB  1  
ATOM 9603   N N   . GLY C 3 11  ? 76.360  66.227  62.655  1.00 0.00 ? 11  GLY C N   1  
ATOM 9604   C CA  . GLY C 3 11  ? 75.385  66.978  63.471  1.00 0.00 ? 11  GLY C CA  1  
ATOM 9605   C C   . GLY C 3 11  ? 73.907  66.445  63.301  1.00 0.00 ? 11  GLY C C   1  
ATOM 9606   O O   . GLY C 3 11  ? 73.684  65.529  62.514  1.00 0.00 ? 11  GLY C O   1  
ATOM 9607   N N   . GLN C 3 12  ? 73.036  67.054  64.150  1.00 0.00 ? 12  GLN C N   1  
ATOM 9608   C CA  . GLN C 3 12  ? 71.676  66.706  64.296  1.00 0.00 ? 12  GLN C CA  1  
ATOM 9609   C C   . GLN C 3 12  ? 70.951  66.948  63.076  1.00 0.00 ? 12  GLN C C   1  
ATOM 9610   O O   . GLN C 3 12  ? 70.206  66.097  62.550  1.00 0.00 ? 12  GLN C O   1  
ATOM 9611   C CB  . GLN C 3 12  ? 70.959  67.425  65.433  1.00 0.00 ? 12  GLN C CB  1  
ATOM 9612   C CG  . GLN C 3 12  ? 71.418  66.926  66.903  1.00 0.00 ? 12  GLN C CG  1  
ATOM 9613   C CD  . GLN C 3 12  ? 72.746  67.480  67.253  1.00 0.00 ? 12  GLN C CD  1  
ATOM 9614   O OE1 . GLN C 3 12  ? 73.720  66.764  67.510  1.00 0.00 ? 12  GLN C OE1 1  
ATOM 9615   N NE2 . GLN C 3 12  ? 72.889  68.830  67.067  1.00 0.00 ? 12  GLN C NE2 1  
ATOM 9616   N N   . CYS C 3 13  ? 71.133  68.200  62.514  1.00 0.00 ? 13  CYS C N   1  
ATOM 9617   C CA  . CYS C 3 13  ? 70.553  68.812  61.346  1.00 0.00 ? 13  CYS C CA  1  
ATOM 9618   C C   . CYS C 3 13  ? 70.991  68.027  60.111  1.00 0.00 ? 13  CYS C C   1  
ATOM 9619   O O   . CYS C 3 13  ? 70.104  67.801  59.291  1.00 0.00 ? 13  CYS C O   1  
ATOM 9620   C CB  . CYS C 3 13  ? 70.958  70.325  61.167  1.00 0.00 ? 13  CYS C CB  1  
ATOM 9621   S SG  . CYS C 3 13  ? 70.727  71.097  59.534  1.00 0.00 ? 13  CYS C SG  1  
ATOM 9622   N N   . GLY C 3 14  ? 72.308  67.664  59.921  1.00 0.00 ? 14  GLY C N   1  
ATOM 9623   C CA  . GLY C 3 14  ? 72.867  66.961  58.742  1.00 0.00 ? 14  GLY C CA  1  
ATOM 9624   C C   . GLY C 3 14  ? 72.283  65.645  58.563  1.00 0.00 ? 14  GLY C C   1  
ATOM 9625   O O   . GLY C 3 14  ? 71.858  65.243  57.479  1.00 0.00 ? 14  GLY C O   1  
ATOM 9626   N N   . ASN C 3 15  ? 72.102  64.854  59.631  1.00 0.00 ? 15  ASN C N   1  
ATOM 9627   C CA  . ASN C 3 15  ? 71.453  63.550  59.570  1.00 0.00 ? 15  ASN C CA  1  
ATOM 9628   C C   . ASN C 3 15  ? 70.051  63.748  59.277  1.00 0.00 ? 15  ASN C C   1  
ATOM 9629   O O   . ASN C 3 15  ? 69.543  62.966  58.504  1.00 0.00 ? 15  ASN C O   1  
ATOM 9630   C CB  . ASN C 3 15  ? 71.495  62.793  60.923  1.00 0.00 ? 15  ASN C CB  1  
ATOM 9631   C CG  . ASN C 3 15  ? 72.771  62.101  61.453  1.00 0.00 ? 15  ASN C CG  1  
ATOM 9632   O OD1 . ASN C 3 15  ? 72.692  61.075  62.118  1.00 0.00 ? 15  ASN C OD1 1  
ATOM 9633   N ND2 . ASN C 3 15  ? 73.871  62.749  61.053  1.00 0.00 ? 15  ASN C ND2 1  
ATOM 9634   N N   . HIS C 3 16  ? 69.256  64.762  59.812  1.00 0.00 ? 16  HIS C N   1  
ATOM 9635   C CA  . HIS C 3 16  ? 67.890  64.980  59.579  1.00 0.00 ? 16  HIS C CA  1  
ATOM 9636   C C   . HIS C 3 16  ? 67.574  65.315  58.149  1.00 0.00 ? 16  HIS C C   1  
ATOM 9637   O O   . HIS C 3 16  ? 66.671  64.737  57.553  1.00 0.00 ? 16  HIS C O   1  
ATOM 9638   C CB  . HIS C 3 16  ? 67.318  66.133  60.490  1.00 0.00 ? 16  HIS C CB  1  
ATOM 9639   C CG  . HIS C 3 16  ? 67.149  65.820  61.893  1.00 0.00 ? 16  HIS C CG  1  
ATOM 9640   N ND1 . HIS C 3 16  ? 66.650  64.634  62.439  1.00 0.00 ? 16  HIS C ND1 1  
ATOM 9641   C CD2 . HIS C 3 16  ? 67.612  66.494  63.007  1.00 0.00 ? 16  HIS C CD2 1  
ATOM 9642   C CE1 . HIS C 3 16  ? 66.787  64.707  63.779  1.00 0.00 ? 16  HIS C CE1 1  
ATOM 9643   N NE2 . HIS C 3 16  ? 67.437  65.821  64.199  1.00 0.00 ? 16  HIS C NE2 1  
ATOM 9644   N N   . VAL C 3 17  ? 68.359  66.260  57.586  1.00 0.00 ? 17  VAL C N   1  
ATOM 9645   C CA  . VAL C 3 17  ? 68.062  66.657  56.230  1.00 0.00 ? 17  VAL C CA  1  
ATOM 9646   C C   . VAL C 3 17  ? 68.401  65.480  55.422  1.00 0.00 ? 17  VAL C C   1  
ATOM 9647   O O   . VAL C 3 17  ? 67.722  65.279  54.389  1.00 0.00 ? 17  VAL C O   1  
ATOM 9648   C CB  . VAL C 3 17  ? 68.878  67.857  55.718  1.00 0.00 ? 17  VAL C CB  1  
ATOM 9649   C CG1 . VAL C 3 17  ? 70.369  67.600  55.708  1.00 0.00 ? 17  VAL C CG1 1  
ATOM 9650   C CG2 . VAL C 3 17  ? 68.372  68.245  54.310  1.00 0.00 ? 17  VAL C CG2 1  
ATOM 9651   N N   . GLY C 3 18  ? 69.461  64.699  55.733  1.00 0.00 ? 18  GLY C N   1  
ATOM 9652   C CA  . GLY C 3 18  ? 69.914  63.593  54.906  1.00 0.00 ? 18  GLY C CA  1  
ATOM 9653   C C   . GLY C 3 18  ? 68.892  62.543  54.796  1.00 0.00 ? 18  GLY C C   1  
ATOM 9654   O O   . GLY C 3 18  ? 68.644  62.007  53.693  1.00 0.00 ? 18  GLY C O   1  
ATOM 9655   N N   . LYS C 3 19  ? 68.237  62.137  55.929  1.00 0.00 ? 19  LYS C N   1  
ATOM 9656   C CA  . LYS C 3 19  ? 67.214  61.023  55.900  1.00 0.00 ? 19  LYS C CA  1  
ATOM 9657   C C   . LYS C 3 19  ? 66.066  61.339  55.073  1.00 0.00 ? 19  LYS C C   1  
ATOM 9658   O O   . LYS C 3 19  ? 65.554  60.505  54.338  1.00 0.00 ? 19  LYS C O   1  
ATOM 9659   C CB  . LYS C 3 19  ? 66.736  60.387  57.216  1.00 0.00 ? 19  LYS C CB  1  
ATOM 9660   C CG  . LYS C 3 19  ? 66.549  61.356  58.455  1.00 0.00 ? 19  LYS C CG  1  
ATOM 9661   C CD  . LYS C 3 19  ? 65.926  60.711  59.674  1.00 0.00 ? 19  LYS C CD  1  
ATOM 9662   C CE  . LYS C 3 19  ? 66.121  61.500  60.996  1.00 0.00 ? 19  LYS C CE  1  
ATOM 9663   N NZ  . LYS C 3 19  ? 67.601  61.516  61.415  1.00 0.00 ? 19  LYS C NZ  1  
ATOM 9664   N N   . PHE C 3 20  ? 65.624  62.603  55.189  1.00 0.00 ? 20  PHE C N   1  
ATOM 9665   C CA  . PHE C 3 20  ? 64.486  63.168  54.497  1.00 0.00 ? 20  PHE C CA  1  
ATOM 9666   C C   . PHE C 3 20  ? 64.845  63.237  52.961  1.00 0.00 ? 20  PHE C C   1  
ATOM 9667   O O   . PHE C 3 20  ? 63.979  63.007  52.077  1.00 0.00 ? 20  PHE C O   1  
ATOM 9668   C CB  . PHE C 3 20  ? 64.058  64.659  54.713  1.00 0.00 ? 20  PHE C CB  1  
ATOM 9669   C CG  . PHE C 3 20  ? 63.453  64.745  56.038  1.00 0.00 ? 20  PHE C CG  1  
ATOM 9670   C CD1 . PHE C 3 20  ? 62.501  63.808  56.510  1.00 0.00 ? 20  PHE C CD1 1  
ATOM 9671   C CD2 . PHE C 3 20  ? 63.916  65.679  56.981  1.00 0.00 ? 20  PHE C CD2 1  
ATOM 9672   C CE1 . PHE C 3 20  ? 62.137  63.788  57.811  1.00 0.00 ? 20  PHE C CE1 1  
ATOM 9673   C CE2 . PHE C 3 20  ? 63.587  65.575  58.315  1.00 0.00 ? 20  PHE C CE2 1  
ATOM 9674   C CZ  . PHE C 3 20  ? 62.719  64.587  58.738  1.00 0.00 ? 20  PHE C CZ  1  
ATOM 9675   N N   . LEU C 3 21  ? 66.120  63.565  52.611  1.00 0.00 ? 21  LEU C N   1  
ATOM 9676   C CA  . LEU C 3 21  ? 66.608  63.696  51.243  1.00 0.00 ? 21  LEU C CA  1  
ATOM 9677   C C   . LEU C 3 21  ? 66.534  62.477  50.444  1.00 0.00 ? 21  LEU C C   1  
ATOM 9678   O O   . LEU C 3 21  ? 66.002  62.464  49.309  1.00 0.00 ? 21  LEU C O   1  
ATOM 9679   C CB  . LEU C 3 21  ? 68.087  64.188  51.174  1.00 0.00 ? 21  LEU C CB  1  
ATOM 9680   C CG  . LEU C 3 21  ? 68.620  64.357  49.741  1.00 0.00 ? 21  LEU C CG  1  
ATOM 9681   C CD1 . LEU C 3 21  ? 68.045  65.487  48.896  1.00 0.00 ? 21  LEU C CD1 1  
ATOM 9682   C CD2 . LEU C 3 21  ? 70.136  64.520  49.701  1.00 0.00 ? 21  LEU C CD2 1  
ATOM 9683   N N   . TRP C 3 22  ? 66.944  61.356  51.107  1.00 0.00 ? 22  TRP C N   1  
ATOM 9684   C CA  . TRP C 3 22  ? 66.910  60.000  50.587  1.00 0.00 ? 22  TRP C CA  1  
ATOM 9685   C C   . TRP C 3 22  ? 65.451  59.551  50.389  1.00 0.00 ? 22  TRP C C   1  
ATOM 9686   O O   . TRP C 3 22  ? 65.131  58.862  49.409  1.00 0.00 ? 22  TRP C O   1  
ATOM 9687   C CB  . TRP C 3 22  ? 67.622  59.000  51.499  1.00 0.00 ? 22  TRP C CB  1  
ATOM 9688   C CG  . TRP C 3 22  ? 69.119  59.222  51.660  1.00 0.00 ? 22  TRP C CG  1  
ATOM 9689   C CD1 . TRP C 3 22  ? 69.708  58.935  52.840  1.00 0.00 ? 22  TRP C CD1 1  
ATOM 9690   C CD2 . TRP C 3 22  ? 70.069  59.869  50.809  1.00 0.00 ? 22  TRP C CD2 1  
ATOM 9691   N NE1 . TRP C 3 22  ? 71.035  59.263  52.783  1.00 0.00 ? 22  TRP C NE1 1  
ATOM 9692   C CE2 . TRP C 3 22  ? 71.269  59.914  51.578  1.00 0.00 ? 22  TRP C CE2 1  
ATOM 9693   C CE3 . TRP C 3 22  ? 70.059  60.333  49.500  1.00 0.00 ? 22  TRP C CE3 1  
ATOM 9694   C CZ2 . TRP C 3 22  ? 72.449  60.574  51.082  1.00 0.00 ? 22  TRP C CZ2 1  
ATOM 9695   C CZ3 . TRP C 3 22  ? 71.267  60.931  48.972  1.00 0.00 ? 22  TRP C CZ3 1  
ATOM 9696   C CH2 . TRP C 3 22  ? 72.327  61.110  49.798  1.00 0.00 ? 22  TRP C CH2 1  
ATOM 9697   N N   . SER C 3 23  ? 64.509  59.879  51.319  1.00 0.00 ? 23  SER C N   1  
ATOM 9698   C CA  . SER C 3 23  ? 63.089  59.545  51.209  1.00 0.00 ? 23  SER C CA  1  
ATOM 9699   C C   . SER C 3 23  ? 62.585  60.209  49.942  1.00 0.00 ? 23  SER C C   1  
ATOM 9700   O O   . SER C 3 23  ? 61.752  59.662  49.155  1.00 0.00 ? 23  SER C O   1  
ATOM 9701   C CB  . SER C 3 23  ? 62.374  60.153  52.407  1.00 0.00 ? 23  SER C CB  1  
ATOM 9702   O OG  . SER C 3 23  ? 62.919  59.742  53.680  1.00 0.00 ? 23  SER C OG  1  
ATOM 9703   N N   . GLN C 3 24  ? 63.024  61.464  49.691  1.00 0.00 ? 24  GLN C N   1  
ATOM 9704   C CA  . GLN C 3 24  ? 62.577  62.153  48.497  1.00 0.00 ? 24  GLN C CA  1  
ATOM 9705   C C   . GLN C 3 24  ? 62.958  61.574  47.182  1.00 0.00 ? 24  GLN C C   1  
ATOM 9706   O O   . GLN C 3 24  ? 62.131  61.559  46.298  1.00 0.00 ? 24  GLN C O   1  
ATOM 9707   C CB  . GLN C 3 24  ? 62.957  63.679  48.534  1.00 0.00 ? 24  GLN C CB  1  
ATOM 9708   C CG  . GLN C 3 24  ? 62.084  64.665  47.667  1.00 0.00 ? 24  GLN C CG  1  
ATOM 9709   C CD  . GLN C 3 24  ? 62.739  66.029  47.736  1.00 0.00 ? 24  GLN C CD  1  
ATOM 9710   O OE1 . GLN C 3 24  ? 63.149  66.462  48.827  1.00 0.00 ? 24  GLN C OE1 1  
ATOM 9711   N NE2 . GLN C 3 24  ? 62.663  66.809  46.592  1.00 0.00 ? 24  GLN C NE2 1  
ATOM 9712   N N   . LEU C 3 25  ? 64.237  61.158  47.060  1.00 0.00 ? 25  LEU C N   1  
ATOM 9713   C CA  . LEU C 3 25  ? 64.813  60.640  45.823  1.00 0.00 ? 25  LEU C CA  1  
ATOM 9714   C C   . LEU C 3 25  ? 64.111  59.306  45.567  1.00 0.00 ? 25  LEU C C   1  
ATOM 9715   O O   . LEU C 3 25  ? 63.746  58.966  44.460  1.00 0.00 ? 25  LEU C O   1  
ATOM 9716   C CB  . LEU C 3 25  ? 66.397  60.502  45.884  1.00 0.00 ? 25  LEU C CB  1  
ATOM 9717   C CG  . LEU C 3 25  ? 67.175  61.827  45.964  1.00 0.00 ? 25  LEU C CG  1  
ATOM 9718   C CD1 . LEU C 3 25  ? 68.746  61.567  46.039  1.00 0.00 ? 25  LEU C CD1 1  
ATOM 9719   C CD2 . LEU C 3 25  ? 66.893  62.748  44.812  1.00 0.00 ? 25  LEU C CD2 1  
ATOM 9720   N N   . ALA C 3 26  ? 63.893  58.502  46.655  1.00 0.00 ? 26  ALA C N   1  
ATOM 9721   C CA  . ALA C 3 26  ? 63.226  57.186  46.525  1.00 0.00 ? 26  ALA C CA  1  
ATOM 9722   C C   . ALA C 3 26  ? 61.800  57.239  45.982  1.00 0.00 ? 26  ALA C C   1  
ATOM 9723   O O   . ALA C 3 26  ? 61.328  56.458  45.158  1.00 0.00 ? 26  ALA C O   1  
ATOM 9724   C CB  . ALA C 3 26  ? 63.241  56.551  47.910  1.00 0.00 ? 26  ALA C CB  1  
ATOM 9725   N N   . LYS C 3 27  ? 61.067  58.222  46.436  1.00 0.00 ? 27  LYS C N   1  
ATOM 9726   C CA  . LYS C 3 27  ? 59.706  58.474  46.059  1.00 0.00 ? 27  LYS C CA  1  
ATOM 9727   C C   . LYS C 3 27  ? 59.641  58.818  44.564  1.00 0.00 ? 27  LYS C C   1  
ATOM 9728   O O   . LYS C 3 27  ? 58.719  58.348  43.913  1.00 0.00 ? 27  LYS C O   1  
ATOM 9729   C CB  . LYS C 3 27  ? 59.029  59.543  46.898  1.00 0.00 ? 27  LYS C CB  1  
ATOM 9730   C CG  . LYS C 3 27  ? 57.443  59.718  46.741  1.00 0.00 ? 27  LYS C CG  1  
ATOM 9731   C CD  . LYS C 3 27  ? 56.697  60.612  47.779  1.00 0.00 ? 27  LYS C CD  1  
ATOM 9732   C CE  . LYS C 3 27  ? 57.412  61.971  47.985  1.00 0.00 ? 27  LYS C CE  1  
ATOM 9733   N NZ  . LYS C 3 27  ? 57.596  62.800  46.690  1.00 0.00 ? 27  LYS C NZ  1  
ATOM 9734   N N   . GLU C 3 28  ? 60.607  59.678  44.107  1.00 0.00 ? 28  GLU C N   1  
ATOM 9735   C CA  . GLU C 3 28  ? 60.683  60.232  42.737  1.00 0.00 ? 28  GLU C CA  1  
ATOM 9736   C C   . GLU C 3 28  ? 60.923  59.134  41.653  1.00 0.00 ? 28  GLU C C   1  
ATOM 9737   O O   . GLU C 3 28  ? 60.302  59.211  40.569  1.00 0.00 ? 28  GLU C O   1  
ATOM 9738   C CB  . GLU C 3 28  ? 61.911  61.206  42.655  1.00 0.00 ? 28  GLU C CB  1  
ATOM 9739   C CG  . GLU C 3 28  ? 61.624  62.659  43.139  1.00 0.00 ? 28  GLU C CG  1  
ATOM 9740   C CD  . GLU C 3 28  ? 62.864  63.477  42.859  1.00 0.00 ? 28  GLU C CD  1  
ATOM 9741   O OE1 . GLU C 3 28  ? 63.240  63.709  41.661  1.00 0.00 ? 28  GLU C OE1 1  
ATOM 9742   O OE2 . GLU C 3 28  ? 63.332  64.113  43.850  1.00 0.00 ? 28  GLU C OE2 1  
ATOM 9743   N N   . HIS C 3 29  ? 61.757  58.084  41.923  1.00 0.00 ? 29  HIS C N   1  
ATOM 9744   C CA  . HIS C 3 29  ? 62.025  57.011  40.885  1.00 0.00 ? 29  HIS C CA  1  
ATOM 9745   C C   . HIS C 3 29  ? 61.228  55.769  40.983  1.00 0.00 ? 29  HIS C C   1  
ATOM 9746   O O   . HIS C 3 29  ? 61.476  54.745  40.392  1.00 0.00 ? 29  HIS C O   1  
ATOM 9747   C CB  . HIS C 3 29  ? 63.501  56.543  41.080  1.00 0.00 ? 29  HIS C CB  1  
ATOM 9748   C CG  . HIS C 3 29  ? 64.402  57.664  41.543  1.00 0.00 ? 29  HIS C CG  1  
ATOM 9749   N ND1 . HIS C 3 29  ? 64.559  58.873  41.020  1.00 0.00 ? 29  HIS C ND1 1  
ATOM 9750   C CD2 . HIS C 3 29  ? 65.475  57.531  42.443  1.00 0.00 ? 29  HIS C CD2 1  
ATOM 9751   C CE1 . HIS C 3 29  ? 65.516  59.512  41.737  1.00 0.00 ? 29  HIS C CE1 1  
ATOM 9752   N NE2 . HIS C 3 29  ? 66.155  58.700  42.633  1.00 0.00 ? 29  HIS C NE2 1  
ATOM 9753   N N   . ALA C 3 30  ? 60.142  55.849  41.759  1.00 0.00 ? 30  ALA C N   1  
ATOM 9754   C CA  . ALA C 3 30  ? 59.142  54.768  41.888  1.00 0.00 ? 30  ALA C CA  1  
ATOM 9755   C C   . ALA C 3 30  ? 59.826  53.540  42.537  1.00 0.00 ? 30  ALA C C   1  
ATOM 9756   O O   . ALA C 3 30  ? 59.761  52.405  42.128  1.00 0.00 ? 30  ALA C O   1  
ATOM 9757   C CB  . ALA C 3 30  ? 58.258  54.404  40.681  1.00 0.00 ? 30  ALA C CB  1  
ATOM 9758   N N   . ILE C 3 31  ? 60.497  53.713  43.656  1.00 0.00 ? 31  ILE C N   1  
ATOM 9759   C CA  . ILE C 3 31  ? 61.096  52.651  44.478  1.00 0.00 ? 31  ILE C CA  1  
ATOM 9760   C C   . ILE C 3 31  ? 60.727  52.802  45.968  1.00 0.00 ? 31  ILE C C   1  
ATOM 9761   O O   . ILE C 3 31  ? 60.083  53.731  46.542  1.00 0.00 ? 31  ILE C O   1  
ATOM 9762   C CB  . ILE C 3 31  ? 62.608  52.517  44.354  1.00 0.00 ? 31  ILE C CB  1  
ATOM 9763   C CG1 . ILE C 3 31  ? 63.349  53.705  44.826  1.00 0.00 ? 31  ILE C CG1 1  
ATOM 9764   C CG2 . ILE C 3 31  ? 62.849  52.193  42.877  1.00 0.00 ? 31  ILE C CG2 1  
ATOM 9765   C CD1 . ILE C 3 31  ? 64.877  53.580  44.705  1.00 0.00 ? 31  ILE C CD1 1  
ATOM 9766   N N   . GLY C 3 32  ? 61.214  51.764  46.723  1.00 0.00 ? 32  GLY C N   1  
ATOM 9767   C CA  . GLY C 3 32  ? 60.909  51.682  48.131  1.00 0.00 ? 32  GLY C CA  1  
ATOM 9768   C C   . GLY C 3 32  ? 61.691  52.600  49.004  1.00 0.00 ? 32  GLY C C   1  
ATOM 9769   O O   . GLY C 3 32  ? 62.619  53.292  48.603  1.00 0.00 ? 32  GLY C O   1  
ATOM 9770   N N   . THR C 3 33  ? 61.255  52.621  50.268  1.00 0.00 ? 33  THR C N   1  
ATOM 9771   C CA  . THR C 3 33  ? 61.805  53.507  51.290  1.00 0.00 ? 33  THR C CA  1  
ATOM 9772   C C   . THR C 3 33  ? 62.888  52.851  52.113  1.00 0.00 ? 33  THR C C   1  
ATOM 9773   O O   . THR C 3 33  ? 63.629  53.537  52.902  1.00 0.00 ? 33  THR C O   1  
ATOM 9774   C CB  . THR C 3 33  ? 60.648  54.057  52.189  1.00 0.00 ? 33  THR C CB  1  
ATOM 9775   O OG1 . THR C 3 33  ? 59.976  52.919  52.725  1.00 0.00 ? 33  THR C OG1 1  
ATOM 9776   C CG2 . THR C 3 33  ? 59.691  54.979  51.268  1.00 0.00 ? 33  THR C CG2 1  
ATOM 9777   N N   . ASP C 3 34  ? 63.083  51.583  51.796  1.00 0.00 ? 34  ASP C N   1  
ATOM 9778   C CA  . ASP C 3 34  ? 64.189  50.826  52.272  1.00 0.00 ? 34  ASP C CA  1  
ATOM 9779   C C   . ASP C 3 34  ? 65.168  50.818  51.141  1.00 0.00 ? 34  ASP C C   1  
ATOM 9780   O O   . ASP C 3 34  ? 66.338  50.601  51.312  1.00 0.00 ? 34  ASP C O   1  
ATOM 9781   C CB  . ASP C 3 34  ? 63.766  49.374  52.486  1.00 0.00 ? 34  ASP C CB  1  
ATOM 9782   C CG  . ASP C 3 34  ? 62.750  49.308  53.687  1.00 0.00 ? 34  ASP C CG  1  
ATOM 9783   O OD1 . ASP C 3 34  ? 61.571  49.703  53.501  1.00 0.00 ? 34  ASP C OD1 1  
ATOM 9784   O OD2 . ASP C 3 34  ? 63.241  48.976  54.826  1.00 0.00 ? 34  ASP C OD2 1  
ATOM 9785   N N   . GLY C 3 35  ? 64.759  51.110  49.892  1.00 0.00 ? 35  GLY C N   1  
ATOM 9786   C CA  . GLY C 3 35  ? 65.664  51.292  48.826  1.00 0.00 ? 35  GLY C CA  1  
ATOM 9787   C C   . GLY C 3 35  ? 65.525  50.216  47.832  1.00 0.00 ? 35  GLY C C   1  
ATOM 9788   O O   . GLY C 3 35  ? 66.450  49.888  47.053  1.00 0.00 ? 35  GLY C O   1  
ATOM 9789   N N   . LEU C 3 36  ? 64.395  49.444  47.790  1.00 0.00 ? 36  LEU C N   1  
ATOM 9790   C CA  . LEU C 3 36  ? 64.197  48.275  46.921  1.00 0.00 ? 36  LEU C CA  1  
ATOM 9791   C C   . LEU C 3 36  ? 64.448  48.546  45.470  1.00 0.00 ? 36  LEU C C   1  
ATOM 9792   O O   . LEU C 3 36  ? 64.138  49.675  44.998  1.00 0.00 ? 36  LEU C O   1  
ATOM 9793   C CB  . LEU C 3 36  ? 62.771  47.822  47.021  1.00 0.00 ? 36  LEU C CB  1  
ATOM 9794   C CG  . LEU C 3 36  ? 62.333  47.339  48.457  1.00 0.00 ? 36  LEU C CG  1  
ATOM 9795   C CD1 . LEU C 3 36  ? 60.946  46.697  48.361  1.00 0.00 ? 36  LEU C CD1 1  
ATOM 9796   C CD2 . LEU C 3 36  ? 63.308  46.212  48.979  1.00 0.00 ? 36  LEU C CD2 1  
ATOM 9797   N N   . SER C 3 37  ? 64.968  47.536  44.742  1.00 0.00 ? 37  SER C N   1  
ATOM 9798   C CA  . SER C 3 37  ? 65.341  47.603  43.368  1.00 0.00 ? 37  SER C CA  1  
ATOM 9799   C C   . SER C 3 37  ? 64.101  47.356  42.602  1.00 0.00 ? 37  SER C C   1  
ATOM 9800   O O   . SER C 3 37  ? 63.535  46.255  42.512  1.00 0.00 ? 37  SER C O   1  
ATOM 9801   C CB  . SER C 3 37  ? 66.395  46.662  42.976  1.00 0.00 ? 37  SER C CB  1  
ATOM 9802   O OG  . SER C 3 37  ? 67.613  47.069  43.509  1.00 0.00 ? 37  SER C OG  1  
ATOM 9803   N N   . GLN C 3 38  ? 63.534  48.423  42.026  1.00 0.00 ? 38  GLN C N   1  
ATOM 9804   C CA  . GLN C 3 38  ? 62.213  48.221  41.324  1.00 0.00 ? 38  GLN C CA  1  
ATOM 9805   C C   . GLN C 3 38  ? 62.015  49.458  40.430  1.00 0.00 ? 38  GLN C C   1  
ATOM 9806   O O   . GLN C 3 38  ? 60.958  50.093  40.274  1.00 0.00 ? 38  GLN C O   1  
ATOM 9807   C CB  . GLN C 3 38  ? 60.991  47.920  42.206  1.00 0.00 ? 38  GLN C CB  1  
ATOM 9808   C CG  . GLN C 3 38  ? 60.676  49.020  43.159  1.00 0.00 ? 38  GLN C CG  1  
ATOM 9809   C CD  . GLN C 3 38  ? 59.529  48.587  44.047  1.00 0.00 ? 38  GLN C CD  1  
ATOM 9810   O OE1 . GLN C 3 38  ? 58.988  47.497  43.916  1.00 0.00 ? 38  GLN C OE1 1  
ATOM 9811   N NE2 . GLN C 3 38  ? 59.315  49.432  45.145  1.00 0.00 ? 38  GLN C NE2 1  
ATOM 9812   N N   . LEU C 3 39  ? 63.098  49.754  39.683  1.00 0.00 ? 39  LEU C N   1  
ATOM 9813   C CA  . LEU C 3 39  ? 63.171  50.777  38.638  1.00 0.00 ? 39  LEU C CA  1  
ATOM 9814   C C   . LEU C 3 39  ? 62.362  50.344  37.436  1.00 0.00 ? 39  LEU C C   1  
ATOM 9815   O O   . LEU C 3 39  ? 62.504  49.207  37.060  1.00 0.00 ? 39  LEU C O   1  
ATOM 9816   C CB  . LEU C 3 39  ? 64.604  51.170  38.161  1.00 0.00 ? 39  LEU C CB  1  
ATOM 9817   C CG  . LEU C 3 39  ? 65.454  51.821  39.263  1.00 0.00 ? 39  LEU C CG  1  
ATOM 9818   C CD1 . LEU C 3 39  ? 64.666  53.033  39.881  1.00 0.00 ? 39  LEU C CD1 1  
ATOM 9819   C CD2 . LEU C 3 39  ? 66.035  50.836  40.283  1.00 0.00 ? 39  LEU C CD2 1  
ATOM 9820   N N   . PRO C 3 40  ? 61.542  51.268  36.827  1.00 0.00 ? 40  PRO C N   1  
ATOM 9821   C CA  . PRO C 3 40  ? 60.789  50.853  35.630  1.00 0.00 ? 40  PRO C CA  1  
ATOM 9822   C C   . PRO C 3 40  ? 61.692  51.066  34.454  1.00 0.00 ? 40  PRO C C   1  
ATOM 9823   O O   . PRO C 3 40  ? 61.299  50.682  33.339  1.00 0.00 ? 40  PRO C O   1  
ATOM 9824   C CB  . PRO C 3 40  ? 59.547  51.733  35.626  1.00 0.00 ? 40  PRO C CB  1  
ATOM 9825   C CG  . PRO C 3 40  ? 60.049  52.991  36.312  1.00 0.00 ? 40  PRO C CG  1  
ATOM 9826   C CD  . PRO C 3 40  ? 60.924  52.436  37.473  1.00 0.00 ? 40  PRO C CD  1  
ATOM 9827   N N   . ASP C 3 41  ? 62.921  51.673  34.654  1.00 0.00 ? 41  ASP C N   1  
ATOM 9828   C CA  . ASP C 3 41  ? 63.741  51.838  33.492  1.00 0.00 ? 41  ASP C CA  1  
ATOM 9829   C C   . ASP C 3 41  ? 65.104  51.465  33.949  1.00 0.00 ? 41  ASP C C   1  
ATOM 9830   O O   . ASP C 3 41  ? 65.741  52.180  34.726  1.00 0.00 ? 41  ASP C O   1  
ATOM 9831   C CB  . ASP C 3 41  ? 63.753  53.199  32.779  1.00 0.00 ? 41  ASP C CB  1  
ATOM 9832   C CG  . ASP C 3 41  ? 62.507  53.445  31.909  1.00 0.00 ? 41  ASP C CG  1  
ATOM 9833   O OD1 . ASP C 3 41  ? 62.413  52.807  30.801  1.00 0.00 ? 41  ASP C OD1 1  
ATOM 9834   O OD2 . ASP C 3 41  ? 61.708  54.285  32.321  1.00 0.00 ? 41  ASP C OD2 1  
ATOM 9835   N N   . SER C 3 42  ? 65.587  50.259  33.595  1.00 0.00 ? 42  SER C N   1  
ATOM 9836   C CA  . SER C 3 42  ? 66.800  49.590  34.000  1.00 0.00 ? 42  SER C CA  1  
ATOM 9837   C C   . SER C 3 42  ? 67.180  48.847  32.750  1.00 0.00 ? 42  SER C C   1  
ATOM 9838   O O   . SER C 3 42  ? 67.836  47.844  32.784  1.00 0.00 ? 42  SER C O   1  
ATOM 9839   C CB  . SER C 3 42  ? 66.602  48.767  35.304  1.00 0.00 ? 42  SER C CB  1  
ATOM 9840   O OG  . SER C 3 42  ? 65.306  48.150  35.317  1.00 0.00 ? 42  SER C OG  1  
ATOM 9841   N N   . SER C 3 43  ? 66.581  49.317  31.632  1.00 0.00 ? 43  SER C N   1  
ATOM 9842   C CA  . SER C 3 43  ? 66.592  48.456  30.410  1.00 0.00 ? 43  SER C CA  1  
ATOM 9843   C C   . SER C 3 43  ? 66.888  49.415  29.309  1.00 0.00 ? 43  SER C C   1  
ATOM 9844   O O   . SER C 3 43  ? 67.103  49.104  28.181  1.00 0.00 ? 43  SER C O   1  
ATOM 9845   C CB  . SER C 3 43  ? 65.138  47.867  30.209  1.00 0.00 ? 43  SER C CB  1  
ATOM 9846   O OG  . SER C 3 43  ? 64.756  47.168  31.397  1.00 0.00 ? 43  SER C OG  1  
ATOM 9847   N N   . THR C 3 44  ? 67.059  50.734  29.647  1.00 0.00 ? 44  THR C N   1  
ATOM 9848   C CA  . THR C 3 44  ? 67.397  51.664  28.686  1.00 0.00 ? 44  THR C CA  1  
ATOM 9849   C C   . THR C 3 44  ? 68.085  52.848  29.340  1.00 0.00 ? 44  THR C C   1  
ATOM 9850   O O   . THR C 3 44  ? 68.576  53.656  28.569  1.00 0.00 ? 44  THR C O   1  
ATOM 9851   C CB  . THR C 3 44  ? 66.129  52.219  27.996  1.00 0.00 ? 44  THR C CB  1  
ATOM 9852   O OG1 . THR C 3 44  ? 66.384  52.940  26.785  1.00 0.00 ? 44  THR C OG1 1  
ATOM 9853   C CG2 . THR C 3 44  ? 65.276  53.051  28.944  1.00 0.00 ? 44  THR C CG2 1  
ATOM 9854   N N   . GLU C 3 45  ? 68.076  52.890  30.699  1.00 0.00 ? 45  GLU C N   1  
ATOM 9855   C CA  . GLU C 3 45  ? 68.670  53.919  31.541  1.00 0.00 ? 45  GLU C CA  1  
ATOM 9856   C C   . GLU C 3 45  ? 68.064  55.306  31.404  1.00 0.00 ? 45  GLU C C   1  
ATOM 9857   O O   . GLU C 3 45  ? 68.674  56.233  30.865  1.00 0.00 ? 45  GLU C O   1  
ATOM 9858   C CB  . GLU C 3 45  ? 70.181  53.965  31.477  1.00 0.00 ? 45  GLU C CB  1  
ATOM 9859   C CG  . GLU C 3 45  ? 70.856  52.652  31.796  1.00 0.00 ? 45  GLU C CG  1  
ATOM 9860   C CD  . GLU C 3 45  ? 70.671  52.247  33.297  1.00 0.00 ? 45  GLU C CD  1  
ATOM 9861   O OE1 . GLU C 3 45  ? 71.011  53.038  34.191  1.00 0.00 ? 45  GLU C OE1 1  
ATOM 9862   O OE2 . GLU C 3 45  ? 70.035  51.174  33.518  1.00 0.00 ? 45  GLU C OE2 1  
ATOM 9863   N N   . ARG C 3 46  ? 66.819  55.465  31.943  1.00 0.00 ? 46  ARG C N   1  
ATOM 9864   C CA  . ARG C 3 46  ? 66.261  56.767  32.077  1.00 0.00 ? 46  ARG C CA  1  
ATOM 9865   C C   . ARG C 3 46  ? 66.350  57.091  33.589  1.00 0.00 ? 46  ARG C C   1  
ATOM 9866   O O   . ARG C 3 46  ? 66.170  58.197  34.062  1.00 0.00 ? 46  ARG C O   1  
ATOM 9867   C CB  . ARG C 3 46  ? 64.816  56.757  31.590  1.00 0.00 ? 46  ARG C CB  1  
ATOM 9868   C CG  . ARG C 3 46  ? 64.151  58.078  31.552  1.00 0.00 ? 46  ARG C CG  1  
ATOM 9869   C CD  . ARG C 3 46  ? 62.787  58.066  32.308  1.00 0.00 ? 46  ARG C CD  1  
ATOM 9870   N NE  . ARG C 3 46  ? 62.994  57.614  33.714  1.00 0.00 ? 46  ARG C NE  1  
ATOM 9871   C CZ  . ARG C 3 46  ? 61.930  57.257  34.537  1.00 0.00 ? 46  ARG C CZ  1  
ATOM 9872   N NH1 . ARG C 3 46  ? 60.642  57.171  33.990  1.00 0.00 ? 46  ARG C NH1 1  
ATOM 9873   N NH2 . ARG C 3 46  ? 62.220  56.847  35.820  1.00 0.00 ? 46  ARG C NH2 1  
ATOM 9874   N N   . ASP C 3 47  ? 66.803  56.133  34.344  1.00 0.00 ? 47  ASP C N   1  
ATOM 9875   C CA  . ASP C 3 47  ? 67.163  56.248  35.656  1.00 0.00 ? 47  ASP C CA  1  
ATOM 9876   C C   . ASP C 3 47  ? 68.685  56.113  35.649  1.00 0.00 ? 47  ASP C C   1  
ATOM 9877   O O   . ASP C 3 47  ? 69.288  55.204  35.120  1.00 0.00 ? 47  ASP C O   1  
ATOM 9878   C CB  . ASP C 3 47  ? 66.575  55.126  36.596  1.00 0.00 ? 47  ASP C CB  1  
ATOM 9879   C CG  . ASP C 3 47  ? 65.087  55.422  36.834  1.00 0.00 ? 47  ASP C CG  1  
ATOM 9880   O OD1 . ASP C 3 47  ? 64.792  56.499  37.457  1.00 0.00 ? 47  ASP C OD1 1  
ATOM 9881   O OD2 . ASP C 3 47  ? 64.249  54.546  36.412  1.00 0.00 ? 47  ASP C OD2 1  
ATOM 9882   N N   . ASP C 3 48  ? 69.325  57.200  36.236  1.00 0.00 ? 48  ASP C N   1  
ATOM 9883   C CA  . ASP C 3 48  ? 70.729  57.178  36.556  1.00 0.00 ? 48  ASP C CA  1  
ATOM 9884   C C   . ASP C 3 48  ? 70.929  57.835  37.866  1.00 0.00 ? 48  ASP C C   1  
ATOM 9885   O O   . ASP C 3 48  ? 71.915  58.330  38.333  1.00 0.00 ? 48  ASP C O   1  
ATOM 9886   C CB  . ASP C 3 48  ? 71.643  57.983  35.523  1.00 0.00 ? 48  ASP C CB  1  
ATOM 9887   C CG  . ASP C 3 48  ? 71.764  57.210  34.229  1.00 0.00 ? 48  ASP C CG  1  
ATOM 9888   O OD1 . ASP C 3 48  ? 70.730  57.197  33.493  1.00 0.00 ? 48  ASP C OD1 1  
ATOM 9889   O OD2 . ASP C 3 48  ? 72.880  56.746  34.034  1.00 0.00 ? 48  ASP C OD2 1  
ATOM 9890   N N   . ASP C 3 49  ? 69.889  57.771  38.756  1.00 0.00 ? 49  ASP C N   1  
ATOM 9891   C CA  . ASP C 3 49  ? 69.804  58.513  40.032  1.00 0.00 ? 49  ASP C CA  1  
ATOM 9892   C C   . ASP C 3 49  ? 70.078  57.481  41.095  1.00 0.00 ? 49  ASP C C   1  
ATOM 9893   O O   . ASP C 3 49  ? 70.148  57.791  42.254  1.00 0.00 ? 49  ASP C O   1  
ATOM 9894   C CB  . ASP C 3 49  ? 68.324  59.037  40.258  1.00 0.00 ? 49  ASP C CB  1  
ATOM 9895   C CG  . ASP C 3 49  ? 67.766  59.707  39.025  1.00 0.00 ? 49  ASP C CG  1  
ATOM 9896   O OD1 . ASP C 3 49  ? 67.848  60.936  38.824  1.00 0.00 ? 49  ASP C OD1 1  
ATOM 9897   O OD2 . ASP C 3 49  ? 67.121  59.000  38.288  1.00 0.00 ? 49  ASP C OD2 1  
ATOM 9898   N N   . THR C 3 50  ? 70.314  56.234  40.630  1.00 0.00 ? 50  THR C N   1  
ATOM 9899   C CA  . THR C 3 50  ? 70.513  55.003  41.409  1.00 0.00 ? 50  THR C CA  1  
ATOM 9900   C C   . THR C 3 50  ? 71.987  54.706  41.252  1.00 0.00 ? 50  THR C C   1  
ATOM 9901   O O   . THR C 3 50  ? 72.323  53.559  41.374  1.00 0.00 ? 50  THR C O   1  
ATOM 9902   C CB  . THR C 3 50  ? 69.595  53.937  40.924  1.00 0.00 ? 50  THR C CB  1  
ATOM 9903   O OG1 . THR C 3 50  ? 69.674  53.734  39.471  1.00 0.00 ? 50  THR C OG1 1  
ATOM 9904   C CG2 . THR C 3 50  ? 68.124  54.292  41.318  1.00 0.00 ? 50  THR C CG2 1  
ATOM 9905   N N   . LYS C 3 51  ? 72.876  55.746  41.071  1.00 0.00 ? 51  LYS C N   1  
ATOM 9906   C CA  . LYS C 3 51  ? 74.328  55.567  40.938  1.00 0.00 ? 51  LYS C CA  1  
ATOM 9907   C C   . LYS C 3 51  ? 75.262  56.777  41.228  1.00 0.00 ? 51  LYS C C   1  
ATOM 9908   O O   . LYS C 3 51  ? 76.340  56.467  41.604  1.00 0.00 ? 51  LYS C O   1  
ATOM 9909   C CB  . LYS C 3 51  ? 74.846  54.866  39.633  1.00 0.00 ? 51  LYS C CB  1  
ATOM 9910   C CG  . LYS C 3 51  ? 74.421  55.467  38.241  1.00 0.00 ? 51  LYS C CG  1  
ATOM 9911   C CD  . LYS C 3 51  ? 74.967  54.845  36.958  1.00 0.00 ? 51  LYS C CD  1  
ATOM 9912   C CE  . LYS C 3 51  ? 74.436  53.420  36.849  1.00 0.00 ? 51  LYS C CE  1  
ATOM 9913   N NZ  . LYS C 3 51  ? 72.951  53.241  36.712  1.00 0.00 ? 51  LYS C NZ  1  
ATOM 9914   N N   . PRO C 3 52  ? 74.896  58.082  41.257  1.00 0.00 ? 52  PRO C N   1  
ATOM 9915   C CA  . PRO C 3 52  ? 75.742  59.135  41.731  1.00 0.00 ? 52  PRO C CA  1  
ATOM 9916   C C   . PRO C 3 52  ? 75.357  59.312  43.147  1.00 0.00 ? 52  PRO C C   1  
ATOM 9917   O O   . PRO C 3 52  ? 75.974  60.089  43.835  1.00 0.00 ? 52  PRO C O   1  
ATOM 9918   C CB  . PRO C 3 52  ? 75.352  60.423  40.993  1.00 0.00 ? 52  PRO C CB  1  
ATOM 9919   C CG  . PRO C 3 52  ? 73.923  60.115  40.604  1.00 0.00 ? 52  PRO C CG  1  
ATOM 9920   C CD  . PRO C 3 52  ? 74.014  58.633  40.276  1.00 0.00 ? 52  PRO C CD  1  
ATOM 9921   N N   . PHE C 3 53  ? 74.326  58.640  43.704  1.00 0.00 ? 53  PHE C N   1  
ATOM 9922   C CA  . PHE C 3 53  ? 74.010  58.783  45.063  1.00 0.00 ? 53  PHE C CA  1  
ATOM 9923   C C   . PHE C 3 53  ? 73.870  57.433  45.687  1.00 0.00 ? 53  PHE C C   1  
ATOM 9924   O O   . PHE C 3 53  ? 74.008  57.369  46.897  1.00 0.00 ? 53  PHE C O   1  
ATOM 9925   C CB  . PHE C 3 53  ? 72.688  59.483  45.235  1.00 0.00 ? 53  PHE C CB  1  
ATOM 9926   C CG  . PHE C 3 53  ? 72.913  60.984  45.070  1.00 0.00 ? 53  PHE C CG  1  
ATOM 9927   C CD1 . PHE C 3 53  ? 73.648  61.648  46.013  1.00 0.00 ? 53  PHE C CD1 1  
ATOM 9928   C CD2 . PHE C 3 53  ? 72.280  61.771  44.067  1.00 0.00 ? 53  PHE C CD2 1  
ATOM 9929   C CE1 . PHE C 3 53  ? 73.677  63.067  46.137  1.00 0.00 ? 53  PHE C CE1 1  
ATOM 9930   C CE2 . PHE C 3 53  ? 72.347  63.172  44.044  1.00 0.00 ? 53  PHE C CE2 1  
ATOM 9931   C CZ  . PHE C 3 53  ? 73.109  63.775  45.059  1.00 0.00 ? 53  PHE C CZ  1  
ATOM 9932   N N   . PHE C 3 54  ? 73.634  56.321  44.948  1.00 0.00 ? 54  PHE C N   1  
ATOM 9933   C CA  . PHE C 3 54  ? 73.389  55.005  45.534  1.00 0.00 ? 54  PHE C CA  1  
ATOM 9934   C C   . PHE C 3 54  ? 74.368  54.037  45.070  1.00 0.00 ? 54  PHE C C   1  
ATOM 9935   O O   . PHE C 3 54  ? 74.949  54.209  44.026  1.00 0.00 ? 54  PHE C O   1  
ATOM 9936   C CB  . PHE C 3 54  ? 71.983  54.418  45.187  1.00 0.00 ? 54  PHE C CB  1  
ATOM 9937   C CG  . PHE C 3 54  ? 70.806  55.324  45.693  1.00 0.00 ? 54  PHE C CG  1  
ATOM 9938   C CD1 . PHE C 3 54  ? 70.520  56.584  45.150  1.00 0.00 ? 54  PHE C CD1 1  
ATOM 9939   C CD2 . PHE C 3 54  ? 69.874  54.789  46.639  1.00 0.00 ? 54  PHE C CD2 1  
ATOM 9940   C CE1 . PHE C 3 54  ? 69.391  57.330  45.578  1.00 0.00 ? 54  PHE C CE1 1  
ATOM 9941   C CE2 . PHE C 3 54  ? 68.735  55.440  47.061  1.00 0.00 ? 54  PHE C CE2 1  
ATOM 9942   C CZ  . PHE C 3 54  ? 68.543  56.734  46.509  1.00 0.00 ? 54  PHE C CZ  1  
ATOM 9943   N N   . ARG C 3 55  ? 74.633  52.934  45.777  1.00 0.00 ? 55  ARG C N   1  
ATOM 9944   C CA  . ARG C 3 55  ? 75.481  51.917  45.449  1.00 0.00 ? 55  ARG C CA  1  
ATOM 9945   C C   . ARG C 3 55  ? 74.737  50.610  45.604  1.00 0.00 ? 55  ARG C C   1  
ATOM 9946   O O   . ARG C 3 55  ? 73.816  50.561  46.458  1.00 0.00 ? 55  ARG C O   1  
ATOM 9947   C CB  . ARG C 3 55  ? 76.726  51.728  46.413  1.00 0.00 ? 55  ARG C CB  1  
ATOM 9948   C CG  . ARG C 3 55  ? 76.382  51.547  47.950  1.00 0.00 ? 55  ARG C CG  1  
ATOM 9949   C CD  . ARG C 3 55  ? 77.683  51.518  48.782  1.00 0.00 ? 55  ARG C CD  1  
ATOM 9950   N NE  . ARG C 3 55  ? 78.621  50.452  48.306  1.00 0.00 ? 55  ARG C NE  1  
ATOM 9951   C CZ  . ARG C 3 55  ? 79.711  50.097  49.089  1.00 0.00 ? 55  ARG C CZ  1  
ATOM 9952   N NH1 . ARG C 3 55  ? 80.073  50.838  50.192  1.00 0.00 ? 55  ARG C NH1 1  
ATOM 9953   N NH2 . ARG C 3 55  ? 80.379  48.946  48.702  1.00 0.00 ? 55  ARG C NH2 1  
ATOM 9954   N N   . GLU C 3 56  ? 75.254  49.566  44.862  1.00 0.00 ? 56  GLU C N   1  
ATOM 9955   C CA  . GLU C 3 56  ? 74.782  48.233  44.867  1.00 0.00 ? 56  GLU C CA  1  
ATOM 9956   C C   . GLU C 3 56  ? 75.764  47.443  45.723  1.00 0.00 ? 56  GLU C C   1  
ATOM 9957   O O   . GLU C 3 56  ? 76.965  47.649  45.589  1.00 0.00 ? 56  GLU C O   1  
ATOM 9958   C CB  . GLU C 3 56  ? 74.701  47.647  43.464  1.00 0.00 ? 56  GLU C CB  1  
ATOM 9959   C CG  . GLU C 3 56  ? 73.907  46.311  43.335  1.00 0.00 ? 56  GLU C CG  1  
ATOM 9960   C CD  . GLU C 3 56  ? 72.548  46.308  43.948  1.00 0.00 ? 56  GLU C CD  1  
ATOM 9961   O OE1 . GLU C 3 56  ? 71.613  46.681  43.159  1.00 0.00 ? 56  GLU C OE1 1  
ATOM 9962   O OE2 . GLU C 3 56  ? 72.379  45.947  45.147  1.00 0.00 ? 56  GLU C OE2 1  
ATOM 9963   N N   . ASN C 3 57  ? 75.276  46.557  46.619  1.00 0.00 ? 57  ASN C N   1  
ATOM 9964   C CA  . ASN C 3 57  ? 75.993  45.679  47.566  1.00 0.00 ? 57  ASN C CA  1  
ATOM 9965   C C   . ASN C 3 57  ? 75.618  44.228  47.347  1.00 0.00 ? 57  ASN C C   1  
ATOM 9966   O O   . ASN C 3 57  ? 76.028  43.358  48.120  1.00 0.00 ? 57  ASN C O   1  
ATOM 9967   C CB  . ASN C 3 57  ? 75.562  46.024  48.990  1.00 0.00 ? 57  ASN C CB  1  
ATOM 9968   C CG  . ASN C 3 57  ? 76.498  47.226  49.357  1.00 0.00 ? 57  ASN C CG  1  
ATOM 9969   O OD1 . ASN C 3 57  ? 77.732  47.041  49.528  1.00 0.00 ? 57  ASN C OD1 1  
ATOM 9970   N ND2 . ASN C 3 57  ? 75.822  48.360  49.353  1.00 0.00 ? 57  ASN C ND2 1  
ATOM 9971   N N   . SER C 3 58  ? 74.754  44.009  46.365  1.00 0.00 ? 58  SER C N   1  
ATOM 9972   C CA  . SER C 3 58  ? 74.208  42.733  45.923  1.00 0.00 ? 58  SER C CA  1  
ATOM 9973   C C   . SER C 3 58  ? 73.458  42.191  47.056  1.00 0.00 ? 58  SER C C   1  
ATOM 9974   O O   . SER C 3 58  ? 73.634  41.013  47.357  1.00 0.00 ? 58  SER C O   1  
ATOM 9975   C CB  . SER C 3 58  ? 75.364  41.784  45.394  1.00 0.00 ? 58  SER C CB  1  
ATOM 9976   O OG  . SER C 3 58  ? 76.155  42.440  44.384  1.00 0.00 ? 58  SER C OG  1  
ATOM 9977   N N   . ARG C 3 59  ? 72.567  42.917  47.730  1.00 0.00 ? 59  ARG C N   1  
ATOM 9978   C CA  . ARG C 3 59  ? 71.576  42.491  48.677  1.00 0.00 ? 59  ARG C CA  1  
ATOM 9979   C C   . ARG C 3 59  ? 70.174  42.683  48.146  1.00 0.00 ? 59  ARG C C   1  
ATOM 9980   O O   . ARG C 3 59  ? 69.134  42.580  48.822  1.00 0.00 ? 59  ARG C O   1  
ATOM 9981   C CB  . ARG C 3 59  ? 71.682  43.361  49.940  1.00 0.00 ? 59  ARG C CB  1  
ATOM 9982   C CG  . ARG C 3 59  ? 71.905  44.886  49.816  1.00 0.00 ? 59  ARG C CG  1  
ATOM 9983   C CD  . ARG C 3 59  ? 71.755  45.692  51.186  1.00 0.00 ? 59  ARG C CD  1  
ATOM 9984   N NE  . ARG C 3 59  ? 72.760  45.164  52.185  1.00 0.00 ? 59  ARG C NE  1  
ATOM 9985   C CZ  . ARG C 3 59  ? 72.499  45.203  53.561  1.00 0.00 ? 59  ARG C CZ  1  
ATOM 9986   N NH1 . ARG C 3 59  ? 71.428  45.903  54.070  1.00 0.00 ? 59  ARG C NH1 1  
ATOM 9987   N NH2 . ARG C 3 59  ? 73.287  44.449  54.358  1.00 0.00 ? 59  ARG C NH2 1  
ATOM 9988   N N   . ASN C 3 60  ? 70.162  42.917  46.812  1.00 0.00 ? 60  ASN C N   1  
ATOM 9989   C CA  . ASN C 3 60  ? 69.038  43.079  45.933  1.00 0.00 ? 60  ASN C CA  1  
ATOM 9990   C C   . ASN C 3 60  ? 68.272  44.294  46.340  1.00 0.00 ? 60  ASN C C   1  
ATOM 9991   O O   . ASN C 3 60  ? 67.071  44.184  46.697  1.00 0.00 ? 60  ASN C O   1  
ATOM 9992   C CB  . ASN C 3 60  ? 68.117  41.807  45.731  1.00 0.00 ? 60  ASN C CB  1  
ATOM 9993   C CG  . ASN C 3 60  ? 68.886  40.590  45.170  1.00 0.00 ? 60  ASN C CG  1  
ATOM 9994   O OD1 . ASN C 3 60  ? 69.570  40.598  44.165  1.00 0.00 ? 60  ASN C OD1 1  
ATOM 9995   N ND2 . ASN C 3 60  ? 68.748  39.469  45.964  1.00 0.00 ? 60  ASN C ND2 1  
ATOM 9996   N N   . LYS C 3 61  ? 68.912  45.499  46.418  1.00 0.00 ? 61  LYS C N   1  
ATOM 9997   C CA  . LYS C 3 61  ? 68.177  46.668  46.883  1.00 0.00 ? 61  LYS C CA  1  
ATOM 9998   C C   . LYS C 3 61  ? 69.322  47.668  47.007  1.00 0.00 ? 61  LYS C C   1  
ATOM 9999   O O   . LYS C 3 61  ? 70.378  47.357  47.579  1.00 0.00 ? 61  LYS C O   1  
ATOM 10000  C CB  . LYS C 3 61  ? 67.437  46.543  48.291  1.00 0.00 ? 61  LYS C CB  1  
ATOM 10001  C CG  . LYS C 3 61  ? 68.292  46.052  49.532  1.00 0.00 ? 61  LYS C CG  1  
ATOM 10002  C CD  . LYS C 3 61  ? 67.555  45.991  50.862  1.00 0.00 ? 61  LYS C CD  1  
ATOM 10003  C CE  . LYS C 3 61  ? 67.541  47.346  51.487  1.00 0.00 ? 61  LYS C CE  1  
ATOM 10004  N NZ  . LYS C 3 61  ? 66.876  47.410  52.807  1.00 0.00 ? 61  LYS C NZ  1  
ATOM 10005  N N   . PHE C 3 62  ? 69.118  48.908  46.480  1.00 0.00 ? 62  PHE C N   1  
ATOM 10006  C CA  . PHE C 3 62  ? 70.091  49.953  46.455  1.00 0.00 ? 62  PHE C CA  1  
ATOM 10007  C C   . PHE C 3 62  ? 70.186  50.689  47.727  1.00 0.00 ? 62  PHE C C   1  
ATOM 10008  O O   . PHE C 3 62  ? 69.155  50.917  48.353  1.00 0.00 ? 62  PHE C O   1  
ATOM 10009  C CB  . PHE C 3 62  ? 69.741  50.967  45.301  1.00 0.00 ? 62  PHE C CB  1  
ATOM 10010  C CG  . PHE C 3 62  ? 70.127  50.391  43.887  1.00 0.00 ? 62  PHE C CG  1  
ATOM 10011  C CD1 . PHE C 3 62  ? 71.552  50.450  43.523  1.00 0.00 ? 62  PHE C CD1 1  
ATOM 10012  C CD2 . PHE C 3 62  ? 69.186  49.899  42.933  1.00 0.00 ? 62  PHE C CD2 1  
ATOM 10013  C CE1 . PHE C 3 62  ? 71.956  49.862  42.343  1.00 0.00 ? 62  PHE C CE1 1  
ATOM 10014  C CE2 . PHE C 3 62  ? 69.661  49.257  41.768  1.00 0.00 ? 62  PHE C CE2 1  
ATOM 10015  C CZ  . PHE C 3 62  ? 71.049  49.353  41.374  1.00 0.00 ? 62  PHE C CZ  1  
ATOM 10016  N N   . THR C 3 63  ? 71.420  51.101  48.110  1.00 0.00 ? 63  THR C N   1  
ATOM 10017  C CA  . THR C 3 63  ? 71.500  51.775  49.381  1.00 0.00 ? 63  THR C CA  1  
ATOM 10018  C C   . THR C 3 63  ? 72.259  52.995  49.032  1.00 0.00 ? 63  THR C C   1  
ATOM 10019  O O   . THR C 3 63  ? 73.161  52.911  48.235  1.00 0.00 ? 63  THR C O   1  
ATOM 10020  C CB  . THR C 3 63  ? 72.227  51.003  50.504  1.00 0.00 ? 63  THR C CB  1  
ATOM 10021  O OG1 . THR C 3 63  ? 73.444  50.467  50.150  1.00 0.00 ? 63  THR C OG1 1  
ATOM 10022  C CG2 . THR C 3 63  ? 71.356  49.753  50.970  1.00 0.00 ? 63  THR C CG2 1  
ATOM 10023  N N   . PRO C 3 64  ? 71.990  54.204  49.660  1.00 0.00 ? 64  PRO C N   1  
ATOM 10024  C CA  . PRO C 3 64  ? 72.692  55.446  49.411  1.00 0.00 ? 64  PRO C CA  1  
ATOM 10025  C C   . PRO C 3 64  ? 74.029  55.430  49.966  1.00 0.00 ? 64  PRO C C   1  
ATOM 10026  O O   . PRO C 3 64  ? 74.250  54.976  51.045  1.00 0.00 ? 64  PRO C O   1  
ATOM 10027  C CB  . PRO C 3 64  ? 71.940  56.575  50.128  1.00 0.00 ? 64  PRO C CB  1  
ATOM 10028  C CG  . PRO C 3 64  ? 70.521  56.042  50.115  1.00 0.00 ? 64  PRO C CG  1  
ATOM 10029  C CD  . PRO C 3 64  ? 70.669  54.540  50.203  1.00 0.00 ? 64  PRO C CD  1  
ATOM 10030  N N   . ARG C 3 65  ? 75.040  56.003  49.273  1.00 0.00 ? 65  ARG C N   1  
ATOM 10031  C CA  . ARG C 3 65  ? 76.400  56.208  49.678  1.00 0.00 ? 65  ARG C CA  1  
ATOM 10032  C C   . ARG C 3 65  ? 76.486  57.218  50.720  1.00 0.00 ? 65  ARG C C   1  
ATOM 10033  O O   . ARG C 3 65  ? 76.874  58.360  50.436  1.00 0.00 ? 65  ARG C O   1  
ATOM 10034  C CB  . ARG C 3 65  ? 77.393  56.599  48.495  1.00 0.00 ? 65  ARG C CB  1  
ATOM 10035  C CG  . ARG C 3 65  ? 77.263  55.482  47.406  1.00 0.00 ? 65  ARG C CG  1  
ATOM 10036  C CD  . ARG C 3 65  ? 78.220  55.775  46.212  1.00 0.00 ? 65  ARG C CD  1  
ATOM 10037  N NE  . ARG C 3 65  ? 77.986  54.763  45.075  1.00 0.00 ? 65  ARG C NE  1  
ATOM 10038  C CZ  . ARG C 3 65  ? 78.748  53.676  44.746  1.00 0.00 ? 65  ARG C CZ  1  
ATOM 10039  N NH1 . ARG C 3 65  ? 79.883  53.470  45.520  1.00 0.00 ? 65  ARG C NH1 1  
ATOM 10040  N NH2 . ARG C 3 65  ? 78.474  53.019  43.621  1.00 0.00 ? 65  ARG C NH2 1  
ATOM 10041  N N   . ALA C 3 66  ? 76.119  56.902  51.991  1.00 0.00 ? 66  ALA C N   1  
ATOM 10042  C CA  . ALA C 3 66  ? 76.074  57.934  52.911  1.00 0.00 ? 66  ALA C CA  1  
ATOM 10043  C C   . ALA C 3 66  ? 76.652  57.399  54.200  1.00 0.00 ? 66  ALA C C   1  
ATOM 10044  O O   . ALA C 3 66  ? 76.397  56.213  54.480  1.00 0.00 ? 66  ALA C O   1  
ATOM 10045  C CB  . ALA C 3 66  ? 74.642  58.391  53.236  1.00 0.00 ? 66  ALA C CB  1  
ATOM 10046  N N   . ILE C 3 67  ? 77.316  58.240  54.928  1.00 0.00 ? 67  ILE C N   1  
ATOM 10047  C CA  . ILE C 3 67  ? 77.871  58.047  56.184  1.00 0.00 ? 67  ILE C CA  1  
ATOM 10048  C C   . ILE C 3 67  ? 77.151  59.096  57.064  1.00 0.00 ? 67  ILE C C   1  
ATOM 10049  O O   . ILE C 3 67  ? 77.113  60.255  56.648  1.00 0.00 ? 67  ILE C O   1  
ATOM 10050  C CB  . ILE C 3 67  ? 79.382  58.232  56.164  1.00 0.00 ? 67  ILE C CB  1  
ATOM 10051  C CG1 . ILE C 3 67  ? 80.140  57.208  55.286  1.00 0.00 ? 67  ILE C CG1 1  
ATOM 10052  C CG2 . ILE C 3 67  ? 79.952  58.034  57.613  1.00 0.00 ? 67  ILE C CG2 1  
ATOM 10053  C CD1 . ILE C 3 67  ? 81.665  57.402  55.270  1.00 0.00 ? 67  ILE C CD1 1  
ATOM 10054  N N   . MET C 3 68  ? 76.558  58.705  58.296  1.00 0.00 ? 68  MET C N   1  
ATOM 10055  C CA  . MET C 3 68  ? 75.837  59.567  59.217  1.00 0.00 ? 68  MET C CA  1  
ATOM 10056  C C   . MET C 3 68  ? 76.651  59.638  60.406  1.00 0.00 ? 68  MET C C   1  
ATOM 10057  O O   . MET C 3 68  ? 77.067  58.575  60.880  1.00 0.00 ? 68  MET C O   1  
ATOM 10058  C CB  . MET C 3 68  ? 74.425  58.988  59.560  1.00 0.00 ? 68  MET C CB  1  
ATOM 10059  C CG  . MET C 3 68  ? 73.254  59.497  58.652  1.00 0.00 ? 68  MET C CG  1  
ATOM 10060  S SD  . MET C 3 68  ? 71.766  58.632  59.237  1.00 0.00 ? 68  MET C SD  1  
ATOM 10061  C CE  . MET C 3 68  ? 70.587  59.753  58.274  1.00 0.00 ? 68  MET C CE  1  
ATOM 10062  N N   . MET C 3 69  ? 76.916  60.900  60.942  1.00 0.00 ? 69  MET C N   1  
ATOM 10063  C CA  . MET C 3 69  ? 77.810  61.015  62.062  1.00 0.00 ? 69  MET C CA  1  
ATOM 10064  C C   . MET C 3 69  ? 77.164  61.991  63.052  1.00 0.00 ? 69  MET C C   1  
ATOM 10065  O O   . MET C 3 69  ? 76.658  62.987  62.616  1.00 0.00 ? 69  MET C O   1  
ATOM 10066  C CB  . MET C 3 69  ? 79.209  61.480  61.647  1.00 0.00 ? 69  MET C CB  1  
ATOM 10067  C CG  . MET C 3 69  ? 80.112  60.427  60.947  1.00 0.00 ? 69  MET C CG  1  
ATOM 10068  S SD  . MET C 3 69  ? 81.836  60.996  60.495  1.00 0.00 ? 69  MET C SD  1  
ATOM 10069  C CE  . MET C 3 69  ? 81.393  61.938  58.962  1.00 0.00 ? 69  MET C CE  1  
ATOM 10070  N N   . ASP C 3 70  ? 77.180  61.731  64.376  1.00 0.00 ? 70  ASP C N   1  
ATOM 10071  C CA  . ASP C 3 70  ? 76.843  62.607  65.405  1.00 0.00 ? 70  ASP C CA  1  
ATOM 10072  C C   . ASP C 3 70  ? 76.769  61.863  66.652  1.00 0.00 ? 70  ASP C C   1  
ATOM 10073  O O   . ASP C 3 70  ? 77.340  60.771  66.711  1.00 0.00 ? 70  ASP C O   1  
ATOM 10074  C CB  . ASP C 3 70  ? 75.603  63.570  65.327  1.00 0.00 ? 70  ASP C CB  1  
ATOM 10075  C CG  . ASP C 3 70  ? 74.235  62.923  65.187  1.00 0.00 ? 70  ASP C CG  1  
ATOM 10076  O OD1 . ASP C 3 70  ? 74.125  61.901  64.553  1.00 0.00 ? 70  ASP C OD1 1  
ATOM 10077  O OD2 . ASP C 3 70  ? 73.377  63.358  65.928  1.00 0.00 ? 70  ASP C OD2 1  
ATOM 10078  N N   . SER C 3 71  ? 76.041  62.438  67.613  1.00 0.00 ? 71  SER C N   1  
ATOM 10079  C CA  . SER C 3 71  ? 75.609  61.817  68.870  1.00 0.00 ? 71  SER C CA  1  
ATOM 10080  C C   . SER C 3 71  ? 74.421  61.042  68.731  1.00 0.00 ? 71  SER C C   1  
ATOM 10081  O O   . SER C 3 71  ? 73.991  60.747  67.628  1.00 0.00 ? 71  SER C O   1  
ATOM 10082  C CB  . SER C 3 71  ? 75.444  62.861  70.025  1.00 0.00 ? 71  SER C CB  1  
ATOM 10083  O OG  . SER C 3 71  ? 76.462  63.873  70.021  1.00 0.00 ? 71  SER C OG  1  
ATOM 10084  N N   . GLU C 3 72  ? 73.923  60.611  69.831  1.00 0.00 ? 72  GLU C N   1  
ATOM 10085  C CA  . GLU C 3 72  ? 72.864  59.654  69.846  1.00 0.00 ? 72  GLU C CA  1  
ATOM 10086  C C   . GLU C 3 72  ? 71.440  60.038  69.366  1.00 0.00 ? 72  GLU C C   1  
ATOM 10087  O O   . GLU C 3 72  ? 70.927  59.200  68.696  1.00 0.00 ? 72  GLU C O   1  
ATOM 10088  C CB  . GLU C 3 72  ? 72.794  59.080  71.232  1.00 0.00 ? 72  GLU C CB  1  
ATOM 10089  C CG  . GLU C 3 72  ? 72.379  59.950  72.402  1.00 0.00 ? 72  GLU C CG  1  
ATOM 10090  C CD  . GLU C 3 72  ? 73.594  60.865  72.795  1.00 0.00 ? 72  GLU C CD  1  
ATOM 10091  O OE1 . GLU C 3 72  ? 74.639  60.221  73.021  1.00 0.00 ? 72  GLU C OE1 1  
ATOM 10092  O OE2 . GLU C 3 72  ? 73.502  62.120  72.847  1.00 0.00 ? 72  GLU C OE2 1  
ATOM 10093  N N   . PRO C 3 73  ? 70.830  61.215  69.582  1.00 0.00 ? 73  PRO C N   1  
ATOM 10094  C CA  . PRO C 3 73  ? 69.462  61.472  69.314  1.00 0.00 ? 73  PRO C CA  1  
ATOM 10095  C C   . PRO C 3 73  ? 69.116  61.196  67.837  1.00 0.00 ? 73  PRO C C   1  
ATOM 10096  O O   . PRO C 3 73  ? 68.039  60.629  67.555  1.00 0.00 ? 73  PRO C O   1  
ATOM 10097  C CB  . PRO C 3 73  ? 69.094  62.931  69.754  1.00 0.00 ? 73  PRO C CB  1  
ATOM 10098  C CG  . PRO C 3 73  ? 70.359  63.368  70.540  1.00 0.00 ? 73  PRO C CG  1  
ATOM 10099  C CD  . PRO C 3 73  ? 71.463  62.450  70.028  1.00 0.00 ? 73  PRO C CD  1  
ATOM 10100  N N   . SER C 3 74  ? 69.932  61.725  66.834  1.00 0.00 ? 74  SER C N   1  
ATOM 10101  C CA  . SER C 3 74  ? 69.512  61.695  65.395  1.00 0.00 ? 74  SER C CA  1  
ATOM 10102  C C   . SER C 3 74  ? 69.543  60.276  64.814  1.00 0.00 ? 74  SER C C   1  
ATOM 10103  O O   . SER C 3 74  ? 68.603  59.850  64.124  1.00 0.00 ? 74  SER C O   1  
ATOM 10104  C CB  . SER C 3 74  ? 70.273  62.689  64.537  1.00 0.00 ? 74  SER C CB  1  
ATOM 10105  O OG  . SER C 3 74  ? 70.040  63.968  65.156  1.00 0.00 ? 74  SER C OG  1  
ATOM 10106  N N   . VAL C 3 75  ? 70.648  59.559  65.144  1.00 0.00 ? 75  VAL C N   1  
ATOM 10107  C CA  . VAL C 3 75  ? 70.862  58.253  64.653  1.00 0.00 ? 75  VAL C CA  1  
ATOM 10108  C C   . VAL C 3 75  ? 69.727  57.273  65.141  1.00 0.00 ? 75  VAL C C   1  
ATOM 10109  O O   . VAL C 3 75  ? 69.215  56.480  64.330  1.00 0.00 ? 75  VAL C O   1  
ATOM 10110  C CB  . VAL C 3 75  ? 72.244  57.801  64.945  1.00 0.00 ? 75  VAL C CB  1  
ATOM 10111  C CG1 . VAL C 3 75  ? 73.303  58.705  64.259  1.00 0.00 ? 75  VAL C CG1 1  
ATOM 10112  C CG2 . VAL C 3 75  ? 72.527  57.357  66.466  1.00 0.00 ? 75  VAL C CG2 1  
ATOM 10113  N N   . ILE C 3 76  ? 69.218  57.456  66.435  1.00 0.00 ? 76  ILE C N   1  
ATOM 10114  C CA  . ILE C 3 76  ? 68.046  56.725  67.009  1.00 0.00 ? 76  ILE C CA  1  
ATOM 10115  C C   . ILE C 3 76  ? 66.758  57.024  66.275  1.00 0.00 ? 76  ILE C C   1  
ATOM 10116  O O   . ILE C 3 76  ? 66.013  56.170  65.849  1.00 0.00 ? 76  ILE C O   1  
ATOM 10117  C CB  . ILE C 3 76  ? 67.905  56.973  68.528  1.00 0.00 ? 76  ILE C CB  1  
ATOM 10118  C CG1 . ILE C 3 76  ? 69.187  56.419  69.247  1.00 0.00 ? 76  ILE C CG1 1  
ATOM 10119  C CG2 . ILE C 3 76  ? 66.654  56.236  69.095  1.00 0.00 ? 76  ILE C CG2 1  
ATOM 10120  C CD1 . ILE C 3 76  ? 69.178  56.601  70.775  1.00 0.00 ? 76  ILE C CD1 1  
ATOM 10121  N N   . ALA C 3 77  ? 66.531  58.310  65.910  1.00 0.00 ? 77  ALA C N   1  
ATOM 10122  C CA  . ALA C 3 77  ? 65.377  58.698  65.078  1.00 0.00 ? 77  ALA C CA  1  
ATOM 10123  C C   . ALA C 3 77  ? 65.348  58.091  63.709  1.00 0.00 ? 77  ALA C C   1  
ATOM 10124  O O   . ALA C 3 77  ? 64.285  57.665  63.262  1.00 0.00 ? 77  ALA C O   1  
ATOM 10125  C CB  . ALA C 3 77  ? 65.211  60.246  64.785  1.00 0.00 ? 77  ALA C CB  1  
ATOM 10126  N N   . ASP C 3 78  ? 66.437  57.999  62.924  1.00 0.00 ? 78  ASP C N   1  
ATOM 10127  C CA  . ASP C 3 78  ? 66.554  57.366  61.646  1.00 0.00 ? 78  ASP C CA  1  
ATOM 10128  C C   . ASP C 3 78  ? 66.299  55.925  61.597  1.00 0.00 ? 78  ASP C C   1  
ATOM 10129  O O   . ASP C 3 78  ? 65.659  55.380  60.715  1.00 0.00 ? 78  ASP C O   1  
ATOM 10130  C CB  . ASP C 3 78  ? 68.023  57.616  61.032  1.00 0.00 ? 78  ASP C CB  1  
ATOM 10131  C CG  . ASP C 3 78  ? 68.305  56.901  59.648  1.00 0.00 ? 78  ASP C CG  1  
ATOM 10132  O OD1 . ASP C 3 78  ? 67.855  57.419  58.624  1.00 0.00 ? 78  ASP C OD1 1  
ATOM 10133  O OD2 . ASP C 3 78  ? 68.989  55.810  59.693  1.00 0.00 ? 78  ASP C OD2 1  
ATOM 10134  N N   . VAL C 3 79  ? 66.838  55.209  62.629  1.00 0.00 ? 79  VAL C N   1  
ATOM 10135  C CA  . VAL C 3 79  ? 66.604  53.790  62.825  1.00 0.00 ? 79  VAL C CA  1  
ATOM 10136  C C   . VAL C 3 79  ? 65.203  53.356  63.205  1.00 0.00 ? 79  VAL C C   1  
ATOM 10137  O O   . VAL C 3 79  ? 64.668  52.309  62.811  1.00 0.00 ? 79  VAL C O   1  
ATOM 10138  C CB  . VAL C 3 79  ? 67.745  53.074  63.546  1.00 0.00 ? 79  VAL C CB  1  
ATOM 10139  C CG1 . VAL C 3 79  ? 67.653  51.490  63.732  1.00 0.00 ? 79  VAL C CG1 1  
ATOM 10140  C CG2 . VAL C 3 79  ? 69.053  53.352  62.755  1.00 0.00 ? 79  VAL C CG2 1  
ATOM 10141  N N   . GLU C 3 80  ? 64.513  54.241  63.932  1.00 0.00 ? 80  GLU C N   1  
ATOM 10142  C CA  . GLU C 3 80  ? 63.182  54.169  64.373  1.00 0.00 ? 80  GLU C CA  1  
ATOM 10143  C C   . GLU C 3 80  ? 62.246  54.255  63.190  1.00 0.00 ? 80  GLU C C   1  
ATOM 10144  O O   . GLU C 3 80  ? 61.260  53.549  63.234  1.00 0.00 ? 80  GLU C O   1  
ATOM 10145  C CB  . GLU C 3 80  ? 62.775  55.352  65.290  1.00 0.00 ? 80  GLU C CB  1  
ATOM 10146  C CG  . GLU C 3 80  ? 61.597  54.851  66.133  1.00 0.00 ? 80  GLU C CG  1  
ATOM 10147  C CD  . GLU C 3 80  ? 61.027  56.025  66.922  1.00 0.00 ? 80  GLU C CD  1  
ATOM 10148  O OE1 . GLU C 3 80  ? 61.721  56.492  67.842  1.00 0.00 ? 80  GLU C OE1 1  
ATOM 10149  O OE2 . GLU C 3 80  ? 59.829  56.418  66.633  1.00 0.00 ? 80  GLU C OE2 1  
ATOM 10150  N N   . ASN C 3 81  ? 62.560  55.072  62.125  1.00 0.00 ? 81  ASN C N   1  
ATOM 10151  C CA  . ASN C 3 81  ? 61.691  55.215  60.958  1.00 0.00 ? 81  ASN C CA  1  
ATOM 10152  C C   . ASN C 3 81  ? 62.121  54.274  59.856  1.00 0.00 ? 81  ASN C C   1  
ATOM 10153  O O   . ASN C 3 81  ? 63.209  53.726  60.003  1.00 0.00 ? 81  ASN C O   1  
ATOM 10154  C CB  . ASN C 3 81  ? 61.470  56.732  60.385  1.00 0.00 ? 81  ASN C CB  1  
ATOM 10155  C CG  . ASN C 3 81  ? 62.819  57.386  60.106  1.00 0.00 ? 81  ASN C CG  1  
ATOM 10156  O OD1 . ASN C 3 81  ? 63.723  56.890  59.406  1.00 0.00 ? 81  ASN C OD1 1  
ATOM 10157  N ND2 . ASN C 3 81  ? 62.952  58.638  60.720  1.00 0.00 ? 81  ASN C ND2 1  
ATOM 10158  N N   . THR C 3 82  ? 61.301  53.960  58.749  1.00 0.00 ? 82  THR C N   1  
ATOM 10159  C CA  . THR C 3 82  ? 61.608  52.947  57.768  1.00 0.00 ? 82  THR C CA  1  
ATOM 10160  C C   . THR C 3 82  ? 62.646  53.343  56.760  1.00 0.00 ? 82  THR C C   1  
ATOM 10161  O O   . THR C 3 82  ? 62.855  52.630  55.796  1.00 0.00 ? 82  THR C O   1  
ATOM 10162  C CB  . THR C 3 82  ? 60.233  52.418  57.130  1.00 0.00 ? 82  THR C CB  1  
ATOM 10163  O OG1 . THR C 3 82  ? 60.439  51.223  56.457  1.00 0.00 ? 82  THR C OG1 1  
ATOM 10164  C CG2 . THR C 3 82  ? 59.582  53.486  56.194  1.00 0.00 ? 82  THR C CG2 1  
ATOM 10165  N N   . PHE C 3 83  ? 63.306  54.471  56.959  1.00 0.00 ? 83  PHE C N   1  
ATOM 10166  C CA  . PHE C 3 83  ? 64.379  55.036  56.116  1.00 0.00 ? 83  PHE C CA  1  
ATOM 10167  C C   . PHE C 3 83  ? 65.716  54.450  56.764  1.00 0.00 ? 83  PHE C C   1  
ATOM 10168  O O   . PHE C 3 83  ? 66.765  55.104  56.725  1.00 0.00 ? 83  PHE C O   1  
ATOM 10169  C CB  . PHE C 3 83  ? 64.501  56.575  56.198  1.00 0.00 ? 83  PHE C CB  1  
ATOM 10170  C CG  . PHE C 3 83  ? 63.251  57.268  55.940  1.00 0.00 ? 83  PHE C CG  1  
ATOM 10171  C CD1 . PHE C 3 83  ? 62.368  56.924  54.910  1.00 0.00 ? 83  PHE C CD1 1  
ATOM 10172  C CD2 . PHE C 3 83  ? 62.857  58.266  56.905  1.00 0.00 ? 83  PHE C CD2 1  
ATOM 10173  C CE1 . PHE C 3 83  ? 61.091  57.463  54.841  1.00 0.00 ? 83  PHE C CE1 1  
ATOM 10174  C CE2 . PHE C 3 83  ? 61.702  58.927  56.742  1.00 0.00 ? 83  PHE C CE2 1  
ATOM 10175  C CZ  . PHE C 3 83  ? 60.757  58.506  55.766  1.00 0.00 ? 83  PHE C CZ  1  
ATOM 10176  N N   . ARG C 3 84  ? 65.676  53.224  57.326  1.00 0.00 ? 84  ARG C N   1  
ATOM 10177  C CA  . ARG C 3 84  ? 66.766  52.590  58.046  1.00 0.00 ? 84  ARG C CA  1  
ATOM 10178  C C   . ARG C 3 84  ? 67.341  51.599  57.067  1.00 0.00 ? 84  ARG C C   1  
ATOM 10179  O O   . ARG C 3 84  ? 68.328  50.949  57.389  1.00 0.00 ? 84  ARG C O   1  
ATOM 10180  C CB  . ARG C 3 84  ? 66.203  51.807  59.277  1.00 0.00 ? 84  ARG C CB  1  
ATOM 10181  C CG  . ARG C 3 84  ? 65.029  50.909  58.890  1.00 0.00 ? 84  ARG C CG  1  
ATOM 10182  C CD  . ARG C 3 84  ? 64.349  50.184  60.100  1.00 0.00 ? 84  ARG C CD  1  
ATOM 10183  N NE  . ARG C 3 84  ? 63.251  49.225  59.590  1.00 0.00 ? 84  ARG C NE  1  
ATOM 10184  C CZ  . ARG C 3 84  ? 62.327  48.679  60.404  1.00 0.00 ? 84  ARG C CZ  1  
ATOM 10185  N NH1 . ARG C 3 84  ? 62.522  48.722  61.732  1.00 0.00 ? 84  ARG C NH1 1  
ATOM 10186  N NH2 . ARG C 3 84  ? 61.224  48.040  59.830  1.00 0.00 ? 84  ARG C NH2 1  
ATOM 10187  N N   . GLY C 3 85  ? 66.729  51.451  55.850  1.00 0.00 ? 85  GLY C N   1  
ATOM 10188  C CA  . GLY C 3 85  ? 67.171  50.493  54.913  1.00 0.00 ? 85  GLY C CA  1  
ATOM 10189  C C   . GLY C 3 85  ? 68.204  51.121  53.972  1.00 0.00 ? 85  GLY C C   1  
ATOM 10190  O O   . GLY C 3 85  ? 68.898  50.457  53.176  1.00 0.00 ? 85  GLY C O   1  
ATOM 10191  N N   . PHE C 3 86  ? 68.332  52.461  54.120  1.00 0.00 ? 86  PHE C N   1  
ATOM 10192  C CA  . PHE C 3 86  ? 69.233  53.213  53.333  1.00 0.00 ? 86  PHE C CA  1  
ATOM 10193  C C   . PHE C 3 86  ? 70.612  53.193  54.043  1.00 0.00 ? 86  PHE C C   1  
ATOM 10194  O O   . PHE C 3 86  ? 71.579  53.746  53.516  1.00 0.00 ? 86  PHE C O   1  
ATOM 10195  C CB  . PHE C 3 86  ? 68.731  54.687  53.332  1.00 0.00 ? 86  PHE C CB  1  
ATOM 10196  C CG  . PHE C 3 86  ? 67.394  54.853  52.615  1.00 0.00 ? 86  PHE C CG  1  
ATOM 10197  C CD1 . PHE C 3 86  ? 67.196  54.278  51.334  1.00 0.00 ? 86  PHE C CD1 1  
ATOM 10198  C CD2 . PHE C 3 86  ? 66.426  55.813  53.021  1.00 0.00 ? 86  PHE C CD2 1  
ATOM 10199  C CE1 . PHE C 3 86  ? 66.078  54.642  50.555  1.00 0.00 ? 86  PHE C CE1 1  
ATOM 10200  C CE2 . PHE C 3 86  ? 65.423  56.296  52.197  1.00 0.00 ? 86  PHE C CE2 1  
ATOM 10201  C CZ  . PHE C 3 86  ? 65.167  55.612  50.950  1.00 0.00 ? 86  PHE C CZ  1  
ATOM 10202  N N   . PHE C 3 87  ? 70.714  52.604  55.237  1.00 0.00 ? 87  PHE C N   1  
ATOM 10203  C CA  . PHE C 3 87  ? 71.881  52.732  56.071  1.00 0.00 ? 87  PHE C CA  1  
ATOM 10204  C C   . PHE C 3 87  ? 72.107  51.380  56.545  1.00 0.00 ? 87  PHE C C   1  
ATOM 10205  O O   . PHE C 3 87  ? 71.335  50.795  57.293  1.00 0.00 ? 87  PHE C O   1  
ATOM 10206  C CB  . PHE C 3 87  ? 71.725  53.569  57.251  1.00 0.00 ? 87  PHE C CB  1  
ATOM 10207  C CG  . PHE C 3 87  ? 71.507  55.001  56.886  1.00 0.00 ? 87  PHE C CG  1  
ATOM 10208  C CD1 . PHE C 3 87  ? 72.612  55.850  56.503  1.00 0.00 ? 87  PHE C CD1 1  
ATOM 10209  C CD2 . PHE C 3 87  ? 70.178  55.570  56.793  1.00 0.00 ? 87  PHE C CD2 1  
ATOM 10210  C CE1 . PHE C 3 87  ? 72.371  57.093  55.980  1.00 0.00 ? 87  PHE C CE1 1  
ATOM 10211  C CE2 . PHE C 3 87  ? 70.010  56.876  56.362  1.00 0.00 ? 87  PHE C CE2 1  
ATOM 10212  C CZ  . PHE C 3 87  ? 71.067  57.620  55.818  1.00 0.00 ? 87  PHE C CZ  1  
ATOM 10213  N N   . ASP C 3 88  ? 73.303  50.923  56.178  1.00 0.00 ? 88  ASP C N   1  
ATOM 10214  C CA  . ASP C 3 88  ? 73.885  49.740  56.691  1.00 0.00 ? 88  ASP C CA  1  
ATOM 10215  C C   . ASP C 3 88  ? 74.301  50.014  58.113  1.00 0.00 ? 88  ASP C C   1  
ATOM 10216  O O   . ASP C 3 88  ? 74.353  51.181  58.539  1.00 0.00 ? 88  ASP C O   1  
ATOM 10217  C CB  . ASP C 3 88  ? 75.119  49.384  55.889  1.00 0.00 ? 88  ASP C CB  1  
ATOM 10218  C CG  . ASP C 3 88  ? 74.827  48.952  54.499  1.00 0.00 ? 88  ASP C CG  1  
ATOM 10219  O OD1 . ASP C 3 88  ? 74.299  49.719  53.683  1.00 0.00 ? 88  ASP C OD1 1  
ATOM 10220  O OD2 . ASP C 3 88  ? 75.107  47.751  54.201  1.00 0.00 ? 88  ASP C OD2 1  
ATOM 10221  N N   . PRO C 3 89  ? 74.618  49.000  58.997  1.00 0.00 ? 89  PRO C N   1  
ATOM 10222  C CA  . PRO C 3 89  ? 74.948  49.269  60.403  1.00 0.00 ? 89  PRO C CA  1  
ATOM 10223  C C   . PRO C 3 89  ? 76.226  50.006  60.526  1.00 0.00 ? 89  PRO C C   1  
ATOM 10224  O O   . PRO C 3 89  ? 76.340  50.764  61.515  1.00 0.00 ? 89  PRO C O   1  
ATOM 10225  C CB  . PRO C 3 89  ? 75.080  47.931  61.070  1.00 0.00 ? 89  PRO C CB  1  
ATOM 10226  C CG  . PRO C 3 89  ? 74.069  47.075  60.285  1.00 0.00 ? 89  PRO C CG  1  
ATOM 10227  C CD  . PRO C 3 89  ? 74.310  47.618  58.868  1.00 0.00 ? 89  PRO C CD  1  
ATOM 10228  N N   . ARG C 3 90  ? 77.162  49.850  59.577  1.00 0.00 ? 90  ARG C N   1  
ATOM 10229  C CA  . ARG C 3 90  ? 78.455  50.545  59.573  1.00 0.00 ? 90  ARG C CA  1  
ATOM 10230  C C   . ARG C 3 90  ? 78.262  52.027  59.306  1.00 0.00 ? 90  ARG C C   1  
ATOM 10231  O O   . ARG C 3 90  ? 78.989  52.811  59.896  1.00 0.00 ? 90  ARG C O   1  
ATOM 10232  C CB  . ARG C 3 90  ? 79.272  50.035  58.430  1.00 0.00 ? 90  ARG C CB  1  
ATOM 10233  C CG  . ARG C 3 90  ? 80.733  50.613  58.226  1.00 0.00 ? 90  ARG C CG  1  
ATOM 10234  C CD  . ARG C 3 90  ? 81.334  50.098  56.948  1.00 0.00 ? 90  ARG C CD  1  
ATOM 10235  N NE  . ARG C 3 90  ? 80.647  50.440  55.780  1.00 0.00 ? 90  ARG C NE  1  
ATOM 10236  C CZ  . ARG C 3 90  ? 80.680  51.736  55.342  1.00 0.00 ? 90  ARG C CZ  1  
ATOM 10237  N NH1 . ARG C 3 90  ? 81.416  52.679  55.956  1.00 0.00 ? 90  ARG C NH1 1  
ATOM 10238  N NH2 . ARG C 3 90  ? 79.996  51.985  54.217  1.00 0.00 ? 90  ARG C NH2 1  
ATOM 10239  N N   . ASN C 3 91  ? 77.197  52.396  58.516  1.00 0.00 ? 91  ASN C N   1  
ATOM 10240  C CA  . ASN C 3 91  ? 76.869  53.780  58.199  1.00 0.00 ? 91  ASN C CA  1  
ATOM 10241  C C   . ASN C 3 91  ? 76.333  54.603  59.366  1.00 0.00 ? 91  ASN C C   1  
ATOM 10242  O O   . ASN C 3 91  ? 76.380  55.824  59.298  1.00 0.00 ? 91  ASN C O   1  
ATOM 10243  C CB  . ASN C 3 91  ? 75.893  53.878  57.056  1.00 0.00 ? 91  ASN C CB  1  
ATOM 10244  C CG  . ASN C 3 91  ? 76.574  53.368  55.792  1.00 0.00 ? 91  ASN C CG  1  
ATOM 10245  O OD1 . ASN C 3 91  ? 77.795  53.523  55.656  1.00 0.00 ? 91  ASN C OD1 1  
ATOM 10246  N ND2 . ASN C 3 91  ? 75.786  52.801  54.851  1.00 0.00 ? 91  ASN C ND2 1  
ATOM 10247  N N   . THR C 3 92  ? 75.808  53.877  60.413  1.00 0.00 ? 92  THR C N   1  
ATOM 10248  C CA  . THR C 3 92  ? 75.404  54.548  61.585  1.00 0.00 ? 92  THR C CA  1  
ATOM 10249  C C   . THR C 3 92  ? 76.571  54.595  62.572  1.00 0.00 ? 92  THR C C   1  
ATOM 10250  O O   . THR C 3 92  ? 77.102  53.532  62.862  1.00 0.00 ? 92  THR C O   1  
ATOM 10251  C CB  . THR C 3 92  ? 74.104  54.013  62.262  1.00 0.00 ? 92  THR C CB  1  
ATOM 10252  O OG1 . THR C 3 92  ? 74.011  52.619  62.178  1.00 0.00 ? 92  THR C OG1 1  
ATOM 10253  C CG2 . THR C 3 92  ? 72.854  54.518  61.510  1.00 0.00 ? 92  THR C CG2 1  
ATOM 10254  N N   . TRP C 3 93  ? 76.949  55.740  63.043  1.00 0.00 ? 93  TRP C N   1  
ATOM 10255  C CA  . TRP C 3 93  ? 78.038  55.980  63.975  1.00 0.00 ? 93  TRP C CA  1  
ATOM 10256  C C   . TRP C 3 93  ? 77.535  56.810  65.139  1.00 0.00 ? 93  TRP C C   1  
ATOM 10257  O O   . TRP C 3 93  ? 76.889  57.873  64.984  1.00 0.00 ? 93  TRP C O   1  
ATOM 10258  C CB  . TRP C 3 93  ? 79.156  56.800  63.254  1.00 0.00 ? 93  TRP C CB  1  
ATOM 10259  C CG  . TRP C 3 93  ? 80.559  56.619  63.858  1.00 0.00 ? 93  TRP C CG  1  
ATOM 10260  C CD1 . TRP C 3 93  ? 81.474  55.586  64.036  1.00 0.00 ? 93  TRP C CD1 1  
ATOM 10261  C CD2 . TRP C 3 93  ? 81.187  57.824  64.315  1.00 0.00 ? 93  TRP C CD2 1  
ATOM 10262  N NE1 . TRP C 3 93  ? 82.644  56.163  64.529  1.00 0.00 ? 93  TRP C NE1 1  
ATOM 10263  C CE2 . TRP C 3 93  ? 82.471  57.524  64.685  1.00 0.00 ? 93  TRP C CE2 1  
ATOM 10264  C CE3 . TRP C 3 93  ? 80.724  59.101  64.332  1.00 0.00 ? 93  TRP C CE3 1  
ATOM 10265  C CZ2 . TRP C 3 93  ? 83.377  58.546  65.101  1.00 0.00 ? 93  TRP C CZ2 1  
ATOM 10266  C CZ3 . TRP C 3 93  ? 81.614  60.143  64.819  1.00 0.00 ? 93  TRP C CZ3 1  
ATOM 10267  C CH2 . TRP C 3 93  ? 82.889  59.834  65.085  1.00 0.00 ? 93  TRP C CH2 1  
ATOM 10268  N N   . VAL C 3 94  ? 77.867  56.316  66.336  1.00 0.00 ? 94  VAL C N   1  
ATOM 10269  C CA  . VAL C 3 94  ? 77.571  56.941  67.617  1.00 0.00 ? 94  VAL C CA  1  
ATOM 10270  C C   . VAL C 3 94  ? 78.914  56.946  68.209  1.00 0.00 ? 94  VAL C C   1  
ATOM 10271  O O   . VAL C 3 94  ? 79.689  55.955  68.210  1.00 0.00 ? 94  VAL C O   1  
ATOM 10272  C CB  . VAL C 3 94  ? 76.496  56.166  68.528  1.00 0.00 ? 94  VAL C CB  1  
ATOM 10273  C CG1 . VAL C 3 94  ? 77.052  54.783  68.820  1.00 0.00 ? 94  VAL C CG1 1  
ATOM 10274  C CG2 . VAL C 3 94  ? 76.287  56.967  69.761  1.00 0.00 ? 94  VAL C CG2 1  
ATOM 10275  N N   . ALA C 3 95  ? 79.346  58.134  68.666  1.00 0.00 ? 95  ALA C N   1  
ATOM 10276  C CA  . ALA C 3 95  ? 80.616  58.344  69.173  1.00 0.00 ? 95  ALA C CA  1  
ATOM 10277  C C   . ALA C 3 95  ? 80.504  59.739  69.784  1.00 0.00 ? 95  ALA C C   1  
ATOM 10278  O O   . ALA C 3 95  ? 80.372  60.663  69.038  1.00 0.00 ? 95  ALA C O   1  
ATOM 10279  C CB  . ALA C 3 95  ? 81.791  58.281  68.193  1.00 0.00 ? 95  ALA C CB  1  
ATOM 10280  N N   . SER C 3 96  ? 80.540  59.864  71.134  1.00 0.00 ? 96  SER C N   1  
ATOM 10281  C CA  . SER C 3 96  ? 80.420  61.103  71.863  1.00 0.00 ? 96  SER C CA  1  
ATOM 10282  C C   . SER C 3 96  ? 81.301  60.927  72.972  1.00 0.00 ? 96  SER C C   1  
ATOM 10283  O O   . SER C 3 96  ? 81.400  59.864  73.475  1.00 0.00 ? 96  SER C O   1  
ATOM 10284  C CB  . SER C 3 96  ? 78.984  61.387  72.454  1.00 0.00 ? 96  SER C CB  1  
ATOM 10285  O OG  . SER C 3 96  ? 77.961  61.254  71.490  1.00 0.00 ? 96  SER C OG  1  
ATOM 10286  N N   . ASP C 3 97  ? 81.975  62.011  73.566  1.00 0.00 ? 97  ASP C N   1  
ATOM 10287  C CA  . ASP C 3 97  ? 82.904  61.889  74.658  1.00 0.00 ? 97  ASP C CA  1  
ATOM 10288  C C   . ASP C 3 97  ? 82.827  63.205  75.387  1.00 0.00 ? 97  ASP C C   1  
ATOM 10289  O O   . ASP C 3 97  ? 82.811  64.199  74.711  1.00 0.00 ? 97  ASP C O   1  
ATOM 10290  C CB  . ASP C 3 97  ? 84.372  61.701  74.084  1.00 0.00 ? 97  ASP C CB  1  
ATOM 10291  C CG  . ASP C 3 97  ? 84.473  60.361  73.374  1.00 0.00 ? 97  ASP C CG  1  
ATOM 10292  O OD1 . ASP C 3 97  ? 84.037  60.362  72.208  1.00 0.00 ? 97  ASP C OD1 1  
ATOM 10293  O OD2 . ASP C 3 97  ? 85.171  59.424  73.837  1.00 0.00 ? 97  ASP C OD2 1  
ATOM 10294  N N   . GLY C 3 98  ? 82.687  63.186  76.745  1.00 0.00 ? 98  GLY C N   1  
ATOM 10295  C CA  . GLY C 3 98  ? 82.350  64.334  77.544  1.00 0.00 ? 98  GLY C CA  1  
ATOM 10296  C C   . GLY C 3 98  ? 80.872  64.587  77.505  1.00 0.00 ? 98  GLY C C   1  
ATOM 10297  O O   . GLY C 3 98  ? 80.386  65.535  78.130  1.00 0.00 ? 98  GLY C O   1  
ATOM 10298  N N   . ALA C 3 99  ? 80.167  63.570  76.901  1.00 0.00 ? 99  ALA C N   1  
ATOM 10299  C CA  . ALA C 3 99  ? 78.736  63.494  76.823  1.00 0.00 ? 99  ALA C CA  1  
ATOM 10300  C C   . ALA C 3 99  ? 78.152  64.558  75.883  1.00 0.00 ? 99  ALA C C   1  
ATOM 10301  O O   . ALA C 3 99  ? 77.684  65.602  76.274  1.00 0.00 ? 99  ALA C O   1  
ATOM 10302  C CB  . ALA C 3 99  ? 78.115  63.417  78.276  1.00 0.00 ? 99  ALA C CB  1  
ATOM 10303  N N   . SER C 3 100 ? 78.313  64.322  74.563  1.00 0.00 ? 100 SER C N   1  
ATOM 10304  C CA  . SER C 3 100 ? 77.934  65.084  73.384  1.00 0.00 ? 100 SER C CA  1  
ATOM 10305  C C   . SER C 3 100 ? 78.838  66.310  73.319  1.00 0.00 ? 100 SER C C   1  
ATOM 10306  O O   . SER C 3 100 ? 79.672  66.552  74.171  1.00 0.00 ? 100 SER C O   1  
ATOM 10307  C CB  . SER C 3 100 ? 76.384  65.421  73.186  1.00 0.00 ? 100 SER C CB  1  
ATOM 10308  O OG  . SER C 3 100 ? 75.621  64.187  73.197  1.00 0.00 ? 100 SER C OG  1  
ATOM 10309  N N   . ALA C 3 101 ? 78.661  67.045  72.212  1.00 0.00 ? 101 ALA C N   1  
ATOM 10310  C CA  . ALA C 3 101 ? 79.317  68.323  72.046  1.00 0.00 ? 101 ALA C CA  1  
ATOM 10311  C C   . ALA C 3 101 ? 78.781  69.340  72.982  1.00 0.00 ? 101 ALA C C   1  
ATOM 10312  O O   . ALA C 3 101 ? 79.621  69.990  73.650  1.00 0.00 ? 101 ALA C O   1  
ATOM 10313  C CB  . ALA C 3 101 ? 79.251  68.811  70.589  1.00 0.00 ? 101 ALA C CB  1  
ATOM 10314  N N   . GLY C 3 102 ? 77.423  69.468  73.041  1.00 0.00 ? 102 GLY C N   1  
ATOM 10315  C CA  . GLY C 3 102 ? 76.759  70.319  74.019  1.00 0.00 ? 102 GLY C CA  1  
ATOM 10316  C C   . GLY C 3 102 ? 76.567  71.662  73.451  1.00 0.00 ? 102 GLY C C   1  
ATOM 10317  O O   . GLY C 3 102 ? 76.303  72.538  74.260  1.00 0.00 ? 102 GLY C O   1  
ATOM 10318  N N   . ASN C 3 103 ? 76.719  71.863  72.107  1.00 0.00 ? 103 ASN C N   1  
ATOM 10319  C CA  . ASN C 3 103 ? 76.591  73.156  71.382  1.00 0.00 ? 103 ASN C CA  1  
ATOM 10320  C C   . ASN C 3 103 ? 77.828  73.938  71.543  1.00 0.00 ? 103 ASN C C   1  
ATOM 10321  O O   . ASN C 3 103 ? 77.788  75.190  71.576  1.00 0.00 ? 103 ASN C O   1  
ATOM 10322  C CB  . ASN C 3 103 ? 75.268  73.906  71.645  1.00 0.00 ? 103 ASN C CB  1  
ATOM 10323  C CG  . ASN C 3 103 ? 74.056  73.169  71.231  1.00 0.00 ? 103 ASN C CG  1  
ATOM 10324  O OD1 . ASN C 3 103 ? 73.845  72.925  70.039  1.00 0.00 ? 103 ASN C OD1 1  
ATOM 10325  N ND2 . ASN C 3 103 ? 73.332  72.780  72.297  1.00 0.00 ? 103 ASN C ND2 1  
ATOM 10326  N N   . SER C 3 104 ? 78.974  73.227  71.496  1.00 0.00 ? 104 SER C N   1  
ATOM 10327  C CA  . SER C 3 104 ? 80.348  73.738  71.586  1.00 0.00 ? 104 SER C CA  1  
ATOM 10328  C C   . SER C 3 104 ? 81.315  73.144  70.594  1.00 0.00 ? 104 SER C C   1  
ATOM 10329  O O   . SER C 3 104 ? 81.527  71.969  70.400  1.00 0.00 ? 104 SER C O   1  
ATOM 10330  C CB  . SER C 3 104 ? 80.900  73.429  73.028  1.00 0.00 ? 104 SER C CB  1  
ATOM 10331  O OG  . SER C 3 104 ? 82.174  74.011  73.281  1.00 0.00 ? 104 SER C OG  1  
ATOM 10332  N N   . TRP C 3 105 ? 81.906  74.082  69.822  1.00 0.00 ? 105 TRP C N   1  
ATOM 10333  C CA  . TRP C 3 105 ? 82.767  73.799  68.707  1.00 0.00 ? 105 TRP C CA  1  
ATOM 10334  C C   . TRP C 3 105 ? 83.951  73.105  69.179  1.00 0.00 ? 105 TRP C C   1  
ATOM 10335  O O   . TRP C 3 105 ? 84.385  72.115  68.620  1.00 0.00 ? 105 TRP C O   1  
ATOM 10336  C CB  . TRP C 3 105 ? 83.176  75.162  68.091  1.00 0.00 ? 105 TRP C CB  1  
ATOM 10337  C CG  . TRP C 3 105 ? 84.076  75.016  66.924  1.00 0.00 ? 105 TRP C CG  1  
ATOM 10338  C CD1 . TRP C 3 105 ? 83.720  74.810  65.655  1.00 0.00 ? 105 TRP C CD1 1  
ATOM 10339  C CD2 . TRP C 3 105 ? 85.571  75.069  66.941  1.00 0.00 ? 105 TRP C CD2 1  
ATOM 10340  N NE1 . TRP C 3 105 ? 84.856  74.638  64.869  1.00 0.00 ? 105 TRP C NE1 1  
ATOM 10341  C CE2 . TRP C 3 105 ? 86.002  74.856  65.652  1.00 0.00 ? 105 TRP C CE2 1  
ATOM 10342  C CE3 . TRP C 3 105 ? 86.486  75.358  67.974  1.00 0.00 ? 105 TRP C CE3 1  
ATOM 10343  C CZ2 . TRP C 3 105 ? 87.315  74.962  65.313  1.00 0.00 ? 105 TRP C CZ2 1  
ATOM 10344  C CZ3 . TRP C 3 105 ? 87.825  75.413  67.670  1.00 0.00 ? 105 TRP C CZ3 1  
ATOM 10345  C CH2 . TRP C 3 105 ? 88.270  75.197  66.339  1.00 0.00 ? 105 TRP C CH2 1  
ATOM 10346  N N   . ALA C 3 106 ? 84.554  73.600  70.302  1.00 0.00 ? 106 ALA C N   1  
ATOM 10347  C CA  . ALA C 3 106 ? 85.738  73.079  70.926  1.00 0.00 ? 106 ALA C CA  1  
ATOM 10348  C C   . ALA C 3 106 ? 85.593  71.664  71.467  1.00 0.00 ? 106 ALA C C   1  
ATOM 10349  O O   . ALA C 3 106 ? 86.505  70.859  71.166  1.00 0.00 ? 106 ALA C O   1  
ATOM 10350  C CB  . ALA C 3 106 ? 86.218  73.944  72.119  1.00 0.00 ? 106 ALA C CB  1  
ATOM 10351  N N   . ASN C 3 107 ? 84.465  71.323  72.117  1.00 0.00 ? 107 ASN C N   1  
ATOM 10352  C CA  . ASN C 3 107 ? 84.172  69.933  72.472  1.00 0.00 ? 107 ASN C CA  1  
ATOM 10353  C C   . ASN C 3 107 ? 84.003  69.019  71.249  1.00 0.00 ? 107 ASN C C   1  
ATOM 10354  O O   . ASN C 3 107 ? 84.495  67.901  71.239  1.00 0.00 ? 107 ASN C O   1  
ATOM 10355  C CB  . ASN C 3 107 ? 82.888  69.835  73.318  1.00 0.00 ? 107 ASN C CB  1  
ATOM 10356  C CG  . ASN C 3 107 ? 83.047  70.494  74.712  1.00 0.00 ? 107 ASN C CG  1  
ATOM 10357  O OD1 . ASN C 3 107 ? 82.420  71.501  74.976  1.00 0.00 ? 107 ASN C OD1 1  
ATOM 10358  N ND2 . ASN C 3 107 ? 83.944  69.888  75.587  1.00 0.00 ? 107 ASN C ND2 1  
ATOM 10359  N N   . GLY C 3 108 ? 83.289  69.509  70.204  1.00 0.00 ? 108 GLY C N   1  
ATOM 10360  C CA  . GLY C 3 108 ? 82.883  68.858  69.048  1.00 0.00 ? 108 GLY C CA  1  
ATOM 10361  C C   . GLY C 3 108 ? 84.037  68.516  68.267  1.00 0.00 ? 108 GLY C C   1  
ATOM 10362  O O   . GLY C 3 108 ? 84.239  67.418  67.778  1.00 0.00 ? 108 GLY C O   1  
ATOM 10363  N N   . TYR C 3 109 ? 84.968  69.466  68.197  1.00 0.00 ? 109 TYR C N   1  
ATOM 10364  C CA  . TYR C 3 109 ? 86.187  69.276  67.505  1.00 0.00 ? 109 TYR C CA  1  
ATOM 10365  C C   . TYR C 3 109 ? 87.068  68.164  68.080  1.00 0.00 ? 109 TYR C C   1  
ATOM 10366  O O   . TYR C 3 109 ? 87.522  67.322  67.338  1.00 0.00 ? 109 TYR C O   1  
ATOM 10367  C CB  . TYR C 3 109 ? 86.947  70.578  67.338  1.00 0.00 ? 109 TYR C CB  1  
ATOM 10368  C CG  . TYR C 3 109 ? 87.846  70.662  66.084  1.00 0.00 ? 109 TYR C CG  1  
ATOM 10369  C CD1 . TYR C 3 109 ? 89.185  70.378  66.270  1.00 0.00 ? 109 TYR C CD1 1  
ATOM 10370  C CD2 . TYR C 3 109 ? 87.418  71.350  64.930  1.00 0.00 ? 109 TYR C CD2 1  
ATOM 10371  C CE1 . TYR C 3 109 ? 90.138  70.525  65.252  1.00 0.00 ? 109 TYR C CE1 1  
ATOM 10372  C CE2 . TYR C 3 109 ? 88.343  71.582  63.905  1.00 0.00 ? 109 TYR C CE2 1  
ATOM 10373  C CZ  . TYR C 3 109 ? 89.646  71.146  64.098  1.00 0.00 ? 109 TYR C CZ  1  
ATOM 10374  O OH  . TYR C 3 109 ? 90.579  71.562  63.119  1.00 0.00 ? 109 TYR C OH  1  
ATOM 10375  N N   . ASP C 3 110 ? 87.199  68.158  69.379  1.00 0.00 ? 110 ASP C N   1  
ATOM 10376  C CA  . ASP C 3 110 ? 87.959  67.256  70.185  1.00 0.00 ? 110 ASP C CA  1  
ATOM 10377  C C   . ASP C 3 110 ? 87.374  65.905  70.019  1.00 0.00 ? 110 ASP C C   1  
ATOM 10378  O O   . ASP C 3 110 ? 88.202  64.977  69.986  1.00 0.00 ? 110 ASP C O   1  
ATOM 10379  C CB  . ASP C 3 110 ? 87.829  67.628  71.668  1.00 0.00 ? 110 ASP C CB  1  
ATOM 10380  C CG  . ASP C 3 110 ? 88.730  68.812  72.129  1.00 0.00 ? 110 ASP C CG  1  
ATOM 10381  O OD1 . ASP C 3 110 ? 89.763  69.080  71.455  1.00 0.00 ? 110 ASP C OD1 1  
ATOM 10382  O OD2 . ASP C 3 110 ? 88.447  69.450  73.220  1.00 0.00 ? 110 ASP C OD2 1  
ATOM 10383  N N   . ILE C 3 111 ? 86.025  65.638  69.945  1.00 0.00 ? 111 ILE C N   1  
ATOM 10384  C CA  . ILE C 3 111 ? 85.475  64.287  69.880  1.00 0.00 ? 111 ILE C CA  1  
ATOM 10385  C C   . ILE C 3 111 ? 85.904  63.589  68.640  1.00 0.00 ? 111 ILE C C   1  
ATOM 10386  O O   . ILE C 3 111 ? 86.239  62.423  68.687  1.00 0.00 ? 111 ILE C O   1  
ATOM 10387  C CB  . ILE C 3 111 ? 83.980  64.278  69.965  1.00 0.00 ? 111 ILE C CB  1  
ATOM 10388  C CG1 . ILE C 3 111 ? 83.531  64.864  71.371  1.00 0.00 ? 111 ILE C CG1 1  
ATOM 10389  C CG2 . ILE C 3 111 ? 83.393  62.827  69.882  1.00 0.00 ? 111 ILE C CG2 1  
ATOM 10390  C CD1 . ILE C 3 111 ? 82.008  64.907  71.576  1.00 0.00 ? 111 ILE C CD1 1  
ATOM 10391  N N   . GLY C 3 112 ? 86.012  64.276  67.436  1.00 0.00 ? 112 GLY C N   1  
ATOM 10392  C CA  . GLY C 3 112 ? 86.465  63.759  66.179  1.00 0.00 ? 112 GLY C CA  1  
ATOM 10393  C C   . GLY C 3 112 ? 87.885  63.208  66.272  1.00 0.00 ? 112 GLY C C   1  
ATOM 10394  O O   . GLY C 3 112 ? 88.203  62.193  65.705  1.00 0.00 ? 112 GLY C O   1  
ATOM 10395  N N   . THR C 3 113 ? 88.777  63.912  66.971  1.00 0.00 ? 113 THR C N   1  
ATOM 10396  C CA  . THR C 3 113 ? 90.202  63.470  67.086  1.00 0.00 ? 113 THR C CA  1  
ATOM 10397  C C   . THR C 3 113 ? 90.508  62.128  67.702  1.00 0.00 ? 113 THR C C   1  
ATOM 10398  O O   . THR C 3 113 ? 91.422  61.408  67.253  1.00 0.00 ? 113 THR C O   1  
ATOM 10399  C CB  . THR C 3 113 ? 91.002  64.597  67.745  1.00 0.00 ? 113 THR C CB  1  
ATOM 10400  O OG1 . THR C 3 113 ? 90.861  65.882  67.131  1.00 0.00 ? 113 THR C OG1 1  
ATOM 10401  C CG2 . THR C 3 113 ? 92.537  64.204  67.801  1.00 0.00 ? 113 THR C CG2 1  
ATOM 10402  N N   . ARG C 3 114 ? 89.741  61.826  68.763  1.00 0.00 ? 114 ARG C N   1  
ATOM 10403  C CA  . ARG C 3 114 ? 89.997  60.542  69.468  1.00 0.00 ? 114 ARG C CA  1  
ATOM 10404  C C   . ARG C 3 114 ? 89.760  59.240  68.589  1.00 0.00 ? 114 ARG C C   1  
ATOM 10405  O O   . ARG C 3 114 ? 90.613  58.373  68.596  1.00 0.00 ? 114 ARG C O   1  
ATOM 10406  C CB  . ARG C 3 114 ? 89.075  60.463  70.700  1.00 0.00 ? 114 ARG C CB  1  
ATOM 10407  C CG  . ARG C 3 114 ? 89.375  61.666  71.644  1.00 0.00 ? 114 ARG C CG  1  
ATOM 10408  C CD  . ARG C 3 114 ? 88.239  61.995  72.550  1.00 0.00 ? 114 ARG C CD  1  
ATOM 10409  N NE  . ARG C 3 114 ? 88.744  63.047  73.447  1.00 0.00 ? 114 ARG C NE  1  
ATOM 10410  C CZ  . ARG C 3 114 ? 87.994  64.067  73.979  1.00 0.00 ? 114 ARG C CZ  1  
ATOM 10411  N NH1 . ARG C 3 114 ? 86.647  64.110  73.770  1.00 0.00 ? 114 ARG C NH1 1  
ATOM 10412  N NH2 . ARG C 3 114 ? 88.527  65.012  74.801  1.00 0.00 ? 114 ARG C NH2 1  
ATOM 10413  N N   . ASN C 3 115 ? 88.625  59.277  67.864  1.00 0.00 ? 115 ASN C N   1  
ATOM 10414  C CA  . ASN C 3 115 ? 88.054  58.288  67.020  1.00 0.00 ? 115 ASN C CA  1  
ATOM 10415  C C   . ASN C 3 115 ? 88.197  58.699  65.598  1.00 0.00 ? 115 ASN C C   1  
ATOM 10416  O O   . ASN C 3 115 ? 87.337  58.407  64.740  1.00 0.00 ? 115 ASN C O   1  
ATOM 10417  C CB  . ASN C 3 115 ? 86.590  57.980  67.318  1.00 0.00 ? 115 ASN C CB  1  
ATOM 10418  C CG  . ASN C 3 115 ? 85.834  59.250  67.849  1.00 0.00 ? 115 ASN C CG  1  
ATOM 10419  O OD1 . ASN C 3 115 ? 85.391  60.092  67.025  1.00 0.00 ? 115 ASN C OD1 1  
ATOM 10420  N ND2 . ASN C 3 115 ? 85.629  59.435  69.186  1.00 0.00 ? 115 ASN C ND2 1  
ATOM 10421  N N   . GLN C 3 116 ? 89.398  59.239  65.335  1.00 0.00 ? 116 GLN C N   1  
ATOM 10422  C CA  . GLN C 3 116 ? 89.875  59.660  64.060  1.00 0.00 ? 116 GLN C CA  1  
ATOM 10423  C C   . GLN C 3 116 ? 90.054  58.509  63.020  1.00 0.00 ? 116 GLN C C   1  
ATOM 10424  O O   . GLN C 3 116 ? 89.635  58.593  61.836  1.00 0.00 ? 116 GLN C O   1  
ATOM 10425  C CB  . GLN C 3 116 ? 91.274  60.399  64.133  1.00 0.00 ? 116 GLN C CB  1  
ATOM 10426  C CG  . GLN C 3 116 ? 92.461  59.625  64.603  1.00 0.00 ? 116 GLN C CG  1  
ATOM 10427  C CD  . GLN C 3 116 ? 93.744  60.582  64.741  1.00 0.00 ? 116 GLN C CD  1  
ATOM 10428  O OE1 . GLN C 3 116 ? 94.023  61.395  63.868  1.00 0.00 ? 116 GLN C OE1 1  
ATOM 10429  N NE2 . GLN C 3 116 ? 94.508  60.362  65.786  1.00 0.00 ? 116 GLN C NE2 1  
ATOM 10430  N N   . ASP C 3 117 ? 90.628  57.352  63.452  1.00 0.00 ? 117 ASP C N   1  
ATOM 10431  C CA  . ASP C 3 117 ? 90.947  56.144  62.749  1.00 0.00 ? 117 ASP C CA  1  
ATOM 10432  C C   . ASP C 3 117 ? 89.652  55.447  62.333  1.00 0.00 ? 117 ASP C C   1  
ATOM 10433  O O   . ASP C 3 117 ? 89.403  55.041  61.200  1.00 0.00 ? 117 ASP C O   1  
ATOM 10434  C CB  . ASP C 3 117 ? 91.789  55.116  63.403  1.00 0.00 ? 117 ASP C CB  1  
ATOM 10435  C CG  . ASP C 3 117 ? 93.148  55.707  63.589  1.00 0.00 ? 117 ASP C CG  1  
ATOM 10436  O OD1 . ASP C 3 117 ? 93.742  56.084  62.533  1.00 0.00 ? 117 ASP C OD1 1  
ATOM 10437  O OD2 . ASP C 3 117 ? 93.511  55.956  64.741  1.00 0.00 ? 117 ASP C OD2 1  
ATOM 10438  N N   . ASP C 3 118 ? 88.664  55.469  63.246  1.00 0.00 ? 118 ASP C N   1  
ATOM 10439  C CA  . ASP C 3 118 ? 87.370  54.880  63.015  1.00 0.00 ? 118 ASP C CA  1  
ATOM 10440  C C   . ASP C 3 118 ? 86.711  55.626  61.843  1.00 0.00 ? 118 ASP C C   1  
ATOM 10441  O O   . ASP C 3 118 ? 86.133  54.890  61.021  1.00 0.00 ? 118 ASP C O   1  
ATOM 10442  C CB  . ASP C 3 118 ? 86.400  54.926  64.183  1.00 0.00 ? 118 ASP C CB  1  
ATOM 10443  C CG  . ASP C 3 118 ? 86.930  54.016  65.295  1.00 0.00 ? 118 ASP C CG  1  
ATOM 10444  O OD1 . ASP C 3 118 ? 88.187  53.898  65.502  1.00 0.00 ? 118 ASP C OD1 1  
ATOM 10445  O OD2 . ASP C 3 118 ? 86.064  53.491  66.093  1.00 0.00 ? 118 ASP C OD2 1  
ATOM 10446  N N   . ILE C 3 119 ? 86.776  56.966  61.769  1.00 0.00 ? 119 ILE C N   1  
ATOM 10447  C CA  . ILE C 3 119 ? 86.130  57.658  60.730  1.00 0.00 ? 119 ILE C CA  1  
ATOM 10448  C C   . ILE C 3 119 ? 86.821  57.319  59.415  1.00 0.00 ? 119 ILE C C   1  
ATOM 10449  O O   . ILE C 3 119 ? 86.158  57.074  58.412  1.00 0.00 ? 119 ILE C O   1  
ATOM 10450  C CB  . ILE C 3 119 ? 86.228  59.154  61.005  1.00 0.00 ? 119 ILE C CB  1  
ATOM 10451  C CG1 . ILE C 3 119 ? 85.543  59.596  62.333  1.00 0.00 ? 119 ILE C CG1 1  
ATOM 10452  C CG2 . ILE C 3 119 ? 85.496  59.820  59.733  1.00 0.00 ? 119 ILE C CG2 1  
ATOM 10453  C CD1 . ILE C 3 119 ? 85.639  61.105  62.617  1.00 0.00 ? 119 ILE C CD1 1  
ATOM 10454  N N   . LEU C 3 120 ? 88.163  57.302  59.399  1.00 0.00 ? 120 LEU C N   1  
ATOM 10455  C CA  . LEU C 3 120 ? 88.911  57.079  58.218  1.00 0.00 ? 120 LEU C CA  1  
ATOM 10456  C C   . LEU C 3 120 ? 88.685  55.727  57.591  1.00 0.00 ? 120 LEU C C   1  
ATOM 10457  O O   . LEU C 3 120 ? 88.664  55.691  56.368  1.00 0.00 ? 120 LEU C O   1  
ATOM 10458  C CB  . LEU C 3 120 ? 90.418  57.270  58.324  1.00 0.00 ? 120 LEU C CB  1  
ATOM 10459  C CG  . LEU C 3 120 ? 90.893  58.756  58.643  1.00 0.00 ? 120 LEU C CG  1  
ATOM 10460  C CD1 . LEU C 3 120 ? 92.363  58.896  58.783  1.00 0.00 ? 120 LEU C CD1 1  
ATOM 10461  C CD2 . LEU C 3 120 ? 90.298  59.836  57.748  1.00 0.00 ? 120 LEU C CD2 1  
ATOM 10462  N N   . ASN C 3 121 ? 88.519  54.673  58.413  1.00 0.00 ? 121 ASN C N   1  
ATOM 10463  C CA  . ASN C 3 121 ? 88.203  53.348  57.956  1.00 0.00 ? 121 ASN C CA  1  
ATOM 10464  C C   . ASN C 3 121 ? 86.864  53.403  57.163  1.00 0.00 ? 121 ASN C C   1  
ATOM 10465  O O   . ASN C 3 121 ? 86.809  52.780  56.109  1.00 0.00 ? 121 ASN C O   1  
ATOM 10466  C CB  . ASN C 3 121 ? 88.166  52.288  59.165  1.00 0.00 ? 121 ASN C CB  1  
ATOM 10467  C CG  . ASN C 3 121 ? 88.263  50.833  58.542  1.00 0.00 ? 121 ASN C CG  1  
ATOM 10468  O OD1 . ASN C 3 121 ? 89.261  50.543  57.894  1.00 0.00 ? 121 ASN C OD1 1  
ATOM 10469  N ND2 . ASN C 3 121 ? 87.251  49.935  58.763  1.00 0.00 ? 121 ASN C ND2 1  
ATOM 10470  N N   . LYS C 3 122 ? 85.861  54.151  57.602  1.00 0.00 ? 122 LYS C N   1  
ATOM 10471  C CA  . LYS C 3 122 ? 84.646  54.294  56.893  1.00 0.00 ? 122 LYS C CA  1  
ATOM 10472  C C   . LYS C 3 122 ? 84.964  55.035  55.510  1.00 0.00 ? 122 LYS C C   1  
ATOM 10473  O O   . LYS C 3 122 ? 84.493  54.506  54.479  1.00 0.00 ? 122 LYS C O   1  
ATOM 10474  C CB  . LYS C 3 122 ? 83.503  54.999  57.595  1.00 0.00 ? 122 LYS C CB  1  
ATOM 10475  C CG  . LYS C 3 122 ? 83.080  54.422  58.959  1.00 0.00 ? 122 LYS C CG  1  
ATOM 10476  C CD  . LYS C 3 122 ? 81.958  55.160  59.606  1.00 0.00 ? 122 LYS C CD  1  
ATOM 10477  C CE  . LYS C 3 122 ? 82.364  56.551  59.908  1.00 0.00 ? 122 LYS C CE  1  
ATOM 10478  N NZ  . LYS C 3 122 ? 81.166  57.172  60.486  1.00 0.00 ? 122 LYS C NZ  1  
ATOM 10479  N N   . ILE C 3 123 ? 85.699  56.113  55.467  1.00 0.00 ? 123 ILE C N   1  
ATOM 10480  C CA  . ILE C 3 123 ? 85.992  56.972  54.284  1.00 0.00 ? 123 ILE C CA  1  
ATOM 10481  C C   . ILE C 3 123 ? 86.736  56.138  53.275  1.00 0.00 ? 123 ILE C C   1  
ATOM 10482  O O   . ILE C 3 123 ? 86.327  56.118  52.123  1.00 0.00 ? 123 ILE C O   1  
ATOM 10483  C CB  . ILE C 3 123 ? 86.838  58.241  54.588  1.00 0.00 ? 123 ILE C CB  1  
ATOM 10484  C CG1 . ILE C 3 123 ? 86.091  59.056  55.646  1.00 0.00 ? 123 ILE C CG1 1  
ATOM 10485  C CG2 . ILE C 3 123 ? 87.078  59.100  53.300  1.00 0.00 ? 123 ILE C CG2 1  
ATOM 10486  C CD1 . ILE C 3 123 ? 86.806  60.353  56.058  1.00 0.00 ? 123 ILE C CD1 1  
ATOM 10487  N N   . ASP C 3 124 ? 87.791  55.398  53.695  1.00 0.00 ? 124 ASP C N   1  
ATOM 10488  C CA  . ASP C 3 124 ? 88.604  54.579  52.842  1.00 0.00 ? 124 ASP C CA  1  
ATOM 10489  C C   . ASP C 3 124 ? 87.859  53.454  52.169  1.00 0.00 ? 124 ASP C C   1  
ATOM 10490  O O   . ASP C 3 124 ? 88.113  53.202  50.989  1.00 0.00 ? 124 ASP C O   1  
ATOM 10491  C CB  . ASP C 3 124 ? 89.704  53.933  53.679  1.00 0.00 ? 124 ASP C CB  1  
ATOM 10492  C CG  . ASP C 3 124 ? 90.818  54.965  53.931  1.00 0.00 ? 124 ASP C CG  1  
ATOM 10493  O OD1 . ASP C 3 124 ? 90.516  56.166  53.616  1.00 0.00 ? 124 ASP C OD1 1  
ATOM 10494  O OD2 . ASP C 3 124 ? 91.884  54.583  54.462  1.00 0.00 ? 124 ASP C OD2 1  
ATOM 10495  N N   . LYS C 3 125 ? 86.926  52.801  52.889  1.00 0.00 ? 125 LYS C N   1  
ATOM 10496  C CA  . LYS C 3 125 ? 86.072  51.764  52.278  1.00 0.00 ? 125 LYS C CA  1  
ATOM 10497  C C   . LYS C 3 125 ? 85.210  52.275  51.171  1.00 0.00 ? 125 LYS C C   1  
ATOM 10498  O O   . LYS C 3 125 ? 85.023  51.681  50.080  1.00 0.00 ? 125 LYS C O   1  
ATOM 10499  C CB  . LYS C 3 125 ? 85.161  51.067  53.358  1.00 0.00 ? 125 LYS C CB  1  
ATOM 10500  C CG  . LYS C 3 125 ? 84.108  50.112  52.798  1.00 0.00 ? 125 LYS C CG  1  
ATOM 10501  C CD  . LYS C 3 125 ? 84.569  48.884  51.971  1.00 0.00 ? 125 LYS C CD  1  
ATOM 10502  C CE  . LYS C 3 125 ? 83.337  48.487  51.086  1.00 0.00 ? 125 LYS C CE  1  
ATOM 10503  N NZ  . LYS C 3 125 ? 82.120  48.180  51.931  1.00 0.00 ? 125 LYS C NZ  1  
ATOM 10504  N N   . GLU C 3 126 ? 84.518  53.405  51.434  1.00 0.00 ? 126 GLU C N   1  
ATOM 10505  C CA  . GLU C 3 126 ? 83.541  54.014  50.546  1.00 0.00 ? 126 GLU C CA  1  
ATOM 10506  C C   . GLU C 3 126 ? 84.229  54.468  49.274  1.00 0.00 ? 126 GLU C C   1  
ATOM 10507  O O   . GLU C 3 126 ? 83.695  54.191  48.224  1.00 0.00 ? 126 GLU C O   1  
ATOM 10508  C CB  . GLU C 3 126 ? 83.011  55.338  51.221  1.00 0.00 ? 126 GLU C CB  1  
ATOM 10509  C CG  . GLU C 3 126 ? 81.956  56.084  50.461  1.00 0.00 ? 126 GLU C CG  1  
ATOM 10510  C CD  . GLU C 3 126 ? 80.596  55.261  50.455  1.00 0.00 ? 126 GLU C CD  1  
ATOM 10511  O OE1 . GLU C 3 126 ? 79.948  55.208  51.528  1.00 0.00 ? 126 GLU C OE1 1  
ATOM 10512  O OE2 . GLU C 3 126 ? 80.260  54.660  49.396  1.00 0.00 ? 126 GLU C OE2 1  
ATOM 10513  N N   . ILE C 3 127 ? 85.446  55.091  49.275  1.00 0.00 ? 127 ILE C N   1  
ATOM 10514  C CA  . ILE C 3 127 ? 86.217  55.510  48.126  1.00 0.00 ? 127 ILE C CA  1  
ATOM 10515  C C   . ILE C 3 127 ? 86.743  54.369  47.288  1.00 0.00 ? 127 ILE C C   1  
ATOM 10516  O O   . ILE C 3 127 ? 86.648  54.441  46.058  1.00 0.00 ? 127 ILE C O   1  
ATOM 10517  C CB  . ILE C 3 127 ? 87.243  56.545  48.376  1.00 0.00 ? 127 ILE C CB  1  
ATOM 10518  C CG1 . ILE C 3 127 ? 88.350  56.221  49.388  1.00 0.00 ? 127 ILE C CG1 1  
ATOM 10519  C CG2 . ILE C 3 127 ? 86.496  57.813  48.793  1.00 0.00 ? 127 ILE C CG2 1  
ATOM 10520  C CD1 . ILE C 3 127 ? 89.372  57.354  49.584  1.00 0.00 ? 127 ILE C CD1 1  
ATOM 10521  N N   . ASP C 3 128 ? 87.264  53.306  47.926  1.00 0.00 ? 128 ASP C N   1  
ATOM 10522  C CA  . ASP C 3 128 ? 87.812  52.185  47.280  1.00 0.00 ? 128 ASP C CA  1  
ATOM 10523  C C   . ASP C 3 128 ? 86.697  51.391  46.589  1.00 0.00 ? 128 ASP C C   1  
ATOM 10524  O O   . ASP C 3 128 ? 86.877  50.837  45.551  1.00 0.00 ? 128 ASP C O   1  
ATOM 10525  C CB  . ASP C 3 128 ? 88.688  51.271  48.117  1.00 0.00 ? 128 ASP C CB  1  
ATOM 10526  C CG  . ASP C 3 128 ? 90.110  51.856  48.289  1.00 0.00 ? 128 ASP C CG  1  
ATOM 10527  O OD1 . ASP C 3 128 ? 90.211  52.836  49.020  1.00 0.00 ? 128 ASP C OD1 1  
ATOM 10528  O OD2 . ASP C 3 128 ? 91.017  51.165  47.802  1.00 0.00 ? 128 ASP C OD2 1  
ATOM 10529  N N   . SER C 3 129 ? 85.463  51.268  47.103  1.00 0.00 ? 129 SER C N   1  
ATOM 10530  C CA  . SER C 3 129 ? 84.404  50.527  46.417  1.00 0.00 ? 129 SER C CA  1  
ATOM 10531  C C   . SER C 3 129 ? 83.853  51.231  45.181  1.00 0.00 ? 129 SER C C   1  
ATOM 10532  O O   . SER C 3 129 ? 83.121  50.650  44.361  1.00 0.00 ? 129 SER C O   1  
ATOM 10533  C CB  . SER C 3 129 ? 83.176  50.247  47.320  1.00 0.00 ? 129 SER C CB  1  
ATOM 10534  O OG  . SER C 3 129 ? 82.633  51.463  47.838  1.00 0.00 ? 129 SER C OG  1  
ATOM 10535  N N   . THR C 3 130 ? 84.150  52.571  45.112  1.00 0.00 ? 130 THR C N   1  
ATOM 10536  C CA  . THR C 3 130 ? 83.529  53.446  44.092  1.00 0.00 ? 130 THR C CA  1  
ATOM 10537  C C   . THR C 3 130 ? 84.410  53.276  42.833  1.00 0.00 ? 130 THR C C   1  
ATOM 10538  O O   . THR C 3 130 ? 85.603  53.081  42.801  1.00 0.00 ? 130 THR C O   1  
ATOM 10539  C CB  . THR C 3 130 ? 83.443  54.889  44.545  1.00 0.00 ? 130 THR C CB  1  
ATOM 10540  O OG1 . THR C 3 130 ? 82.719  55.060  45.744  1.00 0.00 ? 130 THR C OG1 1  
ATOM 10541  C CG2 . THR C 3 130 ? 82.727  55.788  43.602  1.00 0.00 ? 130 THR C CG2 1  
ATOM 10542  N N   . ASP C 3 131 ? 83.674  53.282  41.687  1.00 0.00 ? 131 ASP C N   1  
ATOM 10543  C CA  . ASP C 3 131 ? 84.238  53.167  40.300  1.00 0.00 ? 131 ASP C CA  1  
ATOM 10544  C C   . ASP C 3 131 ? 85.074  54.376  40.021  1.00 0.00 ? 131 ASP C C   1  
ATOM 10545  O O   . ASP C 3 131 ? 86.200  54.189  39.502  1.00 0.00 ? 131 ASP C O   1  
ATOM 10546  C CB  . ASP C 3 131 ? 83.134  53.199  39.247  1.00 0.00 ? 131 ASP C CB  1  
ATOM 10547  C CG  . ASP C 3 131 ? 82.250  51.922  39.506  1.00 0.00 ? 131 ASP C CG  1  
ATOM 10548  O OD1 . ASP C 3 131 ? 81.413  51.957  40.433  1.00 0.00 ? 131 ASP C OD1 1  
ATOM 10549  O OD2 . ASP C 3 131 ? 82.212  50.988  38.659  1.00 0.00 ? 131 ASP C OD2 1  
ATOM 10550  N N   . ASN C 3 132 ? 84.533  55.538  40.269  1.00 0.00 ? 132 ASN C N   1  
ATOM 10551  C CA  . ASN C 3 132 ? 85.303  56.782  40.129  1.00 0.00 ? 132 ASN C CA  1  
ATOM 10552  C C   . ASN C 3 132 ? 84.656  57.972  40.771  1.00 0.00 ? 132 ASN C C   1  
ATOM 10553  O O   . ASN C 3 132 ? 83.816  58.616  40.184  1.00 0.00 ? 132 ASN C O   1  
ATOM 10554  C CB  . ASN C 3 132 ? 85.772  57.103  38.705  1.00 0.00 ? 132 ASN C CB  1  
ATOM 10555  C CG  . ASN C 3 132 ? 84.679  57.405  37.638  1.00 0.00 ? 132 ASN C CG  1  
ATOM 10556  O OD1 . ASN C 3 132 ? 84.479  58.564  37.315  1.00 0.00 ? 132 ASN C OD1 1  
ATOM 10557  N ND2 . ASN C 3 132 ? 83.993  56.389  37.180  1.00 0.00 ? 132 ASN C ND2 1  
ATOM 10558  N N   . PHE C 3 133 ? 85.174  58.269  42.025  1.00 0.00 ? 133 PHE C N   1  
ATOM 10559  C CA  . PHE C 3 133 ? 84.648  59.319  42.877  1.00 0.00 ? 133 PHE C CA  1  
ATOM 10560  C C   . PHE C 3 133 ? 85.096  60.735  42.502  1.00 0.00 ? 133 PHE C C   1  
ATOM 10561  O O   . PHE C 3 133 ? 86.284  60.968  42.436  1.00 0.00 ? 133 PHE C O   1  
ATOM 10562  C CB  . PHE C 3 133 ? 84.920  59.123  44.408  1.00 0.00 ? 133 PHE C CB  1  
ATOM 10563  C CG  . PHE C 3 133 ? 86.356  59.049  44.879  1.00 0.00 ? 133 PHE C CG  1  
ATOM 10564  C CD1 . PHE C 3 133 ? 87.211  58.014  44.417  1.00 0.00 ? 133 PHE C CD1 1  
ATOM 10565  C CD2 . PHE C 3 133 ? 86.888  59.895  45.851  1.00 0.00 ? 133 PHE C CD2 1  
ATOM 10566  C CE1 . PHE C 3 133 ? 88.522  57.794  44.925  1.00 0.00 ? 133 PHE C CE1 1  
ATOM 10567  C CE2 . PHE C 3 133 ? 88.255  59.758  46.285  1.00 0.00 ? 133 PHE C CE2 1  
ATOM 10568  C CZ  . PHE C 3 133 ? 89.033  58.708  45.887  1.00 0.00 ? 133 PHE C CZ  1  
ATOM 10569  N N   . GLU C 3 134 ? 84.122  61.647  42.223  1.00 0.00 ? 134 GLU C N   1  
ATOM 10570  C CA  . GLU C 3 134 ? 84.429  63.050  41.884  1.00 0.00 ? 134 GLU C CA  1  
ATOM 10571  C C   . GLU C 3 134 ? 84.845  63.811  43.105  1.00 0.00 ? 134 GLU C C   1  
ATOM 10572  O O   . GLU C 3 134 ? 85.794  64.589  43.160  1.00 0.00 ? 134 GLU C O   1  
ATOM 10573  C CB  . GLU C 3 134 ? 83.229  63.762  41.204  1.00 0.00 ? 134 GLU C CB  1  
ATOM 10574  C CG  . GLU C 3 134 ? 82.663  62.996  40.039  1.00 0.00 ? 134 GLU C CG  1  
ATOM 10575  C CD  . GLU C 3 134 ? 81.505  63.866  39.506  1.00 0.00 ? 134 GLU C CD  1  
ATOM 10576  O OE1 . GLU C 3 134 ? 80.574  64.077  40.345  1.00 0.00 ? 134 GLU C OE1 1  
ATOM 10577  O OE2 . GLU C 3 134 ? 81.460  64.322  38.360  1.00 0.00 ? 134 GLU C OE2 1  
ATOM 10578  N N   . GLY C 3 135 ? 84.042  63.622  44.210  1.00 0.00 ? 135 GLY C N   1  
ATOM 10579  C CA  . GLY C 3 135 ? 84.356  64.355  45.404  1.00 0.00 ? 135 GLY C CA  1  
ATOM 10580  C C   . GLY C 3 135 ? 83.148  64.308  46.340  1.00 0.00 ? 135 GLY C C   1  
ATOM 10581  O O   . GLY C 3 135 ? 82.217  63.495  46.123  1.00 0.00 ? 135 GLY C O   1  
ATOM 10582  N N   . PHE C 3 136 ? 83.178  65.140  47.368  1.00 0.00 ? 136 PHE C N   1  
ATOM 10583  C CA  . PHE C 3 136 ? 82.322  65.026  48.524  1.00 0.00 ? 136 PHE C CA  1  
ATOM 10584  C C   . PHE C 3 136 ? 81.317  66.158  48.690  1.00 0.00 ? 136 PHE C C   1  
ATOM 10585  O O   . PHE C 3 136 ? 81.700  67.226  48.279  1.00 0.00 ? 136 PHE C O   1  
ATOM 10586  C CB  . PHE C 3 136 ? 83.143  65.072  49.831  1.00 0.00 ? 136 PHE C CB  1  
ATOM 10587  C CG  . PHE C 3 136 ? 84.053  63.888  49.936  1.00 0.00 ? 136 PHE C CG  1  
ATOM 10588  C CD1 . PHE C 3 136 ? 83.578  62.725  50.523  1.00 0.00 ? 136 PHE C CD1 1  
ATOM 10589  C CD2 . PHE C 3 136 ? 85.385  63.935  49.441  1.00 0.00 ? 136 PHE C CD2 1  
ATOM 10590  C CE1 . PHE C 3 136 ? 84.352  61.595  50.696  1.00 0.00 ? 136 PHE C CE1 1  
ATOM 10591  C CE2 . PHE C 3 136 ? 86.227  62.809  49.615  1.00 0.00 ? 136 PHE C CE2 1  
ATOM 10592  C CZ  . PHE C 3 136 ? 85.716  61.660  50.212  1.00 0.00 ? 136 PHE C CZ  1  
ATOM 10593  N N   . GLN C 3 137 ? 80.132  65.923  49.297  1.00 0.00 ? 137 GLN C N   1  
ATOM 10594  C CA  . GLN C 3 137 ? 79.213  66.881  49.735  1.00 0.00 ? 137 GLN C CA  1  
ATOM 10595  C C   . GLN C 3 137 ? 78.857  66.664  51.119  1.00 0.00 ? 137 GLN C C   1  
ATOM 10596  O O   . GLN C 3 137 ? 78.555  65.545  51.514  1.00 0.00 ? 137 GLN C O   1  
ATOM 10597  C CB  . GLN C 3 137 ? 77.927  66.809  48.895  1.00 0.00 ? 137 GLN C CB  1  
ATOM 10598  C CG  . GLN C 3 137 ? 78.174  67.230  47.455  1.00 0.00 ? 137 GLN C CG  1  
ATOM 10599  C CD  . GLN C 3 137 ? 76.843  67.302  46.798  1.00 0.00 ? 137 GLN C CD  1  
ATOM 10600  O OE1 . GLN C 3 137 ? 75.774  66.795  47.158  1.00 0.00 ? 137 GLN C OE1 1  
ATOM 10601  N NE2 . GLN C 3 137 ? 77.055  68.024  45.678  1.00 0.00 ? 137 GLN C NE2 1  
ATOM 10602  N N   . LEU C 3 138 ? 78.947  67.757  51.904  1.00 0.00 ? 138 LEU C N   1  
ATOM 10603  C CA  . LEU C 3 138 ? 78.761  67.784  53.343  1.00 0.00 ? 138 LEU C CA  1  
ATOM 10604  C C   . LEU C 3 138 ? 77.474  68.441  53.581  1.00 0.00 ? 138 LEU C C   1  
ATOM 10605  O O   . LEU C 3 138 ? 77.170  69.570  53.188  1.00 0.00 ? 138 LEU C O   1  
ATOM 10606  C CB  . LEU C 3 138 ? 79.907  68.530  54.146  1.00 0.00 ? 138 LEU C CB  1  
ATOM 10607  C CG  . LEU C 3 138 ? 79.637  68.791  55.681  1.00 0.00 ? 138 LEU C CG  1  
ATOM 10608  C CD1 . LEU C 3 138 ? 79.510  67.494  56.544  1.00 0.00 ? 138 LEU C CD1 1  
ATOM 10609  C CD2 . LEU C 3 138 ? 80.727  69.712  56.132  1.00 0.00 ? 138 LEU C CD2 1  
ATOM 10610  N N   . LEU C 3 139 ? 76.672  67.773  54.377  1.00 0.00 ? 139 LEU C N   1  
ATOM 10611  C CA  . LEU C 3 139 ? 75.453  68.286  54.887  1.00 0.00 ? 139 LEU C CA  1  
ATOM 10612  C C   . LEU C 3 139 ? 75.681  68.492  56.326  1.00 0.00 ? 139 LEU C C   1  
ATOM 10613  O O   . LEU C 3 139 ? 75.975  67.489  56.961  1.00 0.00 ? 139 LEU C O   1  
ATOM 10614  C CB  . LEU C 3 139 ? 74.166  67.368  54.736  1.00 0.00 ? 139 LEU C CB  1  
ATOM 10615  C CG  . LEU C 3 139 ? 73.854  66.978  53.285  1.00 0.00 ? 139 LEU C CG  1  
ATOM 10616  C CD1 . LEU C 3 139 ? 72.472  66.251  53.170  1.00 0.00 ? 139 LEU C CD1 1  
ATOM 10617  C CD2 . LEU C 3 139 ? 73.930  68.154  52.200  1.00 0.00 ? 139 LEU C CD2 1  
ATOM 10618  N N   . HIS C 3 140 ? 75.497  69.698  56.864  1.00 0.00 ? 140 HIS C N   1  
ATOM 10619  C CA  . HIS C 3 140 ? 75.643  69.875  58.229  1.00 0.00 ? 140 HIS C CA  1  
ATOM 10620  C C   . HIS C 3 140 ? 75.145  71.288  58.610  1.00 0.00 ? 140 HIS C C   1  
ATOM 10621  O O   . HIS C 3 140 ? 74.696  71.965  57.726  1.00 0.00 ? 140 HIS C O   1  
ATOM 10622  C CB  . HIS C 3 140 ? 77.082  69.777  58.814  1.00 0.00 ? 140 HIS C CB  1  
ATOM 10623  C CG  . HIS C 3 140 ? 77.971  70.832  58.233  1.00 0.00 ? 140 HIS C CG  1  
ATOM 10624  N ND1 . HIS C 3 140 ? 79.199  71.178  58.794  1.00 0.00 ? 140 HIS C ND1 1  
ATOM 10625  C CD2 . HIS C 3 140 ? 77.825  71.615  57.165  1.00 0.00 ? 140 HIS C CD2 1  
ATOM 10626  C CE1 . HIS C 3 140 ? 79.676  72.242  58.043  1.00 0.00 ? 140 HIS C CE1 1  
ATOM 10627  N NE2 . HIS C 3 140 ? 78.903  72.484  57.057  1.00 0.00 ? 140 HIS C NE2 1  
ATOM 10628  N N   . SER C 3 141 ? 75.106  71.692  59.879  1.00 0.00 ? 141 SER C N   1  
ATOM 10629  C CA  . SER C 3 141 ? 74.728  72.954  60.347  1.00 0.00 ? 141 SER C CA  1  
ATOM 10630  C C   . SER C 3 141 ? 76.003  73.371  61.054  1.00 0.00 ? 141 SER C C   1  
ATOM 10631  O O   . SER C 3 141 ? 76.818  72.630  61.526  1.00 0.00 ? 141 SER C O   1  
ATOM 10632  C CB  . SER C 3 141 ? 73.507  72.936  61.340  1.00 0.00 ? 141 SER C CB  1  
ATOM 10633  O OG  . SER C 3 141 ? 73.156  74.288  61.511  1.00 0.00 ? 141 SER C OG  1  
ATOM 10634  N N   . VAL C 3 142 ? 76.216  74.662  61.064  1.00 0.00 ? 142 VAL C N   1  
ATOM 10635  C CA  . VAL C 3 142 ? 77.295  75.365  61.727  1.00 0.00 ? 142 VAL C CA  1  
ATOM 10636  C C   . VAL C 3 142 ? 76.758  75.944  63.002  1.00 0.00 ? 142 VAL C C   1  
ATOM 10637  O O   . VAL C 3 142 ? 77.542  76.334  63.902  1.00 0.00 ? 142 VAL C O   1  
ATOM 10638  C CB  . VAL C 3 142 ? 77.900  76.472  60.853  1.00 0.00 ? 142 VAL C CB  1  
ATOM 10639  C CG1 . VAL C 3 142 ? 79.050  77.251  61.471  1.00 0.00 ? 142 VAL C CG1 1  
ATOM 10640  C CG2 . VAL C 3 142 ? 78.253  75.912  59.433  1.00 0.00 ? 142 VAL C CG2 1  
ATOM 10641  N N   . ALA C 3 143 ? 75.423  75.829  63.181  1.00 0.00 ? 143 ALA C N   1  
ATOM 10642  C CA  . ALA C 3 143 ? 74.828  76.217  64.478  1.00 0.00 ? 143 ALA C CA  1  
ATOM 10643  C C   . ALA C 3 143 ? 75.156  75.304  65.688  1.00 0.00 ? 143 ALA C C   1  
ATOM 10644  O O   . ALA C 3 143 ? 75.448  75.905  66.688  1.00 0.00 ? 143 ALA C O   1  
ATOM 10645  C CB  . ALA C 3 143 ? 73.293  76.148  64.462  1.00 0.00 ? 143 ALA C CB  1  
ATOM 10646  N N   . GLY C 3 144 ? 75.176  73.992  65.661  1.00 0.00 ? 144 GLY C N   1  
ATOM 10647  C CA  . GLY C 3 144 ? 75.585  73.273  66.845  1.00 0.00 ? 144 GLY C CA  1  
ATOM 10648  C C   . GLY C 3 144 ? 77.073  73.251  67.051  1.00 0.00 ? 144 GLY C C   1  
ATOM 10649  O O   . GLY C 3 144 ? 77.856  74.098  66.643  1.00 0.00 ? 144 GLY C O   1  
ATOM 10650  N N   . GLY C 3 145 ? 77.298  72.346  67.980  1.00 0.00 ? 145 GLY C N   1  
ATOM 10651  C CA  . GLY C 3 145 ? 78.613  71.947  68.472  1.00 0.00 ? 145 GLY C CA  1  
ATOM 10652  C C   . GLY C 3 145 ? 79.156  70.949  67.565  1.00 0.00 ? 145 GLY C C   1  
ATOM 10653  O O   . GLY C 3 145 ? 80.300  70.988  67.149  1.00 0.00 ? 145 GLY C O   1  
ATOM 10654  N N   . THR C 3 146 ? 78.338  69.939  67.390  1.00 0.00 ? 146 THR C N   1  
ATOM 10655  C CA  . THR C 3 146 ? 78.685  68.698  66.804  1.00 0.00 ? 146 THR C CA  1  
ATOM 10656  C C   . THR C 3 146 ? 78.827  69.080  65.298  1.00 0.00 ? 146 THR C C   1  
ATOM 10657  O O   . THR C 3 146 ? 79.730  68.575  64.606  1.00 0.00 ? 146 THR C O   1  
ATOM 10658  C CB  . THR C 3 146 ? 77.691  67.615  66.919  1.00 0.00 ? 146 THR C CB  1  
ATOM 10659  O OG1 . THR C 3 146 ? 77.363  67.311  68.227  1.00 0.00 ? 146 THR C OG1 1  
ATOM 10660  C CG2 . THR C 3 146 ? 78.225  66.326  66.313  1.00 0.00 ? 146 THR C CG2 1  
ATOM 10661  N N   . GLY C 3 147 ? 77.790  69.809  64.676  1.00 0.00 ? 147 GLY C N   1  
ATOM 10662  C CA  . GLY C 3 147 ? 77.663  70.082  63.243  1.00 0.00 ? 147 GLY C CA  1  
ATOM 10663  C C   . GLY C 3 147 ? 78.840  70.901  62.843  1.00 0.00 ? 147 GLY C C   1  
ATOM 10664  O O   . GLY C 3 147 ? 79.527  70.722  61.861  1.00 0.00 ? 147 GLY C O   1  
ATOM 10665  N N   . SER C 3 148 ? 79.190  71.858  63.657  1.00 0.00 ? 148 SER C N   1  
ATOM 10666  C CA  . SER C 3 148 ? 80.329  72.706  63.521  1.00 0.00 ? 148 SER C CA  1  
ATOM 10667  C C   . SER C 3 148 ? 81.684  72.093  63.774  1.00 0.00 ? 148 SER C C   1  
ATOM 10668  O O   . SER C 3 148 ? 82.597  72.168  62.939  1.00 0.00 ? 148 SER C O   1  
ATOM 10669  C CB  . SER C 3 148 ? 80.189  74.033  64.350  1.00 0.00 ? 148 SER C CB  1  
ATOM 10670  O OG  . SER C 3 148 ? 80.551  73.921  65.764  1.00 0.00 ? 148 SER C OG  1  
ATOM 10671  N N   . GLY C 3 149 ? 81.918  71.540  64.947  1.00 0.00 ? 149 GLY C N   1  
ATOM 10672  C CA  . GLY C 3 149 ? 83.217  71.161  65.360  1.00 0.00 ? 149 GLY C CA  1  
ATOM 10673  C C   . GLY C 3 149 ? 83.595  69.941  64.531  1.00 0.00 ? 149 GLY C C   1  
ATOM 10674  O O   . GLY C 3 149 ? 84.636  70.046  63.928  1.00 0.00 ? 149 GLY C O   1  
ATOM 10675  N N   . LEU C 3 150 ? 82.766  68.884  64.491  1.00 0.00 ? 150 LEU C N   1  
ATOM 10676  C CA  . LEU C 3 150 ? 83.103  67.696  63.727  1.00 0.00 ? 150 LEU C CA  1  
ATOM 10677  C C   . LEU C 3 150 ? 83.121  67.954  62.224  1.00 0.00 ? 150 LEU C C   1  
ATOM 10678  O O   . LEU C 3 150 ? 83.988  67.481  61.496  1.00 0.00 ? 150 LEU C O   1  
ATOM 10679  C CB  . LEU C 3 150 ? 82.205  66.489  64.007  1.00 0.00 ? 150 LEU C CB  1  
ATOM 10680  C CG  . LEU C 3 150 ? 82.724  65.078  63.507  1.00 0.00 ? 150 LEU C CG  1  
ATOM 10681  C CD1 . LEU C 3 150 ? 83.999  64.633  64.150  1.00 0.00 ? 150 LEU C CD1 1  
ATOM 10682  C CD2 . LEU C 3 150 ? 81.649  63.991  63.580  1.00 0.00 ? 150 LEU C CD2 1  
ATOM 10683  N N   . GLY C 3 151 ? 82.182  68.770  61.730  1.00 0.00 ? 151 GLY C N   1  
ATOM 10684  C CA  . GLY C 3 151 ? 82.118  69.110  60.293  1.00 0.00 ? 151 GLY C CA  1  
ATOM 10685  C C   . GLY C 3 151 ? 83.303  69.810  59.828  1.00 0.00 ? 151 GLY C C   1  
ATOM 10686  O O   . GLY C 3 151 ? 83.898  69.432  58.799  1.00 0.00 ? 151 GLY C O   1  
ATOM 10687  N N   . SER C 3 152 ? 83.867  70.778  60.608  1.00 0.00 ? 152 SER C N   1  
ATOM 10688  C CA  . SER C 3 152 ? 85.112  71.478  60.345  1.00 0.00 ? 152 SER C CA  1  
ATOM 10689  C C   . SER C 3 152 ? 86.313  70.577  60.340  1.00 0.00 ? 152 SER C C   1  
ATOM 10690  O O   . SER C 3 152 ? 87.207  70.835  59.508  1.00 0.00 ? 152 SER C O   1  
ATOM 10691  C CB  . SER C 3 152 ? 85.522  72.656  61.239  1.00 0.00 ? 152 SER C CB  1  
ATOM 10692  O OG  . SER C 3 152 ? 84.501  73.638  61.045  1.00 0.00 ? 152 SER C OG  1  
ATOM 10693  N N   . ASN C 3 153 ? 86.319  69.601  61.343  1.00 0.00 ? 153 ASN C N   1  
ATOM 10694  C CA  . ASN C 3 153 ? 87.443  68.685  61.613  1.00 0.00 ? 153 ASN C CA  1  
ATOM 10695  C C   . ASN C 3 153 ? 87.666  67.758  60.432  1.00 0.00 ? 153 ASN C C   1  
ATOM 10696  O O   . ASN C 3 153 ? 88.764  67.617  59.892  1.00 0.00 ? 153 ASN C O   1  
ATOM 10697  C CB  . ASN C 3 153 ? 87.088  67.814  62.888  1.00 0.00 ? 153 ASN C CB  1  
ATOM 10698  C CG  . ASN C 3 153 ? 88.185  66.942  63.475  1.00 0.00 ? 153 ASN C CG  1  
ATOM 10699  O OD1 . ASN C 3 153 ? 89.270  67.361  63.771  1.00 0.00 ? 153 ASN C OD1 1  
ATOM 10700  N ND2 . ASN C 3 153 ? 87.903  65.635  63.677  1.00 0.00 ? 153 ASN C ND2 1  
ATOM 10701  N N   . LEU C 3 154 ? 86.536  67.190  59.876  1.00 0.00 ? 154 LEU C N   1  
ATOM 10702  C CA  . LEU C 3 154 ? 86.454  66.378  58.709  1.00 0.00 ? 154 LEU C CA  1  
ATOM 10703  C C   . LEU C 3 154 ? 86.854  67.159  57.495  1.00 0.00 ? 154 LEU C C   1  
ATOM 10704  O O   . LEU C 3 154 ? 87.522  66.569  56.644  1.00 0.00 ? 154 LEU C O   1  
ATOM 10705  C CB  . LEU C 3 154 ? 84.984  65.924  58.476  1.00 0.00 ? 154 LEU C CB  1  
ATOM 10706  C CG  . LEU C 3 154 ? 84.733  64.946  57.382  1.00 0.00 ? 154 LEU C CG  1  
ATOM 10707  C CD1 . LEU C 3 154 ? 85.519  63.532  57.536  1.00 0.00 ? 154 LEU C CD1 1  
ATOM 10708  C CD2 . LEU C 3 154 ? 83.261  64.884  57.218  1.00 0.00 ? 154 LEU C CD2 1  
ATOM 10709  N N   . LEU C 3 155 ? 86.522  68.447  57.353  1.00 0.00 ? 155 LEU C N   1  
ATOM 10710  C CA  . LEU C 3 155 ? 86.979  69.262  56.238  1.00 0.00 ? 155 LEU C CA  1  
ATOM 10711  C C   . LEU C 3 155 ? 88.459  69.467  56.147  1.00 0.00 ? 155 LEU C C   1  
ATOM 10712  O O   . LEU C 3 155 ? 89.005  69.566  55.062  1.00 0.00 ? 155 LEU C O   1  
ATOM 10713  C CB  . LEU C 3 155 ? 86.313  70.680  56.213  1.00 0.00 ? 155 LEU C CB  1  
ATOM 10714  C CG  . LEU C 3 155 ? 84.790  70.665  55.980  1.00 0.00 ? 155 LEU C CG  1  
ATOM 10715  C CD1 . LEU C 3 155 ? 83.999  71.891  56.480  1.00 0.00 ? 155 LEU C CD1 1  
ATOM 10716  C CD2 . LEU C 3 155 ? 84.836  70.480  54.449  1.00 0.00 ? 155 LEU C CD2 1  
ATOM 10717  N N   . GLU C 3 156 ? 89.107  69.680  57.283  1.00 0.00 ? 156 GLU C N   1  
ATOM 10718  C CA  . GLU C 3 156 ? 90.608  69.893  57.425  1.00 0.00 ? 156 GLU C CA  1  
ATOM 10719  C C   . GLU C 3 156 ? 91.361  68.617  57.068  1.00 0.00 ? 156 GLU C C   1  
ATOM 10720  O O   . GLU C 3 156 ? 92.356  68.638  56.325  1.00 0.00 ? 156 GLU C O   1  
ATOM 10721  C CB  . GLU C 3 156 ? 90.862  70.351  58.831  1.00 0.00 ? 156 GLU C CB  1  
ATOM 10722  C CG  . GLU C 3 156 ? 92.200  71.155  58.944  1.00 0.00 ? 156 GLU C CG  1  
ATOM 10723  C CD  . GLU C 3 156 ? 92.650  71.331  60.400  1.00 0.00 ? 156 GLU C CD  1  
ATOM 10724  O OE1 . GLU C 3 156 ? 92.616  70.373  61.260  1.00 0.00 ? 156 GLU C OE1 1  
ATOM 10725  O OE2 . GLU C 3 156 ? 93.094  72.469  60.675  1.00 0.00 ? 156 GLU C OE2 1  
ATOM 10726  N N   . ALA C 3 157 ? 90.878  67.389  57.486  1.00 0.00 ? 157 ALA C N   1  
ATOM 10727  C CA  . ALA C 3 157 ? 91.516  66.222  57.021  1.00 0.00 ? 157 ALA C CA  1  
ATOM 10728  C C   . ALA C 3 157 ? 91.454  65.973  55.509  1.00 0.00 ? 157 ALA C C   1  
ATOM 10729  O O   . ALA C 3 157 ? 92.425  65.593  54.846  1.00 0.00 ? 157 ALA C O   1  
ATOM 10730  C CB  . ALA C 3 157 ? 90.937  65.037  57.683  1.00 0.00 ? 157 ALA C CB  1  
ATOM 10731  N N   . LEU C 3 158 ? 90.252  66.205  54.986  1.00 0.00 ? 158 LEU C N   1  
ATOM 10732  C CA  . LEU C 3 158 ? 89.980  65.980  53.519  1.00 0.00 ? 158 LEU C CA  1  
ATOM 10733  C C   . LEU C 3 158 ? 90.784  66.826  52.556  1.00 0.00 ? 158 LEU C C   1  
ATOM 10734  O O   . LEU C 3 158 ? 91.319  66.295  51.579  1.00 0.00 ? 158 LEU C O   1  
ATOM 10735  C CB  . LEU C 3 158 ? 88.454  66.030  53.105  1.00 0.00 ? 158 LEU C CB  1  
ATOM 10736  C CG  . LEU C 3 158 ? 87.636  64.743  53.510  1.00 0.00 ? 158 LEU C CG  1  
ATOM 10737  C CD1 . LEU C 3 158 ? 86.122  65.085  53.688  1.00 0.00 ? 158 LEU C CD1 1  
ATOM 10738  C CD2 . LEU C 3 158 ? 87.931  63.655  52.518  1.00 0.00 ? 158 LEU C CD2 1  
ATOM 10739  N N   . CYS C 3 159 ? 90.975  68.106  52.869  1.00 0.00 ? 159 CYS C N   1  
ATOM 10740  C CA  . CYS C 3 159 ? 91.721  69.068  52.081  1.00 0.00 ? 159 CYS C CA  1  
ATOM 10741  C C   . CYS C 3 159 ? 93.254  68.610  51.947  1.00 0.00 ? 159 CYS C C   1  
ATOM 10742  O O   . CYS C 3 159 ? 93.921  68.620  50.873  1.00 0.00 ? 159 CYS C O   1  
ATOM 10743  C CB  . CYS C 3 159 ? 91.615  70.481  52.571  1.00 0.00 ? 159 CYS C CB  1  
ATOM 10744  S SG  . CYS C 3 159 ? 92.601  70.863  54.095  1.00 0.00 ? 159 CYS C SG  1  
ATOM 10745  N N   . ASP C 3 160 ? 93.783  68.213  53.143  1.00 0.00 ? 160 ASP C N   1  
ATOM 10746  C CA  . ASP C 3 160 ? 95.151  67.765  53.382  1.00 0.00 ? 160 ASP C CA  1  
ATOM 10747  C C   . ASP C 3 160 ? 95.531  66.454  52.753  1.00 0.00 ? 160 ASP C C   1  
ATOM 10748  O O   . ASP C 3 160 ? 96.538  66.345  52.035  1.00 0.00 ? 160 ASP C O   1  
ATOM 10749  C CB  . ASP C 3 160 ? 95.477  67.716  54.901  1.00 0.00 ? 160 ASP C CB  1  
ATOM 10750  C CG  . ASP C 3 160 ? 97.006  67.611  55.234  1.00 0.00 ? 160 ASP C CG  1  
ATOM 10751  O OD1 . ASP C 3 160 ? 97.435  66.419  55.255  1.00 0.00 ? 160 ASP C OD1 1  
ATOM 10752  O OD2 . ASP C 3 160 ? 97.652  68.615  55.535  1.00 0.00 ? 160 ASP C OD2 1  
ATOM 10753  N N   . ARG C 3 161 ? 94.670  65.457  52.963  1.00 0.00 ? 161 ARG C N   1  
ATOM 10754  C CA  . ARG C 3 161 ? 94.808  64.094  52.384  1.00 0.00 ? 161 ARG C CA  1  
ATOM 10755  C C   . ARG C 3 161 ? 94.674  64.166  50.988  1.00 0.00 ? 161 ARG C C   1  
ATOM 10756  O O   . ARG C 3 161 ? 95.520  63.574  50.294  1.00 0.00 ? 161 ARG C O   1  
ATOM 10757  C CB  . ARG C 3 161 ? 93.763  62.990  52.879  1.00 0.00 ? 161 ARG C CB  1  
ATOM 10758  C CG  . ARG C 3 161 ? 93.703  62.586  54.333  1.00 0.00 ? 161 ARG C CG  1  
ATOM 10759  C CD  . ARG C 3 161 ? 92.570  61.550  54.534  1.00 0.00 ? 161 ARG C CD  1  
ATOM 10760  N NE  . ARG C 3 161 ? 91.253  62.243  54.876  1.00 0.00 ? 161 ARG C NE  1  
ATOM 10761  C CZ  . ARG C 3 161 ? 90.091  61.549  54.817  1.00 0.00 ? 161 ARG C CZ  1  
ATOM 10762  N NH1 . ARG C 3 161 ? 90.016  60.309  54.269  1.00 0.00 ? 161 ARG C NH1 1  
ATOM 10763  N NH2 . ARG C 3 161 ? 88.995  62.014  55.434  1.00 0.00 ? 161 ARG C NH2 1  
ATOM 10764  N N   . TYR C 3 162 ? 93.578  64.800  50.451  1.00 0.00 ? 162 TYR C N   1  
ATOM 10765  C CA  . TYR C 3 162 ? 93.350  64.808  49.049  1.00 0.00 ? 162 TYR C CA  1  
ATOM 10766  C C   . TYR C 3 162 ? 93.296  66.219  48.664  1.00 0.00 ? 162 TYR C C   1  
ATOM 10767  O O   . TYR C 3 162 ? 92.286  66.872  49.078  1.00 0.00 ? 162 TYR C O   1  
ATOM 10768  C CB  . TYR C 3 162 ? 91.967  64.090  48.740  1.00 0.00 ? 162 TYR C CB  1  
ATOM 10769  C CG  . TYR C 3 162 ? 92.135  62.625  48.988  1.00 0.00 ? 162 TYR C CG  1  
ATOM 10770  C CD1 . TYR C 3 162 ? 92.676  61.796  48.028  1.00 0.00 ? 162 TYR C CD1 1  
ATOM 10771  C CD2 . TYR C 3 162 ? 91.765  62.081  50.240  1.00 0.00 ? 162 TYR C CD2 1  
ATOM 10772  C CE1 . TYR C 3 162 ? 92.871  60.384  48.270  1.00 0.00 ? 162 TYR C CE1 1  
ATOM 10773  C CE2 . TYR C 3 162 ? 91.940  60.665  50.460  1.00 0.00 ? 162 TYR C CE2 1  
ATOM 10774  C CZ  . TYR C 3 162 ? 92.504  59.826  49.479  1.00 0.00 ? 162 TYR C CZ  1  
ATOM 10775  O OH  . TYR C 3 162 ? 92.764  58.472  49.871  1.00 0.00 ? 162 TYR C OH  1  
ATOM 10776  N N   . PRO C 3 163 ? 94.187  66.799  47.924  1.00 0.00 ? 163 PRO C N   1  
ATOM 10777  C CA  . PRO C 3 163 ? 94.094  68.184  47.531  1.00 0.00 ? 163 PRO C CA  1  
ATOM 10778  C C   . PRO C 3 163 ? 93.499  68.327  46.148  1.00 0.00 ? 163 PRO C C   1  
ATOM 10779  O O   . PRO C 3 163 ? 93.429  69.462  45.727  1.00 0.00 ? 163 PRO C O   1  
ATOM 10780  C CB  . PRO C 3 163 ? 95.589  68.694  47.639  1.00 0.00 ? 163 PRO C CB  1  
ATOM 10781  C CG  . PRO C 3 163 ? 96.419  67.535  47.361  1.00 0.00 ? 163 PRO C CG  1  
ATOM 10782  C CD  . PRO C 3 163 ? 95.524  66.422  48.091  1.00 0.00 ? 163 PRO C CD  1  
ATOM 10783  N N   . LYS C 3 164 ? 93.178  67.200  45.514  1.00 0.00 ? 164 LYS C N   1  
ATOM 10784  C CA  . LYS C 3 164 ? 92.801  67.206  44.164  1.00 0.00 ? 164 LYS C CA  1  
ATOM 10785  C C   . LYS C 3 164 ? 91.415  66.683  44.133  1.00 0.00 ? 164 LYS C C   1  
ATOM 10786  O O   . LYS C 3 164 ? 90.944  66.302  43.062  1.00 0.00 ? 164 LYS C O   1  
ATOM 10787  C CB  . LYS C 3 164 ? 93.769  66.203  43.323  1.00 0.00 ? 164 LYS C CB  1  
ATOM 10788  C CG  . LYS C 3 164 ? 95.159  66.687  43.261  1.00 0.00 ? 164 LYS C CG  1  
ATOM 10789  C CD  . LYS C 3 164 ? 96.097  65.741  42.402  1.00 0.00 ? 164 LYS C CD  1  
ATOM 10790  C CE  . LYS C 3 164 ? 95.829  65.586  40.905  1.00 0.00 ? 164 LYS C CE  1  
ATOM 10791  N NZ  . LYS C 3 164 ? 95.883  66.951  40.314  1.00 0.00 ? 164 LYS C NZ  1  
ATOM 10792  N N   . LYS C 3 165 ? 90.669  66.754  45.213  1.00 0.00 ? 165 LYS C N   1  
ATOM 10793  C CA  . LYS C 3 165 ? 89.307  66.211  45.215  1.00 0.00 ? 165 LYS C CA  1  
ATOM 10794  C C   . LYS C 3 165 ? 88.546  67.346  45.803  1.00 0.00 ? 165 LYS C C   1  
ATOM 10795  O O   . LYS C 3 165 ? 89.090  67.894  46.789  1.00 0.00 ? 165 LYS C O   1  
ATOM 10796  C CB  . LYS C 3 165 ? 89.090  64.968  46.183  1.00 0.00 ? 165 LYS C CB  1  
ATOM 10797  C CG  . LYS C 3 165 ? 89.812  63.659  45.672  1.00 0.00 ? 165 LYS C CG  1  
ATOM 10798  C CD  . LYS C 3 165 ? 89.178  62.996  44.446  1.00 0.00 ? 165 LYS C CD  1  
ATOM 10799  C CE  . LYS C 3 165 ? 90.024  61.885  43.877  1.00 0.00 ? 165 LYS C CE  1  
ATOM 10800  N NZ  . LYS C 3 165 ? 89.329  61.303  42.661  1.00 0.00 ? 165 LYS C NZ  1  
ATOM 10801  N N   . ILE C 3 166 ? 87.351  67.741  45.226  1.00 0.00 ? 166 ILE C N   1  
ATOM 10802  C CA  . ILE C 3 166 ? 86.594  68.888  45.562  1.00 0.00 ? 166 ILE C CA  1  
ATOM 10803  C C   . ILE C 3 166 ? 85.685  68.556  46.765  1.00 0.00 ? 166 ILE C C   1  
ATOM 10804  O O   . ILE C 3 166 ? 85.208  67.486  46.911  1.00 0.00 ? 166 ILE C O   1  
ATOM 10805  C CB  . ILE C 3 166 ? 85.810  69.382  44.355  1.00 0.00 ? 166 ILE C CB  1  
ATOM 10806  C CG1 . ILE C 3 166 ? 85.231  68.198  43.530  1.00 0.00 ? 166 ILE C CG1 1  
ATOM 10807  C CG2 . ILE C 3 166 ? 86.768  70.251  43.433  1.00 0.00 ? 166 ILE C CG2 1  
ATOM 10808  C CD1 . ILE C 3 166 ? 84.425  68.629  42.293  1.00 0.00 ? 166 ILE C CD1 1  
ATOM 10809  N N   . LEU C 3 167 ? 85.601  69.555  47.600  1.00 0.00 ? 167 LEU C N   1  
ATOM 10810  C CA  . LEU C 3 167 ? 84.809  69.517  48.870  1.00 0.00 ? 167 LEU C CA  1  
ATOM 10811  C C   . LEU C 3 167 ? 83.872  70.581  48.660  1.00 0.00 ? 167 LEU C C   1  
ATOM 10812  O O   . LEU C 3 167 ? 84.280  71.655  48.390  1.00 0.00 ? 167 LEU C O   1  
ATOM 10813  C CB  . LEU C 3 167 ? 85.581  69.903  50.178  1.00 0.00 ? 167 LEU C CB  1  
ATOM 10814  C CG  . LEU C 3 167 ? 86.588  68.901  50.803  1.00 0.00 ? 167 LEU C CG  1  
ATOM 10815  C CD1 . LEU C 3 167 ? 87.378  68.097  49.767  1.00 0.00 ? 167 LEU C CD1 1  
ATOM 10816  C CD2 . LEU C 3 167 ? 87.607  69.576  51.837  1.00 0.00 ? 167 LEU C CD2 1  
ATOM 10817  N N   . THR C 3 168 ? 82.593  70.233  48.677  1.00 0.00 ? 168 THR C N   1  
ATOM 10818  C CA  . THR C 3 168 ? 81.510  71.240  48.451  1.00 0.00 ? 168 THR C CA  1  
ATOM 10819  C C   . THR C 3 168 ? 80.843  71.041  49.714  1.00 0.00 ? 168 THR C C   1  
ATOM 10820  O O   . THR C 3 168 ? 80.760  69.897  50.179  1.00 0.00 ? 168 THR C O   1  
ATOM 10821  C CB  . THR C 3 168 ? 80.651  70.811  47.284  1.00 0.00 ? 168 THR C CB  1  
ATOM 10822  O OG1 . THR C 3 168 ? 81.438  70.950  46.089  1.00 0.00 ? 168 THR C OG1 1  
ATOM 10823  C CG2 . THR C 3 168 ? 79.403  71.798  47.120  1.00 0.00 ? 168 THR C CG2 1  
ATOM 10824  N N   . THR C 3 169 ? 80.271  72.164  50.247  1.00 0.00 ? 169 THR C N   1  
ATOM 10825  C CA  . THR C 3 169 ? 79.577  72.010  51.466  1.00 0.00 ? 169 THR C CA  1  
ATOM 10826  C C   . THR C 3 169 ? 78.301  72.658  51.297  1.00 0.00 ? 169 THR C C   1  
ATOM 10827  O O   . THR C 3 169 ? 78.103  73.567  50.508  1.00 0.00 ? 169 THR C O   1  
ATOM 10828  C CB  . THR C 3 169 ? 80.245  72.556  52.728  1.00 0.00 ? 169 THR C CB  1  
ATOM 10829  O OG1 . THR C 3 169 ? 80.470  73.979  52.733  1.00 0.00 ? 169 THR C OG1 1  
ATOM 10830  C CG2 . THR C 3 169 ? 81.618  71.875  52.947  1.00 0.00 ? 169 THR C CG2 1  
ATOM 10831  N N   . TYR C 3 170 ? 77.345  72.133  52.031  1.00 0.00 ? 170 TYR C N   1  
ATOM 10832  C CA  . TYR C 3 170 ? 76.051  72.779  52.242  1.00 0.00 ? 170 TYR C CA  1  
ATOM 10833  C C   . TYR C 3 170 ? 76.108  73.076  53.680  1.00 0.00 ? 170 TYR C C   1  
ATOM 10834  O O   . TYR C 3 170 ? 75.884  72.173  54.515  1.00 0.00 ? 170 TYR C O   1  
ATOM 10835  C CB  . TYR C 3 170 ? 74.924  71.781  51.942  1.00 0.00 ? 170 TYR C CB  1  
ATOM 10836  C CG  . TYR C 3 170 ? 75.002  71.520  50.484  1.00 0.00 ? 170 TYR C CG  1  
ATOM 10837  C CD1 . TYR C 3 170 ? 74.535  72.490  49.594  1.00 0.00 ? 170 TYR C CD1 1  
ATOM 10838  C CD2 . TYR C 3 170 ? 75.682  70.392  49.965  1.00 0.00 ? 170 TYR C CD2 1  
ATOM 10839  C CE1 . TYR C 3 170 ? 74.648  72.333  48.172  1.00 0.00 ? 170 TYR C CE1 1  
ATOM 10840  C CE2 . TYR C 3 170 ? 75.752  70.209  48.568  1.00 0.00 ? 170 TYR C CE2 1  
ATOM 10841  C CZ  . TYR C 3 170 ? 75.281  71.158  47.681  1.00 0.00 ? 170 TYR C CZ  1  
ATOM 10842  O OH  . TYR C 3 170 ? 75.573  70.920  46.325  1.00 0.00 ? 170 TYR C OH  1  
ATOM 10843  N N   . SER C 3 171 ? 76.294  74.392  54.125  1.00 0.00 ? 171 SER C N   1  
ATOM 10844  C CA  . SER C 3 171 ? 76.390  74.766  55.475  1.00 0.00 ? 171 SER C CA  1  
ATOM 10845  C C   . SER C 3 171 ? 75.182  75.569  55.839  1.00 0.00 ? 171 SER C C   1  
ATOM 10846  O O   . SER C 3 171 ? 74.922  76.613  55.185  1.00 0.00 ? 171 SER C O   1  
ATOM 10847  C CB  . SER C 3 171 ? 77.626  75.532  55.675  1.00 0.00 ? 171 SER C CB  1  
ATOM 10848  O OG  . SER C 3 171 ? 78.830  74.821  55.235  1.00 0.00 ? 171 SER C OG  1  
ATOM 10849  N N   . VAL C 3 172 ? 74.573  75.105  56.939  1.00 0.00 ? 172 VAL C N   1  
ATOM 10850  C CA  . VAL C 3 172 ? 73.491  75.916  57.394  1.00 0.00 ? 172 VAL C CA  1  
ATOM 10851  C C   . VAL C 3 172 ? 74.096  76.878  58.401  1.00 0.00 ? 172 VAL C C   1  
ATOM 10852  O O   . VAL C 3 172 ? 74.753  76.496  59.347  1.00 0.00 ? 172 VAL C O   1  
ATOM 10853  C CB  . VAL C 3 172 ? 72.390  75.038  57.893  1.00 0.00 ? 172 VAL C CB  1  
ATOM 10854  C CG1 . VAL C 3 172 ? 71.446  75.939  58.778  1.00 0.00 ? 172 VAL C CG1 1  
ATOM 10855  C CG2 . VAL C 3 172 ? 71.726  74.349  56.689  1.00 0.00 ? 172 VAL C CG2 1  
ATOM 10856  N N   . PHE C 3 173 ? 73.940  78.236  58.216  1.00 0.00 ? 173 PHE C N   1  
ATOM 10857  C CA  . PHE C 3 173 ? 74.570  79.205  59.109  1.00 0.00 ? 173 PHE C CA  1  
ATOM 10858  C C   . PHE C 3 173 ? 73.393  79.561  60.005  1.00 0.00 ? 173 PHE C C   1  
ATOM 10859  O O   . PHE C 3 173 ? 72.214  79.489  59.630  1.00 0.00 ? 173 PHE C O   1  
ATOM 10860  C CB  . PHE C 3 173 ? 75.067  80.413  58.338  1.00 0.00 ? 173 PHE C CB  1  
ATOM 10861  C CG  . PHE C 3 173 ? 76.465  80.073  57.848  1.00 0.00 ? 173 PHE C CG  1  
ATOM 10862  C CD1 . PHE C 3 173 ? 77.544  80.180  58.720  1.00 0.00 ? 173 PHE C CD1 1  
ATOM 10863  C CD2 . PHE C 3 173 ? 76.640  79.456  56.601  1.00 0.00 ? 173 PHE C CD2 1  
ATOM 10864  C CE1 . PHE C 3 173 ? 78.795  79.746  58.318  1.00 0.00 ? 173 PHE C CE1 1  
ATOM 10865  C CE2 . PHE C 3 173 ? 77.879  78.997  56.175  1.00 0.00 ? 173 PHE C CE2 1  
ATOM 10866  C CZ  . PHE C 3 173 ? 78.973  79.147  57.046  1.00 0.00 ? 173 PHE C CZ  1  
ATOM 10867  N N   . PRO C 3 174 ? 73.603  79.901  61.331  1.00 0.00 ? 174 PRO C N   1  
ATOM 10868  C CA  . PRO C 3 174 ? 72.425  80.039  62.289  1.00 0.00 ? 174 PRO C CA  1  
ATOM 10869  C C   . PRO C 3 174 ? 71.650  81.254  62.030  1.00 0.00 ? 174 PRO C C   1  
ATOM 10870  O O   . PRO C 3 174 ? 71.906  82.051  61.124  1.00 0.00 ? 174 PRO C O   1  
ATOM 10871  C CB  . PRO C 3 174 ? 73.206  80.081  63.636  1.00 0.00 ? 174 PRO C CB  1  
ATOM 10872  C CG  . PRO C 3 174 ? 74.601  80.699  63.355  1.00 0.00 ? 174 PRO C CG  1  
ATOM 10873  C CD  . PRO C 3 174 ? 74.935  80.098  61.971  1.00 0.00 ? 174 PRO C CD  1  
ATOM 10874  N N   . ALA C 3 175 ? 70.686  81.514  62.917  1.00 0.00 ? 175 ALA C N   1  
ATOM 10875  C CA  . ALA C 3 175 ? 69.907  82.729  62.822  1.00 0.00 ? 175 ALA C CA  1  
ATOM 10876  C C   . ALA C 3 175 ? 70.638  83.920  63.266  1.00 0.00 ? 175 ALA C C   1  
ATOM 10877  O O   . ALA C 3 175 ? 71.600  83.740  64.004  1.00 0.00 ? 175 ALA C O   1  
ATOM 10878  C CB  . ALA C 3 175 ? 68.538  82.705  63.576  1.00 0.00 ? 175 ALA C CB  1  
ATOM 10879  N N   . ARG C 3 176 ? 70.241  85.088  62.839  1.00 0.00 ? 176 ARG C N   1  
ATOM 10880  C CA  . ARG C 3 176 ? 71.027  86.310  63.012  1.00 0.00 ? 176 ARG C CA  1  
ATOM 10881  C C   . ARG C 3 176 ? 70.321  87.126  64.089  1.00 0.00 ? 176 ARG C C   1  
ATOM 10882  O O   . ARG C 3 176 ? 70.900  88.082  64.553  1.00 0.00 ? 176 ARG C O   1  
ATOM 10883  C CB  . ARG C 3 176 ? 71.103  87.135  61.667  1.00 0.00 ? 176 ARG C CB  1  
ATOM 10884  C CG  . ARG C 3 176 ? 71.945  86.393  60.698  1.00 0.00 ? 176 ARG C CG  1  
ATOM 10885  C CD  . ARG C 3 176 ? 71.926  87.061  59.301  1.00 0.00 ? 176 ARG C CD  1  
ATOM 10886  N NE  . ARG C 3 176 ? 72.529  88.434  59.453  1.00 0.00 ? 176 ARG C NE  1  
ATOM 10887  C CZ  . ARG C 3 176 ? 72.536  89.296  58.395  1.00 0.00 ? 176 ARG C CZ  1  
ATOM 10888  N NH1 . ARG C 3 176 ? 72.111  88.959  57.209  1.00 0.00 ? 176 ARG C NH1 1  
ATOM 10889  N NH2 . ARG C 3 176 ? 73.029  90.575  58.677  1.00 0.00 ? 176 ARG C NH2 1  
ATOM 10890  N N   . SER C 3 177 ? 69.189  86.657  64.652  1.00 0.00 ? 177 SER C N   1  
ATOM 10891  C CA  . SER C 3 177 ? 68.543  87.107  65.851  1.00 0.00 ? 177 SER C CA  1  
ATOM 10892  C C   . SER C 3 177 ? 68.823  86.162  66.957  1.00 0.00 ? 177 SER C C   1  
ATOM 10893  O O   . SER C 3 177 ? 68.550  86.453  68.161  1.00 0.00 ? 177 SER C O   1  
ATOM 10894  C CB  . SER C 3 177 ? 66.947  87.269  65.684  1.00 0.00 ? 177 SER C CB  1  
ATOM 10895  O OG  . SER C 3 177 ? 66.659  88.168  64.648  1.00 0.00 ? 177 SER C OG  1  
ATOM 10896  N N   . SER C 3 178 ? 69.455  84.994  66.562  1.00 0.00 ? 178 SER C N   1  
ATOM 10897  C CA  . SER C 3 178 ? 69.954  83.982  67.392  1.00 0.00 ? 178 SER C CA  1  
ATOM 10898  C C   . SER C 3 178 ? 68.888  83.207  68.060  1.00 0.00 ? 178 SER C C   1  
ATOM 10899  O O   . SER C 3 178 ? 67.932  83.721  68.677  1.00 0.00 ? 178 SER C O   1  
ATOM 10900  C CB  . SER C 3 178 ? 71.017  84.412  68.444  1.00 0.00 ? 178 SER C CB  1  
ATOM 10901  O OG  . SER C 3 178 ? 72.051  85.232  67.923  1.00 0.00 ? 178 SER C OG  1  
ATOM 10902  N N   . GLU C 3 179 ? 68.933  81.875  68.006  1.00 0.00 ? 179 GLU C N   1  
ATOM 10903  C CA  . GLU C 3 179 ? 67.958  81.017  68.681  1.00 0.00 ? 179 GLU C CA  1  
ATOM 10904  C C   . GLU C 3 179 ? 68.560  80.415  69.929  1.00 0.00 ? 179 GLU C C   1  
ATOM 10905  O O   . GLU C 3 179 ? 67.887  80.319  70.951  1.00 0.00 ? 179 GLU C O   1  
ATOM 10906  C CB  . GLU C 3 179 ? 67.678  79.781  67.816  1.00 0.00 ? 179 GLU C CB  1  
ATOM 10907  C CG  . GLU C 3 179 ? 66.897  80.013  66.533  1.00 0.00 ? 179 GLU C CG  1  
ATOM 10908  C CD  . GLU C 3 179 ? 66.764  78.755  65.699  1.00 0.00 ? 179 GLU C CD  1  
ATOM 10909  O OE1 . GLU C 3 179 ? 67.760  78.298  65.101  1.00 0.00 ? 179 GLU C OE1 1  
ATOM 10910  O OE2 . GLU C 3 179 ? 65.651  78.122  65.767  1.00 0.00 ? 179 GLU C OE2 1  
ATOM 10911  N N   . VAL C 3 180 ? 69.922  80.165  69.864  1.00 0.00 ? 180 VAL C N   1  
ATOM 10912  C CA  . VAL C 3 180 ? 70.778  79.750  70.947  1.00 0.00 ? 180 VAL C CA  1  
ATOM 10913  C C   . VAL C 3 180 ? 71.843  80.864  70.936  1.00 0.00 ? 180 VAL C C   1  
ATOM 10914  O O   . VAL C 3 180 ? 72.127  81.403  69.835  1.00 0.00 ? 180 VAL C O   1  
ATOM 10915  C CB  . VAL C 3 180 ? 71.305  78.377  70.759  1.00 0.00 ? 180 VAL C CB  1  
ATOM 10916  C CG1 . VAL C 3 180 ? 72.577  78.022  71.622  1.00 0.00 ? 180 VAL C CG1 1  
ATOM 10917  C CG2 . VAL C 3 180 ? 70.020  77.583  71.134  1.00 0.00 ? 180 VAL C CG2 1  
ATOM 10918  N N   . VAL C 3 181 ? 72.336  81.256  72.174  1.00 0.00 ? 181 VAL C N   1  
ATOM 10919  C CA  . VAL C 3 181 ? 73.252  82.327  72.326  1.00 0.00 ? 181 VAL C CA  1  
ATOM 10920  C C   . VAL C 3 181 ? 74.635  81.988  71.812  1.00 0.00 ? 181 VAL C C   1  
ATOM 10921  O O   . VAL C 3 181 ? 75.257  82.785  71.061  1.00 0.00 ? 181 VAL C O   1  
ATOM 10922  C CB  . VAL C 3 181 ? 73.195  82.841  73.790  1.00 0.00 ? 181 VAL C CB  1  
ATOM 10923  C CG1 . VAL C 3 181 ? 73.762  84.312  73.985  1.00 0.00 ? 181 VAL C CG1 1  
ATOM 10924  C CG2 . VAL C 3 181 ? 71.708  82.806  74.282  1.00 0.00 ? 181 VAL C CG2 1  
ATOM 10925  N N   . VAL C 3 182 ? 75.159  80.777  72.177  1.00 0.00 ? 182 VAL C N   1  
ATOM 10926  C CA  . VAL C 3 182 ? 76.511  80.343  71.807  1.00 0.00 ? 182 VAL C CA  1  
ATOM 10927  C C   . VAL C 3 182 ? 76.840  79.976  70.384  1.00 0.00 ? 182 VAL C C   1  
ATOM 10928  O O   . VAL C 3 182 ? 78.017  79.731  70.068  1.00 0.00 ? 182 VAL C O   1  
ATOM 10929  C CB  . VAL C 3 182 ? 77.003  79.270  72.718  1.00 0.00 ? 182 VAL C CB  1  
ATOM 10930  C CG1 . VAL C 3 182 ? 76.927  79.795  74.146  1.00 0.00 ? 182 VAL C CG1 1  
ATOM 10931  C CG2 . VAL C 3 182 ? 76.270  77.878  72.580  1.00 0.00 ? 182 VAL C CG2 1  
ATOM 10932  N N   . GLN C 3 183 ? 75.893  80.010  69.467  1.00 0.00 ? 183 GLN C N   1  
ATOM 10933  C CA  . GLN C 3 183 ? 75.947  79.763  68.066  1.00 0.00 ? 183 GLN C CA  1  
ATOM 10934  C C   . GLN C 3 183 ? 77.020  80.608  67.389  1.00 0.00 ? 183 GLN C C   1  
ATOM 10935  O O   . GLN C 3 183 ? 77.686  80.097  66.488  1.00 0.00 ? 183 GLN C O   1  
ATOM 10936  C CB  . GLN C 3 183 ? 74.594  79.928  67.282  1.00 0.00 ? 183 GLN C CB  1  
ATOM 10937  C CG  . GLN C 3 183 ? 73.495  79.085  67.802  1.00 0.00 ? 183 GLN C CG  1  
ATOM 10938  C CD  . GLN C 3 183 ? 72.188  79.254  66.995  1.00 0.00 ? 183 GLN C CD  1  
ATOM 10939  O OE1 . GLN C 3 183 ? 71.514  78.247  66.765  1.00 0.00 ? 183 GLN C OE1 1  
ATOM 10940  N NE2 . GLN C 3 183 ? 71.814  80.515  66.641  1.00 0.00 ? 183 GLN C NE2 1  
ATOM 10941  N N   . SER C 3 184 ? 77.132  81.942  67.814  1.00 0.00 ? 184 SER C N   1  
ATOM 10942  C CA  . SER C 3 184 ? 77.986  82.940  67.203  1.00 0.00 ? 184 SER C CA  1  
ATOM 10943  C C   . SER C 3 184 ? 79.420  82.529  67.320  1.00 0.00 ? 184 SER C C   1  
ATOM 10944  O O   . SER C 3 184 ? 80.179  82.793  66.396  1.00 0.00 ? 184 SER C O   1  
ATOM 10945  C CB  . SER C 3 184 ? 77.642  84.286  67.731  1.00 0.00 ? 184 SER C CB  1  
ATOM 10946  O OG  . SER C 3 184 ? 76.319  84.736  67.351  1.00 0.00 ? 184 SER C OG  1  
ATOM 10947  N N   . TYR C 3 185 ? 79.831  81.895  68.490  1.00 0.00 ? 185 TYR C N   1  
ATOM 10948  C CA  . TYR C 3 185 ? 81.148  81.396  68.780  1.00 0.00 ? 185 TYR C CA  1  
ATOM 10949  C C   . TYR C 3 185 ? 81.445  80.245  67.812  1.00 0.00 ? 185 TYR C C   1  
ATOM 10950  O O   . TYR C 3 185 ? 82.496  80.185  67.202  1.00 0.00 ? 185 TYR C O   1  
ATOM 10951  C CB  . TYR C 3 185 ? 81.371  80.810  70.181  1.00 0.00 ? 185 TYR C CB  1  
ATOM 10952  C CG  . TYR C 3 185 ? 81.327  81.835  71.331  1.00 0.00 ? 185 TYR C CG  1  
ATOM 10953  C CD1 . TYR C 3 185 ? 80.075  82.300  71.752  1.00 0.00 ? 185 TYR C CD1 1  
ATOM 10954  C CD2 . TYR C 3 185 ? 82.463  82.095  72.086  1.00 0.00 ? 185 TYR C CD2 1  
ATOM 10955  C CE1 . TYR C 3 185 ? 79.947  82.914  73.017  1.00 0.00 ? 185 TYR C CE1 1  
ATOM 10956  C CE2 . TYR C 3 185 ? 82.350  82.759  73.370  1.00 0.00 ? 185 TYR C CE2 1  
ATOM 10957  C CZ  . TYR C 3 185 ? 81.076  83.053  73.831  1.00 0.00 ? 185 TYR C CZ  1  
ATOM 10958  O OH  . TYR C 3 185 ? 80.875  83.842  74.992  1.00 0.00 ? 185 TYR C OH  1  
ATOM 10959  N N   . ASN C 3 186 ? 80.446  79.292  67.668  1.00 0.00 ? 186 ASN C N   1  
ATOM 10960  C CA  . ASN C 3 186 ? 80.559  78.111  66.823  1.00 0.00 ? 186 ASN C CA  1  
ATOM 10961  C C   . ASN C 3 186 ? 80.794  78.558  65.422  1.00 0.00 ? 186 ASN C C   1  
ATOM 10962  O O   . ASN C 3 186 ? 81.639  77.992  64.681  1.00 0.00 ? 186 ASN C O   1  
ATOM 10963  C CB  . ASN C 3 186 ? 79.346  77.169  66.827  1.00 0.00 ? 186 ASN C CB  1  
ATOM 10964  C CG  . ASN C 3 186 ? 78.845  76.722  68.265  1.00 0.00 ? 186 ASN C CG  1  
ATOM 10965  O OD1 . ASN C 3 186 ? 77.863  77.227  68.862  1.00 0.00 ? 186 ASN C OD1 1  
ATOM 10966  N ND2 . ASN C 3 186 ? 79.559  75.711  68.791  1.00 0.00 ? 186 ASN C ND2 1  
ATOM 10967  N N   . THR C 3 187 ? 80.101  79.502  64.922  1.00 0.00 ? 187 THR C N   1  
ATOM 10968  C CA  . THR C 3 187 ? 80.153  80.035  63.606  1.00 0.00 ? 187 THR C CA  1  
ATOM 10969  C C   . THR C 3 187 ? 81.466  80.686  63.263  1.00 0.00 ? 187 THR C C   1  
ATOM 10970  O O   . THR C 3 187 ? 81.989  80.271  62.214  1.00 0.00 ? 187 THR C O   1  
ATOM 10971  C CB  . THR C 3 187 ? 79.049  81.043  63.305  1.00 0.00 ? 187 THR C CB  1  
ATOM 10972  O OG1 . THR C 3 187 ? 77.804  80.514  63.703  1.00 0.00 ? 187 THR C OG1 1  
ATOM 10973  C CG2 . THR C 3 187 ? 78.988  81.423  61.830  1.00 0.00 ? 187 THR C CG2 1  
ATOM 10974  N N   . ILE C 3 188 ? 82.015  81.509  64.176  1.00 0.00 ? 188 ILE C N   1  
ATOM 10975  C CA  . ILE C 3 188 ? 83.310  82.037  63.892  1.00 0.00 ? 188 ILE C CA  1  
ATOM 10976  C C   . ILE C 3 188 ? 84.379  81.035  63.781  1.00 0.00 ? 188 ILE C C   1  
ATOM 10977  O O   . ILE C 3 188 ? 85.167  81.024  62.836  1.00 0.00 ? 188 ILE C O   1  
ATOM 10978  C CB  . ILE C 3 188 ? 83.699  83.060  64.934  1.00 0.00 ? 188 ILE C CB  1  
ATOM 10979  C CG1 . ILE C 3 188 ? 82.718  84.236  65.001  1.00 0.00 ? 188 ILE C CG1 1  
ATOM 10980  C CG2 . ILE C 3 188 ? 85.103  83.649  64.670  1.00 0.00 ? 188 ILE C CG2 1  
ATOM 10981  C CD1 . ILE C 3 188 ? 83.082  85.299  66.052  1.00 0.00 ? 188 ILE C CD1 1  
ATOM 10982  N N   . LEU C 3 189 ? 84.479  80.188  64.803  1.00 0.00 ? 189 LEU C N   1  
ATOM 10983  C CA  . LEU C 3 189 ? 85.581  79.186  64.977  1.00 0.00 ? 189 LEU C CA  1  
ATOM 10984  C C   . LEU C 3 189 ? 85.539  78.124  63.832  1.00 0.00 ? 189 LEU C C   1  
ATOM 10985  O O   . LEU C 3 189 ? 86.621  77.779  63.296  1.00 0.00 ? 189 LEU C O   1  
ATOM 10986  C CB  . LEU C 3 189 ? 85.575  78.515  66.324  1.00 0.00 ? 189 LEU C CB  1  
ATOM 10987  C CG  . LEU C 3 189 ? 85.563  79.507  67.448  1.00 0.00 ? 189 LEU C CG  1  
ATOM 10988  C CD1 . LEU C 3 189 ? 85.103  78.946  68.783  1.00 0.00 ? 189 LEU C CD1 1  
ATOM 10989  C CD2 . LEU C 3 189 ? 86.945  80.196  67.668  1.00 0.00 ? 189 LEU C CD2 1  
ATOM 10990  N N   . ALA C 3 190 ? 84.314  77.643  63.418  1.00 0.00 ? 190 ALA C N   1  
ATOM 10991  C CA  . ALA C 3 190 ? 84.051  76.762  62.270  1.00 0.00 ? 190 ALA C CA  1  
ATOM 10992  C C   . ALA C 3 190 ? 84.301  77.469  60.951  1.00 0.00 ? 190 ALA C C   1  
ATOM 10993  O O   . ALA C 3 190 ? 84.876  76.868  60.055  1.00 0.00 ? 190 ALA C O   1  
ATOM 10994  C CB  . ALA C 3 190 ? 82.571  76.366  62.270  1.00 0.00 ? 190 ALA C CB  1  
ATOM 10995  N N   . LEU C 3 191 ? 83.865  78.754  60.734  1.00 0.00 ? 191 LEU C N   1  
ATOM 10996  C CA  . LEU C 3 191 ? 83.947  79.557  59.541  1.00 0.00 ? 191 LEU C CA  1  
ATOM 10997  C C   . LEU C 3 191 ? 85.289  79.903  59.033  1.00 0.00 ? 191 LEU C C   1  
ATOM 10998  O O   . LEU C 3 191 ? 85.478  79.944  57.836  1.00 0.00 ? 191 LEU C O   1  
ATOM 10999  C CB  . LEU C 3 191 ? 83.091  80.906  59.551  1.00 0.00 ? 191 LEU C CB  1  
ATOM 11000  C CG  . LEU C 3 191 ? 82.970  81.812  58.281  1.00 0.00 ? 191 LEU C CG  1  
ATOM 11001  C CD1 . LEU C 3 191 ? 82.398  81.249  56.990  1.00 0.00 ? 191 LEU C CD1 1  
ATOM 11002  C CD2 . LEU C 3 191 ? 82.382  83.102  58.798  1.00 0.00 ? 191 LEU C CD2 1  
ATOM 11003  N N   . ARG C 3 192 ? 86.252  79.996  59.940  1.00 0.00 ? 192 ARG C N   1  
ATOM 11004  C CA  . ARG C 3 192 ? 87.665  80.081  59.603  1.00 0.00 ? 192 ARG C CA  1  
ATOM 11005  C C   . ARG C 3 192 ? 88.240  78.858  58.848  1.00 0.00 ? 192 ARG C C   1  
ATOM 11006  O O   . ARG C 3 192 ? 88.886  79.056  57.819  1.00 0.00 ? 192 ARG C O   1  
ATOM 11007  C CB  . ARG C 3 192 ? 88.370  80.402  60.915  1.00 0.00 ? 192 ARG C CB  1  
ATOM 11008  C CG  . ARG C 3 192 ? 89.779  80.964  60.725  1.00 0.00 ? 192 ARG C CG  1  
ATOM 11009  C CD  . ARG C 3 192 ? 90.789  79.868  60.411  1.00 0.00 ? 192 ARG C CD  1  
ATOM 11010  N NE  . ARG C 3 192 ? 92.202  80.448  60.431  1.00 0.00 ? 192 ARG C NE  1  
ATOM 11011  C CZ  . ARG C 3 192 ? 93.309  79.601  60.590  1.00 0.00 ? 192 ARG C CZ  1  
ATOM 11012  N NH1 . ARG C 3 192 ? 93.200  78.256  60.584  1.00 0.00 ? 192 ARG C NH1 1  
ATOM 11013  N NH2 . ARG C 3 192 ? 94.580  80.130  60.700  1.00 0.00 ? 192 ARG C NH2 1  
ATOM 11014  N N   . ARG C 3 193 ? 87.943  77.656  59.295  1.00 0.00 ? 193 ARG C N   1  
ATOM 11015  C CA  . ARG C 3 193 ? 88.290  76.398  58.751  1.00 0.00 ? 193 ARG C CA  1  
ATOM 11016  C C   . ARG C 3 193 ? 87.494  76.233  57.433  1.00 0.00 ? 193 ARG C C   1  
ATOM 11017  O O   . ARG C 3 193 ? 88.026  75.667  56.431  1.00 0.00 ? 193 ARG C O   1  
ATOM 11018  C CB  . ARG C 3 193 ? 87.928  75.197  59.624  1.00 0.00 ? 193 ARG C CB  1  
ATOM 11019  C CG  . ARG C 3 193 ? 88.966  74.780  60.685  1.00 0.00 ? 193 ARG C CG  1  
ATOM 11020  C CD  . ARG C 3 193 ? 89.140  75.842  61.768  1.00 0.00 ? 193 ARG C CD  1  
ATOM 11021  N NE  . ARG C 3 193 ? 90.134  75.258  62.694  1.00 0.00 ? 193 ARG C NE  1  
ATOM 11022  C CZ  . ARG C 3 193 ? 90.958  75.960  63.567  1.00 0.00 ? 193 ARG C CZ  1  
ATOM 11023  N NH1 . ARG C 3 193 ? 90.771  77.315  63.701  1.00 0.00 ? 193 ARG C NH1 1  
ATOM 11024  N NH2 . ARG C 3 193 ? 91.755  75.204  64.369  1.00 0.00 ? 193 ARG C NH2 1  
ATOM 11025  N N   . LEU C 3 194 ? 86.213  76.695  57.426  1.00 0.00 ? 194 LEU C N   1  
ATOM 11026  C CA  . LEU C 3 194 ? 85.338  76.534  56.301  1.00 0.00 ? 194 LEU C CA  1  
ATOM 11027  C C   . LEU C 3 194 ? 85.845  77.278  55.134  1.00 0.00 ? 194 LEU C C   1  
ATOM 11028  O O   . LEU C 3 194 ? 85.738  76.795  54.040  1.00 0.00 ? 194 LEU C O   1  
ATOM 11029  C CB  . LEU C 3 194 ? 83.879  77.053  56.489  1.00 0.00 ? 194 LEU C CB  1  
ATOM 11030  C CG  . LEU C 3 194 ? 82.963  75.916  57.075  1.00 0.00 ? 194 LEU C CG  1  
ATOM 11031  C CD1 . LEU C 3 194 ? 81.909  76.484  58.027  1.00 0.00 ? 194 LEU C CD1 1  
ATOM 11032  C CD2 . LEU C 3 194 ? 82.368  74.834  56.046  1.00 0.00 ? 194 LEU C CD2 1  
ATOM 11033  N N   . ILE C 3 195 ? 86.379  78.494  55.440  1.00 0.00 ? 195 ILE C N   1  
ATOM 11034  C CA  . ILE C 3 195 ? 86.921  79.272  54.389  1.00 0.00 ? 195 ILE C CA  1  
ATOM 11035  C C   . ILE C 3 195 ? 88.201  78.697  53.795  1.00 0.00 ? 195 ILE C C   1  
ATOM 11036  O O   . ILE C 3 195 ? 88.394  78.697  52.569  1.00 0.00 ? 195 ILE C O   1  
ATOM 11037  C CB  . ILE C 3 195 ? 87.026  80.773  54.544  1.00 0.00 ? 195 ILE C CB  1  
ATOM 11038  C CG1 . ILE C 3 195 ? 88.029  81.295  55.652  1.00 0.00 ? 195 ILE C CG1 1  
ATOM 11039  C CG2 . ILE C 3 195 ? 85.697  81.374  54.898  1.00 0.00 ? 195 ILE C CG2 1  
ATOM 11040  C CD1 . ILE C 3 195 ? 88.097  82.827  55.767  1.00 0.00 ? 195 ILE C CD1 1  
ATOM 11041  N N   . GLU C 3 196 ? 89.161  78.306  54.649  1.00 0.00 ? 196 GLU C N   1  
ATOM 11042  C CA  . GLU C 3 196 ? 90.443  77.923  54.064  1.00 0.00 ? 196 GLU C CA  1  
ATOM 11043  C C   . GLU C 3 196 ? 90.348  76.531  53.511  1.00 0.00 ? 196 GLU C C   1  
ATOM 11044  O O   . GLU C 3 196 ? 90.887  76.198  52.490  1.00 0.00 ? 196 GLU C O   1  
ATOM 11045  C CB  . GLU C 3 196 ? 91.472  78.005  55.121  1.00 0.00 ? 196 GLU C CB  1  
ATOM 11046  C CG  . GLU C 3 196 ? 91.642  79.461  55.568  1.00 0.00 ? 196 GLU C CG  1  
ATOM 11047  C CD  . GLU C 3 196 ? 92.667  79.566  56.687  1.00 0.00 ? 196 GLU C CD  1  
ATOM 11048  O OE1 . GLU C 3 196 ? 93.158  78.547  57.187  1.00 0.00 ? 196 GLU C OE1 1  
ATOM 11049  O OE2 . GLU C 3 196 ? 92.931  80.741  57.096  1.00 0.00 ? 196 GLU C OE2 1  
ATOM 11050  N N   . ASP C 3 197 ? 89.765  75.613  54.314  1.00 0.00 ? 197 ASP C N   1  
ATOM 11051  C CA  . ASP C 3 197 ? 89.808  74.233  54.035  1.00 0.00 ? 197 ASP C CA  1  
ATOM 11052  C C   . ASP C 3 197 ? 88.777  73.689  52.971  1.00 0.00 ? 197 ASP C C   1  
ATOM 11053  O O   . ASP C 3 197 ? 88.885  72.522  52.549  1.00 0.00 ? 197 ASP C O   1  
ATOM 11054  C CB  . ASP C 3 197 ? 89.652  73.271  55.248  1.00 0.00 ? 197 ASP C CB  1  
ATOM 11055  C CG  . ASP C 3 197 ? 90.534  73.661  56.466  1.00 0.00 ? 197 ASP C CG  1  
ATOM 11056  O OD1 . ASP C 3 197 ? 91.666  74.206  56.342  1.00 0.00 ? 197 ASP C OD1 1  
ATOM 11057  O OD2 . ASP C 3 197 ? 90.010  73.474  57.570  1.00 0.00 ? 197 ASP C OD2 1  
ATOM 11058  N N   . SER C 3 198 ? 87.730  74.502  52.625  1.00 0.00 ? 198 SER C N   1  
ATOM 11059  C CA  . SER C 3 198 ? 86.715  74.131  51.689  1.00 0.00 ? 198 SER C CA  1  
ATOM 11060  C C   . SER C 3 198 ? 87.060  74.749  50.352  1.00 0.00 ? 198 SER C C   1  
ATOM 11061  O O   . SER C 3 198 ? 87.547  75.865  50.233  1.00 0.00 ? 198 SER C O   1  
ATOM 11062  C CB  . SER C 3 198 ? 85.285  74.650  52.097  1.00 0.00 ? 198 SER C CB  1  
ATOM 11063  O OG  . SER C 3 198 ? 84.240  73.903  51.441  1.00 0.00 ? 198 SER C OG  1  
ATOM 11064  N N   . ASP C 3 199 ? 86.761  73.993  49.257  1.00 0.00 ? 199 ASP C N   1  
ATOM 11065  C CA  . ASP C 3 199 ? 86.844  74.442  47.919  1.00 0.00 ? 199 ASP C CA  1  
ATOM 11066  C C   . ASP C 3 199 ? 85.566  75.214  47.520  1.00 0.00 ? 199 ASP C C   1  
ATOM 11067  O O   . ASP C 3 199 ? 85.705  76.185  46.810  1.00 0.00 ? 199 ASP C O   1  
ATOM 11068  C CB  . ASP C 3 199 ? 86.975  73.192  46.961  1.00 0.00 ? 199 ASP C CB  1  
ATOM 11069  C CG  . ASP C 3 199 ? 88.350  72.579  47.138  1.00 0.00 ? 199 ASP C CG  1  
ATOM 11070  O OD1 . ASP C 3 199 ? 89.379  73.318  46.996  1.00 0.00 ? 199 ASP C OD1 1  
ATOM 11071  O OD2 . ASP C 3 199 ? 88.493  71.357  47.498  1.00 0.00 ? 199 ASP C OD2 1  
ATOM 11072  N N   . ALA C 3 200 ? 84.375  74.791  48.027  1.00 0.00 ? 200 ALA C N   1  
ATOM 11073  C CA  . ALA C 3 200 ? 83.156  75.495  47.773  1.00 0.00 ? 200 ALA C CA  1  
ATOM 11074  C C   . ALA C 3 200 ? 82.221  75.461  48.968  1.00 0.00 ? 200 ALA C C   1  
ATOM 11075  O O   . ALA C 3 200 ? 82.032  74.416  49.537  1.00 0.00 ? 200 ALA C O   1  
ATOM 11076  C CB  . ALA C 3 200 ? 82.313  74.935  46.586  1.00 0.00 ? 200 ALA C CB  1  
ATOM 11077  N N   . THR C 3 201 ? 81.489  76.588  49.326  1.00 0.00 ? 201 THR C N   1  
ATOM 11078  C CA  . THR C 3 201 ? 80.548  76.622  50.401  1.00 0.00 ? 201 THR C CA  1  
ATOM 11079  C C   . THR C 3 201 ? 79.325  77.311  49.805  1.00 0.00 ? 201 THR C C   1  
ATOM 11080  O O   . THR C 3 201 ? 79.429  78.427  49.406  1.00 0.00 ? 201 THR C O   1  
ATOM 11081  C CB  . THR C 3 201 ? 81.104  77.331  51.707  1.00 0.00 ? 201 THR C CB  1  
ATOM 11082  O OG1 . THR C 3 201 ? 80.145  77.105  52.734  1.00 0.00 ? 201 THR C OG1 1  
ATOM 11083  C CG2 . THR C 3 201 ? 81.511  78.802  51.602  1.00 0.00 ? 201 THR C CG2 1  
ATOM 11084  N N   . VAL C 3 202 ? 78.197  76.583  49.924  1.00 0.00 ? 202 VAL C N   1  
ATOM 11085  C CA  . VAL C 3 202 ? 76.877  77.067  49.653  1.00 0.00 ? 202 VAL C CA  1  
ATOM 11086  C C   . VAL C 3 202 ? 76.272  77.522  50.956  1.00 0.00 ? 202 VAL C C   1  
ATOM 11087  O O   . VAL C 3 202 ? 76.049  76.714  51.875  1.00 0.00 ? 202 VAL C O   1  
ATOM 11088  C CB  . VAL C 3 202 ? 75.906  76.046  49.061  1.00 0.00 ? 202 VAL C CB  1  
ATOM 11089  C CG1 . VAL C 3 202 ? 74.550  76.652  48.738  1.00 0.00 ? 202 VAL C CG1 1  
ATOM 11090  C CG2 . VAL C 3 202 ? 76.520  75.582  47.769  1.00 0.00 ? 202 VAL C CG2 1  
ATOM 11091  N N   . VAL C 3 203 ? 76.003  78.872  51.139  1.00 0.00 ? 203 VAL C N   1  
ATOM 11092  C CA  . VAL C 3 203 ? 75.499  79.439  52.386  1.00 0.00 ? 203 VAL C CA  1  
ATOM 11093  C C   . VAL C 3 203 ? 74.022  79.317  52.348  1.00 0.00 ? 203 VAL C C   1  
ATOM 11094  O O   . VAL C 3 203 ? 73.374  79.846  51.447  1.00 0.00 ? 203 VAL C O   1  
ATOM 11095  C CB  . VAL C 3 203 ? 75.922  80.918  52.591  1.00 0.00 ? 203 VAL C CB  1  
ATOM 11096  C CG1 . VAL C 3 203 ? 75.305  81.599  53.875  1.00 0.00 ? 203 VAL C CG1 1  
ATOM 11097  C CG2 . VAL C 3 203 ? 77.462  81.005  52.462  1.00 0.00 ? 203 VAL C CG2 1  
ATOM 11098  N N   . PHE C 3 204 ? 73.451  78.717  53.395  1.00 0.00 ? 204 PHE C N   1  
ATOM 11099  C CA  . PHE C 3 204 ? 72.007  78.662  53.742  1.00 0.00 ? 204 PHE C CA  1  
ATOM 11100  C C   . PHE C 3 204 ? 71.842  79.385  55.040  1.00 0.00 ? 204 PHE C C   1  
ATOM 11101  O O   . PHE C 3 204 ? 72.287  78.923  56.091  1.00 0.00 ? 204 PHE C O   1  
ATOM 11102  C CB  . PHE C 3 204 ? 71.531  77.207  54.112  1.00 0.00 ? 204 PHE C CB  1  
ATOM 11103  C CG  . PHE C 3 204 ? 71.348  76.359  52.885  1.00 0.00 ? 204 PHE C CG  1  
ATOM 11104  C CD1 . PHE C 3 204 ? 70.565  76.805  51.820  1.00 0.00 ? 204 PHE C CD1 1  
ATOM 11105  C CD2 . PHE C 3 204 ? 72.164  75.181  52.729  1.00 0.00 ? 204 PHE C CD2 1  
ATOM 11106  C CE1 . PHE C 3 204 ? 70.574  76.200  50.631  1.00 0.00 ? 204 PHE C CE1 1  
ATOM 11107  C CE2 . PHE C 3 204 ? 72.120  74.553  51.489  1.00 0.00 ? 204 PHE C CE2 1  
ATOM 11108  C CZ  . PHE C 3 204 ? 71.378  75.037  50.472  1.00 0.00 ? 204 PHE C CZ  1  
ATOM 11109  N N   . ASP C 3 205 ? 71.195  80.567  55.031  1.00 0.00 ? 205 ASP C N   1  
ATOM 11110  C CA  . ASP C 3 205 ? 71.099  81.350  56.231  1.00 0.00 ? 205 ASP C CA  1  
ATOM 11111  C C   . ASP C 3 205 ? 69.811  80.835  56.849  1.00 0.00 ? 205 ASP C C   1  
ATOM 11112  O O   . ASP C 3 205 ? 68.778  80.853  56.210  1.00 0.00 ? 205 ASP C O   1  
ATOM 11113  C CB  . ASP C 3 205 ? 70.982  82.881  55.915  1.00 0.00 ? 205 ASP C CB  1  
ATOM 11114  C CG  . ASP C 3 205 ? 71.450  83.628  57.126  1.00 0.00 ? 205 ASP C CG  1  
ATOM 11115  O OD1 . ASP C 3 205 ? 72.646  83.582  57.467  1.00 0.00 ? 205 ASP C OD1 1  
ATOM 11116  O OD2 . ASP C 3 205 ? 70.651  84.459  57.659  1.00 0.00 ? 205 ASP C OD2 1  
ATOM 11117  N N   . ASN C 3 206 ? 69.851  80.283  58.083  1.00 0.00 ? 206 ASN C N   1  
ATOM 11118  C CA  . ASN C 3 206 ? 68.711  79.600  58.696  1.00 0.00 ? 206 ASN C CA  1  
ATOM 11119  C C   . ASN C 3 206 ? 67.558  80.525  58.975  1.00 0.00 ? 206 ASN C C   1  
ATOM 11120  O O   . ASN C 3 206 ? 66.401  80.043  59.092  1.00 0.00 ? 206 ASN C O   1  
ATOM 11121  C CB  . ASN C 3 206 ? 69.082  78.884  60.086  1.00 0.00 ? 206 ASN C CB  1  
ATOM 11122  C CG  . ASN C 3 206 ? 68.235  77.749  60.664  1.00 0.00 ? 206 ASN C CG  1  
ATOM 11123  O OD1 . ASN C 3 206 ? 67.919  77.701  61.842  1.00 0.00 ? 206 ASN C OD1 1  
ATOM 11124  N ND2 . ASN C 3 206 ? 67.661  76.978  59.656  1.00 0.00 ? 206 ASN C ND2 1  
ATOM 11125  N N   . ALA C 3 207 ? 67.853  81.839  59.233  1.00 0.00 ? 207 ALA C N   1  
ATOM 11126  C CA  . ALA C 3 207 ? 66.886  82.822  59.673  1.00 0.00 ? 207 ALA C CA  1  
ATOM 11127  C C   . ALA C 3 207 ? 65.844  82.942  58.623  1.00 0.00 ? 207 ALA C C   1  
ATOM 11128  O O   . ALA C 3 207 ? 64.634  82.990  58.951  1.00 0.00 ? 207 ALA C O   1  
ATOM 11129  C CB  . ALA C 3 207 ? 67.459  84.244  59.943  1.00 0.00 ? 207 ALA C CB  1  
ATOM 11130  N N   . SER C 3 208 ? 66.304  83.018  57.359  1.00 0.00 ? 208 SER C N   1  
ATOM 11131  C CA  . SER C 3 208 ? 65.540  83.195  56.167  1.00 0.00 ? 208 SER C CA  1  
ATOM 11132  C C   . SER C 3 208 ? 64.807  81.944  55.878  1.00 0.00 ? 208 SER C C   1  
ATOM 11133  O O   . SER C 3 208 ? 63.634  81.884  55.474  1.00 0.00 ? 208 SER C O   1  
ATOM 11134  C CB  . SER C 3 208 ? 66.529  83.491  54.989  1.00 0.00 ? 208 SER C CB  1  
ATOM 11135  O OG  . SER C 3 208 ? 65.748  84.087  53.926  1.00 0.00 ? 208 SER C OG  1  
ATOM 11136  N N   . LEU C 3 209 ? 65.520  80.793  56.060  1.00 0.00 ? 209 LEU C N   1  
ATOM 11137  C CA  . LEU C 3 209 ? 65.064  79.469  55.674  1.00 0.00 ? 209 LEU C CA  1  
ATOM 11138  C C   . LEU C 3 209 ? 63.856  79.088  56.439  1.00 0.00 ? 209 LEU C C   1  
ATOM 11139  O O   . LEU C 3 209 ? 62.918  78.518  55.937  1.00 0.00 ? 209 LEU C O   1  
ATOM 11140  C CB  . LEU C 3 209 ? 66.230  78.501  55.887  1.00 0.00 ? 209 LEU C CB  1  
ATOM 11141  C CG  . LEU C 3 209 ? 66.668  77.668  54.633  1.00 0.00 ? 209 LEU C CG  1  
ATOM 11142  C CD1 . LEU C 3 209 ? 67.926  76.932  54.962  1.00 0.00 ? 209 LEU C CD1 1  
ATOM 11143  C CD2 . LEU C 3 209 ? 65.617  76.654  54.298  1.00 0.00 ? 209 LEU C CD2 1  
ATOM 11144  N N   . LEU C 3 210 ? 63.873  79.396  57.780  1.00 0.00 ? 210 LEU C N   1  
ATOM 11145  C CA  . LEU C 3 210 ? 62.850  79.131  58.795  1.00 0.00 ? 210 LEU C CA  1  
ATOM 11146  C C   . LEU C 3 210 ? 61.590  79.919  58.474  1.00 0.00 ? 210 LEU C C   1  
ATOM 11147  O O   . LEU C 3 210 ? 60.480  79.441  58.491  1.00 0.00 ? 210 LEU C O   1  
ATOM 11148  C CB  . LEU C 3 210 ? 63.454  79.634  60.117  1.00 0.00 ? 210 LEU C CB  1  
ATOM 11149  C CG  . LEU C 3 210 ? 62.496  79.720  61.328  1.00 0.00 ? 210 LEU C CG  1  
ATOM 11150  C CD1 . LEU C 3 210 ? 61.814  78.405  61.827  1.00 0.00 ? 210 LEU C CD1 1  
ATOM 11151  C CD2 . LEU C 3 210 ? 63.293  80.448  62.451  1.00 0.00 ? 210 LEU C CD2 1  
ATOM 11152  N N   . ASN C 3 211 ? 61.777  81.238  58.108  1.00 0.00 ? 211 ASN C N   1  
ATOM 11153  C CA  . ASN C 3 211 ? 60.607  82.137  57.882  1.00 0.00 ? 211 ASN C CA  1  
ATOM 11154  C C   . ASN C 3 211 ? 59.751  81.702  56.769  1.00 0.00 ? 211 ASN C C   1  
ATOM 11155  O O   . ASN C 3 211 ? 58.517  81.758  56.820  1.00 0.00 ? 211 ASN C O   1  
ATOM 11156  C CB  . ASN C 3 211 ? 61.096  83.608  57.508  1.00 0.00 ? 211 ASN C CB  1  
ATOM 11157  C CG  . ASN C 3 211 ? 61.782  84.384  58.662  1.00 0.00 ? 211 ASN C CG  1  
ATOM 11158  O OD1 . ASN C 3 211 ? 62.338  85.474  58.477  1.00 0.00 ? 211 ASN C OD1 1  
ATOM 11159  N ND2 . ASN C 3 211 ? 61.681  83.813  59.900  1.00 0.00 ? 211 ASN C ND2 1  
ATOM 11160  N N   . ILE C 3 212 ? 60.462  81.246  55.679  1.00 0.00 ? 212 ILE C N   1  
ATOM 11161  C CA  . ILE C 3 212 ? 59.838  80.759  54.465  1.00 0.00 ? 212 ILE C CA  1  
ATOM 11162  C C   . ILE C 3 212 ? 59.094  79.504  54.814  1.00 0.00 ? 212 ILE C C   1  
ATOM 11163  O O   . ILE C 3 212 ? 57.976  79.386  54.327  1.00 0.00 ? 212 ILE C O   1  
ATOM 11164  C CB  . ILE C 3 212 ? 60.903  80.587  53.388  1.00 0.00 ? 212 ILE C CB  1  
ATOM 11165  C CG1 . ILE C 3 212 ? 61.600  81.900  52.909  1.00 0.00 ? 212 ILE C CG1 1  
ATOM 11166  C CG2 . ILE C 3 212 ? 60.298  79.890  52.086  1.00 0.00 ? 212 ILE C CG2 1  
ATOM 11167  C CD1 . ILE C 3 212 ? 62.667  81.684  51.823  1.00 0.00 ? 212 ILE C CD1 1  
ATOM 11168  N N   . SER C 3 213 ? 59.650  78.570  55.572  1.00 0.00 ? 213 SER C N   1  
ATOM 11169  C CA  . SER C 3 213 ? 59.099  77.264  55.900  1.00 0.00 ? 213 SER C CA  1  
ATOM 11170  C C   . SER C 3 213 ? 57.824  77.418  56.660  1.00 0.00 ? 213 SER C C   1  
ATOM 11171  O O   . SER C 3 213 ? 56.812  76.801  56.306  1.00 0.00 ? 213 SER C O   1  
ATOM 11172  C CB  . SER C 3 213 ? 60.051  76.412  56.791  1.00 0.00 ? 213 SER C CB  1  
ATOM 11173  O OG  . SER C 3 213 ? 61.130  75.845  56.061  1.00 0.00 ? 213 SER C OG  1  
ATOM 11174  N N   . GLY C 3 214 ? 57.796  78.364  57.660  1.00 0.00 ? 214 GLY C N   1  
ATOM 11175  C CA  . GLY C 3 214 ? 56.586  78.754  58.433  1.00 0.00 ? 214 GLY C CA  1  
ATOM 11176  C C   . GLY C 3 214 ? 55.549  79.446  57.607  1.00 0.00 ? 214 GLY C C   1  
ATOM 11177  O O   . GLY C 3 214 ? 54.388  79.003  57.611  1.00 0.00 ? 214 GLY C O   1  
ATOM 11178  N N   . LYS C 3 215 ? 55.943  80.468  56.836  1.00 0.00 ? 215 LYS C N   1  
ATOM 11179  C CA  . LYS C 3 215 ? 54.958  81.202  56.061  1.00 0.00 ? 215 LYS C CA  1