data_5FN2
# 
_entry.id   5FN2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.314 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5FN2         
PDBE  EBI-65490    
WWPDB D_1290065490 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB  5FN3     unspecified            'CRYO-EM STRUCTURE OF GAMMA SECRETASE IN CLASS 1 OF THE APO-STATE ENSEMBLE' 
PDB  5FN4     unspecified            'CRYO-EM STRUCTURE OF GAMMA SECRETASE IN CLASS 2 OF THE APO-STATE ENSEMBLE' 
PDB  5FN5     unspecified            'CRYO-EM STRUCTURE OF GAMMA SECRETASE IN CLASS 3 OF THE APO-STATE ENSEMBLE' 
EMDB EMD-3237 'associated EM volume' .                                                                           
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        5FN2 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2015-11-10 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bai, X.C.'       1 
'Rajendra, E.'    2 
'Yang, G.H.'      3 
'Shi, Y.G.'       4 
'Scheres, S.H.W.' 5 
# 
_citation.id                        primary 
_citation.title                     'Sampling the conformational space of the catalytic subunit of human gamma-secretase.' 
_citation.journal_abbrev            Elife 
_citation.journal_volume            4 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      2015 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26623517 
_citation.pdbx_database_id_DOI      10.7554/eLife.11182 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bai, X.C.'     1 ? 
primary 'Rajendra, E.'  2 ? 
primary 'Yang, G.'      3 ? 
primary 'Shi, Y.'       4 ? 
primary 'Scheres, S.H.' 5 ? 
# 
_cell.entry_id           5FN2 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5FN2 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Nicastrin                        78483.570 1 ?        ? ? 'A DRUG DAPT WAS BOUND TO GAMMA SECRETASE COMPLEX' 
2 polymer man Presenilin-1                     52651.465 1 3.4.23.- ? ? 'A DRUG DAPT WAS BOUND TO GAMMA SECRETASE COMPLEX' 
3 polymer man 'Gamma-secretase subunit APH-1A' 29017.943 1 ?        ? ? 'A DRUG DAPT WAS BOUND TO GAMMA SECRETASE COMPLEX' 
4 polymer man 'Gamma-secretase subunit PEN-2'  12038.029 1 ?        ? ? 'A DRUG DAPT WAS BOUND TO GAMMA SECRETASE COMPLEX' 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
2 'PS-1,Protein S182'                                 
3 'APH-1a,Aph-1alpha,Presenilin-stabilization factor' 
4 'Presenilin enhancer protein 2'                     
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEE
DLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFSPSVQCPNDGFGVYSNSYGPEFAHCR
EIQWNSLGNGLAYEDFSFPIFLLEDENETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVISTATCMRRSSIQSTF
SINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALQKAPDVTT
LPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQVEDLLAT
LEKSGAGVPAVILRRPNQSQPLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFV
TDTAKALADVATVLGRALYELAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQDLRSYLGDGPLQHYIAVSSP
TNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLYEYSWVQGPLHSNETDRLPRCVRSTARLARALSPAFELSQW
SSTEYSTWTESRWKDIRARIFLIASKELELITLTVGFGILIFSLIVTYCINAKADVLFIAPREPGAVSY
;
;MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEE
DLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFSPSVQCPNDGFGVYSNSYGPEFAHCR
EIQWNSLGNGLAYEDFSFPIFLLEDENETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVISTATCMRRSSIQSTF
SINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALQKAPDVTT
LPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQVEDLLAT
LEKSGAGVPAVILRRPNQSQPLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFV
TDTAKALADVATVLGRALYELAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQDLRSYLGDGPLQHYIAVSSP
TNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLYEYSWVQGPLHSNETDRLPRCVRSTARLARALSPAFELSQW
SSTEYSTWTESRWKDIRARIFLIASKELELITLTVGFGILIFSLIVTYCINAKADVLFIAPREPGAVSY
;
A ? 
2 'polypeptide(L)' no no 
;MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQDEEEDEELTLKYGAK
HVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYK
VIHAWLIISSLLLLFFFSFIYLGEVFKTYNVAVDYITVALLIWNFGVVGMISIHWKGPLRLQQAYLIMISALMALVFIKY
LPEWTAWLILAVISVTDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAEGDPEAQRRVSKNSKYNAEST
ERESQDTVAENDDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSSSILAGEDPEERGVKLGLGDFIFYSVLVGKASATA
SGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI
;
;MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQDEEEDEELTLKYGAK
HVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYK
VIHAWLIISSLLLLFFFSFIYLGEVFKTYNVAVDYITVALLIWNFGVVGMISIHWKGPLRLQQAYLIMISALMALVFIKY
LPEWTAWLILAVISVTDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAEGDPEAQRRVSKNSKYNAEST
ERESQDTVAENDDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSSSILAGEDPEERGVKLGLGDFIFYSVLVGKASATA
SGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI
;
B ? 
3 'polypeptide(L)' no no 
;MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSV
LLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTS
AFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQ
RSLLCRRQEDSRVMVYSALRIPPED
;
;MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSV
LLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTS
AFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQ
RSLLCRRQEDSRVMVYSALRIPPED
;
C ? 
4 'polypeptide(L)' no no 
;MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQI
YRPRWGALGDYLSFTIPLGTP
;
;MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQI
YRPRWGALGDYLSFTIPLGTP
;
D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   THR n 
1 4   ALA n 
1 5   GLY n 
1 6   GLY n 
1 7   GLY n 
1 8   SER n 
1 9   GLY n 
1 10  ALA n 
1 11  ASP n 
1 12  PRO n 
1 13  GLY n 
1 14  SER n 
1 15  ARG n 
1 16  GLY n 
1 17  LEU n 
1 18  LEU n 
1 19  ARG n 
1 20  LEU n 
1 21  LEU n 
1 22  SER n 
1 23  PHE n 
1 24  CYS n 
1 25  VAL n 
1 26  LEU n 
1 27  LEU n 
1 28  ALA n 
1 29  GLY n 
1 30  LEU n 
1 31  CYS n 
1 32  ARG n 
1 33  GLY n 
1 34  ASN n 
1 35  SER n 
1 36  VAL n 
1 37  GLU n 
1 38  ARG n 
1 39  LYS n 
1 40  ILE n 
1 41  TYR n 
1 42  ILE n 
1 43  PRO n 
1 44  LEU n 
1 45  ASN n 
1 46  LYS n 
1 47  THR n 
1 48  ALA n 
1 49  PRO n 
1 50  CYS n 
1 51  VAL n 
1 52  ARG n 
1 53  LEU n 
1 54  LEU n 
1 55  ASN n 
1 56  ALA n 
1 57  THR n 
1 58  HIS n 
1 59  GLN n 
1 60  ILE n 
1 61  GLY n 
1 62  CYS n 
1 63  GLN n 
1 64  SER n 
1 65  SER n 
1 66  ILE n 
1 67  SER n 
1 68  GLY n 
1 69  ASP n 
1 70  THR n 
1 71  GLY n 
1 72  VAL n 
1 73  ILE n 
1 74  HIS n 
1 75  VAL n 
1 76  VAL n 
1 77  GLU n 
1 78  LYS n 
1 79  GLU n 
1 80  GLU n 
1 81  ASP n 
1 82  LEU n 
1 83  GLN n 
1 84  TRP n 
1 85  VAL n 
1 86  LEU n 
1 87  THR n 
1 88  ASP n 
1 89  GLY n 
1 90  PRO n 
1 91  ASN n 
1 92  PRO n 
1 93  PRO n 
1 94  TYR n 
1 95  MET n 
1 96  VAL n 
1 97  LEU n 
1 98  LEU n 
1 99  GLU n 
1 100 SER n 
1 101 LYS n 
1 102 HIS n 
1 103 PHE n 
1 104 THR n 
1 105 ARG n 
1 106 ASP n 
1 107 LEU n 
1 108 MET n 
1 109 GLU n 
1 110 LYS n 
1 111 LEU n 
1 112 LYS n 
1 113 GLY n 
1 114 ARG n 
1 115 THR n 
1 116 SER n 
1 117 ARG n 
1 118 ILE n 
1 119 ALA n 
1 120 GLY n 
1 121 LEU n 
1 122 ALA n 
1 123 VAL n 
1 124 SER n 
1 125 LEU n 
1 126 THR n 
1 127 LYS n 
1 128 PRO n 
1 129 SER n 
1 130 PRO n 
1 131 ALA n 
1 132 SER n 
1 133 GLY n 
1 134 PHE n 
1 135 SER n 
1 136 PRO n 
1 137 SER n 
1 138 VAL n 
1 139 GLN n 
1 140 CYS n 
1 141 PRO n 
1 142 ASN n 
1 143 ASP n 
1 144 GLY n 
1 145 PHE n 
1 146 GLY n 
1 147 VAL n 
1 148 TYR n 
1 149 SER n 
1 150 ASN n 
1 151 SER n 
1 152 TYR n 
1 153 GLY n 
1 154 PRO n 
1 155 GLU n 
1 156 PHE n 
1 157 ALA n 
1 158 HIS n 
1 159 CYS n 
1 160 ARG n 
1 161 GLU n 
1 162 ILE n 
1 163 GLN n 
1 164 TRP n 
1 165 ASN n 
1 166 SER n 
1 167 LEU n 
1 168 GLY n 
1 169 ASN n 
1 170 GLY n 
1 171 LEU n 
1 172 ALA n 
1 173 TYR n 
1 174 GLU n 
1 175 ASP n 
1 176 PHE n 
1 177 SER n 
1 178 PHE n 
1 179 PRO n 
1 180 ILE n 
1 181 PHE n 
1 182 LEU n 
1 183 LEU n 
1 184 GLU n 
1 185 ASP n 
1 186 GLU n 
1 187 ASN n 
1 188 GLU n 
1 189 THR n 
1 190 LYS n 
1 191 VAL n 
1 192 ILE n 
1 193 LYS n 
1 194 GLN n 
1 195 CYS n 
1 196 TYR n 
1 197 GLN n 
1 198 ASP n 
1 199 HIS n 
1 200 ASN n 
1 201 LEU n 
1 202 SER n 
1 203 GLN n 
1 204 ASN n 
1 205 GLY n 
1 206 SER n 
1 207 ALA n 
1 208 PRO n 
1 209 THR n 
1 210 PHE n 
1 211 PRO n 
1 212 LEU n 
1 213 CYS n 
1 214 ALA n 
1 215 MET n 
1 216 GLN n 
1 217 LEU n 
1 218 PHE n 
1 219 SER n 
1 220 HIS n 
1 221 MET n 
1 222 HIS n 
1 223 ALA n 
1 224 VAL n 
1 225 ILE n 
1 226 SER n 
1 227 THR n 
1 228 ALA n 
1 229 THR n 
1 230 CYS n 
1 231 MET n 
1 232 ARG n 
1 233 ARG n 
1 234 SER n 
1 235 SER n 
1 236 ILE n 
1 237 GLN n 
1 238 SER n 
1 239 THR n 
1 240 PHE n 
1 241 SER n 
1 242 ILE n 
1 243 ASN n 
1 244 PRO n 
1 245 GLU n 
1 246 ILE n 
1 247 VAL n 
1 248 CYS n 
1 249 ASP n 
1 250 PRO n 
1 251 LEU n 
1 252 SER n 
1 253 ASP n 
1 254 TYR n 
1 255 ASN n 
1 256 VAL n 
1 257 TRP n 
1 258 SER n 
1 259 MET n 
1 260 LEU n 
1 261 LYS n 
1 262 PRO n 
1 263 ILE n 
1 264 ASN n 
1 265 THR n 
1 266 THR n 
1 267 GLY n 
1 268 THR n 
1 269 LEU n 
1 270 LYS n 
1 271 PRO n 
1 272 ASP n 
1 273 ASP n 
1 274 ARG n 
1 275 VAL n 
1 276 VAL n 
1 277 VAL n 
1 278 ALA n 
1 279 ALA n 
1 280 THR n 
1 281 ARG n 
1 282 LEU n 
1 283 ASP n 
1 284 SER n 
1 285 ARG n 
1 286 SER n 
1 287 PHE n 
1 288 PHE n 
1 289 TRP n 
1 290 ASN n 
1 291 VAL n 
1 292 ALA n 
1 293 PRO n 
1 294 GLY n 
1 295 ALA n 
1 296 GLU n 
1 297 SER n 
1 298 ALA n 
1 299 VAL n 
1 300 ALA n 
1 301 SER n 
1 302 PHE n 
1 303 VAL n 
1 304 THR n 
1 305 GLN n 
1 306 LEU n 
1 307 ALA n 
1 308 ALA n 
1 309 ALA n 
1 310 GLU n 
1 311 ALA n 
1 312 LEU n 
1 313 GLN n 
1 314 LYS n 
1 315 ALA n 
1 316 PRO n 
1 317 ASP n 
1 318 VAL n 
1 319 THR n 
1 320 THR n 
1 321 LEU n 
1 322 PRO n 
1 323 ARG n 
1 324 ASN n 
1 325 VAL n 
1 326 MET n 
1 327 PHE n 
1 328 VAL n 
1 329 PHE n 
1 330 PHE n 
1 331 GLN n 
1 332 GLY n 
1 333 GLU n 
1 334 THR n 
1 335 PHE n 
1 336 ASP n 
1 337 TYR n 
1 338 ILE n 
1 339 GLY n 
1 340 SER n 
1 341 SER n 
1 342 ARG n 
1 343 MET n 
1 344 VAL n 
1 345 TYR n 
1 346 ASP n 
1 347 MET n 
1 348 GLU n 
1 349 LYS n 
1 350 GLY n 
1 351 LYS n 
1 352 PHE n 
1 353 PRO n 
1 354 VAL n 
1 355 GLN n 
1 356 LEU n 
1 357 GLU n 
1 358 ASN n 
1 359 VAL n 
1 360 ASP n 
1 361 SER n 
1 362 PHE n 
1 363 VAL n 
1 364 GLU n 
1 365 LEU n 
1 366 GLY n 
1 367 GLN n 
1 368 VAL n 
1 369 ALA n 
1 370 LEU n 
1 371 ARG n 
1 372 THR n 
1 373 SER n 
1 374 LEU n 
1 375 GLU n 
1 376 LEU n 
1 377 TRP n 
1 378 MET n 
1 379 HIS n 
1 380 THR n 
1 381 ASP n 
1 382 PRO n 
1 383 VAL n 
1 384 SER n 
1 385 GLN n 
1 386 LYS n 
1 387 ASN n 
1 388 GLU n 
1 389 SER n 
1 390 VAL n 
1 391 ARG n 
1 392 ASN n 
1 393 GLN n 
1 394 VAL n 
1 395 GLU n 
1 396 ASP n 
1 397 LEU n 
1 398 LEU n 
1 399 ALA n 
1 400 THR n 
1 401 LEU n 
1 402 GLU n 
1 403 LYS n 
1 404 SER n 
1 405 GLY n 
1 406 ALA n 
1 407 GLY n 
1 408 VAL n 
1 409 PRO n 
1 410 ALA n 
1 411 VAL n 
1 412 ILE n 
1 413 LEU n 
1 414 ARG n 
1 415 ARG n 
1 416 PRO n 
1 417 ASN n 
1 418 GLN n 
1 419 SER n 
1 420 GLN n 
1 421 PRO n 
1 422 LEU n 
1 423 PRO n 
1 424 PRO n 
1 425 SER n 
1 426 SER n 
1 427 LEU n 
1 428 GLN n 
1 429 ARG n 
1 430 PHE n 
1 431 LEU n 
1 432 ARG n 
1 433 ALA n 
1 434 ARG n 
1 435 ASN n 
1 436 ILE n 
1 437 SER n 
1 438 GLY n 
1 439 VAL n 
1 440 VAL n 
1 441 LEU n 
1 442 ALA n 
1 443 ASP n 
1 444 HIS n 
1 445 SER n 
1 446 GLY n 
1 447 ALA n 
1 448 PHE n 
1 449 HIS n 
1 450 ASN n 
1 451 LYS n 
1 452 TYR n 
1 453 TYR n 
1 454 GLN n 
1 455 SER n 
1 456 ILE n 
1 457 TYR n 
1 458 ASP n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 ASN n 
1 463 ILE n 
1 464 ASN n 
1 465 VAL n 
1 466 SER n 
1 467 TYR n 
1 468 PRO n 
1 469 GLU n 
1 470 TRP n 
1 471 LEU n 
1 472 SER n 
1 473 PRO n 
1 474 GLU n 
1 475 GLU n 
1 476 ASP n 
1 477 LEU n 
1 478 ASN n 
1 479 PHE n 
1 480 VAL n 
1 481 THR n 
1 482 ASP n 
1 483 THR n 
1 484 ALA n 
1 485 LYS n 
1 486 ALA n 
1 487 LEU n 
1 488 ALA n 
1 489 ASP n 
1 490 VAL n 
1 491 ALA n 
1 492 THR n 
1 493 VAL n 
1 494 LEU n 
1 495 GLY n 
1 496 ARG n 
1 497 ALA n 
1 498 LEU n 
1 499 TYR n 
1 500 GLU n 
1 501 LEU n 
1 502 ALA n 
1 503 GLY n 
1 504 GLY n 
1 505 THR n 
1 506 ASN n 
1 507 PHE n 
1 508 SER n 
1 509 ASP n 
1 510 THR n 
1 511 VAL n 
1 512 GLN n 
1 513 ALA n 
1 514 ASP n 
1 515 PRO n 
1 516 GLN n 
1 517 THR n 
1 518 VAL n 
1 519 THR n 
1 520 ARG n 
1 521 LEU n 
1 522 LEU n 
1 523 TYR n 
1 524 GLY n 
1 525 PHE n 
1 526 LEU n 
1 527 ILE n 
1 528 LYS n 
1 529 ALA n 
1 530 ASN n 
1 531 ASN n 
1 532 SER n 
1 533 TRP n 
1 534 PHE n 
1 535 GLN n 
1 536 SER n 
1 537 ILE n 
1 538 LEU n 
1 539 ARG n 
1 540 GLN n 
1 541 ASP n 
1 542 LEU n 
1 543 ARG n 
1 544 SER n 
1 545 TYR n 
1 546 LEU n 
1 547 GLY n 
1 548 ASP n 
1 549 GLY n 
1 550 PRO n 
1 551 LEU n 
1 552 GLN n 
1 553 HIS n 
1 554 TYR n 
1 555 ILE n 
1 556 ALA n 
1 557 VAL n 
1 558 SER n 
1 559 SER n 
1 560 PRO n 
1 561 THR n 
1 562 ASN n 
1 563 THR n 
1 564 THR n 
1 565 TYR n 
1 566 VAL n 
1 567 VAL n 
1 568 GLN n 
1 569 TYR n 
1 570 ALA n 
1 571 LEU n 
1 572 ALA n 
1 573 ASN n 
1 574 LEU n 
1 575 THR n 
1 576 GLY n 
1 577 THR n 
1 578 VAL n 
1 579 VAL n 
1 580 ASN n 
1 581 LEU n 
1 582 THR n 
1 583 ARG n 
1 584 GLU n 
1 585 GLN n 
1 586 CYS n 
1 587 GLN n 
1 588 ASP n 
1 589 PRO n 
1 590 SER n 
1 591 LYS n 
1 592 VAL n 
1 593 PRO n 
1 594 SER n 
1 595 GLU n 
1 596 ASN n 
1 597 LYS n 
1 598 ASP n 
1 599 LEU n 
1 600 TYR n 
1 601 GLU n 
1 602 TYR n 
1 603 SER n 
1 604 TRP n 
1 605 VAL n 
1 606 GLN n 
1 607 GLY n 
1 608 PRO n 
1 609 LEU n 
1 610 HIS n 
1 611 SER n 
1 612 ASN n 
1 613 GLU n 
1 614 THR n 
1 615 ASP n 
1 616 ARG n 
1 617 LEU n 
1 618 PRO n 
1 619 ARG n 
1 620 CYS n 
1 621 VAL n 
1 622 ARG n 
1 623 SER n 
1 624 THR n 
1 625 ALA n 
1 626 ARG n 
1 627 LEU n 
1 628 ALA n 
1 629 ARG n 
1 630 ALA n 
1 631 LEU n 
1 632 SER n 
1 633 PRO n 
1 634 ALA n 
1 635 PHE n 
1 636 GLU n 
1 637 LEU n 
1 638 SER n 
1 639 GLN n 
1 640 TRP n 
1 641 SER n 
1 642 SER n 
1 643 THR n 
1 644 GLU n 
1 645 TYR n 
1 646 SER n 
1 647 THR n 
1 648 TRP n 
1 649 THR n 
1 650 GLU n 
1 651 SER n 
1 652 ARG n 
1 653 TRP n 
1 654 LYS n 
1 655 ASP n 
1 656 ILE n 
1 657 ARG n 
1 658 ALA n 
1 659 ARG n 
1 660 ILE n 
1 661 PHE n 
1 662 LEU n 
1 663 ILE n 
1 664 ALA n 
1 665 SER n 
1 666 LYS n 
1 667 GLU n 
1 668 LEU n 
1 669 GLU n 
1 670 LEU n 
1 671 ILE n 
1 672 THR n 
1 673 LEU n 
1 674 THR n 
1 675 VAL n 
1 676 GLY n 
1 677 PHE n 
1 678 GLY n 
1 679 ILE n 
1 680 LEU n 
1 681 ILE n 
1 682 PHE n 
1 683 SER n 
1 684 LEU n 
1 685 ILE n 
1 686 VAL n 
1 687 THR n 
1 688 TYR n 
1 689 CYS n 
1 690 ILE n 
1 691 ASN n 
1 692 ALA n 
1 693 LYS n 
1 694 ALA n 
1 695 ASP n 
1 696 VAL n 
1 697 LEU n 
1 698 PHE n 
1 699 ILE n 
1 700 ALA n 
1 701 PRO n 
1 702 ARG n 
1 703 GLU n 
1 704 PRO n 
1 705 GLY n 
1 706 ALA n 
1 707 VAL n 
1 708 SER n 
1 709 TYR n 
2 1   MET n 
2 2   THR n 
2 3   GLU n 
2 4   LEU n 
2 5   PRO n 
2 6   ALA n 
2 7   PRO n 
2 8   LEU n 
2 9   SER n 
2 10  TYR n 
2 11  PHE n 
2 12  GLN n 
2 13  ASN n 
2 14  ALA n 
2 15  GLN n 
2 16  MET n 
2 17  SER n 
2 18  GLU n 
2 19  ASP n 
2 20  ASN n 
2 21  HIS n 
2 22  LEU n 
2 23  SER n 
2 24  ASN n 
2 25  THR n 
2 26  VAL n 
2 27  ARG n 
2 28  SER n 
2 29  GLN n 
2 30  ASN n 
2 31  ASP n 
2 32  ASN n 
2 33  ARG n 
2 34  GLU n 
2 35  ARG n 
2 36  GLN n 
2 37  GLU n 
2 38  HIS n 
2 39  ASN n 
2 40  ASP n 
2 41  ARG n 
2 42  ARG n 
2 43  SER n 
2 44  LEU n 
2 45  GLY n 
2 46  HIS n 
2 47  PRO n 
2 48  GLU n 
2 49  PRO n 
2 50  LEU n 
2 51  SER n 
2 52  ASN n 
2 53  GLY n 
2 54  ARG n 
2 55  PRO n 
2 56  GLN n 
2 57  GLY n 
2 58  ASN n 
2 59  SER n 
2 60  ARG n 
2 61  GLN n 
2 62  VAL n 
2 63  VAL n 
2 64  GLU n 
2 65  GLN n 
2 66  ASP n 
2 67  GLU n 
2 68  GLU n 
2 69  GLU n 
2 70  ASP n 
2 71  GLU n 
2 72  GLU n 
2 73  LEU n 
2 74  THR n 
2 75  LEU n 
2 76  LYS n 
2 77  TYR n 
2 78  GLY n 
2 79  ALA n 
2 80  LYS n 
2 81  HIS n 
2 82  VAL n 
2 83  ILE n 
2 84  MET n 
2 85  LEU n 
2 86  PHE n 
2 87  VAL n 
2 88  PRO n 
2 89  VAL n 
2 90  THR n 
2 91  LEU n 
2 92  CYS n 
2 93  MET n 
2 94  VAL n 
2 95  VAL n 
2 96  VAL n 
2 97  VAL n 
2 98  ALA n 
2 99  THR n 
2 100 ILE n 
2 101 LYS n 
2 102 SER n 
2 103 VAL n 
2 104 SER n 
2 105 PHE n 
2 106 TYR n 
2 107 THR n 
2 108 ARG n 
2 109 LYS n 
2 110 ASP n 
2 111 GLY n 
2 112 GLN n 
2 113 LEU n 
2 114 ILE n 
2 115 TYR n 
2 116 THR n 
2 117 PRO n 
2 118 PHE n 
2 119 THR n 
2 120 GLU n 
2 121 ASP n 
2 122 THR n 
2 123 GLU n 
2 124 THR n 
2 125 VAL n 
2 126 GLY n 
2 127 GLN n 
2 128 ARG n 
2 129 ALA n 
2 130 LEU n 
2 131 HIS n 
2 132 SER n 
2 133 ILE n 
2 134 LEU n 
2 135 ASN n 
2 136 ALA n 
2 137 ALA n 
2 138 ILE n 
2 139 MET n 
2 140 ILE n 
2 141 SER n 
2 142 VAL n 
2 143 ILE n 
2 144 VAL n 
2 145 VAL n 
2 146 MET n 
2 147 THR n 
2 148 ILE n 
2 149 LEU n 
2 150 LEU n 
2 151 VAL n 
2 152 VAL n 
2 153 LEU n 
2 154 TYR n 
2 155 LYS n 
2 156 TYR n 
2 157 ARG n 
2 158 CYS n 
2 159 TYR n 
2 160 LYS n 
2 161 VAL n 
2 162 ILE n 
2 163 HIS n 
2 164 ALA n 
2 165 TRP n 
2 166 LEU n 
2 167 ILE n 
2 168 ILE n 
2 169 SER n 
2 170 SER n 
2 171 LEU n 
2 172 LEU n 
2 173 LEU n 
2 174 LEU n 
2 175 PHE n 
2 176 PHE n 
2 177 PHE n 
2 178 SER n 
2 179 PHE n 
2 180 ILE n 
2 181 TYR n 
2 182 LEU n 
2 183 GLY n 
2 184 GLU n 
2 185 VAL n 
2 186 PHE n 
2 187 LYS n 
2 188 THR n 
2 189 TYR n 
2 190 ASN n 
2 191 VAL n 
2 192 ALA n 
2 193 VAL n 
2 194 ASP n 
2 195 TYR n 
2 196 ILE n 
2 197 THR n 
2 198 VAL n 
2 199 ALA n 
2 200 LEU n 
2 201 LEU n 
2 202 ILE n 
2 203 TRP n 
2 204 ASN n 
2 205 PHE n 
2 206 GLY n 
2 207 VAL n 
2 208 VAL n 
2 209 GLY n 
2 210 MET n 
2 211 ILE n 
2 212 SER n 
2 213 ILE n 
2 214 HIS n 
2 215 TRP n 
2 216 LYS n 
2 217 GLY n 
2 218 PRO n 
2 219 LEU n 
2 220 ARG n 
2 221 LEU n 
2 222 GLN n 
2 223 GLN n 
2 224 ALA n 
2 225 TYR n 
2 226 LEU n 
2 227 ILE n 
2 228 MET n 
2 229 ILE n 
2 230 SER n 
2 231 ALA n 
2 232 LEU n 
2 233 MET n 
2 234 ALA n 
2 235 LEU n 
2 236 VAL n 
2 237 PHE n 
2 238 ILE n 
2 239 LYS n 
2 240 TYR n 
2 241 LEU n 
2 242 PRO n 
2 243 GLU n 
2 244 TRP n 
2 245 THR n 
2 246 ALA n 
2 247 TRP n 
2 248 LEU n 
2 249 ILE n 
2 250 LEU n 
2 251 ALA n 
2 252 VAL n 
2 253 ILE n 
2 254 SER n 
2 255 VAL n 
2 256 THR n 
2 257 ASP n 
2 258 LEU n 
2 259 VAL n 
2 260 ALA n 
2 261 VAL n 
2 262 LEU n 
2 263 CYS n 
2 264 PRO n 
2 265 LYS n 
2 266 GLY n 
2 267 PRO n 
2 268 LEU n 
2 269 ARG n 
2 270 MET n 
2 271 LEU n 
2 272 VAL n 
2 273 GLU n 
2 274 THR n 
2 275 ALA n 
2 276 GLN n 
2 277 GLU n 
2 278 ARG n 
2 279 ASN n 
2 280 GLU n 
2 281 THR n 
2 282 LEU n 
2 283 PHE n 
2 284 PRO n 
2 285 ALA n 
2 286 LEU n 
2 287 ILE n 
2 288 TYR n 
2 289 SER n 
2 290 SER n 
2 291 THR n 
2 292 MET n 
2 293 VAL n 
2 294 TRP n 
2 295 LEU n 
2 296 VAL n 
2 297 ASN n 
2 298 MET n 
2 299 ALA n 
2 300 GLU n 
2 301 GLY n 
2 302 ASP n 
2 303 PRO n 
2 304 GLU n 
2 305 ALA n 
2 306 GLN n 
2 307 ARG n 
2 308 ARG n 
2 309 VAL n 
2 310 SER n 
2 311 LYS n 
2 312 ASN n 
2 313 SER n 
2 314 LYS n 
2 315 TYR n 
2 316 ASN n 
2 317 ALA n 
2 318 GLU n 
2 319 SER n 
2 320 THR n 
2 321 GLU n 
2 322 ARG n 
2 323 GLU n 
2 324 SER n 
2 325 GLN n 
2 326 ASP n 
2 327 THR n 
2 328 VAL n 
2 329 ALA n 
2 330 GLU n 
2 331 ASN n 
2 332 ASP n 
2 333 ASP n 
2 334 GLY n 
2 335 GLY n 
2 336 PHE n 
2 337 SER n 
2 338 GLU n 
2 339 GLU n 
2 340 TRP n 
2 341 GLU n 
2 342 ALA n 
2 343 GLN n 
2 344 ARG n 
2 345 ASP n 
2 346 SER n 
2 347 HIS n 
2 348 LEU n 
2 349 GLY n 
2 350 PRO n 
2 351 HIS n 
2 352 ARG n 
2 353 SER n 
2 354 THR n 
2 355 PRO n 
2 356 GLU n 
2 357 SER n 
2 358 ARG n 
2 359 ALA n 
2 360 ALA n 
2 361 VAL n 
2 362 GLN n 
2 363 GLU n 
2 364 LEU n 
2 365 SER n 
2 366 SER n 
2 367 SER n 
2 368 ILE n 
2 369 LEU n 
2 370 ALA n 
2 371 GLY n 
2 372 GLU n 
2 373 ASP n 
2 374 PRO n 
2 375 GLU n 
2 376 GLU n 
2 377 ARG n 
2 378 GLY n 
2 379 VAL n 
2 380 LYS n 
2 381 LEU n 
2 382 GLY n 
2 383 LEU n 
2 384 GLY n 
2 385 ASP n 
2 386 PHE n 
2 387 ILE n 
2 388 PHE n 
2 389 TYR n 
2 390 SER n 
2 391 VAL n 
2 392 LEU n 
2 393 VAL n 
2 394 GLY n 
2 395 LYS n 
2 396 ALA n 
2 397 SER n 
2 398 ALA n 
2 399 THR n 
2 400 ALA n 
2 401 SER n 
2 402 GLY n 
2 403 ASP n 
2 404 TRP n 
2 405 ASN n 
2 406 THR n 
2 407 THR n 
2 408 ILE n 
2 409 ALA n 
2 410 CYS n 
2 411 PHE n 
2 412 VAL n 
2 413 ALA n 
2 414 ILE n 
2 415 LEU n 
2 416 ILE n 
2 417 GLY n 
2 418 LEU n 
2 419 CYS n 
2 420 LEU n 
2 421 THR n 
2 422 LEU n 
2 423 LEU n 
2 424 LEU n 
2 425 LEU n 
2 426 ALA n 
2 427 ILE n 
2 428 PHE n 
2 429 LYS n 
2 430 LYS n 
2 431 ALA n 
2 432 LEU n 
2 433 PRO n 
2 434 ALA n 
2 435 LEU n 
2 436 PRO n 
2 437 ILE n 
2 438 SER n 
2 439 ILE n 
2 440 THR n 
2 441 PHE n 
2 442 GLY n 
2 443 LEU n 
2 444 VAL n 
2 445 PHE n 
2 446 TYR n 
2 447 PHE n 
2 448 ALA n 
2 449 THR n 
2 450 ASP n 
2 451 TYR n 
2 452 LEU n 
2 453 VAL n 
2 454 GLN n 
2 455 PRO n 
2 456 PHE n 
2 457 MET n 
2 458 ASP n 
2 459 GLN n 
2 460 LEU n 
2 461 ALA n 
2 462 PHE n 
2 463 HIS n 
2 464 GLN n 
2 465 PHE n 
2 466 TYR n 
2 467 ILE n 
3 1   MET n 
3 2   GLY n 
3 3   ALA n 
3 4   ALA n 
3 5   VAL n 
3 6   PHE n 
3 7   PHE n 
3 8   GLY n 
3 9   CYS n 
3 10  THR n 
3 11  PHE n 
3 12  VAL n 
3 13  ALA n 
3 14  PHE n 
3 15  GLY n 
3 16  PRO n 
3 17  ALA n 
3 18  PHE n 
3 19  ALA n 
3 20  LEU n 
3 21  PHE n 
3 22  LEU n 
3 23  ILE n 
3 24  THR n 
3 25  VAL n 
3 26  ALA n 
3 27  GLY n 
3 28  ASP n 
3 29  PRO n 
3 30  LEU n 
3 31  ARG n 
3 32  VAL n 
3 33  ILE n 
3 34  ILE n 
3 35  LEU n 
3 36  VAL n 
3 37  ALA n 
3 38  GLY n 
3 39  ALA n 
3 40  PHE n 
3 41  PHE n 
3 42  TRP n 
3 43  LEU n 
3 44  VAL n 
3 45  SER n 
3 46  LEU n 
3 47  LEU n 
3 48  LEU n 
3 49  ALA n 
3 50  SER n 
3 51  VAL n 
3 52  VAL n 
3 53  TRP n 
3 54  PHE n 
3 55  ILE n 
3 56  LEU n 
3 57  VAL n 
3 58  HIS n 
3 59  VAL n 
3 60  THR n 
3 61  ASP n 
3 62  ARG n 
3 63  SER n 
3 64  ASP n 
3 65  ALA n 
3 66  ARG n 
3 67  LEU n 
3 68  GLN n 
3 69  TYR n 
3 70  GLY n 
3 71  LEU n 
3 72  LEU n 
3 73  ILE n 
3 74  PHE n 
3 75  GLY n 
3 76  ALA n 
3 77  ALA n 
3 78  VAL n 
3 79  SER n 
3 80  VAL n 
3 81  LEU n 
3 82  LEU n 
3 83  GLN n 
3 84  GLU n 
3 85  VAL n 
3 86  PHE n 
3 87  ARG n 
3 88  PHE n 
3 89  ALA n 
3 90  TYR n 
3 91  TYR n 
3 92  LYS n 
3 93  LEU n 
3 94  LEU n 
3 95  LYS n 
3 96  LYS n 
3 97  ALA n 
3 98  ASP n 
3 99  GLU n 
3 100 GLY n 
3 101 LEU n 
3 102 ALA n 
3 103 SER n 
3 104 LEU n 
3 105 SER n 
3 106 GLU n 
3 107 ASP n 
3 108 GLY n 
3 109 ARG n 
3 110 SER n 
3 111 PRO n 
3 112 ILE n 
3 113 SER n 
3 114 ILE n 
3 115 ARG n 
3 116 GLN n 
3 117 MET n 
3 118 ALA n 
3 119 TYR n 
3 120 VAL n 
3 121 SER n 
3 122 GLY n 
3 123 LEU n 
3 124 SER n 
3 125 PHE n 
3 126 GLY n 
3 127 ILE n 
3 128 ILE n 
3 129 SER n 
3 130 GLY n 
3 131 VAL n 
3 132 PHE n 
3 133 SER n 
3 134 VAL n 
3 135 ILE n 
3 136 ASN n 
3 137 ILE n 
3 138 LEU n 
3 139 ALA n 
3 140 ASP n 
3 141 ALA n 
3 142 LEU n 
3 143 GLY n 
3 144 PRO n 
3 145 GLY n 
3 146 VAL n 
3 147 VAL n 
3 148 GLY n 
3 149 ILE n 
3 150 HIS n 
3 151 GLY n 
3 152 ASP n 
3 153 SER n 
3 154 PRO n 
3 155 TYR n 
3 156 TYR n 
3 157 PHE n 
3 158 LEU n 
3 159 THR n 
3 160 SER n 
3 161 ALA n 
3 162 PHE n 
3 163 LEU n 
3 164 THR n 
3 165 ALA n 
3 166 ALA n 
3 167 ILE n 
3 168 ILE n 
3 169 LEU n 
3 170 LEU n 
3 171 HIS n 
3 172 THR n 
3 173 PHE n 
3 174 TRP n 
3 175 GLY n 
3 176 VAL n 
3 177 VAL n 
3 178 PHE n 
3 179 PHE n 
3 180 ASP n 
3 181 ALA n 
3 182 CYS n 
3 183 GLU n 
3 184 ARG n 
3 185 ARG n 
3 186 ARG n 
3 187 TYR n 
3 188 TRP n 
3 189 ALA n 
3 190 LEU n 
3 191 GLY n 
3 192 LEU n 
3 193 VAL n 
3 194 VAL n 
3 195 GLY n 
3 196 SER n 
3 197 HIS n 
3 198 LEU n 
3 199 LEU n 
3 200 THR n 
3 201 SER n 
3 202 GLY n 
3 203 LEU n 
3 204 THR n 
3 205 PHE n 
3 206 LEU n 
3 207 ASN n 
3 208 PRO n 
3 209 TRP n 
3 210 TYR n 
3 211 GLU n 
3 212 ALA n 
3 213 SER n 
3 214 LEU n 
3 215 LEU n 
3 216 PRO n 
3 217 ILE n 
3 218 TYR n 
3 219 ALA n 
3 220 VAL n 
3 221 THR n 
3 222 VAL n 
3 223 SER n 
3 224 MET n 
3 225 GLY n 
3 226 LEU n 
3 227 TRP n 
3 228 ALA n 
3 229 PHE n 
3 230 ILE n 
3 231 THR n 
3 232 ALA n 
3 233 GLY n 
3 234 GLY n 
3 235 SER n 
3 236 LEU n 
3 237 ARG n 
3 238 SER n 
3 239 ILE n 
3 240 GLN n 
3 241 ARG n 
3 242 SER n 
3 243 LEU n 
3 244 LEU n 
3 245 CYS n 
3 246 ARG n 
3 247 ARG n 
3 248 GLN n 
3 249 GLU n 
3 250 ASP n 
3 251 SER n 
3 252 ARG n 
3 253 VAL n 
3 254 MET n 
3 255 VAL n 
3 256 TYR n 
3 257 SER n 
3 258 ALA n 
3 259 LEU n 
3 260 ARG n 
3 261 ILE n 
3 262 PRO n 
3 263 PRO n 
3 264 GLU n 
3 265 ASP n 
4 1   MET n 
4 2   ASN n 
4 3   LEU n 
4 4   GLU n 
4 5   ARG n 
4 6   VAL n 
4 7   SER n 
4 8   ASN n 
4 9   GLU n 
4 10  GLU n 
4 11  LYS n 
4 12  LEU n 
4 13  ASN n 
4 14  LEU n 
4 15  CYS n 
4 16  ARG n 
4 17  LYS n 
4 18  TYR n 
4 19  TYR n 
4 20  LEU n 
4 21  GLY n 
4 22  GLY n 
4 23  PHE n 
4 24  ALA n 
4 25  PHE n 
4 26  LEU n 
4 27  PRO n 
4 28  PHE n 
4 29  LEU n 
4 30  TRP n 
4 31  LEU n 
4 32  VAL n 
4 33  ASN n 
4 34  ILE n 
4 35  PHE n 
4 36  TRP n 
4 37  PHE n 
4 38  PHE n 
4 39  ARG n 
4 40  GLU n 
4 41  ALA n 
4 42  PHE n 
4 43  LEU n 
4 44  VAL n 
4 45  PRO n 
4 46  ALA n 
4 47  TYR n 
4 48  THR n 
4 49  GLU n 
4 50  GLN n 
4 51  SER n 
4 52  GLN n 
4 53  ILE n 
4 54  LYS n 
4 55  GLY n 
4 56  TYR n 
4 57  VAL n 
4 58  TRP n 
4 59  ARG n 
4 60  SER n 
4 61  ALA n 
4 62  VAL n 
4 63  GLY n 
4 64  PHE n 
4 65  LEU n 
4 66  PHE n 
4 67  TRP n 
4 68  VAL n 
4 69  ILE n 
4 70  VAL n 
4 71  LEU n 
4 72  THR n 
4 73  SER n 
4 74  TRP n 
4 75  ILE n 
4 76  THR n 
4 77  ILE n 
4 78  PHE n 
4 79  GLN n 
4 80  ILE n 
4 81  TYR n 
4 82  ARG n 
4 83  PRO n 
4 84  ARG n 
4 85  TRP n 
4 86  GLY n 
4 87  ALA n 
4 88  LEU n 
4 89  GLY n 
4 90  ASP n 
4 91  TYR n 
4 92  LEU n 
4 93  SER n 
4 94  PHE n 
4 95  THR n 
4 96  ILE n 
4 97  PRO n 
4 98  LEU n 
4 99  GLY n 
4 100 THR n 
4 101 PRO n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 709 Human ? 'NCSTN, KIAA0253, UNQ1874/PRO4317'   ? ? ? ? ? ? 'Homo sapiens' 9606 ? HEK293F ? ? 
? ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? PLASMID ? ? ? PMLINK ? ? 
2 1 sample 'Biological sequence' 1 467 Human ? 'PSEN1, AD3, PS1, PSNL1'             ? ? ? ? ? ? 'Homo sapiens' 9606 ? HEK293F ? ? 
? ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? PLASMID ? ? ? PMLINK ? ? 
3 1 sample 'Biological sequence' 1 265 Human ? 'APH1A, PSF, CGI-78, UNQ579/PRO1141' ? ? ? ? ? ? 'Homo sapiens' 9606 ? HEK293F ? ? 
? ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? PLASMID ? ? ? PMLINK ? ? 
4 1 sample 'Biological sequence' 1 101 Human ? 'PSENEN, PEN2, MDS033'               ? ? ? ? ? ? 'Homo sapiens' 9606 ? HEK293F ? ? 
? ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? PLASMID ? ? ? PMLINK ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP NICA_HUMAN  Q92542 ? 1 
;MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEE
DLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFSPSVQCPNDGFGVYSNSYGPEFAHCR
EIQWNSLGNGLAYEDFSFPIFLLEDENETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVISTATCMRRSSIQSTF
SINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALQKAPDVTT
LPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQVEDLLAT
LEKSGAGVPAVILRRPNQSQPLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFV
TDTAKALADVATVLGRALYELAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQDLRSYLGDGPLQHYIAVSSP
TNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLYEYSWVQGPLHSNETDRLPRCVRSTARLARALSPAFELSQW
SSTEYSTWTESRWKDIRARIFLIASKELELITLTVGFGILIFSLIVTYCINAKADVLFIAPREPGAVSY
;
1 
2 UNP PSN1_HUMAN  P49768 ? 2 
;MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQDEEEDEELTLKYGAK
HVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYK
VIHAWLIISSLLLLFFFSFIYLGEVFKTYNVAVDYITVALLIWNFGVVGMISIHWKGPLRLQQAYLIMISALMALVFIKY
LPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAEGDPEAQRRVSKNSKYNAEST
ERESQDTVAENDDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSSSILAGEDPEERGVKLGLGDFIFYSVLVGKASATA
SGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI
;
1 
3 UNP APH1A_HUMAN Q96BI3 ? 3 
;MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSV
LLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTS
AFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQ
RSLLCRRQEDSRVMVYSALRIPPED
;
1 
4 UNP PEN2_HUMAN  Q9NZ42 ? 4 
;MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQI
YRPRWGALGDYLSFTIPLGTP
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5FN2 A 1 ? 709 ? Q92542 1 ? 709 ? 1 709 
2 2 5FN2 B 1 ? 467 ? P49768 1 ? 467 ? 1 467 
3 3 5FN2 C 1 ? 265 ? Q96BI3 1 ? 265 ? 1 265 
4 4 5FN2 D 1 ? 101 ? Q9NZ42 1 ? 101 ? 1 101 
# 
_struct_ref_seq_dif.align_id                     2 
_struct_ref_seq_dif.pdbx_pdb_id_code             5FN2 
_struct_ref_seq_dif.mon_id                       THR 
_struct_ref_seq_dif.pdbx_pdb_strand_id           B 
_struct_ref_seq_dif.seq_num                      256 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P49768 
_struct_ref_seq_dif.db_mon_id                    TYR 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          256 
_struct_ref_seq_dif.details                      conflict 
_struct_ref_seq_dif.pdbx_auth_seq_num            256 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          5FN2 
_exptl.method            'ELECTRON MICROSCOPY' 
_exptl.crystals_number   ? 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 5FN2 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            4.20 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10276 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               10276 
_refine_hist.d_res_high                       4.20 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  5FN2 
_struct.title                     'Cryo-EM structure of gamma secretase in complex with a drug DAPT' 
_struct.pdbx_descriptor           
'NICASTRIN, PRESENILIN-1 (E.C.3.4.23.-), GAMMA-SECRETASE SUBUNIT APH-1A, GAMMA-SECRETASE SUBUNIT PEN-2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        5FN2 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 35  ? TYR A 41  ? SER A 35  TYR A 41  1 ? 7  
HELX_P HELX_P2  2  LYS A 78  ? ASP A 88  ? LYS A 78  ASP A 88  1 ? 11 
HELX_P HELX_P3  3  THR A 104 ? ARG A 114 ? THR A 104 ARG A 114 1 ? 11 
HELX_P HELX_P4  4  GLU A 186 ? ASP A 198 ? GLU A 186 ASP A 198 1 ? 13 
HELX_P HELX_P5  5  SER A 202 ? SER A 206 ? SER A 202 SER A 206 5 ? 5  
HELX_P HELX_P6  6  ALA A 228 ? PHE A 240 ? ALA A 228 PHE A 240 1 ? 13 
HELX_P HELX_P7  7  ALA A 298 ? ALA A 315 ? ALA A 298 ALA A 315 1 ? 18 
HELX_P HELX_P8  8  GLY A 339 ? GLY A 350 ? GLY A 339 GLY A 350 1 ? 12 
HELX_P HELX_P9  9  ASP A 381 ? ASN A 387 ? ASP A 381 ASN A 387 1 ? 7  
HELX_P HELX_P10 10 ASN A 387 ? GLY A 407 ? ASN A 387 GLY A 407 1 ? 21 
HELX_P HELX_P11 11 SER A 426 ? LEU A 431 ? SER A 426 LEU A 431 1 ? 6  
HELX_P HELX_P12 12 GLU A 474 ? ASN A 478 ? GLU A 474 ASN A 478 5 ? 5  
HELX_P HELX_P13 13 THR A 481 ? ALA A 502 ? THR A 481 ALA A 502 1 ? 22 
HELX_P HELX_P14 14 ASP A 514 ? ILE A 527 ? ASP A 514 ILE A 527 1 ? 14 
HELX_P HELX_P15 15 ASN A 531 ? SER A 536 ? ASN A 531 SER A 536 1 ? 6  
HELX_P HELX_P16 16 ASP A 541 ? TYR A 545 ? ASP A 541 TYR A 545 5 ? 5  
HELX_P HELX_P17 17 THR A 561 ? GLY A 576 ? THR A 561 GLY A 576 1 ? 16 
HELX_P HELX_P18 18 THR A 582 ? ASP A 588 ? THR A 582 ASP A 588 1 ? 7  
HELX_P HELX_P19 19 SER A 665 ? LYS A 693 ? SER A 665 LYS A 693 1 ? 29 
HELX_P HELX_P20 20 LYS A 693 ? PHE A 698 ? LYS A 693 PHE A 698 1 ? 6  
HELX_P HELX_P21 21 ALA B 79  ? VAL B 103 ? ALA B 79  VAL B 103 1 ? 25 
HELX_P HELX_P22 22 THR B 124 ? TYR B 156 ? THR B 124 TYR B 156 1 ? 33 
HELX_P HELX_P23 23 TYR B 159 ? ASN B 190 ? TYR B 159 ASN B 190 1 ? 32 
HELX_P HELX_P24 24 TYR B 195 ? TRP B 215 ? TYR B 195 TRP B 215 1 ? 21 
HELX_P HELX_P25 25 PRO B 218 ? LEU B 241 ? PRO B 218 LEU B 241 1 ? 24 
HELX_P HELX_P26 26 PRO B 242 ? CYS B 263 ? PRO B 242 CYS B 263 1 ? 22 
HELX_P HELX_P27 27 PRO B 264 ? GLN B 276 ? PRO B 264 GLN B 276 1 ? 13 
HELX_P HELX_P28 28 GLY B 382 ? THR B 399 ? GLY B 382 THR B 399 1 ? 18 
HELX_P HELX_P29 29 ASP B 403 ? LYS B 429 ? ASP B 403 LYS B 429 1 ? 27 
HELX_P HELX_P30 30 ALA B 434 ? LEU B 452 ? ALA B 434 LEU B 452 1 ? 19 
HELX_P HELX_P31 31 LEU B 452 ? GLN B 464 ? LEU B 452 GLN B 464 1 ? 13 
HELX_P HELX_P32 32 GLY C 2   ? VAL C 25  ? GLY C 2   VAL C 25  1 ? 24 
HELX_P HELX_P33 33 ASP C 28  ? ASP C 61  ? ASP C 28  ASP C 61  1 ? 34 
HELX_P HELX_P34 34 ASP C 64  ? SER C 105 ? ASP C 64  SER C 105 1 ? 42 
HELX_P HELX_P35 35 SER C 113 ? GLY C 143 ? SER C 113 GLY C 143 1 ? 31 
HELX_P HELX_P36 36 TYR C 155 ? ARG C 185 ? TYR C 155 ARG C 185 1 ? 31 
HELX_P HELX_P37 37 TYR C 187 ? LEU C 206 ? TYR C 187 LEU C 206 1 ? 20 
HELX_P HELX_P38 38 SER C 213 ? GLY C 233 ? SER C 213 GLY C 233 1 ? 21 
HELX_P HELX_P39 39 SER C 235 ? LEU C 243 ? SER C 235 LEU C 243 1 ? 9  
HELX_P HELX_P40 40 SER D 7   ? PHE D 23  ? SER D 7   PHE D 23  1 ? 17 
HELX_P HELX_P41 41 LEU D 26  ? PHE D 37  ? LEU D 26  PHE D 37  1 ? 12 
HELX_P HELX_P42 42 PHE D 37  ? LEU D 43  ? PHE D 37  LEU D 43  1 ? 7  
HELX_P HELX_P43 43 GLU D 49  ? ARG D 82  ? GLU D 49  ARG D 82  1 ? 34 
HELX_P HELX_P44 44 GLY D 86  ? LEU D 92  ? GLY D 86  LEU D 92  1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 50  SG ? ? ? 1_555 A CYS 62  SG ? ? A CYS 50  A CYS 62  1_555 ? ? ? ? ? ? ? 2.016 ? 
disulf2 disulf ? ? A CYS 140 SG ? ? ? 1_555 A CYS 159 SG ? ? A CYS 140 A CYS 159 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf3 disulf ? ? A CYS 195 SG ? ? ? 1_555 A CYS 213 SG ? ? A CYS 195 A CYS 213 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf4 disulf ? ? A CYS 230 SG ? ? ? 1_555 A CYS 248 SG ? ? A CYS 230 A CYS 248 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf5 disulf ? ? A CYS 586 SG ? ? ? 1_555 A CYS 620 SG ? ? A CYS 586 A CYS 620 1_555 ? ? ? ? ? ? ? 2.030 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 549 A . ? GLY 549 A PRO 550 A ? PRO 550 A 1 9.49   
2 SER 559 A . ? SER 559 A PRO 560 A ? PRO 560 A 1 -2.98  
3 GLY 111 B . ? GLY 111 B GLN 112 B ? GLN 112 B 1 1.99   
4 THR 122 B . ? THR 122 B GLU 123 B ? GLU 123 B 1 2.46   
5 ARG 157 B . ? ARG 157 B CYS 158 B ? CYS 158 B 1 14.93  
6 CYS 158 B . ? CYS 158 B TYR 159 B ? TYR 159 B 1 -19.81 
7 ASN 279 B . ? ASN 279 B GLU 280 B ? GLU 280 B 1 -1.41  
8 PRO 284 B . ? PRO 284 B ALA 285 B ? ALA 285 B 1 9.51   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 8 ? 
AB ? 4 ? 
AC ? 4 ? 
AD ? 2 ? 
AE ? 2 ? 
AF ? 3 ? 
BA ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? parallel      
AA 5 6 ? parallel      
AA 6 7 ? parallel      
AA 7 8 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? parallel      
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AD 1 2 ? parallel      
AE 1 2 ? parallel      
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
BA 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ILE A 42  ? LEU A 44  ? ILE A 42  LEU A 44  
AA 2 ARG A 657 ? ILE A 663 ? ARG A 657 ILE A 663 
AA 3 LEU A 212 ? PHE A 218 ? LEU A 212 PHE A 218 
AA 4 ASP A 69  ? VAL A 76  ? ASP A 69  VAL A 76  
AA 5 TYR A 94  ? GLU A 99  ? TYR A 94  GLU A 99  
AA 6 ILE A 118 ? SER A 124 ? ILE A 118 SER A 124 
AA 7 ILE A 180 ? LEU A 183 ? ILE A 180 LEU A 183 
AA 8 ALA A 48  ? PRO A 49  ? ALA A 48  PRO A 49  
AB 1 GLN A 59  ? ILE A 60  ? GLN A 59  ILE A 60  
AB 2 LEU A 53  ? LEU A 54  ? LEU A 53  LEU A 54  
AB 3 THR A 649 ? GLU A 650 ? THR A 649 GLU A 650 
AB 4 ASP A 249 ? PRO A 250 ? ASP A 249 PRO A 250 
AC 1 VAL A 275 ? ALA A 278 ? VAL A 275 ALA A 278 
AC 2 ASN A 324 ? PHE A 329 ? ASN A 324 PHE A 329 
AC 3 TYR A 254 ? TRP A 257 ? TYR A 254 TRP A 257 
AC 4 LEU A 627 ? ARG A 629 ? LEU A 627 ARG A 629 
AD 1 SER A 361 ? GLY A 366 ? SER A 361 GLY A 366 
AD 2 SER A 437 ? ALA A 442 ? SER A 437 ALA A 442 
AE 1 GLU A 375 ? TRP A 377 ? GLU A 375 TRP A 377 
AE 2 ILE A 412 ? ARG A 414 ? ILE A 412 ARG A 414 
AF 1 THR A 577 ? VAL A 579 ? THR A 577 VAL A 579 
AF 2 CYS A 620 ? ARG A 622 ? CYS A 620 ARG A 622 
AF 3 TYR A 602 ? TRP A 604 ? TYR A 602 TRP A 604 
BA 1 VAL B 193 ? ASP B 194 ? VAL B 193 ASP B 194 
BA 2 SER D 93  ? THR D 95  ? SER D 93  THR D 95  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 44  ? N LEU A 44  O ALA A 658 ? O ALA A 658 
AA 2 3 N ILE A 663 ? N ILE A 663 O LEU A 212 ? O LEU A 212 
AA 3 4 N LEU A 217 ? N LEU A 217 O ASP A 69  ? O ASP A 69  
AA 4 5 N HIS A 74  ? N HIS A 74  O MET A 95  ? O MET A 95  
AA 5 6 O TYR A 94  ? O TYR A 94  N ALA A 119 ? N ALA A 119 
AA 6 7 N VAL A 123 ? N VAL A 123 O PHE A 181 ? O PHE A 181 
AA 7 8 N LEU A 182 ? N LEU A 182 O ALA A 48  ? O ALA A 48  
AB 1 2 N ILE A 60  ? N ILE A 60  O LEU A 53  ? O LEU A 53  
AB 2 3 N LEU A 54  ? N LEU A 54  O THR A 649 ? O THR A 649 
AB 3 4 N GLU A 650 ? N GLU A 650 O ASP A 249 ? O ASP A 249 
AC 1 2 N VAL A 276 ? N VAL A 276 O ASN A 324 ? O ASN A 324 
AC 2 3 N PHE A 329 ? N PHE A 329 O VAL A 256 ? O VAL A 256 
AC 3 4 N ASN A 255 ? N ASN A 255 O ALA A 628 ? O ALA A 628 
AD 1 2 N PHE A 362 ? N PHE A 362 O SER A 437 ? O SER A 437 
AE 1 2 N LEU A 376 ? N LEU A 376 O ILE A 412 ? O ILE A 412 
AF 1 2 N VAL A 579 ? N VAL A 579 O CYS A 620 ? O CYS A 620 
AF 2 3 N VAL A 621 ? N VAL A 621 O SER A 603 ? O SER A 603 
BA 1 2 O VAL B 193 ? O VAL B 193 N PHE D 94  ? N PHE D 94  
# 
_database_PDB_matrix.entry_id          5FN2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5FN2 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N   . ASN A 1 34  ? 119.560 120.698 136.682 1.00 494.31 ? 34  ASN A N   1 
ATOM 2     C CA  . ASN A 1 34  ? 118.796 119.627 137.400 1.00 479.58 ? 34  ASN A CA  1 
ATOM 3     C C   . ASN A 1 34  ? 118.652 119.974 138.866 1.00 388.56 ? 34  ASN A C   1 
ATOM 4     O O   . ASN A 1 34  ? 119.629 120.365 139.491 1.00 300.41 ? 34  ASN A O   1 
ATOM 5     C CB  . ASN A 1 34  ? 119.502 118.273 137.276 1.00 500.00 ? 34  ASN A CB  1 
ATOM 6     C CG  . ASN A 1 34  ? 119.754 117.871 135.835 1.00 500.00 ? 34  ASN A CG  1 
ATOM 7     O OD1 . ASN A 1 34  ? 120.881 117.547 135.457 1.00 500.00 ? 34  ASN A OD1 1 
ATOM 8     N ND2 . ASN A 1 34  ? 118.705 117.899 135.017 1.00 500.00 ? 34  ASN A ND2 1 
ATOM 9     N N   . SER A 1 35  ? 117.452 119.776 139.414 1.00 394.20 ? 35  SER A N   1 
ATOM 10    C CA  . SER A 1 35  ? 117.102 120.151 140.800 1.00 416.93 ? 35  SER A CA  1 
ATOM 11    C C   . SER A 1 35  ? 118.100 119.640 141.873 1.00 395.15 ? 35  SER A C   1 
ATOM 12    O O   . SER A 1 35  ? 118.125 120.114 143.022 1.00 425.52 ? 35  SER A O   1 
ATOM 13    C CB  . SER A 1 35  ? 115.693 119.657 141.124 1.00 456.94 ? 35  SER A CB  1 
ATOM 14    O OG  . SER A 1 35  ? 115.545 118.293 140.767 1.00 487.15 ? 35  SER A OG  1 
ATOM 15    N N   . VAL A 1 36  ? 118.951 118.696 141.480 1.00 324.06 ? 36  VAL A N   1 
ATOM 16    C CA  . VAL A 1 36  ? 120.034 118.302 142.350 1.00 373.22 ? 36  VAL A CA  1 
ATOM 17    C C   . VAL A 1 36  ? 120.993 119.494 142.614 1.00 354.40 ? 36  VAL A C   1 
ATOM 18    O O   . VAL A 1 36  ? 121.583 119.544 143.696 1.00 313.86 ? 36  VAL A O   1 
ATOM 19    C CB  . VAL A 1 36  ? 120.697 116.977 141.905 1.00 397.36 ? 36  VAL A CB  1 
ATOM 20    C CG1 . VAL A 1 36  ? 121.506 116.382 143.055 1.00 405.15 ? 36  VAL A CG1 1 
ATOM 21    C CG2 . VAL A 1 36  ? 119.637 115.967 141.441 1.00 388.32 ? 36  VAL A CG2 1 
ATOM 22    N N   . GLU A 1 37  ? 121.039 120.504 141.735 1.00 388.40 ? 37  GLU A N   1 
ATOM 23    C CA  . GLU A 1 37  ? 121.666 121.815 142.059 1.00 424.29 ? 37  GLU A CA  1 
ATOM 24    C C   . GLU A 1 37  ? 121.003 122.414 143.280 1.00 330.52 ? 37  GLU A C   1 
ATOM 25    O O   . GLU A 1 37  ? 121.685 122.897 144.191 1.00 282.74 ? 37  GLU A O   1 
ATOM 26    C CB  . GLU A 1 37  ? 121.591 122.811 140.886 1.00 500.00 ? 37  GLU A CB  1 
ATOM 27    C CG  . GLU A 1 37  ? 122.829 122.832 139.991 1.00 500.00 ? 37  GLU A CG  1 
ATOM 28    C CD  . GLU A 1 37  ? 124.039 123.525 140.616 1.00 500.00 ? 37  GLU A CD  1 
ATOM 29    O OE1 . GLU A 1 37  ? 123.869 124.555 141.308 1.00 500.00 ? 37  GLU A OE1 1 
ATOM 30    O OE2 . GLU A 1 37  ? 125.171 123.041 140.396 1.00 500.00 ? 37  GLU A OE2 1 
ATOM 31    N N   . ARG A 1 38  ? 119.671 122.363 143.280 1.00 330.89 ? 38  ARG A N   1 
ATOM 32    C CA  . ARG A 1 38  ? 118.859 122.868 144.401 1.00 338.17 ? 38  ARG A CA  1 
ATOM 33    C C   . ARG A 1 38  ? 119.245 122.144 145.682 1.00 317.22 ? 38  ARG A C   1 
ATOM 34    O O   . ARG A 1 38  ? 119.425 122.789 146.730 1.00 362.79 ? 38  ARG A O   1 
ATOM 35    C CB  . ARG A 1 38  ? 117.335 122.740 144.189 1.00 366.11 ? 38  ARG A CB  1 
ATOM 36    C CG  . ARG A 1 38  ? 116.714 123.433 142.976 1.00 395.09 ? 38  ARG A CG  1 
ATOM 37    C CD  . ARG A 1 38  ? 115.216 123.122 142.924 1.00 458.76 ? 38  ARG A CD  1 
ATOM 38    N NE  . ARG A 1 38  ? 114.467 123.870 141.903 1.00 487.39 ? 38  ARG A NE  1 
ATOM 39    C CZ  . ARG A 1 38  ? 113.135 123.844 141.742 1.00 475.53 ? 38  ARG A CZ  1 
ATOM 40    N NH1 . ARG A 1 38  ? 112.351 123.104 142.534 1.00 459.00 ? 38  ARG A NH1 1 
ATOM 41    N NH2 . ARG A 1 38  ? 112.574 124.572 140.776 1.00 442.18 ? 38  ARG A NH2 1 
ATOM 42    N N   . LYS A 1 39  ? 119.362 120.823 145.568 1.00 372.65 ? 39  LYS A N   1 
ATOM 43    C CA  . LYS A 1 39  ? 119.729 119.968 146.701 1.00 402.52 ? 39  LYS A CA  1 
ATOM 44    C C   . LYS A 1 39  ? 121.074 120.397 147.280 1.00 353.73 ? 39  LYS A C   1 
ATOM 45    O O   . LYS A 1 39  ? 121.232 120.519 148.495 1.00 352.78 ? 39  LYS A O   1 
ATOM 46    C CB  . LYS A 1 39  ? 119.792 118.510 146.248 1.00 452.10 ? 39  LYS A CB  1 
ATOM 47    C CG  . LYS A 1 39  ? 119.557 117.501 147.351 1.00 472.86 ? 39  LYS A CG  1 
ATOM 48    C CD  . LYS A 1 39  ? 118.093 117.115 147.488 1.00 500.00 ? 39  LYS A CD  1 
ATOM 49    C CE  . LYS A 1 39  ? 117.955 115.637 147.822 1.00 500.00 ? 39  LYS A CE  1 
ATOM 50    N NZ  . LYS A 1 39  ? 118.202 114.760 146.638 1.00 500.00 ? 39  LYS A NZ  1 
ATOM 51    N N   . ILE A 1 40  ? 122.016 120.619 146.374 1.00 277.81 ? 40  ILE A N   1 
ATOM 52    C CA  . ILE A 1 40  ? 123.375 121.043 146.710 1.00 297.89 ? 40  ILE A CA  1 
ATOM 53    C C   . ILE A 1 40  ? 123.603 122.565 147.025 1.00 317.10 ? 40  ILE A C   1 
ATOM 54    O O   . ILE A 1 40  ? 123.881 122.943 148.176 1.00 361.65 ? 40  ILE A O   1 
ATOM 55    C CB  . ILE A 1 40  ? 124.394 120.657 145.599 1.00 323.23 ? 40  ILE A CB  1 
ATOM 56    C CG1 . ILE A 1 40  ? 124.313 119.186 145.230 1.00 398.35 ? 40  ILE A CG1 1 
ATOM 57    C CG2 . ILE A 1 40  ? 125.842 120.947 146.013 1.00 268.35 ? 40  ILE A CG2 1 
ATOM 58    C CD1 . ILE A 1 40  ? 124.939 118.871 143.889 1.00 471.23 ? 40  ILE A CD1 1 
ATOM 59    N N   . TYR A 1 41  ? 123.534 123.420 146.001 1.00 319.76 ? 41  TYR A N   1 
ATOM 60    C CA  . TYR A 1 41  ? 124.077 124.800 146.047 1.00 283.05 ? 41  TYR A CA  1 
ATOM 61    C C   . TYR A 1 41  ? 123.031 125.804 146.543 1.00 336.77 ? 41  TYR A C   1 
ATOM 62    O O   . TYR A 1 41  ? 121.873 125.736 146.129 1.00 387.02 ? 41  TYR A O   1 
ATOM 63    C CB  . TYR A 1 41  ? 124.557 125.234 144.636 1.00 319.06 ? 41  TYR A CB  1 
ATOM 64    C CG  . TYR A 1 41  ? 125.756 124.447 144.094 1.00 381.27 ? 41  TYR A CG  1 
ATOM 65    C CD1 . TYR A 1 41  ? 125.612 123.157 143.567 1.00 383.73 ? 41  TYR A CD1 1 
ATOM 66    C CD2 . TYR A 1 41  ? 127.034 124.998 144.097 1.00 408.25 ? 41  TYR A CD2 1 
ATOM 67    C CE1 . TYR A 1 41  ? 126.709 122.434 143.090 1.00 331.88 ? 41  TYR A CE1 1 
ATOM 68    C CE2 . TYR A 1 41  ? 128.135 124.289 143.617 1.00 384.32 ? 41  TYR A CE2 1 
ATOM 69    C CZ  . TYR A 1 41  ? 127.971 123.013 143.117 1.00 344.11 ? 41  TYR A CZ  1 
ATOM 70    O OH  . TYR A 1 41  ? 129.072 122.341 142.653 1.00 302.59 ? 41  TYR A OH  1 
ATOM 71    N N   . ILE A 1 42  ? 123.441 126.735 147.409 1.00 352.11 ? 42  ILE A N   1 
ATOM 72    C CA  . ILE A 1 42  ? 122.591 127.857 147.855 1.00 325.66 ? 42  ILE A CA  1 
ATOM 73    C C   . ILE A 1 42  ? 123.135 129.194 147.293 1.00 320.36 ? 42  ILE A C   1 
ATOM 74    O O   . ILE A 1 42  ? 124.149 129.707 147.770 1.00 280.76 ? 42  ILE A O   1 
ATOM 75    C CB  . ILE A 1 42  ? 122.435 127.850 149.396 1.00 336.75 ? 42  ILE A CB  1 
ATOM 76    C CG1 . ILE A 1 42  ? 121.233 126.981 149.767 1.00 420.67 ? 42  ILE A CG1 1 
ATOM 77    C CG2 . ILE A 1 42  ? 122.236 129.252 149.976 1.00 370.26 ? 42  ILE A CG2 1 
ATOM 78    C CD1 . ILE A 1 42  ? 121.042 126.768 151.253 1.00 478.79 ? 42  ILE A CD1 1 
ATOM 79    N N   . PRO A 1 43  ? 122.453 129.768 146.281 1.00 337.44 ? 43  PRO A N   1 
ATOM 80    C CA  . PRO A 1 43  ? 122.992 130.917 145.537 1.00 362.63 ? 43  PRO A CA  1 
ATOM 81    C C   . PRO A 1 43  ? 122.752 132.266 146.215 1.00 391.23 ? 43  PRO A C   1 
ATOM 82    O O   . PRO A 1 43  ? 121.632 132.542 146.657 1.00 387.81 ? 43  PRO A O   1 
ATOM 83    C CB  . PRO A 1 43  ? 122.216 130.856 144.228 1.00 380.26 ? 43  PRO A CB  1 
ATOM 84    C CG  . PRO A 1 43  ? 120.878 130.336 144.642 1.00 396.75 ? 43  PRO A CG  1 
ATOM 85    C CD  . PRO A 1 43  ? 121.089 129.434 145.834 1.00 342.52 ? 43  PRO A CD  1 
ATOM 86    N N   . LEU A 1 44  ? 123.782 133.110 146.261 1.00 408.37 ? 44  LEU A N   1 
ATOM 87    C CA  . LEU A 1 44  ? 123.697 134.382 146.991 1.00 398.14 ? 44  LEU A CA  1 
ATOM 88    C C   . LEU A 1 44  ? 123.285 135.483 146.022 1.00 415.32 ? 44  LEU A C   1 
ATOM 89    O O   . LEU A 1 44  ? 124.007 135.766 145.062 1.00 433.60 ? 44  LEU A O   1 
ATOM 90    C CB  . LEU A 1 44  ? 125.034 134.694 147.664 1.00 392.84 ? 44  LEU A CB  1 
ATOM 91    C CG  . LEU A 1 44  ? 125.585 133.549 148.530 1.00 363.68 ? 44  LEU A CG  1 
ATOM 92    C CD1 . LEU A 1 44  ? 127.015 133.819 148.967 1.00 339.74 ? 44  LEU A CD1 1 
ATOM 93    C CD2 . LEU A 1 44  ? 124.690 133.303 149.734 1.00 373.93 ? 44  LEU A CD2 1 
ATOM 94    N N   . ASN A 1 45  ? 122.132 136.104 146.285 1.00 414.89 ? 45  ASN A N   1 
ATOM 95    C CA  . ASN A 1 45  ? 121.402 136.891 145.272 1.00 439.46 ? 45  ASN A CA  1 
ATOM 96    C C   . ASN A 1 45  ? 121.649 138.405 145.296 1.00 420.09 ? 45  ASN A C   1 
ATOM 97    O O   . ASN A 1 45  ? 122.148 138.975 144.323 1.00 374.99 ? 45  ASN A O   1 
ATOM 98    C CB  . ASN A 1 45  ? 119.893 136.635 145.395 1.00 437.07 ? 45  ASN A CB  1 
ATOM 99    C CG  . ASN A 1 45  ? 119.541 135.157 145.394 1.00 410.16 ? 45  ASN A CG  1 
ATOM 100   O OD1 . ASN A 1 45  ? 120.049 134.385 144.577 1.00 408.60 ? 45  ASN A OD1 1 
ATOM 101   N ND2 . ASN A 1 45  ? 118.661 134.758 146.317 1.00 387.90 ? 45  ASN A ND2 1 
ATOM 102   N N   . LYS A 1 46  ? 121.284 139.057 146.399 1.00 439.18 ? 46  LYS A N   1 
ATOM 103   C CA  . LYS A 1 46  ? 121.360 140.516 146.504 1.00 447.70 ? 46  LYS A CA  1 
ATOM 104   C C   . LYS A 1 46  ? 122.784 140.910 146.857 1.00 390.60 ? 46  LYS A C   1 
ATOM 105   O O   . LYS A 1 46  ? 123.036 141.477 147.915 1.00 406.13 ? 46  LYS A O   1 
ATOM 106   C CB  . LYS A 1 46  ? 120.385 141.042 147.573 1.00 500.00 ? 46  LYS A CB  1 
ATOM 107   C CG  . LYS A 1 46  ? 118.926 140.663 147.361 1.00 500.00 ? 46  LYS A CG  1 
ATOM 108   C CD  . LYS A 1 46  ? 118.268 141.486 146.260 1.00 500.00 ? 46  LYS A CD  1 
ATOM 109   C CE  . LYS A 1 46  ? 116.957 140.859 145.800 1.00 500.00 ? 46  LYS A CE  1 
ATOM 110   N NZ  . LYS A 1 46  ? 116.025 140.516 146.916 1.00 500.00 ? 46  LYS A NZ  1 
ATOM 111   N N   . THR A 1 47  ? 123.716 140.620 145.958 1.00 340.27 ? 47  THR A N   1 
ATOM 112   C CA  . THR A 1 47  ? 125.139 140.735 146.262 1.00 363.27 ? 47  THR A CA  1 
ATOM 113   C C   . THR A 1 47  ? 125.818 141.539 145.176 1.00 345.48 ? 47  THR A C   1 
ATOM 114   O O   . THR A 1 47  ? 125.203 141.884 144.160 1.00 331.03 ? 47  THR A O   1 
ATOM 115   C CB  . THR A 1 47  ? 125.819 139.348 146.377 1.00 397.08 ? 47  THR A CB  1 
ATOM 116   O OG1 . THR A 1 47  ? 126.010 138.780 145.074 1.00 424.51 ? 47  THR A OG1 1 
ATOM 117   C CG2 . THR A 1 47  ? 124.984 138.394 147.222 1.00 395.72 ? 47  THR A CG2 1 
ATOM 118   N N   . ALA A 1 48  ? 127.092 141.834 145.402 1.00 332.44 ? 48  ALA A N   1 
ATOM 119   C CA  . ALA A 1 48  ? 127.907 142.487 144.393 1.00 336.49 ? 48  ALA A CA  1 
ATOM 120   C C   . ALA A 1 48  ? 129.390 142.221 144.611 1.00 331.29 ? 48  ALA A C   1 
ATOM 121   O O   . ALA A 1 48  ? 129.830 141.958 145.748 1.00 343.66 ? 48  ALA A O   1 
ATOM 122   C CB  . ALA A 1 48  ? 127.631 143.986 144.360 1.00 388.62 ? 48  ALA A CB  1 
ATOM 123   N N   . PRO A 1 49  ? 130.167 142.318 143.518 1.00 324.86 ? 49  PRO A N   1 
ATOM 124   C CA  . PRO A 1 49  ? 131.568 141.953 143.488 1.00 304.48 ? 49  PRO A CA  1 
ATOM 125   C C   . PRO A 1 49  ? 132.456 143.136 143.667 1.00 290.83 ? 49  PRO A C   1 
ATOM 126   O O   . PRO A 1 49  ? 131.991 144.272 143.814 1.00 348.94 ? 49  PRO A O   1 
ATOM 127   C CB  . PRO A 1 49  ? 131.742 141.491 142.049 1.00 299.74 ? 49  PRO A CB  1 
ATOM 128   C CG  . PRO A 1 49  ? 130.893 142.462 141.294 1.00 345.21 ? 49  PRO A CG  1 
ATOM 129   C CD  . PRO A 1 49  ? 129.744 142.838 142.202 1.00 314.96 ? 49  PRO A CD  1 
ATOM 130   N N   . CYS A 1 50  ? 133.740 142.847 143.615 1.00 287.83 ? 50  CYS A N   1 
ATOM 131   C CA  . CYS A 1 50  ? 134.732 143.814 143.249 1.00 356.53 ? 50  CYS A CA  1 
ATOM 132   C C   . CYS A 1 50  ? 135.205 143.374 141.872 1.00 314.39 ? 50  CYS A C   1 
ATOM 133   O O   . CYS A 1 50  ? 135.242 142.188 141.564 1.00 304.79 ? 50  CYS A O   1 
ATOM 134   C CB  . CYS A 1 50  ? 135.851 143.879 144.289 1.00 386.20 ? 50  CYS A CB  1 
ATOM 135   S SG  . CYS A 1 50  ? 137.500 143.574 143.646 1.00 388.78 ? 50  CYS A SG  1 
ATOM 136   N N   . VAL A 1 51  ? 135.553 144.353 141.052 1.00 326.37 ? 51  VAL A N   1 
ATOM 137   C CA  . VAL A 1 51  ? 135.799 144.145 139.637 1.00 325.87 ? 51  VAL A CA  1 
ATOM 138   C C   . VAL A 1 51  ? 137.192 144.673 139.316 1.00 317.87 ? 51  VAL A C   1 
ATOM 139   O O   . VAL A 1 51  ? 137.751 145.503 140.045 1.00 307.34 ? 51  VAL A O   1 
ATOM 140   C CB  . VAL A 1 51  ? 134.719 144.879 138.805 1.00 347.36 ? 51  VAL A CB  1 
ATOM 141   C CG1 . VAL A 1 51  ? 134.656 144.394 137.363 1.00 351.00 ? 51  VAL A CG1 1 
ATOM 142   C CG2 . VAL A 1 51  ? 133.361 144.679 139.442 1.00 348.92 ? 51  VAL A CG2 1 
ATOM 143   N N   . ARG A 1 52  ? 137.756 144.160 138.234 1.00 301.47 ? 52  ARG A N   1 
ATOM 144   C CA  . ARG A 1 52  ? 139.034 144.623 137.751 1.00 306.98 ? 52  ARG A CA  1 
ATOM 145   C C   . ARG A 1 52  ? 138.851 145.815 136.824 1.00 302.29 ? 52  ARG A C   1 
ATOM 146   O O   . ARG A 1 52  ? 138.195 145.724 135.782 1.00 324.04 ? 52  ARG A O   1 
ATOM 147   C CB  . ARG A 1 52  ? 139.779 143.499 137.032 1.00 336.33 ? 52  ARG A CB  1 
ATOM 148   C CG  . ARG A 1 52  ? 141.183 143.876 136.590 1.00 326.32 ? 52  ARG A CG  1 
ATOM 149   C CD  . ARG A 1 52  ? 142.098 142.674 136.504 1.00 325.11 ? 52  ARG A CD  1 
ATOM 150   N NE  . ARG A 1 52  ? 142.623 142.281 137.813 1.00 338.18 ? 52  ARG A NE  1 
ATOM 151   C CZ  . ARG A 1 52  ? 143.643 141.437 138.012 1.00 405.42 ? 52  ARG A CZ  1 
ATOM 152   N NH1 . ARG A 1 52  ? 144.286 140.866 136.990 1.00 408.75 ? 52  ARG A NH1 1 
ATOM 153   N NH2 . ARG A 1 52  ? 144.028 141.158 139.255 1.00 444.30 ? 52  ARG A NH2 1 
ATOM 154   N N   . LEU A 1 53  ? 139.430 146.934 137.227 1.00 298.04 ? 53  LEU A N   1 
ATOM 155   C CA  . LEU A 1 53  ? 139.588 148.086 136.362 1.00 318.69 ? 53  LEU A CA  1 
ATOM 156   C C   . LEU A 1 53  ? 141.086 148.295 136.057 1.00 349.99 ? 53  LEU A C   1 
ATOM 157   O O   . LEU A 1 53  ? 141.962 147.696 136.706 1.00 294.18 ? 53  LEU A O   1 
ATOM 158   C CB  . LEU A 1 53  ? 139.027 149.315 137.058 1.00 336.42 ? 53  LEU A CB  1 
ATOM 159   C CG  . LEU A 1 53  ? 137.522 149.474 137.286 1.00 337.45 ? 53  LEU A CG  1 
ATOM 160   C CD1 . LEU A 1 53  ? 136.708 148.191 137.254 1.00 330.40 ? 53  LEU A CD1 1 
ATOM 161   C CD2 . LEU A 1 53  ? 137.300 150.199 138.608 1.00 363.58 ? 53  LEU A CD2 1 
ATOM 162   N N   . LEU A 1 54  ? 141.392 149.152 135.084 1.00 352.87 ? 54  LEU A N   1 
ATOM 163   C CA  . LEU A 1 54  ? 142.790 149.297 134.671 1.00 335.92 ? 54  LEU A CA  1 
ATOM 164   C C   . LEU A 1 54  ? 143.289 150.721 134.445 1.00 377.37 ? 54  LEU A C   1 
ATOM 165   O O   . LEU A 1 54  ? 142.510 151.655 134.258 1.00 354.06 ? 54  LEU A O   1 
ATOM 166   C CB  . LEU A 1 54  ? 143.040 148.508 133.397 1.00 365.36 ? 54  LEU A CB  1 
ATOM 167   C CG  . LEU A 1 54  ? 142.245 147.229 133.150 1.00 396.39 ? 54  LEU A CG  1 
ATOM 168   C CD1 . LEU A 1 54  ? 142.135 146.955 131.656 1.00 465.71 ? 54  LEU A CD1 1 
ATOM 169   C CD2 . LEU A 1 54  ? 142.878 146.069 133.908 1.00 392.64 ? 54  LEU A CD2 1 
ATOM 170   N N   . ASN A 1 55  ? 144.623 150.812 134.403 1.00 396.17 ? 55  ASN A N   1 
ATOM 171   C CA  . ASN A 1 55  ? 145.411 152.034 134.226 1.00 375.63 ? 55  ASN A CA  1 
ATOM 172   C C   . ASN A 1 55  ? 146.603 151.780 133.297 1.00 334.40 ? 55  ASN A C   1 
ATOM 173   O O   . ASN A 1 55  ? 147.014 150.629 133.065 1.00 244.60 ? 55  ASN A O   1 
ATOM 174   C CB  . ASN A 1 55  ? 145.935 152.549 135.575 1.00 384.84 ? 55  ASN A CB  1 
ATOM 175   C CG  . ASN A 1 55  ? 144.922 153.394 136.333 1.00 397.41 ? 55  ASN A CG  1 
ATOM 176   O OD1 . ASN A 1 55  ? 143.810 153.613 135.863 1.00 404.52 ? 55  ASN A OD1 1 
ATOM 177   N ND2 . ASN A 1 55  ? 145.308 153.885 137.517 1.00 392.91 ? 55  ASN A ND2 1 
ATOM 178   N N   . ALA A 1 56  ? 147.149 152.869 132.764 1.00 357.05 ? 56  ALA A N   1 
ATOM 179   C CA  . ALA A 1 56  ? 148.268 152.818 131.814 1.00 401.74 ? 56  ALA A CA  1 
ATOM 180   C C   . ALA A 1 56  ? 149.426 151.979 132.336 1.00 403.49 ? 56  ALA A C   1 
ATOM 181   O O   . ALA A 1 56  ? 150.100 151.292 131.569 1.00 414.70 ? 56  ALA A O   1 
ATOM 182   C CB  . ALA A 1 56  ? 148.755 154.224 131.512 1.00 446.41 ? 56  ALA A CB  1 
ATOM 183   N N   . THR A 1 57  ? 149.657 152.075 133.643 1.00 404.02 ? 57  THR A N   1 
ATOM 184   C CA  . THR A 1 57  ? 150.635 151.261 134.339 1.00 414.74 ? 57  THR A CA  1 
ATOM 185   C C   . THR A 1 57  ? 149.985 150.090 135.090 1.00 373.21 ? 57  THR A C   1 
ATOM 186   O O   . THR A 1 57  ? 150.626 149.048 135.261 1.00 389.98 ? 57  THR A O   1 
ATOM 187   C CB  . THR A 1 57  ? 151.432 152.120 135.348 1.00 461.79 ? 57  THR A CB  1 
ATOM 188   O OG1 . THR A 1 57  ? 151.740 153.396 134.768 1.00 448.07 ? 57  THR A OG1 1 
ATOM 189   C CG2 . THR A 1 57  ? 152.730 151.423 135.760 1.00 491.91 ? 57  THR A CG2 1 
ATOM 190   N N   . HIS A 1 58  ? 148.729 150.243 135.520 1.00 300.66 ? 58  HIS A N   1 
ATOM 191   C CA  . HIS A 1 58  ? 148.168 149.367 136.552 1.00 318.41 ? 58  HIS A CA  1 
ATOM 192   C C   . HIS A 1 58  ? 146.714 148.878 136.422 1.00 350.90 ? 58  HIS A C   1 
ATOM 193   O O   . HIS A 1 58  ? 145.904 149.430 135.700 1.00 302.70 ? 58  HIS A O   1 
ATOM 194   C CB  . HIS A 1 58  ? 148.346 150.046 137.908 1.00 324.09 ? 58  HIS A CB  1 
ATOM 195   C CG  . HIS A 1 58  ? 149.572 149.612 138.637 1.00 342.78 ? 58  HIS A CG  1 
ATOM 196   N ND1 . HIS A 1 58  ? 150.575 150.487 138.988 1.00 389.70 ? 58  HIS A ND1 1 
ATOM 197   C CD2 . HIS A 1 58  ? 149.957 148.394 139.083 1.00 382.02 ? 58  HIS A CD2 1 
ATOM 198   C CE1 . HIS A 1 58  ? 151.528 149.825 139.621 1.00 445.78 ? 58  HIS A CE1 1 
ATOM 199   N NE2 . HIS A 1 58  ? 151.177 148.554 139.692 1.00 432.37 ? 58  HIS A NE2 1 
ATOM 200   N N   . GLN A 1 59  ? 146.428 147.818 137.174 1.00 377.68 ? 59  GLN A N   1 
ATOM 201   C CA  . GLN A 1 59  ? 145.137 147.132 137.203 1.00 335.41 ? 59  GLN A CA  1 
ATOM 202   C C   . GLN A 1 59  ? 144.766 146.988 138.664 1.00 332.64 ? 59  GLN A C   1 
ATOM 203   O O   . GLN A 1 59  ? 145.650 146.807 139.504 1.00 320.44 ? 59  GLN A O   1 
ATOM 204   C CB  . GLN A 1 59  ? 145.261 145.749 136.555 1.00 386.77 ? 59  GLN A CB  1 
ATOM 205   C CG  . GLN A 1 59  ? 146.163 144.763 137.309 1.00 401.82 ? 59  GLN A CG  1 
ATOM 206   C CD  . GLN A 1 59  ? 146.960 143.849 136.397 1.00 435.52 ? 59  GLN A CD  1 
ATOM 207   O OE1 . GLN A 1 59  ? 146.396 143.088 135.613 1.00 453.19 ? 59  GLN A OE1 1 
ATOM 208   N NE2 . GLN A 1 59  ? 148.286 143.914 136.504 1.00 432.35 ? 59  GLN A NE2 1 
ATOM 209   N N   . ILE A 1 60  ? 143.480 147.062 138.975 1.00 349.69 ? 60  ILE A N   1 
ATOM 210   C CA  . ILE A 1 60  ? 143.032 147.119 140.377 1.00 351.80 ? 60  ILE A CA  1 
ATOM 211   C C   . ILE A 1 60  ? 141.898 146.144 140.652 1.00 349.93 ? 60  ILE A C   1 
ATOM 212   O O   . ILE A 1 60  ? 141.411 145.475 139.748 1.00 362.23 ? 60  ILE A O   1 
ATOM 213   C CB  . ILE A 1 60  ? 142.632 148.562 140.795 1.00 356.15 ? 60  ILE A CB  1 
ATOM 214   C CG1 . ILE A 1 60  ? 141.789 149.242 139.706 1.00 365.19 ? 60  ILE A CG1 1 
ATOM 215   C CG2 . ILE A 1 60  ? 143.880 149.386 141.089 1.00 370.91 ? 60  ILE A CG2 1 
ATOM 216   C CD1 . ILE A 1 60  ? 141.114 150.525 140.141 1.00 346.56 ? 60  ILE A CD1 1 
ATOM 217   N N   . GLY A 1 61  ? 141.520 146.041 141.920 1.00 358.04 ? 61  GLY A N   1 
ATOM 218   C CA  . GLY A 1 61  ? 140.416 145.199 142.332 1.00 356.42 ? 61  GLY A CA  1 
ATOM 219   C C   . GLY A 1 61  ? 140.769 143.721 142.340 1.00 354.91 ? 61  GLY A C   1 
ATOM 220   O O   . GLY A 1 61  ? 141.902 143.324 142.649 1.00 300.05 ? 61  GLY A O   1 
ATOM 221   N N   . CYS A 1 62  ? 139.777 142.917 141.977 1.00 355.00 ? 62  CYS A N   1 
ATOM 222   C CA  . CYS A 1 62  ? 139.800 141.471 142.147 1.00 360.88 ? 62  CYS A CA  1 
ATOM 223   C C   . CYS A 1 62  ? 140.348 140.771 140.915 1.00 380.72 ? 62  CYS A C   1 
ATOM 224   O O   . CYS A 1 62  ? 140.853 141.426 140.003 1.00 413.88 ? 62  CYS A O   1 
ATOM 225   C CB  . CYS A 1 62  ? 138.365 140.991 142.375 1.00 363.55 ? 62  CYS A CB  1 
ATOM 226   S SG  . CYS A 1 62  ? 137.617 141.578 143.902 1.00 334.17 ? 62  CYS A SG  1 
ATOM 227   N N   . GLN A 1 63  ? 140.276 139.438 140.932 1.00 369.53 ? 63  GLN A N   1 
ATOM 228   C CA  . GLN A 1 63  ? 140.174 138.608 139.714 1.00 369.46 ? 63  GLN A CA  1 
ATOM 229   C C   . GLN A 1 63  ? 140.151 137.148 140.127 1.00 349.86 ? 63  GLN A C   1 
ATOM 230   O O   . GLN A 1 63  ? 141.199 136.590 140.443 1.00 353.56 ? 63  GLN A O   1 
ATOM 231   C CB  . GLN A 1 63  ? 141.329 138.855 138.726 1.00 394.35 ? 63  GLN A CB  1 
ATOM 232   C CG  . GLN A 1 63  ? 141.389 137.926 137.515 1.00 388.89 ? 63  GLN A CG  1 
ATOM 233   C CD  . GLN A 1 63  ? 142.444 138.368 136.514 1.00 405.34 ? 63  GLN A CD  1 
ATOM 234   O OE1 . GLN A 1 63  ? 143.642 138.199 136.747 1.00 436.58 ? 63  GLN A OE1 1 
ATOM 235   N NE2 . GLN A 1 63  ? 142.010 138.945 135.402 1.00 372.05 ? 63  GLN A NE2 1 
ATOM 236   N N   . SER A 1 64  ? 138.975 136.524 140.130 1.00 339.72 ? 64  SER A N   1 
ATOM 237   C CA  . SER A 1 64  ? 138.918 135.075 140.341 1.00 337.23 ? 64  SER A CA  1 
ATOM 238   C C   . SER A 1 64  ? 139.481 134.384 139.100 1.00 406.92 ? 64  SER A C   1 
ATOM 239   O O   . SER A 1 64  ? 139.526 134.985 138.023 1.00 431.98 ? 64  SER A O   1 
ATOM 240   C CB  . SER A 1 64  ? 137.483 134.611 140.575 1.00 322.81 ? 64  SER A CB  1 
ATOM 241   O OG  . SER A 1 64  ? 137.424 133.244 140.949 1.00 310.38 ? 64  SER A OG  1 
ATOM 242   N N   . SER A 1 65  ? 139.935 133.142 139.255 1.00 440.60 ? 65  SER A N   1 
ATOM 243   C CA  . SER A 1 65  ? 140.172 132.270 138.104 1.00 438.57 ? 65  SER A CA  1 
ATOM 244   C C   . SER A 1 65  ? 138.844 131.619 137.755 1.00 390.94 ? 65  SER A C   1 
ATOM 245   O O   . SER A 1 65  ? 137.969 131.474 138.614 1.00 370.04 ? 65  SER A O   1 
ATOM 246   C CB  . SER A 1 65  ? 141.222 131.199 138.394 1.00 469.81 ? 65  SER A CB  1 
ATOM 247   O OG  . SER A 1 65  ? 141.532 130.470 137.214 1.00 444.75 ? 65  SER A OG  1 
ATOM 248   N N   . ILE A 1 66  ? 138.705 131.226 136.494 1.00 361.33 ? 66  ILE A N   1 
ATOM 249   C CA  . ILE A 1 66  ? 137.440 130.699 135.980 1.00 380.28 ? 66  ILE A CA  1 
ATOM 250   C C   . ILE A 1 66  ? 137.006 129.447 136.751 1.00 385.10 ? 66  ILE A C   1 
ATOM 251   O O   . ILE A 1 66  ? 137.824 128.796 137.412 1.00 337.88 ? 66  ILE A O   1 
ATOM 252   C CB  . ILE A 1 66  ? 137.531 130.431 134.449 1.00 431.00 ? 66  ILE A CB  1 
ATOM 253   C CG1 . ILE A 1 66  ? 136.147 130.256 133.787 1.00 430.23 ? 66  ILE A CG1 1 
ATOM 254   C CG2 . ILE A 1 66  ? 138.420 129.225 134.150 1.00 468.90 ? 66  ILE A CG2 1 
ATOM 255   C CD1 . ILE A 1 66  ? 135.193 131.426 133.941 1.00 424.15 ? 66  ILE A CD1 1 
ATOM 256   N N   . SER A 1 67  ? 135.702 129.169 136.696 1.00 420.27 ? 67  SER A N   1 
ATOM 257   C CA  . SER A 1 67  ? 135.037 128.040 137.358 1.00 448.86 ? 67  SER A CA  1 
ATOM 258   C C   . SER A 1 67  ? 134.633 128.400 138.789 1.00 441.51 ? 67  SER A C   1 
ATOM 259   O O   . SER A 1 67  ? 134.089 127.558 139.502 1.00 480.67 ? 67  SER A O   1 
ATOM 260   C CB  . SER A 1 67  ? 135.869 126.736 137.316 1.00 465.89 ? 67  SER A CB  1 
ATOM 261   O OG  . SER A 1 67  ? 136.863 126.687 138.328 1.00 459.04 ? 67  SER A OG  1 
ATOM 262   N N   . GLY A 1 68  ? 134.866 129.652 139.188 1.00 427.79 ? 68  GLY A N   1 
ATOM 263   C CA  . GLY A 1 68  ? 134.661 130.090 140.558 1.00 427.05 ? 68  GLY A CA  1 
ATOM 264   C C   . GLY A 1 68  ? 135.719 129.559 141.501 1.00 417.26 ? 68  GLY A C   1 
ATOM 265   O O   . GLY A 1 68  ? 135.873 128.342 141.648 1.00 428.84 ? 68  GLY A O   1 
ATOM 266   N N   . ASP A 1 69  ? 136.457 130.465 142.137 1.00 380.75 ? 69  ASP A N   1 
ATOM 267   C CA  . ASP A 1 69  ? 137.322 130.066 143.235 1.00 359.35 ? 69  ASP A CA  1 
ATOM 268   C C   . ASP A 1 69  ? 136.428 129.502 144.334 1.00 336.83 ? 69  ASP A C   1 
ATOM 269   O O   . ASP A 1 69  ? 135.512 130.179 144.826 1.00 280.30 ? 69  ASP A O   1 
ATOM 270   C CB  . ASP A 1 69  ? 138.162 131.238 143.768 1.00 393.81 ? 69  ASP A CB  1 
ATOM 271   C CG  . ASP A 1 69  ? 139.418 131.503 142.939 1.00 393.48 ? 69  ASP A CG  1 
ATOM 272   O OD1 . ASP A 1 69  ? 140.052 130.539 142.453 1.00 395.43 ? 69  ASP A OD1 1 
ATOM 273   O OD2 . ASP A 1 69  ? 139.787 132.690 142.798 1.00 368.26 ? 69  ASP A OD2 1 
ATOM 274   N N   . THR A 1 70  ? 136.666 128.237 144.658 1.00 349.82 ? 70  THR A N   1 
ATOM 275   C CA  . THR A 1 70  ? 136.019 127.596 145.797 1.00 401.68 ? 70  THR A CA  1 
ATOM 276   C C   . THR A 1 70  ? 136.605 128.112 147.105 1.00 391.50 ? 70  THR A C   1 
ATOM 277   O O   . THR A 1 70  ? 137.698 128.687 147.123 1.00 400.55 ? 70  THR A O   1 
ATOM 278   C CB  . THR A 1 70  ? 136.173 126.055 145.753 1.00 444.21 ? 70  THR A CB  1 
ATOM 279   O OG1 . THR A 1 70  ? 135.462 125.469 146.854 1.00 458.56 ? 70  THR A OG1 1 
ATOM 280   C CG2 . THR A 1 70  ? 137.660 125.608 145.800 1.00 432.98 ? 70  THR A CG2 1 
ATOM 281   N N   . GLY A 1 71  ? 135.887 127.886 148.200 1.00 343.03 ? 71  GLY A N   1 
ATOM 282   C CA  . GLY A 1 71  ? 136.446 128.141 149.519 1.00 333.73 ? 71  GLY A CA  1 
ATOM 283   C C   . GLY A 1 71  ? 135.568 127.687 150.666 1.00 339.02 ? 71  GLY A C   1 
ATOM 284   O O   . GLY A 1 71  ? 134.398 128.043 150.724 1.00 377.30 ? 71  GLY A O   1 
ATOM 285   N N   . VAL A 1 72  ? 136.138 126.888 151.567 1.00 332.13 ? 72  VAL A N   1 
ATOM 286   C CA  . VAL A 1 72  ? 135.508 126.557 152.857 1.00 307.00 ? 72  VAL A CA  1 
ATOM 287   C C   . VAL A 1 72  ? 135.418 127.830 153.685 1.00 301.16 ? 72  VAL A C   1 
ATOM 288   O O   . VAL A 1 72  ? 136.403 128.583 153.769 1.00 301.14 ? 72  VAL A O   1 
ATOM 289   C CB  . VAL A 1 72  ? 136.268 125.422 153.599 1.00 387.16 ? 72  VAL A CB  1 
ATOM 290   C CG1 . VAL A 1 72  ? 137.784 125.657 153.653 1.00 401.04 ? 72  VAL A CG1 1 
ATOM 291   C CG2 . VAL A 1 72  ? 135.689 125.182 154.989 1.00 402.14 ? 72  VAL A CG2 1 
ATOM 292   N N   . ILE A 1 73  ? 134.243 128.111 154.253 1.00 307.51 ? 73  ILE A N   1 
ATOM 293   C CA  . ILE A 1 73  ? 134.035 129.462 154.835 1.00 344.93 ? 73  ILE A CA  1 
ATOM 294   C C   . ILE A 1 73  ? 134.610 129.577 156.245 1.00 354.12 ? 73  ILE A C   1 
ATOM 295   O O   . ILE A 1 73  ? 134.750 128.576 156.948 1.00 353.65 ? 73  ILE A O   1 
ATOM 296   C CB  . ILE A 1 73  ? 132.562 129.980 154.849 1.00 359.49 ? 73  ILE A CB  1 
ATOM 297   C CG1 . ILE A 1 73  ? 131.595 128.923 155.375 1.00 414.82 ? 73  ILE A CG1 1 
ATOM 298   C CG2 . ILE A 1 73  ? 132.113 130.529 153.485 1.00 309.20 ? 73  ILE A CG2 1 
ATOM 299   C CD1 . ILE A 1 73  ? 130.291 129.517 155.844 1.00 437.79 ? 73  ILE A CD1 1 
ATOM 300   N N   . HIS A 1 74  ? 134.947 130.808 156.625 1.00 390.94 ? 74  HIS A N   1 
ATOM 301   C CA  . HIS A 1 74  ? 135.402 131.128 157.977 1.00 411.36 ? 74  HIS A CA  1 
ATOM 302   C C   . HIS A 1 74  ? 134.968 132.550 158.351 1.00 408.05 ? 74  HIS A C   1 
ATOM 303   O O   . HIS A 1 74  ? 135.373 133.521 157.699 1.00 397.87 ? 74  HIS A O   1 
ATOM 304   C CB  . HIS A 1 74  ? 136.925 130.968 158.074 1.00 443.28 ? 74  HIS A CB  1 
ATOM 305   C CG  . HIS A 1 74  ? 137.436 130.824 159.473 1.00 463.18 ? 74  HIS A CG  1 
ATOM 306   N ND1 . HIS A 1 74  ? 137.328 129.650 160.187 1.00 472.78 ? 74  HIS A ND1 1 
ATOM 307   C CD2 . HIS A 1 74  ? 138.063 131.704 160.290 1.00 463.42 ? 74  HIS A CD2 1 
ATOM 308   C CE1 . HIS A 1 74  ? 137.862 129.815 161.385 1.00 466.75 ? 74  HIS A CE1 1 
ATOM 309   N NE2 . HIS A 1 74  ? 138.318 131.051 161.471 1.00 456.67 ? 74  HIS A NE2 1 
ATOM 310   N N   . VAL A 1 75  ? 134.125 132.676 159.377 1.00 411.68 ? 75  VAL A N   1 
ATOM 311   C CA  . VAL A 1 75  ? 133.647 133.998 159.810 1.00 450.20 ? 75  VAL A CA  1 
ATOM 312   C C   . VAL A 1 75  ? 134.660 134.631 160.779 1.00 439.21 ? 75  VAL A C   1 
ATOM 313   O O   . VAL A 1 75  ? 134.972 134.067 161.835 1.00 348.62 ? 75  VAL A O   1 
ATOM 314   C CB  . VAL A 1 75  ? 132.191 133.967 160.362 1.00 477.99 ? 75  VAL A CB  1 
ATOM 315   C CG1 . VAL A 1 75  ? 131.278 133.212 159.396 1.00 470.33 ? 75  VAL A CG1 1 
ATOM 316   C CG2 . VAL A 1 75  ? 132.108 133.382 161.769 1.00 500.00 ? 75  VAL A CG2 1 
ATOM 317   N N   . VAL A 1 76  ? 135.172 135.804 160.398 1.00 459.97 ? 76  VAL A N   1 
ATOM 318   C CA  . VAL A 1 76  ? 136.335 136.416 161.049 1.00 464.32 ? 76  VAL A CA  1 
ATOM 319   C C   . VAL A 1 76  ? 135.899 137.667 161.821 1.00 500.00 ? 76  VAL A C   1 
ATOM 320   O O   . VAL A 1 76  ? 135.411 138.641 161.232 1.00 453.46 ? 76  VAL A O   1 
ATOM 321   C CB  . VAL A 1 76  ? 137.448 136.784 160.029 1.00 423.84 ? 76  VAL A CB  1 
ATOM 322   C CG1 . VAL A 1 76  ? 138.822 136.782 160.697 1.00 370.98 ? 76  VAL A CG1 1 
ATOM 323   C CG2 . VAL A 1 76  ? 137.451 135.822 158.847 1.00 436.08 ? 76  VAL A CG2 1 
ATOM 324   N N   . GLU A 1 77  ? 136.060 137.605 163.145 1.00 500.00 ? 77  GLU A N   1 
ATOM 325   C CA  . GLU A 1 77  ? 135.795 138.722 164.057 1.00 500.00 ? 77  GLU A CA  1 
ATOM 326   C C   . GLU A 1 77  ? 137.130 139.334 164.495 1.00 500.00 ? 77  GLU A C   1 
ATOM 327   O O   . GLU A 1 77  ? 137.412 140.506 164.228 1.00 489.48 ? 77  GLU A O   1 
ATOM 328   C CB  . GLU A 1 77  ? 135.021 138.239 165.297 1.00 500.00 ? 77  GLU A CB  1 
ATOM 329   C CG  . GLU A 1 77  ? 133.847 137.302 165.026 1.00 500.00 ? 77  GLU A CG  1 
ATOM 330   C CD  . GLU A 1 77  ? 133.689 136.242 166.101 1.00 500.00 ? 77  GLU A CD  1 
ATOM 331   O OE1 . GLU A 1 77  ? 133.750 136.587 167.301 1.00 483.68 ? 77  GLU A OE1 1 
ATOM 332   O OE2 . GLU A 1 77  ? 133.507 135.060 165.743 1.00 500.00 ? 77  GLU A OE2 1 
ATOM 333   N N   . LYS A 1 78  ? 137.949 138.506 165.140 1.00 486.14 ? 78  LYS A N   1 
ATOM 334   C CA  . LYS A 1 78  ? 139.210 138.927 165.735 1.00 472.38 ? 78  LYS A CA  1 
ATOM 335   C C   . LYS A 1 78  ? 140.362 138.388 164.910 1.00 472.42 ? 78  LYS A C   1 
ATOM 336   O O   . LYS A 1 78  ? 140.174 137.529 164.048 1.00 478.56 ? 78  LYS A O   1 
ATOM 337   C CB  . LYS A 1 78  ? 139.317 138.452 167.194 1.00 500.00 ? 78  LYS A CB  1 
ATOM 338   C CG  . LYS A 1 78  ? 139.275 136.941 167.430 1.00 500.00 ? 78  LYS A CG  1 
ATOM 339   C CD  . LYS A 1 78  ? 139.406 136.596 168.911 1.00 500.00 ? 78  LYS A CD  1 
ATOM 340   C CE  . LYS A 1 78  ? 138.103 136.780 169.681 1.00 500.00 ? 78  LYS A CE  1 
ATOM 341   N NZ  . LYS A 1 78  ? 138.244 136.477 171.134 1.00 500.00 ? 78  LYS A NZ  1 
ATOM 342   N N   . GLU A 1 79  ? 141.558 138.894 165.194 1.00 497.90 ? 79  GLU A N   1 
ATOM 343   C CA  . GLU A 1 79  ? 142.769 138.538 164.437 1.00 500.00 ? 79  GLU A CA  1 
ATOM 344   C C   . GLU A 1 79  ? 143.266 137.114 164.655 1.00 465.68 ? 79  GLU A C   1 
ATOM 345   O O   . GLU A 1 79  ? 143.969 136.575 163.786 1.00 452.09 ? 79  GLU A O   1 
ATOM 346   C CB  . GLU A 1 79  ? 143.896 139.563 164.687 1.00 500.00 ? 79  GLU A CB  1 
ATOM 347   C CG  . GLU A 1 79  ? 143.910 140.757 163.723 1.00 500.00 ? 79  GLU A CG  1 
ATOM 348   C CD  . GLU A 1 79  ? 142.552 141.423 163.508 1.00 500.00 ? 79  GLU A CD  1 
ATOM 349   O OE1 . GLU A 1 79  ? 141.729 141.465 164.451 1.00 500.00 ? 79  GLU A OE1 1 
ATOM 350   O OE2 . GLU A 1 79  ? 142.307 141.917 162.387 1.00 500.00 ? 79  GLU A OE2 1 
ATOM 351   N N   . GLU A 1 80  ? 142.836 136.505 165.760 1.00 457.47 ? 80  GLU A N   1 
ATOM 352   C CA  . GLU A 1 80  ? 143.130 135.118 166.065 1.00 500.00 ? 80  GLU A CA  1 
ATOM 353   C C   . GLU A 1 80  ? 142.628 134.205 164.938 1.00 471.30 ? 80  GLU A C   1 
ATOM 354   O O   . GLU A 1 80  ? 143.349 133.306 164.470 1.00 331.64 ? 80  GLU A O   1 
ATOM 355   C CB  . GLU A 1 80  ? 142.536 134.710 167.428 1.00 500.00 ? 80  GLU A CB  1 
ATOM 356   C CG  . GLU A 1 80  ? 142.776 135.666 168.612 1.00 500.00 ? 80  GLU A CG  1 
ATOM 357   C CD  . GLU A 1 80  ? 144.124 136.376 168.607 1.00 500.00 ? 80  GLU A CD  1 
ATOM 358   O OE1 . GLU A 1 80  ? 144.289 137.346 167.832 1.00 495.17 ? 80  GLU A OE1 1 
ATOM 359   O OE2 . GLU A 1 80  ? 145.017 135.977 169.386 1.00 500.00 ? 80  GLU A OE2 1 
ATOM 360   N N   . ASP A 1 81  ? 141.393 134.476 164.529 1.00 471.49 ? 81  ASP A N   1 
ATOM 361   C CA  . ASP A 1 81  ? 140.729 133.727 163.462 1.00 462.15 ? 81  ASP A CA  1 
ATOM 362   C C   . ASP A 1 81  ? 141.552 133.799 162.176 1.00 389.98 ? 81  ASP A C   1 
ATOM 363   O O   . ASP A 1 81  ? 141.787 132.782 161.504 1.00 424.26 ? 81  ASP A O   1 
ATOM 364   C CB  . ASP A 1 81  ? 139.323 134.290 163.190 1.00 490.18 ? 81  ASP A CB  1 
ATOM 365   C CG  . ASP A 1 81  ? 138.391 134.199 164.399 1.00 500.00 ? 81  ASP A CG  1 
ATOM 366   O OD1 . ASP A 1 81  ? 138.849 134.443 165.536 1.00 500.00 ? 81  ASP A OD1 1 
ATOM 367   O OD2 . ASP A 1 81  ? 137.193 133.904 164.205 1.00 500.00 ? 81  ASP A OD2 1 
ATOM 368   N N   . LEU A 1 82  ? 141.968 135.024 161.871 1.00 339.88 ? 82  LEU A N   1 
ATOM 369   C CA  . LEU A 1 82  ? 142.775 135.310 160.678 1.00 380.73 ? 82  LEU A CA  1 
ATOM 370   C C   . LEU A 1 82  ? 144.061 134.499 160.704 1.00 431.34 ? 82  LEU A C   1 
ATOM 371   O O   . LEU A 1 82  ? 144.446 133.888 159.701 1.00 461.56 ? 82  LEU A O   1 
ATOM 372   C CB  . LEU A 1 82  ? 143.108 136.793 160.538 1.00 424.43 ? 82  LEU A CB  1 
ATOM 373   C CG  . LEU A 1 82  ? 144.001 137.169 159.347 1.00 445.23 ? 82  LEU A CG  1 
ATOM 374   C CD1 . LEU A 1 82  ? 143.270 136.950 158.030 1.00 467.36 ? 82  LEU A CD1 1 
ATOM 375   C CD2 . LEU A 1 82  ? 144.475 138.604 159.479 1.00 466.08 ? 82  LEU A CD2 1 
ATOM 376   N N   . GLN A 1 83  ? 144.696 134.516 161.864 1.00 462.07 ? 83  GLN A N   1 
ATOM 377   C CA  . GLN A 1 83  ? 145.956 133.797 162.101 1.00 486.66 ? 83  GLN A CA  1 
ATOM 378   C C   . GLN A 1 83  ? 145.764 132.309 161.825 1.00 447.78 ? 83  GLN A C   1 
ATOM 379   O O   . GLN A 1 83  ? 146.582 131.677 161.139 1.00 471.18 ? 83  GLN A O   1 
ATOM 380   C CB  . GLN A 1 83  ? 146.449 134.026 163.534 1.00 500.00 ? 83  GLN A CB  1 
ATOM 381   C CG  . GLN A 1 83  ? 147.953 133.884 163.724 1.00 500.00 ? 83  GLN A CG  1 
ATOM 382   C CD  . GLN A 1 83  ? 148.467 134.712 164.895 1.00 500.00 ? 83  GLN A CD  1 
ATOM 383   O OE1 . GLN A 1 83  ? 148.379 135.942 164.887 1.00 500.00 ? 83  GLN A OE1 1 
ATOM 384   N NE2 . GLN A 1 83  ? 149.009 134.040 165.906 1.00 500.00 ? 83  GLN A NE2 1 
ATOM 385   N N   . TRP A 1 84  ? 144.673 131.789 162.372 1.00 418.81 ? 84  TRP A N   1 
ATOM 386   C CA  . TRP A 1 84  ? 144.305 130.376 162.225 1.00 444.07 ? 84  TRP A CA  1 
ATOM 387   C C   . TRP A 1 84  ? 144.165 130.020 160.747 1.00 411.90 ? 84  TRP A C   1 
ATOM 388   O O   . TRP A 1 84  ? 144.684 128.997 160.281 1.00 307.76 ? 84  TRP A O   1 
ATOM 389   C CB  . TRP A 1 84  ? 142.994 130.043 162.964 1.00 500.00 ? 84  TRP A CB  1 
ATOM 390   C CG  . TRP A 1 84  ? 142.087 129.045 162.242 1.00 500.00 ? 84  TRP A CG  1 
ATOM 391   C CD1 . TRP A 1 84  ? 141.110 129.333 161.322 1.00 484.48 ? 84  TRP A CD1 1 
ATOM 392   C CD2 . TRP A 1 84  ? 142.085 127.624 162.390 1.00 488.88 ? 84  TRP A CD2 1 
ATOM 393   N NE1 . TRP A 1 84  ? 140.507 128.180 160.891 1.00 472.23 ? 84  TRP A NE1 1 
ATOM 394   C CE2 . TRP A 1 84  ? 141.082 127.115 161.533 1.00 481.24 ? 84  TRP A CE2 1 
ATOM 395   C CE3 . TRP A 1 84  ? 142.830 126.728 163.168 1.00 467.75 ? 84  TRP A CE3 1 
ATOM 396   C CZ2 . TRP A 1 84  ? 140.805 125.750 161.431 1.00 490.04 ? 84  TRP A CZ2 1 
ATOM 397   C CZ3 . TRP A 1 84  ? 142.554 125.371 163.065 1.00 491.69 ? 84  TRP A CZ3 1 
ATOM 398   C CH2 . TRP A 1 84  ? 141.547 124.895 162.204 1.00 492.04 ? 84  TRP A CH2 1 
ATOM 399   N N   . VAL A 1 85  ? 143.454 130.892 160.046 1.00 408.27 ? 85  VAL A N   1 
ATOM 400   C CA  . VAL A 1 85  ? 143.192 130.742 158.611 1.00 389.07 ? 85  VAL A CA  1 
ATOM 401   C C   . VAL A 1 85  ? 144.511 130.670 157.847 1.00 368.91 ? 85  VAL A C   1 
ATOM 402   O O   . VAL A 1 85  ? 144.748 129.808 156.989 1.00 389.21 ? 85  VAL A O   1 
ATOM 403   C CB  . VAL A 1 85  ? 142.297 131.896 158.074 1.00 401.41 ? 85  VAL A CB  1 
ATOM 404   C CG1 . VAL A 1 85  ? 142.498 132.146 156.573 1.00 407.10 ? 85  VAL A CG1 1 
ATOM 405   C CG2 . VAL A 1 85  ? 140.831 131.620 158.410 1.00 376.88 ? 85  VAL A CG2 1 
ATOM 406   N N   . LEU A 1 86  ? 145.400 131.587 158.193 1.00 380.36 ? 86  LEU A N   1 
ATOM 407   C CA  . LEU A 1 86  ? 146.753 131.581 157.586 1.00 405.60 ? 86  LEU A CA  1 
ATOM 408   C C   . LEU A 1 86  ? 147.725 130.491 158.114 1.00 457.16 ? 86  LEU A C   1 
ATOM 409   O O   . LEU A 1 86  ? 148.121 129.570 157.373 1.00 431.82 ? 86  LEU A O   1 
ATOM 410   C CB  . LEU A 1 86  ? 147.390 132.973 157.674 1.00 427.07 ? 86  LEU A CB  1 
ATOM 411   C CG  . LEU A 1 86  ? 146.921 134.030 156.661 1.00 422.90 ? 86  LEU A CG  1 
ATOM 412   C CD1 . LEU A 1 86  ? 146.629 133.458 155.281 1.00 459.47 ? 86  LEU A CD1 1 
ATOM 413   C CD2 . LEU A 1 86  ? 145.690 134.768 157.151 1.00 412.53 ? 86  LEU A CD2 1 
ATOM 414   N N   . THR A 1 87  ? 148.167 130.630 159.363 1.00 498.20 ? 87  THR A N   1 
ATOM 415   C CA  . THR A 1 87  ? 149.278 129.816 159.880 1.00 497.49 ? 87  THR A CA  1 
ATOM 416   C C   . THR A 1 87  ? 148.915 128.347 160.172 1.00 467.93 ? 87  THR A C   1 
ATOM 417   O O   . THR A 1 87  ? 149.758 127.460 160.003 1.00 366.46 ? 87  THR A O   1 
ATOM 418   C CB  . THR A 1 87  ? 149.940 130.483 161.112 1.00 500.00 ? 87  THR A CB  1 
ATOM 419   O OG1 . THR A 1 87  ? 151.259 129.951 161.290 1.00 500.00 ? 87  THR A OG1 1 
ATOM 420   C CG2 . THR A 1 87  ? 149.125 130.282 162.403 1.00 500.00 ? 87  THR A CG2 1 
ATOM 421   N N   . ASP A 1 88  ? 147.673 128.098 160.593 1.00 490.13 ? 88  ASP A N   1 
ATOM 422   C CA  . ASP A 1 88  ? 147.197 126.743 160.887 1.00 500.00 ? 88  ASP A CA  1 
ATOM 423   C C   . ASP A 1 88  ? 146.592 126.117 159.623 1.00 500.00 ? 88  ASP A C   1 
ATOM 424   O O   . ASP A 1 88  ? 147.129 125.135 159.104 1.00 488.17 ? 88  ASP A O   1 
ATOM 425   C CB  . ASP A 1 88  ? 146.192 126.767 162.052 1.00 500.00 ? 88  ASP A CB  1 
ATOM 426   C CG  . ASP A 1 88  ? 146.081 125.428 162.756 1.00 500.00 ? 88  ASP A CG  1 
ATOM 427   O OD1 . ASP A 1 88  ? 145.513 124.486 162.168 1.00 500.00 ? 88  ASP A OD1 1 
ATOM 428   O OD2 . ASP A 1 88  ? 146.556 125.321 163.907 1.00 500.00 ? 88  ASP A OD2 1 
ATOM 429   N N   . GLY A 1 89  ? 145.500 126.715 159.133 1.00 500.00 ? 89  GLY A N   1 
ATOM 430   C CA  . GLY A 1 89  ? 144.778 126.289 157.920 1.00 486.04 ? 89  GLY A CA  1 
ATOM 431   C C   . GLY A 1 89  ? 144.840 124.822 157.519 1.00 467.55 ? 89  GLY A C   1 
ATOM 432   O O   . GLY A 1 89  ? 145.563 124.472 156.585 1.00 462.50 ? 89  GLY A O   1 
ATOM 433   N N   . PRO A 1 90  ? 144.094 123.951 158.228 1.00 457.71 ? 90  PRO A N   1 
ATOM 434   C CA  . PRO A 1 90  ? 144.037 122.533 157.844 1.00 438.27 ? 90  PRO A CA  1 
ATOM 435   C C   . PRO A 1 90  ? 143.295 122.247 156.535 1.00 423.05 ? 90  PRO A C   1 
ATOM 436   O O   . PRO A 1 90  ? 143.555 121.216 155.911 1.00 413.10 ? 90  PRO A O   1 
ATOM 437   C CB  . PRO A 1 90  ? 143.282 121.875 159.008 1.00 459.09 ? 90  PRO A CB  1 
ATOM 438   C CG  . PRO A 1 90  ? 143.336 122.849 160.127 1.00 475.02 ? 90  PRO A CG  1 
ATOM 439   C CD  . PRO A 1 90  ? 143.383 124.202 159.495 1.00 466.68 ? 90  PRO A CD  1 
ATOM 440   N N   . ASN A 1 91  ? 142.384 123.142 156.139 1.00 415.20 ? 91  ASN A N   1 
ATOM 441   C CA  . ASN A 1 91  ? 141.491 122.940 154.990 1.00 399.14 ? 91  ASN A CA  1 
ATOM 442   C C   . ASN A 1 91  ? 141.744 124.027 153.913 1.00 374.33 ? 91  ASN A C   1 
ATOM 443   O O   . ASN A 1 91  ? 140.793 124.554 153.324 1.00 327.23 ? 91  ASN A O   1 
ATOM 444   C CB  . ASN A 1 91  ? 140.030 122.951 155.480 1.00 387.64 ? 91  ASN A CB  1 
ATOM 445   C CG  . ASN A 1 91  ? 139.836 122.225 156.828 1.00 386.67 ? 91  ASN A CG  1 
ATOM 446   O OD1 . ASN A 1 91  ? 140.433 121.176 157.100 1.00 319.81 ? 91  ASN A OD1 1 
ATOM 447   N ND2 . ASN A 1 91  ? 138.984 122.789 157.669 1.00 399.64 ? 91  ASN A ND2 1 
ATOM 448   N N   . PRO A 1 92  ? 143.044 124.266 153.592 1.00 410.33 ? 92  PRO A N   1 
ATOM 449   C CA  . PRO A 1 92  ? 143.764 125.501 153.190 1.00 419.25 ? 92  PRO A CA  1 
ATOM 450   C C   . PRO A 1 92  ? 143.071 126.640 152.414 1.00 408.09 ? 92  PRO A C   1 
ATOM 451   O O   . PRO A 1 92  ? 143.075 127.757 152.905 1.00 402.12 ? 92  PRO A O   1 
ATOM 452   C CB  . PRO A 1 92  ? 144.990 124.979 152.408 1.00 456.15 ? 92  PRO A CB  1 
ATOM 453   C CG  . PRO A 1 92  ? 144.799 123.511 152.260 1.00 472.79 ? 92  PRO A CG  1 
ATOM 454   C CD  . PRO A 1 92  ? 143.916 123.093 153.388 1.00 448.29 ? 92  PRO A CD  1 
ATOM 455   N N   . PRO A 1 93  ? 142.545 126.389 151.200 1.00 393.47 ? 93  PRO A N   1 
ATOM 456   C CA  . PRO A 1 93  ? 141.957 127.506 150.446 1.00 385.18 ? 93  PRO A CA  1 
ATOM 457   C C   . PRO A 1 93  ? 140.619 127.963 151.036 1.00 393.30 ? 93  PRO A C   1 
ATOM 458   O O   . PRO A 1 93  ? 139.567 127.412 150.704 1.00 374.14 ? 93  PRO A O   1 
ATOM 459   C CB  . PRO A 1 93  ? 141.786 126.917 149.048 1.00 423.86 ? 93  PRO A CB  1 
ATOM 460   C CG  . PRO A 1 93  ? 141.562 125.465 149.298 1.00 456.57 ? 93  PRO A CG  1 
ATOM 461   C CD  . PRO A 1 93  ? 142.451 125.122 150.455 1.00 424.11 ? 93  PRO A CD  1 
ATOM 462   N N   . TYR A 1 94  ? 140.677 128.956 151.922 1.00 401.26 ? 94  TYR A N   1 
ATOM 463   C CA  . TYR A 1 94  ? 139.495 129.399 152.670 1.00 407.78 ? 94  TYR A CA  1 
ATOM 464   C C   . TYR A 1 94  ? 138.790 130.567 151.994 1.00 377.63 ? 94  TYR A C   1 
ATOM 465   O O   . TYR A 1 94  ? 139.425 131.382 151.325 1.00 349.19 ? 94  TYR A O   1 
ATOM 466   C CB  . TYR A 1 94  ? 139.870 129.795 154.110 1.00 426.22 ? 94  TYR A CB  1 
ATOM 467   C CG  . TYR A 1 94  ? 140.124 128.616 155.029 1.00 444.44 ? 94  TYR A CG  1 
ATOM 468   C CD1 . TYR A 1 94  ? 139.081 128.005 155.726 1.00 424.29 ? 94  TYR A CD1 1 
ATOM 469   C CD2 . TYR A 1 94  ? 141.414 128.115 155.209 1.00 449.53 ? 94  TYR A CD2 1 
ATOM 470   C CE1 . TYR A 1 94  ? 139.319 126.923 156.564 1.00 412.37 ? 94  TYR A CE1 1 
ATOM 471   C CE2 . TYR A 1 94  ? 141.663 127.032 156.038 1.00 398.96 ? 94  TYR A CE2 1 
ATOM 472   C CZ  . TYR A 1 94  ? 140.616 126.443 156.716 1.00 405.82 ? 94  TYR A CZ  1 
ATOM 473   O OH  . TYR A 1 94  ? 140.865 125.376 157.539 1.00 435.42 ? 94  TYR A OH  1 
ATOM 474   N N   . MET A 1 95  ? 137.471 130.617 152.163 1.00 360.87 ? 95  MET A N   1 
ATOM 475   C CA  . MET A 1 95  ? 136.713 131.859 152.011 1.00 352.40 ? 95  MET A CA  1 
ATOM 476   C C   . MET A 1 95  ? 136.494 132.404 153.408 1.00 367.96 ? 95  MET A C   1 
ATOM 477   O O   . MET A 1 95  ? 136.399 131.635 154.376 1.00 353.29 ? 95  MET A O   1 
ATOM 478   C CB  . MET A 1 95  ? 135.373 131.632 151.321 1.00 395.69 ? 95  MET A CB  1 
ATOM 479   C CG  . MET A 1 95  ? 135.454 131.630 149.805 1.00 450.84 ? 95  MET A CG  1 
ATOM 480   S SD  . MET A 1 95  ? 135.260 133.256 149.053 1.00 471.35 ? 95  MET A SD  1 
ATOM 481   C CE  . MET A 1 95  ? 135.598 132.854 147.344 1.00 484.25 ? 95  MET A CE  1 
ATOM 482   N N   . VAL A 1 96  ? 136.423 133.730 153.512 1.00 389.70 ? 96  VAL A N   1 
ATOM 483   C CA  . VAL A 1 96  ? 136.291 134.401 154.808 1.00 385.45 ? 96  VAL A CA  1 
ATOM 484   C C   . VAL A 1 96  ? 135.179 135.430 154.808 1.00 354.09 ? 96  VAL A C   1 
ATOM 485   O O   . VAL A 1 96  ? 134.940 136.103 153.795 1.00 322.55 ? 96  VAL A O   1 
ATOM 486   C CB  . VAL A 1 96  ? 137.602 135.070 155.282 1.00 381.38 ? 96  VAL A CB  1 
ATOM 487   C CG1 . VAL A 1 96  ? 138.580 134.019 155.794 1.00 375.95 ? 96  VAL A CG1 1 
ATOM 488   C CG2 . VAL A 1 96  ? 138.228 135.921 154.182 1.00 363.34 ? 96  VAL A CG2 1 
ATOM 489   N N   . LEU A 1 97  ? 134.513 135.540 155.957 1.00 337.71 ? 97  LEU A N   1 
ATOM 490   C CA  . LEU A 1 97  ? 133.372 136.431 156.100 1.00 406.16 ? 97  LEU A CA  1 
ATOM 491   C C   . LEU A 1 97  ? 133.664 137.460 157.193 1.00 440.57 ? 97  LEU A C   1 
ATOM 492   O O   . LEU A 1 97  ? 133.757 137.124 158.373 1.00 470.23 ? 97  LEU A O   1 
ATOM 493   C CB  . LEU A 1 97  ? 132.087 135.630 156.379 1.00 413.25 ? 97  LEU A CB  1 
ATOM 494   C CG  . LEU A 1 97  ? 130.784 136.226 155.801 1.00 428.65 ? 97  LEU A CG  1 
ATOM 495   C CD1 . LEU A 1 97  ? 130.043 135.210 154.943 1.00 401.49 ? 97  LEU A CD1 1 
ATOM 496   C CD2 . LEU A 1 97  ? 129.862 136.791 156.879 1.00 436.37 ? 97  LEU A CD2 1 
ATOM 497   N N   . LEU A 1 98  ? 133.834 138.710 156.770 1.00 439.48 ? 98  LEU A N   1 
ATOM 498   C CA  . LEU A 1 98  ? 134.055 139.828 157.674 1.00 413.82 ? 98  LEU A CA  1 
ATOM 499   C C   . LEU A 1 98  ? 132.753 140.582 157.843 1.00 418.52 ? 98  LEU A C   1 
ATOM 500   O O   . LEU A 1 98  ? 131.906 140.588 156.944 1.00 422.49 ? 98  LEU A O   1 
ATOM 501   C CB  . LEU A 1 98  ? 135.094 140.785 157.084 1.00 427.94 ? 98  LEU A CB  1 
ATOM 502   C CG  . LEU A 1 98  ? 136.343 140.170 156.457 1.00 482.25 ? 98  LEU A CG  1 
ATOM 503   C CD1 . LEU A 1 98  ? 137.280 141.267 155.977 1.00 500.00 ? 98  LEU A CD1 1 
ATOM 504   C CD2 . LEU A 1 98  ? 137.047 139.249 157.441 1.00 495.96 ? 98  LEU A CD2 1 
ATOM 505   N N   . GLU A 1 99  ? 132.596 141.215 158.999 1.00 439.26 ? 99  GLU A N   1 
ATOM 506   C CA  . GLU A 1 99  ? 131.704 142.369 159.115 1.00 460.24 ? 99  GLU A CA  1 
ATOM 507   C C   . GLU A 1 99  ? 132.461 143.557 158.520 1.00 390.17 ? 99  GLU A C   1 
ATOM 508   O O   . GLU A 1 99  ? 133.702 143.549 158.446 1.00 345.71 ? 99  GLU A O   1 
ATOM 509   C CB  . GLU A 1 99  ? 131.317 142.637 160.574 1.00 500.00 ? 99  GLU A CB  1 
ATOM 510   C CG  . GLU A 1 99  ? 130.302 141.649 161.158 1.00 500.00 ? 99  GLU A CG  1 
ATOM 511   C CD  . GLU A 1 99  ? 128.850 142.122 161.094 1.00 500.00 ? 99  GLU A CD  1 
ATOM 512   O OE1 . GLU A 1 99  ? 128.580 143.311 161.379 1.00 500.00 ? 99  GLU A OE1 1 
ATOM 513   O OE2 . GLU A 1 99  ? 127.966 141.292 160.787 1.00 500.00 ? 99  GLU A OE2 1 
ATOM 514   N N   . SER A 1 100 ? 131.728 144.576 158.089 1.00 330.64 ? 100 SER A N   1 
ATOM 515   C CA  . SER A 1 100 ? 132.368 145.703 157.398 1.00 398.45 ? 100 SER A CA  1 
ATOM 516   C C   . SER A 1 100 ? 133.328 146.527 158.273 1.00 414.67 ? 100 SER A C   1 
ATOM 517   O O   . SER A 1 100 ? 134.276 147.121 157.754 1.00 357.58 ? 100 SER A O   1 
ATOM 518   C CB  . SER A 1 100 ? 131.318 146.612 156.773 1.00 415.15 ? 100 SER A CB  1 
ATOM 519   O OG  . SER A 1 100 ? 131.885 147.389 155.745 1.00 436.99 ? 100 SER A OG  1 
ATOM 520   N N   . LYS A 1 101 ? 133.077 146.545 159.587 1.00 470.37 ? 101 LYS A N   1 
ATOM 521   C CA  . LYS A 1 101 ? 133.889 147.290 160.576 1.00 486.20 ? 101 LYS A CA  1 
ATOM 522   C C   . LYS A 1 101 ? 135.378 146.996 160.468 1.00 425.66 ? 101 LYS A C   1 
ATOM 523   O O   . LYS A 1 101 ? 136.203 147.910 160.376 1.00 394.24 ? 101 LYS A O   1 
ATOM 524   C CB  . LYS A 1 101 ? 133.468 146.930 162.010 1.00 500.00 ? 101 LYS A CB  1 
ATOM 525   C CG  . LYS A 1 101 ? 132.064 147.352 162.433 1.00 500.00 ? 101 LYS A CG  1 
ATOM 526   C CD  . LYS A 1 101 ? 131.752 146.927 163.868 1.00 500.00 ? 101 LYS A CD  1 
ATOM 527   C CE  . LYS A 1 101 ? 131.852 145.418 164.078 1.00 500.00 ? 101 LYS A CE  1 
ATOM 528   N NZ  . LYS A 1 101 ? 131.178 144.954 165.321 1.00 500.00 ? 101 LYS A NZ  1 
ATOM 529   N N   . HIS A 1 102 ? 135.698 145.706 160.476 1.00 387.78 ? 102 HIS A N   1 
ATOM 530   C CA  . HIS A 1 102 ? 137.078 145.238 160.554 1.00 392.95 ? 102 HIS A CA  1 
ATOM 531   C C   . HIS A 1 102 ? 137.780 145.349 159.211 1.00 391.22 ? 102 HIS A C   1 
ATOM 532   O O   . HIS A 1 102 ? 139.010 145.371 159.165 1.00 391.85 ? 102 HIS A O   1 
ATOM 533   C CB  . HIS A 1 102 ? 137.132 143.794 161.054 1.00 407.03 ? 102 HIS A CB  1 
ATOM 534   C CG  . HIS A 1 102 ? 136.444 143.591 162.366 1.00 449.57 ? 102 HIS A CG  1 
ATOM 535   N ND1 . HIS A 1 102 ? 135.094 143.336 162.466 1.00 463.82 ? 102 HIS A ND1 1 
ATOM 536   C CD2 . HIS A 1 102 ? 136.914 143.631 163.633 1.00 500.00 ? 102 HIS A CD2 1 
ATOM 537   C CE1 . HIS A 1 102 ? 134.762 143.217 163.739 1.00 482.60 ? 102 HIS A CE1 1 
ATOM 538   N NE2 . HIS A 1 102 ? 135.849 143.393 164.468 1.00 500.00 ? 102 HIS A NE2 1 
ATOM 539   N N   . PHE A 1 103 ? 136.994 145.415 158.132 1.00 385.03 ? 103 PHE A N   1 
ATOM 540   C CA  . PHE A 1 103 ? 137.513 145.551 156.770 1.00 403.38 ? 103 PHE A CA  1 
ATOM 541   C C   . PHE A 1 103 ? 138.288 146.864 156.597 1.00 388.17 ? 103 PHE A C   1 
ATOM 542   O O   . PHE A 1 103 ? 137.702 147.946 156.639 1.00 424.14 ? 103 PHE A O   1 
ATOM 543   C CB  . PHE A 1 103 ? 136.350 145.455 155.771 1.00 406.67 ? 103 PHE A CB  1 
ATOM 544   C CG  . PHE A 1 103 ? 136.769 145.452 154.327 1.00 422.78 ? 103 PHE A CG  1 
ATOM 545   C CD1 . PHE A 1 103 ? 137.773 144.599 153.872 1.00 410.61 ? 103 PHE A CD1 1 
ATOM 546   C CD2 . PHE A 1 103 ? 136.132 146.284 153.406 1.00 439.09 ? 103 PHE A CD2 1 
ATOM 547   C CE1 . PHE A 1 103 ? 138.145 144.592 152.538 1.00 413.97 ? 103 PHE A CE1 1 
ATOM 548   C CE2 . PHE A 1 103 ? 136.502 146.279 152.069 1.00 440.64 ? 103 PHE A CE2 1 
ATOM 549   C CZ  . PHE A 1 103 ? 137.511 145.431 151.633 1.00 435.80 ? 103 PHE A CZ  1 
ATOM 550   N N   . THR A 1 104 ? 139.605 146.752 156.418 1.00 370.21 ? 104 THR A N   1 
ATOM 551   C CA  . THR A 1 104 ? 140.520 147.899 156.489 1.00 400.17 ? 104 THR A CA  1 
ATOM 552   C C   . THR A 1 104 ? 141.824 147.602 155.730 1.00 390.78 ? 104 THR A C   1 
ATOM 553   O O   . THR A 1 104 ? 141.878 146.627 154.988 1.00 395.67 ? 104 THR A O   1 
ATOM 554   C CB  . THR A 1 104 ? 140.805 148.295 157.961 1.00 455.53 ? 104 THR A CB  1 
ATOM 555   O OG1 . THR A 1 104 ? 141.504 149.547 158.000 1.00 478.29 ? 104 THR A OG1 1 
ATOM 556   C CG2 . THR A 1 104 ? 141.629 147.226 158.688 1.00 461.06 ? 104 THR A CG2 1 
ATOM 557   N N   . ARG A 1 105 ? 142.864 148.417 155.927 1.00 410.99 ? 105 ARG A N   1 
ATOM 558   C CA  . ARG A 1 105 ? 143.966 148.478 154.984 1.00 439.84 ? 105 ARG A CA  1 
ATOM 559   C C   . ARG A 1 105 ? 144.991 147.451 155.420 1.00 413.24 ? 105 ARG A C   1 
ATOM 560   O O   . ARG A 1 105 ? 145.429 146.622 154.609 1.00 417.79 ? 105 ARG A O   1 
ATOM 561   C CB  . ARG A 1 105 ? 144.597 149.883 154.973 1.00 455.86 ? 105 ARG A CB  1 
ATOM 562   C CG  . ARG A 1 105 ? 145.703 150.110 153.942 1.00 451.25 ? 105 ARG A CG  1 
ATOM 563   C CD  . ARG A 1 105 ? 145.192 149.915 152.522 1.00 459.20 ? 105 ARG A CD  1 
ATOM 564   N NE  . ARG A 1 105 ? 146.012 150.580 151.509 1.00 441.03 ? 105 ARG A NE  1 
ATOM 565   C CZ  . ARG A 1 105 ? 147.181 150.139 151.042 1.00 416.76 ? 105 ARG A CZ  1 
ATOM 566   N NH1 . ARG A 1 105 ? 147.736 149.018 151.500 1.00 421.70 ? 105 ARG A NH1 1 
ATOM 567   N NH2 . ARG A 1 105 ? 147.817 150.843 150.105 1.00 407.39 ? 105 ARG A NH2 1 
ATOM 568   N N   . ASP A 1 106 ? 145.401 147.580 156.682 1.00 457.34 ? 106 ASP A N   1 
ATOM 569   C CA  . ASP A 1 106 ? 146.463 146.735 157.246 1.00 500.00 ? 106 ASP A CA  1 
ATOM 570   C C   . ASP A 1 106 ? 146.064 145.269 157.163 1.00 474.73 ? 106 ASP A C   1 
ATOM 571   O O   . ASP A 1 106 ? 146.876 144.423 156.756 1.00 492.98 ? 106 ASP A O   1 
ATOM 572   C CB  . ASP A 1 106 ? 146.841 147.160 158.674 1.00 500.00 ? 106 ASP A CB  1 
ATOM 573   C CG  . ASP A 1 106 ? 147.720 148.420 158.707 1.00 500.00 ? 106 ASP A CG  1 
ATOM 574   O OD1 . ASP A 1 106 ? 147.730 149.194 157.719 1.00 500.00 ? 106 ASP A OD1 1 
ATOM 575   O OD2 . ASP A 1 106 ? 148.406 148.636 159.730 1.00 500.00 ? 106 ASP A OD2 1 
ATOM 576   N N   . LEU A 1 107 ? 144.817 145.008 157.544 1.00 402.83 ? 107 LEU A N   1 
ATOM 577   C CA  . LEU A 1 107 ? 144.253 143.654 157.530 1.00 444.69 ? 107 LEU A CA  1 
ATOM 578   C C   . LEU A 1 107 ? 144.325 143.070 156.123 1.00 459.76 ? 107 LEU A C   1 
ATOM 579   O O   . LEU A 1 107 ? 144.742 141.917 155.926 1.00 475.99 ? 107 LEU A O   1 
ATOM 580   C CB  . LEU A 1 107 ? 142.787 143.669 158.001 1.00 499.43 ? 107 LEU A CB  1 
ATOM 581   C CG  . LEU A 1 107 ? 141.855 142.477 157.699 1.00 500.00 ? 107 LEU A CG  1 
ATOM 582   C CD1 . LEU A 1 107 ? 142.384 141.172 158.268 1.00 500.00 ? 107 LEU A CD1 1 
ATOM 583   C CD2 . LEU A 1 107 ? 140.455 142.743 158.230 1.00 500.00 ? 107 LEU A CD2 1 
ATOM 584   N N   . MET A 1 108 ? 143.907 143.898 155.171 1.00 455.90 ? 108 MET A N   1 
ATOM 585   C CA  . MET A 1 108 ? 143.891 143.529 153.750 1.00 444.95 ? 108 MET A CA  1 
ATOM 586   C C   . MET A 1 108 ? 145.292 143.147 153.293 1.00 421.01 ? 108 MET A C   1 
ATOM 587   O O   . MET A 1 108 ? 145.484 142.124 152.619 1.00 404.80 ? 108 MET A O   1 
ATOM 588   C CB  . MET A 1 108 ? 143.346 144.666 152.879 1.00 452.28 ? 108 MET A CB  1 
ATOM 589   C CG  . MET A 1 108 ? 142.832 144.229 151.521 1.00 463.95 ? 108 MET A CG  1 
ATOM 590   S SD  . MET A 1 108 ? 141.429 143.099 151.652 1.00 500.00 ? 108 MET A SD  1 
ATOM 591   C CE  . MET A 1 108 ? 140.558 143.369 150.107 1.00 462.87 ? 108 MET A CE  1 
ATOM 592   N N   . GLU A 1 109 ? 146.240 143.990 153.676 1.00 427.93 ? 109 GLU A N   1 
ATOM 593   C CA  . GLU A 1 109 ? 147.657 143.805 153.340 1.00 436.55 ? 109 GLU A CA  1 
ATOM 594   C C   . GLU A 1 109 ? 148.147 142.457 153.864 1.00 418.25 ? 109 GLU A C   1 
ATOM 595   O O   . GLU A 1 109 ? 148.811 141.696 153.146 1.00 430.77 ? 109 GLU A O   1 
ATOM 596   C CB  . GLU A 1 109 ? 148.517 144.955 153.905 1.00 441.43 ? 109 GLU A CB  1 
ATOM 597   C CG  . GLU A 1 109 ? 149.718 145.329 153.043 1.00 438.20 ? 109 GLU A CG  1 
ATOM 598   C CD  . GLU A 1 109 ? 149.347 146.071 151.763 1.00 441.08 ? 109 GLU A CD  1 
ATOM 599   O OE1 . GLU A 1 109 ? 148.141 146.289 151.498 1.00 417.17 ? 109 GLU A OE1 1 
ATOM 600   O OE2 . GLU A 1 109 ? 150.272 146.443 151.010 1.00 440.19 ? 109 GLU A OE2 1 
ATOM 601   N N   . LYS A 1 110 ? 147.799 142.203 155.117 1.00 393.62 ? 110 LYS A N   1 
ATOM 602   C CA  . LYS A 1 110 ? 148.169 140.965 155.813 1.00 395.00 ? 110 LYS A CA  1 
ATOM 603   C C   . LYS A 1 110 ? 147.642 139.756 155.044 1.00 422.59 ? 110 LYS A C   1 
ATOM 604   O O   . LYS A 1 110 ? 148.367 138.775 154.815 1.00 427.64 ? 110 LYS A O   1 
ATOM 605   C CB  . LYS A 1 110 ? 147.588 140.978 157.229 1.00 417.77 ? 110 LYS A CB  1 
ATOM 606   C CG  . LYS A 1 110 ? 148.140 139.914 158.161 1.00 486.07 ? 110 LYS A CG  1 
ATOM 607   C CD  . LYS A 1 110 ? 147.532 140.052 159.550 1.00 500.00 ? 110 LYS A CD  1 
ATOM 608   C CE  . LYS A 1 110 ? 148.210 141.131 160.380 1.00 500.00 ? 110 LYS A CE  1 
ATOM 609   N NZ  . LYS A 1 110 ? 147.313 141.624 161.465 1.00 500.00 ? 110 LYS A NZ  1 
ATOM 610   N N   . LEU A 1 111 ? 146.377 139.865 154.665 1.00 431.40 ? 111 LEU A N   1 
ATOM 611   C CA  . LEU A 1 111 ? 145.674 138.818 153.918 1.00 415.72 ? 111 LEU A CA  1 
ATOM 612   C C   . LEU A 1 111 ? 146.410 138.519 152.612 1.00 400.34 ? 111 LEU A C   1 
ATOM 613   O O   . LEU A 1 111 ? 146.649 137.352 152.259 1.00 318.00 ? 111 LEU A O   1 
ATOM 614   C CB  . LEU A 1 111 ? 144.230 139.273 153.661 1.00 396.04 ? 111 LEU A CB  1 
ATOM 615   C CG  . LEU A 1 111 ? 143.155 138.192 153.622 1.00 387.49 ? 111 LEU A CG  1 
ATOM 616   C CD1 . LEU A 1 111 ? 141.932 138.605 154.437 1.00 373.84 ? 111 LEU A CD1 1 
ATOM 617   C CD2 . LEU A 1 111 ? 142.794 137.891 152.179 1.00 415.78 ? 111 LEU A CD2 1 
ATOM 618   N N   . LYS A 1 112 ? 146.759 139.601 151.930 1.00 413.38 ? 112 LYS A N   1 
ATOM 619   C CA  . LYS A 1 112 ? 147.470 139.539 150.649 1.00 412.53 ? 112 LYS A CA  1 
ATOM 620   C C   . LYS A 1 112 ? 148.787 138.798 150.816 1.00 461.28 ? 112 LYS A C   1 
ATOM 621   O O   . LYS A 1 112 ? 149.132 137.924 150.013 1.00 487.22 ? 112 LYS A O   1 
ATOM 622   C CB  . LYS A 1 112 ? 147.705 140.947 150.108 1.00 423.73 ? 112 LYS A CB  1 
ATOM 623   C CG  . LYS A 1 112 ? 148.206 141.043 148.677 1.00 436.13 ? 112 LYS A CG  1 
ATOM 624   C CD  . LYS A 1 112 ? 148.279 142.513 148.275 1.00 453.60 ? 112 LYS A CD  1 
ATOM 625   C CE  . LYS A 1 112 ? 149.155 142.759 147.059 1.00 452.96 ? 112 LYS A CE  1 
ATOM 626   N NZ  . LYS A 1 112 ? 149.476 144.207 146.920 1.00 421.26 ? 112 LYS A NZ  1 
ATOM 627   N N   . GLY A 1 113 ? 149.498 139.167 151.877 1.00 500.00 ? 113 GLY A N   1 
ATOM 628   C CA  . GLY A 1 113 ? 150.795 138.577 152.222 1.00 500.00 ? 113 GLY A CA  1 
ATOM 629   C C   . GLY A 1 113 ? 150.890 137.057 152.226 1.00 500.00 ? 113 GLY A C   1 
ATOM 630   O O   . GLY A 1 113 ? 151.976 136.508 152.024 1.00 500.00 ? 113 GLY A O   1 
ATOM 631   N N   . ARG A 1 114 ? 149.761 136.385 152.463 1.00 462.69 ? 114 ARG A N   1 
ATOM 632   C CA  . ARG A 1 114 ? 149.633 134.951 152.237 1.00 423.44 ? 114 ARG A CA  1 
ATOM 633   C C   . ARG A 1 114 ? 148.478 134.698 151.265 1.00 404.10 ? 114 ARG A C   1 
ATOM 634   O O   . ARG A 1 114 ? 147.412 134.224 151.648 1.00 432.76 ? 114 ARG A O   1 
ATOM 635   C CB  . ARG A 1 114 ? 149.416 134.242 153.565 1.00 462.40 ? 114 ARG A CB  1 
ATOM 636   C CG  . ARG A 1 114 ? 150.668 134.137 154.416 1.00 500.00 ? 114 ARG A CG  1 
ATOM 637   C CD  . ARG A 1 114 ? 150.314 133.717 155.830 1.00 500.00 ? 114 ARG A CD  1 
ATOM 638   N NE  . ARG A 1 114 ? 151.446 133.136 156.560 1.00 500.00 ? 114 ARG A NE  1 
ATOM 639   C CZ  . ARG A 1 114 ? 151.773 131.837 156.603 1.00 500.00 ? 114 ARG A CZ  1 
ATOM 640   N NH1 . ARG A 1 114 ? 151.068 130.907 155.949 1.00 500.00 ? 114 ARG A NH1 1 
ATOM 641   N NH2 . ARG A 1 114 ? 152.833 131.458 157.317 1.00 500.00 ? 114 ARG A NH2 1 
ATOM 642   N N   . THR A 1 115 ? 148.709 135.044 150.001 1.00 440.71 ? 115 THR A N   1 
ATOM 643   C CA  . THR A 1 115 ? 147.691 134.919 148.941 1.00 457.23 ? 115 THR A CA  1 
ATOM 644   C C   . THR A 1 115 ? 147.351 133.472 148.555 1.00 428.94 ? 115 THR A C   1 
ATOM 645   O O   . THR A 1 115 ? 146.202 133.175 148.206 1.00 336.22 ? 115 THR A O   1 
ATOM 646   C CB  . THR A 1 115 ? 148.076 135.718 147.664 1.00 483.70 ? 115 THR A CB  1 
ATOM 647   O OG1 . THR A 1 115 ? 146.987 135.684 146.733 1.00 500.00 ? 115 THR A OG1 1 
ATOM 648   C CG2 . THR A 1 115 ? 149.345 135.171 146.979 1.00 467.24 ? 115 THR A CG2 1 
ATOM 649   N N   . SER A 1 116 ? 148.350 132.590 148.621 1.00 474.74 ? 116 SER A N   1 
ATOM 650   C CA  . SER A 1 116 ? 148.203 131.176 148.242 1.00 500.00 ? 116 SER A CA  1 
ATOM 651   C C   . SER A 1 116 ? 147.112 130.453 149.024 1.00 482.23 ? 116 SER A C   1 
ATOM 652   O O   . SER A 1 116 ? 146.384 129.624 148.473 1.00 497.47 ? 116 SER A O   1 
ATOM 653   C CB  . SER A 1 116 ? 149.528 130.428 148.451 1.00 500.00 ? 116 SER A CB  1 
ATOM 654   O OG  . SER A 1 116 ? 150.554 130.941 147.618 1.00 500.00 ? 116 SER A OG  1 
ATOM 655   N N   . ARG A 1 117 ? 147.004 130.794 150.304 1.00 430.93 ? 117 ARG A N   1 
ATOM 656   C CA  . ARG A 1 117 ? 146.200 130.049 151.261 1.00 423.76 ? 117 ARG A CA  1 
ATOM 657   C C   . ARG A 1 117 ? 144.781 130.589 151.479 1.00 376.03 ? 117 ARG A C   1 
ATOM 658   O O   . ARG A 1 117 ? 143.909 129.858 151.940 1.00 344.04 ? 117 ARG A O   1 
ATOM 659   C CB  . ARG A 1 117 ? 146.943 130.037 152.589 1.00 439.60 ? 117 ARG A CB  1 
ATOM 660   C CG  . ARG A 1 117 ? 146.554 128.910 153.516 1.00 425.96 ? 117 ARG A CG  1 
ATOM 661   C CD  . ARG A 1 117 ? 147.194 129.146 154.856 1.00 377.44 ? 117 ARG A CD  1 
ATOM 662   N NE  . ARG A 1 117 ? 147.243 127.934 155.665 1.00 424.59 ? 117 ARG A NE  1 
ATOM 663   C CZ  . ARG A 1 117 ? 148.090 126.919 155.469 1.00 500.00 ? 117 ARG A CZ  1 
ATOM 664   N NH1 . ARG A 1 117 ? 148.988 126.937 154.479 1.00 500.00 ? 117 ARG A NH1 1 
ATOM 665   N NH2 . ARG A 1 117 ? 148.037 125.861 156.275 1.00 500.00 ? 117 ARG A NH2 1 
ATOM 666   N N   . ILE A 1 118 ? 144.547 131.862 151.176 1.00 327.02 ? 118 ILE A N   1 
ATOM 667   C CA  . ILE A 1 118 ? 143.234 132.449 151.405 1.00 342.63 ? 118 ILE A CA  1 
ATOM 668   C C   . ILE A 1 118 ? 142.672 132.942 150.080 1.00 361.38 ? 118 ILE A C   1 
ATOM 669   O O   . ILE A 1 118 ? 143.306 133.740 149.380 1.00 322.80 ? 118 ILE A O   1 
ATOM 670   C CB  . ILE A 1 118 ? 143.289 133.556 152.477 1.00 407.65 ? 118 ILE A CB  1 
ATOM 671   C CG1 . ILE A 1 118 ? 141.886 133.826 153.031 1.00 441.36 ? 118 ILE A CG1 1 
ATOM 672   C CG2 . ILE A 1 118 ? 143.950 134.828 151.947 1.00 409.70 ? 118 ILE A CG2 1 
ATOM 673   C CD1 . ILE A 1 118 ? 141.884 134.719 154.253 1.00 460.39 ? 118 ILE A CD1 1 
ATOM 674   N N   . ALA A 1 119 ? 141.483 132.438 149.748 1.00 387.75 ? 119 ALA A N   1 
ATOM 675   C CA  . ALA A 1 119 ? 140.888 132.580 148.425 1.00 390.71 ? 119 ALA A CA  1 
ATOM 676   C C   . ALA A 1 119 ? 139.531 133.242 148.533 1.00 354.13 ? 119 ALA A C   1 
ATOM 677   O O   . ALA A 1 119 ? 138.532 132.589 148.821 1.00 328.06 ? 119 ALA A O   1 
ATOM 678   C CB  . ALA A 1 119 ? 140.755 131.213 147.769 1.00 413.58 ? 119 ALA A CB  1 
ATOM 679   N N   . GLY A 1 120 ? 139.522 134.557 148.356 1.00 372.25 ? 120 GLY A N   1 
ATOM 680   C CA  . GLY A 1 120 ? 138.296 135.319 148.176 1.00 391.41 ? 120 GLY A CA  1 
ATOM 681   C C   . GLY A 1 120 ? 137.585 135.676 149.465 1.00 412.27 ? 120 GLY A C   1 
ATOM 682   O O   . GLY A 1 120 ? 137.705 134.947 150.454 1.00 430.45 ? 120 GLY A O   1 
ATOM 683   N N   . LEU A 1 121 ? 136.844 136.791 149.466 1.00 399.93 ? 121 LEU A N   1 
ATOM 684   C CA  . LEU A 1 121 ? 136.196 137.264 150.719 1.00 368.82 ? 121 LEU A CA  1 
ATOM 685   C C   . LEU A 1 121 ? 134.759 137.771 150.604 1.00 368.49 ? 121 LEU A C   1 
ATOM 686   O O   . LEU A 1 121 ? 134.449 138.681 149.821 1.00 307.24 ? 121 LEU A O   1 
ATOM 687   C CB  . LEU A 1 121 ? 136.996 138.384 151.387 1.00 337.43 ? 121 LEU A CB  1 
ATOM 688   C CG  . LEU A 1 121 ? 138.392 138.706 150.884 1.00 358.38 ? 121 LEU A CG  1 
ATOM 689   C CD1 . LEU A 1 121 ? 138.814 140.057 151.446 1.00 411.87 ? 121 LEU A CD1 1 
ATOM 690   C CD2 . LEU A 1 121 ? 139.380 137.611 151.265 1.00 371.51 ? 121 LEU A CD2 1 
ATOM 691   N N   . ALA A 1 122 ? 133.897 137.201 151.439 1.00 386.23 ? 122 ALA A N   1 
ATOM 692   C CA  . ALA A 1 122 ? 132.642 137.849 151.761 1.00 408.58 ? 122 ALA A CA  1 
ATOM 693   C C   . ALA A 1 122 ? 132.950 139.064 152.632 1.00 402.39 ? 122 ALA A C   1 
ATOM 694   O O   . ALA A 1 122 ? 133.909 139.068 153.416 1.00 366.64 ? 122 ALA A O   1 
ATOM 695   C CB  . ALA A 1 122 ? 131.702 136.898 152.488 1.00 437.29 ? 122 ALA A CB  1 
ATOM 696   N N   . VAL A 1 123 ? 132.146 140.102 152.455 1.00 411.85 ? 123 VAL A N   1 
ATOM 697   C CA  . VAL A 1 123 ? 132.153 141.269 153.319 1.00 408.00 ? 123 VAL A CA  1 
ATOM 698   C C   . VAL A 1 123 ? 130.686 141.603 153.592 1.00 403.30 ? 123 VAL A C   1 
ATOM 699   O O   . VAL A 1 123 ? 129.973 142.146 152.730 1.00 390.77 ? 123 VAL A O   1 
ATOM 700   C CB  . VAL A 1 123 ? 132.932 142.444 152.688 1.00 394.10 ? 123 VAL A CB  1 
ATOM 701   C CG1 . VAL A 1 123 ? 132.739 143.733 153.479 1.00 403.07 ? 123 VAL A CG1 1 
ATOM 702   C CG2 . VAL A 1 123 ? 134.411 142.090 152.614 1.00 383.35 ? 123 VAL A CG2 1 
ATOM 703   N N   . SER A 1 124 ? 130.238 141.207 154.780 1.00 373.95 ? 124 SER A N   1 
ATOM 704   C CA  . SER A 1 124 ? 128.925 141.567 155.275 1.00 380.60 ? 124 SER A CA  1 
ATOM 705   C C   . SER A 1 124 ? 128.933 143.062 155.589 1.00 392.03 ? 124 SER A C   1 
ATOM 706   O O   . SER A 1 124 ? 129.759 143.530 156.392 1.00 393.99 ? 124 SER A O   1 
ATOM 707   C CB  . SER A 1 124 ? 128.599 140.761 156.537 1.00 408.32 ? 124 SER A CB  1 
ATOM 708   O OG  . SER A 1 124 ? 127.291 141.039 157.011 1.00 445.00 ? 124 SER A OG  1 
ATOM 709   N N   . LEU A 1 125 ? 128.037 143.809 154.943 1.00 385.82 ? 125 LEU A N   1 
ATOM 710   C CA  . LEU A 1 125 ? 127.893 145.230 155.231 1.00 382.66 ? 125 LEU A CA  1 
ATOM 711   C C   . LEU A 1 125 ? 127.108 145.421 156.527 1.00 407.68 ? 125 LEU A C   1 
ATOM 712   O O   . LEU A 1 125 ? 125.922 145.077 156.622 1.00 348.86 ? 125 LEU A O   1 
ATOM 713   C CB  . LEU A 1 125 ? 127.220 145.990 154.084 1.00 401.95 ? 125 LEU A CB  1 
ATOM 714   C CG  . LEU A 1 125 ? 127.242 147.526 154.211 1.00 406.09 ? 125 LEU A CG  1 
ATOM 715   C CD1 . LEU A 1 125 ? 128.652 148.060 154.448 1.00 377.32 ? 125 LEU A CD1 1 
ATOM 716   C CD2 . LEU A 1 125 ? 126.617 148.190 152.990 1.00 406.27 ? 125 LEU A CD2 1 
ATOM 717   N N   . THR A 1 126 ? 127.799 145.967 157.523 1.00 444.02 ? 126 THR A N   1 
ATOM 718   C CA  . THR A 1 126 ? 127.231 146.284 158.816 1.00 462.94 ? 126 THR A CA  1 
ATOM 719   C C   . THR A 1 126 ? 126.468 147.598 158.652 1.00 500.00 ? 126 THR A C   1 
ATOM 720   O O   . THR A 1 126 ? 127.077 148.641 158.392 1.00 500.00 ? 126 THR A O   1 
ATOM 721   C CB  . THR A 1 126 ? 128.353 146.451 159.870 1.00 438.31 ? 126 THR A CB  1 
ATOM 722   O OG1 . THR A 1 126 ? 129.295 145.373 159.759 1.00 366.13 ? 126 THR A OG1 1 
ATOM 723   C CG2 . THR A 1 126 ? 127.782 146.502 161.279 1.00 440.21 ? 126 THR A CG2 1 
ATOM 724   N N   . LYS A 1 127 ? 125.141 147.537 158.765 1.00 500.00 ? 127 LYS A N   1 
ATOM 725   C CA  . LYS A 1 127 ? 124.284 148.732 158.652 1.00 500.00 ? 127 LYS A CA  1 
ATOM 726   C C   . LYS A 1 127 ? 124.617 149.855 159.644 1.00 484.61 ? 127 LYS A C   1 
ATOM 727   O O   . LYS A 1 127 ? 124.471 151.029 159.294 1.00 446.79 ? 127 LYS A O   1 
ATOM 728   C CB  . LYS A 1 127 ? 122.798 148.360 158.771 1.00 500.00 ? 127 LYS A CB  1 
ATOM 729   C CG  . LYS A 1 127 ? 122.257 147.603 157.568 1.00 500.00 ? 127 LYS A CG  1 
ATOM 730   C CD  . LYS A 1 127 ? 121.951 148.530 156.396 1.00 500.00 ? 127 LYS A CD  1 
ATOM 731   C CE  . LYS A 1 127 ? 121.841 147.765 155.082 1.00 500.00 ? 127 LYS A CE  1 
ATOM 732   N NZ  . LYS A 1 127 ? 120.813 146.683 155.108 1.00 500.00 ? 127 LYS A NZ  1 
ATOM 733   N N   . PRO A 1 128 ? 125.040 149.506 160.882 1.00 439.95 ? 128 PRO A N   1 
ATOM 734   C CA  . PRO A 1 128 ? 125.577 150.497 161.819 1.00 414.69 ? 128 PRO A CA  1 
ATOM 735   C C   . PRO A 1 128 ? 126.611 151.477 161.256 1.00 397.31 ? 128 PRO A C   1 
ATOM 736   O O   . PRO A 1 128 ? 126.508 152.668 161.537 1.00 320.84 ? 128 PRO A O   1 
ATOM 737   C CB  . PRO A 1 128 ? 126.221 149.625 162.895 1.00 413.63 ? 128 PRO A CB  1 
ATOM 738   C CG  . PRO A 1 128 ? 125.351 148.414 162.945 1.00 408.17 ? 128 PRO A CG  1 
ATOM 739   C CD  . PRO A 1 128 ? 124.719 148.245 161.589 1.00 409.41 ? 128 PRO A CD  1 
ATOM 740   N N   . SER A 1 129 ? 127.573 150.972 160.475 1.00 446.09 ? 129 SER A N   1 
ATOM 741   C CA  . SER A 1 129 ? 128.741 151.734 159.967 1.00 446.79 ? 129 SER A CA  1 
ATOM 742   C C   . SER A 1 129 ? 129.782 151.950 161.080 1.00 464.95 ? 129 SER A C   1 
ATOM 743   O O   . SER A 1 129 ? 129.432 151.901 162.265 1.00 490.77 ? 129 SER A O   1 
ATOM 744   C CB  . SER A 1 129 ? 128.325 153.066 159.320 1.00 400.27 ? 129 SER A CB  1 
ATOM 745   O OG  . SER A 1 129 ? 129.409 153.715 158.695 1.00 335.77 ? 129 SER A OG  1 
ATOM 746   N N   . PRO A 1 130 ? 131.067 152.174 160.716 1.00 437.35 ? 130 PRO A N   1 
ATOM 747   C CA  . PRO A 1 130 ? 132.069 152.319 161.776 1.00 478.68 ? 130 PRO A CA  1 
ATOM 748   C C   . PRO A 1 130 ? 132.008 153.667 162.500 1.00 500.00 ? 130 PRO A C   1 
ATOM 749   O O   . PRO A 1 130 ? 131.443 154.632 161.974 1.00 500.00 ? 130 PRO A O   1 
ATOM 750   C CB  . PRO A 1 130 ? 133.406 152.174 161.026 1.00 458.62 ? 130 PRO A CB  1 
ATOM 751   C CG  . PRO A 1 130 ? 133.058 151.721 159.650 1.00 436.16 ? 130 PRO A CG  1 
ATOM 752   C CD  . PRO A 1 130 ? 131.700 152.269 159.390 1.00 393.76 ? 130 PRO A CD  1 
ATOM 753   N N   . ALA A 1 131 ? 132.587 153.710 163.700 1.00 500.00 ? 131 ALA A N   1 
ATOM 754   C CA  . ALA A 1 131 ? 132.707 154.949 164.480 1.00 500.00 ? 131 ALA A CA  1 
ATOM 755   C C   . ALA A 1 131 ? 133.791 155.842 163.866 1.00 500.00 ? 131 ALA A C   1 
ATOM 756   O O   . ALA A 1 131 ? 133.498 156.946 163.397 1.00 500.00 ? 131 ALA A O   1 
ATOM 757   C CB  . ALA A 1 131 ? 133.008 154.644 165.946 1.00 500.00 ? 131 ALA A CB  1 
ATOM 758   N N   . SER A 1 132 ? 135.033 155.353 163.875 1.00 500.00 ? 132 SER A N   1 
ATOM 759   C CA  . SER A 1 132 ? 136.098 155.910 163.043 1.00 500.00 ? 132 SER A CA  1 
ATOM 760   C C   . SER A 1 132 ? 135.910 155.278 161.674 1.00 500.00 ? 132 SER A C   1 
ATOM 761   O O   . SER A 1 132 ? 136.277 154.116 161.463 1.00 500.00 ? 132 SER A O   1 
ATOM 762   C CB  . SER A 1 132 ? 137.483 155.576 163.605 1.00 500.00 ? 132 SER A CB  1 
ATOM 763   O OG  . SER A 1 132 ? 137.710 154.175 163.645 1.00 500.00 ? 132 SER A OG  1 
ATOM 764   N N   . GLY A 1 133 ? 135.311 156.041 160.763 1.00 500.00 ? 133 GLY A N   1 
ATOM 765   C CA  . GLY A 1 133 ? 134.907 155.536 159.455 1.00 500.00 ? 133 GLY A CA  1 
ATOM 766   C C   . GLY A 1 133 ? 136.032 154.967 158.616 1.00 500.00 ? 133 GLY A C   1 
ATOM 767   O O   . GLY A 1 133 ? 137.208 155.124 158.944 1.00 500.00 ? 133 GLY A O   1 
ATOM 768   N N   . PHE A 1 134 ? 135.662 154.276 157.547 1.00 470.78 ? 134 PHE A N   1 
ATOM 769   C CA  . PHE A 1 134 ? 136.619 153.805 156.553 1.00 425.30 ? 134 PHE A CA  1 
ATOM 770   C C   . PHE A 1 134 ? 136.279 154.474 155.229 1.00 370.68 ? 134 PHE A C   1 
ATOM 771   O O   . PHE A 1 134 ? 135.100 154.660 154.914 1.00 307.63 ? 134 PHE A O   1 
ATOM 772   C CB  . PHE A 1 134 ? 136.611 152.265 156.482 1.00 415.93 ? 134 PHE A CB  1 
ATOM 773   C CG  . PHE A 1 134 ? 136.612 151.701 155.085 1.00 408.53 ? 134 PHE A CG  1 
ATOM 774   C CD1 . PHE A 1 134 ? 137.768 151.683 154.318 1.00 415.94 ? 134 PHE A CD1 1 
ATOM 775   C CD2 . PHE A 1 134 ? 135.451 151.158 154.546 1.00 372.70 ? 134 PHE A CD2 1 
ATOM 776   C CE1 . PHE A 1 134 ? 137.760 151.155 153.032 1.00 425.82 ? 134 PHE A CE1 1 
ATOM 777   C CE2 . PHE A 1 134 ? 135.429 150.625 153.263 1.00 353.70 ? 134 PHE A CE2 1 
ATOM 778   C CZ  . PHE A 1 134 ? 136.589 150.623 152.502 1.00 392.61 ? 134 PHE A CZ  1 
ATOM 779   N N   . SER A 1 135 ? 137.322 154.876 154.499 1.00 343.45 ? 135 SER A N   1 
ATOM 780   C CA  . SER A 1 135 ? 137.195 155.324 153.116 1.00 374.59 ? 135 SER A CA  1 
ATOM 781   C C   . SER A 1 135 ? 138.191 154.555 152.255 1.00 377.84 ? 135 SER A C   1 
ATOM 782   O O   . SER A 1 135 ? 139.371 154.457 152.619 1.00 374.39 ? 135 SER A O   1 
ATOM 783   C CB  . SER A 1 135 ? 137.461 156.821 152.989 1.00 401.17 ? 135 SER A CB  1 
ATOM 784   O OG  . SER A 1 135 ? 137.320 157.244 151.640 1.00 425.82 ? 135 SER A OG  1 
ATOM 785   N N   . PRO A 1 136 ? 137.726 154.016 151.107 1.00 383.07 ? 136 PRO A N   1 
ATOM 786   C CA  . PRO A 1 136 ? 138.599 153.196 150.289 1.00 362.88 ? 136 PRO A CA  1 
ATOM 787   C C   . PRO A 1 136 ? 139.622 154.028 149.554 1.00 367.18 ? 136 PRO A C   1 
ATOM 788   O O   . PRO A 1 136 ? 140.784 153.652 149.527 1.00 371.60 ? 136 PRO A O   1 
ATOM 789   C CB  . PRO A 1 136 ? 137.637 152.545 149.303 1.00 385.13 ? 136 PRO A CB  1 
ATOM 790   C CG  . PRO A 1 136 ? 136.549 153.543 149.128 1.00 385.48 ? 136 PRO A CG  1 
ATOM 791   C CD  . PRO A 1 136 ? 136.432 154.259 150.438 1.00 380.75 ? 136 PRO A CD  1 
ATOM 792   N N   . SER A 1 137 ? 139.217 155.173 149.012 1.00 365.67 ? 137 SER A N   1 
ATOM 793   C CA  . SER A 1 137 ? 140.074 155.910 148.101 1.00 390.70 ? 137 SER A CA  1 
ATOM 794   C C   . SER A 1 137 ? 141.336 156.401 148.832 1.00 384.66 ? 137 SER A C   1 
ATOM 795   O O   . SER A 1 137 ? 141.345 156.571 150.059 1.00 347.97 ? 137 SER A O   1 
ATOM 796   C CB  . SER A 1 137 ? 139.300 157.061 147.438 1.00 390.21 ? 137 SER A CB  1 
ATOM 797   O OG  . SER A 1 137 ? 139.845 157.382 146.165 1.00 372.00 ? 137 SER A OG  1 
ATOM 798   N N   . VAL A 1 138 ? 142.405 156.580 148.065 1.00 373.21 ? 138 VAL A N   1 
ATOM 799   C CA  . VAL A 1 138 ? 143.658 157.135 148.576 1.00 403.14 ? 138 VAL A CA  1 
ATOM 800   C C   . VAL A 1 138 ? 143.444 158.556 149.110 1.00 406.71 ? 138 VAL A C   1 
ATOM 801   O O   . VAL A 1 138 ? 142.503 159.247 148.706 1.00 430.70 ? 138 VAL A O   1 
ATOM 802   C CB  . VAL A 1 138 ? 144.757 157.123 147.478 1.00 461.18 ? 138 VAL A CB  1 
ATOM 803   C CG1 . VAL A 1 138 ? 144.449 158.124 146.362 1.00 468.05 ? 138 VAL A CG1 1 
ATOM 804   C CG2 . VAL A 1 138 ? 146.148 157.354 148.068 1.00 476.19 ? 138 VAL A CG2 1 
ATOM 805   N N   . GLN A 1 139 ? 144.313 158.977 150.024 1.00 410.19 ? 139 GLN A N   1 
ATOM 806   C CA  . GLN A 1 139 ? 144.261 160.329 150.600 1.00 445.05 ? 139 GLN A CA  1 
ATOM 807   C C   . GLN A 1 139 ? 144.179 161.436 149.539 1.00 428.70 ? 139 GLN A C   1 
ATOM 808   O O   . GLN A 1 139 ? 143.467 162.421 149.729 1.00 432.54 ? 139 GLN A O   1 
ATOM 809   C CB  . GLN A 1 139 ? 145.468 160.588 151.524 1.00 467.41 ? 139 GLN A CB  1 
ATOM 810   C CG  . GLN A 1 139 ? 145.185 160.467 153.020 1.00 478.08 ? 139 GLN A CG  1 
ATOM 811   C CD  . GLN A 1 139 ? 144.658 159.105 153.458 1.00 463.56 ? 139 GLN A CD  1 
ATOM 812   O OE1 . GLN A 1 139 ? 143.767 159.017 154.305 1.00 318.48 ? 139 GLN A OE1 1 
ATOM 813   N NE2 . GLN A 1 139 ? 145.224 158.039 152.904 1.00 490.25 ? 139 GLN A NE2 1 
ATOM 814   N N   . CYS A 1 140 ? 144.907 161.254 148.436 1.00 425.67 ? 140 CYS A N   1 
ATOM 815   C CA  . CYS A 1 140 ? 145.030 162.249 147.371 1.00 451.08 ? 140 CYS A CA  1 
ATOM 816   C C   . CYS A 1 140 ? 144.292 161.800 146.098 1.00 429.26 ? 140 CYS A C   1 
ATOM 817   O O   . CYS A 1 140 ? 144.906 161.221 145.198 1.00 486.64 ? 140 CYS A O   1 
ATOM 818   C CB  . CYS A 1 140 ? 146.522 162.471 147.081 1.00 500.00 ? 140 CYS A CB  1 
ATOM 819   S SG  . CYS A 1 140 ? 147.000 164.199 146.985 1.00 500.00 ? 140 CYS A SG  1 
ATOM 820   N N   . PRO A 1 141 ? 142.968 162.041 146.019 1.00 415.81 ? 141 PRO A N   1 
ATOM 821   C CA  . PRO A 1 141 ? 142.230 161.612 144.822 1.00 412.28 ? 141 PRO A CA  1 
ATOM 822   C C   . PRO A 1 141 ? 142.597 162.399 143.567 1.00 410.48 ? 141 PRO A C   1 
ATOM 823   O O   . PRO A 1 141 ? 142.971 163.576 143.654 1.00 351.88 ? 141 PRO A O   1 
ATOM 824   C CB  . PRO A 1 141 ? 140.768 161.862 145.202 1.00 415.19 ? 141 PRO A CB  1 
ATOM 825   C CG  . PRO A 1 141 ? 140.851 162.955 146.203 1.00 445.43 ? 141 PRO A CG  1 
ATOM 826   C CD  . PRO A 1 141 ? 142.052 162.601 147.025 1.00 433.86 ? 141 PRO A CD  1 
ATOM 827   N N   . ASN A 1 142 ? 142.508 161.707 142.426 1.00 437.65 ? 142 ASN A N   1 
ATOM 828   C CA  . ASN A 1 142 ? 142.797 162.235 141.077 1.00 426.94 ? 142 ASN A CA  1 
ATOM 829   C C   . ASN A 1 142 ? 144.142 162.971 140.970 1.00 421.72 ? 142 ASN A C   1 
ATOM 830   O O   . ASN A 1 142 ? 144.301 163.868 140.135 1.00 400.30 ? 142 ASN A O   1 
ATOM 831   C CB  . ASN A 1 142 ? 141.662 163.143 140.558 1.00 397.19 ? 142 ASN A CB  1 
ATOM 832   C CG  . ASN A 1 142 ? 140.257 162.576 140.784 1.00 410.07 ? 142 ASN A CG  1 
ATOM 833   O OD1 . ASN A 1 142 ? 139.291 163.335 140.832 1.00 388.14 ? 142 ASN A OD1 1 
ATOM 834   N ND2 . ASN A 1 142 ? 140.134 161.257 140.912 1.00 427.03 ? 142 ASN A ND2 1 
ATOM 835   N N   . ASP A 1 143 ? 145.106 162.566 141.797 1.00 440.32 ? 143 ASP A N   1 
ATOM 836   C CA  . ASP A 1 143 ? 146.323 163.353 142.024 1.00 468.68 ? 143 ASP A CA  1 
ATOM 837   C C   . ASP A 1 143 ? 147.165 163.546 140.766 1.00 453.39 ? 143 ASP A C   1 
ATOM 838   O O   . ASP A 1 143 ? 147.706 164.632 140.546 1.00 485.90 ? 143 ASP A O   1 
ATOM 839   C CB  . ASP A 1 143 ? 147.181 162.755 143.156 1.00 500.00 ? 143 ASP A CB  1 
ATOM 840   C CG  . ASP A 1 143 ? 147.677 161.339 142.854 1.00 500.00 ? 143 ASP A CG  1 
ATOM 841   O OD1 . ASP A 1 143 ? 147.058 160.639 142.021 1.00 500.00 ? 143 ASP A OD1 1 
ATOM 842   O OD2 . ASP A 1 143 ? 148.689 160.929 143.464 1.00 500.00 ? 143 ASP A OD2 1 
ATOM 843   N N   . GLY A 1 144 ? 147.242 162.510 139.927 1.00 391.03 ? 144 GLY A N   1 
ATOM 844   C CA  . GLY A 1 144 ? 148.042 162.567 138.706 1.00 423.64 ? 144 GLY A CA  1 
ATOM 845   C C   . GLY A 1 144 ? 147.460 163.389 137.565 1.00 427.46 ? 144 GLY A C   1 
ATOM 846   O O   . GLY A 1 144 ? 148.092 163.520 136.512 1.00 450.55 ? 144 GLY A O   1 
ATOM 847   N N   . PHE A 1 145 ? 146.275 163.958 137.776 1.00 407.82 ? 145 PHE A N   1 
ATOM 848   C CA  . PHE A 1 145 ? 145.469 164.519 136.702 1.00 407.76 ? 145 PHE A CA  1 
ATOM 849   C C   . PHE A 1 145 ? 145.083 165.995 136.869 1.00 411.62 ? 145 PHE A C   1 
ATOM 850   O O   . PHE A 1 145 ? 145.003 166.719 135.874 1.00 353.52 ? 145 PHE A O   1 
ATOM 851   C CB  . PHE A 1 145 ? 144.235 163.631 136.558 1.00 405.67 ? 145 PHE A CB  1 
ATOM 852   C CG  . PHE A 1 145 ? 144.528 162.316 135.917 1.00 366.29 ? 145 PHE A CG  1 
ATOM 853   C CD1 . PHE A 1 145 ? 144.509 162.189 134.542 1.00 363.31 ? 145 PHE A CD1 1 
ATOM 854   C CD2 . PHE A 1 145 ? 144.870 161.213 136.683 1.00 413.57 ? 145 PHE A CD2 1 
ATOM 855   C CE1 . PHE A 1 145 ? 144.795 160.979 133.938 1.00 391.11 ? 145 PHE A CE1 1 
ATOM 856   C CE2 . PHE A 1 145 ? 145.148 159.992 136.086 1.00 430.07 ? 145 PHE A CE2 1 
ATOM 857   C CZ  . PHE A 1 145 ? 145.112 159.876 134.708 1.00 414.69 ? 145 PHE A CZ  1 
ATOM 858   N N   . GLY A 1 146 ? 144.840 166.443 138.100 1.00 423.50 ? 146 GLY A N   1 
ATOM 859   C CA  . GLY A 1 146 ? 144.556 167.855 138.364 1.00 446.78 ? 146 GLY A CA  1 
ATOM 860   C C   . GLY A 1 146 ? 145.764 168.734 138.095 1.00 473.31 ? 146 GLY A C   1 
ATOM 861   O O   . GLY A 1 146 ? 146.901 168.267 138.208 1.00 492.84 ? 146 GLY A O   1 
ATOM 862   N N   . VAL A 1 147 ? 145.517 170.001 137.743 1.00 474.68 ? 147 VAL A N   1 
ATOM 863   C CA  . VAL A 1 147 ? 146.575 170.967 137.345 1.00 451.88 ? 147 VAL A CA  1 
ATOM 864   C C   . VAL A 1 147 ? 147.918 170.844 138.042 1.00 405.19 ? 147 VAL A C   1 
ATOM 865   O O   . VAL A 1 147 ? 148.959 170.896 137.387 1.00 378.29 ? 147 VAL A O   1 
ATOM 866   C CB  . VAL A 1 147 ? 146.177 172.457 137.547 1.00 443.08 ? 147 VAL A CB  1 
ATOM 867   C CG1 . VAL A 1 147 ? 145.374 172.977 136.372 1.00 457.48 ? 147 VAL A CG1 1 
ATOM 868   C CG2 . VAL A 1 147 ? 145.478 172.701 138.884 1.00 440.47 ? 147 VAL A CG2 1 
ATOM 869   N N   . TYR A 1 148 ? 147.882 170.678 139.361 1.00 357.89 ? 148 TYR A N   1 
ATOM 870   C CA  . TYR A 1 148 ? 149.063 170.867 140.189 1.00 380.56 ? 148 TYR A CA  1 
ATOM 871   C C   . TYR A 1 148 ? 150.099 169.776 139.940 1.00 411.35 ? 148 TYR A C   1 
ATOM 872   O O   . TYR A 1 148 ? 150.158 168.769 140.644 1.00 447.30 ? 148 TYR A O   1 
ATOM 873   C CB  . TYR A 1 148 ? 148.668 170.967 141.659 1.00 394.99 ? 148 TYR A CB  1 
ATOM 874   C CG  . TYR A 1 148 ? 147.680 172.077 141.893 1.00 431.58 ? 148 TYR A CG  1 
ATOM 875   C CD1 . TYR A 1 148 ? 148.102 173.407 141.949 1.00 482.42 ? 148 TYR A CD1 1 
ATOM 876   C CD2 . TYR A 1 148 ? 146.323 171.810 142.017 1.00 415.69 ? 148 TYR A CD2 1 
ATOM 877   C CE1 . TYR A 1 148 ? 147.199 174.442 142.148 1.00 473.23 ? 148 TYR A CE1 1 
ATOM 878   C CE2 . TYR A 1 148 ? 145.409 172.834 142.213 1.00 448.06 ? 148 TYR A CE2 1 
ATOM 879   C CZ  . TYR A 1 148 ? 145.851 174.151 142.271 1.00 451.69 ? 148 TYR A CZ  1 
ATOM 880   O OH  . TYR A 1 148 ? 144.949 175.172 142.472 1.00 375.87 ? 148 TYR A OH  1 
ATOM 881   N N   . SER A 1 149 ? 150.883 169.989 138.886 1.00 434.67 ? 149 SER A N   1 
ATOM 882   C CA  . SER A 1 149 ? 152.021 169.151 138.559 1.00 457.76 ? 149 SER A CA  1 
ATOM 883   C C   . SER A 1 149 ? 153.250 169.797 139.180 1.00 465.95 ? 149 SER A C   1 
ATOM 884   O O   . SER A 1 149 ? 153.169 170.891 139.754 1.00 433.72 ? 149 SER A O   1 
ATOM 885   C CB  . SER A 1 149 ? 152.177 169.023 137.038 1.00 456.56 ? 149 SER A CB  1 
ATOM 886   O OG  . SER A 1 149 ? 152.487 170.269 136.436 1.00 442.74 ? 149 SER A OG  1 
ATOM 887   N N   . ASN A 1 150 ? 154.386 169.123 139.051 1.00 482.97 ? 150 ASN A N   1 
ATOM 888   C CA  . ASN A 1 150 ? 155.650 169.612 139.605 1.00 497.06 ? 150 ASN A CA  1 
ATOM 889   C C   . ASN A 1 150 ? 156.161 170.876 138.902 1.00 461.89 ? 150 ASN A C   1 
ATOM 890   O O   . ASN A 1 150 ? 156.986 171.603 139.458 1.00 425.14 ? 150 ASN A O   1 
ATOM 891   C CB  . ASN A 1 150 ? 156.709 168.506 139.568 1.00 500.00 ? 150 ASN A CB  1 
ATOM 892   C CG  . ASN A 1 150 ? 156.298 167.275 140.367 1.00 500.00 ? 150 ASN A CG  1 
ATOM 893   O OD1 . ASN A 1 150 ? 155.895 167.377 141.528 1.00 500.00 ? 150 ASN A OD1 1 
ATOM 894   N ND2 . ASN A 1 150 ? 156.393 166.106 139.742 1.00 500.00 ? 150 ASN A ND2 1 
ATOM 895   N N   . SER A 1 151 ? 155.670 171.121 137.687 1.00 467.42 ? 151 SER A N   1 
ATOM 896   C CA  . SER A 1 151 ? 155.887 172.386 136.989 1.00 493.37 ? 151 SER A CA  1 
ATOM 897   C C   . SER A 1 151 ? 154.980 173.494 137.524 1.00 498.23 ? 151 SER A C   1 
ATOM 898   O O   . SER A 1 151 ? 155.461 174.558 137.920 1.00 500.00 ? 151 SER A O   1 
ATOM 899   C CB  . SER A 1 151 ? 155.645 172.213 135.484 1.00 494.66 ? 151 SER A CB  1 
ATOM 900   O OG  . SER A 1 151 ? 154.327 171.761 135.219 1.00 458.31 ? 151 SER A OG  1 
ATOM 901   N N   . TYR A 1 152 ? 153.673 173.231 137.540 1.00 454.33 ? 152 TYR A N   1 
ATOM 902   C CA  . TYR A 1 152 ? 152.660 174.274 137.751 1.00 431.28 ? 152 TYR A CA  1 
ATOM 903   C C   . TYR A 1 152 ? 152.558 174.741 139.192 1.00 409.36 ? 152 TYR A C   1 
ATOM 904   O O   . TYR A 1 152 ? 152.650 175.940 139.456 1.00 467.06 ? 152 TYR A O   1 
ATOM 905   C CB  . TYR A 1 152 ? 151.292 173.780 137.289 1.00 466.88 ? 152 TYR A CB  1 
ATOM 906   C CG  . TYR A 1 152 ? 150.241 174.861 137.101 1.00 460.37 ? 152 TYR A CG  1 
ATOM 907   C CD1 . TYR A 1 152 ? 150.345 175.788 136.061 1.00 456.67 ? 152 TYR A CD1 1 
ATOM 908   C CD2 . TYR A 1 152 ? 149.116 174.928 137.934 1.00 429.20 ? 152 TYR A CD2 1 
ATOM 909   C CE1 . TYR A 1 152 ? 149.374 176.761 135.867 1.00 452.03 ? 152 TYR A CE1 1 
ATOM 910   C CE2 . TYR A 1 152 ? 148.139 175.895 137.747 1.00 410.40 ? 152 TYR A CE2 1 
ATOM 911   C CZ  . TYR A 1 152 ? 148.266 176.808 136.711 1.00 441.38 ? 152 TYR A CZ  1 
ATOM 912   O OH  . TYR A 1 152 ? 147.299 177.774 136.531 1.00 420.75 ? 152 TYR A OH  1 
ATOM 913   N N   . GLY A 1 153 ? 152.366 173.799 140.114 1.00 370.32 ? 153 GLY A N   1 
ATOM 914   C CA  . GLY A 1 153 ? 152.151 174.117 141.531 1.00 393.16 ? 153 GLY A CA  1 
ATOM 915   C C   . GLY A 1 153 ? 153.023 173.279 142.436 1.00 377.53 ? 153 GLY A C   1 
ATOM 916   O O   . GLY A 1 153 ? 152.496 172.537 143.264 1.00 358.10 ? 153 GLY A O   1 
ATOM 917   N N   . PRO A 1 154 ? 154.360 173.422 142.316 1.00 428.41 ? 154 PRO A N   1 
ATOM 918   C CA  . PRO A 1 154 ? 155.337 172.446 142.838 1.00 463.42 ? 154 PRO A CA  1 
ATOM 919   C C   . PRO A 1 154 ? 155.207 172.179 144.331 1.00 447.34 ? 154 PRO A C   1 
ATOM 920   O O   . PRO A 1 154 ? 155.299 171.034 144.765 1.00 457.86 ? 154 PRO A O   1 
ATOM 921   C CB  . PRO A 1 154 ? 156.699 173.090 142.530 1.00 490.90 ? 154 PRO A CB  1 
ATOM 922   C CG  . PRO A 1 154 ? 156.417 174.243 141.625 1.00 500.00 ? 154 PRO A CG  1 
ATOM 923   C CD  . PRO A 1 154 ? 155.021 174.678 141.919 1.00 457.33 ? 154 PRO A CD  1 
ATOM 924   N N   . GLU A 1 155 ? 155.029 173.248 145.091 1.00 450.68 ? 155 GLU A N   1 
ATOM 925   C CA  . GLU A 1 155 ? 154.650 173.169 146.507 1.00 500.00 ? 155 GLU A CA  1 
ATOM 926   C C   . GLU A 1 155 ? 153.354 172.371 146.758 1.00 453.00 ? 155 GLU A C   1 
ATOM 927   O O   . GLU A 1 155 ? 153.310 171.506 147.642 1.00 393.45 ? 155 GLU A O   1 
ATOM 928   C CB  . GLU A 1 155 ? 154.558 174.579 147.143 1.00 500.00 ? 155 GLU A CB  1 
ATOM 929   C CG  . GLU A 1 155 ? 153.987 175.709 146.271 1.00 500.00 ? 155 GLU A CG  1 
ATOM 930   C CD  . GLU A 1 155 ? 155.053 176.506 145.519 1.00 500.00 ? 155 GLU A CD  1 
ATOM 931   O OE1 . GLU A 1 155 ? 156.036 175.898 145.041 1.00 500.00 ? 155 GLU A OE1 1 
ATOM 932   O OE2 . GLU A 1 155 ? 154.908 177.742 145.402 1.00 500.00 ? 155 GLU A OE2 1 
ATOM 933   N N   . PHE A 1 156 ? 152.325 172.644 145.958 1.00 440.95 ? 156 PHE A N   1 
ATOM 934   C CA  . PHE A 1 156 ? 150.994 172.044 146.140 1.00 466.22 ? 156 PHE A CA  1 
ATOM 935   C C   . PHE A 1 156 ? 150.791 170.701 145.433 1.00 454.70 ? 156 PHE A C   1 
ATOM 936   O O   . PHE A 1 156 ? 149.792 170.025 145.691 1.00 421.42 ? 156 PHE A O   1 
ATOM 937   C CB  . PHE A 1 156 ? 149.911 172.994 145.619 1.00 500.00 ? 156 PHE A CB  1 
ATOM 938   C CG  . PHE A 1 156 ? 150.054 174.409 146.092 1.00 500.00 ? 156 PHE A CG  1 
ATOM 939   C CD1 . PHE A 1 156 ? 149.777 174.745 147.415 1.00 500.00 ? 156 PHE A CD1 1 
ATOM 940   C CD2 . PHE A 1 156 ? 150.457 175.413 145.212 1.00 500.00 ? 156 PHE A CD2 1 
ATOM 941   C CE1 . PHE A 1 156 ? 149.906 176.055 147.856 1.00 500.00 ? 156 PHE A CE1 1 
ATOM 942   C CE2 . PHE A 1 156 ? 150.590 176.722 145.645 1.00 500.00 ? 156 PHE A CE2 1 
ATOM 943   C CZ  . PHE A 1 156 ? 150.312 177.043 146.969 1.00 500.00 ? 156 PHE A CZ  1 
ATOM 944   N N   . ALA A 1 157 ? 151.730 170.325 144.561 1.00 468.11 ? 157 ALA A N   1 
ATOM 945   C CA  . ALA A 1 157 ? 151.517 169.305 143.517 1.00 478.31 ? 157 ALA A CA  1 
ATOM 946   C C   . ALA A 1 157 ? 150.690 168.092 143.934 1.00 454.02 ? 157 ALA A C   1 
ATOM 947   O O   . ALA A 1 157 ? 149.634 167.826 143.355 1.00 473.01 ? 157 ALA A O   1 
ATOM 948   C CB  . ALA A 1 157 ? 152.852 168.851 142.941 1.00 500.00 ? 157 ALA A CB  1 
ATOM 949   N N   . HIS A 1 158 ? 151.176 167.369 144.936 1.00 422.03 ? 158 HIS A N   1 
ATOM 950   C CA  . HIS A 1 158 ? 150.543 166.130 145.385 1.00 416.07 ? 158 HIS A CA  1 
ATOM 951   C C   . HIS A 1 158 ? 150.321 166.193 146.894 1.00 413.90 ? 158 HIS A C   1 
ATOM 952   O O   . HIS A 1 158 ? 151.128 165.678 147.682 1.00 280.99 ? 158 HIS A O   1 
ATOM 953   C CB  . HIS A 1 158 ? 151.390 164.926 144.964 1.00 460.17 ? 158 HIS A CB  1 
ATOM 954   C CG  . HIS A 1 158 ? 151.700 164.898 143.498 1.00 470.58 ? 158 HIS A CG  1 
ATOM 955   N ND1 . HIS A 1 158 ? 152.752 165.601 142.949 1.00 468.71 ? 158 HIS A ND1 1 
ATOM 956   C CD2 . HIS A 1 158 ? 151.087 164.273 142.467 1.00 475.15 ? 158 HIS A CD2 1 
ATOM 957   C CE1 . HIS A 1 158 ? 152.779 165.402 141.644 1.00 460.66 ? 158 HIS A CE1 1 
ATOM 958   N NE2 . HIS A 1 158 ? 151.781 164.599 141.326 1.00 477.83 ? 158 HIS A NE2 1 
ATOM 959   N N   . CYS A 1 159 ? 149.206 166.846 147.254 1.00 489.62 ? 159 CYS A N   1 
ATOM 960   C CA  . CYS A 1 159 ? 148.770 167.152 148.638 1.00 500.00 ? 159 CYS A CA  1 
ATOM 961   C C   . CYS A 1 159 ? 149.853 167.079 149.718 1.00 500.00 ? 159 CYS A C   1 
ATOM 962   O O   . CYS A 1 159 ? 149.755 166.344 150.708 1.00 500.00 ? 159 CYS A O   1 
ATOM 963   C CB  . CYS A 1 159 ? 147.538 166.323 149.017 1.00 500.00 ? 159 CYS A CB  1 
ATOM 964   S SG  . CYS A 1 159 ? 147.747 164.544 148.840 1.00 500.00 ? 159 CYS A SG  1 
ATOM 965   N N   . ARG A 1 160 ? 150.888 167.874 149.487 1.00 500.00 ? 160 ARG A N   1 
ATOM 966   C CA  . ARG A 1 160 ? 151.954 168.089 150.446 1.00 500.00 ? 160 ARG A CA  1 
ATOM 967   C C   . ARG A 1 160 ? 151.409 168.922 151.595 1.00 477.41 ? 160 ARG A C   1 
ATOM 968   O O   . ARG A 1 160 ? 151.705 168.662 152.763 1.00 428.83 ? 160 ARG A O   1 
ATOM 969   C CB  . ARG A 1 160 ? 153.093 168.843 149.761 1.00 479.69 ? 160 ARG A CB  1 
ATOM 970   C CG  . ARG A 1 160 ? 154.462 168.652 150.384 1.00 481.23 ? 160 ARG A CG  1 
ATOM 971   C CD  . ARG A 1 160 ? 155.530 169.217 149.466 1.00 474.39 ? 160 ARG A CD  1 
ATOM 972   N NE  . ARG A 1 160 ? 155.431 168.642 148.123 1.00 461.37 ? 160 ARG A NE  1 
ATOM 973   C CZ  . ARG A 1 160 ? 155.940 169.171 147.010 1.00 489.63 ? 160 ARG A CZ  1 
ATOM 974   N NH1 . ARG A 1 160 ? 156.627 170.315 147.026 1.00 494.62 ? 160 ARG A NH1 1 
ATOM 975   N NH2 . ARG A 1 160 ? 155.762 168.541 145.853 1.00 500.00 ? 160 ARG A NH2 1 
ATOM 976   N N   . GLU A 1 161 ? 150.575 169.898 151.237 1.00 500.00 ? 161 GLU A N   1 
ATOM 977   C CA  . GLU A 1 161 ? 150.163 170.971 152.132 1.00 500.00 ? 161 GLU A CA  1 
ATOM 978   C C   . GLU A 1 161 ? 149.142 170.538 153.187 1.00 500.00 ? 161 GLU A C   1 
ATOM 979   O O   . GLU A 1 161 ? 149.288 170.895 154.360 1.00 500.00 ? 161 GLU A O   1 
ATOM 980   C CB  . GLU A 1 161 ? 149.599 172.147 151.316 1.00 500.00 ? 161 GLU A CB  1 
ATOM 981   C CG  . GLU A 1 161 ? 149.790 173.514 151.965 1.00 500.00 ? 161 GLU A CG  1 
ATOM 982   C CD  . GLU A 1 161 ? 151.179 174.101 151.739 1.00 500.00 ? 161 GLU A CD  1 
ATOM 983   O OE1 . GLU A 1 161 ? 151.630 174.156 150.573 1.00 500.00 ? 161 GLU A OE1 1 
ATOM 984   O OE2 . GLU A 1 161 ? 151.817 174.527 152.729 1.00 500.00 ? 161 GLU A OE2 1 
ATOM 985   N N   . ILE A 1 162 ? 148.125 169.779 152.774 1.00 500.00 ? 162 ILE A N   1 
ATOM 986   C CA  . ILE A 1 162 ? 146.950 169.506 153.636 1.00 500.00 ? 162 ILE A CA  1 
ATOM 987   C C   . ILE A 1 162 ? 146.528 168.035 153.819 1.00 500.00 ? 162 ILE A C   1 
ATOM 988   O O   . ILE A 1 162 ? 146.088 167.660 154.910 1.00 500.00 ? 162 ILE A O   1 
ATOM 989   C CB  . ILE A 1 162 ? 145.725 170.352 153.191 1.00 500.00 ? 162 ILE A CB  1 
ATOM 990   C CG1 . ILE A 1 162 ? 145.205 169.927 151.811 1.00 472.33 ? 162 ILE A CG1 1 
ATOM 991   C CG2 . ILE A 1 162 ? 146.072 171.836 153.177 1.00 500.00 ? 162 ILE A CG2 1 
ATOM 992   C CD1 . ILE A 1 162 ? 144.081 168.921 151.860 1.00 470.39 ? 162 ILE A CD1 1 
ATOM 993   N N   . GLN A 1 163 ? 146.648 167.220 152.767 1.00 500.00 ? 163 GLN A N   1 
ATOM 994   C CA  . GLN A 1 163 ? 146.220 165.804 152.761 1.00 496.96 ? 163 GLN A CA  1 
ATOM 995   C C   . GLN A 1 163 ? 144.689 165.688 152.863 1.00 424.21 ? 163 GLN A C   1 
ATOM 996   O O   . GLN A 1 163 ? 144.117 165.705 153.955 1.00 402.76 ? 163 GLN A O   1 
ATOM 997   C CB  . GLN A 1 163 ? 146.933 164.983 153.851 1.00 500.00 ? 163 GLN A CB  1 
ATOM 998   C CG  . GLN A 1 163 ? 147.175 163.520 153.475 1.00 500.00 ? 163 GLN A CG  1 
ATOM 999   C CD  . GLN A 1 163 ? 148.271 163.327 152.432 1.00 500.00 ? 163 GLN A CD  1 
ATOM 1000  O OE1 . GLN A 1 163 ? 148.118 162.544 151.495 1.00 500.00 ? 163 GLN A OE1 1 
ATOM 1001  N NE2 . GLN A 1 163 ? 149.386 164.036 152.594 1.00 500.00 ? 163 GLN A NE2 1 
ATOM 1002  N N   . TRP A 1 164 ? 144.057 165.537 151.703 1.00 367.41 ? 164 TRP A N   1 
ATOM 1003  C CA  . TRP A 1 164 ? 142.630 165.844 151.512 1.00 357.91 ? 164 TRP A CA  1 
ATOM 1004  C C   . TRP A 1 164 ? 141.619 165.021 152.307 1.00 353.60 ? 164 TRP A C   1 
ATOM 1005  O O   . TRP A 1 164 ? 140.636 165.567 152.841 1.00 360.65 ? 164 TRP A O   1 
ATOM 1006  C CB  . TRP A 1 164 ? 142.297 165.754 150.023 1.00 350.40 ? 164 TRP A CB  1 
ATOM 1007  C CG  . TRP A 1 164 ? 142.828 166.896 149.275 1.00 345.35 ? 164 TRP A CG  1 
ATOM 1008  C CD1 . TRP A 1 164 ? 143.982 166.945 148.553 1.00 352.95 ? 164 TRP A CD1 1 
ATOM 1009  C CD2 . TRP A 1 164 ? 142.235 168.186 149.187 1.00 356.12 ? 164 TRP A CD2 1 
ATOM 1010  N NE1 . TRP A 1 164 ? 144.142 168.193 148.007 1.00 400.46 ? 164 TRP A NE1 1 
ATOM 1011  C CE2 . TRP A 1 164 ? 143.084 168.979 148.389 1.00 405.35 ? 164 TRP A CE2 1 
ATOM 1012  C CE3 . TRP A 1 164 ? 141.072 168.758 149.718 1.00 339.03 ? 164 TRP A CE3 1 
ATOM 1013  C CZ2 . TRP A 1 164 ? 142.807 170.318 148.109 1.00 400.74 ? 164 TRP A CZ2 1 
ATOM 1014  C CZ3 . TRP A 1 164 ? 140.793 170.089 149.436 1.00 350.94 ? 164 TRP A CZ3 1 
ATOM 1015  C CH2 . TRP A 1 164 ? 141.663 170.859 148.650 1.00 354.77 ? 164 TRP A CH2 1 
ATOM 1016  N N   . ASN A 1 165 ? 141.873 163.724 152.383 1.00 346.96 ? 165 ASN A N   1 
ATOM 1017  C CA  . ASN A 1 165 ? 140.946 162.768 152.953 1.00 359.12 ? 165 ASN A CA  1 
ATOM 1018  C C   . ASN A 1 165 ? 141.659 162.028 154.081 1.00 344.15 ? 165 ASN A C   1 
ATOM 1019  O O   . ASN A 1 165 ? 142.045 160.875 153.933 1.00 351.10 ? 165 ASN A O   1 
ATOM 1020  C CB  . ASN A 1 165 ? 140.479 161.834 151.827 1.00 381.33 ? 165 ASN A CB  1 
ATOM 1021  C CG  . ASN A 1 165 ? 139.505 160.767 152.292 1.00 399.00 ? 165 ASN A CG  1 
ATOM 1022  O OD1 . ASN A 1 165 ? 138.899 160.866 153.373 1.00 356.76 ? 165 ASN A OD1 1 
ATOM 1023  N ND2 . ASN A 1 165 ? 139.355 159.725 151.473 1.00 374.68 ? 165 ASN A ND2 1 
ATOM 1024  N N   . SER A 1 166 ? 141.819 162.712 155.209 1.00 396.94 ? 166 SER A N   1 
ATOM 1025  C CA  . SER A 1 166 ? 142.584 162.206 156.363 1.00 471.58 ? 166 SER A CA  1 
ATOM 1026  C C   . SER A 1 166 ? 142.363 160.723 156.706 1.00 493.86 ? 166 SER A C   1 
ATOM 1027  O O   . SER A 1 166 ? 143.325 159.990 156.956 1.00 478.56 ? 166 SER A O   1 
ATOM 1028  C CB  . SER A 1 166 ? 142.290 163.068 157.605 1.00 500.00 ? 166 SER A CB  1 
ATOM 1029  O OG  . SER A 1 166 ? 140.901 163.122 157.894 1.00 479.62 ? 166 SER A OG  1 
ATOM 1030  N N   . LEU A 1 167 ? 141.100 160.297 156.708 1.00 500.00 ? 167 LEU A N   1 
ATOM 1031  C CA  . LEU A 1 167 ? 140.716 158.934 157.087 1.00 486.80 ? 167 LEU A CA  1 
ATOM 1032  C C   . LEU A 1 167 ? 140.445 158.112 155.833 1.00 402.47 ? 167 LEU A C   1 
ATOM 1033  O O   . LEU A 1 167 ? 139.302 157.722 155.558 1.00 302.10 ? 167 LEU A O   1 
ATOM 1034  C CB  . LEU A 1 167 ? 139.489 158.984 158.010 1.00 500.00 ? 167 LEU A CB  1 
ATOM 1035  C CG  . LEU A 1 167 ? 138.977 157.715 158.707 1.00 500.00 ? 167 LEU A CG  1 
ATOM 1036  C CD1 . LEU A 1 167 ? 140.073 157.004 159.495 1.00 500.00 ? 167 LEU A CD1 1 
ATOM 1037  C CD2 . LEU A 1 167 ? 137.793 158.068 159.606 1.00 500.00 ? 167 LEU A CD2 1 
ATOM 1038  N N   . GLY A 1 168 ? 141.519 157.866 155.081 1.00 398.93 ? 168 GLY A N   1 
ATOM 1039  C CA  . GLY A 1 168 ? 141.467 157.148 153.801 1.00 448.49 ? 168 GLY A CA  1 
ATOM 1040  C C   . GLY A 1 168 ? 142.480 156.019 153.757 1.00 451.90 ? 168 GLY A C   1 
ATOM 1041  O O   . GLY A 1 168 ? 143.604 156.168 154.244 1.00 460.45 ? 168 GLY A O   1 
ATOM 1042  N N   . ASN A 1 169 ? 142.083 154.890 153.173 1.00 431.09 ? 169 ASN A N   1 
ATOM 1043  C CA  . ASN A 1 169 ? 142.911 153.684 153.186 1.00 384.34 ? 169 ASN A CA  1 
ATOM 1044  C C   . ASN A 1 169 ? 143.847 153.606 151.991 1.00 364.58 ? 169 ASN A C   1 
ATOM 1045  O O   . ASN A 1 169 ? 145.058 153.464 152.169 1.00 371.70 ? 169 ASN A O   1 
ATOM 1046  C CB  . ASN A 1 169 ? 142.033 152.431 153.260 1.00 396.01 ? 169 ASN A CB  1 
ATOM 1047  C CG  . ASN A 1 169 ? 141.252 152.340 154.564 1.00 397.44 ? 169 ASN A CG  1 
ATOM 1048  O OD1 . ASN A 1 169 ? 140.735 153.339 155.064 1.00 402.34 ? 169 ASN A OD1 1 
ATOM 1049  N ND2 . ASN A 1 169 ? 141.151 151.135 155.113 1.00 390.52 ? 169 ASN A ND2 1 
ATOM 1050  N N   . GLY A 1 170 ? 143.285 153.722 150.785 1.00 364.06 ? 170 GLY A N   1 
ATOM 1051  C CA  . GLY A 1 170 ? 144.015 153.471 149.528 1.00 382.21 ? 170 GLY A CA  1 
ATOM 1052  C C   . GLY A 1 170 ? 143.867 152.012 149.112 1.00 384.04 ? 170 GLY A C   1 
ATOM 1053  O O   . GLY A 1 170 ? 144.853 151.311 148.850 1.00 347.99 ? 170 GLY A O   1 
ATOM 1054  N N   . LEU A 1 171 ? 142.608 151.593 149.019 1.00 374.72 ? 171 LEU A N   1 
ATOM 1055  C CA  . LEU A 1 171 ? 142.190 150.197 149.001 1.00 352.72 ? 171 LEU A CA  1 
ATOM 1056  C C   . LEU A 1 171 ? 141.540 149.828 147.658 1.00 337.51 ? 171 LEU A C   1 
ATOM 1057  O O   . LEU A 1 171 ? 141.995 148.910 146.965 1.00 251.91 ? 171 LEU A O   1 
ATOM 1058  C CB  . LEU A 1 171 ? 141.217 149.985 150.169 1.00 332.27 ? 171 LEU A CB  1 
ATOM 1059  C CG  . LEU A 1 171 ? 141.006 148.569 150.697 1.00 371.75 ? 171 LEU A CG  1 
ATOM 1060  C CD1 . LEU A 1 171 ? 142.293 147.966 151.249 1.00 354.82 ? 171 LEU A CD1 1 
ATOM 1061  C CD2 . LEU A 1 171 ? 139.928 148.604 151.768 1.00 405.18 ? 171 LEU A CD2 1 
ATOM 1062  N N   . ALA A 1 172 ? 140.499 150.569 147.275 1.00 360.35 ? 172 ALA A N   1 
ATOM 1063  C CA  . ALA A 1 172 ? 139.893 150.445 145.938 1.00 362.07 ? 172 ALA A CA  1 
ATOM 1064  C C   . ALA A 1 172 ? 140.876 150.801 144.832 1.00 341.24 ? 172 ALA A C   1 
ATOM 1065  O O   . ALA A 1 172 ? 140.555 150.656 143.654 1.00 383.36 ? 172 ALA A O   1 
ATOM 1066  C CB  . ALA A 1 172 ? 138.650 151.314 145.819 1.00 375.69 ? 172 ALA A CB  1 
ATOM 1067  N N   . TYR A 1 173 ? 142.044 151.314 145.213 1.00 301.45 ? 173 TYR A N   1 
ATOM 1068  C CA  . TYR A 1 173 ? 143.208 151.331 144.359 1.00 325.41 ? 173 TYR A CA  1 
ATOM 1069  C C   . TYR A 1 173 ? 144.264 150.389 144.958 1.00 346.34 ? 173 TYR A C   1 
ATOM 1070  O O   . TYR A 1 173 ? 145.342 150.818 145.368 1.00 387.99 ? 173 TYR A O   1 
ATOM 1071  C CB  . TYR A 1 173 ? 143.716 152.762 144.218 1.00 319.45 ? 173 TYR A CB  1 
ATOM 1072  C CG  . TYR A 1 173 ? 142.731 153.704 143.553 1.00 342.33 ? 173 TYR A CG  1 
ATOM 1073  C CD1 . TYR A 1 173 ? 141.520 154.036 144.166 1.00 363.91 ? 173 TYR A CD1 1 
ATOM 1074  C CD2 . TYR A 1 173 ? 143.012 154.278 142.314 1.00 409.34 ? 173 TYR A CD2 1 
ATOM 1075  C CE1 . TYR A 1 173 ? 140.620 154.902 143.566 1.00 416.36 ? 173 TYR A CE1 1 
ATOM 1076  C CE2 . TYR A 1 173 ? 142.112 155.145 141.703 1.00 458.18 ? 173 TYR A CE2 1 
ATOM 1077  C CZ  . TYR A 1 173 ? 140.916 155.454 142.332 1.00 450.23 ? 173 TYR A CZ  1 
ATOM 1078  O OH  . TYR A 1 173 ? 140.014 156.313 141.735 1.00 449.70 ? 173 TYR A OH  1 
ATOM 1079  N N   . GLU A 1 174 ? 143.917 149.103 145.025 1.00 334.71 ? 174 GLU A N   1 
ATOM 1080  C CA  . GLU A 1 174 ? 144.852 148.035 145.398 1.00 344.44 ? 174 GLU A CA  1 
ATOM 1081  C C   . GLU A 1 174 ? 144.450 146.721 144.719 1.00 412.50 ? 174 GLU A C   1 
ATOM 1082  O O   . GLU A 1 174 ? 143.282 146.332 144.766 1.00 457.52 ? 174 GLU A O   1 
ATOM 1083  C CB  . GLU A 1 174 ? 144.880 147.843 146.910 1.00 352.00 ? 174 GLU A CB  1 
ATOM 1084  C CG  . GLU A 1 174 ? 146.063 147.028 147.417 1.00 415.19 ? 174 GLU A CG  1 
ATOM 1085  C CD  . GLU A 1 174 ? 147.396 147.739 147.255 1.00 474.59 ? 174 GLU A CD  1 
ATOM 1086  O OE1 . GLU A 1 174 ? 147.456 148.974 147.450 1.00 499.47 ? 174 GLU A OE1 1 
ATOM 1087  O OE2 . GLU A 1 174 ? 148.396 147.057 146.942 1.00 500.00 ? 174 GLU A OE2 1 
ATOM 1088  N N   . ASP A 1 175 ? 145.428 146.034 144.125 1.00 455.10 ? 175 ASP A N   1 
ATOM 1089  C CA  . ASP A 1 175 ? 145.186 144.886 143.235 1.00 447.86 ? 175 ASP A CA  1 
ATOM 1090  C C   . ASP A 1 175 ? 145.295 143.548 143.979 1.00 436.55 ? 175 ASP A C   1 
ATOM 1091  O O   . ASP A 1 175 ? 146.177 143.386 144.826 1.00 457.42 ? 175 ASP A O   1 
ATOM 1092  C CB  . ASP A 1 175 ? 146.204 144.934 142.084 1.00 436.41 ? 175 ASP A CB  1 
ATOM 1093  C CG  . ASP A 1 175 ? 145.735 144.199 140.839 1.00 426.14 ? 175 ASP A CG  1 
ATOM 1094  O OD1 . ASP A 1 175 ? 144.545 144.306 140.472 1.00 392.26 ? 175 ASP A OD1 1 
ATOM 1095  O OD2 . ASP A 1 175 ? 146.580 143.533 140.208 1.00 456.51 ? 175 ASP A OD2 1 
ATOM 1096  N N   . PHE A 1 176 ? 144.414 142.596 143.650 1.00 412.60 ? 176 PHE A N   1 
ATOM 1097  C CA  . PHE A 1 176 ? 144.354 141.295 144.342 1.00 409.02 ? 176 PHE A CA  1 
ATOM 1098  C C   . PHE A 1 176 ? 144.371 140.096 143.410 1.00 413.59 ? 176 PHE A C   1 
ATOM 1099  O O   . PHE A 1 176 ? 143.798 140.136 142.320 1.00 424.44 ? 176 PHE A O   1 
ATOM 1100  C CB  . PHE A 1 176 ? 143.096 141.211 145.206 1.00 392.42 ? 176 PHE A CB  1 
ATOM 1101  C CG  . PHE A 1 176 ? 143.033 142.267 146.252 1.00 360.20 ? 176 PHE A CG  1 
ATOM 1102  C CD1 . PHE A 1 176 ? 143.931 142.254 147.311 1.00 399.54 ? 176 PHE A CD1 1 
ATOM 1103  C CD2 . PHE A 1 176 ? 142.115 143.291 146.166 1.00 313.35 ? 176 PHE A CD2 1 
ATOM 1104  C CE1 . PHE A 1 176 ? 143.903 143.245 148.275 1.00 402.43 ? 176 PHE A CE1 1 
ATOM 1105  C CE2 . PHE A 1 176 ? 142.076 144.282 147.129 1.00 361.88 ? 176 PHE A CE2 1 
ATOM 1106  C CZ  . PHE A 1 176 ? 142.976 144.264 148.179 1.00 383.54 ? 176 PHE A CZ  1 
ATOM 1107  N N   . SER A 1 177 ? 145.003 139.019 143.874 1.00 416.64 ? 177 SER A N   1 
ATOM 1108  C CA  . SER A 1 177 ? 144.980 137.736 143.168 1.00 439.96 ? 177 SER A CA  1 
ATOM 1109  C C   . SER A 1 177 ? 143.595 137.108 143.201 1.00 422.99 ? 177 SER A C   1 
ATOM 1110  O O   . SER A 1 177 ? 143.222 136.393 142.276 1.00 478.65 ? 177 SER A O   1 
ATOM 1111  C CB  . SER A 1 177 ? 145.976 136.733 143.775 1.00 468.10 ? 177 SER A CB  1 
ATOM 1112  O OG  . SER A 1 177 ? 145.361 135.890 144.745 1.00 395.32 ? 177 SER A OG  1 
ATOM 1113  N N   . PHE A 1 178 ? 142.852 137.382 144.270 1.00 370.09 ? 178 PHE A N   1 
ATOM 1114  C CA  . PHE A 1 178 ? 141.625 136.654 144.601 1.00 372.48 ? 178 PHE A CA  1 
ATOM 1115  C C   . PHE A 1 178 ? 140.414 137.543 144.283 1.00 333.45 ? 178 PHE A C   1 
ATOM 1116  O O   . PHE A 1 178 ? 140.583 138.554 143.574 1.00 279.76 ? 178 PHE A O   1 
ATOM 1117  C CB  . PHE A 1 178 ? 141.670 136.116 146.056 1.00 375.73 ? 178 PHE A CB  1 
ATOM 1118  C CG  . PHE A 1 178 ? 142.092 137.127 147.088 1.00 369.98 ? 178 PHE A CG  1 
ATOM 1119  C CD1 . PHE A 1 178 ? 143.443 137.371 147.332 1.00 401.57 ? 178 PHE A CD1 1 
ATOM 1120  C CD2 . PHE A 1 178 ? 141.149 137.813 147.837 1.00 325.03 ? 178 PHE A CD2 1 
ATOM 1121  C CE1 . PHE A 1 178 ? 143.843 138.303 148.279 1.00 391.55 ? 178 PHE A CE1 1 
ATOM 1122  C CE2 . PHE A 1 178 ? 141.544 138.741 148.785 1.00 338.64 ? 178 PHE A CE2 1 
ATOM 1123  C CZ  . PHE A 1 178 ? 142.891 138.988 149.008 1.00 356.50 ? 178 PHE A CZ  1 
ATOM 1124  N N   . PRO A 1 179 ? 139.192 137.124 144.696 1.00 335.87 ? 179 PRO A N   1 
ATOM 1125  C CA  . PRO A 1 179 ? 138.014 137.984 144.561 1.00 332.47 ? 179 PRO A CA  1 
ATOM 1126  C C   . PRO A 1 179 ? 137.293 138.363 145.857 1.00 325.02 ? 179 PRO A C   1 
ATOM 1127  O O   . PRO A 1 179 ? 137.187 137.553 146.788 1.00 345.51 ? 179 PRO A O   1 
ATOM 1128  C CB  . PRO A 1 179 ? 137.096 137.129 143.711 1.00 345.58 ? 179 PRO A CB  1 
ATOM 1129  C CG  . PRO A 1 179 ? 137.340 135.758 144.249 1.00 383.27 ? 179 PRO A CG  1 
ATOM 1130  C CD  . PRO A 1 179 ? 138.784 135.705 144.688 1.00 345.23 ? 179 PRO A CD  1 
ATOM 1131  N N   . ILE A 1 180 ? 136.785 139.592 145.902 1.00 330.28 ? 180 ILE A N   1 
ATOM 1132  C CA  . ILE A 1 180 ? 136.042 140.069 147.064 1.00 341.98 ? 180 ILE A CA  1 
ATOM 1133  C C   . ILE A 1 180 ? 134.616 140.440 146.652 1.00 324.63 ? 180 ILE A C   1 
ATOM 1134  O O   . ILE A 1 180 ? 134.384 140.941 145.555 1.00 240.57 ? 180 ILE A O   1 
ATOM 1135  C CB  . ILE A 1 180 ? 136.750 141.234 147.810 1.00 339.38 ? 180 ILE A CB  1 
ATOM 1136  C CG1 . ILE A 1 180 ? 138.253 140.963 148.009 1.00 342.38 ? 180 ILE A CG1 1 
ATOM 1137  C CG2 . ILE A 1 180 ? 136.150 141.410 149.195 1.00 356.38 ? 180 ILE A CG2 1 
ATOM 1138  C CD1 . ILE A 1 180 ? 139.176 141.622 147.007 1.00 358.02 ? 180 ILE A CD1 1 
ATOM 1139  N N   . PHE A 1 181 ? 133.677 140.130 147.552 1.00 351.86 ? 181 PHE A N   1 
ATOM 1140  C CA  . PHE A 1 181 ? 132.254 140.402 147.385 1.00 355.16 ? 181 PHE A CA  1 
ATOM 1141  C C   . PHE A 1 181 ? 131.704 141.096 148.604 1.00 360.06 ? 181 PHE A C   1 
ATOM 1142  O O   . PHE A 1 181 ? 132.039 140.713 149.725 1.00 304.64 ? 181 PHE A O   1 
ATOM 1143  C CB  . PHE A 1 181 ? 131.475 139.108 147.213 1.00 357.80 ? 181 PHE A CB  1 
ATOM 1144  C CG  . PHE A 1 181 ? 131.059 138.855 145.809 1.00 381.20 ? 181 PHE A CG  1 
ATOM 1145  C CD1 . PHE A 1 181 ? 132.021 138.677 144.823 1.00 367.60 ? 181 PHE A CD1 1 
ATOM 1146  C CD2 . PHE A 1 181 ? 129.711 138.811 145.463 1.00 392.24 ? 181 PHE A CD2 1 
ATOM 1147  C CE1 . PHE A 1 181 ? 131.648 138.440 143.514 1.00 406.71 ? 181 PHE A CE1 1 
ATOM 1148  C CE2 . PHE A 1 181 ? 129.330 138.579 144.153 1.00 431.21 ? 181 PHE A CE2 1 
ATOM 1149  C CZ  . PHE A 1 181 ? 130.300 138.390 143.176 1.00 450.87 ? 181 PHE A CZ  1 
ATOM 1150  N N   . LEU A 1 182 ? 130.827 142.076 148.367 1.00 378.23 ? 182 LEU A N   1 
ATOM 1151  C CA  . LEU A 1 182 ? 130.180 142.836 149.442 1.00 349.76 ? 182 LEU A CA  1 
ATOM 1152  C C   . LEU A 1 182 ? 128.706 142.521 149.471 1.00 350.07 ? 182 LEU A C   1 
ATOM 1153  O O   . LEU A 1 182 ? 127.945 142.950 148.589 1.00 303.36 ? 182 LEU A O   1 
ATOM 1154  C CB  . LEU A 1 182 ? 130.351 144.320 149.230 1.00 329.13 ? 182 LEU A CB  1 
ATOM 1155  C CG  . LEU A 1 182 ? 129.475 145.290 150.022 1.00 407.86 ? 182 LEU A CG  1 
ATOM 1156  C CD1 . LEU A 1 182 ? 130.101 145.539 151.387 1.00 445.92 ? 182 LEU A CD1 1 
ATOM 1157  C CD2 . LEU A 1 182 ? 129.258 146.590 149.259 1.00 435.03 ? 182 LEU A CD2 1 
ATOM 1158  N N   . LEU A 1 183 ? 128.296 141.811 150.511 1.00 367.51 ? 183 LEU A N   1 
ATOM 1159  C CA  . LEU A 1 183 ? 126.922 141.378 150.587 1.00 379.76 ? 183 LEU A CA  1 
ATOM 1160  C C   . LEU A 1 183 ? 126.059 142.532 151.086 1.00 393.71 ? 183 LEU A C   1 
ATOM 1161  O O   . LEU A 1 183 ? 125.913 142.760 152.291 1.00 382.66 ? 183 LEU A O   1 
ATOM 1162  C CB  . LEU A 1 183 ? 126.795 140.114 151.442 1.00 374.51 ? 183 LEU A CB  1 
ATOM 1163  C CG  . LEU A 1 183 ? 127.713 138.946 151.036 1.00 344.10 ? 183 LEU A CG  1 
ATOM 1164  C CD1 . LEU A 1 183 ? 127.357 137.705 151.836 1.00 352.11 ? 183 LEU A CD1 1 
ATOM 1165  C CD2 . LEU A 1 183 ? 127.665 138.643 149.544 1.00 342.52 ? 183 LEU A CD2 1 
ATOM 1166  N N   . GLU A 1 184 ? 125.537 143.288 150.118 1.00 403.59 ? 184 GLU A N   1 
ATOM 1167  C CA  . GLU A 1 184 ? 124.346 144.101 150.334 1.00 438.30 ? 184 GLU A CA  1 
ATOM 1168  C C   . GLU A 1 184 ? 123.276 143.135 150.815 1.00 422.15 ? 184 GLU A C   1 
ATOM 1169  O O   . GLU A 1 184 ? 123.262 141.979 150.404 1.00 395.40 ? 184 GLU A O   1 
ATOM 1170  C CB  . GLU A 1 184 ? 123.878 144.771 149.038 1.00 475.83 ? 184 GLU A CB  1 
ATOM 1171  C CG  . GLU A 1 184 ? 124.773 145.886 148.514 1.00 473.87 ? 184 GLU A CG  1 
ATOM 1172  C CD  . GLU A 1 184 ? 124.105 146.703 147.414 1.00 479.72 ? 184 GLU A CD  1 
ATOM 1173  O OE1 . GLU A 1 184 ? 123.510 146.110 146.489 1.00 450.99 ? 184 GLU A OE1 1 
ATOM 1174  O OE2 . GLU A 1 184 ? 124.174 147.948 147.473 1.00 500.00 ? 184 GLU A OE2 1 
ATOM 1175  N N   . ASP A 1 185 ? 122.400 143.601 151.696 1.00 440.62 ? 185 ASP A N   1 
ATOM 1176  C CA  . ASP A 1 185 ? 121.478 142.725 152.421 1.00 476.77 ? 185 ASP A CA  1 
ATOM 1177  C C   . ASP A 1 185 ? 122.249 142.008 153.541 1.00 451.78 ? 185 ASP A C   1 
ATOM 1178  O O   . ASP A 1 185 ? 123.440 141.709 153.426 1.00 367.89 ? 185 ASP A O   1 
ATOM 1179  C CB  . ASP A 1 185 ? 120.775 141.711 151.480 1.00 500.00 ? 185 ASP A CB  1 
ATOM 1180  C CG  . ASP A 1 185 ? 119.455 141.181 152.035 1.00 500.00 ? 185 ASP A CG  1 
ATOM 1181  O OD1 . ASP A 1 185 ? 119.241 141.196 153.267 1.00 500.00 ? 185 ASP A OD1 1 
ATOM 1182  O OD2 . ASP A 1 185 ? 118.627 140.721 151.220 1.00 500.00 ? 185 ASP A OD2 1 
ATOM 1183  N N   . GLU A 1 186 ? 121.537 141.766 154.632 1.00 476.74 ? 186 GLU A N   1 
ATOM 1184  C CA  . GLU A 1 186 ? 122.050 141.071 155.810 1.00 500.00 ? 186 GLU A CA  1 
ATOM 1185  C C   . GLU A 1 186 ? 121.693 139.562 155.811 1.00 467.41 ? 186 GLU A C   1 
ATOM 1186  O O   . GLU A 1 186 ? 122.354 138.771 156.499 1.00 478.73 ? 186 GLU A O   1 
ATOM 1187  C CB  . GLU A 1 186 ? 121.411 141.747 157.033 1.00 500.00 ? 186 GLU A CB  1 
ATOM 1188  C CG  . GLU A 1 186 ? 122.024 141.440 158.392 1.00 500.00 ? 186 GLU A CG  1 
ATOM 1189  C CD  . GLU A 1 186 ? 121.307 142.150 159.540 1.00 500.00 ? 186 GLU A CD  1 
ATOM 1190  O OE1 . GLU A 1 186 ? 120.486 143.064 159.289 1.00 500.00 ? 186 GLU A OE1 1 
ATOM 1191  O OE2 . GLU A 1 186 ? 121.569 141.789 160.709 1.00 500.00 ? 186 GLU A OE2 1 
ATOM 1192  N N   . ASN A 1 187 ? 120.548 139.267 155.191 1.00 441.54 ? 187 ASN A N   1 
ATOM 1193  C CA  . ASN A 1 187 ? 119.920 137.966 155.300 1.00 447.23 ? 187 ASN A CA  1 
ATOM 1194  C C   . ASN A 1 187 ? 120.850 136.882 154.785 1.00 436.55 ? 187 ASN A C   1 
ATOM 1195  O O   . ASN A 1 187 ? 121.001 135.836 155.435 1.00 471.13 ? 187 ASN A O   1 
ATOM 1196  C CB  . ASN A 1 187 ? 118.542 137.960 154.646 1.00 452.03 ? 187 ASN A CB  1 
ATOM 1197  C CG  . ASN A 1 187 ? 117.568 138.862 155.390 1.00 455.97 ? 187 ASN A CG  1 
ATOM 1198  O OD1 . ASN A 1 187 ? 117.878 140.029 155.642 1.00 438.72 ? 187 ASN A OD1 1 
ATOM 1199  N ND2 . ASN A 1 187 ? 116.402 138.329 155.753 1.00 469.41 ? 187 ASN A ND2 1 
ATOM 1200  N N   . GLU A 1 188 ? 121.464 137.159 153.641 1.00 412.45 ? 188 GLU A N   1 
ATOM 1201  C CA  . GLU A 1 188 ? 122.401 136.233 152.999 1.00 420.02 ? 188 GLU A CA  1 
ATOM 1202  C C   . GLU A 1 188 ? 123.555 135.912 153.949 1.00 401.96 ? 188 GLU A C   1 
ATOM 1203  O O   . GLU A 1 188 ? 123.933 134.739 154.130 1.00 403.69 ? 188 GLU A O   1 
ATOM 1204  C CB  . GLU A 1 188 ? 122.938 136.837 151.699 1.00 458.46 ? 188 GLU A CB  1 
ATOM 1205  C CG  . GLU A 1 188 ? 121.911 136.853 150.572 1.00 500.00 ? 188 GLU A CG  1 
ATOM 1206  C CD  . GLU A 1 188 ? 121.612 138.242 150.039 1.00 500.00 ? 188 GLU A CD  1 
ATOM 1207  O OE1 . GLU A 1 188 ? 122.560 138.950 149.637 1.00 500.00 ? 188 GLU A OE1 1 
ATOM 1208  O OE2 . GLU A 1 188 ? 120.420 138.618 150.011 1.00 500.00 ? 188 GLU A OE2 1 
ATOM 1209  N N   . THR A 1 189 ? 124.079 136.989 154.539 1.00 392.04 ? 189 THR A N   1 
ATOM 1210  C CA  . THR A 1 189 ? 125.203 136.887 155.481 1.00 425.50 ? 189 THR A CA  1 
ATOM 1211  C C   . THR A 1 189 ? 124.825 135.995 156.656 1.00 407.95 ? 189 THR A C   1 
ATOM 1212  O O   . THR A 1 189 ? 125.602 135.121 157.061 1.00 369.07 ? 189 THR A O   1 
ATOM 1213  C CB  . THR A 1 189 ? 125.744 138.248 155.983 1.00 465.69 ? 189 THR A CB  1 
ATOM 1214  O OG1 . THR A 1 189 ? 124.748 138.931 156.753 1.00 494.49 ? 189 THR A OG1 1 
ATOM 1215  C CG2 . THR A 1 189 ? 126.197 139.129 154.815 1.00 500.00 ? 189 THR A CG2 1 
ATOM 1216  N N   . LYS A 1 190 ? 123.629 136.245 157.170 1.00 425.34 ? 190 LYS A N   1 
ATOM 1217  C CA  . LYS A 1 190 ? 123.075 135.497 158.306 1.00 417.36 ? 190 LYS A CA  1 
ATOM 1218  C C   . LYS A 1 190 ? 123.013 134.009 157.970 1.00 428.22 ? 190 LYS A C   1 
ATOM 1219  O O   . LYS A 1 190 ? 123.420 133.158 158.773 1.00 423.57 ? 190 LYS A O   1 
ATOM 1220  C CB  . LYS A 1 190 ? 121.706 136.096 158.689 1.00 390.29 ? 190 LYS A CB  1 
ATOM 1221  C CG  . LYS A 1 190 ? 120.803 135.260 159.583 1.00 455.30 ? 190 LYS A CG  1 
ATOM 1222  C CD  . LYS A 1 190 ? 119.748 134.508 158.780 1.00 499.15 ? 190 LYS A CD  1 
ATOM 1223  C CE  . LYS A 1 190 ? 118.701 133.885 159.689 1.00 500.00 ? 190 LYS A CE  1 
ATOM 1224  N NZ  . LYS A 1 190 ? 117.626 133.187 158.927 1.00 500.00 ? 190 LYS A NZ  1 
ATOM 1225  N N   . VAL A 1 191 ? 122.502 133.737 156.778 1.00 439.19 ? 191 VAL A N   1 
ATOM 1226  C CA  . VAL A 1 191 ? 122.349 132.372 156.266 1.00 427.96 ? 191 VAL A CA  1 
ATOM 1227  C C   . VAL A 1 191 ? 123.710 131.675 156.233 1.00 374.64 ? 191 VAL A C   1 
ATOM 1228  O O   . VAL A 1 191 ? 123.848 130.519 156.681 1.00 376.00 ? 191 VAL A O   1 
ATOM 1229  C CB  . VAL A 1 191 ? 121.697 132.332 154.857 1.00 467.16 ? 191 VAL A CB  1 
ATOM 1230  C CG1 . VAL A 1 191 ? 121.883 130.974 154.177 1.00 456.02 ? 191 VAL A CG1 1 
ATOM 1231  C CG2 . VAL A 1 191 ? 120.215 132.674 154.950 1.00 500.00 ? 191 VAL A CG2 1 
ATOM 1232  N N   . ILE A 1 192 ? 124.684 132.407 155.698 1.00 318.80 ? 192 ILE A N   1 
ATOM 1233  C CA  . ILE A 1 192 ? 126.053 131.906 155.567 1.00 340.37 ? 192 ILE A CA  1 
ATOM 1234  C C   . ILE A 1 192 ? 126.613 131.541 156.948 1.00 389.81 ? 192 ILE A C   1 
ATOM 1235  O O   . ILE A 1 192 ? 127.215 130.471 157.123 1.00 372.87 ? 192 ILE A O   1 
ATOM 1236  C CB  . ILE A 1 192 ? 126.989 132.777 154.701 1.00 344.71 ? 192 ILE A CB  1 
ATOM 1237  C CG1 . ILE A 1 192 ? 126.458 132.808 153.262 1.00 332.94 ? 192 ILE A CG1 1 
ATOM 1238  C CG2 . ILE A 1 192 ? 128.414 132.205 154.706 1.00 301.54 ? 192 ILE A CG2 1 
ATOM 1239  C CD1 . ILE A 1 192 ? 127.256 133.683 152.317 1.00 354.87 ? 192 ILE A CD1 1 
ATOM 1240  N N   . LYS A 1 193 ? 126.385 132.445 157.890 1.00 428.18 ? 193 LYS A N   1 
ATOM 1241  C CA  . LYS A 1 193 ? 126.835 132.272 159.272 1.00 426.66 ? 193 LYS A CA  1 
ATOM 1242  C C   . LYS A 1 193 ? 126.243 131.006 159.869 1.00 395.79 ? 193 LYS A C   1 
ATOM 1243  O O   . LYS A 1 193 ? 126.949 130.214 160.504 1.00 346.20 ? 193 LYS A O   1 
ATOM 1244  C CB  . LYS A 1 193 ? 126.601 133.512 160.153 1.00 466.95 ? 193 LYS A CB  1 
ATOM 1245  C CG  . LYS A 1 193 ? 127.878 134.320 160.340 1.00 479.19 ? 193 LYS A CG  1 
ATOM 1246  C CD  . LYS A 1 193 ? 127.698 135.570 161.179 1.00 500.00 ? 193 LYS A CD  1 
ATOM 1247  C CE  . LYS A 1 193 ? 129.053 136.166 161.538 1.00 500.00 ? 193 LYS A CE  1 
ATOM 1248  N NZ  . LYS A 1 193 ? 128.944 137.505 162.179 1.00 500.00 ? 193 LYS A NZ  1 
ATOM 1249  N N   . GLN A 1 194 ? 124.950 130.843 159.640 1.00 417.36 ? 194 GLN A N   1 
ATOM 1250  C CA  . GLN A 1 194 ? 124.187 129.678 160.116 1.00 465.82 ? 194 GLN A CA  1 
ATOM 1251  C C   . GLN A 1 194 ? 124.809 128.397 159.582 1.00 448.83 ? 194 GLN A C   1 
ATOM 1252  O O   . GLN A 1 194 ? 125.019 127.428 160.327 1.00 461.48 ? 194 GLN A O   1 
ATOM 1253  C CB  . GLN A 1 194 ? 122.732 129.724 159.632 1.00 499.95 ? 194 GLN A CB  1 
ATOM 1254  C CG  . GLN A 1 194 ? 121.737 130.289 160.626 1.00 500.00 ? 194 GLN A CG  1 
ATOM 1255  C CD  . GLN A 1 194 ? 120.306 129.948 160.256 1.00 500.00 ? 194 GLN A CD  1 
ATOM 1256  O OE1 . GLN A 1 194 ? 119.972 129.808 159.078 1.00 500.00 ? 194 GLN A OE1 1 
ATOM 1257  N NE2 . GLN A 1 194 ? 119.451 129.808 161.266 1.00 500.00 ? 194 GLN A NE2 1 
ATOM 1258  N N   . CYS A 1 195 ? 125.084 128.428 158.282 1.00 413.97 ? 195 CYS A N   1 
ATOM 1259  C CA  . CYS A 1 195 ? 125.684 127.292 157.572 1.00 416.38 ? 195 CYS A CA  1 
ATOM 1260  C C   . CYS A 1 195 ? 127.018 126.918 158.209 1.00 420.88 ? 195 CYS A C   1 
ATOM 1261  O O   . CYS A 1 195 ? 127.298 125.738 158.464 1.00 464.01 ? 195 CYS A O   1 
ATOM 1262  C CB  . CYS A 1 195 ? 125.894 127.558 156.086 1.00 406.79 ? 195 CYS A CB  1 
ATOM 1263  S SG  . CYS A 1 195 ? 126.712 126.163 155.261 1.00 481.10 ? 195 CYS A SG  1 
ATOM 1264  N N   . TYR A 1 196 ? 127.812 127.951 158.452 1.00 385.18 ? 196 TYR A N   1 
ATOM 1265  C CA  . TYR A 1 196 ? 129.139 127.818 159.065 1.00 374.00 ? 196 TYR A CA  1 
ATOM 1266  C C   . TYR A 1 196 ? 129.023 127.126 160.421 1.00 374.67 ? 196 TYR A C   1 
ATOM 1267  O O   . TYR A 1 196 ? 129.778 126.190 160.736 1.00 379.86 ? 196 TYR A O   1 
ATOM 1268  C CB  . TYR A 1 196 ? 129.723 129.218 159.307 1.00 391.29 ? 196 TYR A CB  1 
ATOM 1269  C CG  . TYR A 1 196 ? 131.081 129.254 159.966 1.00 422.42 ? 196 TYR A CG  1 
ATOM 1270  C CD1 . TYR A 1 196 ? 132.221 128.832 159.285 1.00 432.77 ? 196 TYR A CD1 1 
ATOM 1271  C CD2 . TYR A 1 196 ? 131.232 129.735 161.264 1.00 453.24 ? 196 TYR A CD2 1 
ATOM 1272  C CE1 . TYR A 1 196 ? 133.471 128.865 159.887 1.00 420.90 ? 196 TYR A CE1 1 
ATOM 1273  C CE2 . TYR A 1 196 ? 132.481 129.778 161.869 1.00 481.54 ? 196 TYR A CE2 1 
ATOM 1274  C CZ  . TYR A 1 196 ? 133.598 129.344 161.177 1.00 441.08 ? 196 TYR A CZ  1 
ATOM 1275  O OH  . TYR A 1 196 ? 134.835 129.383 161.772 1.00 426.37 ? 196 TYR A OH  1 
ATOM 1276  N N   . GLN A 1 197 ? 128.066 127.616 161.196 1.00 402.90 ? 197 GLN A N   1 
ATOM 1277  C CA  . GLN A 1 197 ? 127.788 127.102 162.539 1.00 461.23 ? 197 GLN A CA  1 
ATOM 1278  C C   . GLN A 1 197 ? 127.454 125.620 162.479 1.00 486.64 ? 197 GLN A C   1 
ATOM 1279  O O   . GLN A 1 197 ? 127.972 124.808 163.257 1.00 500.00 ? 197 GLN A O   1 
ATOM 1280  C CB  . GLN A 1 197 ? 126.680 127.897 163.244 1.00 496.85 ? 197 GLN A CB  1 
ATOM 1281  C CG  . GLN A 1 197 ? 126.829 127.914 164.757 1.00 500.00 ? 197 GLN A CG  1 
ATOM 1282  C CD  . GLN A 1 197 ? 128.154 128.516 165.208 1.00 500.00 ? 197 GLN A CD  1 
ATOM 1283  O OE1 . GLN A 1 197 ? 128.457 129.672 164.908 1.00 500.00 ? 197 GLN A OE1 1 
ATOM 1284  N NE2 . GLN A 1 197 ? 128.956 127.726 165.915 1.00 500.00 ? 197 GLN A NE2 1 
ATOM 1285  N N   . ASP A 1 198 ? 126.591 125.291 161.524 1.00 481.36 ? 198 ASP A N   1 
ATOM 1286  C CA  . ASP A 1 198 ? 126.131 123.917 161.289 1.00 462.96 ? 198 ASP A CA  1 
ATOM 1287  C C   . ASP A 1 198 ? 127.198 122.895 160.866 1.00 388.89 ? 198 ASP A C   1 
ATOM 1288  O O   . ASP A 1 198 ? 126.891 121.702 160.844 1.00 330.91 ? 198 ASP A O   1 
ATOM 1289  C CB  . ASP A 1 198 ? 124.967 123.894 160.272 1.00 471.28 ? 198 ASP A CB  1 
ATOM 1290  C CG  . ASP A 1 198 ? 123.653 124.408 160.861 1.00 491.08 ? 198 ASP A CG  1 
ATOM 1291  O OD1 . ASP A 1 198 ? 123.680 125.284 161.754 1.00 476.40 ? 198 ASP A OD1 1 
ATOM 1292  O OD2 . ASP A 1 198 ? 122.584 123.929 160.421 1.00 477.61 ? 198 ASP A OD2 1 
ATOM 1293  N N   . HIS A 1 199 ? 128.423 123.321 160.543 1.00 374.63 ? 199 HIS A N   1 
ATOM 1294  C CA  . HIS A 1 199 ? 129.473 122.385 160.115 1.00 391.03 ? 199 HIS A CA  1 
ATOM 1295  C C   . HIS A 1 199 ? 130.884 122.762 160.579 1.00 395.04 ? 199 HIS A C   1 
ATOM 1296  O O   . HIS A 1 199 ? 131.497 122.010 161.339 1.00 432.17 ? 199 HIS A O   1 
ATOM 1297  C CB  . HIS A 1 199 ? 129.427 122.211 158.588 1.00 402.73 ? 199 HIS A CB  1 
ATOM 1298  C CG  . HIS A 1 199 ? 128.041 122.004 158.060 1.00 402.38 ? 199 HIS A CG  1 
ATOM 1299  N ND1 . HIS A 1 199 ? 127.290 120.894 158.376 1.00 430.54 ? 199 HIS A ND1 1 
ATOM 1300  C CD2 . HIS A 1 199 ? 127.245 122.794 157.303 1.00 433.30 ? 199 HIS A CD2 1 
ATOM 1301  C CE1 . HIS A 1 199 ? 126.098 120.998 157.815 1.00 458.52 ? 199 HIS A CE1 1 
ATOM 1302  N NE2 . HIS A 1 199 ? 126.047 122.139 157.154 1.00 432.95 ? 199 HIS A NE2 1 
ATOM 1303  N N   . ASN A 1 200 ? 131.389 123.915 160.141 1.00 383.11 ? 200 ASN A N   1 
ATOM 1304  C CA  . ASN A 1 200 ? 132.812 124.259 160.308 1.00 392.63 ? 200 ASN A CA  1 
ATOM 1305  C C   . ASN A 1 200 ? 133.228 124.665 161.727 1.00 415.61 ? 200 ASN A C   1 
ATOM 1306  O O   . ASN A 1 200 ? 133.426 125.850 162.012 1.00 407.02 ? 200 ASN A O   1 
ATOM 1307  C CB  . ASN A 1 200 ? 133.205 125.373 159.336 1.00 397.89 ? 200 ASN A CB  1 
ATOM 1308  C CG  . ASN A 1 200 ? 133.020 124.985 157.885 1.00 411.78 ? 200 ASN A CG  1 
ATOM 1309  O OD1 . ASN A 1 200 ? 132.590 123.878 157.567 1.00 406.45 ? 200 ASN A OD1 1 
ATOM 1310  N ND2 . ASN A 1 200 ? 133.339 125.915 156.993 1.00 424.60 ? 200 ASN A ND2 1 
ATOM 1311  N N   . LEU A 1 201 ? 133.380 123.672 162.602 1.00 448.75 ? 201 LEU A N   1 
ATOM 1312  C CA  . LEU A 1 201 ? 133.864 123.886 163.968 1.00 445.82 ? 201 LEU A CA  1 
ATOM 1313  C C   . LEU A 1 201 ? 134.848 122.786 164.387 1.00 441.48 ? 201 LEU A C   1 
ATOM 1314  O O   . LEU A 1 201 ? 134.482 121.609 164.444 1.00 393.31 ? 201 LEU A O   1 
ATOM 1315  C CB  . LEU A 1 201 ? 132.694 123.920 164.958 1.00 462.80 ? 201 LEU A CB  1 
ATOM 1316  C CG  . LEU A 1 201 ? 131.830 125.185 165.116 1.00 480.60 ? 201 LEU A CG  1 
ATOM 1317  C CD1 . LEU A 1 201 ? 132.693 126.424 165.346 1.00 500.00 ? 201 LEU A CD1 1 
ATOM 1318  C CD2 . LEU A 1 201 ? 130.856 125.406 163.967 1.00 456.24 ? 201 LEU A CD2 1 
ATOM 1319  N N   . SER A 1 202 ? 136.090 123.180 164.672 1.00 472.20 ? 202 SER A N   1 
ATOM 1320  C CA  . SER A 1 202 ? 137.093 122.271 165.232 1.00 491.17 ? 202 SER A CA  1 
ATOM 1321  C C   . SER A 1 202 ? 136.806 122.058 166.721 1.00 500.00 ? 202 SER A C   1 
ATOM 1322  O O   . SER A 1 202 ? 137.266 122.824 167.572 1.00 498.43 ? 202 SER A O   1 
ATOM 1323  C CB  . SER A 1 202 ? 138.510 122.821 165.019 1.00 475.89 ? 202 SER A CB  1 
ATOM 1324  O OG  . SER A 1 202 ? 138.634 124.140 165.523 1.00 488.22 ? 202 SER A OG  1 
ATOM 1325  N N   . GLN A 1 203 ? 136.033 121.012 167.018 1.00 500.00 ? 203 GLN A N   1 
ATOM 1326  C CA  . GLN A 1 203 ? 135.580 120.721 168.382 1.00 500.00 ? 203 GLN A CA  1 
ATOM 1327  C C   . GLN A 1 203 ? 136.644 119.997 169.198 1.00 500.00 ? 203 GLN A C   1 
ATOM 1328  O O   . GLN A 1 203 ? 137.437 119.219 168.657 1.00 473.99 ? 203 GLN A O   1 
ATOM 1329  C CB  . GLN A 1 203 ? 134.298 119.877 168.360 1.00 500.00 ? 203 GLN A CB  1 
ATOM 1330  C CG  . GLN A 1 203 ? 133.122 120.505 167.624 1.00 494.67 ? 203 GLN A CG  1 
ATOM 1331  C CD  . GLN A 1 203 ? 132.608 121.760 168.300 1.00 461.31 ? 203 GLN A CD  1 
ATOM 1332  O OE1 . GLN A 1 203 ? 133.251 122.808 168.263 1.00 430.06 ? 203 GLN A OE1 1 
ATOM 1333  N NE2 . GLN A 1 203 ? 131.436 121.663 168.915 1.00 476.72 ? 203 GLN A NE2 1 
ATOM 1334  N N   . ASN A 1 204 ? 136.631 120.257 170.507 1.00 500.00 ? 204 ASN A N   1 
ATOM 1335  C CA  . ASN A 1 204 ? 137.643 119.758 171.447 1.00 500.00 ? 204 ASN A CA  1 
ATOM 1336  C C   . ASN A 1 204 ? 139.083 120.128 171.038 1.00 500.00 ? 204 ASN A C   1 
ATOM 1337  O O   . ASN A 1 204 ? 140.021 119.345 171.220 1.00 500.00 ? 204 ASN A O   1 
ATOM 1338  C CB  . ASN A 1 204 ? 137.472 118.244 171.664 1.00 487.84 ? 204 ASN A CB  1 
ATOM 1339  C CG  . ASN A 1 204 ? 136.082 117.875 172.166 1.00 460.72 ? 204 ASN A CG  1 
ATOM 1340  O OD1 . ASN A 1 204 ? 135.238 118.742 172.412 1.00 419.28 ? 204 ASN A OD1 1 
ATOM 1341  N ND2 . ASN A 1 204 ? 135.842 116.578 172.325 1.00 450.52 ? 204 ASN A ND2 1 
ATOM 1342  N N   . GLY A 1 205 ? 139.231 121.339 170.493 1.00 500.00 ? 205 GLY A N   1 
ATOM 1343  C CA  . GLY A 1 205 ? 140.521 121.881 170.052 1.00 500.00 ? 205 GLY A CA  1 
ATOM 1344  C C   . GLY A 1 205 ? 141.162 121.225 168.837 1.00 500.00 ? 205 GLY A C   1 
ATOM 1345  O O   . GLY A 1 205 ? 142.313 121.533 168.511 1.00 500.00 ? 205 GLY A O   1 
ATOM 1346  N N   . SER A 1 206 ? 140.418 120.359 168.145 1.00 500.00 ? 206 SER A N   1 
ATOM 1347  C CA  . SER A 1 206 ? 141.004 119.427 167.180 1.00 500.00 ? 206 SER A CA  1 
ATOM 1348  C C   . SER A 1 206 ? 140.915 119.933 165.729 1.00 500.00 ? 206 SER A C   1 
ATOM 1349  O O   . SER A 1 206 ? 141.752 120.739 165.310 1.00 500.00 ? 206 SER A O   1 
ATOM 1350  C CB  . SER A 1 206 ? 140.377 118.031 167.349 1.00 500.00 ? 206 SER A CB  1 
ATOM 1351  O OG  . SER A 1 206 ? 140.729 117.467 168.601 1.00 500.00 ? 206 SER A OG  1 
ATOM 1352  N N   . ALA A 1 207 ? 139.906 119.476 164.982 1.00 500.00 ? 207 ALA A N   1 
ATOM 1353  C CA  . ALA A 1 207 ? 139.803 119.729 163.543 1.00 500.00 ? 207 ALA A CA  1 
ATOM 1354  C C   . ALA A 1 207 ? 138.362 119.479 163.077 1.00 500.00 ? 207 ALA A C   1 
ATOM 1355  O O   . ALA A 1 207 ? 137.730 118.517 163.531 1.00 500.00 ? 207 ALA A O   1 
ATOM 1356  C CB  . ALA A 1 207 ? 140.768 118.832 162.778 1.00 500.00 ? 207 ALA A CB  1 
ATOM 1357  N N   . PRO A 1 208 ? 137.843 120.335 162.170 1.00 500.00 ? 208 PRO A N   1 
ATOM 1358  C CA  . PRO A 1 208 ? 136.435 120.245 161.805 1.00 500.00 ? 208 PRO A CA  1 
ATOM 1359  C C   . PRO A 1 208 ? 136.142 119.062 160.883 1.00 488.19 ? 208 PRO A C   1 
ATOM 1360  O O   . PRO A 1 208 ? 136.971 118.714 160.034 1.00 461.46 ? 208 PRO A O   1 
ATOM 1361  C CB  . PRO A 1 208 ? 136.189 121.565 161.076 1.00 500.00 ? 208 PRO A CB  1 
ATOM 1362  C CG  . PRO A 1 208 ? 137.489 121.854 160.416 1.00 500.00 ? 208 PRO A CG  1 
ATOM 1363  C CD  . PRO A 1 208 ? 138.558 121.310 161.324 1.00 500.00 ? 208 PRO A CD  1 
ATOM 1364  N N   . THR A 1 209 ? 134.975 118.450 161.073 1.00 467.03 ? 209 THR A N   1 
ATOM 1365  C CA  . THR A 1 209 ? 134.501 117.372 160.202 1.00 460.24 ? 209 THR A CA  1 
ATOM 1366  C C   . THR A 1 209 ? 134.339 117.871 158.760 1.00 456.61 ? 209 THR A C   1 
ATOM 1367  O O   . THR A 1 209 ? 133.945 119.016 158.536 1.00 493.01 ? 209 THR A O   1 
ATOM 1368  C CB  . THR A 1 209 ? 133.180 116.752 160.722 1.00 469.30 ? 209 THR A CB  1 
ATOM 1369  O OG1 . THR A 1 209 ? 132.854 115.591 159.946 1.00 493.56 ? 209 THR A OG1 1 
ATOM 1370  C CG2 . THR A 1 209 ? 132.003 117.758 160.687 1.00 451.81 ? 209 THR A CG2 1 
ATOM 1371  N N   . PHE A 1 210 ? 134.616 116.995 157.798 1.00 421.23 ? 210 PHE A N   1 
ATOM 1372  C CA  . PHE A 1 210 ? 134.866 117.404 156.403 1.00 378.10 ? 210 PHE A CA  1 
ATOM 1373  C C   . PHE A 1 210 ? 133.658 117.462 155.424 1.00 348.09 ? 210 PHE A C   1 
ATOM 1374  O O   . PHE A 1 210 ? 133.859 117.548 154.211 1.00 307.19 ? 210 PHE A O   1 
ATOM 1375  C CB  . PHE A 1 210 ? 135.986 116.537 155.823 1.00 410.51 ? 210 PHE A CB  1 
ATOM 1376  C CG  . PHE A 1 210 ? 137.130 117.327 155.261 1.00 479.48 ? 210 PHE A CG  1 
ATOM 1377  C CD1 . PHE A 1 210 ? 136.996 118.027 154.065 1.00 500.00 ? 210 PHE A CD1 1 
ATOM 1378  C CD2 . PHE A 1 210 ? 138.349 117.380 155.934 1.00 500.00 ? 210 PHE A CD2 1 
ATOM 1379  C CE1 . PHE A 1 210 ? 138.056 118.750 153.538 1.00 500.00 ? 210 PHE A CE1 1 
ATOM 1380  C CE2 . PHE A 1 210 ? 139.414 118.105 155.416 1.00 500.00 ? 210 PHE A CE2 1 
ATOM 1381  C CZ  . PHE A 1 210 ? 139.267 118.791 154.217 1.00 500.00 ? 210 PHE A CZ  1 
ATOM 1382  N N   . PRO A 1 211 ? 132.409 117.378 155.932 1.00 366.61 ? 211 PRO A N   1 
ATOM 1383  C CA  . PRO A 1 211 ? 131.247 117.906 155.186 1.00 367.77 ? 211 PRO A CA  1 
ATOM 1384  C C   . PRO A 1 211 ? 131.139 119.444 155.281 1.00 388.43 ? 211 PRO A C   1 
ATOM 1385  O O   . PRO A 1 211 ? 130.118 119.982 155.725 1.00 352.56 ? 211 PRO A O   1 
ATOM 1386  C CB  . PRO A 1 211 ? 130.053 117.226 155.878 1.00 378.68 ? 211 PRO A CB  1 
ATOM 1387  C CG  . PRO A 1 211 ? 130.618 115.990 156.479 1.00 387.65 ? 211 PRO A CG  1 
ATOM 1388  C CD  . PRO A 1 211 ? 131.985 116.380 156.932 1.00 371.54 ? 211 PRO A CD  1 
ATOM 1389  N N   . LEU A 1 212 ? 132.177 120.145 154.829 1.00 390.08 ? 212 LEU A N   1 
ATOM 1390  C CA  . LEU A 1 212 ? 132.406 121.537 155.228 1.00 363.47 ? 212 LEU A CA  1 
ATOM 1391  C C   . LEU A 1 212 ? 131.567 122.532 154.464 1.00 350.59 ? 212 LEU A C   1 
ATOM 1392  O O   . LEU A 1 212 ? 131.398 122.398 153.259 1.00 356.66 ? 212 LEU A O   1 
ATOM 1393  C CB  . LEU A 1 212 ? 133.870 121.913 155.028 1.00 355.72 ? 212 LEU A CB  1 
ATOM 1394  C CG  . LEU A 1 212 ? 134.819 121.140 155.937 1.00 408.53 ? 212 LEU A CG  1 
ATOM 1395  C CD1 . LEU A 1 212 ? 136.215 121.071 155.337 1.00 434.43 ? 212 LEU A CD1 1 
ATOM 1396  C CD2 . LEU A 1 212 ? 134.841 121.736 157.341 1.00 415.12 ? 212 LEU A CD2 1 
ATOM 1397  N N   . CYS A 1 213 ? 131.081 123.546 155.175 1.00 373.03 ? 213 CYS A N   1 
ATOM 1398  C CA  . CYS A 1 213 ? 130.433 124.693 154.551 1.00 366.93 ? 213 CYS A CA  1 
ATOM 1399  C C   . CYS A 1 213 ? 131.457 125.533 153.769 1.00 337.58 ? 213 CYS A C   1 
ATOM 1400  O O   . CYS A 1 213 ? 132.573 125.859 154.241 1.00 264.88 ? 213 CYS A O   1 
ATOM 1401  C CB  . CYS A 1 213 ? 129.702 125.546 155.594 1.00 393.24 ? 213 CYS A CB  1 
ATOM 1402  S SG  . CYS A 1 213 ? 128.609 126.799 154.885 1.00 421.76 ? 213 CYS A SG  1 
ATOM 1403  N N   . ALA A 1 214 ? 131.063 125.884 152.556 1.00 322.43 ? 214 ALA A N   1 
ATOM 1404  C CA  . ALA A 1 214 ? 131.990 126.463 151.625 1.00 327.13 ? 214 ALA A CA  1 
ATOM 1405  C C   . ALA A 1 214 ? 131.262 127.322 150.628 1.00 328.34 ? 214 ALA A C   1 
ATOM 1406  O O   . ALA A 1 214 ? 130.378 126.852 149.936 1.00 311.58 ? 214 ALA A O   1 
ATOM 1407  C CB  . ALA A 1 214 ? 132.741 125.358 150.907 1.00 337.73 ? 214 ALA A CB  1 
ATOM 1408  N N   . MET A 1 215 ? 131.657 128.585 150.555 1.00 327.83 ? 215 MET A N   1 
ATOM 1409  C CA  . MET A 1 215 ? 131.201 129.464 149.503 1.00 312.53 ? 215 MET A CA  1 
ATOM 1410  C C   . MET A 1 215 ? 132.093 129.275 148.262 1.00 341.43 ? 215 MET A C   1 
ATOM 1411  O O   . MET A 1 215 ? 133.287 128.917 148.329 1.00 244.85 ? 215 MET A O   1 
ATOM 1412  C CB  . MET A 1 215 ? 131.185 130.920 149.969 1.00 328.09 ? 215 MET A CB  1 
ATOM 1413  C CG  . MET A 1 215 ? 130.918 131.928 148.856 1.00 387.71 ? 215 MET A CG  1 
ATOM 1414  S SD  . MET A 1 215 ? 130.506 133.577 149.448 1.00 472.10 ? 215 MET A SD  1 
ATOM 1415  C CE  . MET A 1 215 ? 131.959 133.982 150.416 1.00 492.38 ? 215 MET A CE  1 
ATOM 1416  N N   . GLN A 1 216 ? 131.475 129.481 147.110 1.00 370.97 ? 216 GLN A N   1 
ATOM 1417  C CA  . GLN A 1 216 ? 132.200 129.564 145.869 1.00 343.45 ? 216 GLN A CA  1 
ATOM 1418  C C   . GLN A 1 216 ? 131.728 130.841 145.213 1.00 331.70 ? 216 GLN A C   1 
ATOM 1419  O O   . GLN A 1 216 ? 130.516 131.161 145.157 1.00 295.70 ? 216 GLN A O   1 
ATOM 1420  C CB  . GLN A 1 216 ? 131.924 128.338 145.018 1.00 358.20 ? 216 GLN A CB  1 
ATOM 1421  C CG  . GLN A 1 216 ? 132.578 128.289 143.645 1.00 338.27 ? 216 GLN A CG  1 
ATOM 1422  C CD  . GLN A 1 216 ? 131.714 127.593 142.596 1.00 355.74 ? 216 GLN A CD  1 
ATOM 1423  O OE1 . GLN A 1 216 ? 130.553 127.245 142.838 1.00 301.42 ? 216 GLN A OE1 1 
ATOM 1424  N NE2 . GLN A 1 216 ? 132.278 127.403 141.412 1.00 386.74 ? 216 GLN A NE2 1 
ATOM 1425  N N   . LEU A 1 217 ? 132.721 131.559 144.728 1.00 326.50 ? 217 LEU A N   1 
ATOM 1426  C CA  . LEU A 1 217 ? 132.549 132.878 144.218 1.00 339.57 ? 217 LEU A CA  1 
ATOM 1427  C C   . LEU A 1 217 ? 133.251 132.881 142.862 1.00 331.91 ? 217 LEU A C   1 
ATOM 1428  O O   . LEU A 1 217 ? 134.421 132.466 142.757 1.00 266.74 ? 217 LEU A O   1 
ATOM 1429  C CB  . LEU A 1 217 ? 133.203 133.829 145.211 1.00 364.53 ? 217 LEU A CB  1 
ATOM 1430  C CG  . LEU A 1 217 ? 132.965 135.336 145.141 1.00 407.56 ? 217 LEU A CG  1 
ATOM 1431  C CD1 . LEU A 1 217 ? 133.312 135.931 146.504 1.00 436.85 ? 217 LEU A CD1 1 
ATOM 1432  C CD2 . LEU A 1 217 ? 133.761 135.988 144.010 1.00 404.68 ? 217 LEU A CD2 1 
ATOM 1433  N N   . PHE A 1 218 ? 132.527 133.303 141.825 1.00 306.59 ? 218 PHE A N   1 
ATOM 1434  C CA  . PHE A 1 218 ? 133.127 133.503 140.518 1.00 305.05 ? 218 PHE A CA  1 
ATOM 1435  C C   . PHE A 1 218 ? 132.922 134.962 140.133 1.00 309.26 ? 218 PHE A C   1 
ATOM 1436  O O   . PHE A 1 218 ? 131.790 135.469 140.099 1.00 272.64 ? 218 PHE A O   1 
ATOM 1437  C CB  . PHE A 1 218 ? 132.741 132.560 139.322 1.00 356.97 ? 218 PHE A CB  1 
ATOM 1438  C CG  . PHE A 1 218 ? 131.689 131.467 139.557 1.00 364.26 ? 218 PHE A CG  1 
ATOM 1439  C CD1 . PHE A 1 218 ? 131.026 131.198 140.762 1.00 372.52 ? 218 PHE A CD1 1 
ATOM 1440  C CD2 . PHE A 1 218 ? 131.394 130.647 138.467 1.00 353.42 ? 218 PHE A CD2 1 
ATOM 1441  C CE1 . PHE A 1 218 ? 130.092 130.171 140.848 1.00 357.59 ? 218 PHE A CE1 1 
ATOM 1442  C CE2 . PHE A 1 218 ? 130.472 129.623 138.558 1.00 330.92 ? 218 PHE A CE2 1 
ATOM 1443  C CZ  . PHE A 1 218 ? 129.816 129.384 139.748 1.00 327.96 ? 218 PHE A CZ  1 
ATOM 1444  N N   . SER A 1 219 ? 134.063 135.618 139.942 1.00 307.68 ? 219 SER A N   1 
ATOM 1445  C CA  . SER A 1 219 ? 134.202 136.869 139.235 1.00 314.85 ? 219 SER A CA  1 
ATOM 1446  C C   . SER A 1 219 ? 135.486 136.754 138.421 1.00 351.86 ? 219 SER A C   1 
ATOM 1447  O O   . SER A 1 219 ? 136.567 137.202 138.861 1.00 335.95 ? 219 SER A O   1 
ATOM 1448  C CB  . SER A 1 219 ? 134.337 138.000 140.236 1.00 349.08 ? 219 SER A CB  1 
ATOM 1449  O OG  . SER A 1 219 ? 135.372 137.717 141.162 1.00 353.54 ? 219 SER A OG  1 
ATOM 1450  N N   . HIS A 1 220 ? 135.379 136.094 137.265 1.00 381.30 ? 220 HIS A N   1 
ATOM 1451  C CA  . HIS A 1 220 ? 136.542 135.851 136.410 1.00 388.16 ? 220 HIS A CA  1 
ATOM 1452  C C   . HIS A 1 220 ? 136.817 137.082 135.570 1.00 366.38 ? 220 HIS A C   1 
ATOM 1453  O O   . HIS A 1 220 ? 136.210 137.278 134.510 1.00 343.59 ? 220 HIS A O   1 
ATOM 1454  C CB  . HIS A 1 220 ? 136.361 134.620 135.522 1.00 391.73 ? 220 HIS A CB  1 
ATOM 1455  C CG  . HIS A 1 220 ? 137.554 134.324 134.664 1.00 388.53 ? 220 HIS A CG  1 
ATOM 1456  N ND1 . HIS A 1 220 ? 137.524 134.413 133.289 1.00 400.80 ? 220 HIS A ND1 1 
ATOM 1457  C CD2 . HIS A 1 220 ? 138.818 133.969 134.990 1.00 353.77 ? 220 HIS A CD2 1 
ATOM 1458  C CE1 . HIS A 1 220 ? 138.713 134.106 132.803 1.00 380.24 ? 220 HIS A CE1 1 
ATOM 1459  N NE2 . HIS A 1 220 ? 139.517 133.833 133.816 1.00 372.61 ? 220 HIS A NE2 1 
ATOM 1460  N N   . MET A 1 221 ? 137.724 137.916 136.066 1.00 332.57 ? 221 MET A N   1 
ATOM 1461  C CA  . MET A 1 221 ? 138.016 139.183 135.423 1.00 345.97 ? 221 MET A CA  1 
ATOM 1462  C C   . MET A 1 221 ? 138.942 138.948 134.263 1.00 307.82 ? 221 MET A C   1 
ATOM 1463  O O   . MET A 1 221 ? 139.962 138.288 134.423 1.00 308.79 ? 221 MET A O   1 
ATOM 1464  C CB  . MET A 1 221 ? 138.639 140.162 136.408 1.00 385.79 ? 221 MET A CB  1 
ATOM 1465  C CG  . MET A 1 221 ? 137.692 140.592 137.514 1.00 428.35 ? 221 MET A CG  1 
ATOM 1466  S SD  . MET A 1 221 ? 136.321 141.578 136.878 1.00 440.95 ? 221 MET A SD  1 
ATOM 1467  C CE  . MET A 1 221 ? 134.979 140.391 136.866 1.00 461.43 ? 221 MET A CE  1 
ATOM 1468  N N   . HIS A 1 222 ? 138.575 139.485 133.101 1.00 292.46 ? 222 HIS A N   1 
ATOM 1469  C CA  . HIS A 1 222 ? 139.321 139.241 131.865 1.00 317.25 ? 222 HIS A CA  1 
ATOM 1470  C C   . HIS A 1 222 ? 140.568 140.113 131.783 1.00 307.64 ? 222 HIS A C   1 
ATOM 1471  O O   . HIS A 1 222 ? 141.690 139.618 131.863 1.00 315.88 ? 222 HIS A O   1 
ATOM 1472  C CB  . HIS A 1 222 ? 138.444 139.464 130.620 1.00 311.99 ? 222 HIS A CB  1 
ATOM 1473  C CG  . HIS A 1 222 ? 137.221 138.608 130.577 1.00 340.26 ? 222 HIS A CG  1 
ATOM 1474  N ND1 . HIS A 1 222 ? 136.252 138.754 129.610 1.00 366.17 ? 222 HIS A ND1 1 
ATOM 1475  C CD2 . HIS A 1 222 ? 136.792 137.623 131.399 1.00 358.34 ? 222 HIS A CD2 1 
ATOM 1476  C CE1 . HIS A 1 222 ? 135.287 137.880 129.827 1.00 414.88 ? 222 HIS A CE1 1 
ATOM 1477  N NE2 . HIS A 1 222 ? 135.590 137.181 130.907 1.00 391.50 ? 222 HIS A NE2 1 
ATOM 1478  N N   . ALA A 1 223 ? 140.348 141.416 131.658 1.00 334.02 ? 223 ALA A N   1 
ATOM 1479  C CA  . ALA A 1 223 ? 141.391 142.382 131.356 1.00 335.56 ? 223 ALA A CA  1 
ATOM 1480  C C   . ALA A 1 223 ? 142.565 142.244 132.287 1.00 343.07 ? 223 ALA A C   1 
ATOM 1481  O O   . ALA A 1 223 ? 142.389 141.899 133.458 1.00 347.64 ? 223 ALA A O   1 
ATOM 1482  C CB  . ALA A 1 223 ? 140.833 143.778 131.499 1.00 401.51 ? 223 ALA A CB  1 
ATOM 1483  N N   . VAL A 1 224 ? 143.752 142.558 131.783 1.00 341.15 ? 224 VAL A N   1 
ATOM 1484  C CA  . VAL A 1 224 ? 144.969 142.390 132.570 1.00 372.04 ? 224 VAL A CA  1 
ATOM 1485  C C   . VAL A 1 224 ? 146.064 143.391 132.219 1.00 354.17 ? 224 VAL A C   1 
ATOM 1486  O O   . VAL A 1 224 ? 145.952 144.146 131.243 1.00 316.38 ? 224 VAL A O   1 
ATOM 1487  C CB  . VAL A 1 224 ? 145.512 140.938 132.454 1.00 414.02 ? 224 VAL A CB  1 
ATOM 1488  C CG1 . VAL A 1 224 ? 145.081 140.089 133.647 1.00 393.36 ? 224 VAL A CG1 1 
ATOM 1489  C CG2 . VAL A 1 224 ? 145.098 140.296 131.130 1.00 433.95 ? 224 VAL A CG2 1 
ATOM 1490  N N   . ILE A 1 225 ? 147.105 143.376 133.056 1.00 367.26 ? 225 ILE A N   1 
ATOM 1491  C CA  . ILE A 1 225 ? 148.354 144.142 132.896 1.00 417.86 ? 225 ILE A CA  1 
ATOM 1492  C C   . ILE A 1 225 ? 148.184 145.661 132.952 1.00 376.42 ? 225 ILE A C   1 
ATOM 1493  O O   . ILE A 1 225 ? 148.707 146.305 133.863 1.00 317.04 ? 225 ILE A O   1 
ATOM 1494  C CB  . ILE A 1 225 ? 149.134 143.733 131.612 1.00 494.30 ? 225 ILE A CB  1 
ATOM 1495  C CG1 . ILE A 1 225 ? 149.413 142.218 131.590 1.00 500.00 ? 225 ILE A CG1 1 
ATOM 1496  C CG2 . ILE A 1 225 ? 150.438 144.524 131.480 1.00 500.00 ? 225 ILE A CG2 1 
ATOM 1497  C CD1 . ILE A 1 225 ? 150.203 141.678 132.769 1.00 500.00 ? 225 ILE A CD1 1 
ATOM 1498  N N   . SER A 1 226 ? 147.508 146.223 131.950 1.00 382.45 ? 226 SER A N   1 
ATOM 1499  C CA  . SER A 1 226 ? 147.308 147.666 131.849 1.00 374.46 ? 226 SER A CA  1 
ATOM 1500  C C   . SER A 1 226 ? 146.162 148.001 130.915 1.00 348.49 ? 226 SER A C   1 
ATOM 1501  O O   . SER A 1 226 ? 145.766 147.181 130.081 1.00 288.30 ? 226 SER A O   1 
ATOM 1502  C CB  . SER A 1 226 ? 148.572 148.350 131.323 1.00 401.86 ? 226 SER A CB  1 
ATOM 1503  O OG  . SER A 1 226 ? 148.771 148.087 129.941 1.00 403.58 ? 226 SER A OG  1 
ATOM 1504  N N   . THR A 1 227 ? 145.670 149.234 131.035 1.00 387.17 ? 227 THR A N   1 
ATOM 1505  C CA  . THR A 1 227 ? 144.602 149.734 130.149 1.00 384.10 ? 227 THR A CA  1 
ATOM 1506  C C   . THR A 1 227 ? 145.075 150.051 128.736 1.00 342.84 ? 227 THR A C   1 
ATOM 1507  O O   . THR A 1 227 ? 144.274 150.461 127.895 1.00 265.90 ? 227 THR A O   1 
ATOM 1508  C CB  . THR A 1 227 ? 143.938 151.012 130.699 1.00 406.80 ? 227 THR A CB  1 
ATOM 1509  O OG1 . THR A 1 227 ? 142.729 151.266 129.980 1.00 368.79 ? 227 THR A OG1 1 
ATOM 1510  C CG2 . THR A 1 227 ? 144.855 152.218 130.560 1.00 433.30 ? 227 THR A CG2 1 
ATOM 1511  N N   . ALA A 1 228 ? 146.375 149.948 128.495 1.00 360.35 ? 228 ALA A N   1 
ATOM 1512  C CA  . ALA A 1 228 ? 146.874 150.087 127.138 1.00 412.39 ? 228 ALA A CA  1 
ATOM 1513  C C   . ALA A 1 228 ? 146.869 148.712 126.470 1.00 398.76 ? 228 ALA A C   1 
ATOM 1514  O O   . ALA A 1 228 ? 146.368 148.557 125.311 1.00 344.66 ? 228 ALA A O   1 
ATOM 1515  C CB  . ALA A 1 228 ? 148.275 150.660 127.148 1.00 482.78 ? 228 ALA A CB  1 
ATOM 1516  N N   . THR A 1 229 ? 147.422 147.735 127.189 1.00 413.33 ? 229 THR A N   1 
ATOM 1517  C CA  . THR A 1 229 ? 147.656 146.408 126.641 1.00 431.12 ? 229 THR A CA  1 
ATOM 1518  C C   . THR A 1 229 ? 146.300 145.770 126.317 1.00 375.63 ? 229 THR A C   1 
ATOM 1519  O O   . THR A 1 229 ? 146.053 145.215 125.213 1.00 288.16 ? 229 THR A O   1 
ATOM 1520  C CB  . THR A 1 229 ? 148.398 145.498 127.644 1.00 457.84 ? 229 THR A CB  1 
ATOM 1521  O OG1 . THR A 1 229 ? 147.697 145.488 128.895 1.00 443.34 ? 229 THR A OG1 1 
ATOM 1522  C CG2 . THR A 1 229 ? 149.838 145.975 127.862 1.00 477.59 ? 229 THR A CG2 1 
ATOM 1523  N N   . CYS A 1 230 ? 145.463 145.776 127.356 1.00 359.08 ? 230 CYS A N   1 
ATOM 1524  C CA  . CYS A 1 230 ? 144.136 145.152 127.305 1.00 385.09 ? 230 CYS A CA  1 
ATOM 1525  C C   . CYS A 1 230 ? 143.313 145.768 126.183 1.00 375.49 ? 230 CYS A C   1 
ATOM 1526  O O   . CYS A 1 230 ? 142.669 145.048 125.399 1.00 432.22 ? 230 CYS A O   1 
ATOM 1527  C CB  . CYS A 1 230 ? 143.414 145.260 128.639 1.00 390.89 ? 230 CYS A CB  1 
ATOM 1528  S SG  . CYS A 1 230 ? 141.628 145.084 128.474 1.00 440.99 ? 230 CYS A SG  1 
ATOM 1529  N N   . MET A 1 231 ? 143.356 147.099 126.134 1.00 326.76 ? 231 MET A N   1 
ATOM 1530  C CA  . MET A 1 231 ? 142.618 147.868 125.123 1.00 342.73 ? 231 MET A CA  1 
ATOM 1531  C C   . MET A 1 231 ? 143.069 147.455 123.728 1.00 396.16 ? 231 MET A C   1 
ATOM 1532  O O   . MET A 1 231 ? 142.237 147.239 122.839 1.00 334.22 ? 231 MET A O   1 
ATOM 1533  C CB  . MET A 1 231 ? 142.803 149.379 125.288 1.00 382.95 ? 231 MET A CB  1 
ATOM 1534  C CG  . MET A 1 231 ? 141.625 150.113 125.915 1.00 399.69 ? 231 MET A CG  1 
ATOM 1535  S SD  . MET A 1 231 ? 140.425 150.723 124.702 1.00 382.00 ? 231 MET A SD  1 
ATOM 1536  C CE  . MET A 1 231 ? 138.991 149.758 125.146 1.00 382.56 ? 231 MET A CE  1 
ATOM 1537  N N   . ARG A 1 232 ? 144.376 147.352 123.564 1.00 422.52 ? 232 ARG A N   1 
ATOM 1538  C CA  . ARG A 1 232 ? 145.011 146.984 122.303 1.00 413.37 ? 232 ARG A CA  1 
ATOM 1539  C C   . ARG A 1 232 ? 144.491 145.599 121.862 1.00 368.45 ? 232 ARG A C   1 
ATOM 1540  O O   . ARG A 1 232 ? 144.120 145.398 120.695 1.00 279.08 ? 232 ARG A O   1 
ATOM 1541  C CB  . ARG A 1 232 ? 146.526 146.985 122.483 1.00 410.28 ? 232 ARG A CB  1 
ATOM 1542  C CG  . ARG A 1 232 ? 147.352 146.653 121.255 1.00 421.50 ? 232 ARG A CG  1 
ATOM 1543  C CD  . ARG A 1 232 ? 148.802 146.484 121.671 1.00 411.42 ? 232 ARG A CD  1 
ATOM 1544  N NE  . ARG A 1 232 ? 148.934 145.407 122.656 1.00 381.40 ? 232 ARG A NE  1 
ATOM 1545  C CZ  . ARG A 1 232 ? 149.954 145.250 123.499 1.00 399.94 ? 232 ARG A CZ  1 
ATOM 1546  N NH1 . ARG A 1 232 ? 150.990 146.093 123.512 1.00 414.05 ? 232 ARG A NH1 1 
ATOM 1547  N NH2 . ARG A 1 232 ? 149.938 144.226 124.349 1.00 412.58 ? 232 ARG A NH2 1 
ATOM 1548  N N   . ARG A 1 233 ? 144.487 144.680 122.825 1.00 358.31 ? 233 ARG A N   1 
ATOM 1549  C CA  . ARG A 1 233 ? 144.044 143.320 122.503 1.00 361.72 ? 233 ARG A CA  1 
ATOM 1550  C C   . ARG A 1 233 ? 142.584 143.304 122.110 1.00 367.98 ? 233 ARG A C   1 
ATOM 1551  O O   . ARG A 1 233 ? 142.240 142.606 121.145 1.00 443.12 ? 233 ARG A O   1 
ATOM 1552  C CB  . ARG A 1 233 ? 144.455 142.212 123.506 1.00 330.91 ? 233 ARG A CB  1 
ATOM 1553  C CG  . ARG A 1 233 ? 143.924 142.298 124.911 1.00 380.90 ? 233 ARG A CG  1 
ATOM 1554  C CD  . ARG A 1 233 ? 144.280 141.074 125.760 1.00 433.72 ? 233 ARG A CD  1 
ATOM 1555  N NE  . ARG A 1 233 ? 145.730 140.810 125.916 1.00 455.95 ? 233 ARG A NE  1 
ATOM 1556  C CZ  . ARG A 1 233 ? 146.276 139.901 126.747 1.00 431.61 ? 233 ARG A CZ  1 
ATOM 1557  N NH1 . ARG A 1 233 ? 145.517 139.134 127.536 1.00 428.32 ? 233 ARG A NH1 1 
ATOM 1558  N NH2 . ARG A 1 233 ? 147.605 139.759 126.806 1.00 329.07 ? 233 ARG A NH2 1 
ATOM 1559  N N   . SER A 1 234 ? 141.775 144.099 122.798 1.00 349.71 ? 234 SER A N   1 
ATOM 1560  C CA  . SER A 1 234 ? 140.352 144.244 122.482 1.00 390.75 ? 234 SER A CA  1 
ATOM 1561  C C   . SER A 1 234 ? 140.176 144.721 121.043 1.00 400.27 ? 234 SER A C   1 
ATOM 1562  O O   . SER A 1 234 ? 139.357 144.181 120.286 1.00 444.76 ? 234 SER A O   1 
ATOM 1563  C CB  . SER A 1 234 ? 139.664 145.228 123.422 1.00 444.35 ? 234 SER A CB  1 
ATOM 1564  O OG  . SER A 1 234 ? 138.608 145.922 122.771 1.00 449.62 ? 234 SER A OG  1 
ATOM 1565  N N   . SER A 1 235 ? 140.961 145.732 120.705 1.00 322.66 ? 235 SER A N   1 
ATOM 1566  C CA  . SER A 1 235 ? 140.957 146.339 119.370 1.00 388.65 ? 235 SER A CA  1 
ATOM 1567  C C   . SER A 1 235 ? 141.264 145.285 118.313 1.00 410.96 ? 235 SER A C   1 
ATOM 1568  O O   . SER A 1 235 ? 140.580 145.193 117.283 1.00 419.30 ? 235 SER A O   1 
ATOM 1569  C CB  . SER A 1 235 ? 141.977 147.476 119.301 1.00 379.68 ? 235 SER A CB  1 
ATOM 1570  O OG  . SER A 1 235 ? 143.304 146.985 119.287 1.00 350.04 ? 235 SER A OG  1 
ATOM 1571  N N   . ILE A 1 236 ? 142.300 144.511 118.604 1.00 392.15 ? 236 ILE A N   1 
ATOM 1572  C CA  . ILE A 1 236 ? 142.766 143.430 117.726 1.00 370.02 ? 236 ILE A CA  1 
ATOM 1573  C C   . ILE A 1 236 ? 141.635 142.438 117.476 1.00 323.27 ? 236 ILE A C   1 
ATOM 1574  O O   . ILE A 1 236 ? 141.377 142.035 116.329 1.00 334.80 ? 236 ILE A O   1 
ATOM 1575  C CB  . ILE A 1 236 ? 143.990 142.700 118.358 1.00 412.80 ? 236 ILE A CB  1 
ATOM 1576  C CG1 . ILE A 1 236 ? 145.279 143.445 117.992 1.00 463.70 ? 236 ILE A CG1 1 
ATOM 1577  C CG2 . ILE A 1 236 ? 144.077 141.217 117.969 1.00 386.66 ? 236 ILE A CG2 1 
ATOM 1578  C CD1 . ILE A 1 236 ? 146.438 143.180 118.929 1.00 496.34 ? 236 ILE A CD1 1 
ATOM 1579  N N   . GLN A 1 237 ? 140.988 142.066 118.573 1.00 327.79 ? 237 GLN A N   1 
ATOM 1580  C CA  . GLN A 1 237 ? 139.874 141.113 118.554 1.00 364.69 ? 237 GLN A CA  1 
ATOM 1581  C C   . GLN A 1 237 ? 138.759 141.630 117.645 1.00 366.16 ? 237 GLN A C   1 
ATOM 1582  O O   . GLN A 1 237 ? 138.225 140.885 116.797 1.00 447.14 ? 237 GLN A O   1 
ATOM 1583  C CB  . GLN A 1 237 ? 139.340 140.757 119.964 1.00 373.36 ? 237 GLN A CB  1 
ATOM 1584  C CG  . GLN A 1 237 ? 140.265 139.887 120.831 1.00 436.04 ? 237 GLN A CG  1 
ATOM 1585  C CD  . GLN A 1 237 ? 140.345 138.403 120.436 1.00 424.77 ? 237 GLN A CD  1 
ATOM 1586  O OE1 . GLN A 1 237 ? 139.848 137.520 121.149 1.00 338.02 ? 237 GLN A OE1 1 
ATOM 1587  N NE2 . GLN A 1 237 ? 141.019 138.122 119.324 1.00 417.96 ? 237 GLN A NE2 1 
ATOM 1588  N N   . SER A 1 238 ? 138.448 142.905 117.834 1.00 322.71 ? 238 SER A N   1 
ATOM 1589  C CA  . SER A 1 238 ? 137.406 143.591 117.068 1.00 423.61 ? 238 SER A CA  1 
ATOM 1590  C C   . SER A 1 238 ? 137.718 143.535 115.585 1.00 449.56 ? 238 SER A C   1 
ATOM 1591  O O   . SER A 1 238 ? 136.851 143.208 114.746 1.00 411.91 ? 238 SER A O   1 
ATOM 1592  C CB  . SER A 1 238 ? 137.214 145.049 117.520 1.00 450.19 ? 238 SER A CB  1 
ATOM 1593  O OG  . SER A 1 238 ? 138.147 145.925 116.908 1.00 484.70 ? 238 SER A OG  1 
ATOM 1594  N N   . THR A 1 239 ? 138.979 143.831 115.276 1.00 468.81 ? 239 THR A N   1 
ATOM 1595  C CA  . THR A 1 239 ? 139.486 143.806 113.896 1.00 473.89 ? 239 THR A CA  1 
ATOM 1596  C C   . THR A 1 239 ? 139.608 142.365 113.316 1.00 421.48 ? 239 THR A C   1 
ATOM 1597  O O   . THR A 1 239 ? 138.906 141.974 112.333 1.00 432.20 ? 239 THR A O   1 
ATOM 1598  C CB  . THR A 1 239 ? 140.836 144.546 113.755 1.00 500.00 ? 239 THR A CB  1 
ATOM 1599  O OG1 . THR A 1 239 ? 141.803 143.968 114.636 1.00 500.00 ? 239 THR A OG1 1 
ATOM 1600  C CG2 . THR A 1 239 ? 140.684 146.040 114.070 1.00 500.00 ? 239 THR A CG2 1 
ATOM 1601  N N   . PHE A 1 240 ? 140.560 141.614 113.862 1.00 394.05 ? 240 PHE A N   1 
ATOM 1602  C CA  . PHE A 1 240 ? 141.083 140.428 113.185 1.00 405.15 ? 240 PHE A CA  1 
ATOM 1603  C C   . PHE A 1 240 ? 140.251 139.172 113.417 1.00 398.49 ? 240 PHE A C   1 
ATOM 1604  O O   . PHE A 1 240 ? 139.957 138.453 112.456 1.00 441.11 ? 240 PHE A O   1 
ATOM 1605  C CB  . PHE A 1 240 ? 142.553 140.185 113.562 1.00 447.37 ? 240 PHE A CB  1 
ATOM 1606  C CG  . PHE A 1 240 ? 143.497 141.267 113.084 1.00 476.57 ? 240 PHE A CG  1 
ATOM 1607  C CD1 . PHE A 1 240 ? 143.533 141.646 111.742 1.00 497.20 ? 240 PHE A CD1 1 
ATOM 1608  C CD2 . PHE A 1 240 ? 144.370 141.893 113.972 1.00 495.64 ? 240 PHE A CD2 1 
ATOM 1609  C CE1 . PHE A 1 240 ? 144.404 142.636 111.300 1.00 500.00 ? 240 PHE A CE1 1 
ATOM 1610  C CE2 . PHE A 1 240 ? 145.243 142.882 113.535 1.00 500.00 ? 240 PHE A CE2 1 
ATOM 1611  C CZ  . PHE A 1 240 ? 145.261 143.254 112.197 1.00 500.00 ? 240 PHE A CZ  1 
ATOM 1612  N N   . SER A 1 241 ? 139.875 138.900 114.668 1.00 361.47 ? 241 SER A N   1 
ATOM 1613  C CA  . SER A 1 241 ? 139.048 137.719 114.976 1.00 386.69 ? 241 SER A CA  1 
ATOM 1614  C C   . SER A 1 241 ? 137.558 137.981 114.729 1.00 391.50 ? 241 SER A C   1 
ATOM 1615  O O   . SER A 1 241 ? 137.116 139.131 114.661 1.00 340.17 ? 241 SER A O   1 
ATOM 1616  C CB  . SER A 1 241 ? 139.268 137.229 116.413 1.00 369.01 ? 241 SER A CB  1 
ATOM 1617  O OG  . SER A 1 241 ? 138.663 135.956 116.626 1.00 313.25 ? 241 SER A OG  1 
ATOM 1618  N N   . ILE A 1 242 ? 136.816 136.888 114.555 1.00 411.98 ? 242 ILE A N   1 
ATOM 1619  C CA  . ILE A 1 242 ? 135.361 136.903 114.409 1.00 413.60 ? 242 ILE A CA  1 
ATOM 1620  C C   . ILE A 1 242 ? 134.815 136.235 115.656 1.00 414.00 ? 242 ILE A C   1 
ATOM 1621  O O   . ILE A 1 242 ? 135.498 135.401 116.260 1.00 417.40 ? 242 ILE A O   1 
ATOM 1622  C CB  . ILE A 1 242 ? 134.888 136.122 113.158 1.00 439.73 ? 242 ILE A CB  1 
ATOM 1623  C CG1 . ILE A 1 242 ? 135.781 136.422 111.936 1.00 476.81 ? 242 ILE A CG1 1 
ATOM 1624  C CG2 . ILE A 1 242 ? 133.412 136.408 112.866 1.00 415.38 ? 242 ILE A CG2 1 
ATOM 1625  C CD1 . ILE A 1 242 ? 135.951 137.893 111.601 1.00 496.41 ? 242 ILE A CD1 1 
ATOM 1626  N N   . ASN A 1 243 ? 133.589 136.594 116.032 1.00 461.04 ? 243 ASN A N   1 
ATOM 1627  C CA  . ASN A 1 243 ? 133.028 136.238 117.340 1.00 500.00 ? 243 ASN A CA  1 
ATOM 1628  C C   . ASN A 1 243 ? 134.036 136.574 118.446 1.00 476.68 ? 243 ASN A C   1 
ATOM 1629  O O   . ASN A 1 243 ? 134.339 135.723 119.299 1.00 397.46 ? 243 ASN A O   1 
ATOM 1630  C CB  . ASN A 1 243 ? 132.609 134.763 117.373 1.00 500.00 ? 243 ASN A CB  1 
ATOM 1631  C CG  . ASN A 1 243 ? 131.621 134.409 116.270 1.00 500.00 ? 243 ASN A CG  1 
ATOM 1632  O OD1 . ASN A 1 243 ? 130.831 135.249 115.826 1.00 500.00 ? 243 ASN A OD1 1 
ATOM 1633  N ND2 . ASN A 1 243 ? 131.655 133.156 115.826 1.00 500.00 ? 243 ASN A ND2 1 
ATOM 1634  N N   . PRO A 1 244 ? 134.557 137.824 118.419 1.00 450.10 ? 244 PRO A N   1 
ATOM 1635  C CA  . PRO A 1 244 ? 135.712 138.208 119.204 1.00 413.56 ? 244 PRO A CA  1 
ATOM 1636  C C   . PRO A 1 244 ? 135.324 138.719 120.573 1.00 400.92 ? 244 PRO A C   1 
ATOM 1637  O O   . PRO A 1 244 ? 134.614 139.725 120.685 1.00 410.07 ? 244 PRO A O   1 
ATOM 1638  C CB  . PRO A 1 244 ? 136.295 139.349 118.390 1.00 373.87 ? 244 PRO A CB  1 
ATOM 1639  C CG  . PRO A 1 244 ? 135.116 139.992 117.735 1.00 440.91 ? 244 PRO A CG  1 
ATOM 1640  C CD  . PRO A 1 244 ? 133.971 139.016 117.771 1.00 457.72 ? 244 PRO A CD  1 
ATOM 1641  N N   . GLU A 1 245 ? 135.784 138.030 121.607 1.00 388.46 ? 245 GLU A N   1 
ATOM 1642  C CA  . GLU A 1 245 ? 135.518 138.468 122.955 1.00 399.12 ? 245 GLU A CA  1 
ATOM 1643  C C   . GLU A 1 245 ? 136.322 139.753 123.164 1.00 410.70 ? 245 GLU A C   1 
ATOM 1644  O O   . GLU A 1 245 ? 137.555 139.736 123.196 1.00 377.82 ? 245 GLU A O   1 
ATOM 1645  C CB  . GLU A 1 245 ? 135.822 137.354 123.964 1.00 436.37 ? 245 GLU A CB  1 
ATOM 1646  C CG  . GLU A 1 245 ? 134.879 136.160 123.783 1.00 488.95 ? 245 GLU A CG  1 
ATOM 1647  C CD  . GLU A 1 245 ? 134.820 135.214 124.977 1.00 500.00 ? 245 GLU A CD  1 
ATOM 1648  O OE1 . GLU A 1 245 ? 135.858 134.619 125.325 1.00 500.00 ? 245 GLU A OE1 1 
ATOM 1649  O OE2 . GLU A 1 245 ? 133.721 135.042 125.551 1.00 499.47 ? 245 GLU A OE2 1 
ATOM 1650  N N   . ILE A 1 246 ? 135.590 140.869 123.205 1.00 422.41 ? 246 ILE A N   1 
ATOM 1651  C CA  . ILE A 1 246 ? 136.147 142.193 123.460 1.00 390.78 ? 246 ILE A CA  1 
ATOM 1652  C C   . ILE A 1 246 ? 136.295 142.313 124.952 1.00 302.98 ? 246 ILE A C   1 
ATOM 1653  O O   . ILE A 1 246 ? 135.311 142.204 125.671 1.00 287.54 ? 246 ILE A O   1 
ATOM 1654  C CB  . ILE A 1 246 ? 135.203 143.330 122.986 1.00 450.00 ? 246 ILE A CB  1 
ATOM 1655  C CG1 . ILE A 1 246 ? 134.946 143.243 121.474 1.00 500.00 ? 246 ILE A CG1 1 
ATOM 1656  C CG2 . ILE A 1 246 ? 135.761 144.705 123.369 1.00 382.10 ? 246 ILE A CG2 1 
ATOM 1657  C CD1 . ILE A 1 246 ? 136.139 143.586 120.599 1.00 500.00 ? 246 ILE A CD1 1 
ATOM 1658  N N   . VAL A 1 247 ? 137.526 142.493 125.412 1.00 314.92 ? 247 VAL A N   1 
ATOM 1659  C CA  . VAL A 1 247 ? 137.807 142.771 126.829 1.00 367.75 ? 247 VAL A CA  1 
ATOM 1660  C C   . VAL A 1 247 ? 137.861 144.302 126.909 1.00 392.70 ? 247 VAL A C   1 
ATOM 1661  O O   . VAL A 1 247 ? 137.694 144.938 125.872 1.00 450.26 ? 247 VAL A O   1 
ATOM 1662  C CB  . VAL A 1 247 ? 139.109 142.051 127.280 1.00 377.98 ? 247 VAL A CB  1 
ATOM 1663  C CG1 . VAL A 1 247 ? 140.345 142.526 126.507 1.00 403.09 ? 247 VAL A CG1 1 
ATOM 1664  C CG2 . VAL A 1 247 ? 139.318 142.154 128.778 1.00 323.72 ? 247 VAL A CG2 1 
ATOM 1665  N N   . CYS A 1 248 ? 138.041 144.904 128.090 1.00 349.11 ? 248 CYS A N   1 
ATOM 1666  C CA  . CYS A 1 248 ? 138.240 146.373 128.215 1.00 344.58 ? 248 CYS A CA  1 
ATOM 1667  C C   . CYS A 1 248 ? 137.048 147.193 127.751 1.00 299.52 ? 248 CYS A C   1 
ATOM 1668  O O   . CYS A 1 248 ? 136.615 147.089 126.608 1.00 306.39 ? 248 CYS A O   1 
ATOM 1669  C CB  . CYS A 1 248 ? 139.465 146.879 127.419 1.00 358.97 ? 248 CYS A CB  1 
ATOM 1670  S SG  . CYS A 1 248 ? 140.995 147.011 128.342 1.00 431.03 ? 248 CYS A SG  1 
ATOM 1671  N N   . ASP A 1 249 ? 136.530 148.038 128.614 1.00 302.48 ? 249 ASP A N   1 
ATOM 1672  C CA  . ASP A 1 249 ? 135.657 149.085 128.123 1.00 347.45 ? 249 ASP A CA  1 
ATOM 1673  C C   . ASP A 1 249 ? 136.091 150.372 128.788 1.00 377.02 ? 249 ASP A C   1 
ATOM 1674  O O   . ASP A 1 249 ? 136.316 150.378 130.019 1.00 420.96 ? 249 ASP A O   1 
ATOM 1675  C CB  . ASP A 1 249 ? 134.181 148.770 128.378 1.00 397.00 ? 249 ASP A CB  1 
ATOM 1676  C CG  . ASP A 1 249 ? 133.536 147.967 127.239 1.00 395.57 ? 249 ASP A CG  1 
ATOM 1677  O OD1 . ASP A 1 249 ? 133.344 148.529 126.132 1.00 363.35 ? 249 ASP A OD1 1 
ATOM 1678  O OD2 . ASP A 1 249 ? 133.192 146.783 127.463 1.00 349.14 ? 249 ASP A OD2 1 
ATOM 1679  N N   . PRO A 1 250 ? 136.250 151.449 127.979 1.00 385.00 ? 250 PRO A N   1 
ATOM 1680  C CA  . PRO A 1 250 ? 136.557 152.761 128.529 1.00 374.86 ? 250 PRO A CA  1 
ATOM 1681  C C   . PRO A 1 250 ? 135.533 153.123 129.575 1.00 357.53 ? 250 PRO A C   1 
ATOM 1682  O O   . PRO A 1 250 ? 134.329 152.884 129.383 1.00 314.76 ? 250 PRO A O   1 
ATOM 1683  C CB  . PRO A 1 250 ? 136.432 153.696 127.324 1.00 387.48 ? 250 PRO A CB  1 
ATOM 1684  C CG  . PRO A 1 250 ? 136.690 152.830 126.150 1.00 405.41 ? 250 PRO A CG  1 
ATOM 1685  C CD  . PRO A 1 250 ? 136.098 151.507 126.512 1.00 391.71 ? 250 PRO A CD  1 
ATOM 1686  N N   . LEU A 1 251 ? 136.018 153.673 130.677 1.00 331.43 ? 251 LEU A N   1 
ATOM 1687  C CA  . LEU A 1 251 ? 135.144 154.049 131.766 1.00 343.88 ? 251 LEU A CA  1 
ATOM 1688  C C   . LEU A 1 251 ? 134.565 155.418 131.358 1.00 342.56 ? 251 LEU A C   1 
ATOM 1689  O O   . LEU A 1 251 ? 135.278 156.426 131.308 1.00 351.40 ? 251 LEU A O   1 
ATOM 1690  C CB  . LEU A 1 251 ? 135.925 154.042 133.082 1.00 340.89 ? 251 LEU A CB  1 
ATOM 1691  C CG  . LEU A 1 251 ? 135.307 153.419 134.333 1.00 349.08 ? 251 LEU A CG  1 
ATOM 1692  C CD1 . LEU A 1 251 ? 134.515 152.150 134.047 1.00 386.24 ? 251 LEU A CD1 1 
ATOM 1693  C CD2 . LEU A 1 251 ? 136.425 153.134 135.326 1.00 364.54 ? 251 LEU A CD2 1 
ATOM 1694  N N   . SER A 1 252 ? 133.270 155.419 131.040 1.00 304.90 ? 252 SER A N   1 
ATOM 1695  C CA  . SER A 1 252 ? 132.711 156.335 130.054 1.00 285.25 ? 252 SER A CA  1 
ATOM 1696  C C   . SER A 1 252 ? 131.210 156.518 130.155 1.00 301.52 ? 252 SER A C   1 
ATOM 1697  O O   . SER A 1 252 ? 130.478 155.527 130.199 1.00 335.35 ? 252 SER A O   1 
ATOM 1698  C CB  . SER A 1 252 ? 132.963 155.713 128.685 1.00 366.09 ? 252 SER A CB  1 
ATOM 1699  O OG  . SER A 1 252 ? 132.346 154.435 128.589 1.00 394.72 ? 252 SER A OG  1 
ATOM 1700  N N   . ASP A 1 253 ? 130.750 157.769 130.173 1.00 339.60 ? 253 ASP A N   1 
ATOM 1701  C CA  . ASP A 1 253 ? 129.334 158.078 129.879 1.00 378.29 ? 253 ASP A CA  1 
ATOM 1702  C C   . ASP A 1 253 ? 129.109 159.549 129.473 1.00 348.57 ? 253 ASP A C   1 
ATOM 1703  O O   . ASP A 1 253 ? 129.675 159.971 128.459 1.00 304.97 ? 253 ASP A O   1 
ATOM 1704  C CB  . ASP A 1 253 ? 128.367 157.578 130.980 1.00 390.18 ? 253 ASP A CB  1 
ATOM 1705  C CG  . ASP A 1 253 ? 128.878 157.833 132.375 1.00 393.70 ? 253 ASP A CG  1 
ATOM 1706  O OD1 . ASP A 1 253 ? 129.693 158.762 132.540 1.00 426.73 ? 253 ASP A OD1 1 
ATOM 1707  O OD2 . ASP A 1 253 ? 128.466 157.099 133.300 1.00 353.72 ? 253 ASP A OD2 1 
ATOM 1708  N N   . TYR A 1 254 ? 128.311 160.316 130.228 1.00 324.78 ? 254 TYR A N   1 
ATOM 1709  C CA  . TYR A 1 254 ? 127.740 161.562 129.709 1.00 357.56 ? 254 TYR A CA  1 
ATOM 1710  C C   . TYR A 1 254 ? 127.736 162.675 130.738 1.00 363.07 ? 254 TYR A C   1 
ATOM 1711  O O   . TYR A 1 254 ? 127.201 162.513 131.843 1.00 306.37 ? 254 TYR A O   1 
ATOM 1712  C CB  . TYR A 1 254 ? 126.299 161.354 129.222 1.00 355.91 ? 254 TYR A CB  1 
ATOM 1713  C CG  . TYR A 1 254 ? 126.172 160.678 127.870 1.00 381.37 ? 254 TYR A CG  1 
ATOM 1714  C CD1 . TYR A 1 254 ? 126.560 161.325 126.702 1.00 405.13 ? 254 TYR A CD1 1 
ATOM 1715  C CD2 . TYR A 1 254 ? 125.640 159.393 127.759 1.00 378.76 ? 254 TYR A CD2 1 
ATOM 1716  C CE1 . TYR A 1 254 ? 126.435 160.701 125.462 1.00 428.25 ? 254 TYR A CE1 1 
ATOM 1717  C CE2 . TYR A 1 254 ? 125.504 158.760 126.528 1.00 355.05 ? 254 TYR A CE2 1 
ATOM 1718  C CZ  . TYR A 1 254 ? 125.904 159.415 125.382 1.00 400.10 ? 254 TYR A CZ  1 
ATOM 1719  O OH  . TYR A 1 254 ? 125.769 158.787 124.164 1.00 402.44 ? 254 TYR A OH  1 
ATOM 1720  N N   . ASN A 1 255 ? 128.325 163.807 130.345 1.00 372.92 ? 255 ASN A N   1 
ATOM 1721  C CA  . ASN A 1 255 ? 128.204 165.061 131.079 1.00 352.03 ? 255 ASN A CA  1 
ATOM 1722  C C   . ASN A 1 255 ? 126.867 165.666 130.735 1.00 313.16 ? 255 ASN A C   1 
ATOM 1723  O O   . ASN A 1 255 ? 126.643 166.023 129.568 1.00 316.71 ? 255 ASN A O   1 
ATOM 1724  C CB  . ASN A 1 255 ? 129.282 166.068 130.665 1.00 327.77 ? 255 ASN A CB  1 
ATOM 1725  C CG  . ASN A 1 255 ? 130.690 165.559 130.894 1.00 336.32 ? 255 ASN A CG  1 
ATOM 1726  O OD1 . ASN A 1 255 ? 131.150 165.431 132.044 1.00 250.69 ? 255 ASN A OD1 1 
ATOM 1727  N ND2 . ASN A 1 255 ? 131.395 165.270 129.796 1.00 331.78 ? 255 ASN A ND2 1 
ATOM 1728  N N   . VAL A 1 256 ? 125.974 165.777 131.717 1.00 303.41 ? 256 VAL A N   1 
ATOM 1729  C CA  . VAL A 1 256 ? 124.756 166.554 131.492 1.00 322.44 ? 256 VAL A CA  1 
ATOM 1730  C C   . VAL A 1 256 ? 125.178 168.002 131.648 1.00 322.96 ? 256 VAL A C   1 
ATOM 1731  O O   . VAL A 1 256 ? 126.142 168.346 132.348 1.00 361.66 ? 256 VAL A O   1 
ATOM 1732  C CB  . VAL A 1 256 ? 123.489 166.146 132.321 1.00 355.75 ? 256 VAL A CB  1 
ATOM 1733  C CG1 . VAL A 1 256 ? 123.497 164.656 132.646 1.00 386.65 ? 256 VAL A CG1 1 
ATOM 1734  C CG2 . VAL A 1 256 ? 123.276 166.985 133.576 1.00 364.24 ? 256 VAL A CG2 1 
ATOM 1735  N N   . TRP A 1 257 ? 124.392 168.843 131.019 1.00 309.80 ? 257 TRP A N   1 
ATOM 1736  C CA  . TRP A 1 257 ? 124.903 170.025 130.406 1.00 291.41 ? 257 TRP A CA  1 
ATOM 1737  C C   . TRP A 1 257 ? 123.663 170.841 130.161 1.00 316.39 ? 257 TRP A C   1 
ATOM 1738  O O   . TRP A 1 257 ? 122.707 170.330 129.577 1.00 349.67 ? 257 TRP A O   1 
ATOM 1739  C CB  . TRP A 1 257 ? 125.528 169.544 129.107 1.00 326.51 ? 257 TRP A CB  1 
ATOM 1740  C CG  . TRP A 1 257 ? 126.129 170.528 128.257 1.00 354.33 ? 257 TRP A CG  1 
ATOM 1741  C CD1 . TRP A 1 257 ? 127.454 170.751 128.106 1.00 361.80 ? 257 TRP A CD1 1 
ATOM 1742  C CD2 . TRP A 1 257 ? 125.460 171.406 127.346 1.00 384.33 ? 257 TRP A CD2 1 
ATOM 1743  N NE1 . TRP A 1 257 ? 127.657 171.732 127.184 1.00 404.08 ? 257 TRP A NE1 1 
ATOM 1744  C CE2 . TRP A 1 257 ? 126.453 172.155 126.698 1.00 417.63 ? 257 TRP A CE2 1 
ATOM 1745  C CE3 . TRP A 1 257 ? 124.116 171.647 127.030 1.00 376.27 ? 257 TRP A CE3 1 
ATOM 1746  C CZ2 . TRP A 1 257 ? 126.155 173.135 125.751 1.00 437.63 ? 257 TRP A CZ2 1 
ATOM 1747  C CZ3 . TRP A 1 257 ? 123.816 172.617 126.094 1.00 395.74 ? 257 TRP A CZ3 1 
ATOM 1748  C CH2 . TRP A 1 257 ? 124.834 173.349 125.460 1.00 427.14 ? 257 TRP A CH2 1 
ATOM 1749  N N   . SER A 1 258 ? 123.634 172.075 130.643 1.00 344.28 ? 258 SER A N   1 
ATOM 1750  C CA  . SER A 1 258 ? 122.441 172.907 130.479 1.00 382.67 ? 258 SER A CA  1 
ATOM 1751  C C   . SER A 1 258 ? 122.817 174.360 130.208 1.00 372.50 ? 258 SER A C   1 
ATOM 1752  O O   . SER A 1 258 ? 123.996 174.711 130.077 1.00 289.65 ? 258 SER A O   1 
ATOM 1753  C CB  . SER A 1 258 ? 121.510 172.750 131.708 1.00 373.61 ? 258 SER A CB  1 
ATOM 1754  O OG  . SER A 1 258 ? 120.344 173.568 131.654 1.00 325.56 ? 258 SER A OG  1 
ATOM 1755  N N   . MET A 1 259 ? 121.790 175.186 130.081 1.00 380.58 ? 259 MET A N   1 
ATOM 1756  C CA  . MET A 1 259 ? 121.979 176.597 129.877 1.00 387.46 ? 259 MET A CA  1 
ATOM 1757  C C   . MET A 1 259 ? 120.793 177.345 130.458 1.00 396.08 ? 259 MET A C   1 
ATOM 1758  O O   . MET A 1 259 ? 119.711 176.770 130.635 1.00 349.59 ? 259 MET A O   1 
ATOM 1759  C CB  . MET A 1 259 ? 122.132 176.884 128.380 1.00 441.78 ? 259 MET A CB  1 
ATOM 1760  C CG  . MET A 1 259 ? 123.217 177.897 128.037 1.00 500.00 ? 259 MET A CG  1 
ATOM 1761  S SD  . MET A 1 259 ? 124.909 177.445 128.497 1.00 500.00 ? 259 MET A SD  1 
ATOM 1762  C CE  . MET A 1 259 ? 125.242 176.003 127.487 1.00 500.00 ? 259 MET A CE  1 
ATOM 1763  N N   . LEU A 1 260 ? 121.015 178.619 130.772 1.00 434.66 ? 260 LEU A N   1 
ATOM 1764  C CA  . LEU A 1 260 ? 119.936 179.501 131.225 1.00 468.41 ? 260 LEU A CA  1 
ATOM 1765  C C   . LEU A 1 260 ? 119.085 179.932 130.033 1.00 447.96 ? 260 LEU A C   1 
ATOM 1766  O O   . LEU A 1 260 ? 117.922 179.543 129.922 1.00 463.52 ? 260 LEU A O   1 
ATOM 1767  C CB  . LEU A 1 260 ? 120.490 180.724 131.973 1.00 498.00 ? 260 LEU A CB  1 
ATOM 1768  C CG  . LEU A 1 260 ? 119.551 181.924 132.155 1.00 500.00 ? 260 LEU A CG  1 
ATOM 1769  C CD1 . LEU A 1 260 ? 118.231 181.486 132.787 1.00 500.00 ? 260 LEU A CD1 1 
ATOM 1770  C CD2 . LEU A 1 260 ? 120.241 183.024 132.951 1.00 500.00 ? 260 LEU A CD2 1 
ATOM 1771  N N   . LYS A 1 261 ? 119.668 180.746 129.157 1.00 425.38 ? 261 LYS A N   1 
ATOM 1772  C CA  . LYS A 1 261 ? 118.977 181.215 127.965 1.00 439.60 ? 261 LYS A CA  1 
ATOM 1773  C C   . LYS A 1 261 ? 119.077 180.140 126.899 1.00 428.07 ? 261 LYS A C   1 
ATOM 1774  O O   . LYS A 1 261 ? 120.029 179.356 126.909 1.00 418.86 ? 261 LYS A O   1 
ATOM 1775  C CB  . LYS A 1 261 ? 119.614 182.492 127.417 1.00 500.00 ? 261 LYS A CB  1 
ATOM 1776  C CG  . LYS A 1 261 ? 119.708 183.653 128.392 1.00 500.00 ? 261 LYS A CG  1 
ATOM 1777  C CD  . LYS A 1 261 ? 120.314 184.867 127.705 1.00 500.00 ? 261 LYS A CD  1 
ATOM 1778  C CE  . LYS A 1 261 ? 120.768 185.915 128.707 1.00 500.00 ? 261 LYS A CE  1 
ATOM 1779  N NZ  . LYS A 1 261 ? 122.023 185.537 129.419 1.00 500.00 ? 261 LYS A NZ  1 
ATOM 1780  N N   . PRO A 1 262 ? 118.107 180.100 125.963 1.00 477.77 ? 262 PRO A N   1 
ATOM 1781  C CA  . PRO A 1 262 ? 118.263 179.225 124.794 1.00 500.00 ? 262 PRO A CA  1 
ATOM 1782  C C   . PRO A 1 262 ? 119.428 179.703 123.926 1.00 500.00 ? 262 PRO A C   1 
ATOM 1783  O O   . PRO A 1 262 ? 119.696 180.909 123.875 1.00 500.00 ? 262 PRO A O   1 
ATOM 1784  C CB  . PRO A 1 262 ? 116.927 179.367 124.062 1.00 500.00 ? 262 PRO A CB  1 
ATOM 1785  C CG  . PRO A 1 262 ? 116.393 180.692 124.493 1.00 500.00 ? 262 PRO A CG  1 
ATOM 1786  C CD  . PRO A 1 262 ? 116.847 180.867 125.912 1.00 492.04 ? 262 PRO A CD  1 
ATOM 1787  N N   . ILE A 1 263 ? 120.102 178.773 123.248 1.00 469.51 ? 263 ILE A N   1 
ATOM 1788  C CA  . ILE A 1 263 ? 121.414 179.066 122.649 1.00 468.42 ? 263 ILE A CA  1 
ATOM 1789  C C   . ILE A 1 263 ? 121.618 178.553 121.224 1.00 467.06 ? 263 ILE A C   1 
ATOM 1790  O O   . ILE A 1 263 ? 120.827 177.754 120.704 1.00 350.49 ? 263 ILE A O   1 
ATOM 1791  C CB  . ILE A 1 263 ? 122.575 178.575 123.558 1.00 458.28 ? 263 ILE A CB  1 
ATOM 1792  C CG1 . ILE A 1 263 ? 122.229 177.229 124.201 1.00 467.01 ? 263 ILE A CG1 1 
ATOM 1793  C CG2 . ILE A 1 263 ? 122.878 179.612 124.627 1.00 438.34 ? 263 ILE A CG2 1 
ATOM 1794  C CD1 . ILE A 1 263 ? 123.438 176.466 124.685 1.00 498.01 ? 263 ILE A CD1 1 
ATOM 1795  N N   . ASN A 1 264 ? 122.697 179.064 120.620 1.00 500.00 ? 264 ASN A N   1 
ATOM 1796  C CA  . ASN A 1 264 ? 123.128 178.755 119.249 1.00 500.00 ? 264 ASN A CA  1 
ATOM 1797  C C   . ASN A 1 264 ? 123.282 177.248 118.994 1.00 500.00 ? 264 ASN A C   1 
ATOM 1798  O O   . ASN A 1 264 ? 122.863 176.752 117.950 1.00 500.00 ? 264 ASN A O   1 
ATOM 1799  C CB  . ASN A 1 264 ? 124.458 179.487 118.936 1.00 500.00 ? 264 ASN A CB  1 
ATOM 1800  C CG  . ASN A 1 264 ? 124.582 179.919 117.481 1.00 500.00 ? 264 ASN A CG  1 
ATOM 1801  O OD1 . ASN A 1 264 ? 125.021 181.034 117.193 1.00 500.00 ? 264 ASN A OD1 1 
ATOM 1802  N ND2 . ASN A 1 264 ? 124.199 179.040 116.558 1.00 500.00 ? 264 ASN A ND2 1 
ATOM 1803  N N   . THR A 1 265 ? 123.905 176.548 119.943 1.00 500.00 ? 265 THR A N   1 
ATOM 1804  C CA  . THR A 1 265 ? 124.031 175.077 119.949 1.00 446.03 ? 265 THR A CA  1 
ATOM 1805  C C   . THR A 1 265 ? 124.909 174.497 118.842 1.00 418.75 ? 265 THR A C   1 
ATOM 1806  O O   . THR A 1 265 ? 125.934 173.884 119.140 1.00 426.90 ? 265 THR A O   1 
ATOM 1807  C CB  . THR A 1 265 ? 122.664 174.366 119.912 1.00 416.29 ? 265 THR A CB  1 
ATOM 1808  O OG1 . THR A 1 265 ? 121.780 174.969 120.864 1.00 441.96 ? 265 THR A OG1 1 
ATOM 1809  C CG2 . THR A 1 265 ? 122.828 172.873 120.222 1.00 407.76 ? 265 THR A CG2 1 
ATOM 1810  N N   . THR A 1 266 ? 124.488 174.656 117.585 1.00 408.97 ? 266 THR A N   1 
ATOM 1811  C CA  . THR A 1 266 ? 125.211 174.095 116.442 1.00 473.42 ? 266 THR A CA  1 
ATOM 1812  C C   . THR A 1 266 ? 126.682 174.536 116.422 1.00 492.40 ? 266 THR A C   1 
ATOM 1813  O O   . THR A 1 266 ? 127.584 173.712 116.608 1.00 488.56 ? 266 THR A O   1 
ATOM 1814  C CB  . THR A 1 266 ? 124.523 174.463 115.105 1.00 478.93 ? 266 THR A CB  1 
ATOM 1815  O OG1 . THR A 1 266 ? 123.169 174.002 115.124 1.00 438.61 ? 266 THR A OG1 1 
ATOM 1816  C CG2 . THR A 1 266 ? 125.244 173.824 113.913 1.00 500.00 ? 266 THR A CG2 1 
ATOM 1817  N N   . GLY A 1 267 ? 126.902 175.834 116.226 1.00 482.30 ? 267 GLY A N   1 
ATOM 1818  C CA  . GLY A 1 267 ? 128.242 176.399 116.146 1.00 464.78 ? 267 GLY A CA  1 
ATOM 1819  C C   . GLY A 1 267 ? 128.656 177.063 117.442 1.00 466.79 ? 267 GLY A C   1 
ATOM 1820  O O   . GLY A 1 267 ? 127.981 176.938 118.470 1.00 389.05 ? 267 GLY A O   1 
ATOM 1821  N N   . THR A 1 268 ? 129.771 177.786 117.371 1.00 500.00 ? 268 THR A N   1 
ATOM 1822  C CA  . THR A 1 268 ? 130.346 178.483 118.518 1.00 500.00 ? 268 THR A CA  1 
ATOM 1823  C C   . THR A 1 268 ? 129.756 179.891 118.650 1.00 500.00 ? 268 THR A C   1 
ATOM 1824  O O   . THR A 1 268 ? 129.581 180.597 117.654 1.00 500.00 ? 268 THR A O   1 
ATOM 1825  C CB  . THR A 1 268 ? 131.889 178.592 118.388 1.00 500.00 ? 268 THR A CB  1 
ATOM 1826  O OG1 . THR A 1 268 ? 132.436 177.330 117.979 1.00 500.00 ? 268 THR A OG1 1 
ATOM 1827  C CG2 . THR A 1 268 ? 132.543 179.030 119.711 1.00 500.00 ? 268 THR A CG2 1 
ATOM 1828  N N   . LEU A 1 269 ? 129.431 180.277 119.883 1.00 497.33 ? 269 LEU A N   1 
ATOM 1829  C CA  . LEU A 1 269 ? 129.183 181.687 120.225 1.00 474.56 ? 269 LEU A CA  1 
ATOM 1830  C C   . LEU A 1 269 ? 130.421 182.558 119.975 1.00 447.66 ? 269 LEU A C   1 
ATOM 1831  O O   . LEU A 1 269 ? 131.530 182.043 119.794 1.00 358.59 ? 269 LEU A O   1 
ATOM 1832  C CB  . LEU A 1 269 ? 128.678 181.860 121.677 1.00 497.90 ? 269 LEU A CB  1 
ATOM 1833  C CG  . LEU A 1 269 ? 129.214 181.098 122.914 1.00 500.00 ? 269 LEU A CG  1 
ATOM 1834  C CD1 . LEU A 1 269 ? 128.290 179.940 123.291 1.00 500.00 ? 269 LEU A CD1 1 
ATOM 1835  C CD2 . LEU A 1 269 ? 130.661 180.618 122.798 1.00 482.28 ? 269 LEU A CD2 1 
ATOM 1836  N N   . LYS A 1 270 ? 130.217 183.876 119.967 1.00 481.20 ? 270 LYS A N   1 
ATOM 1837  C CA  . LYS A 1 270 ? 131.286 184.833 119.673 1.00 500.00 ? 270 LYS A CA  1 
ATOM 1838  C C   . LYS A 1 270 ? 132.290 184.925 120.832 1.00 500.00 ? 270 LYS A C   1 
ATOM 1839  O O   . LYS A 1 270 ? 131.875 185.144 121.972 1.00 500.00 ? 270 LYS A O   1 
ATOM 1840  C CB  . LYS A 1 270 ? 130.712 186.218 119.388 1.00 500.00 ? 270 LYS A CB  1 
ATOM 1841  C CG  . LYS A 1 270 ? 131.737 187.177 118.794 1.00 500.00 ? 270 LYS A CG  1 
ATOM 1842  C CD  . LYS A 1 270 ? 131.113 188.426 118.178 1.00 500.00 ? 270 LYS A CD  1 
ATOM 1843  C CE  . LYS A 1 270 ? 130.204 188.134 116.984 1.00 500.00 ? 270 LYS A CE  1 
ATOM 1844  N NZ  . LYS A 1 270 ? 130.764 187.162 115.998 1.00 500.00 ? 270 LYS A NZ  1 
ATOM 1845  N N   . PRO A 1 271 ? 133.606 184.766 120.541 1.00 500.00 ? 271 PRO A N   1 
ATOM 1846  C CA  . PRO A 1 271 ? 134.676 184.751 121.564 1.00 500.00 ? 271 PRO A CA  1 
ATOM 1847  C C   . PRO A 1 271 ? 134.638 185.865 122.620 1.00 500.00 ? 271 PRO A C   1 
ATOM 1848  O O   . PRO A 1 271 ? 134.938 185.610 123.791 1.00 500.00 ? 271 PRO A O   1 
ATOM 1849  C CB  . PRO A 1 271 ? 135.954 184.883 120.728 1.00 500.00 ? 271 PRO A CB  1 
ATOM 1850  C CG  . PRO A 1 271 ? 135.618 184.265 119.421 1.00 500.00 ? 271 PRO A CG  1 
ATOM 1851  C CD  . PRO A 1 271 ? 134.153 184.504 119.191 1.00 500.00 ? 271 PRO A CD  1 
ATOM 1852  N N   . ASP A 1 272 ? 134.289 187.081 122.198 1.00 500.00 ? 272 ASP A N   1 
ATOM 1853  C CA  . ASP A 1 272 ? 134.216 188.238 123.097 1.00 500.00 ? 272 ASP A CA  1 
ATOM 1854  C C   . ASP A 1 272 ? 133.148 188.027 124.164 1.00 500.00 ? 272 ASP A C   1 
ATOM 1855  O O   . ASP A 1 272 ? 133.385 188.290 125.347 1.00 447.81 ? 272 ASP A O   1 
ATOM 1856  C CB  . ASP A 1 272 ? 133.896 189.527 122.316 1.00 500.00 ? 272 ASP A CB  1 
ATOM 1857  C CG  . ASP A 1 272 ? 134.955 189.879 121.267 1.00 500.00 ? 272 ASP A CG  1 
ATOM 1858  O OD1 . ASP A 1 272 ? 136.140 189.496 121.434 1.00 500.00 ? 272 ASP A OD1 1 
ATOM 1859  O OD2 . ASP A 1 272 ? 134.596 190.550 120.266 1.00 500.00 ? 272 ASP A OD2 1 
ATOM 1860  N N   . ASP A 1 273 ? 131.981 187.544 123.728 1.00 500.00 ? 273 ASP A N   1 
ATOM 1861  C CA  . ASP A 1 273 ? 130.840 187.294 124.614 1.00 500.00 ? 273 ASP A CA  1 
ATOM 1862  C C   . ASP A 1 273 ? 131.144 186.125 125.556 1.00 462.27 ? 273 ASP A C   1 
ATOM 1863  O O   . ASP A 1 273 ? 131.862 185.199 125.185 1.00 434.66 ? 273 ASP A O   1 
ATOM 1864  C CB  . ASP A 1 273 ? 129.568 187.018 123.798 1.00 500.00 ? 273 ASP A CB  1 
ATOM 1865  C CG  . ASP A 1 273 ? 128.298 187.317 124.575 1.00 500.00 ? 273 ASP A CG  1 
ATOM 1866  O OD1 . ASP A 1 273 ? 127.911 188.501 124.646 1.00 500.00 ? 273 ASP A OD1 1 
ATOM 1867  O OD2 . ASP A 1 273 ? 127.682 186.368 125.105 1.00 500.00 ? 273 ASP A OD2 1 
ATOM 1868  N N   . ARG A 1 274 ? 130.590 186.184 126.767 1.00 437.57 ? 274 ARG A N   1 
ATOM 1869  C CA  . ARG A 1 274 ? 130.982 185.290 127.858 1.00 431.33 ? 274 ARG A CA  1 
ATOM 1870  C C   . ARG A 1 274 ? 129.811 184.526 128.477 1.00 420.33 ? 274 ARG A C   1 
ATOM 1871  O O   . ARG A 1 274 ? 128.652 184.917 128.332 1.00 380.93 ? 274 ARG A O   1 
ATOM 1872  C CB  . ARG A 1 274 ? 131.689 186.100 128.945 1.00 454.16 ? 274 ARG A CB  1 
ATOM 1873  C CG  . ARG A 1 274 ? 133.020 186.702 128.512 1.00 447.79 ? 274 ARG A CG  1 
ATOM 1874  C CD  . ARG A 1 274 ? 134.013 186.747 129.665 1.00 444.45 ? 274 ARG A CD  1 
ATOM 1875  N NE  . ARG A 1 274 ? 135.354 187.142 129.231 1.00 463.99 ? 274 ARG A NE  1 
ATOM 1876  C CZ  . ARG A 1 274 ? 136.464 187.041 129.968 1.00 477.40 ? 274 ARG A CZ  1 
ATOM 1877  N NH1 . ARG A 1 274 ? 136.430 186.550 131.209 1.00 467.28 ? 274 ARG A NH1 1 
ATOM 1878  N NH2 . ARG A 1 274 ? 137.630 187.438 129.458 1.00 484.05 ? 274 ARG A NH2 1 
ATOM 1879  N N   . VAL A 1 275 ? 130.141 183.436 129.177 1.00 419.40 ? 275 VAL A N   1 
ATOM 1880  C CA  . VAL A 1 275 ? 129.148 182.564 129.815 1.00 405.31 ? 275 VAL A CA  1 
ATOM 1881  C C   . VAL A 1 275 ? 129.620 181.989 131.149 1.00 360.36 ? 275 VAL A C   1 
ATOM 1882  O O   . VAL A 1 275 ? 130.815 181.800 131.353 1.00 277.16 ? 275 VAL A O   1 
ATOM 1883  C CB  . VAL A 1 275 ? 128.741 181.385 128.899 1.00 491.85 ? 275 VAL A CB  1 
ATOM 1884  C CG1 . VAL A 1 275 ? 127.870 181.870 127.745 1.00 500.00 ? 275 VAL A CG1 1 
ATOM 1885  C CG2 . VAL A 1 275 ? 129.969 180.636 128.380 1.00 500.00 ? 275 VAL A CG2 1 
ATOM 1886  N N   . VAL A 1 276 ? 128.653 181.651 132.008 1.00 364.24 ? 276 VAL A N   1 
ATOM 1887  C CA  . VAL A 1 276 ? 128.874 181.425 133.446 1.00 389.07 ? 276 VAL A CA  1 
ATOM 1888  C C   . VAL A 1 276 ? 128.761 179.962 133.860 1.00 355.44 ? 276 VAL A C   1 
ATOM 1889  O O   . VAL A 1 276 ? 127.658 179.463 134.037 1.00 325.52 ? 276 VAL A O   1 
ATOM 1890  C CB  . VAL A 1 276 ? 127.853 182.233 134.288 1.00 400.78 ? 276 VAL A CB  1 
ATOM 1891  C CG1 . VAL A 1 276 ? 128.008 181.946 135.790 1.00 376.49 ? 276 VAL A CG1 1 
ATOM 1892  C CG2 . VAL A 1 276 ? 127.983 183.722 133.982 1.00 452.30 ? 276 VAL A CG2 1 
ATOM 1893  N N   . VAL A 1 277 ? 129.899 179.306 134.080 1.00 379.22 ? 277 VAL A N   1 
ATOM 1894  C CA  . VAL A 1 277 ? 129.910 177.899 134.500 1.00 376.99 ? 277 VAL A CA  1 
ATOM 1895  C C   . VAL A 1 277 ? 129.468 177.718 135.950 1.00 394.96 ? 277 VAL A C   1 
ATOM 1896  O O   . VAL A 1 277 ? 130.147 178.153 136.884 1.00 368.66 ? 277 VAL A O   1 
ATOM 1897  C CB  . VAL A 1 277 ? 131.299 177.239 134.328 1.00 348.77 ? 277 VAL A CB  1 
ATOM 1898  C CG1 . VAL A 1 277 ? 131.345 175.854 134.989 1.00 298.81 ? 277 VAL A CG1 1 
ATOM 1899  C CG2 . VAL A 1 277 ? 131.659 177.150 132.854 1.00 356.37 ? 277 VAL A CG2 1 
ATOM 1900  N N   . ALA A 1 278 ? 128.319 177.070 136.114 1.00 410.55 ? 278 ALA A N   1 
ATOM 1901  C CA  . ALA A 1 278 ? 127.969 176.412 137.360 1.00 397.78 ? 278 ALA A CA  1 
ATOM 1902  C C   . ALA A 1 278 ? 128.373 174.951 137.161 1.00 338.58 ? 278 ALA A C   1 
ATOM 1903  O O   . ALA A 1 278 ? 127.825 174.273 136.290 1.00 310.25 ? 278 ALA A O   1 
ATOM 1904  C CB  . ALA A 1 278 ? 126.480 176.552 137.648 1.00 418.66 ? 278 ALA A CB  1 
ATOM 1905  N N   . ALA A 1 279 ? 129.334 174.483 137.958 1.00 322.00 ? 279 ALA A N   1 
ATOM 1906  C CA  . ALA A 1 279 ? 129.956 173.170 137.747 1.00 325.01 ? 279 ALA A CA  1 
ATOM 1907  C C   . ALA A 1 279 ? 129.535 172.142 138.793 1.00 321.16 ? 279 ALA A C   1 
ATOM 1908  O O   . ALA A 1 279 ? 128.992 172.515 139.825 1.00 332.09 ? 279 ALA A O   1 
ATOM 1909  C CB  . ALA A 1 279 ? 131.460 173.326 137.746 1.00 333.25 ? 279 ALA A CB  1 
ATOM 1910  N N   . THR A 1 280 ? 129.768 170.852 138.518 1.00 311.39 ? 280 THR A N   1 
ATOM 1911  C CA  . THR A 1 280 ? 129.518 169.782 139.506 1.00 340.34 ? 280 THR A CA  1 
ATOM 1912  C C   . THR A 1 280 ? 130.188 168.437 139.173 1.00 347.12 ? 280 THR A C   1 
ATOM 1913  O O   . THR A 1 280 ? 130.215 168.008 138.019 1.00 363.25 ? 280 THR A O   1 
ATOM 1914  C CB  . THR A 1 280 ? 127.997 169.475 139.713 1.00 327.91 ? 280 THR A CB  1 
ATOM 1915  O OG1 . THR A 1 280 ? 127.201 170.650 139.518 1.00 313.35 ? 280 THR A OG1 1 
ATOM 1916  C CG2 . THR A 1 280 ? 127.725 168.898 141.126 1.00 289.25 ? 280 THR A CG2 1 
ATOM 1917  N N   . ARG A 1 281 ? 130.706 167.778 140.211 1.00 357.01 ? 281 ARG A N   1 
ATOM 1918  C CA  . ARG A 1 281 ? 130.908 166.327 140.203 1.00 345.85 ? 281 ARG A CA  1 
ATOM 1919  C C   . ARG A 1 281 ? 129.520 165.680 140.283 1.00 329.26 ? 281 ARG A C   1 
ATOM 1920  O O   . ARG A 1 281 ? 128.804 165.891 141.269 1.00 333.82 ? 281 ARG A O   1 
ATOM 1921  C CB  . ARG A 1 281 ? 131.768 165.882 141.404 1.00 358.24 ? 281 ARG A CB  1 
ATOM 1922  C CG  . ARG A 1 281 ? 131.693 164.391 141.737 1.00 356.19 ? 281 ARG A CG  1 
ATOM 1923  C CD  . ARG A 1 281 ? 132.623 163.984 142.869 1.00 357.54 ? 281 ARG A CD  1 
ATOM 1924  N NE  . ARG A 1 281 ? 133.895 163.438 142.398 1.00 413.38 ? 281 ARG A NE  1 
ATOM 1925  C CZ  . ARG A 1 281 ? 134.972 163.240 143.162 1.00 448.14 ? 281 ARG A CZ  1 
ATOM 1926  N NH1 . ARG A 1 281 ? 134.962 163.529 144.462 1.00 465.24 ? 281 ARG A NH1 1 
ATOM 1927  N NH2 . ARG A 1 281 ? 136.080 162.738 142.619 1.00 450.29 ? 281 ARG A NH2 1 
ATOM 1928  N N   . LEU A 1 282 ? 129.149 164.890 139.272 1.00 291.01 ? 282 LEU A N   1 
ATOM 1929  C CA  . LEU A 1 282 ? 127.841 164.190 139.246 1.00 319.03 ? 282 LEU A CA  1 
ATOM 1930  C C   . LEU A 1 282 ? 127.858 162.718 139.766 1.00 345.31 ? 282 LEU A C   1 
ATOM 1931  O O   . LEU A 1 282 ? 126.790 162.104 139.977 1.00 242.22 ? 282 LEU A O   1 
ATOM 1932  C CB  . LEU A 1 282 ? 127.323 164.230 137.809 1.00 329.60 ? 282 LEU A CB  1 
ATOM 1933  C CG  . LEU A 1 282 ? 125.866 163.877 137.497 1.00 371.86 ? 282 LEU A CG  1 
ATOM 1934  C CD1 . LEU A 1 282 ? 124.882 164.788 138.215 1.00 376.26 ? 282 LEU A CD1 1 
ATOM 1935  C CD2 . LEU A 1 282 ? 125.658 163.911 135.986 1.00 402.97 ? 282 LEU A CD2 1 
ATOM 1936  N N   . ASP A 1 283 ? 129.072 162.210 140.036 1.00 399.34 ? 283 ASP A N   1 
ATOM 1937  C CA  . ASP A 1 283 ? 129.412 160.771 140.074 1.00 374.08 ? 283 ASP A CA  1 
ATOM 1938  C C   . ASP A 1 283 ? 130.314 160.386 141.252 1.00 361.62 ? 283 ASP A C   1 
ATOM 1939  O O   . ASP A 1 283 ? 130.966 161.243 141.860 1.00 392.37 ? 283 ASP A O   1 
ATOM 1940  C CB  . ASP A 1 283 ? 130.186 160.420 138.800 1.00 359.45 ? 283 ASP A CB  1 
ATOM 1941  C CG  . ASP A 1 283 ? 131.544 161.135 138.716 1.00 363.58 ? 283 ASP A CG  1 
ATOM 1942  O OD1 . ASP A 1 283 ? 132.517 160.696 139.365 1.00 316.45 ? 283 ASP A OD1 1 
ATOM 1943  O OD2 . ASP A 1 283 ? 131.633 162.151 138.001 1.00 375.71 ? 283 ASP A OD2 1 
ATOM 1944  N N   . SER A 1 284 ? 130.385 159.087 141.521 1.00 303.78 ? 284 SER A N   1 
ATOM 1945  C CA  . SER A 1 284 ? 131.294 158.511 142.517 1.00 332.29 ? 284 SER A CA  1 
ATOM 1946  C C   . SER A 1 284 ? 131.685 157.124 142.078 1.00 321.15 ? 284 SER A C   1 
ATOM 1947  O O   . SER A 1 284 ? 131.200 156.628 141.063 1.00 334.19 ? 284 SER A O   1 
ATOM 1948  C CB  . SER A 1 284 ? 130.639 158.420 143.907 1.00 367.64 ? 284 SER A CB  1 
ATOM 1949  O OG  . SER A 1 284 ? 130.012 157.162 144.145 1.00 312.01 ? 284 SER A OG  1 
ATOM 1950  N N   . ARG A 1 285 ? 132.581 156.517 142.846 1.00 327.52 ? 285 ARG A N   1 
ATOM 1951  C CA  . ARG A 1 285 ? 132.879 155.094 142.720 1.00 339.86 ? 285 ARG A CA  1 
ATOM 1952  C C   . ARG A 1 285 ? 132.716 154.455 144.087 1.00 269.15 ? 285 ARG A C   1 
ATOM 1953  O O   . ARG A 1 285 ? 132.152 155.063 144.993 1.00 281.61 ? 285 ARG A O   1 
ATOM 1954  C CB  . ARG A 1 285 ? 134.276 154.861 142.108 1.00 354.85 ? 285 ARG A CB  1 
ATOM 1955  C CG  . ARG A 1 285 ? 135.474 155.249 142.967 1.00 368.71 ? 285 ARG A CG  1 
ATOM 1956  C CD  . ARG A 1 285 ? 136.062 154.123 143.812 1.00 365.50 ? 285 ARG A CD  1 
ATOM 1957  N NE  . ARG A 1 285 ? 136.302 152.882 143.074 1.00 330.79 ? 285 ARG A NE  1 
ATOM 1958  C CZ  . ARG A 1 285 ? 137.324 152.662 142.248 1.00 367.52 ? 285 ARG A CZ  1 
ATOM 1959  N NH1 . ARG A 1 285 ? 138.235 153.603 141.993 1.00 359.42 ? 285 ARG A NH1 1 
ATOM 1960  N NH2 . ARG A 1 285 ? 137.428 151.479 141.649 1.00 416.22 ? 285 ARG A NH2 1 
ATOM 1961  N N   . SER A 1 286 ? 133.142 153.205 144.196 1.00 263.59 ? 286 SER A N   1 
ATOM 1962  C CA  . SER A 1 286 ? 133.289 152.530 145.474 1.00 300.72 ? 286 SER A CA  1 
ATOM 1963  C C   . SER A 1 286 ? 134.278 151.382 145.324 1.00 309.23 ? 286 SER A C   1 
ATOM 1964  O O   . SER A 1 286 ? 134.805 151.150 144.231 1.00 324.95 ? 286 SER A O   1 
ATOM 1965  C CB  . SER A 1 286 ? 131.929 152.008 145.934 1.00 344.55 ? 286 SER A CB  1 
ATOM 1966  O OG  . SER A 1 286 ? 131.253 151.358 144.873 1.00 360.40 ? 286 SER A OG  1 
ATOM 1967  N N   . PHE A 1 287 ? 134.540 150.678 146.422 1.00 301.67 ? 287 PHE A N   1 
ATOM 1968  C CA  . PHE A 1 287 ? 135.278 149.420 146.355 1.00 303.98 ? 287 PHE A CA  1 
ATOM 1969  C C   . PHE A 1 287 ? 134.436 148.379 145.670 1.00 301.61 ? 287 PHE A C   1 
ATOM 1970  O O   . PHE A 1 287 ? 134.934 147.634 144.826 1.00 327.52 ? 287 PHE A O   1 
ATOM 1971  C CB  . PHE A 1 287 ? 135.641 148.897 147.738 1.00 313.63 ? 287 PHE A CB  1 
ATOM 1972  C CG  . PHE A 1 287 ? 136.684 147.833 147.706 1.00 333.53 ? 287 PHE A CG  1 
ATOM 1973  C CD1 . PHE A 1 287 ? 138.035 148.164 147.703 1.00 357.66 ? 287 PHE A CD1 1 
ATOM 1974  C CD2 . PHE A 1 287 ? 136.326 146.504 147.648 1.00 349.86 ? 287 PHE A CD2 1 
ATOM 1975  C CE1 . PHE A 1 287 ? 139.010 147.184 147.662 1.00 354.09 ? 287 PHE A CE1 1 
ATOM 1976  C CE2 . PHE A 1 287 ? 137.291 145.513 147.607 1.00 404.57 ? 287 PHE A CE2 1 
ATOM 1977  C CZ  . PHE A 1 287 ? 138.636 145.853 147.618 1.00 392.13 ? 287 PHE A CZ  1 
ATOM 1978  N N   . PHE A 1 288 ? 133.154 148.364 146.033 1.00 296.48 ? 288 PHE A N   1 
ATOM 1979  C CA  . PHE A 1 288 ? 132.227 147.335 145.595 1.00 331.65 ? 288 PHE A CA  1 
ATOM 1980  C C   . PHE A 1 288 ? 131.292 147.789 144.484 1.00 361.07 ? 288 PHE A C   1 
ATOM 1981  O O   . PHE A 1 288 ? 130.663 148.839 144.573 1.00 388.10 ? 288 PHE A O   1 
ATOM 1982  C CB  . PHE A 1 288 ? 131.499 146.811 146.803 1.00 304.13 ? 288 PHE A CB  1 
ATOM 1983  C CG  . PHE A 1 288 ? 132.413 146.092 147.747 1.00 317.61 ? 288 PHE A CG  1 
ATOM 1984  C CD1 . PHE A 1 288 ? 132.909 144.838 147.419 1.00 327.02 ? 288 PHE A CD1 1 
ATOM 1985  C CD2 . PHE A 1 288 ? 132.808 146.669 148.942 1.00 342.59 ? 288 PHE A CD2 1 
ATOM 1986  C CE1 . PHE A 1 288 ? 133.745 144.163 148.284 1.00 364.51 ? 288 PHE A CE1 1 
ATOM 1987  C CE2 . PHE A 1 288 ? 133.646 146.002 149.817 1.00 332.69 ? 288 PHE A CE2 1 
ATOM 1988  C CZ  . PHE A 1 288 ? 134.116 144.747 149.489 1.00 370.41 ? 288 PHE A CZ  1 
ATOM 1989  N N   . TRP A 1 289 ? 131.190 146.935 143.466 1.00 363.89 ? 289 TRP A N   1 
ATOM 1990  C CA  . TRP A 1 289 ? 131.008 147.356 142.069 1.00 358.79 ? 289 TRP A CA  1 
ATOM 1991  C C   . TRP A 1 289 ? 129.998 148.483 141.787 1.00 342.86 ? 289 TRP A C   1 
ATOM 1992  O O   . TRP A 1 289 ? 130.390 149.657 141.710 1.00 307.21 ? 289 TRP A O   1 
ATOM 1993  C CB  . TRP A 1 289 ? 130.723 146.137 141.195 1.00 356.27 ? 289 TRP A CB  1 
ATOM 1994  C CG  . TRP A 1 289 ? 130.541 146.500 139.769 1.00 355.48 ? 289 TRP A CG  1 
ATOM 1995  C CD1 . TRP A 1 289 ? 131.428 147.169 138.965 1.00 336.90 ? 289 TRP A CD1 1 
ATOM 1996  C CD2 . TRP A 1 289 ? 129.382 146.256 138.979 1.00 319.27 ? 289 TRP A CD2 1 
ATOM 1997  N NE1 . TRP A 1 289 ? 130.893 147.332 137.714 1.00 308.26 ? 289 TRP A NE1 1 
ATOM 1998  C CE2 . TRP A 1 289 ? 129.633 146.786 137.696 1.00 307.74 ? 289 TRP A CE2 1 
ATOM 1999  C CE3 . TRP A 1 289 ? 128.156 145.623 139.226 1.00 362.93 ? 289 TRP A CE3 1 
ATOM 2000  C CZ2 . TRP A 1 289 ? 128.693 146.718 136.657 1.00 357.55 ? 289 TRP A CZ2 1 
ATOM 2001  C CZ3 . TRP A 1 289 ? 127.220 145.551 138.194 1.00 396.59 ? 289 TRP A CZ3 1 
ATOM 2002  C CH2 . TRP A 1 289 ? 127.498 146.095 136.923 1.00 391.97 ? 289 TRP A CH2 1 
ATOM 2003  N N   . ASN A 1 290 ? 128.722 148.136 141.616 1.00 315.25 ? 290 ASN A N   1 
ATOM 2004  C CA  . ASN A 1 290 ? 127.682 149.124 141.418 1.00 316.30 ? 290 ASN A CA  1 
ATOM 2005  C C   . ASN A 1 290 ? 126.988 149.256 142.769 1.00 352.47 ? 290 ASN A C   1 
ATOM 2006  O O   . ASN A 1 290 ? 125.831 148.855 142.966 1.00 308.39 ? 290 ASN A O   1 
ATOM 2007  C CB  . ASN A 1 290 ? 126.743 148.714 140.275 1.00 350.17 ? 290 ASN A CB  1 
ATOM 2008  C CG  . ASN A 1 290 ? 126.363 149.881 139.375 1.00 406.40 ? 290 ASN A CG  1 
ATOM 2009  O OD1 . ASN A 1 290 ? 127.197 150.724 139.040 1.00 339.67 ? 290 ASN A OD1 1 
ATOM 2010  N ND2 . ASN A 1 290 ? 125.099 149.922 138.960 1.00 456.86 ? 290 ASN A ND2 1 
ATOM 2011  N N   . VAL A 1 291 ? 127.778 149.781 143.708 1.00 381.30 ? 291 VAL A N   1 
ATOM 2012  C CA  . VAL A 1 291 ? 127.362 150.120 145.061 1.00 380.83 ? 291 VAL A CA  1 
ATOM 2013  C C   . VAL A 1 291 ? 128.099 151.427 145.382 1.00 370.26 ? 291 VAL A C   1 
ATOM 2014  O O   . VAL A 1 291 ? 128.868 151.508 146.343 1.00 379.39 ? 291 VAL A O   1 
ATOM 2015  C CB  . VAL A 1 291 ? 127.735 149.023 146.096 1.00 385.16 ? 291 VAL A CB  1 
ATOM 2016  C CG1 . VAL A 1 291 ? 127.066 149.312 147.437 1.00 423.63 ? 291 VAL A CG1 1 
ATOM 2017  C CG2 . VAL A 1 291 ? 127.362 147.634 145.593 1.00 378.98 ? 291 VAL A CG2 1 
ATOM 2018  N N   . ALA A 1 292 ? 127.869 152.438 144.541 1.00 361.67 ? 292 ALA A N   1 
ATOM 2019  C CA  . ALA A 1 292 ? 128.548 153.735 144.631 1.00 365.10 ? 292 ALA A CA  1 
ATOM 2020  C C   . ALA A 1 292 ? 127.526 154.832 144.959 1.00 371.45 ? 292 ALA A C   1 
ATOM 2021  O O   . ALA A 1 292 ? 127.231 155.697 144.112 1.00 307.27 ? 292 ALA A O   1 
ATOM 2022  C CB  . ALA A 1 292 ? 129.266 154.027 143.327 1.00 374.39 ? 292 ALA A CB  1 
ATOM 2023  N N   . PRO A 1 293 ? 126.971 154.788 146.197 1.00 388.91 ? 293 PRO A N   1 
ATOM 2024  C CA  . PRO A 1 293 ? 125.887 155.694 146.573 1.00 373.67 ? 293 PRO A CA  1 
ATOM 2025  C C   . PRO A 1 293 ? 126.326 157.134 146.767 1.00 334.99 ? 293 PRO A C   1 
ATOM 2026  O O   . PRO A 1 293 ? 125.477 158.020 146.740 1.00 305.56 ? 293 PRO A O   1 
ATOM 2027  C CB  . PRO A 1 293 ? 125.409 155.118 147.905 1.00 386.97 ? 293 PRO A CB  1 
ATOM 2028  C CG  . PRO A 1 293 ? 126.640 154.528 148.496 1.00 377.09 ? 293 PRO A CG  1 
ATOM 2029  C CD  . PRO A 1 293 ? 127.333 153.907 147.330 1.00 370.53 ? 293 PRO A CD  1 
ATOM 2030  N N   . GLY A 1 294 ? 127.626 157.341 147.010 1.00 363.69 ? 294 GLY A N   1 
ATOM 2031  C CA  . GLY A 1 294 ? 128.263 158.660 147.099 1.00 387.15 ? 294 GLY A CA  1 
ATOM 2032  C C   . GLY A 1 294 ? 127.389 159.874 147.389 1.00 380.51 ? 294 GLY A C   1 
ATOM 2033  O O   . GLY A 1 294 ? 127.370 160.824 146.599 1.00 352.96 ? 294 GLY A O   1 
ATOM 2034  N N   . ALA A 1 295 ? 126.657 159.844 148.503 1.00 352.36 ? 295 ALA A N   1 
ATOM 2035  C CA  . ALA A 1 295 ? 125.841 160.990 148.883 1.00 307.41 ? 295 ALA A CA  1 
ATOM 2036  C C   . ALA A 1 295 ? 126.659 162.274 149.018 1.00 332.62 ? 295 ALA A C   1 
ATOM 2037  O O   . ALA A 1 295 ? 126.513 163.181 148.195 1.00 352.76 ? 295 ALA A O   1 
ATOM 2038  C CB  . ALA A 1 295 ? 125.055 160.712 150.147 1.00 353.34 ? 295 ALA A CB  1 
ATOM 2039  N N   . GLU A 1 296 ? 127.503 162.344 150.050 1.00 352.59 ? 296 GLU A N   1 
ATOM 2040  C CA  . GLU A 1 296 ? 128.389 163.497 150.287 1.00 407.52 ? 296 GLU A CA  1 
ATOM 2041  C C   . GLU A 1 296 ? 129.341 163.757 149.126 1.00 393.50 ? 296 GLU A C   1 
ATOM 2042  O O   . GLU A 1 296 ? 129.471 164.898 148.672 1.00 419.69 ? 296 GLU A O   1 
ATOM 2043  C CB  . GLU A 1 296 ? 129.205 163.326 151.582 1.00 422.31 ? 296 GLU A CB  1 
ATOM 2044  C CG  . GLU A 1 296 ? 129.406 164.609 152.384 1.00 470.59 ? 296 GLU A CG  1 
ATOM 2045  C CD  . GLU A 1 296 ? 130.302 165.637 151.708 1.00 466.41 ? 296 GLU A CD  1 
ATOM 2046  O OE1 . GLU A 1 296 ? 131.534 165.439 151.688 1.00 438.99 ? 296 GLU A OE1 1 
ATOM 2047  O OE2 . GLU A 1 296 ? 129.774 166.662 151.221 1.00 457.33 ? 296 GLU A OE2 1 
ATOM 2048  N N   . SER A 1 297 ? 129.998 162.703 148.653 1.00 365.24 ? 297 SER A N   1 
ATOM 2049  C CA  . SER A 1 297 ? 130.970 162.831 147.565 1.00 390.50 ? 297 SER A CA  1 
ATOM 2050  C C   . SER A 1 297 ? 130.379 163.280 146.219 1.00 356.80 ? 297 SER A C   1 
ATOM 2051  O O   . SER A 1 297 ? 131.054 163.980 145.468 1.00 336.20 ? 297 SER A O   1 
ATOM 2052  C CB  . SER A 1 297 ? 131.745 161.524 147.378 1.00 424.14 ? 297 SER A CB  1 
ATOM 2053  O OG  . SER A 1 297 ? 130.878 160.405 147.319 1.00 433.57 ? 297 SER A OG  1 
ATOM 2054  N N   . ALA A 1 298 ? 129.138 162.888 145.924 1.00 325.62 ? 298 ALA A N   1 
ATOM 2055  C CA  . ALA A 1 298 ? 128.545 163.128 144.599 1.00 322.72 ? 298 ALA A CA  1 
ATOM 2056  C C   . ALA A 1 298 ? 127.135 163.670 144.626 1.00 321.18 ? 298 ALA A C   1 
ATOM 2057  O O   . ALA A 1 298 ? 126.883 164.735 144.063 1.00 359.61 ? 298 ALA A O   1 
ATOM 2058  C CB  . ALA A 1 298 ? 128.573 161.854 143.779 1.00 384.16 ? 298 ALA A CB  1 
ATOM 2059  N N   . VAL A 1 299 ? 126.225 162.942 145.273 1.00 318.06 ? 299 VAL A N   1 
ATOM 2060  C CA  . VAL A 1 299 ? 124.778 163.184 145.111 1.00 340.05 ? 299 VAL A CA  1 
ATOM 2061  C C   . VAL A 1 299 ? 124.431 164.624 145.447 1.00 350.73 ? 299 VAL A C   1 
ATOM 2062  O O   . VAL A 1 299 ? 123.771 165.339 144.684 1.00 320.24 ? 299 VAL A O   1 
ATOM 2063  C CB  . VAL A 1 299 ? 123.933 162.280 146.041 1.00 332.66 ? 299 VAL A CB  1 
ATOM 2064  C CG1 . VAL A 1 299 ? 122.460 162.676 146.028 1.00 337.82 ? 299 VAL A CG1 1 
ATOM 2065  C CG2 . VAL A 1 299 ? 124.072 160.814 145.654 1.00 386.31 ? 299 VAL A CG2 1 
ATOM 2066  N N   . ALA A 1 300 ? 124.914 164.977 146.627 1.00 346.91 ? 300 ALA A N   1 
ATOM 2067  C CA  . ALA A 1 300 ? 124.436 166.111 147.337 1.00 331.05 ? 300 ALA A CA  1 
ATOM 2068  C C   . ALA A 1 300 ? 124.741 167.386 146.578 1.00 312.48 ? 300 ALA A C   1 
ATOM 2069  O O   . ALA A 1 300 ? 123.861 168.253 146.427 1.00 293.73 ? 300 ALA A O   1 
ATOM 2070  C CB  . ALA A 1 300 ? 125.084 166.170 148.708 1.00 359.69 ? 300 ALA A CB  1 
ATOM 2071  N N   . SER A 1 301 ? 125.988 167.486 146.120 1.00 350.05 ? 301 SER A N   1 
ATOM 2072  C CA  . SER A 1 301 ? 126.480 168.651 145.395 1.00 412.31 ? 301 SER A CA  1 
ATOM 2073  C C   . SER A 1 301 ? 125.616 168.866 144.132 1.00 393.48 ? 301 SER A C   1 
ATOM 2074  O O   . SER A 1 301 ? 125.179 169.996 143.834 1.00 407.44 ? 301 SER A O   1 
ATOM 2075  C CB  . SER A 1 301 ? 127.934 168.434 144.971 1.00 413.13 ? 301 SER A CB  1 
ATOM 2076  O OG  . SER A 1 301 ? 128.092 167.214 144.265 1.00 406.89 ? 301 SER A OG  1 
ATOM 2077  N N   . PHE A 1 302 ? 125.397 167.761 143.424 1.00 341.27 ? 302 PHE A N   1 
ATOM 2078  C CA  . PHE A 1 302 ? 124.626 167.874 142.187 1.00 327.69 ? 302 PHE A CA  1 
ATOM 2079  C C   . PHE A 1 302 ? 123.202 168.274 142.464 1.00 319.56 ? 302 PHE A C   1 
ATOM 2080  O O   . PHE A 1 302 ? 122.676 169.114 141.716 1.00 352.42 ? 302 PHE A O   1 
ATOM 2081  C CB  . PHE A 1 302 ? 124.880 166.756 141.149 1.00 383.25 ? 302 PHE A CB  1 
ATOM 2082  C CG  . PHE A 1 302 ? 124.086 165.490 141.311 1.00 404.19 ? 302 PHE A CG  1 
ATOM 2083  C CD1 . PHE A 1 302 ? 122.745 165.438 140.954 1.00 367.91 ? 302 PHE A CD1 1 
ATOM 2084  C CD2 . PHE A 1 302 ? 124.733 164.294 141.649 1.00 406.07 ? 302 PHE A CD2 1 
ATOM 2085  C CE1 . PHE A 1 302 ? 122.041 164.255 141.043 1.00 335.42 ? 302 PHE A CE1 1 
ATOM 2086  C CE2 . PHE A 1 302 ? 124.031 163.102 141.726 1.00 363.55 ? 302 PHE A CE2 1 
ATOM 2087  C CZ  . PHE A 1 302 ? 122.679 163.084 141.432 1.00 348.07 ? 302 PHE A CZ  1 
ATOM 2088  N N   . VAL A 1 303 ? 122.629 167.755 143.546 1.00 294.55 ? 303 VAL A N   1 
ATOM 2089  C CA  . VAL A 1 303 ? 121.276 168.126 143.977 1.00 344.68 ? 303 VAL A CA  1 
ATOM 2090  C C   . VAL A 1 303 ? 121.198 169.630 144.225 1.00 354.06 ? 303 VAL A C   1 
ATOM 2091  O O   . VAL A 1 303 ? 120.255 170.298 143.778 1.00 287.79 ? 303 VAL A O   1 
ATOM 2092  C CB  . VAL A 1 303 ? 120.805 167.328 145.222 1.00 333.30 ? 303 VAL A CB  1 
ATOM 2093  C CG1 . VAL A 1 303 ? 119.459 167.839 145.719 1.00 365.12 ? 303 VAL A CG1 1 
ATOM 2094  C CG2 . VAL A 1 303 ? 120.694 165.843 144.909 1.00 334.07 ? 303 VAL A CG2 1 
ATOM 2095  N N   . THR A 1 304 ? 122.208 170.120 144.935 1.00 369.66 ? 304 THR A N   1 
ATOM 2096  C CA  . THR A 1 304 ? 122.310 171.542 145.282 1.00 381.33 ? 304 THR A CA  1 
ATOM 2097  C C   . THR A 1 304 ? 122.333 172.390 144.013 1.00 326.59 ? 304 THR A C   1 
ATOM 2098  O O   . THR A 1 304 ? 121.618 173.403 143.914 1.00 353.55 ? 304 THR A O   1 
ATOM 2099  C CB  . THR A 1 304 ? 123.490 171.901 146.213 1.00 403.44 ? 304 THR A CB  1 
ATOM 2100  O OG1 . THR A 1 304 ? 124.682 171.259 145.775 1.00 418.35 ? 304 THR A OG1 1 
ATOM 2101  C CG2 . THR A 1 304 ? 123.193 171.465 147.628 1.00 416.99 ? 304 THR A CG2 1 
ATOM 2102  N N   . GLN A 1 305 ? 123.155 171.942 143.071 1.00 289.62 ? 305 GLN A N   1 
ATOM 2103  C CA  . GLN A 1 305 ? 123.318 172.620 141.781 1.00 293.93 ? 305 GLN A CA  1 
ATOM 2104  C C   . GLN A 1 305 ? 121.971 172.709 141.063 1.00 313.97 ? 305 GLN A C   1 
ATOM 2105  O O   . GLN A 1 305 ? 121.595 173.771 140.541 1.00 307.12 ? 305 GLN A O   1 
ATOM 2106  C CB  . GLN A 1 305 ? 124.400 171.949 140.917 1.00 354.48 ? 305 GLN A CB  1 
ATOM 2107  C CG  . GLN A 1 305 ? 124.362 172.251 139.414 1.00 380.99 ? 305 GLN A CG  1 
ATOM 2108  C CD  . GLN A 1 305 ? 125.443 173.190 138.927 1.00 351.61 ? 305 GLN A CD  1 
ATOM 2109  O OE1 . GLN A 1 305 ? 125.847 174.116 139.627 1.00 357.88 ? 305 GLN A OE1 1 
ATOM 2110  N NE2 . GLN A 1 305 ? 125.911 172.953 137.700 1.00 319.94 ? 305 GLN A NE2 1 
ATOM 2111  N N   . LEU A 1 306 ? 121.279 171.578 141.059 1.00 336.32 ? 306 LEU A N   1 
ATOM 2112  C CA  . LEU A 1 306 ? 119.964 171.452 140.425 1.00 362.14 ? 306 LEU A CA  1 
ATOM 2113  C C   . LEU A 1 306 ? 118.991 172.458 141.028 1.00 370.40 ? 306 LEU A C   1 
ATOM 2114  O O   . LEU A 1 306 ? 118.263 173.155 140.307 1.00 368.65 ? 306 LEU A O   1 
ATOM 2115  C CB  . LEU A 1 306 ? 119.383 170.040 140.609 1.00 370.10 ? 306 LEU A CB  1 
ATOM 2116  C CG  . LEU A 1 306 ? 119.950 168.855 139.826 1.00 356.06 ? 306 LEU A CG  1 
ATOM 2117  C CD1 . LEU A 1 306 ? 119.346 167.541 140.323 1.00 343.93 ? 306 LEU A CD1 1 
ATOM 2118  C CD2 . LEU A 1 306 ? 119.702 169.026 138.335 1.00 370.49 ? 306 LEU A CD2 1 
ATOM 2119  N N   . ALA A 1 307 ? 119.006 172.503 142.352 1.00 334.82 ? 307 ALA A N   1 
ATOM 2120  C CA  . ALA A 1 307 ? 118.144 173.400 143.130 1.00 381.03 ? 307 ALA A CA  1 
ATOM 2121  C C   . ALA A 1 307 ? 118.403 174.849 142.728 1.00 353.22 ? 307 ALA A C   1 
ATOM 2122  O O   . ALA A 1 307 ? 117.460 175.624 142.498 1.00 368.14 ? 307 ALA A O   1 
ATOM 2123  C CB  . ALA A 1 307 ? 118.365 173.156 144.602 1.00 392.47 ? 307 ALA A CB  1 
ATOM 2124  N N   . ALA A 1 308 ? 119.686 175.173 142.655 1.00 356.75 ? 308 ALA A N   1 
ATOM 2125  C CA  . ALA A 1 308 ? 120.148 176.516 142.282 1.00 420.64 ? 308 ALA A CA  1 
ATOM 2126  C C   . ALA A 1 308 ? 119.605 176.894 140.906 1.00 394.63 ? 308 ALA A C   1 
ATOM 2127  O O   . ALA A 1 308 ? 119.087 178.002 140.705 1.00 389.07 ? 308 ALA A O   1 
ATOM 2128  C CB  . ALA A 1 308 ? 121.668 176.587 142.286 1.00 472.02 ? 308 ALA A CB  1 
ATOM 2129  N N   . ALA A 1 309 ? 119.742 175.946 139.989 1.00 354.29 ? 309 ALA A N   1 
ATOM 2130  C CA  . ALA A 1 309 ? 119.286 176.104 138.605 1.00 352.61 ? 309 ALA A CA  1 
ATOM 2131  C C   . ALA A 1 309 ? 117.793 176.414 138.574 1.00 365.80 ? 309 ALA A C   1 
ATOM 2132  O O   . ALA A 1 309 ? 117.343 177.328 137.872 1.00 370.70 ? 309 ALA A O   1 
ATOM 2133  C CB  . ALA A 1 309 ? 119.598 174.846 137.804 1.00 347.30 ? 309 ALA A CB  1 
ATOM 2134  N N   . GLU A 1 310 ? 117.061 175.625 139.348 1.00 323.81 ? 310 GLU A N   1 
ATOM 2135  C CA  . GLU A 1 310 ? 115.603 175.749 139.466 1.00 370.22 ? 310 GLU A CA  1 
ATOM 2136  C C   . GLU A 1 310 ? 115.235 177.151 139.937 1.00 386.35 ? 310 GLU A C   1 
ATOM 2137  O O   . GLU A 1 310 ? 114.334 177.796 139.374 1.00 413.45 ? 310 GLU A O   1 
ATOM 2138  C CB  . GLU A 1 310 ? 115.043 174.703 140.447 1.00 413.99 ? 310 GLU A CB  1 
ATOM 2139  C CG  . GLU A 1 310 ? 113.577 174.853 140.876 1.00 452.55 ? 310 GLU A CG  1 
ATOM 2140  C CD  . GLU A 1 310 ? 112.575 174.635 139.749 1.00 486.16 ? 310 GLU A CD  1 
ATOM 2141  O OE1 . GLU A 1 310 ? 112.533 175.460 138.812 1.00 500.00 ? 310 GLU A OE1 1 
ATOM 2142  O OE2 . GLU A 1 310 ? 111.806 173.649 139.811 1.00 462.67 ? 310 GLU A OE2 1 
ATOM 2143  N N   . ALA A 1 311 ? 115.954 177.590 140.967 1.00 409.18 ? 311 ALA A N   1 
ATOM 2144  C CA  . ALA A 1 311 ? 115.751 178.904 141.571 1.00 425.43 ? 311 ALA A CA  1 
ATOM 2145  C C   . ALA A 1 311 ? 115.946 179.998 140.529 1.00 403.47 ? 311 ALA A C   1 
ATOM 2146  O O   . ALA A 1 311 ? 115.106 180.927 140.396 1.00 419.79 ? 311 ALA A O   1 
ATOM 2147  C CB  . ALA A 1 311 ? 116.693 179.114 142.744 1.00 456.03 ? 311 ALA A CB  1 
ATOM 2148  N N   . LEU A 1 312 ? 117.096 179.931 139.873 1.00 352.76 ? 312 LEU A N   1 
ATOM 2149  C CA  . LEU A 1 312 ? 117.511 180.971 138.917 1.00 374.12 ? 312 LEU A CA  1 
ATOM 2150  C C   . LEU A 1 312 ? 116.499 181.058 137.786 1.00 351.92 ? 312 LEU A C   1 
ATOM 2151  O O   . LEU A 1 312 ? 116.094 182.182 137.405 1.00 410.60 ? 312 LEU A O   1 
ATOM 2152  C CB  . LEU A 1 312 ? 118.985 180.838 138.485 1.00 384.06 ? 312 LEU A CB  1 
ATOM 2153  C CG  . LEU A 1 312 ? 119.537 180.627 137.074 1.00 401.94 ? 312 LEU A CG  1 
ATOM 2154  C CD1 . LEU A 1 312 ? 118.842 181.410 135.976 1.00 386.97 ? 312 LEU A CD1 1 
ATOM 2155  C CD2 . LEU A 1 312 ? 121.008 181.034 137.110 1.00 421.31 ? 312 LEU A CD2 1 
ATOM 2156  N N   . GLN A 1 313 ? 116.089 179.889 137.297 1.00 343.78 ? 313 GLN A N   1 
ATOM 2157  C CA  . GLN A 1 313 ? 115.115 179.817 136.200 1.00 446.79 ? 313 GLN A CA  1 
ATOM 2158  C C   . GLN A 1 313 ? 113.809 180.478 136.617 1.00 457.75 ? 313 GLN A C   1 
ATOM 2159  O O   . GLN A 1 313 ? 113.241 181.245 135.816 1.00 428.49 ? 313 GLN A O   1 
ATOM 2160  C CB  . GLN A 1 313 ? 114.902 178.385 135.708 1.00 477.19 ? 313 GLN A CB  1 
ATOM 2161  C CG  . GLN A 1 313 ? 114.623 178.322 134.216 1.00 500.00 ? 313 GLN A CG  1 
ATOM 2162  C CD  . GLN A 1 313 ? 115.835 178.622 133.345 1.00 500.00 ? 313 GLN A CD  1 
ATOM 2163  O OE1 . GLN A 1 313 ? 115.753 179.422 132.412 1.00 500.00 ? 313 GLN A OE1 1 
ATOM 2164  N NE2 . GLN A 1 313 ? 116.964 177.983 133.641 1.00 485.06 ? 313 GLN A NE2 1 
ATOM 2165  N N   . LYS A 1 314 ? 113.381 180.177 137.842 1.00 463.33 ? 314 LYS A N   1 
ATOM 2166  C CA  . LYS A 1 314 ? 112.168 180.781 138.400 1.00 459.81 ? 314 LYS A CA  1 
ATOM 2167  C C   . LYS A 1 314 ? 112.192 182.312 138.363 1.00 448.54 ? 314 LYS A C   1 
ATOM 2168  O O   . LYS A 1 314 ? 111.124 182.915 138.273 1.00 409.05 ? 314 LYS A O   1 
ATOM 2169  C CB  . LYS A 1 314 ? 111.865 180.294 139.825 1.00 491.78 ? 314 LYS A CB  1 
ATOM 2170  C CG  . LYS A 1 314 ? 111.057 179.005 139.891 1.00 500.00 ? 314 LYS A CG  1 
ATOM 2171  C CD  . LYS A 1 314 ? 110.071 178.998 141.056 1.00 500.00 ? 314 LYS A CD  1 
ATOM 2172  C CE  . LYS A 1 314 ? 110.763 179.113 142.408 1.00 500.00 ? 314 LYS A CE  1 
ATOM 2173  N NZ  . LYS A 1 314 ? 109.833 178.829 143.537 1.00 500.00 ? 314 LYS A NZ  1 
ATOM 2174  N N   . ALA A 1 315 ? 113.361 182.953 138.441 1.00 478.97 ? 315 ALA A N   1 
ATOM 2175  C CA  . ALA A 1 315 ? 113.440 184.421 138.307 1.00 500.00 ? 315 ALA A CA  1 
ATOM 2176  C C   . ALA A 1 315 ? 112.891 184.898 136.947 1.00 500.00 ? 315 ALA A C   1 
ATOM 2177  O O   . ALA A 1 315 ? 113.106 184.233 135.933 1.00 500.00 ? 315 ALA A O   1 
ATOM 2178  C CB  . ALA A 1 315 ? 114.870 184.915 138.499 1.00 485.06 ? 315 ALA A CB  1 
ATOM 2179  N N   . PRO A 1 316 ? 112.165 186.036 136.927 1.00 500.00 ? 316 PRO A N   1 
ATOM 2180  C CA  . PRO A 1 316 ? 111.659 186.593 135.660 1.00 500.00 ? 316 PRO A CA  1 
ATOM 2181  C C   . PRO A 1 316 ? 112.722 187.318 134.826 1.00 500.00 ? 316 PRO A C   1 
ATOM 2182  O O   . PRO A 1 316 ? 112.788 187.111 133.609 1.00 500.00 ? 316 PRO A O   1 
ATOM 2183  C CB  . PRO A 1 316 ? 110.556 187.562 136.109 1.00 500.00 ? 316 PRO A CB  1 
ATOM 2184  C CG  . PRO A 1 316 ? 110.885 187.919 137.514 1.00 500.00 ? 316 PRO A CG  1 
ATOM 2185  C CD  . PRO A 1 316 ? 111.653 186.772 138.101 1.00 500.00 ? 316 PRO A CD  1 
ATOM 2186  N N   . ASP A 1 317 ? 113.526 188.164 135.472 1.00 500.00 ? 317 ASP A N   1 
ATOM 2187  C CA  . ASP A 1 317 ? 114.616 188.873 134.801 1.00 500.00 ? 317 ASP A CA  1 
ATOM 2188  C C   . ASP A 1 317 ? 115.707 187.850 134.475 1.00 500.00 ? 317 ASP A C   1 
ATOM 2189  O O   . ASP A 1 317 ? 116.595 187.581 135.291 1.00 500.00 ? 317 ASP A O   1 
ATOM 2190  C CB  . ASP A 1 317 ? 115.144 190.020 135.682 1.00 500.00 ? 317 ASP A CB  1 
ATOM 2191  C CG  . ASP A 1 317 ? 116.183 190.900 134.977 1.00 500.00 ? 317 ASP A CG  1 
ATOM 2192  O OD1 . ASP A 1 317 ? 116.331 190.819 133.739 1.00 500.00 ? 317 ASP A OD1 1 
ATOM 2193  O OD2 . ASP A 1 317 ? 116.854 191.692 135.675 1.00 500.00 ? 317 ASP A OD2 1 
ATOM 2194  N N   . VAL A 1 318 ? 115.599 187.274 133.278 1.00 500.00 ? 318 VAL A N   1 
ATOM 2195  C CA  . VAL A 1 318 ? 116.433 186.149 132.845 1.00 494.57 ? 318 VAL A CA  1 
ATOM 2196  C C   . VAL A 1 318 ? 116.977 186.398 131.436 1.00 430.74 ? 318 VAL A C   1 
ATOM 2197  O O   . VAL A 1 318 ? 118.190 186.497 131.254 1.00 378.23 ? 318 VAL A O   1 
ATOM 2198  C CB  . VAL A 1 318 ? 115.636 184.815 132.961 1.00 500.00 ? 318 VAL A CB  1 
ATOM 2199  C CG1 . VAL A 1 318 ? 116.052 183.770 131.925 1.00 500.00 ? 318 VAL A CG1 1 
ATOM 2200  C CG2 . VAL A 1 318 ? 115.777 184.250 134.369 1.00 491.19 ? 318 VAL A CG2 1 
ATOM 2201  N N   . THR A 1 319 ? 116.083 186.500 130.454 1.00 431.17 ? 319 THR A N   1 
ATOM 2202  C CA  . THR A 1 319 ? 116.476 186.697 129.053 1.00 469.91 ? 319 THR A CA  1 
ATOM 2203  C C   . THR A 1 319 ? 117.373 187.923 128.845 1.00 500.00 ? 319 THR A C   1 
ATOM 2204  O O   . THR A 1 319 ? 118.232 187.913 127.960 1.00 500.00 ? 319 THR A O   1 
ATOM 2205  C CB  . THR A 1 319 ? 115.245 186.804 128.129 1.00 483.18 ? 319 THR A CB  1 
ATOM 2206  O OG1 . THR A 1 319 ? 114.289 187.705 128.702 1.00 500.00 ? 319 THR A OG1 1 
ATOM 2207  C CG2 . THR A 1 319 ? 114.597 185.440 127.938 1.00 483.00 ? 319 THR A CG2 1 
ATOM 2208  N N   . THR A 1 320 ? 117.169 188.965 129.656 1.00 500.00 ? 320 THR A N   1 
ATOM 2209  C CA  . THR A 1 320 ? 118.017 190.162 129.652 1.00 500.00 ? 320 THR A CA  1 
ATOM 2210  C C   . THR A 1 320 ? 119.150 190.037 130.673 1.00 490.78 ? 320 THR A C   1 
ATOM 2211  O O   . THR A 1 320 ? 119.042 190.533 131.797 1.00 493.16 ? 320 THR A O   1 
ATOM 2212  C CB  . THR A 1 320 ? 117.193 191.433 129.955 1.00 500.00 ? 320 THR A CB  1 
ATOM 2213  O OG1 . THR A 1 320 ? 116.442 191.244 131.160 1.00 500.00 ? 320 THR A OG1 1 
ATOM 2214  C CG2 . THR A 1 320 ? 116.234 191.747 128.808 1.00 500.00 ? 320 THR A CG2 1 
ATOM 2215  N N   . LEU A 1 321 ? 120.223 189.359 130.270 1.00 451.47 ? 321 LEU A N   1 
ATOM 2216  C CA  . LEU A 1 321 ? 121.440 189.225 131.077 1.00 444.14 ? 321 LEU A CA  1 
ATOM 2217  C C   . LEU A 1 321 ? 122.660 189.156 130.157 1.00 485.61 ? 321 LEU A C   1 
ATOM 2218  O O   . LEU A 1 321 ? 122.685 188.315 129.261 1.00 492.52 ? 321 LEU A O   1 
ATOM 2219  C CB  . LEU A 1 321 ? 121.381 187.964 131.937 1.00 440.64 ? 321 LEU A CB  1 
ATOM 2220  C CG  . LEU A 1 321 ? 120.424 187.975 133.133 1.00 498.02 ? 321 LEU A CG  1 
ATOM 2221  C CD1 . LEU A 1 321 ? 120.358 186.590 133.755 1.00 500.00 ? 321 LEU A CD1 1 
ATOM 2222  C CD2 . LEU A 1 321 ? 120.834 189.005 134.175 1.00 500.00 ? 321 LEU A CD2 1 
ATOM 2223  N N   . PRO A 1 322 ? 123.672 190.031 130.363 1.00 500.00 ? 322 PRO A N   1 
ATOM 2224  C CA  . PRO A 1 322 ? 124.821 190.057 129.434 1.00 500.00 ? 322 PRO A CA  1 
ATOM 2225  C C   . PRO A 1 322 ? 125.528 188.715 129.241 1.00 500.00 ? 322 PRO A C   1 
ATOM 2226  O O   . PRO A 1 322 ? 125.731 188.290 128.101 1.00 500.00 ? 322 PRO A O   1 
ATOM 2227  C CB  . PRO A 1 322 ? 125.780 191.088 130.063 1.00 500.00 ? 322 PRO A CB  1 
ATOM 2228  C CG  . PRO A 1 322 ? 125.195 191.460 131.386 1.00 500.00 ? 322 PRO A CG  1 
ATOM 2229  C CD  . PRO A 1 322 ? 123.733 191.150 131.321 1.00 500.00 ? 322 PRO A CD  1 
ATOM 2230  N N   . ARG A 1 323 ? 125.891 188.071 130.348 1.00 500.00 ? 323 ARG A N   1 
ATOM 2231  C CA  . ARG A 1 323 ? 126.500 186.744 130.315 1.00 500.00 ? 323 ARG A CA  1 
ATOM 2232  C C   . ARG A 1 323 ? 125.432 185.678 130.537 1.00 500.00 ? 323 ARG A C   1 
ATOM 2233  O O   . ARG A 1 323 ? 124.488 185.883 131.307 1.00 478.31 ? 323 ARG A O   1 
ATOM 2234  C CB  . ARG A 1 323 ? 127.588 186.617 131.374 1.00 478.39 ? 323 ARG A CB  1 
ATOM 2235  C CG  . ARG A 1 323 ? 128.687 187.657 131.267 1.00 469.73 ? 323 ARG A CG  1 
ATOM 2236  C CD  . ARG A 1 323 ? 129.698 187.489 132.389 1.00 500.00 ? 323 ARG A CD  1 
ATOM 2237  N NE  . ARG A 1 323 ? 130.449 188.718 132.641 1.00 500.00 ? 323 ARG A NE  1 
ATOM 2238  C CZ  . ARG A 1 323 ? 129.975 189.801 133.265 1.00 500.00 ? 323 ARG A CZ  1 
ATOM 2239  N NH1 . ARG A 1 323 ? 128.719 189.852 133.714 1.00 500.00 ? 323 ARG A NH1 1 
ATOM 2240  N NH2 . ARG A 1 323 ? 130.768 190.858 133.430 1.00 500.00 ? 323 ARG A NH2 1 
ATOM 2241  N N   . ASN A 1 324 ? 125.598 184.546 129.853 1.00 481.57 ? 324 ASN A N   1 
ATOM 2242  C CA  . ASN A 1 324 ? 124.662 183.426 129.917 1.00 441.66 ? 324 ASN A CA  1 
ATOM 2243  C C   . ASN A 1 324 ? 125.249 182.308 130.754 1.00 370.92 ? 324 ASN A C   1 
ATOM 2244  O O   . ASN A 1 324 ? 126.459 182.125 130.772 1.00 255.43 ? 324 ASN A O   1 
ATOM 2245  C CB  . ASN A 1 324 ? 124.357 182.916 128.505 1.00 477.68 ? 324 ASN A CB  1 
ATOM 2246  C CG  . ASN A 1 324 ? 123.125 182.030 128.444 1.00 495.80 ? 324 ASN A CG  1 
ATOM 2247  O OD1 . ASN A 1 324 ? 122.369 181.913 129.407 1.00 464.71 ? 324 ASN A OD1 1 
ATOM 2248  N ND2 . ASN A 1 324 ? 122.920 181.397 127.300 1.00 500.00 ? 324 ASN A ND2 1 
ATOM 2249  N N   . VAL A 1 325 ? 124.377 181.547 131.415 1.00 390.38 ? 325 VAL A N   1 
ATOM 2250  C CA  . VAL A 1 325 ? 124.780 180.575 132.439 1.00 410.67 ? 325 VAL A CA  1 
ATOM 2251  C C   . VAL A 1 325 ? 124.700 179.130 131.957 1.00 455.44 ? 325 VAL A C   1 
ATOM 2252  O O   . VAL A 1 325 ? 123.772 178.752 131.244 1.00 472.67 ? 325 VAL A O   1 
ATOM 2253  C CB  . VAL A 1 325 ? 123.927 180.703 133.717 1.00 367.74 ? 325 VAL A CB  1 
ATOM 2254  C CG1 . VAL A 1 325 ? 124.643 180.058 134.905 1.00 321.49 ? 325 VAL A CG1 1 
ATOM 2255  C CG2 . VAL A 1 325 ? 123.615 182.165 134.005 1.00 375.03 ? 325 VAL A CG2 1 
ATOM 2256  N N   . MET A 1 326 ? 125.662 178.339 132.430 1.00 449.74 ? 326 MET A N   1 
ATOM 2257  C CA  . MET A 1 326 ? 125.982 176.998 131.967 1.00 398.21 ? 326 MET A CA  1 
ATOM 2258  C C   . MET A 1 326 ? 125.984 176.076 133.200 1.00 354.16 ? 326 MET A C   1 
ATOM 2259  O O   . MET A 1 326 ? 126.982 175.958 133.917 1.00 374.52 ? 326 MET A O   1 
ATOM 2260  C CB  . MET A 1 326 ? 127.340 177.090 131.218 1.00 381.76 ? 326 MET A CB  1 
ATOM 2261  C CG  . MET A 1 326 ? 128.368 175.975 131.342 1.00 374.35 ? 326 MET A CG  1 
ATOM 2262  S SD  . MET A 1 326 ? 127.830 174.366 130.763 1.00 425.98 ? 326 MET A SD  1 
ATOM 2263  C CE  . MET A 1 326 ? 129.424 173.575 130.536 1.00 394.26 ? 326 MET A CE  1 
ATOM 2264  N N   . PHE A 1 327 ? 124.827 175.483 133.482 1.00 309.81 ? 327 PHE A N   1 
ATOM 2265  C CA  . PHE A 1 327 ? 124.708 174.476 134.547 1.00 335.81 ? 327 PHE A CA  1 
ATOM 2266  C C   . PHE A 1 327 ? 125.169 173.118 134.056 1.00 336.02 ? 327 PHE A C   1 
ATOM 2267  O O   . PHE A 1 327 ? 124.456 172.444 133.297 1.00 363.27 ? 327 PHE A O   1 
ATOM 2268  C CB  . PHE A 1 327 ? 123.268 174.334 135.007 1.00 382.83 ? 327 PHE A CB  1 
ATOM 2269  C CG  . PHE A 1 327 ? 122.783 175.483 135.806 1.00 372.85 ? 327 PHE A CG  1 
ATOM 2270  C CD1 . PHE A 1 327 ? 122.229 176.588 135.177 1.00 338.19 ? 327 PHE A CD1 1 
ATOM 2271  C CD2 . PHE A 1 327 ? 122.878 175.456 137.195 1.00 389.62 ? 327 PHE A CD2 1 
ATOM 2272  C CE1 . PHE A 1 327 ? 121.775 177.652 135.924 1.00 435.65 ? 327 PHE A CE1 1 
ATOM 2273  C CE2 . PHE A 1 327 ? 122.435 176.520 137.949 1.00 413.63 ? 327 PHE A CE2 1 
ATOM 2274  C CZ  . PHE A 1 327 ? 121.884 177.622 137.312 1.00 461.45 ? 327 PHE A CZ  1 
ATOM 2275  N N   . VAL A 1 328 ? 126.353 172.714 134.489 1.00 335.76 ? 328 VAL A N   1 
ATOM 2276  C CA  . VAL A 1 328 ? 126.951 171.480 133.997 1.00 354.41 ? 328 VAL A CA  1 
ATOM 2277  C C   . VAL A 1 328 ? 127.165 170.537 135.156 1.00 314.87 ? 328 VAL A C   1 
ATOM 2278  O O   . VAL A 1 328 ? 127.315 170.950 136.307 1.00 322.29 ? 328 VAL A O   1 
ATOM 2279  C CB  . VAL A 1 328 ? 128.244 171.730 133.169 1.00 365.01 ? 328 VAL A CB  1 
ATOM 2280  C CG1 . VAL A 1 328 ? 129.243 172.615 133.896 1.00 388.92 ? 328 VAL A CG1 1 
ATOM 2281  C CG2 . VAL A 1 328 ? 128.898 170.430 132.720 1.00 345.90 ? 328 VAL A CG2 1 
ATOM 2282  N N   . PHE A 1 329 ? 127.089 169.257 134.826 1.00 291.46 ? 329 PHE A N   1 
ATOM 2283  C CA  . PHE A 1 329 ? 127.294 168.194 135.766 1.00 301.91 ? 329 PHE A CA  1 
ATOM 2284  C C   . PHE A 1 329 ? 128.194 167.245 135.015 1.00 297.90 ? 329 PHE A C   1 
ATOM 2285  O O   . PHE A 1 329 ? 127.818 166.739 133.957 1.00 300.94 ? 329 PHE A O   1 
ATOM 2286  C CB  . PHE A 1 329 ? 125.978 167.481 136.095 1.00 323.04 ? 329 PHE A CB  1 
ATOM 2287  C CG  . PHE A 1 329 ? 124.847 168.391 136.526 1.00 335.37 ? 329 PHE A CG  1 
ATOM 2288  C CD1 . PHE A 1 329 ? 124.313 169.370 135.669 1.00 338.94 ? 329 PHE A CD1 1 
ATOM 2289  C CD2 . PHE A 1 329 ? 124.260 168.216 137.771 1.00 314.61 ? 329 PHE A CD2 1 
ATOM 2290  C CE1 . PHE A 1 329 ? 123.261 170.173 136.068 1.00 324.71 ? 329 PHE A CE1 1 
ATOM 2291  C CE2 . PHE A 1 329 ? 123.201 169.008 138.177 1.00 327.10 ? 329 PHE A CE2 1 
ATOM 2292  C CZ  . PHE A 1 329 ? 122.701 169.990 137.324 1.00 346.98 ? 329 PHE A CZ  1 
ATOM 2293  N N   . PHE A 1 330 ? 129.380 167.003 135.541 1.00 340.39 ? 330 PHE A N   1 
ATOM 2294  C CA  . PHE A 1 330 ? 130.303 166.111 134.875 1.00 353.66 ? 330 PHE A CA  1 
ATOM 2295  C C   . PHE A 1 330 ? 130.231 164.746 135.545 1.00 369.10 ? 330 PHE A C   1 
ATOM 2296  O O   . PHE A 1 330 ? 130.383 164.635 136.770 1.00 391.86 ? 330 PHE A O   1 
ATOM 2297  C CB  . PHE A 1 330 ? 131.712 166.672 134.922 1.00 382.73 ? 330 PHE A CB  1 
ATOM 2298  C CG  . PHE A 1 330 ? 131.829 168.067 134.377 1.00 377.72 ? 330 PHE A CG  1 
ATOM 2299  C CD1 . PHE A 1 330 ? 131.593 169.167 135.190 1.00 388.77 ? 330 PHE A CD1 1 
ATOM 2300  C CD2 . PHE A 1 330 ? 132.189 168.286 133.060 1.00 382.32 ? 330 PHE A CD2 1 
ATOM 2301  C CE1 . PHE A 1 330 ? 131.714 170.455 134.699 1.00 393.50 ? 330 PHE A CE1 1 
ATOM 2302  C CE2 . PHE A 1 330 ? 132.318 169.573 132.561 1.00 388.99 ? 330 PHE A CE2 1 
ATOM 2303  C CZ  . PHE A 1 330 ? 132.078 170.660 133.380 1.00 365.19 ? 330 PHE A CZ  1 
ATOM 2304  N N   . GLN A 1 331 ? 129.954 163.726 134.735 1.00 338.37 ? 331 GLN A N   1 
ATOM 2305  C CA  . GLN A 1 331 ? 129.897 162.346 135.188 1.00 321.92 ? 331 GLN A CA  1 
ATOM 2306  C C   . GLN A 1 331 ? 131.227 161.747 134.788 1.00 288.28 ? 331 GLN A C   1 
ATOM 2307  O O   . GLN A 1 331 ? 131.336 161.090 133.758 1.00 334.38 ? 331 GLN A O   1 
ATOM 2308  C CB  . GLN A 1 331 ? 128.720 161.621 134.522 1.00 361.15 ? 331 GLN A CB  1 
ATOM 2309  C CG  . GLN A 1 331 ? 128.505 160.157 134.921 1.00 417.53 ? 331 GLN A CG  1 
ATOM 2310  C CD  . GLN A 1 331 ? 127.863 159.923 136.284 1.00 452.64 ? 331 GLN A CD  1 
ATOM 2311  O OE1 . GLN A 1 331 ? 128.152 158.923 136.945 1.00 456.30 ? 331 GLN A OE1 1 
ATOM 2312  N NE2 . GLN A 1 331 ? 126.977 160.816 136.699 1.00 472.68 ? 331 GLN A NE2 1 
ATOM 2313  N N   . GLY A 1 332 ? 132.255 162.030 135.578 1.00 319.08 ? 332 GLY A N   1 
ATOM 2314  C CA  . GLY A 1 332 ? 133.575 161.440 135.367 1.00 360.22 ? 332 GLY A CA  1 
ATOM 2315  C C   . GLY A 1 332 ? 134.446 161.436 136.607 1.00 376.00 ? 332 GLY A C   1 
ATOM 2316  O O   . GLY A 1 332 ? 134.559 160.415 137.277 1.00 389.59 ? 332 GLY A O   1 
ATOM 2317  N N   . GLU A 1 333 ? 135.095 162.569 136.866 1.00 363.01 ? 333 GLU A N   1 
ATOM 2318  C CA  . GLU A 1 333 ? 135.723 162.898 138.157 1.00 376.32 ? 333 GLU A CA  1 
ATOM 2319  C C   . GLU A 1 333 ? 136.330 161.749 138.986 1.00 373.43 ? 333 GLU A C   1 
ATOM 2320  O O   . GLU A 1 333 ? 137.553 161.648 139.088 1.00 388.86 ? 333 GLU A O   1 
ATOM 2321  C CB  . GLU A 1 333 ? 134.730 163.678 139.030 1.00 416.36 ? 333 GLU A CB  1 
ATOM 2322  C CG  . GLU A 1 333 ? 134.654 165.172 138.749 1.00 447.13 ? 333 GLU A CG  1 
ATOM 2323  C CD  . GLU A 1 333 ? 134.113 165.522 137.379 1.00 447.26 ? 333 GLU A CD  1 
ATOM 2324  O OE1 . GLU A 1 333 ? 133.457 164.673 136.735 1.00 458.41 ? 333 GLU A OE1 1 
ATOM 2325  O OE2 . GLU A 1 333 ? 134.348 166.667 136.944 1.00 454.69 ? 333 GLU A OE2 1 
ATOM 2326  N N   . THR A 1 334 ? 135.475 160.909 139.580 1.00 364.03 ? 334 THR A N   1 
ATOM 2327  C CA  . THR A 1 334 ? 135.901 159.799 140.463 1.00 379.64 ? 334 THR A CA  1 
ATOM 2328  C C   . THR A 1 334 ? 136.882 158.826 139.795 1.00 361.49 ? 334 THR A C   1 
ATOM 2329  O O   . THR A 1 334 ? 137.694 158.169 140.460 1.00 324.17 ? 334 THR A O   1 
ATOM 2330  C CB  . THR A 1 334 ? 134.686 159.010 141.004 1.00 389.04 ? 334 THR A CB  1 
ATOM 2331  O OG1 . THR A 1 334 ? 135.107 158.146 142.063 1.00 420.08 ? 334 THR A OG1 1 
ATOM 2332  C CG2 . THR A 1 334 ? 134.014 158.180 139.911 1.00 400.45 ? 334 THR A CG2 1 
ATOM 2333  N N   . PHE A 1 335 ? 136.755 158.728 138.478 1.00 363.92 ? 335 PHE A N   1 
ATOM 2334  C CA  . PHE A 1 335 ? 137.785 158.211 137.615 1.00 360.85 ? 335 PHE A CA  1 
ATOM 2335  C C   . PHE A 1 335 ? 138.291 159.455 136.936 1.00 364.46 ? 335 PHE A C   1 
ATOM 2336  O O   . PHE A 1 335 ? 137.513 160.246 136.398 1.00 355.45 ? 335 PHE A O   1 
ATOM 2337  C CB  . PHE A 1 335 ? 137.202 157.192 136.660 1.00 358.85 ? 335 PHE A CB  1 
ATOM 2338  C CG  . PHE A 1 335 ? 136.546 156.056 137.374 1.00 377.12 ? 335 PHE A CG  1 
ATOM 2339  C CD1 . PHE A 1 335 ? 137.291 155.280 138.258 1.00 369.36 ? 335 PHE A CD1 1 
ATOM 2340  C CD2 . PHE A 1 335 ? 135.186 155.791 137.224 1.00 387.29 ? 335 PHE A CD2 1 
ATOM 2341  C CE1 . PHE A 1 335 ? 136.704 154.244 138.952 1.00 388.78 ? 335 PHE A CE1 1 
ATOM 2342  C CE2 . PHE A 1 335 ? 134.589 154.749 137.918 1.00 384.53 ? 335 PHE A CE2 1 
ATOM 2343  C CZ  . PHE A 1 335 ? 135.355 153.976 138.784 1.00 405.48 ? 335 PHE A CZ  1 
ATOM 2344  N N   . ASP A 1 336 ? 139.606 159.600 136.968 1.00 371.68 ? 336 ASP A N   1 
ATOM 2345  C CA  . ASP A 1 336 ? 140.265 160.902 137.089 1.00 352.34 ? 336 ASP A CA  1 
ATOM 2346  C C   . ASP A 1 336 ? 139.923 161.903 135.979 1.00 303.34 ? 336 ASP A C   1 
ATOM 2347  O O   . ASP A 1 336 ? 140.709 162.135 135.054 1.00 252.52 ? 336 ASP A O   1 
ATOM 2348  C CB  . ASP A 1 336 ? 141.781 160.702 137.250 1.00 392.59 ? 336 ASP A CB  1 
ATOM 2349  C CG  . ASP A 1 336 ? 142.132 159.713 138.380 1.00 428.93 ? 336 ASP A CG  1 
ATOM 2350  O OD1 . ASP A 1 336 ? 141.237 159.382 139.191 1.00 434.09 ? 336 ASP A OD1 1 
ATOM 2351  O OD2 . ASP A 1 336 ? 143.292 159.257 138.458 1.00 446.89 ? 336 ASP A OD2 1 
ATOM 2352  N N   . TYR A 1 337 ? 138.728 162.483 136.124 1.00 287.73 ? 337 TYR A N   1 
ATOM 2353  C CA  . TYR A 1 337 ? 138.180 163.526 135.252 1.00 322.71 ? 337 TYR A CA  1 
ATOM 2354  C C   . TYR A 1 337 ? 137.878 163.028 133.838 1.00 312.75 ? 337 TYR A C   1 
ATOM 2355  O O   . TYR A 1 337 ? 137.968 163.783 132.879 1.00 259.92 ? 337 TYR A O   1 
ATOM 2356  C CB  . TYR A 1 337 ? 139.078 164.785 135.259 1.00 370.28 ? 337 TYR A CB  1 
ATOM 2357  C CG  . TYR A 1 337 ? 139.376 165.254 136.670 1.00 385.17 ? 337 TYR A CG  1 
ATOM 2358  C CD1 . TYR A 1 337 ? 138.359 165.736 137.491 1.00 377.80 ? 337 TYR A CD1 1 
ATOM 2359  C CD2 . TYR A 1 337 ? 140.663 165.172 137.202 1.00 391.03 ? 337 TYR A CD2 1 
ATOM 2360  C CE1 . TYR A 1 337 ? 138.617 166.138 138.793 1.00 371.29 ? 337 TYR A CE1 1 
ATOM 2361  C CE2 . TYR A 1 337 ? 140.929 165.575 138.505 1.00 342.62 ? 337 TYR A CE2 1 
ATOM 2362  C CZ  . TYR A 1 337 ? 139.904 166.052 139.296 1.00 332.19 ? 337 TYR A CZ  1 
ATOM 2363  O OH  . TYR A 1 337 ? 140.155 166.455 140.585 1.00 326.74 ? 337 TYR A OH  1 
ATOM 2364  N N   . ILE A 1 338 ? 137.453 161.770 133.720 1.00 373.36 ? 338 ILE A N   1 
ATOM 2365  C CA  . ILE A 1 338 ? 137.103 161.207 132.404 1.00 383.65 ? 338 ILE A CA  1 
ATOM 2366  C C   . ILE A 1 338 ? 135.993 161.997 131.689 1.00 320.96 ? 338 ILE A C   1 
ATOM 2367  O O   . ILE A 1 338 ? 135.878 161.889 130.472 1.00 355.75 ? 338 ILE A O   1 
ATOM 2368  C CB  . ILE A 1 338 ? 136.755 159.673 132.430 1.00 389.90 ? 338 ILE A CB  1 
ATOM 2369  C CG1 . ILE A 1 338 ? 135.496 159.367 133.266 1.00 390.98 ? 338 ILE A CG1 1 
ATOM 2370  C CG2 . ILE A 1 338 ? 137.952 158.837 132.890 1.00 377.15 ? 338 ILE A CG2 1 
ATOM 2371  C CD1 . ILE A 1 338 ? 134.185 159.526 132.522 1.00 417.30 ? 338 ILE A CD1 1 
ATOM 2372  N N   . GLY A 1 339 ? 135.193 162.778 132.416 1.00 263.02 ? 339 GLY A N   1 
ATOM 2373  C CA  . GLY A 1 339 ? 134.078 163.481 131.778 1.00 330.91 ? 339 GLY A CA  1 
ATOM 2374  C C   . GLY A 1 339 ? 134.442 164.948 131.583 1.00 334.22 ? 339 GLY A C   1 
ATOM 2375  O O   . GLY A 1 339 ? 134.332 165.534 130.479 1.00 287.42 ? 339 GLY A O   1 
ATOM 2376  N N   . SER A 1 340 ? 134.870 165.525 132.704 1.00 362.36 ? 340 SER A N   1 
ATOM 2377  C CA  . SER A 1 340 ? 135.275 166.947 132.748 1.00 368.42 ? 340 SER A CA  1 
ATOM 2378  C C   . SER A 1 340 ? 136.411 167.189 131.781 1.00 346.47 ? 340 SER A C   1 
ATOM 2379  O O   . SER A 1 340 ? 136.383 168.181 131.034 1.00 356.25 ? 340 SER A O   1 
ATOM 2380  C CB  . SER A 1 340 ? 135.625 167.408 134.165 1.00 401.26 ? 340 SER A CB  1 
ATOM 2381  O OG  . SER A 1 340 ? 136.199 166.364 134.931 1.00 433.18 ? 340 SER A OG  1 
ATOM 2382  N N   . SER A 1 341 ? 137.385 166.274 131.805 1.00 366.63 ? 341 SER A N   1 
ATOM 2383  C CA  . SER A 1 341 ? 138.561 166.371 130.927 1.00 379.13 ? 341 SER A CA  1 
ATOM 2384  C C   . SER A 1 341 ? 138.129 166.372 129.473 1.00 353.78 ? 341 SER A C   1 
ATOM 2385  O O   . SER A 1 341 ? 138.614 167.188 128.675 1.00 348.29 ? 341 SER A O   1 
ATOM 2386  C CB  . SER A 1 341 ? 139.622 165.287 131.192 1.00 378.06 ? 341 SER A CB  1 
ATOM 2387  O OG  . SER A 1 341 ? 139.143 163.983 130.912 1.00 350.30 ? 341 SER A OG  1 
ATOM 2388  N N   . ARG A 1 342 ? 137.216 165.456 129.163 1.00 290.03 ? 342 ARG A N   1 
ATOM 2389  C CA  . ARG A 1 342 ? 136.674 165.310 127.804 1.00 338.96 ? 342 ARG A CA  1 
ATOM 2390  C C   . ARG A 1 342 ? 136.035 166.612 127.353 1.00 393.60 ? 342 ARG A C   1 
ATOM 2391  O O   . ARG A 1 342 ? 136.266 167.077 126.227 1.00 434.49 ? 342 ARG A O   1 
ATOM 2392  C CB  . ARG A 1 342 ? 135.666 164.167 127.696 1.00 358.52 ? 342 ARG A CB  1 
ATOM 2393  C CG  . ARG A 1 342 ? 135.032 164.015 126.313 1.00 380.94 ? 342 ARG A CG  1 
ATOM 2394  C CD  . ARG A 1 342 ? 136.042 163.714 125.207 1.00 369.82 ? 342 ARG A CD  1 
ATOM 2395  N NE  . ARG A 1 342 ? 135.712 162.491 124.473 1.00 365.31 ? 342 ARG A NE  1 
ATOM 2396  C CZ  . ARG A 1 342 ? 134.684 162.337 123.633 1.00 404.38 ? 342 ARG A CZ  1 
ATOM 2397  N NH1 . ARG A 1 342 ? 133.825 163.334 123.387 1.00 408.57 ? 342 ARG A NH1 1 
ATOM 2398  N NH2 . ARG A 1 342 ? 134.505 161.159 123.033 1.00 393.17 ? 342 ARG A NH2 1 
ATOM 2399  N N   . MET A 1 343 ? 135.233 167.169 128.254 1.00 372.00 ? 343 MET A N   1 
ATOM 2400  C CA  . MET A 1 343 ? 134.519 168.430 128.011 1.00 373.19 ? 343 MET A CA  1 
ATOM 2401  C C   . MET A 1 343 ? 135.512 169.539 127.680 1.00 378.10 ? 343 MET A C   1 
ATOM 2402  O O   . MET A 1 343 ? 135.323 170.299 126.719 1.00 342.94 ? 343 MET A O   1 
ATOM 2403  C CB  . MET A 1 343 ? 133.649 168.817 129.213 1.00 350.09 ? 343 MET A CB  1 
ATOM 2404  C CG  . MET A 1 343 ? 132.188 168.435 129.046 1.00 359.65 ? 343 MET A CG  1 
ATOM 2405  S SD  . MET A 1 343 ? 131.236 169.579 128.014 1.00 401.41 ? 343 MET A SD  1 
ATOM 2406  C CE  . MET A 1 343 ? 131.319 171.121 128.926 1.00 392.48 ? 343 MET A CE  1 
ATOM 2407  N N   . VAL A 1 344 ? 136.554 169.598 128.499 1.00 386.66 ? 344 VAL A N   1 
ATOM 2408  C CA  . VAL A 1 344 ? 137.625 170.592 128.357 1.00 375.24 ? 344 VAL A CA  1 
ATOM 2409  C C   . VAL A 1 344 ? 138.263 170.481 126.977 1.00 393.90 ? 344 VAL A C   1 
ATOM 2410  O O   . VAL A 1 344 ? 138.472 171.490 126.286 1.00 413.70 ? 344 VAL A O   1 
ATOM 2411  C CB  . VAL A 1 344 ? 138.681 170.413 129.483 1.00 418.09 ? 344 VAL A CB  1 
ATOM 2412  C CG1 . VAL A 1 344 ? 140.059 170.950 129.104 1.00 451.52 ? 344 VAL A CG1 1 
ATOM 2413  C CG2 . VAL A 1 344 ? 138.179 171.073 130.755 1.00 447.31 ? 344 VAL A CG2 1 
ATOM 2414  N N   . TYR A 1 345 ? 138.558 169.242 126.616 1.00 395.99 ? 345 TYR A N   1 
ATOM 2415  C CA  . TYR A 1 345 ? 139.181 168.908 125.329 1.00 408.46 ? 345 TYR A CA  1 
ATOM 2416  C C   . TYR A 1 345 ? 138.310 169.418 124.181 1.00 418.98 ? 345 TYR A C   1 
ATOM 2417  O O   . TYR A 1 345 ? 138.805 170.048 123.231 1.00 432.65 ? 345 TYR A O   1 
ATOM 2418  C CB  . TYR A 1 345 ? 139.340 167.380 125.299 1.00 394.67 ? 345 TYR A CB  1 
ATOM 2419  C CG  . TYR A 1 345 ? 140.049 166.755 124.126 1.00 428.60 ? 345 TYR A CG  1 
ATOM 2420  C CD1 . TYR A 1 345 ? 141.439 166.599 124.127 1.00 422.01 ? 345 TYR A CD1 1 
ATOM 2421  C CD2 . TYR A 1 345 ? 139.325 166.238 123.047 1.00 440.85 ? 345 TYR A CD2 1 
ATOM 2422  C CE1 . TYR A 1 345 ? 142.095 165.988 123.065 1.00 411.19 ? 345 TYR A CE1 1 
ATOM 2423  C CE2 . TYR A 1 345 ? 139.970 165.626 121.980 1.00 448.65 ? 345 TYR A CE2 1 
ATOM 2424  C CZ  . TYR A 1 345 ? 141.356 165.499 121.995 1.00 435.14 ? 345 TYR A CZ  1 
ATOM 2425  O OH  . TYR A 1 345 ? 141.993 164.896 120.935 1.00 408.43 ? 345 TYR A OH  1 
ATOM 2426  N N   . ASP A 1 346 ? 137.022 169.127 124.308 1.00 413.71 ? 346 ASP A N   1 
ATOM 2427  C CA  . ASP A 1 346 ? 136.017 169.519 123.314 1.00 436.22 ? 346 ASP A CA  1 
ATOM 2428  C C   . ASP A 1 346 ? 136.016 171.033 123.139 1.00 441.67 ? 346 ASP A C   1 
ATOM 2429  O O   . ASP A 1 346 ? 136.013 171.545 122.009 1.00 441.85 ? 346 ASP A O   1 
ATOM 2430  C CB  . ASP A 1 346 ? 134.623 168.995 123.692 1.00 451.57 ? 346 ASP A CB  1 
ATOM 2431  C CG  . ASP A 1 346 ? 134.510 167.471 123.583 1.00 478.38 ? 346 ASP A CG  1 
ATOM 2432  O OD1 . ASP A 1 346 ? 135.536 166.797 123.340 1.00 488.97 ? 346 ASP A OD1 1 
ATOM 2433  O OD2 . ASP A 1 346 ? 133.387 166.942 123.744 1.00 470.78 ? 346 ASP A OD2 1 
ATOM 2434  N N   . MET A 1 347 ? 136.025 171.714 124.276 1.00 448.95 ? 347 MET A N   1 
ATOM 2435  C CA  . MET A 1 347 ? 136.022 173.180 124.328 1.00 463.67 ? 347 MET A CA  1 
ATOM 2436  C C   . MET A 1 347 ? 137.235 173.730 123.584 1.00 442.51 ? 347 MET A C   1 
ATOM 2437  O O   . MET A 1 347 ? 137.117 174.662 122.773 1.00 451.11 ? 347 MET A O   1 
ATOM 2438  C CB  . MET A 1 347 ? 135.991 173.703 125.769 1.00 500.00 ? 347 MET A CB  1 
ATOM 2439  C CG  . MET A 1 347 ? 134.785 173.255 126.593 1.00 500.00 ? 347 MET A CG  1 
ATOM 2440  S SD  . MET A 1 347 ? 133.707 174.565 127.202 1.00 500.00 ? 347 MET A SD  1 
ATOM 2441  C CE  . MET A 1 347 ? 134.861 175.477 128.204 1.00 500.00 ? 347 MET A CE  1 
ATOM 2442  N N   . GLU A 1 348 ? 138.379 173.126 123.883 1.00 432.66 ? 348 GLU A N   1 
ATOM 2443  C CA  . GLU A 1 348 ? 139.659 173.508 123.279 1.00 442.11 ? 348 GLU A CA  1 
ATOM 2444  C C   . GLU A 1 348 ? 139.579 173.378 121.758 1.00 468.21 ? 348 GLU A C   1 
ATOM 2445  O O   . GLU A 1 348 ? 139.994 174.284 121.015 1.00 490.51 ? 348 GLU A O   1 
ATOM 2446  C CB  . GLU A 1 348 ? 140.840 172.682 123.810 1.00 454.91 ? 348 GLU A CB  1 
ATOM 2447  C CG  . GLU A 1 348 ? 141.374 173.123 125.165 1.00 475.68 ? 348 GLU A CG  1 
ATOM 2448  C CD  . GLU A 1 348 ? 142.734 172.516 125.478 1.00 491.78 ? 348 GLU A CD  1 
ATOM 2449  O OE1 . GLU A 1 348 ? 143.715 172.882 124.797 1.00 500.00 ? 348 GLU A OE1 1 
ATOM 2450  O OE2 . GLU A 1 348 ? 142.830 171.678 126.404 1.00 461.84 ? 348 GLU A OE2 1 
ATOM 2451  N N   . LYS A 1 349 ? 139.035 172.243 121.336 1.00 461.09 ? 349 LYS A N   1 
ATOM 2452  C CA  . LYS A 1 349 ? 138.874 171.927 119.917 1.00 450.24 ? 349 LYS A CA  1 
ATOM 2453  C C   . LYS A 1 349 ? 138.009 172.974 119.236 1.00 463.33 ? 349 LYS A C   1 
ATOM 2454  O O   . LYS A 1 349 ? 138.342 173.502 118.159 1.00 469.26 ? 349 LYS A O   1 
ATOM 2455  C CB  . LYS A 1 349 ? 138.325 170.510 119.697 1.00 407.57 ? 349 LYS A CB  1 
ATOM 2456  C CG  . LYS A 1 349 ? 139.239 169.358 120.123 1.00 408.31 ? 349 LYS A CG  1 
ATOM 2457  C CD  . LYS A 1 349 ? 140.720 169.664 119.932 1.00 473.55 ? 349 LYS A CD  1 
ATOM 2458  C CE  . LYS A 1 349 ? 141.602 168.456 120.179 1.00 500.00 ? 349 LYS A CE  1 
ATOM 2459  N NZ  . LYS A 1 349 ? 143.038 168.778 119.939 1.00 500.00 ? 349 LYS A NZ  1 
ATOM 2460  N N   . GLY A 1 350 ? 136.836 173.187 119.827 1.00 472.83 ? 350 GLY A N   1 
ATOM 2461  C CA  . GLY A 1 350 ? 135.692 173.731 119.113 1.00 478.86 ? 350 GLY A CA  1 
ATOM 2462  C C   . GLY A 1 350 ? 134.993 172.630 118.328 1.00 485.13 ? 350 GLY A C   1 
ATOM 2463  O O   . GLY A 1 350 ? 134.614 172.840 117.172 1.00 495.25 ? 350 GLY A O   1 
ATOM 2464  N N   . LYS A 1 351 ? 134.837 171.457 118.954 1.00 495.34 ? 351 LYS A N   1 
ATOM 2465  C CA  . LYS A 1 351 ? 133.996 170.357 118.440 1.00 500.00 ? 351 LYS A CA  1 
ATOM 2466  C C   . LYS A 1 351 ? 132.695 170.345 119.248 1.00 457.33 ? 351 LYS A C   1 
ATOM 2467  O O   . LYS A 1 351 ? 132.121 169.284 119.520 1.00 377.03 ? 351 LYS A O   1 
ATOM 2468  C CB  . LYS A 1 351 ? 134.715 168.988 118.564 1.00 500.00 ? 351 LYS A CB  1 
ATOM 2469  C CG  . LYS A 1 351 ? 135.370 168.443 117.292 1.00 500.00 ? 351 LYS A CG  1 
ATOM 2470  C CD  . LYS A 1 351 ? 136.886 168.604 117.290 1.00 500.00 ? 351 LYS A CD  1 
ATOM 2471  C CE  . LYS A 1 351 ? 137.590 167.688 116.300 1.00 500.00 ? 351 LYS A CE  1 
ATOM 2472  N NZ  . LYS A 1 351 ? 139.072 167.715 116.482 1.00 500.00 ? 351 LYS A NZ  1 
ATOM 2473  N N   . PHE A 1 352 ? 132.208 171.542 119.583 1.00 439.75 ? 352 PHE A N   1 
ATOM 2474  C CA  . PHE A 1 352 ? 131.369 171.743 120.761 1.00 446.21 ? 352 PHE A CA  1 
ATOM 2475  C C   . PHE A 1 352 ? 131.105 173.259 120.933 1.00 445.62 ? 352 PHE A C   1 
ATOM 2476  O O   . PHE A 1 352 ? 132.023 174.053 120.700 1.00 423.15 ? 352 PHE A O   1 
ATOM 2477  C CB  . PHE A 1 352 ? 132.115 171.142 121.964 1.00 463.97 ? 352 PHE A CB  1 
ATOM 2478  C CG  . PHE A 1 352 ? 131.547 171.500 123.293 1.00 470.71 ? 352 PHE A CG  1 
ATOM 2479  C CD1 . PHE A 1 352 ? 132.009 172.619 123.960 1.00 485.96 ? 352 PHE A CD1 1 
ATOM 2480  C CD2 . PHE A 1 352 ? 130.584 170.697 123.900 1.00 438.49 ? 352 PHE A CD2 1 
ATOM 2481  C CE1 . PHE A 1 352 ? 131.502 172.960 125.192 1.00 474.49 ? 352 PHE A CE1 1 
ATOM 2482  C CE2 . PHE A 1 352 ? 130.072 171.035 125.136 1.00 415.61 ? 352 PHE A CE2 1 
ATOM 2483  C CZ  . PHE A 1 352 ? 130.544 172.171 125.784 1.00 447.29 ? 352 PHE A CZ  1 
ATOM 2484  N N   . PRO A 1 353 ? 129.868 173.662 121.339 1.00 449.56 ? 353 PRO A N   1 
ATOM 2485  C CA  . PRO A 1 353 ? 129.477 175.092 121.327 1.00 435.42 ? 353 PRO A CA  1 
ATOM 2486  C C   . PRO A 1 353 ? 130.376 176.056 122.116 1.00 438.63 ? 353 PRO A C   1 
ATOM 2487  O O   . PRO A 1 353 ? 131.020 176.911 121.509 1.00 462.83 ? 353 PRO A O   1 
ATOM 2488  C CB  . PRO A 1 353 ? 128.039 175.086 121.893 1.00 393.47 ? 353 PRO A CB  1 
ATOM 2489  C CG  . PRO A 1 353 ? 127.862 173.749 122.524 1.00 406.91 ? 353 PRO A CG  1 
ATOM 2490  C CD  . PRO A 1 353 ? 128.723 172.817 121.726 1.00 450.27 ? 353 PRO A CD  1 
ATOM 2491  N N   . VAL A 1 354 ? 130.429 175.913 123.438 1.00 439.85 ? 354 VAL A N   1 
ATOM 2492  C CA  . VAL A 1 354 ? 131.161 176.864 124.280 1.00 431.36 ? 354 VAL A CA  1 
ATOM 2493  C C   . VAL A 1 354 ? 132.675 176.649 124.125 1.00 434.45 ? 354 VAL A C   1 
ATOM 2494  O O   . VAL A 1 354 ? 133.178 175.543 124.313 1.00 397.38 ? 354 VAL A O   1 
ATOM 2495  C CB  . VAL A 1 354 ? 130.748 176.762 125.773 1.00 414.18 ? 354 VAL A CB  1 
ATOM 2496  C CG1 . VAL A 1 354 ? 131.572 177.719 126.630 1.00 442.66 ? 354 VAL A CG1 1 
ATOM 2497  C CG2 . VAL A 1 354 ? 129.259 177.055 125.953 1.00 362.01 ? 354 VAL A CG2 1 
ATOM 2498  N N   . GLN A 1 355 ? 133.383 177.713 123.754 1.00 444.41 ? 355 GLN A N   1 
ATOM 2499  C CA  . GLN A 1 355 ? 134.840 177.697 123.699 1.00 442.67 ? 355 GLN A CA  1 
ATOM 2500  C C   . GLN A 1 355 ? 135.371 178.228 125.025 1.00 381.13 ? 355 GLN A C   1 
ATOM 2501  O O   . GLN A 1 355 ? 134.708 179.022 125.695 1.00 363.03 ? 355 GLN A O   1 
ATOM 2502  C CB  . GLN A 1 355 ? 135.339 178.545 122.523 1.00 500.00 ? 355 GLN A CB  1 
ATOM 2503  C CG  . GLN A 1 355 ? 136.697 178.120 121.969 1.00 500.00 ? 355 GLN A CG  1 
ATOM 2504  C CD  . GLN A 1 355 ? 136.995 178.699 120.590 1.00 500.00 ? 355 GLN A CD  1 
ATOM 2505  O OE1 . GLN A 1 355 ? 136.511 179.775 120.232 1.00 500.00 ? 355 GLN A OE1 1 
ATOM 2506  N NE2 . GLN A 1 355 ? 137.800 177.983 119.809 1.00 500.00 ? 355 GLN A NE2 1 
ATOM 2507  N N   . LEU A 1 356 ? 136.568 177.792 125.393 1.00 365.24 ? 356 LEU A N   1 
ATOM 2508  C CA  . LEU A 1 356 ? 137.164 178.165 126.677 1.00 410.08 ? 356 LEU A CA  1 
ATOM 2509  C C   . LEU A 1 356 ? 137.566 179.643 126.779 1.00 444.40 ? 356 LEU A C   1 
ATOM 2510  O O   . LEU A 1 356 ? 137.618 180.184 127.888 1.00 412.71 ? 356 LEU A O   1 
ATOM 2511  C CB  . LEU A 1 356 ? 138.368 177.266 126.967 1.00 451.26 ? 356 LEU A CB  1 
ATOM 2512  C CG  . LEU A 1 356 ? 138.954 177.280 128.382 1.00 470.56 ? 356 LEU A CG  1 
ATOM 2513  C CD1 . LEU A 1 356 ? 137.939 176.866 129.437 1.00 466.67 ? 356 LEU A CD1 1 
ATOM 2514  C CD2 . LEU A 1 356 ? 140.152 176.353 128.421 1.00 475.50 ? 356 LEU A CD2 1 
ATOM 2515  N N   . GLU A 1 357 ? 137.849 180.288 125.638 1.00 490.22 ? 357 GLU A N   1 
ATOM 2516  C CA  . GLU A 1 357 ? 138.076 181.754 125.580 1.00 499.43 ? 357 GLU A CA  1 
ATOM 2517  C C   . GLU A 1 357 ? 136.950 182.553 126.225 1.00 447.67 ? 357 GLU A C   1 
ATOM 2518  O O   . GLU A 1 357 ? 137.190 183.617 126.798 1.00 404.83 ? 357 GLU A O   1 
ATOM 2519  C CB  . GLU A 1 357 ? 138.272 182.260 124.134 1.00 500.00 ? 357 GLU A CB  1 
ATOM 2520  C CG  . GLU A 1 357 ? 139.728 182.411 123.695 1.00 500.00 ? 357 GLU A CG  1 
ATOM 2521  C CD  . GLU A 1 357 ? 139.914 183.438 122.582 1.00 500.00 ? 357 GLU A CD  1 
ATOM 2522  O OE1 . GLU A 1 357 ? 139.124 183.431 121.613 1.00 500.00 ? 357 GLU A OE1 1 
ATOM 2523  O OE2 . GLU A 1 357 ? 140.860 184.251 122.674 1.00 500.00 ? 357 GLU A OE2 1 
ATOM 2524  N N   . ASN A 1 358 ? 135.732 182.027 126.123 1.00 444.52 ? 358 ASN A N   1 
ATOM 2525  C CA  . ASN A 1 358 ? 134.570 182.564 126.828 1.00 453.96 ? 358 ASN A CA  1 
ATOM 2526  C C   . ASN A 1 358 ? 134.672 182.135 128.302 1.00 450.48 ? 358 ASN A C   1 
ATOM 2527  O O   . ASN A 1 358 ? 135.736 182.317 128.899 1.00 471.70 ? 358 ASN A O   1 
ATOM 2528  C CB  . ASN A 1 358 ? 133.282 182.100 126.140 1.00 442.86 ? 358 ASN A CB  1 
ATOM 2529  C CG  . ASN A 1 358 ? 133.304 182.346 124.639 1.00 451.80 ? 358 ASN A CG  1 
ATOM 2530  O OD1 . ASN A 1 358 ? 134.281 182.018 123.955 1.00 379.64 ? 358 ASN A OD1 1 
ATOM 2531  N ND2 . ASN A 1 358 ? 132.231 182.929 124.120 1.00 466.21 ? 358 ASN A ND2 1 
ATOM 2532  N N   . VAL A 1 359 ? 133.610 181.588 128.899 1.00 407.28 ? 359 VAL A N   1 
ATOM 2533  C CA  . VAL A 1 359 ? 133.706 180.965 130.227 1.00 449.65 ? 359 VAL A CA  1 
ATOM 2534  C C   . VAL A 1 359 ? 134.226 181.949 131.286 1.00 460.16 ? 359 VAL A C   1 
ATOM 2535  O O   . VAL A 1 359 ? 135.374 181.864 131.742 1.00 456.15 ? 359 VAL A O   1 
ATOM 2536  C CB  . VAL A 1 359 ? 134.601 179.700 130.207 1.00 497.25 ? 359 VAL A CB  1 
ATOM 2537  C CG1 . VAL A 1 359 ? 134.493 178.935 131.531 1.00 500.00 ? 359 VAL A CG1 1 
ATOM 2538  C CG2 . VAL A 1 359 ? 134.240 178.803 129.035 1.00 497.53 ? 359 VAL A CG2 1 
ATOM 2539  N N   . ASP A 1 360 ? 133.371 182.897 131.647 1.00 458.47 ? 360 ASP A N   1 
ATOM 2540  C CA  . ASP A 1 360 ? 133.685 183.893 132.661 1.00 458.40 ? 360 ASP A CA  1 
ATOM 2541  C C   . ASP A 1 360 ? 133.944 183.197 133.997 1.00 427.10 ? 360 ASP A C   1 
ATOM 2542  O O   . ASP A 1 360 ? 135.096 183.054 134.414 1.00 384.96 ? 360 ASP A O   1 
ATOM 2543  C CB  . ASP A 1 360 ? 132.533 184.916 132.764 1.00 474.31 ? 360 ASP A CB  1 
ATOM 2544  C CG  . ASP A 1 360 ? 132.788 186.012 133.791 1.00 464.72 ? 360 ASP A CG  1 
ATOM 2545  O OD1 . ASP A 1 360 ? 133.912 186.560 133.828 1.00 469.19 ? 360 ASP A OD1 1 
ATOM 2546  O OD2 . ASP A 1 360 ? 131.847 186.343 134.546 1.00 412.15 ? 360 ASP A OD2 1 
ATOM 2547  N N   . SER A 1 361 ? 132.872 182.702 134.612 1.00 412.09 ? 361 SER A N   1 
ATOM 2548  C CA  . SER A 1 361 ? 132.859 182.394 136.035 1.00 417.03 ? 361 SER A CA  1 
ATOM 2549  C C   . SER A 1 361 ? 132.520 180.939 136.337 1.00 383.89 ? 361 SER A C   1 
ATOM 2550  O O   . SER A 1 361 ? 131.388 180.493 136.132 1.00 341.48 ? 361 SER A O   1 
ATOM 2551  C CB  . SER A 1 361 ? 131.879 183.329 136.745 1.00 449.83 ? 361 SER A CB  1 
ATOM 2552  O OG  . SER A 1 361 ? 130.741 183.601 135.943 1.00 451.01 ? 361 SER A OG  1 
ATOM 2553  N N   . PHE A 1 362 ? 133.519 180.225 136.848 1.00 369.02 ? 362 PHE A N   1 
ATOM 2554  C CA  . PHE A 1 362 ? 133.392 178.829 137.237 1.00 374.40 ? 362 PHE A CA  1 
ATOM 2555  C C   . PHE A 1 362 ? 132.969 178.726 138.707 1.00 340.02 ? 362 PHE A C   1 
ATOM 2556  O O   . PHE A 1 362 ? 133.550 179.398 139.555 1.00 303.01 ? 362 PHE A O   1 
ATOM 2557  C CB  . PHE A 1 362 ? 134.733 178.128 137.014 1.00 395.14 ? 362 PHE A CB  1 
ATOM 2558  C CG  . PHE A 1 362 ? 134.615 176.655 136.772 1.00 411.50 ? 362 PHE A CG  1 
ATOM 2559  C CD1 . PHE A 1 362 ? 134.468 175.767 137.840 1.00 400.14 ? 362 PHE A CD1 1 
ATOM 2560  C CD2 . PHE A 1 362 ? 134.656 176.149 135.477 1.00 392.92 ? 362 PHE A CD2 1 
ATOM 2561  C CE1 . PHE A 1 362 ? 134.373 174.404 137.623 1.00 358.28 ? 362 PHE A CE1 1 
ATOM 2562  C CE2 . PHE A 1 362 ? 134.554 174.789 135.250 1.00 390.34 ? 362 PHE A CE2 1 
ATOM 2563  C CZ  . PHE A 1 362 ? 134.409 173.915 136.323 1.00 395.19 ? 362 PHE A CZ  1 
ATOM 2564  N N   . VAL A 1 363 ? 131.964 177.894 139.000 1.00 346.65 ? 363 VAL A N   1 
ATOM 2565  C CA  . VAL A 1 363 ? 131.477 177.683 140.379 1.00 353.88 ? 363 VAL A CA  1 
ATOM 2566  C C   . VAL A 1 363 ? 131.207 176.195 140.670 1.00 318.78 ? 363 VAL A C   1 
ATOM 2567  O O   . VAL A 1 363 ? 130.123 175.660 140.380 1.00 305.39 ? 363 VAL A O   1 
ATOM 2568  C CB  . VAL A 1 363 ? 130.205 178.518 140.667 1.00 405.21 ? 363 VAL A CB  1 
ATOM 2569  C CG1 . VAL A 1 363 ? 129.727 178.305 142.105 1.00 417.02 ? 363 VAL A CG1 1 
ATOM 2570  C CG2 . VAL A 1 363 ? 130.459 179.997 140.396 1.00 412.11 ? 363 VAL A CG2 1 
ATOM 2571  N N   . GLU A 1 364 ? 132.215 175.533 141.224 1.00 306.63 ? 364 GLU A N   1 
ATOM 2572  C CA  . GLU A 1 364 ? 132.099 174.140 141.626 1.00 321.10 ? 364 GLU A CA  1 
ATOM 2573  C C   . GLU A 1 364 ? 131.420 174.065 142.978 1.00 308.89 ? 364 GLU A C   1 
ATOM 2574  O O   . GLU A 1 364 ? 131.567 174.961 143.820 1.00 355.18 ? 364 GLU A O   1 
ATOM 2575  C CB  . GLU A 1 364 ? 133.484 173.476 141.702 1.00 348.64 ? 364 GLU A CB  1 
ATOM 2576  C CG  . GLU A 1 364 ? 133.514 172.008 142.153 1.00 390.49 ? 364 GLU A CG  1 
ATOM 2577  C CD  . GLU A 1 364 ? 133.242 170.996 141.046 1.00 435.77 ? 364 GLU A CD  1 
ATOM 2578  O OE1 . GLU A 1 364 ? 132.763 171.381 139.956 1.00 446.52 ? 364 GLU A OE1 1 
ATOM 2579  O OE2 . GLU A 1 364 ? 133.506 169.793 141.273 1.00 443.76 ? 364 GLU A OE2 1 
ATOM 2580  N N   . LEU A 1 365 ? 130.703 172.964 143.171 1.00 336.16 ? 365 LEU A N   1 
ATOM 2581  C CA  . LEU A 1 365 ? 130.155 172.565 144.455 1.00 369.82 ? 365 LEU A CA  1 
ATOM 2582  C C   . LEU A 1 365 ? 130.925 171.321 144.923 1.00 357.00 ? 365 LEU A C   1 
ATOM 2583  O O   . LEU A 1 365 ? 130.439 170.189 144.836 1.00 283.83 ? 365 LEU A O   1 
ATOM 2584  C CB  . LEU A 1 365 ? 128.660 172.272 144.320 1.00 368.46 ? 365 LEU A CB  1 
ATOM 2585  C CG  . LEU A 1 365 ? 127.784 173.447 143.876 1.00 376.34 ? 365 LEU A CG  1 
ATOM 2586  C CD1 . LEU A 1 365 ? 128.073 173.896 142.443 1.00 339.63 ? 365 LEU A CD1 1 
ATOM 2587  C CD2 . LEU A 1 365 ? 126.321 173.063 144.052 1.00 382.18 ? 365 LEU A CD2 1 
ATOM 2588  N N   . GLY A 1 366 ? 132.143 171.541 145.409 1.00 368.20 ? 366 GLY A N   1 
ATOM 2589  C CA  . GLY A 1 366 ? 133.004 170.432 145.799 1.00 397.25 ? 366 GLY A CA  1 
ATOM 2590  C C   . GLY A 1 366 ? 132.580 169.800 147.110 1.00 398.58 ? 366 GLY A C   1 
ATOM 2591  O O   . GLY A 1 366 ? 133.194 170.067 148.143 1.00 439.85 ? 366 GLY A O   1 
ATOM 2592  N N   . GLN A 1 367 ? 131.544 168.955 147.060 1.00 367.51 ? 367 GLN A N   1 
ATOM 2593  C CA  . GLN A 1 367 ? 131.027 168.219 148.233 1.00 387.86 ? 367 GLN A CA  1 
ATOM 2594  C C   . GLN A 1 367 ? 130.368 169.184 149.233 1.00 368.43 ? 367 GLN A C   1 
ATOM 2595  O O   . GLN A 1 367 ? 131.064 169.940 149.897 1.00 355.92 ? 367 GLN A O   1 
ATOM 2596  C CB  . GLN A 1 367 ? 132.143 167.411 148.934 1.00 413.74 ? 367 GLN A CB  1 
ATOM 2597  C CG  . GLN A 1 367 ? 133.168 166.722 148.029 1.00 424.36 ? 367 GLN A CG  1 
ATOM 2598  C CD  . GLN A 1 367 ? 134.577 166.766 148.601 1.00 403.72 ? 367 GLN A CD  1 
ATOM 2599  O OE1 . GLN A 1 367 ? 135.516 167.235 147.946 1.00 347.19 ? 367 GLN A OE1 1 
ATOM 2600  N NE2 . GLN A 1 367 ? 134.729 166.280 149.831 1.00 390.73 ? 367 GLN A NE2 1 
ATOM 2601  N N   . VAL A 1 368 ? 129.039 169.170 149.339 1.00 357.95 ? 368 VAL A N   1 
ATOM 2602  C CA  . VAL A 1 368 ? 128.322 170.226 150.078 1.00 362.12 ? 368 VAL A CA  1 
ATOM 2603  C C   . VAL A 1 368 ? 127.121 169.684 150.886 1.00 332.56 ? 368 VAL A C   1 
ATOM 2604  O O   . VAL A 1 368 ? 125.939 169.819 150.500 1.00 254.06 ? 368 VAL A O   1 
ATOM 2605  C CB  . VAL A 1 368 ? 127.896 171.384 149.121 1.00 407.50 ? 368 VAL A CB  1 
ATOM 2606  C CG1 . VAL A 1 368 ? 127.245 172.523 149.896 1.00 461.12 ? 368 VAL A CG1 1 
ATOM 2607  C CG2 . VAL A 1 368 ? 129.084 171.920 148.314 1.00 357.79 ? 368 VAL A CG2 1 
ATOM 2608  N N   . ALA A 1 369 ? 127.441 169.088 152.032 1.00 325.18 ? 369 ALA A N   1 
ATOM 2609  C CA  . ALA A 1 369 ? 126.427 168.539 152.927 1.00 375.80 ? 369 ALA A CA  1 
ATOM 2610  C C   . ALA A 1 369 ? 126.388 169.265 154.262 1.00 422.98 ? 369 ALA A C   1 
ATOM 2611  O O   . ALA A 1 369 ? 125.388 169.912 154.585 1.00 463.21 ? 369 ALA A O   1 
ATOM 2612  C CB  . ALA A 1 369 ? 126.667 167.053 153.144 1.00 391.39 ? 369 ALA A CB  1 
ATOM 2613  N N   . LEU A 1 370 ? 127.478 169.174 155.026 1.00 434.05 ? 370 LEU A N   1 
ATOM 2614  C CA  . LEU A 1 370 ? 127.449 169.517 156.454 1.00 430.66 ? 370 LEU A CA  1 
ATOM 2615  C C   . LEU A 1 370 ? 127.605 171.019 156.700 1.00 381.08 ? 370 LEU A C   1 
ATOM 2616  O O   . LEU A 1 370 ? 126.630 171.702 157.035 1.00 300.01 ? 370 LEU A O   1 
ATOM 2617  C CB  . LEU A 1 370 ? 128.495 168.709 157.261 1.00 419.25 ? 370 LEU A CB  1 
ATOM 2618  C CG  . LEU A 1 370 ? 128.657 167.188 157.068 1.00 433.51 ? 370 LEU A CG  1 
ATOM 2619  C CD1 . LEU A 1 370 ? 127.330 166.488 156.786 1.00 438.82 ? 370 LEU A CD1 1 
ATOM 2620  C CD2 . LEU A 1 370 ? 129.683 166.827 155.998 1.00 432.48 ? 370 LEU A CD2 1 
ATOM 2621  N N   . ARG A 1 371 ? 128.824 171.521 156.499 1.00 394.58 ? 371 ARG A N   1 
ATOM 2622  C CA  . ARG A 1 371 ? 129.237 172.858 156.927 1.00 424.98 ? 371 ARG A CA  1 
ATOM 2623  C C   . ARG A 1 371 ? 129.178 172.978 158.458 1.00 455.85 ? 371 ARG A C   1 
ATOM 2624  O O   . ARG A 1 371 ? 128.093 173.005 159.048 1.00 454.62 ? 371 ARG A O   1 
ATOM 2625  C CB  . ARG A 1 371 ? 128.406 173.954 156.249 1.00 403.47 ? 371 ARG A CB  1 
ATOM 2626  C CG  . ARG A 1 371 ? 128.440 173.917 154.731 1.00 361.97 ? 371 ARG A CG  1 
ATOM 2627  C CD  . ARG A 1 371 ? 127.457 174.896 154.106 1.00 330.85 ? 371 ARG A CD  1 
ATOM 2628  N NE  . ARG A 1 371 ? 126.150 174.267 153.885 1.00 358.12 ? 371 ARG A NE  1 
ATOM 2629  C CZ  . ARG A 1 371 ? 125.102 174.299 154.714 1.00 386.69 ? 371 ARG A CZ  1 
ATOM 2630  N NH1 . ARG A 1 371 ? 125.133 174.946 155.883 1.00 422.04 ? 371 ARG A NH1 1 
ATOM 2631  N NH2 . ARG A 1 371 ? 123.987 173.676 154.362 1.00 369.62 ? 371 ARG A NH2 1 
ATOM 2632  N N   . THR A 1 372 ? 130.353 173.057 159.084 1.00 470.34 ? 372 THR A N   1 
ATOM 2633  C CA  . THR A 1 372 ? 130.476 173.003 160.546 1.00 488.64 ? 372 THR A CA  1 
ATOM 2634  C C   . THR A 1 372 ? 129.734 174.154 161.227 1.00 492.95 ? 372 THR A C   1 
ATOM 2635  O O   . THR A 1 372 ? 128.698 173.936 161.864 1.00 493.09 ? 372 THR A O   1 
ATOM 2636  C CB  . THR A 1 372 ? 131.955 173.007 160.994 1.00 498.82 ? 372 THR A CB  1 
ATOM 2637  O OG1 . THR A 1 372 ? 132.630 174.137 160.423 1.00 461.06 ? 372 THR A OG1 1 
ATOM 2638  C CG2 . THR A 1 372 ? 132.659 171.723 160.562 1.00 500.00 ? 372 THR A CG2 1 
ATOM 2639  N N   . SER A 1 373 ? 130.251 175.372 161.063 1.00 480.61 ? 373 SER A N   1 
ATOM 2640  C CA  . SER A 1 373 ? 129.617 176.582 161.588 1.00 490.24 ? 373 SER A CA  1 
ATOM 2641  C C   . SER A 1 373 ? 128.860 177.275 160.458 1.00 465.62 ? 373 SER A C   1 
ATOM 2642  O O   . SER A 1 373 ? 128.997 178.483 160.257 1.00 478.80 ? 373 SER A O   1 
ATOM 2643  C CB  . SER A 1 373 ? 130.681 177.513 162.183 1.00 500.00 ? 373 SER A CB  1 
ATOM 2644  O OG  . SER A 1 373 ? 130.107 178.704 162.698 1.00 500.00 ? 373 SER A OG  1 
ATOM 2645  N N   . LEU A 1 374 ? 128.058 176.495 159.729 1.00 459.76 ? 374 LEU A N   1 
ATOM 2646  C CA  . LEU A 1 374 ? 127.362 176.945 158.518 1.00 464.30 ? 374 LEU A CA  1 
ATOM 2647  C C   . LEU A 1 374 ? 128.290 177.440 157.391 1.00 442.70 ? 374 LEU A C   1 
ATOM 2648  O O   . LEU A 1 374 ? 127.821 178.074 156.448 1.00 399.90 ? 374 LEU A O   1 
ATOM 2649  C CB  . LEU A 1 374 ? 126.313 178.012 158.869 1.00 456.88 ? 374 LEU A CB  1 
ATOM 2650  C CG  . LEU A 1 374 ? 125.499 177.744 160.143 1.00 486.81 ? 374 LEU A CG  1 
ATOM 2651  C CD1 . LEU A 1 374 ? 124.460 178.834 160.341 1.00 500.00 ? 374 LEU A CD1 1 
ATOM 2652  C CD2 . LEU A 1 374 ? 124.845 176.367 160.112 1.00 488.20 ? 374 LEU A CD2 1 
ATOM 2653  N N   . GLU A 1 375 ? 129.580 177.096 157.462 1.00 438.36 ? 375 GLU A N   1 
ATOM 2654  C CA  . GLU A 1 375 ? 130.611 177.659 156.584 1.00 432.54 ? 375 GLU A CA  1 
ATOM 2655  C C   . GLU A 1 375 ? 130.689 176.925 155.255 1.00 396.43 ? 375 GLU A C   1 
ATOM 2656  O O   . GLU A 1 375 ? 131.188 175.802 155.201 1.00 342.15 ? 375 GLU A O   1 
ATOM 2657  C CB  . GLU A 1 375 ? 131.979 177.606 157.261 1.00 500.00 ? 375 GLU A CB  1 
ATOM 2658  C CG  . GLU A 1 375 ? 132.110 178.538 158.454 1.00 500.00 ? 375 GLU A CG  1 
ATOM 2659  C CD  . GLU A 1 375 ? 133.242 178.151 159.392 1.00 500.00 ? 375 GLU A CD  1 
ATOM 2660  O OE1 . GLU A 1 375 ? 133.303 176.971 159.807 1.00 500.00 ? 375 GLU A OE1 1 
ATOM 2661  O OE2 . GLU A 1 375 ? 134.071 179.028 159.729 1.00 500.00 ? 375 GLU A OE2 1 
ATOM 2662  N N   . LEU A 1 376 ? 130.195 177.554 154.190 1.00 425.12 ? 376 LEU A N   1 
ATOM 2663  C CA  . LEU A 1 376 ? 130.365 177.012 152.831 1.00 412.20 ? 376 LEU A CA  1 
ATOM 2664  C C   . LEU A 1 376 ? 131.714 177.499 152.297 1.00 375.54 ? 376 LEU A C   1 
ATOM 2665  O O   . LEU A 1 376 ? 131.786 178.420 151.483 1.00 357.04 ? 376 LEU A O   1 
ATOM 2666  C CB  . LEU A 1 376 ? 129.208 177.439 151.915 1.00 440.67 ? 376 LEU A CB  1 
ATOM 2667  C CG  . LEU A 1 376 ? 129.189 176.952 150.454 1.00 450.84 ? 376 LEU A CG  1 
ATOM 2668  C CD1 . LEU A 1 376 ? 129.203 175.433 150.350 1.00 458.38 ? 376 LEU A CD1 1 
ATOM 2669  C CD2 . LEU A 1 376 ? 127.973 177.527 149.739 1.00 458.68 ? 376 LEU A CD2 1 
ATOM 2670  N N   . TRP A 1 377 ? 132.778 176.858 152.773 1.00 336.26 ? 377 TRP A N   1 
ATOM 2671  C CA  . TRP A 1 377 ? 134.153 177.300 152.531 1.00 364.48 ? 377 TRP A CA  1 
ATOM 2672  C C   . TRP A 1 377 ? 134.471 177.414 151.043 1.00 353.62 ? 377 TRP A C   1 
ATOM 2673  O O   . TRP A 1 377 ? 134.170 176.503 150.269 1.00 388.39 ? 377 TRP A O   1 
ATOM 2674  C CB  . TRP A 1 377 ? 135.150 176.341 153.175 1.00 376.94 ? 377 TRP A CB  1 
ATOM 2675  C CG  . TRP A 1 377 ? 135.084 176.297 154.668 1.00 409.43 ? 377 TRP A CG  1 
ATOM 2676  C CD1 . TRP A 1 377 ? 134.257 175.527 155.430 1.00 424.37 ? 377 TRP A CD1 1 
ATOM 2677  C CD2 . TRP A 1 377 ? 135.890 177.041 155.584 1.00 424.87 ? 377 TRP A CD2 1 
ATOM 2678  N NE1 . TRP A 1 377 ? 134.491 175.746 156.763 1.00 419.49 ? 377 TRP A NE1 1 
ATOM 2679  C CE2 . TRP A 1 377 ? 135.489 176.674 156.889 1.00 423.24 ? 377 TRP A CE2 1 
ATOM 2680  C CE3 . TRP A 1 377 ? 136.915 177.982 155.431 1.00 422.01 ? 377 TRP A CE3 1 
ATOM 2681  C CZ2 . TRP A 1 377 ? 136.079 177.213 158.038 1.00 424.85 ? 377 TRP A CZ2 1 
ATOM 2682  C CZ3 . TRP A 1 377 ? 137.500 178.524 156.578 1.00 456.67 ? 377 TRP A CZ3 1 
ATOM 2683  C CH2 . TRP A 1 377 ? 137.075 178.137 157.864 1.00 455.85 ? 377 TRP A CH2 1 
ATOM 2684  N N   . MET A 1 378 ? 135.056 178.549 150.658 1.00 371.88 ? 378 MET A N   1 
ATOM 2685  C CA  . MET A 1 378 ? 135.464 178.808 149.273 1.00 382.01 ? 378 MET A CA  1 
ATOM 2686  C C   . MET A 1 378 ? 136.856 178.268 149.046 1.00 381.82 ? 378 MET A C   1 
ATOM 2687  O O   . MET A 1 378 ? 137.552 177.912 149.998 1.00 416.08 ? 378 MET A O   1 
ATOM 2688  C CB  . MET A 1 378 ? 135.481 180.307 148.986 1.00 389.63 ? 378 MET A CB  1 
ATOM 2689  C CG  . MET A 1 378 ? 134.128 180.980 149.105 1.00 420.25 ? 378 MET A CG  1 
ATOM 2690  S SD  . MET A 1 378 ? 134.278 182.705 149.606 1.00 473.04 ? 378 MET A SD  1 
ATOM 2691  C CE  . MET A 1 378 ? 133.053 183.481 148.557 1.00 488.21 ? 378 MET A CE  1 
ATOM 2692  N N   . HIS A 1 379 ? 137.255 178.219 147.779 1.00 382.06 ? 379 HIS A N   1 
ATOM 2693  C CA  . HIS A 1 379 ? 138.592 177.774 147.391 1.00 400.38 ? 379 HIS A CA  1 
ATOM 2694  C C   . HIS A 1 379 ? 138.983 178.410 146.076 1.00 388.69 ? 379 HIS A C   1 
ATOM 2695  O O   . HIS A 1 379 ? 138.139 178.607 145.197 1.00 381.79 ? 379 HIS A O   1 
ATOM 2696  C CB  . HIS A 1 379 ? 138.636 176.257 147.243 1.00 432.22 ? 379 HIS A CB  1 
ATOM 2697  C CG  . HIS A 1 379 ? 138.647 175.524 148.543 1.00 459.38 ? 379 HIS A CG  1 
ATOM 2698  N ND1 . HIS A 1 379 ? 139.787 175.376 149.299 1.00 490.34 ? 379 HIS A ND1 1 
ATOM 2699  C CD2 . HIS A 1 379 ? 137.654 174.909 149.230 1.00 461.62 ? 379 HIS A CD2 1 
ATOM 2700  C CE1 . HIS A 1 379 ? 139.502 174.696 150.393 1.00 497.60 ? 379 HIS A CE1 1 
ATOM 2701  N NE2 . HIS A 1 379 ? 138.214 174.403 150.379 1.00 475.59 ? 379 HIS A NE2 1 
ATOM 2702  N N   . THR A 1 380 ? 140.270 178.716 145.949 1.00 394.24 ? 380 THR A N   1 
ATOM 2703  C CA  . THR A 1 380 ? 140.811 179.338 144.745 1.00 419.49 ? 380 THR A CA  1 
ATOM 2704  C C   . THR A 1 380 ? 142.246 178.878 144.481 1.00 398.74 ? 380 THR A C   1 
ATOM 2705  O O   . THR A 1 380 ? 142.915 178.321 145.366 1.00 297.89 ? 380 THR A O   1 
ATOM 2706  C CB  . THR A 1 380 ? 140.770 180.879 144.837 1.00 467.30 ? 380 THR A CB  1 
ATOM 2707  O OG1 . THR A 1 380 ? 141.361 181.306 146.072 1.00 500.00 ? 380 THR A OG1 1 
ATOM 2708  C CG2 . THR A 1 380 ? 139.341 181.392 144.767 1.00 463.58 ? 380 THR A CG2 1 
ATOM 2709  N N   . ASP A 1 381 ? 142.688 179.133 143.251 1.00 410.18 ? 381 ASP A N   1 
ATOM 2710  C CA  . ASP A 1 381 ? 143.971 178.662 142.731 1.00 439.03 ? 381 ASP A CA  1 
ATOM 2711  C C   . ASP A 1 381 ? 145.064 179.700 143.001 1.00 381.81 ? 381 ASP A C   1 
ATOM 2712  O O   . ASP A 1 381 ? 144.942 180.831 142.552 1.00 368.26 ? 381 ASP A O   1 
ATOM 2713  C CB  . ASP A 1 381 ? 143.847 178.414 141.220 1.00 492.63 ? 381 ASP A CB  1 
ATOM 2714  C CG  . ASP A 1 381 ? 145.130 177.865 140.585 1.00 500.00 ? 381 ASP A CG  1 
ATOM 2715  O OD1 . ASP A 1 381 ? 146.003 177.320 141.296 1.00 500.00 ? 381 ASP A OD1 1 
ATOM 2716  O OD2 . ASP A 1 381 ? 145.260 177.987 139.350 1.00 500.00 ? 381 ASP A OD2 1 
ATOM 2717  N N   . PRO A 1 382 ? 146.141 179.314 143.716 1.00 388.12 ? 382 PRO A N   1 
ATOM 2718  C CA  . PRO A 1 382 ? 147.268 180.182 143.997 1.00 416.69 ? 382 PRO A CA  1 
ATOM 2719  C C   . PRO A 1 382 ? 147.877 180.719 142.712 1.00 414.70 ? 382 PRO A C   1 
ATOM 2720  O O   . PRO A 1 382 ? 148.240 181.899 142.660 1.00 458.95 ? 382 PRO A O   1 
ATOM 2721  C CB  . PRO A 1 382 ? 148.267 179.249 144.687 1.00 449.32 ? 382 PRO A CB  1 
ATOM 2722  C CG  . PRO A 1 382 ? 147.427 178.226 145.346 1.00 434.40 ? 382 PRO A CG  1 
ATOM 2723  C CD  . PRO A 1 382 ? 146.225 178.049 144.480 1.00 407.13 ? 382 PRO A CD  1 
ATOM 2724  N N   . VAL A 1 383 ? 147.992 179.835 141.719 1.00 394.06 ? 383 VAL A N   1 
ATOM 2725  C CA  . VAL A 1 383 ? 148.601 180.178 140.441 1.00 442.55 ? 383 VAL A CA  1 
ATOM 2726  C C   . VAL A 1 383 ? 147.836 181.328 139.785 1.00 460.16 ? 383 VAL A C   1 
ATOM 2727  O O   . VAL A 1 383 ? 148.447 182.288 139.290 1.00 460.04 ? 383 VAL A O   1 
ATOM 2728  C CB  . VAL A 1 383 ? 148.739 178.968 139.492 1.00 500.00 ? 383 VAL A CB  1 
ATOM 2729  C CG1 . VAL A 1 383 ? 149.512 179.388 138.246 1.00 500.00 ? 383 VAL A CG1 1 
ATOM 2730  C CG2 . VAL A 1 383 ? 149.419 177.793 140.205 1.00 496.58 ? 383 VAL A CG2 1 
ATOM 2731  N N   . SER A 1 384 ? 146.515 181.199 139.808 1.00 477.69 ? 384 SER A N   1 
ATOM 2732  C CA  . SER A 1 384 ? 145.615 182.201 139.230 1.00 482.04 ? 384 SER A CA  1 
ATOM 2733  C C   . SER A 1 384 ? 145.845 183.559 139.896 1.00 457.80 ? 384 SER A C   1 
ATOM 2734  O O   . SER A 1 384 ? 145.960 184.597 139.216 1.00 425.91 ? 384 SER A O   1 
ATOM 2735  C CB  . SER A 1 384 ? 144.144 181.781 139.365 1.00 491.77 ? 384 SER A CB  1 
ATOM 2736  O OG  . SER A 1 384 ? 143.860 180.632 138.582 1.00 476.61 ? 384 SER A OG  1 
ATOM 2737  N N   . GLN A 1 385 ? 145.917 183.507 141.223 1.00 460.44 ? 385 GLN A N   1 
ATOM 2738  C CA  . GLN A 1 385 ? 146.132 184.701 142.045 1.00 470.59 ? 385 GLN A CA  1 
ATOM 2739  C C   . GLN A 1 385 ? 147.430 185.382 141.659 1.00 500.00 ? 385 GLN A C   1 
ATOM 2740  O O   . GLN A 1 385 ? 147.455 186.615 141.508 1.00 500.00 ? 385 GLN A O   1 
ATOM 2741  C CB  . GLN A 1 385 ? 146.069 184.411 143.554 1.00 475.71 ? 385 GLN A CB  1 
ATOM 2742  C CG  . GLN A 1 385 ? 144.785 183.755 144.088 1.00 472.65 ? 385 GLN A CG  1 
ATOM 2743  C CD  . GLN A 1 385 ? 143.470 184.351 143.577 1.00 452.90 ? 385 GLN A CD  1 
ATOM 2744  O OE1 . GLN A 1 385 ? 143.233 184.460 142.369 1.00 375.57 ? 385 GLN A OE1 1 
ATOM 2745  N NE2 . GLN A 1 385 ? 142.586 184.697 144.509 1.00 438.20 ? 385 GLN A NE2 1 
ATOM 2746  N N   . LYS A 1 386 ? 148.475 184.564 141.501 1.00 487.60 ? 386 LYS A N   1 
ATOM 2747  C CA  . LYS A 1 386 ? 149.784 185.066 141.051 1.00 474.29 ? 386 LYS A CA  1 
ATOM 2748  C C   . LYS A 1 386 ? 149.692 185.979 139.802 1.00 471.26 ? 386 LYS A C   1 
ATOM 2749  O O   . LYS A 1 386 ? 150.372 186.965 139.813 1.00 476.56 ? 386 LYS A O   1 
ATOM 2750  C CB  . LYS A 1 386 ? 150.809 183.945 140.865 1.00 478.43 ? 386 LYS A CB  1 
ATOM 2751  C CG  . LYS A 1 386 ? 151.350 183.415 142.184 1.00 500.00 ? 386 LYS A CG  1 
ATOM 2752  C CD  . LYS A 1 386 ? 152.504 182.448 141.980 1.00 500.00 ? 386 LYS A CD  1 
ATOM 2753  C CE  . LYS A 1 386 ? 153.810 183.178 141.690 1.00 500.00 ? 386 LYS A CE  1 
ATOM 2754  N NZ  . LYS A 1 386 ? 154.958 182.237 141.567 1.00 500.00 ? 386 LYS A NZ  1 
ATOM 2755  N N   . ASN A 1 387 ? 148.820 185.729 138.813 1.00 465.02 ? 387 ASN A N   1 
ATOM 2756  C CA  . ASN A 1 387 ? 148.551 186.758 137.767 1.00 450.44 ? 387 ASN A CA  1 
ATOM 2757  C C   . ASN A 1 387 ? 147.523 187.815 138.204 1.00 480.85 ? 387 ASN A C   1 
ATOM 2758  O O   . ASN A 1 387 ? 146.481 187.471 138.753 1.00 482.20 ? 387 ASN A O   1 
ATOM 2759  C CB  . ASN A 1 387 ? 148.089 186.151 136.436 1.00 434.09 ? 387 ASN A CB  1 
ATOM 2760  C CG  . ASN A 1 387 ? 148.278 187.112 135.268 1.00 432.09 ? 387 ASN A CG  1 
ATOM 2761  O OD1 . ASN A 1 387 ? 148.777 188.227 135.451 1.00 420.28 ? 387 ASN A OD1 1 
ATOM 2762  N ND2 . ASN A 1 387 ? 147.882 186.690 134.057 1.00 478.55 ? 387 ASN A ND2 1 
ATOM 2763  N N   . GLU A 1 388 ? 147.793 189.085 137.885 1.00 500.00 ? 388 GLU A N   1 
ATOM 2764  C CA  . GLU A 1 388 ? 147.124 190.227 138.550 1.00 500.00 ? 388 GLU A CA  1 
ATOM 2765  C C   . GLU A 1 388 ? 145.670 190.460 138.224 1.00 500.00 ? 388 GLU A C   1 
ATOM 2766  O O   . GLU A 1 388 ? 144.845 190.460 139.153 1.00 500.00 ? 388 GLU A O   1 
ATOM 2767  C CB  . GLU A 1 388 ? 147.909 191.541 138.352 1.00 500.00 ? 388 GLU A CB  1 
ATOM 2768  C CG  . GLU A 1 388 ? 149.014 191.772 139.381 1.00 500.00 ? 388 GLU A CG  1 
ATOM 2769  C CD  . GLU A 1 388 ? 148.495 192.015 140.793 1.00 500.00 ? 388 GLU A CD  1 
ATOM 2770  O OE1 . GLU A 1 388 ? 147.637 192.908 140.974 1.00 500.00 ? 388 GLU A OE1 1 
ATOM 2771  O OE2 . GLU A 1 388 ? 148.951 191.314 141.725 1.00 500.00 ? 388 GLU A OE2 1 
ATOM 2772  N N   . SER A 1 389 ? 145.368 190.664 136.942 1.00 500.00 ? 389 SER A N   1 
ATOM 2773  C CA  . SER A 1 389 ? 143.997 190.909 136.488 1.00 500.00 ? 389 SER A CA  1 
ATOM 2774  C C   . SER A 1 389 ? 143.095 189.740 136.881 1.00 500.00 ? 389 SER A C   1 
ATOM 2775  O O   . SER A 1 389 ? 141.985 189.938 137.402 1.00 500.00 ? 389 SER A O   1 
ATOM 2776  C CB  . SER A 1 389 ? 143.942 191.150 134.977 1.00 500.00 ? 389 SER A CB  1 
ATOM 2777  O OG  . SER A 1 389 ? 142.683 191.679 134.593 1.00 500.00 ? 389 SER A OG  1 
ATOM 2778  N N   . VAL A 1 390 ? 143.610 188.541 136.624 1.00 477.87 ? 390 VAL A N   1 
ATOM 2779  C CA  . VAL A 1 390 ? 142.902 187.295 136.928 1.00 427.41 ? 390 VAL A CA  1 
ATOM 2780  C C   . VAL A 1 390 ? 142.578 187.225 138.416 1.00 402.93 ? 390 VAL A C   1 
ATOM 2781  O O   . VAL A 1 390 ? 141.448 186.898 138.810 1.00 327.28 ? 390 VAL A O   1 
ATOM 2782  C CB  . VAL A 1 390 ? 143.733 186.062 136.492 1.00 420.68 ? 390 VAL A CB  1 
ATOM 2783  C CG1 . VAL A 1 390 ? 143.127 184.766 137.022 1.00 460.48 ? 390 VAL A CG1 1 
ATOM 2784  C CG2 . VAL A 1 390 ? 143.848 186.003 134.972 1.00 403.58 ? 390 VAL A CG2 1 
ATOM 2785  N N   . ARG A 1 391 ? 143.595 187.541 139.210 1.00 434.03 ? 391 ARG A N   1 
ATOM 2786  C CA  . ARG A 1 391 ? 143.490 187.543 140.677 1.00 462.14 ? 391 ARG A CA  1 
ATOM 2787  C C   . ARG A 1 391 ? 142.385 188.486 141.121 1.00 466.44 ? 391 ARG A C   1 
ATOM 2788  O O   . ARG A 1 391 ? 141.556 188.139 141.969 1.00 420.65 ? 391 ARG A O   1 
ATOM 2789  C CB  . ARG A 1 391 ? 144.784 188.041 141.318 1.00 500.00 ? 391 ARG A CB  1 
ATOM 2790  C CG  . ARG A 1 391 ? 144.834 187.974 142.841 1.00 500.00 ? 391 ARG A CG  1 
ATOM 2791  C CD  . ARG A 1 391 ? 146.002 188.773 143.408 1.00 500.00 ? 391 ARG A CD  1 
ATOM 2792  N NE  . ARG A 1 391 ? 145.547 189.998 144.065 1.00 500.00 ? 391 ARG A NE  1 
ATOM 2793  C CZ  . ARG A 1 391 ? 145.071 190.079 145.313 1.00 500.00 ? 391 ARG A CZ  1 
ATOM 2794  N NH1 . ARG A 1 391 ? 144.968 189.003 146.098 1.00 500.00 ? 391 ARG A NH1 1 
ATOM 2795  N NH2 . ARG A 1 391 ? 144.689 191.262 145.788 1.00 500.00 ? 391 ARG A NH2 1 
ATOM 2796  N N   . ASN A 1 392 ? 142.410 189.674 140.534 1.00 496.50 ? 392 ASN A N   1 
ATOM 2797  C CA  . ASN A 1 392 ? 141.431 190.729 140.830 1.00 500.00 ? 392 ASN A CA  1 
ATOM 2798  C C   . ASN A 1 392 ? 140.021 190.228 140.546 1.00 500.00 ? 392 ASN A C   1 
ATOM 2799  O O   . ASN A 1 392 ? 139.106 190.411 141.363 1.00 500.00 ? 392 ASN A O   1 
ATOM 2800  C CB  . ASN A 1 392 ? 141.761 192.049 140.128 1.00 500.00 ? 392 ASN A CB  1 
ATOM 2801  C CG  . ASN A 1 392 ? 142.900 192.795 140.810 1.00 500.00 ? 392 ASN A CG  1 
ATOM 2802  O OD1 . ASN A 1 392 ? 143.783 192.186 141.419 1.00 455.76 ? 392 ASN A OD1 1 
ATOM 2803  N ND2 . ASN A 1 392 ? 142.878 194.119 140.717 1.00 500.00 ? 392 ASN A ND2 1 
ATOM 2804  N N   . GLN A 1 393 ? 139.884 189.599 139.385 1.00 468.86 ? 393 GLN A N   1 
ATOM 2805  C CA  . GLN A 1 393 ? 138.608 189.037 138.931 1.00 416.87 ? 393 GLN A CA  1 
ATOM 2806  C C   . GLN A 1 393 ? 138.084 188.027 139.948 1.00 369.13 ? 393 GLN A C   1 
ATOM 2807  O O   . GLN A 1 393 ? 136.901 188.049 140.329 1.00 317.78 ? 393 GLN A O   1 
ATOM 2808  C CB  . GLN A 1 393 ? 138.719 188.337 137.573 1.00 453.43 ? 393 GLN A CB  1 
ATOM 2809  C CG  . GLN A 1 393 ? 138.736 189.256 136.365 1.00 500.00 ? 393 GLN A CG  1 
ATOM 2810  C CD  . GLN A 1 393 ? 138.486 188.503 135.066 1.00 500.00 ? 393 GLN A CD  1 
ATOM 2811  O OE1 . GLN A 1 393 ? 137.409 187.934 134.868 1.00 500.00 ? 393 GLN A OE1 1 
ATOM 2812  N NE2 . GLN A 1 393 ? 139.478 188.491 134.176 1.00 500.00 ? 393 GLN A NE2 1 
ATOM 2813  N N   . VAL A 1 394 ? 138.999 187.159 140.362 1.00 392.32 ? 394 VAL A N   1 
ATOM 2814  C CA  . VAL A 1 394 ? 138.707 186.101 141.337 1.00 410.63 ? 394 VAL A CA  1 
ATOM 2815  C C   . VAL A 1 394 ? 138.186 186.713 142.632 1.00 399.37 ? 394 VAL A C   1 
ATOM 2816  O O   . VAL A 1 394 ? 137.186 186.255 143.197 1.00 321.69 ? 394 VAL A O   1 
ATOM 2817  C CB  . VAL A 1 394 ? 139.958 185.221 141.620 1.00 429.04 ? 394 VAL A CB  1 
ATOM 2818  C CG1 . VAL A 1 394 ? 139.771 184.341 142.853 1.00 405.14 ? 394 VAL A CG1 1 
ATOM 2819  C CG2 . VAL A 1 394 ? 140.301 184.365 140.405 1.00 475.05 ? 394 VAL A CG2 1 
ATOM 2820  N N   . GLU A 1 395 ? 138.895 187.742 143.072 1.00 434.67 ? 395 GLU A N   1 
ATOM 2821  C CA  . GLU A 1 395 ? 138.567 188.477 144.302 1.00 467.99 ? 395 GLU A CA  1 
ATOM 2822  C C   . GLU A 1 395 ? 137.157 189.034 144.212 1.00 458.35 ? 395 GLU A C   1 
ATOM 2823  O O   . GLU A 1 395 ? 136.366 188.907 145.155 1.00 449.47 ? 395 GLU A O   1 
ATOM 2824  C CB  . GLU A 1 395 ? 139.563 189.621 144.548 1.00 500.00 ? 395 GLU A CB  1 
ATOM 2825  C CG  . GLU A 1 395 ? 140.951 189.166 144.979 1.00 500.00 ? 395 GLU A CG  1 
ATOM 2826  C CD  . GLU A 1 395 ? 141.034 188.795 146.454 1.00 500.00 ? 395 GLU A CD  1 
ATOM 2827  O OE1 . GLU A 1 395 ? 140.549 189.577 147.303 1.00 500.00 ? 395 GLU A OE1 1 
ATOM 2828  O OE2 . GLU A 1 395 ? 141.599 187.724 146.770 1.00 500.00 ? 395 GLU A OE2 1 
ATOM 2829  N N   . ASP A 1 396 ? 136.879 189.646 143.071 1.00 491.64 ? 396 ASP A N   1 
ATOM 2830  C CA  . ASP A 1 396 ? 135.573 190.257 142.788 1.00 500.00 ? 396 ASP A CA  1 
ATOM 2831  C C   . ASP A 1 396 ? 134.470 189.202 142.906 1.00 458.73 ? 396 ASP A C   1 
ATOM 2832  O O   . ASP A 1 396 ? 133.427 189.437 143.543 1.00 363.97 ? 396 ASP A O   1 
ATOM 2833  C CB  . ASP A 1 396 ? 135.551 190.928 141.401 1.00 500.00 ? 396 ASP A CB  1 
ATOM 2834  C CG  . ASP A 1 396 ? 134.455 191.990 141.267 1.00 500.00 ? 396 ASP A CG  1 
ATOM 2835  O OD1 . ASP A 1 396 ? 134.298 192.830 142.181 1.00 500.00 ? 396 ASP A OD1 1 
ATOM 2836  O OD2 . ASP A 1 396 ? 133.759 191.996 140.228 1.00 500.00 ? 396 ASP A OD2 1 
ATOM 2837  N N   . LEU A 1 397 ? 134.741 188.062 142.283 1.00 445.99 ? 397 LEU A N   1 
ATOM 2838  C CA  . LEU A 1 397 ? 133.817 186.929 142.269 1.00 458.40 ? 397 LEU A CA  1 
ATOM 2839  C C   . LEU A 1 397 ? 133.506 186.486 143.706 1.00 442.79 ? 397 LEU A C   1 
ATOM 2840  O O   . LEU A 1 397 ? 132.338 186.268 144.074 1.00 453.62 ? 397 LEU A O   1 
ATOM 2841  C CB  . LEU A 1 397 ? 134.409 185.791 141.420 1.00 465.34 ? 397 LEU A CB  1 
ATOM 2842  C CG  . LEU A 1 397 ? 133.873 184.360 141.465 1.00 445.22 ? 397 LEU A CG  1 
ATOM 2843  C CD1 . LEU A 1 397 ? 132.374 184.297 141.228 1.00 438.99 ? 397 LEU A CD1 1 
ATOM 2844  C CD2 . LEU A 1 397 ? 134.618 183.521 140.431 1.00 423.66 ? 397 LEU A CD2 1 
ATOM 2845  N N   . LEU A 1 398 ? 134.577 186.372 144.478 1.00 399.08 ? 398 LEU A N   1 
ATOM 2846  C CA  . LEU A 1 398 ? 134.497 185.958 145.879 1.00 398.29 ? 398 LEU A CA  1 
ATOM 2847  C C   . LEU A 1 398 ? 133.617 186.917 146.665 1.00 428.11 ? 398 LEU A C   1 
ATOM 2848  O O   . LEU A 1 398 ? 132.755 186.496 147.441 1.00 427.55 ? 398 LEU A O   1 
ATOM 2849  C CB  . LEU A 1 398 ? 135.881 185.760 146.483 1.00 415.43 ? 398 LEU A CB  1 
ATOM 2850  C CG  . LEU A 1 398 ? 136.616 184.548 145.888 1.00 433.78 ? 398 LEU A CG  1 
ATOM 2851  C CD1 . LEU A 1 398 ? 138.118 184.689 146.098 1.00 485.14 ? 398 LEU A CD1 1 
ATOM 2852  C CD2 . LEU A 1 398 ? 136.109 183.228 146.460 1.00 425.52 ? 398 LEU A CD2 1 
ATOM 2853  N N   . ALA A 1 399 ? 133.855 188.200 146.435 1.00 454.74 ? 399 ALA A N   1 
ATOM 2854  C CA  . ALA A 1 399 ? 133.108 189.286 147.085 1.00 484.05 ? 399 ALA A CA  1 
ATOM 2855  C C   . ALA A 1 399 ? 131.623 189.147 146.783 1.00 452.95 ? 399 ALA A C   1 
ATOM 2856  O O   . ALA A 1 399 ? 130.780 189.248 147.687 1.00 426.62 ? 399 ALA A O   1 
ATOM 2857  C CB  . ALA A 1 399 ? 133.628 190.649 146.644 1.00 500.00 ? 399 ALA A CB  1 
ATOM 2858  N N   . THR A 1 400 ? 131.342 188.917 145.505 1.00 430.01 ? 400 THR A N   1 
ATOM 2859  C CA  . THR A 1 400 ? 129.970 188.756 145.011 1.00 447.60 ? 400 THR A CA  1 
ATOM 2860  C C   . THR A 1 400 ? 129.285 187.598 145.742 1.00 413.59 ? 400 THR A C   1 
ATOM 2861  O O   . THR A 1 400 ? 128.139 187.720 146.202 1.00 392.14 ? 400 THR A O   1 
ATOM 2862  C CB  . THR A 1 400 ? 129.865 188.571 143.479 1.00 479.24 ? 400 THR A CB  1 
ATOM 2863  O OG1 . THR A 1 400 ? 130.530 187.371 143.073 1.00 480.55 ? 400 THR A OG1 1 
ATOM 2864  C CG2 . THR A 1 400 ? 130.446 189.777 142.726 1.00 492.91 ? 400 THR A CG2 1 
ATOM 2865  N N   . LEU A 1 401 ? 130.023 186.497 145.825 1.00 402.56 ? 401 LEU A N   1 
ATOM 2866  C CA  . LEU A 1 401 ? 129.553 185.275 146.485 1.00 400.94 ? 401 LEU A CA  1 
ATOM 2867  C C   . LEU A 1 401 ? 129.188 185.569 147.939 1.00 395.90 ? 401 LEU A C   1 
ATOM 2868  O O   . LEU A 1 401 ? 128.129 185.156 148.427 1.00 398.00 ? 401 LEU A O   1 
ATOM 2869  C CB  . LEU A 1 401 ? 130.610 184.163 146.420 1.00 391.46 ? 401 LEU A CB  1 
ATOM 2870  C CG  . LEU A 1 401 ? 130.626 183.317 145.142 1.00 399.19 ? 401 LEU A CG  1 
ATOM 2871  C CD1 . LEU A 1 401 ? 132.024 182.797 144.851 1.00 407.89 ? 401 LEU A CD1 1 
ATOM 2872  C CD2 . LEU A 1 401 ? 129.636 182.165 145.233 1.00 389.65 ? 401 LEU A CD2 1 
ATOM 2873  N N   . GLU A 1 402 ? 130.092 186.284 148.592 1.00 405.91 ? 402 GLU A N   1 
ATOM 2874  C CA  . GLU A 1 402 ? 129.940 186.676 149.998 1.00 455.96 ? 402 GLU A CA  1 
ATOM 2875  C C   . GLU A 1 402 ? 128.657 187.481 150.177 1.00 445.26 ? 402 GLU A C   1 
ATOM 2876  O O   . GLU A 1 402 ? 127.872 187.232 151.104 1.00 412.96 ? 402 GLU A O   1 
ATOM 2877  C CB  . GLU A 1 402 ? 131.150 187.494 150.497 1.00 500.00 ? 402 GLU A CB  1 
ATOM 2878  C CG  . GLU A 1 402 ? 132.429 186.688 150.731 1.00 500.00 ? 402 GLU A CG  1 
ATOM 2879  C CD  . GLU A 1 402 ? 133.676 187.536 150.996 1.00 500.00 ? 402 GLU A CD  1 
ATOM 2880  O OE1 . GLU A 1 402 ? 133.737 188.715 150.576 1.00 463.07 ? 402 GLU A OE1 1 
ATOM 2881  O OE2 . GLU A 1 402 ? 134.622 187.009 151.621 1.00 482.72 ? 402 GLU A OE2 1 
ATOM 2882  N N   . LYS A 1 403 ? 128.481 188.437 149.274 1.00 452.47 ? 403 LYS A N   1 
ATOM 2883  C CA  . LYS A 1 403 ? 127.314 189.325 149.270 1.00 482.09 ? 403 LYS A CA  1 
ATOM 2884  C C   . LYS A 1 403 ? 126.032 188.502 149.167 1.00 485.56 ? 403 LYS A C   1 
ATOM 2885  O O   . LYS A 1 403 ? 125.066 188.727 149.918 1.00 500.00 ? 403 LYS A O   1 
ATOM 2886  C CB  . LYS A 1 403 ? 127.407 190.352 148.135 1.00 500.00 ? 403 LYS A CB  1 
ATOM 2887  C CG  . LYS A 1 403 ? 126.414 191.496 148.257 1.00 500.00 ? 403 LYS A CG  1 
ATOM 2888  C CD  . LYS A 1 403 ? 126.615 192.534 147.161 1.00 500.00 ? 403 LYS A CD  1 
ATOM 2889  C CE  . LYS A 1 403 ? 125.447 193.510 147.099 1.00 500.00 ? 403 LYS A CE  1 
ATOM 2890  N NZ  . LYS A 1 403 ? 125.569 194.474 145.968 1.00 500.00 ? 403 LYS A NZ  1 
ATOM 2891  N N   . SER A 1 404 ? 126.064 187.558 148.236 1.00 477.31 ? 404 SER A N   1 
ATOM 2892  C CA  . SER A 1 404 ? 124.935 186.661 147.978 1.00 478.55 ? 404 SER A CA  1 
ATOM 2893  C C   . SER A 1 404 ? 124.575 185.889 149.244 1.00 477.81 ? 404 SER A C   1 
ATOM 2894  O O   . SER A 1 404 ? 123.399 185.784 149.618 1.00 499.05 ? 404 SER A O   1 
ATOM 2895  C CB  . SER A 1 404 ? 125.213 185.716 146.797 1.00 461.36 ? 404 SER A CB  1 
ATOM 2896  O OG  . SER A 1 404 ? 126.168 184.723 147.110 1.00 420.78 ? 404 SER A OG  1 
ATOM 2897  N N   . GLY A 1 405 ? 125.614 185.367 149.879 1.00 441.31 ? 405 GLY A N   1 
ATOM 2898  C CA  . GLY A 1 405 ? 125.493 184.587 151.114 1.00 435.09 ? 405 GLY A CA  1 
ATOM 2899  C C   . GLY A 1 405 ? 125.035 185.360 152.335 1.00 440.52 ? 405 GLY A C   1 
ATOM 2900  O O   . GLY A 1 405 ? 124.501 184.789 153.285 1.00 402.46 ? 405 GLY A O   1 
ATOM 2901  N N   . ALA A 1 406 ? 125.286 186.661 152.310 1.00 500.00 ? 406 ALA A N   1 
ATOM 2902  C CA  . ALA A 1 406 ? 124.777 187.616 153.293 1.00 500.00 ? 406 ALA A CA  1 
ATOM 2903  C C   . ALA A 1 406 ? 123.270 187.467 153.521 1.00 500.00 ? 406 ALA A C   1 
ATOM 2904  O O   . ALA A 1 406 ? 122.818 187.397 154.666 1.00 469.62 ? 406 ALA A O   1 
ATOM 2905  C CB  . ALA A 1 406 ? 125.123 189.057 152.920 1.00 500.00 ? 406 ALA A CB  1 
ATOM 2906  N N   . GLY A 1 407 ? 122.516 187.370 152.426 1.00 500.00 ? 407 GLY A N   1 
ATOM 2907  C CA  . GLY A 1 407 ? 121.060 187.240 152.462 1.00 491.69 ? 407 GLY A CA  1 
ATOM 2908  C C   . GLY A 1 407 ? 120.464 186.121 153.302 1.00 472.31 ? 407 GLY A C   1 
ATOM 2909  O O   . GLY A 1 407 ? 119.297 186.211 153.690 1.00 495.95 ? 407 GLY A O   1 
ATOM 2910  N N   . VAL A 1 408 ? 121.238 185.068 153.575 1.00 454.84 ? 408 VAL A N   1 
ATOM 2911  C CA  . VAL A 1 408 ? 120.785 183.981 154.453 1.00 493.84 ? 408 VAL A CA  1 
ATOM 2912  C C   . VAL A 1 408 ? 121.932 183.464 155.349 1.00 500.00 ? 408 VAL A C   1 
ATOM 2913  O O   . VAL A 1 408 ? 122.938 182.971 154.838 1.00 500.00 ? 408 VAL A O   1 
ATOM 2914  C CB  . VAL A 1 408 ? 120.116 182.835 153.641 1.00 468.43 ? 408 VAL A CB  1 
ATOM 2915  C CG1 . VAL A 1 408 ? 121.076 182.207 152.630 1.00 468.31 ? 408 VAL A CG1 1 
ATOM 2916  C CG2 . VAL A 1 408 ? 119.521 181.782 154.571 1.00 445.06 ? 408 VAL A CG2 1 
ATOM 2917  N N   . PRO A 1 409 ? 121.782 183.583 156.694 1.00 500.00 ? 409 PRO A N   1 
ATOM 2918  C CA  . PRO A 1 409 ? 122.843 183.135 157.607 1.00 500.00 ? 409 PRO A CA  1 
ATOM 2919  C C   . PRO A 1 409 ? 122.937 181.613 157.747 1.00 500.00 ? 409 PRO A C   1 
ATOM 2920  O O   . PRO A 1 409 ? 123.942 181.119 158.262 1.00 500.00 ? 409 PRO A O   1 
ATOM 2921  C CB  . PRO A 1 409 ? 122.443 183.767 158.941 1.00 500.00 ? 409 PRO A CB  1 
ATOM 2922  C CG  . PRO A 1 409 ? 120.960 183.780 158.893 1.00 500.00 ? 409 PRO A CG  1 
ATOM 2923  C CD  . PRO A 1 409 ? 120.594 184.032 157.449 1.00 500.00 ? 409 PRO A CD  1 
ATOM 2924  N N   . ALA A 1 410 ? 121.905 180.889 157.298 1.00 500.00 ? 410 ALA A N   1 
ATOM 2925  C CA  . ALA A 1 410 ? 121.940 179.419 157.188 1.00 469.43 ? 410 ALA A CA  1 
ATOM 2926  C C   . ALA A 1 410 ? 123.150 178.896 156.405 1.00 443.51 ? 410 ALA A C   1 
ATOM 2927  O O   . ALA A 1 410 ? 123.563 177.751 156.604 1.00 431.69 ? 410 ALA A O   1 
ATOM 2928  C CB  . ALA A 1 410 ? 120.649 178.895 156.562 1.00 423.88 ? 410 ALA A CB  1 
ATOM 2929  N N   . VAL A 1 411 ? 123.687 179.729 155.509 1.00 428.39 ? 411 VAL A N   1 
ATOM 2930  C CA  . VAL A 1 411 ? 124.913 179.434 154.777 1.00 428.16 ? 411 VAL A CA  1 
ATOM 2931  C C   . VAL A 1 411 ? 125.904 180.590 154.922 1.00 400.25 ? 411 VAL A C   1 
ATOM 2932  O O   . VAL A 1 411 ? 125.958 181.478 154.060 1.00 389.79 ? 411 VAL A O   1 
ATOM 2933  C CB  . VAL A 1 411 ? 124.608 179.204 153.277 1.00 456.49 ? 411 VAL A CB  1 
ATOM 2934  C CG1 . VAL A 1 411 ? 125.794 178.550 152.577 1.00 474.08 ? 411 VAL A CG1 1 
ATOM 2935  C CG2 . VAL A 1 411 ? 123.349 178.366 153.113 1.00 469.62 ? 411 VAL A CG2 1 
ATOM 2936  N N   . ILE A 1 412 ? 126.681 180.591 156.005 1.00 373.20 ? 412 ILE A N   1 
ATOM 2937  C CA  . ILE A 1 412 ? 127.757 181.578 156.141 1.00 418.34 ? 412 ILE A CA  1 
ATOM 2938  C C   . ILE A 1 412 ? 128.848 181.225 155.114 1.00 395.71 ? 412 ILE A C   1 
ATOM 2939  O O   . ILE A 1 412 ? 129.313 180.078 155.038 1.00 425.07 ? 412 ILE A O   1 
ATOM 2940  C CB  . ILE A 1 412 ? 128.270 181.742 157.608 1.00 472.70 ? 412 ILE A CB  1 
ATOM 2941  C CG1 . ILE A 1 412 ? 128.799 183.168 157.837 1.00 500.00 ? 412 ILE A CG1 1 
ATOM 2942  C CG2 . ILE A 1 412 ? 129.344 180.731 157.980 1.00 478.76 ? 412 ILE A CG2 1 
ATOM 2943  C CD1 . ILE A 1 412 ? 129.182 183.470 159.275 1.00 500.00 ? 412 ILE A CD1 1 
ATOM 2944  N N   . LEU A 1 413 ? 129.198 182.208 154.289 1.00 379.41 ? 413 LEU A N   1 
ATOM 2945  C CA  . LEU A 1 413 ? 130.073 181.994 153.145 1.00 397.17 ? 413 LEU A CA  1 
ATOM 2946  C C   . LEU A 1 413 ? 131.423 182.639 153.434 1.00 370.80 ? 413 LEU A C   1 
ATOM 2947  O O   . LEU A 1 413 ? 131.492 183.829 153.744 1.00 387.21 ? 413 LEU A O   1 
ATOM 2948  C CB  . LEU A 1 413 ? 129.428 182.571 151.882 1.00 453.76 ? 413 LEU A CB  1 
ATOM 2949  C CG  . LEU A 1 413 ? 129.560 181.666 150.650 1.00 500.00 ? 413 LEU A CG  1 
ATOM 2950  C CD1 . LEU A 1 413 ? 128.756 182.199 149.471 1.00 500.00 ? 413 LEU A CD1 1 
ATOM 2951  C CD2 . LEU A 1 413 ? 131.021 181.485 150.271 1.00 481.65 ? 413 LEU A CD2 1 
ATOM 2952  N N   . ARG A 1 414 ? 132.487 181.852 153.309 1.00 364.57 ? 414 ARG A N   1 
ATOM 2953  C CA  . ARG A 1 414 ? 133.768 182.172 153.923 1.00 396.48 ? 414 ARG A CA  1 
ATOM 2954  C C   . ARG A 1 414 ? 134.957 181.784 153.044 1.00 417.47 ? 414 ARG A C   1 
ATOM 2955  O O   . ARG A 1 414 ? 134.863 180.846 152.248 1.00 474.26 ? 414 ARG A O   1 
ATOM 2956  C CB  . ARG A 1 414 ? 133.850 181.417 155.249 1.00 399.33 ? 414 ARG A CB  1 
ATOM 2957  C CG  . ARG A 1 414 ? 134.839 181.998 156.235 1.00 445.92 ? 414 ARG A CG  1 
ATOM 2958  C CD  . ARG A 1 414 ? 134.874 181.157 157.497 1.00 496.09 ? 414 ARG A CD  1 
ATOM 2959  N NE  . ARG A 1 414 ? 135.904 181.612 158.428 1.00 500.00 ? 414 ARG A NE  1 
ATOM 2960  C CZ  . ARG A 1 414 ? 135.830 182.700 159.198 1.00 500.00 ? 414 ARG A CZ  1 
ATOM 2961  N NH1 . ARG A 1 414 ? 134.759 183.502 159.178 1.00 500.00 ? 414 ARG A NH1 1 
ATOM 2962  N NH2 . ARG A 1 414 ? 136.849 182.996 160.003 1.00 500.00 ? 414 ARG A NH2 1 
ATOM 2963  N N   . ARG A 1 415 ? 136.072 182.500 153.204 1.00 389.62 ? 415 ARG A N   1 
ATOM 2964  C CA  . ARG A 1 415 ? 137.354 182.114 152.590 1.00 383.46 ? 415 ARG A CA  1 
ATOM 2965  C C   . ARG A 1 415 ? 138.015 181.042 153.457 1.00 375.89 ? 415 ARG A C   1 
ATOM 2966  O O   . ARG A 1 415 ? 137.568 180.808 154.575 1.00 320.83 ? 415 ARG A O   1 
ATOM 2967  C CB  . ARG A 1 415 ? 138.304 183.306 152.500 1.00 378.07 ? 415 ARG A CB  1 
ATOM 2968  C CG  . ARG A 1 415 ? 137.765 184.510 151.747 1.00 406.31 ? 415 ARG A CG  1 
ATOM 2969  C CD  . ARG A 1 415 ? 138.095 184.483 150.268 1.00 431.08 ? 415 ARG A CD  1 
ATOM 2970  N NE  . ARG A 1 415 ? 137.928 185.816 149.684 1.00 473.22 ? 415 ARG A NE  1 
ATOM 2971  C CZ  . ARG A 1 415 ? 138.835 186.800 149.713 1.00 494.15 ? 415 ARG A CZ  1 
ATOM 2972  N NH1 . ARG A 1 415 ? 140.025 186.642 150.300 1.00 481.98 ? 415 ARG A NH1 1 
ATOM 2973  N NH2 . ARG A 1 415 ? 138.543 187.969 149.142 1.00 500.00 ? 415 ARG A NH2 1 
ATOM 2974  N N   . PRO A 1 416 ? 139.079 180.387 152.950 1.00 418.09 ? 416 PRO A N   1 
ATOM 2975  C CA  . PRO A 1 416 ? 139.925 179.551 153.792 1.00 435.06 ? 416 PRO A CA  1 
ATOM 2976  C C   . PRO A 1 416 ? 141.193 180.303 154.209 1.00 473.46 ? 416 PRO A C   1 
ATOM 2977  O O   . PRO A 1 416 ? 141.574 181.290 153.562 1.00 446.83 ? 416 PRO A O   1 
ATOM 2978  C CB  . PRO A 1 416 ? 140.268 178.390 152.867 1.00 444.27 ? 416 PRO A CB  1 
ATOM 2979  C CG  . PRO A 1 416 ? 140.341 179.025 151.515 1.00 475.29 ? 416 PRO A CG  1 
ATOM 2980  C CD  . PRO A 1 416 ? 139.474 180.265 151.534 1.00 457.55 ? 416 PRO A CD  1 
ATOM 2981  N N   . ASN A 1 417 ? 141.831 179.843 155.285 1.00 497.09 ? 417 ASN A N   1 
ATOM 2982  C CA  . ASN A 1 417 ? 143.095 180.425 155.747 1.00 500.00 ? 417 ASN A CA  1 
ATOM 2983  C C   . ASN A 1 417 ? 144.228 180.120 154.762 1.00 500.00 ? 417 ASN A C   1 
ATOM 2984  O O   . ASN A 1 417 ? 144.285 179.021 154.203 1.00 500.00 ? 417 ASN A O   1 
ATOM 2985  C CB  . ASN A 1 417 ? 143.480 179.901 157.147 1.00 491.56 ? 417 ASN A CB  1 
ATOM 2986  C CG  . ASN A 1 417 ? 142.634 180.495 158.269 1.00 469.88 ? 417 ASN A CG  1 
ATOM 2987  O OD1 . ASN A 1 417 ? 141.970 181.521 158.109 1.00 474.64 ? 417 ASN A OD1 1 
ATOM 2988  N ND2 . ASN A 1 417 ? 142.676 179.847 159.430 1.00 433.74 ? 417 ASN A ND2 1 
ATOM 2989  N N   . GLN A 1 418 ? 145.104 181.104 154.551 1.00 500.00 ? 418 GLN A N   1 
ATOM 2990  C CA  . GLN A 1 418 ? 146.367 180.929 153.810 1.00 495.71 ? 418 GLN A CA  1 
ATOM 2991  C C   . GLN A 1 418 ? 146.161 180.650 152.305 1.00 453.34 ? 418 GLN A C   1 
ATOM 2992  O O   . GLN A 1 418 ? 145.069 180.874 151.770 1.00 355.29 ? 418 GLN A O   1 
ATOM 2993  C CB  . GLN A 1 418 ? 147.245 179.848 154.487 1.00 500.00 ? 418 GLN A CB  1 
ATOM 2994  C CG  . GLN A 1 418 ? 147.431 180.041 155.990 1.00 500.00 ? 418 GLN A CG  1 
ATOM 2995  C CD  . GLN A 1 418 ? 148.381 179.031 156.609 1.00 500.00 ? 418 GLN A CD  1 
ATOM 2996  O OE1 . GLN A 1 418 ? 148.318 177.836 156.312 1.00 500.00 ? 418 GLN A OE1 1 
ATOM 2997  N NE2 . GLN A 1 418 ? 149.258 179.507 157.490 1.00 500.00 ? 418 GLN A NE2 1 
ATOM 2998  N N   . SER A 1 419 ? 147.233 180.224 151.630 1.00 480.92 ? 419 SER A N   1 
ATOM 2999  C CA  . SER A 1 419 ? 147.186 179.755 150.247 1.00 500.00 ? 419 SER A CA  1 
ATOM 3000  C C   . SER A 1 419 ? 147.208 178.211 150.240 1.00 500.00 ? 419 SER A C   1 
ATOM 3001  O O   . SER A 1 419 ? 148.175 177.595 150.702 1.00 448.93 ? 419 SER A O   1 
ATOM 3002  C CB  . SER A 1 419 ? 148.374 180.335 149.462 1.00 500.00 ? 419 SER A CB  1 
ATOM 3003  O OG  . SER A 1 419 ? 148.080 180.452 148.082 1.00 500.00 ? 419 SER A OG  1 
ATOM 3004  N N   . GLN A 1 420 ? 146.135 177.609 149.719 1.00 493.11 ? 420 GLN A N   1 
ATOM 3005  C CA  . GLN A 1 420 ? 145.924 176.152 149.736 1.00 450.22 ? 420 GLN A CA  1 
ATOM 3006  C C   . GLN A 1 420 ? 146.054 175.555 148.329 1.00 434.91 ? 420 GLN A C   1 
ATOM 3007  O O   . GLN A 1 420 ? 146.147 176.309 147.356 1.00 371.20 ? 420 GLN A O   1 
ATOM 3008  C CB  . GLN A 1 420 ? 144.545 175.840 150.333 1.00 440.31 ? 420 GLN A CB  1 
ATOM 3009  C CG  . GLN A 1 420 ? 144.526 175.900 151.852 1.00 454.26 ? 420 GLN A CG  1 
ATOM 3010  C CD  . GLN A 1 420 ? 143.231 175.391 152.454 1.00 474.91 ? 420 GLN A CD  1 
ATOM 3011  O OE1 . GLN A 1 420 ? 142.599 174.480 151.919 1.00 480.21 ? 420 GLN A OE1 1 
ATOM 3012  N NE2 . GLN A 1 420 ? 142.838 175.967 153.587 1.00 495.81 ? 420 GLN A NE2 1 
ATOM 3013  N N   . PRO A 1 421 ? 146.069 174.203 148.212 1.00 466.35 ? 421 PRO A N   1 
ATOM 3014  C CA  . PRO A 1 421 ? 146.203 173.598 146.875 1.00 462.77 ? 421 PRO A CA  1 
ATOM 3015  C C   . PRO A 1 421 ? 145.019 173.883 145.945 1.00 397.46 ? 421 PRO A C   1 
ATOM 3016  O O   . PRO A 1 421 ? 145.222 174.449 144.877 1.00 291.44 ? 421 PRO A O   1 
ATOM 3017  C CB  . PRO A 1 421 ? 146.332 172.088 147.171 1.00 482.04 ? 421 PRO A CB  1 
ATOM 3018  C CG  . PRO A 1 421 ? 146.730 172.001 148.604 1.00 491.82 ? 421 PRO A CG  1 
ATOM 3019  C CD  . PRO A 1 421 ? 146.073 173.171 149.269 1.00 478.89 ? 421 PRO A CD  1 
ATOM 3020  N N   . LEU A 1 422 ? 143.815 173.524 146.400 1.00 385.81 ? 422 LEU A N   1 
ATOM 3021  C CA  . LEU A 1 422 ? 142.527 173.602 145.673 1.00 378.46 ? 422 LEU A CA  1 
ATOM 3022  C C   . LEU A 1 422 ? 141.996 172.173 145.548 1.00 361.05 ? 422 LEU A C   1 
ATOM 3023  O O   . LEU A 1 422 ? 142.744 171.278 145.149 1.00 393.45 ? 422 LEU A O   1 
ATOM 3024  C CB  . LEU A 1 422 ? 142.605 174.280 144.294 1.00 355.59 ? 422 LEU A CB  1 
ATOM 3025  C CG  . LEU A 1 422 ? 141.319 174.652 143.538 1.00 362.72 ? 422 LEU A CG  1 
ATOM 3026  C CD1 . LEU A 1 422 ? 141.696 175.603 142.410 1.00 384.50 ? 422 LEU A CD1 1 
ATOM 3027  C CD2 . LEU A 1 422 ? 140.543 173.461 142.981 1.00 345.93 ? 422 LEU A CD2 1 
ATOM 3028  N N   . PRO A 1 423 ? 140.711 171.950 145.887 1.00 356.62 ? 423 PRO A N   1 
ATOM 3029  C CA  . PRO A 1 423 ? 140.176 170.583 146.015 1.00 395.27 ? 423 PRO A CA  1 
ATOM 3030  C C   . PRO A 1 423 ? 140.164 169.704 144.764 1.00 432.41 ? 423 PRO A C   1 
ATOM 3031  O O   . PRO A 1 423 ? 140.307 170.211 143.645 1.00 413.76 ? 423 PRO A O   1 
ATOM 3032  C CB  . PRO A 1 423 ? 138.748 170.812 146.540 1.00 400.64 ? 423 PRO A CB  1 
ATOM 3033  C CG  . PRO A 1 423 ? 138.433 172.226 146.202 1.00 376.89 ? 423 PRO A CG  1 
ATOM 3034  C CD  . PRO A 1 423 ? 139.725 172.951 146.335 1.00 347.91 ? 423 PRO A CD  1 
ATOM 3035  N N   . PRO A 1 424 ? 140.010 168.378 144.966 1.00 440.06 ? 424 PRO A N   1 
ATOM 3036  C CA  . PRO A 1 424 ? 139.818 167.476 143.841 1.00 437.37 ? 424 PRO A CA  1 
ATOM 3037  C C   . PRO A 1 424 ? 138.468 167.785 143.209 1.00 416.36 ? 424 PRO A C   1 
ATOM 3038  O O   . PRO A 1 424 ? 137.411 167.363 143.704 1.00 390.33 ? 424 PRO A O   1 
ATOM 3039  C CB  . PRO A 1 424 ? 139.852 166.092 144.484 1.00 458.06 ? 424 PRO A CB  1 
ATOM 3040  C CG  . PRO A 1 424 ? 139.369 166.317 145.870 1.00 449.54 ? 424 PRO A CG  1 
ATOM 3041  C CD  . PRO A 1 424 ? 139.874 167.673 146.257 1.00 430.63 ? 424 PRO A CD  1 
ATOM 3042  N N   . SER A 1 425 ? 138.519 168.570 142.142 1.00 365.86 ? 425 SER A N   1 
ATOM 3043  C CA  . SER A 1 425 ? 137.322 169.145 141.579 1.00 362.75 ? 425 SER A CA  1 
ATOM 3044  C C   . SER A 1 425 ? 137.450 169.404 140.094 1.00 367.48 ? 425 SER A C   1 
ATOM 3045  O O   . SER A 1 425 ? 138.551 169.592 139.563 1.00 322.13 ? 425 SER A O   1 
ATOM 3046  C CB  . SER A 1 425 ? 136.992 170.449 142.296 1.00 409.24 ? 425 SER A CB  1 
ATOM 3047  O OG  . SER A 1 425 ? 136.525 171.427 141.382 1.00 458.99 ? 425 SER A OG  1 
ATOM 3048  N N   . SER A 1 426 ? 136.279 169.449 139.461 1.00 384.42 ? 426 SER A N   1 
ATOM 3049  C CA  . SER A 1 426 ? 136.139 169.637 138.025 1.00 369.98 ? 426 SER A CA  1 
ATOM 3050  C C   . SER A 1 426 ? 136.907 170.866 137.563 1.00 353.30 ? 426 SER A C   1 
ATOM 3051  O O   . SER A 1 426 ? 137.602 170.815 136.552 1.00 334.99 ? 426 SER A O   1 
ATOM 3052  C CB  . SER A 1 426 ? 134.659 169.766 137.650 1.00 353.89 ? 426 SER A CB  1 
ATOM 3053  O OG  . SER A 1 426 ? 134.488 169.653 136.253 1.00 376.97 ? 426 SER A OG  1 
ATOM 3054  N N   . LEU A 1 427 ? 136.786 171.956 138.320 1.00 341.22 ? 427 LEU A N   1 
ATOM 3055  C CA  . LEU A 1 427 ? 137.534 173.184 138.053 1.00 386.00 ? 427 LEU A CA  1 
ATOM 3056  C C   . LEU A 1 427 ? 138.976 172.890 137.632 1.00 372.14 ? 427 LEU A C   1 
ATOM 3057  O O   . LEU A 1 427 ? 139.378 173.196 136.511 1.00 343.97 ? 427 LEU A O   1 
ATOM 3058  C CB  . LEU A 1 427 ? 137.518 174.095 139.290 1.00 407.70 ? 427 LEU A CB  1 
ATOM 3059  C CG  . LEU A 1 427 ? 138.305 175.414 139.250 1.00 442.75 ? 427 LEU A CG  1 
ATOM 3060  C CD1 . LEU A 1 427 ? 137.669 176.419 138.303 1.00 469.52 ? 427 LEU A CD1 1 
ATOM 3061  C CD2 . LEU A 1 427 ? 138.414 176.014 140.643 1.00 435.19 ? 427 LEU A CD2 1 
ATOM 3062  N N   . GLN A 1 428 ? 139.733 172.246 138.511 1.00 372.56 ? 428 GLN A N   1 
ATOM 3063  C CA  . GLN A 1 428 ? 141.169 172.074 138.284 1.00 364.15 ? 428 GLN A CA  1 
ATOM 3064  C C   . GLN A 1 428 ? 141.539 171.084 137.181 1.00 366.65 ? 428 GLN A C   1 
ATOM 3065  O O   . GLN A 1 428 ? 142.720 170.798 136.974 1.00 383.05 ? 428 GLN A O   1 
ATOM 3066  C CB  . GLN A 1 428 ? 141.894 171.744 139.587 1.00 370.28 ? 428 GLN A CB  1 
ATOM 3067  C CG  . GLN A 1 428 ? 141.591 170.389 140.210 1.00 342.40 ? 428 GLN A CG  1 
ATOM 3068  C CD  . GLN A 1 428 ? 142.747 169.894 141.058 1.00 376.54 ? 428 GLN A CD  1 
ATOM 3069  O OE1 . GLN A 1 428 ? 143.923 170.082 140.709 1.00 319.79 ? 428 GLN A OE1 1 
ATOM 3070  N NE2 . GLN A 1 428 ? 142.425 169.254 142.175 1.00 390.71 ? 428 GLN A NE2 1 
ATOM 3071  N N   . ARG A 1 429 ? 140.535 170.535 136.507 1.00 378.96 ? 429 ARG A N   1 
ATOM 3072  C CA  . ARG A 1 429 ? 140.718 169.999 135.166 1.00 419.42 ? 429 ARG A CA  1 
ATOM 3073  C C   . ARG A 1 429 ? 140.802 171.153 134.148 1.00 378.01 ? 429 ARG A C   1 
ATOM 3074  O O   . ARG A 1 429 ? 141.748 171.222 133.354 1.00 344.57 ? 429 ARG A O   1 
ATOM 3075  C CB  . ARG A 1 429 ? 139.576 169.031 134.827 1.00 447.07 ? 429 ARG A CB  1 
ATOM 3076  C CG  . ARG A 1 429 ? 139.528 168.499 133.401 1.00 459.20 ? 429 ARG A CG  1 
ATOM 3077  C CD  . ARG A 1 429 ? 140.875 168.101 132.819 1.00 410.76 ? 429 ARG A CD  1 
ATOM 3078  N NE  . ARG A 1 429 ? 141.595 167.171 133.672 1.00 341.16 ? 429 ARG A NE  1 
ATOM 3079  C CZ  . ARG A 1 429 ? 142.651 166.471 133.282 1.00 327.74 ? 429 ARG A CZ  1 
ATOM 3080  N NH1 . ARG A 1 429 ? 143.124 166.538 132.035 1.00 343.52 ? 429 ARG A NH1 1 
ATOM 3081  N NH2 . ARG A 1 429 ? 143.232 165.674 134.157 1.00 345.55 ? 429 ARG A NH2 1 
ATOM 3082  N N   . PHE A 1 430 ? 139.825 172.057 134.184 1.00 293.90 ? 430 PHE A N   1 
ATOM 3083  C CA  . PHE A 1 430 ? 139.784 173.183 133.240 1.00 358.59 ? 430 PHE A CA  1 
ATOM 3084  C C   . PHE A 1 430 ? 141.081 173.994 133.279 1.00 370.61 ? 430 PHE A C   1 
ATOM 3085  O O   . PHE A 1 430 ? 141.708 174.264 132.243 1.00 313.47 ? 430 PHE A O   1 
ATOM 3086  C CB  . PHE A 1 430 ? 138.591 174.111 133.532 1.00 386.78 ? 430 PHE A CB  1 
ATOM 3087  C CG  . PHE A 1 430 ? 137.280 173.614 132.992 1.00 379.05 ? 430 PHE A CG  1 
ATOM 3088  C CD1 . PHE A 1 430 ? 136.598 172.571 133.619 1.00 376.83 ? 430 PHE A CD1 1 
ATOM 3089  C CD2 . PHE A 1 430 ? 136.715 174.198 131.860 1.00 378.20 ? 430 PHE A CD2 1 
ATOM 3090  C CE1 . PHE A 1 430 ? 135.388 172.114 133.121 1.00 400.29 ? 430 PHE A CE1 1 
ATOM 3091  C CE2 . PHE A 1 430 ? 135.504 173.747 131.360 1.00 391.38 ? 430 PHE A CE2 1 
ATOM 3092  C CZ  . PHE A 1 430 ? 134.838 172.704 131.991 1.00 416.07 ? 430 PHE A CZ  1 
ATOM 3093  N N   . LEU A 1 431 ? 141.487 174.335 134.499 1.00 387.87 ? 431 LEU A N   1 
ATOM 3094  C CA  . LEU A 1 431 ? 142.632 175.209 134.748 1.00 389.94 ? 431 LEU A CA  1 
ATOM 3095  C C   . LEU A 1 431 ? 143.886 174.853 133.952 1.00 385.43 ? 431 LEU A C   1 
ATOM 3096  O O   . LEU A 1 431 ? 144.670 175.742 133.629 1.00 411.84 ? 431 LEU A O   1 
ATOM 3097  C CB  . LEU A 1 431 ? 142.949 175.259 136.249 1.00 388.80 ? 431 LEU A CB  1 
ATOM 3098  C CG  . LEU A 1 431 ? 142.171 176.245 137.138 1.00 406.98 ? 431 LEU A CG  1 
ATOM 3099  C CD1 . LEU A 1 431 ? 140.708 176.455 136.753 1.00 403.46 ? 431 LEU A CD1 1 
ATOM 3100  C CD2 . LEU A 1 431 ? 142.274 175.821 138.599 1.00 398.33 ? 431 LEU A CD2 1 
ATOM 3101  N N   . ARG A 1 432 ? 144.071 173.566 133.647 1.00 405.75 ? 432 ARG A N   1 
ATOM 3102  C CA  . ARG A 1 432 ? 145.174 173.106 132.792 1.00 419.08 ? 432 ARG A CA  1 
ATOM 3103  C C   . ARG A 1 432 ? 145.270 173.894 131.486 1.00 426.30 ? 432 ARG A C   1 
ATOM 3104  O O   . ARG A 1 432 ? 146.373 174.214 131.041 1.00 463.41 ? 432 ARG A O   1 
ATOM 3105  C CB  . ARG A 1 432 ? 145.036 171.612 132.471 1.00 415.48 ? 432 ARG A CB  1 
ATOM 3106  C CG  . ARG A 1 432 ? 145.381 170.693 133.631 1.00 430.24 ? 432 ARG A CG  1 
ATOM 3107  C CD  . ARG A 1 432 ? 145.090 169.243 133.300 1.00 467.83 ? 432 ARG A CD  1 
ATOM 3108  N NE  . ARG A 1 432 ? 145.877 168.325 134.125 1.00 500.00 ? 432 ARG A NE  1 
ATOM 3109  C CZ  . ARG A 1 432 ? 147.164 168.016 133.930 1.00 500.00 ? 432 ARG A CZ  1 
ATOM 3110  N NH1 . ARG A 1 432 ? 147.866 168.556 132.929 1.00 500.00 ? 432 ARG A NH1 1 
ATOM 3111  N NH2 . ARG A 1 432 ? 147.765 167.158 134.756 1.00 500.00 ? 432 ARG A NH2 1 
ATOM 3112  N N   . ALA A 1 433 ? 144.120 174.206 130.892 1.00 395.35 ? 433 ALA A N   1 
ATOM 3113  C CA  . ALA A 1 433 ? 144.082 174.911 129.613 1.00 423.08 ? 433 ALA A CA  1 
ATOM 3114  C C   . ALA A 1 433 ? 144.187 176.422 129.796 1.00 430.96 ? 433 ALA A C   1 
ATOM 3115  O O   . ALA A 1 433 ? 145.191 177.023 129.402 1.00 447.67 ? 433 ALA A O   1 
ATOM 3116  C CB  . ALA A 1 433 ? 142.823 174.546 128.840 1.00 444.32 ? 433 ALA A CB  1 
ATOM 3117  N N   . ARG A 1 434 ? 143.159 177.023 130.392 1.00 437.66 ? 434 ARG A N   1 
ATOM 3118  C CA  . ARG A 1 434 ? 143.074 178.478 130.565 1.00 465.55 ? 434 ARG A CA  1 
ATOM 3119  C C   . ARG A 1 434 ? 143.143 178.815 132.045 1.00 453.44 ? 434 ARG A C   1 
ATOM 3120  O O   . ARG A 1 434 ? 142.796 177.988 132.886 1.00 444.55 ? 434 ARG A O   1 
ATOM 3121  C CB  . ARG A 1 434 ? 141.776 179.005 129.945 1.00 487.31 ? 434 ARG A CB  1 
ATOM 3122  C CG  . ARG A 1 434 ? 141.677 180.522 129.861 1.00 485.97 ? 434 ARG A CG  1 
ATOM 3123  C CD  . ARG A 1 434 ? 140.469 180.971 129.047 1.00 484.56 ? 434 ARG A CD  1 
ATOM 3124  N NE  . ARG A 1 434 ? 140.677 182.284 128.433 1.00 493.30 ? 434 ARG A NE  1 
ATOM 3125  C CZ  . ARG A 1 434 ? 141.431 182.524 127.355 1.00 500.00 ? 434 ARG A CZ  1 
ATOM 3126  N NH1 . ARG A 1 434 ? 142.087 181.542 126.727 1.00 494.15 ? 434 ARG A NH1 1 
ATOM 3127  N NH2 . ARG A 1 434 ? 141.539 183.770 126.897 1.00 500.00 ? 434 ARG A NH2 1 
ATOM 3128  N N   . ASN A 1 435 ? 143.583 180.034 132.358 1.00 434.12 ? 435 ASN A N   1 
ATOM 3129  C CA  . ASN A 1 435 ? 143.780 180.451 133.750 1.00 435.51 ? 435 ASN A CA  1 
ATOM 3130  C C   . ASN A 1 435 ? 142.449 180.547 134.500 1.00 453.75 ? 435 ASN A C   1 
ATOM 3131  O O   . ASN A 1 435 ? 142.299 179.948 135.565 1.00 484.11 ? 435 ASN A O   1 
ATOM 3132  C CB  . ASN A 1 435 ? 144.554 181.769 133.823 1.00 430.78 ? 435 ASN A CB  1 
ATOM 3133  C CG  . ASN A 1 435 ? 145.952 181.659 133.224 1.00 439.78 ? 435 ASN A CG  1 
ATOM 3134  O OD1 . ASN A 1 435 ? 146.095 181.442 132.016 1.00 406.44 ? 435 ASN A OD1 1 
ATOM 3135  N ND2 . ASN A 1 435 ? 146.994 181.813 134.066 1.00 454.67 ? 435 ASN A ND2 1 
ATOM 3136  N N   . ILE A 1 436 ? 141.505 181.300 133.933 1.00 450.45 ? 436 ILE A N   1 
ATOM 3137  C CA  . ILE A 1 436 ? 140.079 181.295 134.333 1.00 471.28 ? 436 ILE A CA  1 
ATOM 3138  C C   . ILE A 1 436 ? 139.763 181.906 135.713 1.00 447.11 ? 436 ILE A C   1 
ATOM 3139  O O   . ILE A 1 436 ? 140.372 181.552 136.731 1.00 379.31 ? 436 ILE A O   1 
ATOM 3140  C CB  . ILE A 1 436 ? 139.450 179.869 134.280 1.00 500.00 ? 436 ILE A CB  1 
ATOM 3141  C CG1 . ILE A 1 436 ? 139.685 179.209 132.918 1.00 493.41 ? 436 ILE A CG1 1 
ATOM 3142  C CG2 . ILE A 1 436 ? 137.944 179.917 134.567 1.00 500.00 ? 436 ILE A CG2 1 
ATOM 3143  C CD1 . ILE A 1 436 ? 139.652 177.695 132.961 1.00 484.36 ? 436 ILE A CD1 1 
ATOM 3144  N N   . SER A 1 437 ? 138.775 182.801 135.731 1.00 441.42 ? 437 SER A N   1 
ATOM 3145  C CA  . SER A 1 437 ? 138.152 183.242 136.977 1.00 453.74 ? 437 SER A CA  1 
ATOM 3146  C C   . SER A 1 437 ? 137.253 182.108 137.461 1.00 430.12 ? 437 SER A C   1 
ATOM 3147  O O   . SER A 1 437 ? 136.231 181.816 136.835 1.00 425.38 ? 437 SER A O   1 
ATOM 3148  C CB  . SER A 1 437 ? 137.332 184.516 136.758 1.00 479.28 ? 437 SER A CB  1 
ATOM 3149  O OG  . SER A 1 437 ? 138.119 185.520 136.144 1.00 500.00 ? 437 SER A OG  1 
ATOM 3150  N N   . GLY A 1 438 ? 137.647 181.463 138.558 1.00 399.66 ? 438 GLY A N   1 
ATOM 3151  C CA  . GLY A 1 438 ? 136.940 180.285 139.057 1.00 386.50 ? 438 GLY A CA  1 
ATOM 3152  C C   . GLY A 1 438 ? 136.825 180.206 140.563 1.00 361.01 ? 438 GLY A C   1 
ATOM 3153  O O   . GLY A 1 438 ? 137.514 180.918 141.294 1.00 399.30 ? 438 GLY A O   1 
ATOM 3154  N N   . VAL A 1 439 ? 135.940 179.316 141.007 1.00 327.44 ? 439 VAL A N   1 
ATOM 3155  C CA  . VAL A 1 439 ? 135.642 179.083 142.416 1.00 342.22 ? 439 VAL A CA  1 
ATOM 3156  C C   . VAL A 1 439 ? 135.551 177.586 142.654 1.00 336.65 ? 439 VAL A C   1 
ATOM 3157  O O   . VAL A 1 439 ? 135.211 176.834 141.741 1.00 375.79 ? 439 VAL A O   1 
ATOM 3158  C CB  . VAL A 1 439 ? 134.269 179.707 142.794 1.00 370.40 ? 439 VAL A CB  1 
ATOM 3159  C CG1 . VAL A 1 439 ? 133.745 179.214 144.151 1.00 359.54 ? 439 VAL A CG1 1 
ATOM 3160  C CG2 . VAL A 1 439 ? 134.342 181.231 142.769 1.00 403.81 ? 439 VAL A CG2 1 
ATOM 3161  N N   . VAL A 1 440 ? 135.836 177.166 143.882 1.00 352.34 ? 440 VAL A N   1 
ATOM 3162  C CA  . VAL A 1 440 ? 135.262 175.929 144.404 1.00 376.83 ? 440 VAL A CA  1 
ATOM 3163  C C   . VAL A 1 440 ? 134.594 176.183 145.740 1.00 334.98 ? 440 VAL A C   1 
ATOM 3164  O O   . VAL A 1 440 ? 135.254 176.587 146.698 1.00 359.13 ? 440 VAL A O   1 
ATOM 3165  C CB  . VAL A 1 440 ? 136.294 174.804 144.610 1.00 396.77 ? 440 VAL A CB  1 
ATOM 3166  C CG1 . VAL A 1 440 ? 135.575 173.490 144.946 1.00 372.34 ? 440 VAL A CG1 1 
ATOM 3167  C CG2 . VAL A 1 440 ? 137.208 174.686 143.396 1.00 408.78 ? 440 VAL A CG2 1 
ATOM 3168  N N   . LEU A 1 441 ? 133.290 175.943 145.804 1.00 331.46 ? 441 LEU A N   1 
ATOM 3169  C CA  . LEU A 1 441 ? 132.610 175.906 147.088 1.00 348.92 ? 441 LEU A CA  1 
ATOM 3170  C C   . LEU A 1 441 ? 132.856 174.547 147.710 1.00 351.20 ? 441 LEU A C   1 
ATOM 3171  O O   . LEU A 1 441 ? 133.207 173.581 147.011 1.00 321.63 ? 441 LEU A O   1 
ATOM 3172  C CB  . LEU A 1 441 ? 131.118 176.179 146.937 1.00 372.94 ? 441 LEU A CB  1 
ATOM 3173  C CG  . LEU A 1 441 ? 130.803 177.568 146.371 1.00 423.72 ? 441 LEU A CG  1 
ATOM 3174  C CD1 . LEU A 1 441 ? 129.317 177.696 146.082 1.00 477.78 ? 441 LEU A CD1 1 
ATOM 3175  C CD2 . LEU A 1 441 ? 131.263 178.678 147.309 1.00 430.96 ? 441 LEU A CD2 1 
ATOM 3176  N N   . ALA A 1 442 ? 132.671 174.488 149.027 1.00 390.27 ? 442 ALA A N   1 
ATOM 3177  C CA  . ALA A 1 442 ? 132.993 173.294 149.800 1.00 412.64 ? 442 ALA A CA  1 
ATOM 3178  C C   . ALA A 1 442 ? 132.309 173.266 151.158 1.00 384.17 ? 442 ALA A C   1 
ATOM 3179  O O   . ALA A 1 442 ? 132.280 174.264 151.860 1.00 361.62 ? 442 ALA A O   1 
ATOM 3180  C CB  . ALA A 1 442 ? 134.499 173.208 149.992 1.00 423.32 ? 442 ALA A CB  1 
ATOM 3181  N N   . ASP A 1 443 ? 131.753 172.114 151.518 1.00 367.70 ? 443 ASP A N   1 
ATOM 3182  C CA  . ASP A 1 443 ? 131.458 171.811 152.916 1.00 395.06 ? 443 ASP A CA  1 
ATOM 3183  C C   . ASP A 1 443 ? 132.771 171.796 153.704 1.00 384.33 ? 443 ASP A C   1 
ATOM 3184  O O   . ASP A 1 443 ? 132.835 172.312 154.822 1.00 406.94 ? 443 ASP A O   1 
ATOM 3185  C CB  . ASP A 1 443 ? 130.711 170.470 153.051 1.00 432.06 ? 443 ASP A CB  1 
ATOM 3186  C CG  . ASP A 1 443 ? 131.139 169.670 154.275 1.00 477.56 ? 443 ASP A CG  1 
ATOM 3187  O OD1 . ASP A 1 443 ? 130.824 170.095 155.405 1.00 469.61 ? 443 ASP A OD1 1 
ATOM 3188  O OD2 . ASP A 1 443 ? 131.792 168.619 154.102 1.00 500.00 ? 443 ASP A OD2 1 
ATOM 3189  N N   . HIS A 1 444 ? 133.806 171.204 153.110 1.00 371.51 ? 444 HIS A N   1 
ATOM 3190  C CA  . HIS A 1 444 ? 135.094 171.033 153.775 1.00 392.10 ? 444 HIS A CA  1 
ATOM 3191  C C   . HIS A 1 444 ? 135.875 172.331 153.932 1.00 397.32 ? 444 HIS A C   1 
ATOM 3192  O O   . HIS A 1 444 ? 135.803 173.216 153.080 1.00 373.55 ? 444 HIS A O   1 
ATOM 3193  C CB  . HIS A 1 444 ? 135.957 170.016 153.024 1.00 414.12 ? 444 HIS A CB  1 
ATOM 3194  C CG  . HIS A 1 444 ? 136.451 170.498 151.696 1.00 418.27 ? 444 HIS A CG  1 
ATOM 3195  N ND1 . HIS A 1 444 ? 135.830 170.171 150.511 1.00 443.43 ? 444 HIS A ND1 1 
ATOM 3196  C CD2 . HIS A 1 444 ? 137.503 171.283 151.366 1.00 406.72 ? 444 HIS A CD2 1 
ATOM 3197  C CE1 . HIS A 1 444 ? 136.486 170.728 149.507 1.00 468.71 ? 444 HIS A CE1 1 
ATOM 3198  N NE2 . HIS A 1 444 ? 137.497 171.419 150.001 1.00 443.45 ? 444 HIS A NE2 1 
ATOM 3199  N N   . SER A 1 445 ? 136.626 172.418 155.029 1.00 421.95 ? 445 SER A N   1 
ATOM 3200  C CA  . SER A 1 445 ? 137.600 173.484 155.234 1.00 424.04 ? 445 SER A CA  1 
ATOM 3201  C C   . SER A 1 445 ? 138.735 173.265 154.244 1.00 411.74 ? 445 SER A C   1 
ATOM 3202  O O   . SER A 1 445 ? 138.803 173.949 153.228 1.00 393.14 ? 445 SER A O   1 
ATOM 3203  C CB  . SER A 1 445 ? 138.115 173.479 156.678 1.00 448.01 ? 445 SER A CB  1 
ATOM 3204  O OG  . SER A 1 445 ? 138.610 172.198 157.045 1.00 418.47 ? 445 SER A OG  1 
ATOM 3205  N N   . GLY A 1 446 ? 139.602 172.296 154.545 1.00 414.54 ? 446 GLY A N   1 
ATOM 3206  C CA  . GLY A 1 446 ? 140.598 171.777 153.608 1.00 413.44 ? 446 GLY A CA  1 
ATOM 3207  C C   . GLY A 1 446 ? 140.463 170.269 153.579 1.00 396.70 ? 446 GLY A C   1 
ATOM 3208  O O   . GLY A 1 446 ? 139.958 169.693 152.609 1.00 305.02 ? 446 GLY A O   1 
ATOM 3209  N N   . ALA A 1 447 ? 140.900 169.635 154.665 1.00 420.03 ? 447 ALA A N   1 
ATOM 3210  C CA  . ALA A 1 447 ? 140.661 168.210 154.887 1.00 443.68 ? 447 ALA A CA  1 
ATOM 3211  C C   . ALA A 1 447 ? 139.156 167.956 154.987 1.00 412.32 ? 447 ALA A C   1 
ATOM 3212  O O   . ALA A 1 447 ? 138.432 168.751 155.595 1.00 401.86 ? 447 ALA A O   1 
ATOM 3213  C CB  . ALA A 1 447 ? 141.366 167.739 156.151 1.00 466.94 ? 447 ALA A CB  1 
ATOM 3214  N N   . PHE A 1 448 ? 138.691 166.853 154.400 1.00 408.11 ? 448 PHE A N   1 
ATOM 3215  C CA  . PHE A 1 448 ? 137.239 166.619 154.276 1.00 407.59 ? 448 PHE A CA  1 
ATOM 3216  C C   . PHE A 1 448 ? 136.544 166.233 155.578 1.00 418.86 ? 448 PHE A C   1 
ATOM 3217  O O   . PHE A 1 448 ? 137.161 165.690 156.500 1.00 405.65 ? 448 PHE A O   1 
ATOM 3218  C CB  . PHE A 1 448 ? 136.932 165.529 153.252 1.00 389.00 ? 448 PHE A CB  1 
ATOM 3219  C CG  . PHE A 1 448 ? 137.566 165.754 151.918 1.00 344.82 ? 448 PHE A CG  1 
ATOM 3220  C CD1 . PHE A 1 448 ? 137.348 166.929 151.223 1.00 381.39 ? 448 PHE A CD1 1 
ATOM 3221  C CD2 . PHE A 1 448 ? 138.375 164.786 151.356 1.00 307.88 ? 448 PHE A CD2 1 
ATOM 3222  C CE1 . PHE A 1 448 ? 137.928 167.135 149.983 1.00 384.66 ? 448 PHE A CE1 1 
ATOM 3223  C CE2 . PHE A 1 448 ? 138.955 164.982 150.125 1.00 324.58 ? 448 PHE A CE2 1 
ATOM 3224  C CZ  . PHE A 1 448 ? 138.731 166.160 149.434 1.00 343.42 ? 448 PHE A CZ  1 
ATOM 3225  N N   . HIS A 1 449 ? 135.237 166.494 155.612 1.00 422.37 ? 449 HIS A N   1 
ATOM 3226  C CA  . HIS A 1 449 ? 134.355 166.024 156.680 1.00 450.83 ? 449 HIS A CA  1 
ATOM 3227  C C   . HIS A 1 449 ? 133.690 164.696 156.292 1.00 430.34 ? 449 HIS A C   1 
ATOM 3228  O O   . HIS A 1 449 ? 132.721 164.276 156.932 1.00 446.48 ? 449 HIS A O   1 
ATOM 3229  C CB  . HIS A 1 449 ? 133.268 167.072 156.975 1.00 473.77 ? 449 HIS A CB  1 
ATOM 3230  C CG  . HIS A 1 449 ? 133.803 168.392 157.442 1.00 484.83 ? 449 HIS A CG  1 
ATOM 3231  N ND1 . HIS A 1 449 ? 134.477 168.544 158.636 1.00 500.00 ? 449 HIS A ND1 1 
ATOM 3232  C CD2 . HIS A 1 449 ? 133.740 169.625 156.888 1.00 456.36 ? 449 HIS A CD2 1 
ATOM 3233  C CE1 . HIS A 1 449 ? 134.824 169.810 158.786 1.00 476.65 ? 449 HIS A CE1 1 
ATOM 3234  N NE2 . HIS A 1 449 ? 134.388 170.486 157.738 1.00 474.22 ? 449 HIS A NE2 1 
ATOM 3235  N N   . ASN A 1 450 ? 134.229 164.018 155.276 1.00 405.09 ? 450 ASN A N   1 
ATOM 3236  C CA  . ASN A 1 450 ? 133.506 162.950 154.589 1.00 418.14 ? 450 ASN A CA  1 
ATOM 3237  C C   . ASN A 1 450 ? 133.534 161.670 155.441 1.00 398.68 ? 450 ASN A C   1 
ATOM 3238  O O   . ASN A 1 450 ? 132.473 161.138 155.790 1.00 320.27 ? 450 ASN A O   1 
ATOM 3239  C CB  . ASN A 1 450 ? 134.093 162.721 153.165 1.00 412.63 ? 450 ASN A CB  1 
ATOM 3240  C CG  . ASN A 1 450 ? 133.022 162.514 152.076 1.00 371.82 ? 450 ASN A CG  1 
ATOM 3241  O OD1 . ASN A 1 450 ? 133.037 163.186 151.037 1.00 275.41 ? 450 ASN A OD1 1 
ATOM 3242  N ND2 . ASN A 1 450 ? 132.123 161.563 152.289 1.00 381.87 ? 450 ASN A ND2 1 
ATOM 3243  N N   . LYS A 1 451 ? 134.737 161.195 155.776 1.00 408.89 ? 451 LYS A N   1 
ATOM 3244  C CA  . LYS A 1 451 ? 134.968 159.874 156.417 1.00 428.69 ? 451 LYS A CA  1 
ATOM 3245  C C   . LYS A 1 451 ? 134.554 158.691 155.542 1.00 395.81 ? 451 LYS A C   1 
ATOM 3246  O O   . LYS A 1 451 ? 135.232 157.663 155.525 1.00 388.95 ? 451 LYS A O   1 
ATOM 3247  C CB  . LYS A 1 451 ? 134.296 159.740 157.793 1.00 472.13 ? 451 LYS A CB  1 
ATOM 3248  C CG  . LYS A 1 451 ? 134.857 160.656 158.871 1.00 500.00 ? 451 LYS A CG  1 
ATOM 3249  C CD  . LYS A 1 451 ? 134.781 160.036 160.265 1.00 500.00 ? 451 LYS A CD  1 
ATOM 3250  C CE  . LYS A 1 451 ? 133.358 159.691 160.688 1.00 500.00 ? 451 LYS A CE  1 
ATOM 3251  N NZ  . LYS A 1 451 ? 133.268 159.297 162.123 1.00 500.00 ? 451 LYS A NZ  1 
ATOM 3252  N N   . TYR A 1 452 ? 133.413 158.829 154.873 1.00 365.30 ? 452 TYR A N   1 
ATOM 3253  C CA  . TYR A 1 452 ? 132.965 157.906 153.850 1.00 370.30 ? 452 TYR A CA  1 
ATOM 3254  C C   . TYR A 1 452 ? 133.020 158.570 152.460 1.00 351.53 ? 452 TYR A C   1 
ATOM 3255  O O   . TYR A 1 452 ? 131.987 158.833 151.838 1.00 381.92 ? 452 TYR A O   1 
ATOM 3256  C CB  . TYR A 1 452 ? 131.553 157.446 154.204 1.00 365.80 ? 452 TYR A CB  1 
ATOM 3257  C CG  . TYR A 1 452 ? 131.424 157.026 155.652 1.00 384.92 ? 452 TYR A CG  1 
ATOM 3258  C CD1 . TYR A 1 452 ? 132.263 156.044 156.187 1.00 392.30 ? 452 TYR A CD1 1 
ATOM 3259  C CD2 . TYR A 1 452 ? 130.469 157.607 156.492 1.00 386.81 ? 452 TYR A CD2 1 
ATOM 3260  C CE1 . TYR A 1 452 ? 132.144 155.642 157.510 1.00 419.51 ? 452 TYR A CE1 1 
ATOM 3261  C CE2 . TYR A 1 452 ? 130.339 157.212 157.817 1.00 429.78 ? 452 TYR A CE2 1 
ATOM 3262  C CZ  . TYR A 1 452 ? 131.182 156.231 158.325 1.00 452.87 ? 452 TYR A CZ  1 
ATOM 3263  O OH  . TYR A 1 452 ? 131.064 155.829 159.637 1.00 437.21 ? 452 TYR A OH  1 
ATOM 3264  N N   . TYR A 1 453 ? 134.244 158.815 151.979 1.00 281.80 ? 453 TYR A N   1 
ATOM 3265  C CA  . TYR A 1 453 ? 134.497 159.478 150.684 1.00 300.97 ? 453 TYR A CA  1 
ATOM 3266  C C   . TYR A 1 453 ? 134.590 158.510 149.496 1.00 326.15 ? 453 TYR A C   1 
ATOM 3267  O O   . TYR A 1 453 ? 135.571 157.758 149.363 1.00 286.19 ? 453 TYR A O   1 
ATOM 3268  C CB  . TYR A 1 453 ? 135.790 160.289 150.760 1.00 351.61 ? 453 TYR A CB  1 
ATOM 3269  C CG  . TYR A 1 453 ? 136.174 160.999 149.481 1.00 345.32 ? 453 TYR A CG  1 
ATOM 3270  C CD1 . TYR A 1 453 ? 135.257 161.824 148.809 1.00 307.77 ? 453 TYR A CD1 1 
ATOM 3271  C CD2 . TYR A 1 453 ? 137.467 160.879 148.958 1.00 330.44 ? 453 TYR A CD2 1 
ATOM 3272  C CE1 . TYR A 1 453 ? 135.606 162.483 147.642 1.00 311.12 ? 453 TYR A CE1 1 
ATOM 3273  C CE2 . TYR A 1 453 ? 137.827 161.539 147.796 1.00 379.12 ? 453 TYR A CE2 1 
ATOM 3274  C CZ  . TYR A 1 453 ? 136.898 162.340 147.137 1.00 361.84 ? 453 TYR A CZ  1 
ATOM 3275  O OH  . TYR A 1 453 ? 137.252 162.994 145.976 1.00 337.02 ? 453 TYR A OH  1 
ATOM 3276  N N   . GLN A 1 454 ? 133.589 158.596 148.611 1.00 374.40 ? 454 GLN A N   1 
ATOM 3277  C CA  . GLN A 1 454 ? 133.320 157.607 147.557 1.00 390.03 ? 454 GLN A CA  1 
ATOM 3278  C C   . GLN A 1 454 ? 133.612 156.216 148.105 1.00 405.26 ? 454 GLN A C   1 
ATOM 3279  O O   . GLN A 1 454 ? 134.547 155.519 147.698 1.00 387.56 ? 454 GLN A O   1 
ATOM 3280  C CB  . GLN A 1 454 ? 134.001 157.928 146.211 1.00 389.59 ? 454 GLN A CB  1 
ATOM 3281  C CG  . GLN A 1 454 ? 135.370 158.591 146.260 1.00 429.30 ? 454 GLN A CG  1 
ATOM 3282  C CD  . GLN A 1 454 ? 135.670 159.394 145.003 1.00 468.19 ? 454 GLN A CD  1 
ATOM 3283  O OE1 . GLN A 1 454 ? 134.886 160.260 144.603 1.00 439.88 ? 454 GLN A OE1 1 
ATOM 3284  N NE2 . GLN A 1 454 ? 136.818 159.125 144.383 1.00 490.17 ? 454 GLN A NE2 1 
ATOM 3285  N N   . SER A 1 455 ? 132.789 155.883 149.095 1.00 403.53 ? 455 SER A N   1 
ATOM 3286  C CA  . SER A 1 455 ? 132.867 154.659 149.856 1.00 373.54 ? 455 SER A CA  1 
ATOM 3287  C C   . SER A 1 455 ? 131.500 154.023 149.812 1.00 343.20 ? 455 SER A C   1 
ATOM 3288  O O   . SER A 1 455 ? 130.555 154.566 149.227 1.00 322.99 ? 455 SER A O   1 
ATOM 3289  C CB  . SER A 1 455 ? 133.220 154.973 151.312 1.00 434.68 ? 455 SER A CB  1 
ATOM 3290  O OG  . SER A 1 455 ? 134.190 155.998 151.400 1.00 484.01 ? 455 SER A OG  1 
ATOM 3291  N N   . ILE A 1 456 ? 131.386 152.908 150.512 1.00 346.54 ? 456 ILE A N   1 
ATOM 3292  C CA  . ILE A 1 456 ? 130.201 152.060 150.464 1.00 369.53 ? 456 ILE A CA  1 
ATOM 3293  C C   . ILE A 1 456 ? 129.020 152.689 151.213 1.00 397.01 ? 456 ILE A C   1 
ATOM 3294  O O   . ILE A 1 456 ? 127.861 152.425 150.875 1.00 397.64 ? 456 ILE A O   1 
ATOM 3295  C CB  . ILE A 1 456 ? 130.549 150.655 151.037 1.00 326.93 ? 456 ILE A CB  1 
ATOM 3296  C CG1 . ILE A 1 456 ? 131.363 149.866 150.010 1.00 355.59 ? 456 ILE A CG1 1 
ATOM 3297  C CG2 . ILE A 1 456 ? 129.309 149.840 151.434 1.00 253.38 ? 456 ILE A CG2 1 
ATOM 3298  C CD1 . ILE A 1 456 ? 132.691 150.473 149.598 1.00 361.19 ? 456 ILE A CD1 1 
ATOM 3299  N N   . TYR A 1 457 ? 129.321 153.559 152.180 1.00 366.01 ? 457 TYR A N   1 
ATOM 3300  C CA  . TYR A 1 457 ? 128.397 153.890 153.256 1.00 312.55 ? 457 TYR A CA  1 
ATOM 3301  C C   . TYR A 1 457 ? 127.857 155.310 153.123 1.00 282.04 ? 457 TYR A C   1 
ATOM 3302  O O   . TYR A 1 457 ? 127.052 155.725 153.954 1.00 306.10 ? 457 TYR A O   1 
ATOM 3303  C CB  . TYR A 1 457 ? 129.063 153.721 154.635 1.00 328.85 ? 457 TYR A CB  1 
ATOM 3304  C CG  . TYR A 1 457 ? 130.024 152.552 154.795 1.00 347.44 ? 457 TYR A CG  1 
ATOM 3305  C CD1 . TYR A 1 457 ? 131.249 152.548 154.121 1.00 373.01 ? 457 TYR A CD1 1 
ATOM 3306  C CD2 . TYR A 1 457 ? 129.744 151.476 155.662 1.00 326.01 ? 457 TYR A CD2 1 
ATOM 3307  C CE1 . TYR A 1 457 ? 132.144 151.512 154.251 1.00 373.29 ? 457 TYR A CE1 1 
ATOM 3308  C CE2 . TYR A 1 457 ? 130.653 150.421 155.805 1.00 361.94 ? 457 TYR A CE2 1 
ATOM 3309  C CZ  . TYR A 1 457 ? 131.859 150.447 155.091 1.00 379.67 ? 457 TYR A CZ  1 
ATOM 3310  O OH  . TYR A 1 457 ? 132.809 149.442 155.184 1.00 295.18 ? 457 TYR A OH  1 
ATOM 3311  N N   . ASP A 1 458 ? 128.246 156.042 152.076 1.00 284.17 ? 458 ASP A N   1 
ATOM 3312  C CA  . ASP A 1 458 ? 127.754 157.420 151.842 1.00 344.50 ? 458 ASP A CA  1 
ATOM 3313  C C   . ASP A 1 458 ? 126.216 157.475 151.460 1.00 297.22 ? 458 ASP A C   1 
ATOM 3314  O O   . ASP A 1 458 ? 125.800 157.940 150.376 1.00 218.19 ? 458 ASP A O   1 
ATOM 3315  C CB  . ASP A 1 458 ? 128.673 158.088 150.795 1.00 391.44 ? 458 ASP A CB  1 
ATOM 3316  C CG  . ASP A 1 458 ? 128.791 159.603 150.962 1.00 414.33 ? 458 ASP A CG  1 
ATOM 3317  O OD1 . ASP A 1 458 ? 127.965 160.227 151.665 1.00 366.05 ? 458 ASP A OD1 1 
ATOM 3318  O OD2 . ASP A 1 458 ? 129.720 160.191 150.366 1.00 420.11 ? 458 ASP A OD2 1 
ATOM 3319  N N   . THR A 1 459 ? 125.384 157.046 152.410 1.00 268.50 ? 459 THR A N   1 
ATOM 3320  C CA  . THR A 1 459 ? 124.034 156.554 152.140 1.00 310.07 ? 459 THR A CA  1 
ATOM 3321  C C   . THR A 1 459 ? 122.942 157.590 152.485 1.00 324.13 ? 459 THR A C   1 
ATOM 3322  O O   . THR A 1 459 ? 122.703 158.517 151.713 1.00 273.84 ? 459 THR A O   1 
ATOM 3323  C CB  . THR A 1 459 ? 123.815 155.230 152.920 1.00 369.81 ? 459 THR A CB  1 
ATOM 3324  O OG1 . THR A 1 459 ? 123.990 155.464 154.324 1.00 369.19 ? 459 THR A OG1 1 
ATOM 3325  C CG2 . THR A 1 459 ? 124.790 154.133 152.477 1.00 409.32 ? 459 THR A CG2 1 
ATOM 3326  N N   . ALA A 1 460 ? 122.239 157.375 153.600 1.00 387.97 ? 460 ALA A N   1 
ATOM 3327  C CA  . ALA A 1 460 ? 121.485 158.406 154.313 1.00 418.47 ? 460 ALA A CA  1 
ATOM 3328  C C   . ALA A 1 460 ? 122.293 158.913 155.516 1.00 418.24 ? 460 ALA A C   1 
ATOM 3329  O O   . ALA A 1 460 ? 122.195 160.085 155.893 1.00 368.87 ? 460 ALA A O   1 
ATOM 3330  C CB  . ALA A 1 460 ? 120.145 157.840 154.779 1.00 421.92 ? 460 ALA A CB  1 
ATOM 3331  N N   . GLU A 1 461 ? 123.093 158.019 156.105 1.00 442.03 ? 461 GLU A N   1 
ATOM 3332  C CA  . GLU A 1 461 ? 123.837 158.292 157.337 1.00 456.24 ? 461 GLU A CA  1 
ATOM 3333  C C   . GLU A 1 461 ? 124.767 159.486 157.201 1.00 407.11 ? 461 GLU A C   1 
ATOM 3334  O O   . GLU A 1 461 ? 124.604 160.479 157.909 1.00 388.29 ? 461 GLU A O   1 
ATOM 3335  C CB  . GLU A 1 461 ? 124.650 157.062 157.769 1.00 472.48 ? 461 GLU A CB  1 
ATOM 3336  C CG  . GLU A 1 461 ? 123.801 155.865 158.189 1.00 482.58 ? 461 GLU A CG  1 
ATOM 3337  C CD  . GLU A 1 461 ? 124.612 154.745 158.814 1.00 465.86 ? 461 GLU A CD  1 
ATOM 3338  O OE1 . GLU A 1 461 ? 125.852 154.742 158.674 1.00 439.72 ? 461 GLU A OE1 1 
ATOM 3339  O OE2 . GLU A 1 461 ? 124.002 153.859 159.447 1.00 456.33 ? 461 GLU A OE2 1 
ATOM 3340  N N   . ASN A 1 462 ? 125.713 159.396 156.273 1.00 396.29 ? 462 ASN A N   1 
ATOM 3341  C CA  . ASN A 1 462 ? 126.726 160.438 156.113 1.00 441.08 ? 462 ASN A CA  1 
ATOM 3342  C C   . ASN A 1 462 ? 126.159 161.786 155.654 1.00 414.12 ? 462 ASN A C   1 
ATOM 3343  O O   . ASN A 1 462 ? 126.657 162.840 156.058 1.00 420.52 ? 462 ASN A O   1 
ATOM 3344  C CB  . ASN A 1 462 ? 127.826 159.989 155.150 1.00 472.96 ? 462 ASN A CB  1 
ATOM 3345  C CG  . ASN A 1 462 ? 129.109 160.785 155.322 1.00 494.84 ? 462 ASN A CG  1 
ATOM 3346  O OD1 . ASN A 1 462 ? 129.661 160.865 156.419 1.00 500.00 ? 462 ASN A OD1 1 
ATOM 3347  N ND2 . ASN A 1 462 ? 129.590 161.371 154.238 1.00 494.91 ? 462 ASN A ND2 1 
ATOM 3348  N N   . ILE A 1 463 ? 125.136 161.749 154.808 1.00 377.26 ? 463 ILE A N   1 
ATOM 3349  C CA  . ILE A 1 463 ? 124.450 162.973 154.395 1.00 395.64 ? 463 ILE A CA  1 
ATOM 3350  C C   . ILE A 1 463 ? 123.449 163.458 155.457 1.00 404.02 ? 463 ILE A C   1 
ATOM 3351  O O   . ILE A 1 463 ? 123.066 164.627 155.439 1.00 468.02 ? 463 ILE A O   1 
ATOM 3352  C CB  . ILE A 1 463 ? 123.789 162.813 153.000 1.00 428.10 ? 463 ILE A CB  1 
ATOM 3353  C CG1 . ILE A 1 463 ? 123.511 164.191 152.357 1.00 427.95 ? 463 ILE A CG1 1 
ATOM 3354  C CG2 . ILE A 1 463 ? 122.528 161.964 153.071 1.00 412.84 ? 463 ILE A CG2 1 
ATOM 3355  C CD1 . ILE A 1 463 ? 122.814 164.149 151.007 1.00 383.05 ? 463 ILE A CD1 1 
ATOM 3356  N N   . ASN A 1 464 ? 123.033 162.573 156.370 1.00 366.78 ? 464 ASN A N   1 
ATOM 3357  C CA  . ASN A 1 464 ? 122.144 162.916 157.509 1.00 438.22 ? 464 ASN A CA  1 
ATOM 3358  C C   . ASN A 1 464 ? 120.658 162.932 157.135 1.00 373.97 ? 464 ASN A C   1 
ATOM 3359  O O   . ASN A 1 464 ? 119.818 163.345 157.940 1.00 365.98 ? 464 ASN A O   1 
ATOM 3360  C CB  . ASN A 1 464 ? 122.537 164.262 158.175 1.00 500.00 ? 464 ASN A CB  1 
ATOM 3361  C CG  . ASN A 1 464 ? 122.245 164.301 159.675 1.00 500.00 ? 464 ASN A CG  1 
ATOM 3362  O OD1 . ASN A 1 464 ? 123.179 164.332 160.482 1.00 500.00 ? 464 ASN A OD1 1 
ATOM 3363  N ND2 . ASN A 1 464 ? 120.948 164.311 160.053 1.00 500.00 ? 464 ASN A ND2 1 
ATOM 3364  N N   . VAL A 1 465 ? 120.326 162.466 155.937 1.00 330.98 ? 465 VAL A N   1 
ATOM 3365  C CA  . VAL A 1 465 ? 118.940 162.412 155.502 1.00 356.83 ? 465 VAL A CA  1 
ATOM 3366  C C   . VAL A 1 465 ? 118.219 161.318 156.285 1.00 411.19 ? 465 VAL A C   1 
ATOM 3367  O O   . VAL A 1 465 ? 118.784 160.258 156.567 1.00 453.72 ? 465 VAL A O   1 
ATOM 3368  C CB  . VAL A 1 465 ? 118.829 162.117 153.992 1.00 367.45 ? 465 VAL A CB  1 
ATOM 3369  C CG1 . VAL A 1 465 ? 117.389 161.773 153.589 1.00 355.93 ? 465 VAL A CG1 1 
ATOM 3370  C CG2 . VAL A 1 465 ? 119.354 163.298 153.186 1.00 370.70 ? 465 VAL A CG2 1 
ATOM 3371  N N   . SER A 1 466 ? 116.977 161.600 156.643 1.00 421.60 ? 466 SER A N   1 
ATOM 3372  C CA  . SER A 1 466 ? 116.089 160.600 157.206 1.00 438.04 ? 466 SER A CA  1 
ATOM 3373  C C   . SER A 1 466 ? 114.661 161.068 157.028 1.00 417.32 ? 466 SER A C   1 
ATOM 3374  O O   . SER A 1 466 ? 114.409 162.245 156.752 1.00 384.26 ? 466 SER A O   1 
ATOM 3375  C CB  . SER A 1 466 ? 116.397 160.357 158.690 1.00 460.64 ? 466 SER A CB  1 
ATOM 3376  O OG  . SER A 1 466 ? 116.392 161.568 159.426 1.00 472.16 ? 466 SER A OG  1 
ATOM 3377  N N   . TYR A 1 467 ? 113.737 160.127 157.155 1.00 413.47 ? 467 TYR A N   1 
ATOM 3378  C CA  . TYR A 1 467 ? 112.317 160.427 157.107 1.00 433.50 ? 467 TYR A CA  1 
ATOM 3379  C C   . TYR A 1 467 ? 111.616 159.578 158.172 1.00 452.86 ? 467 TYR A C   1 
ATOM 3380  O O   . TYR A 1 467 ? 112.106 158.494 158.504 1.00 443.86 ? 467 TYR A O   1 
ATOM 3381  C CB  . TYR A 1 467 ? 111.771 160.152 155.703 1.00 454.40 ? 467 TYR A CB  1 
ATOM 3382  C CG  . TYR A 1 467 ? 112.394 161.017 154.613 1.00 456.93 ? 467 TYR A CG  1 
ATOM 3383  C CD1 . TYR A 1 467 ? 111.853 162.260 154.285 1.00 488.13 ? 467 TYR A CD1 1 
ATOM 3384  C CD2 . TYR A 1 467 ? 113.527 160.596 153.915 1.00 446.90 ? 467 TYR A CD2 1 
ATOM 3385  C CE1 . TYR A 1 467 ? 112.418 163.058 153.291 1.00 487.50 ? 467 TYR A CE1 1 
ATOM 3386  C CE2 . TYR A 1 467 ? 114.100 161.387 152.920 1.00 443.70 ? 467 TYR A CE2 1 
ATOM 3387  C CZ  . TYR A 1 467 ? 113.540 162.623 152.608 1.00 453.25 ? 467 TYR A CZ  1 
ATOM 3388  O OH  . TYR A 1 467 ? 114.093 163.423 151.622 1.00 368.54 ? 467 TYR A OH  1 
ATOM 3389  N N   . PRO A 1 468 ? 110.473 160.060 158.717 1.00 465.70 ? 468 PRO A N   1 
ATOM 3390  C CA  . PRO A 1 468 ? 109.837 159.362 159.849 1.00 455.93 ? 468 PRO A CA  1 
ATOM 3391  C C   . PRO A 1 468 ? 109.274 157.984 159.495 1.00 437.80 ? 468 PRO A C   1 
ATOM 3392  O O   . PRO A 1 468 ? 109.136 157.651 158.318 1.00 381.80 ? 468 PRO A O   1 
ATOM 3393  C CB  . PRO A 1 468 ? 108.702 160.313 160.271 1.00 456.09 ? 468 PRO A CB  1 
ATOM 3394  C CG  . PRO A 1 468 ? 108.929 161.585 159.526 1.00 454.17 ? 468 PRO A CG  1 
ATOM 3395  C CD  . PRO A 1 468 ? 109.654 161.203 158.277 1.00 456.20 ? 468 PRO A CD  1 
ATOM 3396  N N   . GLU A 1 469 ? 108.955 157.202 160.522 1.00 475.29 ? 469 GLU A N   1 
ATOM 3397  C CA  . GLU A 1 469 ? 108.537 155.807 160.345 1.00 500.00 ? 469 GLU A CA  1 
ATOM 3398  C C   . GLU A 1 469 ? 107.024 155.668 160.114 1.00 500.00 ? 469 GLU A C   1 
ATOM 3399  O O   . GLU A 1 469 ? 106.585 154.737 159.431 1.00 500.00 ? 469 GLU A O   1 
ATOM 3400  C CB  . GLU A 1 469 ? 108.991 154.958 161.546 1.00 500.00 ? 469 GLU A CB  1 
ATOM 3401  C CG  . GLU A 1 469 ? 109.352 153.517 161.196 1.00 500.00 ? 469 GLU A CG  1 
ATOM 3402  C CD  . GLU A 1 469 ? 110.704 153.378 160.503 1.00 500.00 ? 469 GLU A CD  1 
ATOM 3403  O OE1 . GLU A 1 469 ? 111.716 153.863 161.054 1.00 500.00 ? 469 GLU A OE1 1 
ATOM 3404  O OE2 . GLU A 1 469 ? 110.758 152.768 159.410 1.00 500.00 ? 469 GLU A OE2 1 
ATOM 3405  N N   . TRP A 1 470 ? 106.239 156.579 160.690 1.00 500.00 ? 470 TRP A N   1 
ATOM 3406  C CA  . TRP A 1 470 ? 104.783 156.640 160.444 1.00 500.00 ? 470 TRP A CA  1 
ATOM 3407  C C   . TRP A 1 470 ? 104.472 157.078 159.007 1.00 500.00 ? 470 TRP A C   1 
ATOM 3408  O O   . TRP A 1 470 ? 103.552 156.547 158.381 1.00 479.91 ? 470 TRP A O   1 
ATOM 3409  C CB  . TRP A 1 470 ? 104.044 157.521 161.479 1.00 500.00 ? 470 TRP A CB  1 
ATOM 3410  C CG  . TRP A 1 470 ? 104.521 158.947 161.606 1.00 500.00 ? 470 TRP A CG  1 
ATOM 3411  C CD1 . TRP A 1 470 ? 104.083 160.031 160.894 1.00 500.00 ? 470 TRP A CD1 1 
ATOM 3412  C CD2 . TRP A 1 470 ? 105.511 159.440 162.520 1.00 500.00 ? 470 TRP A CD2 1 
ATOM 3413  N NE1 . TRP A 1 470 ? 104.751 161.165 161.299 1.00 500.00 ? 470 TRP A NE1 1 
ATOM 3414  C CE2 . TRP A 1 470 ? 105.634 160.831 162.293 1.00 500.00 ? 470 TRP A CE2 1 
ATOM 3415  C CE3 . TRP A 1 470 ? 106.315 158.837 163.504 1.00 500.00 ? 470 TRP A CE3 1 
ATOM 3416  C CZ2 . TRP A 1 470 ? 106.532 161.633 163.017 1.00 500.00 ? 470 TRP A CZ2 1 
ATOM 3417  C CZ3 . TRP A 1 470 ? 107.210 159.633 164.224 1.00 500.00 ? 470 TRP A CZ3 1 
ATOM 3418  C CH2 . TRP A 1 470 ? 107.310 161.019 163.975 1.00 500.00 ? 470 TRP A CH2 1 
ATOM 3419  N N   . LEU A 1 471 ? 105.243 158.037 158.496 1.00 455.05 ? 471 LEU A N   1 
ATOM 3420  C CA  . LEU A 1 471 ? 105.279 158.316 157.060 1.00 454.59 ? 471 LEU A CA  1 
ATOM 3421  C C   . LEU A 1 471 ? 106.207 157.299 156.412 1.00 459.86 ? 471 LEU A C   1 
ATOM 3422  O O   . LEU A 1 471 ? 107.017 156.677 157.096 1.00 463.38 ? 471 LEU A O   1 
ATOM 3423  C CB  . LEU A 1 471 ? 105.794 159.727 156.778 1.00 490.95 ? 471 LEU A CB  1 
ATOM 3424  C CG  . LEU A 1 471 ? 105.109 160.903 157.479 1.00 500.00 ? 471 LEU A CG  1 
ATOM 3425  C CD1 . LEU A 1 471 ? 105.656 162.220 156.939 1.00 500.00 ? 471 LEU A CD1 1 
ATOM 3426  C CD2 . LEU A 1 471 ? 103.594 160.848 157.336 1.00 500.00 ? 471 LEU A CD2 1 
ATOM 3427  N N   . SER A 1 472 ? 106.111 157.155 155.094 1.00 467.36 ? 472 SER A N   1 
ATOM 3428  C CA  . SER A 1 472 ? 106.818 156.086 154.362 1.00 482.37 ? 472 SER A CA  1 
ATOM 3429  C C   . SER A 1 472 ? 106.585 156.065 152.851 1.00 450.71 ? 472 SER A C   1 
ATOM 3430  O O   . SER A 1 472 ? 107.555 156.121 152.090 1.00 452.20 ? 472 SER A O   1 
ATOM 3431  C CB  . SER A 1 472 ? 106.503 154.683 154.925 1.00 500.00 ? 472 SER A CB  1 
ATOM 3432  O OG  . SER A 1 472 ? 105.128 154.504 155.211 1.00 500.00 ? 472 SER A OG  1 
ATOM 3433  N N   . PRO A 1 473 ? 105.310 155.972 152.408 1.00 438.49 ? 473 PRO A N   1 
ATOM 3434  C CA  . PRO A 1 473 ? 105.097 155.591 151.007 1.00 459.72 ? 473 PRO A CA  1 
ATOM 3435  C C   . PRO A 1 473 ? 105.463 156.682 149.982 1.00 434.02 ? 473 PRO A C   1 
ATOM 3436  O O   . PRO A 1 473 ? 106.395 156.487 149.192 1.00 396.14 ? 473 PRO A O   1 
ATOM 3437  C CB  . PRO A 1 473 ? 103.598 155.227 150.963 1.00 472.76 ? 473 PRO A CB  1 
ATOM 3438  C CG  . PRO A 1 473 ? 103.007 155.656 152.274 1.00 434.40 ? 473 PRO A CG  1 
ATOM 3439  C CD  . PRO A 1 473 ? 104.048 156.417 153.027 1.00 411.61 ? 473 PRO A CD  1 
ATOM 3440  N N   . GLU A 1 474 ? 104.744 157.806 150.013 1.00 394.28 ? 474 GLU A N   1 
ATOM 3441  C CA  . GLU A 1 474 ? 105.065 158.972 149.179 1.00 390.71 ? 474 GLU A CA  1 
ATOM 3442  C C   . GLU A 1 474 ? 105.507 160.140 150.049 1.00 378.63 ? 474 GLU A C   1 
ATOM 3443  O O   . GLU A 1 474 ? 106.647 160.591 149.922 1.00 326.90 ? 474 GLU A O   1 
ATOM 3444  C CB  . GLU A 1 474 ? 103.916 159.393 148.230 1.00 407.39 ? 474 GLU A CB  1 
ATOM 3445  C CG  . GLU A 1 474 ? 102.490 159.014 148.618 1.00 397.48 ? 474 GLU A CG  1 
ATOM 3446  C CD  . GLU A 1 474 ? 102.132 157.569 148.301 1.00 402.21 ? 474 GLU A CD  1 
ATOM 3447  O OE1 . GLU A 1 474 ? 103.011 156.797 147.863 1.00 393.93 ? 474 GLU A OE1 1 
ATOM 3448  O OE2 . GLU A 1 474 ? 100.954 157.199 148.498 1.00 438.50 ? 474 GLU A OE2 1 
ATOM 3449  N N   . GLU A 1 475 ? 104.605 160.597 150.929 1.00 416.20 ? 475 GLU A N   1 
ATOM 3450  C CA  . GLU A 1 475 ? 104.790 161.761 151.824 1.00 460.73 ? 475 GLU A CA  1 
ATOM 3451  C C   . GLU A 1 475 ? 106.184 162.406 151.831 1.00 470.18 ? 475 GLU A C   1 
ATOM 3452  O O   . GLU A 1 475 ? 106.310 163.616 151.627 1.00 467.88 ? 475 GLU A O   1 
ATOM 3453  C CB  . GLU A 1 475 ? 104.405 161.383 153.268 1.00 472.79 ? 475 GLU A CB  1 
ATOM 3454  C CG  . GLU A 1 475 ? 102.908 161.436 153.584 1.00 459.72 ? 475 GLU A CG  1 
ATOM 3455  C CD  . GLU A 1 475 ? 102.244 160.072 153.710 1.00 431.03 ? 475 GLU A CD  1 
ATOM 3456  O OE1 . GLU A 1 475 ? 102.782 159.191 154.416 1.00 395.80 ? 475 GLU A OE1 1 
ATOM 3457  O OE2 . GLU A 1 475 ? 101.156 159.893 153.121 1.00 427.56 ? 475 GLU A OE2 1 
ATOM 3458  N N   . ASP A 1 476 ? 107.203 161.583 152.091 1.00 448.20 ? 476 ASP A N   1 
ATOM 3459  C CA  . ASP A 1 476 ? 108.630 161.951 151.983 1.00 414.28 ? 476 ASP A CA  1 
ATOM 3460  C C   . ASP A 1 476 ? 108.957 162.930 150.852 1.00 403.93 ? 476 ASP A C   1 
ATOM 3461  O O   . ASP A 1 476 ? 109.681 163.905 151.065 1.00 390.43 ? 476 ASP A O   1 
ATOM 3462  C CB  . ASP A 1 476 ? 109.478 160.694 151.768 1.00 398.36 ? 476 ASP A CB  1 
ATOM 3463  C CG  . ASP A 1 476 ? 109.464 159.755 152.956 1.00 413.14 ? 476 ASP A CG  1 
ATOM 3464  O OD1 . ASP A 1 476 ? 108.483 159.775 153.730 1.00 446.05 ? 476 ASP A OD1 1 
ATOM 3465  O OD2 . ASP A 1 476 ? 110.429 158.978 153.103 1.00 423.34 ? 476 ASP A OD2 1 
ATOM 3466  N N   . LEU A 1 477 ? 108.438 162.645 149.654 1.00 391.43 ? 477 LEU A N   1 
ATOM 3467  C CA  . LEU A 1 477 ? 108.582 163.528 148.484 1.00 415.99 ? 477 LEU A CA  1 
ATOM 3468  C C   . LEU A 1 477 ? 108.304 164.994 148.816 1.00 445.46 ? 477 LEU A C   1 
ATOM 3469  O O   . LEU A 1 477 ? 109.080 165.880 148.448 1.00 429.54 ? 477 LEU A O   1 
ATOM 3470  C CB  . LEU A 1 477 ? 107.630 163.091 147.371 1.00 438.73 ? 477 LEU A CB  1 
ATOM 3471  C CG  . LEU A 1 477 ? 108.018 161.832 146.595 1.00 500.00 ? 477 LEU A CG  1 
ATOM 3472  C CD1 . LEU A 1 477 ? 106.796 161.219 145.923 1.00 500.00 ? 477 LEU A CD1 1 
ATOM 3473  C CD2 . LEU A 1 477 ? 109.095 162.135 145.563 1.00 500.00 ? 477 LEU A CD2 1 
ATOM 3474  N N   . ASN A 1 478 ? 107.196 165.227 149.518 1.00 471.87 ? 478 ASN A N   1 
ATOM 3475  C CA  . ASN A 1 478 ? 106.783 166.568 149.949 1.00 480.93 ? 478 ASN A CA  1 
ATOM 3476  C C   . ASN A 1 478 ? 107.369 166.957 151.309 1.00 469.51 ? 478 ASN A C   1 
ATOM 3477  O O   . ASN A 1 478 ? 107.724 168.123 151.524 1.00 414.55 ? 478 ASN A O   1 
ATOM 3478  C CB  . ASN A 1 478 ? 105.256 166.659 150.021 1.00 486.76 ? 478 ASN A CB  1 
ATOM 3479  C CG  . ASN A 1 478 ? 104.585 166.284 148.715 1.00 497.45 ? 478 ASN A CG  1 
ATOM 3480  O OD1 . ASN A 1 478 ? 104.338 167.140 147.864 1.00 499.11 ? 478 ASN A OD1 1 
ATOM 3481  N ND2 . ASN A 1 478 ? 104.291 164.999 148.546 1.00 499.27 ? 478 ASN A ND2 1 
ATOM 3482  N N   . PHE A 1 479 ? 107.453 165.980 152.216 1.00 450.69 ? 479 PHE A N   1 
ATOM 3483  C CA  . PHE A 1 479 ? 107.878 166.211 153.599 1.00 425.94 ? 479 PHE A CA  1 
ATOM 3484  C C   . PHE A 1 479 ? 109.369 166.520 153.689 1.00 344.76 ? 479 PHE A C   1 
ATOM 3485  O O   . PHE A 1 479 ? 110.197 165.656 153.426 1.00 333.57 ? 479 PHE A O   1 
ATOM 3486  C CB  . PHE A 1 479 ? 107.546 165.003 154.488 1.00 427.66 ? 479 PHE A CB  1 
ATOM 3487  C CG  . PHE A 1 479 ? 107.972 165.182 155.917 1.00 461.74 ? 479 PHE A CG  1 
ATOM 3488  C CD1 . PHE A 1 479 ? 107.256 166.026 156.761 1.00 500.00 ? 479 PHE A CD1 1 
ATOM 3489  C CD2 . PHE A 1 479 ? 109.103 164.540 156.412 1.00 478.98 ? 479 PHE A CD2 1 
ATOM 3490  C CE1 . PHE A 1 479 ? 107.650 166.213 158.078 1.00 500.00 ? 479 PHE A CE1 1 
ATOM 3491  C CE2 . PHE A 1 479 ? 109.502 164.724 157.728 1.00 500.00 ? 479 PHE A CE2 1 
ATOM 3492  C CZ  . PHE A 1 479 ? 108.773 165.561 158.563 1.00 500.00 ? 479 PHE A CZ  1 
ATOM 3493  N N   . VAL A 1 480 ? 109.702 167.750 154.072 1.00 344.30 ? 480 VAL A N   1 
ATOM 3494  C CA  . VAL A 1 480 ? 111.104 168.176 154.146 1.00 408.94 ? 480 VAL A CA  1 
ATOM 3495  C C   . VAL A 1 480 ? 111.792 167.669 155.417 1.00 390.53 ? 480 VAL A C   1 
ATOM 3496  O O   . VAL A 1 480 ? 111.151 167.093 156.303 1.00 316.41 ? 480 VAL A O   1 
ATOM 3497  C CB  . VAL A 1 480 ? 111.279 169.722 154.008 1.00 456.56 ? 480 VAL A CB  1 
ATOM 3498  C CG1 . VAL A 1 480 ? 111.017 170.171 152.574 1.00 443.92 ? 480 VAL A CG1 1 
ATOM 3499  C CG2 . VAL A 1 480 ? 110.406 170.491 154.999 1.00 500.00 ? 480 VAL A CG2 1 
ATOM 3500  N N   . THR A 1 481 ? 113.110 167.872 155.450 1.00 418.14 ? 481 THR A N   1 
ATOM 3501  C CA  . THR A 1 481 ? 113.974 167.623 156.612 1.00 412.22 ? 481 THR A CA  1 
ATOM 3502  C C   . THR A 1 481 ? 114.995 168.771 156.739 1.00 384.50 ? 481 THR A C   1 
ATOM 3503  O O   . THR A 1 481 ? 115.166 169.564 155.817 1.00 343.81 ? 481 THR A O   1 
ATOM 3504  C CB  . THR A 1 481 ? 114.686 166.245 156.521 1.00 403.71 ? 481 THR A CB  1 
ATOM 3505  O OG1 . THR A 1 481 ? 115.864 166.243 157.339 1.00 418.36 ? 481 THR A OG1 1 
ATOM 3506  C CG2 . THR A 1 481 ? 115.078 165.894 155.083 1.00 361.76 ? 481 THR A CG2 1 
ATOM 3507  N N   . ASP A 1 482 ? 115.661 168.847 157.888 1.00 457.70 ? 482 ASP A N   1 
ATOM 3508  C CA  . ASP A 1 482 ? 116.580 169.943 158.206 1.00 500.00 ? 482 ASP A CA  1 
ATOM 3509  C C   . ASP A 1 482 ? 117.703 170.001 157.184 1.00 498.43 ? 482 ASP A C   1 
ATOM 3510  O O   . ASP A 1 482 ? 118.058 171.094 156.707 1.00 492.25 ? 482 ASP A O   1 
ATOM 3511  C CB  . ASP A 1 482 ? 117.157 169.769 159.629 1.00 500.00 ? 482 ASP A CB  1 
ATOM 3512  C CG  . ASP A 1 482 ? 118.001 170.970 160.100 1.00 500.00 ? 482 ASP A CG  1 
ATOM 3513  O OD1 . ASP A 1 482 ? 117.800 172.107 159.611 1.00 500.00 ? 482 ASP A OD1 1 
ATOM 3514  O OD2 . ASP A 1 482 ? 118.868 170.766 160.980 1.00 500.00 ? 482 ASP A OD2 1 
ATOM 3515  N N   . THR A 1 483 ? 118.237 168.815 156.864 1.00 422.50 ? 483 THR A N   1 
ATOM 3516  C CA  . THR A 1 483 ? 119.333 168.698 155.899 1.00 393.93 ? 483 THR A CA  1 
ATOM 3517  C C   . THR A 1 483 ? 118.903 169.251 154.550 1.00 352.46 ? 483 THR A C   1 
ATOM 3518  O O   . THR A 1 483 ? 119.663 170.008 153.916 1.00 367.31 ? 483 THR A O   1 
ATOM 3519  C CB  . THR A 1 483 ? 119.931 167.279 155.810 1.00 371.23 ? 483 THR A CB  1 
ATOM 3520  O OG1 . THR A 1 483 ? 121.259 167.365 155.264 1.00 335.93 ? 483 THR A OG1 1 
ATOM 3521  C CG2 . THR A 1 483 ? 119.050 166.329 154.981 1.00 340.23 ? 483 THR A CG2 1 
ATOM 3522  N N   . ALA A 1 484 ? 117.688 168.876 154.149 1.00 361.46 ? 484 ALA A N   1 
ATOM 3523  C CA  . ALA A 1 484 ? 117.124 169.322 152.868 1.00 419.56 ? 484 ALA A CA  1 
ATOM 3524  C C   . ALA A 1 484 ? 117.039 170.841 152.833 1.00 392.52 ? 484 ALA A C   1 
ATOM 3525  O O   . ALA A 1 484 ? 117.413 171.464 151.836 1.00 300.48 ? 484 ALA A O   1 
ATOM 3526  C CB  . ALA A 1 484 ? 115.758 168.707 152.609 1.00 465.49 ? 484 ALA A CB  1 
ATOM 3527  N N   . LYS A 1 485 ? 116.549 171.393 153.934 1.00 434.06 ? 485 LYS A N   1 
ATOM 3528  C CA  . LYS A 1 485 ? 116.399 172.848 154.094 1.00 466.34 ? 485 LYS A CA  1 
ATOM 3529  C C   . LYS A 1 485 ? 117.746 173.537 153.920 1.00 393.42 ? 485 LYS A C   1 
ATOM 3530  O O   . LYS A 1 485 ? 117.857 174.541 153.209 1.00 334.36 ? 485 LYS A O   1 
ATOM 3531  C CB  . LYS A 1 485 ? 115.769 173.239 155.449 1.00 500.00 ? 485 LYS A CB  1 
ATOM 3532  C CG  . LYS A 1 485 ? 114.274 173.532 155.366 1.00 500.00 ? 485 LYS A CG  1 
ATOM 3533  C CD  . LYS A 1 485 ? 113.704 174.066 156.675 1.00 500.00 ? 485 LYS A CD  1 
ATOM 3534  C CE  . LYS A 1 485 ? 113.490 172.958 157.693 1.00 500.00 ? 485 LYS A CE  1 
ATOM 3535  N NZ  . LYS A 1 485 ? 112.713 173.435 158.871 1.00 500.00 ? 485 LYS A NZ  1 
ATOM 3536  N N   . ALA A 1 486 ? 118.740 172.968 154.588 1.00 398.24 ? 486 ALA A N   1 
ATOM 3537  C CA  . ALA A 1 486 ? 120.115 173.477 154.558 1.00 444.36 ? 486 ALA A CA  1 
ATOM 3538  C C   . ALA A 1 486 ? 120.626 173.515 153.110 1.00 399.21 ? 486 ALA A C   1 
ATOM 3539  O O   . ALA A 1 486 ? 121.207 174.515 152.654 1.00 282.85 ? 486 ALA A O   1 
ATOM 3540  C CB  . ALA A 1 486 ? 121.023 172.630 155.456 1.00 467.61 ? 486 ALA A CB  1 
ATOM 3541  N N   . LEU A 1 487 ? 120.387 172.400 152.430 1.00 377.33 ? 487 LEU A N   1 
ATOM 3542  C CA  . LEU A 1 487 ? 120.801 172.230 151.035 1.00 380.70 ? 487 LEU A CA  1 
ATOM 3543  C C   . LEU A 1 487 ? 120.174 173.300 150.164 1.00 368.44 ? 487 LEU A C   1 
ATOM 3544  O O   . LEU A 1 487 ? 120.836 173.906 149.325 1.00 362.38 ? 487 LEU A O   1 
ATOM 3545  C CB  . LEU A 1 487 ? 120.593 170.808 150.489 1.00 385.06 ? 487 LEU A CB  1 
ATOM 3546  C CG  . LEU A 1 487 ? 121.916 170.020 150.412 1.00 391.57 ? 487 LEU A CG  1 
ATOM 3547  C CD1 . LEU A 1 487 ? 122.468 169.665 151.787 1.00 381.61 ? 487 LEU A CD1 1 
ATOM 3548  C CD2 . LEU A 1 487 ? 121.749 168.774 149.561 1.00 431.59 ? 487 LEU A CD2 1 
ATOM 3549  N N   . ALA A 1 488 ? 118.881 173.523 150.385 1.00 382.24 ? 488 ALA A N   1 
ATOM 3550  C CA  . ALA A 1 488 ? 118.081 174.502 149.659 1.00 385.93 ? 488 ALA A CA  1 
ATOM 3551  C C   . ALA A 1 488 ? 118.673 175.858 149.831 1.00 385.97 ? 488 ALA A C   1 
ATOM 3552  O O   . ALA A 1 488 ? 118.765 176.556 148.820 1.00 334.66 ? 488 ALA A O   1 
ATOM 3553  C CB  . ALA A 1 488 ? 116.644 174.515 150.185 1.00 360.98 ? 488 ALA A CB  1 
ATOM 3554  N N   . ASP A 1 489 ? 119.054 176.212 151.064 1.00 440.86 ? 489 ASP A N   1 
ATOM 3555  C CA  . ASP A 1 489 ? 119.629 177.537 151.331 1.00 489.90 ? 489 ASP A CA  1 
ATOM 3556  C C   . ASP A 1 489 ? 120.895 177.755 150.481 1.00 406.08 ? 489 ASP A C   1 
ATOM 3557  O O   . ASP A 1 489 ? 121.083 178.810 149.849 1.00 411.45 ? 489 ASP A O   1 
ATOM 3558  C CB  . ASP A 1 489 ? 119.866 177.762 152.831 1.00 500.00 ? 489 ASP A CB  1 
ATOM 3559  C CG  . ASP A 1 489 ? 118.557 177.936 153.614 1.00 500.00 ? 489 ASP A CG  1 
ATOM 3560  O OD1 . ASP A 1 489 ? 117.755 178.829 153.258 1.00 500.00 ? 489 ASP A OD1 1 
ATOM 3561  O OD2 . ASP A 1 489 ? 118.333 177.186 154.589 1.00 500.00 ? 489 ASP A OD2 1 
ATOM 3562  N N   . VAL A 1 490 ? 121.725 176.716 150.496 1.00 333.30 ? 490 VAL A N   1 
ATOM 3563  C CA  . VAL A 1 490 ? 122.988 176.707 149.755 1.00 393.60 ? 490 VAL A CA  1 
ATOM 3564  C C   . VAL A 1 490 ? 122.728 176.931 148.269 1.00 365.00 ? 490 VAL A C   1 
ATOM 3565  O O   . VAL A 1 490 ? 123.400 177.741 147.613 1.00 354.07 ? 490 VAL A O   1 
ATOM 3566  C CB  . VAL A 1 490 ? 123.757 175.368 149.925 1.00 411.41 ? 490 VAL A CB  1 
ATOM 3567  C CG1 . VAL A 1 490 ? 125.065 175.399 149.124 1.00 433.65 ? 490 VAL A CG1 1 
ATOM 3568  C CG2 . VAL A 1 490 ? 123.994 175.025 151.405 1.00 348.94 ? 490 VAL A CG2 1 
ATOM 3569  N N   . ALA A 1 491 ? 121.745 176.194 147.773 1.00 354.54 ? 491 ALA A N   1 
ATOM 3570  C CA  . ALA A 1 491 ? 121.326 176.258 146.369 1.00 401.58 ? 491 ALA A CA  1 
ATOM 3571  C C   . ALA A 1 491 ? 120.916 177.664 146.006 1.00 392.27 ? 491 ALA A C   1 
ATOM 3572  O O   . ALA A 1 491 ? 121.312 178.187 144.971 1.00 393.33 ? 491 ALA A O   1 
ATOM 3573  C CB  . ALA A 1 491 ? 120.172 175.316 146.135 1.00 445.06 ? 491 ALA A CB  1 
ATOM 3574  N N   . THR A 1 492 ? 120.113 178.250 146.878 1.00 413.14 ? 492 THR A N   1 
ATOM 3575  C CA  . THR A 1 492 ? 119.597 179.622 146.725 1.00 441.89 ? 492 THR A CA  1 
ATOM 3576  C C   . THR A 1 492 ? 120.761 180.594 146.593 1.00 413.65 ? 492 THR A C   1 
ATOM 3577  O O   . THR A 1 492 ? 120.773 181.459 145.696 1.00 383.04 ? 492 THR A O   1 
ATOM 3578  C CB  . THR A 1 492 ? 118.788 180.055 147.986 1.00 447.54 ? 492 THR A CB  1 
ATOM 3579  O OG1 . THR A 1 492 ? 117.545 179.347 148.040 1.00 461.67 ? 492 THR A OG1 1 
ATOM 3580  C CG2 . THR A 1 492 ? 118.519 181.572 148.032 1.00 438.13 ? 492 THR A CG2 1 
ATOM 3581  N N   . VAL A 1 493 ? 121.714 180.425 147.507 1.00 423.42 ? 493 VAL A N   1 
ATOM 3582  C CA  . VAL A 1 493 ? 122.912 181.267 147.566 1.00 438.15 ? 493 VAL A CA  1 
ATOM 3583  C C   . VAL A 1 493 ? 123.667 181.193 146.225 1.00 419.07 ? 493 VAL A C   1 
ATOM 3584  O O   . VAL A 1 493 ? 124.071 182.227 145.650 1.00 382.95 ? 493 VAL A O   1 
ATOM 3585  C CB  . VAL A 1 493 ? 123.843 180.856 148.743 1.00 463.81 ? 493 VAL A CB  1 
ATOM 3586  C CG1 . VAL A 1 493 ? 125.215 181.521 148.643 1.00 476.21 ? 493 VAL A CG1 1 
ATOM 3587  C CG2 . VAL A 1 493 ? 123.186 181.168 150.087 1.00 472.53 ? 493 VAL A CG2 1 
ATOM 3588  N N   . LEU A 1 494 ? 123.828 179.955 145.772 1.00 408.03 ? 494 LEU A N   1 
ATOM 3589  C CA  . LEU A 1 494 ? 124.528 179.663 144.521 1.00 403.78 ? 494 LEU A CA  1 
ATOM 3590  C C   . LEU A 1 494 ? 123.851 180.367 143.358 1.00 408.03 ? 494 LEU A C   1 
ATOM 3591  O O   . LEU A 1 494 ? 124.512 180.986 142.518 1.00 404.81 ? 494 LEU A O   1 
ATOM 3592  C CB  . LEU A 1 494 ? 124.669 178.163 144.279 1.00 389.79 ? 494 LEU A CB  1 
ATOM 3593  C CG  . LEU A 1 494 ? 125.804 177.864 143.283 1.00 434.58 ? 494 LEU A CG  1 
ATOM 3594  C CD1 . LEU A 1 494 ? 126.581 176.636 143.719 1.00 495.22 ? 494 LEU A CD1 1 
ATOM 3595  C CD2 . LEU A 1 494 ? 125.333 177.731 141.839 1.00 435.81 ? 494 LEU A CD2 1 
ATOM 3596  N N   . GLY A 1 495 ? 122.533 180.257 143.338 1.00 403.25 ? 495 GLY A N   1 
ATOM 3597  C CA  . GLY A 1 495 ? 121.686 180.869 142.303 1.00 403.55 ? 495 GLY A CA  1 
ATOM 3598  C C   . GLY A 1 495 ? 121.905 182.362 142.271 1.00 415.23 ? 495 GLY A C   1 
ATOM 3599  O O   . GLY A 1 495 ? 122.078 182.953 141.197 1.00 408.68 ? 495 GLY A O   1 
ATOM 3600  N N   . ARG A 1 496 ? 121.891 182.950 143.465 1.00 423.09 ? 496 ARG A N   1 
ATOM 3601  C CA  . ARG A 1 496 ? 122.084 184.397 143.644 1.00 419.46 ? 496 ARG A CA  1 
ATOM 3602  C C   . ARG A 1 496 ? 123.425 184.817 143.051 1.00 409.60 ? 496 ARG A C   1 
ATOM 3603  O O   . ARG A 1 496 ? 123.513 185.816 142.311 1.00 461.26 ? 496 ARG A O   1 
ATOM 3604  C CB  . ARG A 1 496 ? 121.980 184.841 145.112 1.00 433.49 ? 496 ARG A CB  1 
ATOM 3605  C CG  . ARG A 1 496 ? 120.552 184.915 145.614 1.00 425.40 ? 496 ARG A CG  1 
ATOM 3606  C CD  . ARG A 1 496 ? 120.391 185.610 146.959 1.00 356.32 ? 496 ARG A CD  1 
ATOM 3607  N NE  . ARG A 1 496 ? 119.027 185.407 147.457 1.00 376.27 ? 496 ARG A NE  1 
ATOM 3608  C CZ  . ARG A 1 496 ? 118.502 185.976 148.541 1.00 414.06 ? 496 ARG A CZ  1 
ATOM 3609  N NH1 . ARG A 1 496 ? 119.220 186.815 149.290 1.00 462.13 ? 496 ARG A NH1 1 
ATOM 3610  N NH2 . ARG A 1 496 ? 117.239 185.706 148.885 1.00 387.29 ? 496 ARG A NH2 1 
ATOM 3611  N N   . ALA A 1 497 ? 124.443 184.035 143.398 1.00 405.28 ? 497 ALA A N   1 
ATOM 3612  C CA  . ALA A 1 497 ? 125.814 184.270 142.941 1.00 442.08 ? 497 ALA A CA  1 
ATOM 3613  C C   . ALA A 1 497 ? 125.866 184.271 141.412 1.00 411.58 ? 497 ALA A C   1 
ATOM 3614  O O   . ALA A 1 497 ? 126.472 185.158 140.791 1.00 403.28 ? 497 ALA A O   1 
ATOM 3615  C CB  . ALA A 1 497 ? 126.762 183.218 143.504 1.00 461.68 ? 497 ALA A CB  1 
ATOM 3616  N N   . LEU A 1 498 ? 125.221 183.260 140.849 1.00 367.61 ? 498 LEU A N   1 
ATOM 3617  C CA  . LEU A 1 498 ? 125.151 183.071 139.397 1.00 388.17 ? 498 LEU A CA  1 
ATOM 3618  C C   . LEU A 1 498 ? 124.528 184.289 138.737 1.00 371.59 ? 498 LEU A C   1 
ATOM 3619  O O   . LEU A 1 498 ? 125.036 184.799 137.732 1.00 314.03 ? 498 LEU A O   1 
ATOM 3620  C CB  . LEU A 1 498 ? 124.362 181.809 139.047 1.00 429.29 ? 498 LEU A CB  1 
ATOM 3621  C CG  . LEU A 1 498 ? 125.034 180.471 139.377 1.00 449.35 ? 498 LEU A CG  1 
ATOM 3622  C CD1 . LEU A 1 498 ? 123.993 179.365 139.329 1.00 436.23 ? 498 LEU A CD1 1 
ATOM 3623  C CD2 . LEU A 1 498 ? 126.191 180.175 138.430 1.00 471.32 ? 498 LEU A CD2 1 
ATOM 3624  N N   . TYR A 1 499 ? 123.426 184.728 139.330 1.00 393.73 ? 499 TYR A N   1 
ATOM 3625  C CA  . TYR A 1 499 ? 122.668 185.892 138.851 1.00 410.44 ? 499 TYR A CA  1 
ATOM 3626  C C   . TYR A 1 499 ? 123.570 187.122 138.825 1.00 416.70 ? 499 TYR A C   1 
ATOM 3627  O O   . TYR A 1 499 ? 123.600 187.872 137.833 1.00 340.41 ? 499 TYR A O   1 
ATOM 3628  C CB  . TYR A 1 499 ? 121.433 186.102 139.734 1.00 438.26 ? 499 TYR A CB  1 
ATOM 3629  C CG  . TYR A 1 499 ? 120.604 187.326 139.430 1.00 490.00 ? 499 TYR A CG  1 
ATOM 3630  C CD1 . TYR A 1 499 ? 119.789 187.382 138.300 1.00 500.00 ? 499 TYR A CD1 1 
ATOM 3631  C CD2 . TYR A 1 499 ? 120.607 188.423 140.295 1.00 500.00 ? 499 TYR A CD2 1 
ATOM 3632  C CE1 . TYR A 1 499 ? 119.014 188.504 138.031 1.00 500.00 ? 499 TYR A CE1 1 
ATOM 3633  C CE2 . TYR A 1 499 ? 119.833 189.548 140.038 1.00 500.00 ? 499 TYR A CE2 1 
ATOM 3634  C CZ  . TYR A 1 499 ? 119.039 189.588 138.906 1.00 500.00 ? 499 TYR A CZ  1 
ATOM 3635  O OH  . TYR A 1 499 ? 118.277 190.710 138.657 1.00 500.00 ? 499 TYR A OH  1 
ATOM 3636  N N   . GLU A 1 500 ? 124.290 187.293 139.928 1.00 481.88 ? 500 GLU A N   1 
ATOM 3637  C CA  . GLU A 1 500 ? 125.214 188.418 140.104 1.00 492.24 ? 500 GLU A CA  1 
ATOM 3638  C C   . GLU A 1 500 ? 126.267 188.411 138.993 1.00 471.18 ? 500 GLU A C   1 
ATOM 3639  O O   . GLU A 1 500 ? 126.556 189.447 138.378 1.00 493.71 ? 500 GLU A O   1 
ATOM 3640  C CB  . GLU A 1 500 ? 125.869 188.389 141.497 1.00 500.00 ? 500 GLU A CB  1 
ATOM 3641  C CG  . GLU A 1 500 ? 126.064 189.758 142.140 1.00 490.15 ? 500 GLU A CG  1 
ATOM 3642  C CD  . GLU A 1 500 ? 125.997 189.704 143.658 1.00 490.93 ? 500 GLU A CD  1 
ATOM 3643  O OE1 . GLU A 1 500 ? 124.924 189.359 144.202 1.00 458.06 ? 500 GLU A OE1 1 
ATOM 3644  O OE2 . GLU A 1 500 ? 127.012 190.018 144.314 1.00 500.00 ? 500 GLU A OE2 1 
ATOM 3645  N N   . LEU A 1 501 ? 126.808 187.222 138.768 1.00 407.43 ? 501 LEU A N   1 
ATOM 3646  C CA  . LEU A 1 501 ? 127.835 186.997 137.746 1.00 398.07 ? 501 LEU A CA  1 
ATOM 3647  C C   . LEU A 1 501 ? 127.317 187.402 136.376 1.00 357.98 ? 501 LEU A C   1 
ATOM 3648  O O   . LEU A 1 501 ? 127.996 188.101 135.611 1.00 353.33 ? 501 LEU A O   1 
ATOM 3649  C CB  . LEU A 1 501 ? 128.352 185.549 137.771 1.00 410.85 ? 501 LEU A CB  1 
ATOM 3650  C CG  . LEU A 1 501 ? 129.605 185.315 138.637 1.00 459.39 ? 501 LEU A CG  1 
ATOM 3651  C CD1 . LEU A 1 501 ? 130.782 186.156 138.140 1.00 491.25 ? 501 LEU A CD1 1 
ATOM 3652  C CD2 . LEU A 1 501 ? 129.374 185.567 140.125 1.00 443.25 ? 501 LEU A CD2 1 
ATOM 3653  N N   . ALA A 1 502 ? 126.095 186.964 136.099 1.00 312.93 ? 502 ALA A N   1 
ATOM 3654  C CA  . ALA A 1 502 ? 125.407 187.238 134.834 1.00 405.57 ? 502 ALA A CA  1 
ATOM 3655  C C   . ALA A 1 502 ? 125.078 188.706 134.519 1.00 468.21 ? 502 ALA A C   1 
ATOM 3656  O O   . ALA A 1 502 ? 124.557 188.978 133.439 1.00 473.56 ? 502 ALA A O   1 
ATOM 3657  C CB  . ALA A 1 502 ? 124.135 186.402 134.754 1.00 423.66 ? 502 ALA A CB  1 
ATOM 3658  N N   . GLY A 1 503 ? 125.384 189.637 135.428 1.00 500.00 ? 503 GLY A N   1 
ATOM 3659  C CA  . GLY A 1 503 ? 124.982 191.041 135.297 1.00 500.00 ? 503 GLY A CA  1 
ATOM 3660  C C   . GLY A 1 503 ? 123.584 191.264 135.850 1.00 500.00 ? 503 GLY A C   1 
ATOM 3661  O O   . GLY A 1 503 ? 122.833 192.097 135.337 1.00 497.81 ? 503 GLY A O   1 
ATOM 3662  N N   . GLY A 1 504 ? 123.246 190.521 136.908 1.00 500.00 ? 504 GLY A N   1 
ATOM 3663  C CA  . GLY A 1 504 ? 121.914 190.545 137.498 1.00 500.00 ? 504 GLY A CA  1 
ATOM 3664  C C   . GLY A 1 504 ? 121.738 191.754 138.394 1.00 500.00 ? 504 GLY A C   1 
ATOM 3665  O O   . GLY A 1 504 ? 122.573 192.009 139.268 1.00 500.00 ? 504 GLY A O   1 
ATOM 3666  N N   . THR A 1 505 ? 120.635 192.476 138.187 1.00 500.00 ? 505 THR A N   1 
ATOM 3667  C CA  . THR A 1 505 ? 120.415 193.792 138.789 1.00 500.00 ? 505 THR A CA  1 
ATOM 3668  C C   . THR A 1 505 ? 119.348 193.784 139.885 1.00 500.00 ? 505 THR A C   1 
ATOM 3669  O O   . THR A 1 505 ? 119.659 193.883 141.076 1.00 493.76 ? 505 THR A O   1 
ATOM 3670  C CB  . THR A 1 505 ? 120.003 194.825 137.709 1.00 490.54 ? 505 THR A CB  1 
ATOM 3671  O OG1 . THR A 1 505 ? 118.924 194.303 136.919 1.00 379.43 ? 505 THR A OG1 1 
ATOM 3672  C CG2 . THR A 1 505 ? 121.176 195.147 136.797 1.00 490.97 ? 505 THR A CG2 1 
ATOM 3673  N N   . ASN A 1 506 ? 118.099 193.629 139.460 1.00 498.78 ? 506 ASN A N   1 
ATOM 3674  C CA  . ASN A 1 506 ? 116.943 194.108 140.214 1.00 500.00 ? 506 ASN A CA  1 
ATOM 3675  C C   . ASN A 1 506 ? 116.163 193.020 140.970 1.00 459.10 ? 506 ASN A C   1 
ATOM 3676  O O   . ASN A 1 506 ? 115.232 193.348 141.707 1.00 460.09 ? 506 ASN A O   1 
ATOM 3677  C CB  . ASN A 1 506 ? 116.010 194.859 139.236 1.00 500.00 ? 506 ASN A CB  1 
ATOM 3678  C CG  . ASN A 1 506 ? 115.503 196.195 139.787 1.00 500.00 ? 506 ASN A CG  1 
ATOM 3679  O OD1 . ASN A 1 506 ? 114.930 196.218 140.877 1.00 500.00 ? 506 ASN A OD1 1 
ATOM 3680  N ND2 . ASN A 1 506 ? 115.693 197.320 139.046 1.00 500.00 ? 506 ASN A ND2 1 
ATOM 3681  N N   . PHE A 1 507 ? 116.542 191.747 140.806 1.00 418.98 ? 507 PHE A N   1 
ATOM 3682  C CA  . PHE A 1 507 ? 115.737 190.621 141.322 1.00 452.02 ? 507 PHE A CA  1 
ATOM 3683  C C   . PHE A 1 507 ? 116.506 189.536 142.101 1.00 424.08 ? 507 PHE A C   1 
ATOM 3684  O O   . PHE A 1 507 ? 115.976 188.442 142.336 1.00 307.60 ? 507 PHE A O   1 
ATOM 3685  C CB  . PHE A 1 507 ? 114.956 189.998 140.161 1.00 500.00 ? 507 PHE A CB  1 
ATOM 3686  C CG  . PHE A 1 507 ? 113.929 190.919 139.568 1.00 500.00 ? 507 PHE A CG  1 
ATOM 3687  C CD1 . PHE A 1 507 ? 112.650 191.007 140.119 1.00 500.00 ? 507 PHE A CD1 1 
ATOM 3688  C CD2 . PHE A 1 507 ? 114.238 191.715 138.469 1.00 500.00 ? 507 PHE A CD2 1 
ATOM 3689  C CE1 . PHE A 1 507 ? 111.698 191.863 139.576 1.00 500.00 ? 507 PHE A CE1 1 
ATOM 3690  C CE2 . PHE A 1 507 ? 113.289 192.572 137.920 1.00 500.00 ? 507 PHE A CE2 1 
ATOM 3691  C CZ  . PHE A 1 507 ? 112.018 192.647 138.474 1.00 500.00 ? 507 PHE A CZ  1 
ATOM 3692  N N   . SER A 1 508 ? 117.713 189.856 142.566 1.00 486.44 ? 508 SER A N   1 
ATOM 3693  C CA  . SER A 1 508 ? 118.545 188.898 143.317 1.00 500.00 ? 508 SER A CA  1 
ATOM 3694  C C   . SER A 1 508 ? 117.922 188.362 144.623 1.00 500.00 ? 508 SER A C   1 
ATOM 3695  O O   . SER A 1 508 ? 118.406 187.370 145.165 1.00 500.00 ? 508 SER A O   1 
ATOM 3696  C CB  . SER A 1 508 ? 119.914 189.514 143.632 1.00 500.00 ? 508 SER A CB  1 
ATOM 3697  O OG  . SER A 1 508 ? 119.773 190.739 144.330 1.00 500.00 ? 508 SER A OG  1 
ATOM 3698  N N   . ASP A 1 509 ? 116.880 189.023 145.132 1.00 500.00 ? 509 ASP A N   1 
ATOM 3699  C CA  . ASP A 1 509 ? 116.153 188.562 146.324 1.00 500.00 ? 509 ASP A CA  1 
ATOM 3700  C C   . ASP A 1 509 ? 115.124 187.453 146.020 1.00 498.56 ? 509 ASP A C   1 
ATOM 3701  O O   . ASP A 1 509 ? 114.853 186.608 146.882 1.00 434.29 ? 509 ASP A O   1 
ATOM 3702  C CB  . ASP A 1 509 ? 115.458 189.746 147.019 1.00 500.00 ? 509 ASP A CB  1 
ATOM 3703  C CG  . ASP A 1 509 ? 116.436 190.839 147.455 1.00 491.84 ? 509 ASP A CG  1 
ATOM 3704  O OD1 . ASP A 1 509 ? 117.446 190.526 148.125 1.00 424.42 ? 509 ASP A OD1 1 
ATOM 3705  O OD2 . ASP A 1 509 ? 116.185 192.019 147.130 1.00 482.41 ? 509 ASP A OD2 1 
ATOM 3706  N N   . THR A 1 510 ? 114.556 187.463 144.810 1.00 482.35 ? 510 THR A N   1 
ATOM 3707  C CA  . THR A 1 510 ? 113.531 186.485 144.411 1.00 478.43 ? 510 THR A CA  1 
ATOM 3708  C C   . THR A 1 510 ? 114.106 185.078 144.284 1.00 468.65 ? 510 THR A C   1 
ATOM 3709  O O   . THR A 1 510 ? 113.572 184.132 144.866 1.00 469.90 ? 510 THR A O   1 
ATOM 3710  C CB  . THR A 1 510 ? 112.872 186.848 143.060 1.00 479.56 ? 510 THR A CB  1 
ATOM 3711  O OG1 . THR A 1 510 ? 113.879 186.985 142.052 1.00 466.35 ? 510 THR A OG1 1 
ATOM 3712  C CG2 . THR A 1 510 ? 112.072 188.139 143.166 1.00 475.07 ? 510 THR A CG2 1 
ATOM 3713  N N   . VAL A 1 511 ? 115.175 184.962 143.497 1.00 447.03 ? 511 VAL A N   1 
ATOM 3714  C CA  . VAL A 1 511 ? 115.888 183.689 143.272 1.00 426.61 ? 511 VAL A CA  1 
ATOM 3715  C C   . VAL A 1 511 ? 116.208 182.930 144.574 1.00 402.01 ? 511 VAL A C   1 
ATOM 3716  O O   . VAL A 1 511 ? 117.205 183.204 145.243 1.00 399.94 ? 511 VAL A O   1 
ATOM 3717  C CB  . VAL A 1 511 ? 117.176 183.889 142.404 1.00 425.52 ? 511 VAL A CB  1 
ATOM 3718  C CG1 . VAL A 1 511 ? 118.043 185.049 142.899 1.00 432.15 ? 511 VAL A CG1 1 
ATOM 3719  C CG2 . VAL A 1 511 ? 117.992 182.599 142.297 1.00 421.97 ? 511 VAL A CG2 1 
ATOM 3720  N N   . GLN A 1 512 ? 115.325 181.997 144.932 1.00 401.97 ? 512 GLN A N   1 
ATOM 3721  C CA  . GLN A 1 512 ? 115.570 181.059 146.029 1.00 406.61 ? 512 GLN A CA  1 
ATOM 3722  C C   . GLN A 1 512 ? 115.188 179.652 145.622 1.00 414.09 ? 512 GLN A C   1 
ATOM 3723  O O   . GLN A 1 512 ? 114.273 179.449 144.822 1.00 433.02 ? 512 GLN A O   1 
ATOM 3724  C CB  . GLN A 1 512 ? 114.811 181.451 147.302 1.00 429.18 ? 512 GLN A CB  1 
ATOM 3725  C CG  . GLN A 1 512 ? 113.288 181.442 147.188 1.00 462.07 ? 512 GLN A CG  1 
ATOM 3726  C CD  . GLN A 1 512 ? 112.579 181.551 148.529 1.00 500.00 ? 512 GLN A CD  1 
ATOM 3727  O OE1 . GLN A 1 512 ? 113.185 181.399 149.590 1.00 500.00 ? 512 GLN A OE1 1 
ATOM 3728  N NE2 . GLN A 1 512 ? 111.276 181.808 148.481 1.00 500.00 ? 512 GLN A NE2 1 
ATOM 3729  N N   . ALA A 1 513 ? 115.909 178.682 146.172 1.00 438.42 ? 513 ALA A N   1 
ATOM 3730  C CA  . ALA A 1 513 ? 115.617 177.282 145.951 1.00 459.35 ? 513 ALA A CA  1 
ATOM 3731  C C   . ALA A 1 513 ? 114.536 176.871 146.933 1.00 458.68 ? 513 ALA A C   1 
ATOM 3732  O O   . ALA A 1 513 ? 114.793 176.700 148.128 1.00 419.59 ? 513 ALA A O   1 
ATOM 3733  C CB  . ALA A 1 513 ? 116.861 176.431 146.133 1.00 457.41 ? 513 ALA A CB  1 
ATOM 3734  N N   . ASP A 1 514 ? 113.312 176.796 146.421 1.00 487.53 ? 514 ASP A N   1 
ATOM 3735  C CA  . ASP A 1 514 ? 112.210 176.111 147.097 1.00 500.00 ? 514 ASP A CA  1 
ATOM 3736  C C   . ASP A 1 514 ? 112.687 174.752 147.657 1.00 432.62 ? 514 ASP A C   1 
ATOM 3737  O O   . ASP A 1 514 ? 113.056 173.863 146.884 1.00 399.29 ? 514 ASP A O   1 
ATOM 3738  C CB  . ASP A 1 514 ? 111.002 175.934 146.152 1.00 500.00 ? 514 ASP A CB  1 
ATOM 3739  C CG  . ASP A 1 514 ? 111.392 175.449 144.742 1.00 500.00 ? 514 ASP A CG  1 
ATOM 3740  O OD1 . ASP A 1 514 ? 112.447 175.870 144.215 1.00 500.00 ? 514 ASP A OD1 1 
ATOM 3741  O OD2 . ASP A 1 514 ? 110.623 174.657 144.154 1.00 500.00 ? 514 ASP A OD2 1 
ATOM 3742  N N   . PRO A 1 515 ? 112.702 174.594 149.000 1.00 405.04 ? 515 PRO A N   1 
ATOM 3743  C CA  . PRO A 1 515 ? 113.356 173.411 149.578 1.00 429.29 ? 515 PRO A CA  1 
ATOM 3744  C C   . PRO A 1 515 ? 112.657 172.089 149.277 1.00 407.56 ? 515 PRO A C   1 
ATOM 3745  O O   . PRO A 1 515 ? 113.300 171.024 149.340 1.00 437.87 ? 515 PRO A O   1 
ATOM 3746  C CB  . PRO A 1 515 ? 113.328 173.674 151.096 1.00 445.16 ? 515 PRO A CB  1 
ATOM 3747  C CG  . PRO A 1 515 ? 112.734 175.026 151.283 1.00 468.51 ? 515 PRO A CG  1 
ATOM 3748  C CD  . PRO A 1 515 ? 111.994 175.371 150.031 1.00 445.77 ? 515 PRO A CD  1 
ATOM 3749  N N   . GLN A 1 516 ? 111.359 172.175 148.977 1.00 367.97 ? 516 GLN A N   1 
ATOM 3750  C CA  . GLN A 1 516 ? 110.540 171.026 148.668 1.00 429.90 ? 516 GLN A CA  1 
ATOM 3751  C C   . GLN A 1 516 ? 111.131 170.240 147.491 1.00 414.10 ? 516 GLN A C   1 
ATOM 3752  O O   . GLN A 1 516 ? 111.255 169.005 147.537 1.00 392.51 ? 516 GLN A O   1 
ATOM 3753  C CB  . GLN A 1 516 ? 109.110 171.478 148.329 1.00 482.65 ? 516 GLN A CB  1 
ATOM 3754  C CG  . GLN A 1 516 ? 108.054 170.391 148.488 1.00 500.00 ? 516 GLN A CG  1 
ATOM 3755  C CD  . GLN A 1 516 ? 106.749 170.693 147.760 1.00 500.00 ? 516 GLN A CD  1 
ATOM 3756  O OE1 . GLN A 1 516 ? 106.702 171.498 146.824 1.00 500.00 ? 516 GLN A OE1 1 
ATOM 3757  N NE2 . GLN A 1 516 ? 105.679 170.030 148.186 1.00 500.00 ? 516 GLN A NE2 1 
ATOM 3758  N N   . THR A 1 517 ? 111.483 171.001 146.462 1.00 390.88 ? 517 THR A N   1 
ATOM 3759  C CA  . THR A 1 517 ? 112.064 170.462 145.233 1.00 421.27 ? 517 THR A CA  1 
ATOM 3760  C C   . THR A 1 517 ? 113.342 169.684 145.554 1.00 374.70 ? 517 THR A C   1 
ATOM 3761  O O   . THR A 1 517 ? 113.546 168.551 145.074 1.00 406.11 ? 517 THR A O   1 
ATOM 3762  C CB  . THR A 1 517 ? 112.361 171.603 144.228 1.00 435.06 ? 517 THR A CB  1 
ATOM 3763  O OG1 . THR A 1 517 ? 111.127 172.070 143.663 1.00 437.75 ? 517 THR A OG1 1 
ATOM 3764  C CG2 . THR A 1 517 ? 113.286 171.155 143.090 1.00 460.18 ? 517 THR A CG2 1 
ATOM 3765  N N   . VAL A 1 518 ? 114.171 170.328 146.370 1.00 300.45 ? 518 VAL A N   1 
ATOM 3766  C CA  . VAL A 1 518 ? 115.454 169.759 146.794 1.00 351.06 ? 518 VAL A CA  1 
ATOM 3767  C C   . VAL A 1 518 ? 115.230 168.428 147.503 1.00 355.17 ? 518 VAL A C   1 
ATOM 3768  O O   . VAL A 1 518 ? 115.924 167.433 147.218 1.00 411.30 ? 518 VAL A O   1 
ATOM 3769  C CB  . VAL A 1 518 ? 116.271 170.703 147.697 1.00 409.96 ? 518 VAL A CB  1 
ATOM 3770  C CG1 . VAL A 1 518 ? 117.591 170.048 148.123 1.00 381.08 ? 518 VAL A CG1 1 
ATOM 3771  C CG2 . VAL A 1 518 ? 116.495 172.040 146.995 1.00 429.10 ? 518 VAL A CG2 1 
ATOM 3772  N N   . THR A 1 519 ? 114.254 168.445 148.406 1.00 335.58 ? 519 THR A N   1 
ATOM 3773  C CA  . THR A 1 519 ? 113.898 167.258 149.191 1.00 364.98 ? 519 THR A CA  1 
ATOM 3774  C C   . THR A 1 519 ? 113.487 166.121 148.272 1.00 390.58 ? 519 THR A C   1 
ATOM 3775  O O   . THR A 1 519 ? 113.928 164.977 148.451 1.00 394.08 ? 519 THR A O   1 
ATOM 3776  C CB  . THR A 1 519 ? 112.947 167.475 150.399 1.00 426.35 ? 519 THR A CB  1 
ATOM 3777  O OG1 . THR A 1 519 ? 113.225 166.466 151.383 1.00 421.77 ? 519 THR A OG1 1 
ATOM 3778  C CG2 . THR A 1 519 ? 111.446 167.423 150.053 1.00 441.11 ? 519 THR A CG2 1 
ATOM 3779  N N   . ARG A 1 520 ? 112.658 166.468 147.297 1.00 407.59 ? 520 ARG A N   1 
ATOM 3780  C CA  . ARG A 1 520 ? 112.149 165.518 146.299 1.00 428.06 ? 520 ARG A CA  1 
ATOM 3781  C C   . ARG A 1 520 ? 113.314 164.866 145.562 1.00 403.13 ? 520 ARG A C   1 
ATOM 3782  O O   . ARG A 1 520 ? 113.356 163.632 145.388 1.00 297.13 ? 520 ARG A O   1 
ATOM 3783  C CB  . ARG A 1 520 ? 111.278 166.253 145.260 1.00 419.92 ? 520 ARG A CB  1 
ATOM 3784  C CG  . ARG A 1 520 ? 110.290 165.380 144.499 1.00 416.77 ? 520 ARG A CG  1 
ATOM 3785  C CD  . ARG A 1 520 ? 108.843 165.644 144.902 1.00 444.50 ? 520 ARG A CD  1 
ATOM 3786  N NE  . ARG A 1 520 ? 108.247 166.733 144.124 1.00 493.02 ? 520 ARG A NE  1 
ATOM 3787  C CZ  . ARG A 1 520 ? 108.147 168.015 144.498 1.00 500.00 ? 520 ARG A CZ  1 
ATOM 3788  N NH1 . ARG A 1 520 ? 108.574 168.451 145.683 1.00 500.00 ? 520 ARG A NH1 1 
ATOM 3789  N NH2 . ARG A 1 520 ? 107.586 168.886 143.660 1.00 500.00 ? 520 ARG A NH2 1 
ATOM 3790  N N   . LEU A 1 521 ? 114.237 165.728 145.141 1.00 379.99 ? 521 LEU A N   1 
ATOM 3791  C CA  . LEU A 1 521 ? 115.433 165.304 144.403 1.00 350.55 ? 521 LEU A CA  1 
ATOM 3792  C C   . LEU A 1 521 ? 116.231 164.300 145.230 1.00 340.46 ? 521 LEU A C   1 
ATOM 3793  O O   . LEU A 1 521 ? 116.659 163.252 144.723 1.00 293.80 ? 521 LEU A O   1 
ATOM 3794  C CB  . LEU A 1 521 ? 116.334 166.483 144.012 1.00 372.08 ? 521 LEU A CB  1 
ATOM 3795  C CG  . LEU A 1 521 ? 115.867 167.373 142.856 1.00 393.94 ? 521 LEU A CG  1 
ATOM 3796  C CD1 . LEU A 1 521 ? 116.625 168.693 142.864 1.00 423.44 ? 521 LEU A CD1 1 
ATOM 3797  C CD2 . LEU A 1 521 ? 116.034 166.676 141.515 1.00 392.18 ? 521 LEU A CD2 1 
ATOM 3798  N N   . LEU A 1 522 ? 116.408 164.659 146.495 1.00 376.53 ? 522 LEU A N   1 
ATOM 3799  C CA  . LEU A 1 522 ? 117.153 163.838 147.458 1.00 365.62 ? 522 LEU A CA  1 
ATOM 3800  C C   . LEU A 1 522 ? 116.519 162.458 147.571 1.00 388.74 ? 522 LEU A C   1 
ATOM 3801  O O   . LEU A 1 522 ? 117.215 161.431 147.537 1.00 395.15 ? 522 LEU A O   1 
ATOM 3802  C CB  . LEU A 1 522 ? 117.256 164.547 148.820 1.00 335.69 ? 522 LEU A CB  1 
ATOM 3803  C CG  . LEU A 1 522 ? 118.645 164.746 149.464 1.00 369.74 ? 522 LEU A CG  1 
ATOM 3804  C CD1 . LEU A 1 522 ? 119.825 164.881 148.503 1.00 326.56 ? 522 LEU A CD1 1 
ATOM 3805  C CD2 . LEU A 1 522 ? 118.591 165.970 150.373 1.00 413.74 ? 522 LEU A CD2 1 
ATOM 3806  N N   . TYR A 1 523 ? 115.199 162.472 147.699 1.00 400.25 ? 523 TYR A N   1 
ATOM 3807  C CA  . TYR A 1 523 ? 114.394 161.251 147.823 1.00 403.91 ? 523 TYR A CA  1 
ATOM 3808  C C   . TYR A 1 523 ? 114.621 160.353 146.615 1.00 382.08 ? 523 TYR A C   1 
ATOM 3809  O O   . TYR A 1 523 ? 114.847 159.134 146.754 1.00 346.86 ? 523 TYR A O   1 
ATOM 3810  C CB  . TYR A 1 523 ? 112.905 161.608 147.931 1.00 419.69 ? 523 TYR A CB  1 
ATOM 3811  C CG  . TYR A 1 523 ? 111.979 160.459 148.282 1.00 433.38 ? 523 TYR A CG  1 
ATOM 3812  C CD1 . TYR A 1 523 ? 112.038 159.844 149.530 1.00 432.53 ? 523 TYR A CD1 1 
ATOM 3813  C CD2 . TYR A 1 523 ? 111.017 160.012 147.382 1.00 451.27 ? 523 TYR A CD2 1 
ATOM 3814  C CE1 . TYR A 1 523 ? 111.184 158.799 149.862 1.00 428.67 ? 523 TYR A CE1 1 
ATOM 3815  C CE2 . TYR A 1 523 ? 110.153 158.971 147.706 1.00 464.42 ? 523 TYR A CE2 1 
ATOM 3816  C CZ  . TYR A 1 523 ? 110.238 158.369 148.945 1.00 454.52 ? 523 TYR A CZ  1 
ATOM 3817  O OH  . TYR A 1 523 ? 109.382 157.337 149.261 1.00 455.59 ? 523 TYR A OH  1 
ATOM 3818  N N   . GLY A 1 524 ? 114.561 160.985 145.449 1.00 368.73 ? 524 GLY A N   1 
ATOM 3819  C CA  . GLY A 1 524 ? 114.746 160.302 144.165 1.00 392.83 ? 524 GLY A CA  1 
ATOM 3820  C C   . GLY A 1 524 ? 116.107 159.625 144.123 1.00 391.48 ? 524 GLY A C   1 
ATOM 3821  O O   . GLY A 1 524 ? 116.263 158.453 143.750 1.00 413.99 ? 524 GLY A O   1 
ATOM 3822  N N   . PHE A 1 525 ? 117.111 160.384 144.544 1.00 362.06 ? 525 PHE A N   1 
ATOM 3823  C CA  . PHE A 1 525 ? 118.483 159.830 144.617 1.00 347.03 ? 525 PHE A CA  1 
ATOM 3824  C C   . PHE A 1 525 ? 118.740 158.851 145.781 1.00 308.22 ? 525 PHE A C   1 
ATOM 3825  O O   . PHE A 1 525 ? 119.060 157.672 145.524 1.00 352.96 ? 525 PHE A O   1 
ATOM 3826  C CB  . PHE A 1 525 ? 119.541 160.926 144.409 1.00 318.65 ? 525 PHE A CB  1 
ATOM 3827  C CG  . PHE A 1 525 ? 119.336 161.689 143.114 1.00 329.90 ? 525 PHE A CG  1 
ATOM 3828  C CD1 . PHE A 1 525 ? 119.373 161.030 141.892 1.00 321.07 ? 525 PHE A CD1 1 
ATOM 3829  C CD2 . PHE A 1 525 ? 119.047 163.052 143.116 1.00 381.35 ? 525 PHE A CD2 1 
ATOM 3830  C CE1 . PHE A 1 525 ? 119.155 161.714 140.702 1.00 338.35 ? 525 PHE A CE1 1 
ATOM 3831  C CE2 . PHE A 1 525 ? 118.821 163.741 141.929 1.00 377.96 ? 525 PHE A CE2 1 
ATOM 3832  C CZ  . PHE A 1 525 ? 118.876 163.072 140.716 1.00 340.96 ? 525 PHE A CZ  1 
ATOM 3833  N N   . LEU A 1 526 ? 118.581 159.283 147.021 1.00 303.16 ? 526 LEU A N   1 
ATOM 3834  C CA  . LEU A 1 526 ? 119.100 158.506 148.151 1.00 375.90 ? 526 LEU A CA  1 
ATOM 3835  C C   . LEU A 1 526 ? 118.081 157.713 148.977 1.00 411.88 ? 526 LEU A C   1 
ATOM 3836  O O   . LEU A 1 526 ? 118.463 157.104 149.987 1.00 428.90 ? 526 LEU A O   1 
ATOM 3837  C CB  . LEU A 1 526 ? 119.946 159.415 149.047 1.00 401.00 ? 526 LEU A CB  1 
ATOM 3838  C CG  . LEU A 1 526 ? 121.267 159.800 148.374 1.00 429.90 ? 526 LEU A CG  1 
ATOM 3839  C CD1 . LEU A 1 526 ? 121.886 160.992 149.087 1.00 474.66 ? 526 LEU A CD1 1 
ATOM 3840  C CD2 . LEU A 1 526 ? 122.244 158.625 148.307 1.00 420.63 ? 526 LEU A CD2 1 
ATOM 3841  N N   . ILE A 1 527 ? 116.815 157.681 148.553 1.00 391.55 ? 527 ILE A N   1 
ATOM 3842  C CA  . ILE A 1 527 ? 115.809 156.824 149.207 1.00 425.39 ? 527 ILE A CA  1 
ATOM 3843  C C   . ILE A 1 527 ? 115.306 155.726 148.278 1.00 425.61 ? 527 ILE A C   1 
ATOM 3844  O O   . ILE A 1 527 ? 115.347 154.540 148.620 1.00 444.97 ? 527 ILE A O   1 
ATOM 3845  C CB  . ILE A 1 527 ? 114.614 157.644 149.740 1.00 446.47 ? 527 ILE A CB  1 
ATOM 3846  C CG1 . ILE A 1 527 ? 115.111 158.778 150.655 1.00 500.00 ? 527 ILE A CG1 1 
ATOM 3847  C CG2 . ILE A 1 527 ? 113.616 156.743 150.475 1.00 414.64 ? 527 ILE A CG2 1 
ATOM 3848  C CD1 . ILE A 1 527 ? 115.962 158.339 151.833 1.00 500.00 ? 527 ILE A CD1 1 
ATOM 3849  N N   . LYS A 1 528 ? 114.817 156.131 147.116 1.00 403.11 ? 528 LYS A N   1 
ATOM 3850  C CA  . LYS A 1 528 ? 114.228 155.212 146.153 1.00 397.39 ? 528 LYS A CA  1 
ATOM 3851  C C   . LYS A 1 528 ? 114.171 155.957 144.835 1.00 366.21 ? 528 LYS A C   1 
ATOM 3852  O O   . LYS A 1 528 ? 114.075 157.174 144.826 1.00 358.37 ? 528 LYS A O   1 
ATOM 3853  C CB  . LYS A 1 528 ? 112.820 154.828 146.617 1.00 445.91 ? 528 LYS A CB  1 
ATOM 3854  C CG  . LYS A 1 528 ? 112.151 153.690 145.870 1.00 497.79 ? 528 LYS A CG  1 
ATOM 3855  C CD  . LYS A 1 528 ? 110.751 153.453 146.416 1.00 500.00 ? 528 LYS A CD  1 
ATOM 3856  C CE  . LYS A 1 528 ? 109.967 152.455 145.582 1.00 500.00 ? 528 LYS A CE  1 
ATOM 3857  N NZ  . LYS A 1 528 ? 108.604 152.205 146.137 1.00 500.00 ? 528 LYS A NZ  1 
ATOM 3858  N N   . ALA A 1 529 ? 114.233 155.236 143.728 1.00 398.30 ? 529 ALA A N   1 
ATOM 3859  C CA  . ALA A 1 529 ? 114.145 155.855 142.413 1.00 416.14 ? 529 ALA A CA  1 
ATOM 3860  C C   . ALA A 1 529 ? 112.678 155.926 141.994 1.00 409.03 ? 529 ALA A C   1 
ATOM 3861  O O   . ALA A 1 529 ? 112.146 157.010 141.736 1.00 379.76 ? 529 ALA A O   1 
ATOM 3862  C CB  . ALA A 1 529 ? 114.974 155.076 141.402 1.00 432.49 ? 529 ALA A CB  1 
ATOM 3863  N N   . ASN A 1 530 ? 112.026 154.765 141.967 1.00 396.88 ? 530 ASN A N   1 
ATOM 3864  C CA  . ASN A 1 530 ? 110.657 154.628 141.474 1.00 410.62 ? 530 ASN A CA  1 
ATOM 3865  C C   . ASN A 1 530 ? 109.652 155.426 142.322 1.00 437.09 ? 530 ASN A C   1 
ATOM 3866  O O   . ASN A 1 530 ? 108.961 154.877 143.189 1.00 448.39 ? 530 ASN A O   1 
ATOM 3867  C CB  . ASN A 1 530 ? 110.291 153.136 141.419 1.00 435.32 ? 530 ASN A CB  1 
ATOM 3868  C CG  . ASN A 1 530 ? 109.115 152.837 140.501 1.00 455.35 ? 530 ASN A CG  1 
ATOM 3869  O OD1 . ASN A 1 530 ? 108.999 153.405 139.407 1.00 444.87 ? 530 ASN A OD1 1 
ATOM 3870  N ND2 . ASN A 1 530 ? 108.246 151.918 140.935 1.00 434.97 ? 530 ASN A ND2 1 
ATOM 3871  N N   . ASN A 1 531 ? 109.599 156.735 142.063 1.00 435.40 ? 531 ASN A N   1 
ATOM 3872  C CA  . ASN A 1 531 ? 108.769 157.687 142.810 1.00 426.69 ? 531 ASN A CA  1 
ATOM 3873  C C   . ASN A 1 531 ? 108.066 158.615 141.849 1.00 401.02 ? 531 ASN A C   1 
ATOM 3874  O O   . ASN A 1 531 ? 108.629 158.966 140.814 1.00 385.76 ? 531 ASN A O   1 
ATOM 3875  C CB  . ASN A 1 531 ? 109.624 158.513 143.753 1.00 469.17 ? 531 ASN A CB  1 
ATOM 3876  C CG  . ASN A 1 531 ? 110.496 157.660 144.642 1.00 500.00 ? 531 ASN A CG  1 
ATOM 3877  O OD1 . ASN A 1 531 ? 110.027 156.715 145.279 1.00 472.95 ? 531 ASN A OD1 1 
ATOM 3878  N ND2 . ASN A 1 531 ? 111.775 157.992 144.695 1.00 500.00 ? 531 ASN A ND2 1 
ATOM 3879  N N   . SER A 1 532 ? 106.867 159.054 142.226 1.00 413.25 ? 532 SER A N   1 
ATOM 3880  C CA  . SER A 1 532 ? 105.860 159.507 141.261 1.00 449.86 ? 532 SER A CA  1 
ATOM 3881  C C   . SER A 1 532 ? 106.419 160.635 140.392 1.00 431.83 ? 532 SER A C   1 
ATOM 3882  O O   . SER A 1 532 ? 106.329 160.607 139.154 1.00 369.76 ? 532 SER A O   1 
ATOM 3883  C CB  . SER A 1 532 ? 104.581 159.958 141.985 1.00 472.36 ? 532 SER A CB  1 
ATOM 3884  O OG  . SER A 1 532 ? 104.872 160.702 143.159 1.00 444.30 ? 532 SER A OG  1 
ATOM 3885  N N   . TRP A 1 533 ? 107.018 161.591 141.086 1.00 422.43 ? 533 TRP A N   1 
ATOM 3886  C CA  . TRP A 1 533 ? 107.649 162.761 140.459 1.00 392.42 ? 533 TRP A CA  1 
ATOM 3887  C C   . TRP A 1 533 ? 108.725 162.306 139.480 1.00 388.22 ? 533 TRP A C   1 
ATOM 3888  O O   . TRP A 1 533 ? 108.795 162.784 138.331 1.00 373.59 ? 533 TRP A O   1 
ATOM 3889  C CB  . TRP A 1 533 ? 108.285 163.645 141.540 1.00 414.23 ? 533 TRP A CB  1 
ATOM 3890  C CG  . TRP A 1 533 ? 108.766 164.974 141.057 1.00 427.62 ? 533 TRP A CG  1 
ATOM 3891  C CD1 . TRP A 1 533 ? 108.009 166.087 140.837 1.00 455.15 ? 533 TRP A CD1 1 
ATOM 3892  C CD2 . TRP A 1 533 ? 110.111 165.337 140.752 1.00 419.91 ? 533 TRP A CD2 1 
ATOM 3893  N NE1 . TRP A 1 533 ? 108.802 167.123 140.408 1.00 454.17 ? 533 TRP A NE1 1 
ATOM 3894  C CE2 . TRP A 1 533 ? 110.098 166.687 140.345 1.00 445.75 ? 533 TRP A CE2 1 
ATOM 3895  C CE3 . TRP A 1 533 ? 111.328 164.652 140.777 1.00 430.31 ? 533 TRP A CE3 1 
ATOM 3896  C CZ2 . TRP A 1 533 ? 111.258 167.365 139.963 1.00 462.05 ? 533 TRP A CZ2 1 
ATOM 3897  C CZ3 . TRP A 1 533 ? 112.482 165.325 140.396 1.00 427.58 ? 533 TRP A CZ3 1 
ATOM 3898  C CH2 . TRP A 1 533 ? 112.438 166.668 139.997 1.00 440.45 ? 533 TRP A CH2 1 
ATOM 3899  N N   . PHE A 1 534 ? 109.546 161.383 139.974 1.00 418.58 ? 534 PHE A N   1 
ATOM 3900  C CA  . PHE A 1 534 ? 110.660 160.828 139.187 1.00 456.46 ? 534 PHE A CA  1 
ATOM 3901  C C   . PHE A 1 534 ? 110.129 160.171 137.923 1.00 469.95 ? 534 PHE A C   1 
ATOM 3902  O O   . PHE A 1 534 ? 110.675 160.384 136.829 1.00 458.25 ? 534 PHE A O   1 
ATOM 3903  C CB  . PHE A 1 534 ? 111.551 159.889 140.039 1.00 424.89 ? 534 PHE A CB  1 
ATOM 3904  C CG  . PHE A 1 534 ? 112.964 160.397 140.283 1.00 396.64 ? 534 PHE A CG  1 
ATOM 3905  C CD1 . PHE A 1 534 ? 113.333 161.735 140.095 1.00 399.75 ? 534 PHE A CD1 1 
ATOM 3906  C CD2 . PHE A 1 534 ? 113.937 159.516 140.732 1.00 400.67 ? 534 PHE A CD2 1 
ATOM 3907  C CE1 . PHE A 1 534 ? 114.633 162.157 140.334 1.00 398.01 ? 534 PHE A CE1 1 
ATOM 3908  C CE2 . PHE A 1 534 ? 115.236 159.938 140.969 1.00 389.17 ? 534 PHE A CE2 1 
ATOM 3909  C CZ  . PHE A 1 534 ? 115.581 161.262 140.787 1.00 354.89 ? 534 PHE A CZ  1 
ATOM 3910  N N   . GLN A 1 535 ? 109.066 159.394 138.101 1.00 436.02 ? 535 GLN A N   1 
ATOM 3911  C CA  . GLN A 1 535 ? 108.409 158.684 136.998 1.00 373.70 ? 535 GLN A CA  1 
ATOM 3912  C C   . GLN A 1 535 ? 107.948 159.668 135.938 1.00 347.08 ? 535 GLN A C   1 
ATOM 3913  O O   . GLN A 1 535 ? 108.165 159.471 134.735 1.00 363.54 ? 535 GLN A O   1 
ATOM 3914  C CB  . GLN A 1 535 ? 107.197 157.876 137.474 1.00 404.75 ? 535 GLN A CB  1 
ATOM 3915  C CG  . GLN A 1 535 ? 107.495 156.704 138.394 1.00 417.28 ? 535 GLN A CG  1 
ATOM 3916  C CD  . GLN A 1 535 ? 106.226 155.996 138.860 1.00 448.29 ? 535 GLN A CD  1 
ATOM 3917  O OE1 . GLN A 1 535 ? 105.259 156.628 139.319 1.00 337.33 ? 535 GLN A OE1 1 
ATOM 3918  N NE2 . GLN A 1 535 ? 106.224 154.670 138.747 1.00 474.82 ? 535 GLN A NE2 1 
ATOM 3919  N N   . SER A 1 536 ? 107.316 160.734 136.418 1.00 367.64 ? 536 SER A N   1 
ATOM 3920  C CA  . SER A 1 536 ? 106.780 161.802 135.568 1.00 399.32 ? 536 SER A CA  1 
ATOM 3921  C C   . SER A 1 536 ? 107.780 162.629 134.748 1.00 381.26 ? 536 SER A C   1 
ATOM 3922  O O   . SER A 1 536 ? 107.339 163.516 134.007 1.00 354.79 ? 536 SER A O   1 
ATOM 3923  C CB  . SER A 1 536 ? 105.884 162.741 136.396 1.00 414.79 ? 536 SER A CB  1 
ATOM 3924  O OG  . SER A 1 536 ? 106.620 163.447 137.373 1.00 416.32 ? 536 SER A OG  1 
ATOM 3925  N N   . ILE A 1 537 ? 109.091 162.377 134.844 1.00 360.80 ? 537 ILE A N   1 
ATOM 3926  C CA  . ILE A 1 537 ? 110.035 162.949 133.863 1.00 385.45 ? 537 ILE A CA  1 
ATOM 3927  C C   . ILE A 1 537 ? 111.019 161.892 133.353 1.00 354.23 ? 537 ILE A C   1 
ATOM 3928  O O   . ILE A 1 537 ? 112.172 161.847 133.759 1.00 341.64 ? 537 ILE A O   1 
ATOM 3929  C CB  . ILE A 1 537 ? 110.805 164.227 134.348 1.00 458.73 ? 537 ILE A CB  1 
ATOM 3930  C CG1 . ILE A 1 537 ? 110.250 164.832 135.657 1.00 498.73 ? 537 ILE A CG1 1 
ATOM 3931  C CG2 . ILE A 1 537 ? 110.830 165.268 133.230 1.00 452.77 ? 537 ILE A CG2 1 
ATOM 3932  C CD1 . ILE A 1 537 ? 110.978 164.369 136.903 1.00 489.62 ? 537 ILE A CD1 1 
ATOM 3933  N N   . LEU A 1 538 ? 110.518 161.027 132.481 1.00 400.40 ? 538 LEU A N   1 
ATOM 3934  C CA  . LEU A 1 538 ? 111.340 160.126 131.660 1.00 430.11 ? 538 LEU A CA  1 
ATOM 3935  C C   . LEU A 1 538 ? 110.513 159.725 130.440 1.00 445.68 ? 538 LEU A C   1 
ATOM 3936  O O   . LEU A 1 538 ? 109.289 159.788 130.494 1.00 460.56 ? 538 LEU A O   1 
ATOM 3937  C CB  . LEU A 1 538 ? 111.686 158.843 132.419 1.00 458.79 ? 538 LEU A CB  1 
ATOM 3938  C CG  . LEU A 1 538 ? 112.329 158.833 133.807 1.00 448.64 ? 538 LEU A CG  1 
ATOM 3939  C CD1 . LEU A 1 538 ? 112.257 157.432 134.387 1.00 447.54 ? 538 LEU A CD1 1 
ATOM 3940  C CD2 . LEU A 1 538 ? 113.768 159.326 133.759 1.00 465.89 ? 538 LEU A CD2 1 
ATOM 3941  N N   . ARG A 1 539 ? 111.152 159.283 129.358 1.00 430.37 ? 539 ARG A N   1 
ATOM 3942  C CA  . ARG A 1 539 ? 110.402 158.666 128.252 1.00 432.70 ? 539 ARG A CA  1 
ATOM 3943  C C   . ARG A 1 539 ? 109.791 157.343 128.702 1.00 433.62 ? 539 ARG A C   1 
ATOM 3944  O O   . ARG A 1 539 ? 110.183 156.779 129.728 1.00 446.27 ? 539 ARG A O   1 
ATOM 3945  C CB  . ARG A 1 539 ? 111.289 158.429 127.026 1.00 444.08 ? 539 ARG A CB  1 
ATOM 3946  C CG  . ARG A 1 539 ? 111.761 159.710 126.361 1.00 462.95 ? 539 ARG A CG  1 
ATOM 3947  C CD  . ARG A 1 539 ? 112.167 159.529 124.903 1.00 443.38 ? 539 ARG A CD  1 
ATOM 3948  N NE  . ARG A 1 539 ? 113.542 159.051 124.771 1.00 447.88 ? 539 ARG A NE  1 
ATOM 3949  C CZ  . ARG A 1 539 ? 113.929 157.774 124.685 1.00 480.81 ? 539 ARG A CZ  1 
ATOM 3950  N NH1 . ARG A 1 539 ? 113.051 156.771 124.710 1.00 499.51 ? 539 ARG A NH1 1 
ATOM 3951  N NH2 . ARG A 1 539 ? 115.227 157.493 124.570 1.00 493.42 ? 539 ARG A NH2 1 
ATOM 3952  N N   . GLN A 1 540 ? 108.840 156.843 127.925 1.00 457.29 ? 540 GLN A N   1 
ATOM 3953  C CA  . GLN A 1 540 ? 108.205 155.557 128.228 1.00 499.96 ? 540 GLN A CA  1 
ATOM 3954  C C   . GLN A 1 540 ? 109.174 154.362 128.175 1.00 452.19 ? 540 GLN A C   1 
ATOM 3955  O O   . GLN A 1 540 ? 108.878 153.314 128.742 1.00 405.32 ? 540 GLN A O   1 
ATOM 3956  C CB  . GLN A 1 540 ? 107.003 155.311 127.305 1.00 500.00 ? 540 GLN A CB  1 
ATOM 3957  C CG  . GLN A 1 540 ? 105.844 156.271 127.541 1.00 500.00 ? 540 GLN A CG  1 
ATOM 3958  C CD  . GLN A 1 540 ? 104.548 155.814 126.888 1.00 500.00 ? 540 GLN A CD  1 
ATOM 3959  O OE1 . GLN A 1 540 ? 104.479 155.644 125.670 1.00 500.00 ? 540 GLN A OE1 1 
ATOM 3960  N NE2 . GLN A 1 540 ? 103.512 155.621 127.699 1.00 500.00 ? 540 GLN A NE2 1 
ATOM 3961  N N   . ASP A 1 541 ? 110.310 154.519 127.492 1.00 449.28 ? 541 ASP A N   1 
ATOM 3962  C CA  . ASP A 1 541 ? 111.352 153.490 127.465 1.00 487.43 ? 541 ASP A CA  1 
ATOM 3963  C C   . ASP A 1 541 ? 112.149 153.443 128.762 1.00 432.25 ? 541 ASP A C   1 
ATOM 3964  O O   . ASP A 1 541 ? 112.297 152.381 129.368 1.00 467.92 ? 541 ASP A O   1 
ATOM 3965  C CB  . ASP A 1 541 ? 112.316 153.718 126.297 1.00 500.00 ? 541 ASP A CB  1 
ATOM 3966  C CG  . ASP A 1 541 ? 111.653 153.521 124.944 1.00 500.00 ? 541 ASP A CG  1 
ATOM 3967  O OD1 . ASP A 1 541 ? 110.510 153.998 124.757 1.00 500.00 ? 541 ASP A OD1 1 
ATOM 3968  O OD2 . ASP A 1 541 ? 112.278 152.889 124.065 1.00 500.00 ? 541 ASP A OD2 1 
ATOM 3969  N N   . LEU A 1 542 ? 112.665 154.595 129.174 1.00 396.25 ? 542 LEU A N   1 
ATOM 3970  C CA  . LEU A 1 542 ? 113.549 154.681 130.345 1.00 411.32 ? 542 LEU A CA  1 
ATOM 3971  C C   . LEU A 1 542 ? 112.933 154.192 131.653 1.00 379.50 ? 542 LEU A C   1 
ATOM 3972  O O   . LEU A 1 542 ? 113.673 153.733 132.528 1.00 291.58 ? 542 LEU A O   1 
ATOM 3973  C CB  . LEU A 1 542 ? 114.026 156.117 130.575 1.00 444.75 ? 542 LEU A CB  1 
ATOM 3974  C CG  . LEU A 1 542 ? 115.231 156.626 129.795 1.00 426.46 ? 542 LEU A CG  1 
ATOM 3975  C CD1 . LEU A 1 542 ? 114.905 156.856 128.326 1.00 443.34 ? 542 LEU A CD1 1 
ATOM 3976  C CD2 . LEU A 1 542 ? 115.691 157.904 130.469 1.00 397.57 ? 542 LEU A CD2 1 
ATOM 3977  N N   . ARG A 1 543 ? 111.606 154.308 131.783 1.00 376.48 ? 543 ARG A N   1 
ATOM 3978  C CA  . ARG A 1 543 ? 110.859 153.938 133.004 1.00 416.20 ? 543 ARG A CA  1 
ATOM 3979  C C   . ARG A 1 543 ? 111.448 152.763 133.808 1.00 428.19 ? 543 ARG A C   1 
ATOM 3980  O O   . ARG A 1 543 ? 111.284 152.690 135.030 1.00 442.77 ? 543 ARG A O   1 
ATOM 3981  C CB  . ARG A 1 543 ? 109.394 153.643 132.653 1.00 440.73 ? 543 ARG A CB  1 
ATOM 3982  C CG  . ARG A 1 543 ? 109.199 152.431 131.753 1.00 494.21 ? 543 ARG A CG  1 
ATOM 3983  C CD  . ARG A 1 543 ? 107.739 152.213 131.384 1.00 500.00 ? 543 ARG A CD  1 
ATOM 3984  N NE  . ARG A 1 543 ? 106.918 151.882 132.555 1.00 500.00 ? 543 ARG A NE  1 
ATOM 3985  C CZ  . ARG A 1 543 ? 106.876 150.692 133.169 1.00 500.00 ? 543 ARG A CZ  1 
ATOM 3986  N NH1 . ARG A 1 543 ? 107.616 149.661 132.754 1.00 500.00 ? 543 ARG A NH1 1 
ATOM 3987  N NH2 . ARG A 1 543 ? 106.080 150.531 134.228 1.00 500.00 ? 543 ARG A NH2 1 
ATOM 3988  N N   . SER A 1 544 ? 112.093 151.834 133.099 1.00 402.48 ? 544 SER A N   1 
ATOM 3989  C CA  . SER A 1 544 ? 112.934 150.806 133.700 1.00 372.55 ? 544 SER A CA  1 
ATOM 3990  C C   . SER A 1 544 ? 114.012 151.371 134.629 1.00 375.32 ? 544 SER A C   1 
ATOM 3991  O O   . SER A 1 544 ? 114.091 150.954 135.785 1.00 439.22 ? 544 SER A O   1 
ATOM 3992  C CB  . SER A 1 544 ? 113.600 149.966 132.605 1.00 388.37 ? 544 SER A CB  1 
ATOM 3993  O OG  . SER A 1 544 ? 114.258 148.836 133.156 1.00 419.87 ? 544 SER A OG  1 
ATOM 3994  N N   . TYR A 1 545 ? 114.820 152.316 134.131 1.00 342.82 ? 545 TYR A N   1 
ATOM 3995  C CA  . TYR A 1 545 ? 116.028 152.828 134.845 1.00 356.47 ? 545 TYR A CA  1 
ATOM 3996  C C   . TYR A 1 545 ? 115.858 153.169 136.337 1.00 352.94 ? 545 TYR A C   1 
ATOM 3997  O O   . TYR A 1 545 ? 116.812 153.038 137.119 1.00 280.60 ? 545 TYR A O   1 
ATOM 3998  C CB  . TYR A 1 545 ? 116.658 154.025 134.100 1.00 356.90 ? 545 TYR A CB  1 
ATOM 3999  C CG  . TYR A 1 545 ? 117.510 153.614 132.915 1.00 381.17 ? 545 TYR A CG  1 
ATOM 4000  C CD1 . TYR A 1 545 ? 118.710 152.919 133.097 1.00 352.19 ? 545 TYR A CD1 1 
ATOM 4001  C CD2 . TYR A 1 545 ? 117.116 153.908 131.613 1.00 420.71 ? 545 TYR A CD2 1 
ATOM 4002  C CE1 . TYR A 1 545 ? 119.488 152.524 132.012 1.00 374.61 ? 545 TYR A CE1 1 
ATOM 4003  C CE2 . TYR A 1 545 ? 117.892 153.520 130.522 1.00 434.11 ? 545 TYR A CE2 1 
ATOM 4004  C CZ  . TYR A 1 545 ? 119.075 152.830 130.721 1.00 385.41 ? 545 TYR A CZ  1 
ATOM 4005  O OH  . TYR A 1 545 ? 119.832 152.456 129.631 1.00 324.06 ? 545 TYR A OH  1 
ATOM 4006  N N   . LEU A 1 546 ? 114.650 153.588 136.715 1.00 373.32 ? 546 LEU A N   1 
ATOM 4007  C CA  . LEU A 1 546 ? 114.286 153.806 138.117 1.00 383.72 ? 546 LEU A CA  1 
ATOM 4008  C C   . LEU A 1 546 ? 113.878 152.490 138.774 1.00 397.39 ? 546 LEU A C   1 
ATOM 4009  O O   . LEU A 1 546 ? 112.686 152.222 138.959 1.00 393.19 ? 546 LEU A O   1 
ATOM 4010  C CB  . LEU A 1 546 ? 113.129 154.805 138.228 1.00 383.25 ? 546 LEU A CB  1 
ATOM 4011  C CG  . LEU A 1 546 ? 113.269 156.128 137.485 1.00 393.39 ? 546 LEU A CG  1 
ATOM 4012  C CD1 . LEU A 1 546 ? 111.987 156.935 137.663 1.00 441.34 ? 546 LEU A CD1 1 
ATOM 4013  C CD2 . LEU A 1 546 ? 114.497 156.905 137.929 1.00 352.39 ? 546 LEU A CD2 1 
ATOM 4014  N N   . GLY A 1 547 ? 114.866 151.669 139.128 1.00 397.18 ? 547 GLY A N   1 
ATOM 4015  C CA  . GLY A 1 547 ? 114.606 150.451 139.896 1.00 398.06 ? 547 GLY A CA  1 
ATOM 4016  C C   . GLY A 1 547 ? 114.214 150.815 141.317 1.00 402.68 ? 547 GLY A C   1 
ATOM 4017  O O   . GLY A 1 547 ? 114.318 151.979 141.714 1.00 425.49 ? 547 GLY A O   1 
ATOM 4018  N N   . ASP A 1 548 ? 113.744 149.835 142.085 1.00 406.21 ? 548 ASP A N   1 
ATOM 4019  C CA  . ASP A 1 548 ? 113.555 150.029 143.519 1.00 391.06 ? 548 ASP A CA  1 
ATOM 4020  C C   . ASP A 1 548 ? 114.939 150.381 144.058 1.00 420.27 ? 548 ASP A C   1 
ATOM 4021  O O   . ASP A 1 548 ? 115.847 149.540 144.080 1.00 367.42 ? 548 ASP A O   1 
ATOM 4022  C CB  . ASP A 1 548 ? 112.990 148.779 144.193 1.00 470.08 ? 548 ASP A CB  1 
ATOM 4023  C CG  . ASP A 1 548 ? 112.814 148.947 145.698 1.00 500.00 ? 548 ASP A CG  1 
ATOM 4024  O OD1 . ASP A 1 548 ? 112.543 150.077 146.162 1.00 500.00 ? 548 ASP A OD1 1 
ATOM 4025  O OD2 . ASP A 1 548 ? 112.945 147.934 146.420 1.00 500.00 ? 548 ASP A OD2 1 
ATOM 4026  N N   . GLY A 1 549 ? 115.079 151.641 144.463 1.00 455.10 ? 549 GLY A N   1 
ATOM 4027  C CA  . GLY A 1 549 ? 116.372 152.301 144.588 1.00 443.03 ? 549 GLY A CA  1 
ATOM 4028  C C   . GLY A 1 549 ? 117.128 152.047 145.880 1.00 399.50 ? 549 GLY A C   1 
ATOM 4029  O O   . GLY A 1 549 ? 116.785 151.134 146.633 1.00 410.76 ? 549 GLY A O   1 
ATOM 4030  N N   . PRO A 1 550 ? 118.147 152.858 146.167 1.00 351.13 ? 550 PRO A N   1 
ATOM 4031  C CA  . PRO A 1 550 ? 118.476 154.089 145.444 1.00 353.67 ? 550 PRO A CA  1 
ATOM 4032  C C   . PRO A 1 550 ? 119.108 153.899 144.068 1.00 319.01 ? 550 PRO A C   1 
ATOM 4033  O O   . PRO A 1 550 ? 119.402 152.776 143.667 1.00 308.07 ? 550 PRO A O   1 
ATOM 4034  C CB  . PRO A 1 550 ? 119.519 154.725 146.368 1.00 389.64 ? 550 PRO A CB  1 
ATOM 4035  C CG  . PRO A 1 550 ? 120.244 153.560 146.957 1.00 391.13 ? 550 PRO A CG  1 
ATOM 4036  C CD  . PRO A 1 550 ? 119.288 152.387 146.970 1.00 380.20 ? 550 PRO A CD  1 
ATOM 4037  N N   . LEU A 1 551 ? 119.320 155.012 143.370 1.00 332.34 ? 551 LEU A N   1 
ATOM 4038  C CA  . LEU A 1 551 ? 120.271 155.054 142.263 1.00 349.81 ? 551 LEU A CA  1 
ATOM 4039  C C   . LEU A 1 551 ? 121.684 154.931 142.802 1.00 326.39 ? 551 LEU A C   1 
ATOM 4040  O O   . LEU A 1 551 ? 121.962 155.322 143.939 1.00 315.57 ? 551 LEU A O   1 
ATOM 4041  C CB  . LEU A 1 551 ? 120.165 156.356 141.465 1.00 363.50 ? 551 LEU A CB  1 
ATOM 4042  C CG  . LEU A 1 551 ? 118.819 156.687 140.810 1.00 390.13 ? 551 LEU A CG  1 
ATOM 4043  C CD1 . LEU A 1 551 ? 119.023 157.717 139.704 1.00 386.01 ? 551 LEU A CD1 1 
ATOM 4044  C CD2 . LEU A 1 551 ? 118.121 155.446 140.262 1.00 389.95 ? 551 LEU A CD2 1 
ATOM 4045  N N   . GLN A 1 552 ? 122.567 154.398 141.963 1.00 320.62 ? 552 GLN A N   1 
ATOM 4046  C CA  . GLN A 1 552 ? 123.956 154.146 142.322 1.00 318.21 ? 552 GLN A CA  1 
ATOM 4047  C C   . GLN A 1 552 ? 124.864 154.821 141.298 1.00 327.77 ? 552 GLN A C   1 
ATOM 4048  O O   . GLN A 1 552 ? 124.860 154.470 140.102 1.00 256.28 ? 552 GLN A O   1 
ATOM 4049  C CB  . GLN A 1 552 ? 124.195 152.649 142.395 1.00 325.01 ? 552 GLN A CB  1 
ATOM 4050  C CG  . GLN A 1 552 ? 123.467 151.975 143.550 1.00 314.91 ? 552 GLN A CG  1 
ATOM 4051  C CD  . GLN A 1 552 ? 124.084 152.278 144.907 1.00 380.78 ? 552 GLN A CD  1 
ATOM 4052  O OE1 . GLN A 1 552 ? 125.242 152.671 145.002 1.00 389.20 ? 552 GLN A OE1 1 
ATOM 4053  N NE2 . GLN A 1 552 ? 123.307 152.087 145.966 1.00 426.44 ? 552 GLN A NE2 1 
ATOM 4054  N N   . HIS A 1 553 ? 125.659 155.775 141.794 1.00 343.38 ? 553 HIS A N   1 
ATOM 4055  C CA  . HIS A 1 553 ? 126.151 156.899 140.984 1.00 350.04 ? 553 HIS A CA  1 
ATOM 4056  C C   . HIS A 1 553 ? 127.499 156.628 140.348 1.00 340.33 ? 553 HIS A C   1 
ATOM 4057  O O   . HIS A 1 553 ? 128.413 157.436 140.433 1.00 281.38 ? 553 HIS A O   1 
ATOM 4058  C CB  . HIS A 1 553 ? 126.106 158.187 141.823 1.00 311.10 ? 553 HIS A CB  1 
ATOM 4059  C CG  . HIS A 1 553 ? 124.716 158.519 142.266 1.00 355.97 ? 553 HIS A CG  1 
ATOM 4060  N ND1 . HIS A 1 553 ? 123.885 159.351 141.548 1.00 363.64 ? 553 HIS A ND1 1 
ATOM 4061  C CD2 . HIS A 1 553 ? 123.972 158.045 143.293 1.00 397.98 ? 553 HIS A CD2 1 
ATOM 4062  C CE1 . HIS A 1 553 ? 122.704 159.411 142.139 1.00 340.06 ? 553 HIS A CE1 1 
ATOM 4063  N NE2 . HIS A 1 553 ? 122.732 158.630 143.202 1.00 384.11 ? 553 HIS A NE2 1 
ATOM 4064  N N   . TYR A 1 554 ? 127.548 155.506 139.629 1.00 334.58 ? 554 TYR A N   1 
ATOM 4065  C CA  . TYR A 1 554 ? 128.768 154.932 139.082 1.00 330.00 ? 554 TYR A CA  1 
ATOM 4066  C C   . TYR A 1 554 ? 128.867 155.232 137.606 1.00 317.91 ? 554 TYR A C   1 
ATOM 4067  O O   . TYR A 1 554 ? 127.866 155.180 136.896 1.00 310.43 ? 554 TYR A O   1 
ATOM 4068  C CB  . TYR A 1 554 ? 128.723 153.419 139.270 1.00 311.74 ? 554 TYR A CB  1 
ATOM 4069  C CG  . TYR A 1 554 ? 129.993 152.680 138.898 1.00 343.41 ? 554 TYR A CG  1 
ATOM 4070  C CD1 . TYR A 1 554 ? 131.191 152.906 139.571 1.00 335.20 ? 554 TYR A CD1 1 
ATOM 4071  C CD2 . TYR A 1 554 ? 129.989 151.727 137.884 1.00 407.22 ? 554 TYR A CD2 1 
ATOM 4072  C CE1 . TYR A 1 554 ? 132.346 152.209 139.235 1.00 349.26 ? 554 TYR A CE1 1 
ATOM 4073  C CE2 . TYR A 1 554 ? 131.138 151.031 137.537 1.00 398.51 ? 554 TYR A CE2 1 
ATOM 4074  C CZ  . TYR A 1 554 ? 132.313 151.268 138.211 1.00 365.62 ? 554 TYR A CZ  1 
ATOM 4075  O OH  . TYR A 1 554 ? 133.427 150.548 137.847 1.00 315.30 ? 554 TYR A OH  1 
ATOM 4076  N N   . ILE A 1 555 ? 130.074 155.534 137.133 1.00 329.12 ? 555 ILE A N   1 
ATOM 4077  C CA  . ILE A 1 555 ? 130.336 155.496 135.706 1.00 338.32 ? 555 ILE A CA  1 
ATOM 4078  C C   . ILE A 1 555 ? 130.551 154.029 135.375 1.00 385.24 ? 555 ILE A C   1 
ATOM 4079  O O   . ILE A 1 555 ? 131.679 153.522 135.380 1.00 389.14 ? 555 ILE A O   1 
ATOM 4080  C CB  . ILE A 1 555 ? 131.552 156.349 135.292 1.00 367.48 ? 555 ILE A CB  1 
ATOM 4081  C CG1 . ILE A 1 555 ? 131.314 157.819 135.664 1.00 414.07 ? 555 ILE A CG1 1 
ATOM 4082  C CG2 . ILE A 1 555 ? 131.831 156.194 133.799 1.00 360.19 ? 555 ILE A CG2 1 
ATOM 4083  C CD1 . ILE A 1 555 ? 132.155 158.311 136.818 1.00 459.59 ? 555 ILE A CD1 1 
ATOM 4084  N N   . ALA A 1 556 ? 129.437 153.338 135.149 1.00 429.25 ? 556 ALA A N   1 
ATOM 4085  C CA  . ALA A 1 556 ? 129.467 152.003 134.578 1.00 442.13 ? 556 ALA A CA  1 
ATOM 4086  C C   . ALA A 1 556 ? 129.757 152.235 133.124 1.00 396.43 ? 556 ALA A C   1 
ATOM 4087  O O   . ALA A 1 556 ? 129.263 153.207 132.536 1.00 386.77 ? 556 ALA A O   1 
ATOM 4088  C CB  . ALA A 1 556 ? 128.131 151.287 134.748 1.00 492.49 ? 556 ALA A CB  1 
ATOM 4089  N N   . VAL A 1 557 ? 130.565 151.360 132.541 1.00 358.45 ? 557 VAL A N   1 
ATOM 4090  C CA  . VAL A 1 557 ? 130.837 151.431 131.106 1.00 375.56 ? 557 VAL A CA  1 
ATOM 4091  C C   . VAL A 1 557 ? 129.532 151.619 130.326 1.00 344.82 ? 557 VAL A C   1 
ATOM 4092  O O   . VAL A 1 557 ? 129.503 152.353 129.341 1.00 364.22 ? 557 VAL A O   1 
ATOM 4093  C CB  . VAL A 1 557 ? 131.623 150.206 130.587 1.00 438.84 ? 557 VAL A CB  1 
ATOM 4094  C CG1 . VAL A 1 557 ? 133.050 150.219 131.137 1.00 435.05 ? 557 VAL A CG1 1 
ATOM 4095  C CG2 . VAL A 1 557 ? 130.899 148.888 130.893 1.00 481.53 ? 557 VAL A CG2 1 
ATOM 4096  N N   . SER A 1 558 ? 128.470 150.962 130.803 1.00 335.84 ? 558 SER A N   1 
ATOM 4097  C CA  . SER A 1 558 ? 127.085 151.146 130.347 1.00 398.34 ? 558 SER A CA  1 
ATOM 4098  C C   . SER A 1 558 ? 126.841 152.290 129.366 1.00 398.96 ? 558 SER A C   1 
ATOM 4099  O O   . SER A 1 558 ? 126.690 152.042 128.168 1.00 466.26 ? 558 SER A O   1 
ATOM 4100  C CB  . SER A 1 558 ? 126.143 151.304 131.555 1.00 416.03 ? 558 SER A CB  1 
ATOM 4101  O OG  . SER A 1 558 ? 126.375 152.517 132.247 1.00 403.65 ? 558 SER A OG  1 
ATOM 4102  N N   . SER A 1 559 ? 126.830 153.523 129.876 1.00 357.71 ? 559 SER A N   1 
ATOM 4103  C CA  . SER A 1 559 ? 126.402 154.710 129.129 1.00 369.22 ? 559 SER A CA  1 
ATOM 4104  C C   . SER A 1 559 ? 124.896 154.661 128.724 1.00 364.78 ? 559 SER A C   1 
ATOM 4105  O O   . SER A 1 559 ? 124.464 153.709 128.064 1.00 317.77 ? 559 SER A O   1 
ATOM 4106  C CB  . SER A 1 559 ? 127.288 154.939 127.902 1.00 375.31 ? 559 SER A CB  1 
ATOM 4107  O OG  . SER A 1 559 ? 127.146 156.262 127.427 1.00 410.13 ? 559 SER A OG  1 
ATOM 4108  N N   . PRO A 1 560 ? 124.086 155.649 129.116 1.00 367.62 ? 560 PRO A N   1 
ATOM 4109  C CA  . PRO A 1 560 ? 124.474 156.785 129.970 1.00 382.80 ? 560 PRO A CA  1 
ATOM 4110  C C   . PRO A 1 560 ? 124.682 156.474 131.453 1.00 383.13 ? 560 PRO A C   1 
ATOM 4111  O O   . PRO A 1 560 ? 125.431 157.188 132.113 1.00 350.11 ? 560 PRO A O   1 
ATOM 4112  C CB  . PRO A 1 560 ? 123.283 157.738 129.822 1.00 389.50 ? 560 PRO A CB  1 
ATOM 4113  C CG  . PRO A 1 560 ? 122.733 157.423 128.485 1.00 371.66 ? 560 PRO A CG  1 
ATOM 4114  C CD  . PRO A 1 560 ? 122.824 155.928 128.410 1.00 360.55 ? 560 PRO A CD  1 
ATOM 4115  N N   . THR A 1 561 ? 124.019 155.417 131.931 1.00 378.38 ? 561 THR A N   1 
ATOM 4116  C CA  . THR A 1 561 ? 123.934 154.997 133.342 1.00 355.07 ? 561 THR A CA  1 
ATOM 4117  C C   . THR A 1 561 ? 122.656 155.548 133.955 1.00 292.64 ? 561 THR A C   1 
ATOM 4118  O O   . THR A 1 561 ? 122.151 156.578 133.516 1.00 300.59 ? 561 THR A O   1 
ATOM 4119  C CB  . THR A 1 561 ? 125.182 155.307 134.221 1.00 401.03 ? 561 THR A CB  1 
ATOM 4120  O OG1 . THR A 1 561 ? 125.315 154.288 135.221 1.00 461.37 ? 561 THR A OG1 1 
ATOM 4121  C CG2 . THR A 1 561 ? 125.096 156.678 134.920 1.00 376.85 ? 561 THR A CG2 1 
ATOM 4122  N N   . ASN A 1 562 ? 122.168 154.854 134.982 1.00 346.70 ? 562 ASN A N   1 
ATOM 4123  C CA  . ASN A 1 562 ? 120.859 155.113 135.584 1.00 370.95 ? 562 ASN A CA  1 
ATOM 4124  C C   . ASN A 1 562 ? 120.751 156.585 135.994 1.00 378.35 ? 562 ASN A C   1 
ATOM 4125  O O   . ASN A 1 562 ? 119.732 157.226 135.762 1.00 351.53 ? 562 ASN A O   1 
ATOM 4126  C CB  . ASN A 1 562 ? 120.659 154.296 136.872 1.00 380.58 ? 562 ASN A CB  1 
ATOM 4127  C CG  . ASN A 1 562 ? 120.740 152.801 136.658 1.00 366.94 ? 562 ASN A CG  1 
ATOM 4128  O OD1 . ASN A 1 562 ? 121.834 152.229 136.673 1.00 380.36 ? 562 ASN A OD1 1 
ATOM 4129  N ND2 . ASN A 1 562 ? 119.584 152.159 136.479 1.00 325.52 ? 562 ASN A ND2 1 
ATOM 4130  N N   . THR A 1 563 ? 121.780 157.020 136.703 1.00 377.40 ? 563 THR A N   1 
ATOM 4131  C CA  . THR A 1 563 ? 121.843 158.349 137.305 1.00 372.49 ? 563 THR A CA  1 
ATOM 4132  C C   . THR A 1 563 ? 121.615 159.439 136.283 1.00 343.43 ? 563 THR A C   1 
ATOM 4133  O O   . THR A 1 563 ? 120.810 160.359 136.492 1.00 336.39 ? 563 THR A O   1 
ATOM 4134  C CB  . THR A 1 563 ? 123.242 158.524 137.971 1.00 393.16 ? 563 THR A CB  1 
ATOM 4135  O OG1 . THR A 1 563 ? 123.201 157.979 139.297 1.00 417.44 ? 563 THR A OG1 1 
ATOM 4136  C CG2 . THR A 1 563 ? 123.728 159.990 138.034 1.00 408.20 ? 563 THR A CG2 1 
ATOM 4137  N N   . THR A 1 564 ? 122.392 159.280 135.224 1.00 321.87 ? 564 THR A N   1 
ATOM 4138  C CA  . THR A 1 564 ? 122.664 160.396 134.344 1.00 330.93 ? 564 THR A CA  1 
ATOM 4139  C C   . THR A 1 564 ? 121.390 160.839 133.636 1.00 276.68 ? 564 THR A C   1 
ATOM 4140  O O   . THR A 1 564 ? 121.094 162.046 133.559 1.00 299.68 ? 564 THR A O   1 
ATOM 4141  C CB  . THR A 1 564 ? 123.768 160.080 133.318 1.00 376.06 ? 564 THR A CB  1 
ATOM 4142  O OG1 . THR A 1 564 ? 124.959 159.691 134.014 1.00 406.63 ? 564 THR A OG1 1 
ATOM 4143  C CG2 . THR A 1 564 ? 124.092 161.304 132.454 1.00 354.72 ? 564 THR A CG2 1 
ATOM 4144  N N   . TYR A 1 565 ? 120.666 159.852 133.127 1.00 281.50 ? 565 TYR A N   1 
ATOM 4145  C CA  . TYR A 1 565 ? 119.409 160.067 132.410 1.00 333.76 ? 565 TYR A CA  1 
ATOM 4146  C C   . TYR A 1 565 ? 118.418 160.818 133.297 1.00 347.38 ? 565 TYR A C   1 
ATOM 4147  O O   . TYR A 1 565 ? 117.781 161.797 132.870 1.00 383.99 ? 565 TYR A O   1 
ATOM 4148  C CB  . TYR A 1 565 ? 118.785 158.721 132.001 1.00 366.83 ? 565 TYR A CB  1 
ATOM 4149  C CG  . TYR A 1 565 ? 119.014 158.289 130.560 1.00 410.58 ? 565 TYR A CG  1 
ATOM 4150  C CD1 . TYR A 1 565 ? 118.914 159.206 129.496 1.00 428.26 ? 565 TYR A CD1 1 
ATOM 4151  C CD2 . TYR A 1 565 ? 119.265 156.951 130.248 1.00 417.13 ? 565 TYR A CD2 1 
ATOM 4152  C CE1 . TYR A 1 565 ? 119.095 158.808 128.180 1.00 414.33 ? 565 TYR A CE1 1 
ATOM 4153  C CE2 . TYR A 1 565 ? 119.443 156.546 128.931 1.00 451.36 ? 565 TYR A CE2 1 
ATOM 4154  C CZ  . TYR A 1 565 ? 119.352 157.478 127.902 1.00 458.95 ? 565 TYR A CZ  1 
ATOM 4155  O OH  . TYR A 1 565 ? 119.535 157.093 126.594 1.00 499.28 ? 565 TYR A OH  1 
ATOM 4156  N N   . VAL A 1 566 ? 118.320 160.322 134.527 1.00 318.22 ? 566 VAL A N   1 
ATOM 4157  C CA  . VAL A 1 566 ? 117.420 160.889 135.538 1.00 369.48 ? 566 VAL A CA  1 
ATOM 4158  C C   . VAL A 1 566 ? 117.758 162.359 135.774 1.00 353.82 ? 566 VAL A C   1 
ATOM 4159  O O   . VAL A 1 566 ? 116.866 163.220 135.814 1.00 339.86 ? 566 VAL A O   1 
ATOM 4160  C CB  . VAL A 1 566 ? 117.455 160.093 136.858 1.00 394.14 ? 566 VAL A CB  1 
ATOM 4161  C CG1 . VAL A 1 566 ? 116.538 160.732 137.884 1.00 411.36 ? 566 VAL A CG1 1 
ATOM 4162  C CG2 . VAL A 1 566 ? 117.015 158.653 136.633 1.00 406.03 ? 566 VAL A CG2 1 
ATOM 4163  N N   . VAL A 1 567 ? 119.053 162.601 135.925 1.00 330.78 ? 567 VAL A N   1 
ATOM 4164  C CA  . VAL A 1 567 ? 119.585 163.948 136.164 1.00 333.33 ? 567 VAL A CA  1 
ATOM 4165  C C   . VAL A 1 567 ? 119.184 164.880 135.027 1.00 326.28 ? 567 VAL A C   1 
ATOM 4166  O O   . VAL A 1 567 ? 118.731 166.005 135.258 1.00 300.69 ? 567 VAL A O   1 
ATOM 4167  C CB  . VAL A 1 567 ? 121.117 163.920 136.403 1.00 353.18 ? 567 VAL A CB  1 
ATOM 4168  C CG1 . VAL A 1 567 ? 121.820 165.129 135.799 1.00 352.39 ? 567 VAL A CG1 1 
ATOM 4169  C CG2 . VAL A 1 567 ? 121.407 163.809 137.896 1.00 346.02 ? 567 VAL A CG2 1 
ATOM 4170  N N   . GLN A 1 568 ? 119.367 164.374 133.814 1.00 355.43 ? 568 GLN A N   1 
ATOM 4171  C CA  . GLN A 1 568 ? 119.056 165.111 132.587 1.00 372.04 ? 568 GLN A CA  1 
ATOM 4172  C C   . GLN A 1 568 ? 117.582 165.503 132.584 1.00 380.62 ? 568 GLN A C   1 
ATOM 4173  O O   . GLN A 1 568 ? 117.245 166.670 132.279 1.00 390.41 ? 568 GLN A O   1 
ATOM 4174  C CB  . GLN A 1 568 ? 119.336 164.293 131.329 1.00 379.32 ? 568 GLN A CB  1 
ATOM 4175  C CG  . GLN A 1 568 ? 119.242 165.122 130.051 1.00 406.81 ? 568 GLN A CG  1 
ATOM 4176  C CD  . GLN A 1 568 ? 119.017 164.302 128.798 1.00 456.61 ? 568 GLN A CD  1 
ATOM 4177  O OE1 . GLN A 1 568 ? 118.857 163.081 128.846 1.00 484.73 ? 568 GLN A OE1 1 
ATOM 4178  N NE2 . GLN A 1 568 ? 119.003 164.978 127.654 1.00 480.32 ? 568 GLN A NE2 1 
ATOM 4179  N N   . TYR A 1 569 ? 116.746 164.518 132.922 1.00 385.54 ? 569 TYR A N   1 
ATOM 4180  C CA  . TYR A 1 569 ? 115.298 164.691 132.843 1.00 400.55 ? 569 TYR A CA  1 
ATOM 4181  C C   . TYR A 1 569 ? 114.754 165.539 133.972 1.00 381.53 ? 569 TYR A C   1 
ATOM 4182  O O   . TYR A 1 569 ? 113.969 166.476 133.738 1.00 370.37 ? 569 TYR A O   1 
ATOM 4183  C CB  . TYR A 1 569 ? 114.539 163.371 132.606 1.00 402.58 ? 569 TYR A CB  1 
ATOM 4184  C CG  . TYR A 1 569 ? 114.563 162.901 131.142 1.00 428.33 ? 569 TYR A CG  1 
ATOM 4185  C CD1 . TYR A 1 569 ? 114.346 163.803 130.080 1.00 440.73 ? 569 TYR A CD1 1 
ATOM 4186  C CD2 . TYR A 1 569 ? 114.783 161.558 130.812 1.00 401.58 ? 569 TYR A CD2 1 
ATOM 4187  C CE1 . TYR A 1 569 ? 114.370 163.384 128.758 1.00 418.31 ? 569 TYR A CE1 1 
ATOM 4188  C CE2 . TYR A 1 569 ? 114.800 161.135 129.485 1.00 373.75 ? 569 TYR A CE2 1 
ATOM 4189  C CZ  . TYR A 1 569 ? 114.597 162.050 128.466 1.00 401.70 ? 569 TYR A CZ  1 
ATOM 4190  O OH  . TYR A 1 569 ? 114.621 161.633 127.157 1.00 404.40 ? 569 TYR A OH  1 
ATOM 4191  N N   . ALA A 1 570 ? 115.296 165.295 135.163 1.00 375.49 ? 570 ALA A N   1 
ATOM 4192  C CA  . ALA A 1 570 ? 115.031 166.149 136.348 1.00 394.28 ? 570 ALA A CA  1 
ATOM 4193  C C   . ALA A 1 570 ? 115.455 167.578 136.044 1.00 389.31 ? 570 ALA A C   1 
ATOM 4194  O O   . ALA A 1 570 ? 114.703 168.522 136.344 1.00 413.84 ? 570 ALA A O   1 
ATOM 4195  C CB  . ALA A 1 570 ? 115.783 165.626 137.560 1.00 405.89 ? 570 ALA A CB  1 
ATOM 4196  N N   . LEU A 1 571 ? 116.651 167.699 135.446 1.00 358.55 ? 571 LEU A N   1 
ATOM 4197  C CA  . LEU A 1 571 ? 117.200 169.013 135.100 1.00 369.19 ? 571 LEU A CA  1 
ATOM 4198  C C   . LEU A 1 571 ? 116.264 169.745 134.146 1.00 377.20 ? 571 LEU A C   1 
ATOM 4199  O O   . LEU A 1 571 ? 115.991 170.929 134.326 1.00 395.85 ? 571 LEU A O   1 
ATOM 4200  C CB  . LEU A 1 571 ? 118.622 168.915 134.535 1.00 384.22 ? 571 LEU A CB  1 
ATOM 4201  C CG  . LEU A 1 571 ? 119.344 170.206 134.125 1.00 400.05 ? 571 LEU A CG  1 
ATOM 4202  C CD1 . LEU A 1 571 ? 119.283 171.267 135.215 1.00 399.98 ? 571 LEU A CD1 1 
ATOM 4203  C CD2 . LEU A 1 571 ? 120.792 169.897 133.753 1.00 398.10 ? 571 LEU A CD2 1 
ATOM 4204  N N   . ALA A 1 572 ? 115.794 169.010 133.156 1.00 370.34 ? 572 ALA A N   1 
ATOM 4205  C CA  . ALA A 1 572 ? 114.874 169.519 132.134 1.00 372.21 ? 572 ALA A CA  1 
ATOM 4206  C C   . ALA A 1 572 ? 113.612 170.059 132.798 1.00 379.62 ? 572 ALA A C   1 
ATOM 4207  O O   . ALA A 1 572 ? 113.147 171.176 132.482 1.00 393.83 ? 572 ALA A O   1 
ATOM 4208  C CB  . ALA A 1 572 ? 114.520 168.419 131.148 1.00 400.09 ? 572 ALA A CB  1 
ATOM 4209  N N   . ASN A 1 573 ? 113.090 169.248 133.716 1.00 352.00 ? 573 ASN A N   1 
ATOM 4210  C CA  . ASN A 1 573 ? 111.875 169.591 134.464 1.00 333.37 ? 573 ASN A CA  1 
ATOM 4211  C C   . ASN A 1 573 ? 112.071 170.894 135.222 1.00 335.81 ? 573 ASN A C   1 
ATOM 4212  O O   . ASN A 1 573 ? 111.203 171.771 135.203 1.00 374.27 ? 573 ASN A O   1 
ATOM 4213  C CB  . ASN A 1 573 ? 111.382 168.517 135.437 1.00 342.15 ? 573 ASN A CB  1 
ATOM 4214  C CG  . ASN A 1 573 ? 109.863 168.572 135.624 1.00 357.53 ? 573 ASN A CG  1 
ATOM 4215  O OD1 . ASN A 1 573 ? 109.129 168.020 134.803 1.00 389.34 ? 573 ASN A OD1 1 
ATOM 4216  N ND2 . ASN A 1 573 ? 109.386 169.237 136.690 1.00 320.00 ? 573 ASN A ND2 1 
ATOM 4217  N N   . LEU A 1 574 ? 113.221 170.984 135.877 1.00 355.66 ? 574 LEU A N   1 
ATOM 4218  C CA  . LEU A 1 574 ? 113.605 172.158 136.666 1.00 386.07 ? 574 LEU A CA  1 
ATOM 4219  C C   . LEU A 1 574 ? 113.750 173.453 135.889 1.00 379.81 ? 574 LEU A C   1 
ATOM 4220  O O   . LEU A 1 574 ? 113.043 174.459 136.149 1.00 322.67 ? 574 LEU A O   1 
ATOM 4221  C CB  . LEU A 1 574 ? 114.880 171.867 137.477 1.00 401.52 ? 574 LEU A CB  1 
ATOM 4222  C CG  . LEU A 1 574 ? 114.721 171.101 138.807 1.00 420.27 ? 574 LEU A CG  1 
ATOM 4223  C CD1 . LEU A 1 574 ? 113.466 170.235 138.931 1.00 422.09 ? 574 LEU A CD1 1 
ATOM 4224  C CD2 . LEU A 1 574 ? 115.971 170.276 139.077 1.00 428.86 ? 574 LEU A CD2 1 
ATOM 4225  N N   . THR A 1 575 ? 114.659 173.422 134.916 1.00 416.46 ? 575 THR A N   1 
ATOM 4226  C CA  . THR A 1 575 ? 114.877 174.556 133.999 1.00 453.35 ? 575 THR A CA  1 
ATOM 4227  C C   . THR A 1 575 ? 113.661 174.814 133.086 1.00 436.83 ? 575 THR A C   1 
ATOM 4228  O O   . THR A 1 575 ? 113.060 175.911 133.072 1.00 406.63 ? 575 THR A O   1 
ATOM 4229  C CB  . THR A 1 575 ? 116.120 174.337 133.102 1.00 499.76 ? 575 THR A CB  1 
ATOM 4230  O OG1 . THR A 1 575 ? 116.002 173.088 132.406 1.00 500.00 ? 575 THR A OG1 1 
ATOM 4231  C CG2 . THR A 1 575 ? 117.405 174.336 133.923 1.00 500.00 ? 575 THR A CG2 1 
ATOM 4232  N N   . GLY A 1 576 ? 113.305 173.790 132.323 1.00 460.09 ? 576 GLY A N   1 
ATOM 4233  C CA  . GLY A 1 576 ? 112.366 173.924 131.222 1.00 476.13 ? 576 GLY A CA  1 
ATOM 4234  C C   . GLY A 1 576 ? 110.927 174.256 131.557 1.00 475.18 ? 576 GLY A C   1 
ATOM 4235  O O   . GLY A 1 576 ? 110.569 174.527 132.711 1.00 386.23 ? 576 GLY A O   1 
ATOM 4236  N N   . THR A 1 577 ? 110.107 174.224 130.510 1.00 500.00 ? 577 THR A N   1 
ATOM 4237  C CA  . THR A 1 577 ? 108.685 174.540 130.589 1.00 500.00 ? 577 THR A CA  1 
ATOM 4238  C C   . THR A 1 577 ? 107.890 173.644 129.627 1.00 492.87 ? 577 THR A C   1 
ATOM 4239  O O   . THR A 1 577 ? 108.321 173.380 128.500 1.00 451.73 ? 577 THR A O   1 
ATOM 4240  C CB  . THR A 1 577 ? 108.424 176.044 130.317 1.00 500.00 ? 577 THR A CB  1 
ATOM 4241  O OG1 . THR A 1 577 ? 107.041 176.261 130.009 1.00 500.00 ? 577 THR A OG1 1 
ATOM 4242  C CG2 . THR A 1 577 ? 109.281 176.560 129.171 1.00 500.00 ? 577 THR A CG2 1 
ATOM 4243  N N   . VAL A 1 578 ? 106.739 173.168 130.100 1.00 484.11 ? 578 VAL A N   1 
ATOM 4244  C CA  . VAL A 1 578 ? 105.800 172.391 129.290 1.00 472.89 ? 578 VAL A CA  1 
ATOM 4245  C C   . VAL A 1 578 ? 105.212 173.275 128.179 1.00 484.71 ? 578 VAL A C   1 
ATOM 4246  O O   . VAL A 1 578 ? 105.108 174.495 128.340 1.00 471.89 ? 578 VAL A O   1 
ATOM 4247  C CB  . VAL A 1 578 ? 104.680 171.768 130.175 1.00 486.49 ? 578 VAL A CB  1 
ATOM 4248  C CG1 . VAL A 1 578 ? 103.697 172.825 130.683 1.00 496.53 ? 578 VAL A CG1 1 
ATOM 4249  C CG2 . VAL A 1 578 ? 103.939 170.663 129.439 1.00 498.39 ? 578 VAL A CG2 1 
ATOM 4250  N N   . VAL A 1 579 ? 104.844 172.658 127.057 1.00 500.00 ? 579 VAL A N   1 
ATOM 4251  C CA  . VAL A 1 579 ? 104.324 173.391 125.894 1.00 500.00 ? 579 VAL A CA  1 
ATOM 4252  C C   . VAL A 1 579 ? 103.283 172.536 125.122 1.00 500.00 ? 579 VAL A C   1 
ATOM 4253  O O   . VAL A 1 579 ? 103.524 171.355 124.846 1.00 489.62 ? 579 VAL A O   1 
ATOM 4254  C CB  . VAL A 1 579 ? 105.508 173.897 125.023 1.00 463.23 ? 579 VAL A CB  1 
ATOM 4255  C CG1 . VAL A 1 579 ? 106.154 172.764 124.232 1.00 470.46 ? 579 VAL A CG1 1 
ATOM 4256  C CG2 . VAL A 1 579 ? 105.073 175.035 124.110 1.00 473.19 ? 579 VAL A CG2 1 
ATOM 4257  N N   . ASN A 1 580 ? 102.125 173.133 124.806 1.00 500.00 ? 580 ASN A N   1 
ATOM 4258  C CA  . ASN A 1 580 ? 100.945 172.385 124.304 1.00 500.00 ? 580 ASN A CA  1 
ATOM 4259  C C   . ASN A 1 580 ? 101.070 171.885 122.853 1.00 475.39 ? 580 ASN A C   1 
ATOM 4260  O O   . ASN A 1 580 ? 100.866 172.645 121.903 1.00 443.45 ? 580 ASN A O   1 
ATOM 4261  C CB  . ASN A 1 580 ? 99.628  173.183 124.509 1.00 500.00 ? 580 ASN A CB  1 
ATOM 4262  C CG  . ASN A 1 580 ? 99.503  174.412 123.605 1.00 494.30 ? 580 ASN A CG  1 
ATOM 4263  O OD1 . ASN A 1 580 ? 100.455 175.177 123.439 1.00 499.80 ? 580 ASN A OD1 1 
ATOM 4264  N ND2 . ASN A 1 580 ? 98.316  174.608 123.025 1.00 435.16 ? 580 ASN A ND2 1 
ATOM 4265  N N   . LEU A 1 581 ? 101.397 170.600 122.703 1.00 472.16 ? 581 LEU A N   1 
ATOM 4266  C CA  . LEU A 1 581 ? 101.630 169.990 121.385 1.00 500.00 ? 581 LEU A CA  1 
ATOM 4267  C C   . LEU A 1 581 ? 101.027 168.567 121.303 1.00 453.84 ? 581 LEU A C   1 
ATOM 4268  O O   . LEU A 1 581 ? 100.243 168.162 122.168 1.00 388.65 ? 581 LEU A O   1 
ATOM 4269  C CB  . LEU A 1 581 ? 103.145 169.958 121.085 1.00 500.00 ? 581 LEU A CB  1 
ATOM 4270  C CG  . LEU A 1 581 ? 104.013 171.217 121.298 1.00 500.00 ? 581 LEU A CG  1 
ATOM 4271  C CD1 . LEU A 1 581 ? 105.500 170.887 121.173 1.00 500.00 ? 581 LEU A CD1 1 
ATOM 4272  C CD2 . LEU A 1 581 ? 103.636 172.344 120.340 1.00 500.00 ? 581 LEU A CD2 1 
ATOM 4273  N N   . THR A 1 582 ? 101.358 167.852 120.226 1.00 443.36 ? 582 THR A N   1 
ATOM 4274  C CA  . THR A 1 582 ? 101.193 166.390 120.144 1.00 468.29 ? 582 THR A CA  1 
ATOM 4275  C C   . THR A 1 582 ? 102.575 165.722 120.053 1.00 470.79 ? 582 THR A C   1 
ATOM 4276  O O   . THR A 1 582 ? 103.599 166.401 120.157 1.00 483.91 ? 582 THR A O   1 
ATOM 4277  C CB  . THR A 1 582 ? 100.290 165.959 118.964 1.00 490.08 ? 582 THR A CB  1 
ATOM 4278  O OG1 . THR A 1 582 ? 99.993  164.561 119.079 1.00 500.00 ? 582 THR A OG1 1 
ATOM 4279  C CG2 . THR A 1 582 ? 100.947 166.218 117.605 1.00 482.01 ? 582 THR A CG2 1 
ATOM 4280  N N   . ARG A 1 583 ? 102.598 164.402 119.859 1.00 446.77 ? 583 ARG A N   1 
ATOM 4281  C CA  . ARG A 1 583 ? 103.834 163.633 119.910 1.00 457.98 ? 583 ARG A CA  1 
ATOM 4282  C C   . ARG A 1 583 ? 104.673 163.904 118.668 1.00 452.07 ? 583 ARG A C   1 
ATOM 4283  O O   . ARG A 1 583 ? 105.897 164.088 118.767 1.00 431.40 ? 583 ARG A O   1 
ATOM 4284  C CB  . ARG A 1 583 ? 103.527 162.134 120.017 1.00 500.00 ? 583 ARG A CB  1 
ATOM 4285  C CG  . ARG A 1 583 ? 104.765 161.256 120.177 1.00 500.00 ? 583 ARG A CG  1 
ATOM 4286  C CD  . ARG A 1 583 ? 104.468 159.768 120.040 1.00 500.00 ? 583 ARG A CD  1 
ATOM 4287  N NE  . ARG A 1 583 ? 105.625 159.030 119.512 1.00 500.00 ? 583 ARG A NE  1 
ATOM 4288  C CZ  . ARG A 1 583 ? 105.964 158.917 118.220 1.00 500.00 ? 583 ARG A CZ  1 
ATOM 4289  N NH1 . ARG A 1 583 ? 105.244 159.496 117.252 1.00 500.00 ? 583 ARG A NH1 1 
ATOM 4290  N NH2 . ARG A 1 583 ? 107.044 158.214 117.884 1.00 500.00 ? 583 ARG A NH2 1 
ATOM 4291  N N   . GLU A 1 584 ? 103.997 163.888 117.520 1.00 468.29 ? 584 GLU A N   1 
ATOM 4292  C CA  . GLU A 1 584 ? 104.642 164.087 116.224 1.00 500.00 ? 584 GLU A CA  1 
ATOM 4293  C C   . GLU A 1 584 ? 105.353 165.439 116.192 1.00 471.99 ? 584 GLU A C   1 
ATOM 4294  O O   . GLU A 1 584 ? 106.515 165.536 115.758 1.00 391.96 ? 584 GLU A O   1 
ATOM 4295  C CB  . GLU A 1 584 ? 103.641 163.967 115.063 1.00 500.00 ? 584 GLU A CB  1 
ATOM 4296  C CG  . GLU A 1 584 ? 102.828 162.663 115.002 1.00 500.00 ? 584 GLU A CG  1 
ATOM 4297  C CD  . GLU A 1 584 ? 103.660 161.384 115.085 1.00 500.00 ? 584 GLU A CD  1 
ATOM 4298  O OE1 . GLU A 1 584 ? 104.788 161.350 114.547 1.00 500.00 ? 584 GLU A OE1 1 
ATOM 4299  O OE2 . GLU A 1 584 ? 103.174 160.395 115.681 1.00 500.00 ? 584 GLU A OE2 1 
ATOM 4300  N N   . GLN A 1 585 ? 104.630 166.449 116.664 1.00 486.34 ? 585 GLN A N   1 
ATOM 4301  C CA  . GLN A 1 585 ? 105.142 167.826 116.716 1.00 476.65 ? 585 GLN A CA  1 
ATOM 4302  C C   . GLN A 1 585 ? 106.410 167.884 117.556 1.00 464.20 ? 585 GLN A C   1 
ATOM 4303  O O   . GLN A 1 585 ? 107.405 168.499 117.163 1.00 392.64 ? 585 GLN A O   1 
ATOM 4304  C CB  . GLN A 1 585 ? 104.090 168.797 117.270 1.00 463.50 ? 585 GLN A CB  1 
ATOM 4305  C CG  . GLN A 1 585 ? 102.978 169.115 116.279 1.00 484.67 ? 585 GLN A CG  1 
ATOM 4306  C CD  . GLN A 1 585 ? 101.940 170.072 116.836 1.00 478.88 ? 585 GLN A CD  1 
ATOM 4307  O OE1 . GLN A 1 585 ? 101.339 169.813 117.879 1.00 476.55 ? 585 GLN A OE1 1 
ATOM 4308  N NE2 . GLN A 1 585 ? 101.713 171.181 116.133 1.00 460.00 ? 585 GLN A NE2 1 
ATOM 4309  N N   . CYS A 1 586 ? 106.332 167.231 118.708 1.00 500.00 ? 586 CYS A N   1 
ATOM 4310  C CA  . CYS A 1 586 ? 107.445 167.157 119.665 1.00 500.00 ? 586 CYS A CA  1 
ATOM 4311  C C   . CYS A 1 586 ? 108.675 166.554 118.990 1.00 500.00 ? 586 CYS A C   1 
ATOM 4312  O O   . CYS A 1 586 ? 109.793 167.076 119.109 1.00 500.00 ? 586 CYS A O   1 
ATOM 4313  C CB  . CYS A 1 586 ? 107.064 166.268 120.860 1.00 500.00 ? 586 CYS A CB  1 
ATOM 4314  S SG  . CYS A 1 586 ? 107.463 166.992 122.457 1.00 500.00 ? 586 CYS A SG  1 
ATOM 4315  N N   . GLN A 1 587 ? 108.421 165.453 118.294 1.00 493.02 ? 587 GLN A N   1 
ATOM 4316  C CA  . GLN A 1 587 ? 109.462 164.716 117.569 1.00 468.24 ? 587 GLN A CA  1 
ATOM 4317  C C   . GLN A 1 587 ? 110.153 165.633 116.552 1.00 443.05 ? 587 GLN A C   1 
ATOM 4318  O O   . GLN A 1 587 ? 111.395 165.636 116.484 1.00 388.66 ? 587 GLN A O   1 
ATOM 4319  C CB  . GLN A 1 587 ? 108.916 163.434 116.912 1.00 469.78 ? 587 GLN A CB  1 
ATOM 4320  C CG  . GLN A 1 587 ? 109.395 162.131 117.575 1.00 499.64 ? 587 GLN A CG  1 
ATOM 4321  C CD  . GLN A 1 587 ? 109.074 161.996 119.073 1.00 493.66 ? 587 GLN A CD  1 
ATOM 4322  O OE1 . GLN A 1 587 ? 109.696 161.187 119.772 1.00 478.76 ? 587 GLN A OE1 1 
ATOM 4323  N NE2 . GLN A 1 587 ? 108.110 162.774 119.565 1.00 467.94 ? 587 GLN A NE2 1 
ATOM 4324  N N   . ASP A 1 588 ? 109.389 166.396 115.768 1.00 476.34 ? 588 ASP A N   1 
ATOM 4325  C CA  . ASP A 1 588 ? 109.973 167.328 114.777 1.00 495.65 ? 588 ASP A CA  1 
ATOM 4326  C C   . ASP A 1 588 ? 109.496 168.787 114.962 1.00 438.59 ? 588 ASP A C   1 
ATOM 4327  O O   . ASP A 1 588 ? 108.379 169.148 114.572 1.00 299.19 ? 588 ASP A O   1 
ATOM 4328  C CB  . ASP A 1 588 ? 109.719 166.835 113.331 1.00 500.00 ? 588 ASP A CB  1 
ATOM 4329  C CG  . ASP A 1 588 ? 110.962 166.194 112.676 1.00 500.00 ? 588 ASP A CG  1 
ATOM 4330  O OD1 . ASP A 1 588 ? 112.087 166.716 112.847 1.00 500.00 ? 588 ASP A OD1 1 
ATOM 4331  O OD2 . ASP A 1 588 ? 110.801 165.182 111.959 1.00 500.00 ? 588 ASP A OD2 1 
ATOM 4332  N N   . PRO A 1 589 ? 110.337 169.621 115.600 1.00 483.77 ? 589 PRO A N   1 
ATOM 4333  C CA  . PRO A 1 589 ? 110.206 171.075 115.534 1.00 500.00 ? 589 PRO A CA  1 
ATOM 4334  C C   . PRO A 1 589 ? 111.000 171.695 114.369 1.00 500.00 ? 589 PRO A C   1 
ATOM 4335  O O   . PRO A 1 589 ? 110.994 172.920 114.217 1.00 500.00 ? 589 PRO A O   1 
ATOM 4336  C CB  . PRO A 1 589 ? 110.755 171.548 116.893 1.00 500.00 ? 589 PRO A CB  1 
ATOM 4337  C CG  . PRO A 1 589 ? 111.369 170.349 117.542 1.00 500.00 ? 589 PRO A CG  1 
ATOM 4338  C CD  . PRO A 1 589 ? 111.376 169.225 116.562 1.00 500.00 ? 589 PRO A CD  1 
ATOM 4339  N N   . SER A 1 590 ? 111.694 170.870 113.581 1.00 500.00 ? 590 SER A N   1 
ATOM 4340  C CA  . SER A 1 590 ? 112.264 171.302 112.300 1.00 500.00 ? 590 SER A CA  1 
ATOM 4341  C C   . SER A 1 590 ? 111.168 171.363 111.228 1.00 500.00 ? 590 SER A C   1 
ATOM 4342  O O   . SER A 1 590 ? 111.159 172.264 110.384 1.00 500.00 ? 590 SER A O   1 
ATOM 4343  C CB  . SER A 1 590 ? 113.374 170.348 111.862 1.00 489.04 ? 590 SER A CB  1 
ATOM 4344  O OG  . SER A 1 590 ? 114.392 170.273 112.847 1.00 463.78 ? 590 SER A OG  1 
ATOM 4345  N N   . LYS A 1 591 ? 110.255 170.394 111.279 1.00 500.00 ? 591 LYS A N   1 
ATOM 4346  C CA  . LYS A 1 591 ? 109.073 170.351 110.415 1.00 500.00 ? 591 LYS A CA  1 
ATOM 4347  C C   . LYS A 1 591 ? 108.048 171.409 110.830 1.00 500.00 ? 591 LYS A C   1 
ATOM 4348  O O   . LYS A 1 591 ? 107.570 172.178 109.990 1.00 500.00 ? 591 LYS A O   1 
ATOM 4349  C CB  . LYS A 1 591 ? 108.445 168.953 110.488 1.00 500.00 ? 591 LYS A CB  1 
ATOM 4350  C CG  . LYS A 1 591 ? 107.299 168.684 109.523 1.00 500.00 ? 591 LYS A CG  1 
ATOM 4351  C CD  . LYS A 1 591 ? 106.957 167.193 109.447 1.00 500.00 ? 591 LYS A CD  1 
ATOM 4352  C CE  . LYS A 1 591 ? 106.552 166.580 110.791 1.00 500.00 ? 591 LYS A CE  1 
ATOM 4353  N NZ  . LYS A 1 591 ? 105.506 167.360 111.518 1.00 500.00 ? 591 LYS A NZ  1 
ATOM 4354  N N   . VAL A 1 592 ? 107.721 171.440 112.124 1.00 500.00 ? 592 VAL A N   1 
ATOM 4355  C CA  . VAL A 1 592 ? 106.785 172.423 112.682 1.00 500.00 ? 592 VAL A CA  1 
ATOM 4356  C C   . VAL A 1 592 ? 107.496 173.783 112.733 1.00 500.00 ? 592 VAL A C   1 
ATOM 4357  O O   . VAL A 1 592 ? 108.478 173.924 113.465 1.00 500.00 ? 592 VAL A O   1 
ATOM 4358  C CB  . VAL A 1 592 ? 106.304 172.030 114.102 1.00 500.00 ? 592 VAL A CB  1 
ATOM 4359  C CG1 . VAL A 1 592 ? 105.433 173.127 114.717 1.00 500.00 ? 592 VAL A CG1 1 
ATOM 4360  C CG2 . VAL A 1 592 ? 105.542 170.710 114.068 1.00 500.00 ? 592 VAL A CG2 1 
ATOM 4361  N N   . PRO A 1 593 ? 107.002 174.785 111.970 1.00 500.00 ? 593 PRO A N   1 
ATOM 4362  C CA  . PRO A 1 593 ? 107.751 176.043 111.815 1.00 500.00 ? 593 PRO A CA  1 
ATOM 4363  C C   . PRO A 1 593 ? 108.085 176.746 113.141 1.00 500.00 ? 593 PRO A C   1 
ATOM 4364  O O   . PRO A 1 593 ? 109.258 177.030 113.403 1.00 500.00 ? 593 PRO A O   1 
ATOM 4365  C CB  . PRO A 1 593 ? 106.828 176.911 110.937 1.00 500.00 ? 593 PRO A CB  1 
ATOM 4366  C CG  . PRO A 1 593 ? 105.484 176.273 110.986 1.00 500.00 ? 593 PRO A CG  1 
ATOM 4367  C CD  . PRO A 1 593 ? 105.714 174.817 111.248 1.00 500.00 ? 593 PRO A CD  1 
ATOM 4368  N N   . SER A 1 594 ? 107.067 177.003 113.960 1.00 500.00 ? 594 SER A N   1 
ATOM 4369  C CA  . SER A 1 594 ? 107.263 177.603 115.276 1.00 500.00 ? 594 SER A CA  1 
ATOM 4370  C C   . SER A 1 594 ? 108.068 176.647 116.161 1.00 500.00 ? 594 SER A C   1 
ATOM 4371  O O   . SER A 1 594 ? 107.923 175.427 116.038 1.00 500.00 ? 594 SER A O   1 
ATOM 4372  C CB  . SER A 1 594 ? 105.914 177.928 115.925 1.00 500.00 ? 594 SER A CB  1 
ATOM 4373  O OG  . SER A 1 594 ? 105.061 176.793 115.922 1.00 500.00 ? 594 SER A OG  1 
ATOM 4374  N N   . GLU A 1 595 ? 108.917 177.217 117.024 1.00 500.00 ? 595 GLU A N   1 
ATOM 4375  C CA  . GLU A 1 595 ? 109.792 176.472 117.957 1.00 500.00 ? 595 GLU A CA  1 
ATOM 4376  C C   . GLU A 1 595 ? 110.922 175.712 117.233 1.00 500.00 ? 595 GLU A C   1 
ATOM 4377  O O   . GLU A 1 595 ? 110.666 174.799 116.444 1.00 480.93 ? 595 GLU A O   1 
ATOM 4378  C CB  . GLU A 1 595 ? 108.978 175.532 118.875 1.00 500.00 ? 595 GLU A CB  1 
ATOM 4379  C CG  . GLU A 1 595 ? 107.823 176.194 119.623 1.00 500.00 ? 595 GLU A CG  1 
ATOM 4380  C CD  . GLU A 1 595 ? 108.253 177.375 120.483 1.00 500.00 ? 595 GLU A CD  1 
ATOM 4381  O OE1 . GLU A 1 595 ? 109.371 177.352 121.040 1.00 500.00 ? 595 GLU A OE1 1 
ATOM 4382  O OE2 . GLU A 1 595 ? 107.461 178.334 120.606 1.00 500.00 ? 595 GLU A OE2 1 
ATOM 4383  N N   . ASN A 1 596 ? 112.167 176.090 117.526 1.00 491.29 ? 596 ASN A N   1 
ATOM 4384  C CA  . ASN A 1 596 ? 113.337 175.619 116.786 1.00 465.70 ? 596 ASN A CA  1 
ATOM 4385  C C   . ASN A 1 596 ? 114.113 174.526 117.537 1.00 456.35 ? 596 ASN A C   1 
ATOM 4386  O O   . ASN A 1 596 ? 114.512 174.715 118.694 1.00 361.30 ? 596 ASN A O   1 
ATOM 4387  C CB  . ASN A 1 596 ? 114.256 176.808 116.476 1.00 500.00 ? 596 ASN A CB  1 
ATOM 4388  C CG  . ASN A 1 596 ? 115.155 176.570 115.270 1.00 500.00 ? 596 ASN A CG  1 
ATOM 4389  O OD1 . ASN A 1 596 ? 114.778 175.886 114.313 1.00 500.00 ? 596 ASN A OD1 1 
ATOM 4390  N ND2 . ASN A 1 596 ? 116.347 177.160 115.301 1.00 500.00 ? 596 ASN A ND2 1 
ATOM 4391  N N   . LYS A 1 597 ? 114.338 173.407 116.842 1.00 499.56 ? 597 LYS A N   1 
ATOM 4392  C CA  . LYS A 1 597 ? 114.943 172.174 117.399 1.00 500.00 ? 597 LYS A CA  1 
ATOM 4393  C C   . LYS A 1 597 ? 116.372 172.353 117.902 1.00 427.05 ? 597 LYS A C   1 
ATOM 4394  O O   . LYS A 1 597 ? 116.784 171.715 118.870 1.00 406.89 ? 597 LYS A O   1 
ATOM 4395  C CB  . LYS A 1 597 ? 114.920 171.053 116.344 1.00 500.00 ? 597 LYS A CB  1 
ATOM 4396  C CG  . LYS A 1 597 ? 115.073 169.647 116.910 1.00 500.00 ? 597 LYS A CG  1 
ATOM 4397  C CD  . LYS A 1 597 ? 114.951 168.585 115.820 1.00 500.00 ? 597 LYS A CD  1 
ATOM 4398  C CE  . LYS A 1 597 ? 114.444 167.253 116.365 1.00 500.00 ? 597 LYS A CE  1 
ATOM 4399  N NZ  . LYS A 1 597 ? 115.339 166.664 117.403 1.00 500.00 ? 597 LYS A NZ  1 
ATOM 4400  N N   . ASP A 1 598 ? 117.123 173.209 117.223 1.00 401.15 ? 598 ASP A N   1 
ATOM 4401  C CA  . ASP A 1 598 ? 118.495 173.502 117.599 1.00 449.82 ? 598 ASP A CA  1 
ATOM 4402  C C   . ASP A 1 598 ? 118.582 174.248 118.933 1.00 440.46 ? 598 ASP A C   1 
ATOM 4403  O O   . ASP A 1 598 ? 119.506 174.013 119.709 1.00 477.51 ? 598 ASP A O   1 
ATOM 4404  C CB  . ASP A 1 598 ? 119.163 174.330 116.493 1.00 500.00 ? 598 ASP A CB  1 
ATOM 4405  C CG  . ASP A 1 598 ? 120.677 174.376 116.613 1.00 500.00 ? 598 ASP A CG  1 
ATOM 4406  O OD1 . ASP A 1 598 ? 121.299 173.353 116.974 1.00 500.00 ? 598 ASP A OD1 1 
ATOM 4407  O OD2 . ASP A 1 598 ? 121.253 175.436 116.301 1.00 500.00 ? 598 ASP A OD2 1 
ATOM 4408  N N   . LEU A 1 599 ? 117.615 175.126 119.198 1.00 445.43 ? 599 LEU A N   1 
ATOM 4409  C CA  . LEU A 1 599 ? 117.681 176.050 120.343 1.00 466.24 ? 599 LEU A CA  1 
ATOM 4410  C C   . LEU A 1 599 ? 117.168 175.479 121.673 1.00 420.45 ? 599 LEU A C   1 
ATOM 4411  O O   . LEU A 1 599 ? 117.373 176.097 122.724 1.00 365.21 ? 599 LEU A O   1 
ATOM 4412  C CB  . LEU A 1 599 ? 116.957 177.368 120.010 1.00 500.00 ? 599 LEU A CB  1 
ATOM 4413  C CG  . LEU A 1 599 ? 117.755 178.417 119.215 1.00 500.00 ? 599 LEU A CG  1 
ATOM 4414  C CD1 . LEU A 1 599 ? 118.427 177.846 117.973 1.00 500.00 ? 599 LEU A CD1 1 
ATOM 4415  C CD2 . LEU A 1 599 ? 116.847 179.581 118.839 1.00 500.00 ? 599 LEU A CD2 1 
ATOM 4416  N N   . TYR A 1 600 ? 116.526 174.307 121.628 1.00 407.81 ? 600 TYR A N   1 
ATOM 4417  C CA  . TYR A 1 600 ? 116.053 173.596 122.827 1.00 432.48 ? 600 TYR A CA  1 
ATOM 4418  C C   . TYR A 1 600 ? 116.324 172.082 122.705 1.00 428.96 ? 600 TYR A C   1 
ATOM 4419  O O   . TYR A 1 600 ? 117.127 171.667 121.866 1.00 443.65 ? 600 TYR A O   1 
ATOM 4420  C CB  . TYR A 1 600 ? 114.556 173.847 123.002 1.00 430.71 ? 600 TYR A CB  1 
ATOM 4421  C CG  . TYR A 1 600 ? 114.187 175.266 123.346 1.00 427.89 ? 600 TYR A CG  1 
ATOM 4422  C CD1 . TYR A 1 600 ? 114.221 175.715 124.667 1.00 426.39 ? 600 TYR A CD1 1 
ATOM 4423  C CD2 . TYR A 1 600 ? 113.785 176.160 122.357 1.00 449.14 ? 600 TYR A CD2 1 
ATOM 4424  C CE1 . TYR A 1 600 ? 113.877 177.020 124.989 1.00 433.69 ? 600 TYR A CE1 1 
ATOM 4425  C CE2 . TYR A 1 600 ? 113.432 177.465 122.668 1.00 471.39 ? 600 TYR A CE2 1 
ATOM 4426  C CZ  . TYR A 1 600 ? 113.475 177.893 123.985 1.00 457.09 ? 600 TYR A CZ  1 
ATOM 4427  O OH  . TYR A 1 600 ? 113.126 179.189 124.291 1.00 445.38 ? 600 TYR A OH  1 
ATOM 4428  N N   . GLU A 1 601 ? 115.696 171.276 123.564 1.00 404.39 ? 601 GLU A N   1 
ATOM 4429  C CA  . GLU A 1 601 ? 115.508 169.846 123.302 1.00 439.22 ? 601 GLU A CA  1 
ATOM 4430  C C   . GLU A 1 601 ? 114.107 169.410 123.714 1.00 412.91 ? 601 GLU A C   1 
ATOM 4431  O O   . GLU A 1 601 ? 113.843 169.223 124.898 1.00 428.20 ? 601 GLU A O   1 
ATOM 4432  C CB  . GLU A 1 601 ? 116.545 169.018 124.045 1.00 500.00 ? 601 GLU A CB  1 
ATOM 4433  C CG  . GLU A 1 601 ? 117.886 168.934 123.335 1.00 500.00 ? 601 GLU A CG  1 
ATOM 4434  C CD  . GLU A 1 601 ? 118.532 167.565 123.470 1.00 500.00 ? 601 GLU A CD  1 
ATOM 4435  O OE1 . GLU A 1 601 ? 118.523 167.002 124.591 1.00 500.00 ? 601 GLU A OE1 1 
ATOM 4436  O OE2 . GLU A 1 601 ? 119.050 167.051 122.452 1.00 500.00 ? 601 GLU A OE2 1 
ATOM 4437  N N   . TYR A 1 602 ? 113.229 169.219 122.730 1.00 425.61 ? 602 TYR A N   1 
ATOM 4438  C CA  . TYR A 1 602 ? 111.801 169.008 122.988 1.00 428.68 ? 602 TYR A CA  1 
ATOM 4439  C C   . TYR A 1 602 ? 111.545 167.535 123.271 1.00 438.49 ? 602 TYR A C   1 
ATOM 4440  O O   . TYR A 1 602 ? 111.100 166.789 122.393 1.00 468.87 ? 602 TYR A O   1 
ATOM 4441  C CB  . TYR A 1 602 ? 110.940 169.477 121.804 1.00 429.87 ? 602 TYR A CB  1 
ATOM 4442  C CG  . TYR A 1 602 ? 111.148 170.918 121.402 1.00 436.75 ? 602 TYR A CG  1 
ATOM 4443  C CD1 . TYR A 1 602 ? 112.169 171.269 120.522 1.00 442.71 ? 602 TYR A CD1 1 
ATOM 4444  C CD2 . TYR A 1 602 ? 110.321 171.936 121.883 1.00 421.82 ? 602 TYR A CD2 1 
ATOM 4445  C CE1 . TYR A 1 602 ? 112.367 172.579 120.134 1.00 424.49 ? 602 TYR A CE1 1 
ATOM 4446  C CE2 . TYR A 1 602 ? 110.518 173.259 121.501 1.00 413.15 ? 602 TYR A CE2 1 
ATOM 4447  C CZ  . TYR A 1 602 ? 111.550 173.570 120.623 1.00 399.67 ? 602 TYR A CZ  1 
ATOM 4448  O OH  . TYR A 1 602 ? 111.787 174.860 120.220 1.00 403.55 ? 602 TYR A OH  1 
ATOM 4449  N N   . SER A 1 603 ? 111.840 167.116 124.496 1.00 435.76 ? 603 SER A N   1 
ATOM 4450  C CA  . SER A 1 603 ? 111.634 165.727 124.896 1.00 437.74 ? 603 SER A CA  1 
ATOM 4451  C C   . SER A 1 603 ? 110.145 165.485 125.128 1.00 426.31 ? 603 SER A C   1 
ATOM 4452  O O   . SER A 1 603 ? 109.502 166.238 125.879 1.00 412.37 ? 603 SER A O   1 
ATOM 4453  C CB  . SER A 1 603 ? 112.434 165.392 126.157 1.00 448.57 ? 603 SER A CB  1 
ATOM 4454  O OG  . SER A 1 603 ? 111.969 166.124 127.278 1.00 463.53 ? 603 SER A OG  1 
ATOM 4455  N N   . TRP A 1 604 ? 109.601 164.472 124.444 1.00 441.92 ? 604 TRP A N   1 
ATOM 4456  C CA  . TRP A 1 604 ? 108.259 163.964 124.737 1.00 487.10 ? 604 TRP A CA  1 
ATOM 4457  C C   . TRP A 1 604 ? 108.423 162.896 125.804 1.00 425.78 ? 604 TRP A C   1 
ATOM 4458  O O   . TRP A 1 604 ? 109.219 161.975 125.647 1.00 414.41 ? 604 TRP A O   1 
ATOM 4459  C CB  . TRP A 1 604 ? 107.564 163.396 123.494 1.00 500.00 ? 604 TRP A CB  1 
ATOM 4460  C CG  . TRP A 1 604 ? 106.047 163.265 123.651 1.00 500.00 ? 604 TRP A CG  1 
ATOM 4461  C CD1 . TRP A 1 604 ? 105.106 164.240 123.435 1.00 500.00 ? 604 TRP A CD1 1 
ATOM 4462  C CD2 . TRP A 1 604 ? 105.318 162.097 124.054 1.00 500.00 ? 604 TRP A CD2 1 
ATOM 4463  N NE1 . TRP A 1 604 ? 103.847 163.751 123.676 1.00 499.47 ? 604 TRP A NE1 1 
ATOM 4464  C CE2 . TRP A 1 604 ? 103.945 162.439 124.057 1.00 500.00 ? 604 TRP A CE2 1 
ATOM 4465  C CE3 . TRP A 1 604 ? 105.693 160.791 124.411 1.00 500.00 ? 604 TRP A CE3 1 
ATOM 4466  C CZ2 . TRP A 1 604 ? 102.945 161.523 124.399 1.00 500.00 ? 604 TRP A CZ2 1 
ATOM 4467  C CZ3 . TRP A 1 604 ? 104.696 159.879 124.752 1.00 500.00 ? 604 TRP A CZ3 1 
ATOM 4468  C CH2 . TRP A 1 604 ? 103.339 160.251 124.740 1.00 500.00 ? 604 TRP A CH2 1 
ATOM 4469  N N   . VAL A 1 605 ? 107.648 163.020 126.875 1.00 408.75 ? 605 VAL A N   1 
ATOM 4470  C CA  . VAL A 1 605 ? 107.964 162.373 128.145 1.00 412.96 ? 605 VAL A CA  1 
ATOM 4471  C C   . VAL A 1 605 ? 106.786 161.476 128.568 1.00 414.77 ? 605 VAL A C   1 
ATOM 4472  O O   . VAL A 1 605 ? 105.893 161.204 127.761 1.00 395.89 ? 605 VAL A O   1 
ATOM 4473  C CB  . VAL A 1 605 ? 108.270 163.476 129.208 1.00 447.20 ? 605 VAL A CB  1 
ATOM 4474  C CG1 . VAL A 1 605 ? 109.162 162.962 130.332 1.00 468.66 ? 605 VAL A CG1 1 
ATOM 4475  C CG2 . VAL A 1 605 ? 108.937 164.697 128.567 1.00 437.50 ? 605 VAL A CG2 1 
ATOM 4476  N N   . GLN A 1 606 ? 106.845 160.952 129.792 1.00 409.44 ? 606 GLN A N   1 
ATOM 4477  C CA  . GLN A 1 606 ? 105.673 160.536 130.579 1.00 398.58 ? 606 GLN A CA  1 
ATOM 4478  C C   . GLN A 1 606 ? 105.154 161.744 131.390 1.00 387.87 ? 606 GLN A C   1 
ATOM 4479  O O   . GLN A 1 606 ? 105.570 162.879 131.146 1.00 384.13 ? 606 GLN A O   1 
ATOM 4480  C CB  . GLN A 1 606 ? 106.056 159.397 131.534 1.00 398.40 ? 606 GLN A CB  1 
ATOM 4481  C CG  . GLN A 1 606 ? 106.366 158.062 130.882 1.00 406.28 ? 606 GLN A CG  1 
ATOM 4482  C CD  . GLN A 1 606 ? 106.485 156.932 131.901 1.00 434.35 ? 606 GLN A CD  1 
ATOM 4483  O OE1 . GLN A 1 606 ? 106.641 157.170 133.103 1.00 409.98 ? 606 GLN A OE1 1 
ATOM 4484  N NE2 . GLN A 1 606 ? 106.407 155.695 131.426 1.00 455.47 ? 606 GLN A NE2 1 
ATOM 4485  N N   . GLY A 1 607 ? 104.241 161.512 132.337 1.00 401.51 ? 607 GLY A N   1 
ATOM 4486  C CA  . GLY A 1 607 ? 103.830 162.555 133.283 1.00 415.30 ? 607 GLY A CA  1 
ATOM 4487  C C   . GLY A 1 607 ? 103.198 162.065 134.583 1.00 391.97 ? 607 GLY A C   1 
ATOM 4488  O O   . GLY A 1 607 ? 103.334 160.888 134.942 1.00 287.62 ? 607 GLY A O   1 
ATOM 4489  N N   . PRO A 1 608 ? 102.513 162.974 135.314 1.00 419.11 ? 608 PRO A N   1 
ATOM 4490  C CA  . PRO A 1 608 ? 101.853 162.597 136.566 1.00 432.82 ? 608 PRO A CA  1 
ATOM 4491  C C   . PRO A 1 608 ? 100.617 161.726 136.358 1.00 429.22 ? 608 PRO A C   1 
ATOM 4492  O O   . PRO A 1 608 ? 99.761  162.052 135.528 1.00 359.69 ? 608 PRO A O   1 
ATOM 4493  C CB  . PRO A 1 608 ? 101.454 163.949 137.174 1.00 453.64 ? 608 PRO A CB  1 
ATOM 4494  C CG  . PRO A 1 608 ? 101.323 164.864 136.010 1.00 439.28 ? 608 PRO A CG  1 
ATOM 4495  C CD  . PRO A 1 608 ? 102.397 164.425 135.058 1.00 441.18 ? 608 PRO A CD  1 
ATOM 4496  N N   . LEU A 1 609 ? 100.535 160.638 137.126 1.00 479.08 ? 609 LEU A N   1 
ATOM 4497  C CA  . LEU A 1 609 ? 99.402  159.710 137.064 1.00 500.00 ? 609 LEU A CA  1 
ATOM 4498  C C   . LEU A 1 609 ? 98.116  160.394 137.507 1.00 500.00 ? 609 LEU A C   1 
ATOM 4499  O O   . LEU A 1 609 ? 98.086  161.074 138.538 1.00 500.00 ? 609 LEU A O   1 
ATOM 4500  C CB  . LEU A 1 609 ? 99.654  158.481 137.946 1.00 500.00 ? 609 LEU A CB  1 
ATOM 4501  C CG  . LEU A 1 609 ? 100.778 157.547 137.487 1.00 500.00 ? 609 LEU A CG  1 
ATOM 4502  C CD1 . LEU A 1 609 ? 101.269 156.672 138.632 1.00 500.00 ? 609 LEU A CD1 1 
ATOM 4503  C CD2 . LEU A 1 609 ? 100.324 156.688 136.314 1.00 500.00 ? 609 LEU A CD2 1 
ATOM 4504  N N   . HIS A 1 610 ? 97.058  160.195 136.723 1.00 500.00 ? 610 HIS A N   1 
ATOM 4505  C CA  . HIS A 1 610 ? 95.765  160.845 136.959 1.00 500.00 ? 610 HIS A CA  1 
ATOM 4506  C C   . HIS A 1 610 ? 95.094  160.248 138.202 1.00 500.00 ? 610 HIS A C   1 
ATOM 4507  O O   . HIS A 1 610 ? 95.448  159.147 138.644 1.00 500.00 ? 610 HIS A O   1 
ATOM 4508  C CB  . HIS A 1 610 ? 94.858  160.697 135.716 1.00 500.00 ? 610 HIS A CB  1 
ATOM 4509  C CG  . HIS A 1 610 ? 93.837  161.785 135.568 1.00 500.00 ? 610 HIS A CG  1 
ATOM 4510  N ND1 . HIS A 1 610 ? 92.480  161.537 135.546 1.00 500.00 ? 610 HIS A ND1 1 
ATOM 4511  C CD2 . HIS A 1 610 ? 93.977  163.125 135.428 1.00 500.00 ? 610 HIS A CD2 1 
ATOM 4512  C CE1 . HIS A 1 610 ? 91.830  162.678 135.401 1.00 500.00 ? 610 HIS A CE1 1 
ATOM 4513  N NE2 . HIS A 1 610 ? 92.715  163.657 135.328 1.00 500.00 ? 610 HIS A NE2 1 
ATOM 4514  N N   . SER A 1 611 ? 94.141  160.987 138.769 1.00 500.00 ? 611 SER A N   1 
ATOM 4515  C CA  . SER A 1 611 ? 93.320  160.481 139.873 1.00 500.00 ? 611 SER A CA  1 
ATOM 4516  C C   . SER A 1 611 ? 92.396  159.367 139.348 1.00 500.00 ? 611 SER A C   1 
ATOM 4517  O O   . SER A 1 611 ? 91.965  159.412 138.189 1.00 500.00 ? 611 SER A O   1 
ATOM 4518  C CB  . SER A 1 611 ? 92.519  161.616 140.521 1.00 500.00 ? 611 SER A CB  1 
ATOM 4519  O OG  . SER A 1 611 ? 92.067  161.249 141.814 1.00 500.00 ? 611 SER A OG  1 
ATOM 4520  N N   . ASN A 1 612 ? 92.105  158.383 140.208 1.00 500.00 ? 612 ASN A N   1 
ATOM 4521  C CA  . ASN A 1 612 ? 91.478  157.090 139.837 1.00 500.00 ? 612 ASN A CA  1 
ATOM 4522  C C   . ASN A 1 612 ? 92.416  156.215 139.001 1.00 500.00 ? 612 ASN A C   1 
ATOM 4523  O O   . ASN A 1 612 ? 92.996  155.257 139.519 1.00 368.33 ? 612 ASN A O   1 
ATOM 4524  C CB  . ASN A 1 612 ? 90.111  157.235 139.116 1.00 500.00 ? 612 ASN A CB  1 
ATOM 4525  C CG  . ASN A 1 612 ? 89.095  158.041 139.909 1.00 500.00 ? 612 ASN A CG  1 
ATOM 4526  O OD1 . ASN A 1 612 ? 88.481  158.973 139.379 1.00 500.00 ? 612 ASN A OD1 1 
ATOM 4527  N ND2 . ASN A 1 612 ? 88.900  157.681 141.175 1.00 500.00 ? 612 ASN A ND2 1 
ATOM 4528  N N   . GLU A 1 613 ? 92.579  156.579 137.728 1.00 500.00 ? 613 GLU A N   1 
ATOM 4529  C CA  . GLU A 1 613 ? 93.201  155.730 136.715 1.00 500.00 ? 613 GLU A CA  1 
ATOM 4530  C C   . GLU A 1 613 ? 94.710  155.915 136.610 1.00 500.00 ? 613 GLU A C   1 
ATOM 4531  O O   . GLU A 1 613 ? 95.193  157.049 136.466 1.00 329.53 ? 613 GLU A O   1 
ATOM 4532  C CB  . GLU A 1 613 ? 92.603  156.034 135.337 1.00 500.00 ? 613 GLU A CB  1 
ATOM 4533  C CG  . GLU A 1 613 ? 91.095  155.857 135.236 1.00 500.00 ? 613 GLU A CG  1 
ATOM 4534  C CD  . GLU A 1 613 ? 90.568  156.036 133.819 1.00 500.00 ? 613 GLU A CD  1 
ATOM 4535  O OE1 . GLU A 1 613 ? 91.298  156.571 132.951 1.00 500.00 ? 613 GLU A OE1 1 
ATOM 4536  O OE2 . GLU A 1 613 ? 89.410  155.639 133.571 1.00 500.00 ? 613 GLU A OE2 1 
ATOM 4537  N N   . THR A 1 614 ? 95.439  154.793 136.613 1.00 500.00 ? 614 THR A N   1 
ATOM 4538  C CA  . THR A 1 614 ? 96.874  154.767 136.297 1.00 500.00 ? 614 THR A CA  1 
ATOM 4539  C C   . THR A 1 614 ? 97.080  154.988 134.791 1.00 500.00 ? 614 THR A C   1 
ATOM 4540  O O   . THR A 1 614 ? 97.532  154.092 134.066 1.00 500.00 ? 614 THR A O   1 
ATOM 4541  C CB  . THR A 1 614 ? 97.542  153.436 136.725 1.00 500.00 ? 614 THR A CB  1 
ATOM 4542  O OG1 . THR A 1 614 ? 96.912  152.336 136.055 1.00 493.94 ? 614 THR A OG1 1 
ATOM 4543  C CG2 . THR A 1 614 ? 97.436  153.233 138.227 1.00 500.00 ? 614 THR A CG2 1 
ATOM 4544  N N   . ASP A 1 615 ? 96.734  156.196 134.344 1.00 500.00 ? 615 ASP A N   1 
ATOM 4545  C CA  . ASP A 1 615 ? 96.833  156.609 132.950 1.00 500.00 ? 615 ASP A CA  1 
ATOM 4546  C C   . ASP A 1 615 ? 97.443  158.003 132.980 1.00 477.54 ? 615 ASP A C   1 
ATOM 4547  O O   . ASP A 1 615 ? 96.811  158.955 133.453 1.00 417.46 ? 615 ASP A O   1 
ATOM 4548  C CB  . ASP A 1 615 ? 95.450  156.630 132.274 1.00 500.00 ? 615 ASP A CB  1 
ATOM 4549  C CG  . ASP A 1 615 ? 94.999  155.251 131.764 1.00 489.55 ? 615 ASP A CG  1 
ATOM 4550  O OD1 . ASP A 1 615 ? 95.847  154.351 131.557 1.00 448.83 ? 615 ASP A OD1 1 
ATOM 4551  O OD2 . ASP A 1 615 ? 93.779  155.074 131.552 1.00 441.81 ? 615 ASP A OD2 1 
ATOM 4552  N N   . ARG A 1 616 ? 98.678  158.105 132.492 1.00 475.44 ? 616 ARG A N   1 
ATOM 4553  C CA  . ARG A 1 616 ? 99.469  159.328 132.595 1.00 471.21 ? 616 ARG A CA  1 
ATOM 4554  C C   . ARG A 1 616 ? 99.033  160.369 131.574 1.00 452.17 ? 616 ARG A C   1 
ATOM 4555  O O   . ARG A 1 616 ? 98.259  160.083 130.658 1.00 442.87 ? 616 ARG A O   1 
ATOM 4556  C CB  . ARG A 1 616 ? 100.959 159.026 132.396 1.00 471.26 ? 616 ARG A CB  1 
ATOM 4557  C CG  . ARG A 1 616 ? 101.554 158.045 133.395 1.00 472.62 ? 616 ARG A CG  1 
ATOM 4558  C CD  . ARG A 1 616 ? 103.001 157.747 133.036 1.00 483.86 ? 616 ARG A CD  1 
ATOM 4559  N NE  . ARG A 1 616 ? 103.545 156.587 133.742 1.00 476.18 ? 616 ARG A NE  1 
ATOM 4560  C CZ  . ARG A 1 616 ? 104.048 156.596 134.978 1.00 484.32 ? 616 ARG A CZ  1 
ATOM 4561  N NH1 . ARG A 1 616 ? 104.085 157.711 135.710 1.00 498.98 ? 616 ARG A NH1 1 
ATOM 4562  N NH2 . ARG A 1 616 ? 104.516 155.462 135.496 1.00 499.54 ? 616 ARG A NH2 1 
ATOM 4563  N N   . LEU A 1 617 ? 99.559  161.576 131.746 1.00 458.16 ? 617 LEU A N   1 
ATOM 4564  C CA  . LEU A 1 617 ? 99.317  162.691 130.849 1.00 475.96 ? 617 LEU A CA  1 
ATOM 4565  C C   . LEU A 1 617 ? 100.659 163.089 130.242 1.00 427.77 ? 617 LEU A C   1 
ATOM 4566  O O   . LEU A 1 617 ? 101.239 164.113 130.618 1.00 412.71 ? 617 LEU A O   1 
ATOM 4567  C CB  . LEU A 1 617 ? 98.695  163.849 131.625 1.00 500.00 ? 617 LEU A CB  1 
ATOM 4568  C CG  . LEU A 1 617 ? 97.267  163.602 132.125 1.00 500.00 ? 617 LEU A CG  1 
ATOM 4569  C CD1 . LEU A 1 617 ? 96.955  164.467 133.343 1.00 500.00 ? 617 LEU A CD1 1 
ATOM 4570  C CD2 . LEU A 1 617 ? 96.257  163.836 131.005 1.00 500.00 ? 617 LEU A CD2 1 
ATOM 4571  N N   . PRO A 1 618 ? 101.169 162.268 129.306 1.00 429.87 ? 618 PRO A N   1 
ATOM 4572  C CA  . PRO A 1 618 ? 102.475 162.533 128.712 1.00 462.27 ? 618 PRO A CA  1 
ATOM 4573  C C   . PRO A 1 618 ? 102.477 163.756 127.793 1.00 459.14 ? 618 PRO A C   1 
ATOM 4574  O O   . PRO A 1 618 ? 101.455 164.092 127.185 1.00 428.48 ? 618 PRO A O   1 
ATOM 4575  C CB  . PRO A 1 618 ? 102.749 161.263 127.919 1.00 499.57 ? 618 PRO A CB  1 
ATOM 4576  C CG  . PRO A 1 618 ? 101.398 160.820 127.494 1.00 500.00 ? 618 PRO A CG  1 
ATOM 4577  C CD  . PRO A 1 618 ? 100.536 161.087 128.691 1.00 454.46 ? 618 PRO A CD  1 
ATOM 4578  N N   . ARG A 1 619 ? 103.646 164.375 127.676 1.00 456.43 ? 619 ARG A N   1 
ATOM 4579  C CA  . ARG A 1 619 ? 103.752 165.771 127.272 1.00 439.34 ? 619 ARG A CA  1 
ATOM 4580  C C   . ARG A 1 619 ? 105.121 166.125 126.706 1.00 409.21 ? 619 ARG A C   1 
ATOM 4581  O O   . ARG A 1 619 ? 106.066 165.332 126.785 1.00 425.42 ? 619 ARG A O   1 
ATOM 4582  C CB  . ARG A 1 619 ? 103.477 166.648 128.497 1.00 451.91 ? 619 ARG A CB  1 
ATOM 4583  C CG  . ARG A 1 619 ? 104.347 166.311 129.709 1.00 447.33 ? 619 ARG A CG  1 
ATOM 4584  C CD  . ARG A 1 619 ? 103.870 167.004 130.972 1.00 475.32 ? 619 ARG A CD  1 
ATOM 4585  N NE  . ARG A 1 619 ? 102.506 166.620 131.340 1.00 496.48 ? 619 ARG A NE  1 
ATOM 4586  C CZ  . ARG A 1 619 ? 101.856 167.064 132.417 1.00 500.00 ? 619 ARG A CZ  1 
ATOM 4587  N NH1 . ARG A 1 619 ? 102.432 167.909 133.272 1.00 500.00 ? 619 ARG A NH1 1 
ATOM 4588  N NH2 . ARG A 1 619 ? 100.613 166.653 132.647 1.00 500.00 ? 619 ARG A NH2 1 
ATOM 4589  N N   . CYS A 1 620 ? 105.202 167.334 126.150 1.00 398.58 ? 620 CYS A N   1 
ATOM 4590  C CA  . CYS A 1 620 ? 106.447 167.913 125.647 1.00 424.59 ? 620 CYS A CA  1 
ATOM 4591  C C   . CYS A 1 620 ? 107.123 168.762 126.696 1.00 435.28 ? 620 CYS A C   1 
ATOM 4592  O O   . CYS A 1 620 ? 106.452 169.487 127.427 1.00 461.79 ? 620 CYS A O   1 
ATOM 4593  C CB  . CYS A 1 620 ? 106.164 168.806 124.447 1.00 465.18 ? 620 CYS A CB  1 
ATOM 4594  S SG  . CYS A 1 620 ? 105.710 167.866 122.991 1.00 500.00 ? 620 CYS A SG  1 
ATOM 4595  N N   . VAL A 1 621 ? 108.449 168.681 126.766 1.00 437.53 ? 621 VAL A N   1 
ATOM 4596  C CA  . VAL A 1 621 ? 109.227 169.641 127.554 1.00 437.60 ? 621 VAL A CA  1 
ATOM 4597  C C   . VAL A 1 621 ? 110.448 170.061 126.757 1.00 415.38 ? 621 VAL A C   1 
ATOM 4598  O O   . VAL A 1 621 ? 111.166 169.210 126.229 1.00 397.77 ? 621 VAL A O   1 
ATOM 4599  C CB  . VAL A 1 621 ? 109.685 169.067 128.913 1.00 461.85 ? 621 VAL A CB  1 
ATOM 4600  C CG1 . VAL A 1 621 ? 110.531 170.089 129.674 1.00 450.73 ? 621 VAL A CG1 1 
ATOM 4601  C CG2 . VAL A 1 621 ? 108.485 168.633 129.748 1.00 487.08 ? 621 VAL A CG2 1 
ATOM 4602  N N   . ARG A 1 622 ? 110.665 171.374 126.674 1.00 430.11 ? 622 ARG A N   1 
ATOM 4603  C CA  . ARG A 1 622 ? 111.906 171.929 126.136 1.00 428.03 ? 622 ARG A CA  1 
ATOM 4604  C C   . ARG A 1 622 ? 112.811 172.223 127.316 1.00 395.70 ? 622 ARG A C   1 
ATOM 4605  O O   . ARG A 1 622 ? 112.475 173.028 128.179 1.00 404.01 ? 622 ARG A O   1 
ATOM 4606  C CB  . ARG A 1 622 ? 111.687 173.168 125.251 1.00 436.55 ? 622 ARG A CB  1 
ATOM 4607  C CG  . ARG A 1 622 ? 110.862 174.313 125.814 1.00 460.66 ? 622 ARG A CG  1 
ATOM 4608  C CD  . ARG A 1 622 ? 110.647 175.361 124.736 1.00 499.73 ? 622 ARG A CD  1 
ATOM 4609  N NE  . ARG A 1 622 ? 109.672 176.379 125.115 1.00 500.00 ? 622 ARG A NE  1 
ATOM 4610  C CZ  . ARG A 1 622 ? 109.878 177.357 125.999 1.00 500.00 ? 622 ARG A CZ  1 
ATOM 4611  N NH1 . ARG A 1 622 ? 111.036 177.477 126.656 1.00 500.00 ? 622 ARG A NH1 1 
ATOM 4612  N NH2 . ARG A 1 622 ? 108.900 178.224 126.247 1.00 500.00 ? 622 ARG A NH2 1 
ATOM 4613  N N   . SER A 1 623 ? 113.955 171.548 127.342 1.00 414.38 ? 623 SER A N   1 
ATOM 4614  C CA  . SER A 1 623 ? 114.839 171.517 128.503 1.00 427.17 ? 623 SER A CA  1 
ATOM 4615  C C   . SER A 1 623 ? 115.952 172.548 128.465 1.00 407.98 ? 623 SER A C   1 
ATOM 4616  O O   . SER A 1 623 ? 116.369 173.039 129.514 1.00 397.92 ? 623 SER A O   1 
ATOM 4617  C CB  . SER A 1 623 ? 115.491 170.142 128.589 1.00 493.42 ? 623 SER A CB  1 
ATOM 4618  O OG  . SER A 1 623 ? 116.403 169.937 127.522 1.00 500.00 ? 623 SER A OG  1 
ATOM 4619  N N   . THR A 1 624 ? 116.440 172.849 127.259 1.00 395.35 ? 624 THR A N   1 
ATOM 4620  C CA  . THR A 1 624 ? 117.712 173.548 127.051 1.00 404.74 ? 624 THR A CA  1 
ATOM 4621  C C   . THR A 1 624 ? 118.875 172.678 127.561 1.00 427.72 ? 624 THR A C   1 
ATOM 4622  O O   . THR A 1 624 ? 119.954 173.190 127.870 1.00 472.72 ? 624 THR A O   1 
ATOM 4623  C CB  . THR A 1 624 ? 117.739 174.945 127.740 1.00 386.52 ? 624 THR A CB  1 
ATOM 4624  O OG1 . THR A 1 624 ? 116.433 175.538 127.715 1.00 340.97 ? 624 THR A OG1 1 
ATOM 4625  C CG2 . THR A 1 624 ? 118.728 175.891 127.053 1.00 415.51 ? 624 THR A CG2 1 
ATOM 4626  N N   . ALA A 1 625 ? 118.660 171.361 127.610 1.00 397.33 ? 625 ALA A N   1 
ATOM 4627  C CA  . ALA A 1 625 ? 119.497 170.464 128.402 1.00 395.56 ? 625 ALA A CA  1 
ATOM 4628  C C   . ALA A 1 625 ? 119.871 169.208 127.622 1.00 386.29 ? 625 ALA A C   1 
ATOM 4629  O O   . ALA A 1 625 ? 119.123 168.225 127.584 1.00 374.91 ? 625 ALA A O   1 
ATOM 4630  C CB  . ALA A 1 625 ? 118.797 170.110 129.711 1.00 404.04 ? 625 ALA A CB  1 
ATOM 4631  N N   . ARG A 1 626 ? 121.041 169.266 126.997 1.00 398.15 ? 626 ARG A N   1 
ATOM 4632  C CA  . ARG A 1 626 ? 121.600 168.138 126.251 1.00 421.19 ? 626 ARG A CA  1 
ATOM 4633  C C   . ARG A 1 626 ? 122.385 167.175 127.142 1.00 384.06 ? 626 ARG A C   1 
ATOM 4634  O O   . ARG A 1 626 ? 122.465 167.345 128.365 1.00 341.34 ? 626 ARG A O   1 
ATOM 4635  C CB  . ARG A 1 626 ? 122.478 168.668 125.099 1.00 437.93 ? 626 ARG A CB  1 
ATOM 4636  C CG  . ARG A 1 626 ? 121.649 169.208 123.938 1.00 457.41 ? 626 ARG A CG  1 
ATOM 4637  C CD  . ARG A 1 626 ? 121.997 170.626 123.539 1.00 481.52 ? 626 ARG A CD  1 
ATOM 4638  N NE  . ARG A 1 626 ? 120.840 171.287 122.931 1.00 500.00 ? 626 ARG A NE  1 
ATOM 4639  C CZ  . ARG A 1 626 ? 120.681 172.605 122.806 1.00 500.00 ? 626 ARG A CZ  1 
ATOM 4640  N NH1 . ARG A 1 626 ? 121.609 173.469 123.231 1.00 500.00 ? 626 ARG A NH1 1 
ATOM 4641  N NH2 . ARG A 1 626 ? 119.575 173.076 122.237 1.00 500.00 ? 626 ARG A NH2 1 
ATOM 4642  N N   . LEU A 1 627 ? 122.900 166.129 126.504 1.00 361.21 ? 627 LEU A N   1 
ATOM 4643  C CA  . LEU A 1 627 ? 123.961 165.299 127.049 1.00 365.72 ? 627 LEU A CA  1 
ATOM 4644  C C   . LEU A 1 627 ? 125.203 165.536 126.201 1.00 352.87 ? 627 LEU A C   1 
ATOM 4645  O O   . LEU A 1 627 ? 125.092 165.789 125.001 1.00 330.54 ? 627 LEU A O   1 
ATOM 4646  C CB  . LEU A 1 627 ? 123.559 163.830 127.003 1.00 358.61 ? 627 LEU A CB  1 
ATOM 4647  C CG  . LEU A 1 627 ? 122.247 163.497 127.711 1.00 374.64 ? 627 LEU A CG  1 
ATOM 4648  C CD1 . LEU A 1 627 ? 121.940 162.015 127.577 1.00 411.99 ? 627 LEU A CD1 1 
ATOM 4649  C CD2 . LEU A 1 627 ? 122.312 163.899 129.173 1.00 400.67 ? 627 LEU A CD2 1 
ATOM 4650  N N   . ALA A 1 628 ? 126.373 165.482 126.831 1.00 385.21 ? 628 ALA A N   1 
ATOM 4651  C CA  . ALA A 1 628 ? 127.646 165.674 126.131 1.00 409.71 ? 628 ALA A CA  1 
ATOM 4652  C C   . ALA A 1 628 ? 128.534 164.485 126.421 1.00 375.33 ? 628 ALA A C   1 
ATOM 4653  O O   . ALA A 1 628 ? 128.661 164.077 127.579 1.00 356.60 ? 628 ALA A O   1 
ATOM 4654  C CB  . ALA A 1 628 ? 128.311 166.958 126.589 1.00 467.93 ? 628 ALA A CB  1 
ATOM 4655  N N   . ARG A 1 629 ? 129.154 163.936 125.380 1.00 364.39 ? 629 ARG A N   1 
ATOM 4656  C CA  . ARG A 1 629 ? 129.833 162.646 125.504 1.00 426.88 ? 629 ARG A CA  1 
ATOM 4657  C C   . ARG A 1 629 ? 131.120 162.775 126.318 1.00 403.47 ? 629 ARG A C   1 
ATOM 4658  O O   . ARG A 1 629 ? 131.826 163.787 126.212 1.00 335.46 ? 629 ARG A O   1 
ATOM 4659  C CB  . ARG A 1 629 ? 130.105 162.047 124.116 1.00 469.59 ? 629 ARG A CB  1 
ATOM 4660  C CG  . ARG A 1 629 ? 130.645 160.613 124.091 1.00 461.19 ? 629 ARG A CG  1 
ATOM 4661  C CD  . ARG A 1 629 ? 129.725 159.591 124.748 1.00 403.13 ? 629 ARG A CD  1 
ATOM 4662  N NE  . ARG A 1 629 ? 130.147 158.217 124.447 1.00 437.46 ? 629 ARG A NE  1 
ATOM 4663  C CZ  . ARG A 1 629 ? 130.023 157.156 125.257 1.00 460.44 ? 629 ARG A CZ  1 
ATOM 4664  N NH1 . ARG A 1 629 ? 129.496 157.261 126.476 1.00 465.30 ? 629 ARG A NH1 1 
ATOM 4665  N NH2 . ARG A 1 629 ? 130.445 155.959 124.840 1.00 442.88 ? 629 ARG A NH2 1 
ATOM 4666  N N   . ALA A 1 630 ? 131.385 161.749 127.139 1.00 373.78 ? 630 ALA A N   1 
ATOM 4667  C CA  . ALA A 1 630 ? 132.570 161.660 127.999 1.00 346.90 ? 630 ALA A CA  1 
ATOM 4668  C C   . ALA A 1 630 ? 133.637 160.683 127.451 1.00 348.96 ? 630 ALA A C   1 
ATOM 4669  O O   . ALA A 1 630 ? 134.531 161.105 126.707 1.00 262.30 ? 630 ALA A O   1 
ATOM 4670  C CB  . ALA A 1 630 ? 132.157 161.297 129.420 1.00 312.67 ? 630 ALA A CB  1 
ATOM 4671  N N   . LEU A 1 631 ? 133.579 159.402 127.833 1.00 357.77 ? 631 LEU A N   1 
ATOM 4672  C CA  . LEU A 1 631 ? 134.515 158.378 127.328 1.00 375.08 ? 631 LEU A CA  1 
ATOM 4673  C C   . LEU A 1 631 ? 136.013 158.689 127.468 1.00 338.64 ? 631 LEU A C   1 
ATOM 4674  O O   . LEU A 1 631 ? 136.846 157.952 126.949 1.00 374.36 ? 631 LEU A O   1 
ATOM 4675  C CB  . LEU A 1 631 ? 134.156 158.060 125.862 1.00 433.43 ? 631 LEU A CB  1 
ATOM 4676  C CG  . LEU A 1 631 ? 134.736 156.812 125.165 1.00 470.18 ? 631 LEU A CG  1 
ATOM 4677  C CD1 . LEU A 1 631 ? 133.641 155.972 124.515 1.00 497.04 ? 631 LEU A CD1 1 
ATOM 4678  C CD2 . LEU A 1 631 ? 135.805 157.158 124.132 1.00 472.82 ? 631 LEU A CD2 1 
ATOM 4679  N N   . SER A 1 632 ? 136.355 159.736 128.220 1.00 286.74 ? 632 SER A N   1 
ATOM 4680  C CA  . SER A 1 632 ? 137.672 160.389 128.145 1.00 311.36 ? 632 SER A CA  1 
ATOM 4681  C C   . SER A 1 632 ? 137.995 160.986 126.748 1.00 320.34 ? 632 SER A C   1 
ATOM 4682  O O   . SER A 1 632 ? 137.105 161.095 125.890 1.00 219.27 ? 632 SER A O   1 
ATOM 4683  C CB  . SER A 1 632 ? 138.795 159.453 128.647 1.00 293.03 ? 632 SER A CB  1 
ATOM 4684  O OG  . SER A 1 632 ? 139.735 159.088 127.640 1.00 256.15 ? 632 SER A OG  1 
ATOM 4685  N N   . PRO A 1 633 ? 139.246 161.469 126.570 1.00 339.37 ? 633 PRO A N   1 
ATOM 4686  C CA  . PRO A 1 633 ? 139.873 161.637 125.271 1.00 344.39 ? 633 PRO A CA  1 
ATOM 4687  C C   . PRO A 1 633 ? 140.854 160.508 124.943 1.00 343.78 ? 633 PRO A C   1 
ATOM 4688  O O   . PRO A 1 633 ? 141.027 160.197 123.768 1.00 329.14 ? 633 PRO A O   1 
ATOM 4689  C CB  . PRO A 1 633 ? 140.625 162.954 125.428 1.00 357.80 ? 633 PRO A CB  1 
ATOM 4690  C CG  . PRO A 1 633 ? 141.048 162.951 126.851 1.00 318.19 ? 633 PRO A CG  1 
ATOM 4691  C CD  . PRO A 1 633 ? 139.991 162.211 127.613 1.00 342.90 ? 633 PRO A CD  1 
ATOM 4692  N N   . ALA A 1 634 ? 141.469 159.884 125.956 1.00 355.99 ? 634 ALA A N   1 
ATOM 4693  C CA  . ALA A 1 634 ? 142.449 158.806 125.756 1.00 385.26 ? 634 ALA A CA  1 
ATOM 4694  C C   . ALA A 1 634 ? 141.950 157.715 124.832 1.00 379.36 ? 634 ALA A C   1 
ATOM 4695  O O   . ALA A 1 634 ? 142.745 157.112 124.115 1.00 412.37 ? 634 ALA A O   1 
ATOM 4696  C CB  . ALA A 1 634 ? 142.849 158.190 127.091 1.00 408.03 ? 634 ALA A CB  1 
ATOM 4697  N N   . PHE A 1 635 ? 140.642 157.466 124.865 1.00 351.11 ? 635 PHE A N   1 
ATOM 4698  C CA  . PHE A 1 635 ? 139.997 156.470 124.013 1.00 362.69 ? 635 PHE A CA  1 
ATOM 4699  C C   . PHE A 1 635 ? 139.115 157.108 122.926 1.00 393.81 ? 635 PHE A C   1 
ATOM 4700  O O   . PHE A 1 635 ? 138.321 156.426 122.277 1.00 429.95 ? 635 PHE A O   1 
ATOM 4701  C CB  . PHE A 1 635 ? 139.235 155.504 124.906 1.00 332.38 ? 635 PHE A CB  1 
ATOM 4702  C CG  . PHE A 1 635 ? 139.970 155.190 126.173 1.00 352.96 ? 635 PHE A CG  1 
ATOM 4703  C CD1 . PHE A 1 635 ? 141.107 154.399 126.147 1.00 373.07 ? 635 PHE A CD1 1 
ATOM 4704  C CD2 . PHE A 1 635 ? 139.574 155.745 127.383 1.00 392.98 ? 635 PHE A CD2 1 
ATOM 4705  C CE1 . PHE A 1 635 ? 141.813 154.129 127.314 1.00 402.25 ? 635 PHE A CE1 1 
ATOM 4706  C CE2 . PHE A 1 635 ? 140.271 155.480 128.553 1.00 387.33 ? 635 PHE A CE2 1 
ATOM 4707  C CZ  . PHE A 1 635 ? 141.394 154.673 128.520 1.00 375.10 ? 635 PHE A CZ  1 
ATOM 4708  N N   . GLU A 1 636 ? 139.271 158.419 122.748 1.00 395.58 ? 636 GLU A N   1 
ATOM 4709  C CA  . GLU A 1 636 ? 138.869 159.136 121.548 1.00 434.18 ? 636 GLU A CA  1 
ATOM 4710  C C   . GLU A 1 636 ? 140.120 159.339 120.678 1.00 457.06 ? 636 GLU A C   1 
ATOM 4711  O O   . GLU A 1 636 ? 140.146 158.939 119.510 1.00 466.66 ? 636 GLU A O   1 
ATOM 4712  C CB  . GLU A 1 636 ? 138.252 160.488 121.928 1.00 452.81 ? 636 GLU A CB  1 
ATOM 4713  C CG  . GLU A 1 636 ? 137.571 161.234 120.779 1.00 477.69 ? 636 GLU A CG  1 
ATOM 4714  C CD  . GLU A 1 636 ? 137.752 162.756 120.848 1.00 472.58 ? 636 GLU A CD  1 
ATOM 4715  O OE1 . GLU A 1 636 ? 137.726 163.324 121.967 1.00 474.43 ? 636 GLU A OE1 1 
ATOM 4716  O OE2 . GLU A 1 636 ? 137.910 163.389 119.775 1.00 443.07 ? 636 GLU A OE2 1 
ATOM 4717  N N   . LEU A 1 637 ? 141.153 159.945 121.268 1.00 455.63 ? 637 LEU A N   1 
ATOM 4718  C CA  . LEU A 1 637 ? 142.446 160.195 120.615 1.00 454.78 ? 637 LEU A CA  1 
ATOM 4719  C C   . LEU A 1 637 ? 143.353 158.956 120.569 1.00 392.29 ? 637 LEU A C   1 
ATOM 4720  O O   . LEU A 1 637 ? 144.365 158.956 119.865 1.00 370.67 ? 637 LEU A O   1 
ATOM 4721  C CB  . LEU A 1 637 ? 143.173 161.350 121.322 1.00 490.91 ? 637 LEU A CB  1 
ATOM 4722  C CG  . LEU A 1 637 ? 144.319 162.064 120.597 1.00 500.00 ? 637 LEU A CG  1 
ATOM 4723  C CD1 . LEU A 1 637 ? 143.860 162.693 119.285 1.00 500.00 ? 637 LEU A CD1 1 
ATOM 4724  C CD2 . LEU A 1 637 ? 144.932 163.116 121.515 1.00 500.00 ? 637 LEU A CD2 1 
ATOM 4725  N N   . SER A 1 638 ? 142.998 157.921 121.330 1.00 378.98 ? 638 SER A N   1 
ATOM 4726  C CA  . SER A 1 638 ? 143.594 156.585 121.206 1.00 419.14 ? 638 SER A CA  1 
ATOM 4727  C C   . SER A 1 638 ? 145.089 156.548 121.552 1.00 384.07 ? 638 SER A C   1 
ATOM 4728  O O   . SER A 1 638 ? 145.916 156.062 120.776 1.00 347.17 ? 638 SER A O   1 
ATOM 4729  C CB  . SER A 1 638 ? 143.319 156.004 119.811 1.00 469.77 ? 638 SER A CB  1 
ATOM 4730  O OG  . SER A 1 638 ? 143.539 154.605 119.791 1.00 489.37 ? 638 SER A OG  1 
ATOM 4731  N N   . GLN A 1 639 ? 145.409 157.061 122.734 1.00 394.12 ? 639 GLN A N   1 
ATOM 4732  C CA  . GLN A 1 639 ? 146.773 157.054 123.263 1.00 422.51 ? 639 GLN A CA  1 
ATOM 4733  C C   . GLN A 1 639 ? 146.979 155.918 124.277 1.00 406.43 ? 639 GLN A C   1 
ATOM 4734  O O   . GLN A 1 639 ? 148.027 155.269 124.284 1.00 389.00 ? 639 GLN A O   1 
ATOM 4735  C CB  . GLN A 1 639 ? 147.075 158.402 123.904 1.00 458.26 ? 639 GLN A CB  1 
ATOM 4736  C CG  . GLN A 1 639 ? 146.925 159.588 122.963 1.00 486.26 ? 639 GLN A CG  1 
ATOM 4737  C CD  . GLN A 1 639 ? 147.044 160.919 123.683 1.00 500.00 ? 639 GLN A CD  1 
ATOM 4738  O OE1 . GLN A 1 639 ? 146.494 161.102 124.767 1.00 500.00 ? 639 GLN A OE1 1 
ATOM 4739  N NE2 . GLN A 1 639 ? 147.753 161.861 123.073 1.00 500.00 ? 639 GLN A NE2 1 
ATOM 4740  N N   . TRP A 1 640 ? 145.978 155.709 125.134 1.00 380.88 ? 640 TRP A N   1 
ATOM 4741  C CA  . TRP A 1 640 ? 145.886 154.556 126.050 1.00 373.83 ? 640 TRP A CA  1 
ATOM 4742  C C   . TRP A 1 640 ? 146.906 154.585 127.202 1.00 389.65 ? 640 TRP A C   1 
ATOM 4743  O O   . TRP A 1 640 ? 146.545 154.995 128.306 1.00 426.49 ? 640 TRP A O   1 
ATOM 4744  C CB  . TRP A 1 640 ? 145.917 153.210 125.308 1.00 355.97 ? 640 TRP A CB  1 
ATOM 4745  C CG  . TRP A 1 640 ? 145.019 153.095 124.115 1.00 396.48 ? 640 TRP A CG  1 
ATOM 4746  C CD1 . TRP A 1 640 ? 143.851 153.772 123.878 1.00 412.21 ? 640 TRP A CD1 1 
ATOM 4747  C CD2 . TRP A 1 640 ? 145.200 152.210 123.006 1.00 408.74 ? 640 TRP A CD2 1 
ATOM 4748  N NE1 . TRP A 1 640 ? 143.306 153.375 122.677 1.00 395.93 ? 640 TRP A NE1 1 
ATOM 4749  C CE2 . TRP A 1 640 ? 144.114 152.415 122.123 1.00 415.52 ? 640 TRP A CE2 1 
ATOM 4750  C CE3 . TRP A 1 640 ? 146.181 151.264 122.670 1.00 390.66 ? 640 TRP A CE3 1 
ATOM 4751  C CZ2 . TRP A 1 640 ? 143.981 151.708 120.923 1.00 429.29 ? 640 TRP A CZ2 1 
ATOM 4752  C CZ3 . TRP A 1 640 ? 146.052 150.562 121.477 1.00 397.63 ? 640 TRP A CZ3 1 
ATOM 4753  C CH2 . TRP A 1 640 ? 144.959 150.789 120.618 1.00 436.13 ? 640 TRP A CH2 1 
ATOM 4754  N N   . SER A 1 641 ? 148.154 154.160 126.972 1.00 403.56 ? 641 SER A N   1 
ATOM 4755  C CA  . SER A 1 641 ? 149.217 154.327 127.977 1.00 396.45 ? 641 SER A CA  1 
ATOM 4756  C C   . SER A 1 641 ? 149.702 155.750 127.819 1.00 373.59 ? 641 SER A C   1 
ATOM 4757  O O   . SER A 1 641 ? 150.584 156.042 127.007 1.00 410.97 ? 641 SER A O   1 
ATOM 4758  C CB  . SER A 1 641 ? 150.368 153.314 127.838 1.00 453.07 ? 641 SER A CB  1 
ATOM 4759  O OG  . SER A 1 641 ? 150.342 152.375 128.900 1.00 476.92 ? 641 SER A OG  1 
ATOM 4760  N N   . SER A 1 642 ? 149.083 156.637 128.582 1.00 363.94 ? 642 SER A N   1 
ATOM 4761  C CA  . SER A 1 642 ? 149.153 158.057 128.311 1.00 404.35 ? 642 SER A CA  1 
ATOM 4762  C C   . SER A 1 642 ? 148.501 158.791 129.452 1.00 431.86 ? 642 SER A C   1 
ATOM 4763  O O   . SER A 1 642 ? 147.271 158.844 129.542 1.00 432.08 ? 642 SER A O   1 
ATOM 4764  C CB  . SER A 1 642 ? 148.411 158.384 127.011 1.00 427.91 ? 642 SER A CB  1 
ATOM 4765  O OG  . SER A 1 642 ? 147.099 157.841 127.024 1.00 408.05 ? 642 SER A OG  1 
ATOM 4766  N N   . THR A 1 643 ? 149.330 159.356 130.322 1.00 453.82 ? 643 THR A N   1 
ATOM 4767  C CA  . THR A 1 643 ? 148.860 160.084 131.494 1.00 460.13 ? 643 THR A CA  1 
ATOM 4768  C C   . THR A 1 643 ? 148.094 161.355 131.047 1.00 436.05 ? 643 THR A C   1 
ATOM 4769  O O   . THR A 1 643 ? 147.700 161.484 129.872 1.00 317.08 ? 643 THR A O   1 
ATOM 4770  C CB  . THR A 1 643 ? 150.057 160.407 132.441 1.00 451.92 ? 643 THR A CB  1 
ATOM 4771  O OG1 . THR A 1 643 ? 151.177 159.566 132.116 1.00 404.04 ? 643 THR A OG1 1 
ATOM 4772  C CG2 . THR A 1 643 ? 149.692 160.211 133.934 1.00 428.28 ? 643 THR A CG2 1 
ATOM 4773  N N   . GLU A 1 644 ? 147.828 162.261 131.984 1.00 453.89 ? 644 GLU A N   1 
ATOM 4774  C CA  . GLU A 1 644 ? 147.217 163.564 131.691 1.00 477.66 ? 644 GLU A CA  1 
ATOM 4775  C C   . GLU A 1 644 ? 146.046 163.542 130.679 1.00 417.38 ? 644 GLU A C   1 
ATOM 4776  O O   . GLU A 1 644 ? 145.816 164.532 129.972 1.00 388.23 ? 644 GLU A O   1 
ATOM 4777  C CB  . GLU A 1 644 ? 148.305 164.593 131.289 1.00 500.00 ? 644 GLU A CB  1 
ATOM 4778  C CG  . GLU A 1 644 ? 149.039 164.339 129.969 1.00 500.00 ? 644 GLU A CG  1 
ATOM 4779  C CD  . GLU A 1 644 ? 150.120 165.371 129.662 1.00 500.00 ? 644 GLU A CD  1 
ATOM 4780  O OE1 . GLU A 1 644 ? 150.206 166.402 130.365 1.00 500.00 ? 644 GLU A OE1 1 
ATOM 4781  O OE2 . GLU A 1 644 ? 150.895 165.141 128.707 1.00 496.79 ? 644 GLU A OE2 1 
ATOM 4782  N N   . TYR A 1 645 ? 145.311 162.428 130.626 1.00 329.83 ? 645 TYR A N   1 
ATOM 4783  C CA  . TYR A 1 645 ? 144.061 162.375 129.860 1.00 372.67 ? 645 TYR A CA  1 
ATOM 4784  C C   . TYR A 1 645 ? 142.979 161.404 130.379 1.00 375.39 ? 645 TYR A C   1 
ATOM 4785  O O   . TYR A 1 645 ? 141.785 161.677 130.189 1.00 299.24 ? 645 TYR A O   1 
ATOM 4786  C CB  . TYR A 1 645 ? 144.363 162.121 128.383 1.00 412.73 ? 645 TYR A CB  1 
ATOM 4787  C CG  . TYR A 1 645 ? 144.600 163.375 127.563 1.00 438.10 ? 645 TYR A CG  1 
ATOM 4788  C CD1 . TYR A 1 645 ? 143.743 164.477 127.651 1.00 469.42 ? 645 TYR A CD1 1 
ATOM 4789  C CD2 . TYR A 1 645 ? 145.682 163.459 126.693 1.00 490.37 ? 645 TYR A CD2 1 
ATOM 4790  C CE1 . TYR A 1 645 ? 143.959 165.618 126.900 1.00 500.00 ? 645 TYR A CE1 1 
ATOM 4791  C CE2 . TYR A 1 645 ? 145.908 164.597 125.934 1.00 500.00 ? 645 TYR A CE2 1 
ATOM 4792  C CZ  . TYR A 1 645 ? 145.043 165.675 126.039 1.00 500.00 ? 645 TYR A CZ  1 
ATOM 4793  O OH  . TYR A 1 645 ? 145.263 166.808 125.286 1.00 500.00 ? 645 TYR A OH  1 
ATOM 4794  N N   . SER A 1 646 ? 143.404 160.275 130.960 1.00 353.12 ? 646 SER A N   1 
ATOM 4795  C CA  . SER A 1 646 ? 142.610 159.393 131.865 1.00 362.71 ? 646 SER A CA  1 
ATOM 4796  C C   . SER A 1 646 ? 142.531 157.972 131.328 1.00 348.57 ? 646 SER A C   1 
ATOM 4797  O O   . SER A 1 646 ? 141.796 157.668 130.387 1.00 317.86 ? 646 SER A O   1 
ATOM 4798  C CB  . SER A 1 646 ? 141.219 159.918 132.250 1.00 360.58 ? 646 SER A CB  1 
ATOM 4799  O OG  . SER A 1 646 ? 140.313 159.850 131.177 1.00 321.84 ? 646 SER A OG  1 
ATOM 4800  N N   . THR A 1 647 ? 143.283 157.105 131.989 1.00 377.94 ? 647 THR A N   1 
ATOM 4801  C CA  . THR A 1 647 ? 143.635 155.800 131.482 1.00 386.77 ? 647 THR A CA  1 
ATOM 4802  C C   . THR A 1 647 ? 142.748 154.803 132.206 1.00 357.19 ? 647 THR A C   1 
ATOM 4803  O O   . THR A 1 647 ? 143.214 153.972 132.972 1.00 314.54 ? 647 THR A O   1 
ATOM 4804  C CB  . THR A 1 647 ? 145.146 155.544 131.719 1.00 423.31 ? 647 THR A CB  1 
ATOM 4805  O OG1 . THR A 1 647 ? 145.400 155.237 133.099 1.00 379.44 ? 647 THR A OG1 1 
ATOM 4806  C CG2 . THR A 1 647 ? 145.956 156.774 131.334 1.00 449.19 ? 647 THR A CG2 1 
ATOM 4807  N N   . TRP A 1 648 ? 141.450 154.917 131.970 1.00 354.93 ? 648 TRP A N   1 
ATOM 4808  C CA  . TRP A 1 648 ? 140.472 154.249 132.812 1.00 377.41 ? 648 TRP A CA  1 
ATOM 4809  C C   . TRP A 1 648 ? 139.498 153.320 132.103 1.00 377.58 ? 648 TRP A C   1 
ATOM 4810  O O   . TRP A 1 648 ? 138.775 153.710 131.171 1.00 348.44 ? 648 TRP A O   1 
ATOM 4811  C CB  . TRP A 1 648 ? 139.739 155.312 133.612 1.00 399.44 ? 648 TRP A CB  1 
ATOM 4812  C CG  . TRP A 1 648 ? 140.535 155.699 134.767 1.00 346.00 ? 648 TRP A CG  1 
ATOM 4813  C CD1 . TRP A 1 648 ? 141.191 156.871 134.961 1.00 336.94 ? 648 TRP A CD1 1 
ATOM 4814  C CD2 . TRP A 1 648 ? 140.815 154.878 135.894 1.00 335.53 ? 648 TRP A CD2 1 
ATOM 4815  N NE1 . TRP A 1 648 ? 141.851 156.841 136.166 1.00 383.67 ? 648 TRP A NE1 1 
ATOM 4816  C CE2 . TRP A 1 648 ? 141.633 155.625 136.760 1.00 385.85 ? 648 TRP A CE2 1 
ATOM 4817  C CE3 . TRP A 1 648 ? 140.437 153.580 136.264 1.00 312.69 ? 648 TRP A CE3 1 
ATOM 4818  C CZ2 . TRP A 1 648 ? 142.088 155.115 137.982 1.00 406.05 ? 648 TRP A CZ2 1 
ATOM 4819  C CZ3 . TRP A 1 648 ? 140.889 153.072 137.475 1.00 326.72 ? 648 TRP A CZ3 1 
ATOM 4820  C CH2 . TRP A 1 648 ? 141.711 153.835 138.317 1.00 366.76 ? 648 TRP A CH2 1 
ATOM 4821  N N   . THR A 1 649 ? 139.464 152.088 132.601 1.00 354.82 ? 649 THR A N   1 
ATOM 4822  C CA  . THR A 1 649 ? 138.781 151.009 131.928 1.00 387.35 ? 649 THR A CA  1 
ATOM 4823  C C   . THR A 1 649 ? 138.280 149.963 132.888 1.00 359.09 ? 649 THR A C   1 
ATOM 4824  O O   . THR A 1 649 ? 138.898 149.709 133.928 1.00 317.28 ? 649 THR A O   1 
ATOM 4825  C CB  . THR A 1 649 ? 139.718 150.266 130.949 1.00 425.04 ? 649 THR A CB  1 
ATOM 4826  O OG1 . THR A 1 649 ? 141.029 150.167 131.517 1.00 359.09 ? 649 THR A OG1 1 
ATOM 4827  C CG2 . THR A 1 649 ? 139.776 150.974 129.599 1.00 447.81 ? 649 THR A CG2 1 
ATOM 4828  N N   . GLU A 1 650 ? 137.184 149.331 132.474 1.00 367.81 ? 650 GLU A N   1 
ATOM 4829  C CA  . GLU A 1 650 ? 136.633 148.169 133.159 1.00 331.72 ? 650 GLU A CA  1 
ATOM 4830  C C   . GLU A 1 650 ? 137.025 146.924 132.384 1.00 339.21 ? 650 GLU A C   1 
ATOM 4831  O O   . GLU A 1 650 ? 137.002 146.927 131.144 1.00 362.94 ? 650 GLU A O   1 
ATOM 4832  C CB  . GLU A 1 650 ? 135.102 148.264 133.181 1.00 332.14 ? 650 GLU A CB  1 
ATOM 4833  C CG  . GLU A 1 650 ? 134.436 147.750 134.446 1.00 358.79 ? 650 GLU A CG  1 
ATOM 4834  C CD  . GLU A 1 650 ? 132.940 148.019 134.457 1.00 377.00 ? 650 GLU A CD  1 
ATOM 4835  O OE1 . GLU A 1 650 ? 132.240 147.476 133.574 1.00 393.38 ? 650 GLU A OE1 1 
ATOM 4836  O OE2 . GLU A 1 650 ? 132.467 148.769 135.347 1.00 335.45 ? 650 GLU A OE2 1 
ATOM 4837  N N   . SER A 1 651 ? 137.376 145.862 133.106 1.00 346.54 ? 651 SER A N   1 
ATOM 4838  C CA  . SER A 1 651 ? 137.239 144.505 132.566 1.00 358.69 ? 651 SER A CA  1 
ATOM 4839  C C   . SER A 1 651 ? 135.773 144.315 132.207 1.00 391.98 ? 651 SER A C   1 
ATOM 4840  O O   . SER A 1 651 ? 134.902 144.791 132.939 1.00 425.63 ? 651 SER A O   1 
ATOM 4841  C CB  . SER A 1 651 ? 137.627 143.448 133.616 1.00 340.96 ? 651 SER A CB  1 
ATOM 4842  O OG  . SER A 1 651 ? 137.032 142.183 133.356 1.00 306.10 ? 651 SER A OG  1 
ATOM 4843  N N   . ARG A 1 652 ? 135.485 143.651 131.091 1.00 389.62 ? 652 ARG A N   1 
ATOM 4844  C CA  . ARG A 1 652 ? 134.134 143.128 130.901 1.00 415.43 ? 652 ARG A CA  1 
ATOM 4845  C C   . ARG A 1 652 ? 134.161 141.610 131.002 1.00 387.17 ? 652 ARG A C   1 
ATOM 4846  O O   . ARG A 1 652 ? 135.031 140.954 130.434 1.00 375.19 ? 652 ARG A O   1 
ATOM 4847  C CB  . ARG A 1 652 ? 133.452 143.650 129.637 1.00 437.22 ? 652 ARG A CB  1 
ATOM 4848  C CG  . ARG A 1 652 ? 134.001 143.205 128.291 1.00 453.08 ? 652 ARG A CG  1 
ATOM 4849  C CD  . ARG A 1 652 ? 132.878 143.195 127.253 1.00 471.05 ? 652 ARG A CD  1 
ATOM 4850  N NE  . ARG A 1 652 ? 132.056 144.405 127.281 1.00 455.09 ? 652 ARG A NE  1 
ATOM 4851  C CZ  . ARG A 1 652 ? 130.992 144.617 126.506 1.00 460.36 ? 652 ARG A CZ  1 
ATOM 4852  N NH1 . ARG A 1 652 ? 130.599 143.717 125.601 1.00 437.44 ? 652 ARG A NH1 1 
ATOM 4853  N NH2 . ARG A 1 652 ? 130.319 145.759 126.629 1.00 483.15 ? 652 ARG A NH2 1 
ATOM 4854  N N   . TRP A 1 653 ? 133.184 141.082 131.732 1.00 370.83 ? 653 TRP A N   1 
ATOM 4855  C CA  . TRP A 1 653 ? 133.227 139.736 132.289 1.00 369.59 ? 653 TRP A CA  1 
ATOM 4856  C C   . TRP A 1 653 ? 131.902 139.028 132.024 1.00 376.44 ? 653 TRP A C   1 
ATOM 4857  O O   . TRP A 1 653 ? 130.938 139.643 131.533 1.00 315.44 ? 653 TRP A O   1 
ATOM 4858  C CB  . TRP A 1 653 ? 133.479 139.807 133.799 1.00 390.90 ? 653 TRP A CB  1 
ATOM 4859  C CG  . TRP A 1 653 ? 132.309 140.380 134.556 1.00 408.98 ? 653 TRP A CG  1 
ATOM 4860  C CD1 . TRP A 1 653 ? 131.305 139.689 135.163 1.00 439.69 ? 653 TRP A CD1 1 
ATOM 4861  C CD2 . TRP A 1 653 ? 132.008 141.762 134.741 1.00 376.80 ? 653 TRP A CD2 1 
ATOM 4862  N NE1 . TRP A 1 653 ? 130.401 140.556 135.727 1.00 387.12 ? 653 TRP A NE1 1 
ATOM 4863  C CE2 . TRP A 1 653 ? 130.811 141.835 135.486 1.00 333.02 ? 653 TRP A CE2 1 
ATOM 4864  C CE3 . TRP A 1 653 ? 132.637 142.946 134.353 1.00 402.47 ? 653 TRP A CE3 1 
ATOM 4865  C CZ2 . TRP A 1 653 ? 130.233 143.038 135.848 1.00 349.46 ? 653 TRP A CZ2 1 
ATOM 4866  C CZ3 . TRP A 1 653 ? 132.065 144.145 134.711 1.00 417.02 ? 653 TRP A CZ3 1 
ATOM 4867  C CH2 . TRP A 1 653 ? 130.875 144.184 135.454 1.00 417.63 ? 653 TRP A CH2 1 
ATOM 4868  N N   . LYS A 1 654 ? 131.861 137.747 132.390 1.00 378.32 ? 654 LYS A N   1 
ATOM 4869  C CA  . LYS A 1 654 ? 130.672 136.912 132.218 1.00 383.42 ? 654 LYS A CA  1 
ATOM 4870  C C   . LYS A 1 654 ? 130.286 136.249 133.537 1.00 371.78 ? 654 LYS A C   1 
ATOM 4871  O O   . LYS A 1 654 ? 131.116 135.585 134.177 1.00 316.38 ? 654 LYS A O   1 
ATOM 4872  C CB  . LYS A 1 654 ? 130.863 135.868 131.103 1.00 398.00 ? 654 LYS A CB  1 
ATOM 4873  C CG  . LYS A 1 654 ? 132.175 135.096 131.111 1.00 391.23 ? 654 LYS A CG  1 
ATOM 4874  C CD  . LYS A 1 654 ? 132.353 134.330 129.810 1.00 417.70 ? 654 LYS A CD  1 
ATOM 4875  C CE  . LYS A 1 654 ? 133.743 133.719 129.702 1.00 479.95 ? 654 LYS A CE  1 
ATOM 4876  N NZ  . LYS A 1 654 ? 133.964 132.619 130.683 1.00 500.00 ? 654 LYS A NZ  1 
ATOM 4877  N N   . ASP A 1 655 ? 129.019 136.463 133.917 1.00 371.61 ? 655 ASP A N   1 
ATOM 4878  C CA  . ASP A 1 655 ? 128.402 135.956 135.150 1.00 363.68 ? 655 ASP A CA  1 
ATOM 4879  C C   . ASP A 1 655 ? 129.318 135.976 136.364 1.00 368.26 ? 655 ASP A C   1 
ATOM 4880  O O   . ASP A 1 655 ? 129.910 134.955 136.732 1.00 405.38 ? 655 ASP A O   1 
ATOM 4881  C CB  . ASP A 1 655 ? 127.822 134.543 134.934 1.00 424.84 ? 655 ASP A CB  1 
ATOM 4882  C CG  . ASP A 1 655 ? 126.416 134.560 134.341 1.00 480.70 ? 655 ASP A CG  1 
ATOM 4883  O OD1 . ASP A 1 655 ? 126.087 135.496 133.577 1.00 500.00 ? 655 ASP A OD1 1 
ATOM 4884  O OD2 . ASP A 1 655 ? 125.639 133.628 134.639 1.00 492.70 ? 655 ASP A OD2 1 
ATOM 4885  N N   . ILE A 1 656 ? 129.472 137.161 136.952 1.00 373.06 ? 656 ILE A N   1 
ATOM 4886  C CA  . ILE A 1 656 ? 129.884 137.241 138.349 1.00 344.85 ? 656 ILE A CA  1 
ATOM 4887  C C   . ILE A 1 656 ? 128.723 136.632 139.102 1.00 282.70 ? 656 ILE A C   1 
ATOM 4888  O O   . ILE A 1 656 ? 127.579 137.047 138.900 1.00 276.21 ? 656 ILE A O   1 
ATOM 4889  C CB  . ILE A 1 656 ? 130.196 138.677 138.895 1.00 372.94 ? 656 ILE A CB  1 
ATOM 4890  C CG1 . ILE A 1 656 ? 129.026 139.681 138.673 1.00 412.09 ? 656 ILE A CG1 1 
ATOM 4891  C CG2 . ILE A 1 656 ? 131.553 139.175 138.377 1.00 337.48 ? 656 ILE A CG2 1 
ATOM 4892  C CD1 . ILE A 1 656 ? 128.096 139.876 139.861 1.00 427.47 ? 656 ILE A CD1 1 
ATOM 4893  N N   . ARG A 1 657 ? 128.996 135.605 139.898 1.00 283.14 ? 657 ARG A N   1 
ATOM 4894  C CA  . ARG A 1 657 ? 127.996 135.125 140.860 1.00 323.55 ? 657 ARG A CA  1 
ATOM 4895  C C   . ARG A 1 657 ? 128.637 134.317 141.948 1.00 310.26 ? 657 ARG A C   1 
ATOM 4896  O O   . ARG A 1 657 ? 129.780 133.846 141.819 1.00 237.16 ? 657 ARG A O   1 
ATOM 4897  C CB  . ARG A 1 657 ? 126.870 134.308 140.215 1.00 352.03 ? 657 ARG A CB  1 
ATOM 4898  C CG  . ARG A 1 657 ? 127.255 132.898 139.796 1.00 398.79 ? 657 ARG A CG  1 
ATOM 4899  C CD  . ARG A 1 657 ? 126.188 132.296 138.897 1.00 425.81 ? 657 ARG A CD  1 
ATOM 4900  N NE  . ARG A 1 657 ? 126.456 130.895 138.592 1.00 404.52 ? 657 ARG A NE  1 
ATOM 4901  C CZ  . ARG A 1 657 ? 127.364 130.451 137.721 1.00 405.77 ? 657 ARG A CZ  1 
ATOM 4902  N NH1 . ARG A 1 657 ? 128.148 131.285 137.033 1.00 391.04 ? 657 ARG A NH1 1 
ATOM 4903  N NH2 . ARG A 1 657 ? 127.496 129.140 137.542 1.00 460.12 ? 657 ARG A NH2 1 
ATOM 4904  N N   . ALA A 1 658 ? 127.872 134.168 143.021 1.00 312.30 ? 658 ALA A N   1 
ATOM 4905  C CA  . ALA A 1 658 ? 128.342 133.493 144.199 1.00 341.10 ? 658 ALA A CA  1 
ATOM 4906  C C   . ALA A 1 658 ? 127.259 132.567 144.696 1.00 348.23 ? 658 ALA A C   1 
ATOM 4907  O O   . ALA A 1 658 ? 126.043 132.881 144.620 1.00 285.83 ? 658 ALA A O   1 
ATOM 4908  C CB  . ALA A 1 658 ? 128.725 134.492 145.275 1.00 381.43 ? 658 ALA A CB  1 
ATOM 4909  N N   . ARG A 1 659 ? 127.723 131.422 145.197 1.00 350.64 ? 659 ARG A N   1 
ATOM 4910  C CA  . ARG A 1 659 ? 126.843 130.397 145.734 1.00 333.10 ? 659 ARG A CA  1 
ATOM 4911  C C   . ARG A 1 659 ? 127.584 129.611 146.792 1.00 282.05 ? 659 ARG A C   1 
ATOM 4912  O O   . ARG A 1 659 ? 128.732 129.201 146.600 1.00 285.71 ? 659 ARG A O   1 
ATOM 4913  C CB  . ARG A 1 659 ? 126.342 129.461 144.624 1.00 389.58 ? 659 ARG A CB  1 
ATOM 4914  C CG  . ARG A 1 659 ? 127.449 128.755 143.853 1.00 392.22 ? 659 ARG A CG  1 
ATOM 4915  C CD  . ARG A 1 659 ? 126.959 128.048 142.603 1.00 372.95 ? 659 ARG A CD  1 
ATOM 4916  N NE  . ARG A 1 659 ? 128.081 127.337 141.995 1.00 344.42 ? 659 ARG A NE  1 
ATOM 4917  C CZ  . ARG A 1 659 ? 127.991 126.424 141.034 1.00 355.40 ? 659 ARG A CZ  1 
ATOM 4918  N NH1 . ARG A 1 659 ? 126.812 126.081 140.515 1.00 380.83 ? 659 ARG A NH1 1 
ATOM 4919  N NH2 . ARG A 1 659 ? 129.105 125.844 140.585 1.00 334.75 ? 659 ARG A NH2 1 
ATOM 4920  N N   . ILE A 1 660 ? 126.929 129.435 147.924 1.00 303.71 ? 660 ILE A N   1 
ATOM 4921  C CA  . ILE A 1 660 ? 127.435 128.581 148.965 1.00 335.91 ? 660 ILE A CA  1 
ATOM 4922  C C   . ILE A 1 660 ? 127.051 127.144 148.692 1.00 345.85 ? 660 ILE A C   1 
ATOM 4923  O O   . ILE A 1 660 ? 126.205 126.852 147.849 1.00 372.92 ? 660 ILE A O   1 
ATOM 4924  C CB  . ILE A 1 660 ? 126.901 129.018 150.346 1.00 399.65 ? 660 ILE A CB  1 
ATOM 4925  C CG1 . ILE A 1 660 ? 127.861 128.564 151.455 1.00 495.86 ? 660 ILE A CG1 1 
ATOM 4926  C CG2 . ILE A 1 660 ? 125.460 128.539 150.577 1.00 308.13 ? 660 ILE A CG2 1 
ATOM 4927  C CD1 . ILE A 1 660 ? 127.927 129.507 152.626 1.00 500.00 ? 660 ILE A CD1 1 
ATOM 4928  N N   . PHE A 1 661 ? 127.695 126.258 149.429 1.00 334.30 ? 661 PHE A N   1 
ATOM 4929  C CA  . PHE A 1 661 ? 127.346 124.866 149.465 1.00 349.84 ? 661 PHE A CA  1 
ATOM 4930  C C   . PHE A 1 661 ? 128.073 124.198 150.624 1.00 347.60 ? 661 PHE A C   1 
ATOM 4931  O O   . PHE A 1 661 ? 128.699 124.873 151.449 1.00 320.16 ? 661 PHE A O   1 
ATOM 4932  C CB  . PHE A 1 661 ? 127.736 124.209 148.143 1.00 340.14 ? 661 PHE A CB  1 
ATOM 4933  C CG  . PHE A 1 661 ? 129.137 124.519 147.683 1.00 318.23 ? 661 PHE A CG  1 
ATOM 4934  C CD1 . PHE A 1 661 ? 130.260 124.079 148.385 1.00 316.01 ? 661 PHE A CD1 1 
ATOM 4935  C CD2 . PHE A 1 661 ? 129.332 125.203 146.507 1.00 333.17 ? 661 PHE A CD2 1 
ATOM 4936  C CE1 . PHE A 1 661 ? 131.538 124.345 147.921 1.00 345.40 ? 661 PHE A CE1 1 
ATOM 4937  C CE2 . PHE A 1 661 ? 130.599 125.464 146.031 1.00 372.48 ? 661 PHE A CE2 1 
ATOM 4938  C CZ  . PHE A 1 661 ? 131.710 125.042 146.742 1.00 367.76 ? 661 PHE A CZ  1 
ATOM 4939  N N   . LEU A 1 662 ? 127.974 122.872 150.673 1.00 332.45 ? 662 LEU A N   1 
ATOM 4940  C CA  . LEU A 1 662 ? 128.923 122.054 151.402 1.00 350.82 ? 662 LEU A CA  1 
ATOM 4941  C C   . LEU A 1 662 ? 129.837 121.321 150.421 1.00 329.10 ? 662 LEU A C   1 
ATOM 4942  O O   . LEU A 1 662 ? 129.484 121.133 149.262 1.00 319.04 ? 662 LEU A O   1 
ATOM 4943  C CB  . LEU A 1 662 ? 128.205 121.067 152.321 1.00 384.50 ? 662 LEU A CB  1 
ATOM 4944  C CG  . LEU A 1 662 ? 127.914 121.611 153.724 1.00 398.25 ? 662 LEU A CG  1 
ATOM 4945  C CD1 . LEU A 1 662 ? 127.022 122.842 153.649 1.00 404.12 ? 662 LEU A CD1 1 
ATOM 4946  C CD2 . LEU A 1 662 ? 127.295 120.538 154.610 1.00 436.54 ? 662 LEU A CD2 1 
ATOM 4947  N N   . ILE A 1 663 ? 131.013 120.928 150.909 1.00 354.63 ? 663 ILE A N   1 
ATOM 4948  C CA  . ILE A 1 663 ? 131.989 120.147 150.141 1.00 370.37 ? 663 ILE A CA  1 
ATOM 4949  C C   . ILE A 1 663 ? 132.333 118.868 150.911 1.00 414.87 ? 663 ILE A C   1 
ATOM 4950  O O   . ILE A 1 663 ? 132.193 118.816 152.134 1.00 427.47 ? 663 ILE A O   1 
ATOM 4951  C CB  . ILE A 1 663 ? 133.268 120.973 149.866 1.00 383.91 ? 663 ILE A CB  1 
ATOM 4952  C CG1 . ILE A 1 663 ? 134.102 120.344 148.743 1.00 422.08 ? 663 ILE A CG1 1 
ATOM 4953  C CG2 . ILE A 1 663 ? 134.115 121.145 151.128 1.00 398.84 ? 663 ILE A CG2 1 
ATOM 4954  C CD1 . ILE A 1 663 ? 135.302 121.175 148.342 1.00 458.48 ? 663 ILE A CD1 1 
ATOM 4955  N N   . ALA A 1 664 ? 132.773 117.844 150.185 1.00 431.33 ? 664 ALA A N   1 
ATOM 4956  C CA  . ALA A 1 664 ? 133.277 116.610 150.789 1.00 438.97 ? 664 ALA A CA  1 
ATOM 4957  C C   . ALA A 1 664 ? 134.770 116.720 151.074 1.00 393.53 ? 664 ALA A C   1 
ATOM 4958  O O   . ALA A 1 664 ? 135.397 117.739 150.776 1.00 369.94 ? 664 ALA A O   1 
ATOM 4959  C CB  . ALA A 1 664 ? 133.011 115.437 149.859 1.00 499.47 ? 664 ALA A CB  1 
ATOM 4960  N N   . SER A 1 665 ? 135.330 115.659 151.646 1.00 405.54 ? 665 SER A N   1 
ATOM 4961  C CA  . SER A 1 665 ? 136.778 115.549 151.829 1.00 440.65 ? 665 SER A CA  1 
ATOM 4962  C C   . SER A 1 665 ? 137.442 115.102 150.536 1.00 424.67 ? 665 SER A C   1 
ATOM 4963  O O   . SER A 1 665 ? 136.894 114.269 149.817 1.00 405.91 ? 665 SER A O   1 
ATOM 4964  C CB  . SER A 1 665 ? 137.123 114.568 152.963 1.00 463.50 ? 665 SER A CB  1 
ATOM 4965  O OG  . SER A 1 665 ? 137.186 113.221 152.524 1.00 420.99 ? 665 SER A OG  1 
ATOM 4966  N N   . LYS A 1 666 ? 138.625 115.653 150.254 1.00 416.48 ? 666 LYS A N   1 
ATOM 4967  C CA  . LYS A 1 666 ? 139.493 115.138 149.192 1.00 419.20 ? 666 LYS A CA  1 
ATOM 4968  C C   . LYS A 1 666 ? 139.586 113.622 149.303 1.00 405.87 ? 666 LYS A C   1 
ATOM 4969  O O   . LYS A 1 666 ? 139.523 112.917 148.285 1.00 396.51 ? 666 LYS A O   1 
ATOM 4970  C CB  . LYS A 1 666 ? 140.915 115.719 149.296 1.00 500.00 ? 666 LYS A CB  1 
ATOM 4971  C CG  . LYS A 1 666 ? 141.196 116.937 148.426 1.00 500.00 ? 666 LYS A CG  1 
ATOM 4972  C CD  . LYS A 1 666 ? 142.518 117.622 148.792 1.00 500.00 ? 666 LYS A CD  1 
ATOM 4973  C CE  . LYS A 1 666 ? 143.766 116.819 148.421 1.00 500.00 ? 666 LYS A CE  1 
ATOM 4974  N NZ  . LYS A 1 666 ? 144.005 116.731 146.952 1.00 500.00 ? 666 LYS A NZ  1 
ATOM 4975  N N   . GLU A 1 667 ? 139.800 113.161 150.542 1.00 428.76 ? 667 GLU A N   1 
ATOM 4976  C CA  . GLU A 1 667 ? 139.990 111.740 150.819 1.00 460.73 ? 667 GLU A CA  1 
ATOM 4977  C C   . GLU A 1 667 ? 138.773 110.947 150.365 1.00 418.90 ? 667 GLU A C   1 
ATOM 4978  O O   . GLU A 1 667 ? 138.923 109.894 149.720 1.00 434.18 ? 667 GLU A O   1 
ATOM 4979  C CB  . GLU A 1 667 ? 140.369 111.478 152.290 1.00 500.00 ? 667 GLU A CB  1 
ATOM 4980  C CG  . GLU A 1 667 ? 141.741 112.061 152.674 1.00 500.00 ? 667 GLU A CG  1 
ATOM 4981  C CD  . GLU A 1 667 ? 142.524 111.245 153.704 1.00 497.61 ? 667 GLU A CD  1 
ATOM 4982  O OE1 . GLU A 1 667 ? 141.905 110.567 154.554 1.00 500.00 ? 667 GLU A OE1 1 
ATOM 4983  O OE2 . GLU A 1 667 ? 143.776 111.293 153.672 1.00 381.82 ? 667 GLU A OE2 1 
ATOM 4984  N N   . LEU A 1 668 ? 137.598 111.476 150.698 1.00 380.45 ? 668 LEU A N   1 
ATOM 4985  C CA  . LEU A 1 668 ? 136.325 110.846 150.337 1.00 399.98 ? 668 LEU A CA  1 
ATOM 4986  C C   . LEU A 1 668 ? 136.222 110.695 148.822 1.00 403.24 ? 668 LEU A C   1 
ATOM 4987  O O   . LEU A 1 668 ? 135.847 109.627 148.312 1.00 411.20 ? 668 LEU A O   1 
ATOM 4988  C CB  . LEU A 1 668 ? 135.116 111.627 150.871 1.00 412.27 ? 668 LEU A CB  1 
ATOM 4989  C CG  . LEU A 1 668 ? 133.719 111.173 150.396 1.00 414.63 ? 668 LEU A CG  1 
ATOM 4990  C CD1 . LEU A 1 668 ? 132.692 111.305 151.519 1.00 418.20 ? 668 LEU A CD1 1 
ATOM 4991  C CD2 . LEU A 1 668 ? 133.241 111.898 149.126 1.00 375.93 ? 668 LEU A CD2 1 
ATOM 4992  N N   . GLU A 1 669 ? 136.567 111.782 148.142 1.00 449.98 ? 669 GLU A N   1 
ATOM 4993  C CA  . GLU A 1 669 ? 136.535 111.841 146.676 1.00 500.00 ? 669 GLU A CA  1 
ATOM 4994  C C   . GLU A 1 669 ? 137.436 110.758 146.090 1.00 440.67 ? 669 GLU A C   1 
ATOM 4995  O O   . GLU A 1 669 ? 137.042 110.035 145.160 1.00 359.89 ? 669 GLU A O   1 
ATOM 4996  C CB  . GLU A 1 669 ? 136.904 113.242 146.151 1.00 500.00 ? 669 GLU A CB  1 
ATOM 4997  C CG  . GLU A 1 669 ? 135.926 114.346 146.574 1.00 500.00 ? 669 GLU A CG  1 
ATOM 4998  C CD  . GLU A 1 669 ? 136.030 115.628 145.753 1.00 500.00 ? 669 GLU A CD  1 
ATOM 4999  O OE1 . GLU A 1 669 ? 137.112 115.909 145.190 1.00 500.00 ? 669 GLU A OE1 1 
ATOM 5000  O OE2 . GLU A 1 669 ? 135.020 116.366 145.675 1.00 500.00 ? 669 GLU A OE2 1 
ATOM 5001  N N   . LEU A 1 670 ? 138.632 110.676 146.657 1.00 464.23 ? 670 LEU A N   1 
ATOM 5002  C CA  . LEU A 1 670 ? 139.647 109.702 146.243 1.00 500.00 ? 670 LEU A CA  1 
ATOM 5003  C C   . LEU A 1 670 ? 139.096 108.285 146.372 1.00 491.15 ? 670 LEU A C   1 
ATOM 5004  O O   . LEU A 1 670 ? 139.234 107.460 145.456 1.00 422.24 ? 670 LEU A O   1 
ATOM 5005  C CB  . LEU A 1 670 ? 140.939 109.884 147.073 1.00 500.00 ? 670 LEU A CB  1 
ATOM 5006  C CG  . LEU A 1 670 ? 142.067 108.826 147.078 1.00 500.00 ? 670 LEU A CG  1 
ATOM 5007  C CD1 . LEU A 1 670 ? 143.445 109.489 147.152 1.00 500.00 ? 670 LEU A CD1 1 
ATOM 5008  C CD2 . LEU A 1 670 ? 141.913 107.806 148.209 1.00 500.00 ? 670 LEU A CD2 1 
ATOM 5009  N N   . ILE A 1 671 ? 138.480 108.044 147.521 1.00 478.09 ? 671 ILE A N   1 
ATOM 5010  C CA  . ILE A 1 671 ? 137.881 106.743 147.846 1.00 489.22 ? 671 ILE A CA  1 
ATOM 5011  C C   . ILE A 1 671 ? 136.835 106.375 146.800 1.00 403.55 ? 671 ILE A C   1 
ATOM 5012  O O   . ILE A 1 671 ? 136.807 105.241 146.297 1.00 326.84 ? 671 ILE A O   1 
ATOM 5013  C CB  . ILE A 1 671 ? 137.288 106.710 149.288 1.00 500.00 ? 671 ILE A CB  1 
ATOM 5014  C CG1 . ILE A 1 671 ? 138.424 106.622 150.326 1.00 500.00 ? 671 ILE A CG1 1 
ATOM 5015  C CG2 . ILE A 1 671 ? 136.281 105.571 149.482 1.00 500.00 ? 671 ILE A CG2 1 
ATOM 5016  C CD1 . ILE A 1 671 ? 139.063 105.253 150.490 1.00 500.00 ? 671 ILE A CD1 1 
ATOM 5017  N N   . THR A 1 672 ? 135.994 107.355 146.500 1.00 405.21 ? 672 THR A N   1 
ATOM 5018  C CA  . THR A 1 672 ? 134.914 107.207 145.521 1.00 424.29 ? 672 THR A CA  1 
ATOM 5019  C C   . THR A 1 672 ? 135.488 106.802 144.164 1.00 388.29 ? 672 THR A C   1 
ATOM 5020  O O   . THR A 1 672 ? 134.987 105.873 143.507 1.00 346.37 ? 672 THR A O   1 
ATOM 5021  C CB  . THR A 1 672 ? 134.120 108.522 145.349 1.00 456.05 ? 672 THR A CB  1 
ATOM 5022  O OG1 . THR A 1 672 ? 133.698 109.001 146.632 1.00 490.26 ? 672 THR A OG1 1 
ATOM 5023  C CG2 . THR A 1 672 ? 132.898 108.333 144.440 1.00 459.84 ? 672 THR A CG2 1 
ATOM 5024  N N   . LEU A 1 673 ? 136.538 107.523 143.786 1.00 386.86 ? 673 LEU A N   1 
ATOM 5025  C CA  . LEU A 1 673 ? 137.232 107.294 142.514 1.00 426.44 ? 673 LEU A CA  1 
ATOM 5026  C C   . LEU A 1 673 ? 137.746 105.863 142.442 1.00 423.66 ? 673 LEU A C   1 
ATOM 5027  O O   . LEU A 1 673 ? 137.582 105.178 141.430 1.00 494.22 ? 673 LEU A O   1 
ATOM 5028  C CB  . LEU A 1 673 ? 138.363 108.289 142.257 1.00 500.00 ? 673 LEU A CB  1 
ATOM 5029  C CG  . LEU A 1 673 ? 139.084 108.092 140.904 1.00 500.00 ? 673 LEU A CG  1 
ATOM 5030  C CD1 . LEU A 1 673 ? 139.247 109.404 140.144 1.00 500.00 ? 673 LEU A CD1 1 
ATOM 5031  C CD2 . LEU A 1 673 ? 140.437 107.399 141.070 1.00 500.00 ? 673 LEU A CD2 1 
ATOM 5032  N N   . THR A 1 674 ? 138.365 105.452 143.540 1.00 422.56 ? 674 THR A N   1 
ATOM 5033  C CA  . THR A 1 674 ? 138.935 104.106 143.680 1.00 494.09 ? 674 THR A CA  1 
ATOM 5034  C C   . THR A 1 674 ? 137.850 103.055 143.473 1.00 412.62 ? 674 THR A C   1 
ATOM 5035  O O   . THR A 1 674 ? 138.041 102.076 142.733 1.00 345.58 ? 674 THR A O   1 
ATOM 5036  C CB  . THR A 1 674 ? 139.616 103.909 145.051 1.00 500.00 ? 674 THR A CB  1 
ATOM 5037  O OG1 . THR A 1 674 ? 140.582 104.950 145.263 1.00 500.00 ? 674 THR A OG1 1 
ATOM 5038  C CG2 . THR A 1 674 ? 140.305 102.538 145.134 1.00 500.00 ? 674 THR A CG2 1 
ATOM 5039  N N   . VAL A 1 675 ? 136.724 103.295 144.137 1.00 328.64 ? 675 VAL A N   1 
ATOM 5040  C CA  . VAL A 1 675 ? 135.563 102.406 144.074 1.00 356.05 ? 675 VAL A CA  1 
ATOM 5041  C C   . VAL A 1 675 ? 135.089 102.263 142.632 1.00 350.66 ? 675 VAL A C   1 
ATOM 5042  O O   . VAL A 1 675 ? 134.838 101.139 142.146 1.00 330.48 ? 675 VAL A O   1 
ATOM 5043  C CB  . VAL A 1 675 ? 134.427 102.842 145.022 1.00 369.91 ? 675 VAL A CB  1 
ATOM 5044  C CG1 . VAL A 1 675 ? 133.163 102.016 144.794 1.00 370.05 ? 675 VAL A CG1 1 
ATOM 5045  C CG2 . VAL A 1 675 ? 134.876 102.693 146.470 1.00 423.89 ? 675 VAL A CG2 1 
ATOM 5046  N N   . GLY A 1 676 ? 135.002 103.404 141.966 1.00 387.80 ? 676 GLY A N   1 
ATOM 5047  C CA  . GLY A 1 676 ? 134.578 103.480 140.566 1.00 437.22 ? 676 GLY A CA  1 
ATOM 5048  C C   . GLY A 1 676 ? 135.484 102.644 139.686 1.00 408.53 ? 676 GLY A C   1 
ATOM 5049  O O   . GLY A 1 676 ? 135.026 101.725 139.001 1.00 332.90 ? 676 GLY A O   1 
ATOM 5050  N N   . PHE A 1 677 ? 136.774 102.973 139.730 1.00 427.04 ? 677 PHE A N   1 
ATOM 5051  C CA  . PHE A 1 677 ? 137.819 102.252 139.003 1.00 409.30 ? 677 PHE A CA  1 
ATOM 5052  C C   . PHE A 1 677 ? 137.802 100.782 139.384 1.00 416.28 ? 677 PHE A C   1 
ATOM 5053  O O   . PHE A 1 677 ? 137.831 99.886  138.502 1.00 458.46 ? 677 PHE A O   1 
ATOM 5054  C CB  . PHE A 1 677 ? 139.229 102.794 139.322 1.00 420.56 ? 677 PHE A CB  1 
ATOM 5055  C CG  . PHE A 1 677 ? 139.856 103.575 138.199 1.00 500.00 ? 677 PHE A CG  1 
ATOM 5056  C CD1 . PHE A 1 677 ? 140.195 102.947 137.003 1.00 500.00 ? 677 PHE A CD1 1 
ATOM 5057  C CD2 . PHE A 1 677 ? 140.144 104.934 138.343 1.00 500.00 ? 677 PHE A CD2 1 
ATOM 5058  C CE1 . PHE A 1 677 ? 140.784 103.663 135.966 1.00 500.00 ? 677 PHE A CE1 1 
ATOM 5059  C CE2 . PHE A 1 677 ? 140.735 105.654 137.310 1.00 500.00 ? 677 PHE A CE2 1 
ATOM 5060  C CZ  . PHE A 1 677 ? 141.055 105.017 136.118 1.00 500.00 ? 677 PHE A CZ  1 
ATOM 5061  N N   . GLY A 1 678 ? 137.747 100.553 140.684 1.00 408.73 ? 678 GLY A N   1 
ATOM 5062  C CA  . GLY A 1 678 ? 137.681 99.194  141.251 1.00 446.77 ? 678 GLY A CA  1 
ATOM 5063  C C   . GLY A 1 678 ? 136.511 98.404  140.700 1.00 429.76 ? 678 GLY A C   1 
ATOM 5064  O O   . GLY A 1 678 ? 136.686 97.270  140.205 1.00 461.96 ? 678 GLY A O   1 
ATOM 5065  N N   . ILE A 1 679 ? 135.317 98.967  140.892 1.00 371.40 ? 679 ILE A N   1 
ATOM 5066  C CA  . ILE A 1 679 ? 134.061 98.290  140.530 1.00 396.55 ? 679 ILE A CA  1 
ATOM 5067  C C   . ILE A 1 679 ? 134.059 97.971  139.040 1.00 411.52 ? 679 ILE A C   1 
ATOM 5068  O O   . ILE A 1 679 ? 133.704 96.848  138.641 1.00 393.09 ? 679 ILE A O   1 
ATOM 5069  C CB  . ILE A 1 679 ? 132.798 99.072  141.015 1.00 402.67 ? 679 ILE A CB  1 
ATOM 5070  C CG1 . ILE A 1 679 ? 131.553 98.170  141.034 1.00 445.77 ? 679 ILE A CG1 1 
ATOM 5071  C CG2 . ILE A 1 679 ? 132.532 100.331 140.201 1.00 359.54 ? 679 ILE A CG2 1 
ATOM 5072  C CD1 . ILE A 1 679 ? 131.455 97.284  142.258 1.00 460.81 ? 679 ILE A CD1 1 
ATOM 5073  N N   . LEU A 1 680 ? 134.466 98.967  138.253 1.00 421.51 ? 680 LEU A N   1 
ATOM 5074  C CA  . LEU A 1 680 ? 134.533 98.842  136.794 1.00 433.93 ? 680 LEU A CA  1 
ATOM 5075  C C   . LEU A 1 680 ? 135.446 97.686  136.406 1.00 425.32 ? 680 LEU A C   1 
ATOM 5076  O O   . LEU A 1 680 ? 135.100 96.853  135.551 1.00 365.56 ? 680 LEU A O   1 
ATOM 5077  C CB  . LEU A 1 680 ? 135.085 100.138 136.171 1.00 458.79 ? 680 LEU A CB  1 
ATOM 5078  C CG  . LEU A 1 680 ? 135.729 100.112 134.771 1.00 462.05 ? 680 LEU A CG  1 
ATOM 5079  C CD1 . LEU A 1 680 ? 134.739 99.688  133.697 1.00 478.40 ? 680 LEU A CD1 1 
ATOM 5080  C CD2 . LEU A 1 680 ? 136.319 101.473 134.441 1.00 472.09 ? 680 LEU A CD2 1 
ATOM 5081  N N   . ILE A 1 681 ? 136.604 97.670  137.056 1.00 466.63 ? 681 ILE A N   1 
ATOM 5082  C CA  . ILE A 1 681 ? 137.629 96.642  136.826 1.00 475.67 ? 681 ILE A CA  1 
ATOM 5083  C C   . ILE A 1 681 ? 137.053 95.259  137.096 1.00 403.93 ? 681 ILE A C   1 
ATOM 5084  O O   . ILE A 1 681 ? 137.239 94.328  136.301 1.00 332.12 ? 681 ILE A O   1 
ATOM 5085  C CB  . ILE A 1 681 ? 138.927 96.915  137.645 1.00 500.00 ? 681 ILE A CB  1 
ATOM 5086  C CG1 . ILE A 1 681 ? 139.739 98.039  136.983 1.00 500.00 ? 681 ILE A CG1 1 
ATOM 5087  C CG2 . ILE A 1 681 ? 139.804 95.667  137.761 1.00 500.00 ? 681 ILE A CG2 1 
ATOM 5088  C CD1 . ILE A 1 681 ? 140.708 98.747  137.910 1.00 500.00 ? 681 ILE A CD1 1 
ATOM 5089  N N   . PHE A 1 682 ? 136.363 95.166  138.225 1.00 388.13 ? 682 PHE A N   1 
ATOM 5090  C CA  . PHE A 1 682 ? 135.724 93.923  138.674 1.00 402.89 ? 682 PHE A CA  1 
ATOM 5091  C C   . PHE A 1 682 ? 134.748 93.423  137.612 1.00 388.39 ? 682 PHE A C   1 
ATOM 5092  O O   . PHE A 1 682 ? 134.743 92.237  137.253 1.00 379.19 ? 682 PHE A O   1 
ATOM 5093  C CB  . PHE A 1 682 ? 134.971 94.213  139.986 1.00 406.04 ? 682 PHE A CB  1 
ATOM 5094  C CG  . PHE A 1 682 ? 134.414 92.998  140.666 1.00 476.98 ? 682 PHE A CG  1 
ATOM 5095  C CD1 . PHE A 1 682 ? 135.255 92.122  141.348 1.00 500.00 ? 682 PHE A CD1 1 
ATOM 5096  C CD2 . PHE A 1 682 ? 133.046 92.742  140.656 1.00 500.00 ? 682 PHE A CD2 1 
ATOM 5097  C CE1 . PHE A 1 682 ? 134.746 91.000  141.988 1.00 500.00 ? 682 PHE A CE1 1 
ATOM 5098  C CE2 . PHE A 1 682 ? 132.531 91.623  141.294 1.00 500.00 ? 682 PHE A CE2 1 
ATOM 5099  C CZ  . PHE A 1 682 ? 133.381 90.749  141.961 1.00 500.00 ? 682 PHE A CZ  1 
ATOM 5100  N N   . SER A 1 683 ? 133.937 94.366  137.142 1.00 404.06 ? 683 SER A N   1 
ATOM 5101  C CA  . SER A 1 683 ? 132.917 94.095  136.125 1.00 467.80 ? 683 SER A CA  1 
ATOM 5102  C C   . SER A 1 683 ? 133.571 93.530  134.866 1.00 480.80 ? 683 SER A C   1 
ATOM 5103  O O   . SER A 1 683 ? 133.104 92.526  134.297 1.00 484.78 ? 683 SER A O   1 
ATOM 5104  C CB  . SER A 1 683 ? 132.048 95.312  135.832 1.00 490.53 ? 683 SER A CB  1 
ATOM 5105  O OG  . SER A 1 683 ? 132.809 96.404  135.376 1.00 500.00 ? 683 SER A OG  1 
ATOM 5106  N N   . LEU A 1 684 ? 134.650 94.192  134.467 1.00 472.45 ? 684 LEU A N   1 
ATOM 5107  C CA  . LEU A 1 684 ? 135.419 93.812  133.280 1.00 474.55 ? 684 LEU A CA  1 
ATOM 5108  C C   . LEU A 1 684 ? 135.925 92.386  133.416 1.00 452.14 ? 684 LEU A C   1 
ATOM 5109  O O   . LEU A 1 684 ? 135.805 91.572  132.481 1.00 450.78 ? 684 LEU A O   1 
ATOM 5110  C CB  . LEU A 1 684 ? 136.571 94.780  133.025 1.00 500.00 ? 684 LEU A CB  1 
ATOM 5111  C CG  . LEU A 1 684 ? 136.088 96.141  132.523 1.00 500.00 ? 684 LEU A CG  1 
ATOM 5112  C CD1 . LEU A 1 684 ? 137.107 97.222  132.848 1.00 500.00 ? 684 LEU A CD1 1 
ATOM 5113  C CD2 . LEU A 1 684 ? 135.789 96.094  131.032 1.00 500.00 ? 684 LEU A CD2 1 
ATOM 5114  N N   . ILE A 1 685 ? 136.468 92.101  134.593 1.00 447.09 ? 685 ILE A N   1 
ATOM 5115  C CA  . ILE A 1 685 ? 137.015 90.785  134.920 1.00 458.52 ? 685 ILE A CA  1 
ATOM 5116  C C   . ILE A 1 685 ? 135.935 89.719  134.783 1.00 432.45 ? 685 ILE A C   1 
ATOM 5117  O O   . ILE A 1 685 ? 136.121 88.738  134.044 1.00 447.92 ? 685 ILE A O   1 
ATOM 5118  C CB  . ILE A 1 685 ? 137.703 90.759  136.314 1.00 500.00 ? 685 ILE A CB  1 
ATOM 5119  C CG1 . ILE A 1 685 ? 139.080 91.437  136.226 1.00 500.00 ? 685 ILE A CG1 1 
ATOM 5120  C CG2 . ILE A 1 685 ? 137.843 89.342  136.879 1.00 500.00 ? 685 ILE A CG2 1 
ATOM 5121  C CD1 . ILE A 1 685 ? 140.081 90.774  135.291 1.00 500.00 ? 685 ILE A CD1 1 
ATOM 5122  N N   . VAL A 1 686 ? 134.906 89.868  135.605 1.00 417.18 ? 686 VAL A N   1 
ATOM 5123  C CA  . VAL A 1 686 ? 133.862 88.844  135.768 1.00 463.68 ? 686 VAL A CA  1 
ATOM 5124  C C   . VAL A 1 686 ? 133.195 88.573  134.423 1.00 430.46 ? 686 VAL A C   1 
ATOM 5125  O O   . VAL A 1 686 ? 133.003 87.404  134.031 1.00 358.45 ? 686 VAL A O   1 
ATOM 5126  C CB  . VAL A 1 686 ? 132.818 89.301  136.825 1.00 500.00 ? 686 VAL A CB  1 
ATOM 5127  C CG1 . VAL A 1 686 ? 131.572 88.418  136.820 1.00 500.00 ? 686 VAL A CG1 1 
ATOM 5128  C CG2 . VAL A 1 686 ? 133.442 89.319  138.218 1.00 500.00 ? 686 VAL A CG2 1 
ATOM 5129  N N   . THR A 1 687 ? 132.861 89.676  133.747 1.00 413.10 ? 687 THR A N   1 
ATOM 5130  C CA  . THR A 1 687 ? 132.186 89.604  132.444 1.00 418.94 ? 687 THR A CA  1 
ATOM 5131  C C   . THR A 1 687 ? 133.060 88.846  131.448 1.00 400.14 ? 687 THR A C   1 
ATOM 5132  O O   . THR A 1 687 ? 132.563 87.979  130.713 1.00 402.99 ? 687 THR A O   1 
ATOM 5133  C CB  . THR A 1 687 ? 131.745 90.995  131.936 1.00 416.99 ? 687 THR A CB  1 
ATOM 5134  O OG1 . THR A 1 687 ? 131.084 91.707  132.989 1.00 399.56 ? 687 THR A OG1 1 
ATOM 5135  C CG2 . THR A 1 687 ? 130.776 90.859  130.779 1.00 454.06 ? 687 THR A CG2 1 
ATOM 5136  N N   . TYR A 1 688 ? 134.345 89.189  131.459 1.00 393.41 ? 688 TYR A N   1 
ATOM 5137  C CA  . TYR A 1 688 ? 135.334 88.564  130.574 1.00 403.79 ? 688 TYR A CA  1 
ATOM 5138  C C   . TYR A 1 688 ? 135.373 87.062  130.808 1.00 373.92 ? 688 TYR A C   1 
ATOM 5139  O O   . TYR A 1 688 ? 135.368 86.270  129.853 1.00 371.71 ? 688 TYR A O   1 
ATOM 5140  C CB  . TYR A 1 688 ? 136.742 89.161  130.733 1.00 459.84 ? 688 TYR A CB  1 
ATOM 5141  C CG  . TYR A 1 688 ? 137.621 89.069  129.492 1.00 500.00 ? 688 TYR A CG  1 
ATOM 5142  C CD1 . TYR A 1 688 ? 137.216 89.642  128.278 1.00 494.18 ? 688 TYR A CD1 1 
ATOM 5143  C CD2 . TYR A 1 688 ? 138.874 88.450  129.538 1.00 500.00 ? 688 TYR A CD2 1 
ATOM 5144  C CE1 . TYR A 1 688 ? 138.019 89.577  127.144 1.00 498.28 ? 688 TYR A CE1 1 
ATOM 5145  C CE2 . TYR A 1 688 ? 139.687 88.382  128.407 1.00 500.00 ? 688 TYR A CE2 1 
ATOM 5146  C CZ  . TYR A 1 688 ? 139.255 88.948  127.213 1.00 500.00 ? 688 TYR A CZ  1 
ATOM 5147  O OH  . TYR A 1 688 ? 140.057 88.880  126.093 1.00 498.83 ? 688 TYR A OH  1 
ATOM 5148  N N   . CYS A 1 689 ? 135.410 86.708  132.088 1.00 450.23 ? 689 CYS A N   1 
ATOM 5149  C CA  . CYS A 1 689 ? 135.452 85.307  132.520 1.00 500.00 ? 689 CYS A CA  1 
ATOM 5150  C C   . CYS A 1 689 ? 134.238 84.555  131.984 1.00 500.00 ? 689 CYS A C   1 
ATOM 5151  O O   . CYS A 1 689 ? 134.362 83.445  131.449 1.00 500.00 ? 689 CYS A O   1 
ATOM 5152  C CB  . CYS A 1 689 ? 135.608 85.143  134.046 1.00 500.00 ? 689 CYS A CB  1 
ATOM 5153  S SG  . CYS A 1 689 ? 137.293 84.689  134.563 1.00 500.00 ? 689 CYS A SG  1 
ATOM 5154  N N   . ILE A 1 690 ? 133.085 85.194  132.143 1.00 477.73 ? 690 ILE A N   1 
ATOM 5155  C CA  . ILE A 1 690 ? 131.802 84.645  131.695 1.00 493.84 ? 690 ILE A CA  1 
ATOM 5156  C C   . ILE A 1 690 ? 131.848 84.364  130.192 1.00 423.61 ? 690 ILE A C   1 
ATOM 5157  O O   . ILE A 1 690 ? 131.441 83.287  129.730 1.00 387.02 ? 690 ILE A O   1 
ATOM 5158  C CB  . ILE A 1 690 ? 130.631 85.605  132.050 1.00 500.00 ? 690 ILE A CB  1 
ATOM 5159  C CG1 . ILE A 1 690 ? 130.344 85.535  133.557 1.00 500.00 ? 690 ILE A CG1 1 
ATOM 5160  C CG2 . ILE A 1 690 ? 129.361 85.294  131.254 1.00 500.00 ? 690 ILE A CG2 1 
ATOM 5161  C CD1 . ILE A 1 690 ? 129.583 86.729  134.102 1.00 500.00 ? 690 ILE A CD1 1 
ATOM 5162  N N   . ASN A 1 691 ? 132.353 85.355  129.472 1.00 417.40 ? 691 ASN A N   1 
ATOM 5163  C CA  . ASN A 1 691 ? 132.485 85.290  128.014 1.00 500.00 ? 691 ASN A CA  1 
ATOM 5164  C C   . ASN A 1 691 ? 133.345 84.093  127.615 1.00 500.00 ? 691 ASN A C   1 
ATOM 5165  O O   . ASN A 1 691 ? 132.992 83.323  126.712 1.00 500.00 ? 691 ASN A O   1 
ATOM 5166  C CB  . ASN A 1 691 ? 133.083 86.581  127.444 1.00 500.00 ? 691 ASN A CB  1 
ATOM 5167  C CG  . ASN A 1 691 ? 132.955 86.668  125.929 1.00 500.00 ? 691 ASN A CG  1 
ATOM 5168  O OD1 . ASN A 1 691 ? 131.848 86.629  125.383 1.00 500.00 ? 691 ASN A OD1 1 
ATOM 5169  N ND2 . ASN A 1 691 ? 134.090 86.790  125.241 1.00 500.00 ? 691 ASN A ND2 1 
ATOM 5170  N N   . ALA A 1 692 ? 134.463 83.970  128.319 1.00 497.45 ? 692 ALA A N   1 
ATOM 5171  C CA  . ALA A 1 692 ? 135.425 82.885  128.102 1.00 500.00 ? 692 ALA A CA  1 
ATOM 5172  C C   . ALA A 1 692 ? 134.747 81.527  128.278 1.00 499.12 ? 692 ALA A C   1 
ATOM 5173  O O   . ALA A 1 692 ? 134.929 80.632  127.433 1.00 500.00 ? 692 ALA A O   1 
ATOM 5174  C CB  . ALA A 1 692 ? 136.628 83.014  129.035 1.00 491.17 ? 692 ALA A CB  1 
ATOM 5175  N N   . LYS A 1 693 ? 133.984 81.353  129.355 1.00 432.05 ? 693 LYS A N   1 
ATOM 5176  C CA  . LYS A 1 693 ? 133.413 80.039  129.682 1.00 435.22 ? 693 LYS A CA  1 
ATOM 5177  C C   . LYS A 1 693 ? 131.896 80.052  129.650 1.00 408.84 ? 693 LYS A C   1 
ATOM 5178  O O   . LYS A 1 693 ? 131.240 79.487  130.529 1.00 394.78 ? 693 LYS A O   1 
ATOM 5179  C CB  . LYS A 1 693 ? 133.935 79.567  131.047 1.00 500.00 ? 693 LYS A CB  1 
ATOM 5180  C CG  . LYS A 1 693 ? 135.444 79.342  131.123 1.00 500.00 ? 693 LYS A CG  1 
ATOM 5181  C CD  . LYS A 1 693 ? 135.989 78.474  129.989 1.00 500.00 ? 693 LYS A CD  1 
ATOM 5182  C CE  . LYS A 1 693 ? 137.220 77.673  130.401 1.00 500.00 ? 693 LYS A CE  1 
ATOM 5183  N NZ  . LYS A 1 693 ? 136.916 76.549  131.335 1.00 500.00 ? 693 LYS A NZ  1 
ATOM 5184  N N   . ALA A 1 694 ? 131.341 80.680  128.613 1.00 439.65 ? 694 ALA A N   1 
ATOM 5185  C CA  . ALA A 1 694 ? 129.888 80.753  128.440 1.00 500.00 ? 694 ALA A CA  1 
ATOM 5186  C C   . ALA A 1 694 ? 129.329 79.358  128.182 1.00 500.00 ? 694 ALA A C   1 
ATOM 5187  O O   . ALA A 1 694 ? 128.587 78.826  129.007 1.00 465.20 ? 694 ALA A O   1 
ATOM 5188  C CB  . ALA A 1 694 ? 129.519 81.710  127.312 1.00 500.00 ? 694 ALA A CB  1 
ATOM 5189  N N   . ASP A 1 695 ? 129.738 78.757  127.061 1.00 500.00 ? 695 ASP A N   1 
ATOM 5190  C CA  . ASP A 1 695 ? 129.396 77.363  126.712 1.00 500.00 ? 695 ASP A CA  1 
ATOM 5191  C C   . ASP A 1 695 ? 129.563 76.410  127.898 1.00 500.00 ? 695 ASP A C   1 
ATOM 5192  O O   . ASP A 1 695 ? 128.734 75.523  128.116 1.00 500.00 ? 695 ASP A O   1 
ATOM 5193  C CB  . ASP A 1 695 ? 130.274 76.856  125.546 1.00 500.00 ? 695 ASP A CB  1 
ATOM 5194  C CG  . ASP A 1 695 ? 129.823 77.377  124.178 1.00 500.00 ? 695 ASP A CG  1 
ATOM 5195  O OD1 . ASP A 1 695 ? 129.145 78.427  124.110 1.00 500.00 ? 695 ASP A OD1 1 
ATOM 5196  O OD2 . ASP A 1 695 ? 130.163 76.727  123.163 1.00 500.00 ? 695 ASP A OD2 1 
ATOM 5197  N N   . VAL A 1 696 ? 130.643 76.613  128.647 1.00 500.00 ? 696 VAL A N   1 
ATOM 5198  C CA  . VAL A 1 696 ? 130.952 75.805  129.821 1.00 500.00 ? 696 VAL A CA  1 
ATOM 5199  C C   . VAL A 1 696 ? 129.847 75.896  130.874 1.00 500.00 ? 696 VAL A C   1 
ATOM 5200  O O   . VAL A 1 696 ? 129.328 74.867  131.312 1.00 500.00 ? 696 VAL A O   1 
ATOM 5201  C CB  . VAL A 1 696 ? 132.327 76.210  130.410 1.00 500.00 ? 696 VAL A CB  1 
ATOM 5202  C CG1 . VAL A 1 696 ? 132.588 75.546  131.765 1.00 500.00 ? 696 VAL A CG1 1 
ATOM 5203  C CG2 . VAL A 1 696 ? 133.435 75.888  129.409 1.00 500.00 ? 696 VAL A CG2 1 
ATOM 5204  N N   . LEU A 1 697 ? 129.467 77.114  131.251 1.00 482.14 ? 697 LEU A N   1 
ATOM 5205  C CA  . LEU A 1 697 ? 128.549 77.318  132.386 1.00 473.82 ? 697 LEU A CA  1 
ATOM 5206  C C   . LEU A 1 697 ? 127.050 77.143  132.089 1.00 433.37 ? 697 LEU A C   1 
ATOM 5207  O O   . LEU A 1 697 ? 126.231 77.282  133.011 1.00 324.27 ? 697 LEU A O   1 
ATOM 5208  C CB  . LEU A 1 697 ? 128.813 78.681  133.038 1.00 500.00 ? 697 LEU A CB  1 
ATOM 5209  C CG  . LEU A 1 697 ? 130.145 78.761  133.796 1.00 500.00 ? 697 LEU A CG  1 
ATOM 5210  C CD1 . LEU A 1 697 ? 130.507 80.212  134.086 1.00 500.00 ? 697 LEU A CD1 1 
ATOM 5211  C CD2 . LEU A 1 697 ? 130.117 77.943  135.086 1.00 500.00 ? 697 LEU A CD2 1 
ATOM 5212  N N   . PHE A 1 698 ? 126.699 76.827  130.835 1.00 458.67 ? 698 PHE A N   1 
ATOM 5213  C CA  . PHE A 1 698 ? 125.312 76.523  130.437 1.00 488.14 ? 698 PHE A CA  1 
ATOM 5214  C C   . PHE A 1 698 ? 125.244 75.235  129.607 1.00 433.51 ? 698 PHE A C   1 
ATOM 5215  O O   . PHE A 1 698 ? 124.464 74.324  129.901 1.00 358.58 ? 698 PHE A O   1 
ATOM 5216  C CB  . PHE A 1 698 ? 124.704 77.690  129.638 1.00 500.00 ? 698 PHE A CB  1 
ATOM 5217  C CG  . PHE A 1 698 ? 125.124 79.056  130.129 1.00 500.00 ? 698 PHE A CG  1 
ATOM 5218  C CD1 . PHE A 1 698 ? 124.731 79.512  131.381 1.00 495.93 ? 698 PHE A CD1 1 
ATOM 5219  C CD2 . PHE A 1 698 ? 125.914 79.884  129.337 1.00 500.00 ? 698 PHE A CD2 1 
ATOM 5220  C CE1 . PHE A 1 698 ? 125.122 80.763  131.836 1.00 479.79 ? 698 PHE A CE1 1 
ATOM 5221  C CE2 . PHE A 1 698 ? 126.310 81.135  129.787 1.00 470.49 ? 698 PHE A CE2 1 
ATOM 5222  C CZ  . PHE A 1 698 ? 125.911 81.576  131.038 1.00 461.69 ? 698 PHE A CZ  1 
ATOM 5223  N N   . GLY B 2 78  ? 121.944 91.447  106.097 1.00 500.00 ? 78  GLY B N   1 
ATOM 5224  C CA  . GLY B 2 78  ? 122.233 91.238  107.550 1.00 500.00 ? 78  GLY B CA  1 
ATOM 5225  C C   . GLY B 2 78  ? 122.075 92.475  108.434 1.00 500.00 ? 78  GLY B C   1 
ATOM 5226  O O   . GLY B 2 78  ? 121.395 93.437  108.064 1.00 500.00 ? 78  GLY B O   1 
ATOM 5227  N N   . ALA B 2 79  ? 122.704 92.419  109.612 1.00 500.00 ? 79  ALA B N   1 
ATOM 5228  C CA  . ALA B 2 79  ? 122.704 93.491  110.600 1.00 439.92 ? 79  ALA B CA  1 
ATOM 5229  C C   . ALA B 2 79  ? 123.930 94.357  110.498 1.00 352.11 ? 79  ALA B C   1 
ATOM 5230  O O   . ALA B 2 79  ? 123.818 95.530  110.769 1.00 290.83 ? 79  ALA B O   1 
ATOM 5231  C CB  . ALA B 2 79  ? 122.581 92.917  112.005 1.00 446.64 ? 79  ALA B CB  1 
ATOM 5232  N N   . LYS B 2 80  ? 125.063 93.784  110.066 1.00 339.10 ? 80  LYS B N   1 
ATOM 5233  C CA  . LYS B 2 80  ? 126.329 94.470  109.977 1.00 364.27 ? 80  LYS B CA  1 
ATOM 5234  C C   . LYS B 2 80  ? 126.221 95.797  109.242 1.00 332.14 ? 80  LYS B C   1 
ATOM 5235  O O   . LYS B 2 80  ? 126.778 96.794  109.682 1.00 278.17 ? 80  LYS B O   1 
ATOM 5236  C CB  . LYS B 2 80  ? 127.395 93.583  109.305 1.00 425.40 ? 80  LYS B CB  1 
ATOM 5237  C CG  . LYS B 2 80  ? 128.817 94.142  109.387 1.00 477.93 ? 80  LYS B CG  1 
ATOM 5238  C CD  . LYS B 2 80  ? 129.882 93.095  109.060 1.00 491.52 ? 80  LYS B CD  1 
ATOM 5239  C CE  . LYS B 2 80  ? 130.248 92.217  110.256 1.00 469.85 ? 80  LYS B CE  1 
ATOM 5240  N NZ  . LYS B 2 80  ? 131.276 92.829  111.148 1.00 432.97 ? 80  LYS B NZ  1 
ATOM 5241  N N   . HIS B 2 81  ? 125.443 95.772  108.163 1.00 382.89 ? 81  HIS B N   1 
ATOM 5242  C CA  . HIS B 2 81  ? 125.159 96.958  107.352 1.00 432.43 ? 81  HIS B CA  1 
ATOM 5243  C C   . HIS B 2 81  ? 124.528 98.045  108.225 1.00 406.07 ? 81  HIS B C   1 
ATOM 5244  O O   . HIS B 2 81  ? 124.932 99.222  108.188 1.00 411.13 ? 81  HIS B O   1 
ATOM 5245  C CB  . HIS B 2 81  ? 124.156 96.651  106.214 1.00 495.39 ? 81  HIS B CB  1 
ATOM 5246  C CG  . HIS B 2 81  ? 124.548 95.517  105.310 1.00 500.00 ? 81  HIS B CG  1 
ATOM 5247  N ND1 . HIS B 2 81  ? 123.945 94.276  105.371 1.00 500.00 ? 81  HIS B ND1 1 
ATOM 5248  C CD2 . HIS B 2 81  ? 125.450 95.445  104.302 1.00 500.00 ? 81  HIS B CD2 1 
ATOM 5249  C CE1 . HIS B 2 81  ? 124.471 93.485  104.455 1.00 500.00 ? 81  HIS B CE1 1 
ATOM 5250  N NE2 . HIS B 2 81  ? 125.386 94.169  103.791 1.00 500.00 ? 81  HIS B NE2 1 
ATOM 5251  N N   . VAL B 2 82  ? 123.543 97.603  109.012 1.00 390.21 ? 82  VAL B N   1 
ATOM 5252  C CA  . VAL B 2 82  ? 122.780 98.494  109.887 1.00 390.11 ? 82  VAL B CA  1 
ATOM 5253  C C   . VAL B 2 82  ? 123.745 99.123  110.901 1.00 334.50 ? 82  VAL B C   1 
ATOM 5254  O O   . VAL B 2 82  ? 123.700 100.349 111.142 1.00 313.04 ? 82  VAL B O   1 
ATOM 5255  C CB  . VAL B 2 82  ? 121.666 97.777  110.703 1.00 447.45 ? 82  VAL B CB  1 
ATOM 5256  C CG1 . VAL B 2 82  ? 120.841 98.802  111.491 1.00 446.26 ? 82  VAL B CG1 1 
ATOM 5257  C CG2 . VAL B 2 82  ? 120.776 96.888  109.820 1.00 491.30 ? 82  VAL B CG2 1 
ATOM 5258  N N   . ILE B 2 83  ? 124.547 98.249  111.520 1.00 340.99 ? 83  ILE B N   1 
ATOM 5259  C CA  . ILE B 2 83  ? 125.384 98.756  112.635 1.00 329.63 ? 83  ILE B CA  1 
ATOM 5260  C C   . ILE B 2 83  ? 126.425 99.720  112.090 1.00 335.49 ? 83  ILE B C   1 
ATOM 5261  O O   . ILE B 2 83  ? 126.673 100.735 112.734 1.00 318.93 ? 83  ILE B O   1 
ATOM 5262  C CB  . ILE B 2 83  ? 126.063 97.698  113.545 1.00 390.53 ? 83  ILE B CB  1 
ATOM 5263  C CG1 . ILE B 2 83  ? 126.227 98.300  114.961 1.00 405.81 ? 83  ILE B CG1 1 
ATOM 5264  C CG2 . ILE B 2 83  ? 127.400 97.206  112.969 1.00 416.05 ? 83  ILE B CG2 1 
ATOM 5265  C CD1 . ILE B 2 83  ? 127.295 97.677  115.840 1.00 459.95 ? 83  ILE B CD1 1 
ATOM 5266  N N   . MET B 2 84  ? 126.975 99.430  110.917 1.00 386.34 ? 84  MET B N   1 
ATOM 5267  C CA  . MET B 2 84  ? 127.958 100.355 110.344 1.00 386.62 ? 84  MET B CA  1 
ATOM 5268  C C   . MET B 2 84  ? 127.320 101.684 110.013 1.00 368.27 ? 84  MET B C   1 
ATOM 5269  O O   . MET B 2 84  ? 127.942 102.713 110.282 1.00 353.94 ? 84  MET B O   1 
ATOM 5270  C CB  . MET B 2 84  ? 128.726 99.724  109.174 1.00 440.62 ? 84  MET B CB  1 
ATOM 5271  C CG  . MET B 2 84  ? 129.634 98.581  109.645 1.00 482.95 ? 84  MET B CG  1 
ATOM 5272  S SD  . MET B 2 84  ? 130.933 98.045  108.516 1.00 500.00 ? 84  MET B SD  1 
ATOM 5273  C CE  . MET B 2 84  ? 132.216 99.249  108.858 1.00 500.00 ? 84  MET B CE  1 
ATOM 5274  N N   . LEU B 2 85  ? 126.090 101.647 109.506 1.00 427.11 ? 85  LEU B N   1 
ATOM 5275  C CA  . LEU B 2 85  ? 125.328 102.868 109.218 1.00 443.14 ? 85  LEU B CA  1 
ATOM 5276  C C   . LEU B 2 85  ? 125.164 103.705 110.485 1.00 363.91 ? 85  LEU B C   1 
ATOM 5277  O O   . LEU B 2 85  ? 125.375 104.923 110.475 1.00 281.50 ? 85  LEU B O   1 
ATOM 5278  C CB  . LEU B 2 85  ? 123.974 102.583 108.544 1.00 500.00 ? 85  LEU B CB  1 
ATOM 5279  C CG  . LEU B 2 85  ? 123.497 103.712 107.603 1.00 500.00 ? 85  LEU B CG  1 
ATOM 5280  C CD1 . LEU B 2 85  ? 122.424 103.240 106.627 1.00 500.00 ? 85  LEU B CD1 1 
ATOM 5281  C CD2 . LEU B 2 85  ? 123.013 104.943 108.366 1.00 500.00 ? 85  LEU B CD2 1 
ATOM 5282  N N   . PHE B 2 86  ? 124.795 103.009 111.549 1.00 384.20 ? 86  PHE B N   1 
ATOM 5283  C CA  . PHE B 2 86  ? 124.605 103.618 112.873 1.00 415.14 ? 86  PHE B CA  1 
ATOM 5284  C C   . PHE B 2 86  ? 125.859 104.324 113.332 1.00 372.88 ? 86  PHE B C   1 
ATOM 5285  O O   . PHE B 2 86  ? 125.764 105.487 113.799 1.00 338.19 ? 86  PHE B O   1 
ATOM 5286  C CB  . PHE B 2 86  ? 124.343 102.564 113.972 1.00 464.90 ? 86  PHE B CB  1 
ATOM 5287  C CG  . PHE B 2 86  ? 122.901 102.259 114.228 1.00 500.00 ? 86  PHE B CG  1 
ATOM 5288  C CD1 . PHE B 2 86  ? 121.985 103.277 114.425 1.00 500.00 ? 86  PHE B CD1 1 
ATOM 5289  C CD2 . PHE B 2 86  ? 122.469 100.937 114.343 1.00 500.00 ? 86  PHE B CD2 1 
ATOM 5290  C CE1 . PHE B 2 86  ? 120.661 102.988 114.677 1.00 500.00 ? 86  PHE B CE1 1 
ATOM 5291  C CE2 . PHE B 2 86  ? 121.140 100.643 114.605 1.00 500.00 ? 86  PHE B CE2 1 
ATOM 5292  C CZ  . PHE B 2 86  ? 120.232 101.672 114.772 1.00 500.00 ? 86  PHE B CZ  1 
ATOM 5293  N N   . VAL B 2 87  ? 126.995 103.622 113.368 1.00 369.12 ? 87  VAL B N   1 
ATOM 5294  C CA  . VAL B 2 87  ? 128.110 103.971 114.288 1.00 346.19 ? 87  VAL B CA  1 
ATOM 5295  C C   . VAL B 2 87  ? 128.572 105.384 113.991 1.00 298.03 ? 87  VAL B C   1 
ATOM 5296  O O   . VAL B 2 87  ? 128.774 106.175 114.931 1.00 359.09 ? 87  VAL B O   1 
ATOM 5297  C CB  . VAL B 2 87  ? 129.274 102.930 114.233 1.00 428.52 ? 87  VAL B CB  1 
ATOM 5298  C CG1 . VAL B 2 87  ? 130.537 103.447 114.921 1.00 452.52 ? 87  VAL B CG1 1 
ATOM 5299  C CG2 . VAL B 2 87  ? 128.834 101.600 114.845 1.00 475.63 ? 87  VAL B CG2 1 
ATOM 5300  N N   . PRO B 2 88  ? 128.735 105.679 112.684 1.00 372.79 ? 88  PRO B N   1 
ATOM 5301  C CA  . PRO B 2 88  ? 129.197 107.006 112.274 1.00 354.97 ? 88  PRO B CA  1 
ATOM 5302  C C   . PRO B 2 88  ? 128.240 108.075 112.730 1.00 301.81 ? 88  PRO B C   1 
ATOM 5303  O O   . PRO B 2 88  ? 128.671 109.118 113.252 1.00 314.28 ? 88  PRO B O   1 
ATOM 5304  C CB  . PRO B 2 88  ? 129.171 106.945 110.756 1.00 414.94 ? 88  PRO B CB  1 
ATOM 5305  C CG  . PRO B 2 88  ? 129.429 105.532 110.455 1.00 478.90 ? 88  PRO B CG  1 
ATOM 5306  C CD  . PRO B 2 88  ? 128.656 104.804 111.508 1.00 448.99 ? 88  PRO B CD  1 
ATOM 5307  N N   . VAL B 2 89  ? 126.951 107.790 112.542 1.00 307.56 ? 89  VAL B N   1 
ATOM 5308  C CA  . VAL B 2 89  ? 125.873 108.715 112.943 1.00 358.97 ? 89  VAL B CA  1 
ATOM 5309  C C   . VAL B 2 89  ? 125.963 109.002 114.431 1.00 329.30 ? 89  VAL B C   1 
ATOM 5310  O O   . VAL B 2 89  ? 125.870 110.160 114.858 1.00 273.43 ? 89  VAL B O   1 
ATOM 5311  C CB  . VAL B 2 89  ? 124.463 108.144 112.647 1.00 403.25 ? 89  VAL B CB  1 
ATOM 5312  C CG1 . VAL B 2 89  ? 123.362 108.921 113.379 1.00 391.89 ? 89  VAL B CG1 1 
ATOM 5313  C CG2 . VAL B 2 89  ? 124.205 108.119 111.145 1.00 449.71 ? 89  VAL B CG2 1 
ATOM 5314  N N   . THR B 2 90  ? 126.136 107.930 115.190 1.00 369.29 ? 90  THR B N   1 
ATOM 5315  C CA  . THR B 2 90  ? 126.240 107.978 116.650 1.00 395.39 ? 90  THR B CA  1 
ATOM 5316  C C   . THR B 2 90  ? 127.392 108.904 117.054 1.00 337.44 ? 90  THR B C   1 
ATOM 5317  O O   . THR B 2 90  ? 127.245 109.774 117.931 1.00 348.26 ? 90  THR B O   1 
ATOM 5318  C CB  . THR B 2 90  ? 126.568 106.556 117.193 1.00 465.65 ? 90  THR B CB  1 
ATOM 5319  O OG1 . THR B 2 90  ? 125.451 105.678 116.988 1.00 480.87 ? 90  THR B OG1 1 
ATOM 5320  C CG2 . THR B 2 90  ? 126.989 106.561 118.681 1.00 494.92 ? 90  THR B CG2 1 
ATOM 5321  N N   . LEU B 2 91  ? 128.523 108.675 116.392 1.00 326.12 ? 91  LEU B N   1 
ATOM 5322  C CA  . LEU B 2 91  ? 129.749 109.436 116.642 1.00 309.69 ? 91  LEU B CA  1 
ATOM 5323  C C   . LEU B 2 91  ? 129.501 110.923 116.398 1.00 311.65 ? 91  LEU B C   1 
ATOM 5324  O O   . LEU B 2 91  ? 129.893 111.772 117.217 1.00 343.53 ? 91  LEU B O   1 
ATOM 5325  C CB  . LEU B 2 91  ? 130.971 108.881 115.882 1.00 371.45 ? 91  LEU B CB  1 
ATOM 5326  C CG  . LEU B 2 91  ? 132.313 108.908 116.662 1.00 427.85 ? 91  LEU B CG  1 
ATOM 5327  C CD1 . LEU B 2 91  ? 132.880 107.514 116.919 1.00 438.20 ? 91  LEU B CD1 1 
ATOM 5328  C CD2 . LEU B 2 91  ? 133.370 109.785 116.001 1.00 450.14 ? 91  LEU B CD2 1 
ATOM 5329  N N   . CYS B 2 92  ? 128.845 111.194 115.280 1.00 301.91 ? 92  CYS B N   1 
ATOM 5330  C CA  . CYS B 2 92  ? 128.504 112.561 114.868 1.00 342.30 ? 92  CYS B CA  1 
ATOM 5331  C C   . CYS B 2 92  ? 127.666 113.239 115.938 1.00 327.11 ? 92  CYS B C   1 
ATOM 5332  O O   . CYS B 2 92  ? 127.928 114.392 116.325 1.00 310.20 ? 92  CYS B O   1 
ATOM 5333  C CB  . CYS B 2 92  ? 127.735 112.552 113.551 1.00 395.87 ? 92  CYS B CB  1 
ATOM 5334  S SG  . CYS B 2 92  ? 126.138 113.401 113.582 1.00 445.17 ? 92  CYS B SG  1 
ATOM 5335  N N   . MET B 2 93  ? 126.669 112.495 116.397 1.00 358.61 ? 93  MET B N   1 
ATOM 5336  C CA  . MET B 2 93  ? 125.733 112.962 117.428 1.00 373.48 ? 93  MET B CA  1 
ATOM 5337  C C   . MET B 2 93  ? 126.499 113.337 118.688 1.00 324.44 ? 93  MET B C   1 
ATOM 5338  O O   . MET B 2 93  ? 126.266 114.400 119.283 1.00 274.07 ? 93  MET B O   1 
ATOM 5339  C CB  . MET B 2 93  ? 124.690 111.877 117.715 1.00 396.02 ? 93  MET B CB  1 
ATOM 5340  C CG  . MET B 2 93  ? 123.795 111.501 116.535 1.00 396.13 ? 93  MET B CG  1 
ATOM 5341  S SD  . MET B 2 93  ? 122.321 112.508 116.349 1.00 461.99 ? 93  MET B SD  1 
ATOM 5342  C CE  . MET B 2 93  ? 121.385 111.944 117.764 1.00 497.41 ? 93  MET B CE  1 
ATOM 5343  N N   . VAL B 2 94  ? 127.403 112.444 119.068 1.00 339.30 ? 94  VAL B N   1 
ATOM 5344  C CA  . VAL B 2 94  ? 128.241 112.615 120.262 1.00 373.27 ? 94  VAL B CA  1 
ATOM 5345  C C   . VAL B 2 94  ? 129.048 113.899 120.149 1.00 304.23 ? 94  VAL B C   1 
ATOM 5346  O O   . VAL B 2 94  ? 129.118 114.688 121.099 1.00 348.99 ? 94  VAL B O   1 
ATOM 5347  C CB  . VAL B 2 94  ? 129.134 111.377 120.545 1.00 493.25 ? 94  VAL B CB  1 
ATOM 5348  C CG1 . VAL B 2 94  ? 130.199 111.675 121.602 1.00 500.00 ? 94  VAL B CG1 1 
ATOM 5349  C CG2 . VAL B 2 94  ? 128.276 110.192 120.986 1.00 500.00 ? 94  VAL B CG2 1 
ATOM 5350  N N   . VAL B 2 95  ? 129.643 114.076 118.976 1.00 277.46 ? 95  VAL B N   1 
ATOM 5351  C CA  . VAL B 2 95  ? 130.474 115.242 118.670 1.00 353.78 ? 95  VAL B CA  1 
ATOM 5352  C C   . VAL B 2 95  ? 129.653 116.520 118.844 1.00 382.59 ? 95  VAL B C   1 
ATOM 5353  O O   . VAL B 2 95  ? 130.114 117.497 119.488 1.00 383.82 ? 95  VAL B O   1 
ATOM 5354  C CB  . VAL B 2 95  ? 131.077 115.160 117.253 1.00 423.98 ? 95  VAL B CB  1 
ATOM 5355  C CG1 . VAL B 2 95  ? 131.671 116.499 116.817 1.00 476.56 ? 95  VAL B CG1 1 
ATOM 5356  C CG2 . VAL B 2 95  ? 132.129 114.059 117.197 1.00 455.00 ? 95  VAL B CG2 1 
ATOM 5357  N N   . VAL B 2 96  ? 128.448 116.479 118.283 1.00 392.84 ? 96  VAL B N   1 
ATOM 5358  C CA  . VAL B 2 96  ? 127.544 117.627 118.307 1.00 392.70 ? 96  VAL B CA  1 
ATOM 5359  C C   . VAL B 2 96  ? 127.204 117.964 119.777 1.00 355.04 ? 96  VAL B C   1 
ATOM 5360  O O   . VAL B 2 96  ? 127.219 119.124 120.194 1.00 366.04 ? 96  VAL B O   1 
ATOM 5361  C CB  . VAL B 2 96  ? 126.302 117.399 117.427 1.00 429.55 ? 96  VAL B CB  1 
ATOM 5362  C CG1 . VAL B 2 96  ? 125.190 118.392 117.761 1.00 422.78 ? 96  VAL B CG1 1 
ATOM 5363  C CG2 . VAL B 2 96  ? 126.717 117.508 115.962 1.00 455.46 ? 96  VAL B CG2 1 
ATOM 5364  N N   . VAL B 2 97  ? 126.928 116.928 120.548 1.00 314.79 ? 97  VAL B N   1 
ATOM 5365  C CA  . VAL B 2 97  ? 126.276 117.004 121.824 1.00 339.36 ? 97  VAL B CA  1 
ATOM 5366  C C   . VAL B 2 97  ? 127.293 117.565 122.800 1.00 336.93 ? 97  VAL B C   1 
ATOM 5367  O O   . VAL B 2 97  ? 127.029 118.530 123.534 1.00 378.09 ? 97  VAL B O   1 
ATOM 5368  C CB  . VAL B 2 97  ? 125.810 115.603 122.298 1.00 398.09 ? 97  VAL B CB  1 
ATOM 5369  C CG1 . VAL B 2 97  ? 125.600 115.543 123.813 1.00 433.08 ? 97  VAL B CG1 1 
ATOM 5370  C CG2 . VAL B 2 97  ? 124.535 115.199 121.569 1.00 432.24 ? 97  VAL B CG2 1 
ATOM 5371  N N   . ALA B 2 98  ? 128.411 116.847 122.889 1.00 324.00 ? 98  ALA B N   1 
ATOM 5372  C CA  . ALA B 2 98  ? 129.474 117.113 123.858 1.00 419.75 ? 98  ALA B CA  1 
ATOM 5373  C C   . ALA B 2 98  ? 129.984 118.527 123.677 1.00 420.74 ? 98  ALA B C   1 
ATOM 5374  O O   . ALA B 2 98  ? 130.147 119.249 124.675 1.00 466.37 ? 98  ALA B O   1 
ATOM 5375  C CB  . ALA B 2 98  ? 130.610 116.112 123.692 1.00 440.58 ? 98  ALA B CB  1 
ATOM 5376  N N   . THR B 2 99  ? 130.221 118.894 122.409 1.00 338.72 ? 99  THR B N   1 
ATOM 5377  C CA  . THR B 2 99  ? 130.737 120.223 122.081 1.00 360.16 ? 99  THR B CA  1 
ATOM 5378  C C   . THR B 2 99  ? 129.771 121.300 122.572 1.00 355.21 ? 99  THR B C   1 
ATOM 5379  O O   . THR B 2 99  ? 130.193 122.297 123.180 1.00 382.71 ? 99  THR B O   1 
ATOM 5380  C CB  . THR B 2 99  ? 131.142 120.391 120.610 1.00 378.31 ? 99  THR B CB  1 
ATOM 5381  O OG1 . THR B 2 99  ? 131.893 121.604 120.473 1.00 408.42 ? 99  THR B OG1 1 
ATOM 5382  C CG2 . THR B 2 99  ? 129.954 120.439 119.706 1.00 362.33 ? 99  THR B CG2 1 
ATOM 5383  N N   . ILE B 2 100 ? 128.490 121.055 122.305 1.00 327.24 ? 100 ILE B N   1 
ATOM 5384  C CA  . ILE B 2 100 ? 127.421 121.979 122.704 1.00 345.52 ? 100 ILE B CA  1 
ATOM 5385  C C   . ILE B 2 100 ? 127.426 122.167 124.216 1.00 386.46 ? 100 ILE B C   1 
ATOM 5386  O O   . ILE B 2 100 ? 127.335 123.302 124.711 1.00 406.34 ? 100 ILE B O   1 
ATOM 5387  C CB  . ILE B 2 100 ? 126.027 121.557 122.216 1.00 377.24 ? 100 ILE B CB  1 
ATOM 5388  C CG1 . ILE B 2 100 ? 125.906 121.876 120.734 1.00 449.48 ? 100 ILE B CG1 1 
ATOM 5389  C CG2 . ILE B 2 100 ? 124.912 122.295 122.959 1.00 356.21 ? 100 ILE B CG2 1 
ATOM 5390  C CD1 . ILE B 2 100 ? 124.831 121.081 120.038 1.00 500.00 ? 100 ILE B CD1 1 
ATOM 5391  N N   . LYS B 2 101 ? 127.542 121.041 124.911 1.00 389.52 ? 101 LYS B N   1 
ATOM 5392  C CA  . LYS B 2 101 ? 127.556 121.015 126.372 1.00 395.99 ? 101 LYS B CA  1 
ATOM 5393  C C   . LYS B 2 101 ? 128.707 121.856 126.898 1.00 393.16 ? 101 LYS B C   1 
ATOM 5394  O O   . LYS B 2 101 ? 128.510 122.673 127.833 1.00 420.11 ? 101 LYS B O   1 
ATOM 5395  C CB  . LYS B 2 101 ? 127.579 119.590 126.939 1.00 411.08 ? 101 LYS B CB  1 
ATOM 5396  C CG  . LYS B 2 101 ? 126.255 118.828 126.812 1.00 444.33 ? 101 LYS B CG  1 
ATOM 5397  C CD  . LYS B 2 101 ? 125.061 119.463 127.528 1.00 483.06 ? 101 LYS B CD  1 
ATOM 5398  C CE  . LYS B 2 101 ? 125.294 119.692 129.017 1.00 500.00 ? 101 LYS B CE  1 
ATOM 5399  N NZ  . LYS B 2 101 ? 124.042 120.064 129.738 1.00 500.00 ? 101 LYS B NZ  1 
ATOM 5400  N N   . SER B 2 102 ? 129.877 121.666 126.278 1.00 349.37 ? 102 SER B N   1 
ATOM 5401  C CA  . SER B 2 102 ? 131.138 122.160 126.909 1.00 367.16 ? 102 SER B CA  1 
ATOM 5402  C C   . SER B 2 102 ? 131.479 123.559 126.430 1.00 379.71 ? 102 SER B C   1 
ATOM 5403  O O   . SER B 2 102 ? 131.788 124.427 127.236 1.00 442.34 ? 102 SER B O   1 
ATOM 5404  C CB  . SER B 2 102 ? 132.289 121.174 126.694 1.00 353.90 ? 102 SER B CB  1 
ATOM 5405  O OG  . SER B 2 102 ? 132.723 121.164 125.345 1.00 420.93 ? 102 SER B OG  1 
ATOM 5406  N N   . VAL B 2 103 ? 131.381 123.768 125.114 1.00 345.77 ? 103 VAL B N   1 
ATOM 5407  C CA  . VAL B 2 103 ? 131.623 125.078 124.513 1.00 390.74 ? 103 VAL B CA  1 
ATOM 5408  C C   . VAL B 2 103 ? 130.475 125.998 124.889 1.00 416.21 ? 103 VAL B C   1 
ATOM 5409  O O   . VAL B 2 103 ? 129.312 125.586 124.874 1.00 426.72 ? 103 VAL B O   1 
ATOM 5410  C CB  . VAL B 2 103 ? 131.776 125.035 122.970 1.00 408.74 ? 103 VAL B CB  1 
ATOM 5411  C CG1 . VAL B 2 103 ? 131.959 126.441 122.394 1.00 416.02 ? 103 VAL B CG1 1 
ATOM 5412  C CG2 . VAL B 2 103 ? 132.948 124.143 122.571 1.00 409.20 ? 103 VAL B CG2 1 
ATOM 5413  N N   . SER B 2 104 ? 130.821 127.237 125.242 1.00 437.68 ? 104 SER B N   1 
ATOM 5414  C CA  . SER B 2 104 ? 129.841 128.282 125.502 1.00 447.33 ? 104 SER B CA  1 
ATOM 5415  C C   . SER B 2 104 ? 129.323 128.731 124.146 1.00 376.22 ? 104 SER B C   1 
ATOM 5416  O O   . SER B 2 104 ? 129.017 127.892 123.304 1.00 295.11 ? 104 SER B O   1 
ATOM 5417  C CB  . SER B 2 104 ? 130.481 129.433 126.283 1.00 500.00 ? 104 SER B CB  1 
ATOM 5418  O OG  . SER B 2 104 ? 129.524 130.436 126.588 1.00 500.00 ? 104 SER B OG  1 
ATOM 5419  N N   . PHE B 2 105 ? 129.203 130.035 123.918 1.00 412.06 ? 105 PHE B N   1 
ATOM 5420  C CA  . PHE B 2 105 ? 129.000 130.555 122.574 1.00 423.92 ? 105 PHE B CA  1 
ATOM 5421  C C   . PHE B 2 105 ? 127.778 129.931 121.901 1.00 409.44 ? 105 PHE B C   1 
ATOM 5422  O O   . PHE B 2 105 ? 126.743 130.578 121.776 1.00 406.69 ? 105 PHE B O   1 
ATOM 5423  C CB  . PHE B 2 105 ? 130.272 130.331 121.747 1.00 400.34 ? 105 PHE B CB  1 
ATOM 5424  C CG  . PHE B 2 105 ? 130.096 130.563 120.279 1.00 377.97 ? 105 PHE B CG  1 
ATOM 5425  C CD1 . PHE B 2 105 ? 130.160 131.853 119.759 1.00 394.47 ? 105 PHE B CD1 1 
ATOM 5426  C CD2 . PHE B 2 105 ? 129.894 129.493 119.410 1.00 295.63 ? 105 PHE B CD2 1 
ATOM 5427  C CE1 . PHE B 2 105 ? 130.019 132.076 118.401 1.00 411.39 ? 105 PHE B CE1 1 
ATOM 5428  C CE2 . PHE B 2 105 ? 129.752 129.713 118.047 1.00 397.64 ? 105 PHE B CE2 1 
ATOM 5429  C CZ  . PHE B 2 105 ? 129.825 131.006 117.540 1.00 415.39 ? 105 PHE B CZ  1 
ATOM 5430  N N   . TYR B 2 106 ? 127.911 128.664 121.502 1.00 385.01 ? 106 TYR B N   1 
ATOM 5431  C CA  . TYR B 2 106 ? 126.891 127.948 120.751 1.00 405.76 ? 106 TYR B CA  1 
ATOM 5432  C C   . TYR B 2 106 ? 125.473 128.115 121.309 1.00 386.40 ? 106 TYR B C   1 
ATOM 5433  O O   . TYR B 2 106 ? 124.509 128.170 120.539 1.00 390.98 ? 106 TYR B O   1 
ATOM 5434  C CB  . TYR B 2 106 ? 127.273 126.462 120.591 1.00 420.37 ? 106 TYR B CB  1 
ATOM 5435  C CG  . TYR B 2 106 ? 128.346 126.229 119.539 1.00 403.25 ? 106 TYR B CG  1 
ATOM 5436  C CD1 . TYR B 2 106 ? 128.085 126.472 118.189 1.00 436.43 ? 106 TYR B CD1 1 
ATOM 5437  C CD2 . TYR B 2 106 ? 129.617 125.775 119.886 1.00 390.31 ? 106 TYR B CD2 1 
ATOM 5438  C CE1 . TYR B 2 106 ? 129.055 126.267 117.214 1.00 443.17 ? 106 TYR B CE1 1 
ATOM 5439  C CE2 . TYR B 2 106 ? 130.597 125.565 118.917 1.00 410.19 ? 106 TYR B CE2 1 
ATOM 5440  C CZ  . TYR B 2 106 ? 130.311 125.814 117.579 1.00 425.61 ? 106 TYR B CZ  1 
ATOM 5441  O OH  . TYR B 2 106 ? 131.256 125.619 116.592 1.00 372.28 ? 106 TYR B OH  1 
ATOM 5442  N N   . THR B 2 107 ? 125.381 128.147 122.633 1.00 332.74 ? 107 THR B N   1 
ATOM 5443  C CA  . THR B 2 107 ? 124.123 128.311 123.347 1.00 416.33 ? 107 THR B CA  1 
ATOM 5444  C C   . THR B 2 107 ? 123.468 129.674 123.141 1.00 434.41 ? 107 THR B C   1 
ATOM 5445  O O   . THR B 2 107 ? 122.245 129.772 123.038 1.00 420.85 ? 107 THR B O   1 
ATOM 5446  C CB  . THR B 2 107 ? 124.307 128.082 124.859 1.00 485.90 ? 107 THR B CB  1 
ATOM 5447  O OG1 . THR B 2 107 ? 123.046 128.233 125.524 1.00 477.41 ? 107 THR B OG1 1 
ATOM 5448  C CG2 . THR B 2 107 ? 125.302 129.082 125.430 1.00 500.00 ? 107 THR B CG2 1 
ATOM 5449  N N   . ARG B 2 108 ? 124.283 130.724 123.098 1.00 432.06 ? 108 ARG B N   1 
ATOM 5450  C CA  . ARG B 2 108 ? 123.762 132.082 122.960 1.00 427.79 ? 108 ARG B CA  1 
ATOM 5451  C C   . ARG B 2 108 ? 124.239 133.031 121.865 1.00 376.35 ? 108 ARG B C   1 
ATOM 5452  O O   . ARG B 2 108 ? 125.278 132.818 121.243 1.00 340.11 ? 108 ARG B O   1 
ATOM 5453  C CB  . ARG B 2 108 ? 123.917 132.847 124.276 1.00 476.24 ? 108 ARG B CB  1 
ATOM 5454  C CG  . ARG B 2 108 ? 123.041 134.085 124.376 1.00 500.00 ? 108 ARG B CG  1 
ATOM 5455  C CD  . ARG B 2 108 ? 121.578 133.704 124.533 1.00 500.00 ? 108 ARG B CD  1 
ATOM 5456  N NE  . ARG B 2 108 ? 121.172 132.691 123.565 1.00 500.00 ? 108 ARG B NE  1 
ATOM 5457  C CZ  . ARG B 2 108 ? 119.968 132.130 123.527 1.00 500.00 ? 108 ARG B CZ  1 
ATOM 5458  N NH1 . ARG B 2 108 ? 119.042 132.485 124.406 1.00 500.00 ? 108 ARG B NH1 1 
ATOM 5459  N NH2 . ARG B 2 108 ? 119.690 131.213 122.611 1.00 500.00 ? 108 ARG B NH2 1 
ATOM 5460  N N   . LYS B 2 109 ? 123.441 134.076 121.649 1.00 354.75 ? 109 LYS B N   1 
ATOM 5461  C CA  . LYS B 2 109 ? 123.592 135.066 120.590 1.00 369.47 ? 109 LYS B CA  1 
ATOM 5462  C C   . LYS B 2 109 ? 123.212 134.581 119.194 1.00 360.31 ? 109 LYS B C   1 
ATOM 5463  O O   . LYS B 2 109 ? 124.001 133.933 118.509 1.00 428.39 ? 109 LYS B O   1 
ATOM 5464  C CB  . LYS B 2 109 ? 125.032 135.591 120.641 1.00 385.64 ? 109 LYS B CB  1 
ATOM 5465  C CG  . LYS B 2 109 ? 125.379 136.339 121.918 1.00 403.15 ? 109 LYS B CG  1 
ATOM 5466  C CD  . LYS B 2 109 ? 126.800 136.876 121.886 1.00 431.68 ? 109 LYS B CD  1 
ATOM 5467  C CE  . LYS B 2 109 ? 127.811 135.741 121.930 1.00 430.01 ? 109 LYS B CE  1 
ATOM 5468  N NZ  . LYS B 2 109 ? 127.724 134.957 123.193 1.00 409.00 ? 109 LYS B NZ  1 
ATOM 5469  N N   . ASP B 2 110 ? 121.961 134.831 118.827 1.00 377.51 ? 110 ASP B N   1 
ATOM 5470  C CA  . ASP B 2 110 ? 121.400 134.357 117.567 1.00 475.50 ? 110 ASP B CA  1 
ATOM 5471  C C   . ASP B 2 110 ? 122.023 135.017 116.342 1.00 500.00 ? 110 ASP B C   1 
ATOM 5472  O O   . ASP B 2 110 ? 122.147 134.399 115.285 1.00 500.00 ? 110 ASP B O   1 
ATOM 5473  C CB  . ASP B 2 110 ? 119.928 134.745 117.683 1.00 455.45 ? 110 ASP B CB  1 
ATOM 5474  C CG  . ASP B 2 110 ? 119.372 134.497 119.069 1.00 470.61 ? 110 ASP B CG  1 
ATOM 5475  O OD1 . ASP B 2 110 ? 120.104 133.926 119.905 1.00 468.79 ? 110 ASP B OD1 1 
ATOM 5476  O OD2 . ASP B 2 110 ? 118.210 134.876 119.326 1.00 500.00 ? 110 ASP B OD2 1 
ATOM 5477  N N   . GLY B 2 111 ? 122.420 136.276 116.489 1.00 500.00 ? 111 GLY B N   1 
ATOM 5478  C CA  . GLY B 2 111 ? 123.021 137.006 115.391 1.00 500.00 ? 111 GLY B CA  1 
ATOM 5479  C C   . GLY B 2 111 ? 124.318 136.337 114.983 1.00 485.83 ? 111 GLY B C   1 
ATOM 5480  O O   . GLY B 2 111 ? 125.028 135.806 115.835 1.00 415.12 ? 111 GLY B O   1 
ATOM 5481  N N   . GLN B 2 112 ? 124.626 136.328 113.687 1.00 455.29 ? 112 GLN B N   1 
ATOM 5482  C CA  . GLN B 2 112 ? 123.808 136.960 112.653 1.00 415.79 ? 112 GLN B CA  1 
ATOM 5483  C C   . GLN B 2 112 ? 122.409 136.366 112.519 1.00 411.36 ? 112 GLN B C   1 
ATOM 5484  O O   . GLN B 2 112 ? 121.441 137.094 112.303 1.00 430.53 ? 112 GLN B O   1 
ATOM 5485  C CB  . GLN B 2 112 ? 124.517 136.880 111.299 1.00 30.00  ? 112 GLN B CB  1 
ATOM 5486  C CG  . GLN B 2 112 ? 125.762 137.744 111.182 1.00 30.00  ? 112 GLN B CG  1 
ATOM 5487  C CD  . GLN B 2 112 ? 126.475 137.552 109.858 1.00 30.00  ? 112 GLN B CD  1 
ATOM 5488  O OE1 . GLN B 2 112 ? 126.453 136.463 109.281 1.00 30.00  ? 112 GLN B OE1 1 
ATOM 5489  N NE2 . GLN B 2 112 ? 127.113 138.609 109.369 1.00 30.00  ? 112 GLN B NE2 1 
ATOM 5490  N N   . LEU B 2 113 ? 122.316 135.043 112.629 1.00 444.15 ? 113 LEU B N   1 
ATOM 5491  C CA  . LEU B 2 113 ? 121.052 134.322 112.493 1.00 465.02 ? 113 LEU B CA  1 
ATOM 5492  C C   . LEU B 2 113 ? 120.753 134.110 111.016 1.00 476.25 ? 113 LEU B C   1 
ATOM 5493  O O   . LEU B 2 113 ? 121.544 134.491 110.155 1.00 474.57 ? 113 LEU B O   1 
ATOM 5494  C CB  . LEU B 2 113 ? 119.892 135.061 113.168 1.00 459.94 ? 113 LEU B CB  1 
ATOM 5495  C CG  . LEU B 2 113 ? 119.547 134.686 114.610 1.00 416.47 ? 113 LEU B CG  1 
ATOM 5496  C CD1 . LEU B 2 113 ? 118.373 135.514 115.107 1.00 378.99 ? 113 LEU B CD1 1 
ATOM 5497  C CD2 . LEU B 2 113 ? 119.236 133.202 114.709 1.00 399.05 ? 113 LEU B CD2 1 
ATOM 5498  N N   . ILE B 2 114 ? 119.607 133.507 110.723 1.00 452.61 ? 114 ILE B N   1 
ATOM 5499  C CA  . ILE B 2 114 ? 119.230 133.260 109.341 1.00 427.76 ? 114 ILE B CA  1 
ATOM 5500  C C   . ILE B 2 114 ? 118.635 134.506 108.693 1.00 440.37 ? 114 ILE B C   1 
ATOM 5501  O O   . ILE B 2 114 ? 117.912 135.269 109.333 1.00 430.85 ? 114 ILE B O   1 
ATOM 5502  C CB  . ILE B 2 114 ? 118.250 132.100 109.258 1.00 382.93 ? 114 ILE B CB  1 
ATOM 5503  N N   . TYR B 2 115 ? 118.945 134.697 107.418 1.00 432.91 ? 115 TYR B N   1 
ATOM 5504  C CA  . TYR B 2 115 ? 118.440 135.827 106.648 1.00 426.53 ? 115 TYR B CA  1 
ATOM 5505  C C   . TYR B 2 115 ? 116.931 135.946 106.863 1.00 419.70 ? 115 TYR B C   1 
ATOM 5506  O O   . TYR B 2 115 ? 116.387 137.039 107.018 1.00 315.29 ? 115 TYR B O   1 
ATOM 5507  C CB  . TYR B 2 115 ? 118.718 135.636 105.149 1.00 433.74 ? 115 TYR B CB  1 
ATOM 5508  C CG  . TYR B 2 115 ? 119.696 134.523 104.812 1.00 480.88 ? 115 TYR B CG  1 
ATOM 5509  C CD1 . TYR B 2 115 ? 121.065 134.742 104.829 1.00 496.36 ? 115 TYR B CD1 1 
ATOM 5510  C CD2 . TYR B 2 115 ? 119.239 133.252 104.489 1.00 484.97 ? 115 TYR B CD2 1 
ATOM 5511  C CE1 . TYR B 2 115 ? 121.956 133.727 104.527 1.00 488.44 ? 115 TYR B CE1 1 
ATOM 5512  C CE2 . TYR B 2 115 ? 120.121 132.232 104.185 1.00 481.85 ? 115 TYR B CE2 1 
ATOM 5513  C CZ  . TYR B 2 115 ? 121.476 132.474 104.206 1.00 474.01 ? 115 TYR B CZ  1 
ATOM 5514  O OH  . TYR B 2 115 ? 122.355 131.461 103.903 1.00 401.63 ? 115 TYR B OH  1 
ATOM 5515  N N   . THR B 2 116 ? 116.276 134.790 106.861 1.00 449.34 ? 116 THR B N   1 
ATOM 5516  C CA  . THR B 2 116 ? 114.828 134.649 107.033 1.00 453.16 ? 116 THR B CA  1 
ATOM 5517  C C   . THR B 2 116 ? 114.226 135.063 108.377 1.00 451.27 ? 116 THR B C   1 
ATOM 5518  O O   . THR B 2 116 ? 113.116 135.595 108.428 1.00 344.82 ? 116 THR B O   1 
ATOM 5519  C CB  . THR B 2 116 ? 114.383 133.199 106.758 1.00 423.33 ? 116 THR B CB  1 
ATOM 5520  O OG1 . THR B 2 116 ? 114.878 132.342 107.793 1.00 348.64 ? 116 THR B OG1 1 
ATOM 5521  C CG2 . THR B 2 116 ? 114.908 132.722 105.413 1.00 424.22 ? 116 THR B CG2 1 
ATOM 5522  N N   . PRO B 2 117 ? 114.988 134.772 109.501 1.00 467.68 ? 117 PRO B N   1 
ATOM 5523  C CA  . PRO B 2 117 ? 114.338 135.108 110.784 1.00 448.79 ? 117 PRO B CA  1 
ATOM 5524  C C   . PRO B 2 117 ? 113.885 136.537 111.102 1.00 473.56 ? 117 PRO B C   1 
ATOM 5525  O O   . PRO B 2 117 ? 114.507 137.563 110.829 1.00 454.53 ? 117 PRO B O   1 
ATOM 5526  C CB  . PRO B 2 117 ? 115.352 134.646 111.845 1.00 418.71 ? 117 PRO B CB  1 
ATOM 5527  C CG  . PRO B 2 117 ? 116.659 134.659 111.161 1.00 451.47 ? 117 PRO B CG  1 
ATOM 5528  C CD  . PRO B 2 117 ? 116.309 134.076 109.835 1.00 484.78 ? 117 PRO B CD  1 
ATOM 5529  N N   . PHE B 2 118 ? 112.714 136.504 111.724 1.00 500.00 ? 118 PHE B N   1 
ATOM 5530  C CA  . PHE B 2 118 ? 111.891 137.591 112.258 1.00 486.05 ? 118 PHE B CA  1 
ATOM 5531  C C   . PHE B 2 118 ? 111.542 137.376 113.749 1.00 450.21 ? 118 PHE B C   1 
ATOM 5532  O O   . PHE B 2 118 ? 110.532 137.887 114.240 1.00 403.66 ? 118 PHE B O   1 
ATOM 5533  C CB  . PHE B 2 118 ? 110.660 137.808 111.371 1.00 497.51 ? 118 PHE B CB  1 
ATOM 5534  C CG  . PHE B 2 118 ? 111.012 138.264 109.980 1.00 500.00 ? 118 PHE B CG  1 
ATOM 5535  C CD1 . PHE B 2 118 ? 111.394 139.585 109.746 1.00 500.00 ? 118 PHE B CD1 1 
ATOM 5536  C CD2 . PHE B 2 118 ? 111.009 137.369 108.911 1.00 500.00 ? 118 PHE B CD2 1 
ATOM 5537  C CE1 . PHE B 2 118 ? 111.741 140.011 108.472 1.00 500.00 ? 118 PHE B CE1 1 
ATOM 5538  C CE2 . PHE B 2 118 ? 111.356 137.791 107.633 1.00 500.00 ? 118 PHE B CE2 1 
ATOM 5539  C CZ  . PHE B 2 118 ? 111.723 139.113 107.412 1.00 500.00 ? 118 PHE B CZ  1 
ATOM 5540  N N   . THR B 2 119 ? 112.391 136.606 114.442 1.00 447.86 ? 119 THR B N   1 
ATOM 5541  C CA  . THR B 2 119 ? 112.605 136.692 115.899 1.00 445.62 ? 119 THR B CA  1 
ATOM 5542  C C   . THR B 2 119 ? 111.404 136.328 116.801 1.00 455.78 ? 119 THR B C   1 
ATOM 5543  O O   . THR B 2 119 ? 110.390 135.804 116.325 1.00 394.28 ? 119 THR B O   1 
ATOM 5544  C CB  . THR B 2 119 ? 113.162 138.098 116.279 1.00 456.97 ? 119 THR B CB  1 
ATOM 5545  O OG1 . THR B 2 119 ? 112.124 139.084 116.209 1.00 467.94 ? 119 THR B OG1 1 
ATOM 5546  C CG2 . THR B 2 119 ? 114.308 138.503 115.356 1.00 451.33 ? 119 THR B CG2 1 
ATOM 5547  N N   . GLU B 2 120 ? 111.577 136.546 118.111 1.00 490.48 ? 120 GLU B N   1 
ATOM 5548  C CA  . GLU B 2 120 ? 110.484 136.600 119.093 1.00 492.72 ? 120 GLU B CA  1 
ATOM 5549  C C   . GLU B 2 120 ? 109.952 138.039 119.183 1.00 500.00 ? 120 GLU B C   1 
ATOM 5550  O O   . GLU B 2 120 ? 110.457 138.853 119.971 1.00 401.88 ? 120 GLU B O   1 
ATOM 5551  C CB  . GLU B 2 120 ? 110.969 136.130 120.473 1.00 422.96 ? 120 GLU B CB  1 
ATOM 5552  N N   . ASP B 2 121 ? 108.930 138.332 118.372 1.00 500.00 ? 121 ASP B N   1 
ATOM 5553  C CA  . ASP B 2 121 ? 108.400 139.693 118.187 1.00 500.00 ? 121 ASP B CA  1 
ATOM 5554  C C   . ASP B 2 121 ? 107.136 139.987 119.015 1.00 500.00 ? 121 ASP B C   1 
ATOM 5555  O O   . ASP B 2 121 ? 106.018 140.058 118.465 1.00 500.00 ? 121 ASP B O   1 
ATOM 5556  C CB  . ASP B 2 121 ? 108.115 139.939 116.698 1.00 500.00 ? 121 ASP B CB  1 
ATOM 5557  N N   . THR B 2 122 ? 107.357 140.145 120.331 1.00 500.00 ? 122 THR B N   1 
ATOM 5558  C CA  . THR B 2 122 ? 106.379 140.637 121.349 1.00 500.00 ? 122 THR B CA  1 
ATOM 5559  C C   . THR B 2 122 ? 106.763 140.194 122.780 1.00 500.00 ? 122 THR B C   1 
ATOM 5560  O O   . THR B 2 122 ? 107.067 141.058 123.603 1.00 500.00 ? 122 THR B O   1 
ATOM 5561  C CB  . THR B 2 122 ? 104.848 140.395 121.081 1.00 500.00 ? 122 THR B CB  1 
ATOM 5562  O OG1 . THR B 2 122 ? 104.623 139.260 120.232 1.00 500.00 ? 122 THR B OG1 1 
ATOM 5563  C CG2 . THR B 2 122 ? 104.189 141.622 120.450 1.00 500.00 ? 122 THR B CG2 1 
ATOM 5564  N N   . GLU B 2 123 ? 106.776 138.896 123.107 1.00 500.00 ? 123 GLU B N   1 
ATOM 5565  C CA  . GLU B 2 123 ? 106.500 137.764 122.210 1.00 500.00 ? 123 GLU B CA  1 
ATOM 5566  C C   . GLU B 2 123 ? 105.227 137.026 122.644 1.00 500.00 ? 123 GLU B C   1 
ATOM 5567  O O   . GLU B 2 123 ? 105.264 136.230 123.591 1.00 500.00 ? 123 GLU B O   1 
ATOM 5568  C CB  . GLU B 2 123 ? 107.685 136.809 122.210 1.00 500.00 ? 123 GLU B CB  1 
ATOM 5569  N N   . THR B 2 124 ? 104.112 137.290 121.950 1.00 500.00 ? 124 THR B N   1 
ATOM 5570  C CA  . THR B 2 124 ? 102.821 136.641 122.241 1.00 500.00 ? 124 THR B CA  1 
ATOM 5571  C C   . THR B 2 124 ? 102.659 135.437 121.319 1.00 486.25 ? 124 THR B C   1 
ATOM 5572  O O   . THR B 2 124 ? 102.908 135.521 120.104 1.00 331.24 ? 124 THR B O   1 
ATOM 5573  C CB  . THR B 2 124 ? 101.602 137.599 122.148 1.00 483.10 ? 124 THR B CB  1 
ATOM 5574  O OG1 . THR B 2 124 ? 100.460 136.986 122.769 1.00 388.87 ? 124 THR B OG1 1 
ATOM 5575  C CG2 . THR B 2 124 ? 101.255 137.975 120.703 1.00 492.59 ? 124 THR B CG2 1 
ATOM 5576  N N   . VAL B 2 125 ? 102.197 134.338 121.921 1.00 500.00 ? 125 VAL B N   1 
ATOM 5577  C CA  . VAL B 2 125 ? 102.352 132.973 121.387 1.00 500.00 ? 125 VAL B CA  1 
ATOM 5578  C C   . VAL B 2 125 ? 101.991 132.845 119.896 1.00 500.00 ? 125 VAL B C   1 
ATOM 5579  O O   . VAL B 2 125 ? 102.717 132.190 119.146 1.00 500.00 ? 125 VAL B O   1 
ATOM 5580  C CB  . VAL B 2 125 ? 101.574 131.929 122.260 1.00 500.00 ? 125 VAL B CB  1 
ATOM 5581  C CG1 . VAL B 2 125 ? 101.574 130.537 121.624 1.00 500.00 ? 125 VAL B CG1 1 
ATOM 5582  C CG2 . VAL B 2 125 ? 102.156 131.860 123.676 1.00 500.00 ? 125 VAL B CG2 1 
ATOM 5583  N N   . GLY B 2 126 ? 100.906 133.489 119.468 1.00 500.00 ? 126 GLY B N   1 
ATOM 5584  C CA  . GLY B 2 126 ? 100.385 133.305 118.123 1.00 470.64 ? 126 GLY B CA  1 
ATOM 5585  C C   . GLY B 2 126 ? 101.229 134.049 117.108 1.00 477.38 ? 126 GLY B C   1 
ATOM 5586  O O   . GLY B 2 126 ? 101.525 133.511 116.035 1.00 483.63 ? 126 GLY B O   1 
ATOM 5587  N N   . GLN B 2 127 ? 101.627 135.275 117.471 1.00 495.54 ? 127 GLN B N   1 
ATOM 5588  C CA  . GLN B 2 127 ? 102.253 136.207 116.536 1.00 500.00 ? 127 GLN B CA  1 
ATOM 5589  C C   . GLN B 2 127 ? 103.734 135.944 116.376 1.00 470.32 ? 127 GLN B C   1 
ATOM 5590  O O   . GLN B 2 127 ? 104.229 135.902 115.235 1.00 491.73 ? 127 GLN B O   1 
ATOM 5591  C CB  . GLN B 2 127 ? 101.935 137.673 116.889 1.00 500.00 ? 127 GLN B CB  1 
ATOM 5592  C CG  . GLN B 2 127 ? 100.708 138.236 116.154 1.00 500.00 ? 127 GLN B CG  1 
ATOM 5593  C CD  . GLN B 2 127 ? 99.421  137.435 116.359 1.00 500.00 ? 127 GLN B CD  1 
ATOM 5594  O OE1 . GLN B 2 127 ? 99.206  136.827 117.409 1.00 500.00 ? 127 GLN B OE1 1 
ATOM 5595  N NE2 . GLN B 2 127 ? 98.552  137.445 115.350 1.00 450.63 ? 127 GLN B NE2 1 
ATOM 5596  N N   . ARG B 2 128 ? 104.387 135.640 117.492 1.00 412.24 ? 128 ARG B N   1 
ATOM 5597  C CA  . ARG B 2 128 ? 105.795 135.192 117.488 1.00 409.56 ? 128 ARG B CA  1 
ATOM 5598  C C   . ARG B 2 128 ? 105.937 133.937 116.636 1.00 429.50 ? 128 ARG B C   1 
ATOM 5599  O O   . ARG B 2 128 ? 106.855 133.831 115.805 1.00 447.81 ? 128 ARG B O   1 
ATOM 5600  C CB  . ARG B 2 128 ? 106.265 134.891 118.910 1.00 421.51 ? 128 ARG B CB  1 
ATOM 5601  N N   . ALA B 2 129 ? 105.006 133.010 116.867 1.00 452.15 ? 129 ALA B N   1 
ATOM 5602  C CA  . ALA B 2 129 ? 104.981 131.730 116.144 1.00 468.49 ? 129 ALA B CA  1 
ATOM 5603  C C   . ALA B 2 129 ? 104.858 131.978 114.651 1.00 435.19 ? 129 ALA B C   1 
ATOM 5604  O O   . ALA B 2 129 ? 105.579 131.362 113.853 1.00 407.00 ? 129 ALA B O   1 
ATOM 5605  C CB  . ALA B 2 129 ? 103.849 130.837 116.631 1.00 488.64 ? 129 ALA B CB  1 
ATOM 5606  N N   . LEU B 2 130 ? 103.946 132.878 114.307 1.00 407.98 ? 130 LEU B N   1 
ATOM 5607  C CA  . LEU B 2 130 ? 103.688 133.258 112.912 1.00 428.24 ? 130 LEU B CA  1 
ATOM 5608  C C   . LEU B 2 130 ? 104.960 133.782 112.265 1.00 400.77 ? 130 LEU B C   1 
ATOM 5609  O O   . LEU B 2 130 ? 105.307 133.392 111.142 1.00 369.59 ? 130 LEU B O   1 
ATOM 5610  C CB  . LEU B 2 130 ? 102.569 134.305 112.805 1.00 489.55 ? 130 LEU B CB  1 
ATOM 5611  C CG  . LEU B 2 130 ? 102.200 134.882 111.420 1.00 500.00 ? 130 LEU B CG  1 
ATOM 5612  C CD1 . LEU B 2 130 ? 103.180 135.940 110.906 1.00 500.00 ? 130 LEU B CD1 1 
ATOM 5613  C CD2 . LEU B 2 130 ? 102.007 133.773 110.388 1.00 500.00 ? 130 LEU B CD2 1 
ATOM 5614  N N   . HIS B 2 131 ? 105.624 134.661 113.002 1.00 452.39 ? 131 HIS B N   1 
ATOM 5615  C CA  . HIS B 2 131 ? 106.879 135.289 112.561 1.00 477.93 ? 131 HIS B CA  1 
ATOM 5616  C C   . HIS B 2 131 ? 107.919 134.213 112.257 1.00 428.89 ? 131 HIS B C   1 
ATOM 5617  O O   . HIS B 2 131 ? 108.592 134.246 111.212 1.00 328.48 ? 131 HIS B O   1 
ATOM 5618  C CB  . HIS B 2 131 ? 107.458 136.271 113.606 1.00 500.00 ? 131 HIS B CB  1 
ATOM 5619  C CG  . HIS B 2 131 ? 106.954 137.678 113.484 1.00 500.00 ? 131 HIS B CG  1 
ATOM 5620  N ND1 . HIS B 2 131 ? 107.273 138.494 112.420 1.00 465.50 ? 131 HIS B ND1 1 
ATOM 5621  C CD2 . HIS B 2 131 ? 106.181 138.424 114.312 1.00 480.73 ? 131 HIS B CD2 1 
ATOM 5622  C CE1 . HIS B 2 131 ? 106.702 139.675 112.586 1.00 454.26 ? 131 HIS B CE1 1 
ATOM 5623  N NE2 . HIS B 2 131 ? 106.033 139.658 113.726 1.00 451.47 ? 131 HIS B NE2 1 
ATOM 5624  N N   . SER B 2 132 ? 108.022 133.280 113.197 1.00 445.27 ? 132 SER B N   1 
ATOM 5625  C CA  . SER B 2 132 ? 108.965 132.161 113.103 1.00 463.93 ? 132 SER B CA  1 
ATOM 5626  C C   . SER B 2 132 ? 108.702 131.356 111.830 1.00 430.34 ? 132 SER B C   1 
ATOM 5627  O O   . SER B 2 132 ? 109.631 131.020 111.082 1.00 386.85 ? 132 SER B O   1 
ATOM 5628  C CB  . SER B 2 132 ? 108.897 131.248 114.344 1.00 494.21 ? 132 SER B CB  1 
ATOM 5629  O OG  . SER B 2 132 ? 107.798 130.352 114.304 1.00 464.56 ? 132 SER B OG  1 
ATOM 5630  N N   . ILE B 2 133 ? 107.423 131.075 111.622 1.00 429.03 ? 133 ILE B N   1 
ATOM 5631  C CA  . ILE B 2 133 ? 106.957 130.308 110.463 1.00 447.81 ? 133 ILE B CA  1 
ATOM 5632  C C   . ILE B 2 133 ? 107.372 131.007 109.171 1.00 460.28 ? 133 ILE B C   1 
ATOM 5633  O O   . ILE B 2 133 ? 107.883 130.371 108.241 1.00 408.77 ? 133 ILE B O   1 
ATOM 5634  C CB  . ILE B 2 133 ? 105.434 129.948 110.559 1.00 485.49 ? 133 ILE B CB  1 
ATOM 5635  C CG1 . ILE B 2 133 ? 105.243 128.423 110.651 1.00 500.00 ? 133 ILE B CG1 1 
ATOM 5636  C CG2 . ILE B 2 133 ? 104.585 130.548 109.435 1.00 500.00 ? 133 ILE B CG2 1 
ATOM 5637  C CD1 . ILE B 2 133 ? 105.890 127.614 109.542 1.00 500.00 ? 133 ILE B CD1 1 
ATOM 5638  N N   . LEU B 2 134 ? 107.138 132.312 109.156 1.00 500.00 ? 134 LEU B N   1 
ATOM 5639  C CA  . LEU B 2 134 ? 107.463 133.169 108.012 1.00 500.00 ? 134 LEU B CA  1 
ATOM 5640  C C   . LEU B 2 134 ? 108.955 133.073 107.698 1.00 500.00 ? 134 LEU B C   1 
ATOM 5641  O O   . LEU B 2 134 ? 109.355 132.905 106.529 1.00 500.00 ? 134 LEU B O   1 
ATOM 5642  C CB  . LEU B 2 134 ? 107.064 134.625 108.309 1.00 500.00 ? 134 LEU B CB  1 
ATOM 5643  C CG  . LEU B 2 134 ? 107.159 135.682 107.204 1.00 500.00 ? 134 LEU B CG  1 
ATOM 5644  C CD1 . LEU B 2 134 ? 106.225 135.366 106.043 1.00 500.00 ? 134 LEU B CD1 1 
ATOM 5645  C CD2 . LEU B 2 134 ? 106.850 137.057 107.788 1.00 500.00 ? 134 LEU B CD2 1 
ATOM 5646  N N   . ASN B 2 135 ? 109.742 133.178 108.763 1.00 442.64 ? 135 ASN B N   1 
ATOM 5647  C CA  . ASN B 2 135 ? 111.203 133.119 108.668 1.00 421.70 ? 135 ASN B CA  1 
ATOM 5648  C C   . ASN B 2 135 ? 111.637 131.792 108.047 1.00 424.26 ? 135 ASN B C   1 
ATOM 5649  O O   . ASN B 2 135 ? 112.488 131.753 107.148 1.00 401.93 ? 135 ASN B O   1 
ATOM 5650  C CB  . ASN B 2 135 ? 111.918 133.489 109.984 1.00 435.31 ? 135 ASN B CB  1 
ATOM 5651  C CG  . ASN B 2 135 ? 112.656 132.332 110.618 1.00 433.10 ? 135 ASN B CG  1 
ATOM 5652  O OD1 . ASN B 2 135 ? 113.792 132.015 110.255 1.00 413.49 ? 135 ASN B OD1 1 
ATOM 5653  N ND2 . ASN B 2 135 ? 112.021 131.712 111.591 1.00 435.90 ? 135 ASN B ND2 1 
ATOM 5654  N N   . ALA B 2 136 ? 111.024 130.728 108.545 1.00 466.26 ? 136 ALA B N   1 
ATOM 5655  C CA  . ALA B 2 136 ? 111.290 129.361 108.085 1.00 500.00 ? 136 ALA B CA  1 
ATOM 5656  C C   . ALA B 2 136 ? 111.020 129.245 106.602 1.00 487.55 ? 136 ALA B C   1 
ATOM 5657  O O   . ALA B 2 136 ? 111.822 128.687 105.849 1.00 471.52 ? 136 ALA B O   1 
ATOM 5658  C CB  . ALA B 2 136 ? 110.431 128.363 108.856 1.00 500.00 ? 136 ALA B CB  1 
ATOM 5659  N N   . ALA B 2 137 ? 109.877 129.797 106.193 1.00 475.29 ? 137 ALA B N   1 
ATOM 5660  C CA  . ALA B 2 137 ? 109.422 129.789 104.804 1.00 500.00 ? 137 ALA B CA  1 
ATOM 5661  C C   . ALA B 2 137 ? 110.509 130.085 103.774 1.00 490.64 ? 137 ALA B C   1 
ATOM 5662  O O   . ALA B 2 137 ? 110.729 129.315 102.813 1.00 444.21 ? 137 ALA B O   1 
ATOM 5663  C CB  . ALA B 2 137 ? 108.237 130.737 104.608 1.00 500.00 ? 137 ALA B CB  1 
ATOM 5664  N N   . ILE B 2 138 ? 111.217 131.193 104.028 1.00 500.00 ? 138 ILE B N   1 
ATOM 5665  C CA  . ILE B 2 138 ? 112.349 131.598 103.180 1.00 500.00 ? 138 ILE B CA  1 
ATOM 5666  C C   . ILE B 2 138 ? 113.417 130.491 103.221 1.00 500.00 ? 138 ILE B C   1 
ATOM 5667  O O   . ILE B 2 138 ? 113.963 130.154 102.165 1.00 500.00 ? 138 ILE B O   1 
ATOM 5668  C CB  . ILE B 2 138 ? 112.871 133.038 103.470 1.00 500.00 ? 138 ILE B CB  1 
ATOM 5669  C CG1 . ILE B 2 138 ? 111.857 134.072 102.934 1.00 500.00 ? 138 ILE B CG1 1 
ATOM 5670  C CG2 . ILE B 2 138 ? 114.238 133.275 102.818 1.00 500.00 ? 138 ILE B CG2 1 
ATOM 5671  C CD1 . ILE B 2 138 ? 112.176 135.534 103.211 1.00 500.00 ? 138 ILE B CD1 1 
ATOM 5672  N N   . MET B 2 139 ? 113.675 129.946 104.403 1.00 455.76 ? 139 MET B N   1 
ATOM 5673  C CA  . MET B 2 139 ? 114.675 128.897 104.509 1.00 469.83 ? 139 MET B CA  1 
ATOM 5674  C C   . MET B 2 139 ? 114.276 127.665 103.726 1.00 448.95 ? 139 MET B C   1 
ATOM 5675  O O   . MET B 2 139 ? 115.124 127.084 103.038 1.00 480.76 ? 139 MET B O   1 
ATOM 5676  C CB  . MET B 2 139 ? 115.010 128.524 105.961 1.00 500.00 ? 139 MET B CB  1 
ATOM 5677  C CG  . MET B 2 139 ? 116.492 128.223 106.155 1.00 500.00 ? 139 MET B CG  1 
ATOM 5678  S SD  . MET B 2 139 ? 117.606 129.519 105.549 1.00 500.00 ? 139 MET B SD  1 
ATOM 5679  C CE  . MET B 2 139 ? 118.997 128.543 104.970 1.00 500.00 ? 139 MET B CE  1 
ATOM 5680  N N   . ILE B 2 140 ? 112.999 127.325 103.793 1.00 431.15 ? 140 ILE B N   1 
ATOM 5681  C CA  . ILE B 2 140 ? 112.434 126.197 103.038 1.00 449.09 ? 140 ILE B CA  1 
ATOM 5682  C C   . ILE B 2 140 ? 112.666 126.405 101.541 1.00 428.53 ? 140 ILE B C   1 
ATOM 5683  O O   . ILE B 2 140 ? 113.099 125.483 100.832 1.00 384.66 ? 140 ILE B O   1 
ATOM 5684  C CB  . ILE B 2 140 ? 110.937 125.970 103.372 1.00 484.85 ? 140 ILE B CB  1 
ATOM 5685  C CG1 . ILE B 2 140 ? 110.768 125.631 104.866 1.00 484.57 ? 140 ILE B CG1 1 
ATOM 5686  C CG2 . ILE B 2 140 ? 110.349 124.855 102.509 1.00 494.11 ? 140 ILE B CG2 1 
ATOM 5687  C CD1 . ILE B 2 140 ? 109.453 126.082 105.471 1.00 462.98 ? 140 ILE B CD1 1 
ATOM 5688  N N   . SER B 2 141 ? 112.370 127.624 101.106 1.00 434.46 ? 141 SER B N   1 
ATOM 5689  C CA  . SER B 2 141 ? 112.526 128.023 99.706  1.00 451.89 ? 141 SER B CA  1 
ATOM 5690  C C   . SER B 2 141 ? 113.976 127.832 99.262  1.00 399.43 ? 141 SER B C   1 
ATOM 5691  O O   . SER B 2 141 ? 114.250 127.279 98.187  1.00 414.49 ? 141 SER B O   1 
ATOM 5692  C CB  . SER B 2 141 ? 112.061 129.469 99.454  1.00 475.71 ? 141 SER B CB  1 
ATOM 5693  O OG  . SER B 2 141 ? 113.087 130.416 99.698  1.00 484.92 ? 141 SER B OG  1 
ATOM 5694  N N   . VAL B 2 142 ? 114.872 128.299 100.115 1.00 392.00 ? 142 VAL B N   1 
ATOM 5695  C CA  . VAL B 2 142 ? 116.319 128.214 99.883  1.00 422.16 ? 142 VAL B CA  1 
ATOM 5696  C C   . VAL B 2 142 ? 116.735 126.760 99.707  1.00 404.23 ? 142 VAL B C   1 
ATOM 5697  O O   . VAL B 2 142 ? 117.484 126.424 98.781  1.00 439.85 ? 142 VAL B O   1 
ATOM 5698  C CB  . VAL B 2 142 ? 117.157 128.897 100.992 1.00 500.00 ? 142 VAL B CB  1 
ATOM 5699  C CG1 . VAL B 2 142 ? 118.637 128.512 100.909 1.00 500.00 ? 142 VAL B CG1 1 
ATOM 5700  C CG2 . VAL B 2 142 ? 117.003 130.412 100.907 1.00 500.00 ? 142 VAL B CG2 1 
ATOM 5701  N N   . ILE B 2 143 ? 116.232 125.929 100.606 1.00 426.76 ? 143 ILE B N   1 
ATOM 5702  C CA  . ILE B 2 143 ? 116.508 124.488 100.608 1.00 457.44 ? 143 ILE B CA  1 
ATOM 5703  C C   . ILE B 2 143 ? 116.072 123.869 99.269  1.00 450.39 ? 143 ILE B C   1 
ATOM 5704  O O   . ILE B 2 143 ? 116.799 123.109 98.616  1.00 471.06 ? 143 ILE B O   1 
ATOM 5705  C CB  . ILE B 2 143 ? 115.883 123.764 101.832 1.00 485.11 ? 143 ILE B CB  1 
ATOM 5706  C CG1 . ILE B 2 143 ? 116.605 124.190 103.121 1.00 490.45 ? 143 ILE B CG1 1 
ATOM 5707  C CG2 . ILE B 2 143 ? 115.973 122.246 101.694 1.00 499.76 ? 143 ILE B CG2 1 
ATOM 5708  C CD1 . ILE B 2 143 ? 115.766 124.067 104.378 1.00 485.53 ? 143 ILE B CD1 1 
ATOM 5709  N N   . VAL B 2 144 ? 114.789 124.050 98.981  1.00 410.62 ? 144 VAL B N   1 
ATOM 5710  C CA  . VAL B 2 144 ? 114.114 123.231 97.988  1.00 386.38 ? 144 VAL B CA  1 
ATOM 5711  C C   . VAL B 2 144 ? 114.734 123.520 96.643  1.00 365.96 ? 144 VAL B C   1 
ATOM 5712  O O   . VAL B 2 144 ? 115.032 122.621 95.852  1.00 341.69 ? 144 VAL B O   1 
ATOM 5713  C CB  . VAL B 2 144 ? 112.625 123.571 97.927  1.00 425.75 ? 144 VAL B CB  1 
ATOM 5714  C CG1 . VAL B 2 144 ? 111.874 122.495 97.166  1.00 443.74 ? 144 VAL B CG1 1 
ATOM 5715  C CG2 . VAL B 2 144 ? 112.073 123.731 99.335  1.00 454.92 ? 144 VAL B CG2 1 
ATOM 5716  N N   . VAL B 2 145 ? 114.977 124.801 96.426  1.00 417.66 ? 145 VAL B N   1 
ATOM 5717  C CA  . VAL B 2 145 ? 115.668 125.249 95.248  1.00 470.89 ? 145 VAL B CA  1 
ATOM 5718  C C   . VAL B 2 145 ? 117.024 124.601 95.327  1.00 474.33 ? 145 VAL B C   1 
ATOM 5719  O O   . VAL B 2 145 ? 117.572 124.179 94.321  1.00 451.47 ? 145 VAL B O   1 
ATOM 5720  C CB  . VAL B 2 145 ? 115.840 126.770 95.243  1.00 500.00 ? 145 VAL B CB  1 
ATOM 5721  C CG1 . VAL B 2 145 ? 116.094 127.257 93.827  1.00 500.00 ? 145 VAL B CG1 1 
ATOM 5722  C CG2 . VAL B 2 145 ? 114.607 127.439 95.825  1.00 500.00 ? 145 VAL B CG2 1 
ATOM 5723  N N   . MET B 2 146 ? 117.561 124.508 96.537  1.00 500.00 ? 146 MET B N   1 
ATOM 5724  C CA  . MET B 2 146 ? 118.894 123.972 96.702  1.00 500.00 ? 146 MET B CA  1 
ATOM 5725  C C   . MET B 2 146 ? 118.837 122.557 96.163  1.00 500.00 ? 146 MET B C   1 
ATOM 5726  O O   . MET B 2 146 ? 119.686 122.149 95.374  1.00 500.00 ? 146 MET B O   1 
ATOM 5727  C CB  . MET B 2 146 ? 119.261 123.942 98.189  1.00 500.00 ? 146 MET B CB  1 
ATOM 5728  C CG  . MET B 2 146 ? 120.750 124.040 98.502  1.00 500.00 ? 146 MET B CG  1 
ATOM 5729  S SD  . MET B 2 146 ? 121.620 122.470 98.685  1.00 500.00 ? 146 MET B SD  1 
ATOM 5730  C CE  . MET B 2 146 ? 121.861 122.004 96.974  1.00 500.00 ? 146 MET B CE  1 
ATOM 5731  N N   . THR B 2 147 ? 117.791 121.830 96.533  1.00 500.00 ? 147 THR B N   1 
ATOM 5732  C CA  . THR B 2 147 ? 117.678 120.435 96.134  1.00 500.00 ? 147 THR B CA  1 
ATOM 5733  C C   . THR B 2 147 ? 117.559 120.275 94.620  1.00 500.00 ? 147 THR B C   1 
ATOM 5734  O O   . THR B 2 147 ? 118.214 119.418 94.020  1.00 500.00 ? 147 THR B O   1 
ATOM 5735  C CB  . THR B 2 147 ? 116.468 119.776 96.812  1.00 500.00 ? 147 THR B CB  1 
ATOM 5736  O OG1 . THR B 2 147 ? 116.508 118.365 96.568  1.00 500.00 ? 147 THR B OG1 1 
ATOM 5737  C CG2 . THR B 2 147 ? 115.171 120.339 96.251  1.00 500.00 ? 147 THR B CG2 1 
ATOM 5738  N N   . ILE B 2 148 ? 116.739 121.114 93.996  1.00 500.00 ? 148 ILE B N   1 
ATOM 5739  C CA  . ILE B 2 148 ? 116.566 121.030 92.547  1.00 500.00 ? 148 ILE B CA  1 
ATOM 5740  C C   . ILE B 2 148 ? 117.868 121.356 91.828  1.00 439.51 ? 148 ILE B C   1 
ATOM 5741  O O   . ILE B 2 148 ? 118.195 120.754 90.810  1.00 430.35 ? 148 ILE B O   1 
ATOM 5742  C CB  . ILE B 2 148 ? 115.429 121.934 92.030  1.00 500.00 ? 148 ILE B CB  1 
ATOM 5743  C CG1 . ILE B 2 148 ? 114.079 121.455 92.566  1.00 500.00 ? 148 ILE B CG1 1 
ATOM 5744  C CG2 . ILE B 2 148 ? 115.402 121.932 90.511  1.00 500.00 ? 148 ILE B CG2 1 
ATOM 5745  C CD1 . ILE B 2 148 ? 112.890 122.074 91.865  1.00 500.00 ? 148 ILE B CD1 1 
ATOM 5746  N N   . LEU B 2 149 ? 118.581 122.341 92.357  1.00 438.30 ? 149 LEU B N   1 
ATOM 5747  C CA  . LEU B 2 149 ? 119.847 122.779 91.798  1.00 489.66 ? 149 LEU B CA  1 
ATOM 5748  C C   . LEU B 2 149 ? 120.842 121.640 91.875  1.00 500.00 ? 149 LEU B C   1 
ATOM 5749  O O   . LEU B 2 149 ? 121.619 121.407 90.953  1.00 500.00 ? 149 LEU B O   1 
ATOM 5750  C CB  . LEU B 2 149 ? 120.359 123.989 92.580  1.00 500.00 ? 149 LEU B CB  1 
ATOM 5751  C CG  . LEU B 2 149 ? 121.857 124.116 92.872  1.00 500.00 ? 149 LEU B CG  1 
ATOM 5752  C CD1 . LEU B 2 149 ? 122.155 125.500 93.421  1.00 500.00 ? 149 LEU B CD1 1 
ATOM 5753  C CD2 . LEU B 2 149 ? 122.310 123.058 93.867  1.00 500.00 ? 149 LEU B CD2 1 
ATOM 5754  N N   . LEU B 2 150 ? 120.804 120.937 93.000  1.00 500.00 ? 150 LEU B N   1 
ATOM 5755  C CA  . LEU B 2 150 ? 121.663 119.790 93.227  1.00 500.00 ? 150 LEU B CA  1 
ATOM 5756  C C   . LEU B 2 150 ? 121.352 118.705 92.216  1.00 457.34 ? 150 LEU B C   1 
ATOM 5757  O O   . LEU B 2 150 ? 122.254 118.065 91.683  1.00 465.37 ? 150 LEU B O   1 
ATOM 5758  C CB  . LEU B 2 150 ? 121.471 119.251 94.645  1.00 500.00 ? 150 LEU B CB  1 
ATOM 5759  C CG  . LEU B 2 150 ? 122.040 117.857 94.918  1.00 500.00 ? 150 LEU B CG  1 
ATOM 5760  C CD1 . LEU B 2 150 ? 121.162 116.775 94.310  1.00 500.00 ? 150 LEU B CD1 1 
ATOM 5761  C CD2 . LEU B 2 150 ? 123.451 117.756 94.367  1.00 500.00 ? 150 LEU B CD2 1 
ATOM 5762  N N   . VAL B 2 151 ? 120.071 118.495 91.947  1.00 365.13 ? 151 VAL B N   1 
ATOM 5763  C CA  . VAL B 2 151 ? 119.708 117.507 90.951  1.00 423.51 ? 151 VAL B CA  1 
ATOM 5764  C C   . VAL B 2 151 ? 120.269 117.926 89.598  1.00 439.56 ? 151 VAL B C   1 
ATOM 5765  O O   . VAL B 2 151 ? 120.876 117.123 88.888  1.00 433.05 ? 151 VAL B O   1 
ATOM 5766  C CB  . VAL B 2 151 ? 118.180 117.385 90.824  1.00 478.16 ? 151 VAL B CB  1 
ATOM 5767  C CG1 . VAL B 2 151 ? 117.806 116.038 90.229  1.00 500.00 ? 151 VAL B CG1 1 
ATOM 5768  C CG2 . VAL B 2 151 ? 117.517 117.566 92.179  1.00 491.25 ? 151 VAL B CG2 1 
ATOM 5769  N N   . VAL B 2 152 ? 120.101 119.200 89.264  1.00 475.99 ? 152 VAL B N   1 
ATOM 5770  C CA  . VAL B 2 152 ? 120.301 119.653 87.894  1.00 500.00 ? 152 VAL B CA  1 
ATOM 5771  C C   . VAL B 2 152 ? 121.746 119.492 87.456  1.00 488.18 ? 152 VAL B C   1 
ATOM 5772  O O   . VAL B 2 152 ? 122.025 119.080 86.333  1.00 451.97 ? 152 VAL B O   1 
ATOM 5773  C CB  . VAL B 2 152 ? 119.887 121.118 87.711  1.00 500.00 ? 152 VAL B CB  1 
ATOM 5774  C CG1 . VAL B 2 152 ? 120.170 121.564 86.286  1.00 500.00 ? 152 VAL B CG1 1 
ATOM 5775  C CG2 . VAL B 2 152 ? 118.414 121.287 88.041  1.00 500.00 ? 152 VAL B CG2 1 
ATOM 5776  N N   . LEU B 2 153 ? 122.660 119.820 88.360  1.00 500.00 ? 153 LEU B N   1 
ATOM 5777  C CA  . LEU B 2 153 ? 124.028 119.313 88.294  1.00 500.00 ? 153 LEU B CA  1 
ATOM 5778  C C   . LEU B 2 153 ? 124.064 117.940 87.652  1.00 500.00 ? 153 LEU B C   1 
ATOM 5779  O O   . LEU B 2 153 ? 124.917 117.689 86.778  1.00 496.15 ? 153 LEU B O   1 
ATOM 5780  C CB  . LEU B 2 153 ? 124.672 119.314 89.702  1.00 500.00 ? 153 LEU B CB  1 
ATOM 5781  C CG  . LEU B 2 153 ? 126.158 118.980 89.995  1.00 500.00 ? 153 LEU B CG  1 
ATOM 5782  C CD1 . LEU B 2 153 ? 126.316 117.675 90.768  1.00 500.00 ? 153 LEU B CD1 1 
ATOM 5783  C CD2 . LEU B 2 153 ? 127.064 118.981 88.764  1.00 500.00 ? 153 LEU B CD2 1 
ATOM 5784  N N   . TYR B 2 154 ? 123.105 117.093 88.045  1.00 500.00 ? 154 TYR B N   1 
ATOM 5785  C CA  . TYR B 2 154 ? 122.995 115.741 87.515  1.00 500.00 ? 154 TYR B CA  1 
ATOM 5786  C C   . TYR B 2 154 ? 122.282 115.670 86.184  1.00 500.00 ? 154 TYR B C   1 
ATOM 5787  O O   . TYR B 2 154 ? 122.707 114.883 85.366  1.00 500.00 ? 154 TYR B O   1 
ATOM 5788  C CB  . TYR B 2 154 ? 122.412 114.755 88.534  1.00 500.00 ? 154 TYR B CB  1 
ATOM 5789  C CG  . TYR B 2 154 ? 123.490 114.250 89.459  1.00 500.00 ? 154 TYR B CG  1 
ATOM 5790  C CD1 . TYR B 2 154 ? 124.516 113.427 88.981  1.00 500.00 ? 154 TYR B CD1 1 
ATOM 5791  C CD2 . TYR B 2 154 ? 123.525 114.634 90.800  1.00 500.00 ? 154 TYR B CD2 1 
ATOM 5792  C CE1 . TYR B 2 154 ? 125.527 112.982 89.821  1.00 500.00 ? 154 TYR B CE1 1 
ATOM 5793  C CE2 . TYR B 2 154 ? 124.529 114.191 91.649  1.00 500.00 ? 154 TYR B CE2 1 
ATOM 5794  C CZ  . TYR B 2 154 ? 125.524 113.366 91.157  1.00 500.00 ? 154 TYR B CZ  1 
ATOM 5795  O OH  . TYR B 2 154 ? 126.509 112.943 92.005  1.00 500.00 ? 154 TYR B OH  1 
ATOM 5796  N N   . LYS B 2 155 ? 121.249 116.489 85.951  1.00 500.00 ? 155 LYS B N   1 
ATOM 5797  C CA  . LYS B 2 155 ? 120.522 116.522 84.653  1.00 500.00 ? 155 LYS B CA  1 
ATOM 5798  C C   . LYS B 2 155 ? 121.458 116.332 83.438  1.00 500.00 ? 155 LYS B C   1 
ATOM 5799  O O   . LYS B 2 155 ? 121.171 115.527 82.544  1.00 500.00 ? 155 LYS B O   1 
ATOM 5800  C CB  . LYS B 2 155 ? 119.719 117.831 84.510  1.00 500.00 ? 155 LYS B CB  1 
ATOM 5801  C CG  . LYS B 2 155 ? 118.815 117.921 83.280  1.00 497.26 ? 155 LYS B CG  1 
ATOM 5802  C CD  . LYS B 2 155 ? 118.331 119.345 83.026  1.00 485.05 ? 155 LYS B CD  1 
ATOM 5803  C CE  . LYS B 2 155 ? 117.650 119.488 81.666  1.00 455.81 ? 155 LYS B CE  1 
ATOM 5804  N NZ  . LYS B 2 155 ? 117.390 120.905 81.274  1.00 409.79 ? 155 LYS B NZ  1 
ATOM 5805  N N   . TYR B 2 156 ? 122.574 117.062 83.436  1.00 500.00 ? 156 TYR B N   1 
ATOM 5806  C CA  . TYR B 2 156 ? 123.609 116.936 82.406  1.00 500.00 ? 156 TYR B CA  1 
ATOM 5807  C C   . TYR B 2 156 ? 124.955 117.510 82.939  1.00 483.37 ? 156 TYR B C   1 
ATOM 5808  O O   . TYR B 2 156 ? 125.278 117.301 84.108  1.00 372.21 ? 156 TYR B O   1 
ATOM 5809  C CB  . TYR B 2 156 ? 123.118 117.574 81.080  1.00 500.00 ? 156 TYR B CB  1 
ATOM 5810  C CG  . TYR B 2 156 ? 122.866 119.080 81.098  1.00 500.00 ? 156 TYR B CG  1 
ATOM 5811  C CD1 . TYR B 2 156 ? 121.831 119.636 81.856  1.00 500.00 ? 156 TYR B CD1 1 
ATOM 5812  C CD2 . TYR B 2 156 ? 123.641 119.949 80.317  1.00 500.00 ? 156 TYR B CD2 1 
ATOM 5813  C CE1 . TYR B 2 156 ? 121.595 121.008 81.859  1.00 500.00 ? 156 TYR B CE1 1 
ATOM 5814  C CE2 . TYR B 2 156 ? 123.411 121.323 80.313  1.00 500.00 ? 156 TYR B CE2 1 
ATOM 5815  C CZ  . TYR B 2 156 ? 122.387 121.849 81.086  1.00 500.00 ? 156 TYR B CZ  1 
ATOM 5816  O OH  . TYR B 2 156 ? 122.152 123.206 81.089  1.00 500.00 ? 156 TYR B OH  1 
ATOM 5817  N N   . ARG B 2 157 ? 125.750 118.161 82.082  1.00 500.00 ? 157 ARG B N   1 
ATOM 5818  C CA  . ARG B 2 157 ? 126.874 119.041 82.484  1.00 500.00 ? 157 ARG B CA  1 
ATOM 5819  C C   . ARG B 2 157 ? 126.345 120.085 83.517  1.00 500.00 ? 157 ARG B C   1 
ATOM 5820  O O   . ARG B 2 157 ? 125.266 120.628 83.272  1.00 500.00 ? 157 ARG B O   1 
ATOM 5821  C CB  . ARG B 2 157 ? 127.421 119.725 81.205  1.00 500.00 ? 157 ARG B CB  1 
ATOM 5822  C CG  . ARG B 2 157 ? 128.719 120.494 81.341  1.00 500.00 ? 157 ARG B CG  1 
ATOM 5823  C CD  . ARG B 2 157 ? 129.029 121.397 80.153  1.00 497.75 ? 157 ARG B CD  1 
ATOM 5824  N NE  . ARG B 2 157 ? 130.094 122.362 80.466  1.00 482.81 ? 157 ARG B NE  1 
ATOM 5825  C CZ  . ARG B 2 157 ? 129.964 123.456 81.232  1.00 476.52 ? 157 ARG B CZ  1 
ATOM 5826  N NH1 . ARG B 2 157 ? 128.802 123.777 81.811  1.00 459.75 ? 157 ARG B NH1 1 
ATOM 5827  N NH2 . ARG B 2 157 ? 131.019 124.243 81.432  1.00 454.12 ? 157 ARG B NH2 1 
ATOM 5828  N N   . CYS B 2 158 ? 127.007 120.415 84.648  1.00 500.00 ? 158 CYS B N   1 
ATOM 5829  C CA  . CYS B 2 158 ? 128.423 120.164 85.056  1.00 500.00 ? 158 CYS B CA  1 
ATOM 5830  C C   . CYS B 2 158 ? 129.371 121.182 84.333  1.00 500.00 ? 158 CYS B C   1 
ATOM 5831  O O   . CYS B 2 158 ? 128.931 122.330 84.214  1.00 500.00 ? 158 CYS B O   1 
ATOM 5832  C CB  . CYS B 2 158 ? 128.776 118.676 85.047  1.00 459.38 ? 158 CYS B CB  1 
ATOM 5833  S SG  . CYS B 2 158 ? 129.648 118.207 86.555  1.00 368.17 ? 158 CYS B SG  1 
ATOM 5834  N N   . TYR B 2 159 ? 130.618 120.931 83.886  1.00 500.00 ? 159 TYR B N   1 
ATOM 5835  C CA  . TYR B 2 159 ? 131.586 119.866 84.243  1.00 500.00 ? 159 TYR B CA  1 
ATOM 5836  C C   . TYR B 2 159 ? 132.124 120.077 85.669  1.00 418.30 ? 159 TYR B C   1 
ATOM 5837  O O   . TYR B 2 159 ? 131.481 120.765 86.460  1.00 265.02 ? 159 TYR B O   1 
ATOM 5838  C CB  . TYR B 2 159 ? 132.723 119.796 83.170  1.00 500.00 ? 159 TYR B CB  1 
ATOM 5839  C CG  . TYR B 2 159 ? 133.846 120.865 83.202  1.00 500.00 ? 159 TYR B CG  1 
ATOM 5840  C CD1 . TYR B 2 159 ? 133.621 122.190 82.776  1.00 500.00 ? 159 TYR B CD1 1 
ATOM 5841  C CD2 . TYR B 2 159 ? 135.152 120.530 83.598  1.00 500.00 ? 159 TYR B CD2 1 
ATOM 5842  C CE1 . TYR B 2 159 ? 134.644 123.142 82.789  1.00 500.00 ? 159 TYR B CE1 1 
ATOM 5843  C CE2 . TYR B 2 159 ? 136.178 121.481 83.612  1.00 500.00 ? 159 TYR B CE2 1 
ATOM 5844  C CZ  . TYR B 2 159 ? 135.920 122.783 83.208  1.00 500.00 ? 159 TYR B CZ  1 
ATOM 5845  O OH  . TYR B 2 159 ? 136.929 123.723 83.220  1.00 500.00 ? 159 TYR B OH  1 
ATOM 5846  N N   . LYS B 2 160 ? 133.276 119.479 86.001  1.00 472.03 ? 160 LYS B N   1 
ATOM 5847  C CA  . LYS B 2 160 ? 133.972 119.656 87.305  1.00 500.00 ? 160 LYS B CA  1 
ATOM 5848  C C   . LYS B 2 160 ? 133.655 120.957 88.061  1.00 496.94 ? 160 LYS B C   1 
ATOM 5849  O O   . LYS B 2 160 ? 133.573 120.938 89.282  1.00 461.88 ? 160 LYS B O   1 
ATOM 5850  C CB  . LYS B 2 160 ? 135.508 119.534 87.146  1.00 500.00 ? 160 LYS B CB  1 
ATOM 5851  C CG  . LYS B 2 160 ? 136.060 118.139 86.818  1.00 500.00 ? 160 LYS B CG  1 
ATOM 5852  C CD  . LYS B 2 160 ? 135.905 117.126 87.951  1.00 500.00 ? 160 LYS B CD  1 
ATOM 5853  C CE  . LYS B 2 160 ? 136.435 115.752 87.547  1.00 466.95 ? 160 LYS B CE  1 
ATOM 5854  N NZ  . LYS B 2 160 ? 135.975 114.659 88.450  1.00 420.77 ? 160 LYS B NZ  1 
ATOM 5855  N N   . VAL B 2 161 ? 133.489 122.063 87.330  1.00 500.00 ? 161 VAL B N   1 
ATOM 5856  C CA  . VAL B 2 161 ? 133.033 123.367 87.874  1.00 500.00 ? 161 VAL B CA  1 
ATOM 5857  C C   . VAL B 2 161 ? 131.802 123.286 88.813  1.00 500.00 ? 161 VAL B C   1 
ATOM 5858  O O   . VAL B 2 161 ? 131.742 124.028 89.798  1.00 500.00 ? 161 VAL B O   1 
ATOM 5859  C CB  . VAL B 2 161 ? 132.792 124.408 86.723  1.00 500.00 ? 161 VAL B CB  1 
ATOM 5860  C CG1 . VAL B 2 161 ? 132.064 125.667 87.202  1.00 500.00 ? 161 VAL B CG1 1 
ATOM 5861  C CG2 . VAL B 2 161 ? 134.111 124.824 86.072  1.00 500.00 ? 161 VAL B CG2 1 
ATOM 5862  N N   . ILE B 2 162 ? 130.844 122.402 88.530  1.00 457.67 ? 162 ILE B N   1 
ATOM 5863  C CA  . ILE B 2 162 ? 129.605 122.320 89.328  1.00 417.04 ? 162 ILE B CA  1 
ATOM 5864  C C   . ILE B 2 162 ? 129.641 121.191 90.371  1.00 413.94 ? 162 ILE B C   1 
ATOM 5865  O O   . ILE B 2 162 ? 128.955 121.269 91.391  1.00 431.60 ? 162 ILE B O   1 
ATOM 5866  C CB  . ILE B 2 162 ? 128.355 122.245 88.423  1.00 431.16 ? 162 ILE B CB  1 
ATOM 5867  C CG1 . ILE B 2 162 ? 128.416 123.304 87.313  1.00 448.35 ? 162 ILE B CG1 1 
ATOM 5868  C CG2 . ILE B 2 162 ? 127.075 122.456 89.226  1.00 467.39 ? 162 ILE B CG2 1 
ATOM 5869  C CD1 . ILE B 2 162 ? 128.430 124.744 87.798  1.00 459.44 ? 162 ILE B CD1 1 
ATOM 5870  N N   . HIS B 2 163 ? 130.432 120.147 90.132  1.00 412.65 ? 163 HIS B N   1 
ATOM 5871  C CA  . HIS B 2 163 ? 130.976 119.363 91.246  1.00 419.78 ? 163 HIS B CA  1 
ATOM 5872  C C   . HIS B 2 163 ? 131.735 120.281 92.194  1.00 412.20 ? 163 HIS B C   1 
ATOM 5873  O O   . HIS B 2 163 ? 131.609 120.153 93.420  1.00 419.02 ? 163 HIS B O   1 
ATOM 5874  C CB  . HIS B 2 163 ? 131.940 118.274 90.761  1.00 500.00 ? 163 HIS B CB  1 
ATOM 5875  C CG  . HIS B 2 163 ? 131.277 117.120 90.070  1.00 500.00 ? 163 HIS B CG  1 
ATOM 5876  N ND1 . HIS B 2 163 ? 130.087 116.569 90.496  1.00 500.00 ? 163 HIS B ND1 1 
ATOM 5877  C CD2 . HIS B 2 163 ? 131.663 116.390 88.994  1.00 500.00 ? 163 HIS B CD2 1 
ATOM 5878  C CE1 . HIS B 2 163 ? 129.760 115.562 89.703  1.00 500.00 ? 163 HIS B CE1 1 
ATOM 5879  N NE2 . HIS B 2 163 ? 130.700 115.433 88.785  1.00 500.00 ? 163 HIS B NE2 1 
ATOM 5880  N N   . ALA B 2 164 ? 132.537 121.179 91.613  1.00 463.87 ? 164 ALA B N   1 
ATOM 5881  C CA  . ALA B 2 164 ? 133.387 122.090 92.346  1.00 498.54 ? 164 ALA B CA  1 
ATOM 5882  C C   . ALA B 2 164 ? 132.630 123.118 93.099  1.00 461.79 ? 164 ALA B C   1 
ATOM 5883  O O   . ALA B 2 164 ? 133.199 123.610 94.044  1.00 351.88 ? 164 ALA B O   1 
ATOM 5884  C CB  . ALA B 2 164 ? 134.438 122.749 91.448  1.00 499.78 ? 164 ALA B CB  1 
ATOM 5885  N N   . TRP B 2 165 ? 131.403 123.468 92.682  1.00 427.60 ? 165 TRP B N   1 
ATOM 5886  C CA  . TRP B 2 165 ? 130.520 124.328 93.478  1.00 387.79 ? 165 TRP B CA  1 
ATOM 5887  C C   . TRP B 2 165 ? 130.361 123.727 94.883  1.00 343.47 ? 165 TRP B C   1 
ATOM 5888  O O   . TRP B 2 165 ? 130.647 124.362 95.925  1.00 338.70 ? 165 TRP B O   1 
ATOM 5889  C CB  . TRP B 2 165 ? 129.153 124.464 92.789  1.00 422.10 ? 165 TRP B CB  1 
ATOM 5890  C CG  . TRP B 2 165 ? 128.094 125.183 93.583  1.00 448.93 ? 165 TRP B CG  1 
ATOM 5891  C CD1 . TRP B 2 165 ? 127.846 126.528 93.595  1.00 471.08 ? 165 TRP B CD1 1 
ATOM 5892  C CD2 . TRP B 2 165 ? 127.121 124.588 94.454  1.00 438.83 ? 165 TRP B CD2 1 
ATOM 5893  N NE1 . TRP B 2 165 ? 126.788 126.808 94.429  1.00 476.28 ? 165 TRP B NE1 1 
ATOM 5894  C CE2 . TRP B 2 165 ? 126.324 125.636 94.969  1.00 466.25 ? 165 TRP B CE2 1 
ATOM 5895  C CE3 . TRP B 2 165 ? 126.853 123.270 94.860  1.00 380.00 ? 165 TRP B CE3 1 
ATOM 5896  C CZ2 . TRP B 2 165 ? 125.275 125.408 95.872  1.00 461.87 ? 165 TRP B CZ2 1 
ATOM 5897  C CZ3 . TRP B 2 165 ? 125.805 123.043 95.754  1.00 387.19 ? 165 TRP B CZ3 1 
ATOM 5898  C CH2 . TRP B 2 165 ? 125.031 124.109 96.248  1.00 441.65 ? 165 TRP B CH2 1 
ATOM 5899  N N   . LEU B 2 166 ? 129.974 122.463 94.849  1.00 356.22 ? 166 LEU B N   1 
ATOM 5900  C CA  . LEU B 2 166 ? 129.805 121.662 96.089  1.00 372.97 ? 166 LEU B CA  1 
ATOM 5901  C C   . LEU B 2 166 ? 131.144 121.583 96.817  1.00 357.29 ? 166 LEU B C   1 
ATOM 5902  O O   . LEU B 2 166 ? 131.201 121.768 98.041  1.00 374.20 ? 166 LEU B O   1 
ATOM 5903  C CB  . LEU B 2 166 ? 129.237 120.260 95.849  1.00 389.26 ? 166 LEU B CB  1 
ATOM 5904  C CG  . LEU B 2 166 ? 127.767 120.044 96.242  1.00 431.30 ? 166 LEU B CG  1 
ATOM 5905  C CD1 . LEU B 2 166 ? 127.441 118.562 96.114  1.00 494.53 ? 166 LEU B CD1 1 
ATOM 5906  C CD2 . LEU B 2 166 ? 127.422 120.539 97.647  1.00 370.18 ? 166 LEU B CD2 1 
ATOM 5907  N N   . ILE B 2 167 ? 132.202 121.325 96.028  1.00 382.40 ? 167 ILE B N   1 
ATOM 5908  C CA  . ILE B 2 167 ? 133.535 121.207 96.645  1.00 424.71 ? 167 ILE B CA  1 
ATOM 5909  C C   . ILE B 2 167 ? 133.954 122.516 97.263  1.00 369.42 ? 167 ILE B C   1 
ATOM 5910  O O   . ILE B 2 167 ? 134.502 122.500 98.367  1.00 380.67 ? 167 ILE B O   1 
ATOM 5911  C CB  . ILE B 2 167 ? 134.676 120.555 95.779  1.00 500.00 ? 167 ILE B CB  1 
ATOM 5912  C CG1 . ILE B 2 167 ? 135.518 121.569 94.950  1.00 500.00 ? 167 ILE B CG1 1 
ATOM 5913  C CG2 . ILE B 2 167 ? 134.154 119.372 94.954  1.00 500.00 ? 167 ILE B CG2 1 
ATOM 5914  C CD1 . ILE B 2 167 ? 136.788 122.075 95.613  1.00 500.00 ? 167 ILE B CD1 1 
ATOM 5915  N N   . ILE B 2 168 ? 133.661 123.615 96.582  1.00 343.94 ? 168 ILE B N   1 
ATOM 5916  C CA  . ILE B 2 168 ? 133.958 124.964 97.078  1.00 425.26 ? 168 ILE B CA  1 
ATOM 5917  C C   . ILE B 2 168 ? 133.272 125.187 98.426  1.00 397.30 ? 168 ILE B C   1 
ATOM 5918  O O   . ILE B 2 168 ? 133.891 125.681 99.382  1.00 413.79 ? 168 ILE B O   1 
ATOM 5919  C CB  . ILE B 2 168 ? 133.591 126.066 96.030  1.00 500.00 ? 168 ILE B CB  1 
ATOM 5920  C CG1 . ILE B 2 168 ? 134.844 126.503 95.244  1.00 500.00 ? 168 ILE B CG1 1 
ATOM 5921  C CG2 . ILE B 2 168 ? 132.971 127.316 96.664  1.00 500.00 ? 168 ILE B CG2 1 
ATOM 5922  C CD1 . ILE B 2 168 ? 135.557 125.424 94.443  1.00 500.00 ? 168 ILE B CD1 1 
ATOM 5923  N N   . SER B 2 169 ? 131.999 124.808 98.460  1.00 377.35 ? 169 SER B N   1 
ATOM 5924  C CA  . SER B 2 169 ? 131.166 124.942 99.657  1.00 376.13 ? 169 SER B CA  1 
ATOM 5925  C C   . SER B 2 169 ? 131.795 124.171 100.820 1.00 379.04 ? 169 SER B C   1 
ATOM 5926  O O   . SER B 2 169 ? 131.901 124.687 101.947 1.00 392.51 ? 169 SER B O   1 
ATOM 5927  C CB  . SER B 2 169 ? 129.711 124.500 99.423  1.00 399.21 ? 169 SER B CB  1 
ATOM 5928  O OG  . SER B 2 169 ? 128.823 125.064 100.387 1.00 322.97 ? 169 SER B OG  1 
ATOM 5929  N N   . SER B 2 170 ? 132.199 122.947 100.506 1.00 374.66 ? 170 SER B N   1 
ATOM 5930  C CA  . SER B 2 170 ? 132.828 122.049 101.479 1.00 393.14 ? 170 SER B CA  1 
ATOM 5931  C C   . SER B 2 170 ? 134.083 122.691 102.058 1.00 359.63 ? 170 SER B C   1 
ATOM 5932  O O   . SER B 2 170 ? 134.303 122.681 103.268 1.00 324.52 ? 170 SER B O   1 
ATOM 5933  C CB  . SER B 2 170 ? 133.115 120.656 100.903 1.00 429.66 ? 170 SER B CB  1 
ATOM 5934  O OG  . SER B 2 170 ? 134.198 120.663 99.995  1.00 444.93 ? 170 SER B OG  1 
ATOM 5935  N N   . LEU B 2 171 ? 134.880 123.240 101.157 1.00 358.87 ? 171 LEU B N   1 
ATOM 5936  C CA  . LEU B 2 171 ? 136.140 123.918 101.495 1.00 393.76 ? 171 LEU B CA  1 
ATOM 5937  C C   . LEU B 2 171 ? 135.868 125.056 102.469 1.00 390.93 ? 171 LEU B C   1 
ATOM 5938  O O   . LEU B 2 171 ? 136.561 125.205 103.491 1.00 375.92 ? 171 LEU B O   1 
ATOM 5939  C CB  . LEU B 2 171 ? 136.815 124.432 100.199 1.00 440.58 ? 171 LEU B CB  1 
ATOM 5940  C CG  . LEU B 2 171 ? 137.714 125.685 100.114 1.00 469.67 ? 171 LEU B CG  1 
ATOM 5941  C CD1 . LEU B 2 171 ? 138.716 125.525 98.970  1.00 472.52 ? 171 LEU B CD1 1 
ATOM 5942  C CD2 . LEU B 2 171 ? 136.934 126.992 99.943  1.00 451.06 ? 171 LEU B CD2 1 
ATOM 5943  N N   . LEU B 2 172 ? 134.855 125.839 102.121 1.00 412.59 ? 172 LEU B N   1 
ATOM 5944  C CA  . LEU B 2 172 ? 134.428 126.994 102.921 1.00 428.11 ? 172 LEU B CA  1 
ATOM 5945  C C   . LEU B 2 172 ? 134.063 126.549 104.330 1.00 381.72 ? 172 LEU B C   1 
ATOM 5946  O O   . LEU B 2 172 ? 134.484 127.146 105.337 1.00 381.19 ? 172 LEU B O   1 
ATOM 5947  C CB  . LEU B 2 172 ? 133.246 127.723 102.260 1.00 464.18 ? 172 LEU B CB  1 
ATOM 5948  C CG  . LEU B 2 172 ? 132.432 128.738 103.086 1.00 477.84 ? 172 LEU B CG  1 
ATOM 5949  C CD1 . LEU B 2 172 ? 131.804 129.788 102.174 1.00 500.00 ? 172 LEU B CD1 1 
ATOM 5950  C CD2 . LEU B 2 172 ? 131.365 128.079 103.964 1.00 438.48 ? 172 LEU B CD2 1 
ATOM 5951  N N   . LEU B 2 173 ? 133.284 125.480 104.377 1.00 346.27 ? 173 LEU B N   1 
ATOM 5952  C CA  . LEU B 2 173 ? 132.843 124.868 105.642 1.00 395.17 ? 173 LEU B CA  1 
ATOM 5953  C C   . LEU B 2 173 ? 134.114 124.329 106.344 1.00 360.31 ? 173 LEU B C   1 
ATOM 5954  O O   . LEU B 2 173 ? 134.358 124.585 107.568 1.00 351.83 ? 173 LEU B O   1 
ATOM 5955  C CB  . LEU B 2 173 ? 131.816 123.771 105.372 1.00 397.95 ? 173 LEU B CB  1 
ATOM 5956  C CG  . LEU B 2 173 ? 131.458 122.891 106.571 1.00 402.52 ? 173 LEU B CG  1 
ATOM 5957  C CD1 . LEU B 2 173 ? 130.019 122.404 106.448 1.00 426.51 ? 173 LEU B CD1 1 
ATOM 5958  C CD2 . LEU B 2 173 ? 132.450 121.739 106.726 1.00 369.20 ? 173 LEU B CD2 1 
ATOM 5959  N N   . LEU B 2 174 ? 134.847 123.526 105.569 1.00 334.92 ? 174 LEU B N   1 
ATOM 5960  C CA  . LEU B 2 174 ? 136.021 122.830 106.087 1.00 380.30 ? 174 LEU B CA  1 
ATOM 5961  C C   . LEU B 2 174 ? 137.050 123.799 106.632 1.00 395.81 ? 174 LEU B C   1 
ATOM 5962  O O   . LEU B 2 174 ? 137.600 123.574 107.699 1.00 416.14 ? 174 LEU B O   1 
ATOM 5963  C CB  . LEU B 2 174 ? 136.676 121.863 105.086 1.00 422.27 ? 174 LEU B CB  1 
ATOM 5964  C CG  . LEU B 2 174 ? 136.796 120.425 105.632 1.00 478.82 ? 174 LEU B CG  1 
ATOM 5965  C CD1 . LEU B 2 174 ? 137.461 119.502 104.615 1.00 500.00 ? 174 LEU B CD1 1 
ATOM 5966  C CD2 . LEU B 2 174 ? 137.505 120.352 106.988 1.00 462.12 ? 174 LEU B CD2 1 
ATOM 5967  N N   . PHE B 2 175 ? 137.319 124.877 105.913 1.00 388.82 ? 175 PHE B N   1 
ATOM 5968  C CA  . PHE B 2 175 ? 138.186 125.907 106.446 1.00 393.11 ? 175 PHE B CA  1 
ATOM 5969  C C   . PHE B 2 175 ? 137.414 126.761 107.447 1.00 408.00 ? 175 PHE B C   1 
ATOM 5970  O O   . PHE B 2 175 ? 137.628 126.619 108.643 1.00 365.59 ? 175 PHE B O   1 
ATOM 5971  C CB  . PHE B 2 175 ? 138.789 126.784 105.337 1.00 437.61 ? 175 PHE B CB  1 
ATOM 5972  C CG  . PHE B 2 175 ? 139.797 126.082 104.447 1.00 448.62 ? 175 PHE B CG  1 
ATOM 5973  C CD1 . PHE B 2 175 ? 140.674 125.100 104.934 1.00 445.23 ? 175 PHE B CD1 1 
ATOM 5974  C CD2 . PHE B 2 175 ? 139.911 126.454 103.110 1.00 455.04 ? 175 PHE B CD2 1 
ATOM 5975  C CE1 . PHE B 2 175 ? 141.601 124.494 104.096 1.00 420.86 ? 175 PHE B CE1 1 
ATOM 5976  C CE2 . PHE B 2 175 ? 140.840 125.850 102.273 1.00 432.77 ? 175 PHE B CE2 1 
ATOM 5977  C CZ  . PHE B 2 175 ? 141.685 124.871 102.766 1.00 420.08 ? 175 PHE B CZ  1 
ATOM 5978  N N   . PHE B 2 176 ? 136.458 127.559 106.951 1.00 449.45 ? 176 PHE B N   1 
ATOM 5979  C CA  . PHE B 2 176 ? 136.032 128.813 107.576 1.00 443.18 ? 176 PHE B CA  1 
ATOM 5980  C C   . PHE B 2 176 ? 135.269 128.427 108.829 1.00 426.31 ? 176 PHE B C   1 
ATOM 5981  O O   . PHE B 2 176 ? 135.632 128.831 109.947 1.00 458.73 ? 176 PHE B O   1 
ATOM 5982  C CB  . PHE B 2 176 ? 135.131 129.617 106.614 1.00 398.76 ? 176 PHE B CB  1 
ATOM 5983  C CG  . PHE B 2 176 ? 135.156 131.096 106.827 1.00 444.71 ? 176 PHE B CG  1 
ATOM 5984  C CD1 . PHE B 2 176 ? 136.319 131.825 106.585 1.00 478.34 ? 176 PHE B CD1 1 
ATOM 5985  C CD2 . PHE B 2 176 ? 134.004 131.781 107.208 1.00 487.69 ? 176 PHE B CD2 1 
ATOM 5986  C CE1 . PHE B 2 176 ? 136.342 133.203 106.758 1.00 500.00 ? 176 PHE B CE1 1 
ATOM 5987  C CE2 . PHE B 2 176 ? 134.020 133.161 107.379 1.00 500.00 ? 176 PHE B CE2 1 
ATOM 5988  C CZ  . PHE B 2 176 ? 135.191 133.873 107.154 1.00 500.00 ? 176 PHE B CZ  1 
ATOM 5989  N N   . PHE B 2 177 ? 134.225 127.627 108.615 1.00 376.79 ? 177 PHE B N   1 
ATOM 5990  C CA  . PHE B 2 177 ? 133.379 127.200 109.754 1.00 372.43 ? 177 PHE B CA  1 
ATOM 5991  C C   . PHE B 2 177 ? 134.211 126.352 110.705 1.00 355.65 ? 177 PHE B C   1 
ATOM 5992  O O   . PHE B 2 177 ? 134.085 126.541 111.922 1.00 339.02 ? 177 PHE B O   1 
ATOM 5993  C CB  . PHE B 2 177 ? 132.087 126.489 109.346 1.00 397.38 ? 177 PHE B CB  1 
ATOM 5994  C CG  . PHE B 2 177 ? 130.986 127.425 108.933 1.00 446.18 ? 177 PHE B CG  1 
ATOM 5995  C CD1 . PHE B 2 177 ? 130.660 128.541 109.705 1.00 472.00 ? 177 PHE B CD1 1 
ATOM 5996  C CD2 . PHE B 2 177 ? 130.255 127.185 107.775 1.00 500.00 ? 177 PHE B CD2 1 
ATOM 5997  C CE1 . PHE B 2 177 ? 129.646 129.403 109.321 1.00 500.00 ? 177 PHE B CE1 1 
ATOM 5998  C CE2 . PHE B 2 177 ? 129.235 128.043 107.386 1.00 500.00 ? 177 PHE B CE2 1 
ATOM 5999  C CZ  . PHE B 2 177 ? 128.931 129.154 108.161 1.00 500.00 ? 177 PHE B CZ  1 
ATOM 6000  N N   . SER B 2 178 ? 135.057 125.483 110.163 1.00 332.78 ? 178 SER B N   1 
ATOM 6001  C CA  . SER B 2 178 ? 135.895 124.662 111.042 1.00 395.35 ? 178 SER B CA  1 
ATOM 6002  C C   . SER B 2 178 ? 136.850 125.504 111.838 1.00 381.58 ? 178 SER B C   1 
ATOM 6003  O O   . SER B 2 178 ? 137.020 125.245 113.033 1.00 328.20 ? 178 SER B O   1 
ATOM 6004  C CB  . SER B 2 178 ? 136.660 123.575 110.305 1.00 461.16 ? 178 SER B CB  1 
ATOM 6005  O OG  . SER B 2 178 ? 137.103 122.575 111.211 1.00 489.17 ? 178 SER B OG  1 
ATOM 6006  N N   . PHE B 2 179 ? 137.412 126.521 111.198 1.00 409.74 ? 179 PHE B N   1 
ATOM 6007  C CA  . PHE B 2 179 ? 138.313 127.481 111.855 1.00 396.64 ? 179 PHE B CA  1 
ATOM 6008  C C   . PHE B 2 179 ? 137.601 128.144 113.029 1.00 353.36 ? 179 PHE B C   1 
ATOM 6009  O O   . PHE B 2 179 ? 138.152 128.249 114.138 1.00 285.52 ? 179 PHE B O   1 
ATOM 6010  C CB  . PHE B 2 179 ? 138.807 128.520 110.832 1.00 410.67 ? 179 PHE B CB  1 
ATOM 6011  C CG  . PHE B 2 179 ? 139.266 129.810 111.426 1.00 431.73 ? 179 PHE B CG  1 
ATOM 6012  C CD1 . PHE B 2 179 ? 140.518 129.906 112.018 1.00 489.08 ? 179 PHE B CD1 1 
ATOM 6013  C CD2 . PHE B 2 179 ? 138.462 130.944 111.362 1.00 494.63 ? 179 PHE B CD2 1 
ATOM 6014  C CE1 . PHE B 2 179 ? 140.955 131.108 112.557 1.00 500.00 ? 179 PHE B CE1 1 
ATOM 6015  C CE2 . PHE B 2 179 ? 138.891 132.148 111.898 1.00 500.00 ? 179 PHE B CE2 1 
ATOM 6016  C CZ  . PHE B 2 179 ? 140.140 132.232 112.498 1.00 500.00 ? 179 PHE B CZ  1 
ATOM 6017  N N   . ILE B 2 180 ? 136.378 128.578 112.748 1.00 368.68 ? 180 ILE B N   1 
ATOM 6018  C CA  . ILE B 2 180 ? 135.521 129.246 113.733 1.00 379.93 ? 180 ILE B CA  1 
ATOM 6019  C C   . ILE B 2 180 ? 135.306 128.337 114.940 1.00 358.01 ? 180 ILE B C   1 
ATOM 6020  O O   . ILE B 2 180 ? 135.428 128.769 116.095 1.00 357.82 ? 180 ILE B O   1 
ATOM 6021  C CB  . ILE B 2 180 ? 134.152 129.614 113.108 1.00 412.12 ? 180 ILE B CB  1 
ATOM 6022  C CG1 . ILE B 2 180 ? 134.315 130.760 112.103 1.00 420.77 ? 180 ILE B CG1 1 
ATOM 6023  C CG2 . ILE B 2 180 ? 133.126 129.998 114.173 1.00 447.62 ? 180 ILE B CG2 1 
ATOM 6024  C CD1 . ILE B 2 180 ? 133.236 130.795 111.039 1.00 436.06 ? 180 ILE B CD1 1 
ATOM 6025  N N   . TYR B 2 181 ? 134.986 127.091 114.632 1.00 341.74 ? 181 TYR B N   1 
ATOM 6026  C CA  . TYR B 2 181 ? 134.735 126.055 115.643 1.00 379.07 ? 181 TYR B CA  1 
ATOM 6027  C C   . TYR B 2 181 ? 135.959 125.891 116.539 1.00 369.64 ? 181 TYR B C   1 
ATOM 6028  O O   . TYR B 2 181 ? 135.840 125.842 117.769 1.00 386.02 ? 181 TYR B O   1 
ATOM 6029  C CB  . TYR B 2 181 ? 134.335 124.726 114.988 1.00 434.95 ? 181 TYR B CB  1 
ATOM 6030  C CG  . TYR B 2 181 ? 134.513 123.480 115.841 1.00 423.11 ? 181 TYR B CG  1 
ATOM 6031  C CD1 . TYR B 2 181 ? 133.578 123.138 116.824 1.00 347.46 ? 181 TYR B CD1 1 
ATOM 6032  C CD2 . TYR B 2 181 ? 135.599 122.624 115.637 1.00 428.75 ? 181 TYR B CD2 1 
ATOM 6033  C CE1 . TYR B 2 181 ? 133.734 121.993 117.588 1.00 354.85 ? 181 TYR B CE1 1 
ATOM 6034  C CE2 . TYR B 2 181 ? 135.760 121.476 116.400 1.00 449.96 ? 181 TYR B CE2 1 
ATOM 6035  C CZ  . TYR B 2 181 ? 134.827 121.163 117.376 1.00 424.02 ? 181 TYR B CZ  1 
ATOM 6036  O OH  . TYR B 2 181 ? 134.986 120.024 118.140 1.00 430.02 ? 181 TYR B OH  1 
ATOM 6037  N N   . LEU B 2 182 ? 137.107 125.814 115.887 1.00 343.96 ? 182 LEU B N   1 
ATOM 6038  C CA  . LEU B 2 182 ? 138.401 125.653 116.559 1.00 365.42 ? 182 LEU B CA  1 
ATOM 6039  C C   . LEU B 2 182 ? 138.624 126.805 117.539 1.00 370.75 ? 182 LEU B C   1 
ATOM 6040  O O   . LEU B 2 182 ? 139.016 126.596 118.704 1.00 378.52 ? 182 LEU B O   1 
ATOM 6041  C CB  . LEU B 2 182 ? 139.527 125.600 115.516 1.00 396.72 ? 182 LEU B CB  1 
ATOM 6042  C CG  . LEU B 2 182 ? 140.725 124.724 115.895 1.00 451.57 ? 182 LEU B CG  1 
ATOM 6043  C CD1 . LEU B 2 182 ? 140.377 123.243 115.782 1.00 487.77 ? 182 LEU B CD1 1 
ATOM 6044  C CD2 . LEU B 2 182 ? 141.953 125.042 115.051 1.00 456.67 ? 182 LEU B CD2 1 
ATOM 6045  N N   . GLY B 2 183 ? 138.365 128.005 117.029 1.00 329.58 ? 183 GLY B N   1 
ATOM 6046  C CA  . GLY B 2 183 ? 138.516 129.241 117.800 1.00 353.86 ? 183 GLY B CA  1 
ATOM 6047  C C   . GLY B 2 183 ? 137.647 129.193 119.048 1.00 372.31 ? 183 GLY B C   1 
ATOM 6048  O O   . GLY B 2 183 ? 138.096 129.520 120.155 1.00 368.76 ? 183 GLY B O   1 
ATOM 6049  N N   . GLU B 2 184 ? 136.408 128.781 118.833 1.00 375.76 ? 184 GLU B N   1 
ATOM 6050  C CA  . GLU B 2 184 ? 135.408 128.661 119.902 1.00 382.59 ? 184 GLU B CA  1 
ATOM 6051  C C   . GLU B 2 184 ? 135.902 127.712 120.979 1.00 326.26 ? 184 GLU B C   1 
ATOM 6052  O O   . GLU B 2 184 ? 135.814 128.013 122.173 1.00 343.70 ? 184 GLU B O   1 
ATOM 6053  C CB  . GLU B 2 184 ? 134.037 128.280 119.333 1.00 442.31 ? 184 GLU B CB  1 
ATOM 6054  C CG  . GLU B 2 184 ? 133.107 129.471 119.098 1.00 500.00 ? 184 GLU B CG  1 
ATOM 6055  C CD  . GLU B 2 184 ? 133.785 130.761 118.625 1.00 500.00 ? 184 GLU B CD  1 
ATOM 6056  O OE1 . GLU B 2 184 ? 134.163 130.843 117.440 1.00 500.00 ? 184 GLU B OE1 1 
ATOM 6057  O OE2 . GLU B 2 184 ? 133.914 131.711 119.433 1.00 475.28 ? 184 GLU B OE2 1 
ATOM 6058  N N   . VAL B 2 185 ? 136.416 126.581 120.524 1.00 307.94 ? 185 VAL B N   1 
ATOM 6059  C CA  . VAL B 2 185 ? 136.956 125.529 121.398 1.00 305.56 ? 185 VAL B CA  1 
ATOM 6060  C C   . VAL B 2 185 ? 138.068 126.107 122.272 1.00 309.13 ? 185 VAL B C   1 
ATOM 6061  O O   . VAL B 2 185 ? 138.103 125.886 123.499 1.00 313.07 ? 185 VAL B O   1 
ATOM 6062  C CB  . VAL B 2 185 ? 137.551 124.375 120.554 1.00 383.07 ? 185 VAL B CB  1 
ATOM 6063  C CG1 . VAL B 2 185 ? 138.470 123.468 121.375 1.00 436.67 ? 185 VAL B CG1 1 
ATOM 6064  C CG2 . VAL B 2 185 ? 136.438 123.567 119.893 1.00 451.46 ? 185 VAL B CG2 1 
ATOM 6065  N N   . PHE B 2 186 ? 138.958 126.834 121.603 1.00 308.46 ? 186 PHE B N   1 
ATOM 6066  C CA  . PHE B 2 186 ? 140.105 127.462 122.260 1.00 326.69 ? 186 PHE B CA  1 
ATOM 6067  C C   . PHE B 2 186 ? 139.631 128.417 123.358 1.00 331.88 ? 186 PHE B C   1 
ATOM 6068  O O   . PHE B 2 186 ? 140.154 128.408 124.478 1.00 286.98 ? 186 PHE B O   1 
ATOM 6069  C CB  . PHE B 2 186 ? 141.063 128.097 121.265 1.00 320.76 ? 186 PHE B CB  1 
ATOM 6070  C CG  . PHE B 2 186 ? 141.830 127.104 120.445 1.00 378.42 ? 186 PHE B CG  1 
ATOM 6071  C CD1 . PHE B 2 186 ? 142.453 126.000 121.042 1.00 413.57 ? 186 PHE B CD1 1 
ATOM 6072  C CD2 . PHE B 2 186 ? 141.970 127.286 119.072 1.00 412.06 ? 186 PHE B CD2 1 
ATOM 6073  C CE1 . PHE B 2 186 ? 143.166 125.088 120.279 1.00 464.40 ? 186 PHE B CE1 1 
ATOM 6074  C CE2 . PHE B 2 186 ? 142.688 126.376 118.306 1.00 444.68 ? 186 PHE B CE2 1 
ATOM 6075  C CZ  . PHE B 2 186 ? 143.284 125.275 118.909 1.00 477.37 ? 186 PHE B CZ  1 
ATOM 6076  N N   . LYS B 2 187 ? 138.637 129.213 122.997 1.00 346.23 ? 187 LYS B N   1 
ATOM 6077  C CA  . LYS B 2 187 ? 138.031 130.196 123.901 1.00 357.41 ? 187 LYS B CA  1 
ATOM 6078  C C   . LYS B 2 187 ? 137.487 129.500 125.142 1.00 333.29 ? 187 LYS B C   1 
ATOM 6079  O O   . LYS B 2 187 ? 137.715 129.946 126.274 1.00 389.27 ? 187 LYS B O   1 
ATOM 6080  C CB  . LYS B 2 187 ? 136.915 131.015 123.210 1.00 388.82 ? 187 LYS B CB  1 
ATOM 6081  C CG  . LYS B 2 187 ? 137.325 131.843 121.980 1.00 410.90 ? 187 LYS B CG  1 
ATOM 6082  C CD  . LYS B 2 187 ? 138.266 133.011 122.278 1.00 451.08 ? 187 LYS B CD  1 
ATOM 6083  C CE  . LYS B 2 187 ? 139.128 133.404 121.077 1.00 417.90 ? 187 LYS B CE  1 
ATOM 6084  N NZ  . LYS B 2 187 ? 138.339 133.806 119.880 1.00 426.13 ? 187 LYS B NZ  1 
ATOM 6085  N N   . THR B 2 188 ? 136.774 128.414 124.889 1.00 346.55 ? 188 THR B N   1 
ATOM 6086  C CA  . THR B 2 188 ? 136.161 127.592 125.941 1.00 398.98 ? 188 THR B CA  1 
ATOM 6087  C C   . THR B 2 188 ? 137.231 127.098 126.906 1.00 358.78 ? 188 THR B C   1 
ATOM 6088  O O   . THR B 2 188 ? 137.071 127.184 128.139 1.00 375.21 ? 188 THR B O   1 
ATOM 6089  C CB  . THR B 2 188 ? 135.484 126.345 125.337 1.00 433.22 ? 188 THR B CB  1 
ATOM 6090  O OG1 . THR B 2 188 ? 134.660 126.736 124.231 1.00 432.04 ? 188 THR B OG1 1 
ATOM 6091  C CG2 . THR B 2 188 ? 134.646 125.610 126.387 1.00 474.59 ? 188 THR B CG2 1 
ATOM 6092  N N   . TYR B 2 189 ? 138.309 126.592 126.313 1.00 292.65 ? 189 TYR B N   1 
ATOM 6093  C CA  . TYR B 2 189 ? 139.452 126.076 127.070 1.00 364.56 ? 189 TYR B CA  1 
ATOM 6094  C C   . TYR B 2 189 ? 140.386 127.201 127.483 1.00 357.31 ? 189 TYR B C   1 
ATOM 6095  O O   . TYR B 2 189 ? 141.197 127.018 128.382 1.00 382.08 ? 189 TYR B O   1 
ATOM 6096  C CB  . TYR B 2 189 ? 140.105 124.871 126.395 1.00 404.86 ? 189 TYR B CB  1 
ATOM 6097  C CG  . TYR B 2 189 ? 139.406 123.613 126.867 1.00 439.50 ? 189 TYR B CG  1 
ATOM 6098  C CD1 . TYR B 2 189 ? 138.046 123.411 126.600 1.00 439.51 ? 189 TYR B CD1 1 
ATOM 6099  C CD2 . TYR B 2 189 ? 140.067 122.670 127.650 1.00 472.67 ? 189 TYR B CD2 1 
ATOM 6100  C CE1 . TYR B 2 189 ? 137.381 122.285 127.059 1.00 444.94 ? 189 TYR B CE1 1 
ATOM 6101  C CE2 . TYR B 2 189 ? 139.409 121.539 128.113 1.00 497.05 ? 189 TYR B CE2 1 
ATOM 6102  C CZ  . TYR B 2 189 ? 138.070 121.350 127.815 1.00 485.90 ? 189 TYR B CZ  1 
ATOM 6103  O OH  . TYR B 2 189 ? 137.420 120.227 128.272 1.00 500.00 ? 189 TYR B OH  1 
ATOM 6104  N N   . ASN B 2 190 ? 140.209 128.375 126.876 1.00 341.56 ? 190 ASN B N   1 
ATOM 6105  C CA  . ASN B 2 190 ? 140.779 129.636 127.357 1.00 386.25 ? 190 ASN B CA  1 
ATOM 6106  C C   . ASN B 2 190 ? 142.282 129.515 127.559 1.00 378.36 ? 190 ASN B C   1 
ATOM 6107  O O   . ASN B 2 190 ? 142.810 129.832 128.632 1.00 383.30 ? 190 ASN B O   1 
ATOM 6108  C CB  . ASN B 2 190 ? 140.062 130.094 128.647 1.00 431.41 ? 190 ASN B CB  1 
ATOM 6109  C CG  . ASN B 2 190 ? 140.236 131.587 128.939 1.00 435.64 ? 190 ASN B CG  1 
ATOM 6110  O OD1 . ASN B 2 190 ? 139.320 132.385 128.721 1.00 393.86 ? 190 ASN B OD1 1 
ATOM 6111  N ND2 . ASN B 2 190 ? 141.399 131.966 129.465 1.00 430.14 ? 190 ASN B ND2 1 
ATOM 6112  N N   . VAL B 2 191 ? 142.957 129.022 126.526 1.00 364.43 ? 191 VAL B N   1 
ATOM 6113  C CA  . VAL B 2 191 ? 144.410 128.931 126.537 1.00 370.95 ? 191 VAL B CA  1 
ATOM 6114  C C   . VAL B 2 191 ? 144.962 129.717 125.356 1.00 377.24 ? 191 VAL B C   1 
ATOM 6115  O O   . VAL B 2 191 ? 144.285 129.916 124.342 1.00 290.37 ? 191 VAL B O   1 
ATOM 6116  C CB  . VAL B 2 191 ? 144.933 127.474 126.503 1.00 384.43 ? 191 VAL B CB  1 
ATOM 6117  C CG1 . VAL B 2 191 ? 146.298 127.377 127.191 1.00 372.46 ? 191 VAL B CG1 1 
ATOM 6118  C CG2 . VAL B 2 191 ? 143.953 126.525 127.176 1.00 413.80 ? 191 VAL B CG2 1 
ATOM 6119  N N   . ALA B 2 192 ? 146.190 130.195 125.531 1.00 446.66 ? 192 ALA B N   1 
ATOM 6120  C CA  . ALA B 2 192 ? 146.895 130.939 124.505 1.00 459.38 ? 192 ALA B CA  1 
ATOM 6121  C C   . ALA B 2 192 ? 147.215 130.038 123.335 1.00 410.56 ? 192 ALA B C   1 
ATOM 6122  O O   . ALA B 2 192 ? 148.051 129.134 123.437 1.00 415.08 ? 192 ALA B O   1 
ATOM 6123  C CB  . ALA B 2 192 ? 148.178 131.530 125.066 1.00 500.00 ? 192 ALA B CB  1 
ATOM 6124  N N   . VAL B 2 193 ? 146.534 130.281 122.223 1.00 377.25 ? 193 VAL B N   1 
ATOM 6125  C CA  . VAL B 2 193 ? 146.907 129.670 120.963 1.00 389.90 ? 193 VAL B CA  1 
ATOM 6126  C C   . VAL B 2 193 ? 147.040 130.794 119.954 1.00 353.25 ? 193 VAL B C   1 
ATOM 6127  O O   . VAL B 2 193 ? 146.293 131.780 119.997 1.00 288.80 ? 193 VAL B O   1 
ATOM 6128  C CB  . VAL B 2 193 ? 145.903 128.592 120.517 1.00 432.40 ? 193 VAL B CB  1 
ATOM 6129  C CG1 . VAL B 2 193 ? 146.355 127.948 119.213 1.00 445.18 ? 193 VAL B CG1 1 
ATOM 6130  C CG2 . VAL B 2 193 ? 145.757 127.529 121.606 1.00 424.57 ? 193 VAL B CG2 1 
ATOM 6131  N N   . ASP B 2 194 ? 148.020 130.628 119.067 1.00 389.74 ? 194 ASP B N   1 
ATOM 6132  C CA  . ASP B 2 194 ? 148.438 131.665 118.127 1.00 426.73 ? 194 ASP B CA  1 
ATOM 6133  C C   . ASP B 2 194 ? 147.823 131.463 116.768 1.00 384.45 ? 194 ASP B C   1 
ATOM 6134  O O   . ASP B 2 194 ? 147.405 130.356 116.429 1.00 362.38 ? 194 ASP B O   1 
ATOM 6135  C CB  . ASP B 2 194 ? 149.972 131.723 117.990 1.00 470.10 ? 194 ASP B CB  1 
ATOM 6136  C CG  . ASP B 2 194 ? 150.590 130.404 117.565 1.00 489.04 ? 194 ASP B CG  1 
ATOM 6137  O OD1 . ASP B 2 194 ? 150.526 130.081 116.365 1.00 428.84 ? 194 ASP B OD1 1 
ATOM 6138  O OD2 . ASP B 2 194 ? 151.159 129.700 118.425 1.00 500.00 ? 194 ASP B OD2 1 
ATOM 6139  N N   . TYR B 2 195 ? 147.794 132.545 115.991 1.00 376.24 ? 195 TYR B N   1 
ATOM 6140  C CA  . TYR B 2 195 ? 147.309 132.497 114.620 1.00 385.32 ? 195 TYR B CA  1 
ATOM 6141  C C   . TYR B 2 195 ? 148.074 131.471 113.819 1.00 370.50 ? 195 TYR B C   1 
ATOM 6142  O O   . TYR B 2 195 ? 147.433 130.768 113.010 1.00 387.46 ? 195 TYR B O   1 
ATOM 6143  C CB  . TYR B 2 195 ? 147.377 133.861 113.915 1.00 425.19 ? 195 TYR B CB  1 
ATOM 6144  C CG  . TYR B 2 195 ? 146.196 134.772 114.188 1.00 453.95 ? 195 TYR B CG  1 
ATOM 6145  C CD1 . TYR B 2 195 ? 144.998 134.621 113.490 1.00 487.91 ? 195 TYR B CD1 1 
ATOM 6146  C CD2 . TYR B 2 195 ? 146.282 135.796 115.133 1.00 448.50 ? 195 TYR B CD2 1 
ATOM 6147  C CE1 . TYR B 2 195 ? 143.917 135.460 113.733 1.00 500.00 ? 195 TYR B CE1 1 
ATOM 6148  C CE2 . TYR B 2 195 ? 145.209 136.642 115.384 1.00 452.24 ? 195 TYR B CE2 1 
ATOM 6149  C CZ  . TYR B 2 195 ? 144.028 136.472 114.686 1.00 500.00 ? 195 TYR B CZ  1 
ATOM 6150  O OH  . TYR B 2 195 ? 142.966 137.310 114.941 1.00 500.00 ? 195 TYR B OH  1 
ATOM 6151  N N   . ILE B 2 196 ? 149.381 131.321 114.076 1.00 345.25 ? 196 ILE B N   1 
ATOM 6152  C CA  . ILE B 2 196 ? 150.251 130.578 113.163 1.00 368.50 ? 196 ILE B CA  1 
ATOM 6153  C C   . ILE B 2 196 ? 149.864 129.089 113.240 1.00 360.90 ? 196 ILE B C   1 
ATOM 6154  O O   . ILE B 2 196 ? 149.643 128.395 112.222 1.00 375.16 ? 196 ILE B O   1 
ATOM 6155  C CB  . ILE B 2 196 ? 151.756 130.780 113.483 1.00 392.13 ? 196 ILE B CB  1 
ATOM 6156  C CG1 . ILE B 2 196 ? 152.145 132.269 113.391 1.00 439.01 ? 196 ILE B CG1 1 
ATOM 6157  C CG2 . ILE B 2 196 ? 152.630 129.940 112.556 1.00 438.72 ? 196 ILE B CG2 1 
ATOM 6158  C CD1 . ILE B 2 196 ? 151.824 132.951 112.072 1.00 455.89 ? 196 ILE B CD1 1 
ATOM 6159  N N   . THR B 2 197 ? 149.886 128.617 114.475 1.00 355.06 ? 197 THR B N   1 
ATOM 6160  C CA  . THR B 2 197 ? 149.634 127.210 114.802 1.00 378.56 ? 197 THR B CA  1 
ATOM 6161  C C   . THR B 2 197 ? 148.262 126.790 114.284 1.00 341.27 ? 197 THR B C   1 
ATOM 6162  O O   . THR B 2 197 ? 148.108 125.732 113.654 1.00 316.28 ? 197 THR B O   1 
ATOM 6163  C CB  . THR B 2 197 ? 149.689 126.977 116.333 1.00 414.05 ? 197 THR B CB  1 
ATOM 6164  O OG1 . THR B 2 197 ? 151.034 127.162 116.802 1.00 370.13 ? 197 THR B OG1 1 
ATOM 6165  C CG2 . THR B 2 197 ? 149.200 125.568 116.722 1.00 424.91 ? 197 THR B CG2 1 
ATOM 6166  N N   . VAL B 2 198 ? 147.292 127.646 114.576 1.00 370.79 ? 198 VAL B N   1 
ATOM 6167  C CA  . VAL B 2 198 ? 145.894 127.429 114.175 1.00 395.42 ? 198 VAL B CA  1 
ATOM 6168  C C   . VAL B 2 198 ? 145.804 127.298 112.661 1.00 354.74 ? 198 VAL B C   1 
ATOM 6169  O O   . VAL B 2 198 ? 145.138 126.387 112.145 1.00 361.77 ? 198 VAL B O   1 
ATOM 6170  C CB  . VAL B 2 198 ? 144.968 128.570 114.676 1.00 454.45 ? 198 VAL B CB  1 
ATOM 6171  C CG1 . VAL B 2 198 ? 143.627 128.587 113.934 1.00 480.57 ? 198 VAL B CG1 1 
ATOM 6172  C CG2 . VAL B 2 198 ? 144.768 128.464 116.189 1.00 447.01 ? 198 VAL B CG2 1 
ATOM 6173  N N   . ALA B 2 199 ? 146.478 128.214 111.985 1.00 363.49 ? 199 ALA B N   1 
ATOM 6174  C CA  . ALA B 2 199 ? 146.518 128.259 110.520 1.00 433.55 ? 199 ALA B CA  1 
ATOM 6175  C C   . ALA B 2 199 ? 147.062 126.946 109.969 1.00 398.19 ? 199 ALA B C   1 
ATOM 6176  O O   . ALA B 2 199 ? 146.495 126.361 109.034 1.00 396.37 ? 199 ALA B O   1 
ATOM 6177  C CB  . ALA B 2 199 ? 147.351 129.440 110.031 1.00 477.11 ? 199 ALA B CB  1 
ATOM 6178  N N   . LEU B 2 200 ? 148.159 126.514 110.578 1.00 357.07 ? 200 LEU B N   1 
ATOM 6179  C CA  . LEU B 2 200 ? 148.842 125.271 110.202 1.00 404.85 ? 200 LEU B CA  1 
ATOM 6180  C C   . LEU B 2 200 ? 147.883 124.090 110.321 1.00 395.52 ? 200 LEU B C   1 
ATOM 6181  O O   . LEU B 2 200 ? 147.788 123.248 109.413 1.00 409.87 ? 200 LEU B O   1 
ATOM 6182  C CB  . LEU B 2 200 ? 150.090 125.071 111.090 1.00 431.58 ? 200 LEU B CB  1 
ATOM 6183  C CG  . LEU B 2 200 ? 150.791 123.709 111.266 1.00 437.60 ? 200 LEU B CG  1 
ATOM 6184  C CD1 . LEU B 2 200 ? 152.202 123.961 111.784 1.00 434.51 ? 200 LEU B CD1 1 
ATOM 6185  C CD2 . LEU B 2 200 ? 150.039 122.733 112.181 1.00 422.39 ? 200 LEU B CD2 1 
ATOM 6186  N N   . LEU B 2 201 ? 147.190 124.067 111.452 1.00 377.97 ? 201 LEU B N   1 
ATOM 6187  C CA  . LEU B 2 201 ? 146.224 123.011 111.765 1.00 359.18 ? 201 LEU B CA  1 
ATOM 6188  C C   . LEU B 2 201 ? 145.138 122.963 110.692 1.00 359.26 ? 201 LEU B C   1 
ATOM 6189  O O   . LEU B 2 201 ? 144.781 121.885 110.195 1.00 402.16 ? 201 LEU B O   1 
ATOM 6190  C CB  . LEU B 2 201 ? 145.666 123.165 113.184 1.00 412.66 ? 201 LEU B CB  1 
ATOM 6191  C CG  . LEU B 2 201 ? 145.011 121.982 113.928 1.00 454.69 ? 201 LEU B CG  1 
ATOM 6192  C CD1 . LEU B 2 201 ? 145.076 120.637 113.215 1.00 484.38 ? 201 LEU B CD1 1 
ATOM 6193  C CD2 . LEU B 2 201 ? 145.612 121.852 115.325 1.00 477.62 ? 201 LEU B CD2 1 
ATOM 6194  N N   . ILE B 2 202 ? 144.643 124.147 110.358 1.00 355.25 ? 202 ILE B N   1 
ATOM 6195  C CA  . ILE B 2 202 ? 143.591 124.307 109.351 1.00 389.52 ? 202 ILE B CA  1 
ATOM 6196  C C   . ILE B 2 202 ? 144.056 123.746 108.012 1.00 380.93 ? 202 ILE B C   1 
ATOM 6197  O O   . ILE B 2 202 ? 143.315 123.011 107.344 1.00 343.24 ? 202 ILE B O   1 
ATOM 6198  C CB  . ILE B 2 202 ? 142.984 125.733 109.316 1.00 431.23 ? 202 ILE B CB  1 
ATOM 6199  C CG1 . ILE B 2 202 ? 141.710 125.772 110.182 1.00 423.92 ? 202 ILE B CG1 1 
ATOM 6200  C CG2 . ILE B 2 202 ? 142.606 126.170 107.902 1.00 463.85 ? 202 ILE B CG2 1 
ATOM 6201  C CD1 . ILE B 2 202 ? 141.837 125.193 111.581 1.00 352.84 ? 202 ILE B CD1 1 
ATOM 6202  N N   . TRP B 2 203 ? 145.283 124.103 107.660 1.00 386.20 ? 203 TRP B N   1 
ATOM 6203  C CA  . TRP B 2 203 ? 145.913 123.658 106.413 1.00 394.12 ? 203 TRP B CA  1 
ATOM 6204  C C   . TRP B 2 203 ? 145.972 122.146 106.362 1.00 361.52 ? 203 TRP B C   1 
ATOM 6205  O O   . TRP B 2 203 ? 145.618 121.504 105.358 1.00 387.33 ? 203 TRP B O   1 
ATOM 6206  C CB  . TRP B 2 203 ? 147.314 124.247 106.249 1.00 412.04 ? 203 TRP B CB  1 
ATOM 6207  C CG  . TRP B 2 203 ? 147.756 124.250 104.845 1.00 388.90 ? 203 TRP B CG  1 
ATOM 6208  C CD1 . TRP B 2 203 ? 148.844 123.628 104.328 1.00 337.48 ? 203 TRP B CD1 1 
ATOM 6209  C CD2 . TRP B 2 203 ? 147.101 124.899 103.756 1.00 411.11 ? 203 TRP B CD2 1 
ATOM 6210  N NE1 . TRP B 2 203 ? 148.929 123.863 102.978 1.00 403.48 ? 203 TRP B NE1 1 
ATOM 6211  C CE2 . TRP B 2 203 ? 147.863 124.635 102.598 1.00 440.80 ? 203 TRP B CE2 1 
ATOM 6212  C CE3 . TRP B 2 203 ? 145.939 125.681 103.645 1.00 404.01 ? 203 TRP B CE3 1 
ATOM 6213  C CZ2 . TRP B 2 203 ? 147.504 125.125 101.336 1.00 485.93 ? 203 TRP B CZ2 1 
ATOM 6214  C CZ3 . TRP B 2 203 ? 145.581 126.168 102.395 1.00 452.56 ? 203 TRP B CZ3 1 
ATOM 6215  C CH2 . TRP B 2 203 ? 146.363 125.888 101.253 1.00 496.16 ? 203 TRP B CH2 1 
ATOM 6216  N N   . ASN B 2 204 ? 146.401 121.572 107.483 1.00 316.75 ? 204 ASN B N   1 
ATOM 6217  C CA  . ASN B 2 204 ? 146.513 120.116 107.652 1.00 351.36 ? 204 ASN B CA  1 
ATOM 6218  C C   . ASN B 2 204 ? 145.099 119.553 107.540 1.00 386.93 ? 204 ASN B C   1 
ATOM 6219  O O   . ASN B 2 204 ? 144.776 118.834 106.609 1.00 453.95 ? 204 ASN B O   1 
ATOM 6220  C CB  . ASN B 2 204 ? 147.116 119.772 109.008 1.00 387.38 ? 204 ASN B CB  1 
ATOM 6221  C CG  . ASN B 2 204 ? 148.621 119.886 109.022 1.00 444.04 ? 204 ASN B CG  1 
ATOM 6222  O OD1 . ASN B 2 204 ? 149.314 118.930 109.366 1.00 479.88 ? 204 ASN B OD1 1 
ATOM 6223  N ND2 . ASN B 2 204 ? 149.139 121.051 108.648 1.00 473.90 ? 204 ASN B ND2 1 
ATOM 6224  N N   . PHE B 2 205 ? 144.254 119.984 108.471 1.00 395.57 ? 205 PHE B N   1 
ATOM 6225  C CA  . PHE B 2 205 ? 142.941 119.403 108.724 1.00 409.31 ? 205 PHE B CA  1 
ATOM 6226  C C   . PHE B 2 205 ? 142.019 119.642 107.540 1.00 380.72 ? 205 PHE B C   1 
ATOM 6227  O O   . PHE B 2 205 ? 141.318 118.721 107.077 1.00 403.92 ? 205 PHE B O   1 
ATOM 6228  C CB  . PHE B 2 205 ? 142.356 120.046 109.987 1.00 432.79 ? 205 PHE B CB  1 
ATOM 6229  C CG  . PHE B 2 205 ? 140.972 119.602 110.324 1.00 426.31 ? 205 PHE B CG  1 
ATOM 6230  C CD1 . PHE B 2 205 ? 140.768 118.494 111.137 1.00 446.11 ? 205 PHE B CD1 1 
ATOM 6231  C CD2 . PHE B 2 205 ? 139.866 120.315 109.856 1.00 394.25 ? 205 PHE B CD2 1 
ATOM 6232  C CE1 . PHE B 2 205 ? 139.483 118.091 111.462 1.00 499.68 ? 205 PHE B CE1 1 
ATOM 6233  C CE2 . PHE B 2 205 ? 138.582 119.917 110.177 1.00 425.26 ? 205 PHE B CE2 1 
ATOM 6234  C CZ  . PHE B 2 205 ? 138.390 118.804 110.983 1.00 497.97 ? 205 PHE B CZ  1 
ATOM 6235  N N   . GLY B 2 206 ? 142.032 120.888 107.075 1.00 359.46 ? 206 GLY B N   1 
ATOM 6236  C CA  . GLY B 2 206 ? 141.211 121.314 105.933 1.00 403.01 ? 206 GLY B CA  1 
ATOM 6237  C C   . GLY B 2 206 ? 141.546 120.625 104.622 1.00 395.31 ? 206 GLY B C   1 
ATOM 6238  O O   . GLY B 2 206 ? 140.679 119.989 103.992 1.00 376.65 ? 206 GLY B O   1 
ATOM 6239  N N   . VAL B 2 207 ? 142.802 120.820 104.208 1.00 400.77 ? 207 VAL B N   1 
ATOM 6240  C CA  . VAL B 2 207 ? 143.264 120.312 102.893 1.00 408.02 ? 207 VAL B CA  1 
ATOM 6241  C C   . VAL B 2 207 ? 143.151 118.795 102.889 1.00 327.07 ? 207 VAL B C   1 
ATOM 6242  O O   . VAL B 2 207 ? 142.684 118.232 101.885 1.00 325.18 ? 207 VAL B O   1 
ATOM 6243  C CB  . VAL B 2 207 ? 144.682 120.763 102.483 1.00 476.71 ? 207 VAL B CB  1 
ATOM 6244  C CG1 . VAL B 2 207 ? 145.066 120.163 101.128 1.00 477.73 ? 207 VAL B CG1 1 
ATOM 6245  C CG2 . VAL B 2 207 ? 144.773 122.284 102.417 1.00 500.00 ? 207 VAL B CG2 1 
ATOM 6246  N N   . VAL B 2 208 ? 143.555 118.163 103.994 1.00 339.38 ? 208 VAL B N   1 
ATOM 6247  C CA  . VAL B 2 208 ? 143.486 116.699 104.051 1.00 374.29 ? 208 VAL B CA  1 
ATOM 6248  C C   . VAL B 2 208 ? 142.061 116.219 103.958 1.00 361.83 ? 208 VAL B C   1 
ATOM 6249  O O   . VAL B 2 208 ? 141.802 115.247 103.240 1.00 393.03 ? 208 VAL B O   1 
ATOM 6250  C CB  . VAL B 2 208 ? 144.199 115.989 105.243 1.00 399.04 ? 208 VAL B CB  1 
ATOM 6251  C CG1 . VAL B 2 208 ? 145.665 116.401 105.329 1.00 423.32 ? 208 VAL B CG1 1 
ATOM 6252  C CG2 . VAL B 2 208 ? 143.436 116.112 106.563 1.00 387.59 ? 208 VAL B CG2 1 
ATOM 6253  N N   . GLY B 2 209 ? 141.159 116.923 104.635 1.00 333.40 ? 209 GLY B N   1 
ATOM 6254  C CA  . GLY B 2 209 ? 139.723 116.617 104.599 1.00 350.72 ? 209 GLY B CA  1 
ATOM 6255  C C   . GLY B 2 209 ? 139.212 116.671 103.163 1.00 343.81 ? 209 GLY B C   1 
ATOM 6256  O O   . GLY B 2 209 ? 138.492 115.767 102.706 1.00 345.93 ? 209 GLY B O   1 
ATOM 6257  N N   . MET B 2 210 ? 139.610 117.741 102.482 1.00 331.60 ? 210 MET B N   1 
ATOM 6258  C CA  . MET B 2 210 ? 139.216 117.992 101.098 1.00 387.28 ? 210 MET B CA  1 
ATOM 6259  C C   . MET B 2 210 ? 139.682 116.820 100.213 1.00 364.23 ? 210 MET B C   1 
ATOM 6260  O O   . MET B 2 210 ? 138.917 116.307 99.381  1.00 357.14 ? 210 MET B O   1 
ATOM 6261  C CB  . MET B 2 210 ? 139.746 119.336 100.598 1.00 421.63 ? 210 MET B CB  1 
ATOM 6262  C CG  . MET B 2 210 ? 138.963 120.530 101.139 1.00 445.28 ? 210 MET B CG  1 
ATOM 6263  S SD  . MET B 2 210 ? 137.203 120.551 100.714 1.00 437.80 ? 210 MET B SD  1 
ATOM 6264  C CE  . MET B 2 210 ? 137.287 120.550 98.924  1.00 466.77 ? 210 MET B CE  1 
ATOM 6265  N N   . ILE B 2 211 ? 140.930 116.432 100.424 1.00 338.20 ? 211 ILE B N   1 
ATOM 6266  C CA  . ILE B 2 211 ? 141.483 115.348 99.610  1.00 372.28 ? 211 ILE B CA  1 
ATOM 6267  C C   . ILE B 2 211 ? 140.761 114.049 99.872  1.00 366.79 ? 211 ILE B C   1 
ATOM 6268  O O   . ILE B 2 211 ? 140.482 113.327 98.910  1.00 409.93 ? 211 ILE B O   1 
ATOM 6269  C CB  . ILE B 2 211 ? 143.039 115.268 99.550  1.00 425.46 ? 211 ILE B CB  1 
ATOM 6270  C CG1 . ILE B 2 211 ? 143.684 114.847 100.870 1.00 419.54 ? 211 ILE B CG1 1 
ATOM 6271  C CG2 . ILE B 2 211 ? 143.609 116.599 99.064  1.00 442.55 ? 211 ILE B CG2 1 
ATOM 6272  C CD1 . ILE B 2 211 ? 143.611 113.370 101.194 1.00 407.31 ? 211 ILE B CD1 1 
ATOM 6273  N N   . SER B 2 212 ? 140.419 113.799 101.130 1.00 384.77 ? 212 SER B N   1 
ATOM 6274  C CA  . SER B 2 212 ? 139.647 112.615 101.523 1.00 412.93 ? 212 SER B CA  1 
ATOM 6275  C C   . SER B 2 212 ? 138.312 112.589 100.781 1.00 392.76 ? 212 SER B C   1 
ATOM 6276  O O   . SER B 2 212 ? 137.909 111.551 100.229 1.00 414.97 ? 212 SER B O   1 
ATOM 6277  C CB  . SER B 2 212 ? 139.403 112.553 103.040 1.00 407.10 ? 212 SER B CB  1 
ATOM 6278  O OG  . SER B 2 212 ? 140.588 112.250 103.757 1.00 393.90 ? 212 SER B OG  1 
ATOM 6279  N N   . ILE B 2 213 ? 137.667 113.749 100.783 1.00 329.80 ? 213 ILE B N   1 
ATOM 6280  C CA  . ILE B 2 213 ? 136.374 113.934 100.118 1.00 362.18 ? 213 ILE B CA  1 
ATOM 6281  C C   . ILE B 2 213 ? 136.486 113.584 98.623  1.00 398.57 ? 213 ILE B C   1 
ATOM 6282  O O   . ILE B 2 213 ? 135.609 112.880 98.111  1.00 455.85 ? 213 ILE B O   1 
ATOM 6283  C CB  . ILE B 2 213 ? 135.771 115.358 100.244 1.00 396.51 ? 213 ILE B CB  1 
ATOM 6284  C CG1 . ILE B 2 213 ? 135.724 115.881 101.687 1.00 426.78 ? 213 ILE B CG1 1 
ATOM 6285  C CG2 . ILE B 2 213 ? 134.341 115.377 99.725  1.00 404.13 ? 213 ILE B CG2 1 
ATOM 6286  C CD1 . ILE B 2 213 ? 135.441 114.847 102.750 1.00 454.60 ? 213 ILE B CD1 1 
ATOM 6287  N N   . HIS B 2 214 ? 137.555 114.005 97.935  1.00 388.93 ? 214 HIS B N   1 
ATOM 6288  C CA  . HIS B 2 214 ? 137.591 113.960 96.446  1.00 408.10 ? 214 HIS B CA  1 
ATOM 6289  C C   . HIS B 2 214 ? 138.686 113.128 95.732  1.00 414.65 ? 214 HIS B C   1 
ATOM 6290  O O   . HIS B 2 214 ? 138.387 112.406 94.772  1.00 374.34 ? 214 HIS B O   1 
ATOM 6291  C CB  . HIS B 2 214 ? 137.614 115.390 95.934  1.00 398.96 ? 214 HIS B CB  1 
ATOM 6292  C CG  . HIS B 2 214 ? 136.520 116.226 96.508  1.00 405.15 ? 214 HIS B CG  1 
ATOM 6293  N ND1 . HIS B 2 214 ? 136.747 117.224 97.429  1.00 428.38 ? 214 HIS B ND1 1 
ATOM 6294  C CD2 . HIS B 2 214 ? 135.179 116.169 96.336  1.00 428.01 ? 214 HIS B CD2 1 
ATOM 6295  C CE1 . HIS B 2 214 ? 135.596 117.771 97.774  1.00 440.39 ? 214 HIS B CE1 1 
ATOM 6296  N NE2 . HIS B 2 214 ? 134.629 117.148 97.126  1.00 435.75 ? 214 HIS B NE2 1 
ATOM 6297  N N   . TRP B 2 215 ? 139.934 113.243 96.188  1.00 416.92 ? 215 TRP B N   1 
ATOM 6298  C CA  . TRP B 2 215 ? 141.089 112.600 95.537  1.00 388.18 ? 215 TRP B CA  1 
ATOM 6299  C C   . TRP B 2 215 ? 141.577 111.361 96.321  1.00 398.92 ? 215 TRP B C   1 
ATOM 6300  O O   . TRP B 2 215 ? 142.785 111.136 96.505  1.00 341.70 ? 215 TRP B O   1 
ATOM 6301  C CB  . TRP B 2 215 ? 142.199 113.641 95.376  1.00 413.71 ? 215 TRP B CB  1 
ATOM 6302  C CG  . TRP B 2 215 ? 143.162 113.362 94.285  1.00 433.27 ? 215 TRP B CG  1 
ATOM 6303  C CD1 . TRP B 2 215 ? 144.474 113.020 94.422  1.00 429.67 ? 215 TRP B CD1 1 
ATOM 6304  C CD2 . TRP B 2 215 ? 142.902 113.411 92.876  1.00 486.12 ? 215 TRP B CD2 1 
ATOM 6305  N NE1 . TRP B 2 215 ? 145.049 112.849 93.186  1.00 470.41 ? 215 TRP B NE1 1 
ATOM 6306  C CE2 . TRP B 2 215 ? 144.108 113.081 92.218  1.00 492.57 ? 215 TRP B CE2 1 
ATOM 6307  C CE3 . TRP B 2 215 ? 141.765 113.700 92.105  1.00 500.00 ? 215 TRP B CE3 1 
ATOM 6308  C CZ2 . TRP B 2 215 ? 144.215 113.027 90.817  1.00 488.78 ? 215 TRP B CZ2 1 
ATOM 6309  C CZ3 . TRP B 2 215 ? 141.870 113.648 90.706  1.00 500.00 ? 215 TRP B CZ3 1 
ATOM 6310  C CH2 . TRP B 2 215 ? 143.090 113.313 90.082  1.00 493.04 ? 215 TRP B CH2 1 
ATOM 6311  N N   . LYS B 2 216 ? 140.598 110.575 96.782  1.00 428.84 ? 216 LYS B N   1 
ATOM 6312  C CA  . LYS B 2 216 ? 140.776 109.247 97.391  1.00 457.84 ? 216 LYS B CA  1 
ATOM 6313  C C   . LYS B 2 216 ? 141.057 109.238 98.923  1.00 428.70 ? 216 LYS B C   1 
ATOM 6314  O O   . LYS B 2 216 ? 140.161 109.610 99.687  1.00 399.34 ? 216 LYS B O   1 
ATOM 6315  C CB  . LYS B 2 216 ? 141.716 108.353 96.542  1.00 462.55 ? 216 LYS B CB  1 
ATOM 6316  C CG  . LYS B 2 216 ? 141.472 106.858 96.732  1.00 492.01 ? 216 LYS B CG  1 
ATOM 6317  C CD  . LYS B 2 216 ? 141.536 106.082 95.423  1.00 474.93 ? 216 LYS B CD  1 
ATOM 6318  C CE  . LYS B 2 216 ? 141.485 104.575 95.660  1.00 481.41 ? 216 LYS B CE  1 
ATOM 6319  N NZ  . LYS B 2 216 ? 140.304 104.122 96.450  1.00 462.69 ? 216 LYS B NZ  1 
ATOM 6320  N N   . GLY B 2 217 ? 142.248 108.822 99.382  1.00 382.89 ? 217 GLY B N   1 
ATOM 6321  C CA  . GLY B 2 217 ? 142.483 108.523 100.811 1.00 331.41 ? 217 GLY B CA  1 
ATOM 6322  C C   . GLY B 2 217 ? 141.714 107.311 101.340 1.00 346.96 ? 217 GLY B C   1 
ATOM 6323  O O   . GLY B 2 217 ? 140.681 106.937 100.768 1.00 332.64 ? 217 GLY B O   1 
ATOM 6324  N N   . PRO B 2 218 ? 142.183 106.703 102.461 1.00 371.22 ? 218 PRO B N   1 
ATOM 6325  C CA  . PRO B 2 218 ? 141.518 105.508 103.024 1.00 392.75 ? 218 PRO B CA  1 
ATOM 6326  C C   . PRO B 2 218 ? 140.082 105.810 103.406 1.00 398.57 ? 218 PRO B C   1 
ATOM 6327  O O   . PRO B 2 218 ? 139.745 106.971 103.661 1.00 443.56 ? 218 PRO B O   1 
ATOM 6328  C CB  . PRO B 2 218 ? 142.321 105.198 104.288 1.00 388.46 ? 218 PRO B CB  1 
ATOM 6329  C CG  . PRO B 2 218 ? 142.912 106.497 104.682 1.00 418.31 ? 218 PRO B CG  1 
ATOM 6330  C CD  . PRO B 2 218 ? 143.107 107.314 103.433 1.00 400.82 ? 218 PRO B CD  1 
ATOM 6331  N N   . LEU B 2 219 ? 139.250 104.781 103.473 1.00 355.26 ? 219 LEU B N   1 
ATOM 6332  C CA  . LEU B 2 219 ? 137.826 105.020 103.507 1.00 432.14 ? 219 LEU B CA  1 
ATOM 6333  C C   . LEU B 2 219 ? 137.375 105.472 104.882 1.00 425.18 ? 219 LEU B C   1 
ATOM 6334  O O   . LEU B 2 219 ? 136.498 106.339 104.954 1.00 434.53 ? 219 LEU B O   1 
ATOM 6335  C CB  . LEU B 2 219 ? 137.033 103.805 102.991 1.00 500.00 ? 219 LEU B CB  1 
ATOM 6336  C CG  . LEU B 2 219 ? 135.832 104.142 102.077 1.00 500.00 ? 219 LEU B CG  1 
ATOM 6337  C CD1 . LEU B 2 219 ? 135.642 103.094 100.982 1.00 500.00 ? 219 LEU B CD1 1 
ATOM 6338  C CD2 . LEU B 2 219 ? 134.538 104.342 102.864 1.00 500.00 ? 219 LEU B CD2 1 
ATOM 6339  N N   . ARG B 2 220 ? 137.965 104.891 105.926 1.00 389.70 ? 220 ARG B N   1 
ATOM 6340  C CA  . ARG B 2 220 ? 137.625 105.215 107.301 1.00 414.71 ? 220 ARG B CA  1 
ATOM 6341  C C   . ARG B 2 220 ? 137.830 106.709 107.567 1.00 379.22 ? 220 ARG B C   1 
ATOM 6342  O O   . ARG B 2 220 ? 136.966 107.387 108.149 1.00 367.16 ? 220 ARG B O   1 
ATOM 6343  C CB  . ARG B 2 220 ? 138.465 104.384 108.286 1.00 459.45 ? 220 ARG B CB  1 
ATOM 6344  C CG  . ARG B 2 220 ? 137.892 103.009 108.598 1.00 481.99 ? 220 ARG B CG  1 
ATOM 6345  C CD  . ARG B 2 220 ? 136.655 103.108 109.486 1.00 500.00 ? 220 ARG B CD  1 
ATOM 6346  N NE  . ARG B 2 220 ? 136.304 101.837 110.118 1.00 500.00 ? 220 ARG B NE  1 
ATOM 6347  C CZ  . ARG B 2 220 ? 136.943 101.283 111.153 1.00 500.00 ? 220 ARG B CZ  1 
ATOM 6348  N NH1 . ARG B 2 220 ? 138.009 101.870 111.708 1.00 463.92 ? 220 ARG B NH1 1 
ATOM 6349  N NH2 . ARG B 2 220 ? 136.516 100.115 111.634 1.00 500.00 ? 220 ARG B NH2 1 
ATOM 6350  N N   . LEU B 2 221 ? 138.991 107.178 107.117 1.00 378.91 ? 221 LEU B N   1 
ATOM 6351  C CA  . LEU B 2 221 ? 139.385 108.583 107.276 1.00 387.69 ? 221 LEU B CA  1 
ATOM 6352  C C   . LEU B 2 221 ? 138.361 109.491 106.607 1.00 369.14 ? 221 LEU B C   1 
ATOM 6353  O O   . LEU B 2 221 ? 137.930 110.501 107.193 1.00 335.71 ? 221 LEU B O   1 
ATOM 6354  C CB  . LEU B 2 221 ? 140.756 108.843 106.677 1.00 421.25 ? 221 LEU B CB  1 
ATOM 6355  C CG  . LEU B 2 221 ? 141.265 110.267 106.903 1.00 484.13 ? 221 LEU B CG  1 
ATOM 6356  C CD1 . LEU B 2 221 ? 141.705 110.450 108.349 1.00 500.00 ? 221 LEU B CD1 1 
ATOM 6357  C CD2 . LEU B 2 221 ? 142.397 110.566 105.944 1.00 500.00 ? 221 LEU B CD2 1 
ATOM 6358  N N   . GLN B 2 222 ? 137.994 109.103 105.390 1.00 373.24 ? 222 GLN B N   1 
ATOM 6359  C CA  . GLN B 2 222 ? 137.012 109.844 104.587 1.00 387.62 ? 222 GLN B CA  1 
ATOM 6360  C C   . GLN B 2 222 ? 135.693 109.950 105.334 1.00 380.96 ? 222 GLN B C   1 
ATOM 6361  O O   . GLN B 2 222 ? 135.091 111.028 105.405 1.00 396.56 ? 222 GLN B O   1 
ATOM 6362  C CB  . GLN B 2 222 ? 136.771 109.203 103.220 1.00 404.25 ? 222 GLN B CB  1 
ATOM 6363  C CG  . GLN B 2 222 ? 135.961 110.090 102.276 1.00 407.80 ? 222 GLN B CG  1 
ATOM 6364  C CD  . GLN B 2 222 ? 134.772 109.396 101.637 1.00 435.91 ? 222 GLN B CD  1 
ATOM 6365  O OE1 . GLN B 2 222 ? 134.647 109.362 100.412 1.00 457.84 ? 222 GLN B OE1 1 
ATOM 6366  N NE2 . GLN B 2 222 ? 133.882 108.847 102.463 1.00 439.73 ? 222 GLN B NE2 1 
ATOM 6367  N N   . GLN B 2 223 ? 135.277 108.815 105.876 1.00 358.53 ? 223 GLN B N   1 
ATOM 6368  C CA  . GLN B 2 223 ? 134.030 108.701 106.642 1.00 385.50 ? 223 GLN B CA  1 
ATOM 6369  C C   . GLN B 2 223 ? 134.049 109.678 107.816 1.00 377.90 ? 223 GLN B C   1 
ATOM 6370  O O   . GLN B 2 223 ? 133.073 110.408 108.062 1.00 405.74 ? 223 GLN B O   1 
ATOM 6371  C CB  . GLN B 2 223 ? 133.876 107.303 107.261 1.00 410.27 ? 223 GLN B CB  1 
ATOM 6372  C CG  . GLN B 2 223 ? 133.501 106.163 106.333 1.00 445.59 ? 223 GLN B CG  1 
ATOM 6373  C CD  . GLN B 2 223 ? 133.631 104.810 107.019 1.00 468.16 ? 223 GLN B CD  1 
ATOM 6374  O OE1 . GLN B 2 223 ? 134.249 103.890 106.486 1.00 499.73 ? 223 GLN B OE1 1 
ATOM 6375  N NE2 . GLN B 2 223 ? 133.058 104.687 108.213 1.00 463.94 ? 223 GLN B NE2 1 
ATOM 6376  N N   . ALA B 2 224 ? 135.176 109.654 108.520 1.00 361.68 ? 224 ALA B N   1 
ATOM 6377  C CA  . ALA B 2 224 ? 135.396 110.500 109.693 1.00 422.29 ? 224 ALA B CA  1 
ATOM 6378  C C   . ALA B 2 224 ? 135.245 111.980 109.306 1.00 376.96 ? 224 ALA B C   1 
ATOM 6379  O O   . ALA B 2 224 ? 134.560 112.761 109.999 1.00 405.86 ? 224 ALA B O   1 
ATOM 6380  C CB  . ALA B 2 224 ? 136.766 110.244 110.303 1.00 500.00 ? 224 ALA B CB  1 
ATOM 6381  N N   . TYR B 2 225 ? 135.891 112.314 108.195 1.00 321.14 ? 225 TYR B N   1 
ATOM 6382  C CA  . TYR B 2 225 ? 135.874 113.679 107.670 1.00 357.99 ? 225 TYR B CA  1 
ATOM 6383  C C   . TYR B 2 225 ? 134.450 114.117 107.370 1.00 382.75 ? 225 TYR B C   1 
ATOM 6384  O O   . TYR B 2 225 ? 134.046 115.229 107.723 1.00 342.50 ? 225 TYR B O   1 
ATOM 6385  C CB  . TYR B 2 225 ? 136.879 113.930 106.550 1.00 389.63 ? 225 TYR B CB  1 
ATOM 6386  C CG  . TYR B 2 225 ? 138.108 114.563 107.121 1.00 390.66 ? 225 TYR B CG  1 
ATOM 6387  C CD1 . TYR B 2 225 ? 138.125 115.919 107.424 1.00 391.38 ? 225 TYR B CD1 1 
ATOM 6388  C CD2 . TYR B 2 225 ? 139.231 113.798 107.432 1.00 438.14 ? 225 TYR B CD2 1 
ATOM 6389  C CE1 . TYR B 2 225 ? 139.248 116.512 107.983 1.00 453.94 ? 225 TYR B CE1 1 
ATOM 6390  C CE2 . TYR B 2 225 ? 140.361 114.381 107.992 1.00 463.85 ? 225 TYR B CE2 1 
ATOM 6391  C CZ  . TYR B 2 225 ? 140.367 115.738 108.267 1.00 462.90 ? 225 TYR B CZ  1 
ATOM 6392  O OH  . TYR B 2 225 ? 141.480 116.319 108.828 1.00 444.12 ? 225 TYR B OH  1 
ATOM 6393  N N   . LEU B 2 226 ? 133.716 113.219 106.733 1.00 399.90 ? 226 LEU B N   1 
ATOM 6394  C CA  . LEU B 2 226 ? 132.310 113.441 106.366 1.00 397.60 ? 226 LEU B CA  1 
ATOM 6395  C C   . LEU B 2 226 ? 131.491 113.743 107.606 1.00 393.75 ? 226 LEU B C   1 
ATOM 6396  O O   . LEU B 2 226 ? 130.691 114.689 107.624 1.00 415.95 ? 226 LEU B O   1 
ATOM 6397  C CB  . LEU B 2 226 ? 131.716 112.210 105.654 1.00 449.14 ? 226 LEU B CB  1 
ATOM 6398  C CG  . LEU B 2 226 ? 131.542 112.245 104.134 1.00 500.00 ? 226 LEU B CG  1 
ATOM 6399  C CD1 . LEU B 2 226 ? 132.771 112.781 103.423 1.00 500.00 ? 226 LEU B CD1 1 
ATOM 6400  C CD2 . LEU B 2 226 ? 131.190 110.856 103.620 1.00 500.00 ? 226 LEU B CD2 1 
ATOM 6401  N N   . ILE B 2 227 ? 131.713 112.914 108.626 1.00 367.22 ? 227 ILE B N   1 
ATOM 6402  C CA  . ILE B 2 227 ? 131.008 113.044 109.910 1.00 346.75 ? 227 ILE B CA  1 
ATOM 6403  C C   . ILE B 2 227 ? 131.269 114.422 110.511 1.00 312.01 ? 227 ILE B C   1 
ATOM 6404  O O   . ILE B 2 227 ? 130.334 115.100 110.971 1.00 334.70 ? 227 ILE B O   1 
ATOM 6405  C CB  . ILE B 2 227 ? 131.131 111.894 110.969 1.00 409.11 ? 227 ILE B CB  1 
ATOM 6406  C CG1 . ILE B 2 227 ? 132.341 112.037 111.908 1.00 442.67 ? 227 ILE B CG1 1 
ATOM 6407  C CG2 . ILE B 2 227 ? 131.033 110.514 110.326 1.00 449.74 ? 227 ILE B CG2 1 
ATOM 6408  C CD1 . ILE B 2 227 ? 132.255 111.148 113.124 1.00 472.23 ? 227 ILE B CD1 1 
ATOM 6409  N N   . MET B 2 228 ? 132.542 114.801 110.482 1.00 313.09 ? 228 MET B N   1 
ATOM 6410  C CA  . MET B 2 228 ? 132.992 116.092 111.009 1.00 353.57 ? 228 MET B CA  1 
ATOM 6411  C C   . MET B 2 228 ? 132.267 117.235 110.301 1.00 355.76 ? 228 MET B C   1 
ATOM 6412  O O   . MET B 2 228 ? 131.774 118.174 110.937 1.00 289.04 ? 228 MET B O   1 
ATOM 6413  C CB  . MET B 2 228 ? 134.527 116.277 110.940 1.00 386.84 ? 228 MET B CB  1 
ATOM 6414  C CG  . MET B 2 228 ? 135.257 116.256 112.299 1.00 432.49 ? 228 MET B CG  1 
ATOM 6415  S SD  . MET B 2 228 ? 134.761 117.452 113.592 1.00 456.09 ? 228 MET B SD  1 
ATOM 6416  C CE  . MET B 2 228 ? 135.742 118.942 113.317 1.00 349.49 ? 228 MET B CE  1 
ATOM 6417  N N   . ILE B 2 229 ? 132.223 117.117 108.984 1.00 363.21 ? 229 ILE B N   1 
ATOM 6418  C CA  . ILE B 2 229 ? 131.575 118.095 108.103 1.00 385.88 ? 229 ILE B CA  1 
ATOM 6419  C C   . ILE B 2 229 ? 130.108 118.259 108.499 1.00 336.84 ? 229 ILE B C   1 
ATOM 6420  O O   . ILE B 2 229 ? 129.597 119.383 108.633 1.00 339.02 ? 229 ILE B O   1 
ATOM 6421  C CB  . ILE B 2 229 ? 131.597 117.578 106.619 1.00 440.31 ? 229 ILE B CB  1 
ATOM 6422  C CG1 . ILE B 2 229 ? 133.034 117.517 106.047 1.00 459.57 ? 229 ILE B CG1 1 
ATOM 6423  C CG2 . ILE B 2 229 ? 130.620 118.345 105.720 1.00 491.54 ? 229 ILE B CG2 1 
ATOM 6424  C CD1 . ILE B 2 229 ? 133.393 118.509 104.956 1.00 481.00 ? 229 ILE B CD1 1 
ATOM 6425  N N   . SER B 2 230 ? 129.467 117.110 108.672 1.00 329.78 ? 230 SER B N   1 
ATOM 6426  C CA  . SER B 2 230 ? 128.050 117.044 109.045 1.00 325.87 ? 230 SER B CA  1 
ATOM 6427  C C   . SER B 2 230 ? 127.817 117.772 110.359 1.00 329.06 ? 230 SER B C   1 
ATOM 6428  O O   . SER B 2 230 ? 126.875 118.568 110.491 1.00 312.27 ? 230 SER B O   1 
ATOM 6429  C CB  . SER B 2 230 ? 127.513 115.623 109.110 1.00 369.89 ? 230 SER B CB  1 
ATOM 6430  O OG  . SER B 2 230 ? 128.537 114.675 108.942 1.00 419.00 ? 230 SER B OG  1 
ATOM 6431  N N   . ALA B 2 231 ? 128.700 117.483 111.311 1.00 349.97 ? 231 ALA B N   1 
ATOM 6432  C CA  . ALA B 2 231 ? 128.657 118.081 112.647 1.00 361.20 ? 231 ALA B CA  1 
ATOM 6433  C C   . ALA B 2 231 ? 128.734 119.592 112.552 1.00 351.14 ? 231 ALA B C   1 
ATOM 6434  O O   . ALA B 2 231 ? 127.713 120.266 112.701 1.00 288.74 ? 231 ALA B O   1 
ATOM 6435  C CB  . ALA B 2 231 ? 129.765 117.528 113.541 1.00 367.72 ? 231 ALA B CB  1 
ATOM 6436  N N   . LEU B 2 232 ? 129.906 120.156 112.291 1.00 348.95 ? 232 LEU B N   1 
ATOM 6437  C CA  . LEU B 2 232 ? 130.003 121.620 112.376 1.00 373.25 ? 232 LEU B CA  1 
ATOM 6438  C C   . LEU B 2 232 ? 128.887 122.327 111.603 1.00 315.66 ? 232 LEU B C   1 
ATOM 6439  O O   . LEU B 2 232 ? 128.455 123.397 112.020 1.00 326.03 ? 232 LEU B O   1 
ATOM 6440  C CB  . LEU B 2 232 ? 131.394 122.184 112.038 1.00 424.41 ? 232 LEU B CB  1 
ATOM 6441  C CG  . LEU B 2 232 ? 132.393 121.438 111.166 1.00 471.50 ? 232 LEU B CG  1 
ATOM 6442  C CD1 . LEU B 2 232 ? 131.795 121.169 109.817 1.00 459.23 ? 232 LEU B CD1 1 
ATOM 6443  C CD2 . LEU B 2 232 ? 133.671 122.232 111.016 1.00 500.00 ? 232 LEU B CD2 1 
ATOM 6444  N N   . MET B 2 233 ? 128.393 121.716 110.522 1.00 325.67 ? 233 MET B N   1 
ATOM 6445  C CA  . MET B 2 233 ? 127.233 122.258 109.818 1.00 345.60 ? 233 MET B CA  1 
ATOM 6446  C C   . MET B 2 233 ? 126.034 122.228 110.743 1.00 302.83 ? 233 MET B C   1 
ATOM 6447  O O   . MET B 2 233 ? 125.311 123.213 110.863 1.00 340.23 ? 233 MET B O   1 
ATOM 6448  C CB  . MET B 2 233 ? 126.909 121.509 108.512 1.00 372.96 ? 233 MET B CB  1 
ATOM 6449  C CG  . MET B 2 233 ? 126.227 122.413 107.483 1.00 420.95 ? 233 MET B CG  1 
ATOM 6450  S SD  . MET B 2 233 ? 125.163 121.611 106.261 1.00 480.31 ? 233 MET B SD  1 
ATOM 6451  C CE  . MET B 2 233 ? 126.338 121.131 104.994 1.00 488.55 ? 233 MET B CE  1 
ATOM 6452  N N   . ALA B 2 234 ? 125.820 121.096 111.393 1.00 318.13 ? 234 ALA B N   1 
ATOM 6453  C CA  . ALA B 2 234 ? 124.744 120.992 112.371 1.00 377.37 ? 234 ALA B CA  1 
ATOM 6454  C C   . ALA B 2 234 ? 124.913 122.030 113.466 1.00 332.23 ? 234 ALA B C   1 
ATOM 6455  O O   . ALA B 2 234 ? 123.969 122.750 113.795 1.00 333.26 ? 234 ALA B O   1 
ATOM 6456  C CB  . ALA B 2 234 ? 124.686 119.594 112.972 1.00 442.69 ? 234 ALA B CB  1 
ATOM 6457  N N   . LEU B 2 235 ? 126.122 122.118 114.009 1.00 288.17 ? 235 LEU B N   1 
ATOM 6458  C CA  . LEU B 2 235 ? 126.392 123.086 115.062 1.00 330.16 ? 235 LEU B CA  1 
ATOM 6459  C C   . LEU B 2 235 ? 125.987 124.485 114.633 1.00 342.61 ? 235 LEU B C   1 
ATOM 6460  O O   . LEU B 2 235 ? 125.357 125.223 115.404 1.00 300.27 ? 235 LEU B O   1 
ATOM 6461  C CB  . LEU B 2 235 ? 127.869 123.083 115.432 1.00 378.41 ? 235 LEU B CB  1 
ATOM 6462  C CG  . LEU B 2 235 ? 128.334 121.870 116.234 1.00 435.36 ? 235 LEU B CG  1 
ATOM 6463  C CD1 . LEU B 2 235 ? 129.854 121.737 116.178 1.00 490.84 ? 235 LEU B CD1 1 
ATOM 6464  C CD2 . LEU B 2 235 ? 127.831 121.954 117.669 1.00 450.22 ? 235 LEU B CD2 1 
ATOM 6465  N N   . VAL B 2 236 ? 126.353 124.816 113.395 1.00 343.25 ? 236 VAL B N   1 
ATOM 6466  C CA  . VAL B 2 236 ? 126.033 126.113 112.792 1.00 319.22 ? 236 VAL B CA  1 
ATOM 6467  C C   . VAL B 2 236 ? 124.525 126.329 112.789 1.00 260.07 ? 236 VAL B C   1 
ATOM 6468  O O   . VAL B 2 236 ? 124.043 127.413 113.161 1.00 310.73 ? 236 VAL B O   1 
ATOM 6469  C CB  . VAL B 2 236 ? 126.589 126.216 111.348 1.00 344.25 ? 236 VAL B CB  1 
ATOM 6470  C CG1 . VAL B 2 236 ? 125.877 127.294 110.531 1.00 360.19 ? 236 VAL B CG1 1 
ATOM 6471  C CG2 . VAL B 2 236 ? 128.101 126.446 111.377 1.00 367.52 ? 236 VAL B CG2 1 
ATOM 6472  N N   . PHE B 2 237 ? 123.818 125.287 112.365 1.00 289.84 ? 237 PHE B N   1 
ATOM 6473  C CA  . PHE B 2 237 ? 122.356 125.308 112.286 1.00 351.24 ? 237 PHE B CA  1 
ATOM 6474  C C   . PHE B 2 237 ? 121.758 125.601 113.665 1.00 360.72 ? 237 PHE B C   1 
ATOM 6475  O O   . PHE B 2 237 ? 120.854 126.440 113.801 1.00 390.67 ? 237 PHE B O   1 
ATOM 6476  C CB  . PHE B 2 237 ? 121.814 124.005 111.663 1.00 333.39 ? 237 PHE B CB  1 
ATOM 6477  C CG  . PHE B 2 237 ? 121.787 124.027 110.157 1.00 411.22 ? 237 PHE B CG  1 
ATOM 6478  C CD1 . PHE B 2 237 ? 122.843 124.571 109.417 1.00 469.14 ? 237 PHE B CD1 1 
ATOM 6479  C CD2 . PHE B 2 237 ? 120.701 123.510 109.466 1.00 495.41 ? 237 PHE B CD2 1 
ATOM 6480  C CE1 . PHE B 2 237 ? 122.809 124.594 108.028 1.00 500.00 ? 237 PHE B CE1 1 
ATOM 6481  C CE2 . PHE B 2 237 ? 120.664 123.528 108.075 1.00 500.00 ? 237 PHE B CE2 1 
ATOM 6482  C CZ  . PHE B 2 237 ? 121.720 124.070 107.354 1.00 500.00 ? 237 PHE B CZ  1 
ATOM 6483  N N   . ILE B 2 238 ? 122.295 124.903 114.654 1.00 317.79 ? 238 ILE B N   1 
ATOM 6484  C CA  . ILE B 2 238 ? 121.857 125.021 116.041 1.00 342.26 ? 238 ILE B CA  1 
ATOM 6485  C C   . ILE B 2 238 ? 122.033 126.473 116.513 1.00 364.98 ? 238 ILE B C   1 
ATOM 6486  O O   . ILE B 2 238 ? 121.104 127.032 117.136 1.00 384.25 ? 238 ILE B O   1 
ATOM 6487  C CB  . ILE B 2 238 ? 122.584 124.022 116.964 1.00 371.33 ? 238 ILE B CB  1 
ATOM 6488  C CG1 . ILE B 2 238 ? 122.202 122.588 116.573 1.00 421.28 ? 238 ILE B CG1 1 
ATOM 6489  C CG2 . ILE B 2 238 ? 122.217 124.250 118.430 1.00 383.53 ? 238 ILE B CG2 1 
ATOM 6490  C CD1 . ILE B 2 238 ? 123.270 121.571 116.885 1.00 430.65 ? 238 ILE B CD1 1 
ATOM 6491  N N   . LYS B 2 239 ? 123.203 127.016 116.197 1.00 348.47 ? 239 LYS B N   1 
ATOM 6492  C CA  . LYS B 2 239 ? 123.589 128.331 116.704 1.00 349.15 ? 239 LYS B CA  1 
ATOM 6493  C C   . LYS B 2 239 ? 122.639 129.412 116.282 1.00 343.66 ? 239 LYS B C   1 
ATOM 6494  O O   . LYS B 2 239 ? 122.212 130.234 117.105 1.00 384.54 ? 239 LYS B O   1 
ATOM 6495  C CB  . LYS B 2 239 ? 124.986 128.709 116.220 1.00 356.45 ? 239 LYS B CB  1 
ATOM 6496  C CG  . LYS B 2 239 ? 125.480 130.086 116.640 1.00 330.27 ? 239 LYS B CG  1 
ATOM 6497  C CD  . LYS B 2 239 ? 125.911 130.141 118.084 1.00 384.60 ? 239 LYS B CD  1 
ATOM 6498  C CE  . LYS B 2 239 ? 126.824 131.330 118.355 1.00 414.36 ? 239 LYS B CE  1 
ATOM 6499  N NZ  . LYS B 2 239 ? 126.147 132.617 118.632 1.00 439.06 ? 239 LYS B NZ  1 
ATOM 6500  N N   . TYR B 2 240 ? 122.388 129.490 114.982 1.00 319.55 ? 240 TYR B N   1 
ATOM 6501  C CA  . TYR B 2 240 ? 121.735 130.653 114.398 1.00 329.51 ? 240 TYR B CA  1 
ATOM 6502  C C   . TYR B 2 240 ? 120.212 130.556 114.226 1.00 358.90 ? 240 TYR B C   1 
ATOM 6503  O O   . TYR B 2 240 ? 119.597 131.499 113.722 1.00 326.42 ? 240 TYR B O   1 
ATOM 6504  C CB  . TYR B 2 240 ? 122.380 130.962 113.052 1.00 325.32 ? 240 TYR B CB  1 
ATOM 6505  C CG  . TYR B 2 240 ? 123.878 131.128 113.099 1.00 349.14 ? 240 TYR B CG  1 
ATOM 6506  C CD1 . TYR B 2 240 ? 124.506 131.766 114.170 1.00 340.65 ? 240 TYR B CD1 1 
ATOM 6507  C CD2 . TYR B 2 240 ? 124.675 130.692 112.038 1.00 449.47 ? 240 TYR B CD2 1 
ATOM 6508  C CE1 . TYR B 2 240 ? 125.885 131.951 114.189 1.00 439.85 ? 240 TYR B CE1 1 
ATOM 6509  C CE2 . TYR B 2 240 ? 126.056 130.861 112.056 1.00 500.00 ? 240 TYR B CE2 1 
ATOM 6510  C CZ  . TYR B 2 240 ? 126.660 131.487 113.137 1.00 497.59 ? 240 TYR B CZ  1 
ATOM 6511  O OH  . TYR B 2 240 ? 128.028 131.662 113.165 1.00 493.36 ? 240 TYR B OH  1 
ATOM 6512  N N   . LEU B 2 241 ? 119.601 129.445 114.648 1.00 345.34 ? 241 LEU B N   1 
ATOM 6513  C CA  . LEU B 2 241 ? 118.148 129.286 114.527 1.00 356.27 ? 241 LEU B CA  1 
ATOM 6514  C C   . LEU B 2 241 ? 117.460 129.639 115.850 1.00 354.36 ? 241 LEU B C   1 
ATOM 6515  O O   . LEU B 2 241 ? 117.991 129.304 116.918 1.00 318.80 ? 241 LEU B O   1 
ATOM 6516  C CB  . LEU B 2 241 ? 117.771 127.862 114.079 1.00 387.66 ? 241 LEU B CB  1 
ATOM 6517  C CG  . LEU B 2 241 ? 117.459 127.628 112.589 1.00 396.58 ? 241 LEU B CG  1 
ATOM 6518  C CD1 . LEU B 2 241 ? 118.456 128.310 111.655 1.00 422.07 ? 241 LEU B CD1 1 
ATOM 6519  C CD2 . LEU B 2 241 ? 117.394 126.135 112.297 1.00 371.66 ? 241 LEU B CD2 1 
ATOM 6520  N N   . PRO B 2 242 ? 116.295 130.339 115.784 1.00 393.14 ? 242 PRO B N   1 
ATOM 6521  C CA  . PRO B 2 242 ? 115.377 130.498 116.937 1.00 395.12 ? 242 PRO B CA  1 
ATOM 6522  C C   . PRO B 2 242 ? 114.690 129.188 117.274 1.00 345.18 ? 242 PRO B C   1 
ATOM 6523  O O   . PRO B 2 242 ? 114.475 128.374 116.378 1.00 293.16 ? 242 PRO B O   1 
ATOM 6524  C CB  . PRO B 2 242 ? 114.341 131.522 116.452 1.00 427.03 ? 242 PRO B CB  1 
ATOM 6525  C CG  . PRO B 2 242 ? 114.931 132.157 115.243 1.00 452.43 ? 242 PRO B CG  1 
ATOM 6526  C CD  . PRO B 2 242 ? 115.865 131.158 114.634 1.00 421.98 ? 242 PRO B CD  1 
ATOM 6527  N N   . GLU B 2 243 ? 114.322 128.988 118.535 1.00 355.98 ? 243 GLU B N   1 
ATOM 6528  C CA  . GLU B 2 243 ? 114.001 127.627 118.985 1.00 441.74 ? 243 GLU B CA  1 
ATOM 6529  C C   . GLU B 2 243 ? 112.752 127.107 118.263 1.00 472.50 ? 243 GLU B C   1 
ATOM 6530  O O   . GLU B 2 243 ? 112.738 126.008 117.688 1.00 500.00 ? 243 GLU B O   1 
ATOM 6531  C CB  . GLU B 2 243 ? 113.808 127.597 120.492 1.00 470.99 ? 243 GLU B CB  1 
ATOM 6532  N N   . TRP B 2 244 ? 111.741 127.965 118.284 1.00 444.84 ? 244 TRP B N   1 
ATOM 6533  C CA  . TRP B 2 244 ? 110.456 127.698 117.618 1.00 422.87 ? 244 TRP B CA  1 
ATOM 6534  C C   . TRP B 2 244 ? 110.687 127.460 116.126 1.00 371.77 ? 244 TRP B C   1 
ATOM 6535  O O   . TRP B 2 244 ? 110.159 126.495 115.542 1.00 371.65 ? 244 TRP B O   1 
ATOM 6536  C CB  . TRP B 2 244 ? 109.462 128.856 117.871 1.00 442.81 ? 244 TRP B CB  1 
ATOM 6537  C CG  . TRP B 2 244 ? 108.358 128.604 118.932 1.00 484.58 ? 244 TRP B CG  1 
ATOM 6538  C CD1 . TRP B 2 244 ? 107.097 129.153 118.929 1.00 479.82 ? 244 TRP B CD1 1 
ATOM 6539  C CD2 . TRP B 2 244 ? 108.411 127.754 120.103 1.00 486.79 ? 244 TRP B CD2 1 
ATOM 6540  N NE1 . TRP B 2 244 ? 106.376 128.709 120.012 1.00 459.30 ? 244 TRP B NE1 1 
ATOM 6541  C CE2 . TRP B 2 244 ? 107.150 127.850 120.747 1.00 477.79 ? 244 TRP B CE2 1 
ATOM 6542  C CE3 . TRP B 2 244 ? 109.396 126.923 120.670 1.00 465.14 ? 244 TRP B CE3 1 
ATOM 6543  C CZ2 . TRP B 2 244 ? 106.848 127.147 121.930 1.00 448.57 ? 244 TRP B CZ2 1 
ATOM 6544  C CZ3 . TRP B 2 244 ? 109.090 126.222 121.853 1.00 450.85 ? 244 TRP B CZ3 1 
ATOM 6545  C CH2 . TRP B 2 244 ? 107.825 126.345 122.466 1.00 420.18 ? 244 TRP B CH2 1 
ATOM 6546  N N   . THR B 2 245 ? 111.479 128.350 115.551 1.00 354.31 ? 245 THR B N   1 
ATOM 6547  C CA  . THR B 2 245 ? 111.832 128.299 114.124 1.00 388.91 ? 245 THR B CA  1 
ATOM 6548  C C   . THR B 2 245 ? 112.499 126.957 113.797 1.00 372.33 ? 245 THR B C   1 
ATOM 6549  O O   . THR B 2 245 ? 112.173 126.291 112.819 1.00 376.13 ? 245 THR B O   1 
ATOM 6550  C CB  . THR B 2 245 ? 112.861 129.397 113.777 1.00 443.86 ? 245 THR B CB  1 
ATOM 6551  O OG1 . THR B 2 245 ? 112.244 130.684 113.869 1.00 490.30 ? 245 THR B OG1 1 
ATOM 6552  C CG2 . THR B 2 245 ? 113.483 129.198 112.372 1.00 460.87 ? 245 THR B CG2 1 
ATOM 6553  N N   . ALA B 2 246 ? 113.448 126.619 114.653 1.00 357.04 ? 246 ALA B N   1 
ATOM 6554  C CA  . ALA B 2 246 ? 114.267 125.418 114.525 1.00 375.63 ? 246 ALA B CA  1 
ATOM 6555  C C   . ALA B 2 246 ? 113.376 124.180 114.513 1.00 375.63 ? 246 ALA B C   1 
ATOM 6556  O O   . ALA B 2 246 ? 113.512 123.287 113.639 1.00 335.21 ? 246 ALA B O   1 
ATOM 6557  C CB  . ALA B 2 246 ? 115.276 125.326 115.665 1.00 400.30 ? 246 ALA B CB  1 
ATOM 6558  N N   . TRP B 2 247 ? 112.572 124.036 115.560 1.00 392.69 ? 247 TRP B N   1 
ATOM 6559  C CA  . TRP B 2 247 ? 111.807 122.777 115.701 1.00 407.32 ? 247 TRP B CA  1 
ATOM 6560  C C   . TRP B 2 247 ? 110.901 122.601 114.468 1.00 405.70 ? 247 TRP B C   1 
ATOM 6561  O O   . TRP B 2 247 ? 110.872 121.544 113.813 1.00 411.80 ? 247 TRP B O   1 
ATOM 6562  C CB  . TRP B 2 247 ? 111.024 122.761 117.016 1.00 409.26 ? 247 TRP B CB  1 
ATOM 6563  C CG  . TRP B 2 247 ? 111.947 122.688 118.188 1.00 395.21 ? 247 TRP B CG  1 
ATOM 6564  C CD1 . TRP B 2 247 ? 112.123 123.626 119.164 1.00 395.82 ? 247 TRP B CD1 1 
ATOM 6565  C CD2 . TRP B 2 247 ? 112.869 121.636 118.473 1.00 412.30 ? 247 TRP B CD2 1 
ATOM 6566  N NE1 . TRP B 2 247 ? 113.091 123.217 120.048 1.00 410.83 ? 247 TRP B NE1 1 
ATOM 6567  C CE2 . TRP B 2 247 ? 113.566 121.996 119.647 1.00 437.15 ? 247 TRP B CE2 1 
ATOM 6568  C CE3 . TRP B 2 247 ? 113.168 120.416 117.854 1.00 406.71 ? 247 TRP B CE3 1 
ATOM 6569  C CZ2 . TRP B 2 247 ? 114.544 121.173 120.219 1.00 458.65 ? 247 TRP B CZ2 1 
ATOM 6570  C CZ3 . TRP B 2 247 ? 114.141 119.596 118.422 1.00 430.16 ? 247 TRP B CZ3 1 
ATOM 6571  C CH2 . TRP B 2 247 ? 114.814 119.979 119.596 1.00 453.86 ? 247 TRP B CH2 1 
ATOM 6572  N N   . LEU B 2 248 ? 110.183 123.687 114.194 1.00 422.62 ? 248 LEU B N   1 
ATOM 6573  C CA  . LEU B 2 248 ? 109.226 123.733 113.083 1.00 458.16 ? 248 LEU B CA  1 
ATOM 6574  C C   . LEU B 2 248 ? 109.960 123.486 111.775 1.00 383.81 ? 248 LEU B C   1 
ATOM 6575  O O   . LEU B 2 248 ? 109.496 122.675 110.926 1.00 412.28 ? 248 LEU B O   1 
ATOM 6576  C CB  . LEU B 2 248 ? 108.417 125.029 113.085 1.00 500.00 ? 248 LEU B CB  1 
ATOM 6577  C CG  . LEU B 2 248 ? 107.444 125.131 114.275 1.00 500.00 ? 248 LEU B CG  1 
ATOM 6578  C CD1 . LEU B 2 248 ? 106.871 126.539 114.378 1.00 500.00 ? 248 LEU B CD1 1 
ATOM 6579  C CD2 . LEU B 2 248 ? 106.323 124.095 114.196 1.00 500.00 ? 248 LEU B CD2 1 
ATOM 6580  N N   . ILE B 2 249 ? 111.124 124.147 111.632 1.00 349.80 ? 249 ILE B N   1 
ATOM 6581  C CA  . ILE B 2 249 ? 111.908 124.067 110.407 1.00 409.64 ? 249 ILE B CA  1 
ATOM 6582  C C   . ILE B 2 249 ? 112.374 122.630 110.245 1.00 383.99 ? 249 ILE B C   1 
ATOM 6583  O O   . ILE B 2 249 ? 112.355 122.192 109.124 1.00 398.82 ? 249 ILE B O   1 
ATOM 6584  C CB  . ILE B 2 249 ? 113.103 125.071 110.232 1.00 458.71 ? 249 ILE B CB  1 
ATOM 6585  C CG1 . ILE B 2 249 ? 113.594 125.121 108.770 1.00 467.05 ? 249 ILE B CG1 1 
ATOM 6586  C CG2 . ILE B 2 249 ? 114.310 124.716 111.080 1.00 451.50 ? 249 ILE B CG2 1 
ATOM 6587  C CD1 . ILE B 2 249 ? 112.781 125.991 107.852 1.00 500.00 ? 249 ILE B CD1 1 
ATOM 6588  N N   . LEU B 2 250 ? 112.778 121.945 111.312 1.00 345.37 ? 250 LEU B N   1 
ATOM 6589  C CA  . LEU B 2 250 ? 113.265 120.593 111.119 1.00 378.23 ? 250 LEU B CA  1 
ATOM 6590  C C   . LEU B 2 250 ? 112.153 119.670 110.645 1.00 418.18 ? 250 LEU B C   1 
ATOM 6591  O O   . LEU B 2 250 ? 112.389 118.857 109.730 1.00 407.61 ? 250 LEU B O   1 
ATOM 6592  C CB  . LEU B 2 250 ? 114.048 120.098 112.342 1.00 431.80 ? 250 LEU B CB  1 
ATOM 6593  C CG  . LEU B 2 250 ? 113.391 119.358 113.507 1.00 460.42 ? 250 LEU B CG  1 
ATOM 6594  C CD1 . LEU B 2 250 ? 113.294 117.869 113.217 1.00 479.84 ? 250 LEU B CD1 1 
ATOM 6595  C CD2 . LEU B 2 250 ? 114.188 119.596 114.783 1.00 465.89 ? 250 LEU B CD2 1 
ATOM 6596  N N   . ALA B 2 251 ? 110.955 119.866 111.180 1.00 462.96 ? 251 ALA B N   1 
ATOM 6597  C CA  . ALA B 2 251 ? 109.795 119.054 110.840 1.00 464.53 ? 251 ALA B CA  1 
ATOM 6598  C C   . ALA B 2 251 ? 109.476 119.217 109.354 1.00 424.38 ? 251 ALA B C   1 
ATOM 6599  O O   . ALA B 2 251 ? 109.324 118.235 108.549 1.00 443.54 ? 251 ALA B O   1 
ATOM 6600  C CB  . ALA B 2 251 ? 108.585 119.444 111.683 1.00 461.50 ? 251 ALA B CB  1 
ATOM 6601  N N   . VAL B 2 252 ? 109.376 120.503 108.991 1.00 399.68 ? 252 VAL B N   1 
ATOM 6602  C CA  . VAL B 2 252 ? 109.103 120.889 107.586 1.00 432.94 ? 252 VAL B CA  1 
ATOM 6603  C C   . VAL B 2 252 ? 110.213 120.368 106.700 1.00 399.99 ? 252 VAL B C   1 
ATOM 6604  O O   . VAL B 2 252 ? 109.911 119.844 105.617 1.00 431.57 ? 252 VAL B O   1 
ATOM 6605  C CB  . VAL B 2 252 ? 108.835 122.394 107.418 1.00 500.00 ? 252 VAL B CB  1 
ATOM 6606  C CG1 . VAL B 2 252 ? 108.697 122.754 105.942 1.00 500.00 ? 252 VAL B CG1 1 
ATOM 6607  C CG2 . VAL B 2 252 ? 107.555 122.772 108.156 1.00 500.00 ? 252 VAL B CG2 1 
ATOM 6608  N N   . ILE B 2 253 ? 111.461 120.505 107.165 1.00 396.60 ? 253 ILE B N   1 
ATOM 6609  C CA  . ILE B 2 253 ? 112.623 120.046 106.400 1.00 440.41 ? 253 ILE B CA  1 
ATOM 6610  C C   . ILE B 2 253 ? 112.518 118.549 106.140 1.00 409.71 ? 253 ILE B C   1 
ATOM 6611  O O   . ILE B 2 253 ? 112.759 118.094 105.014 1.00 396.27 ? 253 ILE B O   1 
ATOM 6612  C CB  . ILE B 2 253 ? 113.970 120.368 107.114 1.00 498.57 ? 253 ILE B CB  1 
ATOM 6613  C CG1 . ILE B 2 253 ? 114.361 121.838 106.891 1.00 500.00 ? 253 ILE B CG1 1 
ATOM 6614  C CG2 . ILE B 2 253 ? 115.102 119.469 106.609 1.00 500.00 ? 253 ILE B CG2 1 
ATOM 6615  C CD1 . ILE B 2 253 ? 115.343 122.392 107.909 1.00 499.43 ? 253 ILE B CD1 1 
ATOM 6616  N N   . SER B 2 254 ? 112.156 117.820 107.186 1.00 425.20 ? 254 SER B N   1 
ATOM 6617  C CA  . SER B 2 254 ? 111.996 116.365 107.126 1.00 441.82 ? 254 SER B CA  1 
ATOM 6618  C C   . SER B 2 254 ? 110.960 115.995 106.062 1.00 462.94 ? 254 SER B C   1 
ATOM 6619  O O   . SER B 2 254 ? 111.189 115.095 105.234 1.00 469.84 ? 254 SER B O   1 
ATOM 6620  C CB  . SER B 2 254 ? 111.582 115.766 108.487 1.00 448.73 ? 254 SER B CB  1 
ATOM 6621  O OG  . SER B 2 254 ? 110.182 115.837 108.721 1.00 391.85 ? 254 SER B OG  1 
ATOM 6622  N N   . VAL B 2 255 ? 109.845 116.717 106.118 1.00 489.17 ? 255 VAL B N   1 
ATOM 6623  C CA  . VAL B 2 255 ? 108.731 116.510 105.191 1.00 482.64 ? 255 VAL B CA  1 
ATOM 6624  C C   . VAL B 2 255 ? 109.207 116.707 103.744 1.00 416.07 ? 255 VAL B C   1 
ATOM 6625  O O   . VAL B 2 255 ? 108.903 115.896 102.853 1.00 320.15 ? 255 VAL B O   1 
ATOM 6626  C CB  . VAL B 2 255 ? 107.419 117.270 105.573 1.00 500.00 ? 255 VAL B CB  1 
ATOM 6627  C CG1 . VAL B 2 255 ? 107.007 118.326 104.544 1.00 500.00 ? 255 VAL B CG1 1 
ATOM 6628  C CG2 . VAL B 2 255 ? 106.284 116.274 105.793 1.00 500.00 ? 255 VAL B CG2 1 
ATOM 6629  N N   . THR B 2 256 ? 109.951 117.790 103.560 1.00 431.52 ? 256 THR B N   1 
ATOM 6630  C CA  . THR B 2 256 ? 110.504 118.156 102.254 1.00 463.04 ? 256 THR B CA  1 
ATOM 6631  C C   . THR B 2 256 ? 111.390 117.037 101.725 1.00 500.00 ? 256 THR B C   1 
ATOM 6632  O O   . THR B 2 256 ? 111.292 116.647 100.556 1.00 500.00 ? 256 THR B O   1 
ATOM 6633  C CB  . THR B 2 256 ? 111.258 119.511 102.228 1.00 452.77 ? 256 THR B CB  1 
ATOM 6634  O OG1 . THR B 2 256 ? 112.404 119.464 103.086 1.00 478.98 ? 256 THR B OG1 1 
ATOM 6635  C CG2 . THR B 2 256 ? 110.348 120.671 102.635 1.00 423.03 ? 256 THR B CG2 1 
ATOM 6636  N N   . ASP B 2 257 ? 112.240 116.541 102.613 1.00 500.00 ? 257 ASP B N   1 
ATOM 6637  C CA  . ASP B 2 257 ? 113.178 115.453 102.303 1.00 500.00 ? 257 ASP B CA  1 
ATOM 6638  C C   . ASP B 2 257 ? 112.409 114.223 101.833 1.00 500.00 ? 257 ASP B C   1 
ATOM 6639  O O   . ASP B 2 257 ? 112.769 113.600 100.830 1.00 497.73 ? 257 ASP B O   1 
ATOM 6640  C CB  . ASP B 2 257 ? 114.108 115.140 103.497 1.00 500.00 ? 257 ASP B CB  1 
ATOM 6641  C CG  . ASP B 2 257 ? 115.593 115.226 103.130 1.00 500.00 ? 257 ASP B CG  1 
ATOM 6642  O OD1 . ASP B 2 257 ? 116.019 114.564 102.156 1.00 500.00 ? 257 ASP B OD1 1 
ATOM 6643  O OD2 . ASP B 2 257 ? 116.336 115.951 103.828 1.00 500.00 ? 257 ASP B OD2 1 
ATOM 6644  N N   . LEU B 2 258 ? 111.361 113.910 102.581 1.00 495.82 ? 258 LEU B N   1 
ATOM 6645  C CA  . LEU B 2 258 ? 110.487 112.766 102.298 1.00 479.44 ? 258 LEU B CA  1 
ATOM 6646  C C   . LEU B 2 258 ? 109.900 112.894 100.888 1.00 380.15 ? 258 LEU B C   1 
ATOM 6647  O O   . LEU B 2 258 ? 109.904 111.933 100.097 1.00 348.52 ? 258 LEU B O   1 
ATOM 6648  C CB  . LEU B 2 258 ? 109.335 112.729 103.321 1.00 500.00 ? 258 LEU B CB  1 
ATOM 6649  C CG  . LEU B 2 258 ? 108.215 111.671 103.291 1.00 500.00 ? 258 LEU B CG  1 
ATOM 6650  C CD1 . LEU B 2 258 ? 106.996 112.163 102.513 1.00 500.00 ? 258 LEU B CD1 1 
ATOM 6651  C CD2 . LEU B 2 258 ? 108.684 110.322 102.752 1.00 500.00 ? 258 LEU B CD2 1 
ATOM 6652  N N   . VAL B 2 259 ? 109.406 114.095 100.620 1.00 392.21 ? 259 VAL B N   1 
ATOM 6653  C CA  . VAL B 2 259 ? 108.790 114.427 99.332  1.00 452.04 ? 259 VAL B CA  1 
ATOM 6654  C C   . VAL B 2 259 ? 109.794 114.195 98.196  1.00 432.34 ? 259 VAL B C   1 
ATOM 6655  O O   . VAL B 2 259 ? 109.465 113.593 97.168  1.00 324.02 ? 259 VAL B O   1 
ATOM 6656  C CB  . VAL B 2 259 ? 108.136 115.837 99.301  1.00 500.00 ? 259 VAL B CB  1 
ATOM 6657  C CG1 . VAL B 2 259 ? 107.655 116.195 97.890  1.00 500.00 ? 259 VAL B CG1 1 
ATOM 6658  C CG2 . VAL B 2 259 ? 106.971 115.910 100.291 1.00 500.00 ? 259 VAL B CG2 1 
ATOM 6659  N N   . ALA B 2 260 ? 111.001 114.688 98.426  1.00 456.59 ? 260 ALA B N   1 
ATOM 6660  C CA  . ALA B 2 260 ? 112.106 114.569 97.471  1.00 435.20 ? 260 ALA B CA  1 
ATOM 6661  C C   . ALA B 2 260 ? 112.383 113.106 97.165  1.00 482.62 ? 260 ALA B C   1 
ATOM 6662  O O   . ALA B 2 260 ? 112.547 112.721 96.015  1.00 500.00 ? 260 ALA B O   1 
ATOM 6663  C CB  . ALA B 2 260 ? 113.361 115.264 97.980  1.00 451.62 ? 260 ALA B CB  1 
ATOM 6664  N N   . VAL B 2 261 ? 112.311 112.260 98.185  1.00 500.00 ? 261 VAL B N   1 
ATOM 6665  C CA  . VAL B 2 261 ? 112.738 110.874 98.040  1.00 500.00 ? 261 VAL B CA  1 
ATOM 6666  C C   . VAL B 2 261 ? 111.912 110.167 96.974  1.00 500.00 ? 261 VAL B C   1 
ATOM 6667  O O   . VAL B 2 261 ? 112.446 109.419 96.156  1.00 445.05 ? 261 VAL B O   1 
ATOM 6668  C CB  . VAL B 2 261 ? 112.545 110.092 99.351  1.00 500.00 ? 261 VAL B CB  1 
ATOM 6669  C CG1 . VAL B 2 261 ? 113.025 108.657 99.192  1.00 500.00 ? 261 VAL B CG1 1 
ATOM 6670  C CG2 . VAL B 2 261 ? 113.252 110.780 100.505 1.00 500.00 ? 261 VAL B CG2 1 
ATOM 6671  N N   . LEU B 2 262 ? 110.607 110.411 96.985  1.00 500.00 ? 262 LEU B N   1 
ATOM 6672  C CA  . LEU B 2 262 ? 109.698 109.701 96.095  1.00 500.00 ? 262 LEU B CA  1 
ATOM 6673  C C   . LEU B 2 262 ? 109.980 109.996 94.626  1.00 500.00 ? 262 LEU B C   1 
ATOM 6674  O O   . LEU B 2 262 ? 109.947 109.098 93.789  1.00 478.93 ? 262 LEU B O   1 
ATOM 6675  C CB  . LEU B 2 262 ? 108.245 110.025 96.443  1.00 500.00 ? 262 LEU B CB  1 
ATOM 6676  C CG  . LEU B 2 262 ? 107.687 109.259 97.644  1.00 500.00 ? 262 LEU B CG  1 
ATOM 6677  C CD1 . LEU B 2 262 ? 106.468 109.954 98.227  1.00 500.00 ? 262 LEU B CD1 1 
ATOM 6678  C CD2 . LEU B 2 262 ? 107.367 107.825 97.255  1.00 500.00 ? 262 LEU B CD2 1 
ATOM 6679  N N   . CYS B 2 263 ? 110.265 111.253 94.313  1.00 500.00 ? 263 CYS B N   1 
ATOM 6680  C CA  . CYS B 2 263 ? 110.793 111.590 93.000  1.00 500.00 ? 263 CYS B CA  1 
ATOM 6681  C C   . CYS B 2 263 ? 112.209 112.123 93.121  1.00 500.00 ? 263 CYS B C   1 
ATOM 6682  O O   . CYS B 2 263 ? 113.182 111.372 93.040  1.00 500.00 ? 263 CYS B O   1 
ATOM 6683  C CB  . CYS B 2 263 ? 109.913 112.642 92.327  1.00 500.00 ? 263 CYS B CB  1 
ATOM 6684  S SG  . CYS B 2 263 ? 108.137 112.398 92.547  1.00 376.53 ? 263 CYS B SG  1 
ATOM 6685  N N   . PRO B 2 264 ? 112.314 113.487 93.334  1.00 500.00 ? 264 PRO B N   1 
ATOM 6686  C CA  . PRO B 2 264 ? 113.127 114.153 92.309  1.00 500.00 ? 264 PRO B CA  1 
ATOM 6687  C C   . PRO B 2 264 ? 114.538 113.622 92.408  1.00 500.00 ? 264 PRO B C   1 
ATOM 6688  O O   . PRO B 2 264 ? 115.186 113.343 91.404  1.00 450.67 ? 264 PRO B O   1 
ATOM 6689  C CB  . PRO B 2 264 ? 113.086 115.629 92.712  1.00 500.00 ? 264 PRO B CB  1 
ATOM 6690  C CG  . PRO B 2 264 ? 112.932 115.607 94.184  1.00 500.00 ? 264 PRO B CG  1 
ATOM 6691  C CD  . PRO B 2 264 ? 111.900 114.542 94.361  1.00 500.00 ? 264 PRO B CD  1 
ATOM 6692  N N   . LYS B 2 265 ? 114.992 113.459 93.643  1.00 500.00 ? 265 LYS B N   1 
ATOM 6693  C CA  . LYS B 2 265 ? 116.168 112.655 93.918  1.00 500.00 ? 265 LYS B CA  1 
ATOM 6694  C C   . LYS B 2 265 ? 115.963 111.197 93.530  1.00 486.13 ? 265 LYS B C   1 
ATOM 6695  O O   . LYS B 2 265 ? 116.887 110.573 93.011  1.00 428.72 ? 265 LYS B O   1 
ATOM 6696  C CB  . LYS B 2 265 ? 116.614 112.791 95.374  1.00 500.00 ? 265 LYS B CB  1 
ATOM 6697  C CG  . LYS B 2 265 ? 115.614 112.293 96.397  1.00 500.00 ? 265 LYS B CG  1 
ATOM 6698  C CD  . LYS B 2 265 ? 116.050 112.708 97.789  1.00 500.00 ? 265 LYS B CD  1 
ATOM 6699  C CE  . LYS B 2 265 ? 115.217 112.028 98.855  1.00 472.96 ? 265 LYS B CE  1 
ATOM 6700  N NZ  . LYS B 2 265 ? 115.346 110.548 98.769  1.00 466.53 ? 265 LYS B NZ  1 
ATOM 6701  N N   . GLY B 2 266 ? 114.771 110.643 93.758  1.00 500.00 ? 266 GLY B N   1 
ATOM 6702  C CA  . GLY B 2 266 ? 114.466 109.402 93.024  1.00 500.00 ? 266 GLY B CA  1 
ATOM 6703  C C   . GLY B 2 266 ? 115.119 109.567 91.671  1.00 500.00 ? 266 GLY B C   1 
ATOM 6704  O O   . GLY B 2 266 ? 115.902 108.697 91.250  1.00 500.00 ? 266 GLY B O   1 
ATOM 6705  N N   . PRO B 2 267 ? 114.740 110.654 90.939  1.00 500.00 ? 267 PRO B N   1 
ATOM 6706  C CA  . PRO B 2 267 ? 115.415 111.024 89.713  1.00 500.00 ? 267 PRO B CA  1 
ATOM 6707  C C   . PRO B 2 267 ? 116.919 111.088 89.833  1.00 500.00 ? 267 PRO B C   1 
ATOM 6708  O O   . PRO B 2 267 ? 117.607 110.531 88.954  1.00 500.00 ? 267 PRO B O   1 
ATOM 6709  C CB  . PRO B 2 267 ? 114.777 112.360 89.363  1.00 500.00 ? 267 PRO B CB  1 
ATOM 6710  C CG  . PRO B 2 267 ? 113.347 112.080 89.669  1.00 500.00 ? 267 PRO B CG  1 
ATOM 6711  C CD  . PRO B 2 267 ? 113.370 111.196 90.903  1.00 500.00 ? 267 PRO B CD  1 
ATOM 6712  N N   . LEU B 2 268 ? 117.399 111.733 90.882  1.00 467.91 ? 268 LEU B N   1 
ATOM 6713  C CA  . LEU B 2 268 ? 118.838 111.861 91.134  1.00 442.08 ? 268 LEU B CA  1 
ATOM 6714  C C   . LEU B 2 268 ? 119.505 110.476 91.220  1.00 441.45 ? 268 LEU B C   1 
ATOM 6715  O O   . LEU B 2 268 ? 120.452 110.185 90.465  1.00 443.69 ? 268 LEU B O   1 
ATOM 6716  C CB  . LEU B 2 268 ? 119.091 112.695 92.409  1.00 486.55 ? 268 LEU B CB  1 
ATOM 6717  C CG  . LEU B 2 268 ? 120.363 112.591 93.282  1.00 500.00 ? 268 LEU B CG  1 
ATOM 6718  C CD1 . LEU B 2 268 ? 120.288 111.514 94.370  1.00 500.00 ? 268 LEU B CD1 1 
ATOM 6719  C CD2 . LEU B 2 268 ? 121.639 112.454 92.453  1.00 500.00 ? 268 LEU B CD2 1 
ATOM 6720  N N   . ARG B 2 269 ? 119.079 109.722 92.222  1.00 459.99 ? 269 ARG B N   1 
ATOM 6721  C CA  . ARG B 2 269 ? 119.698 108.452 92.584  1.00 500.00 ? 269 ARG B CA  1 
ATOM 6722  C C   . ARG B 2 269 ? 119.663 107.493 91.393  1.00 500.00 ? 269 ARG B C   1 
ATOM 6723  O O   . ARG B 2 269 ? 120.672 106.852 91.044  1.00 500.00 ? 269 ARG B O   1 
ATOM 6724  C CB  . ARG B 2 269 ? 119.011 107.815 93.823  1.00 488.07 ? 269 ARG B CB  1 
ATOM 6725  C CG  . ARG B 2 269 ? 119.821 106.731 94.552  1.00 486.94 ? 269 ARG B CG  1 
ATOM 6726  C CD  . ARG B 2 269 ? 119.235 106.373 95.926  1.00 480.58 ? 269 ARG B CD  1 
ATOM 6727  N NE  . ARG B 2 269 ? 120.095 105.497 96.751  1.00 475.86 ? 269 ARG B NE  1 
ATOM 6728  C CZ  . ARG B 2 269 ? 119.800 105.057 97.987  1.00 435.39 ? 269 ARG B CZ  1 
ATOM 6729  N NH1 . ARG B 2 269 ? 118.660 105.395 98.581  1.00 446.60 ? 269 ARG B NH1 1 
ATOM 6730  N NH2 . ARG B 2 269 ? 120.648 104.267 98.648  1.00 369.66 ? 269 ARG B NH2 1 
ATOM 6731  N N   . MET B 2 270 ? 118.474 107.427 90.795  1.00 500.00 ? 270 MET B N   1 
ATOM 6732  C CA  . MET B 2 270 ? 118.233 106.549 89.635  1.00 477.13 ? 270 MET B CA  1 
ATOM 6733  C C   . MET B 2 270 ? 119.162 106.928 88.499  1.00 444.17 ? 270 MET B C   1 
ATOM 6734  O O   . MET B 2 270 ? 119.765 106.046 87.871  1.00 331.48 ? 270 MET B O   1 
ATOM 6735  C CB  . MET B 2 270 ? 116.751 106.492 89.184  1.00 492.41 ? 270 MET B CB  1 
ATOM 6736  C CG  . MET B 2 270 ? 116.217 107.651 88.337  1.00 490.91 ? 270 MET B CG  1 
ATOM 6737  S SD  . MET B 2 270 ? 116.703 107.676 86.591  1.00 480.96 ? 270 MET B SD  1 
ATOM 6738  C CE  . MET B 2 270 ? 116.339 109.372 86.129  1.00 423.04 ? 270 MET B CE  1 
ATOM 6739  N N   . LEU B 2 271 ? 119.263 108.233 88.263  1.00 500.00 ? 271 LEU B N   1 
ATOM 6740  C CA  . LEU B 2 271 ? 120.124 108.786 87.208  1.00 500.00 ? 271 LEU B CA  1 
ATOM 6741  C C   . LEU B 2 271 ? 121.565 108.350 87.425  1.00 500.00 ? 271 LEU B C   1 
ATOM 6742  O O   . LEU B 2 271 ? 122.246 107.906 86.488  1.00 493.68 ? 271 LEU B O   1 
ATOM 6743  C CB  . LEU B 2 271 ? 120.050 110.331 87.162  1.00 500.00 ? 271 LEU B CB  1 
ATOM 6744  C CG  . LEU B 2 271 ? 121.033 111.205 86.349  1.00 500.00 ? 271 LEU B CG  1 
ATOM 6745  C CD1 . LEU B 2 271 ? 122.413 111.345 86.992  1.00 500.00 ? 271 LEU B CD1 1 
ATOM 6746  C CD2 . LEU B 2 271 ? 121.154 110.719 84.908  1.00 500.00 ? 271 LEU B CD2 1 
ATOM 6747  N N   . VAL B 2 272 ? 121.994 108.494 88.672  1.00 483.87 ? 272 VAL B N   1 
ATOM 6748  C CA  . VAL B 2 272 ? 123.355 108.139 89.093  1.00 500.00 ? 272 VAL B CA  1 
ATOM 6749  C C   . VAL B 2 272 ? 123.626 106.666 88.788  1.00 495.50 ? 272 VAL B C   1 
ATOM 6750  O O   . VAL B 2 272 ? 124.679 106.310 88.232  1.00 499.79 ? 272 VAL B O   1 
ATOM 6751  C CB  . VAL B 2 272 ? 123.561 108.459 90.601  1.00 500.00 ? 272 VAL B CB  1 
ATOM 6752  C CG1 . VAL B 2 272 ? 124.723 107.681 91.207  1.00 500.00 ? 272 VAL B CG1 1 
ATOM 6753  C CG2 . VAL B 2 272 ? 123.744 109.957 90.793  1.00 500.00 ? 272 VAL B CG2 1 
ATOM 6754  N N   . GLU B 2 273 ? 122.655 105.846 89.168  1.00 479.63 ? 273 GLU B N   1 
ATOM 6755  C CA  . GLU B 2 273 ? 122.724 104.396 88.975  1.00 500.00 ? 273 GLU B CA  1 
ATOM 6756  C C   . GLU B 2 273 ? 122.894 104.070 87.491  1.00 500.00 ? 273 GLU B C   1 
ATOM 6757  O O   . GLU B 2 273 ? 123.741 103.247 87.111  1.00 500.00 ? 273 GLU B O   1 
ATOM 6758  C CB  . GLU B 2 273 ? 121.533 103.670 89.626  1.00 500.00 ? 273 GLU B CB  1 
ATOM 6759  C CG  . GLU B 2 273 ? 121.666 103.563 91.149  1.00 494.34 ? 273 GLU B CG  1 
ATOM 6760  C CD  . GLU B 2 273 ? 120.525 102.808 91.829  1.00 476.67 ? 273 GLU B CD  1 
ATOM 6761  O OE1 . GLU B 2 273 ? 119.382 102.839 91.323  1.00 479.38 ? 273 GLU B OE1 1 
ATOM 6762  O OE2 . GLU B 2 273 ? 120.773 102.191 92.891  1.00 381.77 ? 273 GLU B OE2 1 
ATOM 6763  N N   . THR B 2 274 ? 122.083 104.745 86.685  1.00 500.00 ? 274 THR B N   1 
ATOM 6764  C CA  . THR B 2 274 ? 122.080 104.575 85.233  1.00 500.00 ? 274 THR B CA  1 
ATOM 6765  C C   . THR B 2 274 ? 123.459 104.896 84.671  1.00 500.00 ? 274 THR B C   1 
ATOM 6766  O O   . THR B 2 274 ? 124.007 104.131 83.845  1.00 500.00 ? 274 THR B O   1 
ATOM 6767  C CB  . THR B 2 274 ? 121.006 105.447 84.533  1.00 500.00 ? 274 THR B CB  1 
ATOM 6768  O OG1 . THR B 2 274 ? 119.776 105.391 85.267  1.00 500.00 ? 274 THR B OG1 1 
ATOM 6769  C CG2 . THR B 2 274 ? 120.756 104.960 83.108  1.00 500.00 ? 274 THR B CG2 1 
ATOM 6770  N N   . ALA B 2 275 ? 124.001 106.014 85.145  1.00 500.00 ? 275 ALA B N   1 
ATOM 6771  C CA  . ALA B 2 275 ? 125.279 106.533 84.647  1.00 500.00 ? 275 ALA B CA  1 
ATOM 6772  C C   . ALA B 2 275 ? 126.534 105.729 85.063  1.00 500.00 ? 275 ALA B C   1 
ATOM 6773  O O   . ALA B 2 275 ? 127.236 105.118 84.221  1.00 500.00 ? 275 ALA B O   1 
ATOM 6774  C CB  . ALA B 2 275 ? 125.431 108.005 85.027  1.00 500.00 ? 275 ALA B CB  1 
ATOM 6775  N N   . GLN B 2 276 ? 126.807 105.750 86.365  1.00 500.00 ? 276 GLN B N   1 
ATOM 6776  C CA  . GLN B 2 276 ? 128.053 105.214 86.909  1.00 492.85 ? 276 GLN B CA  1 
ATOM 6777  C C   . GLN B 2 276 ? 127.988 105.078 88.441  1.00 458.41 ? 276 GLN B C   1 
ATOM 6778  O O   . GLN B 2 276 ? 126.992 104.574 88.967  1.00 430.53 ? 276 GLN B O   1 
ATOM 6779  C CB  . GLN B 2 276 ? 129.235 106.085 86.457  1.00 497.46 ? 276 GLN B CB  1 
ATOM 6780  N N   . GLU B 2 277 ? 129.029 105.525 89.148  1.00 450.78 ? 277 GLU B N   1 
ATOM 6781  C CA  . GLU B 2 277 ? 129.202 105.217 90.570  1.00 470.92 ? 277 GLU B CA  1 
ATOM 6782  C C   . GLU B 2 277 ? 128.303 106.063 91.454  1.00 500.00 ? 277 GLU B C   1 
ATOM 6783  O O   . GLU B 2 277 ? 127.861 107.135 91.046  1.00 500.00 ? 277 GLU B O   1 
ATOM 6784  C CB  . GLU B 2 277 ? 130.659 105.437 90.986  1.00 480.44 ? 277 GLU B CB  1 
ATOM 6785  N N   . ARG B 2 278 ? 128.048 105.571 92.668  1.00 500.00 ? 278 ARG B N   1 
ATOM 6786  C CA  . ARG B 2 278 ? 127.272 106.311 93.673  1.00 500.00 ? 278 ARG B CA  1 
ATOM 6787  C C   . ARG B 2 278 ? 128.061 107.547 94.117  1.00 500.00 ? 278 ARG B C   1 
ATOM 6788  O O   . ARG B 2 278 ? 129.124 107.427 94.735  1.00 500.00 ? 278 ARG B O   1 
ATOM 6789  C CB  . ARG B 2 278 ? 126.936 105.421 94.873  1.00 500.00 ? 278 ARG B CB  1 
ATOM 6790  N N   . ASN B 2 279 ? 127.519 108.722 93.805  1.00 473.95 ? 279 ASN B N   1 
ATOM 6791  C CA  . ASN B 2 279 ? 128.288 109.961 93.755  1.00 441.14 ? 279 ASN B CA  1 
ATOM 6792  C C   . ASN B 2 279 ? 127.387 111.173 94.086  1.00 448.94 ? 279 ASN B C   1 
ATOM 6793  O O   . ASN B 2 279 ? 126.167 111.008 94.159  1.00 460.22 ? 279 ASN B O   1 
ATOM 6794  C CB  . ASN B 2 279 ? 128.908 110.065 92.348  1.00 465.76 ? 279 ASN B CB  1 
ATOM 6795  C CG  . ASN B 2 279 ? 127.870 110.264 91.257  1.00 480.27 ? 279 ASN B CG  1 
ATOM 6796  O OD1 . ASN B 2 279 ? 126.695 109.955 91.438  1.00 388.07 ? 279 ASN B OD1 1 
ATOM 6797  N ND2 . ASN B 2 279 ? 128.306 110.782 90.112  1.00 500.00 ? 279 ASN B ND2 1 
ATOM 6798  N N   . GLU B 2 280 ? 127.954 112.354 94.295  1.00 446.93 ? 280 GLU B N   1 
ATOM 6799  C CA  . GLU B 2 280 ? 129.387 112.583 94.262  1.00 442.71 ? 280 GLU B CA  1 
ATOM 6800  C C   . GLU B 2 280 ? 129.966 112.098 95.584  1.00 454.85 ? 280 GLU B C   1 
ATOM 6801  O O   . GLU B 2 280 ? 129.222 111.795 96.517  1.00 418.87 ? 280 GLU B O   1 
ATOM 6802  C CB  . GLU B 2 280 ? 129.689 114.067 94.048  1.00 434.25 ? 280 GLU B CB  1 
ATOM 6803  C CG  . GLU B 2 280 ? 131.166 114.387 93.894  1.00 421.24 ? 280 GLU B CG  1 
ATOM 6804  C CD  . GLU B 2 280 ? 131.401 115.769 93.319  1.00 446.09 ? 280 GLU B CD  1 
ATOM 6805  O OE1 . GLU B 2 280 ? 130.559 116.229 92.520  1.00 456.82 ? 280 GLU B OE1 1 
ATOM 6806  O OE2 . GLU B 2 280 ? 132.423 116.396 93.665  1.00 431.31 ? 280 GLU B OE2 1 
ATOM 6807  N N   . THR B 2 281 ? 131.288 112.020 95.665  1.00 483.76 ? 281 THR B N   1 
ATOM 6808  C CA  . THR B 2 281 ? 131.941 111.552 96.880  1.00 473.57 ? 281 THR B CA  1 
ATOM 6809  C C   . THR B 2 281 ? 131.581 112.450 98.056  1.00 402.19 ? 281 THR B C   1 
ATOM 6810  O O   . THR B 2 281 ? 131.372 111.969 99.168  1.00 361.77 ? 281 THR B O   1 
ATOM 6811  C CB  . THR B 2 281 ? 133.471 111.519 96.724  1.00 500.00 ? 281 THR B CB  1 
ATOM 6812  O OG1 . THR B 2 281 ? 134.064 111.036 97.935  1.00 500.00 ? 281 THR B OG1 1 
ATOM 6813  C CG2 . THR B 2 281 ? 134.004 112.911 96.423  1.00 500.00 ? 281 THR B CG2 1 
ATOM 6814  N N   . LEU B 2 282 ? 131.504 113.753 97.810  1.00 404.41 ? 282 LEU B N   1 
ATOM 6815  C CA  . LEU B 2 282 ? 131.158 114.692 98.867  1.00 428.19 ? 282 LEU B CA  1 
ATOM 6816  C C   . LEU B 2 282 ? 129.764 114.365 99.384  1.00 388.45 ? 282 LEU B C   1 
ATOM 6817  O O   . LEU B 2 282 ? 129.512 114.405 100.585 1.00 381.68 ? 282 LEU B O   1 
ATOM 6818  C CB  . LEU B 2 282 ? 131.203 116.127 98.344  1.00 489.77 ? 282 LEU B CB  1 
ATOM 6819  C CG  . LEU B 2 282 ? 130.881 117.241 99.343  1.00 500.00 ? 282 LEU B CG  1 
ATOM 6820  C CD1 . LEU B 2 282 ? 131.191 118.602 98.737  1.00 500.00 ? 282 LEU B CD1 1 
ATOM 6821  C CD2 . LEU B 2 282 ? 129.432 117.169 99.801  1.00 500.00 ? 282 LEU B CD2 1 
ATOM 6822  N N   . PHE B 2 283 ? 128.860 114.038 98.467  1.00 397.39 ? 283 PHE B N   1 
ATOM 6823  C CA  . PHE B 2 283 ? 127.496 113.679 98.833  1.00 434.41 ? 283 PHE B CA  1 
ATOM 6824  C C   . PHE B 2 283 ? 127.196 112.224 98.435  1.00 444.93 ? 283 PHE B C   1 
ATOM 6825  O O   . PHE B 2 283 ? 126.389 111.991 97.529  1.00 492.40 ? 283 PHE B O   1 
ATOM 6826  C CB  . PHE B 2 283 ? 126.530 114.657 98.133  1.00 470.62 ? 283 PHE B CB  1 
ATOM 6827  C CG  . PHE B 2 283 ? 125.223 114.882 98.861  1.00 500.00 ? 283 PHE B CG  1 
ATOM 6828  C CD1 . PHE B 2 283 ? 124.496 113.824 99.419  1.00 500.00 ? 283 PHE B CD1 1 
ATOM 6829  C CD2 . PHE B 2 283 ? 124.696 116.170 98.958  1.00 500.00 ? 283 PHE B CD2 1 
ATOM 6830  C CE1 . PHE B 2 283 ? 123.295 114.054 100.073 1.00 500.00 ? 283 PHE B CE1 1 
ATOM 6831  C CE2 . PHE B 2 283 ? 123.493 116.402 99.611  1.00 500.00 ? 283 PHE B CE2 1 
ATOM 6832  C CZ  . PHE B 2 283 ? 122.791 115.343 100.168 1.00 500.00 ? 283 PHE B CZ  1 
ATOM 6833  N N   . PRO B 2 284 ? 127.869 111.237 99.072  1.00 453.22 ? 284 PRO B N   1 
ATOM 6834  C CA  . PRO B 2 284 ? 127.385 109.862 98.859  1.00 495.07 ? 284 PRO B CA  1 
ATOM 6835  C C   . PRO B 2 284 ? 125.993 109.576 99.457  1.00 480.33 ? 284 PRO B C   1 
ATOM 6836  O O   . PRO B 2 284 ? 125.093 109.212 98.698  1.00 489.87 ? 284 PRO B O   1 
ATOM 6837  C CB  . PRO B 2 284 ? 128.476 108.974 99.490  1.00 500.00 ? 284 PRO B CB  1 
ATOM 6838  C CG  . PRO B 2 284 ? 129.670 109.839 99.639  1.00 487.68 ? 284 PRO B CG  1 
ATOM 6839  C CD  . PRO B 2 284 ? 129.220 111.263 99.667  1.00 431.91 ? 284 PRO B CD  1 
ATOM 6840  N N   . ALA B 2 285 ? 125.766 109.766 100.761 1.00 432.85 ? 285 ALA B N   1 
ATOM 6841  C CA  . ALA B 2 285 ? 126.672 110.421 101.706 1.00 368.79 ? 285 ALA B CA  1 
ATOM 6842  C C   . ALA B 2 285 ? 127.009 109.533 102.892 1.00 360.82 ? 285 ALA B C   1 
ATOM 6843  O O   . ALA B 2 285 ? 126.157 109.256 103.737 1.00 317.04 ? 285 ALA B O   1 
ATOM 6844  C CB  . ALA B 2 285 ? 126.070 111.718 102.159 1.00 390.65 ? 285 ALA B CB  1 
ATOM 6845  N N   . LEU B 2 286 ? 128.276 109.127 102.950 1.00 391.63 ? 286 LEU B N   1 
ATOM 6846  C CA  . LEU B 2 286 ? 128.783 108.087 103.849 1.00 442.34 ? 286 LEU B CA  1 
ATOM 6847  C C   . LEU B 2 286 ? 128.459 106.693 103.313 1.00 417.73 ? 286 LEU B C   1 
ATOM 6848  O O   . LEU B 2 286 ? 127.383 106.445 102.758 1.00 371.58 ? 286 LEU B O   1 
ATOM 6849  C CB  . LEU B 2 286 ? 128.284 108.257 105.298 1.00 458.33 ? 286 LEU B CB  1 
ATOM 6850  C CG  . LEU B 2 286 ? 129.108 107.642 106.439 1.00 415.44 ? 286 LEU B CG  1 
ATOM 6851  C CD1 . LEU B 2 286 ? 130.499 108.252 106.538 1.00 413.82 ? 286 LEU B CD1 1 
ATOM 6852  C CD2 . LEU B 2 286 ? 128.364 107.802 107.757 1.00 377.84 ? 286 LEU B CD2 1 
ATOM 6853  N N   . ILE B 2 287 ? 129.414 105.794 103.504 1.00 427.40 ? 287 ILE B N   1 
ATOM 6854  C CA  . ILE B 2 287 ? 129.383 104.463 102.918 1.00 463.45 ? 287 ILE B CA  1 
ATOM 6855  C C   . ILE B 2 287 ? 129.586 103.471 104.070 1.00 483.29 ? 287 ILE B C   1 
ATOM 6856  O O   . ILE B 2 287 ? 129.418 103.840 105.238 1.00 478.33 ? 287 ILE B O   1 
ATOM 6857  C CB  . ILE B 2 287 ? 130.474 104.314 101.814 1.00 473.59 ? 287 ILE B CB  1 
ATOM 6858  C CG1 . ILE B 2 287 ? 131.000 105.684 101.345 1.00 458.58 ? 287 ILE B CG1 1 
ATOM 6859  C CG2 . ILE B 2 287 ? 129.936 103.517 100.623 1.00 494.20 ? 287 ILE B CG2 1 
ATOM 6860  C CD1 . ILE B 2 287 ? 131.982 105.613 100.196 1.00 486.00 ? 287 ILE B CD1 1 
ATOM 6861  N N   . TYR B 2 288 ? 129.916 102.220 103.753 1.00 483.52 ? 288 TYR B N   1 
ATOM 6862  C CA  . TYR B 2 288 ? 130.307 101.244 104.764 1.00 468.70 ? 288 TYR B CA  1 
ATOM 6863  C C   . TYR B 2 288 ? 131.646 101.640 105.386 1.00 429.56 ? 288 TYR B C   1 
ATOM 6864  O O   . TYR B 2 288 ? 132.478 102.271 104.732 1.00 357.83 ? 288 TYR B O   1 
ATOM 6865  C CB  . TYR B 2 288 ? 130.414 99.850  104.147 1.00 500.00 ? 288 TYR B CB  1 
ATOM 6866  N N   . GLY B 2 378 ? 127.512 97.661  99.460  1.00 437.12 ? 378 GLY B N   1 
ATOM 6867  C CA  . GLY B 2 378 ? 127.408 98.406  100.714 1.00 470.14 ? 378 GLY B CA  1 
ATOM 6868  C C   . GLY B 2 378 ? 126.059 99.081  100.918 1.00 486.50 ? 378 GLY B C   1 
ATOM 6869  O O   . GLY B 2 378 ? 125.053 98.674  100.324 1.00 455.89 ? 378 GLY B O   1 
ATOM 6870  N N   . VAL B 2 379 ? 126.049 100.113 101.769 1.00 495.58 ? 379 VAL B N   1 
ATOM 6871  C CA  . VAL B 2 379 ? 124.836 100.889 102.085 1.00 480.85 ? 379 VAL B CA  1 
ATOM 6872  C C   . VAL B 2 379 ? 125.125 102.401 102.084 1.00 445.19 ? 379 VAL B C   1 
ATOM 6873  O O   . VAL B 2 379 ? 126.206 102.842 102.491 1.00 387.34 ? 379 VAL B O   1 
ATOM 6874  C CB  . VAL B 2 379 ? 124.202 100.434 103.427 1.00 480.55 ? 379 VAL B CB  1 
ATOM 6875  C CG1 . VAL B 2 379 ? 125.037 100.869 104.629 1.00 459.69 ? 379 VAL B CG1 1 
ATOM 6876  C CG2 . VAL B 2 379 ? 122.764 100.934 103.548 1.00 481.83 ? 379 VAL B CG2 1 
ATOM 6877  N N   . LYS B 2 380 ? 124.141 103.176 101.627 1.00 434.27 ? 380 LYS B N   1 
ATOM 6878  C CA  . LYS B 2 380 ? 124.309 104.598 101.333 1.00 425.33 ? 380 LYS B CA  1 
ATOM 6879  C C   . LYS B 2 380 ? 123.264 105.428 102.068 1.00 431.55 ? 380 LYS B C   1 
ATOM 6880  O O   . LYS B 2 380 ? 122.094 105.039 102.140 1.00 420.73 ? 380 LYS B O   1 
ATOM 6881  C CB  . LYS B 2 380 ? 124.202 104.813 99.822  1.00 457.60 ? 380 LYS B CB  1 
ATOM 6882  C CG  . LYS B 2 380 ? 124.648 106.185 99.330  1.00 461.14 ? 380 LYS B CG  1 
ATOM 6883  C CD  . LYS B 2 380 ? 125.721 106.087 98.253  1.00 455.03 ? 380 LYS B CD  1 
ATOM 6884  C CE  . LYS B 2 380 ? 127.069 105.726 98.864  1.00 466.72 ? 380 LYS B CE  1 
ATOM 6885  N NZ  . LYS B 2 380 ? 128.185 105.749 97.878  1.00 481.96 ? 380 LYS B NZ  1 
ATOM 6886  N N   . LEU B 2 381 ? 123.701 106.583 102.575 1.00 443.21 ? 381 LEU B N   1 
ATOM 6887  C CA  . LEU B 2 381 ? 122.956 107.395 103.544 1.00 439.80 ? 381 LEU B CA  1 
ATOM 6888  C C   . LEU B 2 381 ? 122.887 108.866 103.099 1.00 448.99 ? 381 LEU B C   1 
ATOM 6889  O O   . LEU B 2 381 ? 123.820 109.368 102.485 1.00 471.65 ? 381 LEU B O   1 
ATOM 6890  C CB  . LEU B 2 381 ? 123.663 107.254 104.898 1.00 415.24 ? 381 LEU B CB  1 
ATOM 6891  C CG  . LEU B 2 381 ? 123.341 108.098 106.138 1.00 419.51 ? 381 LEU B CG  1 
ATOM 6892  C CD1 . LEU B 2 381 ? 124.112 109.415 106.134 1.00 413.58 ? 381 LEU B CD1 1 
ATOM 6893  C CD2 . LEU B 2 381 ? 121.842 108.312 106.349 1.00 429.89 ? 381 LEU B CD2 1 
ATOM 6894  N N   . GLY B 2 382 ? 121.778 109.549 103.388 1.00 428.84 ? 382 GLY B N   1 
ATOM 6895  C CA  . GLY B 2 382 ? 121.641 110.981 103.087 1.00 400.22 ? 382 GLY B CA  1 
ATOM 6896  C C   . GLY B 2 382 ? 122.366 111.843 104.111 1.00 406.57 ? 382 GLY B C   1 
ATOM 6897  O O   . GLY B 2 382 ? 122.078 111.752 105.306 1.00 431.58 ? 382 GLY B O   1 
ATOM 6898  N N   . LEU B 2 383 ? 123.295 112.683 103.648 1.00 409.07 ? 383 LEU B N   1 
ATOM 6899  C CA  . LEU B 2 383 ? 124.116 113.515 104.542 1.00 416.36 ? 383 LEU B CA  1 
ATOM 6900  C C   . LEU B 2 383 ? 123.247 114.523 105.247 1.00 307.44 ? 383 LEU B C   1 
ATOM 6901  O O   . LEU B 2 383 ? 123.478 114.790 106.428 1.00 287.44 ? 383 LEU B O   1 
ATOM 6902  C CB  . LEU B 2 383 ? 125.235 114.291 103.807 1.00 467.80 ? 383 LEU B CB  1 
ATOM 6903  C CG  . LEU B 2 383 ? 126.661 114.189 104.389 1.00 478.27 ? 383 LEU B CG  1 
ATOM 6904  C CD1 . LEU B 2 383 ? 127.697 114.803 103.448 1.00 493.97 ? 383 LEU B CD1 1 
ATOM 6905  C CD2 . LEU B 2 383 ? 126.774 114.817 105.767 1.00 460.13 ? 383 LEU B CD2 1 
ATOM 6906  N N   . GLY B 2 384 ? 122.308 115.123 104.507 1.00 354.86 ? 384 GLY B N   1 
ATOM 6907  C CA  . GLY B 2 384 ? 121.441 116.171 105.019 1.00 396.87 ? 384 GLY B CA  1 
ATOM 6908  C C   . GLY B 2 384 ? 120.656 115.640 106.230 1.00 391.63 ? 384 GLY B C   1 
ATOM 6909  O O   . GLY B 2 384 ? 120.564 116.315 107.273 1.00 386.01 ? 384 GLY B O   1 
ATOM 6910  N N   . ASP B 2 385 ? 120.112 114.444 106.064 1.00 374.94 ? 385 ASP B N   1 
ATOM 6911  C CA  . ASP B 2 385 ? 119.324 113.867 107.155 1.00 395.63 ? 385 ASP B CA  1 
ATOM 6912  C C   . ASP B 2 385 ? 120.172 113.595 108.367 1.00 340.38 ? 385 ASP B C   1 
ATOM 6913  O O   . ASP B 2 385 ? 119.717 113.871 109.477 1.00 400.51 ? 385 ASP B O   1 
ATOM 6914  C CB  . ASP B 2 385 ? 118.516 112.660 106.711 1.00 435.87 ? 385 ASP B CB  1 
ATOM 6915  C CG  . ASP B 2 385 ? 117.315 113.064 105.872 1.00 478.31 ? 385 ASP B CG  1 
ATOM 6916  O OD1 . ASP B 2 385 ? 117.494 113.279 104.654 1.00 500.00 ? 385 ASP B OD1 1 
ATOM 6917  O OD2 . ASP B 2 385 ? 116.201 113.183 106.435 1.00 437.57 ? 385 ASP B OD2 1 
ATOM 6918  N N   . PHE B 2 386 ? 121.386 113.134 108.152 1.00 321.06 ? 386 PHE B N   1 
ATOM 6919  C CA  . PHE B 2 386 ? 122.374 112.889 109.208 1.00 356.63 ? 386 PHE B CA  1 
ATOM 6920  C C   . PHE B 2 386 ? 122.608 114.190 110.001 1.00 328.75 ? 386 PHE B C   1 
ATOM 6921  O O   . PHE B 2 386 ? 122.584 114.207 111.255 1.00 292.66 ? 386 PHE B O   1 
ATOM 6922  C CB  . PHE B 2 386 ? 123.626 112.471 108.413 1.00 369.53 ? 386 PHE B CB  1 
ATOM 6923  C CG  . PHE B 2 386 ? 124.824 112.091 109.206 1.00 391.60 ? 386 PHE B CG  1 
ATOM 6924  C CD1 . PHE B 2 386 ? 125.619 113.053 109.787 1.00 410.19 ? 386 PHE B CD1 1 
ATOM 6925  C CD2 . PHE B 2 386 ? 125.250 110.767 109.232 1.00 448.98 ? 386 PHE B CD2 1 
ATOM 6926  C CE1 . PHE B 2 386 ? 126.771 112.699 110.463 1.00 465.22 ? 386 PHE B CE1 1 
ATOM 6927  C CE2 . PHE B 2 386 ? 126.401 110.404 109.907 1.00 490.17 ? 386 PHE B CE2 1 
ATOM 6928  C CZ  . PHE B 2 386 ? 127.164 111.373 110.525 1.00 491.39 ? 386 PHE B CZ  1 
ATOM 6929  N N   . ILE B 2 387 ? 122.823 115.248 109.229 1.00 317.33 ? 387 ILE B N   1 
ATOM 6930  C CA  . ILE B 2 387 ? 123.096 116.576 109.779 1.00 306.97 ? 387 ILE B CA  1 
ATOM 6931  C C   . ILE B 2 387 ? 121.908 117.019 110.660 1.00 327.72 ? 387 ILE B C   1 
ATOM 6932  O O   . ILE B 2 387 ? 122.067 117.539 111.745 1.00 349.21 ? 387 ILE B O   1 
ATOM 6933  C CB  . ILE B 2 387 ? 123.405 117.632 108.704 1.00 392.21 ? 387 ILE B CB  1 
ATOM 6934  C CG1 . ILE B 2 387 ? 124.784 117.353 108.129 1.00 460.06 ? 387 ILE B CG1 1 
ATOM 6935  C CG2 . ILE B 2 387 ? 123.380 119.047 109.280 1.00 403.31 ? 387 ILE B CG2 1 
ATOM 6936  C CD1 . ILE B 2 387 ? 125.190 118.220 106.957 1.00 500.00 ? 387 ILE B CD1 1 
ATOM 6937  N N   . PHE B 2 388 ? 120.718 116.818 110.125 1.00 327.00 ? 388 PHE B N   1 
ATOM 6938  C CA  . PHE B 2 388 ? 119.510 117.215 110.829 1.00 349.51 ? 388 PHE B CA  1 
ATOM 6939  C C   . PHE B 2 388 ? 119.332 116.435 112.081 1.00 333.71 ? 388 PHE B C   1 
ATOM 6940  O O   . PHE B 2 388 ? 118.872 117.025 113.067 1.00 300.14 ? 388 PHE B O   1 
ATOM 6941  C CB  . PHE B 2 388 ? 118.290 117.300 109.921 1.00 360.27 ? 388 PHE B CB  1 
ATOM 6942  C CG  . PHE B 2 388 ? 118.385 118.445 108.963 1.00 402.19 ? 388 PHE B CG  1 
ATOM 6943  C CD1 . PHE B 2 388 ? 118.434 119.746 109.439 1.00 427.56 ? 388 PHE B CD1 1 
ATOM 6944  C CD2 . PHE B 2 388 ? 118.504 118.229 107.594 1.00 474.64 ? 388 PHE B CD2 1 
ATOM 6945  C CE1 . PHE B 2 388 ? 118.567 120.811 108.566 1.00 500.00 ? 388 PHE B CE1 1 
ATOM 6946  C CE2 . PHE B 2 388 ? 118.637 119.289 106.713 1.00 500.00 ? 388 PHE B CE2 1 
ATOM 6947  C CZ  . PHE B 2 388 ? 118.665 120.584 107.200 1.00 500.00 ? 388 PHE B CZ  1 
ATOM 6948  N N   . TYR B 2 389 ? 119.680 115.150 112.092 1.00 337.50 ? 389 TYR B N   1 
ATOM 6949  C CA  . TYR B 2 389 ? 119.660 114.313 113.289 1.00 340.76 ? 389 TYR B CA  1 
ATOM 6950  C C   . TYR B 2 389 ? 120.505 114.957 114.400 1.00 357.64 ? 389 TYR B C   1 
ATOM 6951  O O   . TYR B 2 389 ? 120.086 115.100 115.567 1.00 375.26 ? 389 TYR B O   1 
ATOM 6952  C CB  . TYR B 2 389 ? 120.217 112.902 113.078 1.00 362.34 ? 389 TYR B CB  1 
ATOM 6953  C CG  . TYR B 2 389 ? 119.619 112.092 111.961 1.00 392.31 ? 389 TYR B CG  1 
ATOM 6954  C CD1 . TYR B 2 389 ? 118.297 112.267 111.552 1.00 413.21 ? 389 TYR B CD1 1 
ATOM 6955  C CD2 . TYR B 2 389 ? 120.382 111.121 111.322 1.00 409.98 ? 389 TYR B CD2 1 
ATOM 6956  C CE1 . TYR B 2 389 ? 117.777 111.516 110.509 1.00 418.52 ? 389 TYR B CE1 1 
ATOM 6957  C CE2 . TYR B 2 389 ? 119.868 110.367 110.285 1.00 391.91 ? 389 TYR B CE2 1 
ATOM 6958  C CZ  . TYR B 2 389 ? 118.567 110.571 109.885 1.00 392.27 ? 389 TYR B CZ  1 
ATOM 6959  O OH  . TYR B 2 389 ? 118.056 109.823 108.867 1.00 393.50 ? 389 TYR B OH  1 
ATOM 6960  N N   . SER B 2 390 ? 121.705 115.328 113.978 1.00 347.21 ? 390 SER B N   1 
ATOM 6961  C CA  . SER B 2 390 ? 122.693 115.969 114.867 1.00 364.39 ? 390 SER B CA  1 
ATOM 6962  C C   . SER B 2 390 ? 122.111 117.251 115.445 1.00 333.57 ? 390 SER B C   1 
ATOM 6963  O O   . SER B 2 390 ? 122.231 117.509 116.646 1.00 290.26 ? 390 SER B O   1 
ATOM 6964  C CB  . SER B 2 390 ? 124.005 116.247 114.116 1.00 367.08 ? 390 SER B CB  1 
ATOM 6965  O OG  . SER B 2 390 ? 125.037 115.381 114.553 1.00 317.60 ? 390 SER B OG  1 
ATOM 6966  N N   . VAL B 2 391 ? 121.488 118.032 114.564 1.00 329.72 ? 391 VAL B N   1 
ATOM 6967  C CA  . VAL B 2 391 ? 120.878 119.309 114.907 1.00 381.62 ? 391 VAL B CA  1 
ATOM 6968  C C   . VAL B 2 391 ? 119.827 119.097 115.998 1.00 335.86 ? 391 VAL B C   1 
ATOM 6969  O O   . VAL B 2 391 ? 119.794 119.845 117.004 1.00 338.01 ? 391 VAL B O   1 
ATOM 6970  C CB  . VAL B 2 391 ? 120.210 119.998 113.653 1.00 419.26 ? 391 VAL B CB  1 
ATOM 6971  C CG1 . VAL B 2 391 ? 119.074 120.969 114.011 1.00 394.40 ? 391 VAL B CG1 1 
ATOM 6972  C CG2 . VAL B 2 391 ? 121.250 120.718 112.807 1.00 437.09 ? 391 VAL B CG2 1 
ATOM 6973  N N   . LEU B 2 392 ? 118.997 118.072 115.786 1.00 297.02 ? 392 LEU B N   1 
ATOM 6974  C CA  . LEU B 2 392 ? 117.857 117.810 116.652 1.00 347.73 ? 392 LEU B CA  1 
ATOM 6975  C C   . LEU B 2 392 ? 118.352 117.579 118.103 1.00 358.42 ? 392 LEU B C   1 
ATOM 6976  O O   . LEU B 2 392 ? 117.885 118.210 119.080 1.00 396.18 ? 392 LEU B O   1 
ATOM 6977  C CB  . LEU B 2 392 ? 117.073 116.594 116.135 1.00 409.21 ? 392 LEU B CB  1 
ATOM 6978  C CG  . LEU B 2 392 ? 115.624 116.403 116.602 1.00 471.50 ? 392 LEU B CG  1 
ATOM 6979  C CD1 . LEU B 2 392 ? 114.951 115.343 115.739 1.00 500.00 ? 392 LEU B CD1 1 
ATOM 6980  C CD2 . LEU B 2 392 ? 115.515 116.041 118.081 1.00 475.85 ? 392 LEU B CD2 1 
ATOM 6981  N N   . VAL B 2 393 ? 119.317 116.673 118.162 1.00 322.53 ? 393 VAL B N   1 
ATOM 6982  C CA  . VAL B 2 393 ? 119.903 116.275 119.452 1.00 339.56 ? 393 VAL B CA  1 
ATOM 6983  C C   . VAL B 2 393 ? 120.560 117.472 120.120 1.00 355.02 ? 393 VAL B C   1 
ATOM 6984  O O   . VAL B 2 393 ? 120.380 117.697 121.325 1.00 348.80 ? 393 VAL B O   1 
ATOM 6985  C CB  . VAL B 2 393 ? 120.787 115.016 119.363 1.00 390.20 ? 393 VAL B CB  1 
ATOM 6986  C CG1 . VAL B 2 393 ? 122.058 115.241 118.559 1.00 422.12 ? 393 VAL B CG1 1 
ATOM 6987  C CG2 . VAL B 2 393 ? 121.110 114.500 120.757 1.00 440.53 ? 393 VAL B CG2 1 
ATOM 6988  N N   . GLY B 2 394 ? 121.289 118.237 119.306 1.00 361.21 ? 394 GLY B N   1 
ATOM 6989  C CA  . GLY B 2 394 ? 121.986 119.444 119.774 1.00 373.38 ? 394 GLY B CA  1 
ATOM 6990  C C   . GLY B 2 394 ? 120.984 120.425 120.357 1.00 343.50 ? 394 GLY B C   1 
ATOM 6991  O O   . GLY B 2 394 ? 121.211 120.990 121.439 1.00 276.34 ? 394 GLY B O   1 
ATOM 6992  N N   . LYS B 2 395 ? 119.891 120.607 119.621 1.00 327.54 ? 395 LYS B N   1 
ATOM 6993  C CA  . LYS B 2 395 ? 118.813 121.518 120.023 1.00 340.69 ? 395 LYS B CA  1 
ATOM 6994  C C   . LYS B 2 395 ? 118.255 121.105 121.380 1.00 339.67 ? 395 LYS B C   1 
ATOM 6995  O O   . LYS B 2 395 ? 118.061 121.947 122.268 1.00 395.29 ? 395 LYS B O   1 
ATOM 6996  C CB  . LYS B 2 395 ? 117.726 121.647 118.950 1.00 366.38 ? 395 LYS B CB  1 
ATOM 6997  C CG  . LYS B 2 395 ? 117.974 122.788 117.968 1.00 383.24 ? 395 LYS B CG  1 
ATOM 6998  C CD  . LYS B 2 395 ? 117.493 124.124 118.532 1.00 414.03 ? 395 LYS B CD  1 
ATOM 6999  C CE  . LYS B 2 395 ? 118.135 125.318 117.832 1.00 440.97 ? 395 LYS B CE  1 
ATOM 7000  N NZ  . LYS B 2 395 ? 117.777 126.631 118.450 1.00 445.06 ? 395 LYS B NZ  1 
ATOM 7001  N N   . ALA B 2 396 ? 118.018 119.807 121.503 1.00 329.41 ? 396 ALA B N   1 
ATOM 7002  C CA  . ALA B 2 396 ? 117.484 119.209 122.733 1.00 369.70 ? 396 ALA B CA  1 
ATOM 7003  C C   . ALA B 2 396 ? 118.410 119.511 123.907 1.00 359.98 ? 396 ALA B C   1 
ATOM 7004  O O   . ALA B 2 396 ? 117.959 119.920 124.988 1.00 367.31 ? 396 ALA B O   1 
ATOM 7005  C CB  . ALA B 2 396 ? 117.301 117.707 122.568 1.00 387.98 ? 396 ALA B CB  1 
ATOM 7006  N N   . SER B 2 397 ? 119.694 119.300 123.656 1.00 315.73 ? 397 SER B N   1 
ATOM 7007  C CA  . SER B 2 397 ? 120.751 119.528 124.646 1.00 362.68 ? 397 SER B CA  1 
ATOM 7008  C C   . SER B 2 397 ? 120.716 120.979 125.125 1.00 358.03 ? 397 SER B C   1 
ATOM 7009  O O   . SER B 2 397 ? 120.774 121.257 126.332 1.00 376.98 ? 397 SER B O   1 
ATOM 7010  C CB  . SER B 2 397 ? 122.126 119.231 124.040 1.00 380.41 ? 397 SER B CB  1 
ATOM 7011  O OG  . SER B 2 397 ? 123.149 119.309 125.018 1.00 411.44 ? 397 SER B OG  1 
ATOM 7012  N N   . ALA B 2 398 ? 120.618 121.870 124.147 1.00 365.11 ? 398 ALA B N   1 
ATOM 7013  C CA  . ALA B 2 398 ? 120.569 123.312 124.392 1.00 393.49 ? 398 ALA B CA  1 
ATOM 7014  C C   . ALA B 2 398 ? 119.384 123.666 125.290 1.00 350.17 ? 398 ALA B C   1 
ATOM 7015  O O   . ALA B 2 398 ? 119.530 124.411 126.273 1.00 384.68 ? 398 ALA B O   1 
ATOM 7016  C CB  . ALA B 2 398 ? 120.513 124.088 123.083 1.00 417.42 ? 398 ALA B CB  1 
ATOM 7017  N N   . THR B 2 399 ? 118.202 123.193 124.911 1.00 357.53 ? 399 THR B N   1 
ATOM 7018  C CA  . THR B 2 399 ? 116.952 123.855 125.287 1.00 438.41 ? 399 THR B CA  1 
ATOM 7019  C C   . THR B 2 399 ? 116.023 122.941 126.087 1.00 433.95 ? 399 THR B C   1 
ATOM 7020  O O   . THR B 2 399 ? 114.940 122.567 125.626 1.00 448.55 ? 399 THR B O   1 
ATOM 7021  C CB  . THR B 2 399 ? 116.244 124.416 124.023 1.00 500.00 ? 399 THR B CB  1 
ATOM 7022  O OG1 . THR B 2 399 ? 117.178 125.181 123.249 1.00 500.00 ? 399 THR B OG1 1 
ATOM 7023  C CG2 . THR B 2 399 ? 115.050 125.313 124.387 1.00 500.00 ? 399 THR B CG2 1 
ATOM 7024  N N   . ALA B 2 400 ? 116.461 122.595 127.295 1.00 425.92 ? 400 ALA B N   1 
ATOM 7025  C CA  . ALA B 2 400 ? 115.622 121.860 128.243 1.00 449.61 ? 400 ALA B CA  1 
ATOM 7026  C C   . ALA B 2 400 ? 116.215 121.855 129.656 1.00 465.15 ? 400 ALA B C   1 
ATOM 7027  O O   . ALA B 2 400 ? 117.364 122.259 129.859 1.00 414.41 ? 400 ALA B O   1 
ATOM 7028  C CB  . ALA B 2 400 ? 115.390 120.435 127.753 1.00 460.21 ? 400 ALA B CB  1 
ATOM 7029  N N   . SER B 2 401 ? 115.401 121.418 130.617 1.00 500.00 ? 401 SER B N   1 
ATOM 7030  C CA  . SER B 2 401 ? 115.795 121.282 132.030 1.00 500.00 ? 401 SER B CA  1 
ATOM 7031  C C   . SER B 2 401 ? 116.146 119.833 132.382 1.00 500.00 ? 401 SER B C   1 
ATOM 7032  O O   . SER B 2 401 ? 117.128 119.581 133.084 1.00 500.00 ? 401 SER B O   1 
ATOM 7033  C CB  . SER B 2 401 ? 114.666 121.774 132.940 1.00 500.00 ? 401 SER B CB  1 
ATOM 7034  O OG  . SER B 2 401 ? 115.048 121.743 134.308 1.00 500.00 ? 401 SER B OG  1 
ATOM 7035  N N   . GLY B 2 402 ? 115.329 118.894 131.897 1.00 500.00 ? 402 GLY B N   1 
ATOM 7036  C CA  . GLY B 2 402 ? 115.646 117.457 131.941 1.00 487.24 ? 402 GLY B CA  1 
ATOM 7037  C C   . GLY B 2 402 ? 116.847 117.251 131.046 1.00 470.83 ? 402 GLY B C   1 
ATOM 7038  O O   . GLY B 2 402 ? 117.696 116.389 131.290 1.00 421.91 ? 402 GLY B O   1 
ATOM 7039  N N   . ASP B 2 403 ? 116.866 118.047 129.978 1.00 489.94 ? 403 ASP B N   1 
ATOM 7040  C CA  . ASP B 2 403 ? 118.090 118.530 129.358 1.00 500.00 ? 403 ASP B CA  1 
ATOM 7041  C C   . ASP B 2 403 ? 118.856 117.354 128.782 1.00 429.95 ? 403 ASP B C   1 
ATOM 7042  O O   . ASP B 2 403 ? 118.569 116.928 127.654 1.00 324.21 ? 403 ASP B O   1 
ATOM 7043  C CB  . ASP B 2 403 ? 118.888 119.396 130.380 1.00 500.00 ? 403 ASP B CB  1 
ATOM 7044  C CG  . ASP B 2 403 ? 120.104 120.089 129.776 1.00 500.00 ? 403 ASP B CG  1 
ATOM 7045  O OD1 . ASP B 2 403 ? 119.919 121.078 129.036 1.00 500.00 ? 403 ASP B OD1 1 
ATOM 7046  O OD2 . ASP B 2 403 ? 121.245 119.672 130.078 1.00 500.00 ? 403 ASP B OD2 1 
ATOM 7047  N N   . TRP B 2 404 ? 119.819 116.855 129.560 1.00 383.26 ? 404 TRP B N   1 
ATOM 7048  C CA  . TRP B 2 404 ? 120.654 115.729 129.170 1.00 336.67 ? 404 TRP B CA  1 
ATOM 7049  C C   . TRP B 2 404 ? 119.799 114.519 128.841 1.00 341.43 ? 404 TRP B C   1 
ATOM 7050  O O   . TRP B 2 404 ? 120.001 113.853 127.810 1.00 342.52 ? 404 TRP B O   1 
ATOM 7051  C CB  . TRP B 2 404 ? 121.523 115.287 130.348 1.00 346.59 ? 404 TRP B CB  1 
ATOM 7052  C CG  . TRP B 2 404 ? 122.923 115.736 130.338 1.00 406.39 ? 404 TRP B CG  1 
ATOM 7053  C CD1 . TRP B 2 404 ? 123.506 116.613 131.200 1.00 489.74 ? 404 TRP B CD1 1 
ATOM 7054  C CD2 . TRP B 2 404 ? 123.954 115.281 129.467 1.00 382.21 ? 404 TRP B CD2 1 
ATOM 7055  N NE1 . TRP B 2 404 ? 124.842 116.749 130.912 1.00 487.46 ? 404 TRP B NE1 1 
ATOM 7056  C CE2 . TRP B 2 404 ? 125.145 115.938 129.851 1.00 435.20 ? 404 TRP B CE2 1 
ATOM 7057  C CE3 . TRP B 2 404 ? 123.989 114.390 128.396 1.00 348.90 ? 404 TRP B CE3 1 
ATOM 7058  C CZ2 . TRP B 2 404 ? 126.356 115.732 129.198 1.00 436.64 ? 404 TRP B CZ2 1 
ATOM 7059  C CZ3 . TRP B 2 404 ? 125.193 114.180 127.748 1.00 400.87 ? 404 TRP B CZ3 1 
ATOM 7060  C CH2 . TRP B 2 404 ? 126.361 114.852 128.148 1.00 446.76 ? 404 TRP B CH2 1 
ATOM 7061  N N   . ASN B 2 405 ? 118.852 114.259 129.745 1.00 324.36 ? 405 ASN B N   1 
ATOM 7062  C CA  . ASN B 2 405 ? 117.921 113.134 129.616 1.00 351.94 ? 405 ASN B CA  1 
ATOM 7063  C C   . ASN B 2 405 ? 117.157 113.226 128.307 1.00 329.63 ? 405 ASN B C   1 
ATOM 7064  O O   . ASN B 2 405 ? 117.032 112.240 127.559 1.00 316.07 ? 405 ASN B O   1 
ATOM 7065  C CB  . ASN B 2 405 ? 116.856 113.169 130.713 1.00 366.45 ? 405 ASN B CB  1 
ATOM 7066  C CG  . ASN B 2 405 ? 117.379 112.724 132.052 1.00 430.09 ? 405 ASN B CG  1 
ATOM 7067  O OD1 . ASN B 2 405 ? 118.521 112.992 132.393 1.00 455.76 ? 405 ASN B OD1 1 
ATOM 7068  N ND2 . ASN B 2 405 ? 116.534 112.061 132.832 1.00 457.42 ? 405 ASN B ND2 1 
ATOM 7069  N N   . THR B 2 406 ? 116.653 114.436 128.069 1.00 328.10 ? 406 THR B N   1 
ATOM 7070  C CA  . THR B 2 406 ? 115.865 114.733 126.862 1.00 341.47 ? 406 THR B CA  1 
ATOM 7071  C C   . THR B 2 406 ? 116.688 114.443 125.617 1.00 341.88 ? 406 THR B C   1 
ATOM 7072  O O   . THR B 2 406 ? 116.197 113.808 124.669 1.00 379.19 ? 406 THR B O   1 
ATOM 7073  C CB  . THR B 2 406 ? 115.336 116.182 126.831 1.00 411.91 ? 406 THR B CB  1 
ATOM 7074  O OG1 . THR B 2 406 ? 114.986 116.597 128.159 1.00 468.54 ? 406 THR B OG1 1 
ATOM 7075  C CG2 . THR B 2 406 ? 114.101 116.306 125.907 1.00 388.37 ? 406 THR B CG2 1 
ATOM 7076  N N   . THR B 2 407 ? 117.929 114.917 125.653 1.00 354.00 ? 407 THR B N   1 
ATOM 7077  C CA  . THR B 2 407 ? 118.872 114.749 124.545 1.00 388.08 ? 407 THR B CA  1 
ATOM 7078  C C   . THR B 2 407 ? 119.076 113.261 124.255 1.00 366.82 ? 407 THR B C   1 
ATOM 7079  O O   . THR B 2 407 ? 119.037 112.832 123.091 1.00 354.04 ? 407 THR B O   1 
ATOM 7080  C CB  . THR B 2 407 ? 120.166 115.613 124.715 1.00 442.74 ? 407 THR B CB  1 
ATOM 7081  O OG1 . THR B 2 407 ? 120.597 116.075 123.430 1.00 492.05 ? 407 THR B OG1 1 
ATOM 7082  C CG2 . THR B 2 407 ? 121.347 114.906 125.425 1.00 457.98 ? 407 THR B CG2 1 
ATOM 7083  N N   . ILE B 2 408 ? 119.277 112.515 125.334 1.00 336.13 ? 408 ILE B N   1 
ATOM 7084  C CA  . ILE B 2 408 ? 119.500 111.069 125.260 1.00 336.66 ? 408 ILE B CA  1 
ATOM 7085  C C   . ILE B 2 408 ? 118.308 110.390 124.592 1.00 347.76 ? 408 ILE B C   1 
ATOM 7086  O O   . ILE B 2 408 ? 118.480 109.539 123.700 1.00 296.43 ? 408 ILE B O   1 
ATOM 7087  C CB  . ILE B 2 408 ? 119.935 110.439 126.613 1.00 355.01 ? 408 ILE B CB  1 
ATOM 7088  C CG1 . ILE B 2 408 ? 121.253 109.654 126.408 1.00 390.87 ? 408 ILE B CG1 1 
ATOM 7089  C CG2 . ILE B 2 408 ? 118.829 109.575 127.256 1.00 325.22 ? 408 ILE B CG2 1 
ATOM 7090  C CD1 . ILE B 2 408 ? 122.162 109.606 127.620 1.00 416.72 ? 408 ILE B CD1 1 
ATOM 7091  N N   . ALA B 2 409 ? 117.125 110.794 125.038 1.00 373.17 ? 409 ALA B N   1 
ATOM 7092  C CA  . ALA B 2 409 ? 115.858 110.266 124.518 1.00 389.11 ? 409 ALA B CA  1 
ATOM 7093  C C   . ALA B 2 409 ? 115.768 110.499 123.021 1.00 352.00 ? 409 ALA B C   1 
ATOM 7094  O O   . ALA B 2 409 ? 115.414 109.589 122.251 1.00 355.62 ? 409 ALA B O   1 
ATOM 7095  C CB  . ALA B 2 409 ? 114.669 110.919 125.210 1.00 426.75 ? 409 ALA B CB  1 
ATOM 7096  N N   . CYS B 2 410 ? 116.095 111.730 122.640 1.00 378.28 ? 410 CYS B N   1 
ATOM 7097  C CA  . CYS B 2 410 ? 116.077 112.161 121.235 1.00 407.16 ? 410 CYS B CA  1 
ATOM 7098  C C   . CYS B 2 410 ? 116.987 111.280 120.406 1.00 379.14 ? 410 CYS B C   1 
ATOM 7099  O O   . CYS B 2 410 ? 116.610 110.814 119.322 1.00 376.36 ? 410 CYS B O   1 
ATOM 7100  C CB  . CYS B 2 410 ? 116.561 113.604 121.068 1.00 423.96 ? 410 CYS B CB  1 
ATOM 7101  S SG  . CYS B 2 410 ? 115.452 114.859 121.724 1.00 500.00 ? 410 CYS B SG  1 
ATOM 7102  N N   . PHE B 2 411 ? 118.182 111.072 120.937 1.00 339.40 ? 411 PHE B N   1 
ATOM 7103  C CA  . PHE B 2 411 ? 119.220 110.253 120.297 1.00 392.22 ? 411 PHE B CA  1 
ATOM 7104  C C   . PHE B 2 411 ? 118.689 108.844 120.047 1.00 381.64 ? 411 PHE B C   1 
ATOM 7105  O O   . PHE B 2 411 ? 118.840 108.287 118.943 1.00 376.27 ? 411 PHE B O   1 
ATOM 7106  C CB  . PHE B 2 411 ? 120.424 110.194 121.239 1.00 410.93 ? 411 PHE B CB  1 
ATOM 7107  C CG  . PHE B 2 411 ? 121.582 109.423 120.707 1.00 403.92 ? 411 PHE B CG  1 
ATOM 7108  C CD1 . PHE B 2 411 ? 121.567 108.032 120.721 1.00 384.75 ? 411 PHE B CD1 1 
ATOM 7109  C CD2 . PHE B 2 411 ? 122.706 110.083 120.220 1.00 378.69 ? 411 PHE B CD2 1 
ATOM 7110  C CE1 . PHE B 2 411 ? 122.643 107.319 120.249 1.00 419.13 ? 411 PHE B CE1 1 
ATOM 7111  C CE2 . PHE B 2 411 ? 123.778 109.367 119.736 1.00 398.70 ? 411 PHE B CE2 1 
ATOM 7112  C CZ  . PHE B 2 411 ? 123.746 107.986 119.751 1.00 453.91 ? 411 PHE B CZ  1 
ATOM 7113  N N   . VAL B 2 412 ? 118.076 108.306 121.097 1.00 370.63 ? 412 VAL B N   1 
ATOM 7114  C CA  . VAL B 2 412 ? 117.513 106.954 121.065 1.00 367.61 ? 412 VAL B CA  1 
ATOM 7115  C C   . VAL B 2 412 ? 116.464 106.848 119.959 1.00 367.98 ? 412 VAL B C   1 
ATOM 7116  O O   . VAL B 2 412 ? 116.457 105.880 119.172 1.00 318.05 ? 412 VAL B O   1 
ATOM 7117  C CB  . VAL B 2 412 ? 116.974 106.463 122.414 1.00 381.56 ? 412 VAL B CB  1 
ATOM 7118  C CG1 . VAL B 2 412 ? 116.344 105.083 122.247 1.00 380.80 ? 412 VAL B CG1 1 
ATOM 7119  C CG2 . VAL B 2 412 ? 118.097 106.413 123.449 1.00 422.64 ? 412 VAL B CG2 1 
ATOM 7120  N N   . ALA B 2 413 ? 115.605 107.860 119.924 1.00 384.76 ? 413 ALA B N   1 
ATOM 7121  C CA  . ALA B 2 413 ? 114.525 107.943 118.936 1.00 375.20 ? 413 ALA B CA  1 
ATOM 7122  C C   . ALA B 2 413 ? 115.094 107.933 117.533 1.00 387.69 ? 413 ALA B C   1 
ATOM 7123  O O   . ALA B 2 413 ? 114.606 107.211 116.655 1.00 402.82 ? 413 ALA B O   1 
ATOM 7124  C CB  . ALA B 2 413 ? 113.666 109.163 119.167 1.00 433.90 ? 413 ALA B CB  1 
ATOM 7125  N N   . ILE B 2 414 ? 116.130 108.739 117.348 1.00 389.11 ? 414 ILE B N   1 
ATOM 7126  C CA  . ILE B 2 414 ? 116.826 108.867 116.060 1.00 410.18 ? 414 ILE B CA  1 
ATOM 7127  C C   . ILE B 2 414 ? 117.362 107.522 115.622 1.00 376.20 ? 414 ILE B C   1 
ATOM 7128  O O   . ILE B 2 414 ? 117.200 107.132 114.465 1.00 394.12 ? 414 ILE B O   1 
ATOM 7129  C CB  . ILE B 2 414 ? 117.927 109.941 116.081 1.00 455.49 ? 414 ILE B CB  1 
ATOM 7130  C CG1 . ILE B 2 414 ? 117.258 111.314 115.929 1.00 500.00 ? 414 ILE B CG1 1 
ATOM 7131  C CG2 . ILE B 2 414 ? 118.953 109.709 114.969 1.00 419.23 ? 414 ILE B CG2 1 
ATOM 7132  C CD1 . ILE B 2 414 ? 118.046 112.473 116.487 1.00 500.00 ? 414 ILE B CD1 1 
ATOM 7133  N N   . LEU B 2 415 ? 117.992 106.842 116.567 1.00 354.98 ? 415 LEU B N   1 
ATOM 7134  C CA  . LEU B 2 415 ? 118.580 105.512 116.343 1.00 410.03 ? 415 LEU B CA  1 
ATOM 7135  C C   . LEU B 2 415 ? 117.502 104.542 115.855 1.00 372.91 ? 415 LEU B C   1 
ATOM 7136  O O   . LEU B 2 415 ? 117.701 103.803 114.874 1.00 334.07 ? 415 LEU B O   1 
ATOM 7137  C CB  . LEU B 2 415 ? 119.202 104.957 117.627 1.00 500.00 ? 415 LEU B CB  1 
ATOM 7138  C CG  . LEU B 2 415 ? 120.720 105.024 117.723 1.00 500.00 ? 415 LEU B CG  1 
ATOM 7139  C CD1 . LEU B 2 415 ? 121.249 106.435 117.495 1.00 500.00 ? 415 LEU B CD1 1 
ATOM 7140  C CD2 . LEU B 2 415 ? 121.148 104.467 119.075 1.00 500.00 ? 415 LEU B CD2 1 
ATOM 7141  N N   . ILE B 2 416 ? 116.381 104.582 116.569 1.00 356.54 ? 416 ILE B N   1 
ATOM 7142  C CA  . ILE B 2 416 ? 115.232 103.724 116.269 1.00 367.89 ? 416 ILE B CA  1 
ATOM 7143  C C   . ILE B 2 416 ? 114.750 103.968 114.837 1.00 367.44 ? 416 ILE B C   1 
ATOM 7144  O O   . ILE B 2 416 ? 114.499 103.020 114.073 1.00 363.53 ? 416 ILE B O   1 
ATOM 7145  C CB  . ILE B 2 416 ? 114.109 103.782 117.344 1.00 396.91 ? 416 ILE B CB  1 
ATOM 7146  C CG1 . ILE B 2 416 ? 113.980 102.406 118.026 1.00 357.47 ? 416 ILE B CG1 1 
ATOM 7147  C CG2 . ILE B 2 416 ? 112.738 104.155 116.766 1.00 405.08 ? 416 ILE B CG2 1 
ATOM 7148  C CD1 . ILE B 2 416 ? 115.216 101.919 118.763 1.00 250.96 ? 416 ILE B CD1 1 
ATOM 7149  N N   . GLY B 2 417 ? 114.640 105.247 114.512 1.00 380.88 ? 417 GLY B N   1 
ATOM 7150  C CA  . GLY B 2 417 ? 114.200 105.699 113.189 1.00 429.36 ? 417 GLY B CA  1 
ATOM 7151  C C   . GLY B 2 417 ? 115.114 105.154 112.116 1.00 452.08 ? 417 GLY B C   1 
ATOM 7152  O O   . GLY B 2 417 ? 114.655 104.642 111.091 1.00 470.42 ? 417 GLY B O   1 
ATOM 7153  N N   . LEU B 2 418 ? 116.405 105.275 112.376 1.00 421.54 ? 418 LEU B N   1 
ATOM 7154  C CA  . LEU B 2 418 ? 117.462 104.806 111.464 1.00 380.40 ? 418 LEU B CA  1 
ATOM 7155  C C   . LEU B 2 418 ? 117.298 103.321 111.208 1.00 414.13 ? 418 LEU B C   1 
ATOM 7156  O O   . LEU B 2 418 ? 117.361 102.866 110.060 1.00 445.69 ? 418 LEU B O   1 
ATOM 7157  C CB  . LEU B 2 418 ? 118.842 105.114 112.046 1.00 401.17 ? 418 LEU B CB  1 
ATOM 7158  C CG  . LEU B 2 418 ? 120.044 105.010 111.104 1.00 428.62 ? 418 LEU B CG  1 
ATOM 7159  C CD1 . LEU B 2 418 ? 121.055 106.092 111.457 1.00 456.48 ? 418 LEU B CD1 1 
ATOM 7160  C CD2 . LEU B 2 418 ? 120.705 103.630 111.113 1.00 431.47 ? 418 LEU B CD2 1 
ATOM 7161  N N   . CYS B 2 419 ? 117.094 102.591 112.299 1.00 392.72 ? 419 CYS B N   1 
ATOM 7162  C CA  . CYS B 2 419 ? 116.911 101.134 112.268 1.00 410.51 ? 419 CYS B CA  1 
ATOM 7163  C C   . CYS B 2 419 ? 115.728 100.779 111.362 1.00 405.69 ? 419 CYS B C   1 
ATOM 7164  O O   . CYS B 2 419 ? 115.818 99.879  110.503 1.00 403.80 ? 419 CYS B O   1 
ATOM 7165  C CB  . CYS B 2 419 ? 116.653 100.585 113.682 1.00 427.32 ? 419 CYS B CB  1 
ATOM 7166  S SG  . CYS B 2 419 ? 115.181 99.539  113.861 1.00 456.83 ? 419 CYS B SG  1 
ATOM 7167  N N   . LEU B 2 420 ? 114.640 101.508 111.592 1.00 378.15 ? 420 LEU B N   1 
ATOM 7168  C CA  . LEU B 2 420 ? 113.399 101.319 110.837 1.00 413.94 ? 420 LEU B CA  1 
ATOM 7169  C C   . LEU B 2 420 ? 113.642 101.521 109.350 1.00 431.33 ? 420 LEU B C   1 
ATOM 7170  O O   . LEU B 2 420 ? 113.187 100.748 108.526 1.00 462.56 ? 420 LEU B O   1 
ATOM 7171  C CB  . LEU B 2 420 ? 112.232 102.150 111.378 1.00 470.95 ? 420 LEU B CB  1 
ATOM 7172  C CG  . LEU B 2 420 ? 111.656 101.696 112.736 1.00 500.00 ? 420 LEU B CG  1 
ATOM 7173  C CD1 . LEU B 2 420 ? 110.320 102.383 112.988 1.00 500.00 ? 420 LEU B CD1 1 
ATOM 7174  C CD2 . LEU B 2 420 ? 111.492 100.184 112.870 1.00 500.00 ? 420 LEU B CD2 1 
ATOM 7175  N N   . THR B 2 421 ? 114.357 102.592 109.052 1.00 427.27 ? 421 THR B N   1 
ATOM 7176  C CA  . THR B 2 421 ? 114.725 102.972 107.678 1.00 433.43 ? 421 THR B CA  1 
ATOM 7177  C C   . THR B 2 421 ? 115.488 101.829 107.013 1.00 403.22 ? 421 THR B C   1 
ATOM 7178  O O   . THR B 2 421 ? 115.204 101.423 105.879 1.00 420.81 ? 421 THR B O   1 
ATOM 7179  C CB  . THR B 2 421 ? 115.692 104.192 107.678 1.00 444.03 ? 421 THR B CB  1 
ATOM 7180  O OG1 . THR B 2 421 ? 115.302 105.146 108.674 1.00 397.44 ? 421 THR B OG1 1 
ATOM 7181  C CG2 . THR B 2 421 ? 115.760 104.854 106.300 1.00 487.23 ? 421 THR B CG2 1 
ATOM 7182  N N   . LEU B 2 422 ? 116.460 101.331 107.758 1.00 354.40 ? 422 LEU B N   1 
ATOM 7183  C CA  . LEU B 2 422 ? 117.367 100.275 107.320 1.00 389.94 ? 422 LEU B CA  1 
ATOM 7184  C C   . LEU B 2 422 ? 116.482 99.120  106.915 1.00 428.60 ? 422 LEU B C   1 
ATOM 7185  O O   . LEU B 2 422 ? 116.586 98.673  105.764 1.00 446.15 ? 422 LEU B O   1 
ATOM 7186  C CB  . LEU B 2 422 ? 118.352 99.887  108.430 1.00 361.37 ? 422 LEU B CB  1 
ATOM 7187  C CG  . LEU B 2 422 ? 119.755 99.517  107.936 1.00 451.98 ? 422 LEU B CG  1 
ATOM 7188  C CD1 . LEU B 2 422 ? 119.740 98.453  106.840 1.00 487.44 ? 422 LEU B CD1 1 
ATOM 7189  C CD2 . LEU B 2 422 ? 120.517 100.744 107.467 1.00 460.49 ? 422 LEU B CD2 1 
ATOM 7190  N N   . LEU B 2 423 ? 115.640 98.685  107.855 1.00 412.63 ? 423 LEU B N   1 
ATOM 7191  C CA  . LEU B 2 423 ? 114.786 97.507  107.620 1.00 418.63 ? 423 LEU B CA  1 
ATOM 7192  C C   . LEU B 2 423 ? 113.852 97.767  106.436 1.00 362.60 ? 423 LEU B C   1 
ATOM 7193  O O   . LEU B 2 423 ? 113.689 96.927  105.541 1.00 343.04 ? 423 LEU B O   1 
ATOM 7194  C CB  . LEU B 2 423 ? 114.042 97.085  108.900 1.00 458.79 ? 423 LEU B CB  1 
ATOM 7195  C CG  . LEU B 2 423 ? 114.876 96.658  110.139 1.00 472.77 ? 423 LEU B CG  1 
ATOM 7196  C CD1 . LEU B 2 423 ? 114.127 95.607  110.954 1.00 497.44 ? 423 LEU B CD1 1 
ATOM 7197  C CD2 . LEU B 2 423 ? 116.278 96.131  109.832 1.00 426.90 ? 423 LEU B CD2 1 
ATOM 7198  N N   . LEU B 2 424 ? 113.266 98.964  106.473 1.00 384.85 ? 424 LEU B N   1 
ATOM 7199  C CA  . LEU B 2 424 ? 112.318 99.406  105.432 1.00 444.34 ? 424 LEU B CA  1 
ATOM 7200  C C   . LEU B 2 424 ? 113.014 99.409  104.080 1.00 417.67 ? 424 LEU B C   1 
ATOM 7201  O O   . LEU B 2 424 ? 112.446 98.923  103.089 1.00 433.40 ? 424 LEU B O   1 
ATOM 7202  C CB  . LEU B 2 424 ? 111.768 100.804 105.760 1.00 484.86 ? 424 LEU B CB  1 
ATOM 7203  C CG  . LEU B 2 424 ? 110.763 101.527 104.840 1.00 500.00 ? 424 LEU B CG  1 
ATOM 7204  C CD1 . LEU B 2 424 ? 111.404 102.078 103.568 1.00 486.40 ? 424 LEU B CD1 1 
ATOM 7205  C CD2 . LEU B 2 424 ? 109.556 100.654 104.511 1.00 500.00 ? 424 LEU B CD2 1 
ATOM 7206  N N   . LEU B 2 425 ? 114.229 99.953  104.071 1.00 400.03 ? 425 LEU B N   1 
ATOM 7207  C CA  . LEU B 2 425 ? 115.043 100.040 102.855 1.00 443.06 ? 425 LEU B CA  1 
ATOM 7208  C C   . LEU B 2 425 ? 115.279 98.646  102.281 1.00 418.39 ? 425 LEU B C   1 
ATOM 7209  O O   . LEU B 2 425 ? 115.132 98.426  101.070 1.00 454.22 ? 425 LEU B O   1 
ATOM 7210  C CB  . LEU B 2 425 ? 116.380 100.766 103.098 1.00 500.00 ? 425 LEU B CB  1 
ATOM 7211  C CG  . LEU B 2 425 ? 117.172 101.245 101.871 1.00 500.00 ? 425 LEU B CG  1 
ATOM 7212  C CD1 . LEU B 2 425 ? 116.459 102.392 101.162 1.00 500.00 ? 425 LEU B CD1 1 
ATOM 7213  C CD2 . LEU B 2 425 ? 118.587 101.664 102.258 1.00 500.00 ? 425 LEU B CD2 1 
ATOM 7214  N N   . ALA B 2 426 ? 115.639 97.738  103.177 1.00 388.42 ? 426 ALA B N   1 
ATOM 7215  C CA  . ALA B 2 426 ? 115.913 96.339  102.829 1.00 461.08 ? 426 ALA B CA  1 
ATOM 7216  C C   . ALA B 2 426 ? 114.685 95.717  102.167 1.00 448.78 ? 426 ALA B C   1 
ATOM 7217  O O   . ALA B 2 426 ? 114.789 95.050  101.125 1.00 462.76 ? 426 ALA B O   1 
ATOM 7218  C CB  . ALA B 2 426 ? 116.326 95.545  104.064 1.00 477.71 ? 426 ALA B CB  1 
ATOM 7219  N N   . ILE B 2 427 ? 113.541 95.962  102.799 1.00 398.01 ? 427 ILE B N   1 
ATOM 7220  C CA  . ILE B 2 427 ? 112.254 95.447  102.333 1.00 413.18 ? 427 ILE B CA  1 
ATOM 7221  C C   . ILE B 2 427 ? 111.976 95.941  100.916 1.00 400.84 ? 427 ILE B C   1 
ATOM 7222  O O   . ILE B 2 427 ? 111.576 95.157  100.035 1.00 458.73 ? 427 ILE B O   1 
ATOM 7223  C CB  . ILE B 2 427 ? 111.064 95.692  103.319 1.00 435.49 ? 427 ILE B CB  1 
ATOM 7224  C CG1 . ILE B 2 427 ? 110.870 94.481  104.256 1.00 466.11 ? 427 ILE B CG1 1 
ATOM 7225  C CG2 . ILE B 2 427 ? 109.727 95.873  102.593 1.00 382.58 ? 427 ILE B CG2 1 
ATOM 7226  C CD1 . ILE B 2 427 ? 112.073 94.065  105.087 1.00 469.24 ? 427 ILE B CD1 1 
ATOM 7227  N N   . PHE B 2 428 ? 112.211 97.236  100.727 1.00 378.42 ? 428 PHE B N   1 
ATOM 7228  C CA  . PHE B 2 428 ? 111.951 97.908  99.452  1.00 383.59 ? 428 PHE B CA  1 
ATOM 7229  C C   . PHE B 2 428 ? 113.147 98.154  98.515  1.00 398.13 ? 428 PHE B C   1 
ATOM 7230  O O   . PHE B 2 428 ? 113.189 97.618  97.401  1.00 411.14 ? 428 PHE B O   1 
ATOM 7231  C CB  . PHE B 2 428 ? 111.209 99.245  99.677  1.00 401.45 ? 428 PHE B CB  1 
ATOM 7232  C CG  . PHE B 2 428 ? 109.718 99.101  99.911  1.00 446.62 ? 428 PHE B CG  1 
ATOM 7233  C CD1 . PHE B 2 428 ? 108.846 98.873  98.844  1.00 461.75 ? 428 PHE B CD1 1 
ATOM 7234  C CD2 . PHE B 2 428 ? 109.178 99.228  101.193 1.00 447.84 ? 428 PHE B CD2 1 
ATOM 7235  C CE1 . PHE B 2 428 ? 107.474 98.751  99.056  1.00 455.85 ? 428 PHE B CE1 1 
ATOM 7236  C CE2 . PHE B 2 428 ? 107.806 99.106  101.410 1.00 430.39 ? 428 PHE B CE2 1 
ATOM 7237  C CZ  . PHE B 2 428 ? 106.954 98.868  100.339 1.00 439.41 ? 428 PHE B CZ  1 
ATOM 7238  N N   . LYS B 2 429 ? 114.073 98.998  98.973  1.00 444.59 ? 429 LYS B N   1 
ATOM 7239  C CA  . LYS B 2 429 ? 115.210 99.561  98.199  1.00 463.26 ? 429 LYS B CA  1 
ATOM 7240  C C   . LYS B 2 429 ? 114.739 100.721 97.305  1.00 457.39 ? 429 LYS B C   1 
ATOM 7241  O O   . LYS B 2 429 ? 115.161 100.841 96.150  1.00 459.92 ? 429 LYS B O   1 
ATOM 7242  C CB  . LYS B 2 429 ? 115.999 98.505  97.389  1.00 462.30 ? 429 LYS B CB  1 
ATOM 7243  C CG  . LYS B 2 429 ? 116.528 97.318  98.190  1.00 458.76 ? 429 LYS B CG  1 
ATOM 7244  C CD  . LYS B 2 429 ? 117.735 97.693  99.041  1.00 476.43 ? 429 LYS B CD  1 
ATOM 7245  C CE  . LYS B 2 429 ? 118.330 96.483  99.751  1.00 479.63 ? 429 LYS B CE  1 
ATOM 7246  N NZ  . LYS B 2 429 ? 119.201 96.850  100.908 1.00 464.30 ? 429 LYS B NZ  1 
ATOM 7247  N N   . LYS B 2 430 ? 113.885 101.582 97.863  1.00 453.93 ? 430 LYS B N   1 
ATOM 7248  C CA  . LYS B 2 430 ? 113.287 102.690 97.111  1.00 470.16 ? 430 LYS B CA  1 
ATOM 7249  C C   . LYS B 2 430 ? 114.273 103.861 96.968  1.00 500.00 ? 430 LYS B C   1 
ATOM 7250  O O   . LYS B 2 430 ? 114.954 103.938 95.940  1.00 500.00 ? 430 LYS B O   1 
ATOM 7251  C CB  . LYS B 2 430 ? 111.939 103.116 97.725  1.00 484.44 ? 430 LYS B CB  1 
ATOM 7252  C CG  . LYS B 2 430 ? 111.138 104.098 96.876  1.00 497.00 ? 430 LYS B CG  1 
ATOM 7253  C CD  . LYS B 2 430 ? 109.779 104.424 97.485  1.00 491.52 ? 430 LYS B CD  1 
ATOM 7254  C CE  . LYS B 2 430 ? 108.731 103.349 97.213  1.00 482.80 ? 430 LYS B CE  1 
ATOM 7255  N NZ  . LYS B 2 430 ? 108.131 103.441 95.852  1.00 471.63 ? 430 LYS B NZ  1 
ATOM 7256  N N   . ALA B 2 431 ? 114.380 104.744 97.973  1.00 500.00 ? 431 ALA B N   1 
ATOM 7257  C CA  . ALA B 2 431 ? 115.197 105.972 97.849  1.00 500.00 ? 431 ALA B CA  1 
ATOM 7258  C C   . ALA B 2 431 ? 115.458 106.752 99.167  1.00 500.00 ? 431 ALA B C   1 
ATOM 7259  O O   . ALA B 2 431 ? 115.363 107.978 99.175  1.00 500.00 ? 431 ALA B O   1 
ATOM 7260  C CB  . ALA B 2 431 ? 114.584 106.903 96.793  1.00 500.00 ? 431 ALA B CB  1 
ATOM 7261  N N   . LEU B 2 432 ? 115.845 106.058 100.245 1.00 498.36 ? 432 LEU B N   1 
ATOM 7262  C CA  . LEU B 2 432 ? 116.085 106.665 101.593 1.00 466.11 ? 432 LEU B CA  1 
ATOM 7263  C C   . LEU B 2 432 ? 114.829 107.324 102.234 1.00 436.56 ? 432 LEU B C   1 
ATOM 7264  O O   . LEU B 2 432 ? 114.863 108.489 102.656 1.00 396.74 ? 432 LEU B O   1 
ATOM 7265  C CB  . LEU B 2 432 ? 117.270 107.666 101.558 1.00 454.33 ? 432 LEU B CB  1 
ATOM 7266  C CG  . LEU B 2 432 ? 118.718 107.178 101.663 1.00 409.96 ? 432 LEU B CG  1 
ATOM 7267  C CD1 . LEU B 2 432 ? 119.653 108.264 101.141 1.00 355.47 ? 432 LEU B CD1 1 
ATOM 7268  C CD2 . LEU B 2 432 ? 119.077 106.778 103.092 1.00 408.68 ? 432 LEU B CD2 1 
ATOM 7269  N N   . PRO B 2 433 ? 113.721 106.573 102.344 1.00 440.38 ? 433 PRO B N   1 
ATOM 7270  C CA  . PRO B 2 433 ? 112.449 107.218 102.668 1.00 467.08 ? 433 PRO B CA  1 
ATOM 7271  C C   . PRO B 2 433 ? 112.065 107.325 104.150 1.00 490.78 ? 433 PRO B C   1 
ATOM 7272  O O   . PRO B 2 433 ? 111.037 107.935 104.439 1.00 500.00 ? 433 PRO B O   1 
ATOM 7273  C CB  . PRO B 2 433 ? 111.428 106.334 101.919 1.00 498.99 ? 433 PRO B CB  1 
ATOM 7274  C CG  . PRO B 2 433 ? 112.186 105.112 101.461 1.00 494.98 ? 433 PRO B CG  1 
ATOM 7275  C CD  . PRO B 2 433 ? 113.518 105.132 102.145 1.00 453.69 ? 433 PRO B CD  1 
ATOM 7276  N N   . ALA B 2 434 ? 112.847 106.748 105.065 1.00 500.00 ? 434 ALA B N   1 
ATOM 7277  C CA  . ALA B 2 434 ? 112.503 106.740 106.508 1.00 500.00 ? 434 ALA B CA  1 
ATOM 7278  C C   . ALA B 2 434 ? 113.532 107.470 107.400 1.00 483.61 ? 434 ALA B C   1 
ATOM 7279  O O   . ALA B 2 434 ? 113.630 107.241 108.609 1.00 414.23 ? 434 ALA B O   1 
ATOM 7280  C CB  . ALA B 2 434 ? 112.262 105.306 106.977 1.00 500.00 ? 434 ALA B CB  1 
ATOM 7281  N N   . LEU B 2 435 ? 114.303 108.349 106.777 1.00 453.93 ? 435 LEU B N   1 
ATOM 7282  C CA  . LEU B 2 435 ? 115.029 109.398 107.484 1.00 434.57 ? 435 LEU B CA  1 
ATOM 7283  C C   . LEU B 2 435 ? 114.022 110.402 108.076 1.00 387.79 ? 435 LEU B C   1 
ATOM 7284  O O   . LEU B 2 435 ? 114.150 110.805 109.251 1.00 331.09 ? 435 LEU B O   1 
ATOM 7285  C CB  . LEU B 2 435 ? 116.034 110.065 106.525 1.00 449.76 ? 435 LEU B CB  1 
ATOM 7286  C CG  . LEU B 2 435 ? 116.892 109.171 105.587 1.00 495.76 ? 435 LEU B CG  1 
ATOM 7287  C CD1 . LEU B 2 435 ? 117.727 109.997 104.618 1.00 500.00 ? 435 LEU B CD1 1 
ATOM 7288  C CD2 . LEU B 2 435 ? 117.782 108.177 106.329 1.00 500.00 ? 435 LEU B CD2 1 
ATOM 7289  N N   . PRO B 2 436 ? 113.004 110.758 107.259 1.00 414.04 ? 436 PRO B N   1 
ATOM 7290  C CA  . PRO B 2 436 ? 111.997 111.676 107.784 1.00 423.19 ? 436 PRO B CA  1 
ATOM 7291  C C   . PRO B 2 436 ? 111.225 111.058 108.913 1.00 403.74 ? 436 PRO B C   1 
ATOM 7292  O O   . PRO B 2 436 ? 110.961 111.777 109.888 1.00 423.81 ? 436 PRO B O   1 
ATOM 7293  C CB  . PRO B 2 436 ? 111.077 111.937 106.585 1.00 446.24 ? 436 PRO B CB  1 
ATOM 7294  C CG  . PRO B 2 436 ? 111.417 110.882 105.599 1.00 467.95 ? 436 PRO B CG  1 
ATOM 7295  C CD  . PRO B 2 436 ? 112.873 110.667 105.793 1.00 432.14 ? 436 PRO B CD  1 
ATOM 7296  N N   . ILE B 2 437 ? 110.937 109.756 108.814 1.00 402.94 ? 437 ILE B N   1 
ATOM 7297  C CA  . ILE B 2 437 ? 110.241 109.050 109.899 1.00 429.12 ? 437 ILE B CA  1 
ATOM 7298  C C   . ILE B 2 437 ? 111.059 109.115 111.179 1.00 401.68 ? 437 ILE B C   1 
ATOM 7299  O O   . ILE B 2 437 ? 110.504 109.383 112.255 1.00 429.52 ? 437 ILE B O   1 
ATOM 7300  C CB  . ILE B 2 437 ? 109.761 107.598 109.573 1.00 500.00 ? 437 ILE B CB  1 
ATOM 7301  C CG1 . ILE B 2 437 ? 108.529 107.253 110.431 1.00 500.00 ? 437 ILE B CG1 1 
ATOM 7302  C CG2 . ILE B 2 437 ? 110.838 106.543 109.805 1.00 496.27 ? 437 ILE B CG2 1 
ATOM 7303  C CD1 . ILE B 2 437 ? 107.998 105.837 110.261 1.00 500.00 ? 437 ILE B CD1 1 
ATOM 7304  N N   . SER B 2 438 ? 112.358 108.885 111.031 1.00 363.23 ? 438 SER B N   1 
ATOM 7305  C CA  . SER B 2 438 ? 113.300 108.924 112.154 1.00 380.22 ? 438 SER B CA  1 
ATOM 7306  C C   . SER B 2 438 ? 113.261 110.289 112.829 1.00 391.60 ? 438 SER B C   1 
ATOM 7307  O O   . SER B 2 438 ? 113.192 110.389 114.066 1.00 400.48 ? 438 SER B O   1 
ATOM 7308  C CB  . SER B 2 438 ? 114.731 108.620 111.706 1.00 425.79 ? 438 SER B CB  1 
ATOM 7309  O OG  . SER B 2 438 ? 115.294 109.703 110.999 1.00 467.05 ? 438 SER B OG  1 
ATOM 7310  N N   . ILE B 2 439 ? 113.299 111.313 111.986 1.00 393.79 ? 439 ILE B N   1 
ATOM 7311  C CA  . ILE B 2 439 ? 113.269 112.710 112.435 1.00 383.86 ? 439 ILE B CA  1 
ATOM 7312  C C   . ILE B 2 439 ? 112.006 112.973 113.253 1.00 350.71 ? 439 ILE B C   1 
ATOM 7313  O O   . ILE B 2 439 ? 112.058 113.578 114.331 1.00 348.62 ? 439 ILE B O   1 
ATOM 7314  C CB  . ILE B 2 439 ? 113.392 113.705 111.258 1.00 434.81 ? 439 ILE B CB  1 
ATOM 7315  C CG1 . ILE B 2 439 ? 114.812 113.665 110.686 1.00 483.35 ? 439 ILE B CG1 1 
ATOM 7316  C CG2 . ILE B 2 439 ? 113.061 115.125 111.696 1.00 400.48 ? 439 ILE B CG2 1 
ATOM 7317  C CD1 . ILE B 2 439 ? 114.907 114.086 109.235 1.00 500.00 ? 439 ILE B CD1 1 
ATOM 7318  N N   . THR B 2 440 ? 110.895 112.502 112.705 1.00 352.40 ? 440 THR B N   1 
ATOM 7319  C CA  . THR B 2 440 ? 109.573 112.645 113.325 1.00 364.48 ? 440 THR B CA  1 
ATOM 7320  C C   . THR B 2 440 ? 109.579 112.016 114.715 1.00 327.45 ? 440 THR B C   1 
ATOM 7321  O O   . THR B 2 440 ? 109.100 112.614 115.691 1.00 267.00 ? 440 THR B O   1 
ATOM 7322  C CB  . THR B 2 440 ? 108.487 111.958 112.464 1.00 435.10 ? 440 THR B CB  1 
ATOM 7323  O OG1 . THR B 2 440 ? 108.646 112.331 111.088 1.00 443.62 ? 440 THR B OG1 1 
ATOM 7324  C CG2 . THR B 2 440 ? 107.086 112.333 112.936 1.00 492.77 ? 440 THR B CG2 1 
ATOM 7325  N N   . PHE B 2 441 ? 110.125 110.808 114.762 1.00 377.61 ? 441 PHE B N   1 
ATOM 7326  C CA  . PHE B 2 441 ? 110.224 110.031 116.004 1.00 393.05 ? 441 PHE B CA  1 
ATOM 7327  C C   . PHE B 2 441 ? 111.010 110.810 117.049 1.00 425.09 ? 441 PHE B C   1 
ATOM 7328  O O   . PHE B 2 441 ? 110.600 110.904 118.214 1.00 419.25 ? 441 PHE B O   1 
ATOM 7329  C CB  . PHE B 2 441 ? 110.784 108.626 115.780 1.00 413.94 ? 441 PHE B CB  1 
ATOM 7330  C CG  . PHE B 2 441 ? 109.722 107.600 115.531 1.00 432.17 ? 441 PHE B CG  1 
ATOM 7331  C CD1 . PHE B 2 441 ? 108.780 107.790 114.522 1.00 474.63 ? 441 PHE B CD1 1 
ATOM 7332  C CD2 . PHE B 2 441 ? 109.647 106.449 116.305 1.00 477.84 ? 441 PHE B CD2 1 
ATOM 7333  C CE1 . PHE B 2 441 ? 107.788 106.850 114.287 1.00 500.00 ? 441 PHE B CE1 1 
ATOM 7334  C CE2 . PHE B 2 441 ? 108.659 105.501 116.072 1.00 500.00 ? 441 PHE B CE2 1 
ATOM 7335  C CZ  . PHE B 2 441 ? 107.726 105.702 115.062 1.00 500.00 ? 441 PHE B CZ  1 
ATOM 7336  N N   . GLY B 2 442 ? 112.133 111.354 116.596 1.00 435.49 ? 442 GLY B N   1 
ATOM 7337  C CA  . GLY B 2 442 ? 113.032 112.151 117.440 1.00 403.28 ? 442 GLY B CA  1 
ATOM 7338  C C   . GLY B 2 442 ? 112.280 113.332 118.037 1.00 367.73 ? 442 GLY B C   1 
ATOM 7339  O O   . GLY B 2 442 ? 112.376 113.611 119.242 1.00 335.36 ? 442 GLY B O   1 
ATOM 7340  N N   . LEU B 2 443 ? 111.543 114.005 117.165 1.00 315.30 ? 443 LEU B N   1 
ATOM 7341  C CA  . LEU B 2 443 ? 110.738 115.176 117.531 1.00 332.88 ? 443 LEU B CA  1 
ATOM 7342  C C   . LEU B 2 443 ? 109.744 114.806 118.625 1.00 329.24 ? 443 LEU B C   1 
ATOM 7343  O O   . LEU B 2 443 ? 109.598 115.524 119.630 1.00 301.60 ? 443 LEU B O   1 
ATOM 7344  C CB  . LEU B 2 443 ? 109.981 115.700 116.314 1.00 364.39 ? 443 LEU B CB  1 
ATOM 7345  C CG  . LEU B 2 443 ? 110.817 116.503 115.320 1.00 423.24 ? 443 LEU B CG  1 
ATOM 7346  C CD1 . LEU B 2 443 ? 110.042 116.666 114.015 1.00 477.98 ? 443 LEU B CD1 1 
ATOM 7347  C CD2 . LEU B 2 443 ? 111.228 117.849 115.917 1.00 437.75 ? 443 LEU B CD2 1 
ATOM 7348  N N   . VAL B 2 444 ? 109.079 113.683 118.398 1.00 347.93 ? 444 VAL B N   1 
ATOM 7349  C CA  . VAL B 2 444 ? 108.073 113.148 119.322 1.00 404.04 ? 444 VAL B CA  1 
ATOM 7350  C C   . VAL B 2 444 ? 108.697 112.918 120.694 1.00 365.78 ? 444 VAL B C   1 
ATOM 7351  O O   . VAL B 2 444 ? 108.129 113.295 121.728 1.00 374.36 ? 444 VAL B O   1 
ATOM 7352  C CB  . VAL B 2 444 ? 107.466 111.821 118.809 1.00 486.52 ? 444 VAL B CB  1 
ATOM 7353  C CG1 . VAL B 2 444 ? 106.742 111.052 119.918 1.00 500.00 ? 444 VAL B CG1 1 
ATOM 7354  C CG2 . VAL B 2 444 ? 106.524 112.096 117.642 1.00 500.00 ? 444 VAL B CG2 1 
ATOM 7355  N N   . PHE B 2 445 ? 109.861 112.291 120.667 1.00 389.76 ? 445 PHE B N   1 
ATOM 7356  C CA  . PHE B 2 445 ? 110.488 112.004 121.954 1.00 408.99 ? 445 PHE B CA  1 
ATOM 7357  C C   . PHE B 2 445 ? 110.935 113.258 122.661 1.00 387.53 ? 445 PHE B C   1 
ATOM 7358  O O   . PHE B 2 445 ? 110.766 113.363 123.862 1.00 421.34 ? 445 PHE B O   1 
ATOM 7359  C CB  . PHE B 2 445 ? 111.569 110.938 121.846 1.00 492.41 ? 445 PHE B CB  1 
ATOM 7360  C CG  . PHE B 2 445 ? 111.004 109.550 121.826 1.00 500.00 ? 445 PHE B CG  1 
ATOM 7361  C CD1 . PHE B 2 445 ? 110.389 109.052 120.677 1.00 500.00 ? 445 PHE B CD1 1 
ATOM 7362  C CD2 . PHE B 2 445 ? 111.026 108.760 122.970 1.00 500.00 ? 445 PHE B CD2 1 
ATOM 7363  C CE1 . PHE B 2 445 ? 109.847 107.781 120.651 1.00 500.00 ? 445 PHE B CE1 1 
ATOM 7364  C CE2 . PHE B 2 445 ? 110.483 107.483 122.950 1.00 500.00 ? 445 PHE B CE2 1 
ATOM 7365  C CZ  . PHE B 2 445 ? 109.894 106.998 121.792 1.00 500.00 ? 445 PHE B CZ  1 
ATOM 7366  N N   . TYR B 2 446 ? 111.397 114.237 121.903 1.00 354.49 ? 446 TYR B N   1 
ATOM 7367  C CA  . TYR B 2 446 ? 111.850 115.528 122.389 1.00 380.76 ? 446 TYR B CA  1 
ATOM 7368  C C   . TYR B 2 446 ? 110.816 116.258 123.233 1.00 357.28 ? 446 TYR B C   1 
ATOM 7369  O O   . TYR B 2 446 ? 111.062 116.440 124.431 1.00 319.20 ? 446 TYR B O   1 
ATOM 7370  C CB  . TYR B 2 446 ? 112.355 116.457 121.261 1.00 388.65 ? 446 TYR B CB  1 
ATOM 7371  C CG  . TYR B 2 446 ? 112.580 117.873 121.765 1.00 383.80 ? 446 TYR B CG  1 
ATOM 7372  C CD1 . TYR B 2 446 ? 113.590 118.153 122.687 1.00 359.14 ? 446 TYR B CD1 1 
ATOM 7373  C CD2 . TYR B 2 446 ? 111.743 118.913 121.373 1.00 392.80 ? 446 TYR B CD2 1 
ATOM 7374  C CE1 . TYR B 2 446 ? 113.776 119.434 123.181 1.00 385.85 ? 446 TYR B CE1 1 
ATOM 7375  C CE2 . TYR B 2 446 ? 111.917 120.198 121.864 1.00 430.72 ? 446 TYR B CE2 1 
ATOM 7376  C CZ  . TYR B 2 446 ? 112.933 120.456 122.768 1.00 438.76 ? 446 TYR B CZ  1 
ATOM 7377  O OH  . TYR B 2 446 ? 113.115 121.737 123.241 1.00 464.40 ? 446 TYR B OH  1 
ATOM 7378  N N   . PHE B 2 447 ? 109.812 116.821 122.555 1.00 313.22 ? 447 PHE B N   1 
ATOM 7379  C CA  . PHE B 2 447 ? 108.899 117.791 123.168 1.00 361.26 ? 447 PHE B CA  1 
ATOM 7380  C C   . PHE B 2 447 ? 108.203 117.171 124.371 1.00 374.24 ? 447 PHE B C   1 
ATOM 7381  O O   . PHE B 2 447 ? 108.118 117.767 125.456 1.00 383.50 ? 447 PHE B O   1 
ATOM 7382  C CB  . PHE B 2 447 ? 107.761 118.183 122.211 1.00 387.19 ? 447 PHE B CB  1 
ATOM 7383  C CG  . PHE B 2 447 ? 108.198 118.866 120.954 1.00 436.35 ? 447 PHE B CG  1 
ATOM 7384  C CD1 . PHE B 2 447 ? 108.704 120.160 120.983 1.00 476.84 ? 447 PHE B CD1 1 
ATOM 7385  C CD2 . PHE B 2 447 ? 108.040 118.238 119.723 1.00 492.56 ? 447 PHE B CD2 1 
ATOM 7386  C CE1 . PHE B 2 447 ? 109.091 120.795 119.810 1.00 500.00 ? 447 PHE B CE1 1 
ATOM 7387  C CE2 . PHE B 2 447 ? 108.416 118.869 118.549 1.00 500.00 ? 447 PHE B CE2 1 
ATOM 7388  C CZ  . PHE B 2 447 ? 108.941 120.148 118.593 1.00 500.00 ? 447 PHE B CZ  1 
ATOM 7389  N N   . ALA B 2 448 ? 107.705 115.960 124.126 1.00 393.08 ? 448 ALA B N   1 
ATOM 7390  C CA  . ALA B 2 448 ? 106.973 115.188 125.147 1.00 398.53 ? 448 ALA B CA  1 
ATOM 7391  C C   . ALA B 2 448 ? 107.865 114.959 126.355 1.00 351.74 ? 448 ALA B C   1 
ATOM 7392  O O   . ALA B 2 448 ? 107.429 115.142 127.500 1.00 366.38 ? 448 ALA B O   1 
ATOM 7393  C CB  . ALA B 2 448 ? 106.494 113.867 124.573 1.00 461.86 ? 448 ALA B CB  1 
ATOM 7394  N N   . THR B 2 449 ? 109.104 114.565 126.070 1.00 331.86 ? 449 THR B N   1 
ATOM 7395  C CA  . THR B 2 449 ? 110.105 114.283 127.102 1.00 367.70 ? 449 THR B CA  1 
ATOM 7396  C C   . THR B 2 449 ? 110.323 115.524 127.960 1.00 374.47 ? 449 THR B C   1 
ATOM 7397  O O   . THR B 2 449 ? 110.339 115.440 129.211 1.00 400.77 ? 449 THR B O   1 
ATOM 7398  C CB  . THR B 2 449 ? 111.464 113.787 126.549 1.00 409.35 ? 449 THR B CB  1 
ATOM 7399  O OG1 . THR B 2 449 ? 111.287 112.508 125.927 1.00 452.32 ? 449 THR B OG1 1 
ATOM 7400  C CG2 . THR B 2 449 ? 112.507 113.633 127.662 1.00 412.08 ? 449 THR B CG2 1 
ATOM 7401  N N   . ASP B 2 450 ? 110.471 116.654 127.270 1.00 376.45 ? 450 ASP B N   1 
ATOM 7402  C CA  . ASP B 2 450 ? 110.757 117.927 127.927 1.00 418.57 ? 450 ASP B CA  1 
ATOM 7403  C C   . ASP B 2 450 ? 109.565 118.275 128.845 1.00 403.72 ? 450 ASP B C   1 
ATOM 7404  O O   . ASP B 2 450 ? 109.758 118.690 130.003 1.00 350.18 ? 450 ASP B O   1 
ATOM 7405  C CB  . ASP B 2 450 ? 111.106 119.052 126.944 1.00 438.66 ? 450 ASP B CB  1 
ATOM 7406  C CG  . ASP B 2 450 ? 111.966 120.157 127.587 1.00 459.91 ? 450 ASP B CG  1 
ATOM 7407  O OD1 . ASP B 2 450 ? 112.340 120.053 128.783 1.00 391.16 ? 450 ASP B OD1 1 
ATOM 7408  O OD2 . ASP B 2 450 ? 112.269 121.145 126.885 1.00 489.68 ? 450 ASP B OD2 1 
ATOM 7409  N N   . TYR B 2 451 ? 108.345 118.062 128.348 1.00 394.94 ? 451 TYR B N   1 
ATOM 7410  C CA  . TYR B 2 451 ? 107.189 118.541 129.063 1.00 381.44 ? 451 TYR B CA  1 
ATOM 7411  C C   . TYR B 2 451 ? 106.528 117.470 129.879 1.00 397.00 ? 451 TYR B C   1 
ATOM 7412  O O   . TYR B 2 451 ? 105.874 117.815 130.819 1.00 399.82 ? 451 TYR B O   1 
ATOM 7413  C CB  . TYR B 2 451 ? 106.182 119.205 128.108 1.00 407.58 ? 451 TYR B CB  1 
ATOM 7414  C CG  . TYR B 2 451 ? 106.564 120.625 127.721 1.00 485.42 ? 451 TYR B CG  1 
ATOM 7415  C CD1 . TYR B 2 451 ? 106.316 121.699 128.583 1.00 500.00 ? 451 TYR B CD1 1 
ATOM 7416  C CD2 . TYR B 2 451 ? 107.181 120.899 126.496 1.00 500.00 ? 451 TYR B CD2 1 
ATOM 7417  C CE1 . TYR B 2 451 ? 106.668 123.004 128.234 1.00 500.00 ? 451 TYR B CE1 1 
ATOM 7418  C CE2 . TYR B 2 451 ? 107.538 122.199 126.138 1.00 500.00 ? 451 TYR B CE2 1 
ATOM 7419  C CZ  . TYR B 2 451 ? 107.281 123.250 127.006 1.00 500.00 ? 451 TYR B CZ  1 
ATOM 7420  O OH  . TYR B 2 451 ? 107.634 124.536 126.648 1.00 469.46 ? 451 TYR B OH  1 
ATOM 7421  N N   . LEU B 2 452 ? 106.726 116.191 129.552 1.00 418.49 ? 452 LEU B N   1 
ATOM 7422  C CA  . LEU B 2 452 ? 105.912 115.091 130.105 1.00 414.23 ? 452 LEU B CA  1 
ATOM 7423  C C   . LEU B 2 452 ? 106.754 114.076 130.865 1.00 385.84 ? 452 LEU B C   1 
ATOM 7424  O O   . LEU B 2 452 ? 106.464 113.798 132.029 1.00 421.11 ? 452 LEU B O   1 
ATOM 7425  C CB  . LEU B 2 452 ? 105.090 114.405 129.003 1.00 382.17 ? 452 LEU B CB  1 
ATOM 7426  C CG  . LEU B 2 452 ? 104.382 115.388 128.045 1.00 441.84 ? 452 LEU B CG  1 
ATOM 7427  C CD1 . LEU B 2 452 ? 103.770 114.696 126.833 1.00 467.90 ? 452 LEU B CD1 1 
ATOM 7428  C CD2 . LEU B 2 452 ? 103.331 116.201 128.795 1.00 471.57 ? 452 LEU B CD2 1 
ATOM 7429  N N   . VAL B 2 453 ? 107.789 113.538 130.231 1.00 356.49 ? 453 VAL B N   1 
ATOM 7430  C CA  . VAL B 2 453 ? 108.714 112.626 130.917 1.00 411.97 ? 453 VAL B CA  1 
ATOM 7431  C C   . VAL B 2 453 ? 109.479 113.359 132.003 1.00 381.30 ? 453 VAL B C   1 
ATOM 7432  O O   . VAL B 2 453 ? 109.469 112.955 133.170 1.00 347.20 ? 453 VAL B O   1 
ATOM 7433  C CB  . VAL B 2 453 ? 109.743 111.993 129.953 1.00 487.58 ? 453 VAL B CB  1 
ATOM 7434  C CG1 . VAL B 2 453 ? 110.800 111.200 130.719 1.00 500.00 ? 453 VAL B CG1 1 
ATOM 7435  C CG2 . VAL B 2 453 ? 109.054 111.104 128.917 1.00 500.00 ? 453 VAL B CG2 1 
ATOM 7436  N N   . GLN B 2 454 ? 110.128 114.439 131.577 1.00 394.76 ? 454 GLN B N   1 
ATOM 7437  C CA  . GLN B 2 454 ? 111.099 115.186 132.381 1.00 408.07 ? 454 GLN B CA  1 
ATOM 7438  C C   . GLN B 2 454 ? 110.669 115.539 133.777 1.00 385.76 ? 454 GLN B C   1 
ATOM 7439  O O   . GLN B 2 454 ? 111.470 115.294 134.681 1.00 336.58 ? 454 GLN B O   1 
ATOM 7440  C CB  . GLN B 2 454 ? 111.539 116.463 131.641 1.00 431.59 ? 454 GLN B CB  1 
ATOM 7441  C CG  . GLN B 2 454 ? 112.284 117.524 132.446 1.00 442.45 ? 454 GLN B CG  1 
ATOM 7442  C CD  . GLN B 2 454 ? 111.389 118.542 133.144 1.00 452.87 ? 454 GLN B CD  1 
ATOM 7443  O OE1 . GLN B 2 454 ? 110.311 118.886 132.664 1.00 422.86 ? 454 GLN B OE1 1 
ATOM 7444  N NE2 . GLN B 2 454 ? 111.847 119.036 134.287 1.00 486.30 ? 454 GLN B NE2 1 
ATOM 7445  N N   . PRO B 2 455 ? 109.482 116.180 133.921 1.00 372.07 ? 455 PRO B N   1 
ATOM 7446  C CA  . PRO B 2 455 ? 109.101 116.759 135.211 1.00 397.97 ? 455 PRO B CA  1 
ATOM 7447  C C   . PRO B 2 455 ? 109.026 115.672 136.283 1.00 400.99 ? 455 PRO B C   1 
ATOM 7448  O O   . PRO B 2 455 ? 109.584 115.816 137.387 1.00 361.69 ? 455 PRO B O   1 
ATOM 7449  C CB  . PRO B 2 455 ? 107.706 117.351 134.956 1.00 406.58 ? 455 PRO B CB  1 
ATOM 7450  C CG  . PRO B 2 455 ? 107.515 117.353 133.488 1.00 382.21 ? 455 PRO B CG  1 
ATOM 7451  C CD  . PRO B 2 455 ? 108.410 116.317 132.917 1.00 329.70 ? 455 PRO B CD  1 
ATOM 7452  N N   . PHE B 2 456 ? 108.362 114.602 135.914 1.00 402.69 ? 456 PHE B N   1 
ATOM 7453  C CA  . PHE B 2 456 ? 108.166 113.424 136.768 1.00 416.36 ? 456 PHE B CA  1 
ATOM 7454  C C   . PHE B 2 456 ? 109.525 112.867 137.210 1.00 393.26 ? 456 PHE B C   1 
ATOM 7455  O O   . PHE B 2 456 ? 109.790 112.592 138.395 1.00 326.66 ? 456 PHE B O   1 
ATOM 7456  C CB  . PHE B 2 456 ? 107.411 112.385 135.912 1.00 405.55 ? 456 PHE B CB  1 
ATOM 7457  C CG  . PHE B 2 456 ? 107.363 110.999 136.487 1.00 457.30 ? 456 PHE B CG  1 
ATOM 7458  C CD1 . PHE B 2 456 ? 106.511 110.693 137.547 1.00 494.26 ? 456 PHE B CD1 1 
ATOM 7459  C CD2 . PHE B 2 456 ? 108.129 109.979 135.932 1.00 452.52 ? 456 PHE B CD2 1 
ATOM 7460  C CE1 . PHE B 2 456 ? 106.449 109.403 138.064 1.00 483.90 ? 456 PHE B CE1 1 
ATOM 7461  C CE2 . PHE B 2 456 ? 108.068 108.688 136.443 1.00 466.92 ? 456 PHE B CE2 1 
ATOM 7462  C CZ  . PHE B 2 456 ? 107.227 108.397 137.510 1.00 453.87 ? 456 PHE B CZ  1 
ATOM 7463  N N   . MET B 2 457 ? 110.368 112.721 136.186 1.00 395.70 ? 457 MET B N   1 
ATOM 7464  C CA  . MET B 2 457 ? 111.730 112.177 136.370 1.00 423.70 ? 457 MET B CA  1 
ATOM 7465  C C   . MET B 2 457 ? 112.508 113.062 137.324 1.00 403.87 ? 457 MET B C   1 
ATOM 7466  O O   . MET B 2 457 ? 113.183 112.549 138.225 1.00 398.31 ? 457 MET B O   1 
ATOM 7467  C CB  . MET B 2 457 ? 112.464 112.028 135.042 1.00 477.74 ? 457 MET B CB  1 
ATOM 7468  C CG  . MET B 2 457 ? 113.269 110.750 134.993 1.00 500.00 ? 457 MET B CG  1 
ATOM 7469  S SD  . MET B 2 457 ? 112.170 109.327 134.857 1.00 491.44 ? 457 MET B SD  1 
ATOM 7470  C CE  . MET B 2 457 ? 113.202 108.060 135.592 1.00 500.00 ? 457 MET B CE  1 
ATOM 7471  N N   . ASP B 2 458 ? 112.398 114.368 137.107 1.00 396.25 ? 458 ASP B N   1 
ATOM 7472  C CA  . ASP B 2 458 ? 113.079 115.369 137.935 1.00 413.62 ? 458 ASP B CA  1 
ATOM 7473  C C   . ASP B 2 458 ? 112.660 115.219 139.393 1.00 383.91 ? 458 ASP B C   1 
ATOM 7474  O O   . ASP B 2 458 ? 113.505 115.221 140.299 1.00 341.21 ? 458 ASP B O   1 
ATOM 7475  C CB  . ASP B 2 458 ? 112.865 116.811 137.437 1.00 460.97 ? 458 ASP B CB  1 
ATOM 7476  C CG  . ASP B 2 458 ? 114.045 117.737 137.773 1.00 458.36 ? 458 ASP B CG  1 
ATOM 7477  O OD1 . ASP B 2 458 ? 115.159 117.501 137.255 1.00 438.33 ? 458 ASP B OD1 1 
ATOM 7478  O OD2 . ASP B 2 458 ? 113.856 118.712 138.533 1.00 444.65 ? 458 ASP B OD2 1 
ATOM 7479  N N   . GLN B 2 459 ? 111.354 115.086 139.574 1.00 390.33 ? 459 GLN B N   1 
ATOM 7480  C CA  . GLN B 2 459 ? 110.748 114.929 140.903 1.00 409.40 ? 459 GLN B CA  1 
ATOM 7481  C C   . GLN B 2 459 ? 111.328 113.700 141.599 1.00 375.75 ? 459 GLN B C   1 
ATOM 7482  O O   . GLN B 2 459 ? 111.712 113.754 142.780 1.00 327.50 ? 459 GLN B O   1 
ATOM 7483  C CB  . GLN B 2 459 ? 109.215 114.825 140.819 1.00 434.45 ? 459 GLN B CB  1 
ATOM 7484  C CG  . GLN B 2 459 ? 108.477 115.900 141.611 1.00 446.94 ? 459 GLN B CG  1 
ATOM 7485  C CD  . GLN B 2 459 ? 108.471 117.260 140.930 1.00 458.42 ? 459 GLN B CD  1 
ATOM 7486  O OE1 . GLN B 2 459 ? 109.220 117.512 139.978 1.00 413.23 ? 459 GLN B OE1 1 
ATOM 7487  N NE2 . GLN B 2 459 ? 107.616 118.151 141.417 1.00 477.52 ? 459 GLN B NE2 1 
ATOM 7488  N N   . LEU B 2 460 ? 111.377 112.616 140.835 1.00 367.54 ? 460 LEU B N   1 
ATOM 7489  C CA  . LEU B 2 460 ? 111.896 111.332 141.311 1.00 397.66 ? 460 LEU B CA  1 
ATOM 7490  C C   . LEU B 2 460 ? 113.341 111.494 141.789 1.00 393.79 ? 460 LEU B C   1 
ATOM 7491  O O   . LEU B 2 460 ? 113.720 111.021 142.873 1.00 370.52 ? 460 LEU B O   1 
ATOM 7492  C CB  . LEU B 2 460 ? 111.775 110.258 140.215 1.00 427.08 ? 460 LEU B CB  1 
ATOM 7493  C CG  . LEU B 2 460 ? 110.536 109.358 140.308 1.00 448.68 ? 460 LEU B CG  1 
ATOM 7494  C CD1 . LEU B 2 460 ? 109.230 110.116 140.106 1.00 454.31 ? 460 LEU B CD1 1 
ATOM 7495  C CD2 . LEU B 2 460 ? 110.635 108.209 139.313 1.00 457.70 ? 460 LEU B CD2 1 
ATOM 7496  N N   . ALA B 2 461 ? 114.115 112.178 140.958 1.00 400.06 ? 461 ALA B N   1 
ATOM 7497  C CA  . ALA B 2 461 ? 115.531 112.431 141.210 1.00 411.83 ? 461 ALA B CA  1 
ATOM 7498  C C   . ALA B 2 461 ? 115.689 113.196 142.514 1.00 407.23 ? 461 ALA B C   1 
ATOM 7499  O O   . ALA B 2 461 ? 116.569 112.844 143.299 1.00 441.98 ? 461 ALA B O   1 
ATOM 7500  C CB  . ALA B 2 461 ? 116.172 113.189 140.058 1.00 452.59 ? 461 ALA B CB  1 
ATOM 7501  N N   . PHE B 2 462 ? 114.848 114.222 142.684 1.00 379.93 ? 462 PHE B N   1 
ATOM 7502  C CA  . PHE B 2 462 ? 114.963 115.122 143.819 1.00 410.13 ? 462 PHE B CA  1 
ATOM 7503  C C   . PHE B 2 462 ? 114.827 114.375 145.138 1.00 397.42 ? 462 PHE B C   1 
ATOM 7504  O O   . PHE B 2 462 ? 115.645 114.581 146.060 1.00 396.82 ? 462 PHE B O   1 
ATOM 7505  C CB  . PHE B 2 462 ? 113.956 116.279 143.773 1.00 493.89 ? 462 PHE B CB  1 
ATOM 7506  C CG  . PHE B 2 462 ? 114.124 117.278 144.904 1.00 500.00 ? 462 PHE B CG  1 
ATOM 7507  C CD1 . PHE B 2 462 ? 115.273 118.068 144.995 1.00 500.00 ? 462 PHE B CD1 1 
ATOM 7508  C CD2 . PHE B 2 462 ? 113.139 117.427 145.888 1.00 500.00 ? 462 PHE B CD2 1 
ATOM 7509  C CE1 . PHE B 2 462 ? 115.433 118.985 146.032 1.00 500.00 ? 462 PHE B CE1 1 
ATOM 7510  C CE2 . PHE B 2 462 ? 113.296 118.342 146.926 1.00 500.00 ? 462 PHE B CE2 1 
ATOM 7511  C CZ  . PHE B 2 462 ? 114.444 119.121 146.999 1.00 500.00 ? 462 PHE B CZ  1 
ATOM 7512  N N   . HIS B 2 463 ? 113.725 113.646 145.261 1.00 395.79 ? 463 HIS B N   1 
ATOM 7513  C CA  . HIS B 2 463 ? 113.423 112.869 146.461 1.00 402.32 ? 463 HIS B CA  1 
ATOM 7514  C C   . HIS B 2 463 ? 114.388 111.711 146.468 1.00 401.52 ? 463 HIS B C   1 
ATOM 7515  O O   . HIS B 2 463 ? 114.733 111.179 147.518 1.00 405.01 ? 463 HIS B O   1 
ATOM 7516  C CB  . HIS B 2 463 ? 111.976 112.423 146.454 1.00 395.00 ? 463 HIS B CB  1 
ATOM 7517  C CG  . HIS B 2 463 ? 111.015 113.566 146.389 1.00 425.47 ? 463 HIS B CG  1 
ATOM 7518  N ND1 . HIS B 2 463 ? 110.474 114.014 145.202 1.00 426.17 ? 463 HIS B ND1 1 
ATOM 7519  C CD2 . HIS B 2 463 ? 110.541 114.389 147.353 1.00 447.02 ? 463 HIS B CD2 1 
ATOM 7520  C CE1 . HIS B 2 463 ? 109.684 115.044 145.443 1.00 454.18 ? 463 HIS B CE1 1 
ATOM 7521  N NE2 . HIS B 2 463 ? 109.706 115.292 146.741 1.00 473.30 ? 463 HIS B NE2 1 
ATOM 7522  N N   . GLN B 2 464 ? 114.795 111.318 145.258 1.00 404.16 ? 464 GLN B N   1 
ATOM 7523  C CA  . GLN B 2 464 ? 115.845 110.340 144.948 1.00 421.53 ? 464 GLN B CA  1 
ATOM 7524  C C   . GLN B 2 464 ? 115.237 108.991 144.658 1.00 404.70 ? 464 GLN B C   1 
ATOM 7525  O O   . GLN B 2 464 ? 115.945 108.089 144.212 1.00 434.47 ? 464 GLN B O   1 
ATOM 7526  C CB  . GLN B 2 464 ? 116.964 110.232 145.995 1.00 452.05 ? 464 GLN B CB  1 
ATOM 7527  C CG  . GLN B 2 464 ? 118.275 109.689 145.414 1.00 478.59 ? 464 GLN B CG  1 
ATOM 7528  C CD  . GLN B 2 464 ? 119.272 109.250 146.469 1.00 500.00 ? 464 GLN B CD  1 
ATOM 7529  O OE1 . GLN B 2 464 ? 119.176 109.645 147.626 1.00 500.00 ? 464 GLN B OE1 1 
ATOM 7530  N NE2 . GLN B 2 464 ? 120.237 108.431 146.069 1.00 499.71 ? 464 GLN B NE2 1 
ATOM 7531  N N   . PHE B 2 465 ? 113.933 108.845 144.870 1.00 364.39 ? 465 PHE B N   1 
ATOM 7532  C CA  . PHE B 2 465 ? 113.300 107.559 144.614 1.00 397.15 ? 465 PHE B CA  1 
ATOM 7533  C C   . PHE B 2 465 ? 113.115 107.302 143.135 1.00 340.80 ? 465 PHE B C   1 
ATOM 7534  O O   . PHE B 2 465 ? 112.982 108.236 142.353 1.00 387.99 ? 465 PHE B O   1 
ATOM 7535  C CB  . PHE B 2 465 ? 112.014 107.381 145.399 1.00 435.23 ? 465 PHE B CB  1 
ATOM 7536  C CG  . PHE B 2 465 ? 110.946 108.411 145.140 1.00 464.72 ? 465 PHE B CG  1 
ATOM 7537  C CD1 . PHE B 2 465 ? 110.194 108.393 143.966 1.00 492.35 ? 465 PHE B CD1 1 
ATOM 7538  C CD2 . PHE B 2 465 ? 110.620 109.341 146.124 1.00 493.89 ? 465 PHE B CD2 1 
ATOM 7539  C CE1 . PHE B 2 465 ? 109.183 109.319 143.754 1.00 500.00 ? 465 PHE B CE1 1 
ATOM 7540  C CE2 . PHE B 2 465 ? 109.608 110.267 145.916 1.00 500.00 ? 465 PHE B CE2 1 
ATOM 7541  C CZ  . PHE B 2 465 ? 108.891 110.258 144.729 1.00 500.00 ? 465 PHE B CZ  1 
ATOM 7542  N N   . TYR B 2 466 ? 113.081 106.026 142.769 1.00 301.20 ? 466 TYR B N   1 
ATOM 7543  C CA  . TYR B 2 466 ? 113.391 105.606 141.407 1.00 371.69 ? 466 TYR B CA  1 
ATOM 7544  C C   . TYR B 2 466 ? 112.197 105.115 140.601 1.00 394.58 ? 466 TYR B C   1 
ATOM 7545  O O   . TYR B 2 466 ? 111.095 104.902 141.111 1.00 384.27 ? 466 TYR B O   1 
ATOM 7546  C CB  . TYR B 2 466 ? 114.465 104.510 141.439 1.00 370.79 ? 466 TYR B CB  1 
ATOM 7547  C CG  . TYR B 2 466 ? 115.907 104.972 141.403 1.00 361.60 ? 466 TYR B CG  1 
ATOM 7548  C CD1 . TYR B 2 466 ? 116.274 106.284 141.727 1.00 406.36 ? 466 TYR B CD1 1 
ATOM 7549  C CD2 . TYR B 2 466 ? 116.918 104.075 141.061 1.00 367.01 ? 466 TYR B CD2 1 
ATOM 7550  C CE1 . TYR B 2 466 ? 117.597 106.690 141.688 1.00 457.20 ? 466 TYR B CE1 1 
ATOM 7551  C CE2 . TYR B 2 466 ? 118.247 104.467 141.020 1.00 429.80 ? 466 TYR B CE2 1 
ATOM 7552  C CZ  . TYR B 2 466 ? 118.582 105.780 141.333 1.00 486.76 ? 466 TYR B CZ  1 
ATOM 7553  O OH  . TYR B 2 466 ? 119.892 106.198 141.307 1.00 500.00 ? 466 TYR B OH  1 
ATOM 7554  N N   . ILE B 2 467 ? 112.463 104.967 139.311 1.00 394.94 ? 467 ILE B N   1 
ATOM 7555  C CA  . ILE B 2 467 ? 111.578 104.288 138.395 1.00 400.82 ? 467 ILE B CA  1 
ATOM 7556  C C   . ILE B 2 467 ? 111.649 102.784 138.697 1.00 408.64 ? 467 ILE B C   1 
ATOM 7557  O O   . ILE B 2 467 ? 111.296 101.937 137.878 1.00 417.68 ? 467 ILE B O   1 
ATOM 7558  C CB  . ILE B 2 467 ? 111.984 104.625 136.941 1.00 460.10 ? 467 ILE B CB  1 
ATOM 7559  C CG1 . ILE B 2 467 ? 110.826 104.353 135.977 1.00 500.00 ? 467 ILE B CG1 1 
ATOM 7560  C CG2 . ILE B 2 467 ? 113.274 103.920 136.529 1.00 458.49 ? 467 ILE B CG2 1 
ATOM 7561  C CD1 . ILE B 2 467 ? 109.814 105.474 135.923 1.00 500.00 ? 467 ILE B CD1 1 
ATOM 7562  N N   . GLY C 3 2   ? 135.798 117.317 142.216 1.00 421.29 ? 2   GLY C N   1 
ATOM 7563  C CA  . GLY C 3 2   ? 134.492 117.317 141.475 1.00 441.77 ? 2   GLY C CA  1 
ATOM 7564  C C   . GLY C 3 2   ? 134.489 116.389 140.274 1.00 443.63 ? 2   GLY C C   1 
ATOM 7565  O O   . GLY C 3 2   ? 133.642 115.483 140.180 1.00 445.70 ? 2   GLY C O   1 
ATOM 7566  N N   . ALA C 3 3   ? 135.471 116.595 139.395 1.00 438.27 ? 3   ALA C N   1 
ATOM 7567  C CA  . ALA C 3 3   ? 135.682 115.740 138.227 1.00 432.29 ? 3   ALA C CA  1 
ATOM 7568  C C   . ALA C 3 3   ? 135.884 114.288 138.664 1.00 401.26 ? 3   ALA C C   1 
ATOM 7569  O O   . ALA C 3 3   ? 135.285 113.366 138.092 1.00 347.25 ? 3   ALA C O   1 
ATOM 7570  C CB  . ALA C 3 3   ? 136.875 116.231 137.418 1.00 454.43 ? 3   ALA C CB  1 
ATOM 7571  N N   . ALA C 3 4   ? 136.726 114.129 139.677 1.00 377.78 ? 4   ALA C N   1 
ATOM 7572  C CA  . ALA C 3 4   ? 137.052 112.827 140.250 1.00 383.55 ? 4   ALA C CA  1 
ATOM 7573  C C   . ALA C 3 4   ? 135.781 112.126 140.730 1.00 347.08 ? 4   ALA C C   1 
ATOM 7574  O O   . ALA C 3 4   ? 135.549 110.936 140.446 1.00 341.30 ? 4   ALA C O   1 
ATOM 7575  C CB  . ALA C 3 4   ? 138.022 113.016 141.412 1.00 379.38 ? 4   ALA C CB  1 
ATOM 7576  N N   . VAL C 3 5   ? 134.984 112.902 141.452 1.00 338.41 ? 5   VAL C N   1 
ATOM 7577  C CA  . VAL C 3 5   ? 133.709 112.429 142.012 1.00 346.49 ? 5   VAL C CA  1 
ATOM 7578  C C   . VAL C 3 5   ? 132.801 111.932 140.902 1.00 324.20 ? 5   VAL C C   1 
ATOM 7579  O O   . VAL C 3 5   ? 132.201 110.864 141.006 1.00 376.90 ? 5   VAL C O   1 
ATOM 7580  C CB  . VAL C 3 5   ? 132.934 113.520 142.801 1.00 440.33 ? 5   VAL C CB  1 
ATOM 7581  C CG1 . VAL C 3 5   ? 131.521 113.057 143.173 1.00 440.74 ? 5   VAL C CG1 1 
ATOM 7582  C CG2 . VAL C 3 5   ? 133.685 113.913 144.060 1.00 490.78 ? 5   VAL C CG2 1 
ATOM 7583  N N   . PHE C 3 6   ? 132.721 112.743 139.856 1.00 359.30 ? 6   PHE C N   1 
ATOM 7584  C CA  . PHE C 3 6   ? 131.896 112.449 138.674 1.00 400.68 ? 6   PHE C CA  1 
ATOM 7585  C C   . PHE C 3 6   ? 132.318 111.117 138.064 1.00 396.67 ? 6   PHE C C   1 
ATOM 7586  O O   . PHE C 3 6   ? 131.475 110.266 137.743 1.00 289.56 ? 6   PHE C O   1 
ATOM 7587  C CB  . PHE C 3 6   ? 131.968 113.550 137.608 1.00 418.43 ? 6   PHE C CB  1 
ATOM 7588  C CG  . PHE C 3 6   ? 131.697 113.057 136.204 1.00 412.68 ? 6   PHE C CG  1 
ATOM 7589  C CD1 . PHE C 3 6   ? 130.400 112.767 135.793 1.00 387.59 ? 6   PHE C CD1 1 
ATOM 7590  C CD2 . PHE C 3 6   ? 132.744 112.871 135.297 1.00 424.79 ? 6   PHE C CD2 1 
ATOM 7591  C CE1 . PHE C 3 6   ? 130.148 112.317 134.505 1.00 416.12 ? 6   PHE C CE1 1 
ATOM 7592  C CE2 . PHE C 3 6   ? 132.496 112.422 134.007 1.00 425.23 ? 6   PHE C CE2 1 
ATOM 7593  C CZ  . PHE C 3 6   ? 131.196 112.144 133.610 1.00 441.82 ? 6   PHE C CZ  1 
ATOM 7594  N N   . PHE C 3 7   ? 133.632 110.977 137.918 1.00 410.54 ? 7   PHE C N   1 
ATOM 7595  C CA  . PHE C 3 7   ? 134.240 109.773 137.344 1.00 396.73 ? 7   PHE C CA  1 
ATOM 7596  C C   . PHE C 3 7   ? 133.842 108.544 138.161 1.00 357.19 ? 7   PHE C C   1 
ATOM 7597  O O   . PHE C 3 7   ? 133.439 107.505 137.604 1.00 357.81 ? 7   PHE C O   1 
ATOM 7598  C CB  . PHE C 3 7   ? 135.765 109.875 137.202 1.00 410.12 ? 7   PHE C CB  1 
ATOM 7599  C CG  . PHE C 3 7   ? 136.209 110.638 135.980 1.00 428.69 ? 7   PHE C CG  1 
ATOM 7600  C CD1 . PHE C 3 7   ? 135.779 110.261 134.708 1.00 417.05 ? 7   PHE C CD1 1 
ATOM 7601  C CD2 . PHE C 3 7   ? 137.072 111.727 136.091 1.00 464.66 ? 7   PHE C CD2 1 
ATOM 7602  C CE1 . PHE C 3 7   ? 136.187 110.958 133.581 1.00 458.09 ? 7   PHE C CE1 1 
ATOM 7603  C CE2 . PHE C 3 7   ? 137.485 112.428 134.965 1.00 479.69 ? 7   PHE C CE2 1 
ATOM 7604  C CZ  . PHE C 3 7   ? 137.043 112.043 133.707 1.00 462.36 ? 7   PHE C CZ  1 
ATOM 7605  N N   . GLY C 3 8   ? 133.956 108.703 139.473 1.00 356.59 ? 8   GLY C N   1 
ATOM 7606  C CA  . GLY C 3 8   ? 133.615 107.650 140.431 1.00 390.17 ? 8   GLY C CA  1 
ATOM 7607  C C   . GLY C 3 8   ? 132.171 107.216 140.268 1.00 361.32 ? 8   GLY C C   1 
ATOM 7608  O O   . GLY C 3 8   ? 131.863 106.007 140.179 1.00 361.71 ? 8   GLY C O   1 
ATOM 7609  N N   . CYS C 3 9   ? 131.285 108.194 140.343 1.00 379.58 ? 9   CYS C N   1 
ATOM 7610  C CA  . CYS C 3 9   ? 129.829 107.970 140.328 1.00 405.68 ? 9   CYS C CA  1 
ATOM 7611  C C   . CYS C 3 9   ? 129.449 107.268 139.028 1.00 365.78 ? 9   CYS C C   1 
ATOM 7612  O O   . CYS C 3 9   ? 128.678 106.294 139.050 1.00 387.70 ? 9   CYS C O   1 
ATOM 7613  C CB  . CYS C 3 9   ? 129.078 109.300 140.467 1.00 454.19 ? 9   CYS C CB  1 
ATOM 7614  S SG  . CYS C 3 9   ? 129.372 110.185 142.025 1.00 465.08 ? 9   CYS C SG  1 
ATOM 7615  N N   . THR C 3 10  ? 130.003 107.767 137.925 1.00 310.78 ? 10  THR C N   1 
ATOM 7616  C CA  . THR C 3 10  ? 129.677 107.219 136.610 1.00 371.74 ? 10  THR C CA  1 
ATOM 7617  C C   . THR C 3 10  ? 130.156 105.754 136.548 1.00 348.81 ? 10  THR C C   1 
ATOM 7618  O O   . THR C 3 10  ? 129.408 104.896 136.042 1.00 273.53 ? 10  THR C O   1 
ATOM 7619  C CB  . THR C 3 10  ? 130.173 108.074 135.411 1.00 440.03 ? 10  THR C CB  1 
ATOM 7620  O OG1 . THR C 3 10  ? 129.626 107.551 134.193 1.00 489.83 ? 10  THR C OG1 1 
ATOM 7621  C CG2 . THR C 3 10  ? 131.678 108.116 135.276 1.00 462.36 ? 10  THR C CG2 1 
ATOM 7622  N N   . PHE C 3 11  ? 131.348 105.498 137.085 1.00 358.06 ? 11  PHE C N   1 
ATOM 7623  C CA  . PHE C 3 11  ? 131.809 104.107 137.028 1.00 342.07 ? 11  PHE C CA  1 
ATOM 7624  C C   . PHE C 3 11  ? 130.975 103.207 137.890 1.00 350.07 ? 11  PHE C C   1 
ATOM 7625  O O   . PHE C 3 11  ? 130.703 102.092 137.457 1.00 363.27 ? 11  PHE C O   1 
ATOM 7626  C CB  . PHE C 3 11  ? 133.302 103.932 137.296 1.00 348.43 ? 11  PHE C CB  1 
ATOM 7627  C CG  . PHE C 3 11  ? 134.192 104.378 136.166 1.00 337.09 ? 11  PHE C CG  1 
ATOM 7628  C CD1 . PHE C 3 11  ? 133.775 104.326 134.822 1.00 347.66 ? 11  PHE C CD1 1 
ATOM 7629  C CD2 . PHE C 3 11  ? 135.481 104.828 136.447 1.00 365.75 ? 11  PHE C CD2 1 
ATOM 7630  C CE1 . PHE C 3 11  ? 134.622 104.737 133.801 1.00 421.42 ? 11  PHE C CE1 1 
ATOM 7631  C CE2 . PHE C 3 11  ? 136.328 105.239 135.426 1.00 442.95 ? 11  PHE C CE2 1 
ATOM 7632  C CZ  . PHE C 3 11  ? 135.900 105.192 134.102 1.00 459.46 ? 11  PHE C CZ  1 
ATOM 7633  N N   . VAL C 3 12  ? 130.513 103.705 139.031 1.00 359.33 ? 12  VAL C N   1 
ATOM 7634  C CA  . VAL C 3 12  ? 129.606 102.963 139.913 1.00 381.22 ? 12  VAL C CA  1 
ATOM 7635  C C   . VAL C 3 12  ? 128.339 102.593 139.162 1.00 344.84 ? 12  VAL C C   1 
ATOM 7636  O O   . VAL C 3 12  ? 127.880 101.429 139.219 1.00 405.08 ? 12  VAL C O   1 
ATOM 7637  C CB  . VAL C 3 12  ? 129.272 103.727 141.224 1.00 411.62 ? 12  VAL C CB  1 
ATOM 7638  C CG1 . VAL C 3 12  ? 128.261 102.946 142.070 1.00 419.57 ? 12  VAL C CG1 1 
ATOM 7639  C CG2 . VAL C 3 12  ? 130.536 104.018 142.040 1.00 402.65 ? 12  VAL C CG2 1 
ATOM 7640  N N   . ALA C 3 13  ? 127.808 103.584 138.450 1.00 286.21 ? 13  ALA C N   1 
ATOM 7641  C CA  . ALA C 3 13  ? 126.501 103.440 137.783 1.00 349.09 ? 13  ALA C CA  1 
ATOM 7642  C C   . ALA C 3 13  ? 126.554 102.562 136.535 1.00 355.52 ? 13  ALA C C   1 
ATOM 7643  O O   . ALA C 3 13  ? 125.931 101.464 136.437 1.00 362.59 ? 13  ALA C O   1 
ATOM 7644  C CB  . ALA C 3 13  ? 125.930 104.812 137.442 1.00 397.63 ? 13  ALA C CB  1 
ATOM 7645  N N   . PHE C 3 14  ? 127.305 103.080 135.572 1.00 366.04 ? 14  PHE C N   1 
ATOM 7646  C CA  . PHE C 3 14  ? 127.397 102.473 134.266 1.00 411.53 ? 14  PHE C CA  1 
ATOM 7647  C C   . PHE C 3 14  ? 128.501 101.462 134.213 1.00 397.69 ? 14  PHE C C   1 
ATOM 7648  O O   . PHE C 3 14  ? 128.530 100.672 133.286 1.00 397.48 ? 14  PHE C O   1 
ATOM 7649  C CB  . PHE C 3 14  ? 127.610 103.526 133.186 1.00 418.29 ? 14  PHE C CB  1 
ATOM 7650  C CG  . PHE C 3 14  ? 126.509 104.534 133.118 1.00 408.52 ? 14  PHE C CG  1 
ATOM 7651  C CD1 . PHE C 3 14  ? 125.183 104.124 132.992 1.00 377.41 ? 14  PHE C CD1 1 
ATOM 7652  C CD2 . PHE C 3 14  ? 126.788 105.889 133.184 1.00 443.56 ? 14  PHE C CD2 1 
ATOM 7653  C CE1 . PHE C 3 14  ? 124.160 105.048 132.940 1.00 378.04 ? 14  PHE C CE1 1 
ATOM 7654  C CE2 . PHE C 3 14  ? 125.768 106.820 133.129 1.00 466.69 ? 14  PHE C CE2 1 
ATOM 7655  C CZ  . PHE C 3 14  ? 124.454 106.399 133.003 1.00 440.09 ? 14  PHE C CZ  1 
ATOM 7656  N N   . GLY C 3 15  ? 129.398 101.473 135.195 1.00 379.46 ? 15  GLY C N   1 
ATOM 7657  C CA  . GLY C 3 15  ? 130.510 100.545 135.212 1.00 389.36 ? 15  GLY C CA  1 
ATOM 7658  C C   . GLY C 3 15  ? 130.114 99.176  134.759 1.00 382.65 ? 15  GLY C C   1 
ATOM 7659  O O   . GLY C 3 15  ? 130.622 98.744  133.719 1.00 417.33 ? 15  GLY C O   1 
ATOM 7660  N N   . PRO C 3 16  ? 129.264 98.489  135.552 1.00 382.78 ? 16  PRO C N   1 
ATOM 7661  C CA  . PRO C 3 16  ? 128.865 97.118  135.242 1.00 415.57 ? 16  PRO C CA  1 
ATOM 7662  C C   . PRO C 3 16  ? 128.202 97.052  133.873 1.00 398.52 ? 16  PRO C C   1 
ATOM 7663  O O   . PRO C 3 16  ? 128.515 96.168  133.058 1.00 346.07 ? 16  PRO C O   1 
ATOM 7664  C CB  . PRO C 3 16  ? 127.864 96.768  136.355 1.00 426.68 ? 16  PRO C CB  1 
ATOM 7665  C CG  . PRO C 3 16  ? 128.129 97.747  137.437 1.00 421.96 ? 16  PRO C CG  1 
ATOM 7666  C CD  . PRO C 3 16  ? 128.547 98.998  136.734 1.00 395.13 ? 16  PRO C CD  1 
ATOM 7667  N N   . ALA C 3 17  ? 127.299 98.002  133.657 1.00 392.71 ? 17  ALA C N   1 
ATOM 7668  C CA  . ALA C 3 17  ? 126.550 98.111  132.397 1.00 419.69 ? 17  ALA C CA  1 
ATOM 7669  C C   . ALA C 3 17  ? 127.511 98.259  131.224 1.00 396.65 ? 17  ALA C C   1 
ATOM 7670  O O   . ALA C 3 17  ? 127.372 97.584  130.193 1.00 370.02 ? 17  ALA C O   1 
ATOM 7671  C CB  . ALA C 3 17  ? 125.611 99.313  132.433 1.00 448.20 ? 17  ALA C CB  1 
ATOM 7672  N N   . PHE C 3 18  ? 128.470 99.154  131.421 1.00 390.74 ? 18  PHE C N   1 
ATOM 7673  C CA  . PHE C 3 18  ? 129.500 99.458  130.419 1.00 391.27 ? 18  PHE C CA  1 
ATOM 7674  C C   . PHE C 3 18  ? 130.263 98.186  130.057 1.00 416.04 ? 18  PHE C C   1 
ATOM 7675  O O   . PHE C 3 18  ? 130.483 97.888  128.871 1.00 460.01 ? 18  PHE C O   1 
ATOM 7676  C CB  . PHE C 3 18  ? 130.439 100.536 130.977 1.00 369.35 ? 18  PHE C CB  1 
ATOM 7677  C CG  . PHE C 3 18  ? 131.731 100.674 130.243 1.00 404.25 ? 18  PHE C CG  1 
ATOM 7678  C CD1 . PHE C 3 18  ? 131.824 101.502 129.129 1.00 463.83 ? 18  PHE C CD1 1 
ATOM 7679  C CD2 . PHE C 3 18  ? 132.872 100.006 130.686 1.00 386.41 ? 18  PHE C CD2 1 
ATOM 7680  C CE1 . PHE C 3 18  ? 133.027 101.650 128.454 1.00 497.28 ? 18  PHE C CE1 1 
ATOM 7681  C CE2 . PHE C 3 18  ? 134.076 100.148 130.014 1.00 448.79 ? 18  PHE C CE2 1 
ATOM 7682  C CZ  . PHE C 3 18  ? 134.156 100.974 128.899 1.00 489.40 ? 18  PHE C CZ  1 
ATOM 7683  N N   . ALA C 3 19  ? 130.652 97.472  131.104 1.00 387.15 ? 19  ALA C N   1 
ATOM 7684  C CA  . ALA C 3 19  ? 131.404 96.219  130.976 1.00 394.30 ? 19  ALA C CA  1 
ATOM 7685  C C   . ALA C 3 19  ? 130.617 95.216  130.138 1.00 370.32 ? 19  ALA C C   1 
ATOM 7686  O O   . ALA C 3 19  ? 131.162 94.580  129.229 1.00 354.61 ? 19  ALA C O   1 
ATOM 7687  C CB  . ALA C 3 19  ? 131.729 95.633  132.339 1.00 414.12 ? 19  ALA C CB  1 
ATOM 7688  N N   . LEU C 3 20  ? 129.338 95.110  130.479 1.00 305.00 ? 20  LEU C N   1 
ATOM 7689  C CA  . LEU C 3 20  ? 128.411 94.198  129.800 1.00 374.74 ? 20  LEU C CA  1 
ATOM 7690  C C   . LEU C 3 20  ? 128.349 94.528  128.311 1.00 388.70 ? 20  LEU C C   1 
ATOM 7691  O O   . LEU C 3 20  ? 128.426 93.630  127.457 1.00 374.58 ? 20  LEU C O   1 
ATOM 7692  C CB  . LEU C 3 20  ? 127.024 94.210  130.443 1.00 397.11 ? 20  LEU C CB  1 
ATOM 7693  C CG  . LEU C 3 20  ? 126.881 93.865  131.940 1.00 431.66 ? 20  LEU C CG  1 
ATOM 7694  C CD1 . LEU C 3 20  ? 125.540 93.199  132.210 1.00 473.33 ? 20  LEU C CD1 1 
ATOM 7695  C CD2 . LEU C 3 20  ? 128.012 92.995  132.489 1.00 427.29 ? 20  LEU C CD2 1 
ATOM 7696  N N   . PHE C 3 21  ? 128.225 95.824  128.039 1.00 388.94 ? 21  PHE C N   1 
ATOM 7697  C CA  . PHE C 3 21  ? 128.140 96.337  126.673 1.00 357.43 ? 21  PHE C CA  1 
ATOM 7698  C C   . PHE C 3 21  ? 129.386 95.948  125.892 1.00 367.70 ? 21  PHE C C   1 
ATOM 7699  O O   . PHE C 3 21  ? 129.288 95.472  124.741 1.00 389.30 ? 21  PHE C O   1 
ATOM 7700  C CB  . PHE C 3 21  ? 127.924 97.824  126.561 1.00 340.24 ? 21  PHE C CB  1 
ATOM 7701  C CG  . PHE C 3 21  ? 127.585 98.240  125.168 1.00 361.25 ? 21  PHE C CG  1 
ATOM 7702  C CD1 . PHE C 3 21  ? 126.383 97.831  124.592 1.00 358.78 ? 21  PHE C CD1 1 
ATOM 7703  C CD2 . PHE C 3 21  ? 128.476 98.984  124.404 1.00 436.36 ? 21  PHE C CD2 1 
ATOM 7704  C CE1 . PHE C 3 21  ? 126.059 98.189  123.291 1.00 419.27 ? 21  PHE C CE1 1 
ATOM 7705  C CE2 . PHE C 3 21  ? 128.158 99.350  123.101 1.00 487.66 ? 21  PHE C CE2 1 
ATOM 7706  C CZ  . PHE C 3 21  ? 126.948 98.951  122.544 1.00 477.95 ? 21  PHE C CZ  1 
ATOM 7707  N N   . LEU C 3 22  ? 130.532 96.146  126.539 1.00 397.70 ? 22  LEU C N   1 
ATOM 7708  C CA  . LEU C 3 22  ? 131.831 95.953  125.884 1.00 444.59 ? 22  LEU C CA  1 
ATOM 7709  C C   . LEU C 3 22  ? 131.978 94.491  125.539 1.00 430.01 ? 22  LEU C C   1 
ATOM 7710  O O   . LEU C 3 22  ? 132.360 94.079  124.411 1.00 469.32 ? 22  LEU C O   1 
ATOM 7711  C CB  . LEU C 3 22  ? 133.006 96.389  126.769 1.00 490.55 ? 22  LEU C CB  1 
ATOM 7712  C CG  . LEU C 3 22  ? 133.352 97.880  126.910 1.00 500.00 ? 22  LEU C CG  1 
ATOM 7713  C CD1 . LEU C 3 22  ? 134.771 98.023  127.458 1.00 500.00 ? 22  LEU C CD1 1 
ATOM 7714  C CD2 . LEU C 3 22  ? 133.204 98.654  125.601 1.00 500.00 ? 22  LEU C CD2 1 
ATOM 7715  N N   . ILE C 3 23  ? 131.785 93.672  126.547 1.00 338.85 ? 23  ILE C N   1 
ATOM 7716  C CA  . ILE C 3 23  ? 132.046 92.255  126.344 1.00 375.58 ? 23  ILE C CA  1 
ATOM 7717  C C   . ILE C 3 23  ? 130.890 91.529  125.623 1.00 374.65 ? 23  ILE C C   1 
ATOM 7718  O O   . ILE C 3 23  ? 131.088 90.928  124.533 1.00 371.05 ? 23  ILE C O   1 
ATOM 7719  C CB  . ILE C 3 23  ? 132.486 91.626  127.672 1.00 429.45 ? 23  ILE C CB  1 
ATOM 7720  C CG1 . ILE C 3 23  ? 133.845 92.244  128.070 1.00 477.50 ? 23  ILE C CG1 1 
ATOM 7721  C CG2 . ILE C 3 23  ? 132.596 90.110  127.554 1.00 475.27 ? 23  ILE C CG2 1 
ATOM 7722  C CD1 . ILE C 3 23  ? 134.007 92.530  129.545 1.00 500.00 ? 23  ILE C CD1 1 
ATOM 7723  N N   . THR C 3 24  ? 129.694 91.626  126.209 1.00 387.57 ? 24  THR C N   1 
ATOM 7724  C CA  . THR C 3 24  ? 128.506 90.921  125.711 1.00 424.83 ? 24  THR C CA  1 
ATOM 7725  C C   . THR C 3 24  ? 128.215 91.271  124.264 1.00 421.39 ? 24  THR C C   1 
ATOM 7726  O O   . THR C 3 24  ? 128.132 90.390  123.407 1.00 481.54 ? 24  THR C O   1 
ATOM 7727  C CB  . THR C 3 24  ? 127.222 91.236  126.533 1.00 411.29 ? 24  THR C CB  1 
ATOM 7728  O OG1 . THR C 3 24  ? 127.514 91.200  127.933 1.00 452.28 ? 24  THR C OG1 1 
ATOM 7729  C CG2 . THR C 3 24  ? 126.104 90.238  126.231 1.00 430.36 ? 24  THR C CG2 1 
ATOM 7730  N N   . VAL C 3 25  ? 128.104 92.562  123.991 1.00 352.80 ? 25  VAL C N   1 
ATOM 7731  C CA  . VAL C 3 25  ? 127.421 93.022  122.793 1.00 354.75 ? 25  VAL C CA  1 
ATOM 7732  C C   . VAL C 3 25  ? 128.371 93.508  121.696 1.00 377.38 ? 25  VAL C C   1 
ATOM 7733  O O   . VAL C 3 25  ? 128.183 93.154  120.529 1.00 362.12 ? 25  VAL C O   1 
ATOM 7734  C CB  . VAL C 3 25  ? 126.424 94.153  123.138 1.00 372.97 ? 25  VAL C CB  1 
ATOM 7735  C CG1 . VAL C 3 25  ? 125.330 94.248  122.082 1.00 367.37 ? 25  VAL C CG1 1 
ATOM 7736  C CG2 . VAL C 3 25  ? 125.797 93.941  124.512 1.00 388.12 ? 25  VAL C CG2 1 
ATOM 7737  N N   . ALA C 3 26  ? 129.385 94.291  122.084 1.00 407.32 ? 26  ALA C N   1 
ATOM 7738  C CA  . ALA C 3 26  ? 130.144 95.205  121.188 1.00 441.95 ? 26  ALA C CA  1 
ATOM 7739  C C   . ALA C 3 26  ? 130.256 94.811  119.715 1.00 463.38 ? 26  ALA C C   1 
ATOM 7740  O O   . ALA C 3 26  ? 130.011 95.630  118.818 1.00 398.50 ? 26  ALA C O   1 
ATOM 7741  C CB  . ALA C 3 26  ? 131.539 95.453  121.753 1.00 436.97 ? 26  ALA C CB  1 
ATOM 7742  N N   . GLY C 3 27  ? 130.645 93.560  119.484 1.00 500.00 ? 27  GLY C N   1 
ATOM 7743  C CA  . GLY C 3 27  ? 130.802 93.027  118.138 1.00 500.00 ? 27  GLY C CA  1 
ATOM 7744  C C   . GLY C 3 27  ? 129.467 92.769  117.478 1.00 473.36 ? 27  GLY C C   1 
ATOM 7745  O O   . GLY C 3 27  ? 129.139 93.402  116.472 1.00 397.59 ? 27  GLY C O   1 
ATOM 7746  N N   . ASP C 3 28  ? 128.695 91.861  118.082 1.00 479.35 ? 28  ASP C N   1 
ATOM 7747  C CA  . ASP C 3 28  ? 127.475 91.312  117.475 1.00 479.97 ? 28  ASP C CA  1 
ATOM 7748  C C   . ASP C 3 28  ? 126.415 92.391  117.229 1.00 376.67 ? 28  ASP C C   1 
ATOM 7749  O O   . ASP C 3 28  ? 125.704 92.771  118.154 1.00 291.40 ? 28  ASP C O   1 
ATOM 7750  C CB  . ASP C 3 28  ? 126.879 90.192  118.341 1.00 500.00 ? 28  ASP C CB  1 
ATOM 7751  C CG  . ASP C 3 28  ? 127.784 88.968  118.435 1.00 500.00 ? 28  ASP C CG  1 
ATOM 7752  O OD1 . ASP C 3 28  ? 129.017 89.133  118.591 1.00 500.00 ? 28  ASP C OD1 1 
ATOM 7753  O OD2 . ASP C 3 28  ? 127.255 87.836  118.362 1.00 500.00 ? 28  ASP C OD2 1 
ATOM 7754  N N   . PRO C 3 29  ? 126.301 92.870  115.972 1.00 374.73 ? 29  PRO C N   1 
ATOM 7755  C CA  . PRO C 3 29  ? 125.487 94.038  115.642 1.00 388.48 ? 29  PRO C CA  1 
ATOM 7756  C C   . PRO C 3 29  ? 124.002 93.831  115.902 1.00 388.99 ? 29  PRO C C   1 
ATOM 7757  O O   . PRO C 3 29  ? 123.298 94.771  116.322 1.00 304.50 ? 29  PRO C O   1 
ATOM 7758  C CB  . PRO C 3 29  ? 125.750 94.229  114.149 1.00 387.57 ? 29  PRO C CB  1 
ATOM 7759  C CG  . PRO C 3 29  ? 126.045 92.874  113.636 1.00 401.81 ? 29  PRO C CG  1 
ATOM 7760  C CD  . PRO C 3 29  ? 126.745 92.162  114.753 1.00 408.82 ? 29  PRO C CD  1 
ATOM 7761  N N   . LEU C 3 30  ? 123.559 92.586  115.692 1.00 410.66 ? 30  LEU C N   1 
ATOM 7762  C CA  . LEU C 3 30  ? 122.178 92.193  115.958 1.00 449.05 ? 30  LEU C CA  1 
ATOM 7763  C C   . LEU C 3 30  ? 121.832 92.448  117.421 1.00 411.16 ? 30  LEU C C   1 
ATOM 7764  O O   . LEU C 3 30  ? 120.761 93.002  117.723 1.00 357.33 ? 30  LEU C O   1 
ATOM 7765  C CB  . LEU C 3 30  ? 121.940 90.727  115.559 1.00 478.44 ? 30  LEU C CB  1 
ATOM 7766  C CG  . LEU C 3 30  ? 120.498 90.272  115.291 1.00 500.00 ? 30  LEU C CG  1 
ATOM 7767  C CD1 . LEU C 3 30  ? 119.764 91.124  114.257 1.00 466.90 ? 30  LEU C CD1 1 
ATOM 7768  C CD2 . LEU C 3 30  ? 120.519 88.819  114.845 1.00 500.00 ? 30  LEU C CD2 1 
ATOM 7769  N N   . ARG C 3 31  ? 122.755 92.047  118.294 1.00 384.12 ? 31  ARG C N   1 
ATOM 7770  C CA  . ARG C 3 31  ? 122.596 92.216  119.738 1.00 404.97 ? 31  ARG C CA  1 
ATOM 7771  C C   . ARG C 3 31  ? 122.404 93.688  120.083 1.00 409.40 ? 31  ARG C C   1 
ATOM 7772  O O   . ARG C 3 31  ? 121.510 94.052  120.861 1.00 378.40 ? 31  ARG C O   1 
ATOM 7773  C CB  . ARG C 3 31  ? 123.821 91.696  120.503 1.00 406.30 ? 31  ARG C CB  1 
ATOM 7774  C CG  . ARG C 3 31  ? 124.070 90.206  120.409 1.00 423.72 ? 31  ARG C CG  1 
ATOM 7775  C CD  . ARG C 3 31  ? 125.115 89.763  121.427 1.00 394.56 ? 31  ARG C CD  1 
ATOM 7776  N NE  . ARG C 3 31  ? 125.749 88.499  121.055 1.00 406.78 ? 31  ARG C NE  1 
ATOM 7777  C CZ  . ARG C 3 31  ? 126.536 87.769  121.848 1.00 436.95 ? 31  ARG C CZ  1 
ATOM 7778  N NH1 . ARG C 3 31  ? 126.804 88.145  123.098 1.00 460.69 ? 31  ARG C NH1 1 
ATOM 7779  N NH2 . ARG C 3 31  ? 127.057 86.635  121.384 1.00 474.55 ? 31  ARG C NH2 1 
ATOM 7780  N N   . VAL C 3 32  ? 123.263 94.502  119.481 1.00 414.50 ? 32  VAL C N   1 
ATOM 7781  C CA  . VAL C 3 32  ? 123.250 95.959  119.676 1.00 390.04 ? 32  VAL C CA  1 
ATOM 7782  C C   . VAL C 3 32  ? 121.889 96.525  119.285 1.00 363.84 ? 32  VAL C C   1 
ATOM 7783  O O   . VAL C 3 32  ? 121.301 97.335  120.020 1.00 390.62 ? 32  VAL C O   1 
ATOM 7784  C CB  . VAL C 3 32  ? 124.364 96.677  118.868 1.00 386.51 ? 32  VAL C CB  1 
ATOM 7785  C CG1 . VAL C 3 32  ? 124.151 98.187  118.823 1.00 390.27 ? 32  VAL C CG1 1 
ATOM 7786  C CG2 . VAL C 3 32  ? 125.731 96.372  119.460 1.00 422.94 ? 32  VAL C CG2 1 
ATOM 7787  N N   . ILE C 3 33  ? 121.427 96.076  118.122 1.00 309.06 ? 33  ILE C N   1 
ATOM 7788  C CA  . ILE C 3 33  ? 120.141 96.508  117.567 1.00 349.74 ? 33  ILE C CA  1 
ATOM 7789  C C   . ILE C 3 33  ? 119.011 96.181  118.546 1.00 357.65 ? 33  ILE C C   1 
ATOM 7790  O O   . ILE C 3 33  ? 118.141 97.024  118.819 1.00 313.85 ? 33  ILE C O   1 
ATOM 7791  C CB  . ILE C 3 33  ? 119.895 95.962  116.158 1.00 372.93 ? 33  ILE C CB  1 
ATOM 7792  C CG1 . ILE C 3 33  ? 120.917 96.573  115.188 1.00 414.46 ? 33  ILE C CG1 1 
ATOM 7793  C CG2 . ILE C 3 33  ? 118.483 96.312  115.691 1.00 398.35 ? 33  ILE C CG2 1 
ATOM 7794  C CD1 . ILE C 3 33  ? 121.222 95.699  113.993 1.00 469.41 ? 33  ILE C CD1 1 
ATOM 7795  N N   . ILE C 3 34  ? 119.066 94.956  119.050 1.00 375.42 ? 34  ILE C N   1 
ATOM 7796  C CA  . ILE C 3 34  ? 118.075 94.449  120.003 1.00 430.87 ? 34  ILE C CA  1 
ATOM 7797  C C   . ILE C 3 34  ? 118.043 95.335  121.247 1.00 416.27 ? 34  ILE C C   1 
ATOM 7798  O O   . ILE C 3 34  ? 116.966 95.717  121.726 1.00 408.50 ? 34  ILE C O   1 
ATOM 7799  C CB  . ILE C 3 34  ? 118.284 92.937  120.277 1.00 464.74 ? 34  ILE C CB  1 
ATOM 7800  C CG1 . ILE C 3 34  ? 117.968 92.136  119.004 1.00 463.17 ? 34  ILE C CG1 1 
ATOM 7801  C CG2 . ILE C 3 34  ? 117.395 92.410  121.403 1.00 479.09 ? 34  ILE C CG2 1 
ATOM 7802  C CD1 . ILE C 3 34  ? 118.600 90.768  118.985 1.00 500.00 ? 34  ILE C CD1 1 
ATOM 7803  N N   . LEU C 3 35  ? 119.236 95.642  121.734 1.00 386.38 ? 35  LEU C N   1 
ATOM 7804  C CA  . LEU C 3 35  ? 119.421 96.485  122.919 1.00 394.71 ? 35  LEU C CA  1 
ATOM 7805  C C   . LEU C 3 35  ? 118.770 97.849  122.696 1.00 337.89 ? 35  LEU C C   1 
ATOM 7806  O O   . LEU C 3 35  ? 118.045 98.359  123.564 1.00 295.53 ? 35  LEU C O   1 
ATOM 7807  C CB  . LEU C 3 35  ? 120.914 96.622  123.303 1.00 397.42 ? 35  LEU C CB  1 
ATOM 7808  C CG  . LEU C 3 35  ? 121.333 97.620  124.417 1.00 385.52 ? 35  LEU C CG  1 
ATOM 7809  C CD1 . LEU C 3 35  ? 121.990 96.950  125.628 1.00 314.72 ? 35  LEU C CD1 1 
ATOM 7810  C CD2 . LEU C 3 35  ? 122.221 98.729  123.866 1.00 394.76 ? 35  LEU C CD2 1 
ATOM 7811  N N   . VAL C 3 36  ? 119.049 98.401  121.527 1.00 320.74 ? 36  VAL C N   1 
ATOM 7812  C CA  . VAL C 3 36  ? 118.531 99.710  121.118 1.00 362.99 ? 36  VAL C CA  1 
ATOM 7813  C C   . VAL C 3 36  ? 116.991 99.691  121.145 1.00 313.57 ? 36  VAL C C   1 
ATOM 7814  O O   . VAL C 3 36  ? 116.350 100.612 121.681 1.00 261.78 ? 36  VAL C O   1 
ATOM 7815  C CB  . VAL C 3 36  ? 119.185 100.138 119.761 1.00 392.25 ? 36  VAL C CB  1 
ATOM 7816  C CG1 . VAL C 3 36  ? 118.346 101.119 118.954 1.00 376.09 ? 36  VAL C CG1 1 
ATOM 7817  C CG2 . VAL C 3 36  ? 120.579 100.706 120.016 1.00 378.86 ? 36  VAL C CG2 1 
ATOM 7818  N N   . ALA C 3 37  ? 116.454 98.627  120.568 1.00 298.11 ? 37  ALA C N   1 
ATOM 7819  C CA  . ALA C 3 37  ? 115.010 98.421  120.485 1.00 372.61 ? 37  ALA C CA  1 
ATOM 7820  C C   . ALA C 3 37  ? 114.395 98.405  121.887 1.00 365.88 ? 37  ALA C C   1 
ATOM 7821  O O   . ALA C 3 37  ? 113.371 99.057  122.147 1.00 351.19 ? 37  ALA C O   1 
ATOM 7822  C CB  . ALA C 3 37  ? 114.692 97.153  119.705 1.00 432.16 ? 37  ALA C CB  1 
ATOM 7823  N N   . GLY C 3 38  ? 115.056 97.654  122.759 1.00 417.94 ? 38  GLY C N   1 
ATOM 7824  C CA  . GLY C 3 38  ? 114.639 97.505  124.156 1.00 454.78 ? 38  GLY C CA  1 
ATOM 7825  C C   . GLY C 3 38  ? 114.584 98.864  124.837 1.00 382.80 ? 38  GLY C C   1 
ATOM 7826  O O   . GLY C 3 38  ? 113.608 99.195  125.533 1.00 359.59 ? 38  GLY C O   1 
ATOM 7827  N N   . ALA C 3 39  ? 115.648 99.625  124.615 1.00 323.11 ? 39  ALA C N   1 
ATOM 7828  C CA  . ALA C 3 39  ? 115.796 100.972 125.180 1.00 413.63 ? 39  ALA C CA  1 
ATOM 7829  C C   . ALA C 3 39  ? 114.632 101.853 124.740 1.00 388.81 ? 39  ALA C C   1 
ATOM 7830  O O   . ALA C 3 39  ? 114.024 102.562 125.559 1.00 398.63 ? 39  ALA C O   1 
ATOM 7831  C CB  . ALA C 3 39  ? 117.128 101.590 124.775 1.00 470.30 ? 39  ALA C CB  1 
ATOM 7832  N N   . PHE C 3 40  ? 114.354 101.780 123.444 1.00 301.97 ? 40  PHE C N   1 
ATOM 7833  C CA  . PHE C 3 40  ? 113.270 102.546 122.820 1.00 338.45 ? 40  PHE C CA  1 
ATOM 7834  C C   . PHE C 3 40  ? 111.942 102.222 123.487 1.00 332.30 ? 40  PHE C C   1 
ATOM 7835  O O   . PHE C 3 40  ? 111.160 103.121 123.829 1.00 262.43 ? 40  PHE C O   1 
ATOM 7836  C CB  . PHE C 3 40  ? 113.189 102.205 121.341 1.00 326.91 ? 40  PHE C CB  1 
ATOM 7837  C CG  . PHE C 3 40  ? 111.856 102.507 120.723 1.00 384.26 ? 40  PHE C CG  1 
ATOM 7838  C CD1 . PHE C 3 40  ? 111.397 103.819 120.625 1.00 383.20 ? 40  PHE C CD1 1 
ATOM 7839  C CD2 . PHE C 3 40  ? 111.064 101.479 120.223 1.00 440.31 ? 40  PHE C CD2 1 
ATOM 7840  C CE1 . PHE C 3 40  ? 110.168 104.093 120.047 1.00 413.93 ? 40  PHE C CE1 1 
ATOM 7841  C CE2 . PHE C 3 40  ? 109.835 101.749 119.645 1.00 479.65 ? 40  PHE C CE2 1 
ATOM 7842  C CZ  . PHE C 3 40  ? 109.386 103.058 119.558 1.00 483.38 ? 40  PHE C CZ  1 
ATOM 7843  N N   . PHE C 3 41  ? 111.723 100.924 123.655 1.00 354.21 ? 41  PHE C N   1 
ATOM 7844  C CA  . PHE C 3 41  ? 110.504 100.393 124.276 1.00 366.63 ? 41  PHE C CA  1 
ATOM 7845  C C   . PHE C 3 41  ? 110.336 100.971 125.679 1.00 378.51 ? 41  PHE C C   1 
ATOM 7846  O O   . PHE C 3 41  ? 109.243 101.435 126.059 1.00 402.17 ? 41  PHE C O   1 
ATOM 7847  C CB  . PHE C 3 41  ? 110.532 98.858  124.376 1.00 401.60 ? 41  PHE C CB  1 
ATOM 7848  C CG  . PHE C 3 41  ? 109.895 98.160  123.205 1.00 465.56 ? 41  PHE C CG  1 
ATOM 7849  C CD1 . PHE C 3 41  ? 110.324 98.416  121.908 1.00 482.89 ? 41  PHE C CD1 1 
ATOM 7850  C CD2 . PHE C 3 41  ? 108.872 97.234  123.396 1.00 500.00 ? 41  PHE C CD2 1 
ATOM 7851  C CE1 . PHE C 3 41  ? 109.747 97.776  120.823 1.00 464.58 ? 41  PHE C CE1 1 
ATOM 7852  C CE2 . PHE C 3 41  ? 108.289 96.591  122.313 1.00 500.00 ? 41  PHE C CE2 1 
ATOM 7853  C CZ  . PHE C 3 41  ? 108.728 96.863  121.025 1.00 497.98 ? 41  PHE C CZ  1 
ATOM 7854  N N   . TRP C 3 42  ? 111.444 100.926 126.416 1.00 407.73 ? 42  TRP C N   1 
ATOM 7855  C CA  . TRP C 3 42  ? 111.491 101.420 127.793 1.00 413.04 ? 42  TRP C CA  1 
ATOM 7856  C C   . TRP C 3 42  ? 111.099 102.893 127.839 1.00 354.14 ? 42  TRP C C   1 
ATOM 7857  O O   . TRP C 3 42  ? 110.286 103.314 128.685 1.00 263.73 ? 42  TRP C O   1 
ATOM 7858  C CB  . TRP C 3 42  ? 112.853 101.251 128.460 1.00 429.35 ? 42  TRP C CB  1 
ATOM 7859  C CG  . TRP C 3 42  ? 112.846 101.832 129.847 1.00 426.93 ? 42  TRP C CG  1 
ATOM 7860  C CD1 . TRP C 3 42  ? 112.477 101.211 131.007 1.00 440.21 ? 42  TRP C CD1 1 
ATOM 7861  C CD2 . TRP C 3 42  ? 113.164 103.176 130.201 1.00 384.31 ? 42  TRP C CD2 1 
ATOM 7862  N NE1 . TRP C 3 42  ? 112.571 102.079 132.061 1.00 422.58 ? 42  TRP C NE1 1 
ATOM 7863  C CE2 . TRP C 3 42  ? 112.992 103.292 131.595 1.00 390.76 ? 42  TRP C CE2 1 
ATOM 7864  C CE3 . TRP C 3 42  ? 113.593 104.290 129.477 1.00 380.99 ? 42  TRP C CE3 1 
ATOM 7865  C CZ2 . TRP C 3 42  ? 113.228 104.476 132.277 1.00 390.06 ? 42  TRP C CZ2 1 
ATOM 7866  C CZ3 . TRP C 3 42  ? 113.841 105.464 130.160 1.00 429.82 ? 42  TRP C CZ3 1 
ATOM 7867  C CH2 . TRP C 3 42  ? 113.664 105.545 131.548 1.00 413.85 ? 42  TRP C CH2 1 
ATOM 7868  N N   . LEU C 3 43  ? 111.692 103.642 126.917 1.00 311.77 ? 43  LEU C N   1 
ATOM 7869  C CA  . LEU C 3 43  ? 111.450 105.083 126.792 1.00 347.83 ? 43  LEU C CA  1 
ATOM 7870  C C   . LEU C 3 43  ? 109.974 105.352 126.563 1.00 369.29 ? 43  LEU C C   1 
ATOM 7871  O O   . LEU C 3 43  ? 109.380 106.231 127.203 1.00 377.62 ? 43  LEU C O   1 
ATOM 7872  C CB  . LEU C 3 43  ? 112.248 105.688 125.651 1.00 392.87 ? 43  LEU C CB  1 
ATOM 7873  C CG  . LEU C 3 43  ? 113.743 105.834 125.884 1.00 414.59 ? 43  LEU C CG  1 
ATOM 7874  C CD1 . LEU C 3 43  ? 114.433 105.999 124.550 1.00 377.07 ? 43  LEU C CD1 1 
ATOM 7875  C CD2 . LEU C 3 43  ? 114.049 107.019 126.789 1.00 464.17 ? 43  LEU C CD2 1 
ATOM 7876  N N   . VAL C 3 44  ? 109.414 104.576 125.643 1.00 350.85 ? 44  VAL C N   1 
ATOM 7877  C CA  . VAL C 3 44  ? 107.997 104.676 125.267 1.00 351.22 ? 44  VAL C CA  1 
ATOM 7878  C C   . VAL C 3 44  ? 107.119 104.462 126.493 1.00 332.23 ? 44  VAL C C   1 
ATOM 7879  O O   . VAL C 3 44  ? 106.172 105.224 126.739 1.00 288.17 ? 44  VAL C O   1 
ATOM 7880  C CB  . VAL C 3 44  ? 107.596 103.649 124.177 1.00 411.12 ? 44  VAL C CB  1 
ATOM 7881  C CG1 . VAL C 3 44  ? 106.128 103.832 123.787 1.00 483.49 ? 44  VAL C CG1 1 
ATOM 7882  C CG2 . VAL C 3 44  ? 108.495 103.742 122.940 1.00 377.84 ? 44  VAL C CG2 1 
ATOM 7883  N N   . SER C 3 45  ? 107.465 103.414 127.235 1.00 346.06 ? 45  SER C N   1 
ATOM 7884  C CA  . SER C 3 45  ? 106.745 103.029 128.455 1.00 364.81 ? 45  SER C CA  1 
ATOM 7885  C C   . SER C 3 45  ? 106.741 104.193 129.446 1.00 388.73 ? 45  SER C C   1 
ATOM 7886  O O   . SER C 3 45  ? 105.697 104.549 130.024 1.00 391.22 ? 45  SER C O   1 
ATOM 7887  C CB  . SER C 3 45  ? 107.404 101.820 129.136 1.00 369.52 ? 45  SER C CB  1 
ATOM 7888  O OG  . SER C 3 45  ? 108.484 102.207 129.982 1.00 322.79 ? 45  SER C OG  1 
ATOM 7889  N N   . LEU C 3 46  ? 107.936 104.752 129.615 1.00 393.79 ? 46  LEU C N   1 
ATOM 7890  C CA  . LEU C 3 46  ? 108.156 105.872 130.536 1.00 403.15 ? 46  LEU C CA  1 
ATOM 7891  C C   . LEU C 3 46  ? 107.267 107.047 130.152 1.00 397.34 ? 46  LEU C C   1 
ATOM 7892  O O   . LEU C 3 46  ? 106.612 107.672 130.989 1.00 392.93 ? 46  LEU C O   1 
ATOM 7893  C CB  . LEU C 3 46  ? 109.634 106.284 130.585 1.00 429.00 ? 46  LEU C CB  1 
ATOM 7894  C CG  . LEU C 3 46  ? 110.234 106.711 131.941 1.00 449.53 ? 46  LEU C CG  1 
ATOM 7895  C CD1 . LEU C 3 46  ? 111.342 107.731 131.719 1.00 466.66 ? 46  LEU C CD1 1 
ATOM 7896  C CD2 . LEU C 3 46  ? 109.235 107.285 132.941 1.00 459.96 ? 46  LEU C CD2 1 
ATOM 7897  N N   . LEU C 3 47  ? 107.259 107.332 128.854 1.00 394.15 ? 47  LEU C N   1 
ATOM 7898  C CA  . LEU C 3 47  ? 106.514 108.426 128.252 1.00 384.80 ? 47  LEU C CA  1 
ATOM 7899  C C   . LEU C 3 47  ? 105.057 108.238 128.539 1.00 363.61 ? 47  LEU C C   1 
ATOM 7900  O O   . LEU C 3 47  ? 104.414 109.207 128.888 1.00 336.52 ? 47  LEU C O   1 
ATOM 7901  C CB  . LEU C 3 47  ? 106.778 108.462 126.741 1.00 428.12 ? 47  LEU C CB  1 
ATOM 7902  C CG  . LEU C 3 47  ? 105.962 109.397 125.844 1.00 492.92 ? 47  LEU C CG  1 
ATOM 7903  C CD1 . LEU C 3 47  ? 104.556 108.872 125.535 1.00 486.29 ? 47  LEU C CD1 1 
ATOM 7904  C CD2 . LEU C 3 47  ? 105.924 110.799 126.440 1.00 500.00 ? 47  LEU C CD2 1 
ATOM 7905  N N   . LEU C 3 48  ? 104.548 107.008 128.375 1.00 401.62 ? 48  LEU C N   1 
ATOM 7906  C CA  . LEU C 3 48  ? 103.126 106.753 128.632 1.00 434.72 ? 48  LEU C CA  1 
ATOM 7907  C C   . LEU C 3 48  ? 102.808 107.029 130.103 1.00 400.67 ? 48  LEU C C   1 
ATOM 7908  O O   . LEU C 3 48  ? 101.822 107.727 130.461 1.00 318.70 ? 48  LEU C O   1 
ATOM 7909  C CB  . LEU C 3 48  ? 102.738 105.311 128.286 1.00 480.57 ? 48  LEU C CB  1 
ATOM 7910  C CG  . LEU C 3 48  ? 102.807 104.853 126.826 1.00 500.00 ? 48  LEU C CG  1 
ATOM 7911  C CD1 . LEU C 3 48  ? 102.242 103.446 126.718 1.00 500.00 ? 48  LEU C CD1 1 
ATOM 7912  C CD2 . LEU C 3 48  ? 102.065 105.796 125.891 1.00 500.00 ? 48  LEU C CD2 1 
ATOM 7913  N N   . ALA C 3 49  ? 103.681 106.441 130.944 1.00 384.36 ? 49  ALA C N   1 
ATOM 7914  C CA  . ALA C 3 49  ? 103.542 106.578 132.406 1.00 417.77 ? 49  ALA C CA  1 
ATOM 7915  C C   . ALA C 3 49  ? 103.606 108.040 132.799 1.00 372.99 ? 49  ALA C C   1 
ATOM 7916  O O   . ALA C 3 49  ? 102.791 108.506 133.615 1.00 347.82 ? 49  ALA C O   1 
ATOM 7917  C CB  . ALA C 3 49  ? 104.655 105.803 133.098 1.00 434.09 ? 49  ALA C CB  1 
ATOM 7918  N N   . SER C 3 50  ? 104.577 108.737 132.200 1.00 374.42 ? 50  SER C N   1 
ATOM 7919  C CA  . SER C 3 50  ? 104.787 110.167 132.469 1.00 419.89 ? 50  SER C CA  1 
ATOM 7920  C C   . SER C 3 50  ? 103.541 110.951 132.129 1.00 399.14 ? 50  SER C C   1 
ATOM 7921  O O   . SER C 3 50  ? 103.109 111.811 132.909 1.00 420.00 ? 50  SER C O   1 
ATOM 7922  C CB  . SER C 3 50  ? 105.952 110.723 131.659 1.00 470.24 ? 50  SER C CB  1 
ATOM 7923  O OG  . SER C 3 50  ? 105.591 111.040 130.319 1.00 418.72 ? 50  SER C OG  1 
ATOM 7924  N N   . VAL C 3 51  ? 102.983 110.640 130.968 1.00 411.64 ? 51  VAL C N   1 
ATOM 7925  C CA  . VAL C 3 51  ? 101.767 111.287 130.457 1.00 453.11 ? 51  VAL C CA  1 
ATOM 7926  C C   . VAL C 3 51  ? 100.631 111.113 131.455 1.00 423.35 ? 51  VAL C C   1 
ATOM 7927  O O   . VAL C 3 51  ? 99.918  112.080 131.788 1.00 380.96 ? 51  VAL C O   1 
ATOM 7928  C CB  . VAL C 3 51  ? 101.345 110.724 129.062 1.00 486.10 ? 51  VAL C CB  1 
ATOM 7929  C CG1 . VAL C 3 51  ? 99.912  111.107 128.687 1.00 500.00 ? 51  VAL C CG1 1 
ATOM 7930  C CG2 . VAL C 3 51  ? 102.298 111.198 127.972 1.00 500.00 ? 51  VAL C CG2 1 
ATOM 7931  N N   . VAL C 3 52  ? 100.493 109.870 131.909 1.00 405.52 ? 52  VAL C N   1 
ATOM 7932  C CA  . VAL C 3 52  ? 99.452  109.489 132.871 1.00 444.25 ? 52  VAL C CA  1 
ATOM 7933  C C   . VAL C 3 52  ? 99.583  110.329 134.144 1.00 428.98 ? 52  VAL C C   1 
ATOM 7934  O O   . VAL C 3 52  ? 98.587  110.876 134.658 1.00 411.89 ? 52  VAL C O   1 
ATOM 7935  C CB  . VAL C 3 52  ? 99.543  107.981 133.234 1.00 486.12 ? 52  VAL C CB  1 
ATOM 7936  C CG1 . VAL C 3 52  ? 98.742  107.639 134.493 1.00 495.73 ? 52  VAL C CG1 1 
ATOM 7937  C CG2 . VAL C 3 52  ? 99.085  107.123 132.058 1.00 500.00 ? 52  VAL C CG2 1 
ATOM 7938  N N   . TRP C 3 53  ? 100.825 110.404 134.611 1.00 419.17 ? 53  TRP C N   1 
ATOM 7939  C CA  . TRP C 3 53  ? 101.164 111.149 135.826 1.00 417.62 ? 53  TRP C CA  1 
ATOM 7940  C C   . TRP C 3 53  ? 100.756 112.611 135.681 1.00 393.22 ? 53  TRP C C   1 
ATOM 7941  O O   . TRP C 3 53  ? 100.144 113.195 136.587 1.00 333.61 ? 53  TRP C O   1 
ATOM 7942  C CB  . TRP C 3 53  ? 102.647 111.007 136.151 1.00 432.04 ? 53  TRP C CB  1 
ATOM 7943  C CG  . TRP C 3 53  ? 103.087 111.804 137.331 1.00 443.70 ? 53  TRP C CG  1 
ATOM 7944  C CD1 . TRP C 3 53  ? 102.949 111.471 138.647 1.00 453.82 ? 53  TRP C CD1 1 
ATOM 7945  C CD2 . TRP C 3 53  ? 103.752 113.067 137.300 1.00 418.57 ? 53  TRP C CD2 1 
ATOM 7946  N NE1 . TRP C 3 53  ? 103.489 112.455 139.441 1.00 427.58 ? 53  TRP C NE1 1 
ATOM 7947  C CE2 . TRP C 3 53  ? 103.989 113.446 138.640 1.00 407.17 ? 53  TRP C CE2 1 
ATOM 7948  C CE3 . TRP C 3 53  ? 104.173 113.917 136.269 1.00 414.98 ? 53  TRP C CE3 1 
ATOM 7949  C CZ2 . TRP C 3 53  ? 104.630 114.641 138.979 1.00 405.66 ? 53  TRP C CZ2 1 
ATOM 7950  C CZ3 . TRP C 3 53  ? 104.815 115.103 136.603 1.00 427.86 ? 53  TRP C CZ3 1 
ATOM 7951  C CH2 . TRP C 3 53  ? 105.037 115.455 137.951 1.00 433.11 ? 53  TRP C CH2 1 
ATOM 7952  N N   . PHE C 3 54  ? 101.108 113.162 134.529 1.00 385.05 ? 54  PHE C N   1 
ATOM 7953  C CA  . PHE C 3 54  ? 100.815 114.558 134.185 1.00 375.26 ? 54  PHE C CA  1 
ATOM 7954  C C   . PHE C 3 54  ? 99.314  114.808 134.252 1.00 387.14 ? 54  PHE C C   1 
ATOM 7955  O O   . PHE C 3 54  ? 98.857  115.803 134.842 1.00 380.53 ? 54  PHE C O   1 
ATOM 7956  C CB  . PHE C 3 54  ? 101.349 114.823 132.767 1.00 384.77 ? 54  PHE C CB  1 
ATOM 7957  C CG  . PHE C 3 54  ? 101.123 116.219 132.262 1.00 433.44 ? 54  PHE C CG  1 
ATOM 7958  C CD1 . PHE C 3 54  ? 101.987 117.251 132.620 1.00 449.51 ? 54  PHE C CD1 1 
ATOM 7959  C CD2 . PHE C 3 54  ? 100.073 116.496 131.390 1.00 461.92 ? 54  PHE C CD2 1 
ATOM 7960  C CE1 . PHE C 3 54  ? 101.792 118.540 132.140 1.00 463.40 ? 54  PHE C CE1 1 
ATOM 7961  C CE2 . PHE C 3 54  ? 99.872  117.784 130.909 1.00 483.34 ? 54  PHE C CE2 1 
ATOM 7962  C CZ  . PHE C 3 54  ? 100.732 118.806 131.284 1.00 481.86 ? 54  PHE C CZ  1 
ATOM 7963  N N   . ILE C 3 55  ? 98.586  113.880 133.636 1.00 380.85 ? 55  ILE C N   1 
ATOM 7964  C CA  . ILE C 3 55  ? 97.120  113.950 133.576 1.00 433.36 ? 55  ILE C CA  1 
ATOM 7965  C C   . ILE C 3 55  ? 96.539  113.971 134.989 1.00 410.88 ? 55  ILE C C   1 
ATOM 7966  O O   . ILE C 3 55  ? 95.654  114.780 135.297 1.00 371.08 ? 55  ILE C O   1 
ATOM 7967  C CB  . ILE C 3 55  ? 96.512  112.862 132.668 1.00 500.00 ? 55  ILE C CB  1 
ATOM 7968  C CG1 . ILE C 3 55  ? 96.922  113.111 131.212 1.00 500.00 ? 55  ILE C CG1 1 
ATOM 7969  C CG2 . ILE C 3 55  ? 94.987  112.874 132.750 1.00 500.00 ? 55  ILE C CG2 1 
ATOM 7970  C CD1 . ILE C 3 55  ? 96.860  111.873 130.345 1.00 500.00 ? 55  ILE C CD1 1 
ATOM 7971  N N   . LEU C 3 56  ? 97.070  113.072 135.812 1.00 372.85 ? 56  LEU C N   1 
ATOM 7972  C CA  . LEU C 3 56  ? 96.642  112.932 137.206 1.00 356.08 ? 56  LEU C CA  1 
ATOM 7973  C C   . LEU C 3 56  ? 96.846  114.248 137.951 1.00 342.87 ? 56  LEU C C   1 
ATOM 7974  O O   . LEU C 3 56  ? 95.954  114.710 138.678 1.00 364.46 ? 56  LEU C O   1 
ATOM 7975  C CB  . LEU C 3 56  ? 97.346  111.746 137.891 1.00 421.68 ? 56  LEU C CB  1 
ATOM 7976  C CG  . LEU C 3 56  ? 96.768  110.319 137.703 1.00 460.84 ? 56  LEU C CG  1 
ATOM 7977  C CD1 . LEU C 3 56  ? 96.003  109.851 138.938 1.00 486.14 ? 56  LEU C CD1 1 
ATOM 7978  C CD2 . LEU C 3 56  ? 95.889  110.134 136.466 1.00 446.65 ? 56  LEU C CD2 1 
ATOM 7979  N N   . VAL C 3 57  ? 98.024  114.823 137.739 1.00 381.36 ? 57  VAL C N   1 
ATOM 7980  C CA  . VAL C 3 57  ? 98.421  116.079 138.372 1.00 448.91 ? 57  VAL C CA  1 
ATOM 7981  C C   . VAL C 3 57  ? 97.432  117.180 137.991 1.00 420.07 ? 57  VAL C C   1 
ATOM 7982  O O   . VAL C 3 57  ? 96.964  117.944 138.876 1.00 386.06 ? 57  VAL C O   1 
ATOM 7983  C CB  . VAL C 3 57  ? 99.880  116.465 138.032 1.00 500.00 ? 57  VAL C CB  1 
ATOM 7984  C CG1 . VAL C 3 57  ? 100.196 117.892 138.486 1.00 500.00 ? 57  VAL C CG1 1 
ATOM 7985  C CG2 . VAL C 3 57  ? 100.852 115.467 138.664 1.00 500.00 ? 57  VAL C CG2 1 
ATOM 7986  N N   . HIS C 3 58  ? 97.116  117.222 136.696 1.00 401.00 ? 58  HIS C N   1 
ATOM 7987  C CA  . HIS C 3 58  ? 96.295  118.294 136.146 1.00 461.88 ? 58  HIS C CA  1 
ATOM 7988  C C   . HIS C 3 58  ? 94.844  118.201 136.545 1.00 495.92 ? 58  HIS C C   1 
ATOM 7989  O O   . HIS C 3 58  ? 94.269  119.233 136.900 1.00 441.78 ? 58  HIS C O   1 
ATOM 7990  C CB  . HIS C 3 58  ? 96.495  118.445 134.633 1.00 500.00 ? 58  HIS C CB  1 
ATOM 7991  C CG  . HIS C 3 58  ? 97.689  119.277 134.281 1.00 500.00 ? 58  HIS C CG  1 
ATOM 7992  N ND1 . HIS C 3 58  ? 97.593  120.463 133.586 1.00 500.00 ? 58  HIS C ND1 1 
ATOM 7993  C CD2 . HIS C 3 58  ? 99.003  119.120 134.576 1.00 500.00 ? 58  HIS C CD2 1 
ATOM 7994  C CE1 . HIS C 3 58  ? 98.798  120.987 133.445 1.00 500.00 ? 58  HIS C CE1 1 
ATOM 7995  N NE2 . HIS C 3 58  ? 99.671  120.190 134.036 1.00 500.00 ? 58  HIS C NE2 1 
ATOM 7996  N N   . VAL C 3 59  ? 94.276  117.004 136.520 1.00 500.00 ? 59  VAL C N   1 
ATOM 7997  C CA  . VAL C 3 59  ? 92.870  116.830 136.896 1.00 500.00 ? 59  VAL C CA  1 
ATOM 7998  C C   . VAL C 3 59  ? 92.682  117.216 138.369 1.00 500.00 ? 59  VAL C C   1 
ATOM 7999  O O   . VAL C 3 59  ? 91.717  117.914 138.708 1.00 500.00 ? 59  VAL C O   1 
ATOM 8000  C CB  . VAL C 3 59  ? 92.345  115.401 136.570 1.00 500.00 ? 59  VAL C CB  1 
ATOM 8001  C CG1 . VAL C 3 59  ? 90.958  115.158 137.167 1.00 500.00 ? 59  VAL C CG1 1 
ATOM 8002  C CG2 . VAL C 3 59  ? 92.305  115.179 135.058 1.00 500.00 ? 59  VAL C CG2 1 
ATOM 8003  N N   . THR C 3 60  ? 93.640  116.810 139.208 1.00 500.00 ? 60  THR C N   1 
ATOM 8004  C CA  . THR C 3 60  ? 93.536  116.906 140.638 1.00 500.00 ? 60  THR C CA  1 
ATOM 8005  C C   . THR C 3 60  ? 94.068  118.227 141.202 1.00 500.00 ? 60  THR C C   1 
ATOM 8006  O O   . THR C 3 60  ? 93.427  118.782 142.083 1.00 500.00 ? 60  THR C O   1 
ATOM 8007  C CB  . THR C 3 60  ? 94.224  115.701 141.329 1.00 500.00 ? 60  THR C CB  1 
ATOM 8008  O OG1 . THR C 3 60  ? 93.663  114.480 140.830 1.00 500.00 ? 60  THR C OG1 1 
ATOM 8009  C CG2 . THR C 3 60  ? 94.042  115.747 142.853 1.00 500.00 ? 60  THR C CG2 1 
ATOM 8010  N N   . ASP C 3 61  ? 95.209  118.716 140.706 1.00 500.00 ? 61  ASP C N   1 
ATOM 8011  C CA  . ASP C 3 61  ? 95.823  120.016 141.107 1.00 500.00 ? 61  ASP C CA  1 
ATOM 8012  C C   . ASP C 3 61  ? 96.743  119.894 142.348 1.00 500.00 ? 61  ASP C C   1 
ATOM 8013  O O   . ASP C 3 61  ? 96.525  119.052 143.225 1.00 500.00 ? 61  ASP C O   1 
ATOM 8014  C CB  . ASP C 3 61  ? 94.758  121.134 141.311 1.00 500.00 ? 61  ASP C CB  1 
ATOM 8015  C CG  . ASP C 3 61  ? 95.302  122.555 141.059 1.00 500.00 ? 61  ASP C CG  1 
ATOM 8016  O OD1 . ASP C 3 61  ? 95.834  122.823 139.957 1.00 500.00 ? 61  ASP C OD1 1 
ATOM 8017  O OD2 . ASP C 3 61  ? 95.161  123.415 141.957 1.00 500.00 ? 61  ASP C OD2 1 
ATOM 8018  N N   . ARG C 3 62  ? 97.768  120.750 142.388 1.00 500.00 ? 62  ARG C N   1 
ATOM 8019  C CA  . ARG C 3 62  ? 98.742  120.827 143.495 1.00 500.00 ? 62  ARG C CA  1 
ATOM 8020  C C   . ARG C 3 62  ? 98.102  121.460 144.731 1.00 477.30 ? 62  ARG C C   1 
ATOM 8021  O O   . ARG C 3 62  ? 97.741  122.639 144.715 1.00 389.22 ? 62  ARG C O   1 
ATOM 8022  C CB  . ARG C 3 62  ? 99.988  121.627 143.049 1.00 500.00 ? 62  ARG C CB  1 
ATOM 8023  C CG  . ARG C 3 62  ? 100.833 122.307 144.130 1.00 500.00 ? 62  ARG C CG  1 
ATOM 8024  C CD  . ARG C 3 62  ? 101.494 121.333 145.097 1.00 500.00 ? 62  ARG C CD  1 
ATOM 8025  N NE  . ARG C 3 62  ? 102.457 122.011 145.976 1.00 500.00 ? 62  ARG C NE  1 
ATOM 8026  C CZ  . ARG C 3 62  ? 103.686 122.424 145.629 1.00 500.00 ? 62  ARG C CZ  1 
ATOM 8027  N NH1 . ARG C 3 62  ? 104.164 122.247 144.391 1.00 500.00 ? 62  ARG C NH1 1 
ATOM 8028  N NH2 . ARG C 3 62  ? 104.453 123.031 146.534 1.00 500.00 ? 62  ARG C NH2 1 
ATOM 8029  N N   . SER C 3 63  ? 97.974  120.672 145.796 1.00 475.56 ? 63  SER C N   1 
ATOM 8030  C CA  . SER C 3 63  ? 97.366  121.143 147.042 1.00 500.00 ? 63  SER C CA  1 
ATOM 8031  C C   . SER C 3 63  ? 97.977  120.442 148.264 1.00 500.00 ? 63  SER C C   1 
ATOM 8032  O O   . SER C 3 63  ? 98.724  121.061 149.032 1.00 468.59 ? 63  SER C O   1 
ATOM 8033  C CB  . SER C 3 63  ? 95.840  120.949 146.995 1.00 500.00 ? 63  SER C CB  1 
ATOM 8034  O OG  . SER C 3 63  ? 95.251  121.651 145.909 1.00 492.24 ? 63  SER C OG  1 
ATOM 8035  N N   . ASP C 3 64  ? 97.681  119.150 148.412 1.00 500.00 ? 64  ASP C N   1 
ATOM 8036  C CA  . ASP C 3 64  ? 98.107  118.357 149.571 1.00 500.00 ? 64  ASP C CA  1 
ATOM 8037  C C   . ASP C 3 64  ? 99.456  117.696 149.263 1.00 472.28 ? 64  ASP C C   1 
ATOM 8038  O O   . ASP C 3 64  ? 99.561  116.886 148.317 1.00 285.55 ? 64  ASP C O   1 
ATOM 8039  C CB  . ASP C 3 64  ? 97.050  117.292 149.933 1.00 500.00 ? 64  ASP C CB  1 
ATOM 8040  C CG  . ASP C 3 64  ? 95.953  117.812 150.858 1.00 500.00 ? 64  ASP C CG  1 
ATOM 8041  O OD1 . ASP C 3 64  ? 95.535  118.982 150.714 1.00 500.00 ? 64  ASP C OD1 1 
ATOM 8042  O OD2 . ASP C 3 64  ? 95.492  117.028 151.718 1.00 500.00 ? 64  ASP C OD2 1 
ATOM 8043  N N   . ALA C 3 65  ? 100.466 118.040 150.071 1.00 478.12 ? 65  ALA C N   1 
ATOM 8044  C CA  . ALA C 3 65  ? 101.848 117.570 149.881 1.00 500.00 ? 65  ALA C CA  1 
ATOM 8045  C C   . ALA C 3 65  ? 101.929 116.055 149.965 1.00 500.00 ? 65  ALA C C   1 
ATOM 8046  O O   . ALA C 3 65  ? 102.495 115.388 149.075 1.00 500.00 ? 65  ALA C O   1 
ATOM 8047  C CB  . ALA C 3 65  ? 102.766 118.206 150.913 1.00 500.00 ? 65  ALA C CB  1 
ATOM 8048  N N   . ARG C 3 66  ? 101.260 115.532 150.988 1.00 500.00 ? 66  ARG C N   1 
ATOM 8049  C CA  . ARG C 3 66  ? 101.108 114.069 151.169 1.00 500.00 ? 66  ARG C CA  1 
ATOM 8050  C C   . ARG C 3 66  ? 100.411 113.479 149.950 1.00 494.08 ? 66  ARG C C   1 
ATOM 8051  O O   . ARG C 3 66  ? 100.845 112.442 149.425 1.00 470.28 ? 66  ARG C O   1 
ATOM 8052  C CB  . ARG C 3 66  ? 100.330 113.764 152.456 1.00 500.00 ? 66  ARG C CB  1 
ATOM 8053  C CG  . ARG C 3 66  ? 100.157 112.283 152.792 1.00 500.00 ? 66  ARG C CG  1 
ATOM 8054  C CD  . ARG C 3 66  ? 98.762  111.740 152.460 1.00 500.00 ? 66  ARG C CD  1 
ATOM 8055  N NE  . ARG C 3 66  ? 97.674  112.381 153.226 1.00 500.00 ? 66  ARG C NE  1 
ATOM 8056  C CZ  . ARG C 3 66  ? 96.411  111.937 153.317 1.00 500.00 ? 66  ARG C CZ  1 
ATOM 8057  N NH1 . ARG C 3 66  ? 96.018  110.817 152.705 1.00 500.00 ? 66  ARG C NH1 1 
ATOM 8058  N NH2 . ARG C 3 66  ? 95.527  112.619 154.045 1.00 500.00 ? 66  ARG C NH2 1 
ATOM 8059  N N   . LEU C 3 67  ? 99.345  114.159 149.529 1.00 428.17 ? 67  LEU C N   1 
ATOM 8060  C CA  . LEU C 3 67  ? 98.554  113.718 148.373 1.00 413.00 ? 67  LEU C CA  1 
ATOM 8061  C C   . LEU C 3 67  ? 99.434  113.666 147.129 1.00 369.93 ? 67  LEU C C   1 
ATOM 8062  O O   . LEU C 3 67  ? 99.379  112.691 146.370 1.00 373.94 ? 67  LEU C O   1 
ATOM 8063  C CB  . LEU C 3 67  ? 97.311  114.577 148.150 1.00 469.01 ? 67  LEU C CB  1 
ATOM 8064  C CG  . LEU C 3 67  ? 96.260  114.038 147.164 1.00 500.00 ? 67  LEU C CG  1 
ATOM 8065  C CD1 . LEU C 3 67  ? 94.843  114.280 147.675 1.00 500.00 ? 67  LEU C CD1 1 
ATOM 8066  C CD2 . LEU C 3 67  ? 96.428  114.627 145.767 1.00 500.00 ? 67  LEU C CD2 1 
ATOM 8067  N N   . GLN C 3 68  ? 100.231 114.708 146.955 1.00 309.12 ? 68  GLN C N   1 
ATOM 8068  C CA  . GLN C 3 68  ? 101.151 114.819 145.822 1.00 365.08 ? 68  GLN C CA  1 
ATOM 8069  C C   . GLN C 3 68  ? 102.124 113.642 145.812 1.00 372.26 ? 68  GLN C C   1 
ATOM 8070  O O   . GLN C 3 68  ? 102.357 113.023 144.768 1.00 370.01 ? 68  GLN C O   1 
ATOM 8071  C CB  . GLN C 3 68  ? 101.870 116.170 145.762 1.00 431.25 ? 68  GLN C CB  1 
ATOM 8072  C CG  . GLN C 3 68  ? 102.370 116.536 144.362 1.00 464.77 ? 68  GLN C CG  1 
ATOM 8073  C CD  . GLN C 3 68  ? 101.263 116.643 143.314 1.00 475.72 ? 68  GLN C CD  1 
ATOM 8074  O OE1 . GLN C 3 68  ? 101.476 116.323 142.144 1.00 457.54 ? 68  GLN C OE1 1 
ATOM 8075  N NE2 . GLN C 3 68  ? 100.076 117.087 143.731 1.00 471.05 ? 68  GLN C NE2 1 
ATOM 8076  N N   . TYR C 3 69  ? 102.659 113.363 146.989 1.00 404.72 ? 69  TYR C N   1 
ATOM 8077  C CA  . TYR C 3 69  ? 103.613 112.268 147.197 1.00 400.98 ? 69  TYR C CA  1 
ATOM 8078  C C   . TYR C 3 69  ? 102.971 110.934 146.771 1.00 418.82 ? 69  TYR C C   1 
ATOM 8079  O O   . TYR C 3 69  ? 103.584 110.126 146.052 1.00 418.08 ? 69  TYR C O   1 
ATOM 8080  C CB  . TYR C 3 69  ? 104.137 112.386 148.652 1.00 382.89 ? 69  TYR C CB  1 
ATOM 8081  C CG  . TYR C 3 69  ? 104.811 111.229 149.355 1.00 428.92 ? 69  TYR C CG  1 
ATOM 8082  C CD1 . TYR C 3 69  ? 104.065 110.344 150.139 1.00 468.45 ? 69  TYR C CD1 1 
ATOM 8083  C CD2 . TYR C 3 69  ? 106.201 111.095 149.357 1.00 425.67 ? 69  TYR C CD2 1 
ATOM 8084  C CE1 . TYR C 3 69  ? 104.674 109.308 150.842 1.00 455.14 ? 69  TYR C CE1 1 
ATOM 8085  C CE2 . TYR C 3 69  ? 106.822 110.060 150.058 1.00 436.02 ? 69  TYR C CE2 1 
ATOM 8086  C CZ  . TYR C 3 69  ? 106.050 109.168 150.800 1.00 416.20 ? 69  TYR C CZ  1 
ATOM 8087  O OH  . TYR C 3 69  ? 106.636 108.139 151.499 1.00 359.51 ? 69  TYR C OH  1 
ATOM 8088  N N   . GLY C 3 70  ? 101.742 110.754 147.231 1.00 406.83 ? 70  GLY C N   1 
ATOM 8089  C CA  . GLY C 3 70  ? 100.955 109.557 146.936 1.00 429.23 ? 70  GLY C CA  1 
ATOM 8090  C C   . GLY C 3 70  ? 100.790 109.385 145.434 1.00 404.51 ? 70  GLY C C   1 
ATOM 8091  O O   . GLY C 3 70  ? 100.969 108.295 144.887 1.00 439.31 ? 70  GLY C O   1 
ATOM 8092  N N   . LEU C 3 71  ? 100.441 110.490 144.795 1.00 376.00 ? 71  LEU C N   1 
ATOM 8093  C CA  . LEU C 3 71  ? 100.239 110.553 143.338 1.00 408.47 ? 71  LEU C CA  1 
ATOM 8094  C C   . LEU C 3 71  ? 101.504 110.115 142.619 1.00 397.78 ? 71  LEU C C   1 
ATOM 8095  O O   . LEU C 3 71  ? 101.453 109.318 141.682 1.00 391.61 ? 71  LEU C O   1 
ATOM 8096  C CB  . LEU C 3 71  ? 99.850  111.970 142.870 1.00 460.27 ? 71  LEU C CB  1 
ATOM 8097  C CG  . LEU C 3 71  ? 98.393  112.225 142.472 1.00 495.72 ? 71  LEU C CG  1 
ATOM 8098  C CD1 . LEU C 3 71  ? 97.420  111.856 143.584 1.00 500.00 ? 71  LEU C CD1 1 
ATOM 8099  C CD2 . LEU C 3 71  ? 98.224  113.682 142.059 1.00 490.50 ? 71  LEU C CD2 1 
ATOM 8100  N N   . LEU C 3 72  ? 102.618 110.664 143.080 1.00 410.30 ? 72  LEU C N   1 
ATOM 8101  C CA  . LEU C 3 72  ? 103.946 110.370 142.527 1.00 408.55 ? 72  LEU C CA  1 
ATOM 8102  C C   . LEU C 3 72  ? 104.225 108.869 142.606 1.00 377.73 ? 72  LEU C C   1 
ATOM 8103  O O   . LEU C 3 72  ? 104.676 108.248 141.631 1.00 372.80 ? 72  LEU C O   1 
ATOM 8104  C CB  . LEU C 3 72  ? 105.065 111.121 143.257 1.00 476.61 ? 72  LEU C CB  1 
ATOM 8105  C CG  . LEU C 3 72  ? 105.589 112.362 142.537 1.00 500.00 ? 72  LEU C CG  1 
ATOM 8106  C CD1 . LEU C 3 72  ? 106.384 113.251 143.487 1.00 500.00 ? 72  LEU C CD1 1 
ATOM 8107  C CD2 . LEU C 3 72  ? 106.433 111.964 141.330 1.00 500.00 ? 72  LEU C CD2 1 
ATOM 8108  N N   . ILE C 3 73  ? 103.944 108.330 143.785 1.00 368.06 ? 73  ILE C N   1 
ATOM 8109  C CA  . ILE C 3 73  ? 104.139 106.907 144.075 1.00 389.02 ? 73  ILE C CA  1 
ATOM 8110  C C   . ILE C 3 73  ? 103.330 106.053 143.083 1.00 389.03 ? 73  ILE C C   1 
ATOM 8111  O O   . ILE C 3 73  ? 103.834 105.078 142.509 1.00 282.30 ? 73  ILE C O   1 
ATOM 8112  C CB  . ILE C 3 73  ? 103.764 106.577 145.546 1.00 417.47 ? 73  ILE C CB  1 
ATOM 8113  C CG1 . ILE C 3 73  ? 104.813 107.162 146.498 1.00 439.16 ? 73  ILE C CG1 1 
ATOM 8114  C CG2 . ILE C 3 73  ? 103.643 105.068 145.776 1.00 457.81 ? 73  ILE C CG2 1 
ATOM 8115  C CD1 . ILE C 3 73  ? 104.329 107.343 147.922 1.00 451.04 ? 73  ILE C CD1 1 
ATOM 8116  N N   . PHE C 3 74  ? 102.083 106.459 142.920 1.00 436.33 ? 74  PHE C N   1 
ATOM 8117  C CA  . PHE C 3 74  ? 101.134 105.793 142.023 1.00 471.92 ? 74  PHE C CA  1 
ATOM 8118  C C   . PHE C 3 74  ? 101.684 105.774 140.600 1.00 442.28 ? 74  PHE C C   1 
ATOM 8119  O O   . PHE C 3 74  ? 101.658 104.745 139.921 1.00 456.72 ? 74  PHE C O   1 
ATOM 8120  C CB  . PHE C 3 74  ? 99.770  106.505 142.110 1.00 500.00 ? 74  PHE C CB  1 
ATOM 8121  C CG  . PHE C 3 74  ? 98.727  105.964 141.179 1.00 500.00 ? 74  PHE C CG  1 
ATOM 8122  C CD1 . PHE C 3 74  ? 98.155  104.715 141.403 1.00 500.00 ? 74  PHE C CD1 1 
ATOM 8123  C CD2 . PHE C 3 74  ? 98.295  106.714 140.081 1.00 500.00 ? 74  PHE C CD2 1 
ATOM 8124  C CE1 . PHE C 3 74  ? 97.188  104.214 140.541 1.00 500.00 ? 74  PHE C CE1 1 
ATOM 8125  C CE2 . PHE C 3 74  ? 97.326  106.220 139.220 1.00 500.00 ? 74  PHE C CE2 1 
ATOM 8126  C CZ  . PHE C 3 74  ? 96.772  104.968 139.447 1.00 500.00 ? 74  PHE C CZ  1 
ATOM 8127  N N   . GLY C 3 75  ? 102.174 106.931 140.186 1.00 414.51 ? 75  GLY C N   1 
ATOM 8128  C CA  . GLY C 3 75  ? 102.758 107.127 138.853 1.00 406.14 ? 75  GLY C CA  1 
ATOM 8129  C C   . GLY C 3 75  ? 103.916 106.165 138.646 1.00 381.43 ? 75  GLY C C   1 
ATOM 8130  O O   . GLY C 3 75  ? 104.021 105.513 137.603 1.00 363.39 ? 75  GLY C O   1 
ATOM 8131  N N   . ALA C 3 76  ? 104.770 106.105 139.660 1.00 382.08 ? 76  ALA C N   1 
ATOM 8132  C CA  . ALA C 3 76  ? 105.953 105.237 139.660 1.00 433.68 ? 76  ALA C CA  1 
ATOM 8133  C C   . ALA C 3 76  ? 105.529 103.776 139.460 1.00 434.44 ? 76  ALA C C   1 
ATOM 8134  O O   . ALA C 3 76  ? 106.111 103.047 138.641 1.00 447.14 ? 76  ALA C O   1 
ATOM 8135  C CB  . ALA C 3 76  ? 106.736 105.381 140.954 1.00 457.76 ? 76  ALA C CB  1 
ATOM 8136  N N   . ALA C 3 77  ? 104.514 103.399 140.225 1.00 437.20 ? 77  ALA C N   1 
ATOM 8137  C CA  . ALA C 3 77  ? 103.956 102.047 140.191 1.00 464.94 ? 77  ALA C CA  1 
ATOM 8138  C C   . ALA C 3 77  ? 103.476 101.710 138.777 1.00 436.15 ? 77  ALA C C   1 
ATOM 8139  O O   . ALA C 3 77  ? 103.760 100.629 138.241 1.00 368.14 ? 77  ALA C O   1 
ATOM 8140  C CB  . ALA C 3 77  ? 102.824 101.886 141.200 1.00 494.76 ? 77  ALA C CB  1 
ATOM 8141  N N   . VAL C 3 78  ? 102.756 102.663 138.208 1.00 435.95 ? 78  VAL C N   1 
ATOM 8142  C CA  . VAL C 3 78  ? 102.199 102.553 136.855 1.00 450.92 ? 78  VAL C CA  1 
ATOM 8143  C C   . VAL C 3 78  ? 103.318 102.312 135.850 1.00 391.40 ? 78  VAL C C   1 
ATOM 8144  O O   . VAL C 3 78  ? 103.221 101.439 134.984 1.00 379.85 ? 78  VAL C O   1 
ATOM 8145  C CB  . VAL C 3 78  ? 101.392 103.835 136.457 1.00 467.20 ? 78  VAL C CB  1 
ATOM 8146  C CG1 . VAL C 3 78  ? 101.075 103.878 134.962 1.00 490.32 ? 78  VAL C CG1 1 
ATOM 8147  C CG2 . VAL C 3 78  ? 100.101 103.944 137.265 1.00 486.46 ? 78  VAL C CG2 1 
ATOM 8148  N N   . SER C 3 79  ? 104.362 103.114 135.994 1.00 365.58 ? 79  SER C N   1 
ATOM 8149  C CA  . SER C 3 79  ? 105.548 103.049 135.129 1.00 417.70 ? 79  SER C CA  1 
ATOM 8150  C C   . SER C 3 79  ? 106.166 101.664 135.195 1.00 388.70 ? 79  SER C C   1 
ATOM 8151  O O   . SER C 3 79  ? 106.498 101.074 134.160 1.00 343.57 ? 79  SER C O   1 
ATOM 8152  C CB  . SER C 3 79  ? 106.566 104.137 135.484 1.00 468.66 ? 79  SER C CB  1 
ATOM 8153  O OG  . SER C 3 79  ? 107.212 103.872 136.711 1.00 500.00 ? 79  SER C OG  1 
ATOM 8154  N N   . VAL C 3 80  ? 106.297 101.171 136.419 1.00 377.69 ? 80  VAL C N   1 
ATOM 8155  C CA  . VAL C 3 80  ? 106.858 99.843  136.692 1.00 398.17 ? 80  VAL C CA  1 
ATOM 8156  C C   . VAL C 3 80  ? 106.040 98.764  135.943 1.00 396.02 ? 80  VAL C C   1 
ATOM 8157  O O   . VAL C 3 80  ? 106.580 97.917  135.184 1.00 396.04 ? 80  VAL C O   1 
ATOM 8158  C CB  . VAL C 3 80  ? 106.853 99.510  138.208 1.00 411.86 ? 80  VAL C CB  1 
ATOM 8159  C CG1 . VAL C 3 80  ? 107.135 98.025  138.464 1.00 394.03 ? 80  VAL C CG1 1 
ATOM 8160  C CG2 . VAL C 3 80  ? 107.847 100.392 138.959 1.00 454.46 ? 80  VAL C CG2 1 
ATOM 8161  N N   . LEU C 3 81  ? 104.744 98.893  136.123 1.00 397.91 ? 81  LEU C N   1 
ATOM 8162  C CA  . LEU C 3 81  ? 103.771 97.968  135.515 1.00 429.97 ? 81  LEU C CA  1 
ATOM 8163  C C   . LEU C 3 81  ? 103.858 98.062  134.007 1.00 426.75 ? 81  LEU C C   1 
ATOM 8164  O O   . LEU C 3 81  ? 103.921 97.074  133.259 1.00 441.82 ? 81  LEU C O   1 
ATOM 8165  C CB  . LEU C 3 81  ? 102.347 98.261  135.998 1.00 452.08 ? 81  LEU C CB  1 
ATOM 8166  C CG  . LEU C 3 81  ? 102.062 97.892  137.458 1.00 481.63 ? 81  LEU C CG  1 
ATOM 8167  C CD1 . LEU C 3 81  ? 100.703 98.431  137.879 1.00 500.00 ? 81  LEU C CD1 1 
ATOM 8168  C CD2 . LEU C 3 81  ? 102.138 96.385  137.682 1.00 497.14 ? 81  LEU C CD2 1 
ATOM 8169  N N   . LEU C 3 82  ? 103.838 99.313  133.536 1.00 384.79 ? 82  LEU C N   1 
ATOM 8170  C CA  . LEU C 3 82  ? 103.953 99.667  132.115 1.00 411.02 ? 82  LEU C CA  1 
ATOM 8171  C C   . LEU C 3 82  ? 105.248 99.130  131.587 1.00 424.99 ? 82  LEU C C   1 
ATOM 8172  O O   . LEU C 3 82  ? 105.214 98.572  130.489 1.00 387.73 ? 82  LEU C O   1 
ATOM 8173  C CB  . LEU C 3 82  ? 103.792 101.178 131.856 1.00 433.34 ? 82  LEU C CB  1 
ATOM 8174  C CG  . LEU C 3 82  ? 102.380 101.613 131.401 1.00 458.02 ? 82  LEU C CG  1 
ATOM 8175  C CD1 . LEU C 3 82  ? 101.266 101.109 132.314 1.00 477.98 ? 82  LEU C CD1 1 
ATOM 8176  C CD2 . LEU C 3 82  ? 102.283 103.124 131.244 1.00 444.62 ? 82  LEU C CD2 1 
ATOM 8177  N N   . GLN C 3 83  ? 106.340 99.283  132.327 1.00 453.72 ? 83  GLN C N   1 
ATOM 8178  C CA  . GLN C 3 83  ? 107.652 98.790  131.907 1.00 474.79 ? 83  GLN C CA  1 
ATOM 8179  C C   . GLN C 3 83  ? 107.599 97.279  131.666 1.00 425.42 ? 83  GLN C C   1 
ATOM 8180  O O   . GLN C 3 83  ? 108.092 96.780  130.647 1.00 380.66 ? 83  GLN C O   1 
ATOM 8181  C CB  . GLN C 3 83  ? 108.758 99.149  132.910 1.00 489.37 ? 83  GLN C CB  1 
ATOM 8182  C CG  . GLN C 3 83  ? 109.289 100.568 132.749 1.00 485.07 ? 83  GLN C CG  1 
ATOM 8183  C CD  . GLN C 3 83  ? 110.069 101.045 133.958 1.00 441.69 ? 83  GLN C CD  1 
ATOM 8184  O OE1 . GLN C 3 83  ? 111.257 100.760 134.099 1.00 448.75 ? 83  GLN C OE1 1 
ATOM 8185  N NE2 . GLN C 3 83  ? 109.405 101.781 134.833 1.00 377.46 ? 83  GLN C NE2 1 
ATOM 8186  N N   . GLU C 3 84  ? 106.987 96.599  132.622 1.00 434.60 ? 84  GLU C N   1 
ATOM 8187  C CA  . GLU C 3 84  ? 106.832 95.142  132.576 1.00 481.84 ? 84  GLU C CA  1 
ATOM 8188  C C   . GLU C 3 84  ? 106.061 94.734  131.313 1.00 401.78 ? 84  GLU C C   1 
ATOM 8189  O O   . GLU C 3 84  ? 106.454 93.803  130.603 1.00 413.57 ? 84  GLU C O   1 
ATOM 8190  C CB  . GLU C 3 84  ? 106.226 94.565  133.864 1.00 500.00 ? 84  GLU C CB  1 
ATOM 8191  C CG  . GLU C 3 84  ? 107.195 94.557  135.057 1.00 500.00 ? 84  GLU C CG  1 
ATOM 8192  C CD  . GLU C 3 84  ? 108.238 93.430  135.040 1.00 500.00 ? 84  GLU C CD  1 
ATOM 8193  O OE1 . GLU C 3 84  ? 108.428 92.769  133.996 1.00 500.00 ? 84  GLU C OE1 1 
ATOM 8194  O OE2 . GLU C 3 84  ? 108.883 93.207  136.090 1.00 500.00 ? 84  GLU C OE2 1 
ATOM 8195  N N   . VAL C 3 85  ? 104.980 95.462  131.076 1.00 332.08 ? 85  VAL C N   1 
ATOM 8196  C CA  . VAL C 3 85  ? 104.109 95.243  129.922 1.00 388.35 ? 85  VAL C CA  1 
ATOM 8197  C C   . VAL C 3 85  ? 104.922 95.372  128.620 1.00 394.90 ? 85  VAL C C   1 
ATOM 8198  O O   . VAL C 3 85  ? 104.824 94.531  127.711 1.00 451.75 ? 85  VAL C O   1 
ATOM 8199  C CB  . VAL C 3 85  ? 102.905 96.217  129.938 1.00 423.67 ? 85  VAL C CB  1 
ATOM 8200  C CG1 . VAL C 3 85  ? 102.165 96.230  128.599 1.00 475.25 ? 85  VAL C CG1 1 
ATOM 8201  C CG2 . VAL C 3 85  ? 101.952 95.855  131.077 1.00 441.50 ? 85  VAL C CG2 1 
ATOM 8202  N N   . PHE C 3 86  ? 105.708 96.435  128.579 1.00 340.44 ? 86  PHE C N   1 
ATOM 8203  C CA  . PHE C 3 86  ? 106.560 96.736  127.431 1.00 392.13 ? 86  PHE C CA  1 
ATOM 8204  C C   . PHE C 3 86  ? 107.534 95.599  127.175 1.00 403.47 ? 86  PHE C C   1 
ATOM 8205  O O   . PHE C 3 86  ? 107.723 95.171  126.042 1.00 398.20 ? 86  PHE C O   1 
ATOM 8206  C CB  . PHE C 3 86  ? 107.152 98.140  127.489 1.00 398.89 ? 86  PHE C CB  1 
ATOM 8207  C CG  . PHE C 3 86  ? 106.281 99.139  126.792 1.00 415.10 ? 86  PHE C CG  1 
ATOM 8208  C CD1 . PHE C 3 86  ? 105.055 99.499  127.340 1.00 386.25 ? 86  PHE C CD1 1 
ATOM 8209  C CD2 . PHE C 3 86  ? 106.631 99.640  125.537 1.00 458.51 ? 86  PHE C CD2 1 
ATOM 8210  C CE1 . PHE C 3 86  ? 104.221 100.387 126.681 1.00 455.59 ? 86  PHE C CE1 1 
ATOM 8211  C CE2 . PHE C 3 86  ? 105.802 100.529 124.871 1.00 470.16 ? 86  PHE C CE2 1 
ATOM 8212  C CZ  . PHE C 3 86  ? 104.594 100.903 125.445 1.00 491.01 ? 86  PHE C CZ  1 
ATOM 8213  N N   . ARG C 3 87  ? 108.132 95.121  128.254 1.00 420.89 ? 87  ARG C N   1 
ATOM 8214  C CA  . ARG C 3 87  ? 109.086 94.008  128.230 1.00 455.01 ? 87  ARG C CA  1 
ATOM 8215  C C   . ARG C 3 87  ? 108.432 92.778  127.627 1.00 446.15 ? 87  ARG C C   1 
ATOM 8216  O O   . ARG C 3 87  ? 109.029 92.123  126.802 1.00 461.55 ? 87  ARG C O   1 
ATOM 8217  C CB  . ARG C 3 87  ? 109.591 93.739  129.651 1.00 472.02 ? 87  ARG C CB  1 
ATOM 8218  C CG  . ARG C 3 87  ? 110.552 92.572  129.798 1.00 488.36 ? 87  ARG C CG  1 
ATOM 8219  C CD  . ARG C 3 87  ? 111.230 92.622  131.154 1.00 464.68 ? 87  ARG C CD  1 
ATOM 8220  N NE  . ARG C 3 87  ? 112.529 93.295  131.082 1.00 452.77 ? 87  ARG C NE  1 
ATOM 8221  C CZ  . ARG C 3 87  ? 113.029 94.136  131.990 1.00 471.04 ? 87  ARG C CZ  1 
ATOM 8222  N NH1 . ARG C 3 87  ? 112.355 94.484  133.089 1.00 490.80 ? 87  ARG C NH1 1 
ATOM 8223  N NH2 . ARG C 3 87  ? 114.234 94.655  131.785 1.00 466.42 ? 87  ARG C NH2 1 
ATOM 8224  N N   . PHE C 3 88  ? 107.225 92.504  128.103 1.00 434.93 ? 88  PHE C N   1 
ATOM 8225  C CA  . PHE C 3 88  ? 106.427 91.359  127.614 1.00 450.75 ? 88  PHE C CA  1 
ATOM 8226  C C   . PHE C 3 88  ? 106.251 91.439  126.068 1.00 408.83 ? 88  PHE C C   1 
ATOM 8227  O O   . PHE C 3 88  ? 106.487 90.498  125.259 1.00 377.46 ? 88  PHE C O   1 
ATOM 8228  C CB  . PHE C 3 88  ? 105.042 91.317  128.308 1.00 500.00 ? 88  PHE C CB  1 
ATOM 8229  C CG  . PHE C 3 88  ? 103.978 90.566  127.539 1.00 500.00 ? 88  PHE C CG  1 
ATOM 8230  C CD1 . PHE C 3 88  ? 104.104 89.196  127.292 1.00 500.00 ? 88  PHE C CD1 1 
ATOM 8231  C CD2 . PHE C 3 88  ? 102.836 91.226  127.074 1.00 500.00 ? 88  PHE C CD2 1 
ATOM 8232  C CE1 . PHE C 3 88  ? 103.123 88.503  126.583 1.00 500.00 ? 88  PHE C CE1 1 
ATOM 8233  C CE2 . PHE C 3 88  ? 101.853 90.537  126.370 1.00 500.00 ? 88  PHE C CE2 1 
ATOM 8234  C CZ  . PHE C 3 88  ? 101.995 89.175  126.123 1.00 500.00 ? 88  PHE C CZ  1 
ATOM 8235  N N   . ALA C 3 89  ? 105.815 92.648  125.719 1.00 398.39 ? 89  ALA C N   1 
ATOM 8236  C CA  . ALA C 3 89  ? 105.555 92.995  124.302 1.00 420.95 ? 89  ALA C CA  1 
ATOM 8237  C C   . ALA C 3 89  ? 106.843 92.855  123.505 1.00 423.09 ? 89  ALA C C   1 
ATOM 8238  O O   . ALA C 3 89  ? 106.812 92.304  122.395 1.00 405.62 ? 89  ALA C O   1 
ATOM 8239  C CB  . ALA C 3 89  ? 104.979 94.399  124.175 1.00 431.51 ? 89  ALA C CB  1 
ATOM 8240  N N   . TYR C 3 90  ? 107.940 93.344  124.077 1.00 419.53 ? 90  TYR C N   1 
ATOM 8241  C CA  . TYR C 3 90  ? 109.254 93.282  123.450 1.00 414.14 ? 90  TYR C CA  1 
ATOM 8242  C C   . TYR C 3 90  ? 109.633 91.832  123.150 1.00 387.75 ? 90  TYR C C   1 
ATOM 8243  O O   . TYR C 3 90  ? 110.096 91.507  122.053 1.00 281.47 ? 90  TYR C O   1 
ATOM 8244  C CB  . TYR C 3 90  ? 110.281 93.953  124.362 1.00 385.66 ? 90  TYR C CB  1 
ATOM 8245  C CG  . TYR C 3 90  ? 111.583 94.101  123.676 1.00 387.94 ? 90  TYR C CG  1 
ATOM 8246  C CD1 . TYR C 3 90  ? 111.746 95.048  122.675 1.00 386.92 ? 90  TYR C CD1 1 
ATOM 8247  C CD2 . TYR C 3 90  ? 112.646 93.260  123.977 1.00 400.90 ? 90  TYR C CD2 1 
ATOM 8248  C CE1 . TYR C 3 90  ? 112.947 95.171  122.010 1.00 410.11 ? 90  TYR C CE1 1 
ATOM 8249  C CE2 . TYR C 3 90  ? 113.853 93.379  123.321 1.00 384.04 ? 90  TYR C CE2 1 
ATOM 8250  C CZ  . TYR C 3 90  ? 114.000 94.332  122.347 1.00 385.14 ? 90  TYR C CZ  1 
ATOM 8251  O OH  . TYR C 3 90  ? 115.198 94.419  121.719 1.00 360.28 ? 90  TYR C OH  1 
ATOM 8252  N N   . TYR C 3 91  ? 109.416 90.995  124.154 1.00 382.27 ? 91  TYR C N   1 
ATOM 8253  C CA  . TYR C 3 91  ? 109.702 89.554  124.072 1.00 385.71 ? 91  TYR C CA  1 
ATOM 8254  C C   . TYR C 3 91  ? 108.927 88.935  122.921 1.00 368.32 ? 91  TYR C C   1 
ATOM 8255  O O   . TYR C 3 91  ? 109.483 88.167  122.120 1.00 386.98 ? 91  TYR C O   1 
ATOM 8256  C CB  . TYR C 3 91  ? 109.331 88.791  125.359 1.00 385.37 ? 91  TYR C CB  1 
ATOM 8257  C CG  . TYR C 3 91  ? 109.046 87.311  125.121 1.00 423.36 ? 91  TYR C CG  1 
ATOM 8258  C CD1 . TYR C 3 91  ? 110.090 86.395  124.943 1.00 424.96 ? 91  TYR C CD1 1 
ATOM 8259  C CD2 . TYR C 3 91  ? 107.734 86.829  125.044 1.00 466.04 ? 91  TYR C CD2 1 
ATOM 8260  C CE1 . TYR C 3 91  ? 109.839 85.045  124.709 1.00 425.46 ? 91  TYR C CE1 1 
ATOM 8261  C CE2 . TYR C 3 91  ? 107.472 85.481  124.804 1.00 486.75 ? 91  TYR C CE2 1 
ATOM 8262  C CZ  . TYR C 3 91  ? 108.527 84.590  124.641 1.00 464.28 ? 91  TYR C CZ  1 
ATOM 8263  O OH  . TYR C 3 91  ? 108.268 83.253  124.415 1.00 422.82 ? 91  TYR C OH  1 
ATOM 8264  N N   . LYS C 3 92  ? 107.645 89.286  122.875 1.00 382.76 ? 92  LYS C N   1 
ATOM 8265  C CA  . LYS C 3 92  ? 106.726 88.793  121.842 1.00 465.03 ? 92  LYS C CA  1 
ATOM 8266  C C   . LYS C 3 92  ? 107.258 89.162  120.449 1.00 457.09 ? 92  LYS C C   1 
ATOM 8267  O O   . LYS C 3 92  ? 107.292 88.325  119.533 1.00 433.14 ? 92  LYS C O   1 
ATOM 8268  C CB  . LYS C 3 92  ? 105.284 89.309  122.030 1.00 500.00 ? 92  LYS C CB  1 
ATOM 8269  C CG  . LYS C 3 92  ? 104.404 88.479  122.970 1.00 500.00 ? 92  LYS C CG  1 
ATOM 8270  C CD  . LYS C 3 92  ? 104.180 87.022  122.543 1.00 500.00 ? 92  LYS C CD  1 
ATOM 8271  C CE  . LYS C 3 92  ? 103.605 86.867  121.136 1.00 500.00 ? 92  LYS C CE  1 
ATOM 8272  N NZ  . LYS C 3 92  ? 103.298 85.446  120.798 1.00 500.00 ? 92  LYS C NZ  1 
ATOM 8273  N N   . LEU C 3 93  ? 107.656 90.422  120.340 1.00 438.07 ? 93  LEU C N   1 
ATOM 8274  C CA  . LEU C 3 93  ? 108.191 90.976  119.097 1.00 431.54 ? 93  LEU C CA  1 
ATOM 8275  C C   . LEU C 3 93  ? 109.419 90.184  118.649 1.00 390.94 ? 93  LEU C C   1 
ATOM 8276  O O   . LEU C 3 93  ? 109.545 89.816  117.472 1.00 432.32 ? 93  LEU C O   1 
ATOM 8277  C CB  . LEU C 3 93  ? 108.486 92.472  119.201 1.00 433.48 ? 93  LEU C CB  1 
ATOM 8278  C CG  . LEU C 3 93  ? 107.283 93.435  119.345 1.00 500.00 ? 93  LEU C CG  1 
ATOM 8279  C CD1 . LEU C 3 93  ? 107.412 94.544  118.310 1.00 500.00 ? 93  LEU C CD1 1 
ATOM 8280  C CD2 . LEU C 3 93  ? 105.888 92.817  119.217 1.00 481.24 ? 93  LEU C CD2 1 
ATOM 8281  N N   . LEU C 3 94  ? 110.291 89.938  119.613 1.00 364.13 ? 94  LEU C N   1 
ATOM 8282  C CA  . LEU C 3 94  ? 111.531 89.185  119.395 1.00 420.91 ? 94  LEU C CA  1 
ATOM 8283  C C   . LEU C 3 94  ? 111.214 87.798  118.848 1.00 448.97 ? 94  LEU C C   1 
ATOM 8284  O O   . LEU C 3 94  ? 111.835 87.337  117.883 1.00 429.51 ? 94  LEU C O   1 
ATOM 8285  C CB  . LEU C 3 94  ? 112.364 89.039  120.679 1.00 425.29 ? 94  LEU C CB  1 
ATOM 8286  C CG  . LEU C 3 94  ? 113.051 90.238  121.345 1.00 407.02 ? 94  LEU C CG  1 
ATOM 8287  C CD1 . LEU C 3 94  ? 114.288 89.784  122.123 1.00 380.77 ? 94  LEU C CD1 1 
ATOM 8288  C CD2 . LEU C 3 94  ? 113.429 91.311  120.331 1.00 436.62 ? 94  LEU C CD2 1 
ATOM 8289  N N   . LYS C 3 95  ? 110.245 87.166  119.496 1.00 468.68 ? 95  LYS C N   1 
ATOM 8290  C CA  . LYS C 3 95  ? 109.784 85.822  119.130 1.00 490.40 ? 95  LYS C CA  1 
ATOM 8291  C C   . LYS C 3 95  ? 109.310 85.810  117.675 1.00 482.97 ? 95  LYS C C   1 
ATOM 8292  O O   . LYS C 3 95  ? 109.669 84.917  116.892 1.00 462.14 ? 95  LYS C O   1 
ATOM 8293  C CB  . LYS C 3 95  ? 108.651 85.387  120.069 1.00 500.00 ? 95  LYS C CB  1 
ATOM 8294  C CG  . LYS C 3 95  ? 108.316 83.908  120.042 1.00 500.00 ? 95  LYS C CG  1 
ATOM 8295  C CD  . LYS C 3 95  ? 109.391 83.064  120.702 1.00 500.00 ? 95  LYS C CD  1 
ATOM 8296  C CE  . LYS C 3 95  ? 108.857 81.682  121.035 1.00 500.00 ? 95  LYS C CE  1 
ATOM 8297  N NZ  . LYS C 3 95  ? 108.217 81.003  119.870 1.00 500.00 ? 95  LYS C NZ  1 
ATOM 8298  N N   . LYS C 3 96  ? 108.509 86.819  117.358 1.00 488.42 ? 96  LYS C N   1 
ATOM 8299  C CA  . LYS C 3 96  ? 107.945 86.995  116.017 1.00 500.00 ? 96  LYS C CA  1 
ATOM 8300  C C   . LYS C 3 96  ? 109.070 87.091  114.981 1.00 500.00 ? 96  LYS C C   1 
ATOM 8301  O O   . LYS C 3 96  ? 109.034 86.439  113.927 1.00 500.00 ? 96  LYS C O   1 
ATOM 8302  C CB  . LYS C 3 96  ? 107.060 88.264  115.912 1.00 500.00 ? 96  LYS C CB  1 
ATOM 8303  C CG  . LYS C 3 96  ? 105.562 88.019  115.718 1.00 500.00 ? 96  LYS C CG  1 
ATOM 8304  C CD  . LYS C 3 96  ? 104.850 89.256  115.154 1.00 500.00 ? 96  LYS C CD  1 
ATOM 8305  C CE  . LYS C 3 96  ? 103.357 89.020  114.938 1.00 474.50 ? 96  LYS C CE  1 
ATOM 8306  N NZ  . LYS C 3 96  ? 102.721 90.054  114.073 1.00 392.55 ? 96  LYS C NZ  1 
ATOM 8307  N N   . ALA C 3 97  ? 110.046 87.916  115.326 1.00 500.00 ? 97  ALA C N   1 
ATOM 8308  C CA  . ALA C 3 97  ? 111.221 88.157  114.480 1.00 500.00 ? 97  ALA C CA  1 
ATOM 8309  C C   . ALA C 3 97  ? 111.950 86.843  114.199 1.00 500.00 ? 97  ALA C C   1 
ATOM 8310  O O   . ALA C 3 97  ? 112.334 86.596  113.071 1.00 500.00 ? 97  ALA C O   1 
ATOM 8311  C CB  . ALA C 3 97  ? 112.168 89.161  115.126 1.00 500.00 ? 97  ALA C CB  1 
ATOM 8312  N N   . ASP C 3 98  ? 112.133 86.081  115.270 1.00 445.47 ? 98  ASP C N   1 
ATOM 8313  C CA  . ASP C 3 98  ? 112.811 84.790  115.226 1.00 448.26 ? 98  ASP C CA  1 
ATOM 8314  C C   . ASP C 3 98  ? 112.605 83.836  114.083 1.00 440.23 ? 98  ASP C C   1 
ATOM 8315  O O   . ASP C 3 98  ? 113.614 83.484  113.469 1.00 376.44 ? 98  ASP C O   1 
ATOM 8316  C CB  . ASP C 3 98  ? 112.589 84.010  116.533 1.00 500.00 ? 98  ASP C CB  1 
ATOM 8317  C CG  . ASP C 3 98  ? 113.470 82.769  116.637 1.00 500.00 ? 98  ASP C CG  1 
ATOM 8318  O OD1 . ASP C 3 98  ? 114.677 82.845  116.305 1.00 500.00 ? 98  ASP C OD1 1 
ATOM 8319  O OD2 . ASP C 3 98  ? 112.949 81.708  117.042 1.00 500.00 ? 98  ASP C OD2 1 
ATOM 8320  N N   . GLU C 3 99  ? 111.361 83.424  113.822 1.00 500.00 ? 99  GLU C N   1 
ATOM 8321  C CA  . GLU C 3 99  ? 111.059 82.483  112.749 1.00 500.00 ? 99  GLU C CA  1 
ATOM 8322  C C   . GLU C 3 99  ? 111.544 83.031  111.403 1.00 500.00 ? 99  GLU C C   1 
ATOM 8323  O O   . GLU C 3 99  ? 112.189 82.323  110.614 1.00 500.00 ? 99  GLU C O   1 
ATOM 8324  C CB  . GLU C 3 99  ? 109.545 82.112  112.693 1.00 500.00 ? 99  GLU C CB  1 
ATOM 8325  C CG  . GLU C 3 99  ? 108.547 83.216  112.289 1.00 500.00 ? 99  GLU C CG  1 
ATOM 8326  C CD  . GLU C 3 99  ? 107.107 82.732  112.093 1.00 500.00 ? 99  GLU C CD  1 
ATOM 8327  O OE1 . GLU C 3 99  ? 106.900 81.612  111.575 1.00 500.00 ? 99  GLU C OE1 1 
ATOM 8328  O OE2 . GLU C 3 99  ? 106.172 83.489  112.443 1.00 500.00 ? 99  GLU C OE2 1 
ATOM 8329  N N   . GLY C 3 100 ? 111.218 84.299  111.191 1.00 500.00 ? 100 GLY C N   1 
ATOM 8330  C CA  . GLY C 3 100 ? 111.591 85.019  109.969 1.00 500.00 ? 100 GLY C CA  1 
ATOM 8331  C C   . GLY C 3 100 ? 113.100 85.014  109.790 1.00 495.81 ? 100 GLY C C   1 
ATOM 8332  O O   . GLY C 3 100 ? 113.616 84.740  108.700 1.00 431.73 ? 100 GLY C O   1 
ATOM 8333  N N   . LEU C 3 101 ? 113.778 85.322  110.889 1.00 500.00 ? 101 LEU C N   1 
ATOM 8334  C CA  . LEU C 3 101 ? 115.246 85.378  110.935 1.00 500.00 ? 101 LEU C CA  1 
ATOM 8335  C C   . LEU C 3 101 ? 115.984 84.059  110.659 1.00 500.00 ? 101 LEU C C   1 
ATOM 8336  O O   . LEU C 3 101 ? 116.767 83.970  109.703 1.00 457.25 ? 101 LEU C O   1 
ATOM 8337  C CB  . LEU C 3 101 ? 115.732 85.972  112.261 1.00 500.00 ? 101 LEU C CB  1 
ATOM 8338  C CG  . LEU C 3 101 ? 115.479 87.477  112.393 1.00 500.00 ? 101 LEU C CG  1 
ATOM 8339  C CD1 . LEU C 3 101 ? 115.556 87.913  113.850 1.00 500.00 ? 101 LEU C CD1 1 
ATOM 8340  C CD2 . LEU C 3 101 ? 116.443 88.283  111.526 1.00 500.00 ? 101 LEU C CD2 1 
ATOM 8341  N N   . ALA C 3 102 ? 115.737 83.060  111.505 1.00 500.00 ? 102 ALA C N   1 
ATOM 8342  C CA  . ALA C 3 102 ? 116.487 81.785  111.505 1.00 500.00 ? 102 ALA C CA  1 
ATOM 8343  C C   . ALA C 3 102 ? 116.391 80.991  110.197 1.00 500.00 ? 102 ALA C C   1 
ATOM 8344  O O   . ALA C 3 102 ? 117.389 80.446  109.714 1.00 500.00 ? 102 ALA C O   1 
ATOM 8345  C CB  . ALA C 3 102 ? 116.028 80.911  112.670 1.00 500.00 ? 102 ALA C CB  1 
ATOM 8346  N N   . SER C 3 103 ? 115.180 80.926  109.646 1.00 500.00 ? 103 SER C N   1 
ATOM 8347  C CA  . SER C 3 103 ? 114.908 80.222  108.389 1.00 500.00 ? 103 SER C CA  1 
ATOM 8348  C C   . SER C 3 103 ? 115.642 80.818  107.175 1.00 500.00 ? 103 SER C C   1 
ATOM 8349  O O   . SER C 3 103 ? 116.055 80.079  106.278 1.00 500.00 ? 103 SER C O   1 
ATOM 8350  C CB  . SER C 3 103 ? 113.391 80.212  108.127 1.00 500.00 ? 103 SER C CB  1 
ATOM 8351  O OG  . SER C 3 103 ? 113.062 79.516  106.936 1.00 500.00 ? 103 SER C OG  1 
ATOM 8352  N N   . LEU C 3 104 ? 115.813 82.141  107.165 1.00 500.00 ? 104 LEU C N   1 
ATOM 8353  C CA  . LEU C 3 104 ? 116.222 82.878  105.957 1.00 500.00 ? 104 LEU C CA  1 
ATOM 8354  C C   . LEU C 3 104 ? 117.679 82.638  105.515 1.00 500.00 ? 104 LEU C C   1 
ATOM 8355  O O   . LEU C 3 104 ? 117.918 81.855  104.589 1.00 500.00 ? 104 LEU C O   1 
ATOM 8356  C CB  . LEU C 3 104 ? 115.915 84.390  106.110 1.00 500.00 ? 104 LEU C CB  1 
ATOM 8357  C CG  . LEU C 3 104 ? 114.532 84.925  105.674 1.00 500.00 ? 104 LEU C CG  1 
ATOM 8358  C CD1 . LEU C 3 104 ? 114.580 85.487  104.255 1.00 500.00 ? 104 LEU C CD1 1 
ATOM 8359  C CD2 . LEU C 3 104 ? 113.396 83.907  105.787 1.00 500.00 ? 104 LEU C CD2 1 
ATOM 8360  N N   . SER C 3 105 ? 118.635 83.300  106.172 1.00 500.00 ? 105 SER C N   1 
ATOM 8361  C CA  . SER C 3 105 ? 120.031 83.352  105.697 1.00 500.00 ? 105 SER C CA  1 
ATOM 8362  C C   . SER C 3 105 ? 120.930 82.200  106.201 1.00 500.00 ? 105 SER C C   1 
ATOM 8363  O O   . SER C 3 105 ? 121.843 81.774  105.482 1.00 500.00 ? 105 SER C O   1 
ATOM 8364  C CB  . SER C 3 105 ? 120.653 84.708  106.062 1.00 500.00 ? 105 SER C CB  1 
ATOM 8365  O OG  . SER C 3 105 ? 121.840 84.945  105.327 1.00 500.00 ? 105 SER C OG  1 
ATOM 8366  N N   . GLU C 3 106 ? 120.670 81.705  107.419 1.00 500.00 ? 106 GLU C N   1 
ATOM 8367  C CA  . GLU C 3 106 ? 121.501 80.667  108.076 1.00 500.00 ? 106 GLU C CA  1 
ATOM 8368  C C   . GLU C 3 106 ? 121.018 79.226  107.840 1.00 500.00 ? 106 GLU C C   1 
ATOM 8369  O O   . GLU C 3 106 ? 121.846 78.323  107.684 1.00 500.00 ? 106 GLU C O   1 
ATOM 8370  C CB  . GLU C 3 106 ? 121.595 80.942  109.574 1.00 500.00 ? 106 GLU C CB  1 
ATOM 8371  N N   . ASP C 3 107 ? 119.694 79.028  107.839 1.00 500.00 ? 107 ASP C N   1 
ATOM 8372  C CA  . ASP C 3 107 ? 119.039 77.718  107.617 1.00 500.00 ? 107 ASP C CA  1 
ATOM 8373  C C   . ASP C 3 107 ? 119.211 76.769  108.806 1.00 500.00 ? 107 ASP C C   1 
ATOM 8374  O O   . ASP C 3 107 ? 120.325 76.333  109.104 1.00 500.00 ? 107 ASP C O   1 
ATOM 8375  C CB  . ASP C 3 107 ? 119.528 77.028  106.330 1.00 500.00 ? 107 ASP C CB  1 
ATOM 8376  C CG  . ASP C 3 107 ? 119.558 77.962  105.130 1.00 500.00 ? 107 ASP C CG  1 
ATOM 8377  O OD1 . ASP C 3 107 ? 118.622 78.779  104.980 1.00 500.00 ? 107 ASP C OD1 1 
ATOM 8378  O OD2 . ASP C 3 107 ? 120.522 77.876  104.336 1.00 500.00 ? 107 ASP C OD2 1 
ATOM 8379  N N   . GLY C 3 108 ? 118.101 76.452  109.475 1.00 500.00 ? 108 GLY C N   1 
ATOM 8380  C CA  . GLY C 3 108 ? 118.085 75.491  110.586 1.00 500.00 ? 108 GLY C CA  1 
ATOM 8381  C C   . GLY C 3 108 ? 118.129 76.143  111.956 1.00 500.00 ? 108 GLY C C   1 
ATOM 8382  O O   . GLY C 3 108 ? 117.112 76.215  112.650 1.00 500.00 ? 108 GLY C O   1 
ATOM 8383  N N   . ARG C 3 109 ? 119.316 76.610  112.340 1.00 500.00 ? 109 ARG C N   1 
ATOM 8384  C CA  . ARG C 3 109 ? 119.536 77.267  113.633 1.00 500.00 ? 109 ARG C CA  1 
ATOM 8385  C C   . ARG C 3 109 ? 119.457 78.792  113.491 1.00 500.00 ? 109 ARG C C   1 
ATOM 8386  O O   . ARG C 3 109 ? 119.753 79.346  112.425 1.00 452.90 ? 109 ARG C O   1 
ATOM 8387  C CB  . ARG C 3 109 ? 120.907 76.868  114.196 1.00 500.00 ? 109 ARG C CB  1 
ATOM 8388  C CG  . ARG C 3 109 ? 121.121 77.141  115.691 1.00 500.00 ? 109 ARG C CG  1 
ATOM 8389  C CD  . ARG C 3 109 ? 121.156 75.872  116.542 1.00 500.00 ? 109 ARG C CD  1 
ATOM 8390  N NE  . ARG C 3 109 ? 119.829 75.280  116.737 1.00 500.00 ? 109 ARG C NE  1 
ATOM 8391  C CZ  . ARG C 3 109 ? 118.919 75.685  117.631 1.00 500.00 ? 109 ARG C CZ  1 
ATOM 8392  N NH1 . ARG C 3 109 ? 119.151 76.720  118.447 1.00 500.00 ? 109 ARG C NH1 1 
ATOM 8393  N NH2 . ARG C 3 109 ? 117.748 75.049  117.704 1.00 500.00 ? 109 ARG C NH2 1 
ATOM 8394  N N   . SER C 3 110 ? 119.058 79.457  114.575 1.00 500.00 ? 110 SER C N   1 
ATOM 8395  C CA  . SER C 3 110 ? 119.043 80.917  114.645 1.00 491.24 ? 110 SER C CA  1 
ATOM 8396  C C   . SER C 3 110 ? 120.456 81.511  114.564 1.00 476.55 ? 110 SER C C   1 
ATOM 8397  O O   . SER C 3 110 ? 121.443 80.787  114.740 1.00 431.48 ? 110 SER C O   1 
ATOM 8398  C CB  . SER C 3 110 ? 118.362 81.382  115.942 1.00 471.13 ? 110 SER C CB  1 
ATOM 8399  O OG  . SER C 3 110 ? 119.083 80.946  117.085 1.00 448.60 ? 110 SER C OG  1 
ATOM 8400  N N   . PRO C 3 111 ? 120.556 82.831  114.291 1.00 476.37 ? 111 PRO C N   1 
ATOM 8401  C CA  . PRO C 3 111 ? 121.867 83.507  114.354 1.00 486.82 ? 111 PRO C CA  1 
ATOM 8402  C C   . PRO C 3 111 ? 122.373 83.917  115.759 1.00 461.40 ? 111 PRO C C   1 
ATOM 8403  O O   . PRO C 3 111 ? 123.472 84.476  115.859 1.00 411.00 ? 111 PRO C O   1 
ATOM 8404  C CB  . PRO C 3 111 ? 121.680 84.752  113.462 1.00 475.67 ? 111 PRO C CB  1 
ATOM 8405  C CG  . PRO C 3 111 ? 120.225 84.870  113.167 1.00 445.72 ? 111 PRO C CG  1 
ATOM 8406  C CD  . PRO C 3 111 ? 119.497 83.691  113.726 1.00 451.00 ? 111 PRO C CD  1 
ATOM 8407  N N   . ILE C 3 112 ? 121.605 83.642  116.821 1.00 445.03 ? 112 ILE C N   1 
ATOM 8408  C CA  . ILE C 3 112 ? 121.899 84.193  118.160 1.00 437.95 ? 112 ILE C CA  1 
ATOM 8409  C C   . ILE C 3 112 ? 121.532 83.348  119.402 1.00 441.82 ? 112 ILE C C   1 
ATOM 8410  O O   . ILE C 3 112 ? 122.263 83.393  120.389 1.00 366.75 ? 112 ILE C O   1 
ATOM 8411  C CB  . ILE C 3 112 ? 121.248 85.598  118.343 1.00 448.07 ? 112 ILE C CB  1 
ATOM 8412  C CG1 . ILE C 3 112 ? 119.752 85.592  117.948 1.00 421.20 ? 112 ILE C CG1 1 
ATOM 8413  C CG2 . ILE C 3 112 ? 122.057 86.684  117.631 1.00 459.86 ? 112 ILE C CG2 1 
ATOM 8414  C CD1 . ILE C 3 112 ? 119.396 85.783  116.484 1.00 365.31 ? 112 ILE C CD1 1 
ATOM 8415  N N   . SER C 3 113 ? 120.414 82.610  119.362 1.00 474.70 ? 113 SER C N   1 
ATOM 8416  C CA  . SER C 3 113 ? 119.812 81.924  120.536 1.00 493.70 ? 113 SER C CA  1 
ATOM 8417  C C   . SER C 3 113 ? 119.068 82.923  121.439 1.00 480.80 ? 113 SER C C   1 
ATOM 8418  O O   . SER C 3 113 ? 119.598 83.990  121.759 1.00 500.00 ? 113 SER C O   1 
ATOM 8419  C CB  . SER C 3 113 ? 120.825 81.085  121.339 1.00 492.75 ? 113 SER C CB  1 
ATOM 8420  O OG  . SER C 3 113 ? 121.439 81.829  122.379 1.00 499.48 ? 113 SER C OG  1 
ATOM 8421  N N   . ILE C 3 114 ? 117.854 82.557  121.856 1.00 412.80 ? 114 ILE C N   1 
ATOM 8422  C CA  . ILE C 3 114 ? 116.909 83.490  122.414 1.00 371.57 ? 114 ILE C CA  1 
ATOM 8423  C C   . ILE C 3 114 ? 117.253 83.924  123.805 1.00 394.71 ? 114 ILE C C   1 
ATOM 8424  O O   . ILE C 3 114 ? 116.928 85.067  124.123 1.00 338.12 ? 114 ILE C O   1 
ATOM 8425  C CB  . ILE C 3 114 ? 115.454 82.983  122.323 1.00 383.92 ? 114 ILE C CB  1 
ATOM 8426  C CG1 . ILE C 3 114 ? 114.473 84.164  122.407 1.00 422.34 ? 114 ILE C CG1 1 
ATOM 8427  C CG2 . ILE C 3 114 ? 115.164 81.938  123.397 1.00 429.66 ? 114 ILE C CG2 1 
ATOM 8428  C CD1 . ILE C 3 114 ? 113.087 83.861  121.873 1.00 445.41 ? 114 ILE C CD1 1 
ATOM 8429  N N   . ARG C 3 115 ? 117.966 83.093  124.572 1.00 448.12 ? 115 ARG C N   1 
ATOM 8430  C CA  . ARG C 3 115 ? 118.457 83.460  125.892 1.00 480.75 ? 115 ARG C CA  1 
ATOM 8431  C C   . ARG C 3 115 ? 119.335 84.713  125.801 1.00 453.40 ? 115 ARG C C   1 
ATOM 8432  O O   . ARG C 3 115 ? 119.187 85.662  126.587 1.00 469.32 ? 115 ARG C O   1 
ATOM 8433  C CB  . ARG C 3 115 ? 119.294 82.335  126.526 1.00 500.00 ? 115 ARG C CB  1 
ATOM 8434  C CG  . ARG C 3 115 ? 118.516 81.111  127.005 1.00 500.00 ? 115 ARG C CG  1 
ATOM 8435  C CD  . ARG C 3 115 ? 119.120 80.521  128.283 1.00 500.00 ? 115 ARG C CD  1 
ATOM 8436  N NE  . ARG C 3 115 ? 118.850 79.083  128.462 1.00 500.00 ? 115 ARG C NE  1 
ATOM 8437  C CZ  . ARG C 3 115 ? 119.714 78.075  128.249 1.00 500.00 ? 115 ARG C CZ  1 
ATOM 8438  N NH1 . ARG C 3 115 ? 120.967 78.288  127.830 1.00 500.00 ? 115 ARG C NH1 1 
ATOM 8439  N NH2 . ARG C 3 115 ? 119.319 76.817  128.464 1.00 500.00 ? 115 ARG C NH2 1 
ATOM 8440  N N   . GLN C 3 116 ? 120.237 84.667  124.823 1.00 422.59 ? 116 GLN C N   1 
ATOM 8441  C CA  . GLN C 3 116 ? 121.180 85.768  124.589 1.00 397.85 ? 116 GLN C CA  1 
ATOM 8442  C C   . GLN C 3 116 ? 120.417 87.054  124.282 1.00 393.61 ? 116 GLN C C   1 
ATOM 8443  O O   . GLN C 3 116 ? 120.742 88.118  124.830 1.00 415.10 ? 116 GLN C O   1 
ATOM 8444  C CB  . GLN C 3 116 ? 122.256 85.392  123.558 1.00 439.41 ? 116 GLN C CB  1 
ATOM 8445  C CG  . GLN C 3 116 ? 123.213 84.327  124.115 1.00 492.91 ? 116 GLN C CG  1 
ATOM 8446  C CD  . GLN C 3 116 ? 124.377 83.959  123.196 1.00 500.00 ? 116 GLN C CD  1 
ATOM 8447  O OE1 . GLN C 3 116 ? 124.485 84.454  122.073 1.00 500.00 ? 116 GLN C OE1 1 
ATOM 8448  N NE2 . GLN C 3 116 ? 125.258 83.077  123.678 1.00 447.89 ? 116 GLN C NE2 1 
ATOM 8449  N N   . MET C 3 117 ? 119.415 86.918  123.426 1.00 396.39 ? 117 MET C N   1 
ATOM 8450  C CA  . MET C 3 117 ? 118.556 88.034  123.022 1.00 390.82 ? 117 MET C CA  1 
ATOM 8451  C C   . MET C 3 117 ? 117.892 88.659  124.245 1.00 367.22 ? 117 MET C C   1 
ATOM 8452  O O   . MET C 3 117 ? 117.873 89.888  124.405 1.00 306.19 ? 117 MET C O   1 
ATOM 8453  C CB  . MET C 3 117 ? 117.478 87.592  122.022 1.00 421.05 ? 117 MET C CB  1 
ATOM 8454  C CG  . MET C 3 117 ? 118.004 87.239  120.637 1.00 448.13 ? 117 MET C CG  1 
ATOM 8455  S SD  . MET C 3 117 ? 116.698 86.946  119.410 1.00 477.10 ? 117 MET C SD  1 
ATOM 8456  C CE  . MET C 3 117 ? 116.633 85.158  119.278 1.00 439.91 ? 117 MET C CE  1 
ATOM 8457  N N   . ALA C 3 118 ? 117.363 87.783  125.081 1.00 390.86 ? 118 ALA C N   1 
ATOM 8458  C CA  . ALA C 3 118 ? 116.681 88.166  126.324 1.00 405.45 ? 118 ALA C CA  1 
ATOM 8459  C C   . ALA C 3 118 ? 117.618 88.980  127.206 1.00 382.20 ? 118 ALA C C   1 
ATOM 8460  O O   . ALA C 3 118 ? 117.249 90.034  127.740 1.00 261.65 ? 118 ALA C O   1 
ATOM 8461  C CB  . ALA C 3 118 ? 116.284 86.912  127.083 1.00 426.71 ? 118 ALA C CB  1 
ATOM 8462  N N   . TYR C 3 119 ? 118.828 88.453  127.340 1.00 383.29 ? 119 TYR C N   1 
ATOM 8463  C CA  . TYR C 3 119 ? 119.888 89.060  128.155 1.00 335.10 ? 119 TYR C CA  1 
ATOM 8464  C C   . TYR C 3 119 ? 120.168 90.477  127.651 1.00 328.41 ? 119 TYR C C   1 
ATOM 8465  O O   . TYR C 3 119 ? 120.259 91.430  128.444 1.00 337.38 ? 119 TYR C O   1 
ATOM 8466  C CB  . TYR C 3 119 ? 121.147 88.221  127.973 1.00 369.15 ? 119 TYR C CB  1 
ATOM 8467  C CG  . TYR C 3 119 ? 122.387 88.458  128.812 1.00 389.04 ? 119 TYR C CG  1 
ATOM 8468  C CD1 . TYR C 3 119 ? 123.106 89.664  128.777 1.00 302.96 ? 119 TYR C CD1 1 
ATOM 8469  C CD2 . TYR C 3 119 ? 122.932 87.386  129.549 1.00 456.83 ? 119 TYR C CD2 1 
ATOM 8470  C CE1 . TYR C 3 119 ? 124.295 89.795  129.516 1.00 393.25 ? 119 TYR C CE1 1 
ATOM 8471  C CE2 . TYR C 3 119 ? 124.101 87.507  130.285 1.00 433.19 ? 119 TYR C CE2 1 
ATOM 8472  C CZ  . TYR C 3 119 ? 124.790 88.699  130.278 1.00 410.98 ? 119 TYR C CZ  1 
ATOM 8473  O OH  . TYR C 3 119 ? 125.951 88.739  131.040 1.00 319.67 ? 119 TYR C OH  1 
ATOM 8474  N N   . VAL C 3 120 ? 120.304 90.572  126.330 1.00 348.50 ? 120 VAL C N   1 
ATOM 8475  C CA  . VAL C 3 120 ? 120.615 91.877  125.727 1.00 364.23 ? 120 VAL C CA  1 
ATOM 8476  C C   . VAL C 3 120 ? 119.491 92.859  125.968 1.00 338.67 ? 120 VAL C C   1 
ATOM 8477  O O   . VAL C 3 120 ? 119.773 94.017  126.296 1.00 304.34 ? 120 VAL C O   1 
ATOM 8478  C CB  . VAL C 3 120 ? 121.104 91.902  124.243 1.00 410.31 ? 120 VAL C CB  1 
ATOM 8479  C CG1 . VAL C 3 120 ? 121.893 90.652  123.861 1.00 453.58 ? 120 VAL C CG1 1 
ATOM 8480  C CG2 . VAL C 3 120 ? 119.987 92.229  123.251 1.00 405.90 ? 120 VAL C CG2 1 
ATOM 8481  N N   . SER C 3 121 ? 118.257 92.383  125.854 1.00 334.45 ? 121 SER C N   1 
ATOM 8482  C CA  . SER C 3 121 ? 117.066 93.196  126.112 1.00 348.02 ? 121 SER C CA  1 
ATOM 8483  C C   . SER C 3 121 ? 117.104 93.750  127.533 1.00 369.43 ? 121 SER C C   1 
ATOM 8484  O O   . SER C 3 121 ? 116.858 94.945  127.766 1.00 313.33 ? 121 SER C O   1 
ATOM 8485  C CB  . SER C 3 121 ? 115.804 92.358  125.965 1.00 410.86 ? 121 SER C CB  1 
ATOM 8486  O OG  . SER C 3 121 ? 114.650 93.098  126.339 1.00 428.76 ? 121 SER C OG  1 
ATOM 8487  N N   . GLY C 3 122 ? 117.416 92.848  128.456 1.00 408.66 ? 122 GLY C N   1 
ATOM 8488  C CA  . GLY C 3 122 ? 117.508 93.172  129.884 1.00 429.44 ? 122 GLY C CA  1 
ATOM 8489  C C   . GLY C 3 122 ? 118.529 94.275  130.110 1.00 424.96 ? 122 GLY C C   1 
ATOM 8490  O O   . GLY C 3 122 ? 118.273 95.250  130.833 1.00 421.09 ? 122 GLY C O   1 
ATOM 8491  N N   . LEU C 3 123 ? 119.678 94.086  129.472 1.00 399.09 ? 123 LEU C N   1 
ATOM 8492  C CA  . LEU C 3 123 ? 120.802 95.031  129.547 1.00 368.79 ? 123 LEU C CA  1 
ATOM 8493  C C   . LEU C 3 123 ? 120.358 96.408  129.086 1.00 321.22 ? 123 LEU C C   1 
ATOM 8494  O O   . LEU C 3 123 ? 120.640 97.423  129.737 1.00 352.03 ? 123 LEU C O   1 
ATOM 8495  C CB  . LEU C 3 123 ? 121.952 94.552  128.628 1.00 384.20 ? 123 LEU C CB  1 
ATOM 8496  C CG  . LEU C 3 123 ? 123.387 94.480  129.167 1.00 419.78 ? 123 LEU C CG  1 
ATOM 8497  C CD1 . LEU C 3 123 ? 124.353 93.992  128.084 1.00 415.25 ? 123 LEU C CD1 1 
ATOM 8498  C CD2 . LEU C 3 123 ? 123.848 95.809  129.746 1.00 435.37 ? 123 LEU C CD2 1 
ATOM 8499  N N   . SER C 3 124 ? 119.673 96.407  127.953 1.00 278.46 ? 124 SER C N   1 
ATOM 8500  C CA  . SER C 3 124 ? 119.142 97.628  127.330 1.00 324.93 ? 124 SER C CA  1 
ATOM 8501  C C   . SER C 3 124 ? 118.238 98.362  128.298 1.00 320.29 ? 124 SER C C   1 
ATOM 8502  O O   . SER C 3 124 ? 118.350 99.589  128.480 1.00 361.03 ? 124 SER C O   1 
ATOM 8503  C CB  . SER C 3 124 ? 118.212 97.262  126.187 1.00 349.24 ? 124 SER C CB  1 
ATOM 8504  O OG  . SER C 3 124 ? 116.922 97.851  126.371 1.00 262.22 ? 124 SER C OG  1 
ATOM 8505  N N   . PHE C 3 125 ? 117.343 97.581  128.894 1.00 297.02 ? 125 PHE C N   1 
ATOM 8506  C CA  . PHE C 3 125 ? 116.362 98.105  129.847 1.00 373.45 ? 125 PHE C CA  1 
ATOM 8507  C C   . PHE C 3 125 ? 117.079 98.768  131.026 1.00 356.98 ? 125 PHE C C   1 
ATOM 8508  O O   . PHE C 3 125 ? 116.714 99.884  131.437 1.00 346.64 ? 125 PHE C O   1 
ATOM 8509  C CB  . PHE C 3 125 ? 115.245 97.109  130.185 1.00 411.83 ? 125 PHE C CB  1 
ATOM 8510  C CG  . PHE C 3 125 ? 113.935 97.420  129.481 1.00 428.46 ? 125 PHE C CG  1 
ATOM 8511  C CD1 . PHE C 3 125 ? 113.795 97.232  128.100 1.00 397.49 ? 125 PHE C CD1 1 
ATOM 8512  C CD2 . PHE C 3 125 ? 112.850 97.938  130.190 1.00 428.77 ? 125 PHE C CD2 1 
ATOM 8513  C CE1 . PHE C 3 125 ? 112.593 97.533  127.451 1.00 342.84 ? 125 PHE C CE1 1 
ATOM 8514  C CE2 . PHE C 3 125 ? 111.652 98.240  129.542 1.00 420.84 ? 125 PHE C CE2 1 
ATOM 8515  C CZ  . PHE C 3 125 ? 111.526 98.043  128.170 1.00 373.32 ? 125 PHE C CZ  1 
ATOM 8516  N N   . GLY C 3 126 ? 118.096 98.074  131.519 1.00 353.77 ? 126 GLY C N   1 
ATOM 8517  C CA  . GLY C 3 126 ? 118.900 98.540  132.642 1.00 413.03 ? 126 GLY C CA  1 
ATOM 8518  C C   . GLY C 3 126 ? 119.544 99.883  132.303 1.00 391.88 ? 126 GLY C C   1 
ATOM 8519  O O   . GLY C 3 126 ? 119.503 100.851 133.101 1.00 370.90 ? 126 GLY C O   1 
ATOM 8520  N N   . ILE C 3 127 ? 120.105 99.933  131.103 1.00 358.58 ? 127 ILE C N   1 
ATOM 8521  C CA  . ILE C 3 127 ? 121.006 101.013 130.697 1.00 352.41 ? 127 ILE C CA  1 
ATOM 8522  C C   . ILE C 3 127 ? 120.185 102.259 130.594 1.00 320.68 ? 127 ILE C C   1 
ATOM 8523  O O   . ILE C 3 127 ? 120.663 103.300 131.055 1.00 354.37 ? 127 ILE C O   1 
ATOM 8524  C CB  . ILE C 3 127 ? 121.761 100.749 129.349 1.00 402.59 ? 127 ILE C CB  1 
ATOM 8525  C CG1 . ILE C 3 127 ? 123.237 100.430 129.624 1.00 399.24 ? 127 ILE C CG1 1 
ATOM 8526  C CG2 . ILE C 3 127 ? 121.696 101.931 128.362 1.00 406.97 ? 127 ILE C CG2 1 
ATOM 8527  C CD1 . ILE C 3 127 ? 123.470 98.988  129.981 1.00 389.19 ? 127 ILE C CD1 1 
ATOM 8528  N N   . ILE C 3 128 ? 118.990 102.151 129.998 1.00 284.27 ? 128 ILE C N   1 
ATOM 8529  C CA  . ILE C 3 128 ? 118.228 103.356 129.611 1.00 341.81 ? 128 ILE C CA  1 
ATOM 8530  C C   . ILE C 3 128 ? 117.571 103.987 130.843 1.00 357.12 ? 128 ILE C C   1 
ATOM 8531  O O   . ILE C 3 128 ? 117.705 105.203 131.081 1.00 315.64 ? 128 ILE C O   1 
ATOM 8532  C CB  . ILE C 3 128 ? 117.323 103.099 128.390 1.00 344.99 ? 128 ILE C CB  1 
ATOM 8533  C CG1 . ILE C 3 128 ? 116.910 104.432 127.753 1.00 389.72 ? 128 ILE C CG1 1 
ATOM 8534  C CG2 . ILE C 3 128 ? 116.126 102.230 128.733 1.00 339.38 ? 128 ILE C CG2 1 
ATOM 8535  C CD1 . ILE C 3 128 ? 118.062 105.235 127.181 1.00 377.69 ? 128 ILE C CD1 1 
ATOM 8536  N N   . SER C 3 129 ? 116.946 103.130 131.632 1.00 343.75 ? 129 SER C N   1 
ATOM 8537  C CA  . SER C 3 129 ? 116.326 103.511 132.902 1.00 367.45 ? 129 SER C CA  1 
ATOM 8538  C C   . SER C 3 129 ? 117.363 104.161 133.822 1.00 374.32 ? 129 SER C C   1 
ATOM 8539  O O   . SER C 3 129 ? 117.144 105.231 134.420 1.00 376.92 ? 129 SER C O   1 
ATOM 8540  C CB  . SER C 3 129 ? 115.792 102.242 133.563 1.00 408.50 ? 129 SER C CB  1 
ATOM 8541  O OG  . SER C 3 129 ? 115.345 102.485 134.880 1.00 496.82 ? 129 SER C OG  1 
ATOM 8542  N N   . GLY C 3 130 ? 118.488 103.462 133.907 1.00 360.49 ? 130 GLY C N   1 
ATOM 8543  C CA  . GLY C 3 130 ? 119.626 103.889 134.742 1.00 378.22 ? 130 GLY C CA  1 
ATOM 8544  C C   . GLY C 3 130 ? 120.100 105.261 134.305 1.00 355.58 ? 130 GLY C C   1 
ATOM 8545  O O   . GLY C 3 130 ? 120.338 106.139 135.145 1.00 286.52 ? 130 GLY C O   1 
ATOM 8546  N N   . VAL C 3 131 ? 120.233 105.417 132.998 1.00 338.82 ? 131 VAL C N   1 
ATOM 8547  C CA  . VAL C 3 131 ? 120.678 106.667 132.373 1.00 335.52 ? 131 VAL C CA  1 
ATOM 8548  C C   . VAL C 3 131 ? 119.748 107.808 132.779 1.00 305.73 ? 131 VAL C C   1 
ATOM 8549  O O   . VAL C 3 131 ? 120.206 108.898 133.174 1.00 357.51 ? 131 VAL C O   1 
ATOM 8550  C CB  . VAL C 3 131 ? 120.734 106.526 130.823 1.00 347.56 ? 131 VAL C CB  1 
ATOM 8551  C CG1 . VAL C 3 131 ? 120.272 107.789 130.096 1.00 377.98 ? 131 VAL C CG1 1 
ATOM 8552  C CG2 . VAL C 3 131 ? 122.141 106.123 130.369 1.00 345.80 ? 131 VAL C CG2 1 
ATOM 8553  N N   . PHE C 3 132 ? 118.459 107.521 132.664 1.00 297.36 ? 132 PHE C N   1 
ATOM 8554  C CA  . PHE C 3 132 ? 117.409 108.489 132.994 1.00 360.99 ? 132 PHE C CA  1 
ATOM 8555  C C   . PHE C 3 132 ? 117.533 108.931 134.447 1.00 349.67 ? 132 PHE C C   1 
ATOM 8556  O O   . PHE C 3 132 ? 117.467 110.136 134.752 1.00 255.75 ? 132 PHE C O   1 
ATOM 8557  C CB  . PHE C 3 132 ? 116.018 108.038 132.582 1.00 386.82 ? 132 PHE C CB  1 
ATOM 8558  C CG  . PHE C 3 132 ? 115.540 108.741 131.356 1.00 374.56 ? 132 PHE C CG  1 
ATOM 8559  C CD1 . PHE C 3 132 ? 116.055 108.394 130.107 1.00 388.03 ? 132 PHE C CD1 1 
ATOM 8560  C CD2 . PHE C 3 132 ? 114.648 109.811 131.452 1.00 289.70 ? 132 PHE C CD2 1 
ATOM 8561  C CE1 . PHE C 3 132 ? 115.645 109.067 128.967 1.00 409.31 ? 132 PHE C CE1 1 
ATOM 8562  C CE2 . PHE C 3 132 ? 114.231 110.483 130.322 1.00 356.29 ? 132 PHE C CE2 1 
ATOM 8563  C CZ  . PHE C 3 132 ? 114.730 110.112 129.077 1.00 426.03 ? 132 PHE C CZ  1 
ATOM 8564  N N   . SER C 3 133 ? 117.730 107.939 135.308 1.00 345.03 ? 133 SER C N   1 
ATOM 8565  C CA  . SER C 3 133 ? 117.889 108.160 136.747 1.00 357.73 ? 133 SER C CA  1 
ATOM 8566  C C   . SER C 3 133 ? 119.053 109.088 137.019 1.00 328.55 ? 133 SER C C   1 
ATOM 8567  O O   . SER C 3 133 ? 118.943 110.048 137.805 1.00 386.82 ? 133 SER C O   1 
ATOM 8568  C CB  . SER C 3 133 ? 118.166 106.860 137.493 1.00 361.90 ? 133 SER C CB  1 
ATOM 8569  O OG  . SER C 3 133 ? 119.173 107.072 138.476 1.00 342.99 ? 133 SER C OG  1 
ATOM 8570  N N   . VAL C 3 134 ? 120.153 108.781 136.347 1.00 273.40 ? 134 VAL C N   1 
ATOM 8571  C CA  . VAL C 3 134 ? 121.445 109.148 136.825 1.00 352.26 ? 134 VAL C CA  1 
ATOM 8572  C C   . VAL C 3 134 ? 122.127 110.256 136.057 1.00 352.35 ? 134 VAL C C   1 
ATOM 8573  O O   . VAL C 3 134 ? 122.700 111.143 136.678 1.00 374.27 ? 134 VAL C O   1 
ATOM 8574  C CB  . VAL C 3 134 ? 122.392 107.925 136.953 1.00 384.79 ? 134 VAL C CB  1 
ATOM 8575  C CG1 . VAL C 3 134 ? 123.165 107.631 135.664 1.00 346.70 ? 134 VAL C CG1 1 
ATOM 8576  C CG2 . VAL C 3 134 ? 123.359 108.133 138.114 1.00 409.62 ? 134 VAL C CG2 1 
ATOM 8577  N N   . ILE C 3 135 ? 122.077 110.232 134.729 1.00 336.70 ? 135 ILE C N   1 
ATOM 8578  C CA  . ILE C 3 135 ? 122.810 111.237 133.965 1.00 368.87 ? 135 ILE C CA  1 
ATOM 8579  C C   . ILE C 3 135 ? 122.641 112.611 134.580 1.00 350.77 ? 135 ILE C C   1 
ATOM 8580  O O   . ILE C 3 135 ? 123.644 113.348 134.667 1.00 344.78 ? 135 ILE C O   1 
ATOM 8581  C CB  . ILE C 3 135 ? 122.483 111.210 132.441 1.00 436.96 ? 135 ILE C CB  1 
ATOM 8582  C CG1 . ILE C 3 135 ? 123.553 111.953 131.614 1.00 463.56 ? 135 ILE C CG1 1 
ATOM 8583  C CG2 . ILE C 3 135 ? 121.106 111.776 132.151 1.00 452.00 ? 135 ILE C CG2 1 
ATOM 8584  C CD1 . ILE C 3 135 ? 124.817 111.156 131.354 1.00 459.61 ? 135 ILE C CD1 1 
ATOM 8585  N N   . ASN C 3 136 ? 121.425 112.915 135.035 1.00 348.36 ? 136 ASN C N   1 
ATOM 8586  C CA  . ASN C 3 136 ? 121.154 114.166 135.749 1.00 362.43 ? 136 ASN C CA  1 
ATOM 8587  C C   . ASN C 3 136 ? 122.065 114.354 136.950 1.00 356.35 ? 136 ASN C C   1 
ATOM 8588  O O   . ASN C 3 136 ? 122.813 115.338 137.009 1.00 348.82 ? 136 ASN C O   1 
ATOM 8589  C CB  . ASN C 3 136 ? 119.685 114.236 136.193 1.00 383.72 ? 136 ASN C CB  1 
ATOM 8590  C CG  . ASN C 3 136 ? 118.749 114.681 135.080 1.00 440.59 ? 136 ASN C CG  1 
ATOM 8591  O OD1 . ASN C 3 136 ? 117.552 114.857 135.307 1.00 485.66 ? 136 ASN C OD1 1 
ATOM 8592  N ND2 . ASN C 3 136 ? 119.287 114.881 133.875 1.00 434.44 ? 136 ASN C ND2 1 
ATOM 8593  N N   . ILE C 3 137 ? 121.919 113.465 137.929 1.00 328.90 ? 137 ILE C N   1 
ATOM 8594  C CA  . ILE C 3 137 ? 122.767 113.542 139.134 1.00 339.45 ? 137 ILE C CA  1 
ATOM 8595  C C   . ILE C 3 137 ? 124.248 113.476 138.806 1.00 320.62 ? 137 ILE C C   1 
ATOM 8596  O O   . ILE C 3 137 ? 125.061 114.120 139.493 1.00 324.57 ? 137 ILE C O   1 
ATOM 8597  C CB  . ILE C 3 137 ? 122.367 112.530 140.231 1.00 337.81 ? 137 ILE C CB  1 
ATOM 8598  C CG1 . ILE C 3 137 ? 122.851 111.104 139.924 1.00 386.73 ? 137 ILE C CG1 1 
ATOM 8599  C CG2 . ILE C 3 137 ? 120.857 112.587 140.458 1.00 394.69 ? 137 ILE C CG2 1 
ATOM 8600  C CD1 . ILE C 3 137 ? 124.202 110.751 140.513 1.00 406.16 ? 137 ILE C CD1 1 
ATOM 8601  N N   . LEU C 3 138 ? 124.579 112.719 137.753 1.00 324.46 ? 138 LEU C N   1 
ATOM 8602  C CA  . LEU C 3 138 ? 125.948 112.592 137.276 1.00 346.18 ? 138 LEU C CA  1 
ATOM 8603  C C   . LEU C 3 138 ? 126.521 113.965 136.924 1.00 341.26 ? 138 LEU C C   1 
ATOM 8604  O O   . LEU C 3 138 ? 127.650 114.294 137.297 1.00 340.15 ? 138 LEU C O   1 
ATOM 8605  C CB  . LEU C 3 138 ? 126.048 111.593 136.112 1.00 393.35 ? 138 LEU C CB  1 
ATOM 8606  C CG  . LEU C 3 138 ? 126.993 110.401 136.334 1.00 419.70 ? 138 LEU C CG  1 
ATOM 8607  C CD1 . LEU C 3 138 ? 126.516 109.454 137.435 1.00 362.60 ? 138 LEU C CD1 1 
ATOM 8608  C CD2 . LEU C 3 138 ? 127.166 109.645 135.021 1.00 473.68 ? 138 LEU C CD2 1 
ATOM 8609  N N   . ALA C 3 139 ? 125.697 114.735 136.205 1.00 348.08 ? 139 ALA C N   1 
ATOM 8610  C CA  . ALA C 3 139 ? 126.061 116.081 135.769 1.00 412.19 ? 139 ALA C CA  1 
ATOM 8611  C C   . ALA C 3 139 ? 126.396 116.954 136.982 1.00 390.08 ? 139 ALA C C   1 
ATOM 8612  O O   . ALA C 3 139 ? 127.414 117.667 136.998 1.00 396.64 ? 139 ALA C O   1 
ATOM 8613  C CB  . ALA C 3 139 ? 124.931 116.720 134.971 1.00 432.39 ? 139 ALA C CB  1 
ATOM 8614  N N   . ASP C 3 140 ? 125.518 116.865 137.971 1.00 330.91 ? 140 ASP C N   1 
ATOM 8615  C CA  . ASP C 3 140 ? 125.663 117.625 139.218 1.00 327.97 ? 140 ASP C CA  1 
ATOM 8616  C C   . ASP C 3 140 ? 126.978 117.280 139.900 1.00 301.15 ? 140 ASP C C   1 
ATOM 8617  O O   . ASP C 3 140 ? 127.716 118.174 140.340 1.00 318.16 ? 140 ASP C O   1 
ATOM 8618  C CB  . ASP C 3 140 ? 124.446 117.486 140.110 1.00 317.42 ? 140 ASP C CB  1 
ATOM 8619  C CG  . ASP C 3 140 ? 123.250 118.212 139.534 1.00 392.63 ? 140 ASP C CG  1 
ATOM 8620  O OD1 . ASP C 3 140 ? 122.905 117.947 138.362 1.00 427.79 ? 140 ASP C OD1 1 
ATOM 8621  O OD2 . ASP C 3 140 ? 122.679 119.071 140.231 1.00 396.15 ? 140 ASP C OD2 1 
ATOM 8622  N N   . ALA C 3 141 ? 127.251 115.984 139.954 1.00 304.37 ? 141 ALA C N   1 
ATOM 8623  C CA  . ALA C 3 141 ? 128.472 115.448 140.555 1.00 346.47 ? 141 ALA C CA  1 
ATOM 8624  C C   . ALA C 3 141 ? 129.700 116.032 139.870 1.00 350.93 ? 141 ALA C C   1 
ATOM 8625  O O   . ALA C 3 141 ? 130.714 116.118 140.522 1.00 358.97 ? 141 ALA C O   1 
ATOM 8626  C CB  . ALA C 3 141 ? 128.500 113.926 140.510 1.00 358.18 ? 141 ALA C CB  1 
ATOM 8627  N N   . LEU C 3 142 ? 129.630 116.436 138.595 1.00 343.09 ? 142 LEU C N   1 
ATOM 8628  C CA  . LEU C 3 142 ? 130.721 117.221 137.987 1.00 375.72 ? 142 LEU C CA  1 
ATOM 8629  C C   . LEU C 3 142 ? 131.109 118.357 138.911 1.00 393.43 ? 142 LEU C C   1 
ATOM 8630  O O   . LEU C 3 142 ? 132.286 118.520 139.237 1.00 421.42 ? 142 LEU C O   1 
ATOM 8631  C CB  . LEU C 3 142 ? 130.337 117.862 136.645 1.00 428.34 ? 142 LEU C CB  1 
ATOM 8632  C CG  . LEU C 3 142 ? 130.002 117.011 135.419 1.00 500.00 ? 142 LEU C CG  1 
ATOM 8633  C CD1 . LEU C 3 142 ? 129.323 117.853 134.342 1.00 500.00 ? 142 LEU C CD1 1 
ATOM 8634  C CD2 . LEU C 3 142 ? 131.267 116.365 134.875 1.00 500.00 ? 142 LEU C CD2 1 
ATOM 8635  N N   . GLY C 3 143 ? 130.101 119.128 139.322 1.00 392.80 ? 143 GLY C N   1 
ATOM 8636  C CA  . GLY C 3 143 ? 130.288 120.354 140.090 1.00 417.80 ? 143 GLY C CA  1 
ATOM 8637  C C   . GLY C 3 143 ? 131.115 120.201 141.354 1.00 410.59 ? 143 GLY C C   1 
ATOM 8638  O O   . GLY C 3 143 ? 131.126 119.127 141.959 1.00 427.87 ? 143 GLY C O   1 
ATOM 8639  N N   . PRO C 3 144 ? 131.802 121.283 141.775 1.00 399.25 ? 144 PRO C N   1 
ATOM 8640  C CA  . PRO C 3 144 ? 132.685 121.226 142.950 1.00 395.97 ? 144 PRO C CA  1 
ATOM 8641  C C   . PRO C 3 144 ? 131.996 121.129 144.326 1.00 364.02 ? 144 PRO C C   1 
ATOM 8642  O O   . PRO C 3 144 ? 132.695 121.143 145.340 1.00 349.26 ? 144 PRO C O   1 
ATOM 8643  C CB  . PRO C 3 144 ? 133.488 122.526 142.838 1.00 403.39 ? 144 PRO C CB  1 
ATOM 8644  C CG  . PRO C 3 144 ? 132.571 123.454 142.123 1.00 420.84 ? 144 PRO C CG  1 
ATOM 8645  C CD  . PRO C 3 144 ? 131.868 122.600 141.115 1.00 388.71 ? 144 PRO C CD  1 
ATOM 8646  N N   . GLY C 3 145 ? 130.666 121.020 144.363 1.00 347.32 ? 145 GLY C N   1 
ATOM 8647  C CA  . GLY C 3 145 ? 129.931 120.802 145.606 1.00 360.02 ? 145 GLY C CA  1 
ATOM 8648  C C   . GLY C 3 145 ? 129.668 119.352 145.994 1.00 340.32 ? 145 GLY C C   1 
ATOM 8649  O O   . GLY C 3 145 ? 130.418 118.440 145.644 1.00 333.30 ? 145 GLY C O   1 
ATOM 8650  N N   . VAL C 3 146 ? 128.613 119.182 146.784 1.00 354.17 ? 146 VAL C N   1 
ATOM 8651  C CA  . VAL C 3 146 ? 128.020 117.890 147.148 1.00 363.77 ? 146 VAL C CA  1 
ATOM 8652  C C   . VAL C 3 146 ? 126.754 118.207 147.929 1.00 364.37 ? 146 VAL C C   1 
ATOM 8653  O O   . VAL C 3 146 ? 126.712 119.228 148.623 1.00 389.26 ? 146 VAL C O   1 
ATOM 8654  C CB  . VAL C 3 146 ? 128.945 117.017 148.033 1.00 379.83 ? 146 VAL C CB  1 
ATOM 8655  C CG1 . VAL C 3 146 ? 129.369 117.732 149.312 1.00 369.35 ? 146 VAL C CG1 1 
ATOM 8656  C CG2 . VAL C 3 146 ? 128.269 115.695 148.374 1.00 405.82 ? 146 VAL C CG2 1 
ATOM 8657  N N   . VAL C 3 147 ? 125.737 117.354 147.849 1.00 315.06 ? 147 VAL C N   1 
ATOM 8658  C CA  . VAL C 3 147 ? 124.534 117.618 148.621 1.00 342.27 ? 147 VAL C CA  1 
ATOM 8659  C C   . VAL C 3 147 ? 124.918 117.575 150.098 1.00 401.06 ? 147 VAL C C   1 
ATOM 8660  O O   . VAL C 3 147 ? 125.710 116.724 150.522 1.00 383.99 ? 147 VAL C O   1 
ATOM 8661  C CB  . VAL C 3 147 ? 123.407 116.621 148.337 1.00 387.74 ? 147 VAL C CB  1 
ATOM 8662  C CG1 . VAL C 3 147 ? 122.232 116.834 149.292 1.00 411.38 ? 147 VAL C CG1 1 
ATOM 8663  C CG2 . VAL C 3 147 ? 122.928 116.768 146.908 1.00 377.62 ? 147 VAL C CG2 1 
ATOM 8664  N N   . GLY C 3 148 ? 124.341 118.496 150.868 1.00 423.32 ? 148 GLY C N   1 
ATOM 8665  C CA  . GLY C 3 148 ? 124.744 118.709 152.258 1.00 424.44 ? 148 GLY C CA  1 
ATOM 8666  C C   . GLY C 3 148 ? 124.106 119.906 152.942 1.00 393.38 ? 148 GLY C C   1 
ATOM 8667  O O   . GLY C 3 148 ? 123.704 119.815 154.104 1.00 403.62 ? 148 GLY C O   1 
ATOM 8668  N N   . ILE C 3 149 ? 124.019 121.023 152.218 1.00 362.82 ? 149 ILE C N   1 
ATOM 8669  C CA  . ILE C 3 149 ? 123.512 122.303 152.743 1.00 351.35 ? 149 ILE C CA  1 
ATOM 8670  C C   . ILE C 3 149 ? 122.216 122.229 153.552 1.00 333.26 ? 149 ILE C C   1 
ATOM 8671  O O   . ILE C 3 149 ? 122.040 123.010 154.481 1.00 362.76 ? 149 ILE C O   1 
ATOM 8672  C CB  . ILE C 3 149 ? 123.337 123.337 151.596 1.00 385.79 ? 149 ILE C CB  1 
ATOM 8673  C CG1 . ILE C 3 149 ? 123.491 124.772 152.099 1.00 388.68 ? 149 ILE C CG1 1 
ATOM 8674  C CG2 . ILE C 3 149 ? 122.000 123.170 150.874 1.00 376.53 ? 149 ILE C CG2 1 
ATOM 8675  C CD1 . ILE C 3 149 ? 124.875 125.126 152.576 1.00 376.43 ? 149 ILE C CD1 1 
ATOM 8676  N N   . HIS C 3 150 ? 121.326 121.302 153.196 1.00 340.87 ? 150 HIS C N   1 
ATOM 8677  C CA  . HIS C 3 150 ? 120.092 121.061 153.957 1.00 398.57 ? 150 HIS C CA  1 
ATOM 8678  C C   . HIS C 3 150 ? 120.089 119.718 154.701 1.00 433.31 ? 150 HIS C C   1 
ATOM 8679  O O   . HIS C 3 150 ? 119.059 119.030 154.772 1.00 392.03 ? 150 HIS C O   1 
ATOM 8680  C CB  . HIS C 3 150 ? 118.897 121.174 153.022 1.00 389.73 ? 150 HIS C CB  1 
ATOM 8681  C CG  . HIS C 3 150 ? 118.788 122.511 152.371 1.00 386.46 ? 150 HIS C CG  1 
ATOM 8682  N ND1 . HIS C 3 150 ? 118.600 122.668 151.016 1.00 420.13 ? 150 HIS C ND1 1 
ATOM 8683  C CD2 . HIS C 3 150 ? 118.873 123.758 152.888 1.00 361.38 ? 150 HIS C CD2 1 
ATOM 8684  C CE1 . HIS C 3 150 ? 118.548 123.955 150.728 1.00 412.41 ? 150 HIS C CE1 1 
ATOM 8685  N NE2 . HIS C 3 150 ? 118.709 124.637 151.848 1.00 394.53 ? 150 HIS C NE2 1 
ATOM 8686  N N   . GLY C 3 151 ? 121.249 119.351 155.255 1.00 445.14 ? 151 GLY C N   1 
ATOM 8687  C CA  . GLY C 3 151 ? 121.398 118.140 156.063 1.00 444.64 ? 151 GLY C CA  1 
ATOM 8688  C C   . GLY C 3 151 ? 121.674 116.846 155.311 1.00 459.33 ? 151 GLY C C   1 
ATOM 8689  O O   . GLY C 3 151 ? 122.399 115.990 155.822 1.00 456.05 ? 151 GLY C O   1 
ATOM 8690  N N   . ASP C 3 152 ? 121.116 116.709 154.100 1.00 470.00 ? 152 ASP C N   1 
ATOM 8691  C CA  . ASP C 3 152 ? 121.083 115.431 153.359 1.00 435.65 ? 152 ASP C CA  1 
ATOM 8692  C C   . ASP C 3 152 ? 122.474 114.872 153.055 1.00 394.72 ? 152 ASP C C   1 
ATOM 8693  O O   . ASP C 3 152 ? 123.481 115.572 153.190 1.00 348.56 ? 152 ASP C O   1 
ATOM 8694  C CB  . ASP C 3 152 ? 120.241 115.563 152.076 1.00 403.92 ? 152 ASP C CB  1 
ATOM 8695  C CG  . ASP C 3 152 ? 118.749 115.752 152.373 1.00 425.93 ? 152 ASP C CG  1 
ATOM 8696  O OD1 . ASP C 3 152 ? 118.369 116.753 153.029 1.00 336.32 ? 152 ASP C OD1 1 
ATOM 8697  O OD2 . ASP C 3 152 ? 117.953 114.888 151.947 1.00 458.75 ? 152 ASP C OD2 1 
ATOM 8698  N N   . SER C 3 153 ? 122.514 113.603 152.658 1.00 398.30 ? 153 SER C N   1 
ATOM 8699  C CA  . SER C 3 153 ? 123.747 112.820 152.726 1.00 436.67 ? 153 SER C CA  1 
ATOM 8700  C C   . SER C 3 153 ? 124.895 113.382 151.875 1.00 409.81 ? 153 SER C C   1 
ATOM 8701  O O   . SER C 3 153 ? 124.675 113.788 150.732 1.00 346.54 ? 153 SER C O   1 
ATOM 8702  C CB  . SER C 3 153 ? 123.482 111.356 152.354 1.00 455.00 ? 153 SER C CB  1 
ATOM 8703  O OG  . SER C 3 153 ? 124.657 110.567 152.479 1.00 420.66 ? 153 SER C OG  1 
ATOM 8704  N N   . PRO C 3 154 ? 126.121 113.409 152.436 1.00 424.86 ? 154 PRO C N   1 
ATOM 8705  C CA  . PRO C 3 154 ? 127.297 113.741 151.638 1.00 418.75 ? 154 PRO C CA  1 
ATOM 8706  C C   . PRO C 3 154 ? 127.701 112.576 150.743 1.00 440.07 ? 154 PRO C C   1 
ATOM 8707  O O   . PRO C 3 154 ? 128.331 112.792 149.710 1.00 493.33 ? 154 PRO C O   1 
ATOM 8708  C CB  . PRO C 3 154 ? 128.370 113.991 152.690 1.00 452.33 ? 154 PRO C CB  1 
ATOM 8709  C CG  . PRO C 3 154 ? 127.993 113.083 153.810 1.00 462.67 ? 154 PRO C CG  1 
ATOM 8710  C CD  . PRO C 3 154 ? 126.492 113.057 153.822 1.00 448.06 ? 154 PRO C CD  1 
ATOM 8711  N N   . TYR C 3 155 ? 127.354 111.353 151.144 1.00 427.59 ? 155 TYR C N   1 
ATOM 8712  C CA  . TYR C 3 155 ? 127.501 110.194 150.278 1.00 425.45 ? 155 TYR C CA  1 
ATOM 8713  C C   . TYR C 3 155 ? 126.531 110.273 149.102 1.00 391.12 ? 155 TYR C C   1 
ATOM 8714  O O   . TYR C 3 155 ? 126.891 109.855 148.005 1.00 353.97 ? 155 TYR C O   1 
ATOM 8715  C CB  . TYR C 3 155 ? 127.264 108.894 151.053 1.00 459.22 ? 155 TYR C CB  1 
ATOM 8716  C CG  . TYR C 3 155 ? 128.252 108.646 152.174 1.00 470.99 ? 155 TYR C CG  1 
ATOM 8717  C CD1 . TYR C 3 155 ? 129.599 108.407 151.897 1.00 481.23 ? 155 TYR C CD1 1 
ATOM 8718  C CD2 . TYR C 3 155 ? 127.843 108.632 153.509 1.00 463.84 ? 155 TYR C CD2 1 
ATOM 8719  C CE1 . TYR C 3 155 ? 130.515 108.173 152.916 1.00 472.70 ? 155 TYR C CE1 1 
ATOM 8720  C CE2 . TYR C 3 155 ? 128.751 108.396 154.534 1.00 489.84 ? 155 TYR C CE2 1 
ATOM 8721  C CZ  . TYR C 3 155 ? 130.088 108.166 154.234 1.00 476.50 ? 155 TYR C CZ  1 
ATOM 8722  O OH  . TYR C 3 155 ? 130.999 107.929 155.242 1.00 438.82 ? 155 TYR C OH  1 
ATOM 8723  N N   . TYR C 3 156 ? 125.338 110.845 149.340 1.00 367.40 ? 156 TYR C N   1 
ATOM 8724  C CA  . TYR C 3 156 ? 124.180 110.848 148.412 1.00 374.18 ? 156 TYR C CA  1 
ATOM 8725  C C   . TYR C 3 156 ? 124.447 110.405 147.003 1.00 364.04 ? 156 TYR C C   1 
ATOM 8726  O O   . TYR C 3 156 ? 123.771 109.489 146.534 1.00 346.33 ? 156 TYR C O   1 
ATOM 8727  C CB  . TYR C 3 156 ? 123.515 112.220 148.288 1.00 407.39 ? 156 TYR C CB  1 
ATOM 8728  C CG  . TYR C 3 156 ? 122.537 112.333 147.096 1.00 403.86 ? 156 TYR C CG  1 
ATOM 8729  C CD1 . TYR C 3 156 ? 122.985 112.653 145.785 1.00 352.32 ? 156 TYR C CD1 1 
ATOM 8730  C CD2 . TYR C 3 156 ? 121.173 112.120 147.277 1.00 380.87 ? 156 TYR C CD2 1 
ATOM 8731  C CE1 . TYR C 3 156 ? 122.107 112.751 144.722 1.00 301.33 ? 156 TYR C CE1 1 
ATOM 8732  C CE2 . TYR C 3 156 ? 120.288 112.236 146.221 1.00 347.32 ? 156 TYR C CE2 1 
ATOM 8733  C CZ  . TYR C 3 156 ? 120.753 112.551 144.956 1.00 344.03 ? 156 TYR C CZ  1 
ATOM 8734  O OH  . TYR C 3 156 ? 119.851 112.651 143.930 1.00 401.18 ? 156 TYR C OH  1 
ATOM 8735  N N   . PHE C 3 157 ? 125.341 111.121 146.317 1.00 343.25 ? 157 PHE C N   1 
ATOM 8736  C CA  . PHE C 3 157 ? 125.618 110.880 144.896 1.00 319.77 ? 157 PHE C CA  1 
ATOM 8737  C C   . PHE C 3 157 ? 126.077 109.450 144.685 1.00 349.39 ? 157 PHE C C   1 
ATOM 8738  O O   . PHE C 3 157 ? 125.603 108.763 143.768 1.00 316.35 ? 157 PHE C O   1 
ATOM 8739  C CB  . PHE C 3 157 ? 126.725 111.789 144.392 1.00 345.10 ? 157 PHE C CB  1 
ATOM 8740  C CG  . PHE C 3 157 ? 126.251 113.102 143.888 1.00 344.12 ? 157 PHE C CG  1 
ATOM 8741  C CD1 . PHE C 3 157 ? 125.089 113.208 143.111 1.00 341.51 ? 157 PHE C CD1 1 
ATOM 8742  C CD2 . PHE C 3 157 ? 127.009 114.238 144.129 1.00 332.84 ? 157 PHE C CD2 1 
ATOM 8743  C CE1 . PHE C 3 157 ? 124.685 114.427 142.623 1.00 369.40 ? 157 PHE C CE1 1 
ATOM 8744  C CE2 . PHE C 3 157 ? 126.608 115.460 143.641 1.00 383.23 ? 157 PHE C CE2 1 
ATOM 8745  C CZ  . PHE C 3 157 ? 125.447 115.555 142.885 1.00 409.08 ? 157 PHE C CZ  1 
ATOM 8746  N N   . LEU C 3 158 ? 126.997 109.031 145.545 1.00 368.02 ? 158 LEU C N   1 
ATOM 8747  C CA  . LEU C 3 158 ? 127.568 107.680 145.512 1.00 372.49 ? 158 LEU C CA  1 
ATOM 8748  C C   . LEU C 3 158 ? 126.456 106.640 145.636 1.00 355.32 ? 158 LEU C C   1 
ATOM 8749  O O   . LEU C 3 158 ? 126.404 105.659 144.878 1.00 352.46 ? 158 LEU C O   1 
ATOM 8750  C CB  . LEU C 3 158 ? 128.544 107.523 146.677 1.00 386.19 ? 158 LEU C CB  1 
ATOM 8751  C CG  . LEU C 3 158 ? 129.307 106.210 146.772 1.00 452.27 ? 158 LEU C CG  1 
ATOM 8752  C CD1 . LEU C 3 158 ? 130.227 106.054 145.570 1.00 471.13 ? 158 LEU C CD1 1 
ATOM 8753  C CD2 . LEU C 3 158 ? 130.085 106.165 148.080 1.00 487.68 ? 158 LEU C CD2 1 
ATOM 8754  N N   . THR C 3 159 ? 125.592 106.891 146.612 1.00 360.83 ? 159 THR C N   1 
ATOM 8755  C CA  . THR C 3 159 ? 124.452 106.015 146.908 1.00 379.26 ? 159 THR C CA  1 
ATOM 8756  C C   . THR C 3 159 ? 123.564 105.879 145.678 1.00 341.42 ? 159 THR C C   1 
ATOM 8757  O O   . THR C 3 159 ? 123.155 104.771 145.309 1.00 329.84 ? 159 THR C O   1 
ATOM 8758  C CB  . THR C 3 159 ? 123.616 106.544 148.095 1.00 437.27 ? 159 THR C CB  1 
ATOM 8759  O OG1 . THR C 3 159 ? 124.242 107.704 148.659 1.00 466.37 ? 159 THR C OG1 1 
ATOM 8760  C CG2 . THR C 3 159 ? 123.477 105.475 149.172 1.00 496.65 ? 159 THR C CG2 1 
ATOM 8761  N N   . SER C 3 160 ? 123.289 107.021 145.072 1.00 331.01 ? 160 SER C N   1 
ATOM 8762  C CA  . SER C 3 160 ? 122.452 107.110 143.868 1.00 360.40 ? 160 SER C CA  1 
ATOM 8763  C C   . SER C 3 160 ? 123.046 106.262 142.756 1.00 343.44 ? 160 SER C C   1 
ATOM 8764  O O   . SER C 3 160 ? 122.338 105.498 142.091 1.00 379.54 ? 160 SER C O   1 
ATOM 8765  C CB  . SER C 3 160 ? 122.277 108.549 143.399 1.00 408.22 ? 160 SER C CB  1 
ATOM 8766  O OG  . SER C 3 160 ? 121.254 108.614 142.417 1.00 431.17 ? 160 SER C OG  1 
ATOM 8767  N N   . ALA C 3 161 ? 124.349 106.423 142.580 1.00 333.99 ? 161 ALA C N   1 
ATOM 8768  C CA  . ALA C 3 161 ? 125.115 105.698 141.559 1.00 377.04 ? 161 ALA C CA  1 
ATOM 8769  C C   . ALA C 3 161 ? 124.970 104.194 141.772 1.00 393.38 ? 161 ALA C C   1 
ATOM 8770  O O   . ALA C 3 161 ? 124.716 103.435 140.822 1.00 330.95 ? 161 ALA C O   1 
ATOM 8771  C CB  . ALA C 3 161 ? 126.572 106.113 141.582 1.00 415.00 ? 161 ALA C CB  1 
ATOM 8772  N N   . PHE C 3 162 ? 125.140 103.803 143.028 1.00 402.43 ? 162 PHE C N   1 
ATOM 8773  C CA  . PHE C 3 162 ? 125.039 102.398 143.442 1.00 378.81 ? 162 PHE C CA  1 
ATOM 8774  C C   . PHE C 3 162 ? 123.669 101.840 143.080 1.00 354.61 ? 162 PHE C C   1 
ATOM 8775  O O   . PHE C 3 162 ? 123.552 100.740 142.526 1.00 351.34 ? 162 PHE C O   1 
ATOM 8776  C CB  . PHE C 3 162 ? 125.264 102.201 144.953 1.00 395.02 ? 162 PHE C CB  1 
ATOM 8777  C CG  . PHE C 3 162 ? 126.669 101.818 145.346 1.00 409.95 ? 162 PHE C CG  1 
ATOM 8778  C CD1 . PHE C 3 162 ? 127.412 100.892 144.611 1.00 430.45 ? 162 PHE C CD1 1 
ATOM 8779  C CD2 . PHE C 3 162 ? 127.223 102.327 146.518 1.00 432.67 ? 162 PHE C CD2 1 
ATOM 8780  C CE1 . PHE C 3 162 ? 128.690 100.529 145.009 1.00 465.78 ? 162 PHE C CE1 1 
ATOM 8781  C CE2 . PHE C 3 162 ? 128.500 101.965 146.922 1.00 460.91 ? 162 PHE C CE2 1 
ATOM 8782  C CZ  . PHE C 3 162 ? 129.237 101.065 146.167 1.00 468.46 ? 162 PHE C CZ  1 
ATOM 8783  N N   . LEU C 3 163 ? 122.658 102.623 143.409 1.00 333.89 ? 163 LEU C N   1 
ATOM 8784  C CA  . LEU C 3 163 ? 121.251 102.285 143.148 1.00 362.58 ? 163 LEU C CA  1 
ATOM 8785  C C   . LEU C 3 163 ? 121.043 102.039 141.658 1.00 368.79 ? 163 LEU C C   1 
ATOM 8786  O O   . LEU C 3 163 ? 120.421 101.049 141.253 1.00 369.79 ? 163 LEU C O   1 
ATOM 8787  C CB  . LEU C 3 163 ? 120.387 103.476 143.599 1.00 362.17 ? 163 LEU C CB  1 
ATOM 8788  C CG  . LEU C 3 163 ? 118.949 103.289 144.059 1.00 428.27 ? 163 LEU C CG  1 
ATOM 8789  C CD1 . LEU C 3 163 ? 118.935 102.417 145.302 1.00 484.53 ? 163 LEU C CD1 1 
ATOM 8790  C CD2 . LEU C 3 163 ? 118.283 104.637 144.344 1.00 431.74 ? 163 LEU C CD2 1 
ATOM 8791  N N   . THR C 3 164 ? 121.576 102.966 140.877 1.00 352.60 ? 164 THR C N   1 
ATOM 8792  C CA  . THR C 3 164 ? 121.492 102.924 139.410 1.00 339.21 ? 164 THR C CA  1 
ATOM 8793  C C   . THR C 3 164 ? 122.099 101.632 138.889 1.00 360.21 ? 164 THR C C   1 
ATOM 8794  O O   . THR C 3 164 ? 121.517 100.948 138.039 1.00 387.57 ? 164 THR C O   1 
ATOM 8795  C CB  . THR C 3 164 ? 122.278 104.078 138.767 1.00 398.36 ? 164 THR C CB  1 
ATOM 8796  O OG1 . THR C 3 164 ? 122.003 105.300 139.463 1.00 447.88 ? 164 THR C OG1 1 
ATOM 8797  C CG2 . THR C 3 164 ? 121.904 104.232 137.295 1.00 450.77 ? 164 THR C CG2 1 
ATOM 8798  N N   . ALA C 3 165 ? 123.277 101.333 139.418 1.00 356.24 ? 165 ALA C N   1 
ATOM 8799  C CA  . ALA C 3 165 ? 124.040 100.130 139.056 1.00 377.61 ? 165 ALA C CA  1 
ATOM 8800  C C   . ALA C 3 165 ? 123.203 98.885  139.320 1.00 348.61 ? 165 ALA C C   1 
ATOM 8801  O O   . ALA C 3 165 ? 123.110 97.981  138.474 1.00 305.47 ? 165 ALA C O   1 
ATOM 8802  C CB  . ALA C 3 165 ? 125.325 100.065 139.868 1.00 395.66 ? 165 ALA C CB  1 
ATOM 8803  N N   . ALA C 3 166 ? 122.611 98.871  140.506 1.00 350.17 ? 166 ALA C N   1 
ATOM 8804  C CA  . ALA C 3 166 ? 121.760 97.763  140.959 1.00 390.90 ? 166 ALA C CA  1 
ATOM 8805  C C   . ALA C 3 166 ? 120.608 97.554  139.988 1.00 321.03 ? 166 ALA C C   1 
ATOM 8806  O O   . ALA C 3 166 ? 120.306 96.424  139.583 1.00 310.01 ? 166 ALA C O   1 
ATOM 8807  C CB  . ALA C 3 166 ? 121.245 98.002  142.372 1.00 453.34 ? 166 ALA C CB  1 
ATOM 8808  N N   . ILE C 3 167 ? 119.984 98.668  139.637 1.00 307.26 ? 167 ILE C N   1 
ATOM 8809  C CA  . ILE C 3 167 ? 118.846 98.699  138.709 1.00 360.08 ? 167 ILE C CA  1 
ATOM 8810  C C   . ILE C 3 167 ? 119.243 98.077  137.377 1.00 319.19 ? 167 ILE C C   1 
ATOM 8811  O O   . ILE C 3 167 ? 118.520 97.246  136.817 1.00 302.68 ? 167 ILE C O   1 
ATOM 8812  C CB  . ILE C 3 167 ? 118.411 100.183 138.493 1.00 407.35 ? 167 ILE C CB  1 
ATOM 8813  C CG1 . ILE C 3 167 ? 117.755 100.756 139.767 1.00 415.34 ? 167 ILE C CG1 1 
ATOM 8814  C CG2 . ILE C 3 167 ? 117.520 100.367 137.264 1.00 431.93 ? 167 ILE C CG2 1 
ATOM 8815  C CD1 . ILE C 3 167 ? 116.260 100.539 139.893 1.00 462.24 ? 167 ILE C CD1 1 
ATOM 8816  N N   . ILE C 3 168 ? 120.400 98.511  136.898 1.00 318.38 ? 168 ILE C N   1 
ATOM 8817  C CA  . ILE C 3 168 ? 120.974 98.047  135.632 1.00 358.23 ? 168 ILE C CA  1 
ATOM 8818  C C   . ILE C 3 168 ? 121.146 96.536  135.659 1.00 325.86 ? 168 ILE C C   1 
ATOM 8819  O O   . ILE C 3 168 ? 120.752 95.794  134.730 1.00 312.05 ? 168 ILE C O   1 
ATOM 8820  C CB  . ILE C 3 168 ? 122.334 98.769  135.423 1.00 401.90 ? 168 ILE C CB  1 
ATOM 8821  C CG1 . ILE C 3 168 ? 122.076 100.171 134.857 1.00 424.75 ? 168 ILE C CG1 1 
ATOM 8822  C CG2 . ILE C 3 168 ? 123.306 97.972  134.559 1.00 404.07 ? 168 ILE C CG2 1 
ATOM 8823  C CD1 . ILE C 3 168 ? 123.149 101.182 135.182 1.00 431.27 ? 168 ILE C CD1 1 
ATOM 8824  N N   . LEU C 3 169 ? 121.727 96.086  136.760 1.00 317.90 ? 169 LEU C N   1 
ATOM 8825  C CA  . LEU C 3 169 ? 121.990 94.652  136.997 1.00 356.91 ? 169 LEU C CA  1 
ATOM 8826  C C   . LEU C 3 169 ? 120.632 93.965  137.063 1.00 336.19 ? 169 LEU C C   1 
ATOM 8827  O O   . LEU C 3 169 ? 120.373 92.901  136.473 1.00 343.31 ? 169 LEU C O   1 
ATOM 8828  C CB  . LEU C 3 169 ? 122.762 94.439  138.299 1.00 392.02 ? 169 LEU C CB  1 
ATOM 8829  C CG  . LEU C 3 169 ? 124.255 94.776  138.282 1.00 467.37 ? 169 LEU C CG  1 
ATOM 8830  C CD1 . LEU C 3 169 ? 124.816 94.743  139.697 1.00 500.00 ? 169 LEU C CD1 1 
ATOM 8831  C CD2 . LEU C 3 169 ? 125.035 93.825  137.381 1.00 496.15 ? 169 LEU C CD2 1 
ATOM 8832  N N   . LEU C 3 170 ? 119.841 94.587  137.915 1.00 343.57 ? 170 LEU C N   1 
ATOM 8833  C CA  . LEU C 3 170 ? 118.555 94.021  138.340 1.00 397.64 ? 170 LEU C CA  1 
ATOM 8834  C C   . LEU C 3 170 ? 117.646 93.833  137.146 1.00 385.60 ? 170 LEU C C   1 
ATOM 8835  O O   . LEU C 3 170 ? 117.021 92.766  136.996 1.00 374.92 ? 170 LEU C O   1 
ATOM 8836  C CB  . LEU C 3 170 ? 117.889 94.848  139.443 1.00 433.09 ? 170 LEU C CB  1 
ATOM 8837  C CG  . LEU C 3 170 ? 116.741 94.266  140.285 1.00 474.92 ? 170 LEU C CG  1 
ATOM 8838  C CD1 . LEU C 3 170 ? 116.552 92.752  140.198 1.00 486.98 ? 170 LEU C CD1 1 
ATOM 8839  C CD2 . LEU C 3 170 ? 116.919 94.671  141.743 1.00 500.00 ? 170 LEU C CD2 1 
ATOM 8840  N N   . HIS C 3 171 ? 117.596 94.869  136.315 1.00 356.03 ? 171 HIS C N   1 
ATOM 8841  C CA  . HIS C 3 171 ? 116.756 94.863  135.104 1.00 329.86 ? 171 HIS C CA  1 
ATOM 8842  C C   . HIS C 3 171 ? 117.161 93.709  134.198 1.00 336.31 ? 171 HIS C C   1 
ATOM 8843  O O   . HIS C 3 171 ? 116.301 92.967  133.689 1.00 327.51 ? 171 HIS C O   1 
ATOM 8844  C CB  . HIS C 3 171 ? 116.802 96.194  134.328 1.00 328.77 ? 171 HIS C CB  1 
ATOM 8845  C CG  . HIS C 3 171 ? 115.756 97.187  134.751 1.00 388.89 ? 171 HIS C CG  1 
ATOM 8846  N ND1 . HIS C 3 171 ? 114.790 97.668  133.892 1.00 380.80 ? 171 HIS C ND1 1 
ATOM 8847  C CD2 . HIS C 3 171 ? 115.528 97.792  135.942 1.00 399.84 ? 171 HIS C CD2 1 
ATOM 8848  C CE1 . HIS C 3 171 ? 114.014 98.523  134.533 1.00 385.12 ? 171 HIS C CE1 1 
ATOM 8849  N NE2 . HIS C 3 171 ? 114.438 98.616  135.781 1.00 371.69 ? 171 HIS C NE2 1 
ATOM 8850  N N   . THR C 3 172 ? 118.479 93.584  134.025 1.00 358.55 ? 172 THR C N   1 
ATOM 8851  C CA  . THR C 3 172 ? 119.066 92.543  133.179 1.00 374.34 ? 172 THR C CA  1 
ATOM 8852  C C   . THR C 3 172 ? 118.638 91.159  133.688 1.00 352.15 ? 172 THR C C   1 
ATOM 8853  O O   . THR C 3 172 ? 118.229 90.288  132.906 1.00 405.55 ? 172 THR C O   1 
ATOM 8854  C CB  . THR C 3 172 ? 120.606 92.614  133.155 1.00 381.08 ? 172 THR C CB  1 
ATOM 8855  O OG1 . THR C 3 172 ? 121.028 93.965  132.934 1.00 360.73 ? 172 THR C OG1 1 
ATOM 8856  C CG2 . THR C 3 172 ? 121.162 91.727  132.046 1.00 409.51 ? 172 THR C CG2 1 
ATOM 8857  N N   . PHE C 3 173 ? 118.750 91.002  134.997 1.00 307.79 ? 173 PHE C N   1 
ATOM 8858  C CA  . PHE C 3 173 ? 118.410 89.738  135.638 1.00 333.63 ? 173 PHE C CA  1 
ATOM 8859  C C   . PHE C 3 173 ? 116.946 89.399  135.424 1.00 335.71 ? 173 PHE C C   1 
ATOM 8860  O O   . PHE C 3 173 ? 116.620 88.247  135.095 1.00 375.73 ? 173 PHE C O   1 
ATOM 8861  C CB  . PHE C 3 173 ? 118.976 89.703  137.045 1.00 369.28 ? 173 PHE C CB  1 
ATOM 8862  C CG  . PHE C 3 173 ? 120.491 89.895  137.073 1.00 427.05 ? 173 PHE C CG  1 
ATOM 8863  C CD1 . PHE C 3 173 ? 121.305 89.498  135.984 1.00 385.77 ? 173 PHE C CD1 1 
ATOM 8864  C CD2 . PHE C 3 173 ? 121.112 90.482  138.170 1.00 499.96 ? 173 PHE C CD2 1 
ATOM 8865  C CE1 . PHE C 3 173 ? 122.678 89.680  136.013 1.00 415.30 ? 173 PHE C CE1 1 
ATOM 8866  C CE2 . PHE C 3 173 ? 122.494 90.665  138.194 1.00 500.00 ? 173 PHE C CE2 1 
ATOM 8867  C CZ  . PHE C 3 173 ? 123.276 90.264  137.118 1.00 466.80 ? 173 PHE C CZ  1 
ATOM 8868  N N   . TRP C 3 174 ? 116.101 90.415  135.566 1.00 303.71 ? 174 TRP C N   1 
ATOM 8869  C CA  . TRP C 3 174 ? 114.655 90.279  135.348 1.00 349.89 ? 174 TRP C CA  1 
ATOM 8870  C C   . TRP C 3 174 ? 114.378 89.791  133.938 1.00 367.42 ? 174 TRP C C   1 
ATOM 8871  O O   . TRP C 3 174 ? 113.577 88.864  133.731 1.00 328.27 ? 174 TRP C O   1 
ATOM 8872  C CB  . TRP C 3 174 ? 113.875 91.588  135.553 1.00 343.51 ? 174 TRP C CB  1 
ATOM 8873  C CG  . TRP C 3 174 ? 113.720 91.978  136.947 1.00 370.46 ? 174 TRP C CG  1 
ATOM 8874  C CD1 . TRP C 3 174 ? 113.583 91.152  138.017 1.00 421.74 ? 174 TRP C CD1 1 
ATOM 8875  C CD2 . TRP C 3 174 ? 113.665 93.304  137.454 1.00 380.56 ? 174 TRP C CD2 1 
ATOM 8876  N NE1 . TRP C 3 174 ? 113.463 91.879  139.163 1.00 441.12 ? 174 TRP C NE1 1 
ATOM 8877  C CE2 . TRP C 3 174 ? 113.508 93.207  138.845 1.00 419.78 ? 174 TRP C CE2 1 
ATOM 8878  C CE3 . TRP C 3 174 ? 113.742 94.569  136.871 1.00 406.85 ? 174 TRP C CE3 1 
ATOM 8879  C CZ2 . TRP C 3 174 ? 113.438 94.321  139.664 1.00 428.90 ? 174 TRP C CZ2 1 
ATOM 8880  C CZ3 . TRP C 3 174 ? 113.669 95.684  137.690 1.00 424.79 ? 174 TRP C CZ3 1 
ATOM 8881  C CH2 . TRP C 3 174 ? 113.520 95.554  139.068 1.00 428.17 ? 174 TRP C CH2 1 
ATOM 8882  N N   . GLY C 3 175 ? 115.059 90.429  132.996 1.00 384.08 ? 175 GLY C N   1 
ATOM 8883  C CA  . GLY C 3 175 ? 114.935 90.109  131.568 1.00 393.58 ? 175 GLY C CA  1 
ATOM 8884  C C   . GLY C 3 175 ? 115.285 88.645  131.327 1.00 348.59 ? 175 GLY C C   1 
ATOM 8885  O O   . GLY C 3 175 ? 114.557 87.917  130.627 1.00 326.48 ? 175 GLY C O   1 
ATOM 8886  N N   . VAL C 3 176 ? 116.398 88.248  131.928 1.00 346.54 ? 176 VAL C N   1 
ATOM 8887  C CA  . VAL C 3 176 ? 116.920 86.882  131.816 1.00 354.19 ? 176 VAL C CA  1 
ATOM 8888  C C   . VAL C 3 176 ? 115.880 85.888  132.319 1.00 329.00 ? 176 VAL C C   1 
ATOM 8889  O O   . VAL C 3 176 ? 115.612 84.862  131.659 1.00 413.23 ? 176 VAL C O   1 
ATOM 8890  C CB  . VAL C 3 176 ? 118.267 86.709  132.570 1.00 412.59 ? 176 VAL C CB  1 
ATOM 8891  C CG1 . VAL C 3 176 ? 118.676 85.238  132.651 1.00 458.49 ? 176 VAL C CG1 1 
ATOM 8892  C CG2 . VAL C 3 176 ? 119.369 87.531  131.902 1.00 442.96 ? 176 VAL C CG2 1 
ATOM 8893  N N   . VAL C 3 177 ? 115.306 86.219  133.474 1.00 317.25 ? 177 VAL C N   1 
ATOM 8894  C CA  . VAL C 3 177 ? 114.311 85.377  134.124 1.00 384.34 ? 177 VAL C CA  1 
ATOM 8895  C C   . VAL C 3 177 ? 112.956 85.553  133.465 1.00 378.78 ? 177 VAL C C   1 
ATOM 8896  O O   . VAL C 3 177 ? 112.254 84.546  133.285 1.00 413.59 ? 177 VAL C O   1 
ATOM 8897  C CB  . VAL C 3 177 ? 114.336 85.507  135.669 1.00 402.55 ? 177 VAL C CB  1 
ATOM 8898  C CG1 . VAL C 3 177 ? 113.110 84.855  136.307 1.00 419.94 ? 177 VAL C CG1 1 
ATOM 8899  C CG2 . VAL C 3 177 ? 115.636 84.886  136.210 1.00 312.94 ? 177 VAL C CG2 1 
ATOM 8900  N N   . PHE C 3 178 ? 112.607 86.792  133.148 1.00 330.74 ? 178 PHE C N   1 
ATOM 8901  C CA  . PHE C 3 178 ? 111.322 87.125  132.558 1.00 350.97 ? 178 PHE C CA  1 
ATOM 8902  C C   . PHE C 3 178 ? 111.124 86.357  131.246 1.00 368.16 ? 178 PHE C C   1 
ATOM 8903  O O   . PHE C 3 178 ? 110.063 85.747  130.994 1.00 380.59 ? 178 PHE C O   1 
ATOM 8904  C CB  . PHE C 3 178 ? 111.236 88.620  132.251 1.00 361.56 ? 178 PHE C CB  1 
ATOM 8905  C CG  . PHE C 3 178 ? 109.948 89.028  131.609 1.00 439.26 ? 178 PHE C CG  1 
ATOM 8906  C CD1 . PHE C 3 178 ? 109.743 88.855  130.239 1.00 455.30 ? 178 PHE C CD1 1 
ATOM 8907  C CD2 . PHE C 3 178 ? 108.927 89.578  132.374 1.00 496.17 ? 178 PHE C CD2 1 
ATOM 8908  C CE1 . PHE C 3 178 ? 108.546 89.219  129.654 1.00 477.84 ? 178 PHE C CE1 1 
ATOM 8909  C CE2 . PHE C 3 178 ? 107.729 89.951  131.791 1.00 500.00 ? 178 PHE C CE2 1 
ATOM 8910  C CZ  . PHE C 3 178 ? 107.540 89.772  130.434 1.00 493.03 ? 178 PHE C CZ  1 
ATOM 8911  N N   . PHE C 3 179 ? 112.181 86.420  130.438 1.00 350.24 ? 179 PHE C N   1 
ATOM 8912  C CA  . PHE C 3 179 ? 112.177 85.759  129.121 1.00 377.91 ? 179 PHE C CA  1 
ATOM 8913  C C   . PHE C 3 179 ? 111.978 84.265  129.287 1.00 392.54 ? 179 PHE C C   1 
ATOM 8914  O O   . PHE C 3 179 ? 111.179 83.664  128.553 1.00 426.09 ? 179 PHE C O   1 
ATOM 8915  C CB  . PHE C 3 179 ? 113.362 86.150  128.265 1.00 435.08 ? 179 PHE C CB  1 
ATOM 8916  C CG  . PHE C 3 179 ? 113.152 87.452  127.522 1.00 469.20 ? 179 PHE C CG  1 
ATOM 8917  C CD1 . PHE C 3 179 ? 112.821 88.621  128.205 1.00 461.52 ? 179 PHE C CD1 1 
ATOM 8918  C CD2 . PHE C 3 179 ? 113.271 87.508  126.137 1.00 500.00 ? 179 PHE C CD2 1 
ATOM 8919  C CE1 . PHE C 3 179 ? 112.628 89.813  127.528 1.00 457.27 ? 179 PHE C CE1 1 
ATOM 8920  C CE2 . PHE C 3 179 ? 113.082 88.698  125.457 1.00 496.90 ? 179 PHE C CE2 1 
ATOM 8921  C CZ  . PHE C 3 179 ? 112.759 89.851  126.153 1.00 484.52 ? 179 PHE C CZ  1 
ATOM 8922  N N   . ASP C 3 180 ? 112.687 83.701  130.255 1.00 376.13 ? 180 ASP C N   1 
ATOM 8923  C CA  . ASP C 3 180 ? 112.610 82.271  130.573 1.00 383.95 ? 180 ASP C CA  1 
ATOM 8924  C C   . ASP C 3 180 ? 111.174 81.887  130.916 1.00 413.37 ? 180 ASP C C   1 
ATOM 8925  O O   . ASP C 3 180 ? 110.645 80.880  130.422 1.00 430.34 ? 180 ASP C O   1 
ATOM 8926  C CB  . ASP C 3 180 ? 113.541 81.945  131.757 1.00 407.39 ? 180 ASP C CB  1 
ATOM 8927  C CG  . ASP C 3 180 ? 113.995 80.497  131.781 1.00 449.45 ? 180 ASP C CG  1 
ATOM 8928  O OD1 . ASP C 3 180 ? 114.544 80.020  130.764 1.00 488.37 ? 180 ASP C OD1 1 
ATOM 8929  O OD2 . ASP C 3 180 ? 113.837 79.843  132.837 1.00 449.81 ? 180 ASP C OD2 1 
ATOM 8930  N N   . ALA C 3 181 ? 110.579 82.715  131.767 1.00 440.62 ? 181 ALA C N   1 
ATOM 8931  C CA  . ALA C 3 181 ? 109.201 82.526  132.232 1.00 465.08 ? 181 ALA C CA  1 
ATOM 8932  C C   . ALA C 3 181 ? 108.248 82.499  131.039 1.00 448.80 ? 181 ALA C C   1 
ATOM 8933  O O   . ALA C 3 181 ? 107.372 81.617  130.938 1.00 425.85 ? 181 ALA C O   1 
ATOM 8934  C CB  . ALA C 3 181 ? 108.799 83.635  133.195 1.00 474.50 ? 181 ALA C CB  1 
ATOM 8935  N N   . CYS C 3 182 ? 108.452 83.478  130.158 1.00 470.96 ? 182 CYS C N   1 
ATOM 8936  C CA  . CYS C 3 182 ? 107.632 83.624  128.953 1.00 500.00 ? 182 CYS C CA  1 
ATOM 8937  C C   . CYS C 3 182 ? 107.724 82.363  128.095 1.00 500.00 ? 182 CYS C C   1 
ATOM 8938  O O   . CYS C 3 182 ? 106.704 81.846  127.617 1.00 488.40 ? 182 CYS C O   1 
ATOM 8939  C CB  . CYS C 3 182 ? 107.776 84.940  128.160 1.00 500.00 ? 182 CYS C CB  1 
ATOM 8940  S SG  . CYS C 3 182 ? 109.240 85.977  128.314 1.00 398.57 ? 182 CYS C SG  1 
ATOM 8941  N N   . GLU C 3 183 ? 108.953 81.895  127.934 1.00 500.00 ? 183 GLU C N   1 
ATOM 8942  C CA  . GLU C 3 183 ? 109.253 80.692  127.153 1.00 500.00 ? 183 GLU C CA  1 
ATOM 8943  C C   . GLU C 3 183 ? 108.499 79.498  127.715 1.00 500.00 ? 183 GLU C C   1 
ATOM 8944  O O   . GLU C 3 183 ? 107.872 78.722  126.976 1.00 500.00 ? 183 GLU C O   1 
ATOM 8945  C CB  . GLU C 3 183 ? 110.760 80.385  127.139 1.00 500.00 ? 183 GLU C CB  1 
ATOM 8946  C CG  . GLU C 3 183 ? 111.615 81.398  126.382 1.00 500.00 ? 183 GLU C CG  1 
ATOM 8947  C CD  . GLU C 3 183 ? 111.778 81.068  124.913 1.00 500.00 ? 183 GLU C CD  1 
ATOM 8948  O OE1 . GLU C 3 183 ? 112.396 80.025  124.601 1.00 500.00 ? 183 GLU C OE1 1 
ATOM 8949  O OE2 . GLU C 3 183 ? 111.302 81.858  124.069 1.00 500.00 ? 183 GLU C OE2 1 
ATOM 8950  N N   . ARG C 3 184 ? 108.570 79.380  129.037 1.00 500.00 ? 184 ARG C N   1 
ATOM 8951  C CA  . ARG C 3 184 ? 107.919 78.296  129.782 1.00 487.13 ? 184 ARG C CA  1 
ATOM 8952  C C   . ARG C 3 184 ? 106.383 78.241  129.723 1.00 495.62 ? 184 ARG C C   1 
ATOM 8953  O O   . ARG C 3 184 ? 105.812 77.200  130.053 1.00 500.00 ? 184 ARG C O   1 
ATOM 8954  C CB  . ARG C 3 184 ? 108.358 78.305  131.255 1.00 444.60 ? 184 ARG C CB  1 
ATOM 8955  C CG  . ARG C 3 184 ? 109.815 77.936  131.487 1.00 411.06 ? 184 ARG C CG  1 
ATOM 8956  C CD  . ARG C 3 184 ? 110.001 76.524  132.026 1.00 369.22 ? 184 ARG C CD  1 
ATOM 8957  N NE  . ARG C 3 184 ? 111.433 76.183  132.041 1.00 417.21 ? 184 ARG C NE  1 
ATOM 8958  C CZ  . ARG C 3 184 ? 112.160 75.798  133.099 1.00 436.16 ? 184 ARG C CZ  1 
ATOM 8959  N NH1 . ARG C 3 184 ? 111.620 75.640  134.309 1.00 462.79 ? 184 ARG C NH1 1 
ATOM 8960  N NH2 . ARG C 3 184 ? 113.462 75.540  132.938 1.00 398.97 ? 184 ARG C NH2 1 
ATOM 8961  N N   . ARG C 3 185 ? 105.724 79.339  129.329 1.00 471.32 ? 185 ARG C N   1 
ATOM 8962  C CA  . ARG C 3 185 ? 104.273 79.517  129.510 1.00 463.69 ? 185 ARG C CA  1 
ATOM 8963  C C   . ARG C 3 185 ? 103.930 79.603  131.014 1.00 480.49 ? 185 ARG C C   1 
ATOM 8964  O O   . ARG C 3 185 ? 102.760 79.508  131.391 1.00 460.72 ? 185 ARG C O   1 
ATOM 8965  C CB  . ARG C 3 185 ? 103.473 78.392  128.808 1.00 474.58 ? 185 ARG C CB  1 
ATOM 8966  C CG  . ARG C 3 185 ? 102.015 78.711  128.457 1.00 500.00 ? 185 ARG C CG  1 
ATOM 8967  C CD  . ARG C 3 185 ? 101.243 77.478  127.968 1.00 495.51 ? 185 ARG C CD  1 
ATOM 8968  N NE  . ARG C 3 185 ? 99.885  77.380  128.540 1.00 490.05 ? 185 ARG C NE  1 
ATOM 8969  C CZ  . ARG C 3 185 ? 98.753  77.858  128.003 1.00 462.92 ? 185 ARG C CZ  1 
ATOM 8970  N NH1 . ARG C 3 185 ? 98.743  78.505  126.836 1.00 478.89 ? 185 ARG C NH1 1 
ATOM 8971  N NH2 . ARG C 3 185 ? 97.599  77.688  128.655 1.00 400.02 ? 185 ARG C NH2 1 
ATOM 8972  N N   . ARG C 3 186 ? 104.946 79.811  131.864 1.00 500.00 ? 186 ARG C N   1 
ATOM 8973  C CA  . ARG C 3 186 ? 104.781 79.790  133.316 1.00 500.00 ? 186 ARG C CA  1 
ATOM 8974  C C   . ARG C 3 186 ? 104.667 81.252  133.761 1.00 498.28 ? 186 ARG C C   1 
ATOM 8975  O O   . ARG C 3 186 ? 105.519 82.084  133.436 1.00 488.77 ? 186 ARG C O   1 
ATOM 8976  C CB  . ARG C 3 186 ? 105.932 79.014  134.007 1.00 500.00 ? 186 ARG C CB  1 
ATOM 8977  C CG  . ARG C 3 186 ? 107.159 79.819  134.429 1.00 500.00 ? 186 ARG C CG  1 
ATOM 8978  C CD  . ARG C 3 186 ? 108.415 78.986  134.667 1.00 500.00 ? 186 ARG C CD  1 
ATOM 8979  N NE  . ARG C 3 186 ? 108.308 77.969  135.716 1.00 500.00 ? 186 ARG C NE  1 
ATOM 8980  C CZ  . ARG C 3 186 ? 109.343 77.435  136.380 1.00 500.00 ? 186 ARG C CZ  1 
ATOM 8981  N NH1 . ARG C 3 186 ? 110.602 77.825  136.144 1.00 500.00 ? 186 ARG C NH1 1 
ATOM 8982  N NH2 . ARG C 3 186 ? 109.121 76.504  137.312 1.00 500.00 ? 186 ARG C NH2 1 
ATOM 8983  N N   . TYR C 3 187 ? 103.581 81.563  134.460 1.00 472.52 ? 187 TYR C N   1 
ATOM 8984  C CA  . TYR C 3 187 ? 103.250 82.937  134.821 1.00 452.82 ? 187 TYR C CA  1 
ATOM 8985  C C   . TYR C 3 187 ? 103.654 83.306  136.252 1.00 406.41 ? 187 TYR C C   1 
ATOM 8986  O O   . TYR C 3 187 ? 103.785 84.504  136.549 1.00 445.89 ? 187 TYR C O   1 
ATOM 8987  C CB  . TYR C 3 187 ? 101.754 83.183  134.602 1.00 492.64 ? 187 TYR C CB  1 
ATOM 8988  C CG  . TYR C 3 187 ? 101.322 83.076  133.141 1.00 500.00 ? 187 TYR C CG  1 
ATOM 8989  C CD1 . TYR C 3 187 ? 100.989 81.839  132.573 1.00 500.00 ? 187 TYR C CD1 1 
ATOM 8990  C CD2 . TYR C 3 187 ? 101.237 84.214  132.327 1.00 500.00 ? 187 TYR C CD2 1 
ATOM 8991  C CE1 . TYR C 3 187 ? 100.587 81.743  131.244 1.00 495.86 ? 187 TYR C CE1 1 
ATOM 8992  C CE2 . TYR C 3 187 ? 100.836 84.123  130.997 1.00 500.00 ? 187 TYR C CE2 1 
ATOM 8993  C CZ  . TYR C 3 187 ? 100.512 82.887  130.460 1.00 487.28 ? 187 TYR C CZ  1 
ATOM 8994  O OH  . TYR C 3 187 ? 100.112 82.794  129.144 1.00 447.35 ? 187 TYR C OH  1 
ATOM 8995  N N   . TRP C 3 188 ? 103.847 82.299  137.110 1.00 410.44 ? 188 TRP C N   1 
ATOM 8996  C CA  . TRP C 3 188 ? 104.241 82.561  138.471 1.00 423.88 ? 188 TRP C CA  1 
ATOM 8997  C C   . TRP C 3 188 ? 105.590 83.264  138.535 1.00 391.12 ? 188 TRP C C   1 
ATOM 8998  O O   . TRP C 3 188 ? 105.739 84.223  139.312 1.00 435.96 ? 188 TRP C O   1 
ATOM 8999  C CB  . TRP C 3 188 ? 104.178 81.303  139.363 1.00 437.27 ? 188 TRP C CB  1 
ATOM 9000  C CG  . TRP C 3 188 ? 105.259 80.276  139.185 1.00 442.12 ? 188 TRP C CG  1 
ATOM 9001  C CD1 . TRP C 3 188 ? 105.258 79.230  138.310 1.00 435.75 ? 188 TRP C CD1 1 
ATOM 9002  C CD2 . TRP C 3 188 ? 106.476 80.165  139.942 1.00 477.77 ? 188 TRP C CD2 1 
ATOM 9003  N NE1 . TRP C 3 188 ? 106.403 78.486  138.458 1.00 479.79 ? 188 TRP C NE1 1 
ATOM 9004  C CE2 . TRP C 3 188 ? 107.169 79.036  139.453 1.00 499.58 ? 188 TRP C CE2 1 
ATOM 9005  C CE3 . TRP C 3 188 ? 107.050 80.915  140.980 1.00 490.26 ? 188 TRP C CE3 1 
ATOM 9006  C CZ2 . TRP C 3 188 ? 108.420 78.637  139.964 1.00 500.00 ? 188 TRP C CZ2 1 
ATOM 9007  C CZ3 . TRP C 3 188 ? 108.295 80.519  141.491 1.00 482.73 ? 188 TRP C CZ3 1 
ATOM 9008  C CH2 . TRP C 3 188 ? 108.963 79.390  140.979 1.00 478.99 ? 188 TRP C CH2 1 
ATOM 9009  N N   . ALA C 3 189 ? 106.514 82.815  137.692 1.00 325.91 ? 189 ALA C N   1 
ATOM 9010  C CA  . ALA C 3 189 ? 107.842 83.423  137.597 1.00 410.64 ? 189 ALA C CA  1 
ATOM 9011  C C   . ALA C 3 189 ? 107.725 84.904  137.227 1.00 412.30 ? 189 ALA C C   1 
ATOM 9012  O O   . ALA C 3 189 ? 108.377 85.765  137.831 1.00 368.93 ? 189 ALA C O   1 
ATOM 9013  C CB  . ALA C 3 189 ? 108.711 82.670  136.602 1.00 472.54 ? 189 ALA C CB  1 
ATOM 9014  N N   . LEU C 3 190 ? 106.879 85.155  136.241 1.00 410.14 ? 190 LEU C N   1 
ATOM 9015  C CA  . LEU C 3 190 ? 106.608 86.504  135.736 1.00 393.28 ? 190 LEU C CA  1 
ATOM 9016  C C   . LEU C 3 190 ? 106.108 87.396  136.873 1.00 382.49 ? 190 LEU C C   1 
ATOM 9017  O O   . LEU C 3 190 ? 106.574 88.535  137.054 1.00 375.81 ? 190 LEU C O   1 
ATOM 9018  C CB  . LEU C 3 190 ? 105.519 86.434  134.646 1.00 448.43 ? 190 LEU C CB  1 
ATOM 9019  C CG  . LEU C 3 190 ? 105.532 87.442  133.491 1.00 500.00 ? 190 LEU C CG  1 
ATOM 9020  C CD1 . LEU C 3 190 ? 106.368 86.906  132.334 1.00 500.00 ? 190 LEU C CD1 1 
ATOM 9021  C CD2 . LEU C 3 190 ? 104.116 87.751  133.014 1.00 500.00 ? 190 LEU C CD2 1 
ATOM 9022  N N   . GLY C 3 191 ? 105.154 86.840  137.613 1.00 431.44 ? 191 GLY C N   1 
ATOM 9023  C CA  . GLY C 3 191 ? 104.534 87.524  138.753 1.00 448.83 ? 191 GLY C CA  1 
ATOM 9024  C C   . GLY C 3 191 ? 105.593 87.908  139.774 1.00 442.60 ? 191 GLY C C   1 
ATOM 9025  O O   . GLY C 3 191 ? 105.618 89.041  140.275 1.00 489.32 ? 191 GLY C O   1 
ATOM 9026  N N   . LEU C 3 192 ? 106.451 86.940  140.062 1.00 459.88 ? 192 LEU C N   1 
ATOM 9027  C CA  . LEU C 3 192 ? 107.552 87.105  141.024 1.00 500.00 ? 192 LEU C CA  1 
ATOM 9028  C C   . LEU C 3 192 ? 108.451 88.253  140.591 1.00 500.00 ? 192 LEU C C   1 
ATOM 9029  O O   . LEU C 3 192 ? 108.822 89.106  141.403 1.00 500.00 ? 192 LEU C O   1 
ATOM 9030  C CB  . LEU C 3 192 ? 108.370 85.814  141.207 1.00 500.00 ? 192 LEU C CB  1 
ATOM 9031  C CG  . LEU C 3 192 ? 109.099 85.660  142.564 1.00 500.00 ? 192 LEU C CG  1 
ATOM 9032  C CD1 . LEU C 3 192 ? 109.455 84.202  142.840 1.00 500.00 ? 192 LEU C CD1 1 
ATOM 9033  C CD2 . LEU C 3 192 ? 110.342 86.540  142.687 1.00 500.00 ? 192 LEU C CD2 1 
ATOM 9034  N N   . VAL C 3 193 ? 108.784 88.239  139.310 1.00 467.11 ? 193 VAL C N   1 
ATOM 9035  C CA  . VAL C 3 193 ? 109.647 89.255  138.696 1.00 467.99 ? 193 VAL C CA  1 
ATOM 9036  C C   . VAL C 3 193 ? 109.030 90.649  138.891 1.00 398.15 ? 193 VAL C C   1 
ATOM 9037  O O   . VAL C 3 193 ? 109.719 91.604  139.287 1.00 289.51 ? 193 VAL C O   1 
ATOM 9038  C CB  . VAL C 3 193 ? 109.931 88.952  137.200 1.00 500.00 ? 193 VAL C CB  1 
ATOM 9039  C CG1 . VAL C 3 193 ? 110.540 90.161  136.484 1.00 500.00 ? 193 VAL C CG1 1 
ATOM 9040  C CG2 . VAL C 3 193 ? 110.831 87.723  137.065 1.00 500.00 ? 193 VAL C CG2 1 
ATOM 9041  N N   . VAL C 3 194 ? 107.735 90.710  138.604 1.00 397.62 ? 194 VAL C N   1 
ATOM 9042  C CA  . VAL C 3 194 ? 106.966 91.948  138.719 1.00 391.75 ? 194 VAL C CA  1 
ATOM 9043  C C   . VAL C 3 194 ? 107.032 92.481  140.155 1.00 415.60 ? 194 VAL C C   1 
ATOM 9044  O O   . VAL C 3 194 ? 107.264 93.677  140.390 1.00 342.76 ? 194 VAL C O   1 
ATOM 9045  C CB  . VAL C 3 194 ? 105.521 91.813  138.198 1.00 448.02 ? 194 VAL C CB  1 
ATOM 9046  C CG1 . VAL C 3 194 ? 104.694 93.059  138.527 1.00 451.12 ? 194 VAL C CG1 1 
ATOM 9047  C CG2 . VAL C 3 194 ? 105.531 91.557  136.690 1.00 453.24 ? 194 VAL C CG2 1 
ATOM 9048  N N   . GLY C 3 195 ? 106.827 91.559  141.084 1.00 499.62 ? 195 GLY C N   1 
ATOM 9049  C CA  . GLY C 3 195 ? 106.858 91.855  142.520 1.00 500.00 ? 195 GLY C CA  1 
ATOM 9050  C C   . GLY C 3 195 ? 108.200 92.443  142.910 1.00 500.00 ? 195 GLY C C   1 
ATOM 9051  O O   . GLY C 3 195 ? 108.275 93.444  143.625 1.00 500.00 ? 195 GLY C O   1 
ATOM 9052  N N   . SER C 3 196 ? 109.246 91.795  142.421 1.00 429.58 ? 196 SER C N   1 
ATOM 9053  C CA  . SER C 3 196 ? 110.636 92.206  142.671 1.00 396.08 ? 196 SER C CA  1 
ATOM 9054  C C   . SER C 3 196 ? 110.854 93.630  142.188 1.00 390.50 ? 196 SER C C   1 
ATOM 9055  O O   . SER C 3 196 ? 111.437 94.456  142.896 1.00 352.17 ? 196 SER C O   1 
ATOM 9056  C CB  . SER C 3 196 ? 111.622 91.244  142.010 1.00 396.72 ? 196 SER C CB  1 
ATOM 9057  O OG  . SER C 3 196 ? 111.589 89.979  142.645 1.00 430.28 ? 196 SER C OG  1 
ATOM 9058  N N   . HIS C 3 197 ? 110.373 93.882  140.979 1.00 396.27 ? 197 HIS C N   1 
ATOM 9059  C CA  . HIS C 3 197 ? 110.469 95.195  140.330 1.00 409.91 ? 197 HIS C CA  1 
ATOM 9060  C C   . HIS C 3 197 ? 109.816 96.262  141.214 1.00 413.64 ? 197 HIS C C   1 
ATOM 9061  O O   . HIS C 3 197 ? 110.389 97.340  141.459 1.00 379.66 ? 197 HIS C O   1 
ATOM 9062  C CB  . HIS C 3 197 ? 109.757 95.150  138.962 1.00 402.17 ? 197 HIS C CB  1 
ATOM 9063  C CG  . HIS C 3 197 ? 110.226 96.184  137.985 1.00 389.15 ? 197 HIS C CG  1 
ATOM 9064  N ND1 . HIS C 3 197 ? 110.343 97.521  138.297 1.00 358.80 ? 197 HIS C ND1 1 
ATOM 9065  C CD2 . HIS C 3 197 ? 110.577 96.074  136.681 1.00 399.72 ? 197 HIS C CD2 1 
ATOM 9066  C CE1 . HIS C 3 197 ? 110.767 98.185  137.238 1.00 366.23 ? 197 HIS C CE1 1 
ATOM 9067  N NE2 . HIS C 3 197 ? 110.915 97.330  136.242 1.00 387.42 ? 197 HIS C NE2 1 
ATOM 9068  N N   . LEU C 3 198 ? 108.617 95.919  141.667 1.00 471.54 ? 198 LEU C N   1 
ATOM 9069  C CA  . LEU C 3 198 ? 107.815 96.797  142.525 1.00 500.00 ? 198 LEU C CA  1 
ATOM 9070  C C   . LEU C 3 198 ? 108.589 97.146  143.797 1.00 461.26 ? 198 LEU C C   1 
ATOM 9071  O O   . LEU C 3 198 ? 108.686 98.295  144.235 1.00 478.04 ? 198 LEU C O   1 
ATOM 9072  C CB  . LEU C 3 198 ? 106.454 96.198  142.898 1.00 500.00 ? 198 LEU C CB  1 
ATOM 9073  C CG  . LEU C 3 198 ? 105.272 96.728  142.085 1.00 500.00 ? 198 LEU C CG  1 
ATOM 9074  C CD1 . LEU C 3 198 ? 105.247 96.107  140.694 1.00 500.00 ? 198 LEU C CD1 1 
ATOM 9075  C CD2 . LEU C 3 198 ? 103.967 96.466  142.825 1.00 500.00 ? 198 LEU C CD2 1 
ATOM 9076  N N   . LEU C 3 199 ? 109.167 96.108  144.383 1.00 425.35 ? 199 LEU C N   1 
ATOM 9077  C CA  . LEU C 3 199 ? 109.922 96.147  145.620 1.00 453.46 ? 199 LEU C CA  1 
ATOM 9078  C C   . LEU C 3 199 ? 111.088 97.023  145.418 1.00 437.67 ? 199 LEU C C   1 
ATOM 9079  O O   . LEU C 3 199 ? 111.308 97.755  146.378 1.00 444.89 ? 199 LEU C O   1 
ATOM 9080  C CB  . LEU C 3 199 ? 110.388 94.738  146.036 1.00 500.00 ? 199 LEU C CB  1 
ATOM 9081  C CG  . LEU C 3 199 ? 111.467 94.592  147.124 1.00 500.00 ? 199 LEU C CG  1 
ATOM 9082  C CD1 . LEU C 3 199 ? 110.971 95.143  148.454 1.00 500.00 ? 199 LEU C CD1 1 
ATOM 9083  C CD2 . LEU C 3 199 ? 111.905 93.140  147.277 1.00 500.00 ? 199 LEU C CD2 1 
ATOM 9084  N N   . THR C 3 200 ? 111.794 96.992  144.284 1.00 411.46 ? 200 THR C N   1 
ATOM 9085  C CA  . THR C 3 200 ? 112.955 97.855  144.078 1.00 429.03 ? 200 THR C CA  1 
ATOM 9086  C C   . THR C 3 200 ? 112.562 99.340  144.229 1.00 398.01 ? 200 THR C C   1 
ATOM 9087  O O   . THR C 3 200 ? 113.213 100.144 144.923 1.00 408.15 ? 200 THR C O   1 
ATOM 9088  C CB  . THR C 3 200 ? 113.568 97.718  142.677 1.00 448.20 ? 200 THR C CB  1 
ATOM 9089  O OG1 . THR C 3 200 ? 112.595 98.052  141.680 1.00 409.22 ? 200 THR C OG1 1 
ATOM 9090  C CG2 . THR C 3 200 ? 114.081 96.329  142.446 1.00 472.78 ? 200 THR C CG2 1 
ATOM 9091  N N   . SER C 3 201 ? 111.471 99.644  143.543 1.00 345.71 ? 201 SER C N   1 
ATOM 9092  C CA  . SER C 3 201 ? 110.901 101.001 143.531 1.00 379.94 ? 201 SER C CA  1 
ATOM 9093  C C   . SER C 3 201 ? 110.548 101.433 144.948 1.00 387.17 ? 201 SER C C   1 
ATOM 9094  O O   . SER C 3 201 ? 110.857 102.558 145.357 1.00 324.13 ? 201 SER C O   1 
ATOM 9095  C CB  . SER C 3 201 ? 109.735 101.134 142.547 1.00 431.11 ? 201 SER C CB  1 
ATOM 9096  O OG  . SER C 3 201 ? 110.233 101.273 141.226 1.00 420.65 ? 201 SER C OG  1 
ATOM 9097  N N   . GLY C 3 202 ? 109.908 100.519 145.666 1.00 397.25 ? 202 GLY C N   1 
ATOM 9098  C CA  . GLY C 3 202 ? 109.496 100.735 147.054 1.00 372.97 ? 202 GLY C CA  1 
ATOM 9099  C C   . GLY C 3 202 ? 110.702 101.086 147.916 1.00 346.61 ? 202 GLY C C   1 
ATOM 9100  O O   . GLY C 3 202 ? 110.676 102.035 148.708 1.00 359.52 ? 202 GLY C O   1 
ATOM 9101  N N   . LEU C 3 203 ? 111.745 100.291 147.735 1.00 358.11 ? 203 LEU C N   1 
ATOM 9102  C CA  . LEU C 3 203 ? 113.009 100.446 148.466 1.00 421.59 ? 203 LEU C CA  1 
ATOM 9103  C C   . LEU C 3 203 ? 113.585 101.836 148.215 1.00 395.70 ? 203 LEU C C   1 
ATOM 9104  O O   . LEU C 3 203 ? 114.001 102.541 149.159 1.00 387.46 ? 203 LEU C O   1 
ATOM 9105  C CB  . LEU C 3 203 ? 113.999 99.330  148.121 1.00 438.00 ? 203 LEU C CB  1 
ATOM 9106  C CG  . LEU C 3 203 ? 113.603 97.963  148.694 1.00 474.08 ? 203 LEU C CG  1 
ATOM 9107  C CD1 . LEU C 3 203 ? 114.326 96.819  147.990 1.00 500.00 ? 203 LEU C CD1 1 
ATOM 9108  C CD2 . LEU C 3 203 ? 113.831 97.902  150.202 1.00 490.52 ? 203 LEU C CD2 1 
ATOM 9109  N N   . THR C 3 204 ? 113.582 102.207 146.942 1.00 354.43 ? 204 THR C N   1 
ATOM 9110  C CA  . THR C 3 204 ? 114.094 103.506 146.494 1.00 375.39 ? 204 THR C CA  1 
ATOM 9111  C C   . THR C 3 204 ? 113.348 104.626 147.168 1.00 401.60 ? 204 THR C C   1 
ATOM 9112  O O   . THR C 3 204 ? 113.974 105.580 147.633 1.00 457.17 ? 204 THR C O   1 
ATOM 9113  C CB  . THR C 3 204 ? 114.075 103.692 144.969 1.00 407.80 ? 204 THR C CB  1 
ATOM 9114  O OG1 . THR C 3 204 ? 112.731 103.691 144.481 1.00 375.41 ? 204 THR C OG1 1 
ATOM 9115  C CG2 . THR C 3 204 ? 114.902 102.611 144.273 1.00 465.20 ? 204 THR C CG2 1 
ATOM 9116  N N   . PHE C 3 205 ? 112.016 104.489 147.208 1.00 374.26 ? 205 PHE C N   1 
ATOM 9117  C CA  . PHE C 3 205 ? 111.148 105.457 147.907 1.00 391.80 ? 205 PHE C CA  1 
ATOM 9118  C C   . PHE C 3 205 ? 111.632 105.784 149.307 1.00 402.67 ? 205 PHE C C   1 
ATOM 9119  O O   . PHE C 3 205 ? 111.640 106.936 149.680 1.00 347.34 ? 205 PHE C O   1 
ATOM 9120  C CB  . PHE C 3 205 ? 109.703 104.957 148.089 1.00 400.53 ? 205 PHE C CB  1 
ATOM 9121  C CG  . PHE C 3 205 ? 108.902 104.827 146.823 1.00 408.99 ? 205 PHE C CG  1 
ATOM 9122  C CD1 . PHE C 3 205 ? 108.987 105.764 145.803 1.00 374.90 ? 205 PHE C CD1 1 
ATOM 9123  C CD2 . PHE C 3 205 ? 107.985 103.795 146.694 1.00 450.13 ? 205 PHE C CD2 1 
ATOM 9124  C CE1 . PHE C 3 205 ? 108.221 105.645 144.657 1.00 409.97 ? 205 PHE C CE1 1 
ATOM 9125  C CE2 . PHE C 3 205 ? 107.212 103.663 145.551 1.00 473.05 ? 205 PHE C CE2 1 
ATOM 9126  C CZ  . PHE C 3 205 ? 107.329 104.591 144.529 1.00 442.63 ? 205 PHE C CZ  1 
ATOM 9127  N N   . LEU C 3 206 ? 112.094 104.764 150.025 1.00 434.17 ? 206 LEU C N   1 
ATOM 9128  C CA  . LEU C 3 206 ? 112.753 104.941 151.312 1.00 468.94 ? 206 LEU C CA  1 
ATOM 9129  C C   . LEU C 3 206 ? 114.246 105.209 151.093 1.00 428.40 ? 206 LEU C C   1 
ATOM 9130  O O   . LEU C 3 206 ? 115.090 104.554 151.699 1.00 453.02 ? 206 LEU C O   1 
ATOM 9131  C CB  . LEU C 3 206 ? 112.550 103.700 152.200 1.00 500.00 ? 206 LEU C CB  1 
ATOM 9132  C CG  . LEU C 3 206 ? 111.150 103.388 152.751 1.00 500.00 ? 206 LEU C CG  1 
ATOM 9133  C CD1 . LEU C 3 206 ? 110.173 102.847 151.709 1.00 500.00 ? 206 LEU C CD1 1 
ATOM 9134  C CD2 . LEU C 3 206 ? 111.293 102.395 153.897 1.00 500.00 ? 206 LEU C CD2 1 
ATOM 9135  N N   . ASN C 3 207 ? 114.572 106.181 150.240 1.00 405.98 ? 207 ASN C N   1 
ATOM 9136  C CA  . ASN C 3 207 ? 115.971 106.482 149.922 1.00 437.88 ? 207 ASN C CA  1 
ATOM 9137  C C   . ASN C 3 207 ? 116.737 107.038 151.116 1.00 398.23 ? 207 ASN C C   1 
ATOM 9138  O O   . ASN C 3 207 ? 117.825 106.562 151.412 1.00 376.43 ? 207 ASN C O   1 
ATOM 9139  C CB  . ASN C 3 207 ? 116.104 107.448 148.735 1.00 485.01 ? 207 ASN C CB  1 
ATOM 9140  C CG  . ASN C 3 207 ? 117.082 106.941 147.694 1.00 500.00 ? 207 ASN C CG  1 
ATOM 9141  O OD1 . ASN C 3 207 ? 118.248 106.704 147.991 1.00 500.00 ? 207 ASN C OD1 1 
ATOM 9142  N ND2 . ASN C 3 207 ? 116.604 106.745 146.473 1.00 500.00 ? 207 ASN C ND2 1 
ATOM 9143  N N   . PRO C 3 208 ? 116.159 108.030 151.816 1.00 388.52 ? 208 PRO C N   1 
ATOM 9144  C CA  . PRO C 3 208 ? 116.857 108.618 152.955 1.00 401.75 ? 208 PRO C CA  1 
ATOM 9145  C C   . PRO C 3 208 ? 117.322 107.606 154.003 1.00 395.27 ? 208 PRO C C   1 
ATOM 9146  O O   . PRO C 3 208 ? 118.367 107.807 154.616 1.00 452.11 ? 208 PRO C O   1 
ATOM 9147  C CB  . PRO C 3 208 ? 115.806 109.551 153.563 1.00 445.52 ? 208 PRO C CB  1 
ATOM 9148  C CG  . PRO C 3 208 ? 114.915 109.894 152.430 1.00 456.98 ? 208 PRO C CG  1 
ATOM 9149  C CD  . PRO C 3 208 ? 114.826 108.632 151.636 1.00 417.87 ? 208 PRO C CD  1 
ATOM 9150  N N   . TRP C 3 209 ? 116.549 106.544 154.205 1.00 389.76 ? 209 TRP C N   1 
ATOM 9151  C CA  . TRP C 3 209 ? 116.907 105.487 155.149 1.00 431.10 ? 209 TRP C CA  1 
ATOM 9152  C C   . TRP C 3 209 ? 117.805 104.447 154.444 1.00 417.73 ? 209 TRP C C   1 
ATOM 9153  O O   . TRP C 3 209 ? 117.347 103.389 154.007 1.00 396.47 ? 209 TRP C O   1 
ATOM 9154  C CB  . TRP C 3 209 ? 115.625 104.865 155.726 1.00 459.68 ? 209 TRP C CB  1 
ATOM 9155  C CG  . TRP C 3 209 ? 115.743 104.278 157.104 1.00 450.18 ? 209 TRP C CG  1 
ATOM 9156  C CD1 . TRP C 3 209 ? 116.884 103.873 157.746 1.00 422.17 ? 209 TRP C CD1 1 
ATOM 9157  C CD2 . TRP C 3 209 ? 114.660 104.000 157.994 1.00 442.93 ? 209 TRP C CD2 1 
ATOM 9158  N NE1 . TRP C 3 209 ? 116.575 103.376 158.989 1.00 411.93 ? 209 TRP C NE1 1 
ATOM 9159  C CE2 . TRP C 3 209 ? 115.218 103.439 159.168 1.00 443.67 ? 209 TRP C CE2 1 
ATOM 9160  C CE3 . TRP C 3 209 ? 113.271 104.177 157.917 1.00 420.86 ? 209 TRP C CE3 1 
ATOM 9161  C CZ2 . TRP C 3 209 ? 114.430 103.049 160.258 1.00 462.00 ? 209 TRP C CZ2 1 
ATOM 9162  C CZ3 . TRP C 3 209 ? 112.486 103.789 158.999 1.00 445.86 ? 209 TRP C CZ3 1 
ATOM 9163  C CH2 . TRP C 3 209 ? 113.071 103.231 160.156 1.00 465.36 ? 209 TRP C CH2 1 
ATOM 9164  N N   . TYR C 3 210 ? 119.095 104.765 154.345 1.00 413.23 ? 210 TYR C N   1 
ATOM 9165  C CA  . TYR C 3 210 ? 120.061 103.942 153.597 1.00 413.69 ? 210 TYR C CA  1 
ATOM 9166  C C   . TYR C 3 210 ? 120.528 102.694 154.335 1.00 398.65 ? 210 TYR C C   1 
ATOM 9167  O O   . TYR C 3 210 ? 121.255 101.883 153.764 1.00 406.45 ? 210 TYR C O   1 
ATOM 9168  C CB  . TYR C 3 210 ? 121.277 104.775 153.194 1.00 437.59 ? 210 TYR C CB  1 
ATOM 9169  C CG  . TYR C 3 210 ? 120.934 105.937 152.289 1.00 465.17 ? 210 TYR C CG  1 
ATOM 9170  C CD1 . TYR C 3 210 ? 120.798 105.760 150.910 1.00 445.99 ? 210 TYR C CD1 1 
ATOM 9171  C CD2 . TYR C 3 210 ? 120.744 107.217 152.811 1.00 467.85 ? 210 TYR C CD2 1 
ATOM 9172  C CE1 . TYR C 3 210 ? 120.499 106.829 150.075 1.00 387.84 ? 210 TYR C CE1 1 
ATOM 9173  C CE2 . TYR C 3 210 ? 120.431 108.288 151.988 1.00 449.67 ? 210 TYR C CE2 1 
ATOM 9174  C CZ  . TYR C 3 210 ? 120.312 108.089 150.625 1.00 438.29 ? 210 TYR C CZ  1 
ATOM 9175  O OH  . TYR C 3 210 ? 120.006 109.155 149.820 1.00 495.65 ? 210 TYR C OH  1 
ATOM 9176  N N   . GLU C 3 211 ? 120.146 102.556 155.603 1.00 461.64 ? 211 GLU C N   1 
ATOM 9177  C CA  . GLU C 3 211 ? 120.207 101.267 156.289 1.00 500.00 ? 211 GLU C CA  1 
ATOM 9178  C C   . GLU C 3 211 ? 119.315 100.297 155.521 1.00 500.00 ? 211 GLU C C   1 
ATOM 9179  O O   . GLU C 3 211 ? 119.790 99.298  154.973 1.00 500.00 ? 211 GLU C O   1 
ATOM 9180  C CB  . GLU C 3 211 ? 119.742 101.398 157.755 1.00 500.00 ? 211 GLU C CB  1 
ATOM 9181  C CG  . GLU C 3 211 ? 119.609 100.084 158.542 1.00 500.00 ? 211 GLU C CG  1 
ATOM 9182  C CD  . GLU C 3 211 ? 118.176 99.557  158.651 1.00 500.00 ? 211 GLU C CD  1 
ATOM 9183  O OE1 . GLU C 3 211 ? 117.291 100.312 159.113 1.00 500.00 ? 211 GLU C OE1 1 
ATOM 9184  O OE2 . GLU C 3 211 ? 117.940 98.377  158.299 1.00 500.00 ? 211 GLU C OE2 1 
ATOM 9185  N N   . ALA C 3 212 ? 118.029 100.633 155.460 1.00 500.00 ? 212 ALA C N   1 
ATOM 9186  C CA  . ALA C 3 212 ? 117.032 99.811  154.800 1.00 498.66 ? 212 ALA C CA  1 
ATOM 9187  C C   . ALA C 3 212 ? 116.649 100.454 153.476 1.00 428.69 ? 212 ALA C C   1 
ATOM 9188  O O   . ALA C 3 212 ? 115.516 100.917 153.296 1.00 405.46 ? 212 ALA C O   1 
ATOM 9189  C CB  . ALA C 3 212 ? 115.815 99.633  155.700 1.00 500.00 ? 212 ALA C CB  1 
ATOM 9190  N N   . SER C 3 213 ? 117.613 100.514 152.563 1.00 382.93 ? 213 SER C N   1 
ATOM 9191  C CA  . SER C 3 213 ? 117.291 100.756 151.130 1.00 410.19 ? 213 SER C CA  1 
ATOM 9192  C C   . SER C 3 213 ? 118.236 100.126 150.074 1.00 410.19 ? 213 SER C C   1 
ATOM 9193  O O   . SER C 3 213 ? 117.878 99.141  149.377 1.00 375.97 ? 213 SER C O   1 
ATOM 9194  C CB  . SER C 3 213 ? 117.118 102.271 150.893 1.00 404.78 ? 213 SER C CB  1 
ATOM 9195  O OG  . SER C 3 213 ? 116.649 102.570 149.583 1.00 362.29 ? 213 SER C OG  1 
ATOM 9196  N N   . LEU C 3 214 ? 119.381 100.797 149.920 1.00 406.18 ? 214 LEU C N   1 
ATOM 9197  C CA  . LEU C 3 214 ? 120.324 100.469 148.852 1.00 430.42 ? 214 LEU C CA  1 
ATOM 9198  C C   . LEU C 3 214 ? 120.813 99.022  149.042 1.00 460.40 ? 214 LEU C C   1 
ATOM 9199  O O   . LEU C 3 214 ? 120.883 98.256  148.071 1.00 496.08 ? 214 LEU C O   1 
ATOM 9200  C CB  . LEU C 3 214 ? 121.511 101.433 148.810 1.00 445.37 ? 214 LEU C CB  1 
ATOM 9201  C CG  . LEU C 3 214 ? 122.573 101.128 147.728 1.00 470.41 ? 214 LEU C CG  1 
ATOM 9202  C CD1 . LEU C 3 214 ? 122.036 101.334 146.306 1.00 391.54 ? 214 LEU C CD1 1 
ATOM 9203  C CD2 . LEU C 3 214 ? 123.848 101.935 147.965 1.00 500.00 ? 214 LEU C CD2 1 
ATOM 9204  N N   . LEU C 3 215 ? 121.135 98.684  150.277 1.00 487.07 ? 215 LEU C N   1 
ATOM 9205  C CA  . LEU C 3 215 ? 121.636 97.334  150.544 1.00 500.00 ? 215 LEU C CA  1 
ATOM 9206  C C   . LEU C 3 215 ? 120.576 96.298  150.260 1.00 454.84 ? 215 LEU C C   1 
ATOM 9207  O O   . LEU C 3 215 ? 120.914 95.260  149.671 1.00 448.76 ? 215 LEU C O   1 
ATOM 9208  C CB  . LEU C 3 215 ? 122.284 97.203  151.932 1.00 500.00 ? 215 LEU C CB  1 
ATOM 9209  C CG  . LEU C 3 215 ? 123.813 97.434  151.894 1.00 500.00 ? 215 LEU C CG  1 
ATOM 9210  C CD1 . LEU C 3 215 ? 124.180 98.804  151.317 1.00 500.00 ? 215 LEU C CD1 1 
ATOM 9211  C CD2 . LEU C 3 215 ? 124.453 97.239  153.267 1.00 500.00 ? 215 LEU C CD2 1 
ATOM 9212  N N   . PRO C 3 216 ? 119.321 96.607  150.614 1.00 405.59 ? 216 PRO C N   1 
ATOM 9213  C CA  . PRO C 3 216 ? 118.197 95.721  150.317 1.00 415.77 ? 216 PRO C CA  1 
ATOM 9214  C C   . PRO C 3 216 ? 118.090 95.470  148.817 1.00 407.50 ? 216 PRO C C   1 
ATOM 9215  O O   . PRO C 3 216 ? 117.920 94.324  148.373 1.00 406.04 ? 216 PRO C O   1 
ATOM 9216  C CB  . PRO C 3 216 ? 116.994 96.487  150.846 1.00 432.12 ? 216 PRO C CB  1 
ATOM 9217  C CG  . PRO C 3 216 ? 117.531 97.245  152.001 1.00 431.68 ? 216 PRO C CG  1 
ATOM 9218  C CD  . PRO C 3 216 ? 119.015 97.424  151.808 1.00 400.69 ? 216 PRO C CD  1 
ATOM 9219  N N   . ILE C 3 217 ? 118.199 96.565  148.075 1.00 405.52 ? 217 ILE C N   1 
ATOM 9220  C CA  . ILE C 3 217 ? 118.126 96.532  146.609 1.00 425.16 ? 217 ILE C CA  1 
ATOM 9221  C C   . ILE C 3 217 ? 119.215 95.621  146.048 1.00 412.68 ? 217 ILE C C   1 
ATOM 9222  O O   . ILE C 3 217 ? 118.956 94.792  145.172 1.00 358.60 ? 217 ILE C O   1 
ATOM 9223  C CB  . ILE C 3 217 ? 118.061 97.924  145.954 1.00 445.10 ? 217 ILE C CB  1 
ATOM 9224  C CG1 . ILE C 3 217 ? 116.759 98.615  146.368 1.00 448.23 ? 217 ILE C CG1 1 
ATOM 9225  C CG2 . ILE C 3 217 ? 118.083 97.803  144.433 1.00 445.97 ? 217 ILE C CG2 1 
ATOM 9226  C CD1 . ILE C 3 217 ? 116.814 100.116 146.283 1.00 486.00 ? 217 ILE C CD1 1 
ATOM 9227  N N   . TYR C 3 218 ? 120.412 95.801  146.583 1.00 435.10 ? 218 TYR C N   1 
ATOM 9228  C CA  . TYR C 3 218 ? 121.590 95.021  146.187 1.00 452.14 ? 218 TYR C CA  1 
ATOM 9229  C C   . TYR C 3 218 ? 121.330 93.532  146.406 1.00 476.25 ? 218 TYR C C   1 
ATOM 9230  O O   . TYR C 3 218 ? 121.613 92.703  145.535 1.00 455.34 ? 218 TYR C O   1 
ATOM 9231  C CB  . TYR C 3 218 ? 122.855 95.486  146.934 1.00 480.10 ? 218 TYR C CB  1 
ATOM 9232  C CG  . TYR C 3 218 ? 123.865 96.179  146.044 1.00 473.90 ? 218 TYR C CG  1 
ATOM 9233  C CD1 . TYR C 3 218 ? 123.579 97.408  145.450 1.00 431.33 ? 218 TYR C CD1 1 
ATOM 9234  C CD2 . TYR C 3 218 ? 125.110 95.597  145.791 1.00 500.00 ? 218 TYR C CD2 1 
ATOM 9235  C CE1 . TYR C 3 218 ? 124.510 98.038  144.633 1.00 469.48 ? 218 TYR C CE1 1 
ATOM 9236  C CE2 . TYR C 3 218 ? 126.044 96.216  144.976 1.00 500.00 ? 218 TYR C CE2 1 
ATOM 9237  C CZ  . TYR C 3 218 ? 125.744 97.433  144.399 1.00 494.29 ? 218 TYR C CZ  1 
ATOM 9238  O OH  . TYR C 3 218 ? 126.686 98.028  143.591 1.00 489.53 ? 218 TYR C OH  1 
ATOM 9239  N N   . ALA C 3 219 ? 120.793 93.238  147.580 1.00 500.00 ? 219 ALA C N   1 
ATOM 9240  C CA  . ALA C 3 219 ? 120.461 91.869  147.988 1.00 500.00 ? 219 ALA C CA  1 
ATOM 9241  C C   . ALA C 3 219 ? 119.487 91.247  146.987 1.00 439.25 ? 219 ALA C C   1 
ATOM 9242  O O   . ALA C 3 219 ? 119.668 90.104  146.539 1.00 386.88 ? 219 ALA C O   1 
ATOM 9243  C CB  . ALA C 3 219 ? 119.873 91.848  149.395 1.00 500.00 ? 219 ALA C CB  1 
ATOM 9244  N N   . VAL C 3 220 ? 118.469 92.034  146.663 1.00 367.74 ? 220 VAL C N   1 
ATOM 9245  C CA  . VAL C 3 220 ? 117.423 91.633  145.715 1.00 392.32 ? 220 VAL C CA  1 
ATOM 9246  C C   . VAL C 3 220 ? 118.042 91.278  144.369 1.00 359.27 ? 220 VAL C C   1 
ATOM 9247  O O   . VAL C 3 220 ? 117.719 90.246  143.764 1.00 373.77 ? 220 VAL C O   1 
ATOM 9248  C CB  . VAL C 3 220 ? 116.375 92.756  145.489 1.00 450.39 ? 220 VAL C CB  1 
ATOM 9249  C CG1 . VAL C 3 220 ? 115.414 92.388  144.357 1.00 483.17 ? 220 VAL C CG1 1 
ATOM 9250  C CG2 . VAL C 3 220 ? 115.602 93.060  146.774 1.00 492.20 ? 220 VAL C CG2 1 
ATOM 9251  N N   . THR C 3 221 ? 118.925 92.159  143.929 1.00 409.52 ? 221 THR C N   1 
ATOM 9252  C CA  . THR C 3 221 ? 119.649 92.016  142.658 1.00 476.40 ? 221 THR C CA  1 
ATOM 9253  C C   . THR C 3 221 ? 120.415 90.701  142.638 1.00 476.78 ? 221 THR C C   1 
ATOM 9254  O O   . THR C 3 221 ? 120.370 89.949  141.661 1.00 499.52 ? 221 THR C O   1 
ATOM 9255  C CB  . THR C 3 221 ? 120.722 93.132  142.503 1.00 476.60 ? 221 THR C CB  1 
ATOM 9256  O OG1 . THR C 3 221 ? 120.226 94.379  143.005 1.00 479.58 ? 221 THR C OG1 1 
ATOM 9257  C CG2 . THR C 3 221 ? 121.145 93.298  141.054 1.00 490.91 ? 221 THR C CG2 1 
ATOM 9258  N N   . VAL C 3 222 ? 121.116 90.467  143.738 1.00 450.94 ? 222 VAL C N   1 
ATOM 9259  C CA  . VAL C 3 222 ? 121.932 89.261  143.926 1.00 464.93 ? 222 VAL C CA  1 
ATOM 9260  C C   . VAL C 3 222 ? 121.052 88.013  143.789 1.00 411.43 ? 222 VAL C C   1 
ATOM 9261  O O   . VAL C 3 222 ? 121.422 87.055  143.085 1.00 402.51 ? 222 VAL C O   1 
ATOM 9262  C CB  . VAL C 3 222 ? 122.687 89.267  145.282 1.00 500.00 ? 222 VAL C CB  1 
ATOM 9263  C CG1 . VAL C 3 222 ? 123.305 87.900  145.591 1.00 500.00 ? 222 VAL C CG1 1 
ATOM 9264  C CG2 . VAL C 3 222 ? 123.760 90.355  145.293 1.00 500.00 ? 222 VAL C CG2 1 
ATOM 9265  N N   . SER C 3 223 ? 119.923 88.072  144.471 1.00 397.25 ? 223 SER C N   1 
ATOM 9266  C CA  . SER C 3 223 ? 118.943 86.979  144.466 1.00 449.79 ? 223 SER C CA  1 
ATOM 9267  C C   . SER C 3 223 ? 118.490 86.673  143.011 1.00 409.64 ? 223 SER C C   1 
ATOM 9268  O O   . SER C 3 223 ? 118.465 85.529  142.475 1.00 396.49 ? 223 SER C O   1 
ATOM 9269  C CB  . SER C 3 223 ? 117.738 87.337  145.349 1.00 476.22 ? 223 SER C CB  1 
ATOM 9270  O OG  . SER C 3 223 ? 116.823 86.260  145.452 1.00 500.00 ? 223 SER C OG  1 
ATOM 9271  N N   . MET C 3 224 ? 118.128 87.788  142.383 1.00 388.00 ? 224 MET C N   1 
ATOM 9272  C CA  . MET C 3 224 ? 117.644 87.781  140.985 1.00 377.47 ? 224 MET C CA  1 
ATOM 9273  C C   . MET C 3 224 ? 118.740 87.279  140.099 1.00 361.16 ? 224 MET C C   1 
ATOM 9274  O O   . MET C 3 224 ? 118.427 86.483  139.211 1.00 408.33 ? 224 MET C O   1 
ATOM 9275  C CB  . MET C 3 224 ? 117.163 89.161  140.529 1.00 424.72 ? 224 MET C CB  1 
ATOM 9276  C CG  . MET C 3 224 ? 116.168 89.116  139.379 1.00 430.36 ? 224 MET C CG  1 
ATOM 9277  S SD  . MET C 3 224 ? 114.714 88.079  139.682 1.00 485.56 ? 224 MET C SD  1 
ATOM 9278  C CE  . MET C 3 224 ? 114.303 88.473  141.383 1.00 484.05 ? 224 MET C CE  1 
ATOM 9279  N N   . GLY C 3 225 ? 119.981 87.705  140.331 1.00 382.25 ? 225 GLY C N   1 
ATOM 9280  C CA  . GLY C 3 225 ? 121.133 87.263  139.544 1.00 433.56 ? 225 GLY C CA  1 
ATOM 9281  C C   . GLY C 3 225 ? 121.265 85.749  139.605 1.00 453.13 ? 225 GLY C C   1 
ATOM 9282  O O   . GLY C 3 225 ? 121.457 85.084  138.579 1.00 476.98 ? 225 GLY C O   1 
ATOM 9283  N N   . LEU C 3 226 ? 121.155 85.238  140.825 1.00 431.02 ? 226 LEU C N   1 
ATOM 9284  C CA  . LEU C 3 226 ? 121.256 83.802  141.104 1.00 408.99 ? 226 LEU C CA  1 
ATOM 9285  C C   . LEU C 3 226 ? 120.192 83.044  140.302 1.00 377.88 ? 226 LEU C C   1 
ATOM 9286  O O   . LEU C 3 226 ? 120.484 82.018  139.657 1.00 376.94 ? 226 LEU C O   1 
ATOM 9287  C CB  . LEU C 3 226 ? 121.063 83.529  142.597 1.00 474.30 ? 226 LEU C CB  1 
ATOM 9288  C CG  . LEU C 3 226 ? 121.207 82.088  143.087 1.00 500.00 ? 226 LEU C CG  1 
ATOM 9289  C CD1 . LEU C 3 226 ? 122.649 81.626  142.943 1.00 500.00 ? 226 LEU C CD1 1 
ATOM 9290  C CD2 . LEU C 3 226 ? 120.735 81.966  144.530 1.00 500.00 ? 226 LEU C CD2 1 
ATOM 9291  N N   . TRP C 3 227 ? 118.976 83.585  140.370 1.00 378.85 ? 227 TRP C N   1 
ATOM 9292  C CA  . TRP C 3 227 ? 117.826 83.001  139.682 1.00 379.47 ? 227 TRP C CA  1 
ATOM 9293  C C   . TRP C 3 227 ? 118.092 82.927  138.174 1.00 378.85 ? 227 TRP C C   1 
ATOM 9294  O O   . TRP C 3 227 ? 117.840 81.898  137.531 1.00 367.93 ? 227 TRP C O   1 
ATOM 9295  C CB  . TRP C 3 227 ? 116.507 83.686  140.035 1.00 373.60 ? 227 TRP C CB  1 
ATOM 9296  C CG  . TRP C 3 227 ? 115.296 82.824  139.754 1.00 411.38 ? 227 TRP C CG  1 
ATOM 9297  C CD1 . TRP C 3 227 ? 115.272 81.476  139.466 1.00 415.93 ? 227 TRP C CD1 1 
ATOM 9298  C CD2 . TRP C 3 227 ? 113.930 83.246  139.767 1.00 468.53 ? 227 TRP C CD2 1 
ATOM 9299  N NE1 . TRP C 3 227 ? 113.981 81.052  139.281 1.00 441.72 ? 227 TRP C NE1 1 
ATOM 9300  C CE2 . TRP C 3 227 ? 113.136 82.114  139.462 1.00 481.26 ? 227 TRP C CE2 1 
ATOM 9301  C CE3 . TRP C 3 227 ? 113.297 84.475  140.002 1.00 477.03 ? 227 TRP C CE3 1 
ATOM 9302  C CZ2 . TRP C 3 227 ? 111.739 82.177  139.386 1.00 494.29 ? 227 TRP C CZ2 1 
ATOM 9303  C CZ3 . TRP C 3 227 ? 111.906 84.538  139.921 1.00 467.73 ? 227 TRP C CZ3 1 
ATOM 9304  C CH2 . TRP C 3 227 ? 111.144 83.394  139.616 1.00 488.53 ? 227 TRP C CH2 1 
ATOM 9305  N N   . ALA C 3 228 ? 118.606 84.032  137.656 1.00 415.78 ? 228 ALA C N   1 
ATOM 9306  C CA  . ALA C 3 228 ? 118.941 84.167  136.234 1.00 435.56 ? 228 ALA C CA  1 
ATOM 9307  C C   . ALA C 3 228 ? 119.943 83.096  135.827 1.00 438.98 ? 228 ALA C C   1 
ATOM 9308  O O   . ALA C 3 228 ? 119.782 82.435  134.792 1.00 467.99 ? 228 ALA C O   1 
ATOM 9309  C CB  . ALA C 3 228 ? 119.477 85.559  135.920 1.00 471.87 ? 228 ALA C CB  1 
ATOM 9310  N N   . PHE C 3 229 ? 120.962 82.954  136.665 1.00 404.22 ? 229 PHE C N   1 
ATOM 9311  C CA  . PHE C 3 229 ? 122.033 81.975  136.451 1.00 421.59 ? 229 PHE C CA  1 
ATOM 9312  C C   . PHE C 3 229 ? 121.450 80.570  136.370 1.00 406.53 ? 229 PHE C C   1 
ATOM 9313  O O   . PHE C 3 229 ? 121.798 79.788  135.474 1.00 399.33 ? 229 PHE C O   1 
ATOM 9314  C CB  . PHE C 3 229 ? 123.131 82.039  137.497 1.00 458.69 ? 229 PHE C CB  1 
ATOM 9315  C CG  . PHE C 3 229 ? 124.331 81.250  137.101 1.00 500.00 ? 229 PHE C CG  1 
ATOM 9316  C CD1 . PHE C 3 229 ? 124.416 79.892  137.400 1.00 500.00 ? 229 PHE C CD1 1 
ATOM 9317  C CD2 . PHE C 3 229 ? 125.338 81.842  136.347 1.00 500.00 ? 229 PHE C CD2 1 
ATOM 9318  C CE1 . PHE C 3 229 ? 125.510 79.146  136.995 1.00 500.00 ? 229 PHE C CE1 1 
ATOM 9319  C CE2 . PHE C 3 229 ? 126.438 81.103  135.940 1.00 500.00 ? 229 PHE C CE2 1 
ATOM 9320  C CZ  . PHE C 3 229 ? 126.524 79.752  136.263 1.00 500.00 ? 229 PHE C CZ  1 
ATOM 9321  N N   . ILE C 3 230 ? 120.564 80.288  137.319 1.00 407.75 ? 230 ILE C N   1 
ATOM 9322  C CA  . ILE C 3 230 ? 119.888 78.989  137.414 1.00 434.43 ? 230 ILE C CA  1 
ATOM 9323  C C   . ILE C 3 230 ? 119.125 78.702  136.121 1.00 406.54 ? 230 ILE C C   1 
ATOM 9324  O O   . ILE C 3 230 ? 119.207 77.597  135.563 1.00 439.46 ? 230 ILE C O   1 
ATOM 9325  C CB  . ILE C 3 230 ? 118.934 78.863  138.633 1.00 500.00 ? 230 ILE C CB  1 
ATOM 9326  C CG1 . ILE C 3 230 ? 119.736 78.783  139.936 1.00 500.00 ? 230 ILE C CG1 1 
ATOM 9327  C CG2 . ILE C 3 230 ? 118.046 77.616  138.524 1.00 500.00 ? 230 ILE C CG2 1 
ATOM 9328  C CD1 . ILE C 3 230 ? 118.914 79.022  141.190 1.00 500.00 ? 230 ILE C CD1 1 
ATOM 9329  N N   . THR C 3 231 ? 118.399 79.723  135.679 1.00 420.52 ? 231 THR C N   1 
ATOM 9330  C CA  . THR C 3 231 ? 117.595 79.649  134.455 1.00 420.42 ? 231 THR C CA  1 
ATOM 9331  C C   . THR C 3 231 ? 118.477 79.307  133.263 1.00 394.61 ? 231 THR C C   1 
ATOM 9332  O O   . THR C 3 231 ? 118.138 78.439  132.450 1.00 414.29 ? 231 THR C O   1 
ATOM 9333  C CB  . THR C 3 231 ? 116.783 80.913  134.096 1.00 411.50 ? 231 THR C CB  1 
ATOM 9334  O OG1 . THR C 3 231 ? 117.642 82.050  134.004 1.00 378.54 ? 231 THR C OG1 1 
ATOM 9335  C CG2 . THR C 3 231 ? 115.673 81.162  135.109 1.00 463.57 ? 231 THR C CG2 1 
ATOM 9336  N N   . ALA C 3 232 ? 119.601 80.007  133.195 1.00 400.35 ? 232 ALA C N   1 
ATOM 9337  C CA  . ALA C 3 232 ? 120.587 79.834  132.124 1.00 429.15 ? 232 ALA C CA  1 
ATOM 9338  C C   . ALA C 3 232 ? 121.254 78.443  132.054 1.00 441.45 ? 232 ALA C C   1 
ATOM 9339  O O   . ALA C 3 232 ? 121.148 77.727  131.052 1.00 358.20 ? 232 ALA C O   1 
ATOM 9340  C CB  . ALA C 3 232 ? 121.651 80.926  132.192 1.00 444.75 ? 232 ALA C CB  1 
ATOM 9341  N N   . GLY C 3 233 ? 121.936 78.094  133.148 1.00 491.13 ? 233 GLY C N   1 
ATOM 9342  C CA  . GLY C 3 233 ? 122.758 76.880  133.241 1.00 500.00 ? 233 GLY C CA  1 
ATOM 9343  C C   . GLY C 3 233 ? 122.585 76.097  134.530 1.00 500.00 ? 233 GLY C C   1 
ATOM 9344  O O   . GLY C 3 233 ? 121.540 76.168  135.174 1.00 500.00 ? 233 GLY C O   1 
ATOM 9345  N N   . GLY C 3 234 ? 123.623 75.349  134.906 1.00 500.00 ? 234 GLY C N   1 
ATOM 9346  C CA  . GLY C 3 234 ? 123.550 74.387  136.013 1.00 500.00 ? 234 GLY C CA  1 
ATOM 9347  C C   . GLY C 3 234 ? 123.679 75.001  137.397 1.00 500.00 ? 234 GLY C C   1 
ATOM 9348  O O   . GLY C 3 234 ? 122.910 75.898  137.755 1.00 500.00 ? 234 GLY C O   1 
ATOM 9349  N N   . SER C 3 235 ? 124.644 74.511  138.178 1.00 500.00 ? 235 SER C N   1 
ATOM 9350  C CA  . SER C 3 235 ? 124.832 74.968  139.555 1.00 500.00 ? 235 SER C CA  1 
ATOM 9351  C C   . SER C 3 235 ? 126.318 75.001  139.951 1.00 500.00 ? 235 SER C C   1 
ATOM 9352  O O   . SER C 3 235 ? 127.059 75.852  139.463 1.00 500.00 ? 235 SER C O   1 
ATOM 9353  C CB  . SER C 3 235 ? 123.990 74.110  140.513 1.00 498.28 ? 235 SER C CB  1 
ATOM 9354  O OG  . SER C 3 235 ? 124.365 72.743  140.448 1.00 447.80 ? 235 SER C OG  1 
ATOM 9355  N N   . LEU C 3 236 ? 126.746 74.077  140.811 1.00 500.00 ? 236 LEU C N   1 
ATOM 9356  C CA  . LEU C 3 236 ? 128.041 74.128  141.466 1.00 500.00 ? 236 LEU C CA  1 
ATOM 9357  C C   . LEU C 3 236 ? 129.086 73.417  140.637 1.00 500.00 ? 236 LEU C C   1 
ATOM 9358  O O   . LEU C 3 236 ? 130.230 73.884  140.571 1.00 500.00 ? 236 LEU C O   1 
ATOM 9359  C CB  . LEU C 3 236 ? 127.965 73.474  142.855 1.00 500.00 ? 236 LEU C CB  1 
ATOM 9360  C CG  . LEU C 3 236 ? 126.894 73.973  143.834 1.00 500.00 ? 236 LEU C CG  1 
ATOM 9361  C CD1 . LEU C 3 236 ? 126.804 73.060  145.052 1.00 500.00 ? 236 LEU C CD1 1 
ATOM 9362  C CD2 . LEU C 3 236 ? 127.178 75.411  144.250 1.00 500.00 ? 236 LEU C CD2 1 
ATOM 9363  N N   . ARG C 3 237 ? 128.700 72.260  140.075 1.00 500.00 ? 237 ARG C N   1 
ATOM 9364  C CA  . ARG C 3 237 ? 129.606 71.430  139.293 1.00 500.00 ? 237 ARG C CA  1 
ATOM 9365  C C   . ARG C 3 237 ? 130.180 72.221  138.124 1.00 499.33 ? 237 ARG C C   1 
ATOM 9366  O O   . ARG C 3 237 ? 131.390 72.168  137.874 1.00 500.00 ? 237 ARG C O   1 
ATOM 9367  C CB  . ARG C 3 237 ? 128.923 70.142  138.812 1.00 500.00 ? 237 ARG C CB  1 
ATOM 9368  C CG  . ARG C 3 237 ? 128.692 69.134  139.929 1.00 500.00 ? 237 ARG C CG  1 
ATOM 9369  C CD  . ARG C 3 237 ? 127.747 68.012  139.522 1.00 500.00 ? 237 ARG C CD  1 
ATOM 9370  N NE  . ARG C 3 237 ? 127.334 67.188  140.665 1.00 500.00 ? 237 ARG C NE  1 
ATOM 9371  C CZ  . ARG C 3 237 ? 126.493 66.148  140.606 1.00 500.00 ? 237 ARG C CZ  1 
ATOM 9372  N NH1 . ARG C 3 237 ? 125.942 65.766  139.451 1.00 500.00 ? 237 ARG C NH1 1 
ATOM 9373  N NH2 . ARG C 3 237 ? 126.196 65.478  141.720 1.00 500.00 ? 237 ARG C NH2 1 
ATOM 9374  N N   . SER C 3 238 ? 129.301 72.936  137.442 1.00 439.57 ? 238 SER C N   1 
ATOM 9375  C CA  . SER C 3 238 ? 129.646 73.772  136.301 1.00 418.84 ? 238 SER C CA  1 
ATOM 9376  C C   . SER C 3 238 ? 130.724 74.792  136.692 1.00 405.00 ? 238 SER C C   1 
ATOM 9377  O O   . SER C 3 238 ? 131.740 74.976  136.001 1.00 307.15 ? 238 SER C O   1 
ATOM 9378  C CB  . SER C 3 238 ? 128.386 74.536  135.916 1.00 400.13 ? 238 SER C CB  1 
ATOM 9379  O OG  . SER C 3 238 ? 127.749 75.013  137.094 1.00 318.02 ? 238 SER C OG  1 
ATOM 9380  N N   . ILE C 3 239 ? 130.441 75.438  137.819 1.00 476.08 ? 239 ILE C N   1 
ATOM 9381  C CA  . ILE C 3 239 ? 131.325 76.471  138.377 1.00 500.00 ? 239 ILE C CA  1 
ATOM 9382  C C   . ILE C 3 239 ? 132.710 75.882  138.646 1.00 500.00 ? 239 ILE C C   1 
ATOM 9383  O O   . ILE C 3 239 ? 133.734 76.487  138.298 1.00 500.00 ? 239 ILE C O   1 
ATOM 9384  C CB  . ILE C 3 239 ? 130.726 77.194  139.613 1.00 500.00 ? 239 ILE C CB  1 
ATOM 9385  C CG1 . ILE C 3 239 ? 129.512 78.040  139.186 1.00 500.00 ? 239 ILE C CG1 1 
ATOM 9386  C CG2 . ILE C 3 239 ? 131.765 78.111  140.277 1.00 500.00 ? 239 ILE C CG2 1 
ATOM 9387  C CD1 . ILE C 3 239 ? 128.645 78.532  140.331 1.00 500.00 ? 239 ILE C CD1 1 
ATOM 9388  N N   . GLN C 3 240 ? 132.695 74.708  139.262 1.00 500.00 ? 240 GLN C N   1 
ATOM 9389  C CA  . GLN C 3 240 ? 133.919 73.981  139.610 1.00 500.00 ? 240 GLN C CA  1 
ATOM 9390  C C   . GLN C 3 240 ? 134.743 73.706  138.353 1.00 500.00 ? 240 GLN C C   1 
ATOM 9391  O O   . GLN C 3 240 ? 135.963 73.925  138.327 1.00 500.00 ? 240 GLN C O   1 
ATOM 9392  C CB  . GLN C 3 240 ? 133.631 72.740  140.470 1.00 500.00 ? 240 GLN C CB  1 
ATOM 9393  C CG  . GLN C 3 240 ? 133.281 73.122  141.911 1.00 500.00 ? 240 GLN C CG  1 
ATOM 9394  C CD  . GLN C 3 240 ? 132.948 71.941  142.809 1.00 500.00 ? 240 GLN C CD  1 
ATOM 9395  O OE1 . GLN C 3 240 ? 132.946 70.787  142.377 1.00 500.00 ? 240 GLN C OE1 1 
ATOM 9396  N NE2 . GLN C 3 240 ? 132.662 72.231  144.077 1.00 500.00 ? 240 GLN C NE2 1 
ATOM 9397  N N   . ARG C 3 241 ? 134.041 73.237  137.332 1.00 500.00 ? 241 ARG C N   1 
ATOM 9398  C CA  . ARG C 3 241 ? 134.637 72.912  136.031 1.00 500.00 ? 241 ARG C CA  1 
ATOM 9399  C C   . ARG C 3 241 ? 135.320 74.134  135.448 1.00 500.00 ? 241 ARG C C   1 
ATOM 9400  O O   . ARG C 3 241 ? 136.464 74.072  134.973 1.00 500.00 ? 241 ARG C O   1 
ATOM 9401  C CB  . ARG C 3 241 ? 133.553 72.410  135.058 1.00 500.00 ? 241 ARG C CB  1 
ATOM 9402  C CG  . ARG C 3 241 ? 134.065 71.591  133.880 1.00 500.00 ? 241 ARG C CG  1 
ATOM 9403  C CD  . ARG C 3 241 ? 133.075 71.574  132.720 1.00 500.00 ? 241 ARG C CD  1 
ATOM 9404  N NE  . ARG C 3 241 ? 131.699 71.275  133.132 1.00 500.00 ? 241 ARG C NE  1 
ATOM 9405  C CZ  . ARG C 3 241 ? 130.650 71.224  132.306 1.00 500.00 ? 241 ARG C CZ  1 
ATOM 9406  N NH1 . ARG C 3 241 ? 130.790 71.430  130.996 1.00 497.15 ? 241 ARG C NH1 1 
ATOM 9407  N NH2 . ARG C 3 241 ? 129.442 70.951  132.797 1.00 500.00 ? 241 ARG C NH2 1 
ATOM 9408  N N   . SER C 3 242 ? 134.600 75.252  135.508 1.00 495.71 ? 242 SER C N   1 
ATOM 9409  C CA  . SER C 3 242 ? 135.062 76.545  134.998 1.00 494.76 ? 242 SER C CA  1 
ATOM 9410  C C   . SER C 3 242 ? 136.572 76.811  135.019 1.00 500.00 ? 242 SER C C   1 
ATOM 9411  O O   . SER C 3 242 ? 137.100 77.175  133.996 1.00 500.00 ? 242 SER C O   1 
ATOM 9412  C CB  . SER C 3 242 ? 134.366 77.713  135.704 1.00 500.00 ? 242 SER C CB  1 
ATOM 9413  O OG  . SER C 3 242 ? 134.528 78.919  134.972 1.00 500.00 ? 242 SER C OG  1 
ATOM 9414  N N   . LEU C 3 243 ? 137.234 76.559  136.153 1.00 500.00 ? 243 LEU C N   1 
ATOM 9415  C CA  . LEU C 3 243 ? 138.662 76.918  136.385 1.00 500.00 ? 243 LEU C CA  1 
ATOM 9416  C C   . LEU C 3 243 ? 139.560 77.022  135.131 1.00 500.00 ? 243 LEU C C   1 
ATOM 9417  O O   . LEU C 3 243 ? 140.138 78.084  134.877 1.00 500.00 ? 243 LEU C O   1 
ATOM 9418  C CB  . LEU C 3 243 ? 139.315 75.972  137.424 1.00 500.00 ? 243 LEU C CB  1 
ATOM 9419  C CG  . LEU C 3 243 ? 140.463 76.549  138.290 1.00 471.71 ? 243 LEU C CG  1 
ATOM 9420  C CD1 . LEU C 3 243 ? 140.503 75.883  139.660 1.00 471.08 ? 243 LEU C CD1 1 
ATOM 9421  C CD2 . LEU C 3 243 ? 141.834 76.453  137.625 1.00 423.44 ? 243 LEU C CD2 1 
ATOM 9422  N N   . LEU C 3 244 ? 139.654 75.942  134.352 1.00 500.00 ? 244 LEU C N   1 
ATOM 9423  C CA  . LEU C 3 244 ? 140.565 75.889  133.189 1.00 500.00 ? 244 LEU C CA  1 
ATOM 9424  C C   . LEU C 3 244 ? 140.037 76.701  132.004 1.00 500.00 ? 244 LEU C C   1 
ATOM 9425  O O   . LEU C 3 244 ? 140.333 77.890  131.861 1.00 385.44 ? 244 LEU C O   1 
ATOM 9426  C CB  . LEU C 3 244 ? 140.824 74.431  132.767 1.00 500.00 ? 244 LEU C CB  1 
ATOM 9427  C CG  . LEU C 3 244 ? 142.058 74.149  131.882 1.00 500.00 ? 244 LEU C CG  1 
ATOM 9428  C CD1 . LEU C 3 244 ? 142.657 72.779  132.199 1.00 500.00 ? 244 LEU C CD1 1 
ATOM 9429  C CD2 . LEU C 3 244 ? 141.754 74.267  130.390 1.00 500.00 ? 244 LEU C CD2 1 
ATOM 9430  N N   . ASN D 4 2   ? 137.173 100.905 98.239  1.00 500.00 ? 2   ASN D N   1 
ATOM 9431  C CA  . ASN D 4 2   ? 138.086 100.291 99.250  1.00 500.00 ? 2   ASN D CA  1 
ATOM 9432  C C   . ASN D 4 2   ? 139.503 100.107 98.692  1.00 500.00 ? 2   ASN D C   1 
ATOM 9433  O O   . ASN D 4 2   ? 139.780 100.489 97.549  1.00 500.00 ? 2   ASN D O   1 
ATOM 9434  C CB  . ASN D 4 2   ? 137.514 98.963  99.734  1.00 500.00 ? 2   ASN D CB  1 
ATOM 9435  N N   . LEU D 4 3   ? 140.391 99.535  99.509  1.00 500.00 ? 3   LEU D N   1 
ATOM 9436  C CA  . LEU D 4 3   ? 141.786 99.278  99.123  1.00 500.00 ? 3   LEU D CA  1 
ATOM 9437  C C   . LEU D 4 3   ? 142.072 97.822  98.679  1.00 500.00 ? 3   LEU D C   1 
ATOM 9438  O O   . LEU D 4 3   ? 143.189 97.519  98.244  1.00 500.00 ? 3   LEU D O   1 
ATOM 9439  C CB  . LEU D 4 3   ? 142.719 99.671  100.279 1.00 500.00 ? 3   LEU D CB  1 
ATOM 9440  C CG  . LEU D 4 3   ? 144.188 99.969  99.941  1.00 500.00 ? 3   LEU D CG  1 
ATOM 9441  C CD1 . LEU D 4 3   ? 144.317 101.165 99.001  1.00 500.00 ? 3   LEU D CD1 1 
ATOM 9442  C CD2 . LEU D 4 3   ? 144.996 100.175 101.217 1.00 500.00 ? 3   LEU D CD2 1 
ATOM 9443  N N   . GLU D 4 4   ? 141.070 96.937  98.755  1.00 500.00 ? 4   GLU D N   1 
ATOM 9444  C CA  . GLU D 4 4   ? 141.234 95.517  98.380  1.00 500.00 ? 4   GLU D CA  1 
ATOM 9445  C C   . GLU D 4 4   ? 140.882 95.211  96.905  1.00 500.00 ? 4   GLU D C   1 
ATOM 9446  O O   . GLU D 4 4   ? 140.829 94.038  96.518  1.00 498.72 ? 4   GLU D O   1 
ATOM 9447  C CB  . GLU D 4 4   ? 140.404 94.617  99.313  1.00 500.00 ? 4   GLU D CB  1 
ATOM 9448  C CG  . GLU D 4 4   ? 140.520 94.926  100.808 1.00 500.00 ? 4   GLU D CG  1 
ATOM 9449  C CD  . GLU D 4 4   ? 141.949 94.907  101.338 1.00 500.00 ? 4   GLU D CD  1 
ATOM 9450  O OE1 . GLU D 4 4   ? 142.762 94.080  100.872 1.00 500.00 ? 4   GLU D OE1 1 
ATOM 9451  O OE2 . GLU D 4 4   ? 142.262 95.724  102.232 1.00 500.00 ? 4   GLU D OE2 1 
ATOM 9452  N N   . ARG D 4 5   ? 140.646 96.255  96.099  1.00 500.00 ? 5   ARG D N   1 
ATOM 9453  C CA  . ARG D 4 5   ? 140.390 96.131  94.652  1.00 500.00 ? 5   ARG D CA  1 
ATOM 9454  C C   . ARG D 4 5   ? 141.243 97.131  93.832  1.00 500.00 ? 5   ARG D C   1 
ATOM 9455  O O   . ARG D 4 5   ? 140.767 97.694  92.834  1.00 500.00 ? 5   ARG D O   1 
ATOM 9456  C CB  . ARG D 4 5   ? 138.899 96.364  94.352  1.00 500.00 ? 5   ARG D CB  1 
ATOM 9457  C CG  . ARG D 4 5   ? 137.915 95.624  95.254  1.00 500.00 ? 5   ARG D CG  1 
ATOM 9458  C CD  . ARG D 4 5   ? 136.548 95.469  94.586  1.00 500.00 ? 5   ARG D CD  1 
ATOM 9459  N NE  . ARG D 4 5   ? 136.063 96.717  93.978  1.00 500.00 ? 5   ARG D NE  1 
ATOM 9460  C CZ  . ARG D 4 5   ? 135.188 97.577  94.515  1.00 500.00 ? 5   ARG D CZ  1 
ATOM 9461  N NH1 . ARG D 4 5   ? 134.636 97.373  95.715  1.00 500.00 ? 5   ARG D NH1 1 
ATOM 9462  N NH2 . ARG D 4 5   ? 134.853 98.672  93.829  1.00 500.00 ? 5   ARG D NH2 1 
ATOM 9463  N N   . VAL D 4 6   ? 142.497 97.331  94.251  1.00 500.00 ? 6   VAL D N   1 
ATOM 9464  C CA  . VAL D 4 6   ? 143.412 98.300  93.622  1.00 500.00 ? 6   VAL D CA  1 
ATOM 9465  C C   . VAL D 4 6   ? 144.771 97.639  93.346  1.00 500.00 ? 6   VAL D C   1 
ATOM 9466  O O   . VAL D 4 6   ? 145.221 96.782  94.117  1.00 500.00 ? 6   VAL D O   1 
ATOM 9467  C CB  . VAL D 4 6   ? 143.593 99.562  94.509  1.00 500.00 ? 6   VAL D CB  1 
ATOM 9468  C CG1 . VAL D 4 6   ? 144.495 100.591 93.833  1.00 500.00 ? 6   VAL D CG1 1 
ATOM 9469  C CG2 . VAL D 4 6   ? 142.237 100.182 94.839  1.00 500.00 ? 6   VAL D CG2 1 
ATOM 9470  N N   . SER D 4 7   ? 145.411 98.042  92.244  1.00 500.00 ? 7   SER D N   1 
ATOM 9471  C CA  . SER D 4 7   ? 146.694 97.468  91.816  1.00 500.00 ? 7   SER D CA  1 
ATOM 9472  C C   . SER D 4 7   ? 147.855 97.990  92.651  1.00 485.08 ? 7   SER D C   1 
ATOM 9473  O O   . SER D 4 7   ? 147.699 98.904  93.465  1.00 446.90 ? 7   SER D O   1 
ATOM 9474  C CB  . SER D 4 7   ? 146.964 97.764  90.331  1.00 500.00 ? 7   SER D CB  1 
ATOM 9475  O OG  . SER D 4 7   ? 147.405 99.100  90.132  1.00 486.84 ? 7   SER D OG  1 
ATOM 9476  N N   . ASN D 4 8   ? 149.023 97.401  92.425  1.00 451.29 ? 8   ASN D N   1 
ATOM 9477  C CA  . ASN D 4 8   ? 150.242 97.847  93.075  1.00 478.18 ? 8   ASN D CA  1 
ATOM 9478  C C   . ASN D 4 8   ? 150.560 99.278  92.587  1.00 500.00 ? 8   ASN D C   1 
ATOM 9479  O O   . ASN D 4 8   ? 150.933 100.153 93.382  1.00 500.00 ? 8   ASN D O   1 
ATOM 9480  C CB  . ASN D 4 8   ? 151.414 96.922  92.685  1.00 473.09 ? 8   ASN D CB  1 
ATOM 9481  C CG  . ASN D 4 8   ? 152.766 97.408  93.208  1.00 465.41 ? 8   ASN D CG  1 
ATOM 9482  O OD1 . ASN D 4 8   ? 152.875 97.893  94.335  1.00 483.82 ? 8   ASN D OD1 1 
ATOM 9483  N ND2 . ASN D 4 8   ? 153.805 97.272  92.382  1.00 409.95 ? 8   ASN D ND2 1 
ATOM 9484  N N   . GLU D 4 9   ? 150.549 99.399  91.261  1.00 500.00 ? 9   GLU D N   1 
ATOM 9485  C CA  . GLU D 4 9   ? 151.038 100.589 90.579  1.00 500.00 ? 9   GLU D CA  1 
ATOM 9486  C C   . GLU D 4 9   ? 150.257 101.817 91.033  1.00 500.00 ? 9   GLU D C   1 
ATOM 9487  O O   . GLU D 4 9   ? 150.843 102.870 91.349  1.00 500.00 ? 9   GLU D O   1 
ATOM 9488  C CB  . GLU D 4 9   ? 150.960 100.433 89.049  1.00 500.00 ? 9   GLU D CB  1 
ATOM 9489  C CG  . GLU D 4 9   ? 151.624 99.178  88.464  1.00 500.00 ? 9   GLU D CG  1 
ATOM 9490  C CD  . GLU D 4 9   ? 152.967 98.820  89.099  1.00 500.00 ? 9   GLU D CD  1 
ATOM 9491  O OE1 . GLU D 4 9   ? 153.820 99.721  89.268  1.00 500.00 ? 9   GLU D OE1 1 
ATOM 9492  O OE2 . GLU D 4 9   ? 153.176 97.630  89.430  1.00 500.00 ? 9   GLU D OE2 1 
ATOM 9493  N N   . GLU D 4 10  ? 148.937 101.642 91.058  1.00 500.00 ? 10  GLU D N   1 
ATOM 9494  C CA  . GLU D 4 10  ? 148.014 102.716 91.458  1.00 500.00 ? 10  GLU D CA  1 
ATOM 9495  C C   . GLU D 4 10  ? 148.328 103.168 92.877  1.00 500.00 ? 10  GLU D C   1 
ATOM 9496  O O   . GLU D 4 10  ? 148.395 104.379 93.151  1.00 500.00 ? 10  GLU D O   1 
ATOM 9497  C CB  . GLU D 4 10  ? 146.548 102.288 91.319  1.00 500.00 ? 10  GLU D CB  1 
ATOM 9498  C CG  . GLU D 4 10  ? 145.551 103.434 91.518  1.00 500.00 ? 10  GLU D CG  1 
ATOM 9499  C CD  . GLU D 4 10  ? 144.306 103.332 90.638  1.00 500.00 ? 10  GLU D CD  1 
ATOM 9500  O OE1 . GLU D 4 10  ? 143.747 102.220 90.498  1.00 500.00 ? 10  GLU D OE1 1 
ATOM 9501  O OE2 . GLU D 4 10  ? 143.881 104.372 90.082  1.00 500.00 ? 10  GLU D OE2 1 
ATOM 9502  N N   . LYS D 4 11  ? 148.520 102.175 93.745  1.00 500.00 ? 11  LYS D N   1 
ATOM 9503  C CA  . LYS D 4 11  ? 148.835 102.418 95.158  1.00 481.72 ? 11  LYS D CA  1 
ATOM 9504  C C   . LYS D 4 11  ? 150.105 103.243 95.282  1.00 469.07 ? 11  LYS D C   1 
ATOM 9505  O O   . LYS D 4 11  ? 150.162 104.219 96.046  1.00 434.54 ? 11  LYS D O   1 
ATOM 9506  C CB  . LYS D 4 11  ? 148.941 101.111 95.966  1.00 451.23 ? 11  LYS D CB  1 
ATOM 9507  C CG  . LYS D 4 11  ? 147.580 100.547 96.338  1.00 446.27 ? 11  LYS D CG  1 
ATOM 9508  C CD  . LYS D 4 11  ? 147.644 99.195  97.036  1.00 421.57 ? 11  LYS D CD  1 
ATOM 9509  C CE  . LYS D 4 11  ? 146.272 98.526  97.010  1.00 402.21 ? 11  LYS D CE  1 
ATOM 9510  N NZ  . LYS D 4 11  ? 146.182 97.235  97.750  1.00 378.61 ? 11  LYS D NZ  1 
ATOM 9511  N N   . LEU D 4 12  ? 151.104 102.826 94.513  1.00 489.86 ? 12  LEU D N   1 
ATOM 9512  C CA  . LEU D 4 12  ? 152.418 103.486 94.478  1.00 500.00 ? 12  LEU D CA  1 
ATOM 9513  C C   . LEU D 4 12  ? 152.258 104.947 94.096  1.00 492.68 ? 12  LEU D C   1 
ATOM 9514  O O   . LEU D 4 12  ? 152.833 105.843 94.732  1.00 498.38 ? 12  LEU D O   1 
ATOM 9515  C CB  . LEU D 4 12  ? 153.374 102.805 93.466  1.00 500.00 ? 12  LEU D CB  1 
ATOM 9516  C CG  . LEU D 4 12  ? 154.273 103.654 92.525  1.00 500.00 ? 12  LEU D CG  1 
ATOM 9517  C CD1 . LEU D 4 12  ? 155.404 104.352 93.275  1.00 500.00 ? 12  LEU D CD1 1 
ATOM 9518  C CD2 . LEU D 4 12  ? 154.840 102.817 91.386  1.00 500.00 ? 12  LEU D CD2 1 
ATOM 9519  N N   . ASN D 4 13  ? 151.473 105.148 93.043  1.00 467.98 ? 13  ASN D N   1 
ATOM 9520  C CA  . ASN D 4 13  ? 151.190 106.485 92.504  1.00 464.79 ? 13  ASN D CA  1 
ATOM 9521  C C   . ASN D 4 13  ? 150.576 107.367 93.585  1.00 486.97 ? 13  ASN D C   1 
ATOM 9522  O O   . ASN D 4 13  ? 150.990 108.524 93.781  1.00 500.00 ? 13  ASN D O   1 
ATOM 9523  C CB  . ASN D 4 13  ? 150.249 106.410 91.283  1.00 475.53 ? 13  ASN D CB  1 
ATOM 9524  C CG  . ASN D 4 13  ? 149.351 107.641 91.144  1.00 470.71 ? 13  ASN D CG  1 
ATOM 9525  O OD1 . ASN D 4 13  ? 149.836 108.759 90.979  1.00 500.00 ? 13  ASN D OD1 1 
ATOM 9526  N ND2 . ASN D 4 13  ? 148.037 107.435 91.204  1.00 422.04 ? 13  ASN D ND2 1 
ATOM 9527  N N   . LEU D 4 14  ? 149.595 106.784 94.266  1.00 480.86 ? 14  LEU D N   1 
ATOM 9528  C CA  . LEU D 4 14  ? 148.866 107.461 95.341  1.00 490.82 ? 14  LEU D CA  1 
ATOM 9529  C C   . LEU D 4 14  ? 149.838 107.909 96.433  1.00 417.39 ? 14  LEU D C   1 
ATOM 9530  O O   . LEU D 4 14  ? 149.786 109.061 96.906  1.00 404.21 ? 14  LEU D O   1 
ATOM 9531  C CB  . LEU D 4 14  ? 147.750 106.569 95.911  1.00 500.00 ? 14  LEU D CB  1 
ATOM 9532  C CG  . LEU D 4 14  ? 146.338 106.740 95.313  1.00 500.00 ? 14  LEU D CG  1 
ATOM 9533  C CD1 . LEU D 4 14  ? 145.669 108.008 95.845  1.00 500.00 ? 14  LEU D CD1 1 
ATOM 9534  C CD2 . LEU D 4 14  ? 146.301 106.730 93.786  1.00 500.00 ? 14  LEU D CD2 1 
ATOM 9535  N N   . CYS D 4 15  ? 150.706 106.975 96.800  1.00 373.58 ? 15  CYS D N   1 
ATOM 9536  C CA  . CYS D 4 15  ? 151.720 107.197 97.834  1.00 394.81 ? 15  CYS D CA  1 
ATOM 9537  C C   . CYS D 4 15  ? 152.610 108.372 97.453  1.00 410.17 ? 15  CYS D C   1 
ATOM 9538  O O   . CYS D 4 15  ? 152.882 109.260 98.278  1.00 393.08 ? 15  CYS D O   1 
ATOM 9539  C CB  . CYS D 4 15  ? 152.562 105.938 98.053  1.00 404.72 ? 15  CYS D CB  1 
ATOM 9540  S SG  . CYS D 4 15  ? 153.622 106.017 99.512  1.00 451.25 ? 15  CYS D SG  1 
ATOM 9541  N N   . ARG D 4 16  ? 153.041 108.345 96.197  1.00 430.15 ? 16  ARG D N   1 
ATOM 9542  C CA  . ARG D 4 16  ? 153.912 109.381 95.631  1.00 436.84 ? 16  ARG D CA  1 
ATOM 9543  C C   . ARG D 4 16  ? 153.242 110.744 95.744  1.00 454.05 ? 16  ARG D C   1 
ATOM 9544  O O   . ARG D 4 16  ? 153.871 111.730 96.168  1.00 462.94 ? 16  ARG D O   1 
ATOM 9545  C CB  . ARG D 4 16  ? 154.265 109.074 94.163  1.00 463.70 ? 16  ARG D CB  1 
ATOM 9546  C CG  . ARG D 4 16  ? 155.282 110.025 93.532  1.00 490.58 ? 16  ARG D CG  1 
ATOM 9547  C CD  . ARG D 4 16  ? 154.651 111.135 92.689  1.00 486.95 ? 16  ARG D CD  1 
ATOM 9548  N NE  . ARG D 4 16  ? 154.383 110.724 91.307  1.00 492.50 ? 16  ARG D NE  1 
ATOM 9549  C CZ  . ARG D 4 16  ? 155.290 110.629 90.329  1.00 494.46 ? 16  ARG D CZ  1 
ATOM 9550  N NH1 . ARG D 4 16  ? 156.580 110.901 90.543  1.00 493.20 ? 16  ARG D NH1 1 
ATOM 9551  N NH2 . ARG D 4 16  ? 154.904 110.244 89.113  1.00 481.90 ? 16  ARG D NH2 1 
ATOM 9552  N N   . LYS D 4 17  ? 151.970 110.761 95.357  1.00 482.45 ? 17  LYS D N   1 
ATOM 9553  C CA  . LYS D 4 17  ? 151.156 111.980 95.379  1.00 484.82 ? 17  LYS D CA  1 
ATOM 9554  C C   . LYS D 4 17  ? 151.098 112.543 96.801  1.00 437.30 ? 17  LYS D C   1 
ATOM 9555  O O   . LYS D 4 17  ? 151.284 113.757 97.012  1.00 359.96 ? 17  LYS D O   1 
ATOM 9556  C CB  . LYS D 4 17  ? 149.770 111.773 94.748  1.00 500.00 ? 17  LYS D CB  1 
ATOM 9557  C CG  . LYS D 4 17  ? 149.830 111.552 93.234  1.00 500.00 ? 17  LYS D CG  1 
ATOM 9558  C CD  . LYS D 4 17  ? 148.635 112.137 92.497  1.00 500.00 ? 17  LYS D CD  1 
ATOM 9559  C CE  . LYS D 4 17  ? 148.769 113.637 92.242  1.00 500.00 ? 17  LYS D CE  1 
ATOM 9560  N NZ  . LYS D 4 17  ? 149.587 113.970 91.038  1.00 466.24 ? 17  LYS D NZ  1 
ATOM 9561  N N   . TYR D 4 18  ? 150.848 111.635 97.738  1.00 426.50 ? 18  TYR D N   1 
ATOM 9562  C CA  . TYR D 4 18  ? 150.749 111.985 99.157  1.00 439.54 ? 18  TYR D CA  1 
ATOM 9563  C C   . TYR D 4 18  ? 152.052 112.623 99.636  1.00 466.33 ? 18  TYR D C   1 
ATOM 9564  O O   . TYR D 4 18  ? 152.035 113.656 100.321 1.00 498.73 ? 18  TYR D O   1 
ATOM 9565  C CB  . TYR D 4 18  ? 150.255 110.838 100.035 1.00 446.90 ? 18  TYR D CB  1 
ATOM 9566  C CG  . TYR D 4 18  ? 148.735 110.771 100.098 1.00 500.00 ? 18  TYR D CG  1 
ATOM 9567  C CD1 . TYR D 4 18  ? 147.970 110.745 98.925  1.00 500.00 ? 18  TYR D CD1 1 
ATOM 9568  C CD2 . TYR D 4 18  ? 148.051 110.748 101.318 1.00 500.00 ? 18  TYR D CD2 1 
ATOM 9569  C CE1 . TYR D 4 18  ? 146.584 110.690 98.963  1.00 500.00 ? 18  TYR D CE1 1 
ATOM 9570  C CE2 . TYR D 4 18  ? 146.660 110.690 101.362 1.00 500.00 ? 18  TYR D CE2 1 
ATOM 9571  C CZ  . TYR D 4 18  ? 145.934 110.662 100.182 1.00 500.00 ? 18  TYR D CZ  1 
ATOM 9572  O OH  . TYR D 4 18  ? 144.562 110.605 100.196 1.00 500.00 ? 18  TYR D OH  1 
ATOM 9573  N N   . TYR D 4 19  ? 153.149 111.989 99.248  1.00 457.93 ? 19  TYR D N   1 
ATOM 9574  C CA  . TYR D 4 19  ? 154.495 112.441 99.600  1.00 452.98 ? 19  TYR D CA  1 
ATOM 9575  C C   . TYR D 4 19  ? 154.718 113.866 99.093  1.00 425.68 ? 19  TYR D C   1 
ATOM 9576  O O   . TYR D 4 19  ? 155.217 114.736 99.827  1.00 329.94 ? 19  TYR D O   1 
ATOM 9577  C CB  . TYR D 4 19  ? 155.533 111.450 99.063  1.00 460.18 ? 19  TYR D CB  1 
ATOM 9578  C CG  . TYR D 4 19  ? 156.912 111.696 99.589  1.00 500.00 ? 19  TYR D CG  1 
ATOM 9579  C CD1 . TYR D 4 19  ? 157.183 111.591 100.954 1.00 500.00 ? 19  TYR D CD1 1 
ATOM 9580  C CD2 . TYR D 4 19  ? 157.952 112.046 98.731  1.00 500.00 ? 19  TYR D CD2 1 
ATOM 9581  C CE1 . TYR D 4 19  ? 158.453 111.830 101.450 1.00 500.00 ? 19  TYR D CE1 1 
ATOM 9582  C CE2 . TYR D 4 19  ? 159.227 112.286 99.213  1.00 500.00 ? 19  TYR D CE2 1 
ATOM 9583  C CZ  . TYR D 4 19  ? 159.472 112.175 100.572 1.00 500.00 ? 19  TYR D CZ  1 
ATOM 9584  O OH  . TYR D 4 19  ? 160.737 112.425 101.042 1.00 500.00 ? 19  TYR D OH  1 
ATOM 9585  N N   . LEU D 4 20  ? 154.331 114.063 97.839  1.00 446.78 ? 20  LEU D N   1 
ATOM 9586  C CA  . LEU D 4 20  ? 154.460 115.360 97.167  1.00 497.20 ? 20  LEU D CA  1 
ATOM 9587  C C   . LEU D 4 20  ? 153.699 116.431 97.939  1.00 473.81 ? 20  LEU D C   1 
ATOM 9588  O O   . LEU D 4 20  ? 154.215 117.532 98.183  1.00 500.00 ? 20  LEU D O   1 
ATOM 9589  C CB  . LEU D 4 20  ? 153.979 115.302 95.712  1.00 500.00 ? 20  LEU D CB  1 
ATOM 9590  C CG  . LEU D 4 20  ? 154.318 116.514 94.834  1.00 500.00 ? 20  LEU D CG  1 
ATOM 9591  C CD1 . LEU D 4 20  ? 155.825 116.735 94.740  1.00 500.00 ? 20  LEU D CD1 1 
ATOM 9592  C CD2 . LEU D 4 20  ? 153.707 116.348 93.447  1.00 500.00 ? 20  LEU D CD2 1 
ATOM 9593  N N   . GLY D 4 21  ? 152.476 116.070 98.309  1.00 468.67 ? 21  GLY D N   1 
ATOM 9594  C CA  . GLY D 4 21  ? 151.581 116.953 99.064  1.00 474.66 ? 21  GLY D CA  1 
ATOM 9595  C C   . GLY D 4 21  ? 152.231 117.371 100.372 1.00 462.16 ? 21  GLY D C   1 
ATOM 9596  O O   . GLY D 4 21  ? 152.233 118.552 100.745 1.00 412.06 ? 21  GLY D O   1 
ATOM 9597  N N   . GLY D 4 22  ? 152.792 116.374 101.049 1.00 423.04 ? 22  GLY D N   1 
ATOM 9598  C CA  . GLY D 4 22  ? 153.470 116.553 102.336 1.00 365.54 ? 22  GLY D CA  1 
ATOM 9599  C C   . GLY D 4 22  ? 154.458 117.700 102.502 1.00 366.47 ? 22  GLY D C   1 
ATOM 9600  O O   . GLY D 4 22  ? 154.608 118.226 103.612 1.00 293.22 ? 22  GLY D O   1 
ATOM 9601  N N   . PHE D 4 23  ? 155.136 118.087 101.416 1.00 412.28 ? 23  PHE D N   1 
ATOM 9602  C CA  . PHE D 4 23  ? 156.024 119.275 101.402 1.00 432.84 ? 23  PHE D CA  1 
ATOM 9603  C C   . PHE D 4 23  ? 155.310 120.594 101.037 1.00 415.44 ? 23  PHE D C   1 
ATOM 9604  O O   . PHE D 4 23  ? 155.925 121.495 100.447 1.00 343.40 ? 23  PHE D O   1 
ATOM 9605  C CB  . PHE D 4 23  ? 157.235 119.040 100.478 1.00 458.54 ? 23  PHE D CB  1 
ATOM 9606  C CG  . PHE D 4 23  ? 158.269 118.127 101.064 1.00 500.00 ? 23  PHE D CG  1 
ATOM 9607  C CD1 . PHE D 4 23  ? 159.121 118.582 102.069 1.00 500.00 ? 23  PHE D CD1 1 
ATOM 9608  C CD2 . PHE D 4 23  ? 158.396 116.813 100.627 1.00 500.00 ? 23  PHE D CD2 1 
ATOM 9609  C CE1 . PHE D 4 23  ? 160.079 117.745 102.627 1.00 500.00 ? 23  PHE D CE1 1 
ATOM 9610  C CE2 . PHE D 4 23  ? 159.354 115.972 101.179 1.00 500.00 ? 23  PHE D CE2 1 
ATOM 9611  C CZ  . PHE D 4 23  ? 160.195 116.437 102.181 1.00 500.00 ? 23  PHE D CZ  1 
ATOM 9612  N N   . ALA D 4 24  ? 154.017 120.685 101.371 1.00 418.08 ? 24  ALA D N   1 
ATOM 9613  C CA  . ALA D 4 24  ? 153.265 121.945 101.395 1.00 420.09 ? 24  ALA D CA  1 
ATOM 9614  C C   . ALA D 4 24  ? 152.736 122.220 102.809 1.00 410.44 ? 24  ALA D C   1 
ATOM 9615  O O   . ALA D 4 24  ? 151.784 122.987 102.982 1.00 379.86 ? 24  ALA D O   1 
ATOM 9616  C CB  . ALA D 4 24  ? 152.120 121.889 100.397 1.00 438.83 ? 24  ALA D CB  1 
ATOM 9617  N N   . PHE D 4 25  ? 153.387 121.611 103.808 1.00 433.96 ? 25  PHE D N   1 
ATOM 9618  C CA  . PHE D 4 25  ? 153.049 121.731 105.233 1.00 440.60 ? 25  PHE D CA  1 
ATOM 9619  C C   . PHE D 4 25  ? 151.703 121.085 105.557 1.00 384.26 ? 25  PHE D C   1 
ATOM 9620  O O   . PHE D 4 25  ? 150.717 121.758 105.844 1.00 328.55 ? 25  PHE D O   1 
ATOM 9621  C CB  . PHE D 4 25  ? 153.097 123.194 105.735 1.00 500.00 ? 25  PHE D CB  1 
ATOM 9622  C CG  . PHE D 4 25  ? 154.259 124.008 105.206 1.00 500.00 ? 25  PHE D CG  1 
ATOM 9623  C CD1 . PHE D 4 25  ? 155.551 123.474 105.136 1.00 500.00 ? 25  PHE D CD1 1 
ATOM 9624  C CD2 . PHE D 4 25  ? 154.064 125.329 104.801 1.00 500.00 ? 25  PHE D CD2 1 
ATOM 9625  C CE1 . PHE D 4 25  ? 156.612 124.240 104.662 1.00 500.00 ? 25  PHE D CE1 1 
ATOM 9626  C CE2 . PHE D 4 25  ? 155.123 126.095 104.323 1.00 500.00 ? 25  PHE D CE2 1 
ATOM 9627  C CZ  . PHE D 4 25  ? 156.399 125.551 104.254 1.00 500.00 ? 25  PHE D CZ  1 
ATOM 9628  N N   . LEU D 4 26  ? 151.665 119.762 105.500 1.00 373.68 ? 26  LEU D N   1 
ATOM 9629  C CA  . LEU D 4 26  ? 150.478 119.030 105.930 1.00 384.21 ? 26  LEU D CA  1 
ATOM 9630  C C   . LEU D 4 26  ? 150.834 117.769 106.694 1.00 344.96 ? 26  LEU D C   1 
ATOM 9631  O O   . LEU D 4 26  ? 150.325 116.711 106.367 1.00 294.35 ? 26  LEU D O   1 
ATOM 9632  C CB  . LEU D 4 26  ? 149.590 118.667 104.739 1.00 435.67 ? 26  LEU D CB  1 
ATOM 9633  C CG  . LEU D 4 26  ? 148.989 119.777 103.880 1.00 488.51 ? 26  LEU D CG  1 
ATOM 9634  C CD1 . LEU D 4 26  ? 149.972 120.340 102.860 1.00 491.53 ? 26  LEU D CD1 1 
ATOM 9635  C CD2 . LEU D 4 26  ? 147.761 119.216 103.178 1.00 500.00 ? 26  LEU D CD2 1 
ATOM 9636  N N   . PRO D 4 27  ? 151.667 117.873 107.750 1.00 390.93 ? 27  PRO D N   1 
ATOM 9637  C CA  . PRO D 4 27  ? 152.089 116.740 108.552 1.00 439.18 ? 27  PRO D CA  1 
ATOM 9638  C C   . PRO D 4 27  ? 150.944 115.765 108.776 1.00 446.96 ? 27  PRO D C   1 
ATOM 9639  O O   . PRO D 4 27  ? 151.185 114.556 108.755 1.00 456.56 ? 27  PRO D O   1 
ATOM 9640  C CB  . PRO D 4 27  ? 152.548 117.378 109.876 1.00 464.32 ? 27  PRO D CB  1 
ATOM 9641  C CG  . PRO D 4 27  ? 152.508 118.859 109.679 1.00 445.41 ? 27  PRO D CG  1 
ATOM 9642  C CD  . PRO D 4 27  ? 152.278 119.127 108.230 1.00 396.48 ? 27  PRO D CD  1 
ATOM 9643  N N   . PHE D 4 28  ? 149.720 116.280 108.920 1.00 444.90 ? 28  PHE D N   1 
ATOM 9644  C CA  . PHE D 4 28  ? 148.572 115.391 109.058 1.00 488.23 ? 28  PHE D CA  1 
ATOM 9645  C C   . PHE D 4 28  ? 148.380 114.551 107.822 1.00 479.87 ? 28  PHE D C   1 
ATOM 9646  O O   . PHE D 4 28  ? 148.105 113.352 107.963 1.00 491.54 ? 28  PHE D O   1 
ATOM 9647  C CB  . PHE D 4 28  ? 147.276 116.115 109.436 1.00 500.00 ? 28  PHE D CB  1 
ATOM 9648  C CG  . PHE D 4 28  ? 146.257 115.206 110.073 1.00 500.00 ? 28  PHE D CG  1 
ATOM 9649  C CD1 . PHE D 4 28  ? 145.372 114.468 109.293 1.00 498.02 ? 28  PHE D CD1 1 
ATOM 9650  C CD2 . PHE D 4 28  ? 146.209 115.058 111.458 1.00 500.00 ? 28  PHE D CD2 1 
ATOM 9651  C CE1 . PHE D 4 28  ? 144.448 113.614 109.880 1.00 495.94 ? 28  PHE D CE1 1 
ATOM 9652  C CE2 . PHE D 4 28  ? 145.287 114.206 112.050 1.00 500.00 ? 28  PHE D CE2 1 
ATOM 9653  C CZ  . PHE D 4 28  ? 144.407 113.482 111.260 1.00 500.00 ? 28  PHE D CZ  1 
ATOM 9654  N N   . LEU D 4 29  ? 148.579 115.156 106.650 1.00 433.40 ? 29  LEU D N   1 
ATOM 9655  C CA  . LEU D 4 29  ? 148.494 114.435 105.375 1.00 421.86 ? 29  LEU D CA  1 
ATOM 9656  C C   . LEU D 4 29  ? 149.484 113.279 105.351 1.00 347.63 ? 29  LEU D C   1 
ATOM 9657  O O   . LEU D 4 29  ? 149.142 112.152 104.965 1.00 375.78 ? 29  LEU D O   1 
ATOM 9658  C CB  . LEU D 4 29  ? 148.784 115.323 104.154 1.00 447.21 ? 29  LEU D CB  1 
ATOM 9659  C CG  . LEU D 4 29  ? 148.496 114.644 102.794 1.00 489.92 ? 29  LEU D CG  1 
ATOM 9660  C CD1 . LEU D 4 29  ? 147.092 114.944 102.283 1.00 485.26 ? 29  LEU D CD1 1 
ATOM 9661  C CD2 . LEU D 4 29  ? 149.530 115.022 101.745 1.00 500.00 ? 29  LEU D CD2 1 
ATOM 9662  N N   . TRP D 4 30  ? 150.700 113.597 105.769 1.00 348.03 ? 30  TRP D N   1 
ATOM 9663  C CA  . TRP D 4 30  ? 151.799 112.622 105.829 1.00 393.68 ? 30  TRP D CA  1 
ATOM 9664  C C   . TRP D 4 30  ? 151.415 111.450 106.720 1.00 368.30 ? 30  TRP D C   1 
ATOM 9665  O O   . TRP D 4 30  ? 151.613 110.283 106.354 1.00 346.75 ? 30  TRP D O   1 
ATOM 9666  C CB  . TRP D 4 30  ? 153.125 113.245 106.287 1.00 417.93 ? 30  TRP D CB  1 
ATOM 9667  C CG  . TRP D 4 30  ? 154.029 113.702 105.177 1.00 405.15 ? 30  TRP D CG  1 
ATOM 9668  C CD1 . TRP D 4 30  ? 154.030 113.286 103.868 1.00 412.04 ? 30  TRP D CD1 1 
ATOM 9669  C CD2 . TRP D 4 30  ? 155.107 114.625 105.298 1.00 379.58 ? 30  TRP D CD2 1 
ATOM 9670  N NE1 . TRP D 4 30  ? 155.031 113.909 103.176 1.00 405.71 ? 30  TRP D NE1 1 
ATOM 9671  C CE2 . TRP D 4 30  ? 155.709 114.738 104.027 1.00 395.17 ? 30  TRP D CE2 1 
ATOM 9672  C CE3 . TRP D 4 30  ? 155.623 115.373 106.358 1.00 377.71 ? 30  TRP D CE3 1 
ATOM 9673  C CZ2 . TRP D 4 30  ? 156.792 115.579 103.783 1.00 412.16 ? 30  TRP D CZ2 1 
ATOM 9674  C CZ3 . TRP D 4 30  ? 156.704 116.212 106.115 1.00 432.62 ? 30  TRP D CZ3 1 
ATOM 9675  C CH2 . TRP D 4 30  ? 157.280 116.304 104.836 1.00 423.97 ? 30  TRP D CH2 1 
ATOM 9676  N N   . LEU D 4 31  ? 150.872 111.795 107.876 1.00 362.65 ? 31  LEU D N   1 
ATOM 9677  C CA  . LEU D 4 31  ? 150.426 110.822 108.879 1.00 423.92 ? 31  LEU D CA  1 
ATOM 9678  C C   . LEU D 4 31  ? 149.395 109.876 108.264 1.00 428.16 ? 31  LEU D C   1 
ATOM 9679  O O   . LEU D 4 31  ? 149.476 108.646 108.421 1.00 420.02 ? 31  LEU D O   1 
ATOM 9680  C CB  . LEU D 4 31  ? 149.819 111.561 110.080 1.00 486.10 ? 31  LEU D CB  1 
ATOM 9681  C CG  . LEU D 4 31  ? 149.460 110.760 111.336 1.00 500.00 ? 31  LEU D CG  1 
ATOM 9682  C CD1 . LEU D 4 31  ? 150.707 110.212 112.027 1.00 500.00 ? 31  LEU D CD1 1 
ATOM 9683  C CD2 . LEU D 4 31  ? 148.620 111.613 112.283 1.00 500.00 ? 31  LEU D CD2 1 
ATOM 9684  N N   . VAL D 4 32  ? 148.442 110.488 107.576 1.00 419.04 ? 32  VAL D N   1 
ATOM 9685  C CA  . VAL D 4 32  ? 147.352 109.771 106.904 1.00 443.80 ? 32  VAL D CA  1 
ATOM 9686  C C   . VAL D 4 32  ? 147.920 108.768 105.909 1.00 442.77 ? 32  VAL D C   1 
ATOM 9687  O O   . VAL D 4 32  ? 147.502 107.603 105.863 1.00 447.82 ? 32  VAL D O   1 
ATOM 9688  C CB  . VAL D 4 32  ? 146.429 110.767 106.149 1.00 463.69 ? 32  VAL D CB  1 
ATOM 9689  C CG1 . VAL D 4 32  ? 145.613 110.089 105.053 1.00 475.71 ? 32  VAL D CG1 1 
ATOM 9690  C CG2 . VAL D 4 32  ? 145.519 111.487 107.130 1.00 500.00 ? 32  VAL D CG2 1 
ATOM 9691  N N   . ASN D 4 33  ? 148.868 109.260 105.126 1.00 446.84 ? 33  ASN D N   1 
ATOM 9692  C CA  . ASN D 4 33  ? 149.553 108.467 104.095 1.00 423.67 ? 33  ASN D CA  1 
ATOM 9693  C C   . ASN D 4 33  ? 150.207 107.244 104.728 1.00 387.07 ? 33  ASN D C   1 
ATOM 9694  O O   . ASN D 4 33  ? 150.078 106.116 104.228 1.00 396.01 ? 33  ASN D O   1 
ATOM 9695  C CB  . ASN D 4 33  ? 150.648 109.326 103.445 1.00 455.19 ? 33  ASN D CB  1 
ATOM 9696  C CG  . ASN D 4 33  ? 151.421 108.597 102.368 1.00 446.11 ? 33  ASN D CG  1 
ATOM 9697  O OD1 . ASN D 4 33  ? 150.861 108.193 101.358 1.00 440.97 ? 33  ASN D OD1 1 
ATOM 9698  N ND2 . ASN D 4 33  ? 152.728 108.450 102.570 1.00 438.40 ? 33  ASN D ND2 1 
ATOM 9699  N N   . ILE D 4 34  ? 150.904 107.510 105.822 1.00 353.78 ? 34  ILE D N   1 
ATOM 9700  C CA  . ILE D 4 34  ? 151.621 106.482 106.583 1.00 378.38 ? 34  ILE D CA  1 
ATOM 9701  C C   . ILE D 4 34  ? 150.646 105.397 107.040 1.00 366.37 ? 34  ILE D C   1 
ATOM 9702  O O   . ILE D 4 34  ? 150.916 104.189 106.891 1.00 408.94 ? 34  ILE D O   1 
ATOM 9703  C CB  . ILE D 4 34  ? 152.366 107.116 107.768 1.00 403.89 ? 34  ILE D CB  1 
ATOM 9704  C CG1 . ILE D 4 34  ? 153.500 108.001 107.233 1.00 409.94 ? 34  ILE D CG1 1 
ATOM 9705  C CG2 . ILE D 4 34  ? 152.912 106.052 108.722 1.00 439.90 ? 34  ILE D CG2 1 
ATOM 9706  C CD1 . ILE D 4 34  ? 153.814 109.172 108.128 1.00 449.59 ? 34  ILE D CD1 1 
ATOM 9707  N N   . PHE D 4 35  ? 149.528 105.863 107.579 1.00 351.24 ? 35  PHE D N   1 
ATOM 9708  C CA  . PHE D 4 35  ? 148.475 104.983 108.085 1.00 452.56 ? 35  PHE D CA  1 
ATOM 9709  C C   . PHE D 4 35  ? 147.953 104.085 106.963 1.00 487.88 ? 35  PHE D C   1 
ATOM 9710  O O   . PHE D 4 35  ? 147.799 102.868 107.124 1.00 500.00 ? 35  PHE D O   1 
ATOM 9711  C CB  . PHE D 4 35  ? 147.404 105.747 108.881 1.00 465.05 ? 35  PHE D CB  1 
ATOM 9712  C CG  . PHE D 4 35  ? 147.652 105.715 110.369 1.00 466.66 ? 35  PHE D CG  1 
ATOM 9713  C CD1 . PHE D 4 35  ? 148.929 105.963 110.882 1.00 437.00 ? 35  PHE D CD1 1 
ATOM 9714  C CD2 . PHE D 4 35  ? 146.629 105.394 111.258 1.00 499.58 ? 35  PHE D CD2 1 
ATOM 9715  C CE1 . PHE D 4 35  ? 149.175 105.908 112.245 1.00 443.60 ? 35  PHE D CE1 1 
ATOM 9716  C CE2 . PHE D 4 35  ? 146.869 105.343 112.624 1.00 500.00 ? 35  PHE D CE2 1 
ATOM 9717  C CZ  . PHE D 4 35  ? 148.143 105.604 113.119 1.00 490.56 ? 35  PHE D CZ  1 
ATOM 9718  N N   . TRP D 4 36  ? 147.698 104.721 105.821 1.00 454.50 ? 36  TRP D N   1 
ATOM 9719  C CA  . TRP D 4 36  ? 147.031 104.107 104.675 1.00 402.87 ? 36  TRP D CA  1 
ATOM 9720  C C   . TRP D 4 36  ? 147.943 103.270 103.777 1.00 355.71 ? 36  TRP D C   1 
ATOM 9721  O O   . TRP D 4 36  ? 147.469 102.647 102.832 1.00 282.23 ? 36  TRP D O   1 
ATOM 9722  C CB  . TRP D 4 36  ? 146.385 105.226 103.859 1.00 400.62 ? 36  TRP D CB  1 
ATOM 9723  C CG  . TRP D 4 36  ? 145.524 104.790 102.745 1.00 367.09 ? 36  TRP D CG  1 
ATOM 9724  C CD1 . TRP D 4 36  ? 144.759 103.669 102.682 1.00 383.53 ? 36  TRP D CD1 1 
ATOM 9725  C CD2 . TRP D 4 36  ? 145.323 105.486 101.521 1.00 360.15 ? 36  TRP D CD2 1 
ATOM 9726  N NE1 . TRP D 4 36  ? 144.096 103.619 101.486 1.00 415.24 ? 36  TRP D NE1 1 
ATOM 9727  C CE2 . TRP D 4 36  ? 144.425 104.726 100.752 1.00 391.28 ? 36  TRP D CE2 1 
ATOM 9728  C CE3 . TRP D 4 36  ? 145.812 106.689 101.001 1.00 382.95 ? 36  TRP D CE3 1 
ATOM 9729  C CZ2 . TRP D 4 36  ? 144.011 105.121 99.482  1.00 433.67 ? 36  TRP D CZ2 1 
ATOM 9730  C CZ3 . TRP D 4 36  ? 145.407 107.081 99.739  1.00 400.33 ? 36  TRP D CZ3 1 
ATOM 9731  C CH2 . TRP D 4 36  ? 144.512 106.301 98.994  1.00 443.51 ? 36  TRP D CH2 1 
ATOM 9732  N N   . PHE D 4 37  ? 149.244 103.266 104.055 1.00 374.82 ? 37  PHE D N   1 
ATOM 9733  C CA  . PHE D 4 37  ? 150.188 102.429 103.319 1.00 391.00 ? 37  PHE D CA  1 
ATOM 9734  C C   . PHE D 4 37  ? 151.212 101.749 104.251 1.00 402.24 ? 37  PHE D C   1 
ATOM 9735  O O   . PHE D 4 37  ? 152.356 101.506 103.855 1.00 414.06 ? 37  PHE D O   1 
ATOM 9736  C CB  . PHE D 4 37  ? 150.881 103.274 102.237 1.00 360.96 ? 37  PHE D CB  1 
ATOM 9737  C CG  . PHE D 4 37  ? 149.926 103.905 101.248 1.00 381.25 ? 37  PHE D CG  1 
ATOM 9738  C CD1 . PHE D 4 37  ? 149.059 103.122 100.487 1.00 437.43 ? 37  PHE D CD1 1 
ATOM 9739  C CD2 . PHE D 4 37  ? 149.908 105.276 101.054 1.00 388.04 ? 37  PHE D CD2 1 
ATOM 9740  C CE1 . PHE D 4 37  ? 148.183 103.698 99.571  1.00 421.96 ? 37  PHE D CE1 1 
ATOM 9741  C CE2 . PHE D 4 37  ? 149.042 105.858 100.132 1.00 406.56 ? 37  PHE D CE2 1 
ATOM 9742  C CZ  . PHE D 4 37  ? 148.178 105.067 99.387  1.00 373.34 ? 37  PHE D CZ  1 
ATOM 9743  N N   . PHE D 4 38  ? 150.787 101.418 105.472 1.00 389.24 ? 38  PHE D N   1 
ATOM 9744  C CA  . PHE D 4 38  ? 151.662 100.759 106.447 1.00 398.29 ? 38  PHE D CA  1 
ATOM 9745  C C   . PHE D 4 38  ? 151.678 99.258  106.207 1.00 437.32 ? 38  PHE D C   1 
ATOM 9746  O O   . PHE D 4 38  ? 152.752 98.654  106.111 1.00 416.99 ? 38  PHE D O   1 
ATOM 9747  C CB  . PHE D 4 38  ? 151.214 101.059 107.881 1.00 430.92 ? 38  PHE D CB  1 
ATOM 9748  C CG  . PHE D 4 38  ? 151.769 100.105 108.911 1.00 463.22 ? 38  PHE D CG  1 
ATOM 9749  C CD1 . PHE D 4 38  ? 153.139 99.816  108.958 1.00 438.84 ? 38  PHE D CD1 1 
ATOM 9750  C CD2 . PHE D 4 38  ? 150.925 99.500  109.847 1.00 466.39 ? 38  PHE D CD2 1 
ATOM 9751  C CE1 . PHE D 4 38  ? 153.643 98.938  109.906 1.00 439.41 ? 38  PHE D CE1 1 
ATOM 9752  C CE2 . PHE D 4 38  ? 151.428 98.627  110.800 1.00 454.18 ? 38  PHE D CE2 1 
ATOM 9753  C CZ  . PHE D 4 38  ? 152.790 98.347  110.830 1.00 466.02 ? 38  PHE D CZ  1 
ATOM 9754  N N   . ARG D 4 39  ? 150.483 98.664  106.144 1.00 474.66 ? 39  ARG D N   1 
ATOM 9755  C CA  . ARG D 4 39  ? 150.316 97.234  105.814 1.00 474.81 ? 39  ARG D CA  1 
ATOM 9756  C C   . ARG D 4 39  ? 151.078 96.933  104.533 1.00 415.73 ? 39  ARG D C   1 
ATOM 9757  O O   . ARG D 4 39  ? 151.838 95.966  104.464 1.00 357.06 ? 39  ARG D O   1 
ATOM 9758  C CB  . ARG D 4 39  ? 148.825 96.871  105.642 1.00 483.20 ? 39  ARG D CB  1 
ATOM 9759  C CG  . ARG D 4 39  ? 148.513 95.373  105.588 1.00 452.41 ? 39  ARG D CG  1 
ATOM 9760  C CD  . ARG D 4 39  ? 148.504 94.709  106.967 1.00 463.28 ? 39  ARG D CD  1 
ATOM 9761  N NE  . ARG D 4 39  ? 147.148 94.523  107.518 1.00 481.73 ? 39  ARG D NE  1 
ATOM 9762  C CZ  . ARG D 4 39  ? 146.713 94.893  108.734 1.00 477.46 ? 39  ARG D CZ  1 
ATOM 9763  N NH1 . ARG D 4 39  ? 147.503 95.495  109.629 1.00 474.73 ? 39  ARG D NH1 1 
ATOM 9764  N NH2 . ARG D 4 39  ? 145.446 94.643  109.073 1.00 448.99 ? 39  ARG D NH2 1 
ATOM 9765  N N   . GLU D 4 40  ? 150.893 97.815  103.554 1.00 413.57 ? 40  GLU D N   1 
ATOM 9766  C CA  . GLU D 4 40  ? 151.524 97.701  102.244 1.00 463.38 ? 40  GLU D CA  1 
ATOM 9767  C C   . GLU D 4 40  ? 153.052 97.748  102.358 1.00 453.66 ? 40  GLU D C   1 
ATOM 9768  O O   . GLU D 4 40  ? 153.753 96.997  101.677 1.00 492.67 ? 40  GLU D O   1 
ATOM 9769  C CB  . GLU D 4 40  ? 151.010 98.803  101.299 1.00 487.36 ? 40  GLU D CB  1 
ATOM 9770  C CG  . GLU D 4 40  ? 149.608 98.564  100.724 1.00 500.00 ? 40  GLU D CG  1 
ATOM 9771  C CD  . GLU D 4 40  ? 148.474 98.615  101.749 1.00 500.00 ? 40  GLU D CD  1 
ATOM 9772  O OE1 . GLU D 4 40  ? 148.660 99.184  102.850 1.00 491.13 ? 40  GLU D OE1 1 
ATOM 9773  O OE2 . GLU D 4 40  ? 147.387 98.077  101.450 1.00 491.39 ? 40  GLU D OE2 1 
ATOM 9774  N N   . ALA D 4 41  ? 153.552 98.624  103.224 1.00 414.08 ? 41  ALA D N   1 
ATOM 9775  C CA  . ALA D 4 41  ? 154.977 98.684  103.530 1.00 405.21 ? 41  ALA D CA  1 
ATOM 9776  C C   . ALA D 4 41  ? 155.459 97.464  104.319 1.00 393.77 ? 41  ALA D C   1 
ATOM 9777  O O   . ALA D 4 41  ? 156.189 96.637  103.782 1.00 387.64 ? 41  ALA D O   1 
ATOM 9778  C CB  . ALA D 4 41  ? 155.298 99.961  104.291 1.00 448.23 ? 41  ALA D CB  1 
ATOM 9779  N N   . PHE D 4 42  ? 155.035 97.342  105.579 1.00 396.31 ? 42  PHE D N   1 
ATOM 9780  C CA  . PHE D 4 42  ? 155.688 96.428  106.526 1.00 433.92 ? 42  PHE D CA  1 
ATOM 9781  C C   . PHE D 4 42  ? 155.221 94.975  106.449 1.00 435.07 ? 42  PHE D C   1 
ATOM 9782  O O   . PHE D 4 42  ? 156.050 94.064  106.489 1.00 445.68 ? 42  PHE D O   1 
ATOM 9783  C CB  . PHE D 4 42  ? 155.544 96.948  107.967 1.00 485.18 ? 42  PHE D CB  1 
ATOM 9784  C CG  . PHE D 4 42  ? 156.635 96.471  108.912 1.00 500.00 ? 42  PHE D CG  1 
ATOM 9785  C CD1 . PHE D 4 42  ? 157.955 96.894  108.746 1.00 500.00 ? 42  PHE D CD1 1 
ATOM 9786  C CD2 . PHE D 4 42  ? 156.346 95.620  109.982 1.00 500.00 ? 42  PHE D CD2 1 
ATOM 9787  C CE1 . PHE D 4 42  ? 158.959 96.468  109.614 1.00 500.00 ? 42  PHE D CE1 1 
ATOM 9788  C CE2 . PHE D 4 42  ? 157.347 95.194  110.853 1.00 500.00 ? 42  PHE D CE2 1 
ATOM 9789  C CZ  . PHE D 4 42  ? 158.654 95.618  110.668 1.00 500.00 ? 42  PHE D CZ  1 
ATOM 9790  N N   . LEU D 4 43  ? 153.912 94.757  106.326 1.00 468.12 ? 43  LEU D N   1 
ATOM 9791  C CA  . LEU D 4 43  ? 153.328 93.415  106.539 1.00 500.00 ? 43  LEU D CA  1 
ATOM 9792  C C   . LEU D 4 43  ? 153.233 92.502  105.295 1.00 500.00 ? 43  LEU D C   1 
ATOM 9793  O O   . LEU D 4 43  ? 153.232 91.275  105.445 1.00 500.00 ? 43  LEU D O   1 
ATOM 9794  C CB  . LEU D 4 43  ? 151.959 93.532  107.242 1.00 500.00 ? 43  LEU D CB  1 
ATOM 9795  C CG  . LEU D 4 43  ? 152.000 93.549  108.782 1.00 500.00 ? 43  LEU D CG  1 
ATOM 9796  C CD1 . LEU D 4 43  ? 152.882 94.670  109.299 1.00 500.00 ? 43  LEU D CD1 1 
ATOM 9797  C CD2 . LEU D 4 43  ? 150.609 93.652  109.391 1.00 500.00 ? 43  LEU D CD2 1 
ATOM 9798  N N   . VAL D 4 44  ? 153.153 93.084  104.094 1.00 500.00 ? 44  VAL D N   1 
ATOM 9799  C CA  . VAL D 4 44  ? 153.032 92.304  102.841 1.00 500.00 ? 44  VAL D CA  1 
ATOM 9800  C C   . VAL D 4 44  ? 154.300 91.474  102.592 1.00 500.00 ? 44  VAL D C   1 
ATOM 9801  O O   . VAL D 4 44  ? 155.405 92.007  102.708 1.00 500.00 ? 44  VAL D O   1 
ATOM 9802  C CB  . VAL D 4 44  ? 152.748 93.221  101.615 1.00 500.00 ? 44  VAL D CB  1 
ATOM 9803  C CG1 . VAL D 4 44  ? 152.945 92.498  100.282 1.00 500.00 ? 44  VAL D CG1 1 
ATOM 9804  C CG2 . VAL D 4 44  ? 151.334 93.778  101.694 1.00 500.00 ? 44  VAL D CG2 1 
ATOM 9805  N N   . PRO D 4 45  ? 154.145 90.171  102.253 1.00 500.00 ? 45  PRO D N   1 
ATOM 9806  C CA  . PRO D 4 45  ? 155.330 89.358  101.946 1.00 500.00 ? 45  PRO D CA  1 
ATOM 9807  C C   . PRO D 4 45  ? 156.008 89.735  100.624 1.00 500.00 ? 45  PRO D C   1 
ATOM 9808  O O   . PRO D 4 45  ? 157.239 89.688  100.544 1.00 500.00 ? 45  PRO D O   1 
ATOM 9809  C CB  . PRO D 4 45  ? 154.780 87.928  101.895 1.00 500.00 ? 45  PRO D CB  1 
ATOM 9810  C CG  . PRO D 4 45  ? 153.344 88.086  101.555 1.00 500.00 ? 45  PRO D CG  1 
ATOM 9811  C CD  . PRO D 4 45  ? 152.908 89.368  102.200 1.00 500.00 ? 45  PRO D CD  1 
ATOM 9812  N N   . ALA D 4 46  ? 155.221 90.095  99.604  1.00 500.00 ? 46  ALA D N   1 
ATOM 9813  C CA  . ALA D 4 46  ? 155.778 90.519  98.315  1.00 500.00 ? 46  ALA D CA  1 
ATOM 9814  C C   . ALA D 4 46  ? 154.844 91.385  97.460  1.00 497.59 ? 46  ALA D C   1 
ATOM 9815  O O   . ALA D 4 46  ? 153.872 90.895  96.881  1.00 446.06 ? 46  ALA D O   1 
ATOM 9816  C CB  . ALA D 4 46  ? 156.230 89.302  97.516  1.00 500.00 ? 46  ALA D CB  1 
ATOM 9817  N N   . TYR D 4 47  ? 155.142 92.680  97.433  1.00 495.01 ? 47  TYR D N   1 
ATOM 9818  C CA  . TYR D 4 47  ? 154.842 93.545  96.286  1.00 500.00 ? 47  TYR D CA  1 
ATOM 9819  C C   . TYR D 4 47  ? 156.148 93.667  95.475  1.00 466.23 ? 47  TYR D C   1 
ATOM 9820  O O   . TYR D 4 47  ? 157.231 93.366  95.984  1.00 438.95 ? 47  TYR D O   1 
ATOM 9821  C CB  . TYR D 4 47  ? 154.319 94.935  96.729  1.00 500.00 ? 47  TYR D CB  1 
ATOM 9822  C CG  . TYR D 4 47  ? 152.799 95.088  96.762  1.00 500.00 ? 47  TYR D CG  1 
ATOM 9823  C CD1 . TYR D 4 47  ? 152.046 95.081  95.580  1.00 500.00 ? 47  TYR D CD1 1 
ATOM 9824  C CD2 . TYR D 4 47  ? 152.112 95.270  97.970  1.00 500.00 ? 47  TYR D CD2 1 
ATOM 9825  C CE1 . TYR D 4 47  ? 150.658 95.227  95.601  1.00 500.00 ? 47  TYR D CE1 1 
ATOM 9826  C CE2 . TYR D 4 47  ? 150.725 95.416  97.996  1.00 500.00 ? 47  TYR D CE2 1 
ATOM 9827  C CZ  . TYR D 4 47  ? 150.004 95.395  96.808  1.00 500.00 ? 47  TYR D CZ  1 
ATOM 9828  O OH  . TYR D 4 47  ? 148.633 95.538  96.812  1.00 500.00 ? 47  TYR D OH  1 
ATOM 9829  N N   . THR D 4 48  ? 156.040 94.081  94.214  1.00 465.75 ? 48  THR D N   1 
ATOM 9830  C CA  . THR D 4 48  ? 157.216 94.297  93.356  1.00 481.80 ? 48  THR D CA  1 
ATOM 9831  C C   . THR D 4 48  ? 157.957 95.573  93.742  1.00 489.88 ? 48  THR D C   1 
ATOM 9832  O O   . THR D 4 48  ? 159.189 95.577  93.851  1.00 424.41 ? 48  THR D O   1 
ATOM 9833  C CB  . THR D 4 48  ? 156.822 94.405  91.873  1.00 500.00 ? 48  THR D CB  1 
ATOM 9834  O OG1 . THR D 4 48  ? 155.826 95.424  91.709  1.00 500.00 ? 48  THR D OG1 1 
ATOM 9835  C CG2 . THR D 4 48  ? 156.275 93.080  91.376  1.00 500.00 ? 48  THR D CG2 1 
ATOM 9836  N N   . GLU D 4 49  ? 157.180 96.641  93.951  1.00 500.00 ? 49  GLU D N   1 
ATOM 9837  C CA  . GLU D 4 49  ? 157.673 97.953  94.419  1.00 496.86 ? 49  GLU D CA  1 
ATOM 9838  C C   . GLU D 4 49  ? 157.782 98.048  95.949  1.00 445.69 ? 49  GLU D C   1 
ATOM 9839  O O   . GLU D 4 49  ? 158.037 99.132  96.491  1.00 302.23 ? 49  GLU D O   1 
ATOM 9840  C CB  . GLU D 4 49  ? 156.754 99.085  93.894  1.00 463.00 ? 49  GLU D CB  1 
ATOM 9841  C CG  . GLU D 4 49  ? 157.259 99.748  92.623  1.00 459.21 ? 49  GLU D CG  1 
ATOM 9842  C CD  . GLU D 4 49  ? 158.389 100.736 92.879  1.00 432.60 ? 49  GLU D CD  1 
ATOM 9843  O OE1 . GLU D 4 49  ? 158.191 101.667 93.687  1.00 367.08 ? 49  GLU D OE1 1 
ATOM 9844  O OE2 . GLU D 4 49  ? 159.470 100.589 92.265  1.00 419.01 ? 49  GLU D OE2 1 
ATOM 9845  N N   . GLN D 4 50  ? 157.666 96.907  96.632  1.00 451.62 ? 50  GLN D N   1 
ATOM 9846  C CA  . GLN D 4 50  ? 157.290 96.884  98.044  1.00 465.04 ? 50  GLN D CA  1 
ATOM 9847  C C   . GLN D 4 50  ? 158.303 97.679  98.854  1.00 460.01 ? 50  GLN D C   1 
ATOM 9848  O O   . GLN D 4 50  ? 157.931 98.504  99.712  1.00 449.64 ? 50  GLN D O   1 
ATOM 9849  C CB  . GLN D 4 50  ? 157.257 95.443  98.562  1.00 500.00 ? 50  GLN D CB  1 
ATOM 9850  C CG  . GLN D 4 50  ? 156.710 95.269  99.974  1.00 500.00 ? 50  GLN D CG  1 
ATOM 9851  C CD  . GLN D 4 50  ? 157.782 94.856  100.970 1.00 500.00 ? 50  GLN D CD  1 
ATOM 9852  O OE1 . GLN D 4 50  ? 158.151 95.624  101.858 1.00 500.00 ? 50  GLN D OE1 1 
ATOM 9853  N NE2 . GLN D 4 50  ? 158.298 93.640  100.815 1.00 500.00 ? 50  GLN D NE2 1 
ATOM 9854  N N   . SER D 4 51  ? 159.577 97.378  98.588  1.00 481.10 ? 51  SER D N   1 
ATOM 9855  C CA  . SER D 4 51  ? 160.691 97.999  99.310  1.00 497.44 ? 51  SER D CA  1 
ATOM 9856  C C   . SER D 4 51  ? 160.652 99.510  99.131  1.00 494.21 ? 51  SER D C   1 
ATOM 9857  O O   . SER D 4 51  ? 160.808 100.260 100.110 1.00 500.00 ? 51  SER D O   1 
ATOM 9858  C CB  . SER D 4 51  ? 162.052 97.447  98.877  1.00 500.00 ? 51  SER D CB  1 
ATOM 9859  O OG  . SER D 4 51  ? 163.071 97.865  99.776  1.00 466.21 ? 51  SER D OG  1 
ATOM 9860  N N   . GLN D 4 52  ? 160.436 99.918  97.884  1.00 455.06 ? 52  GLN D N   1 
ATOM 9861  C CA  . GLN D 4 52  ? 160.374 101.343 97.532  1.00 455.99 ? 52  GLN D CA  1 
ATOM 9862  C C   . GLN D 4 52  ? 159.260 102.028 98.312  1.00 451.57 ? 52  GLN D C   1 
ATOM 9863  O O   . GLN D 4 52  ? 159.460 103.119 98.868  1.00 413.80 ? 52  GLN D O   1 
ATOM 9864  C CB  . GLN D 4 52  ? 160.224 101.545 96.023  1.00 455.04 ? 52  GLN D CB  1 
ATOM 9865  C CG  . GLN D 4 52  ? 161.518 101.340 95.246  1.00 469.90 ? 52  GLN D CG  1 
ATOM 9866  C CD  . GLN D 4 52  ? 162.157 102.660 94.807  1.00 492.16 ? 52  GLN D CD  1 
ATOM 9867  O OE1 . GLN D 4 52  ? 162.542 103.497 95.640  1.00 452.13 ? 52  GLN D OE1 1 
ATOM 9868  N NE2 . GLN D 4 52  ? 162.278 102.850 93.488  1.00 500.00 ? 52  GLN D NE2 1 
ATOM 9869  N N   . ILE D 4 53  ? 158.111 101.360 98.340  1.00 449.36 ? 53  ILE D N   1 
ATOM 9870  C CA  . ILE D 4 53  ? 156.923 101.852 99.045  1.00 447.22 ? 53  ILE D CA  1 
ATOM 9871  C C   . ILE D 4 53  ? 157.243 102.070 100.518 1.00 394.87 ? 53  ILE D C   1 
ATOM 9872  O O   . ILE D 4 53  ? 156.905 103.115 101.103 1.00 425.09 ? 53  ILE D O   1 
ATOM 9873  C CB  . ILE D 4 53  ? 155.722 100.868 98.909  1.00 500.00 ? 53  ILE D CB  1 
ATOM 9874  C CG1 . ILE D 4 53  ? 155.174 100.865 97.471  1.00 500.00 ? 53  ILE D CG1 1 
ATOM 9875  C CG2 . ILE D 4 53  ? 154.602 101.175 99.906  1.00 497.53 ? 53  ILE D CG2 1 
ATOM 9876  C CD1 . ILE D 4 53  ? 154.412 102.110 97.065  1.00 500.00 ? 53  ILE D CD1 1 
ATOM 9877  N N   . LYS D 4 54  ? 157.895 101.061 101.087 1.00 396.26 ? 54  LYS D N   1 
ATOM 9878  C CA  . LYS D 4 54  ? 158.293 101.073 102.502 1.00 429.86 ? 54  LYS D CA  1 
ATOM 9879  C C   . LYS D 4 54  ? 159.189 102.267 102.783 1.00 435.32 ? 54  LYS D C   1 
ATOM 9880  O O   . LYS D 4 54  ? 158.999 102.978 103.772 1.00 428.90 ? 54  LYS D O   1 
ATOM 9881  C CB  . LYS D 4 54  ? 158.958 99.762  102.952 1.00 456.10 ? 54  LYS D CB  1 
ATOM 9882  C CG  . LYS D 4 54  ? 159.236 99.687  104.457 1.00 445.23 ? 54  LYS D CG  1 
ATOM 9883  C CD  . LYS D 4 54  ? 160.105 98.495  104.840 1.00 453.84 ? 54  LYS D CD  1 
ATOM 9884  C CE  . LYS D 4 54  ? 159.294 97.223  105.007 1.00 440.89 ? 54  LYS D CE  1 
ATOM 9885  N NZ  . LYS D 4 54  ? 160.154 96.073  105.401 1.00 438.36 ? 54  LYS D NZ  1 
ATOM 9886  N N   . GLY D 4 55  ? 160.152 102.458 101.895 1.00 458.14 ? 55  GLY D N   1 
ATOM 9887  C CA  . GLY D 4 55  ? 161.119 103.561 101.983 1.00 483.10 ? 55  GLY D CA  1 
ATOM 9888  C C   . GLY D 4 55  ? 160.392 104.895 102.002 1.00 480.92 ? 55  GLY D C   1 
ATOM 9889  O O   . GLY D 4 55  ? 160.686 105.770 102.826 1.00 486.10 ? 55  GLY D O   1 
ATOM 9890  N N   . TYR D 4 56  ? 159.445 105.014 101.078 1.00 443.57 ? 56  TYR D N   1 
ATOM 9891  C CA  . TYR D 4 56  ? 158.625 106.221 100.923 1.00 431.41 ? 56  TYR D CA  1 
ATOM 9892  C C   . TYR D 4 56  ? 157.894 106.524 102.236 1.00 436.62 ? 56  TYR D C   1 
ATOM 9893  O O   . TYR D 4 56  ? 157.881 107.674 102.723 1.00 443.19 ? 56  TYR D O   1 
ATOM 9894  C CB  . TYR D 4 56  ? 157.576 106.042 99.814  1.00 442.74 ? 56  TYR D CB  1 
ATOM 9895  C CG  . TYR D 4 56  ? 158.048 106.240 98.389  1.00 473.92 ? 56  TYR D CG  1 
ATOM 9896  C CD1 . TYR D 4 56  ? 159.371 106.004 98.009  1.00 500.00 ? 56  TYR D CD1 1 
ATOM 9897  C CD2 . TYR D 4 56  ? 157.144 106.636 97.402  1.00 497.69 ? 56  TYR D CD2 1 
ATOM 9898  C CE1 . TYR D 4 56  ? 159.781 106.176 96.693  1.00 500.00 ? 56  TYR D CE1 1 
ATOM 9899  C CE2 . TYR D 4 56  ? 157.546 106.812 96.084  1.00 500.00 ? 56  TYR D CE2 1 
ATOM 9900  C CZ  . TYR D 4 56  ? 158.865 106.582 95.734  1.00 500.00 ? 56  TYR D CZ  1 
ATOM 9901  O OH  . TYR D 4 56  ? 159.277 106.753 94.430  1.00 500.00 ? 56  TYR D OH  1 
ATOM 9902  N N   . VAL D 4 57  ? 157.296 105.466 102.771 1.00 426.69 ? 57  VAL D N   1 
ATOM 9903  C CA  . VAL D 4 57  ? 156.533 105.538 104.022 1.00 418.54 ? 57  VAL D CA  1 
ATOM 9904  C C   . VAL D 4 57  ? 157.421 106.046 105.149 1.00 403.03 ? 57  VAL D C   1 
ATOM 9905  O O   . VAL D 4 57  ? 157.030 106.924 105.922 1.00 412.46 ? 57  VAL D O   1 
ATOM 9906  C CB  . VAL D 4 57  ? 155.813 104.202 104.366 1.00 446.50 ? 57  VAL D CB  1 
ATOM 9907  C CG1 . VAL D 4 57  ? 155.261 104.190 105.791 1.00 436.74 ? 57  VAL D CG1 1 
ATOM 9908  C CG2 . VAL D 4 57  ? 154.681 103.948 103.378 1.00 459.15 ? 57  VAL D CG2 1 
ATOM 9909  N N   . TRP D 4 58  ? 158.606 105.472 105.215 1.00 406.51 ? 58  TRP D N   1 
ATOM 9910  C CA  . TRP D 4 58  ? 159.627 105.809 106.218 1.00 415.74 ? 58  TRP D CA  1 
ATOM 9911  C C   . TRP D 4 58  ? 159.957 107.291 106.140 1.00 412.71 ? 58  TRP D C   1 
ATOM 9912  O O   . TRP D 4 58  ? 160.008 107.987 107.160 1.00 461.35 ? 58  TRP D O   1 
ATOM 9913  C CB  . TRP D 4 58  ? 160.857 104.943 105.856 1.00 425.44 ? 58  TRP D CB  1 
ATOM 9914  C CG  . TRP D 4 58  ? 162.032 104.942 106.737 1.00 435.54 ? 58  TRP D CG  1 
ATOM 9915  C CD1 . TRP D 4 58  ? 163.236 105.539 106.495 1.00 424.17 ? 58  TRP D CD1 1 
ATOM 9916  C CD2 . TRP D 4 58  ? 162.171 104.228 107.967 1.00 483.59 ? 58  TRP D CD2 1 
ATOM 9917  N NE1 . TRP D 4 58  ? 164.106 105.277 107.525 1.00 485.98 ? 58  TRP D NE1 1 
ATOM 9918  C CE2 . TRP D 4 58  ? 163.478 104.473 108.443 1.00 500.00 ? 58  TRP D CE2 1 
ATOM 9919  C CE3 . TRP D 4 58  ? 161.309 103.423 108.728 1.00 486.50 ? 58  TRP D CE3 1 
ATOM 9920  C CZ2 . TRP D 4 58  ? 163.947 103.940 109.654 1.00 500.00 ? 58  TRP D CZ2 1 
ATOM 9921  C CZ3 . TRP D 4 58  ? 161.773 102.891 109.932 1.00 496.97 ? 58  TRP D CZ3 1 
ATOM 9922  C CH2 . TRP D 4 58  ? 163.083 103.153 110.382 1.00 500.00 ? 58  TRP D CH2 1 
ATOM 9923  N N   . ARG D 4 59  ? 160.178 107.737 104.913 1.00 428.04 ? 59  ARG D N   1 
ATOM 9924  C CA  . ARG D 4 59  ? 160.516 109.134 104.605 1.00 472.47 ? 59  ARG D CA  1 
ATOM 9925  C C   . ARG D 4 59  ? 159.419 110.059 105.141 1.00 449.02 ? 59  ARG D C   1 
ATOM 9926  O O   . ARG D 4 59  ? 159.699 111.079 105.808 1.00 467.19 ? 59  ARG D O   1 
ATOM 9927  C CB  . ARG D 4 59  ? 160.583 109.285 103.069 1.00 495.85 ? 59  ARG D CB  1 
ATOM 9928  C CG  . ARG D 4 59  ? 161.850 109.907 102.515 1.00 500.00 ? 59  ARG D CG  1 
ATOM 9929  C CD  . ARG D 4 59  ? 161.945 109.683 101.007 1.00 500.00 ? 59  ARG D CD  1 
ATOM 9930  N NE  . ARG D 4 59  ? 162.576 108.402 100.682 1.00 500.00 ? 59  ARG D NE  1 
ATOM 9931  C CZ  . ARG D 4 59  ? 163.893 108.177 100.633 1.00 500.00 ? 59  ARG D CZ  1 
ATOM 9932  N NH1 . ARG D 4 59  ? 164.784 109.142 100.886 1.00 500.00 ? 59  ARG D NH1 1 
ATOM 9933  N NH2 . ARG D 4 59  ? 164.333 106.957 100.328 1.00 500.00 ? 59  ARG D NH2 1 
ATOM 9934  N N   . SER D 4 60  ? 158.186 109.667 104.823 1.00 436.39 ? 60  SER D N   1 
ATOM 9935  C CA  . SER D 4 60  ? 156.994 110.415 105.226 1.00 438.71 ? 60  SER D CA  1 
ATOM 9936  C C   . SER D 4 60  ? 156.945 110.554 106.746 1.00 416.74 ? 60  SER D C   1 
ATOM 9937  O O   . SER D 4 60  ? 156.699 111.646 107.287 1.00 354.96 ? 60  SER D O   1 
ATOM 9938  C CB  . SER D 4 60  ? 155.704 109.747 104.729 1.00 430.01 ? 60  SER D CB  1 
ATOM 9939  O OG  . SER D 4 60  ? 155.743 109.533 103.330 1.00 462.97 ? 60  SER D OG  1 
ATOM 9940  N N   . ALA D 4 61  ? 157.184 109.424 107.399 1.00 453.22 ? 61  ALA D N   1 
ATOM 9941  C CA  . ALA D 4 61  ? 157.183 109.334 108.864 1.00 487.00 ? 61  ALA D CA  1 
ATOM 9942  C C   . ALA D 4 61  ? 158.198 110.292 109.449 1.00 442.98 ? 61  ALA D C   1 
ATOM 9943  O O   . ALA D 4 61  ? 157.905 111.026 110.402 1.00 381.24 ? 61  ALA D O   1 
ATOM 9944  C CB  . ALA D 4 61  ? 157.469 107.911 109.338 1.00 500.00 ? 61  ALA D CB  1 
ATOM 9945  N N   . VAL D 4 62  ? 159.386 110.261 108.860 1.00 483.13 ? 62  VAL D N   1 
ATOM 9946  C CA  . VAL D 4 62  ? 160.512 111.111 109.278 1.00 500.00 ? 62  VAL D CA  1 
ATOM 9947  C C   . VAL D 4 62  ? 160.111 112.578 109.192 1.00 444.64 ? 62  VAL D C   1 
ATOM 9948  O O   . VAL D 4 62  ? 160.351 113.357 110.131 1.00 431.96 ? 62  VAL D O   1 
ATOM 9949  C CB  . VAL D 4 62  ? 161.809 110.815 108.471 1.00 500.00 ? 62  VAL D CB  1 
ATOM 9950  C CG1 . VAL D 4 62  ? 162.856 111.918 108.635 1.00 500.00 ? 62  VAL D CG1 1 
ATOM 9951  C CG2 . VAL D 4 62  ? 162.396 109.468 108.886 1.00 500.00 ? 62  VAL D CG2 1 
ATOM 9952  N N   . GLY D 4 63  ? 159.502 112.913 108.058 1.00 410.29 ? 63  GLY D N   1 
ATOM 9953  C CA  . GLY D 4 63  ? 159.044 114.276 107.780 1.00 404.41 ? 63  GLY D CA  1 
ATOM 9954  C C   . GLY D 4 63  ? 158.067 114.733 108.861 1.00 409.99 ? 63  GLY D C   1 
ATOM 9955  O O   . GLY D 4 63  ? 158.175 115.851 109.400 1.00 390.64 ? 63  GLY D O   1 
ATOM 9956  N N   . PHE D 4 64  ? 157.126 113.841 109.148 1.00 422.03 ? 64  PHE D N   1 
ATOM 9957  C CA  . PHE D 4 64  ? 156.081 114.077 110.150 1.00 445.71 ? 64  PHE D CA  1 
ATOM 9958  C C   . PHE D 4 64  ? 156.716 114.376 111.506 1.00 455.99 ? 64  PHE D C   1 
ATOM 9959  O O   . PHE D 4 64  ? 156.330 115.336 112.197 1.00 491.13 ? 64  PHE D O   1 
ATOM 9960  C CB  . PHE D 4 64  ? 155.132 112.858 110.191 1.00 478.42 ? 64  PHE D CB  1 
ATOM 9961  C CG  . PHE D 4 64  ? 154.244 112.780 111.407 1.00 490.36 ? 64  PHE D CG  1 
ATOM 9962  C CD1 . PHE D 4 64  ? 154.707 112.205 112.595 1.00 495.36 ? 64  PHE D CD1 1 
ATOM 9963  C CD2 . PHE D 4 64  ? 152.927 113.228 111.351 1.00 456.65 ? 64  PHE D CD2 1 
ATOM 9964  C CE1 . PHE D 4 64  ? 153.884 112.117 113.710 1.00 488.33 ? 64  PHE D CE1 1 
ATOM 9965  C CE2 . PHE D 4 64  ? 152.099 113.141 112.462 1.00 467.64 ? 64  PHE D CE2 1 
ATOM 9966  C CZ  . PHE D 4 64  ? 152.577 112.583 113.643 1.00 489.75 ? 64  PHE D CZ  1 
ATOM 9967  N N   . LEU D 4 65  ? 157.684 113.537 111.848 1.00 451.82 ? 65  LEU D N   1 
ATOM 9968  C CA  . LEU D 4 65  ? 158.418 113.644 113.114 1.00 471.56 ? 65  LEU D CA  1 
ATOM 9969  C C   . LEU D 4 65  ? 159.086 115.003 113.219 1.00 448.81 ? 65  LEU D C   1 
ATOM 9970  O O   . LEU D 4 65  ? 159.005 115.673 114.259 1.00 418.66 ? 65  LEU D O   1 
ATOM 9971  C CB  . LEU D 4 65  ? 159.435 112.507 113.253 1.00 500.00 ? 65  LEU D CB  1 
ATOM 9972  C CG  . LEU D 4 65  ? 160.029 112.254 114.648 1.00 500.00 ? 65  LEU D CG  1 
ATOM 9973  C CD1 . LEU D 4 65  ? 160.344 110.772 114.827 1.00 500.00 ? 65  LEU D CD1 1 
ATOM 9974  C CD2 . LEU D 4 65  ? 161.273 113.100 114.926 1.00 500.00 ? 65  LEU D CD2 1 
ATOM 9975  N N   . PHE D 4 66  ? 159.735 115.381 112.124 1.00 441.36 ? 66  PHE D N   1 
ATOM 9976  C CA  . PHE D 4 66  ? 160.450 116.662 112.019 1.00 437.95 ? 66  PHE D CA  1 
ATOM 9977  C C   . PHE D 4 66  ? 159.491 117.813 112.280 1.00 437.81 ? 66  PHE D C   1 
ATOM 9978  O O   . PHE D 4 66  ? 159.802 118.739 113.052 1.00 427.76 ? 66  PHE D O   1 
ATOM 9979  C CB  . PHE D 4 66  ? 161.145 116.778 110.633 1.00 465.95 ? 66  PHE D CB  1 
ATOM 9980  C CG  . PHE D 4 66  ? 161.036 118.137 109.969 1.00 500.00 ? 66  PHE D CG  1 
ATOM 9981  C CD1 . PHE D 4 66  ? 161.923 119.160 110.285 1.00 500.00 ? 66  PHE D CD1 1 
ATOM 9982  C CD2 . PHE D 4 66  ? 160.068 118.380 108.985 1.00 490.53 ? 66  PHE D CD2 1 
ATOM 9983  C CE1 . PHE D 4 66  ? 161.830 120.400 109.657 1.00 500.00 ? 66  PHE D CE1 1 
ATOM 9984  C CE2 . PHE D 4 66  ? 159.972 119.615 108.356 1.00 457.10 ? 66  PHE D CE2 1 
ATOM 9985  C CZ  . PHE D 4 66  ? 160.854 120.628 108.692 1.00 500.00 ? 66  PHE D CZ  1 
ATOM 9986  N N   . TRP D 4 67  ? 158.338 117.721 111.621 1.00 432.11 ? 67  TRP D N   1 
ATOM 9987  C CA  . TRP D 4 67  ? 157.285 118.737 111.731 1.00 426.63 ? 67  TRP D CA  1 
ATOM 9988  C C   . TRP D 4 67  ? 156.850 118.889 113.184 1.00 435.50 ? 67  TRP D C   1 
ATOM 9989  O O   . TRP D 4 67  ? 156.729 120.014 113.702 1.00 411.78 ? 67  TRP D O   1 
ATOM 9990  C CB  . TRP D 4 67  ? 156.059 118.451 110.845 1.00 396.34 ? 67  TRP D CB  1 
ATOM 9991  C CG  . TRP D 4 67  ? 155.876 119.461 109.753 1.00 449.41 ? 67  TRP D CG  1 
ATOM 9992  C CD1 . TRP D 4 67  ? 155.741 119.214 108.419 1.00 497.85 ? 67  TRP D CD1 1 
ATOM 9993  C CD2 . TRP D 4 67  ? 155.799 120.879 109.906 1.00 475.36 ? 67  TRP D CD2 1 
ATOM 9994  N NE1 . TRP D 4 67  ? 155.585 120.393 107.729 1.00 476.11 ? 67  TRP D NE1 1 
ATOM 9995  C CE2 . TRP D 4 67  ? 155.620 121.431 108.619 1.00 466.58 ? 67  TRP D CE2 1 
ATOM 9996  C CE3 . TRP D 4 67  ? 155.874 121.741 111.006 1.00 500.00 ? 67  TRP D CE3 1 
ATOM 9997  C CZ2 . TRP D 4 67  ? 155.515 122.807 108.405 1.00 483.84 ? 67  TRP D CZ2 1 
ATOM 9998  C CZ3 . TRP D 4 67  ? 155.767 123.110 110.790 1.00 500.00 ? 67  TRP D CZ3 1 
ATOM 9999  C CH2 . TRP D 4 67  ? 155.590 123.629 109.496 1.00 500.00 ? 67  TRP D CH2 1 
ATOM 10000 N N   . VAL D 4 68  ? 156.636 117.737 113.809 1.00 490.43 ? 68  VAL D N   1 
ATOM 10001 C CA  . VAL D 4 68  ? 156.205 117.666 115.209 1.00 500.00 ? 68  VAL D CA  1 
ATOM 10002 C C   . VAL D 4 68  ? 157.219 118.366 116.106 1.00 444.05 ? 68  VAL D C   1 
ATOM 10003 O O   . VAL D 4 68  ? 156.850 119.163 116.983 1.00 461.15 ? 68  VAL D O   1 
ATOM 10004 C CB  . VAL D 4 68  ? 155.943 116.210 115.684 1.00 500.00 ? 68  VAL D CB  1 
ATOM 10005 C CG1 . VAL D 4 68  ? 155.796 116.126 117.205 1.00 500.00 ? 68  VAL D CG1 1 
ATOM 10006 C CG2 . VAL D 4 68  ? 154.694 115.649 115.011 1.00 500.00 ? 68  VAL D CG2 1 
ATOM 10007 N N   . ILE D 4 69  ? 158.482 118.045 115.856 1.00 367.40 ? 69  ILE D N   1 
ATOM 10008 C CA  . ILE D 4 69  ? 159.607 118.601 116.612 1.00 462.04 ? 69  ILE D CA  1 
ATOM 10009 C C   . ILE D 4 69  ? 159.612 120.114 116.502 1.00 472.57 ? 69  ILE D C   1 
ATOM 10010 O O   . ILE D 4 69  ? 159.745 120.843 117.521 1.00 500.00 ? 69  ILE D O   1 
ATOM 10011 C CB  . ILE D 4 69  ? 160.955 117.915 116.219 1.00 500.00 ? 69  ILE D CB  1 
ATOM 10012 C CG1 . ILE D 4 69  ? 161.335 116.858 117.267 1.00 500.00 ? 69  ILE D CG1 1 
ATOM 10013 C CG2 . ILE D 4 69  ? 162.116 118.901 116.091 1.00 500.00 ? 69  ILE D CG2 1 
ATOM 10014 C CD1 . ILE D 4 69  ? 160.244 115.858 117.599 1.00 500.00 ? 69  ILE D CD1 1 
ATOM 10015 N N   . VAL D 4 70  ? 159.426 120.583 115.268 1.00 459.00 ? 70  VAL D N   1 
ATOM 10016 C CA  . VAL D 4 70  ? 159.403 122.013 114.962 1.00 491.40 ? 70  VAL D CA  1 
ATOM 10017 C C   . VAL D 4 70  ? 158.169 122.607 115.672 1.00 484.35 ? 70  VAL D C   1 
ATOM 10018 O O   . VAL D 4 70  ? 158.240 123.652 116.359 1.00 493.07 ? 70  VAL D O   1 
ATOM 10019 C CB  . VAL D 4 70  ? 159.339 122.275 113.443 1.00 500.00 ? 70  VAL D CB  1 
ATOM 10020 C CG1 . VAL D 4 70  ? 159.047 123.746 113.145 1.00 500.00 ? 70  VAL D CG1 1 
ATOM 10021 C CG2 . VAL D 4 70  ? 160.638 121.834 112.774 1.00 500.00 ? 70  VAL D CG2 1 
ATOM 10022 N N   . LEU D 4 71  ? 157.039 122.001 115.318 1.00 465.51 ? 71  LEU D N   1 
ATOM 10023 C CA  . LEU D 4 71  ? 155.718 122.541 115.661 1.00 460.69 ? 71  LEU D CA  1 
ATOM 10024 C C   . LEU D 4 71  ? 155.580 122.659 117.170 1.00 446.49 ? 71  LEU D C   1 
ATOM 10025 O O   . LEU D 4 71  ? 155.137 123.695 117.704 1.00 437.17 ? 71  LEU D O   1 
ATOM 10026 C CB  . LEU D 4 71  ? 154.607 121.636 115.120 1.00 479.82 ? 71  LEU D CB  1 
ATOM 10027 C CG  . LEU D 4 71  ? 153.164 121.986 115.494 1.00 500.00 ? 71  LEU D CG  1 
ATOM 10028 C CD1 . LEU D 4 71  ? 152.826 123.407 115.051 1.00 500.00 ? 71  LEU D CD1 1 
ATOM 10029 C CD2 . LEU D 4 71  ? 152.202 120.966 114.899 1.00 500.00 ? 71  LEU D CD2 1 
ATOM 10030 N N   . THR D 4 72  ? 155.967 121.567 117.828 1.00 447.41 ? 72  THR D N   1 
ATOM 10031 C CA  . THR D 4 72  ? 155.889 121.474 119.303 1.00 457.22 ? 72  THR D CA  1 
ATOM 10032 C C   . THR D 4 72  ? 156.733 122.568 119.925 1.00 429.30 ? 72  THR D C   1 
ATOM 10033 O O   . THR D 4 72  ? 156.278 123.238 120.871 1.00 445.97 ? 72  THR D O   1 
ATOM 10034 C CB  . THR D 4 72  ? 156.334 120.111 119.885 1.00 481.42 ? 72  THR D CB  1 
ATOM 10035 O OG1 . THR D 4 72  ? 157.581 119.707 119.303 1.00 484.96 ? 72  THR D OG1 1 
ATOM 10036 C CG2 . THR D 4 72  ? 155.265 119.043 119.655 1.00 487.54 ? 72  THR D CG2 1 
ATOM 10037 N N   . SER D 4 73  ? 157.942 122.731 119.383 1.00 408.86 ? 73  SER D N   1 
ATOM 10038 C CA  . SER D 4 73  ? 158.891 123.735 119.860 1.00 434.80 ? 73  SER D CA  1 
ATOM 10039 C C   . SER D 4 73  ? 158.267 125.131 119.776 1.00 402.78 ? 73  SER D C   1 
ATOM 10040 O O   . SER D 4 73  ? 158.336 125.928 120.733 1.00 456.96 ? 73  SER D O   1 
ATOM 10041 C CB  . SER D 4 73  ? 160.221 123.680 119.094 1.00 445.42 ? 73  SER D CB  1 
ATOM 10042 O OG  . SER D 4 73  ? 160.977 122.540 119.473 1.00 447.04 ? 73  SER D OG  1 
ATOM 10043 N N   . TRP D 4 74  ? 157.668 125.381 118.618 1.00 365.75 ? 74  TRP D N   1 
ATOM 10044 C CA  . TRP D 4 74  ? 157.011 126.662 118.330 1.00 376.27 ? 74  TRP D CA  1 
ATOM 10045 C C   . TRP D 4 74  ? 155.924 126.939 119.352 1.00 332.10 ? 74  TRP D C   1 
ATOM 10046 O O   . TRP D 4 74  ? 155.826 128.051 119.892 1.00 274.18 ? 74  TRP D O   1 
ATOM 10047 C CB  . TRP D 4 74  ? 156.417 126.650 116.917 1.00 424.41 ? 74  TRP D CB  1 
ATOM 10048 C CG  . TRP D 4 74  ? 155.344 127.640 116.737 1.00 419.51 ? 74  TRP D CG  1 
ATOM 10049 C CD1 . TRP D 4 74  ? 154.029 127.395 116.490 1.00 397.65 ? 74  TRP D CD1 1 
ATOM 10050 C CD2 . TRP D 4 74  ? 155.485 129.050 116.835 1.00 398.92 ? 74  TRP D CD2 1 
ATOM 10051 N NE1 . TRP D 4 74  ? 153.338 128.576 116.404 1.00 393.93 ? 74  TRP D NE1 1 
ATOM 10052 C CE2 . TRP D 4 74  ? 154.212 129.611 116.614 1.00 419.29 ? 74  TRP D CE2 1 
ATOM 10053 C CE3 . TRP D 4 74  ? 156.572 129.899 117.083 1.00 385.84 ? 74  TRP D CE3 1 
ATOM 10054 C CZ2 . TRP D 4 74  ? 153.993 130.986 116.630 1.00 470.34 ? 74  TRP D CZ2 1 
ATOM 10055 C CZ3 . TRP D 4 74  ? 156.359 131.261 117.098 1.00 433.26 ? 74  TRP D CZ3 1 
ATOM 10056 C CH2 . TRP D 4 74  ? 155.076 131.796 116.874 1.00 490.56 ? 74  TRP D CH2 1 
ATOM 10057 N N   . ILE D 4 75  ? 155.126 125.907 119.591 1.00 332.96 ? 75  ILE D N   1 
ATOM 10058 C CA  . ILE D 4 75  ? 154.009 125.961 120.541 1.00 383.75 ? 75  ILE D CA  1 
ATOM 10059 C C   . ILE D 4 75  ? 154.523 126.347 121.927 1.00 388.91 ? 75  ILE D C   1 
ATOM 10060 O O   . ILE D 4 75  ? 153.951 127.229 122.597 1.00 446.66 ? 75  ILE D O   1 
ATOM 10061 C CB  . ILE D 4 75  ? 153.203 124.609 120.524 1.00 407.95 ? 75  ILE D CB  1 
ATOM 10062 C CG1 . ILE D 4 75  ? 151.818 124.841 119.890 1.00 436.15 ? 75  ILE D CG1 1 
ATOM 10063 C CG2 . ILE D 4 75  ? 153.076 123.944 121.908 1.00 410.53 ? 75  ILE D CG2 1 
ATOM 10064 C CD1 . ILE D 4 75  ? 150.930 123.614 119.807 1.00 454.53 ? 75  ILE D CD1 1 
ATOM 10065 N N   . THR D 4 76  ? 155.598 125.668 122.314 1.00 342.96 ? 76  THR D N   1 
ATOM 10066 C CA  . THR D 4 76  ? 156.229 125.881 123.618 1.00 411.62 ? 76  THR D CA  1 
ATOM 10067 C C   . THR D 4 76  ? 156.673 127.339 123.753 1.00 374.93 ? 76  THR D C   1 
ATOM 10068 O O   . THR D 4 76  ? 156.430 127.983 124.789 1.00 408.98 ? 76  THR D O   1 
ATOM 10069 C CB  . THR D 4 76  ? 157.339 124.852 123.932 1.00 497.52 ? 76  THR D CB  1 
ATOM 10070 O OG1 . THR D 4 76  ? 156.750 123.548 124.036 1.00 495.80 ? 76  THR D OG1 1 
ATOM 10071 C CG2 . THR D 4 76  ? 158.044 125.170 125.256 1.00 500.00 ? 76  THR D CG2 1 
ATOM 10072 N N   . ILE D 4 77  ? 157.307 127.817 122.690 1.00 359.98 ? 77  ILE D N   1 
ATOM 10073 C CA  . ILE D 4 77  ? 157.813 129.190 122.624 1.00 432.02 ? 77  ILE D CA  1 
ATOM 10074 C C   . ILE D 4 77  ? 156.667 130.182 122.825 1.00 432.99 ? 77  ILE D C   1 
ATOM 10075 O O   . ILE D 4 77  ? 156.785 131.142 123.608 1.00 464.30 ? 77  ILE D O   1 
ATOM 10076 C CB  . ILE D 4 77  ? 158.611 129.444 121.314 1.00 500.00 ? 77  ILE D CB  1 
ATOM 10077 C CG1 . ILE D 4 77  ? 159.982 128.752 121.409 1.00 500.00 ? 77  ILE D CG1 1 
ATOM 10078 C CG2 . ILE D 4 77  ? 158.798 130.938 121.041 1.00 500.00 ? 77  ILE D CG2 1 
ATOM 10079 C CD1 . ILE D 4 77  ? 160.720 128.609 120.090 1.00 500.00 ? 77  ILE D CD1 1 
ATOM 10080 N N   . PHE D 4 78  ? 155.578 129.910 122.114 1.00 401.07 ? 78  PHE D N   1 
ATOM 10081 C CA  . PHE D 4 78  ? 154.379 130.744 122.160 1.00 389.63 ? 78  PHE D CA  1 
ATOM 10082 C C   . PHE D 4 78  ? 153.844 130.814 123.585 1.00 362.84 ? 78  PHE D C   1 
ATOM 10083 O O   . PHE D 4 78  ? 153.517 131.913 124.091 1.00 363.43 ? 78  PHE D O   1 
ATOM 10084 C CB  . PHE D 4 78  ? 153.313 130.267 121.196 1.00 372.83 ? 78  PHE D CB  1 
ATOM 10085 C CG  . PHE D 4 78  ? 152.116 131.139 121.207 1.00 399.75 ? 78  PHE D CG  1 
ATOM 10086 C CD1 . PHE D 4 78  ? 152.214 132.461 120.774 1.00 392.56 ? 78  PHE D CD1 1 
ATOM 10087 C CD2 . PHE D 4 78  ? 150.911 130.681 121.717 1.00 423.48 ? 78  PHE D CD2 1 
ATOM 10088 C CE1 . PHE D 4 78  ? 151.110 133.300 120.817 1.00 442.53 ? 78  PHE D CE1 1 
ATOM 10089 C CE2 . PHE D 4 78  ? 149.809 131.512 121.751 1.00 461.89 ? 78  PHE D CE2 1 
ATOM 10090 C CZ  . PHE D 4 78  ? 149.904 132.818 121.307 1.00 468.83 ? 78  PHE D CZ  1 
ATOM 10091 N N   . GLN D 4 79  ? 153.785 129.641 124.210 1.00 337.45 ? 79  GLN D N   1 
ATOM 10092 C CA  . GLN D 4 79  ? 153.276 129.513 125.577 1.00 362.97 ? 79  GLN D CA  1 
ATOM 10093 C C   . GLN D 4 79  ? 154.137 130.343 126.523 1.00 403.24 ? 79  GLN D C   1 
ATOM 10094 O O   . GLN D 4 79  ? 153.633 131.089 127.379 1.00 417.96 ? 79  GLN D O   1 
ATOM 10095 C CB  . GLN D 4 79  ? 153.185 128.060 126.046 1.00 422.08 ? 79  GLN D CB  1 
ATOM 10096 C CG  . GLN D 4 79  ? 152.003 127.297 125.466 1.00 463.58 ? 79  GLN D CG  1 
ATOM 10097 C CD  . GLN D 4 79  ? 150.654 127.855 125.885 1.00 478.24 ? 79  GLN D CD  1 
ATOM 10098 O OE1 . GLN D 4 79  ? 150.506 128.433 126.964 1.00 484.50 ? 79  GLN D OE1 1 
ATOM 10099 N NE2 . GLN D 4 79  ? 149.657 127.681 125.025 1.00 490.04 ? 79  GLN D NE2 1 
ATOM 10100 N N   . ILE D 4 80  ? 155.450 130.243 126.340 1.00 435.89 ? 80  ILE D N   1 
ATOM 10101 C CA  . ILE D 4 80  ? 156.351 131.060 127.181 1.00 429.85 ? 80  ILE D CA  1 
ATOM 10102 C C   . ILE D 4 80  ? 156.436 132.545 126.780 1.00 381.05 ? 80  ILE D C   1 
ATOM 10103 O O   . ILE D 4 80  ? 156.092 133.430 127.589 1.00 353.17 ? 80  ILE D O   1 
ATOM 10104 C CB  . ILE D 4 80  ? 157.743 130.401 127.371 1.00 462.77 ? 80  ILE D CB  1 
ATOM 10105 C CG1 . ILE D 4 80  ? 157.591 129.177 128.289 1.00 499.98 ? 80  ILE D CG1 1 
ATOM 10106 C CG2 . ILE D 4 80  ? 158.746 131.378 127.988 1.00 455.43 ? 80  ILE D CG2 1 
ATOM 10107 C CD1 . ILE D 4 80  ? 158.845 128.351 128.479 1.00 500.00 ? 80  ILE D CD1 1 
ATOM 10108 N N   . TYR D 4 81  ? 156.922 132.823 125.574 1.00 349.21 ? 81  TYR D N   1 
ATOM 10109 C CA  . TYR D 4 81  ? 157.196 134.202 125.160 1.00 367.49 ? 81  TYR D CA  1 
ATOM 10110 C C   . TYR D 4 81  ? 156.035 134.943 124.460 1.00 393.16 ? 81  TYR D C   1 
ATOM 10111 O O   . TYR D 4 81  ? 156.288 135.867 123.690 1.00 367.44 ? 81  TYR D O   1 
ATOM 10112 C CB  . TYR D 4 81  ? 158.461 134.264 124.290 1.00 367.35 ? 81  TYR D CB  1 
ATOM 10113 C CG  . TYR D 4 81  ? 159.723 133.746 124.944 1.00 389.81 ? 81  TYR D CG  1 
ATOM 10114 C CD1 . TYR D 4 81  ? 160.151 134.235 126.178 1.00 422.34 ? 81  TYR D CD1 1 
ATOM 10115 C CD2 . TYR D 4 81  ? 160.523 132.796 124.306 1.00 456.68 ? 81  TYR D CD2 1 
ATOM 10116 C CE1 . TYR D 4 81  ? 161.321 133.767 126.773 1.00 471.69 ? 81  TYR D CE1 1 
ATOM 10117 C CE2 . TYR D 4 81  ? 161.694 132.326 124.888 1.00 492.99 ? 81  TYR D CE2 1 
ATOM 10118 C CZ  . TYR D 4 81  ? 162.092 132.811 126.122 1.00 487.06 ? 81  TYR D CZ  1 
ATOM 10119 O OH  . TYR D 4 81  ? 163.255 132.340 126.697 1.00 459.01 ? 81  TYR D OH  1 
ATOM 10120 N N   . ARG D 4 82  ? 154.778 134.564 124.712 1.00 404.54 ? 82  ARG D N   1 
ATOM 10121 C CA  . ARG D 4 82  ? 153.659 135.504 124.477 1.00 419.33 ? 82  ARG D CA  1 
ATOM 10122 C C   . ARG D 4 82  ? 153.669 136.610 125.539 1.00 427.50 ? 82  ARG D C   1 
ATOM 10123 O O   . ARG D 4 82  ? 153.429 137.778 125.209 1.00 411.41 ? 82  ARG D O   1 
ATOM 10124 C CB  . ARG D 4 82  ? 152.285 134.821 124.443 1.00 403.25 ? 82  ARG D CB  1 
ATOM 10125 C CG  . ARG D 4 82  ? 151.099 135.803 124.380 1.00 390.80 ? 82  ARG D CG  1 
ATOM 10126 C CD  . ARG D 4 82  ? 149.754 135.124 124.556 1.00 401.89 ? 82  ARG D CD  1 
ATOM 10127 N NE  . ARG D 4 82  ? 149.748 134.256 125.734 1.00 412.91 ? 82  ARG D NE  1 
ATOM 10128 C CZ  . ARG D 4 82  ? 149.604 134.657 126.998 1.00 403.09 ? 82  ARG D CZ  1 
ATOM 10129 N NH1 . ARG D 4 82  ? 149.441 135.945 127.306 1.00 436.97 ? 82  ARG D NH1 1 
ATOM 10130 N NH2 . ARG D 4 82  ? 149.627 133.748 127.973 1.00 369.57 ? 82  ARG D NH2 1 
ATOM 10131 N N   . PRO D 4 83  ? 153.884 136.241 126.819 1.00 404.84 ? 83  PRO D N   1 
ATOM 10132 C CA  . PRO D 4 83  ? 154.208 137.244 127.825 1.00 410.39 ? 83  PRO D CA  1 
ATOM 10133 C C   . PRO D 4 83  ? 155.224 138.322 127.398 1.00 403.92 ? 83  PRO D C   1 
ATOM 10134 O O   . PRO D 4 83  ? 154.838 139.486 127.276 1.00 391.66 ? 83  PRO D O   1 
ATOM 10135 C CB  . PRO D 4 83  ? 154.724 136.382 128.979 1.00 392.93 ? 83  PRO D CB  1 
ATOM 10136 C CG  . PRO D 4 83  ? 153.847 135.168 128.912 1.00 374.59 ? 83  PRO D CG  1 
ATOM 10137 C CD  . PRO D 4 83  ? 153.404 135.007 127.475 1.00 352.73 ? 83  PRO D CD  1 
ATOM 10138 N N   . ARG D 4 84  ? 156.472 137.938 127.127 1.00 429.61 ? 84  ARG D N   1 
ATOM 10139 C CA  . ARG D 4 84  ? 157.563 138.914 126.936 1.00 449.63 ? 84  ARG D CA  1 
ATOM 10140 C C   . ARG D 4 84  ? 157.661 139.522 125.526 1.00 445.00 ? 84  ARG D C   1 
ATOM 10141 O O   . ARG D 4 84  ? 158.183 140.631 125.391 1.00 455.66 ? 84  ARG D O   1 
ATOM 10142 C CB  . ARG D 4 84  ? 158.914 138.327 127.372 1.00 473.05 ? 84  ARG D CB  1 
ATOM 10143 C CG  . ARG D 4 84  ? 159.038 138.148 128.881 1.00 476.15 ? 84  ARG D CG  1 
ATOM 10144 C CD  . ARG D 4 84  ? 160.272 137.345 129.269 1.00 495.58 ? 84  ARG D CD  1 
ATOM 10145 N NE  . ARG D 4 84  ? 160.187 136.814 130.635 1.00 500.00 ? 84  ARG D NE  1 
ATOM 10146 C CZ  . ARG D 4 84  ? 159.448 135.767 131.022 1.00 500.00 ? 84  ARG D CZ  1 
ATOM 10147 N NH1 . ARG D 4 84  ? 158.679 135.097 130.160 1.00 500.00 ? 84  ARG D NH1 1 
ATOM 10148 N NH2 . ARG D 4 84  ? 159.465 135.385 132.301 1.00 500.00 ? 84  ARG D NH2 1 
ATOM 10149 N N   . TRP D 4 85  ? 157.192 138.817 124.490 1.00 430.07 ? 85  TRP D N   1 
ATOM 10150 C CA  . TRP D 4 85  ? 156.982 139.454 123.177 1.00 449.79 ? 85  TRP D CA  1 
ATOM 10151 C C   . TRP D 4 85  ? 155.658 140.210 123.253 1.00 415.53 ? 85  TRP D C   1 
ATOM 10152 O O   . TRP D 4 85  ? 154.612 139.610 123.486 1.00 411.07 ? 85  TRP D O   1 
ATOM 10153 C CB  . TRP D 4 85  ? 156.965 138.453 122.011 1.00 477.62 ? 85  TRP D CB  1 
ATOM 10154 C CG  . TRP D 4 85  ? 158.288 137.753 121.737 1.00 495.15 ? 85  TRP D CG  1 
ATOM 10155 C CD1 . TRP D 4 85  ? 158.494 136.403 121.627 1.00 483.62 ? 85  TRP D CD1 1 
ATOM 10156 C CD2 . TRP D 4 85  ? 159.573 138.368 121.519 1.00 500.00 ? 85  TRP D CD2 1 
ATOM 10157 N NE1 . TRP D 4 85  ? 159.817 136.141 121.368 1.00 489.23 ? 85  TRP D NE1 1 
ATOM 10158 C CE2 . TRP D 4 85  ? 160.503 137.325 121.295 1.00 494.93 ? 85  TRP D CE2 1 
ATOM 10159 C CE3 . TRP D 4 85  ? 160.030 139.699 121.494 1.00 472.17 ? 85  TRP D CE3 1 
ATOM 10160 C CZ2 . TRP D 4 85  ? 161.864 137.569 121.051 1.00 472.02 ? 85  TRP D CZ2 1 
ATOM 10161 C CZ3 . TRP D 4 85  ? 161.386 139.942 121.249 1.00 417.71 ? 85  TRP D CZ3 1 
ATOM 10162 C CH2 . TRP D 4 85  ? 162.284 138.878 121.033 1.00 442.46 ? 85  TRP D CH2 1 
ATOM 10163 N N   . GLY D 4 86  ? 155.713 141.525 123.058 1.00 376.06 ? 86  GLY D N   1 
ATOM 10164 C CA  . GLY D 4 86  ? 154.619 142.406 123.453 1.00 379.65 ? 86  GLY D CA  1 
ATOM 10165 C C   . GLY D 4 86  ? 153.476 142.465 122.465 1.00 380.22 ? 86  GLY D C   1 
ATOM 10166 O O   . GLY D 4 86  ? 152.859 141.446 122.158 1.00 346.49 ? 86  GLY D O   1 
ATOM 10167 N N   . ALA D 4 87  ? 153.198 143.677 121.975 1.00 434.77 ? 87  ALA D N   1 
ATOM 10168 C CA  . ALA D 4 87  ? 152.166 143.941 120.975 1.00 446.80 ? 87  ALA D CA  1 
ATOM 10169 C C   . ALA D 4 87  ? 152.227 142.951 119.844 1.00 428.85 ? 87  ALA D C   1 
ATOM 10170 O O   . ALA D 4 87  ? 151.174 142.491 119.386 1.00 355.63 ? 87  ALA D O   1 
ATOM 10171 C CB  . ALA D 4 87  ? 152.297 145.359 120.429 1.00 475.48 ? 87  ALA D CB  1 
ATOM 10172 N N   . LEU D 4 88  ? 153.450 142.599 119.433 1.00 477.94 ? 88  LEU D N   1 
ATOM 10173 C CA  . LEU D 4 88  ? 153.666 141.595 118.385 1.00 500.00 ? 88  LEU D CA  1 
ATOM 10174 C C   . LEU D 4 88  ? 153.040 140.270 118.795 1.00 464.88 ? 88  LEU D C   1 
ATOM 10175 O O   . LEU D 4 88  ? 152.363 139.631 117.980 1.00 478.33 ? 88  LEU D O   1 
ATOM 10176 C CB  . LEU D 4 88  ? 155.153 141.455 118.034 1.00 500.00 ? 88  LEU D CB  1 
ATOM 10177 C CG  . LEU D 4 88  ? 155.756 142.686 117.324 1.00 500.00 ? 88  LEU D CG  1 
ATOM 10178 C CD1 . LEU D 4 88  ? 157.279 142.598 117.258 1.00 500.00 ? 88  LEU D CD1 1 
ATOM 10179 C CD2 . LEU D 4 88  ? 155.164 142.899 115.929 1.00 500.00 ? 88  LEU D CD2 1 
ATOM 10180 N N   . GLY D 4 89  ? 153.276 139.895 120.048 1.00 425.21 ? 89  GLY D N   1 
ATOM 10181 C CA  . GLY D 4 89  ? 152.741 138.659 120.616 1.00 444.36 ? 89  GLY D CA  1 
ATOM 10182 C C   . GLY D 4 89  ? 151.220 138.639 120.522 1.00 395.51 ? 89  GLY D C   1 
ATOM 10183 O O   . GLY D 4 89  ? 150.610 137.642 120.102 1.00 319.68 ? 89  GLY D O   1 
ATOM 10184 N N   . ASP D 4 90  ? 150.644 139.764 120.918 1.00 398.26 ? 90  ASP D N   1 
ATOM 10185 C CA  . ASP D 4 90  ? 149.184 139.957 120.903 1.00 426.35 ? 90  ASP D CA  1 
ATOM 10186 C C   . ASP D 4 90  ? 148.644 139.767 119.494 1.00 406.51 ? 90  ASP D C   1 
ATOM 10187 O O   . ASP D 4 90  ? 147.641 139.079 119.289 1.00 444.74 ? 90  ASP D O   1 
ATOM 10188 C CB  . ASP D 4 90  ? 148.759 141.311 121.496 1.00 490.33 ? 90  ASP D CB  1 
ATOM 10189 C CG  . ASP D 4 90  ? 148.599 141.273 123.020 1.00 500.00 ? 90  ASP D CG  1 
ATOM 10190 O OD1 . ASP D 4 90  ? 149.041 140.296 123.669 1.00 500.00 ? 90  ASP D OD1 1 
ATOM 10191 O OD2 . ASP D 4 90  ? 148.027 142.236 123.574 1.00 500.00 ? 90  ASP D OD2 1 
ATOM 10192 N N   . TYR D 4 91  ? 149.337 140.389 118.550 1.00 381.50 ? 91  TYR D N   1 
ATOM 10193 C CA  . TYR D 4 91  ? 148.984 140.345 117.128 1.00 375.13 ? 91  TYR D CA  1 
ATOM 10194 C C   . TYR D 4 91  ? 148.965 138.895 116.654 1.00 343.76 ? 91  TYR D C   1 
ATOM 10195 O O   . TYR D 4 91  ? 148.005 138.459 115.973 1.00 304.41 ? 91  TYR D O   1 
ATOM 10196 C CB  . TYR D 4 91  ? 150.011 141.112 116.264 1.00 378.23 ? 91  TYR D CB  1 
ATOM 10197 C CG  . TYR D 4 91  ? 149.690 142.562 115.986 1.00 405.31 ? 91  TYR D CG  1 
ATOM 10198 C CD1 . TYR D 4 91  ? 149.208 143.402 116.991 1.00 430.17 ? 91  TYR D CD1 1 
ATOM 10199 C CD2 . TYR D 4 91  ? 149.901 143.110 114.717 1.00 427.92 ? 91  TYR D CD2 1 
ATOM 10200 C CE1 . TYR D 4 91  ? 148.921 144.739 116.737 1.00 460.68 ? 91  TYR D CE1 1 
ATOM 10201 C CE2 . TYR D 4 91  ? 149.618 144.448 114.453 1.00 464.03 ? 91  TYR D CE2 1 
ATOM 10202 C CZ  . TYR D 4 91  ? 149.128 145.261 115.466 1.00 466.28 ? 91  TYR D CZ  1 
ATOM 10203 O OH  . TYR D 4 91  ? 148.845 146.589 115.221 1.00 426.40 ? 91  TYR D OH  1 
ATOM 10204 N N   . LEU D 4 92  ? 150.023 138.173 117.032 1.00 331.01 ? 92  LEU D N   1 
ATOM 10205 C CA  . LEU D 4 92  ? 150.243 136.815 116.555 1.00 377.18 ? 92  LEU D CA  1 
ATOM 10206 C C   . LEU D 4 92  ? 149.479 135.831 117.381 1.00 378.66 ? 92  LEU D C   1 
ATOM 10207 O O   . LEU D 4 92  ? 149.151 134.791 116.868 1.00 429.28 ? 92  LEU D O   1 
ATOM 10208 C CB  . LEU D 4 92  ? 151.739 136.465 116.462 1.00 398.62 ? 92  LEU D CB  1 
ATOM 10209 C CG  . LEU D 4 92  ? 152.554 136.149 117.724 1.00 469.46 ? 92  LEU D CG  1 
ATOM 10210 C CD1 . LEU D 4 92  ? 152.556 134.659 118.049 1.00 476.84 ? 92  LEU D CD1 1 
ATOM 10211 C CD2 . LEU D 4 92  ? 153.991 136.644 117.580 1.00 500.00 ? 92  LEU D CD2 1 
ATOM 10212 N N   . SER D 4 93  ? 149.169 136.149 118.636 1.00 374.44 ? 93  SER D N   1 
ATOM 10213 C CA  . SER D 4 93  ? 148.233 135.328 119.397 1.00 414.90 ? 93  SER D CA  1 
ATOM 10214 C C   . SER D 4 93  ? 146.865 135.360 118.694 1.00 404.58 ? 93  SER D C   1 
ATOM 10215 O O   . SER D 4 93  ? 146.534 136.341 118.028 1.00 345.64 ? 93  SER D O   1 
ATOM 10216 C CB  . SER D 4 93  ? 148.145 135.787 120.862 1.00 438.09 ? 93  SER D CB  1 
ATOM 10217 O OG  . SER D 4 93  ? 147.667 137.111 120.988 1.00 442.90 ? 93  SER D OG  1 
ATOM 10218 N N   . PHE D 4 94  ? 146.095 134.283 118.831 1.00 390.36 ? 94  PHE D N   1 
ATOM 10219 C CA  . PHE D 4 94  ? 144.791 134.150 118.176 1.00 377.33 ? 94  PHE D CA  1 
ATOM 10220 C C   . PHE D 4 94  ? 143.670 133.977 119.201 1.00 412.16 ? 94  PHE D C   1 
ATOM 10221 O O   . PHE D 4 94  ? 142.730 134.781 119.240 1.00 424.86 ? 94  PHE D O   1 
ATOM 10222 C CB  . PHE D 4 94  ? 144.814 132.979 117.215 1.00 367.12 ? 94  PHE D CB  1 
ATOM 10223 C CG  . PHE D 4 94  ? 143.455 132.488 116.833 1.00 377.64 ? 94  PHE D CG  1 
ATOM 10224 C CD1 . PHE D 4 94  ? 142.608 133.286 116.068 1.00 382.66 ? 94  PHE D CD1 1 
ATOM 10225 C CD2 . PHE D 4 94  ? 143.014 131.240 117.249 1.00 369.19 ? 94  PHE D CD2 1 
ATOM 10226 C CE1 . PHE D 4 94  ? 141.345 132.847 115.712 1.00 401.08 ? 94  PHE D CE1 1 
ATOM 10227 C CE2 . PHE D 4 94  ? 141.754 130.789 116.894 1.00 437.83 ? 94  PHE D CE2 1 
ATOM 10228 C CZ  . PHE D 4 94  ? 140.916 131.593 116.125 1.00 452.84 ? 94  PHE D CZ  1 
ATOM 10229 N N   . THR D 4 95  ? 143.761 132.921 120.004 1.00 391.12 ? 95  THR D N   1 
ATOM 10230 C CA  . THR D 4 95  ? 142.854 132.743 121.129 1.00 414.94 ? 95  THR D CA  1 
ATOM 10231 C C   . THR D 4 95  ? 143.484 133.353 122.370 1.00 418.05 ? 95  THR D C   1 
ATOM 10232 O O   . THR D 4 95  ? 144.300 132.717 123.048 1.00 371.45 ? 95  THR D O   1 
ATOM 10233 C CB  . THR D 4 95  ? 142.538 131.269 121.379 1.00 451.44 ? 95  THR D CB  1 
ATOM 10234 O OG1 . THR D 4 95  ? 142.124 130.668 120.148 1.00 459.65 ? 95  THR D OG1 1 
ATOM 10235 C CG2 . THR D 4 95  ? 141.428 131.132 122.441 1.00 471.46 ? 95  THR D CG2 1 
ATOM 10236 N N   . ILE D 4 96  ? 143.083 134.590 122.661 1.00 419.82 ? 96  ILE D N   1 
ATOM 10237 C CA  . ILE D 4 96  ? 143.658 135.351 123.761 1.00 405.69 ? 96  ILE D CA  1 
ATOM 10238 C C   . ILE D 4 96  ? 143.050 134.831 125.061 1.00 375.01 ? 96  ILE D C   1 
ATOM 10239 O O   . ILE D 4 96  ? 141.838 134.949 125.254 1.00 375.67 ? 96  ILE D O   1 
ATOM 10240 C CB  . ILE D 4 96  ? 143.396 136.869 123.618 1.00 417.27 ? 96  ILE D CB  1 
ATOM 10241 C CG1 . ILE D 4 96  ? 144.221 137.456 122.447 1.00 423.61 ? 96  ILE D CG1 1 
ATOM 10242 C CG2 . ILE D 4 96  ? 143.704 137.596 124.926 1.00 411.66 ? 96  ILE D CG2 1 
ATOM 10243 C CD1 . ILE D 4 96  ? 143.500 137.518 121.114 1.00 398.45 ? 96  ILE D CD1 1 
ATOM 10244 N N   . PRO D 4 97  ? 143.887 134.274 125.959 1.00 363.32 ? 97  PRO D N   1 
ATOM 10245 C CA  . PRO D 4 97  ? 143.354 133.705 127.187 1.00 356.13 ? 97  PRO D CA  1 
ATOM 10246 C C   . PRO D 4 97  ? 142.827 134.827 128.057 1.00 361.05 ? 97  PRO D C   1 
ATOM 10247 O O   . PRO D 4 97  ? 143.586 135.449 128.802 1.00 372.34 ? 97  PRO D O   1 
ATOM 10248 C CB  . PRO D 4 97  ? 144.569 133.027 127.819 1.00 370.61 ? 97  PRO D CB  1 
ATOM 10249 C CG  . PRO D 4 97  ? 145.730 133.833 127.349 1.00 372.16 ? 97  PRO D CG  1 
ATOM 10250 C CD  . PRO D 4 97  ? 145.360 134.370 125.993 1.00 371.71 ? 97  PRO D CD  1 
ATOM 10251 N N   . LEU D 4 98  ? 141.532 135.089 127.917 1.00 363.78 ? 98  LEU D N   1 
ATOM 10252 C CA  . LEU D 4 98  ? 140.874 136.225 128.554 1.00 398.60 ? 98  LEU D CA  1 
ATOM 10253 C C   . LEU D 4 98  ? 141.539 136.624 129.868 1.00 414.62 ? 98  LEU D C   1 
ATOM 10254 O O   . LEU D 4 98  ? 142.256 137.628 129.928 1.00 430.65 ? 98  LEU D O   1 
ATOM 10255 C CB  . LEU D 4 98  ? 139.388 135.922 128.785 1.00 402.16 ? 98  LEU D CB  1 
ATOM 10256 C CG  . LEU D 4 98  ? 138.377 136.340 127.718 1.00 404.43 ? 98  LEU D CG  1 
ATOM 10257 C CD1 . LEU D 4 98  ? 138.827 136.049 126.293 1.00 388.23 ? 98  LEU D CD1 1 
ATOM 10258 C CD2 . LEU D 4 98  ? 137.057 135.647 128.019 1.00 442.38 ? 98  LEU D CD2 1 
ATOM 10259 N N   . GLY D 4 99  ? 141.341 135.802 130.896 1.00 374.15 ? 99  GLY D N   1 
ATOM 10260 C CA  . GLY D 4 99  ? 141.769 136.128 132.244 1.00 327.54 ? 99  GLY D CA  1 
ATOM 10261 C C   . GLY D 4 99  ? 143.114 135.533 132.523 1.00 334.01 ? 99  GLY D C   1 
ATOM 10262 O O   . GLY D 4 99  ? 143.242 134.654 133.377 1.00 396.06 ? 99  GLY D O   1 
ATOM 10263 N N   . THR D 4 100 ? 144.118 135.993 131.786 1.00 351.96 ? 100 THR D N   1 
ATOM 10264 C CA  . THR D 4 100 ? 145.484 135.519 131.980 1.00 400.45 ? 100 THR D CA  1 
ATOM 10265 C C   . THR D 4 100 ? 146.466 136.568 131.444 1.00 382.44 ? 100 THR D C   1 
ATOM 10266 O O   . THR D 4 100 ? 146.254 137.121 130.347 1.00 304.58 ? 100 THR D O   1 
ATOM 10267 C CB  . THR D 4 100 ? 145.743 134.150 131.295 1.00 470.78 ? 100 THR D CB  1 
ATOM 10268 O OG1 . THR D 4 100 ? 144.609 133.286 131.442 1.00 482.66 ? 100 THR D OG1 1 
ATOM 10269 C CG2 . THR D 4 100 ? 146.963 133.461 131.901 1.00 489.40 ? 100 THR D CG2 1 
ATOM 10270 N N   . PRO D 4 101 ? 147.532 136.855 132.216 1.00 395.00 ? 101 PRO D N   1 
ATOM 10271 C CA  . PRO D 4 101 ? 148.563 137.800 131.777 1.00 432.40 ? 101 PRO D CA  1 
ATOM 10272 C C   . PRO D 4 101 ? 149.583 137.169 130.831 1.00 413.38 ? 101 PRO D C   1 
ATOM 10273 O O   . PRO D 4 101 ? 149.663 137.565 129.667 1.00 427.10 ? 101 PRO D O   1 
ATOM 10274 C CB  . PRO D 4 101 ? 149.226 138.229 133.088 1.00 450.63 ? 101 PRO D CB  1 
ATOM 10275 C CG  . PRO D 4 101 ? 149.043 137.067 133.996 1.00 455.69 ? 101 PRO D CG  1 
ATOM 10276 C CD  . PRO D 4 101 ? 147.750 136.412 133.609 1.00 389.57 ? 101 PRO D CD  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   THR 3   3   ?   ?   ?   A . n 
A 1 4   ALA 4   4   ?   ?   ?   A . n 
A 1 5   GLY 5   5   ?   ?   ?   A . n 
A 1 6   GLY 6   6   ?   ?   ?   A . n 
A 1 7   GLY 7   7   ?   ?   ?   A . n 
A 1 8   SER 8   8   ?   ?   ?   A . n 
A 1 9   GLY 9   9   ?   ?   ?   A . n 
A 1 10  ALA 10  10  ?   ?   ?   A . n 
A 1 11  ASP 11  11  ?   ?   ?   A . n 
A 1 12  PRO 12  12  ?   ?   ?   A . n 
A 1 13  GLY 13  13  ?   ?   ?   A . n 
A 1 14  SER 14  14  ?   ?   ?   A . n 
A 1 15  ARG 15  15  ?   ?   ?   A . n 
A 1 16  GLY 16  16  ?   ?   ?   A . n 
A 1 17  LEU 17  17  ?   ?   ?   A . n 
A 1 18  LEU 18  18  ?   ?   ?   A . n 
A 1 19  ARG 19  19  ?   ?   ?   A . n 
A 1 20  LEU 20  20  ?   ?   ?   A . n 
A 1 21  LEU 21  21  ?   ?   ?   A . n 
A 1 22  SER 22  22  ?   ?   ?   A . n 
A 1 23  PHE 23  23  ?   ?   ?   A . n 
A 1 24  CYS 24  24  ?   ?   ?   A . n 
A 1 25  VAL 25  25  ?   ?   ?   A . n 
A 1 26  LEU 26  26  ?   ?   ?   A . n 
A 1 27  LEU 27  27  ?   ?   ?   A . n 
A 1 28  ALA 28  28  ?   ?   ?   A . n 
A 1 29  GLY 29  29  ?   ?   ?   A . n 
A 1 30  LEU 30  30  ?   ?   ?   A . n 
A 1 31  CYS 31  31  ?   ?   ?   A . n 
A 1 32  ARG 32  32  ?   ?   ?   A . n 
A 1 33  GLY 33  33  ?   ?   ?   A . n 
A 1 34  ASN 34  34  34  ASN ASN A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  VAL 36  36  36  VAL VAL A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  ARG 38  38  38  ARG ARG A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  ILE 40  40  40  ILE ILE A . n 
A 1 41  TYR 41  41  41  TYR TYR A . n 
A 1 42  ILE 42  42  42  ILE ILE A . n 
A 1 43  PRO 43  43  43  PRO PRO A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  ASN 45  45  45  ASN ASN A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  THR 47  47  47  THR THR A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  CYS 50  50  50  CYS CYS A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  ARG 52  52  52  ARG ARG A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  ASN 55  55  55  ASN ASN A . n 
A 1 56  ALA 56  56  56  ALA ALA A . n 
A 1 57  THR 57  57  57  THR THR A . n 
A 1 58  HIS 58  58  58  HIS HIS A . n 
A 1 59  GLN 59  59  59  GLN GLN A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  CYS 62  62  62  CYS CYS A . n 
A 1 63  GLN 63  63  63  GLN GLN A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  ILE 66  66  66  ILE ILE A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  ASP 69  69  69  ASP ASP A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  HIS 74  74  74  HIS HIS A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  VAL 76  76  76  VAL VAL A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  ASP 81  81  81  ASP ASP A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  GLN 83  83  83  GLN GLN A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  THR 87  87  87  THR THR A . n 
A 1 88  ASP 88  88  88  ASP ASP A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  PRO 90  90  90  PRO PRO A . n 
A 1 91  ASN 91  91  91  ASN ASN A . n 
A 1 92  PRO 92  92  92  PRO PRO A . n 
A 1 93  PRO 93  93  93  PRO PRO A . n 
A 1 94  TYR 94  94  94  TYR TYR A . n 
A 1 95  MET 95  95  95  MET MET A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  GLU 99  99  99  GLU GLU A . n 
A 1 100 SER 100 100 100 SER SER A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 HIS 102 102 102 HIS HIS A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 THR 104 104 104 THR THR A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 ASP 106 106 106 ASP ASP A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 MET 108 108 108 MET MET A . n 
A 1 109 GLU 109 109 109 GLU GLU A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 LYS 112 112 112 LYS LYS A . n 
A 1 113 GLY 113 113 113 GLY GLY A . n 
A 1 114 ARG 114 114 114 ARG ARG A . n 
A 1 115 THR 115 115 115 THR THR A . n 
A 1 116 SER 116 116 116 SER SER A . n 
A 1 117 ARG 117 117 117 ARG ARG A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 ALA 119 119 119 ALA ALA A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 VAL 123 123 123 VAL VAL A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LYS 127 127 127 LYS LYS A . n 
A 1 128 PRO 128 128 128 PRO PRO A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 PRO 130 130 130 PRO PRO A . n 
A 1 131 ALA 131 131 131 ALA ALA A . n 
A 1 132 SER 132 132 132 SER SER A . n 
A 1 133 GLY 133 133 133 GLY GLY A . n 
A 1 134 PHE 134 134 134 PHE PHE A . n 
A 1 135 SER 135 135 135 SER SER A . n 
A 1 136 PRO 136 136 136 PRO PRO A . n 
A 1 137 SER 137 137 137 SER SER A . n 
A 1 138 VAL 138 138 138 VAL VAL A . n 
A 1 139 GLN 139 139 139 GLN GLN A . n 
A 1 140 CYS 140 140 140 CYS CYS A . n 
A 1 141 PRO 141 141 141 PRO PRO A . n 
A 1 142 ASN 142 142 142 ASN ASN A . n 
A 1 143 ASP 143 143 143 ASP ASP A . n 
A 1 144 GLY 144 144 144 GLY GLY A . n 
A 1 145 PHE 145 145 145 PHE PHE A . n 
A 1 146 GLY 146 146 146 GLY GLY A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 SER 149 149 149 SER SER A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 SER 151 151 151 SER SER A . n 
A 1 152 TYR 152 152 152 TYR TYR A . n 
A 1 153 GLY 153 153 153 GLY GLY A . n 
A 1 154 PRO 154 154 154 PRO PRO A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 HIS 158 158 158 HIS HIS A . n 
A 1 159 CYS 159 159 159 CYS CYS A . n 
A 1 160 ARG 160 160 160 ARG ARG A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 ILE 162 162 162 ILE ILE A . n 
A 1 163 GLN 163 163 163 GLN GLN A . n 
A 1 164 TRP 164 164 164 TRP TRP A . n 
A 1 165 ASN 165 165 165 ASN ASN A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 LEU 167 167 167 LEU LEU A . n 
A 1 168 GLY 168 168 168 GLY GLY A . n 
A 1 169 ASN 169 169 169 ASN ASN A . n 
A 1 170 GLY 170 170 170 GLY GLY A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 TYR 173 173 173 TYR TYR A . n 
A 1 174 GLU 174 174 174 GLU GLU A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 PHE 176 176 176 PHE PHE A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 PHE 178 178 178 PHE PHE A . n 
A 1 179 PRO 179 179 179 PRO PRO A . n 
A 1 180 ILE 180 180 180 ILE ILE A . n 
A 1 181 PHE 181 181 181 PHE PHE A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 LEU 183 183 183 LEU LEU A . n 
A 1 184 GLU 184 184 184 GLU GLU A . n 
A 1 185 ASP 185 185 185 ASP ASP A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 ASN 187 187 187 ASN ASN A . n 
A 1 188 GLU 188 188 188 GLU GLU A . n 
A 1 189 THR 189 189 189 THR THR A . n 
A 1 190 LYS 190 190 190 LYS LYS A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 ILE 192 192 192 ILE ILE A . n 
A 1 193 LYS 193 193 193 LYS LYS A . n 
A 1 194 GLN 194 194 194 GLN GLN A . n 
A 1 195 CYS 195 195 195 CYS CYS A . n 
A 1 196 TYR 196 196 196 TYR TYR A . n 
A 1 197 GLN 197 197 197 GLN GLN A . n 
A 1 198 ASP 198 198 198 ASP ASP A . n 
A 1 199 HIS 199 199 199 HIS HIS A . n 
A 1 200 ASN 200 200 200 ASN ASN A . n 
A 1 201 LEU 201 201 201 LEU LEU A . n 
A 1 202 SER 202 202 202 SER SER A . n 
A 1 203 GLN 203 203 203 GLN GLN A . n 
A 1 204 ASN 204 204 204 ASN ASN A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 SER 206 206 206 SER SER A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 PRO 208 208 208 PRO PRO A . n 
A 1 209 THR 209 209 209 THR THR A . n 
A 1 210 PHE 210 210 210 PHE PHE A . n 
A 1 211 PRO 211 211 211 PRO PRO A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 CYS 213 213 213 CYS CYS A . n 
A 1 214 ALA 214 214 214 ALA ALA A . n 
A 1 215 MET 215 215 215 MET MET A . n 
A 1 216 GLN 216 216 216 GLN GLN A . n 
A 1 217 LEU 217 217 217 LEU LEU A . n 
A 1 218 PHE 218 218 218 PHE PHE A . n 
A 1 219 SER 219 219 219 SER SER A . n 
A 1 220 HIS 220 220 220 HIS HIS A . n 
A 1 221 MET 221 221 221 MET MET A . n 
A 1 222 HIS 222 222 222 HIS HIS A . n 
A 1 223 ALA 223 223 223 ALA ALA A . n 
A 1 224 VAL 224 224 224 VAL VAL A . n 
A 1 225 ILE 225 225 225 ILE ILE A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 THR 227 227 227 THR THR A . n 
A 1 228 ALA 228 228 228 ALA ALA A . n 
A 1 229 THR 229 229 229 THR THR A . n 
A 1 230 CYS 230 230 230 CYS CYS A . n 
A 1 231 MET 231 231 231 MET MET A . n 
A 1 232 ARG 232 232 232 ARG ARG A . n 
A 1 233 ARG 233 233 233 ARG ARG A . n 
A 1 234 SER 234 234 234 SER SER A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 ILE 236 236 236 ILE ILE A . n 
A 1 237 GLN 237 237 237 GLN GLN A . n 
A 1 238 SER 238 238 238 SER SER A . n 
A 1 239 THR 239 239 239 THR THR A . n 
A 1 240 PHE 240 240 240 PHE PHE A . n 
A 1 241 SER 241 241 241 SER SER A . n 
A 1 242 ILE 242 242 242 ILE ILE A . n 
A 1 243 ASN 243 243 243 ASN ASN A . n 
A 1 244 PRO 244 244 244 PRO PRO A . n 
A 1 245 GLU 245 245 245 GLU GLU A . n 
A 1 246 ILE 246 246 246 ILE ILE A . n 
A 1 247 VAL 247 247 247 VAL VAL A . n 
A 1 248 CYS 248 248 248 CYS CYS A . n 
A 1 249 ASP 249 249 249 ASP ASP A . n 
A 1 250 PRO 250 250 250 PRO PRO A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 SER 252 252 252 SER SER A . n 
A 1 253 ASP 253 253 253 ASP ASP A . n 
A 1 254 TYR 254 254 254 TYR TYR A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 VAL 256 256 256 VAL VAL A . n 
A 1 257 TRP 257 257 257 TRP TRP A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 MET 259 259 259 MET MET A . n 
A 1 260 LEU 260 260 260 LEU LEU A . n 
A 1 261 LYS 261 261 261 LYS LYS A . n 
A 1 262 PRO 262 262 262 PRO PRO A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 ASN 264 264 264 ASN ASN A . n 
A 1 265 THR 265 265 265 THR THR A . n 
A 1 266 THR 266 266 266 THR THR A . n 
A 1 267 GLY 267 267 267 GLY GLY A . n 
A 1 268 THR 268 268 268 THR THR A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 ASP 272 272 272 ASP ASP A . n 
A 1 273 ASP 273 273 273 ASP ASP A . n 
A 1 274 ARG 274 274 274 ARG ARG A . n 
A 1 275 VAL 275 275 275 VAL VAL A . n 
A 1 276 VAL 276 276 276 VAL VAL A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 ALA 279 279 279 ALA ALA A . n 
A 1 280 THR 280 280 280 THR THR A . n 
A 1 281 ARG 281 281 281 ARG ARG A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 ASP 283 283 283 ASP ASP A . n 
A 1 284 SER 284 284 284 SER SER A . n 
A 1 285 ARG 285 285 285 ARG ARG A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 PHE 287 287 287 PHE PHE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 TRP 289 289 289 TRP TRP A . n 
A 1 290 ASN 290 290 290 ASN ASN A . n 
A 1 291 VAL 291 291 291 VAL VAL A . n 
A 1 292 ALA 292 292 292 ALA ALA A . n 
A 1 293 PRO 293 293 293 PRO PRO A . n 
A 1 294 GLY 294 294 294 GLY GLY A . n 
A 1 295 ALA 295 295 295 ALA ALA A . n 
A 1 296 GLU 296 296 296 GLU GLU A . n 
A 1 297 SER 297 297 297 SER SER A . n 
A 1 298 ALA 298 298 298 ALA ALA A . n 
A 1 299 VAL 299 299 299 VAL VAL A . n 
A 1 300 ALA 300 300 300 ALA ALA A . n 
A 1 301 SER 301 301 301 SER SER A . n 
A 1 302 PHE 302 302 302 PHE PHE A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 THR 304 304 304 THR THR A . n 
A 1 305 GLN 305 305 305 GLN GLN A . n 
A 1 306 LEU 306 306 306 LEU LEU A . n 
A 1 307 ALA 307 307 307 ALA ALA A . n 
A 1 308 ALA 308 308 308 ALA ALA A . n 
A 1 309 ALA 309 309 309 ALA ALA A . n 
A 1 310 GLU 310 310 310 GLU GLU A . n 
A 1 311 ALA 311 311 311 ALA ALA A . n 
A 1 312 LEU 312 312 312 LEU LEU A . n 
A 1 313 GLN 313 313 313 GLN GLN A . n 
A 1 314 LYS 314 314 314 LYS LYS A . n 
A 1 315 ALA 315 315 315 ALA ALA A . n 
A 1 316 PRO 316 316 316 PRO PRO A . n 
A 1 317 ASP 317 317 317 ASP ASP A . n 
A 1 318 VAL 318 318 318 VAL VAL A . n 
A 1 319 THR 319 319 319 THR THR A . n 
A 1 320 THR 320 320 320 THR THR A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 PRO 322 322 322 PRO PRO A . n 
A 1 323 ARG 323 323 323 ARG ARG A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 VAL 325 325 325 VAL VAL A . n 
A 1 326 MET 326 326 326 MET MET A . n 
A 1 327 PHE 327 327 327 PHE PHE A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 PHE 329 329 329 PHE PHE A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 GLN 331 331 331 GLN GLN A . n 
A 1 332 GLY 332 332 332 GLY GLY A . n 
A 1 333 GLU 333 333 333 GLU GLU A . n 
A 1 334 THR 334 334 334 THR THR A . n 
A 1 335 PHE 335 335 335 PHE PHE A . n 
A 1 336 ASP 336 336 336 ASP ASP A . n 
A 1 337 TYR 337 337 337 TYR TYR A . n 
A 1 338 ILE 338 338 338 ILE ILE A . n 
A 1 339 GLY 339 339 339 GLY GLY A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 SER 341 341 341 SER SER A . n 
A 1 342 ARG 342 342 342 ARG ARG A . n 
A 1 343 MET 343 343 343 MET MET A . n 
A 1 344 VAL 344 344 344 VAL VAL A . n 
A 1 345 TYR 345 345 345 TYR TYR A . n 
A 1 346 ASP 346 346 346 ASP ASP A . n 
A 1 347 MET 347 347 347 MET MET A . n 
A 1 348 GLU 348 348 348 GLU GLU A . n 
A 1 349 LYS 349 349 349 LYS LYS A . n 
A 1 350 GLY 350 350 350 GLY GLY A . n 
A 1 351 LYS 351 351 351 LYS LYS A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 PRO 353 353 353 PRO PRO A . n 
A 1 354 VAL 354 354 354 VAL VAL A . n 
A 1 355 GLN 355 355 355 GLN GLN A . n 
A 1 356 LEU 356 356 356 LEU LEU A . n 
A 1 357 GLU 357 357 357 GLU GLU A . n 
A 1 358 ASN 358 358 358 ASN ASN A . n 
A 1 359 VAL 359 359 359 VAL VAL A . n 
A 1 360 ASP 360 360 360 ASP ASP A . n 
A 1 361 SER 361 361 361 SER SER A . n 
A 1 362 PHE 362 362 362 PHE PHE A . n 
A 1 363 VAL 363 363 363 VAL VAL A . n 
A 1 364 GLU 364 364 364 GLU GLU A . n 
A 1 365 LEU 365 365 365 LEU LEU A . n 
A 1 366 GLY 366 366 366 GLY GLY A . n 
A 1 367 GLN 367 367 367 GLN GLN A . n 
A 1 368 VAL 368 368 368 VAL VAL A . n 
A 1 369 ALA 369 369 369 ALA ALA A . n 
A 1 370 LEU 370 370 370 LEU LEU A . n 
A 1 371 ARG 371 371 371 ARG ARG A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 SER 373 373 373 SER SER A . n 
A 1 374 LEU 374 374 374 LEU LEU A . n 
A 1 375 GLU 375 375 375 GLU GLU A . n 
A 1 376 LEU 376 376 376 LEU LEU A . n 
A 1 377 TRP 377 377 377 TRP TRP A . n 
A 1 378 MET 378 378 378 MET MET A . n 
A 1 379 HIS 379 379 379 HIS HIS A . n 
A 1 380 THR 380 380 380 THR THR A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 PRO 382 382 382 PRO PRO A . n 
A 1 383 VAL 383 383 383 VAL VAL A . n 
A 1 384 SER 384 384 384 SER SER A . n 
A 1 385 GLN 385 385 385 GLN GLN A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 GLU 388 388 388 GLU GLU A . n 
A 1 389 SER 389 389 389 SER SER A . n 
A 1 390 VAL 390 390 390 VAL VAL A . n 
A 1 391 ARG 391 391 391 ARG ARG A . n 
A 1 392 ASN 392 392 392 ASN ASN A . n 
A 1 393 GLN 393 393 393 GLN GLN A . n 
A 1 394 VAL 394 394 394 VAL VAL A . n 
A 1 395 GLU 395 395 395 GLU GLU A . n 
A 1 396 ASP 396 396 396 ASP ASP A . n 
A 1 397 LEU 397 397 397 LEU LEU A . n 
A 1 398 LEU 398 398 398 LEU LEU A . n 
A 1 399 ALA 399 399 399 ALA ALA A . n 
A 1 400 THR 400 400 400 THR THR A . n 
A 1 401 LEU 401 401 401 LEU LEU A . n 
A 1 402 GLU 402 402 402 GLU GLU A . n 
A 1 403 LYS 403 403 403 LYS LYS A . n 
A 1 404 SER 404 404 404 SER SER A . n 
A 1 405 GLY 405 405 405 GLY GLY A . n 
A 1 406 ALA 406 406 406 ALA ALA A . n 
A 1 407 GLY 407 407 407 GLY GLY A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 PRO 409 409 409 PRO PRO A . n 
A 1 410 ALA 410 410 410 ALA ALA A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 ILE 412 412 412 ILE ILE A . n 
A 1 413 LEU 413 413 413 LEU LEU A . n 
A 1 414 ARG 414 414 414 ARG ARG A . n 
A 1 415 ARG 415 415 415 ARG ARG A . n 
A 1 416 PRO 416 416 416 PRO PRO A . n 
A 1 417 ASN 417 417 417 ASN ASN A . n 
A 1 418 GLN 418 418 418 GLN GLN A . n 
A 1 419 SER 419 419 419 SER SER A . n 
A 1 420 GLN 420 420 420 GLN GLN A . n 
A 1 421 PRO 421 421 421 PRO PRO A . n 
A 1 422 LEU 422 422 422 LEU LEU A . n 
A 1 423 PRO 423 423 423 PRO PRO A . n 
A 1 424 PRO 424 424 424 PRO PRO A . n 
A 1 425 SER 425 425 425 SER SER A . n 
A 1 426 SER 426 426 426 SER SER A . n 
A 1 427 LEU 427 427 427 LEU LEU A . n 
A 1 428 GLN 428 428 428 GLN GLN A . n 
A 1 429 ARG 429 429 429 ARG ARG A . n 
A 1 430 PHE 430 430 430 PHE PHE A . n 
A 1 431 LEU 431 431 431 LEU LEU A . n 
A 1 432 ARG 432 432 432 ARG ARG A . n 
A 1 433 ALA 433 433 433 ALA ALA A . n 
A 1 434 ARG 434 434 434 ARG ARG A . n 
A 1 435 ASN 435 435 435 ASN ASN A . n 
A 1 436 ILE 436 436 436 ILE ILE A . n 
A 1 437 SER 437 437 437 SER SER A . n 
A 1 438 GLY 438 438 438 GLY GLY A . n 
A 1 439 VAL 439 439 439 VAL VAL A . n 
A 1 440 VAL 440 440 440 VAL VAL A . n 
A 1 441 LEU 441 441 441 LEU LEU A . n 
A 1 442 ALA 442 442 442 ALA ALA A . n 
A 1 443 ASP 443 443 443 ASP ASP A . n 
A 1 444 HIS 444 444 444 HIS HIS A . n 
A 1 445 SER 445 445 445 SER SER A . n 
A 1 446 GLY 446 446 446 GLY GLY A . n 
A 1 447 ALA 447 447 447 ALA ALA A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 HIS 449 449 449 HIS HIS A . n 
A 1 450 ASN 450 450 450 ASN ASN A . n 
A 1 451 LYS 451 451 451 LYS LYS A . n 
A 1 452 TYR 452 452 452 TYR TYR A . n 
A 1 453 TYR 453 453 453 TYR TYR A . n 
A 1 454 GLN 454 454 454 GLN GLN A . n 
A 1 455 SER 455 455 455 SER SER A . n 
A 1 456 ILE 456 456 456 ILE ILE A . n 
A 1 457 TYR 457 457 457 TYR TYR A . n 
A 1 458 ASP 458 458 458 ASP ASP A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 ASN 462 462 462 ASN ASN A . n 
A 1 463 ILE 463 463 463 ILE ILE A . n 
A 1 464 ASN 464 464 464 ASN ASN A . n 
A 1 465 VAL 465 465 465 VAL VAL A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 TYR 467 467 467 TYR TYR A . n 
A 1 468 PRO 468 468 468 PRO PRO A . n 
A 1 469 GLU 469 469 469 GLU GLU A . n 
A 1 470 TRP 470 470 470 TRP TRP A . n 
A 1 471 LEU 471 471 471 LEU LEU A . n 
A 1 472 SER 472 472 472 SER SER A . n 
A 1 473 PRO 473 473 473 PRO PRO A . n 
A 1 474 GLU 474 474 474 GLU GLU A . n 
A 1 475 GLU 475 475 475 GLU GLU A . n 
A 1 476 ASP 476 476 476 ASP ASP A . n 
A 1 477 LEU 477 477 477 LEU LEU A . n 
A 1 478 ASN 478 478 478 ASN ASN A . n 
A 1 479 PHE 479 479 479 PHE PHE A . n 
A 1 480 VAL 480 480 480 VAL VAL A . n 
A 1 481 THR 481 481 481 THR THR A . n 
A 1 482 ASP 482 482 482 ASP ASP A . n 
A 1 483 THR 483 483 483 THR THR A . n 
A 1 484 ALA 484 484 484 ALA ALA A . n 
A 1 485 LYS 485 485 485 LYS LYS A . n 
A 1 486 ALA 486 486 486 ALA ALA A . n 
A 1 487 LEU 487 487 487 LEU LEU A . n 
A 1 488 ALA 488 488 488 ALA ALA A . n 
A 1 489 ASP 489 489 489 ASP ASP A . n 
A 1 490 VAL 490 490 490 VAL VAL A . n 
A 1 491 ALA 491 491 491 ALA ALA A . n 
A 1 492 THR 492 492 492 THR THR A . n 
A 1 493 VAL 493 493 493 VAL VAL A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 GLY 495 495 495 GLY GLY A . n 
A 1 496 ARG 496 496 496 ARG ARG A . n 
A 1 497 ALA 497 497 497 ALA ALA A . n 
A 1 498 LEU 498 498 498 LEU LEU A . n 
A 1 499 TYR 499 499 499 TYR TYR A . n 
A 1 500 GLU 500 500 500 GLU GLU A . n 
A 1 501 LEU 501 501 501 LEU LEU A . n 
A 1 502 ALA 502 502 502 ALA ALA A . n 
A 1 503 GLY 503 503 503 GLY GLY A . n 
A 1 504 GLY 504 504 504 GLY GLY A . n 
A 1 505 THR 505 505 505 THR THR A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 PHE 507 507 507 PHE PHE A . n 
A 1 508 SER 508 508 508 SER SER A . n 
A 1 509 ASP 509 509 509 ASP ASP A . n 
A 1 510 THR 510 510 510 THR THR A . n 
A 1 511 VAL 511 511 511 VAL VAL A . n 
A 1 512 GLN 512 512 512 GLN GLN A . n 
A 1 513 ALA 513 513 513 ALA ALA A . n 
A 1 514 ASP 514 514 514 ASP ASP A . n 
A 1 515 PRO 515 515 515 PRO PRO A . n 
A 1 516 GLN 516 516 516 GLN GLN A . n 
A 1 517 THR 517 517 517 THR THR A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 THR 519 519 519 THR THR A . n 
A 1 520 ARG 520 520 520 ARG ARG A . n 
A 1 521 LEU 521 521 521 LEU LEU A . n 
A 1 522 LEU 522 522 522 LEU LEU A . n 
A 1 523 TYR 523 523 523 TYR TYR A . n 
A 1 524 GLY 524 524 524 GLY GLY A . n 
A 1 525 PHE 525 525 525 PHE PHE A . n 
A 1 526 LEU 526 526 526 LEU LEU A . n 
A 1 527 ILE 527 527 527 ILE ILE A . n 
A 1 528 LYS 528 528 528 LYS LYS A . n 
A 1 529 ALA 529 529 529 ALA ALA A . n 
A 1 530 ASN 530 530 530 ASN ASN A . n 
A 1 531 ASN 531 531 531 ASN ASN A . n 
A 1 532 SER 532 532 532 SER SER A . n 
A 1 533 TRP 533 533 533 TRP TRP A . n 
A 1 534 PHE 534 534 534 PHE PHE A . n 
A 1 535 GLN 535 535 535 GLN GLN A . n 
A 1 536 SER 536 536 536 SER SER A . n 
A 1 537 ILE 537 537 537 ILE ILE A . n 
A 1 538 LEU 538 538 538 LEU LEU A . n 
A 1 539 ARG 539 539 539 ARG ARG A . n 
A 1 540 GLN 540 540 540 GLN GLN A . n 
A 1 541 ASP 541 541 541 ASP ASP A . n 
A 1 542 LEU 542 542 542 LEU LEU A . n 
A 1 543 ARG 543 543 543 ARG ARG A . n 
A 1 544 SER 544 544 544 SER SER A . n 
A 1 545 TYR 545 545 545 TYR TYR A . n 
A 1 546 LEU 546 546 546 LEU LEU A . n 
A 1 547 GLY 547 547 547 GLY GLY A . n 
A 1 548 ASP 548 548 548 ASP ASP A . n 
A 1 549 GLY 549 549 549 GLY GLY A . n 
A 1 550 PRO 550 550 550 PRO PRO A . n 
A 1 551 LEU 551 551 551 LEU LEU A . n 
A 1 552 GLN 552 552 552 GLN GLN A . n 
A 1 553 HIS 553 553 553 HIS HIS A . n 
A 1 554 TYR 554 554 554 TYR TYR A . n 
A 1 555 ILE 555 555 555 ILE ILE A . n 
A 1 556 ALA 556 556 556 ALA ALA A . n 
A 1 557 VAL 557 557 557 VAL VAL A . n 
A 1 558 SER 558 558 558 SER SER A . n 
A 1 559 SER 559 559 559 SER SER A . n 
A 1 560 PRO 560 560 560 PRO PRO A . n 
A 1 561 THR 561 561 561 THR THR A . n 
A 1 562 ASN 562 562 562 ASN ASN A . n 
A 1 563 THR 563 563 563 THR THR A . n 
A 1 564 THR 564 564 564 THR THR A . n 
A 1 565 TYR 565 565 565 TYR TYR A . n 
A 1 566 VAL 566 566 566 VAL VAL A . n 
A 1 567 VAL 567 567 567 VAL VAL A . n 
A 1 568 GLN 568 568 568 GLN GLN A . n 
A 1 569 TYR 569 569 569 TYR TYR A . n 
A 1 570 ALA 570 570 570 ALA ALA A . n 
A 1 571 LEU 571 571 571 LEU LEU A . n 
A 1 572 ALA 572 572 572 ALA ALA A . n 
A 1 573 ASN 573 573 573 ASN ASN A . n 
A 1 574 LEU 574 574 574 LEU LEU A . n 
A 1 575 THR 575 575 575 THR THR A . n 
A 1 576 GLY 576 576 576 GLY GLY A . n 
A 1 577 THR 577 577 577 THR THR A . n 
A 1 578 VAL 578 578 578 VAL VAL A . n 
A 1 579 VAL 579 579 579 VAL VAL A . n 
A 1 580 ASN 580 580 580 ASN ASN A . n 
A 1 581 LEU 581 581 581 LEU LEU A . n 
A 1 582 THR 582 582 582 THR THR A . n 
A 1 583 ARG 583 583 583 ARG ARG A . n 
A 1 584 GLU 584 584 584 GLU GLU A . n 
A 1 585 GLN 585 585 585 GLN GLN A . n 
A 1 586 CYS 586 586 586 CYS CYS A . n 
A 1 587 GLN 587 587 587 GLN GLN A . n 
A 1 588 ASP 588 588 588 ASP ASP A . n 
A 1 589 PRO 589 589 589 PRO PRO A . n 
A 1 590 SER 590 590 590 SER SER A . n 
A 1 591 LYS 591 591 591 LYS LYS A . n 
A 1 592 VAL 592 592 592 VAL VAL A . n 
A 1 593 PRO 593 593 593 PRO PRO A . n 
A 1 594 SER 594 594 594 SER SER A . n 
A 1 595 GLU 595 595 595 GLU GLU A . n 
A 1 596 ASN 596 596 596 ASN ASN A . n 
A 1 597 LYS 597 597 597 LYS LYS A . n 
A 1 598 ASP 598 598 598 ASP ASP A . n 
A 1 599 LEU 599 599 599 LEU LEU A . n 
A 1 600 TYR 600 600 600 TYR TYR A . n 
A 1 601 GLU 601 601 601 GLU GLU A . n 
A 1 602 TYR 602 602 602 TYR TYR A . n 
A 1 603 SER 603 603 603 SER SER A . n 
A 1 604 TRP 604 604 604 TRP TRP A . n 
A 1 605 VAL 605 605 605 VAL VAL A . n 
A 1 606 GLN 606 606 606 GLN GLN A . n 
A 1 607 GLY 607 607 607 GLY GLY A . n 
A 1 608 PRO 608 608 608 PRO PRO A . n 
A 1 609 LEU 609 609 609 LEU LEU A . n 
A 1 610 HIS 610 610 610 HIS HIS A . n 
A 1 611 SER 611 611 611 SER SER A . n 
A 1 612 ASN 612 612 612 ASN ASN A . n 
A 1 613 GLU 613 613 613 GLU GLU A . n 
A 1 614 THR 614 614 614 THR THR A . n 
A 1 615 ASP 615 615 615 ASP ASP A . n 
A 1 616 ARG 616 616 616 ARG ARG A . n 
A 1 617 LEU 617 617 617 LEU LEU A . n 
A 1 618 PRO 618 618 618 PRO PRO A . n 
A 1 619 ARG 619 619 619 ARG ARG A . n 
A 1 620 CYS 620 620 620 CYS CYS A . n 
A 1 621 VAL 621 621 621 VAL VAL A . n 
A 1 622 ARG 622 622 622 ARG ARG A . n 
A 1 623 SER 623 623 623 SER SER A . n 
A 1 624 THR 624 624 624 THR THR A . n 
A 1 625 ALA 625 625 625 ALA ALA A . n 
A 1 626 ARG 626 626 626 ARG ARG A . n 
A 1 627 LEU 627 627 627 LEU LEU A . n 
A 1 628 ALA 628 628 628 ALA ALA A . n 
A 1 629 ARG 629 629 629 ARG ARG A . n 
A 1 630 ALA 630 630 630 ALA ALA A . n 
A 1 631 LEU 631 631 631 LEU LEU A . n 
A 1 632 SER 632 632 632 SER SER A . n 
A 1 633 PRO 633 633 633 PRO PRO A . n 
A 1 634 ALA 634 634 634 ALA ALA A . n 
A 1 635 PHE 635 635 635 PHE PHE A . n 
A 1 636 GLU 636 636 636 GLU GLU A . n 
A 1 637 LEU 637 637 637 LEU LEU A . n 
A 1 638 SER 638 638 638 SER SER A . n 
A 1 639 GLN 639 639 639 GLN GLN A . n 
A 1 640 TRP 640 640 640 TRP TRP A . n 
A 1 641 SER 641 641 641 SER SER A . n 
A 1 642 SER 642 642 642 SER SER A . n 
A 1 643 THR 643 643 643 THR THR A . n 
A 1 644 GLU 644 644 644 GLU GLU A . n 
A 1 645 TYR 645 645 645 TYR TYR A . n 
A 1 646 SER 646 646 646 SER SER A . n 
A 1 647 THR 647 647 647 THR THR A . n 
A 1 648 TRP 648 648 648 TRP TRP A . n 
A 1 649 THR 649 649 649 THR THR A . n 
A 1 650 GLU 650 650 650 GLU GLU A . n 
A 1 651 SER 651 651 651 SER SER A . n 
A 1 652 ARG 652 652 652 ARG ARG A . n 
A 1 653 TRP 653 653 653 TRP TRP A . n 
A 1 654 LYS 654 654 654 LYS LYS A . n 
A 1 655 ASP 655 655 655 ASP ASP A . n 
A 1 656 ILE 656 656 656 ILE ILE A . n 
A 1 657 ARG 657 657 657 ARG ARG A . n 
A 1 658 ALA 658 658 658 ALA ALA A . n 
A 1 659 ARG 659 659 659 ARG ARG A . n 
A 1 660 ILE 660 660 660 ILE ILE A . n 
A 1 661 PHE 661 661 661 PHE PHE A . n 
A 1 662 LEU 662 662 662 LEU LEU A . n 
A 1 663 ILE 663 663 663 ILE ILE A . n 
A 1 664 ALA 664 664 664 ALA ALA A . n 
A 1 665 SER 665 665 665 SER SER A . n 
A 1 666 LYS 666 666 666 LYS LYS A . n 
A 1 667 GLU 667 667 667 GLU GLU A . n 
A 1 668 LEU 668 668 668 LEU LEU A . n 
A 1 669 GLU 669 669 669 GLU GLU A . n 
A 1 670 LEU 670 670 670 LEU LEU A . n 
A 1 671 ILE 671 671 671 ILE ILE A . n 
A 1 672 THR 672 672 672 THR THR A . n 
A 1 673 LEU 673 673 673 LEU LEU A . n 
A 1 674 THR 674 674 674 THR THR A . n 
A 1 675 VAL 675 675 675 VAL VAL A . n 
A 1 676 GLY 676 676 676 GLY GLY A . n 
A 1 677 PHE 677 677 677 PHE PHE A . n 
A 1 678 GLY 678 678 678 GLY GLY A . n 
A 1 679 ILE 679 679 679 ILE ILE A . n 
A 1 680 LEU 680 680 680 LEU LEU A . n 
A 1 681 ILE 681 681 681 ILE ILE A . n 
A 1 682 PHE 682 682 682 PHE PHE A . n 
A 1 683 SER 683 683 683 SER SER A . n 
A 1 684 LEU 684 684 684 LEU LEU A . n 
A 1 685 ILE 685 685 685 ILE ILE A . n 
A 1 686 VAL 686 686 686 VAL VAL A . n 
A 1 687 THR 687 687 687 THR THR A . n 
A 1 688 TYR 688 688 688 TYR TYR A . n 
A 1 689 CYS 689 689 689 CYS CYS A . n 
A 1 690 ILE 690 690 690 ILE ILE A . n 
A 1 691 ASN 691 691 691 ASN ASN A . n 
A 1 692 ALA 692 692 692 ALA ALA A . n 
A 1 693 LYS 693 693 693 LYS LYS A . n 
A 1 694 ALA 694 694 694 ALA ALA A . n 
A 1 695 ASP 695 695 695 ASP ASP A . n 
A 1 696 VAL 696 696 696 VAL VAL A . n 
A 1 697 LEU 697 697 697 LEU LEU A . n 
A 1 698 PHE 698 698 698 PHE PHE A . n 
A 1 699 ILE 699 699 ?   ?   ?   A . n 
A 1 700 ALA 700 700 ?   ?   ?   A . n 
A 1 701 PRO 701 701 ?   ?   ?   A . n 
A 1 702 ARG 702 702 ?   ?   ?   A . n 
A 1 703 GLU 703 703 ?   ?   ?   A . n 
A 1 704 PRO 704 704 ?   ?   ?   A . n 
A 1 705 GLY 705 705 ?   ?   ?   A . n 
A 1 706 ALA 706 706 ?   ?   ?   A . n 
A 1 707 VAL 707 707 ?   ?   ?   A . n 
A 1 708 SER 708 708 ?   ?   ?   A . n 
A 1 709 TYR 709 709 ?   ?   ?   A . n 
B 2 1   MET 1   1   ?   ?   ?   B . n 
B 2 2   THR 2   2   ?   ?   ?   B . n 
B 2 3   GLU 3   3   ?   ?   ?   B . n 
B 2 4   LEU 4   4   ?   ?   ?   B . n 
B 2 5   PRO 5   5   ?   ?   ?   B . n 
B 2 6   ALA 6   6   ?   ?   ?   B . n 
B 2 7   PRO 7   7   ?   ?   ?   B . n 
B 2 8   LEU 8   8   ?   ?   ?   B . n 
B 2 9   SER 9   9   ?   ?   ?   B . n 
B 2 10  TYR 10  10  ?   ?   ?   B . n 
B 2 11  PHE 11  11  ?   ?   ?   B . n 
B 2 12  GLN 12  12  ?   ?   ?   B . n 
B 2 13  ASN 13  13  ?   ?   ?   B . n 
B 2 14  ALA 14  14  ?   ?   ?   B . n 
B 2 15  GLN 15  15  ?   ?   ?   B . n 
B 2 16  MET 16  16  ?   ?   ?   B . n 
B 2 17  SER 17  17  ?   ?   ?   B . n 
B 2 18  GLU 18  18  ?   ?   ?   B . n 
B 2 19  ASP 19  19  ?   ?   ?   B . n 
B 2 20  ASN 20  20  ?   ?   ?   B . n 
B 2 21  HIS 21  21  ?   ?   ?   B . n 
B 2 22  LEU 22  22  ?   ?   ?   B . n 
B 2 23  SER 23  23  ?   ?   ?   B . n 
B 2 24  ASN 24  24  ?   ?   ?   B . n 
B 2 25  THR 25  25  ?   ?   ?   B . n 
B 2 26  VAL 26  26  ?   ?   ?   B . n 
B 2 27  ARG 27  27  ?   ?   ?   B . n 
B 2 28  SER 28  28  ?   ?   ?   B . n 
B 2 29  GLN 29  29  ?   ?   ?   B . n 
B 2 30  ASN 30  30  ?   ?   ?   B . n 
B 2 31  ASP 31  31  ?   ?   ?   B . n 
B 2 32  ASN 32  32  ?   ?   ?   B . n 
B 2 33  ARG 33  33  ?   ?   ?   B . n 
B 2 34  GLU 34  34  ?   ?   ?   B . n 
B 2 35  ARG 35  35  ?   ?   ?   B . n 
B 2 36  GLN 36  36  ?   ?   ?   B . n 
B 2 37  GLU 37  37  ?   ?   ?   B . n 
B 2 38  HIS 38  38  ?   ?   ?   B . n 
B 2 39  ASN 39  39  ?   ?   ?   B . n 
B 2 40  ASP 40  40  ?   ?   ?   B . n 
B 2 41  ARG 41  41  ?   ?   ?   B . n 
B 2 42  ARG 42  42  ?   ?   ?   B . n 
B 2 43  SER 43  43  ?   ?   ?   B . n 
B 2 44  LEU 44  44  ?   ?   ?   B . n 
B 2 45  GLY 45  45  ?   ?   ?   B . n 
B 2 46  HIS 46  46  ?   ?   ?   B . n 
B 2 47  PRO 47  47  ?   ?   ?   B . n 
B 2 48  GLU 48  48  ?   ?   ?   B . n 
B 2 49  PRO 49  49  ?   ?   ?   B . n 
B 2 50  LEU 50  50  ?   ?   ?   B . n 
B 2 51  SER 51  51  ?   ?   ?   B . n 
B 2 52  ASN 52  52  ?   ?   ?   B . n 
B 2 53  GLY 53  53  ?   ?   ?   B . n 
B 2 54  ARG 54  54  ?   ?   ?   B . n 
B 2 55  PRO 55  55  ?   ?   ?   B . n 
B 2 56  GLN 56  56  ?   ?   ?   B . n 
B 2 57  GLY 57  57  ?   ?   ?   B . n 
B 2 58  ASN 58  58  ?   ?   ?   B . n 
B 2 59  SER 59  59  ?   ?   ?   B . n 
B 2 60  ARG 60  60  ?   ?   ?   B . n 
B 2 61  GLN 61  61  ?   ?   ?   B . n 
B 2 62  VAL 62  62  ?   ?   ?   B . n 
B 2 63  VAL 63  63  ?   ?   ?   B . n 
B 2 64  GLU 64  64  ?   ?   ?   B . n 
B 2 65  GLN 65  65  ?   ?   ?   B . n 
B 2 66  ASP 66  66  ?   ?   ?   B . n 
B 2 67  GLU 67  67  ?   ?   ?   B . n 
B 2 68  GLU 68  68  ?   ?   ?   B . n 
B 2 69  GLU 69  69  ?   ?   ?   B . n 
B 2 70  ASP 70  70  ?   ?   ?   B . n 
B 2 71  GLU 71  71  ?   ?   ?   B . n 
B 2 72  GLU 72  72  ?   ?   ?   B . n 
B 2 73  LEU 73  73  ?   ?   ?   B . n 
B 2 74  THR 74  74  ?   ?   ?   B . n 
B 2 75  LEU 75  75  ?   ?   ?   B . n 
B 2 76  LYS 76  76  ?   ?   ?   B . n 
B 2 77  TYR 77  77  ?   ?   ?   B . n 
B 2 78  GLY 78  78  78  GLY GLY B . n 
B 2 79  ALA 79  79  79  ALA ALA B . n 
B 2 80  LYS 80  80  80  LYS LYS B . n 
B 2 81  HIS 81  81  81  HIS HIS B . n 
B 2 82  VAL 82  82  82  VAL VAL B . n 
B 2 83  ILE 83  83  83  ILE ILE B . n 
B 2 84  MET 84  84  84  MET MET B . n 
B 2 85  LEU 85  85  85  LEU LEU B . n 
B 2 86  PHE 86  86  86  PHE PHE B . n 
B 2 87  VAL 87  87  87  VAL VAL B . n 
B 2 88  PRO 88  88  88  PRO PRO B . n 
B 2 89  VAL 89  89  89  VAL VAL B . n 
B 2 90  THR 90  90  90  THR THR B . n 
B 2 91  LEU 91  91  91  LEU LEU B . n 
B 2 92  CYS 92  92  92  CYS CYS B . n 
B 2 93  MET 93  93  93  MET MET B . n 
B 2 94  VAL 94  94  94  VAL VAL B . n 
B 2 95  VAL 95  95  95  VAL VAL B . n 
B 2 96  VAL 96  96  96  VAL VAL B . n 
B 2 97  VAL 97  97  97  VAL VAL B . n 
B 2 98  ALA 98  98  98  ALA ALA B . n 
B 2 99  THR 99  99  99  THR THR B . n 
B 2 100 ILE 100 100 100 ILE ILE B . n 
B 2 101 LYS 101 101 101 LYS LYS B . n 
B 2 102 SER 102 102 102 SER SER B . n 
B 2 103 VAL 103 103 103 VAL VAL B . n 
B 2 104 SER 104 104 104 SER SER B . n 
B 2 105 PHE 105 105 105 PHE PHE B . n 
B 2 106 TYR 106 106 106 TYR TYR B . n 
B 2 107 THR 107 107 107 THR THR B . n 
B 2 108 ARG 108 108 108 ARG ARG B . n 
B 2 109 LYS 109 109 109 LYS LYS B . n 
B 2 110 ASP 110 110 110 ASP ASP B . n 
B 2 111 GLY 111 111 111 GLY GLY B . n 
B 2 112 GLN 112 112 112 GLN GLN B . n 
B 2 113 LEU 113 113 113 LEU LEU B . n 
B 2 114 ILE 114 114 114 ILE ILE B . n 
B 2 115 TYR 115 115 115 TYR TYR B . n 
B 2 116 THR 116 116 116 THR THR B . n 
B 2 117 PRO 117 117 117 PRO PRO B . n 
B 2 118 PHE 118 118 118 PHE PHE B . n 
B 2 119 THR 119 119 119 THR THR B . n 
B 2 120 GLU 120 120 120 GLU GLU B . n 
B 2 121 ASP 121 121 121 ASP ASP B . n 
B 2 122 THR 122 122 122 THR THR B . n 
B 2 123 GLU 123 123 123 GLU GLU B . n 
B 2 124 THR 124 124 124 THR THR B . n 
B 2 125 VAL 125 125 125 VAL VAL B . n 
B 2 126 GLY 126 126 126 GLY GLY B . n 
B 2 127 GLN 127 127 127 GLN GLN B . n 
B 2 128 ARG 128 128 128 ARG ARG B . n 
B 2 129 ALA 129 129 129 ALA ALA B . n 
B 2 130 LEU 130 130 130 LEU LEU B . n 
B 2 131 HIS 131 131 131 HIS HIS B . n 
B 2 132 SER 132 132 132 SER SER B . n 
B 2 133 ILE 133 133 133 ILE ILE B . n 
B 2 134 LEU 134 134 134 LEU LEU B . n 
B 2 135 ASN 135 135 135 ASN ASN B . n 
B 2 136 ALA 136 136 136 ALA ALA B . n 
B 2 137 ALA 137 137 137 ALA ALA B . n 
B 2 138 ILE 138 138 138 ILE ILE B . n 
B 2 139 MET 139 139 139 MET MET B . n 
B 2 140 ILE 140 140 140 ILE ILE B . n 
B 2 141 SER 141 141 141 SER SER B . n 
B 2 142 VAL 142 142 142 VAL VAL B . n 
B 2 143 ILE 143 143 143 ILE ILE B . n 
B 2 144 VAL 144 144 144 VAL VAL B . n 
B 2 145 VAL 145 145 145 VAL VAL B . n 
B 2 146 MET 146 146 146 MET MET B . n 
B 2 147 THR 147 147 147 THR THR B . n 
B 2 148 ILE 148 148 148 ILE ILE B . n 
B 2 149 LEU 149 149 149 LEU LEU B . n 
B 2 150 LEU 150 150 150 LEU LEU B . n 
B 2 151 VAL 151 151 151 VAL VAL B . n 
B 2 152 VAL 152 152 152 VAL VAL B . n 
B 2 153 LEU 153 153 153 LEU LEU B . n 
B 2 154 TYR 154 154 154 TYR TYR B . n 
B 2 155 LYS 155 155 155 LYS LYS B . n 
B 2 156 TYR 156 156 156 TYR TYR B . n 
B 2 157 ARG 157 157 157 ARG ARG B . n 
B 2 158 CYS 158 158 158 CYS CYS B . n 
B 2 159 TYR 159 159 159 TYR TYR B . n 
B 2 160 LYS 160 160 160 LYS LYS B . n 
B 2 161 VAL 161 161 161 VAL VAL B . n 
B 2 162 ILE 162 162 162 ILE ILE B . n 
B 2 163 HIS 163 163 163 HIS HIS B . n 
B 2 164 ALA 164 164 164 ALA ALA B . n 
B 2 165 TRP 165 165 165 TRP TRP B . n 
B 2 166 LEU 166 166 166 LEU LEU B . n 
B 2 167 ILE 167 167 167 ILE ILE B . n 
B 2 168 ILE 168 168 168 ILE ILE B . n 
B 2 169 SER 169 169 169 SER SER B . n 
B 2 170 SER 170 170 170 SER SER B . n 
B 2 171 LEU 171 171 171 LEU LEU B . n 
B 2 172 LEU 172 172 172 LEU LEU B . n 
B 2 173 LEU 173 173 173 LEU LEU B . n 
B 2 174 LEU 174 174 174 LEU LEU B . n 
B 2 175 PHE 175 175 175 PHE PHE B . n 
B 2 176 PHE 176 176 176 PHE PHE B . n 
B 2 177 PHE 177 177 177 PHE PHE B . n 
B 2 178 SER 178 178 178 SER SER B . n 
B 2 179 PHE 179 179 179 PHE PHE B . n 
B 2 180 ILE 180 180 180 ILE ILE B . n 
B 2 181 TYR 181 181 181 TYR TYR B . n 
B 2 182 LEU 182 182 182 LEU LEU B . n 
B 2 183 GLY 183 183 183 GLY GLY B . n 
B 2 184 GLU 184 184 184 GLU GLU B . n 
B 2 185 VAL 185 185 185 VAL VAL B . n 
B 2 186 PHE 186 186 186 PHE PHE B . n 
B 2 187 LYS 187 187 187 LYS LYS B . n 
B 2 188 THR 188 188 188 THR THR B . n 
B 2 189 TYR 189 189 189 TYR TYR B . n 
B 2 190 ASN 190 190 190 ASN ASN B . n 
B 2 191 VAL 191 191 191 VAL VAL B . n 
B 2 192 ALA 192 192 192 ALA ALA B . n 
B 2 193 VAL 193 193 193 VAL VAL B . n 
B 2 194 ASP 194 194 194 ASP ASP B . n 
B 2 195 TYR 195 195 195 TYR TYR B . n 
B 2 196 ILE 196 196 196 ILE ILE B . n 
B 2 197 THR 197 197 197 THR THR B . n 
B 2 198 VAL 198 198 198 VAL VAL B . n 
B 2 199 ALA 199 199 199 ALA ALA B . n 
B 2 200 LEU 200 200 200 LEU LEU B . n 
B 2 201 LEU 201 201 201 LEU LEU B . n 
B 2 202 ILE 202 202 202 ILE ILE B . n 
B 2 203 TRP 203 203 203 TRP TRP B . n 
B 2 204 ASN 204 204 204 ASN ASN B . n 
B 2 205 PHE 205 205 205 PHE PHE B . n 
B 2 206 GLY 206 206 206 GLY GLY B . n 
B 2 207 VAL 207 207 207 VAL VAL B . n 
B 2 208 VAL 208 208 208 VAL VAL B . n 
B 2 209 GLY 209 209 209 GLY GLY B . n 
B 2 210 MET 210 210 210 MET MET B . n 
B 2 211 ILE 211 211 211 ILE ILE B . n 
B 2 212 SER 212 212 212 SER SER B . n 
B 2 213 ILE 213 213 213 ILE ILE B . n 
B 2 214 HIS 214 214 214 HIS HIS B . n 
B 2 215 TRP 215 215 215 TRP TRP B . n 
B 2 216 LYS 216 216 216 LYS LYS B . n 
B 2 217 GLY 217 217 217 GLY GLY B . n 
B 2 218 PRO 218 218 218 PRO PRO B . n 
B 2 219 LEU 219 219 219 LEU LEU B . n 
B 2 220 ARG 220 220 220 ARG ARG B . n 
B 2 221 LEU 221 221 221 LEU LEU B . n 
B 2 222 GLN 222 222 222 GLN GLN B . n 
B 2 223 GLN 223 223 223 GLN GLN B . n 
B 2 224 ALA 224 224 224 ALA ALA B . n 
B 2 225 TYR 225 225 225 TYR TYR B . n 
B 2 226 LEU 226 226 226 LEU LEU B . n 
B 2 227 ILE 227 227 227 ILE ILE B . n 
B 2 228 MET 228 228 228 MET MET B . n 
B 2 229 ILE 229 229 229 ILE ILE B . n 
B 2 230 SER 230 230 230 SER SER B . n 
B 2 231 ALA 231 231 231 ALA ALA B . n 
B 2 232 LEU 232 232 232 LEU LEU B . n 
B 2 233 MET 233 233 233 MET MET B . n 
B 2 234 ALA 234 234 234 ALA ALA B . n 
B 2 235 LEU 235 235 235 LEU LEU B . n 
B 2 236 VAL 236 236 236 VAL VAL B . n 
B 2 237 PHE 237 237 237 PHE PHE B . n 
B 2 238 ILE 238 238 238 ILE ILE B . n 
B 2 239 LYS 239 239 239 LYS LYS B . n 
B 2 240 TYR 240 240 240 TYR TYR B . n 
B 2 241 LEU 241 241 241 LEU LEU B . n 
B 2 242 PRO 242 242 242 PRO PRO B . n 
B 2 243 GLU 243 243 243 GLU GLU B . n 
B 2 244 TRP 244 244 244 TRP TRP B . n 
B 2 245 THR 245 245 245 THR THR B . n 
B 2 246 ALA 246 246 246 ALA ALA B . n 
B 2 247 TRP 247 247 247 TRP TRP B . n 
B 2 248 LEU 248 248 248 LEU LEU B . n 
B 2 249 ILE 249 249 249 ILE ILE B . n 
B 2 250 LEU 250 250 250 LEU LEU B . n 
B 2 251 ALA 251 251 251 ALA ALA B . n 
B 2 252 VAL 252 252 252 VAL VAL B . n 
B 2 253 ILE 253 253 253 ILE ILE B . n 
B 2 254 SER 254 254 254 SER SER B . n 
B 2 255 VAL 255 255 255 VAL VAL B . n 
B 2 256 THR 256 256 256 THR THR B . n 
B 2 257 ASP 257 257 257 ASP ASP B . n 
B 2 258 LEU 258 258 258 LEU LEU B . n 
B 2 259 VAL 259 259 259 VAL VAL B . n 
B 2 260 ALA 260 260 260 ALA ALA B . n 
B 2 261 VAL 261 261 261 VAL VAL B . n 
B 2 262 LEU 262 262 262 LEU LEU B . n 
B 2 263 CYS 263 263 263 CYS CYS B . n 
B 2 264 PRO 264 264 264 PRO PRO B . n 
B 2 265 LYS 265 265 265 LYS LYS B . n 
B 2 266 GLY 266 266 266 GLY GLY B . n 
B 2 267 PRO 267 267 267 PRO PRO B . n 
B 2 268 LEU 268 268 268 LEU LEU B . n 
B 2 269 ARG 269 269 269 ARG ARG B . n 
B 2 270 MET 270 270 270 MET MET B . n 
B 2 271 LEU 271 271 271 LEU LEU B . n 
B 2 272 VAL 272 272 272 VAL VAL B . n 
B 2 273 GLU 273 273 273 GLU GLU B . n 
B 2 274 THR 274 274 274 THR THR B . n 
B 2 275 ALA 275 275 275 ALA ALA B . n 
B 2 276 GLN 276 276 276 GLN GLN B . n 
B 2 277 GLU 277 277 277 GLU GLU B . n 
B 2 278 ARG 278 278 278 ARG ARG B . n 
B 2 279 ASN 279 279 279 ASN ASN B . n 
B 2 280 GLU 280 280 280 GLU GLU B . n 
B 2 281 THR 281 281 281 THR THR B . n 
B 2 282 LEU 282 282 282 LEU LEU B . n 
B 2 283 PHE 283 283 283 PHE PHE B . n 
B 2 284 PRO 284 284 284 PRO PRO B . n 
B 2 285 ALA 285 285 285 ALA ALA B . n 
B 2 286 LEU 286 286 286 LEU LEU B . n 
B 2 287 ILE 287 287 287 ILE ILE B . n 
B 2 288 TYR 288 288 288 TYR TYR B . n 
B 2 289 SER 289 289 ?   ?   ?   B . n 
B 2 290 SER 290 290 ?   ?   ?   B . n 
B 2 291 THR 291 291 ?   ?   ?   B . n 
B 2 292 MET 292 292 ?   ?   ?   B . n 
B 2 293 VAL 293 293 ?   ?   ?   B . n 
B 2 294 TRP 294 294 ?   ?   ?   B . n 
B 2 295 LEU 295 295 ?   ?   ?   B . n 
B 2 296 VAL 296 296 ?   ?   ?   B . n 
B 2 297 ASN 297 297 ?   ?   ?   B . n 
B 2 298 MET 298 298 ?   ?   ?   B . n 
B 2 299 ALA 299 299 ?   ?   ?   B . n 
B 2 300 GLU 300 300 ?   ?   ?   B . n 
B 2 301 GLY 301 301 ?   ?   ?   B . n 
B 2 302 ASP 302 302 ?   ?   ?   B . n 
B 2 303 PRO 303 303 ?   ?   ?   B . n 
B 2 304 GLU 304 304 ?   ?   ?   B . n 
B 2 305 ALA 305 305 ?   ?   ?   B . n 
B 2 306 GLN 306 306 ?   ?   ?   B . n 
B 2 307 ARG 307 307 ?   ?   ?   B . n 
B 2 308 ARG 308 308 ?   ?   ?   B . n 
B 2 309 VAL 309 309 ?   ?   ?   B . n 
B 2 310 SER 310 310 ?   ?   ?   B . n 
B 2 311 LYS 311 311 ?   ?   ?   B . n 
B 2 312 ASN 312 312 ?   ?   ?   B . n 
B 2 313 SER 313 313 ?   ?   ?   B . n 
B 2 314 LYS 314 314 ?   ?   ?   B . n 
B 2 315 TYR 315 315 ?   ?   ?   B . n 
B 2 316 ASN 316 316 ?   ?   ?   B . n 
B 2 317 ALA 317 317 ?   ?   ?   B . n 
B 2 318 GLU 318 318 ?   ?   ?   B . n 
B 2 319 SER 319 319 ?   ?   ?   B . n 
B 2 320 THR 320 320 ?   ?   ?   B . n 
B 2 321 GLU 321 321 ?   ?   ?   B . n 
B 2 322 ARG 322 322 ?   ?   ?   B . n 
B 2 323 GLU 323 323 ?   ?   ?   B . n 
B 2 324 SER 324 324 ?   ?   ?   B . n 
B 2 325 GLN 325 325 ?   ?   ?   B . n 
B 2 326 ASP 326 326 ?   ?   ?   B . n 
B 2 327 THR 327 327 ?   ?   ?   B . n 
B 2 328 VAL 328 328 ?   ?   ?   B . n 
B 2 329 ALA 329 329 ?   ?   ?   B . n 
B 2 330 GLU 330 330 ?   ?   ?   B . n 
B 2 331 ASN 331 331 ?   ?   ?   B . n 
B 2 332 ASP 332 332 ?   ?   ?   B . n 
B 2 333 ASP 333 333 ?   ?   ?   B . n 
B 2 334 GLY 334 334 ?   ?   ?   B . n 
B 2 335 GLY 335 335 ?   ?   ?   B . n 
B 2 336 PHE 336 336 ?   ?   ?   B . n 
B 2 337 SER 337 337 ?   ?   ?   B . n 
B 2 338 GLU 338 338 ?   ?   ?   B . n 
B 2 339 GLU 339 339 ?   ?   ?   B . n 
B 2 340 TRP 340 340 ?   ?   ?   B . n 
B 2 341 GLU 341 341 ?   ?   ?   B . n 
B 2 342 ALA 342 342 ?   ?   ?   B . n 
B 2 343 GLN 343 343 ?   ?   ?   B . n 
B 2 344 ARG 344 344 ?   ?   ?   B . n 
B 2 345 ASP 345 345 ?   ?   ?   B . n 
B 2 346 SER 346 346 ?   ?   ?   B . n 
B 2 347 HIS 347 347 ?   ?   ?   B . n 
B 2 348 LEU 348 348 ?   ?   ?   B . n 
B 2 349 GLY 349 349 ?   ?   ?   B . n 
B 2 350 PRO 350 350 ?   ?   ?   B . n 
B 2 351 HIS 351 351 ?   ?   ?   B . n 
B 2 352 ARG 352 352 ?   ?   ?   B . n 
B 2 353 SER 353 353 ?   ?   ?   B . n 
B 2 354 THR 354 354 ?   ?   ?   B . n 
B 2 355 PRO 355 355 ?   ?   ?   B . n 
B 2 356 GLU 356 356 ?   ?   ?   B . n 
B 2 357 SER 357 357 ?   ?   ?   B . n 
B 2 358 ARG 358 358 ?   ?   ?   B . n 
B 2 359 ALA 359 359 ?   ?   ?   B . n 
B 2 360 ALA 360 360 ?   ?   ?   B . n 
B 2 361 VAL 361 361 ?   ?   ?   B . n 
B 2 362 GLN 362 362 ?   ?   ?   B . n 
B 2 363 GLU 363 363 ?   ?   ?   B . n 
B 2 364 LEU 364 364 ?   ?   ?   B . n 
B 2 365 SER 365 365 ?   ?   ?   B . n 
B 2 366 SER 366 366 ?   ?   ?   B . n 
B 2 367 SER 367 367 ?   ?   ?   B . n 
B 2 368 ILE 368 368 ?   ?   ?   B . n 
B 2 369 LEU 369 369 ?   ?   ?   B . n 
B 2 370 ALA 370 370 ?   ?   ?   B . n 
B 2 371 GLY 371 371 ?   ?   ?   B . n 
B 2 372 GLU 372 372 ?   ?   ?   B . n 
B 2 373 ASP 373 373 ?   ?   ?   B . n 
B 2 374 PRO 374 374 ?   ?   ?   B . n 
B 2 375 GLU 375 375 ?   ?   ?   B . n 
B 2 376 GLU 376 376 ?   ?   ?   B . n 
B 2 377 ARG 377 377 ?   ?   ?   B . n 
B 2 378 GLY 378 378 378 GLY GLY B . n 
B 2 379 VAL 379 379 379 VAL VAL B . n 
B 2 380 LYS 380 380 380 LYS LYS B . n 
B 2 381 LEU 381 381 381 LEU LEU B . n 
B 2 382 GLY 382 382 382 GLY GLY B . n 
B 2 383 LEU 383 383 383 LEU LEU B . n 
B 2 384 GLY 384 384 384 GLY GLY B . n 
B 2 385 ASP 385 385 385 ASP ASP B . n 
B 2 386 PHE 386 386 386 PHE PHE B . n 
B 2 387 ILE 387 387 387 ILE ILE B . n 
B 2 388 PHE 388 388 388 PHE PHE B . n 
B 2 389 TYR 389 389 389 TYR TYR B . n 
B 2 390 SER 390 390 390 SER SER B . n 
B 2 391 VAL 391 391 391 VAL VAL B . n 
B 2 392 LEU 392 392 392 LEU LEU B . n 
B 2 393 VAL 393 393 393 VAL VAL B . n 
B 2 394 GLY 394 394 394 GLY GLY B . n 
B 2 395 LYS 395 395 395 LYS LYS B . n 
B 2 396 ALA 396 396 396 ALA ALA B . n 
B 2 397 SER 397 397 397 SER SER B . n 
B 2 398 ALA 398 398 398 ALA ALA B . n 
B 2 399 THR 399 399 399 THR THR B . n 
B 2 400 ALA 400 400 400 ALA ALA B . n 
B 2 401 SER 401 401 401 SER SER B . n 
B 2 402 GLY 402 402 402 GLY GLY B . n 
B 2 403 ASP 403 403 403 ASP ASP B . n 
B 2 404 TRP 404 404 404 TRP TRP B . n 
B 2 405 ASN 405 405 405 ASN ASN B . n 
B 2 406 THR 406 406 406 THR THR B . n 
B 2 407 THR 407 407 407 THR THR B . n 
B 2 408 ILE 408 408 408 ILE ILE B . n 
B 2 409 ALA 409 409 409 ALA ALA B . n 
B 2 410 CYS 410 410 410 CYS CYS B . n 
B 2 411 PHE 411 411 411 PHE PHE B . n 
B 2 412 VAL 412 412 412 VAL VAL B . n 
B 2 413 ALA 413 413 413 ALA ALA B . n 
B 2 414 ILE 414 414 414 ILE ILE B . n 
B 2 415 LEU 415 415 415 LEU LEU B . n 
B 2 416 ILE 416 416 416 ILE ILE B . n 
B 2 417 GLY 417 417 417 GLY GLY B . n 
B 2 418 LEU 418 418 418 LEU LEU B . n 
B 2 419 CYS 419 419 419 CYS CYS B . n 
B 2 420 LEU 420 420 420 LEU LEU B . n 
B 2 421 THR 421 421 421 THR THR B . n 
B 2 422 LEU 422 422 422 LEU LEU B . n 
B 2 423 LEU 423 423 423 LEU LEU B . n 
B 2 424 LEU 424 424 424 LEU LEU B . n 
B 2 425 LEU 425 425 425 LEU LEU B . n 
B 2 426 ALA 426 426 426 ALA ALA B . n 
B 2 427 ILE 427 427 427 ILE ILE B . n 
B 2 428 PHE 428 428 428 PHE PHE B . n 
B 2 429 LYS 429 429 429 LYS LYS B . n 
B 2 430 LYS 430 430 430 LYS LYS B . n 
B 2 431 ALA 431 431 431 ALA ALA B . n 
B 2 432 LEU 432 432 432 LEU LEU B . n 
B 2 433 PRO 433 433 433 PRO PRO B . n 
B 2 434 ALA 434 434 434 ALA ALA B . n 
B 2 435 LEU 435 435 435 LEU LEU B . n 
B 2 436 PRO 436 436 436 PRO PRO B . n 
B 2 437 ILE 437 437 437 ILE ILE B . n 
B 2 438 SER 438 438 438 SER SER B . n 
B 2 439 ILE 439 439 439 ILE ILE B . n 
B 2 440 THR 440 440 440 THR THR B . n 
B 2 441 PHE 441 441 441 PHE PHE B . n 
B 2 442 GLY 442 442 442 GLY GLY B . n 
B 2 443 LEU 443 443 443 LEU LEU B . n 
B 2 444 VAL 444 444 444 VAL VAL B . n 
B 2 445 PHE 445 445 445 PHE PHE B . n 
B 2 446 TYR 446 446 446 TYR TYR B . n 
B 2 447 PHE 447 447 447 PHE PHE B . n 
B 2 448 ALA 448 448 448 ALA ALA B . n 
B 2 449 THR 449 449 449 THR THR B . n 
B 2 450 ASP 450 450 450 ASP ASP B . n 
B 2 451 TYR 451 451 451 TYR TYR B . n 
B 2 452 LEU 452 452 452 LEU LEU B . n 
B 2 453 VAL 453 453 453 VAL VAL B . n 
B 2 454 GLN 454 454 454 GLN GLN B . n 
B 2 455 PRO 455 455 455 PRO PRO B . n 
B 2 456 PHE 456 456 456 PHE PHE B . n 
B 2 457 MET 457 457 457 MET MET B . n 
B 2 458 ASP 458 458 458 ASP ASP B . n 
B 2 459 GLN 459 459 459 GLN GLN B . n 
B 2 460 LEU 460 460 460 LEU LEU B . n 
B 2 461 ALA 461 461 461 ALA ALA B . n 
B 2 462 PHE 462 462 462 PHE PHE B . n 
B 2 463 HIS 463 463 463 HIS HIS B . n 
B 2 464 GLN 464 464 464 GLN GLN B . n 
B 2 465 PHE 465 465 465 PHE PHE B . n 
B 2 466 TYR 466 466 466 TYR TYR B . n 
B 2 467 ILE 467 467 467 ILE ILE B . n 
C 3 1   MET 1   1   ?   ?   ?   C . n 
C 3 2   GLY 2   2   2   GLY GLY C . n 
C 3 3   ALA 3   3   3   ALA ALA C . n 
C 3 4   ALA 4   4   4   ALA ALA C . n 
C 3 5   VAL 5   5   5   VAL VAL C . n 
C 3 6   PHE 6   6   6   PHE PHE C . n 
C 3 7   PHE 7   7   7   PHE PHE C . n 
C 3 8   GLY 8   8   8   GLY GLY C . n 
C 3 9   CYS 9   9   9   CYS CYS C . n 
C 3 10  THR 10  10  10  THR THR C . n 
C 3 11  PHE 11  11  11  PHE PHE C . n 
C 3 12  VAL 12  12  12  VAL VAL C . n 
C 3 13  ALA 13  13  13  ALA ALA C . n 
C 3 14  PHE 14  14  14  PHE PHE C . n 
C 3 15  GLY 15  15  15  GLY GLY C . n 
C 3 16  PRO 16  16  16  PRO PRO C . n 
C 3 17  ALA 17  17  17  ALA ALA C . n 
C 3 18  PHE 18  18  18  PHE PHE C . n 
C 3 19  ALA 19  19  19  ALA ALA C . n 
C 3 20  LEU 20  20  20  LEU LEU C . n 
C 3 21  PHE 21  21  21  PHE PHE C . n 
C 3 22  LEU 22  22  22  LEU LEU C . n 
C 3 23  ILE 23  23  23  ILE ILE C . n 
C 3 24  THR 24  24  24  THR THR C . n 
C 3 25  VAL 25  25  25  VAL VAL C . n 
C 3 26  ALA 26  26  26  ALA ALA C . n 
C 3 27  GLY 27  27  27  GLY GLY C . n 
C 3 28  ASP 28  28  28  ASP ASP C . n 
C 3 29  PRO 29  29  29  PRO PRO C . n 
C 3 30  LEU 30  30  30  LEU LEU C . n 
C 3 31  ARG 31  31  31  ARG ARG C . n 
C 3 32  VAL 32  32  32  VAL VAL C . n 
C 3 33  ILE 33  33  33  ILE ILE C . n 
C 3 34  ILE 34  34  34  ILE ILE C . n 
C 3 35  LEU 35  35  35  LEU LEU C . n 
C 3 36  VAL 36  36  36  VAL VAL C . n 
C 3 37  ALA 37  37  37  ALA ALA C . n 
C 3 38  GLY 38  38  38  GLY GLY C . n 
C 3 39  ALA 39  39  39  ALA ALA C . n 
C 3 40  PHE 40  40  40  PHE PHE C . n 
C 3 41  PHE 41  41  41  PHE PHE C . n 
C 3 42  TRP 42  42  42  TRP TRP C . n 
C 3 43  LEU 43  43  43  LEU LEU C . n 
C 3 44  VAL 44  44  44  VAL VAL C . n 
C 3 45  SER 45  45  45  SER SER C . n 
C 3 46  LEU 46  46  46  LEU LEU C . n 
C 3 47  LEU 47  47  47  LEU LEU C . n 
C 3 48  LEU 48  48  48  LEU LEU C . n 
C 3 49  ALA 49  49  49  ALA ALA C . n 
C 3 50  SER 50  50  50  SER SER C . n 
C 3 51  VAL 51  51  51  VAL VAL C . n 
C 3 52  VAL 52  52  52  VAL VAL C . n 
C 3 53  TRP 53  53  53  TRP TRP C . n 
C 3 54  PHE 54  54  54  PHE PHE C . n 
C 3 55  ILE 55  55  55  ILE ILE C . n 
C 3 56  LEU 56  56  56  LEU LEU C . n 
C 3 57  VAL 57  57  57  VAL VAL C . n 
C 3 58  HIS 58  58  58  HIS HIS C . n 
C 3 59  VAL 59  59  59  VAL VAL C . n 
C 3 60  THR 60  60  60  THR THR C . n 
C 3 61  ASP 61  61  61  ASP ASP C . n 
C 3 62  ARG 62  62  62  ARG ARG C . n 
C 3 63  SER 63  63  63  SER SER C . n 
C 3 64  ASP 64  64  64  ASP ASP C . n 
C 3 65  ALA 65  65  65  ALA ALA C . n 
C 3 66  ARG 66  66  66  ARG ARG C . n 
C 3 67  LEU 67  67  67  LEU LEU C . n 
C 3 68  GLN 68  68  68  GLN GLN C . n 
C 3 69  TYR 69  69  69  TYR TYR C . n 
C 3 70  GLY 70  70  70  GLY GLY C . n 
C 3 71  LEU 71  71  71  LEU LEU C . n 
C 3 72  LEU 72  72  72  LEU LEU C . n 
C 3 73  ILE 73  73  73  ILE ILE C . n 
C 3 74  PHE 74  74  74  PHE PHE C . n 
C 3 75  GLY 75  75  75  GLY GLY C . n 
C 3 76  ALA 76  76  76  ALA ALA C . n 
C 3 77  ALA 77  77  77  ALA ALA C . n 
C 3 78  VAL 78  78  78  VAL VAL C . n 
C 3 79  SER 79  79  79  SER SER C . n 
C 3 80  VAL 80  80  80  VAL VAL C . n 
C 3 81  LEU 81  81  81  LEU LEU C . n 
C 3 82  LEU 82  82  82  LEU LEU C . n 
C 3 83  GLN 83  83  83  GLN GLN C . n 
C 3 84  GLU 84  84  84  GLU GLU C . n 
C 3 85  VAL 85  85  85  VAL VAL C . n 
C 3 86  PHE 86  86  86  PHE PHE C . n 
C 3 87  ARG 87  87  87  ARG ARG C . n 
C 3 88  PHE 88  88  88  PHE PHE C . n 
C 3 89  ALA 89  89  89  ALA ALA C . n 
C 3 90  TYR 90  90  90  TYR TYR C . n 
C 3 91  TYR 91  91  91  TYR TYR C . n 
C 3 92  LYS 92  92  92  LYS LYS C . n 
C 3 93  LEU 93  93  93  LEU LEU C . n 
C 3 94  LEU 94  94  94  LEU LEU C . n 
C 3 95  LYS 95  95  95  LYS LYS C . n 
C 3 96  LYS 96  96  96  LYS LYS C . n 
C 3 97  ALA 97  97  97  ALA ALA C . n 
C 3 98  ASP 98  98  98  ASP ASP C . n 
C 3 99  GLU 99  99  99  GLU GLU C . n 
C 3 100 GLY 100 100 100 GLY GLY C . n 
C 3 101 LEU 101 101 101 LEU LEU C . n 
C 3 102 ALA 102 102 102 ALA ALA C . n 
C 3 103 SER 103 103 103 SER SER C . n 
C 3 104 LEU 104 104 104 LEU LEU C . n 
C 3 105 SER 105 105 105 SER SER C . n 
C 3 106 GLU 106 106 106 GLU GLU C . n 
C 3 107 ASP 107 107 107 ASP ASP C . n 
C 3 108 GLY 108 108 108 GLY GLY C . n 
C 3 109 ARG 109 109 109 ARG ARG C . n 
C 3 110 SER 110 110 110 SER SER C . n 
C 3 111 PRO 111 111 111 PRO PRO C . n 
C 3 112 ILE 112 112 112 ILE ILE C . n 
C 3 113 SER 113 113 113 SER SER C . n 
C 3 114 ILE 114 114 114 ILE ILE C . n 
C 3 115 ARG 115 115 115 ARG ARG C . n 
C 3 116 GLN 116 116 116 GLN GLN C . n 
C 3 117 MET 117 117 117 MET MET C . n 
C 3 118 ALA 118 118 118 ALA ALA C . n 
C 3 119 TYR 119 119 119 TYR TYR C . n 
C 3 120 VAL 120 120 120 VAL VAL C . n 
C 3 121 SER 121 121 121 SER SER C . n 
C 3 122 GLY 122 122 122 GLY GLY C . n 
C 3 123 LEU 123 123 123 LEU LEU C . n 
C 3 124 SER 124 124 124 SER SER C . n 
C 3 125 PHE 125 125 125 PHE PHE C . n 
C 3 126 GLY 126 126 126 GLY GLY C . n 
C 3 127 ILE 127 127 127 ILE ILE C . n 
C 3 128 ILE 128 128 128 ILE ILE C . n 
C 3 129 SER 129 129 129 SER SER C . n 
C 3 130 GLY 130 130 130 GLY GLY C . n 
C 3 131 VAL 131 131 131 VAL VAL C . n 
C 3 132 PHE 132 132 132 PHE PHE C . n 
C 3 133 SER 133 133 133 SER SER C . n 
C 3 134 VAL 134 134 134 VAL VAL C . n 
C 3 135 ILE 135 135 135 ILE ILE C . n 
C 3 136 ASN 136 136 136 ASN ASN C . n 
C 3 137 ILE 137 137 137 ILE ILE C . n 
C 3 138 LEU 138 138 138 LEU LEU C . n 
C 3 139 ALA 139 139 139 ALA ALA C . n 
C 3 140 ASP 140 140 140 ASP ASP C . n 
C 3 141 ALA 141 141 141 ALA ALA C . n 
C 3 142 LEU 142 142 142 LEU LEU C . n 
C 3 143 GLY 143 143 143 GLY GLY C . n 
C 3 144 PRO 144 144 144 PRO PRO C . n 
C 3 145 GLY 145 145 145 GLY GLY C . n 
C 3 146 VAL 146 146 146 VAL VAL C . n 
C 3 147 VAL 147 147 147 VAL VAL C . n 
C 3 148 GLY 148 148 148 GLY GLY C . n 
C 3 149 ILE 149 149 149 ILE ILE C . n 
C 3 150 HIS 150 150 150 HIS HIS C . n 
C 3 151 GLY 151 151 151 GLY GLY C . n 
C 3 152 ASP 152 152 152 ASP ASP C . n 
C 3 153 SER 153 153 153 SER SER C . n 
C 3 154 PRO 154 154 154 PRO PRO C . n 
C 3 155 TYR 155 155 155 TYR TYR C . n 
C 3 156 TYR 156 156 156 TYR TYR C . n 
C 3 157 PHE 157 157 157 PHE PHE C . n 
C 3 158 LEU 158 158 158 LEU LEU C . n 
C 3 159 THR 159 159 159 THR THR C . n 
C 3 160 SER 160 160 160 SER SER C . n 
C 3 161 ALA 161 161 161 ALA ALA C . n 
C 3 162 PHE 162 162 162 PHE PHE C . n 
C 3 163 LEU 163 163 163 LEU LEU C . n 
C 3 164 THR 164 164 164 THR THR C . n 
C 3 165 ALA 165 165 165 ALA ALA C . n 
C 3 166 ALA 166 166 166 ALA ALA C . n 
C 3 167 ILE 167 167 167 ILE ILE C . n 
C 3 168 ILE 168 168 168 ILE ILE C . n 
C 3 169 LEU 169 169 169 LEU LEU C . n 
C 3 170 LEU 170 170 170 LEU LEU C . n 
C 3 171 HIS 171 171 171 HIS HIS C . n 
C 3 172 THR 172 172 172 THR THR C . n 
C 3 173 PHE 173 173 173 PHE PHE C . n 
C 3 174 TRP 174 174 174 TRP TRP C . n 
C 3 175 GLY 175 175 175 GLY GLY C . n 
C 3 176 VAL 176 176 176 VAL VAL C . n 
C 3 177 VAL 177 177 177 VAL VAL C . n 
C 3 178 PHE 178 178 178 PHE PHE C . n 
C 3 179 PHE 179 179 179 PHE PHE C . n 
C 3 180 ASP 180 180 180 ASP ASP C . n 
C 3 181 ALA 181 181 181 ALA ALA C . n 
C 3 182 CYS 182 182 182 CYS CYS C . n 
C 3 183 GLU 183 183 183 GLU GLU C . n 
C 3 184 ARG 184 184 184 ARG ARG C . n 
C 3 185 ARG 185 185 185 ARG ARG C . n 
C 3 186 ARG 186 186 186 ARG ARG C . n 
C 3 187 TYR 187 187 187 TYR TYR C . n 
C 3 188 TRP 188 188 188 TRP TRP C . n 
C 3 189 ALA 189 189 189 ALA ALA C . n 
C 3 190 LEU 190 190 190 LEU LEU C . n 
C 3 191 GLY 191 191 191 GLY GLY C . n 
C 3 192 LEU 192 192 192 LEU LEU C . n 
C 3 193 VAL 193 193 193 VAL VAL C . n 
C 3 194 VAL 194 194 194 VAL VAL C . n 
C 3 195 GLY 195 195 195 GLY GLY C . n 
C 3 196 SER 196 196 196 SER SER C . n 
C 3 197 HIS 197 197 197 HIS HIS C . n 
C 3 198 LEU 198 198 198 LEU LEU C . n 
C 3 199 LEU 199 199 199 LEU LEU C . n 
C 3 200 THR 200 200 200 THR THR C . n 
C 3 201 SER 201 201 201 SER SER C . n 
C 3 202 GLY 202 202 202 GLY GLY C . n 
C 3 203 LEU 203 203 203 LEU LEU C . n 
C 3 204 THR 204 204 204 THR THR C . n 
C 3 205 PHE 205 205 205 PHE PHE C . n 
C 3 206 LEU 206 206 206 LEU LEU C . n 
C 3 207 ASN 207 207 207 ASN ASN C . n 
C 3 208 PRO 208 208 208 PRO PRO C . n 
C 3 209 TRP 209 209 209 TRP TRP C . n 
C 3 210 TYR 210 210 210 TYR TYR C . n 
C 3 211 GLU 211 211 211 GLU GLU C . n 
C 3 212 ALA 212 212 212 ALA ALA C . n 
C 3 213 SER 213 213 213 SER SER C . n 
C 3 214 LEU 214 214 214 LEU LEU C . n 
C 3 215 LEU 215 215 215 LEU LEU C . n 
C 3 216 PRO 216 216 216 PRO PRO C . n 
C 3 217 ILE 217 217 217 ILE ILE C . n 
C 3 218 TYR 218 218 218 TYR TYR C . n 
C 3 219 ALA 219 219 219 ALA ALA C . n 
C 3 220 VAL 220 220 220 VAL VAL C . n 
C 3 221 THR 221 221 221 THR THR C . n 
C 3 222 VAL 222 222 222 VAL VAL C . n 
C 3 223 SER 223 223 223 SER SER C . n 
C 3 224 MET 224 224 224 MET MET C . n 
C 3 225 GLY 225 225 225 GLY GLY C . n 
C 3 226 LEU 226 226 226 LEU LEU C . n 
C 3 227 TRP 227 227 227 TRP TRP C . n 
C 3 228 ALA 228 228 228 ALA ALA C . n 
C 3 229 PHE 229 229 229 PHE PHE C . n 
C 3 230 ILE 230 230 230 ILE ILE C . n 
C 3 231 THR 231 231 231 THR THR C . n 
C 3 232 ALA 232 232 232 ALA ALA C . n 
C 3 233 GLY 233 233 233 GLY GLY C . n 
C 3 234 GLY 234 234 234 GLY GLY C . n 
C 3 235 SER 235 235 235 SER SER C . n 
C 3 236 LEU 236 236 236 LEU LEU C . n 
C 3 237 ARG 237 237 237 ARG ARG C . n 
C 3 238 SER 238 238 238 SER SER C . n 
C 3 239 ILE 239 239 239 ILE ILE C . n 
C 3 240 GLN 240 240 240 GLN GLN C . n 
C 3 241 ARG 241 241 241 ARG ARG C . n 
C 3 242 SER 242 242 242 SER SER C . n 
C 3 243 LEU 243 243 243 LEU LEU C . n 
C 3 244 LEU 244 244 244 LEU LEU C . n 
C 3 245 CYS 245 245 ?   ?   ?   C . n 
C 3 246 ARG 246 246 ?   ?   ?   C . n 
C 3 247 ARG 247 247 ?   ?   ?   C . n 
C 3 248 GLN 248 248 ?   ?   ?   C . n 
C 3 249 GLU 249 249 ?   ?   ?   C . n 
C 3 250 ASP 250 250 ?   ?   ?   C . n 
C 3 251 SER 251 251 ?   ?   ?   C . n 
C 3 252 ARG 252 252 ?   ?   ?   C . n 
C 3 253 VAL 253 253 ?   ?   ?   C . n 
C 3 254 MET 254 254 ?   ?   ?   C . n 
C 3 255 VAL 255 255 ?   ?   ?   C . n 
C 3 256 TYR 256 256 ?   ?   ?   C . n 
C 3 257 SER 257 257 ?   ?   ?   C . n 
C 3 258 ALA 258 258 ?   ?   ?   C . n 
C 3 259 LEU 259 259 ?   ?   ?   C . n 
C 3 260 ARG 260 260 ?   ?   ?   C . n 
C 3 261 ILE 261 261 ?   ?   ?   C . n 
C 3 262 PRO 262 262 ?   ?   ?   C . n 
C 3 263 PRO 263 263 ?   ?   ?   C . n 
C 3 264 GLU 264 264 ?   ?   ?   C . n 
C 3 265 ASP 265 265 ?   ?   ?   C . n 
D 4 1   MET 1   1   ?   ?   ?   D . n 
D 4 2   ASN 2   2   2   ASN ASN D . n 
D 4 3   LEU 3   3   3   LEU LEU D . n 
D 4 4   GLU 4   4   4   GLU GLU D . n 
D 4 5   ARG 5   5   5   ARG ARG D . n 
D 4 6   VAL 6   6   6   VAL VAL D . n 
D 4 7   SER 7   7   7   SER SER D . n 
D 4 8   ASN 8   8   8   ASN ASN D . n 
D 4 9   GLU 9   9   9   GLU GLU D . n 
D 4 10  GLU 10  10  10  GLU GLU D . n 
D 4 11  LYS 11  11  11  LYS LYS D . n 
D 4 12  LEU 12  12  12  LEU LEU D . n 
D 4 13  ASN 13  13  13  ASN ASN D . n 
D 4 14  LEU 14  14  14  LEU LEU D . n 
D 4 15  CYS 15  15  15  CYS CYS D . n 
D 4 16  ARG 16  16  16  ARG ARG D . n 
D 4 17  LYS 17  17  17  LYS LYS D . n 
D 4 18  TYR 18  18  18  TYR TYR D . n 
D 4 19  TYR 19  19  19  TYR TYR D . n 
D 4 20  LEU 20  20  20  LEU LEU D . n 
D 4 21  GLY 21  21  21  GLY GLY D . n 
D 4 22  GLY 22  22  22  GLY GLY D . n 
D 4 23  PHE 23  23  23  PHE PHE D . n 
D 4 24  ALA 24  24  24  ALA ALA D . n 
D 4 25  PHE 25  25  25  PHE PHE D . n 
D 4 26  LEU 26  26  26  LEU LEU D . n 
D 4 27  PRO 27  27  27  PRO PRO D . n 
D 4 28  PHE 28  28  28  PHE PHE D . n 
D 4 29  LEU 29  29  29  LEU LEU D . n 
D 4 30  TRP 30  30  30  TRP TRP D . n 
D 4 31  LEU 31  31  31  LEU LEU D . n 
D 4 32  VAL 32  32  32  VAL VAL D . n 
D 4 33  ASN 33  33  33  ASN ASN D . n 
D 4 34  ILE 34  34  34  ILE ILE D . n 
D 4 35  PHE 35  35  35  PHE PHE D . n 
D 4 36  TRP 36  36  36  TRP TRP D . n 
D 4 37  PHE 37  37  37  PHE PHE D . n 
D 4 38  PHE 38  38  38  PHE PHE D . n 
D 4 39  ARG 39  39  39  ARG ARG D . n 
D 4 40  GLU 40  40  40  GLU GLU D . n 
D 4 41  ALA 41  41  41  ALA ALA D . n 
D 4 42  PHE 42  42  42  PHE PHE D . n 
D 4 43  LEU 43  43  43  LEU LEU D . n 
D 4 44  VAL 44  44  44  VAL VAL D . n 
D 4 45  PRO 45  45  45  PRO PRO D . n 
D 4 46  ALA 46  46  46  ALA ALA D . n 
D 4 47  TYR 47  47  47  TYR TYR D . n 
D 4 48  THR 48  48  48  THR THR D . n 
D 4 49  GLU 49  49  49  GLU GLU D . n 
D 4 50  GLN 50  50  50  GLN GLN D . n 
D 4 51  SER 51  51  51  SER SER D . n 
D 4 52  GLN 52  52  52  GLN GLN D . n 
D 4 53  ILE 53  53  53  ILE ILE D . n 
D 4 54  LYS 54  54  54  LYS LYS D . n 
D 4 55  GLY 55  55  55  GLY GLY D . n 
D 4 56  TYR 56  56  56  TYR TYR D . n 
D 4 57  VAL 57  57  57  VAL VAL D . n 
D 4 58  TRP 58  58  58  TRP TRP D . n 
D 4 59  ARG 59  59  59  ARG ARG D . n 
D 4 60  SER 60  60  60  SER SER D . n 
D 4 61  ALA 61  61  61  ALA ALA D . n 
D 4 62  VAL 62  62  62  VAL VAL D . n 
D 4 63  GLY 63  63  63  GLY GLY D . n 
D 4 64  PHE 64  64  64  PHE PHE D . n 
D 4 65  LEU 65  65  65  LEU LEU D . n 
D 4 66  PHE 66  66  66  PHE PHE D . n 
D 4 67  TRP 67  67  67  TRP TRP D . n 
D 4 68  VAL 68  68  68  VAL VAL D . n 
D 4 69  ILE 69  69  69  ILE ILE D . n 
D 4 70  VAL 70  70  70  VAL VAL D . n 
D 4 71  LEU 71  71  71  LEU LEU D . n 
D 4 72  THR 72  72  72  THR THR D . n 
D 4 73  SER 73  73  73  SER SER D . n 
D 4 74  TRP 74  74  74  TRP TRP D . n 
D 4 75  ILE 75  75  75  ILE ILE D . n 
D 4 76  THR 76  76  76  THR THR D . n 
D 4 77  ILE 77  77  77  ILE ILE D . n 
D 4 78  PHE 78  78  78  PHE PHE D . n 
D 4 79  GLN 79  79  79  GLN GLN D . n 
D 4 80  ILE 80  80  80  ILE ILE D . n 
D 4 81  TYR 81  81  81  TYR TYR D . n 
D 4 82  ARG 82  82  82  ARG ARG D . n 
D 4 83  PRO 83  83  83  PRO PRO D . n 
D 4 84  ARG 84  84  84  ARG ARG D . n 
D 4 85  TRP 85  85  85  TRP TRP D . n 
D 4 86  GLY 86  86  86  GLY GLY D . n 
D 4 87  ALA 87  87  87  ALA ALA D . n 
D 4 88  LEU 88  88  88  LEU LEU D . n 
D 4 89  GLY 89  89  89  GLY GLY D . n 
D 4 90  ASP 90  90  90  ASP ASP D . n 
D 4 91  TYR 91  91  91  TYR TYR D . n 
D 4 92  LEU 92  92  92  LEU LEU D . n 
D 4 93  SER 93  93  93  SER SER D . n 
D 4 94  PHE 94  94  94  PHE PHE D . n 
D 4 95  THR 95  95  95  THR THR D . n 
D 4 96  ILE 96  96  96  ILE ILE D . n 
D 4 97  PRO 97  97  97  PRO PRO D . n 
D 4 98  LEU 98  98  98  LEU LEU D . n 
D 4 99  GLY 99  99  99  GLY GLY D . n 
D 4 100 THR 100 100 100 THR THR D . n 
D 4 101 PRO 101 101 101 PRO PRO D . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-12-16 
2 'Structure model' 1 1 2016-12-21 
3 'Structure model' 1 2 2019-09-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Data collection'     
3 3 'Structure model' 'Database references' 
4 3 'Structure model' 'Source and taxonomy' 
5 3 'Structure model' 'Structure summary'   
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' entity          
2 3 'Structure model' entity_name_com 
3 3 'Structure model' entity_src_gen  
4 3 'Structure model' struct_ref      
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_entity.pdbx_description'                      
2 3 'Structure model' '_entity_src_gen.gene_src_common_name'          
3 3 'Structure model' '_entity_src_gen.pdbx_beg_seq_num'              
4 3 'Structure model' '_entity_src_gen.pdbx_end_seq_num'              
5 3 'Structure model' '_entity_src_gen.pdbx_gene_src_gene'            
6 3 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name' 
7 3 'Structure model' '_entity_src_gen.pdbx_seq_type'                 
8 3 'Structure model' '_struct_ref.pdbx_align_begin'                  
9 3 'Structure model' '_struct_ref.pdbx_seq_one_letter_code'          
# 
_em_3d_reconstruction.entry_id                    5FN2 
_em_3d_reconstruction.id                          1 
_em_3d_reconstruction.resolution_method           'FSC 0.143 CUT-OFF' 
_em_3d_reconstruction.refinement_type             'HALF-MAPS REFINED INDEPENDENTLY' 
_em_3d_reconstruction.resolution                  4.2 
_em_3d_reconstruction.symmetry_type               POINT 
_em_3d_reconstruction.num_particles               51366 
_em_3d_reconstruction.image_processing_id         1 
_em_3d_reconstruction.method                      ? 
_em_3d_reconstruction.algorithm                   ? 
_em_3d_reconstruction.nominal_pixel_size          ? 
_em_3d_reconstruction.actual_pixel_size           ? 
_em_3d_reconstruction.num_class_averages          ? 
_em_3d_reconstruction.magnification_calibration   ? 
_em_3d_reconstruction.details                     ? 
# 
_em_buffer.id            1 
_em_buffer.specimen_id   1 
_em_buffer.name          '25 MM HEPES, PH 7.4, 150 MM NACL AND AMPHIPOL A8-35' 
_em_buffer.pH            7.4 
_em_buffer.details       '25 MM HEPES, PH 7.4, 150 MM NACL AND AMPHIPOL A8-35' 
# 
_em_entity_assembly.id                   1 
_em_entity_assembly.name                 'GAMMA SECRETASE' 
_em_entity_assembly.type                 COMPLEX 
_em_entity_assembly.parent_id            0 
_em_entity_assembly.synonym              ? 
_em_entity_assembly.details              ? 
_em_entity_assembly.oligomeric_details   ? 
# 
_em_image_scans.entry_id                5FN2 
_em_image_scans.id                      1 
_em_image_scans.image_recording_id      1 
_em_image_scans.number_digital_images   2000 
_em_image_scans.citation_id             ? 
_em_image_scans.od_range                ? 
_em_image_scans.quant_bit_size          ? 
_em_image_scans.sampling_size           ? 
_em_image_scans.scanner_model           ? 
_em_image_scans.details                 ? 
# 
_em_imaging.entry_id                        5FN2 
_em_imaging.id                              1 
_em_imaging.microscope_model                'FEI TITAN KRIOS' 
_em_imaging.specimen_id                     1 
_em_imaging.date                            2014-12-31 
_em_imaging.temperature                     85 
_em_imaging.nominal_defocus_min             800 
_em_imaging.nominal_defocus_max             2700 
_em_imaging.tilt_angle_min                  ? 
_em_imaging.tilt_angle_max                  ? 
_em_imaging.nominal_cs                      2 
_em_imaging.mode                            'BRIGHT FIELD' 
_em_imaging.illumination_mode               'FLOOD BEAM' 
_em_imaging.nominal_magnification           81000 
_em_imaging.calibrated_magnification        35714 
_em_imaging.electron_source                 'FIELD EMISSION GUN' 
_em_imaging.accelerating_voltage            300 
_em_imaging.details                         ? 
_em_imaging.specimen_holder_type            . 
_em_imaging.specimen_holder_model           . 
_em_imaging.citation_id                     ? 
_em_imaging.astigmatism                     ? 
_em_imaging.detector_distance               ? 
_em_imaging.electron_beam_tilt_params       ? 
_em_imaging.recording_temperature_maximum   ? 
_em_imaging.recording_temperature_minimum   ? 
# 
_em_sample_support.id               1 
_em_sample_support.specimen_id      1 
_em_sample_support.details          'HOLEY CARBON' 
_em_sample_support.method           ? 
_em_sample_support.film_material    ? 
_em_sample_support.grid_material    ? 
_em_sample_support.grid_mesh_size   ? 
_em_sample_support.grid_type        ? 
# 
_em_vitrification.entry_id              5FN2 
_em_vitrification.id                    1 
_em_vitrification.instrument            'FEI VITROBOT MARK IV' 
_em_vitrification.cryogen_name          ETHANE 
_em_vitrification.specimen_id           1 
_em_vitrification.details               'LIQUID ETHANE' 
_em_vitrification.citation_id           ? 
_em_vitrification.humidity              ? 
_em_vitrification.method                ? 
_em_vitrification.temp                  ? 
_em_vitrification.time_resolved_state   ? 
# 
_em_experiment.entry_id                5FN2 
_em_experiment.id                      1 
_em_experiment.aggregation_state       PARTICLE 
_em_experiment.entity_assembly_id      1 
_em_experiment.reconstruction_method   'SINGLE PARTICLE' 
# 
_em_single_particle_entity.entry_id              5FN2 
_em_single_particle_entity.id                    1 
_em_single_particle_entity.point_symmetry        C1 
_em_single_particle_entity.image_processing_id   1 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   B CYS 263 ? ? N   B GLY 266 ? ? 1.89 
2 1 CD2 B LEU 113 ? ? O   B TYR 240 ? ? 2.00 
3 1 O   B ILE 114 ? ? CD  B PRO 117 ? ? 2.06 
4 1 ND1 B HIS 163 ? ? OE1 B GLU 280 ? ? 2.11 
5 1 O   B CYS 263 ? ? CD  B PRO 267 ? ? 2.15 
6 1 O   C ILE 34  ? ? OH  C TYR 90  ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C  A ASN 91  ? ? N  A PRO 92  ? ? CA  A PRO 92  ? ? 132.33 119.30 13.03 1.50 Y 
2 1 CB A PHE 218 ? ? CG A PHE 218 ? ? CD2 A PHE 218 ? ? 116.34 120.80 -4.46 0.70 N 
3 1 CB A PHE 218 ? ? CG A PHE 218 ? ? CD1 A PHE 218 ? ? 126.33 120.80 5.53  0.70 N 
4 1 CB B CYS 158 ? ? CA B CYS 158 ? ? C   B CYS 158 ? ? 119.31 111.50 7.81  1.20 N 
5 1 CA C CYS 182 ? ? CB C CYS 182 ? ? SG  C CYS 182 ? ? 121.54 114.20 7.34  1.10 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 ILE A 40  ? ? -80.16  -71.47  
2   1 ASN A 45  ? ? -96.65  -62.67  
3   1 GLN A 63  ? ? 178.51  102.03  
4   1 SER A 67  ? ? 86.96   3.39    
5   1 GLU A 77  ? ? -103.90 -60.46  
6   1 ASP A 88  ? ? -90.03  -63.89  
7   1 SER A 129 ? ? 75.43   156.47  
8   1 ASN A 142 ? ? 49.55   29.32   
9   1 TYR A 148 ? ? -69.01  82.98   
10  1 CYS A 159 ? ? 18.50   57.24   
11  1 GLN A 163 ? ? 67.35   96.61   
12  1 LEU A 167 ? ? -101.45 67.57   
13  1 TYR A 173 ? ? -112.63 63.08   
14  1 ASP A 185 ? ? 76.67   146.90  
15  1 HIS A 199 ? ? -144.65 -62.31  
16  1 SER A 206 ? ? -97.43  -97.42  
17  1 ILE A 225 ? ? 64.22   -67.10  
18  1 CYS A 248 ? ? 63.22   123.86  
19  1 ASP A 253 ? ? -160.03 -118.84 
20  1 THR A 265 ? ? 67.31   -64.82  
21  1 TRP A 289 ? ? -43.52  -86.47  
22  1 ASN A 290 ? ? -101.25 66.41   
23  1 VAL A 291 ? ? -141.61 57.41   
24  1 ALA A 292 ? ? -115.30 68.33   
25  1 ALA A 298 ? ? -134.19 -57.20  
26  1 VAL A 318 ? ? -133.19 -62.88  
27  1 GLU A 333 ? ? 33.19   -72.28  
28  1 ASP A 336 ? ? -58.47  77.65   
29  1 PHE A 352 ? ? 174.17  141.25  
30  1 ASN A 358 ? ? -76.11  -131.25 
31  1 VAL A 359 ? ? 57.89   72.04   
32  1 ASP A 360 ? ? -61.65  -72.71  
33  1 LEU A 365 ? ? -110.42 76.50   
34  1 GLN A 367 ? ? 68.49   107.65  
35  1 LEU A 370 ? ? -83.22  -72.84  
36  1 ARG A 371 ? ? 63.04   109.86  
37  1 SER A 373 ? ? -99.94  48.80   
38  1 LEU A 374 ? ? 59.67   17.18   
39  1 GLN A 418 ? ? 67.97   -167.27 
40  1 LEU A 422 ? ? 118.11  131.50  
41  1 PRO A 424 ? ? -67.05  97.93   
42  1 ILE A 436 ? ? 69.59   130.45  
43  1 SER A 445 ? ? -69.02  -76.58  
44  1 LYS A 451 ? ? 63.55   -41.36  
45  1 TYR A 452 ? ? -110.51 69.23   
46  1 GLN A 454 ? ? 37.08   64.79   
47  1 ASP A 458 ? ? -68.43  63.64   
48  1 THR A 459 ? ? -102.86 -104.92 
49  1 ASN A 464 ? ? 83.05   9.31    
50  1 SER A 472 ? ? 179.60  -56.66  
51  1 GLU A 475 ? ? -6.21   -54.70  
52  1 THR A 505 ? ? -108.71 -71.48  
53  1 VAL A 511 ? ? -48.35  94.89   
54  1 ASN A 530 ? ? -63.15  79.63   
55  1 ARG A 543 ? ? -32.11  -30.94  
56  1 HIS A 553 ? ? -92.50  53.89   
57  1 SER A 558 ? ? -7.25   -75.98  
58  1 SER A 559 ? ? 63.97   122.88  
59  1 THR A 561 ? ? 95.85   153.87  
60  1 GLU A 595 ? ? 69.49   117.13  
61  1 ASN A 612 ? ? 68.52   -74.96  
62  1 LEU A 617 ? ? -117.60 73.83   
63  1 ALA A 630 ? ? -103.97 -90.48  
64  1 LEU A 631 ? ? 53.27   10.74   
65  1 SER A 632 ? ? 60.82   -172.95 
66  1 TRP A 640 ? ? 70.44   -81.78  
67  1 SER A 642 ? ? -172.72 102.71  
68  1 THR A 643 ? ? -65.43  -167.21 
69  1 GLU A 644 ? ? 42.61   29.44   
70  1 TYR A 645 ? ? -150.49 -33.16  
71  1 SER A 646 ? ? 122.37  106.32  
72  1 THR A 647 ? ? -102.95 64.20   
73  1 ASP A 655 ? ? 38.56   78.48   
74  1 SER B 104 ? ? -75.50  -135.30 
75  1 PHE B 105 ? ? 55.63   -73.22  
76  1 LYS B 109 ? ? 74.10   93.51   
77  1 LEU B 113 ? ? 82.27   -177.67 
78  1 THR B 119 ? ? 64.89   -173.34 
79  1 THR B 122 ? ? 158.15  -64.20  
80  1 TYR B 156 ? ? -159.75 -143.67 
81  1 CYS B 158 ? ? 77.77   -144.39 
82  1 TYR B 159 ? ? -69.96  -159.91 
83  1 LYS B 160 ? ? -23.81  -37.24  
84  1 TRP B 215 ? ? -104.63 42.29   
85  1 LYS B 216 ? ? 86.61   -113.55 
86  1 ALA B 231 ? ? -57.92  -75.96  
87  1 CYS B 263 ? ? -114.69 -87.81  
88  1 GLN B 276 ? ? -167.47 -133.64 
89  1 PHE B 283 ? ? -116.86 66.25   
90  1 LEU B 286 ? ? 79.13   142.11  
91  1 ILE B 287 ? ? -127.27 -164.17 
92  1 ASP B 403 ? ? 64.94   -96.20  
93  1 PHE B 428 ? ? -99.93  -65.38  
94  1 LYS B 429 ? ? 78.94   42.61   
95  1 LYS B 430 ? ? -78.96  -83.40  
96  1 ALA B 431 ? ? -168.31 46.64   
97  1 TYR B 446 ? ? -54.90  -75.83  
98  1 LEU B 452 ? ? -120.39 -53.98  
99  1 GLN B 464 ? ? 98.00   -7.59   
100 1 ALA C 26  ? ? -29.16  -49.38  
101 1 ASP C 61  ? ? 86.82   149.18  
102 1 SER C 63  ? ? -148.80 -69.93  
103 1 LEU C 104 ? ? -70.38  -79.35  
104 1 ASP C 107 ? ? 71.83   113.74  
105 1 ILE C 112 ? ? -148.06 -36.12  
106 1 SER C 113 ? ? 76.75   134.08  
107 1 VAL C 146 ? ? -173.69 149.16  
108 1 TYR C 156 ? ? -12.14  -60.19  
109 1 ALA C 212 ? ? -105.46 65.35   
110 1 SER C 213 ? ? -149.35 -77.67  
111 1 SER C 235 ? ? -144.86 -108.40 
112 1 SER C 242 ? ? -29.82  -48.61  
113 1 LEU C 243 ? ? -26.40  -57.79  
114 1 PHE D 25  ? ? 67.33   70.33   
115 1 PRO D 27  ? ? -39.48  -35.43  
116 1 PRO D 97  ? ? -68.61  93.61   
117 1 LEU D 98  ? ? -29.43  -72.86  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 ASN A 91  ? ? PRO A 92  ? ? -146.34 
2 1 LEU A 251 ? ? SER A 252 ? ? -148.68 
3 1 VAL A 256 ? ? TRP A 257 ? ? -144.83 
4 1 PHE A 288 ? ? TRP A 289 ? ? -145.68 
5 1 PHE A 335 ? ? ASP A 336 ? ? -144.79 
6 1 CYS B 263 ? ? PRO B 264 ? ? -123.15 
7 1 GLY B 402 ? ? ASP B 403 ? ? 148.79  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 B ILE 114 ? CG1 ? B ILE 114 CG1 
2  1 Y 1 B ILE 114 ? CG2 ? B ILE 114 CG2 
3  1 Y 1 B ILE 114 ? CD1 ? B ILE 114 CD1 
4  1 Y 1 B GLU 120 ? CG  ? B GLU 120 CG  
5  1 Y 1 B GLU 120 ? CD  ? B GLU 120 CD  
6  1 Y 1 B GLU 120 ? OE1 ? B GLU 120 OE1 
7  1 Y 1 B GLU 120 ? OE2 ? B GLU 120 OE2 
8  1 Y 1 B ASP 121 ? CG  ? B ASP 121 CG  
9  1 Y 1 B ASP 121 ? OD1 ? B ASP 121 OD1 
10 1 Y 1 B ASP 121 ? OD2 ? B ASP 121 OD2 
11 1 Y 1 B GLU 123 ? CG  ? B GLU 123 CG  
12 1 Y 1 B GLU 123 ? CD  ? B GLU 123 CD  
13 1 Y 1 B GLU 123 ? OE1 ? B GLU 123 OE1 
14 1 Y 1 B GLU 123 ? OE2 ? B GLU 123 OE2 
15 1 Y 1 B ARG 128 ? CG  ? B ARG 128 CG  
16 1 Y 1 B ARG 128 ? CD  ? B ARG 128 CD  
17 1 Y 1 B ARG 128 ? NE  ? B ARG 128 NE  
18 1 Y 1 B ARG 128 ? CZ  ? B ARG 128 CZ  
19 1 Y 1 B ARG 128 ? NH1 ? B ARG 128 NH1 
20 1 Y 1 B ARG 128 ? NH2 ? B ARG 128 NH2 
21 1 Y 1 B GLU 243 ? CG  ? B GLU 243 CG  
22 1 Y 1 B GLU 243 ? CD  ? B GLU 243 CD  
23 1 Y 1 B GLU 243 ? OE1 ? B GLU 243 OE1 
24 1 Y 1 B GLU 243 ? OE2 ? B GLU 243 OE2 
25 1 Y 1 B GLN 276 ? CG  ? B GLN 276 CG  
26 1 Y 1 B GLN 276 ? CD  ? B GLN 276 CD  
27 1 Y 1 B GLN 276 ? OE1 ? B GLN 276 OE1 
28 1 Y 1 B GLN 276 ? NE2 ? B GLN 276 NE2 
29 1 Y 1 B GLU 277 ? CG  ? B GLU 277 CG  
30 1 Y 1 B GLU 277 ? CD  ? B GLU 277 CD  
31 1 Y 1 B GLU 277 ? OE1 ? B GLU 277 OE1 
32 1 Y 1 B GLU 277 ? OE2 ? B GLU 277 OE2 
33 1 Y 1 B ARG 278 ? CG  ? B ARG 278 CG  
34 1 Y 1 B ARG 278 ? CD  ? B ARG 278 CD  
35 1 Y 1 B ARG 278 ? NE  ? B ARG 278 NE  
36 1 Y 1 B ARG 278 ? CZ  ? B ARG 278 CZ  
37 1 Y 1 B ARG 278 ? NH1 ? B ARG 278 NH1 
38 1 Y 1 B ARG 278 ? NH2 ? B ARG 278 NH2 
39 1 Y 1 B TYR 288 ? CG  ? B TYR 288 CG  
40 1 Y 1 B TYR 288 ? CD1 ? B TYR 288 CD1 
41 1 Y 1 B TYR 288 ? CD2 ? B TYR 288 CD2 
42 1 Y 1 B TYR 288 ? CE1 ? B TYR 288 CE1 
43 1 Y 1 B TYR 288 ? CE2 ? B TYR 288 CE2 
44 1 Y 1 B TYR 288 ? CZ  ? B TYR 288 CZ  
45 1 Y 1 B TYR 288 ? OH  ? B TYR 288 OH  
46 1 Y 1 C GLU 106 ? CG  ? C GLU 106 CG  
47 1 Y 1 C GLU 106 ? CD  ? C GLU 106 CD  
48 1 Y 1 C GLU 106 ? OE1 ? C GLU 106 OE1 
49 1 Y 1 C GLU 106 ? OE2 ? C GLU 106 OE2 
50 1 Y 1 D ASN 2   ? CG  ? D ASN 2   CG  
51 1 Y 1 D ASN 2   ? OD1 ? D ASN 2   OD1 
52 1 Y 1 D ASN 2   ? ND2 ? D ASN 2   ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1   ? A MET 1   
2   1 Y 1 A ALA 2   ? A ALA 2   
3   1 Y 1 A THR 3   ? A THR 3   
4   1 Y 1 A ALA 4   ? A ALA 4   
5   1 Y 1 A GLY 5   ? A GLY 5   
6   1 Y 1 A GLY 6   ? A GLY 6   
7   1 Y 1 A GLY 7   ? A GLY 7   
8   1 Y 1 A SER 8   ? A SER 8   
9   1 Y 1 A GLY 9   ? A GLY 9   
10  1 Y 1 A ALA 10  ? A ALA 10  
11  1 Y 1 A ASP 11  ? A ASP 11  
12  1 Y 1 A PRO 12  ? A PRO 12  
13  1 Y 1 A GLY 13  ? A GLY 13  
14  1 Y 1 A SER 14  ? A SER 14  
15  1 Y 1 A ARG 15  ? A ARG 15  
16  1 Y 1 A GLY 16  ? A GLY 16  
17  1 Y 1 A LEU 17  ? A LEU 17  
18  1 Y 1 A LEU 18  ? A LEU 18  
19  1 Y 1 A ARG 19  ? A ARG 19  
20  1 Y 1 A LEU 20  ? A LEU 20  
21  1 Y 1 A LEU 21  ? A LEU 21  
22  1 Y 1 A SER 22  ? A SER 22  
23  1 Y 1 A PHE 23  ? A PHE 23  
24  1 Y 1 A CYS 24  ? A CYS 24  
25  1 Y 1 A VAL 25  ? A VAL 25  
26  1 Y 1 A LEU 26  ? A LEU 26  
27  1 Y 1 A LEU 27  ? A LEU 27  
28  1 Y 1 A ALA 28  ? A ALA 28  
29  1 Y 1 A GLY 29  ? A GLY 29  
30  1 Y 1 A LEU 30  ? A LEU 30  
31  1 Y 1 A CYS 31  ? A CYS 31  
32  1 Y 1 A ARG 32  ? A ARG 32  
33  1 Y 1 A GLY 33  ? A GLY 33  
34  1 Y 1 A ILE 699 ? A ILE 699 
35  1 Y 1 A ALA 700 ? A ALA 700 
36  1 Y 1 A PRO 701 ? A PRO 701 
37  1 Y 1 A ARG 702 ? A ARG 702 
38  1 Y 1 A GLU 703 ? A GLU 703 
39  1 Y 1 A PRO 704 ? A PRO 704 
40  1 Y 1 A GLY 705 ? A GLY 705 
41  1 Y 1 A ALA 706 ? A ALA 706 
42  1 Y 1 A VAL 707 ? A VAL 707 
43  1 Y 1 A SER 708 ? A SER 708 
44  1 Y 1 A TYR 709 ? A TYR 709 
45  1 Y 1 B MET 1   ? B MET 1   
46  1 Y 1 B THR 2   ? B THR 2   
47  1 Y 1 B GLU 3   ? B GLU 3   
48  1 Y 1 B LEU 4   ? B LEU 4   
49  1 Y 1 B PRO 5   ? B PRO 5   
50  1 Y 1 B ALA 6   ? B ALA 6   
51  1 Y 1 B PRO 7   ? B PRO 7   
52  1 Y 1 B LEU 8   ? B LEU 8   
53  1 Y 1 B SER 9   ? B SER 9   
54  1 Y 1 B TYR 10  ? B TYR 10  
55  1 Y 1 B PHE 11  ? B PHE 11  
56  1 Y 1 B GLN 12  ? B GLN 12  
57  1 Y 1 B ASN 13  ? B ASN 13  
58  1 Y 1 B ALA 14  ? B ALA 14  
59  1 Y 1 B GLN 15  ? B GLN 15  
60  1 Y 1 B MET 16  ? B MET 16  
61  1 Y 1 B SER 17  ? B SER 17  
62  1 Y 1 B GLU 18  ? B GLU 18  
63  1 Y 1 B ASP 19  ? B ASP 19  
64  1 Y 1 B ASN 20  ? B ASN 20  
65  1 Y 1 B HIS 21  ? B HIS 21  
66  1 Y 1 B LEU 22  ? B LEU 22  
67  1 Y 1 B SER 23  ? B SER 23  
68  1 Y 1 B ASN 24  ? B ASN 24  
69  1 Y 1 B THR 25  ? B THR 25  
70  1 Y 1 B VAL 26  ? B VAL 26  
71  1 Y 1 B ARG 27  ? B ARG 27  
72  1 Y 1 B SER 28  ? B SER 28  
73  1 Y 1 B GLN 29  ? B GLN 29  
74  1 Y 1 B ASN 30  ? B ASN 30  
75  1 Y 1 B ASP 31  ? B ASP 31  
76  1 Y 1 B ASN 32  ? B ASN 32  
77  1 Y 1 B ARG 33  ? B ARG 33  
78  1 Y 1 B GLU 34  ? B GLU 34  
79  1 Y 1 B ARG 35  ? B ARG 35  
80  1 Y 1 B GLN 36  ? B GLN 36  
81  1 Y 1 B GLU 37  ? B GLU 37  
82  1 Y 1 B HIS 38  ? B HIS 38  
83  1 Y 1 B ASN 39  ? B ASN 39  
84  1 Y 1 B ASP 40  ? B ASP 40  
85  1 Y 1 B ARG 41  ? B ARG 41  
86  1 Y 1 B ARG 42  ? B ARG 42  
87  1 Y 1 B SER 43  ? B SER 43  
88  1 Y 1 B LEU 44  ? B LEU 44  
89  1 Y 1 B GLY 45  ? B GLY 45  
90  1 Y 1 B HIS 46  ? B HIS 46  
91  1 Y 1 B PRO 47  ? B PRO 47  
92  1 Y 1 B GLU 48  ? B GLU 48  
93  1 Y 1 B PRO 49  ? B PRO 49  
94  1 Y 1 B LEU 50  ? B LEU 50  
95  1 Y 1 B SER 51  ? B SER 51  
96  1 Y 1 B ASN 52  ? B ASN 52  
97  1 Y 1 B GLY 53  ? B GLY 53  
98  1 Y 1 B ARG 54  ? B ARG 54  
99  1 Y 1 B PRO 55  ? B PRO 55  
100 1 Y 1 B GLN 56  ? B GLN 56  
101 1 Y 1 B GLY 57  ? B GLY 57  
102 1 Y 1 B ASN 58  ? B ASN 58  
103 1 Y 1 B SER 59  ? B SER 59  
104 1 Y 1 B ARG 60  ? B ARG 60  
105 1 Y 1 B GLN 61  ? B GLN 61  
106 1 Y 1 B VAL 62  ? B VAL 62  
107 1 Y 1 B VAL 63  ? B VAL 63  
108 1 Y 1 B GLU 64  ? B GLU 64  
109 1 Y 1 B GLN 65  ? B GLN 65  
110 1 Y 1 B ASP 66  ? B ASP 66  
111 1 Y 1 B GLU 67  ? B GLU 67  
112 1 Y 1 B GLU 68  ? B GLU 68  
113 1 Y 1 B GLU 69  ? B GLU 69  
114 1 Y 1 B ASP 70  ? B ASP 70  
115 1 Y 1 B GLU 71  ? B GLU 71  
116 1 Y 1 B GLU 72  ? B GLU 72  
117 1 Y 1 B LEU 73  ? B LEU 73  
118 1 Y 1 B THR 74  ? B THR 74  
119 1 Y 1 B LEU 75  ? B LEU 75  
120 1 Y 1 B LYS 76  ? B LYS 76  
121 1 Y 1 B TYR 77  ? B TYR 77  
122 1 Y 1 B SER 289 ? B SER 289 
123 1 Y 1 B SER 290 ? B SER 290 
124 1 Y 1 B THR 291 ? B THR 291 
125 1 Y 1 B MET 292 ? B MET 292 
126 1 Y 1 B VAL 293 ? B VAL 293 
127 1 Y 1 B TRP 294 ? B TRP 294 
128 1 Y 1 B LEU 295 ? B LEU 295 
129 1 Y 1 B VAL 296 ? B VAL 296 
130 1 Y 1 B ASN 297 ? B ASN 297 
131 1 Y 1 B MET 298 ? B MET 298 
132 1 Y 1 B ALA 299 ? B ALA 299 
133 1 Y 1 B GLU 300 ? B GLU 300 
134 1 Y 1 B GLY 301 ? B GLY 301 
135 1 Y 1 B ASP 302 ? B ASP 302 
136 1 Y 1 B PRO 303 ? B PRO 303 
137 1 Y 1 B GLU 304 ? B GLU 304 
138 1 Y 1 B ALA 305 ? B ALA 305 
139 1 Y 1 B GLN 306 ? B GLN 306 
140 1 Y 1 B ARG 307 ? B ARG 307 
141 1 Y 1 B ARG 308 ? B ARG 308 
142 1 Y 1 B VAL 309 ? B VAL 309 
143 1 Y 1 B SER 310 ? B SER 310 
144 1 Y 1 B LYS 311 ? B LYS 311 
145 1 Y 1 B ASN 312 ? B ASN 312 
146 1 Y 1 B SER 313 ? B SER 313 
147 1 Y 1 B LYS 314 ? B LYS 314 
148 1 Y 1 B TYR 315 ? B TYR 315 
149 1 Y 1 B ASN 316 ? B ASN 316 
150 1 Y 1 B ALA 317 ? B ALA 317 
151 1 Y 1 B GLU 318 ? B GLU 318 
152 1 Y 1 B SER 319 ? B SER 319 
153 1 Y 1 B THR 320 ? B THR 320 
154 1 Y 1 B GLU 321 ? B GLU 321 
155 1 Y 1 B ARG 322 ? B ARG 322 
156 1 Y 1 B GLU 323 ? B GLU 323 
157 1 Y 1 B SER 324 ? B SER 324 
158 1 Y 1 B GLN 325 ? B GLN 325 
159 1 Y 1 B ASP 326 ? B ASP 326 
160 1 Y 1 B THR 327 ? B THR 327 
161 1 Y 1 B VAL 328 ? B VAL 328 
162 1 Y 1 B ALA 329 ? B ALA 329 
163 1 Y 1 B GLU 330 ? B GLU 330 
164 1 Y 1 B ASN 331 ? B ASN 331 
165 1 Y 1 B ASP 332 ? B ASP 332 
166 1 Y 1 B ASP 333 ? B ASP 333 
167 1 Y 1 B GLY 334 ? B GLY 334 
168 1 Y 1 B GLY 335 ? B GLY 335 
169 1 Y 1 B PHE 336 ? B PHE 336 
170 1 Y 1 B SER 337 ? B SER 337 
171 1 Y 1 B GLU 338 ? B GLU 338 
172 1 Y 1 B GLU 339 ? B GLU 339 
173 1 Y 1 B TRP 340 ? B TRP 340 
174 1 Y 1 B GLU 341 ? B GLU 341 
175 1 Y 1 B ALA 342 ? B ALA 342 
176 1 Y 1 B GLN 343 ? B GLN 343 
177 1 Y 1 B ARG 344 ? B ARG 344 
178 1 Y 1 B ASP 345 ? B ASP 345 
179 1 Y 1 B SER 346 ? B SER 346 
180 1 Y 1 B HIS 347 ? B HIS 347 
181 1 Y 1 B LEU 348 ? B LEU 348 
182 1 Y 1 B GLY 349 ? B GLY 349 
183 1 Y 1 B PRO 350 ? B PRO 350 
184 1 Y 1 B HIS 351 ? B HIS 351 
185 1 Y 1 B ARG 352 ? B ARG 352 
186 1 Y 1 B SER 353 ? B SER 353 
187 1 Y 1 B THR 354 ? B THR 354 
188 1 Y 1 B PRO 355 ? B PRO 355 
189 1 Y 1 B GLU 356 ? B GLU 356 
190 1 Y 1 B SER 357 ? B SER 357 
191 1 Y 1 B ARG 358 ? B ARG 358 
192 1 Y 1 B ALA 359 ? B ALA 359 
193 1 Y 1 B ALA 360 ? B ALA 360 
194 1 Y 1 B VAL 361 ? B VAL 361 
195 1 Y 1 B GLN 362 ? B GLN 362 
196 1 Y 1 B GLU 363 ? B GLU 363 
197 1 Y 1 B LEU 364 ? B LEU 364 
198 1 Y 1 B SER 365 ? B SER 365 
199 1 Y 1 B SER 366 ? B SER 366 
200 1 Y 1 B SER 367 ? B SER 367 
201 1 Y 1 B ILE 368 ? B ILE 368 
202 1 Y 1 B LEU 369 ? B LEU 369 
203 1 Y 1 B ALA 370 ? B ALA 370 
204 1 Y 1 B GLY 371 ? B GLY 371 
205 1 Y 1 B GLU 372 ? B GLU 372 
206 1 Y 1 B ASP 373 ? B ASP 373 
207 1 Y 1 B PRO 374 ? B PRO 374 
208 1 Y 1 B GLU 375 ? B GLU 375 
209 1 Y 1 B GLU 376 ? B GLU 376 
210 1 Y 1 B ARG 377 ? B ARG 377 
211 1 Y 1 C MET 1   ? C MET 1   
212 1 Y 1 C CYS 245 ? C CYS 245 
213 1 Y 1 C ARG 246 ? C ARG 246 
214 1 Y 1 C ARG 247 ? C ARG 247 
215 1 Y 1 C GLN 248 ? C GLN 248 
216 1 Y 1 C GLU 249 ? C GLU 249 
217 1 Y 1 C ASP 250 ? C ASP 250 
218 1 Y 1 C SER 251 ? C SER 251 
219 1 Y 1 C ARG 252 ? C ARG 252 
220 1 Y 1 C VAL 253 ? C VAL 253 
221 1 Y 1 C MET 254 ? C MET 254 
222 1 Y 1 C VAL 255 ? C VAL 255 
223 1 Y 1 C TYR 256 ? C TYR 256 
224 1 Y 1 C SER 257 ? C SER 257 
225 1 Y 1 C ALA 258 ? C ALA 258 
226 1 Y 1 C LEU 259 ? C LEU 259 
227 1 Y 1 C ARG 260 ? C ARG 260 
228 1 Y 1 C ILE 261 ? C ILE 261 
229 1 Y 1 C PRO 262 ? C PRO 262 
230 1 Y 1 C PRO 263 ? C PRO 263 
231 1 Y 1 C GLU 264 ? C GLU 264 
232 1 Y 1 C ASP 265 ? C ASP 265 
233 1 Y 1 D MET 1   ? D MET 1   
# 
_em_image_processing.id                   1 
_em_image_processing.image_recording_id   1 
_em_image_processing.details              ? 
# 
_em_image_recording.avg_electron_dose_per_image   38 
_em_image_recording.details                       ? 
_em_image_recording.id                            1 
_em_image_recording.film_or_detector_model        'GATAN K2 QUANTUM (4k x 4k)' 
_em_image_recording.imaging_id                    1 
_em_image_recording.detector_mode                 ? 
_em_image_recording.average_exposure_time         ? 
_em_image_recording.num_diffraction_images        ? 
_em_image_recording.num_grids_imaged              ? 
_em_image_recording.num_real_images               ? 
# 
_em_specimen.experiment_id           1 
_em_specimen.id                      1 
_em_specimen.concentration           6 
_em_specimen.vitrification_applied   YES 
_em_specimen.staining_applied        NO 
_em_specimen.embedding_applied       NO 
_em_specimen.shadowing_applied       NO 
_em_specimen.details                 ? 
#