data_5FN3
# 
_entry.id   5FN3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.314 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5FN3         
PDBE  EBI-65494    
WWPDB D_1290065494 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB  5FN2     unspecified            'CRYO-EM STRUCTURE OF GAMMA SECRETASE IN COMPLEX WITH A DRUG DAPT'          
PDB  5FN4     unspecified            'CRYO-EM STRUCTURE OF GAMMA SECRETASE IN CLASS 2 OF THE APO-STATE ENSEMBLE' 
PDB  5FN5     unspecified            'CRYO-EM STRUCTURE OF GAMMA SECRETASE IN CLASS 3 OF THE APO-STATE ENSEMBLE' 
EMDB EMD-3238 'associated EM volume' .                                                                           
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        5FN3 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2015-11-10 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bai, X.C.'       1 
'Rajendra, E.'    2 
'Yang, G.H.'      3 
'Shi, Y.G.'       4 
'Scheres, S.H.W.' 5 
# 
_citation.id                        primary 
_citation.title                     'Sampling the conformational space of the catalytic subunit of human gamma-secretase.' 
_citation.journal_abbrev            Elife 
_citation.journal_volume            4 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      2015 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26623517 
_citation.pdbx_database_id_DOI      10.7554/eLife.11182 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bai, X.C.'     1 ? 
primary 'Rajendra, E.'  2 ? 
primary 'Yang, G.'      3 ? 
primary 'Shi, Y.'       4 ? 
primary 'Scheres, S.H.' 5 ? 
# 
_cell.entry_id           5FN3 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5FN3 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Nicastrin                        78483.570 1 ?        ? ? ? 
2 polymer man Presenilin-1                     52651.465 1 3.4.23.- ? ? ? 
3 polymer man 'Gamma-secretase subunit APH-1A' 29017.943 1 ?        ? ? ? 
4 polymer man 'Gamma-secretase subunit PEN-2'  12038.029 1 ?        ? ? ? 
5 polymer man 'POLY ALA CHAIN'                 1723.883  1 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
2 'PS-1,Protein S182'                                 
3 'APH-1a,Aph-1alpha,Presenilin-stabilization factor' 
4 'Presenilin enhancer protein 2'                     
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEE
DLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFSPSVQCPNDGFGVYSNSYGPEFAHCR
EIQWNSLGNGLAYEDFSFPIFLLEDENETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVISTATCMRRSSIQSTF
SINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALQKAPDVTT
LPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQVEDLLAT
LEKSGAGVPAVILRRPNQSQPLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFV
TDTAKALADVATVLGRALYELAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQDLRSYLGDGPLQHYIAVSSP
TNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLYEYSWVQGPLHSNETDRLPRCVRSTARLARALSPAFELSQW
SSTEYSTWTESRWKDIRARIFLIASKELELITLTVGFGILIFSLIVTYCINAKADVLFIAPREPGAVSY
;
;MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEE
DLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFSPSVQCPNDGFGVYSNSYGPEFAHCR
EIQWNSLGNGLAYEDFSFPIFLLEDENETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVISTATCMRRSSIQSTF
SINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALQKAPDVTT
LPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQVEDLLAT
LEKSGAGVPAVILRRPNQSQPLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFV
TDTAKALADVATVLGRALYELAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQDLRSYLGDGPLQHYIAVSSP
TNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLYEYSWVQGPLHSNETDRLPRCVRSTARLARALSPAFELSQW
SSTEYSTWTESRWKDIRARIFLIASKELELITLTVGFGILIFSLIVTYCINAKADVLFIAPREPGAVSY
;
A ? 
2 'polypeptide(L)' no no 
;MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQDEEEDEELTLKYGAK
HVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYK
VIHAWLIISSLLLLFFFSFIYLGEVFKTYNVAVDYITVALLIWNFGVVGMISIHWKGPLRLQQAYLIMISALMALVFIKY
LPEWTAWLILAVISVTDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAEGDPEAQRRVSKNSKYNAEST
ERESQDTVAENDDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSSSILAGEDPEERGVKLGLGDFIFYSVLVGKASATA
SGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI
;
;MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQDEEEDEELTLKYGAK
HVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYK
VIHAWLIISSLLLLFFFSFIYLGEVFKTYNVAVDYITVALLIWNFGVVGMISIHWKGPLRLQQAYLIMISALMALVFIKY
LPEWTAWLILAVISVTDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAEGDPEAQRRVSKNSKYNAEST
ERESQDTVAENDDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSSSILAGEDPEERGVKLGLGDFIFYSVLVGKASATA
SGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI
;
B ? 
3 'polypeptide(L)' no no 
;MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSV
LLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTS
AFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQ
RSLLCRRQEDSRVMVYSALRIPPED
;
;MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSV
LLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTS
AFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQ
RSLLCRRQEDSRVMVYSALRIPPED
;
C ? 
4 'polypeptide(L)' no no 
;MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQI
YRPRWGALGDYLSFTIPLGTP
;
;MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQI
YRPRWGALGDYLSFTIPLGTP
;
D ? 
5 'polypeptide(L)' no no AAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAA G ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   THR n 
1 4   ALA n 
1 5   GLY n 
1 6   GLY n 
1 7   GLY n 
1 8   SER n 
1 9   GLY n 
1 10  ALA n 
1 11  ASP n 
1 12  PRO n 
1 13  GLY n 
1 14  SER n 
1 15  ARG n 
1 16  GLY n 
1 17  LEU n 
1 18  LEU n 
1 19  ARG n 
1 20  LEU n 
1 21  LEU n 
1 22  SER n 
1 23  PHE n 
1 24  CYS n 
1 25  VAL n 
1 26  LEU n 
1 27  LEU n 
1 28  ALA n 
1 29  GLY n 
1 30  LEU n 
1 31  CYS n 
1 32  ARG n 
1 33  GLY n 
1 34  ASN n 
1 35  SER n 
1 36  VAL n 
1 37  GLU n 
1 38  ARG n 
1 39  LYS n 
1 40  ILE n 
1 41  TYR n 
1 42  ILE n 
1 43  PRO n 
1 44  LEU n 
1 45  ASN n 
1 46  LYS n 
1 47  THR n 
1 48  ALA n 
1 49  PRO n 
1 50  CYS n 
1 51  VAL n 
1 52  ARG n 
1 53  LEU n 
1 54  LEU n 
1 55  ASN n 
1 56  ALA n 
1 57  THR n 
1 58  HIS n 
1 59  GLN n 
1 60  ILE n 
1 61  GLY n 
1 62  CYS n 
1 63  GLN n 
1 64  SER n 
1 65  SER n 
1 66  ILE n 
1 67  SER n 
1 68  GLY n 
1 69  ASP n 
1 70  THR n 
1 71  GLY n 
1 72  VAL n 
1 73  ILE n 
1 74  HIS n 
1 75  VAL n 
1 76  VAL n 
1 77  GLU n 
1 78  LYS n 
1 79  GLU n 
1 80  GLU n 
1 81  ASP n 
1 82  LEU n 
1 83  GLN n 
1 84  TRP n 
1 85  VAL n 
1 86  LEU n 
1 87  THR n 
1 88  ASP n 
1 89  GLY n 
1 90  PRO n 
1 91  ASN n 
1 92  PRO n 
1 93  PRO n 
1 94  TYR n 
1 95  MET n 
1 96  VAL n 
1 97  LEU n 
1 98  LEU n 
1 99  GLU n 
1 100 SER n 
1 101 LYS n 
1 102 HIS n 
1 103 PHE n 
1 104 THR n 
1 105 ARG n 
1 106 ASP n 
1 107 LEU n 
1 108 MET n 
1 109 GLU n 
1 110 LYS n 
1 111 LEU n 
1 112 LYS n 
1 113 GLY n 
1 114 ARG n 
1 115 THR n 
1 116 SER n 
1 117 ARG n 
1 118 ILE n 
1 119 ALA n 
1 120 GLY n 
1 121 LEU n 
1 122 ALA n 
1 123 VAL n 
1 124 SER n 
1 125 LEU n 
1 126 THR n 
1 127 LYS n 
1 128 PRO n 
1 129 SER n 
1 130 PRO n 
1 131 ALA n 
1 132 SER n 
1 133 GLY n 
1 134 PHE n 
1 135 SER n 
1 136 PRO n 
1 137 SER n 
1 138 VAL n 
1 139 GLN n 
1 140 CYS n 
1 141 PRO n 
1 142 ASN n 
1 143 ASP n 
1 144 GLY n 
1 145 PHE n 
1 146 GLY n 
1 147 VAL n 
1 148 TYR n 
1 149 SER n 
1 150 ASN n 
1 151 SER n 
1 152 TYR n 
1 153 GLY n 
1 154 PRO n 
1 155 GLU n 
1 156 PHE n 
1 157 ALA n 
1 158 HIS n 
1 159 CYS n 
1 160 ARG n 
1 161 GLU n 
1 162 ILE n 
1 163 GLN n 
1 164 TRP n 
1 165 ASN n 
1 166 SER n 
1 167 LEU n 
1 168 GLY n 
1 169 ASN n 
1 170 GLY n 
1 171 LEU n 
1 172 ALA n 
1 173 TYR n 
1 174 GLU n 
1 175 ASP n 
1 176 PHE n 
1 177 SER n 
1 178 PHE n 
1 179 PRO n 
1 180 ILE n 
1 181 PHE n 
1 182 LEU n 
1 183 LEU n 
1 184 GLU n 
1 185 ASP n 
1 186 GLU n 
1 187 ASN n 
1 188 GLU n 
1 189 THR n 
1 190 LYS n 
1 191 VAL n 
1 192 ILE n 
1 193 LYS n 
1 194 GLN n 
1 195 CYS n 
1 196 TYR n 
1 197 GLN n 
1 198 ASP n 
1 199 HIS n 
1 200 ASN n 
1 201 LEU n 
1 202 SER n 
1 203 GLN n 
1 204 ASN n 
1 205 GLY n 
1 206 SER n 
1 207 ALA n 
1 208 PRO n 
1 209 THR n 
1 210 PHE n 
1 211 PRO n 
1 212 LEU n 
1 213 CYS n 
1 214 ALA n 
1 215 MET n 
1 216 GLN n 
1 217 LEU n 
1 218 PHE n 
1 219 SER n 
1 220 HIS n 
1 221 MET n 
1 222 HIS n 
1 223 ALA n 
1 224 VAL n 
1 225 ILE n 
1 226 SER n 
1 227 THR n 
1 228 ALA n 
1 229 THR n 
1 230 CYS n 
1 231 MET n 
1 232 ARG n 
1 233 ARG n 
1 234 SER n 
1 235 SER n 
1 236 ILE n 
1 237 GLN n 
1 238 SER n 
1 239 THR n 
1 240 PHE n 
1 241 SER n 
1 242 ILE n 
1 243 ASN n 
1 244 PRO n 
1 245 GLU n 
1 246 ILE n 
1 247 VAL n 
1 248 CYS n 
1 249 ASP n 
1 250 PRO n 
1 251 LEU n 
1 252 SER n 
1 253 ASP n 
1 254 TYR n 
1 255 ASN n 
1 256 VAL n 
1 257 TRP n 
1 258 SER n 
1 259 MET n 
1 260 LEU n 
1 261 LYS n 
1 262 PRO n 
1 263 ILE n 
1 264 ASN n 
1 265 THR n 
1 266 THR n 
1 267 GLY n 
1 268 THR n 
1 269 LEU n 
1 270 LYS n 
1 271 PRO n 
1 272 ASP n 
1 273 ASP n 
1 274 ARG n 
1 275 VAL n 
1 276 VAL n 
1 277 VAL n 
1 278 ALA n 
1 279 ALA n 
1 280 THR n 
1 281 ARG n 
1 282 LEU n 
1 283 ASP n 
1 284 SER n 
1 285 ARG n 
1 286 SER n 
1 287 PHE n 
1 288 PHE n 
1 289 TRP n 
1 290 ASN n 
1 291 VAL n 
1 292 ALA n 
1 293 PRO n 
1 294 GLY n 
1 295 ALA n 
1 296 GLU n 
1 297 SER n 
1 298 ALA n 
1 299 VAL n 
1 300 ALA n 
1 301 SER n 
1 302 PHE n 
1 303 VAL n 
1 304 THR n 
1 305 GLN n 
1 306 LEU n 
1 307 ALA n 
1 308 ALA n 
1 309 ALA n 
1 310 GLU n 
1 311 ALA n 
1 312 LEU n 
1 313 GLN n 
1 314 LYS n 
1 315 ALA n 
1 316 PRO n 
1 317 ASP n 
1 318 VAL n 
1 319 THR n 
1 320 THR n 
1 321 LEU n 
1 322 PRO n 
1 323 ARG n 
1 324 ASN n 
1 325 VAL n 
1 326 MET n 
1 327 PHE n 
1 328 VAL n 
1 329 PHE n 
1 330 PHE n 
1 331 GLN n 
1 332 GLY n 
1 333 GLU n 
1 334 THR n 
1 335 PHE n 
1 336 ASP n 
1 337 TYR n 
1 338 ILE n 
1 339 GLY n 
1 340 SER n 
1 341 SER n 
1 342 ARG n 
1 343 MET n 
1 344 VAL n 
1 345 TYR n 
1 346 ASP n 
1 347 MET n 
1 348 GLU n 
1 349 LYS n 
1 350 GLY n 
1 351 LYS n 
1 352 PHE n 
1 353 PRO n 
1 354 VAL n 
1 355 GLN n 
1 356 LEU n 
1 357 GLU n 
1 358 ASN n 
1 359 VAL n 
1 360 ASP n 
1 361 SER n 
1 362 PHE n 
1 363 VAL n 
1 364 GLU n 
1 365 LEU n 
1 366 GLY n 
1 367 GLN n 
1 368 VAL n 
1 369 ALA n 
1 370 LEU n 
1 371 ARG n 
1 372 THR n 
1 373 SER n 
1 374 LEU n 
1 375 GLU n 
1 376 LEU n 
1 377 TRP n 
1 378 MET n 
1 379 HIS n 
1 380 THR n 
1 381 ASP n 
1 382 PRO n 
1 383 VAL n 
1 384 SER n 
1 385 GLN n 
1 386 LYS n 
1 387 ASN n 
1 388 GLU n 
1 389 SER n 
1 390 VAL n 
1 391 ARG n 
1 392 ASN n 
1 393 GLN n 
1 394 VAL n 
1 395 GLU n 
1 396 ASP n 
1 397 LEU n 
1 398 LEU n 
1 399 ALA n 
1 400 THR n 
1 401 LEU n 
1 402 GLU n 
1 403 LYS n 
1 404 SER n 
1 405 GLY n 
1 406 ALA n 
1 407 GLY n 
1 408 VAL n 
1 409 PRO n 
1 410 ALA n 
1 411 VAL n 
1 412 ILE n 
1 413 LEU n 
1 414 ARG n 
1 415 ARG n 
1 416 PRO n 
1 417 ASN n 
1 418 GLN n 
1 419 SER n 
1 420 GLN n 
1 421 PRO n 
1 422 LEU n 
1 423 PRO n 
1 424 PRO n 
1 425 SER n 
1 426 SER n 
1 427 LEU n 
1 428 GLN n 
1 429 ARG n 
1 430 PHE n 
1 431 LEU n 
1 432 ARG n 
1 433 ALA n 
1 434 ARG n 
1 435 ASN n 
1 436 ILE n 
1 437 SER n 
1 438 GLY n 
1 439 VAL n 
1 440 VAL n 
1 441 LEU n 
1 442 ALA n 
1 443 ASP n 
1 444 HIS n 
1 445 SER n 
1 446 GLY n 
1 447 ALA n 
1 448 PHE n 
1 449 HIS n 
1 450 ASN n 
1 451 LYS n 
1 452 TYR n 
1 453 TYR n 
1 454 GLN n 
1 455 SER n 
1 456 ILE n 
1 457 TYR n 
1 458 ASP n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 ASN n 
1 463 ILE n 
1 464 ASN n 
1 465 VAL n 
1 466 SER n 
1 467 TYR n 
1 468 PRO n 
1 469 GLU n 
1 470 TRP n 
1 471 LEU n 
1 472 SER n 
1 473 PRO n 
1 474 GLU n 
1 475 GLU n 
1 476 ASP n 
1 477 LEU n 
1 478 ASN n 
1 479 PHE n 
1 480 VAL n 
1 481 THR n 
1 482 ASP n 
1 483 THR n 
1 484 ALA n 
1 485 LYS n 
1 486 ALA n 
1 487 LEU n 
1 488 ALA n 
1 489 ASP n 
1 490 VAL n 
1 491 ALA n 
1 492 THR n 
1 493 VAL n 
1 494 LEU n 
1 495 GLY n 
1 496 ARG n 
1 497 ALA n 
1 498 LEU n 
1 499 TYR n 
1 500 GLU n 
1 501 LEU n 
1 502 ALA n 
1 503 GLY n 
1 504 GLY n 
1 505 THR n 
1 506 ASN n 
1 507 PHE n 
1 508 SER n 
1 509 ASP n 
1 510 THR n 
1 511 VAL n 
1 512 GLN n 
1 513 ALA n 
1 514 ASP n 
1 515 PRO n 
1 516 GLN n 
1 517 THR n 
1 518 VAL n 
1 519 THR n 
1 520 ARG n 
1 521 LEU n 
1 522 LEU n 
1 523 TYR n 
1 524 GLY n 
1 525 PHE n 
1 526 LEU n 
1 527 ILE n 
1 528 LYS n 
1 529 ALA n 
1 530 ASN n 
1 531 ASN n 
1 532 SER n 
1 533 TRP n 
1 534 PHE n 
1 535 GLN n 
1 536 SER n 
1 537 ILE n 
1 538 LEU n 
1 539 ARG n 
1 540 GLN n 
1 541 ASP n 
1 542 LEU n 
1 543 ARG n 
1 544 SER n 
1 545 TYR n 
1 546 LEU n 
1 547 GLY n 
1 548 ASP n 
1 549 GLY n 
1 550 PRO n 
1 551 LEU n 
1 552 GLN n 
1 553 HIS n 
1 554 TYR n 
1 555 ILE n 
1 556 ALA n 
1 557 VAL n 
1 558 SER n 
1 559 SER n 
1 560 PRO n 
1 561 THR n 
1 562 ASN n 
1 563 THR n 
1 564 THR n 
1 565 TYR n 
1 566 VAL n 
1 567 VAL n 
1 568 GLN n 
1 569 TYR n 
1 570 ALA n 
1 571 LEU n 
1 572 ALA n 
1 573 ASN n 
1 574 LEU n 
1 575 THR n 
1 576 GLY n 
1 577 THR n 
1 578 VAL n 
1 579 VAL n 
1 580 ASN n 
1 581 LEU n 
1 582 THR n 
1 583 ARG n 
1 584 GLU n 
1 585 GLN n 
1 586 CYS n 
1 587 GLN n 
1 588 ASP n 
1 589 PRO n 
1 590 SER n 
1 591 LYS n 
1 592 VAL n 
1 593 PRO n 
1 594 SER n 
1 595 GLU n 
1 596 ASN n 
1 597 LYS n 
1 598 ASP n 
1 599 LEU n 
1 600 TYR n 
1 601 GLU n 
1 602 TYR n 
1 603 SER n 
1 604 TRP n 
1 605 VAL n 
1 606 GLN n 
1 607 GLY n 
1 608 PRO n 
1 609 LEU n 
1 610 HIS n 
1 611 SER n 
1 612 ASN n 
1 613 GLU n 
1 614 THR n 
1 615 ASP n 
1 616 ARG n 
1 617 LEU n 
1 618 PRO n 
1 619 ARG n 
1 620 CYS n 
1 621 VAL n 
1 622 ARG n 
1 623 SER n 
1 624 THR n 
1 625 ALA n 
1 626 ARG n 
1 627 LEU n 
1 628 ALA n 
1 629 ARG n 
1 630 ALA n 
1 631 LEU n 
1 632 SER n 
1 633 PRO n 
1 634 ALA n 
1 635 PHE n 
1 636 GLU n 
1 637 LEU n 
1 638 SER n 
1 639 GLN n 
1 640 TRP n 
1 641 SER n 
1 642 SER n 
1 643 THR n 
1 644 GLU n 
1 645 TYR n 
1 646 SER n 
1 647 THR n 
1 648 TRP n 
1 649 THR n 
1 650 GLU n 
1 651 SER n 
1 652 ARG n 
1 653 TRP n 
1 654 LYS n 
1 655 ASP n 
1 656 ILE n 
1 657 ARG n 
1 658 ALA n 
1 659 ARG n 
1 660 ILE n 
1 661 PHE n 
1 662 LEU n 
1 663 ILE n 
1 664 ALA n 
1 665 SER n 
1 666 LYS n 
1 667 GLU n 
1 668 LEU n 
1 669 GLU n 
1 670 LEU n 
1 671 ILE n 
1 672 THR n 
1 673 LEU n 
1 674 THR n 
1 675 VAL n 
1 676 GLY n 
1 677 PHE n 
1 678 GLY n 
1 679 ILE n 
1 680 LEU n 
1 681 ILE n 
1 682 PHE n 
1 683 SER n 
1 684 LEU n 
1 685 ILE n 
1 686 VAL n 
1 687 THR n 
1 688 TYR n 
1 689 CYS n 
1 690 ILE n 
1 691 ASN n 
1 692 ALA n 
1 693 LYS n 
1 694 ALA n 
1 695 ASP n 
1 696 VAL n 
1 697 LEU n 
1 698 PHE n 
1 699 ILE n 
1 700 ALA n 
1 701 PRO n 
1 702 ARG n 
1 703 GLU n 
1 704 PRO n 
1 705 GLY n 
1 706 ALA n 
1 707 VAL n 
1 708 SER n 
1 709 TYR n 
2 1   MET n 
2 2   THR n 
2 3   GLU n 
2 4   LEU n 
2 5   PRO n 
2 6   ALA n 
2 7   PRO n 
2 8   LEU n 
2 9   SER n 
2 10  TYR n 
2 11  PHE n 
2 12  GLN n 
2 13  ASN n 
2 14  ALA n 
2 15  GLN n 
2 16  MET n 
2 17  SER n 
2 18  GLU n 
2 19  ASP n 
2 20  ASN n 
2 21  HIS n 
2 22  LEU n 
2 23  SER n 
2 24  ASN n 
2 25  THR n 
2 26  VAL n 
2 27  ARG n 
2 28  SER n 
2 29  GLN n 
2 30  ASN n 
2 31  ASP n 
2 32  ASN n 
2 33  ARG n 
2 34  GLU n 
2 35  ARG n 
2 36  GLN n 
2 37  GLU n 
2 38  HIS n 
2 39  ASN n 
2 40  ASP n 
2 41  ARG n 
2 42  ARG n 
2 43  SER n 
2 44  LEU n 
2 45  GLY n 
2 46  HIS n 
2 47  PRO n 
2 48  GLU n 
2 49  PRO n 
2 50  LEU n 
2 51  SER n 
2 52  ASN n 
2 53  GLY n 
2 54  ARG n 
2 55  PRO n 
2 56  GLN n 
2 57  GLY n 
2 58  ASN n 
2 59  SER n 
2 60  ARG n 
2 61  GLN n 
2 62  VAL n 
2 63  VAL n 
2 64  GLU n 
2 65  GLN n 
2 66  ASP n 
2 67  GLU n 
2 68  GLU n 
2 69  GLU n 
2 70  ASP n 
2 71  GLU n 
2 72  GLU n 
2 73  LEU n 
2 74  THR n 
2 75  LEU n 
2 76  LYS n 
2 77  TYR n 
2 78  GLY n 
2 79  ALA n 
2 80  LYS n 
2 81  HIS n 
2 82  VAL n 
2 83  ILE n 
2 84  MET n 
2 85  LEU n 
2 86  PHE n 
2 87  VAL n 
2 88  PRO n 
2 89  VAL n 
2 90  THR n 
2 91  LEU n 
2 92  CYS n 
2 93  MET n 
2 94  VAL n 
2 95  VAL n 
2 96  VAL n 
2 97  VAL n 
2 98  ALA n 
2 99  THR n 
2 100 ILE n 
2 101 LYS n 
2 102 SER n 
2 103 VAL n 
2 104 SER n 
2 105 PHE n 
2 106 TYR n 
2 107 THR n 
2 108 ARG n 
2 109 LYS n 
2 110 ASP n 
2 111 GLY n 
2 112 GLN n 
2 113 LEU n 
2 114 ILE n 
2 115 TYR n 
2 116 THR n 
2 117 PRO n 
2 118 PHE n 
2 119 THR n 
2 120 GLU n 
2 121 ASP n 
2 122 THR n 
2 123 GLU n 
2 124 THR n 
2 125 VAL n 
2 126 GLY n 
2 127 GLN n 
2 128 ARG n 
2 129 ALA n 
2 130 LEU n 
2 131 HIS n 
2 132 SER n 
2 133 ILE n 
2 134 LEU n 
2 135 ASN n 
2 136 ALA n 
2 137 ALA n 
2 138 ILE n 
2 139 MET n 
2 140 ILE n 
2 141 SER n 
2 142 VAL n 
2 143 ILE n 
2 144 VAL n 
2 145 VAL n 
2 146 MET n 
2 147 THR n 
2 148 ILE n 
2 149 LEU n 
2 150 LEU n 
2 151 VAL n 
2 152 VAL n 
2 153 LEU n 
2 154 TYR n 
2 155 LYS n 
2 156 TYR n 
2 157 ARG n 
2 158 CYS n 
2 159 TYR n 
2 160 LYS n 
2 161 VAL n 
2 162 ILE n 
2 163 HIS n 
2 164 ALA n 
2 165 TRP n 
2 166 LEU n 
2 167 ILE n 
2 168 ILE n 
2 169 SER n 
2 170 SER n 
2 171 LEU n 
2 172 LEU n 
2 173 LEU n 
2 174 LEU n 
2 175 PHE n 
2 176 PHE n 
2 177 PHE n 
2 178 SER n 
2 179 PHE n 
2 180 ILE n 
2 181 TYR n 
2 182 LEU n 
2 183 GLY n 
2 184 GLU n 
2 185 VAL n 
2 186 PHE n 
2 187 LYS n 
2 188 THR n 
2 189 TYR n 
2 190 ASN n 
2 191 VAL n 
2 192 ALA n 
2 193 VAL n 
2 194 ASP n 
2 195 TYR n 
2 196 ILE n 
2 197 THR n 
2 198 VAL n 
2 199 ALA n 
2 200 LEU n 
2 201 LEU n 
2 202 ILE n 
2 203 TRP n 
2 204 ASN n 
2 205 PHE n 
2 206 GLY n 
2 207 VAL n 
2 208 VAL n 
2 209 GLY n 
2 210 MET n 
2 211 ILE n 
2 212 SER n 
2 213 ILE n 
2 214 HIS n 
2 215 TRP n 
2 216 LYS n 
2 217 GLY n 
2 218 PRO n 
2 219 LEU n 
2 220 ARG n 
2 221 LEU n 
2 222 GLN n 
2 223 GLN n 
2 224 ALA n 
2 225 TYR n 
2 226 LEU n 
2 227 ILE n 
2 228 MET n 
2 229 ILE n 
2 230 SER n 
2 231 ALA n 
2 232 LEU n 
2 233 MET n 
2 234 ALA n 
2 235 LEU n 
2 236 VAL n 
2 237 PHE n 
2 238 ILE n 
2 239 LYS n 
2 240 TYR n 
2 241 LEU n 
2 242 PRO n 
2 243 GLU n 
2 244 TRP n 
2 245 THR n 
2 246 ALA n 
2 247 TRP n 
2 248 LEU n 
2 249 ILE n 
2 250 LEU n 
2 251 ALA n 
2 252 VAL n 
2 253 ILE n 
2 254 SER n 
2 255 VAL n 
2 256 THR n 
2 257 ASP n 
2 258 LEU n 
2 259 VAL n 
2 260 ALA n 
2 261 VAL n 
2 262 LEU n 
2 263 CYS n 
2 264 PRO n 
2 265 LYS n 
2 266 GLY n 
2 267 PRO n 
2 268 LEU n 
2 269 ARG n 
2 270 MET n 
2 271 LEU n 
2 272 VAL n 
2 273 GLU n 
2 274 THR n 
2 275 ALA n 
2 276 GLN n 
2 277 GLU n 
2 278 ARG n 
2 279 ASN n 
2 280 GLU n 
2 281 THR n 
2 282 LEU n 
2 283 PHE n 
2 284 PRO n 
2 285 ALA n 
2 286 LEU n 
2 287 ILE n 
2 288 TYR n 
2 289 SER n 
2 290 SER n 
2 291 THR n 
2 292 MET n 
2 293 VAL n 
2 294 TRP n 
2 295 LEU n 
2 296 VAL n 
2 297 ASN n 
2 298 MET n 
2 299 ALA n 
2 300 GLU n 
2 301 GLY n 
2 302 ASP n 
2 303 PRO n 
2 304 GLU n 
2 305 ALA n 
2 306 GLN n 
2 307 ARG n 
2 308 ARG n 
2 309 VAL n 
2 310 SER n 
2 311 LYS n 
2 312 ASN n 
2 313 SER n 
2 314 LYS n 
2 315 TYR n 
2 316 ASN n 
2 317 ALA n 
2 318 GLU n 
2 319 SER n 
2 320 THR n 
2 321 GLU n 
2 322 ARG n 
2 323 GLU n 
2 324 SER n 
2 325 GLN n 
2 326 ASP n 
2 327 THR n 
2 328 VAL n 
2 329 ALA n 
2 330 GLU n 
2 331 ASN n 
2 332 ASP n 
2 333 ASP n 
2 334 GLY n 
2 335 GLY n 
2 336 PHE n 
2 337 SER n 
2 338 GLU n 
2 339 GLU n 
2 340 TRP n 
2 341 GLU n 
2 342 ALA n 
2 343 GLN n 
2 344 ARG n 
2 345 ASP n 
2 346 SER n 
2 347 HIS n 
2 348 LEU n 
2 349 GLY n 
2 350 PRO n 
2 351 HIS n 
2 352 ARG n 
2 353 SER n 
2 354 THR n 
2 355 PRO n 
2 356 GLU n 
2 357 SER n 
2 358 ARG n 
2 359 ALA n 
2 360 ALA n 
2 361 VAL n 
2 362 GLN n 
2 363 GLU n 
2 364 LEU n 
2 365 SER n 
2 366 SER n 
2 367 SER n 
2 368 ILE n 
2 369 LEU n 
2 370 ALA n 
2 371 GLY n 
2 372 GLU n 
2 373 ASP n 
2 374 PRO n 
2 375 GLU n 
2 376 GLU n 
2 377 ARG n 
2 378 GLY n 
2 379 VAL n 
2 380 LYS n 
2 381 LEU n 
2 382 GLY n 
2 383 LEU n 
2 384 GLY n 
2 385 ASP n 
2 386 PHE n 
2 387 ILE n 
2 388 PHE n 
2 389 TYR n 
2 390 SER n 
2 391 VAL n 
2 392 LEU n 
2 393 VAL n 
2 394 GLY n 
2 395 LYS n 
2 396 ALA n 
2 397 SER n 
2 398 ALA n 
2 399 THR n 
2 400 ALA n 
2 401 SER n 
2 402 GLY n 
2 403 ASP n 
2 404 TRP n 
2 405 ASN n 
2 406 THR n 
2 407 THR n 
2 408 ILE n 
2 409 ALA n 
2 410 CYS n 
2 411 PHE n 
2 412 VAL n 
2 413 ALA n 
2 414 ILE n 
2 415 LEU n 
2 416 ILE n 
2 417 GLY n 
2 418 LEU n 
2 419 CYS n 
2 420 LEU n 
2 421 THR n 
2 422 LEU n 
2 423 LEU n 
2 424 LEU n 
2 425 LEU n 
2 426 ALA n 
2 427 ILE n 
2 428 PHE n 
2 429 LYS n 
2 430 LYS n 
2 431 ALA n 
2 432 LEU n 
2 433 PRO n 
2 434 ALA n 
2 435 LEU n 
2 436 PRO n 
2 437 ILE n 
2 438 SER n 
2 439 ILE n 
2 440 THR n 
2 441 PHE n 
2 442 GLY n 
2 443 LEU n 
2 444 VAL n 
2 445 PHE n 
2 446 TYR n 
2 447 PHE n 
2 448 ALA n 
2 449 THR n 
2 450 ASP n 
2 451 TYR n 
2 452 LEU n 
2 453 VAL n 
2 454 GLN n 
2 455 PRO n 
2 456 PHE n 
2 457 MET n 
2 458 ASP n 
2 459 GLN n 
2 460 LEU n 
2 461 ALA n 
2 462 PHE n 
2 463 HIS n 
2 464 GLN n 
2 465 PHE n 
2 466 TYR n 
2 467 ILE n 
3 1   MET n 
3 2   GLY n 
3 3   ALA n 
3 4   ALA n 
3 5   VAL n 
3 6   PHE n 
3 7   PHE n 
3 8   GLY n 
3 9   CYS n 
3 10  THR n 
3 11  PHE n 
3 12  VAL n 
3 13  ALA n 
3 14  PHE n 
3 15  GLY n 
3 16  PRO n 
3 17  ALA n 
3 18  PHE n 
3 19  ALA n 
3 20  LEU n 
3 21  PHE n 
3 22  LEU n 
3 23  ILE n 
3 24  THR n 
3 25  VAL n 
3 26  ALA n 
3 27  GLY n 
3 28  ASP n 
3 29  PRO n 
3 30  LEU n 
3 31  ARG n 
3 32  VAL n 
3 33  ILE n 
3 34  ILE n 
3 35  LEU n 
3 36  VAL n 
3 37  ALA n 
3 38  GLY n 
3 39  ALA n 
3 40  PHE n 
3 41  PHE n 
3 42  TRP n 
3 43  LEU n 
3 44  VAL n 
3 45  SER n 
3 46  LEU n 
3 47  LEU n 
3 48  LEU n 
3 49  ALA n 
3 50  SER n 
3 51  VAL n 
3 52  VAL n 
3 53  TRP n 
3 54  PHE n 
3 55  ILE n 
3 56  LEU n 
3 57  VAL n 
3 58  HIS n 
3 59  VAL n 
3 60  THR n 
3 61  ASP n 
3 62  ARG n 
3 63  SER n 
3 64  ASP n 
3 65  ALA n 
3 66  ARG n 
3 67  LEU n 
3 68  GLN n 
3 69  TYR n 
3 70  GLY n 
3 71  LEU n 
3 72  LEU n 
3 73  ILE n 
3 74  PHE n 
3 75  GLY n 
3 76  ALA n 
3 77  ALA n 
3 78  VAL n 
3 79  SER n 
3 80  VAL n 
3 81  LEU n 
3 82  LEU n 
3 83  GLN n 
3 84  GLU n 
3 85  VAL n 
3 86  PHE n 
3 87  ARG n 
3 88  PHE n 
3 89  ALA n 
3 90  TYR n 
3 91  TYR n 
3 92  LYS n 
3 93  LEU n 
3 94  LEU n 
3 95  LYS n 
3 96  LYS n 
3 97  ALA n 
3 98  ASP n 
3 99  GLU n 
3 100 GLY n 
3 101 LEU n 
3 102 ALA n 
3 103 SER n 
3 104 LEU n 
3 105 SER n 
3 106 GLU n 
3 107 ASP n 
3 108 GLY n 
3 109 ARG n 
3 110 SER n 
3 111 PRO n 
3 112 ILE n 
3 113 SER n 
3 114 ILE n 
3 115 ARG n 
3 116 GLN n 
3 117 MET n 
3 118 ALA n 
3 119 TYR n 
3 120 VAL n 
3 121 SER n 
3 122 GLY n 
3 123 LEU n 
3 124 SER n 
3 125 PHE n 
3 126 GLY n 
3 127 ILE n 
3 128 ILE n 
3 129 SER n 
3 130 GLY n 
3 131 VAL n 
3 132 PHE n 
3 133 SER n 
3 134 VAL n 
3 135 ILE n 
3 136 ASN n 
3 137 ILE n 
3 138 LEU n 
3 139 ALA n 
3 140 ASP n 
3 141 ALA n 
3 142 LEU n 
3 143 GLY n 
3 144 PRO n 
3 145 GLY n 
3 146 VAL n 
3 147 VAL n 
3 148 GLY n 
3 149 ILE n 
3 150 HIS n 
3 151 GLY n 
3 152 ASP n 
3 153 SER n 
3 154 PRO n 
3 155 TYR n 
3 156 TYR n 
3 157 PHE n 
3 158 LEU n 
3 159 THR n 
3 160 SER n 
3 161 ALA n 
3 162 PHE n 
3 163 LEU n 
3 164 THR n 
3 165 ALA n 
3 166 ALA n 
3 167 ILE n 
3 168 ILE n 
3 169 LEU n 
3 170 LEU n 
3 171 HIS n 
3 172 THR n 
3 173 PHE n 
3 174 TRP n 
3 175 GLY n 
3 176 VAL n 
3 177 VAL n 
3 178 PHE n 
3 179 PHE n 
3 180 ASP n 
3 181 ALA n 
3 182 CYS n 
3 183 GLU n 
3 184 ARG n 
3 185 ARG n 
3 186 ARG n 
3 187 TYR n 
3 188 TRP n 
3 189 ALA n 
3 190 LEU n 
3 191 GLY n 
3 192 LEU n 
3 193 VAL n 
3 194 VAL n 
3 195 GLY n 
3 196 SER n 
3 197 HIS n 
3 198 LEU n 
3 199 LEU n 
3 200 THR n 
3 201 SER n 
3 202 GLY n 
3 203 LEU n 
3 204 THR n 
3 205 PHE n 
3 206 LEU n 
3 207 ASN n 
3 208 PRO n 
3 209 TRP n 
3 210 TYR n 
3 211 GLU n 
3 212 ALA n 
3 213 SER n 
3 214 LEU n 
3 215 LEU n 
3 216 PRO n 
3 217 ILE n 
3 218 TYR n 
3 219 ALA n 
3 220 VAL n 
3 221 THR n 
3 222 VAL n 
3 223 SER n 
3 224 MET n 
3 225 GLY n 
3 226 LEU n 
3 227 TRP n 
3 228 ALA n 
3 229 PHE n 
3 230 ILE n 
3 231 THR n 
3 232 ALA n 
3 233 GLY n 
3 234 GLY n 
3 235 SER n 
3 236 LEU n 
3 237 ARG n 
3 238 SER n 
3 239 ILE n 
3 240 GLN n 
3 241 ARG n 
3 242 SER n 
3 243 LEU n 
3 244 LEU n 
3 245 CYS n 
3 246 ARG n 
3 247 ARG n 
3 248 GLN n 
3 249 GLU n 
3 250 ASP n 
3 251 SER n 
3 252 ARG n 
3 253 VAL n 
3 254 MET n 
3 255 VAL n 
3 256 TYR n 
3 257 SER n 
3 258 ALA n 
3 259 LEU n 
3 260 ARG n 
3 261 ILE n 
3 262 PRO n 
3 263 PRO n 
3 264 GLU n 
3 265 ASP n 
4 1   MET n 
4 2   ASN n 
4 3   LEU n 
4 4   GLU n 
4 5   ARG n 
4 6   VAL n 
4 7   SER n 
4 8   ASN n 
4 9   GLU n 
4 10  GLU n 
4 11  LYS n 
4 12  LEU n 
4 13  ASN n 
4 14  LEU n 
4 15  CYS n 
4 16  ARG n 
4 17  LYS n 
4 18  TYR n 
4 19  TYR n 
4 20  LEU n 
4 21  GLY n 
4 22  GLY n 
4 23  PHE n 
4 24  ALA n 
4 25  PHE n 
4 26  LEU n 
4 27  PRO n 
4 28  PHE n 
4 29  LEU n 
4 30  TRP n 
4 31  LEU n 
4 32  VAL n 
4 33  ASN n 
4 34  ILE n 
4 35  PHE n 
4 36  TRP n 
4 37  PHE n 
4 38  PHE n 
4 39  ARG n 
4 40  GLU n 
4 41  ALA n 
4 42  PHE n 
4 43  LEU n 
4 44  VAL n 
4 45  PRO n 
4 46  ALA n 
4 47  TYR n 
4 48  THR n 
4 49  GLU n 
4 50  GLN n 
4 51  SER n 
4 52  GLN n 
4 53  ILE n 
4 54  LYS n 
4 55  GLY n 
4 56  TYR n 
4 57  VAL n 
4 58  TRP n 
4 59  ARG n 
4 60  SER n 
4 61  ALA n 
4 62  VAL n 
4 63  GLY n 
4 64  PHE n 
4 65  LEU n 
4 66  PHE n 
4 67  TRP n 
4 68  VAL n 
4 69  ILE n 
4 70  VAL n 
4 71  LEU n 
4 72  THR n 
4 73  SER n 
4 74  TRP n 
4 75  ILE n 
4 76  THR n 
4 77  ILE n 
4 78  PHE n 
4 79  GLN n 
4 80  ILE n 
4 81  TYR n 
4 82  ARG n 
4 83  PRO n 
4 84  ARG n 
4 85  TRP n 
4 86  GLY n 
4 87  ALA n 
4 88  LEU n 
4 89  GLY n 
4 90  ASP n 
4 91  TYR n 
4 92  LEU n 
4 93  SER n 
4 94  PHE n 
4 95  THR n 
4 96  ILE n 
4 97  PRO n 
4 98  LEU n 
4 99  GLY n 
4 100 THR n 
4 101 PRO n 
5 1   ALA n 
5 2   ALA n 
5 3   ALA n 
5 4   ALA n 
5 5   ALA n 
5 6   ALA n 
5 7   ALA n 
5 8   ALA n 
5 9   ALA n 
5 10  ALA n 
5 11  ALA n 
5 12  ALA n 
5 13  ALA n 
5 14  ALA n 
5 15  ALA n 
5 16  ALA n 
5 17  ALA n 
5 18  ALA n 
5 19  ALA n 
5 20  ALA n 
5 21  ALA n 
5 22  ALA n 
5 23  ALA n 
5 24  ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 709 Human ? 'NCSTN, KIAA0253, UNQ1874/PRO4317'   ? ? ? ? ? ? 'Homo sapiens' 9606 ? HEK293F ? ? 
? ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? PLASMID ? ? ? PMLINK ? ? 
2 1 sample 'Biological sequence' 1 467 Human ? 'PSEN1, AD3, PS1, PSNL1'             ? ? ? ? ? ? 'Homo sapiens' 9606 ? HEK293F ? ? 
? ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? PLASMID ? ? ? PMLINK ? ? 
3 1 sample 'Biological sequence' 1 265 Human ? 'APH1A, PSF, CGI-78, UNQ579/PRO1141' ? ? ? ? ? ? 'Homo sapiens' 9606 ? HEK293F ? ? 
? ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? PLASMID ? ? ? PMLINK ? ? 
4 1 sample 'Biological sequence' 1 101 Human ? 'PSENEN, PEN2, MDS033'               ? ? ? ? ? ? 'Homo sapiens' 9606 ? HEK293F ? ? 
? ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? PLASMID ? ? ? PMLINK ? ? 
5 1 sample 'Biological sequence' 1 24  HUMAN ? ?                                    ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? HEK293F ? ? 
? ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? PLASMID ? ? ? PMLINK ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP NICA_HUMAN  Q92542 ? 1 
;MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEE
DLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFSPSVQCPNDGFGVYSNSYGPEFAHCR
EIQWNSLGNGLAYEDFSFPIFLLEDENETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVISTATCMRRSSIQSTF
SINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALQKAPDVTT
LPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQVEDLLAT
LEKSGAGVPAVILRRPNQSQPLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFV
TDTAKALADVATVLGRALYELAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQDLRSYLGDGPLQHYIAVSSP
TNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLYEYSWVQGPLHSNETDRLPRCVRSTARLARALSPAFELSQW
SSTEYSTWTESRWKDIRARIFLIASKELELITLTVGFGILIFSLIVTYCINAKADVLFIAPREPGAVSY
;
1 
2 UNP PSN1_HUMAN  P49768 ? 2 
;MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQDEEEDEELTLKYGAK
HVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYK
VIHAWLIISSLLLLFFFSFIYLGEVFKTYNVAVDYITVALLIWNFGVVGMISIHWKGPLRLQQAYLIMISALMALVFIKY
LPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAEGDPEAQRRVSKNSKYNAEST
ERESQDTVAENDDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSSSILAGEDPEERGVKLGLGDFIFYSVLVGKASATA
SGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI
;
1 
3 UNP APH1A_HUMAN Q96BI3 ? 3 
;MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSV
LLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTS
AFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQ
RSLLCRRQEDSRVMVYSALRIPPED
;
1 
4 UNP PEN2_HUMAN  Q9NZ42 ? 4 
;MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQI
YRPRWGALGDYLSFTIPLGTP
;
1 
5 PDB 5FN3        5FN3   ? 5 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5FN3 A 1 ? 709 ? Q92542 1 ? 709 ? 1 709 
2 2 5FN3 B 1 ? 467 ? P49768 1 ? 467 ? 1 467 
3 3 5FN3 C 1 ? 265 ? Q96BI3 1 ? 265 ? 1 265 
4 4 5FN3 D 1 ? 101 ? Q9NZ42 1 ? 101 ? 1 101 
5 5 5FN3 G 1 ? 24  ? 5FN3   5 ? 28  ? 5 28  
# 
_struct_ref_seq_dif.align_id                     2 
_struct_ref_seq_dif.pdbx_pdb_id_code             5FN3 
_struct_ref_seq_dif.mon_id                       THR 
_struct_ref_seq_dif.pdbx_pdb_strand_id           B 
_struct_ref_seq_dif.seq_num                      256 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P49768 
_struct_ref_seq_dif.db_mon_id                    TYR 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          256 
_struct_ref_seq_dif.details                      conflict 
_struct_ref_seq_dif.pdbx_auth_seq_num            256 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          5FN3 
_exptl.method            'ELECTRON MICROSCOPY' 
_exptl.crystals_number   ? 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 5FN3 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            4.10 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10291 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               10291 
_refine_hist.d_res_high                       4.10 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  5FN3 
_struct.title                     'Cryo-EM structure of gamma secretase in class 1 of the apo- state ensemble' 
_struct.pdbx_descriptor           
'NICASTRIN, PRESENILIN-1 (E.C.3.4.23.-), GAMMA-SECRETASE SUBUNIT APH-1A, GAMMA-SECRETASE SUBUNIT PEN-2, POLY ALA CHAIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        5FN3 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 34  ? TYR A 41  ? ASN A 34  TYR A 41  1 ? 8  
HELX_P HELX_P2  2  LYS A 78  ? THR A 87  ? LYS A 78  THR A 87  1 ? 10 
HELX_P HELX_P3  3  LYS A 101 ? PHE A 103 ? LYS A 101 PHE A 103 5 ? 3  
HELX_P HELX_P4  4  THR A 104 ? ARG A 114 ? THR A 104 ARG A 114 1 ? 11 
HELX_P HELX_P5  5  ASN A 142 ? GLY A 146 ? ASN A 142 GLY A 146 5 ? 5  
HELX_P HELX_P6  6  ASP A 185 ? ASN A 200 ? ASP A 185 ASN A 200 1 ? 16 
HELX_P HELX_P7  7  SER A 202 ? SER A 206 ? SER A 202 SER A 206 5 ? 5  
HELX_P HELX_P8  8  SER A 226 ? PHE A 240 ? SER A 226 PHE A 240 1 ? 15 
HELX_P HELX_P9  9  ALA A 298 ? ALA A 315 ? ALA A 298 ALA A 315 1 ? 18 
HELX_P HELX_P10 10 GLY A 339 ? GLY A 350 ? GLY A 339 GLY A 350 1 ? 12 
HELX_P HELX_P11 11 ASP A 381 ? ASN A 387 ? ASP A 381 ASN A 387 1 ? 7  
HELX_P HELX_P12 12 ASN A 387 ? GLY A 407 ? ASN A 387 GLY A 407 1 ? 21 
HELX_P HELX_P13 13 SER A 426 ? LEU A 431 ? SER A 426 LEU A 431 1 ? 6  
HELX_P HELX_P14 14 THR A 459 ? ASN A 464 ? THR A 459 ASN A 464 1 ? 6  
HELX_P HELX_P15 15 GLU A 474 ? PHE A 479 ? GLU A 474 PHE A 479 1 ? 6  
HELX_P HELX_P16 16 THR A 481 ? ALA A 502 ? THR A 481 ALA A 502 1 ? 22 
HELX_P HELX_P17 17 ASP A 514 ? ILE A 527 ? ASP A 514 ILE A 527 1 ? 14 
HELX_P HELX_P18 18 ASN A 531 ? ILE A 537 ? ASN A 531 ILE A 537 1 ? 7  
HELX_P HELX_P19 19 ARG A 539 ? LEU A 546 ? ARG A 539 LEU A 546 5 ? 8  
HELX_P HELX_P20 20 THR A 561 ? GLY A 576 ? THR A 561 GLY A 576 1 ? 16 
HELX_P HELX_P21 21 THR A 582 ? ASP A 588 ? THR A 582 ASP A 588 1 ? 7  
HELX_P HELX_P22 22 PRO A 633 ? SER A 638 ? PRO A 633 SER A 638 1 ? 6  
HELX_P HELX_P23 23 SER A 665 ? LYS A 693 ? SER A 665 LYS A 693 1 ? 29 
HELX_P HELX_P24 24 ALA B 79  ? VAL B 103 ? ALA B 79  VAL B 103 1 ? 25 
HELX_P HELX_P25 25 GLY B 126 ? TYR B 156 ? GLY B 126 TYR B 156 1 ? 31 
HELX_P HELX_P26 26 TYR B 159 ? ASN B 190 ? TYR B 159 ASN B 190 1 ? 32 
HELX_P HELX_P27 27 TYR B 195 ? TRP B 215 ? TYR B 195 TRP B 215 1 ? 21 
HELX_P HELX_P28 28 PRO B 218 ? LEU B 241 ? PRO B 218 LEU B 241 1 ? 24 
HELX_P HELX_P29 29 PRO B 242 ? LEU B 262 ? PRO B 242 LEU B 262 1 ? 21 
HELX_P HELX_P30 30 GLY B 382 ? THR B 399 ? GLY B 382 THR B 399 1 ? 18 
HELX_P HELX_P31 31 ASP B 403 ? LYS B 429 ? ASP B 403 LYS B 429 1 ? 27 
HELX_P HELX_P32 32 ALA B 434 ? LEU B 452 ? ALA B 434 LEU B 452 1 ? 19 
HELX_P HELX_P33 33 LEU B 452 ? GLN B 464 ? LEU B 452 GLN B 464 1 ? 13 
HELX_P HELX_P34 34 GLY C 2   ? THR C 24  ? GLY C 2   THR C 24  1 ? 23 
HELX_P HELX_P35 35 ASP C 28  ? ASP C 61  ? ASP C 28  ASP C 61  1 ? 34 
HELX_P HELX_P36 36 ASP C 64  ? GLU C 106 ? ASP C 64  GLU C 106 1 ? 43 
HELX_P HELX_P37 37 SER C 113 ? ALA C 141 ? SER C 113 ALA C 141 1 ? 29 
HELX_P HELX_P38 38 TYR C 155 ? ARG C 185 ? TYR C 155 ARG C 185 1 ? 31 
HELX_P HELX_P39 39 ARG C 186 ? LEU C 206 ? ARG C 186 LEU C 206 1 ? 21 
HELX_P HELX_P40 40 SER C 213 ? GLY C 233 ? SER C 213 GLY C 233 1 ? 21 
HELX_P HELX_P41 41 SER C 235 ? LEU C 243 ? SER C 235 LEU C 243 1 ? 9  
HELX_P HELX_P42 42 SER D 7   ? PHE D 23  ? SER D 7   PHE D 23  1 ? 17 
HELX_P HELX_P43 43 LEU D 26  ? PHE D 37  ? LEU D 26  PHE D 37  1 ? 12 
HELX_P HELX_P44 44 PHE D 38  ? VAL D 44  ? PHE D 38  VAL D 44  1 ? 7  
HELX_P HELX_P45 45 GLU D 49  ? ARG D 82  ? GLU D 49  ARG D 82  1 ? 34 
HELX_P HELX_P46 46 TRP D 85  ? LEU D 92  ? TRP D 85  LEU D 92  1 ? 8  
HELX_P HELX_P47 47 ALA E 1   ? ALA E 9   ? ALA G 5   ALA G 13  1 ? 9  
HELX_P HELX_P48 48 ALA E 12  ? ALA E 20  ? ALA G 16  ALA G 24  1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 50  SG ? ? ? 1_555 A CYS 62  SG ? ? A CYS 50  A CYS 62  1_555 ? ? ? ? ? ? ? 2.009 ? 
disulf2 disulf ? ? A CYS 140 SG ? ? ? 1_555 A CYS 159 SG ? ? A CYS 140 A CYS 159 1_555 ? ? ? ? ? ? ? 2.047 ? 
disulf3 disulf ? ? A CYS 195 SG ? ? ? 1_555 A CYS 213 SG ? ? A CYS 195 A CYS 213 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf4 disulf ? ? A CYS 230 SG ? ? ? 1_555 A CYS 248 SG ? ? A CYS 230 A CYS 248 1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf5 disulf ? ? A CYS 586 SG ? ? ? 1_555 A CYS 620 SG ? ? A CYS 586 A CYS 620 1_555 ? ? ? ? ? ? ? 2.036 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 549 A . ? GLY 549 A PRO 550 A ? PRO 550 A 1 8.14   
2 SER 559 A . ? SER 559 A PRO 560 A ? PRO 560 A 1 -14.22 
3 ILE 114 B . ? ILE 114 B TYR 115 B ? TYR 115 B 1 11.26  
4 THR 122 B . ? THR 122 B GLU 123 B ? GLU 123 B 1 4.76   
5 LEU 262 B . ? LEU 262 B CYS 263 B ? CYS 263 B 1 9.42   
6 ASN 279 B . ? ASN 279 B GLU 280 B ? GLU 280 B 1 8.50   
7 PRO 284 B . ? PRO 284 B ALA 285 B ? ALA 285 B 1 7.33   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 8 ? 
AB ? 3 ? 
AC ? 8 ? 
AD ? 2 ? 
BA ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? parallel      
AA 5 6 ? parallel      
AA 6 7 ? parallel      
AA 7 8 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AC 1 2 ? parallel      
AC 2 3 ? anti-parallel 
AC 3 4 ? parallel      
AC 4 5 ? parallel      
AC 5 6 ? parallel      
AC 6 7 ? anti-parallel 
AC 7 8 ? anti-parallel 
AD 1 2 ? anti-parallel 
BA 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ILE A 42  ? PRO A 43  ? ILE A 42  PRO A 43  
AA 2 ARG A 657 ? ILE A 663 ? ARG A 657 ILE A 663 
AA 3 LEU A 212 ? PHE A 218 ? LEU A 212 PHE A 218 
AA 4 ASP A 69  ? VAL A 75  ? ASP A 69  VAL A 75  
AA 5 TYR A 94  ? GLU A 99  ? TYR A 94  GLU A 99  
AA 6 LEU A 121 ? SER A 124 ? LEU A 121 SER A 124 
AA 7 ILE A 180 ? LEU A 183 ? ILE A 180 LEU A 183 
AA 8 ALA A 48  ? PRO A 49  ? ALA A 48  PRO A 49  
AB 1 LEU A 53  ? LEU A 54  ? LEU A 53  LEU A 54  
AB 2 THR A 649 ? GLU A 650 ? THR A 649 GLU A 650 
AB 3 ASP A 249 ? PRO A 250 ? ASP A 249 PRO A 250 
AC 1 ILE A 412 ? ARG A 414 ? ILE A 412 ARG A 414 
AC 2 GLU A 375 ? HIS A 379 ? GLU A 375 HIS A 379 
AC 3 SER A 437 ? ALA A 442 ? SER A 437 ALA A 442 
AC 4 SER A 361 ? LEU A 365 ? SER A 361 LEU A 365 
AC 5 VAL A 275 ? THR A 280 ? VAL A 275 THR A 280 
AC 6 ASN A 324 ? PHE A 329 ? ASN A 324 PHE A 329 
AC 7 TYR A 254 ? TRP A 257 ? TYR A 254 TRP A 257 
AC 8 LEU A 627 ? ARG A 629 ? LEU A 627 ARG A 629 
AD 1 TYR A 602 ? VAL A 605 ? TYR A 602 VAL A 605 
AD 2 ARG A 619 ? ARG A 622 ? ARG A 619 ARG A 622 
BA 1 VAL B 193 ? ASP B 194 ? VAL B 193 ASP B 194 
BA 2 SER D 93  ? THR D 95  ? SER D 93  THR D 95  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ILE A 42  ? N ILE A 42  O ILE A 660 ? O ILE A 660 
AA 2 3 N ILE A 663 ? N ILE A 663 O LEU A 212 ? O LEU A 212 
AA 3 4 N LEU A 217 ? N LEU A 217 O ASP A 69  ? O ASP A 69  
AA 4 5 N HIS A 74  ? N HIS A 74  O MET A 95  ? O MET A 95  
AA 5 6 N LEU A 98  ? N LEU A 98  O ALA A 122 ? O ALA A 122 
AA 6 7 N VAL A 123 ? N VAL A 123 O PHE A 181 ? O PHE A 181 
AA 7 8 N LEU A 182 ? N LEU A 182 O ALA A 48  ? O ALA A 48  
AB 1 2 N LEU A 54  ? N LEU A 54  O THR A 649 ? O THR A 649 
AB 2 3 N GLU A 650 ? N GLU A 650 O ASP A 249 ? O ASP A 249 
AC 1 2 N ARG A 414 ? N ARG A 414 O LEU A 376 ? O LEU A 376 
AC 2 3 N HIS A 379 ? N HIS A 379 O VAL A 440 ? O VAL A 440 
AC 3 4 N VAL A 439 ? N VAL A 439 O PHE A 362 ? O PHE A 362 
AC 4 5 N VAL A 363 ? N VAL A 363 O VAL A 277 ? O VAL A 277 
AC 5 6 N VAL A 276 ? N VAL A 276 O ASN A 324 ? O ASN A 324 
AC 6 7 N PHE A 329 ? N PHE A 329 O VAL A 256 ? O VAL A 256 
AC 7 8 N ASN A 255 ? N ASN A 255 O ALA A 628 ? O ALA A 628 
AD 1 2 N VAL A 605 ? N VAL A 605 O ARG A 619 ? O ARG A 619 
BA 1 2 O VAL B 193 ? O VAL B 193 N PHE D 94  ? N PHE D 94  
# 
_database_PDB_matrix.entry_id          5FN3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5FN3 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N   . ASN A 1 34  ? 115.990 124.787 135.436 1.00 500.00 ? 34  ASN A N   1 
ATOM 2     C CA  . ASN A 1 34  ? 115.823 123.705 136.459 1.00 500.00 ? 34  ASN A CA  1 
ATOM 3     C C   . ASN A 1 34  ? 115.444 124.316 137.799 1.00 500.00 ? 34  ASN A C   1 
ATOM 4     O O   . ASN A 1 34  ? 116.193 125.124 138.341 1.00 500.00 ? 34  ASN A O   1 
ATOM 5     C CB  . ASN A 1 34  ? 117.118 122.882 136.631 1.00 500.00 ? 34  ASN A CB  1 
ATOM 6     C CG  . ASN A 1 34  ? 117.704 122.381 135.308 1.00 500.00 ? 34  ASN A CG  1 
ATOM 7     O OD1 . ASN A 1 34  ? 118.913 122.479 135.073 1.00 500.00 ? 34  ASN A OD1 1 
ATOM 8     N ND2 . ASN A 1 34  ? 116.848 121.849 134.435 1.00 500.00 ? 34  ASN A ND2 1 
ATOM 9     N N   . SER A 1 35  ? 114.292 123.918 138.335 1.00 499.94 ? 35  SER A N   1 
ATOM 10    C CA  . SER A 1 35  ? 113.858 124.304 139.693 1.00 500.00 ? 35  SER A CA  1 
ATOM 11    C C   . SER A 1 35  ? 114.933 124.081 140.795 1.00 500.00 ? 35  SER A C   1 
ATOM 12    O O   . SER A 1 35  ? 114.929 124.727 141.868 1.00 500.00 ? 35  SER A O   1 
ATOM 13    C CB  . SER A 1 35  ? 112.608 123.502 140.056 1.00 500.00 ? 35  SER A CB  1 
ATOM 14    O OG  . SER A 1 35  ? 112.857 122.109 139.947 1.00 500.00 ? 35  SER A OG  1 
ATOM 15    N N   . VAL A 1 36  ? 115.839 123.156 140.505 1.00 432.34 ? 36  VAL A N   1 
ATOM 16    C CA  . VAL A 1 36  ? 116.914 122.826 141.398 1.00 426.35 ? 36  VAL A CA  1 
ATOM 17    C C   . VAL A 1 36  ? 117.799 124.044 141.655 1.00 430.91 ? 36  VAL A C   1 
ATOM 18    O O   . VAL A 1 36  ? 118.346 124.121 142.735 1.00 420.97 ? 36  VAL A O   1 
ATOM 19    C CB  . VAL A 1 36  ? 117.662 121.572 140.908 1.00 478.50 ? 36  VAL A CB  1 
ATOM 20    C CG1 . VAL A 1 36  ? 118.829 121.241 141.828 1.00 500.00 ? 36  VAL A CG1 1 
ATOM 21    C CG2 . VAL A 1 36  ? 116.687 120.395 140.810 1.00 500.00 ? 36  VAL A CG2 1 
ATOM 22    N N   . GLU A 1 37  ? 117.890 125.014 140.732 1.00 452.11 ? 37  GLU A N   1 
ATOM 23    C CA  . GLU A 1 37  ? 118.506 126.340 140.976 1.00 470.99 ? 37  GLU A CA  1 
ATOM 24    C C   . GLU A 1 37  ? 117.853 126.986 142.189 1.00 409.19 ? 37  GLU A C   1 
ATOM 25    O O   . GLU A 1 37  ? 118.515 127.479 143.129 1.00 427.85 ? 37  GLU A O   1 
ATOM 26    C CB  . GLU A 1 37  ? 118.276 127.293 139.792 1.00 500.00 ? 37  GLU A CB  1 
ATOM 27    C CG  . GLU A 1 37  ? 119.221 127.123 138.606 1.00 500.00 ? 37  GLU A CG  1 
ATOM 28    C CD  . GLU A 1 37  ? 120.463 128.010 138.664 1.00 500.00 ? 37  GLU A CD  1 
ATOM 29    O OE1 . GLU A 1 37  ? 120.347 129.204 139.031 1.00 500.00 ? 37  GLU A OE1 1 
ATOM 30    O OE2 . GLU A 1 37  ? 121.558 127.515 138.312 1.00 500.00 ? 37  GLU A OE2 1 
ATOM 31    N N   . ARG A 1 38  ? 116.520 126.980 142.128 1.00 401.99 ? 38  ARG A N   1 
ATOM 32    C CA  . ARG A 1 38  ? 115.677 127.553 143.201 1.00 472.86 ? 38  ARG A CA  1 
ATOM 33    C C   . ARG A 1 38  ? 115.978 126.845 144.511 1.00 446.33 ? 38  ARG A C   1 
ATOM 34    O O   . ARG A 1 38  ? 116.124 127.519 145.547 1.00 443.64 ? 38  ARG A O   1 
ATOM 35    C CB  . ARG A 1 38  ? 114.158 127.454 142.937 1.00 500.00 ? 38  ARG A CB  1 
ATOM 36    C CG  . ARG A 1 38  ? 113.579 127.987 141.619 1.00 500.00 ? 38  ARG A CG  1 
ATOM 37    C CD  . ARG A 1 38  ? 112.087 127.617 141.552 1.00 500.00 ? 38  ARG A CD  1 
ATOM 38    N NE  . ARG A 1 38  ? 111.312 128.271 140.487 1.00 500.00 ? 38  ARG A NE  1 
ATOM 39    C CZ  . ARG A 1 38  ? 109.977 128.214 140.351 1.00 500.00 ? 38  ARG A CZ  1 
ATOM 40    N NH1 . ARG A 1 38  ? 109.210 127.531 141.212 1.00 490.44 ? 38  ARG A NH1 1 
ATOM 41    N NH2 . ARG A 1 38  ? 109.395 128.859 139.340 1.00 500.00 ? 38  ARG A NH2 1 
ATOM 42    N N   . LYS A 1 39  ? 116.061 125.514 144.441 1.00 429.82 ? 39  LYS A N   1 
ATOM 43    C CA  . LYS A 1 39  ? 116.338 124.690 145.615 1.00 444.69 ? 39  LYS A CA  1 
ATOM 44    C C   . LYS A 1 39  ? 117.664 125.094 146.253 1.00 429.73 ? 39  LYS A C   1 
ATOM 45    O O   . LYS A 1 39  ? 117.758 125.249 147.475 1.00 493.54 ? 39  LYS A O   1 
ATOM 46    C CB  . LYS A 1 39  ? 116.371 123.207 145.240 1.00 473.36 ? 39  LYS A CB  1 
ATOM 47    C CG  . LYS A 1 39  ? 115.833 122.285 146.319 1.00 499.45 ? 39  LYS A CG  1 
ATOM 48    C CD  . LYS A 1 39  ? 114.316 122.152 146.248 1.00 500.00 ? 39  LYS A CD  1 
ATOM 49    C CE  . LYS A 1 39  ? 113.824 120.924 147.000 1.00 500.00 ? 39  LYS A CE  1 
ATOM 50    N NZ  . LYS A 1 39  ? 114.360 119.641 146.451 1.00 500.00 ? 39  LYS A NZ  1 
ATOM 51    N N   . ILE A 1 40  ? 118.662 125.267 145.392 1.00 377.36 ? 40  ILE A N   1 
ATOM 52    C CA  . ILE A 1 40  ? 120.010 125.648 145.800 1.00 366.21 ? 40  ILE A CA  1 
ATOM 53    C C   . ILE A 1 40  ? 120.345 127.127 146.036 1.00 386.58 ? 40  ILE A C   1 
ATOM 54    O O   . ILE A 1 40  ? 120.670 127.508 147.157 1.00 403.45 ? 40  ILE A O   1 
ATOM 55    C CB  . ILE A 1 40  ? 121.071 125.159 144.805 1.00 417.13 ? 40  ILE A CB  1 
ATOM 56    C CG1 . ILE A 1 40  ? 120.989 123.665 144.596 1.00 434.63 ? 40  ILE A CG1 1 
ATOM 57    C CG2 . ILE A 1 40  ? 122.477 125.484 145.311 1.00 452.13 ? 40  ILE A CG2 1 
ATOM 58    C CD1 . ILE A 1 40  ? 121.654 123.230 143.317 1.00 487.28 ? 40  ILE A CD1 1 
ATOM 59    N N   . TYR A 1 41  ? 120.343 127.917 144.961 1.00 412.49 ? 41  TYR A N   1 
ATOM 60    C CA  . TYR A 1 41  ? 120.926 129.262 144.927 1.00 400.29 ? 41  TYR A CA  1 
ATOM 61    C C   . TYR A 1 41  ? 119.851 130.320 145.089 1.00 449.98 ? 41  TYR A C   1 
ATOM 62    O O   . TYR A 1 41  ? 119.010 130.474 144.198 1.00 500.00 ? 41  TYR A O   1 
ATOM 63    C CB  . TYR A 1 41  ? 121.616 129.503 143.575 1.00 400.39 ? 41  TYR A CB  1 
ATOM 64    C CG  . TYR A 1 41  ? 122.710 128.522 143.236 1.00 420.52 ? 41  TYR A CG  1 
ATOM 65    C CD1 . TYR A 1 41  ? 124.022 128.765 143.611 1.00 451.98 ? 41  TYR A CD1 1 
ATOM 66    C CD2 . TYR A 1 41  ? 122.439 127.356 142.527 1.00 453.25 ? 41  TYR A CD2 1 
ATOM 67    C CE1 . TYR A 1 41  ? 125.044 127.879 143.304 1.00 441.34 ? 41  TYR A CE1 1 
ATOM 68    C CE2 . TYR A 1 41  ? 123.450 126.453 142.217 1.00 453.65 ? 41  TYR A CE2 1 
ATOM 69    C CZ  . TYR A 1 41  ? 124.752 126.723 142.607 1.00 443.12 ? 41  TYR A CZ  1 
ATOM 70    O OH  . TYR A 1 41  ? 125.755 125.839 142.308 1.00 431.92 ? 41  TYR A OH  1 
ATOM 71    N N   . ILE A 1 42  ? 119.858 131.044 146.208 1.00 437.03 ? 42  ILE A N   1 
ATOM 72    C CA  . ILE A 1 42  ? 118.997 132.217 146.349 1.00 419.73 ? 42  ILE A CA  1 
ATOM 73    C C   . ILE A 1 42  ? 119.717 133.397 145.739 1.00 386.64 ? 42  ILE A C   1 
ATOM 74    O O   . ILE A 1 42  ? 120.804 133.715 146.175 1.00 366.95 ? 42  ILE A O   1 
ATOM 75    C CB  . ILE A 1 42  ? 118.634 132.540 147.801 1.00 423.91 ? 42  ILE A CB  1 
ATOM 76    C CG1 . ILE A 1 42  ? 117.600 131.526 148.291 1.00 499.31 ? 42  ILE A CG1 1 
ATOM 77    C CG2 . ILE A 1 42  ? 118.047 133.949 147.900 1.00 437.71 ? 42  ILE A CG2 1 
ATOM 78    C CD1 . ILE A 1 42  ? 117.207 131.684 149.743 1.00 500.00 ? 42  ILE A CD1 1 
ATOM 79    N N   . PRO A 1 43  ? 119.104 134.051 144.737 1.00 410.27 ? 43  PRO A N   1 
ATOM 80    C CA  . PRO A 1 43  ? 119.711 135.248 144.189 1.00 431.38 ? 43  PRO A CA  1 
ATOM 81    C C   . PRO A 1 43  ? 119.344 136.489 144.990 1.00 417.94 ? 43  PRO A C   1 
ATOM 82    O O   . PRO A 1 43  ? 118.292 136.524 145.634 1.00 416.30 ? 43  PRO A O   1 
ATOM 83    C CB  . PRO A 1 43  ? 119.137 135.313 142.769 1.00 454.20 ? 43  PRO A CB  1 
ATOM 84    C CG  . PRO A 1 43  ? 117.842 134.587 142.828 1.00 457.45 ? 43  PRO A CG  1 
ATOM 85    C CD  . PRO A 1 43  ? 117.829 133.737 144.066 1.00 460.65 ? 43  PRO A CD  1 
ATOM 86    N N   . LEU A 1 44  ? 120.223 137.487 144.945 1.00 428.16 ? 44  LEU A N   1 
ATOM 87    C CA  . LEU A 1 44  ? 119.984 138.770 145.591 1.00 417.18 ? 44  LEU A CA  1 
ATOM 88    C C   . LEU A 1 44  ? 119.554 139.786 144.548 1.00 430.85 ? 44  LEU A C   1 
ATOM 89    O O   . LEU A 1 44  ? 120.104 139.833 143.444 1.00 428.98 ? 44  LEU A O   1 
ATOM 90    C CB  . LEU A 1 44  ? 121.243 139.239 146.301 1.00 427.79 ? 44  LEU A CB  1 
ATOM 91    C CG  . LEU A 1 44  ? 121.687 138.314 147.431 1.00 407.41 ? 44  LEU A CG  1 
ATOM 92    C CD1 . LEU A 1 44  ? 123.108 138.639 147.859 1.00 439.79 ? 44  LEU A CD1 1 
ATOM 93    C CD2 . LEU A 1 44  ? 120.721 138.421 148.601 1.00 404.93 ? 44  LEU A CD2 1 
ATOM 94    N N   . ASN A 1 45  ? 118.584 140.613 144.926 1.00 441.02 ? 45  ASN A N   1 
ATOM 95    C CA  . ASN A 1 45  ? 117.823 141.413 143.978 1.00 481.47 ? 45  ASN A CA  1 
ATOM 96    C C   . ASN A 1 45  ? 118.212 142.903 144.022 1.00 444.19 ? 45  ASN A C   1 
ATOM 97    O O   . ASN A 1 45  ? 118.768 143.434 143.058 1.00 418.51 ? 45  ASN A O   1 
ATOM 98    C CB  . ASN A 1 45  ? 116.315 141.178 144.232 1.00 500.00 ? 45  ASN A CB  1 
ATOM 99    C CG  . ASN A 1 45  ? 115.933 139.692 144.167 1.00 488.36 ? 45  ASN A CG  1 
ATOM 100   O OD1 . ASN A 1 45  ? 116.460 138.965 143.325 1.00 500.00 ? 45  ASN A OD1 1 
ATOM 101   N ND2 . ASN A 1 45  ? 115.020 139.238 145.052 1.00 429.96 ? 45  ASN A ND2 1 
ATOM 102   N N   . LYS A 1 46  ? 117.943 143.557 145.148 1.00 429.49 ? 46  LYS A N   1 
ATOM 103   C CA  . LYS A 1 46  ? 118.218 144.985 145.320 1.00 452.10 ? 46  LYS A CA  1 
ATOM 104   C C   . LYS A 1 46  ? 119.676 145.205 145.702 1.00 454.13 ? 46  LYS A C   1 
ATOM 105   O O   . LYS A 1 46  ? 119.969 145.641 146.813 1.00 486.50 ? 46  LYS A O   1 
ATOM 106   C CB  . LYS A 1 46  ? 117.333 145.591 146.426 1.00 500.00 ? 46  LYS A CB  1 
ATOM 107   C CG  . LYS A 1 46  ? 115.839 145.360 146.307 1.00 500.00 ? 46  LYS A CG  1 
ATOM 108   C CD  . LYS A 1 46  ? 115.230 146.161 145.172 1.00 500.00 ? 46  LYS A CD  1 
ATOM 109   C CE  . LYS A 1 46  ? 113.758 145.809 144.989 1.00 500.00 ? 46  LYS A CE  1 
ATOM 110   N NZ  . LYS A 1 46  ? 112.932 146.071 146.206 1.00 500.00 ? 46  LYS A NZ  1 
ATOM 111   N N   . THR A 1 47  ? 120.600 144.915 144.799 1.00 422.87 ? 47  THR A N   1 
ATOM 112   C CA  . THR A 1 47  ? 122.012 145.128 145.094 1.00 401.25 ? 47  THR A CA  1 
ATOM 113   C C   . THR A 1 47  ? 122.598 145.979 144.001 1.00 413.11 ? 47  THR A C   1 
ATOM 114   O O   . THR A 1 47  ? 122.205 145.854 142.839 1.00 449.81 ? 47  THR A O   1 
ATOM 115   C CB  . THR A 1 47  ? 122.799 143.813 145.162 1.00 402.99 ? 47  THR A CB  1 
ATOM 116   O OG1 . THR A 1 47  ? 123.135 143.375 143.841 1.00 422.14 ? 47  THR A OG1 1 
ATOM 117   C CG2 . THR A 1 47  ? 121.992 142.733 145.841 1.00 479.89 ? 47  THR A CG2 1 
ATOM 118   N N   . ALA A 1 48  ? 123.518 146.855 144.379 1.00 413.55 ? 48  ALA A N   1 
ATOM 119   C CA  . ALA A 1 48  ? 124.377 147.511 143.417 1.00 402.94 ? 48  ALA A CA  1 
ATOM 120   C C   . ALA A 1 48  ? 125.802 147.048 143.682 1.00 371.79 ? 48  ALA A C   1 
ATOM 121   O O   . ALA A 1 48  ? 126.186 146.799 144.836 1.00 373.49 ? 48  ALA A O   1 
ATOM 122   C CB  . ALA A 1 48  ? 124.274 149.021 143.511 1.00 433.73 ? 48  ALA A CB  1 
ATOM 123   N N   . PRO A 1 49  ? 126.586 146.913 142.614 1.00 365.22 ? 49  PRO A N   1 
ATOM 124   C CA  . PRO A 1 49  ? 127.946 146.465 142.715 1.00 374.79 ? 49  PRO A CA  1 
ATOM 125   C C   . PRO A 1 49  ? 128.881 147.611 142.865 1.00 364.23 ? 49  PRO A C   1 
ATOM 126   O O   . PRO A 1 49  ? 128.501 148.787 142.680 1.00 446.49 ? 49  PRO A O   1 
ATOM 127   C CB  . PRO A 1 49  ? 128.195 145.847 141.344 1.00 399.04 ? 49  PRO A CB  1 
ATOM 128   C CG  . PRO A 1 49  ? 127.407 146.709 140.431 1.00 428.99 ? 49  PRO A CG  1 
ATOM 129   C CD  . PRO A 1 49  ? 126.219 147.194 141.216 1.00 394.58 ? 49  PRO A CD  1 
ATOM 130   N N   . CYS A 1 50  ? 130.116 147.261 143.174 1.00 376.97 ? 50  CYS A N   1 
ATOM 131   C CA  . CYS A 1 50  ? 131.224 148.126 142.873 1.00 434.29 ? 50  CYS A CA  1 
ATOM 132   C C   . CYS A 1 50  ? 131.670 147.736 141.472 1.00 416.87 ? 50  CYS A C   1 
ATOM 133   O O   . CYS A 1 50  ? 131.502 146.581 141.045 1.00 336.67 ? 50  CYS A O   1 
ATOM 134   C CB  . CYS A 1 50  ? 132.333 148.043 143.915 1.00 435.33 ? 50  CYS A CB  1 
ATOM 135   S SG  . CYS A 1 50  ? 133.987 147.958 143.233 1.00 446.08 ? 50  CYS A SG  1 
ATOM 136   N N   . VAL A 1 51  ? 132.196 148.736 140.769 1.00 421.93 ? 51  VAL A N   1 
ATOM 137   C CA  . VAL A 1 51  ? 132.510 148.657 139.352 1.00 391.70 ? 51  VAL A CA  1 
ATOM 138   C C   . VAL A 1 51  ? 133.872 149.282 139.134 1.00 355.56 ? 51  VAL A C   1 
ATOM 139   O O   . VAL A 1 51  ? 134.285 150.161 139.879 1.00 384.00 ? 51  VAL A O   1 
ATOM 140   C CB  . VAL A 1 51  ? 131.412 149.361 138.524 1.00 383.79 ? 51  VAL A CB  1 
ATOM 141   C CG1 . VAL A 1 51  ? 131.884 149.786 137.143 1.00 434.74 ? 51  VAL A CG1 1 
ATOM 142   C CG2 . VAL A 1 51  ? 130.232 148.432 138.362 1.00 419.77 ? 51  VAL A CG2 1 
ATOM 143   N N   . ARG A 1 52  ? 134.544 148.814 138.091 1.00 357.37 ? 52  ARG A N   1 
ATOM 144   C CA  . ARG A 1 52  ? 135.867 149.262 137.732 1.00 374.97 ? 52  ARG A CA  1 
ATOM 145   C C   . ARG A 1 52  ? 135.874 150.250 136.530 1.00 400.98 ? 52  ARG A C   1 
ATOM 146   O O   . ARG A 1 52  ? 135.188 150.087 135.490 1.00 391.74 ? 52  ARG A O   1 
ATOM 147   C CB  . ARG A 1 52  ? 136.774 148.046 137.487 1.00 387.37 ? 52  ARG A CB  1 
ATOM 148   C CG  . ARG A 1 52  ? 138.008 148.315 136.643 1.00 427.01 ? 52  ARG A CG  1 
ATOM 149   C CD  . ARG A 1 52  ? 138.809 147.062 136.382 1.00 386.26 ? 52  ARG A CD  1 
ATOM 150   N NE  . ARG A 1 52  ? 139.441 146.563 137.596 1.00 377.18 ? 52  ARG A NE  1 
ATOM 151   C CZ  . ARG A 1 52  ? 140.456 145.706 137.617 1.00 397.91 ? 52  ARG A CZ  1 
ATOM 152   N NH1 . ARG A 1 52  ? 140.958 145.320 138.786 1.00 422.09 ? 52  ARG A NH1 1 
ATOM 153   N NH2 . ARG A 1 52  ? 140.984 145.231 136.488 1.00 430.36 ? 52  ARG A NH2 1 
ATOM 154   N N   . LEU A 1 53  ? 136.699 151.267 136.712 1.00 398.68 ? 53  LEU A N   1 
ATOM 155   C CA  . LEU A 1 53  ? 136.897 152.342 135.780 1.00 374.07 ? 53  LEU A CA  1 
ATOM 156   C C   . LEU A 1 53  ? 138.398 152.560 135.695 1.00 383.04 ? 53  LEU A C   1 
ATOM 157   O O   . LEU A 1 53  ? 139.154 152.010 136.509 1.00 394.84 ? 53  LEU A O   1 
ATOM 158   C CB  . LEU A 1 53  ? 136.291 153.611 136.359 1.00 413.16 ? 53  LEU A CB  1 
ATOM 159   C CG  . LEU A 1 53  ? 134.812 153.963 136.298 1.00 436.43 ? 53  LEU A CG  1 
ATOM 160   C CD1 . LEU A 1 53  ? 133.880 152.779 136.428 1.00 453.97 ? 53  LEU A CD1 1 
ATOM 161   C CD2 . LEU A 1 53  ? 134.538 154.966 137.411 1.00 442.63 ? 53  LEU A CD2 1 
ATOM 162   N N   . LEU A 1 54  ? 138.832 153.405 134.765 1.00 366.50 ? 54  LEU A N   1 
ATOM 163   C CA  . LEU A 1 54  ? 140.240 153.616 134.539 1.00 370.63 ? 54  LEU A CA  1 
ATOM 164   C C   . LEU A 1 54  ? 140.691 155.059 134.278 1.00 406.04 ? 54  LEU A C   1 
ATOM 165   O O   . LEU A 1 54  ? 139.922 155.911 133.834 1.00 360.33 ? 54  LEU A O   1 
ATOM 166   C CB  . LEU A 1 54  ? 140.675 152.771 133.364 1.00 409.53 ? 54  LEU A CB  1 
ATOM 167   C CG  . LEU A 1 54  ? 139.882 151.501 133.079 1.00 440.62 ? 54  LEU A CG  1 
ATOM 168   C CD1 . LEU A 1 54  ? 140.261 151.011 131.699 1.00 500.00 ? 54  LEU A CD1 1 
ATOM 169   C CD2 . LEU A 1 54  ? 140.120 150.429 134.135 1.00 397.77 ? 54  LEU A CD2 1 
ATOM 170   N N   . ASN A 1 55  ? 141.984 155.260 134.543 1.00 431.45 ? 55  ASN A N   1 
ATOM 171   C CA  . ASN A 1 55  ? 142.738 156.482 134.303 1.00 387.74 ? 55  ASN A CA  1 
ATOM 172   C C   . ASN A 1 55  ? 143.947 156.182 133.446 1.00 372.89 ? 55  ASN A C   1 
ATOM 173   O O   . ASN A 1 55  ? 144.247 155.016 133.133 1.00 380.97 ? 55  ASN A O   1 
ATOM 174   C CB  . ASN A 1 55  ? 143.220 157.072 135.625 1.00 408.70 ? 55  ASN A CB  1 
ATOM 175   C CG  . ASN A 1 55  ? 142.313 158.162 136.149 1.00 422.27 ? 55  ASN A CG  1 
ATOM 176   O OD1 . ASN A 1 55  ? 141.277 158.433 135.554 1.00 429.80 ? 55  ASN A OD1 1 
ATOM 177   N ND2 . ASN A 1 55  ? 142.695 158.803 137.260 1.00 432.18 ? 55  ASN A ND2 1 
ATOM 178   N N   . ALA A 1 56  ? 144.627 157.249 133.042 1.00 408.57 ? 56  ALA A N   1 
ATOM 179   C CA  . ALA A 1 56  ? 145.839 157.136 132.240 1.00 464.80 ? 56  ALA A CA  1 
ATOM 180   C C   . ALA A 1 56  ? 146.781 156.116 132.864 1.00 447.58 ? 56  ALA A C   1 
ATOM 181   O O   . ALA A 1 56  ? 147.403 155.332 132.153 1.00 500.00 ? 56  ALA A O   1 
ATOM 182   C CB  . ALA A 1 56  ? 146.531 158.490 132.087 1.00 483.73 ? 56  ALA A CB  1 
ATOM 183   N N   . THR A 1 57  ? 146.869 156.131 134.191 1.00 404.11 ? 57  THR A N   1 
ATOM 184   C CA  . THR A 1 57  ? 147.664 155.161 134.919 1.00 442.85 ? 57  THR A CA  1 
ATOM 185   C C   . THR A 1 57  ? 146.801 154.000 135.323 1.00 408.67 ? 57  THR A C   1 
ATOM 186   O O   . THR A 1 57  ? 147.084 152.849 135.004 1.00 432.99 ? 57  THR A O   1 
ATOM 187   C CB  . THR A 1 57  ? 148.245 155.748 136.229 1.00 491.14 ? 57  THR A CB  1 
ATOM 188   O OG1 . THR A 1 57  ? 148.530 157.143 136.069 1.00 500.00 ? 57  THR A OG1 1 
ATOM 189   C CG2 . THR A 1 57  ? 149.510 154.996 136.653 1.00 493.92 ? 57  THR A CG2 1 
ATOM 190   N N   . HIS A 1 58  ? 145.733 154.326 136.030 1.00 401.32 ? 58  HIS A N   1 
ATOM 191   C CA  . HIS A 1 58  ? 145.198 153.421 137.013 1.00 428.75 ? 58  HIS A CA  1 
ATOM 192   C C   . HIS A 1 58  ? 143.849 152.890 136.666 1.00 413.25 ? 58  HIS A C   1 
ATOM 193   O O   . HIS A 1 58  ? 143.199 153.344 135.736 1.00 438.96 ? 58  HIS A O   1 
ATOM 194   C CB  . HIS A 1 58  ? 145.136 154.127 138.366 1.00 476.55 ? 58  HIS A CB  1 
ATOM 195   C CG  . HIS A 1 58  ? 146.418 154.059 139.118 1.00 500.00 ? 58  HIS A CG  1 
ATOM 196   N ND1 . HIS A 1 58  ? 147.195 155.167 139.378 1.00 500.00 ? 58  HIS A ND1 1 
ATOM 197   C CD2 . HIS A 1 58  ? 147.082 153.002 139.642 1.00 500.00 ? 58  HIS A CD2 1 
ATOM 198   C CE1 . HIS A 1 58  ? 148.276 154.798 140.042 1.00 500.00 ? 58  HIS A CE1 1 
ATOM 199   N NE2 . HIS A 1 58  ? 148.230 153.489 140.219 1.00 500.00 ? 58  HIS A NE2 1 
ATOM 200   N N   . GLN A 1 59  ? 143.458 151.895 137.440 1.00 407.76 ? 59  GLN A N   1 
ATOM 201   C CA  . GLN A 1 59  ? 142.127 151.356 137.411 1.00 412.49 ? 59  GLN A CA  1 
ATOM 202   C C   . GLN A 1 59  ? 141.640 151.374 138.835 1.00 391.41 ? 59  GLN A C   1 
ATOM 203   O O   . GLN A 1 59  ? 142.443 151.340 139.775 1.00 374.40 ? 59  GLN A O   1 
ATOM 204   C CB  . GLN A 1 59  ? 142.125 149.937 136.833 1.00 494.08 ? 59  GLN A CB  1 
ATOM 205   C CG  . GLN A 1 59  ? 142.850 148.870 137.643 1.00 500.00 ? 59  GLN A CG  1 
ATOM 206   C CD  . GLN A 1 59  ? 143.394 147.743 136.786 1.00 500.00 ? 59  GLN A CD  1 
ATOM 207   O OE1 . GLN A 1 59  ? 142.708 147.235 135.901 1.00 432.87 ? 59  GLN A OE1 1 
ATOM 208   N NE2 . GLN A 1 59  ? 144.635 147.344 137.045 1.00 500.00 ? 59  GLN A NE2 1 
ATOM 209   N N   . ILE A 1 60  ? 140.324 151.432 138.990 1.00 402.73 ? 60  ILE A N   1 
ATOM 210   C CA  . ILE A 1 60  ? 139.718 151.560 140.314 1.00 405.00 ? 60  ILE A CA  1 
ATOM 211   C C   . ILE A 1 60  ? 138.580 150.580 140.535 1.00 437.60 ? 60  ILE A C   1 
ATOM 212   O O   . ILE A 1 60  ? 138.203 149.826 139.641 1.00 406.69 ? 60  ILE A O   1 
ATOM 213   C CB  . ILE A 1 60  ? 139.214 152.992 140.547 1.00 401.52 ? 60  ILE A CB  1 
ATOM 214   C CG1 . ILE A 1 60  ? 138.227 153.395 139.448 1.00 392.17 ? 60  ILE A CG1 1 
ATOM 215   C CG2 . ILE A 1 60  ? 140.396 153.943 140.604 1.00 460.20 ? 60  ILE A CG2 1 
ATOM 216   C CD1 . ILE A 1 60  ? 137.359 154.579 139.801 1.00 433.25 ? 60  ILE A CD1 1 
ATOM 217   N N   . GLY A 1 61  ? 138.064 150.584 141.760 1.00 477.60 ? 61  GLY A N   1 
ATOM 218   C CA  . GLY A 1 61  ? 136.916 149.784 142.121 1.00 474.14 ? 61  GLY A CA  1 
ATOM 219   C C   . GLY A 1 61  ? 137.320 148.347 142.326 1.00 429.69 ? 61  GLY A C   1 
ATOM 220   O O   . GLY A 1 61  ? 138.293 148.060 143.027 1.00 432.97 ? 61  GLY A O   1 
ATOM 221   N N   . CYS A 1 62  ? 136.588 147.451 141.683 1.00 380.79 ? 62  CYS A N   1 
ATOM 222   C CA  . CYS A 1 62  ? 136.684 146.039 141.958 1.00 399.33 ? 62  CYS A CA  1 
ATOM 223   C C   . CYS A 1 62  ? 137.347 145.296 140.821 1.00 442.02 ? 62  CYS A C   1 
ATOM 224   O O   . CYS A 1 62  ? 137.815 145.885 139.844 1.00 430.09 ? 62  CYS A O   1 
ATOM 225   C CB  . CYS A 1 62  ? 135.274 145.467 142.135 1.00 442.88 ? 62  CYS A CB  1 
ATOM 226   S SG  . CYS A 1 62  ? 134.395 146.025 143.597 1.00 449.89 ? 62  CYS A SG  1 
ATOM 227   N N   . GLN A 1 63  ? 137.423 143.984 141.014 1.00 442.86 ? 63  GLN A N   1 
ATOM 228   C CA  . GLN A 1 63  ? 137.251 143.016 139.940 1.00 406.25 ? 63  GLN A CA  1 
ATOM 229   C C   . GLN A 1 63  ? 136.827 141.729 140.562 1.00 347.21 ? 63  GLN A C   1 
ATOM 230   O O   . GLN A 1 63  ? 137.263 141.398 141.662 1.00 338.40 ? 63  GLN A O   1 
ATOM 231   C CB  . GLN A 1 63  ? 138.521 142.772 139.152 1.00 408.38 ? 63  GLN A CB  1 
ATOM 232   C CG  . GLN A 1 63  ? 138.236 142.176 137.791 1.00 409.79 ? 63  GLN A CG  1 
ATOM 233   C CD  . GLN A 1 63  ? 139.500 141.864 137.025 1.00 500.00 ? 63  GLN A CD  1 
ATOM 234   O OE1 . GLN A 1 63  ? 140.474 141.362 137.588 1.00 500.00 ? 63  GLN A OE1 1 
ATOM 235   N NE2 . GLN A 1 63  ? 139.495 142.161 135.729 1.00 500.00 ? 63  GLN A NE2 1 
ATOM 236   N N   . SER A 1 64  ? 135.954 141.013 139.879 1.00 389.36 ? 64  SER A N   1 
ATOM 237   C CA  . SER A 1 64  ? 135.800 139.612 140.178 1.00 463.40 ? 64  SER A CA  1 
ATOM 238   C C   . SER A 1 64  ? 136.608 138.892 139.124 1.00 472.09 ? 64  SER A C   1 
ATOM 239   O O   . SER A 1 64  ? 136.689 139.341 137.979 1.00 431.80 ? 64  SER A O   1 
ATOM 240   C CB  . SER A 1 64  ? 134.333 139.191 140.137 1.00 491.67 ? 64  SER A CB  1 
ATOM 241   O OG  . SER A 1 64  ? 134.127 137.967 140.821 1.00 500.00 ? 64  SER A OG  1 
ATOM 242   N N   . SER A 1 65  ? 137.240 137.795 139.521 1.00 482.45 ? 65  SER A N   1 
ATOM 243   C CA  . SER A 1 65  ? 137.683 136.811 138.557 1.00 480.09 ? 65  SER A CA  1 
ATOM 244   C C   . SER A 1 65  ? 136.418 136.119 138.075 1.00 452.09 ? 65  SER A C   1 
ATOM 245   O O   . SER A 1 65  ? 135.427 136.027 138.809 1.00 453.74 ? 65  SER A O   1 
ATOM 246   C CB  . SER A 1 65  ? 138.652 135.807 139.174 1.00 500.00 ? 65  SER A CB  1 
ATOM 247   O OG  . SER A 1 65  ? 139.251 135.013 138.164 1.00 500.00 ? 65  SER A OG  1 
ATOM 248   N N   . ILE A 1 66  ? 136.459 135.655 136.833 1.00 427.50 ? 66  ILE A N   1 
ATOM 249   C CA  . ILE A 1 66  ? 135.303 135.075 136.142 1.00 409.76 ? 66  ILE A CA  1 
ATOM 250   C C   . ILE A 1 66  ? 134.558 134.027 136.996 1.00 430.36 ? 66  ILE A C   1 
ATOM 251   O O   . ILE A 1 66  ? 135.149 133.413 137.894 1.00 448.50 ? 66  ILE A O   1 
ATOM 252   C CB  . ILE A 1 66  ? 135.763 134.490 134.773 1.00 426.24 ? 66  ILE A CB  1 
ATOM 253   C CG1 . ILE A 1 66  ? 134.583 134.085 133.880 1.00 489.93 ? 66  ILE A CG1 1 
ATOM 254   C CG2 . ILE A 1 66  ? 136.722 133.314 134.957 1.00 426.74 ? 66  ILE A CG2 1 
ATOM 255   C CD1 . ILE A 1 66  ? 133.693 135.234 133.457 1.00 500.00 ? 66  ILE A CD1 1 
ATOM 256   N N   . SER A 1 67  ? 133.262 133.852 136.723 1.00 429.03 ? 67  SER A N   1 
ATOM 257   C CA  . SER A 1 67  ? 132.411 132.843 137.384 1.00 490.87 ? 67  SER A CA  1 
ATOM 258   C C   . SER A 1 67  ? 132.062 133.281 138.789 1.00 440.03 ? 67  SER A C   1 
ATOM 259   O O   . SER A 1 67  ? 131.798 132.455 139.661 1.00 439.56 ? 67  SER A O   1 
ATOM 260   C CB  . SER A 1 67  ? 133.068 131.443 137.417 1.00 500.00 ? 67  SER A CB  1 
ATOM 261   O OG  . SER A 1 67  ? 133.943 131.270 138.531 1.00 500.00 ? 67  SER A OG  1 
ATOM 262   N N   . GLY A 1 68  ? 132.059 134.591 139.002 1.00 459.04 ? 68  GLY A N   1 
ATOM 263   C CA  . GLY A 1 68  ? 131.955 135.147 140.335 1.00 493.66 ? 68  GLY A CA  1 
ATOM 264   C C   . GLY A 1 68  ? 133.166 134.825 141.182 1.00 458.67 ? 68  GLY A C   1 
ATOM 265   O O   . GLY A 1 68  ? 134.083 134.108 140.753 1.00 418.09 ? 68  GLY A O   1 
ATOM 266   N N   . ASP A 1 69  ? 133.175 135.403 142.377 1.00 428.96 ? 69  ASP A N   1 
ATOM 267   C CA  . ASP A 1 69  ? 134.044 134.950 143.442 1.00 436.49 ? 69  ASP A CA  1 
ATOM 268   C C   . ASP A 1 69  ? 133.141 134.562 144.584 1.00 408.14 ? 69  ASP A C   1 
ATOM 269   O O   . ASP A 1 69  ? 132.251 135.317 144.971 1.00 375.51 ? 69  ASP A O   1 
ATOM 270   C CB  . ASP A 1 69  ? 135.065 136.013 143.851 1.00 470.12 ? 69  ASP A CB  1 
ATOM 271   C CG  . ASP A 1 69  ? 136.414 135.813 143.165 1.00 492.61 ? 69  ASP A CG  1 
ATOM 272   O OD1 . ASP A 1 69  ? 136.442 135.641 141.928 1.00 492.78 ? 69  ASP A OD1 1 
ATOM 273   O OD2 . ASP A 1 69  ? 137.448 135.821 143.868 1.00 500.00 ? 69  ASP A OD2 1 
ATOM 274   N N   . THR A 1 70  ? 133.368 133.350 145.077 1.00 434.72 ? 70  THR A N   1 
ATOM 275   C CA  . THR A 1 70  ? 132.541 132.753 146.099 1.00 430.55 ? 70  THR A CA  1 
ATOM 276   C C   . THR A 1 70  ? 133.205 132.831 147.433 1.00 417.84 ? 70  THR A C   1 
ATOM 277   O O   . THR A 1 70  ? 134.377 133.194 147.540 1.00 414.04 ? 70  THR A O   1 
ATOM 278   C CB  . THR A 1 70  ? 132.283 131.262 145.841 1.00 464.91 ? 70  THR A CB  1 
ATOM 279   O OG1 . THR A 1 70  ? 131.197 130.829 146.669 1.00 442.68 ? 70  THR A OG1 1 
ATOM 280   C CG2 . THR A 1 70  ? 133.539 130.397 146.146 1.00 484.24 ? 70  THR A CG2 1 
ATOM 281   N N   . GLY A 1 71  ? 132.443 132.435 148.440 1.00 435.95 ? 71  GLY A N   1 
ATOM 282   C CA  . GLY A 1 71  ? 132.991 132.203 149.755 1.00 475.86 ? 71  GLY A CA  1 
ATOM 283   C C   . GLY A 1 71  ? 131.917 131.952 150.784 1.00 467.00 ? 71  GLY A C   1 
ATOM 284   O O   . GLY A 1 71  ? 130.785 132.416 150.639 1.00 495.65 ? 71  GLY A O   1 
ATOM 285   N N   . VAL A 1 72  ? 132.281 131.197 151.813 1.00 430.85 ? 72  VAL A N   1 
ATOM 286   C CA  . VAL A 1 72  ? 131.487 131.108 153.030 1.00 421.53 ? 72  VAL A CA  1 
ATOM 287   C C   . VAL A 1 72  ? 131.368 132.498 153.649 1.00 418.67 ? 72  VAL A C   1 
ATOM 288   O O   . VAL A 1 72  ? 132.336 133.273 153.655 1.00 384.06 ? 72  VAL A O   1 
ATOM 289   C CB  . VAL A 1 72  ? 132.096 130.100 154.033 1.00 500.00 ? 72  VAL A CB  1 
ATOM 290   C CG1 . VAL A 1 72  ? 133.555 130.427 154.368 1.00 500.00 ? 72  VAL A CG1 1 
ATOM 291   C CG2 . VAL A 1 72  ? 131.242 129.987 155.294 1.00 500.00 ? 72  VAL A CG2 1 
ATOM 292   N N   . ILE A 1 73  ? 130.178 132.811 154.155 1.00 425.23 ? 73  ILE A N   1 
ATOM 293   C CA  . ILE A 1 73  ? 129.876 134.162 154.610 1.00 428.53 ? 73  ILE A CA  1 
ATOM 294   C C   . ILE A 1 73  ? 130.248 134.411 156.065 1.00 424.13 ? 73  ILE A C   1 
ATOM 295   O O   . ILE A 1 73  ? 130.422 133.470 156.840 1.00 435.95 ? 73  ILE A O   1 
ATOM 296   C CB  . ILE A 1 73  ? 128.408 134.544 154.374 1.00 441.19 ? 73  ILE A CB  1 
ATOM 297   C CG1 . ILE A 1 73  ? 127.449 133.752 155.260 1.00 490.39 ? 73  ILE A CG1 1 
ATOM 298   C CG2 . ILE A 1 73  ? 128.045 134.344 152.916 1.00 461.38 ? 73  ILE A CG2 1 
ATOM 299   C CD1 . ILE A 1 73  ? 126.158 134.492 155.484 1.00 500.00 ? 73  ILE A CD1 1 
ATOM 300   N N   . HIS A 1 74  ? 130.364 135.686 156.423 1.00 446.65 ? 74  HIS A N   1 
ATOM 301   C CA  . HIS A 1 74  ? 130.741 136.078 157.779 1.00 441.03 ? 74  HIS A CA  1 
ATOM 302   C C   . HIS A 1 74  ? 130.360 137.522 158.098 1.00 438.40 ? 74  HIS A C   1 
ATOM 303   O O   . HIS A 1 74  ? 130.891 138.463 157.497 1.00 430.21 ? 74  HIS A O   1 
ATOM 304   C CB  . HIS A 1 74  ? 132.243 135.878 157.985 1.00 444.65 ? 74  HIS A CB  1 
ATOM 305   C CG  . HIS A 1 74  ? 132.636 135.783 159.419 1.00 446.46 ? 74  HIS A CG  1 
ATOM 306   N ND1 . HIS A 1 74  ? 132.355 134.678 160.191 1.00 477.12 ? 74  HIS A ND1 1 
ATOM 307   C CD2 . HIS A 1 74  ? 133.278 136.657 160.228 1.00 459.31 ? 74  HIS A CD2 1 
ATOM 308   C CE1 . HIS A 1 74  ? 132.811 134.872 161.416 1.00 491.64 ? 74  HIS A CE1 1 
ATOM 309   N NE2 . HIS A 1 74  ? 133.379 136.064 161.463 1.00 491.11 ? 74  HIS A NE2 1 
ATOM 310   N N   . VAL A 1 75  ? 129.426 137.698 159.031 1.00 442.43 ? 75  VAL A N   1 
ATOM 311   C CA  . VAL A 1 75  ? 129.096 139.041 159.514 1.00 472.42 ? 75  VAL A CA  1 
ATOM 312   C C   . VAL A 1 75  ? 130.277 139.509 160.349 1.00 448.51 ? 75  VAL A C   1 
ATOM 313   O O   . VAL A 1 75  ? 130.896 138.692 161.035 1.00 427.43 ? 75  VAL A O   1 
ATOM 314   C CB  . VAL A 1 75  ? 127.776 139.110 160.335 1.00 494.65 ? 75  VAL A CB  1 
ATOM 315   C CG1 . VAL A 1 75  ? 126.602 138.578 159.520 1.00 500.00 ? 75  VAL A CG1 1 
ATOM 316   C CG2 . VAL A 1 75  ? 127.889 138.381 161.672 1.00 500.00 ? 75  VAL A CG2 1 
ATOM 317   N N   . VAL A 1 76  ? 130.608 140.800 160.262 1.00 468.70 ? 76  VAL A N   1 
ATOM 318   C CA  . VAL A 1 76  ? 131.709 141.369 161.063 1.00 468.53 ? 76  VAL A CA  1 
ATOM 319   C C   . VAL A 1 76  ? 131.204 142.572 161.870 1.00 440.82 ? 76  VAL A C   1 
ATOM 320   O O   . VAL A 1 76  ? 131.156 143.700 161.375 1.00 463.44 ? 76  VAL A O   1 
ATOM 321   C CB  . VAL A 1 76  ? 132.927 141.740 160.182 1.00 490.74 ? 76  VAL A CB  1 
ATOM 322   C CG1 . VAL A 1 76  ? 134.175 141.974 161.034 1.00 453.83 ? 76  VAL A CG1 1 
ATOM 323   C CG2 . VAL A 1 76  ? 133.196 140.647 159.151 1.00 500.00 ? 76  VAL A CG2 1 
ATOM 324   N N   . GLU A 1 77  ? 130.817 142.298 163.116 1.00 450.29 ? 77  GLU A N   1 
ATOM 325   C CA  . GLU A 1 77  ? 130.260 143.295 164.036 1.00 499.17 ? 77  GLU A CA  1 
ATOM 326   C C   . GLU A 1 77  ? 131.276 143.767 165.087 1.00 471.05 ? 77  GLU A C   1 
ATOM 327   O O   . GLU A 1 77  ? 130.930 144.541 165.982 1.00 457.33 ? 77  GLU A O   1 
ATOM 328   C CB  . GLU A 1 77  ? 129.001 142.729 164.710 1.00 500.00 ? 77  GLU A CB  1 
ATOM 329   C CG  . GLU A 1 77  ? 127.890 142.365 163.717 1.00 500.00 ? 77  GLU A CG  1 
ATOM 330   C CD  . GLU A 1 77  ? 126.721 141.609 164.338 1.00 500.00 ? 77  GLU A CD  1 
ATOM 331   O OE1 . GLU A 1 77  ? 126.489 141.747 165.562 1.00 500.00 ? 77  GLU A OE1 1 
ATOM 332   O OE2 . GLU A 1 77  ? 126.025 140.878 163.592 1.00 500.00 ? 77  GLU A OE2 1 
ATOM 333   N N   . LYS A 1 78  ? 132.515 143.285 164.977 1.00 478.36 ? 78  LYS A N   1 
ATOM 334   C CA  . LYS A 1 78  ? 133.666 143.844 165.697 1.00 471.06 ? 78  LYS A CA  1 
ATOM 335   C C   . LYS A 1 78  ? 134.950 143.332 165.078 1.00 445.63 ? 78  LYS A C   1 
ATOM 336   O O   . LYS A 1 78  ? 134.940 142.403 164.269 1.00 459.02 ? 78  LYS A O   1 
ATOM 337   C CB  . LYS A 1 78  ? 133.643 143.488 167.180 1.00 490.18 ? 78  LYS A CB  1 
ATOM 338   C CG  . LYS A 1 78  ? 133.681 141.995 167.467 1.00 500.00 ? 78  LYS A CG  1 
ATOM 339   C CD  . LYS A 1 78  ? 133.375 141.715 168.926 1.00 500.00 ? 78  LYS A CD  1 
ATOM 340   C CE  . LYS A 1 78  ? 131.882 141.816 169.212 1.00 500.00 ? 78  LYS A CE  1 
ATOM 341   N NZ  . LYS A 1 78  ? 131.580 141.589 170.652 1.00 500.00 ? 78  LYS A NZ  1 
ATOM 342   N N   . GLU A 1 79  ? 136.059 143.924 165.488 1.00 427.84 ? 79  GLU A N   1 
ATOM 343   C CA  . GLU A 1 79  ? 137.361 143.634 164.874 1.00 500.00 ? 79  GLU A CA  1 
ATOM 344   C C   . GLU A 1 79  ? 137.888 142.209 165.111 1.00 500.00 ? 79  GLU A C   1 
ATOM 345   O O   . GLU A 1 79  ? 138.693 141.683 164.317 1.00 500.00 ? 79  GLU A O   1 
ATOM 346   C CB  . GLU A 1 79  ? 138.376 144.715 165.292 1.00 500.00 ? 79  GLU A CB  1 
ATOM 347   C CG  . GLU A 1 79  ? 138.296 146.027 164.483 1.00 500.00 ? 79  GLU A CG  1 
ATOM 348   C CD  . GLU A 1 79  ? 136.882 146.590 164.270 1.00 500.00 ? 79  GLU A CD  1 
ATOM 349   O OE1 . GLU A 1 79  ? 136.048 146.513 165.197 1.00 500.00 ? 79  GLU A OE1 1 
ATOM 350   O OE2 . GLU A 1 79  ? 136.604 147.125 163.172 1.00 494.71 ? 79  GLU A OE2 1 
ATOM 351   N N   . GLU A 1 80  ? 137.376 141.590 166.175 1.00 500.00 ? 80  GLU A N   1 
ATOM 352   C CA  . GLU A 1 80  ? 137.693 140.210 166.500 1.00 500.00 ? 80  GLU A CA  1 
ATOM 353   C C   . GLU A 1 80  ? 137.296 139.287 165.351 1.00 500.00 ? 80  GLU A C   1 
ATOM 354   O O   . GLU A 1 80  ? 138.078 138.404 164.972 1.00 440.91 ? 80  GLU A O   1 
ATOM 355   C CB  . GLU A 1 80  ? 137.084 139.789 167.843 1.00 500.00 ? 80  GLU A CB  1 
ATOM 356   C CG  . GLU A 1 80  ? 137.407 140.732 169.017 1.00 500.00 ? 80  GLU A CG  1 
ATOM 357   C CD  . GLU A 1 80  ? 138.758 141.452 168.903 1.00 500.00 ? 80  GLU A CD  1 
ATOM 358   O OE1 . GLU A 1 80  ? 139.813 140.770 168.886 1.00 500.00 ? 80  GLU A OE1 1 
ATOM 359   O OE2 . GLU A 1 80  ? 138.761 142.704 168.828 1.00 500.00 ? 80  GLU A OE2 1 
ATOM 360   N N   . ASP A 1 81  ? 136.106 139.526 164.815 1.00 478.95 ? 81  ASP A N   1 
ATOM 361   C CA  . ASP A 1 81  ? 135.575 138.746 163.700 1.00 500.00 ? 81  ASP A CA  1 
ATOM 362   C C   . ASP A 1 81  ? 136.519 138.839 162.496 1.00 498.03 ? 81  ASP A C   1 
ATOM 363   O O   . ASP A 1 81  ? 136.845 137.821 161.862 1.00 500.00 ? 81  ASP A O   1 
ATOM 364   C CB  . ASP A 1 81  ? 134.137 139.178 163.396 1.00 500.00 ? 81  ASP A CB  1 
ATOM 365   C CG  . ASP A 1 81  ? 133.175 138.887 164.566 1.00 500.00 ? 81  ASP A CG  1 
ATOM 366   O OD1 . ASP A 1 81  ? 133.652 138.641 165.699 1.00 500.00 ? 81  ASP A OD1 1 
ATOM 367   O OD2 . ASP A 1 81  ? 131.942 138.909 164.359 1.00 500.00 ? 81  ASP A OD2 1 
ATOM 368   N N   . LEU A 1 82  ? 136.937 140.067 162.225 1.00 447.93 ? 82  LEU A N   1 
ATOM 369   C CA  . LEU A 1 82  ? 137.855 140.366 161.122 1.00 486.96 ? 82  LEU A CA  1 
ATOM 370   C C   . LEU A 1 82  ? 139.153 139.579 161.285 1.00 500.00 ? 82  LEU A C   1 
ATOM 371   O O   . LEU A 1 82  ? 139.655 138.966 160.332 1.00 500.00 ? 82  LEU A O   1 
ATOM 372   C CB  . LEU A 1 82  ? 138.158 141.864 161.077 1.00 500.00 ? 82  LEU A CB  1 
ATOM 373   C CG  . LEU A 1 82  ? 139.156 142.329 160.018 1.00 500.00 ? 82  LEU A CG  1 
ATOM 374   C CD1 . LEU A 1 82  ? 138.597 142.097 158.619 1.00 500.00 ? 82  LEU A CD1 1 
ATOM 375   C CD2 . LEU A 1 82  ? 139.507 143.791 160.235 1.00 500.00 ? 82  LEU A CD2 1 
ATOM 376   N N   . GLN A 1 83  ? 139.662 139.624 162.506 1.00 500.00 ? 83  GLN A N   1 
ATOM 377   C CA  . GLN A 1 83  ? 140.902 138.932 162.881 1.00 500.00 ? 83  GLN A CA  1 
ATOM 378   C C   . GLN A 1 83  ? 140.776 137.437 162.603 1.00 478.76 ? 83  GLN A C   1 
ATOM 379   O O   . GLN A 1 83  ? 141.670 136.817 162.021 1.00 469.89 ? 83  GLN A O   1 
ATOM 380   C CB  . GLN A 1 83  ? 141.167 139.172 164.368 1.00 500.00 ? 83  GLN A CB  1 
ATOM 381   C CG  . GLN A 1 83  ? 142.542 138.820 164.890 1.00 500.00 ? 83  GLN A CG  1 
ATOM 382   C CD  . GLN A 1 83  ? 142.692 139.238 166.349 1.00 500.00 ? 83  GLN A CD  1 
ATOM 383   O OE1 . GLN A 1 83  ? 142.556 140.417 166.686 1.00 500.00 ? 83  GLN A OE1 1 
ATOM 384   N NE2 . GLN A 1 83  ? 142.952 138.272 167.221 1.00 500.00 ? 83  GLN A NE2 1 
ATOM 385   N N   . TRP A 1 84  ? 139.646 136.899 163.038 1.00 500.00 ? 84  TRP A N   1 
ATOM 386   C CA  . TRP A 1 84  ? 139.319 135.476 162.871 1.00 500.00 ? 84  TRP A CA  1 
ATOM 387   C C   . TRP A 1 84  ? 139.345 135.104 161.392 1.00 487.37 ? 84  TRP A C   1 
ATOM 388   O O   . TRP A 1 84  ? 139.932 134.086 160.997 1.00 424.04 ? 84  TRP A O   1 
ATOM 389   C CB  . TRP A 1 84  ? 137.937 135.118 163.475 1.00 500.00 ? 84  TRP A CB  1 
ATOM 390   C CG  . TRP A 1 84  ? 137.050 134.191 162.610 1.00 500.00 ? 84  TRP A CG  1 
ATOM 391   C CD1 . TRP A 1 84  ? 136.241 134.563 161.568 1.00 500.00 ? 84  TRP A CD1 1 
ATOM 392   C CD2 . TRP A 1 84  ? 136.890 132.777 162.743 1.00 500.00 ? 84  TRP A CD2 1 
ATOM 393   N NE1 . TRP A 1 84  ? 135.609 133.474 161.038 1.00 500.00 ? 84  TRP A NE1 1 
ATOM 394   C CE2 . TRP A 1 84  ? 135.982 132.362 161.743 1.00 500.00 ? 84  TRP A CE2 1 
ATOM 395   C CE3 . TRP A 1 84  ? 137.421 131.819 163.611 1.00 500.00 ? 84  TRP A CE3 1 
ATOM 396   C CZ2 . TRP A 1 84  ? 135.594 131.030 161.585 1.00 500.00 ? 84  TRP A CZ2 1 
ATOM 397   C CZ3 . TRP A 1 84  ? 137.042 130.493 163.451 1.00 500.00 ? 84  TRP A CZ3 1 
ATOM 398   C CH2 . TRP A 1 84  ? 136.133 130.111 162.445 1.00 500.00 ? 84  TRP A CH2 1 
ATOM 399   N N   . VAL A 1 85  ? 138.694 135.954 160.609 1.00 463.94 ? 85  VAL A N   1 
ATOM 400   C CA  . VAL A 1 85  ? 138.595 135.779 159.154 1.00 429.74 ? 85  VAL A CA  1 
ATOM 401   C C   . VAL A 1 85  ? 139.990 135.723 158.538 1.00 443.91 ? 85  VAL A C   1 
ATOM 402   O O   . VAL A 1 85  ? 140.288 134.849 157.710 1.00 456.61 ? 85  VAL A O   1 
ATOM 403   C CB  . VAL A 1 85  ? 137.752 136.886 158.470 1.00 444.77 ? 85  VAL A CB  1 
ATOM 404   C CG1 . VAL A 1 85  ? 138.157 137.094 157.008 1.00 462.07 ? 85  VAL A CG1 1 
ATOM 405   C CG2 . VAL A 1 85  ? 136.265 136.565 158.580 1.00 438.05 ? 85  VAL A CG2 1 
ATOM 406   N N   . LEU A 1 86  ? 140.811 136.672 158.966 1.00 473.11 ? 86  LEU A N   1 
ATOM 407   C CA  . LEU A 1 86  ? 142.200 136.787 158.508 1.00 500.00 ? 86  LEU A CA  1 
ATOM 408   C C   . LEU A 1 86  ? 143.113 135.760 159.200 1.00 500.00 ? 86  LEU A C   1 
ATOM 409   O O   . LEU A 1 86  ? 143.712 134.908 158.538 1.00 500.00 ? 86  LEU A O   1 
ATOM 410   C CB  . LEU A 1 86  ? 142.738 138.214 158.699 1.00 500.00 ? 86  LEU A CB  1 
ATOM 411   C CG  . LEU A 1 86  ? 142.404 139.289 157.640 1.00 500.00 ? 86  LEU A CG  1 
ATOM 412   C CD1 . LEU A 1 86  ? 142.044 138.735 156.263 1.00 500.00 ? 86  LEU A CD1 1 
ATOM 413   C CD2 . LEU A 1 86  ? 141.286 140.207 158.098 1.00 500.00 ? 86  LEU A CD2 1 
ATOM 414   N N   . THR A 1 87  ? 143.235 135.862 160.521 1.00 500.00 ? 87  THR A N   1 
ATOM 415   C CA  . THR A 1 87  ? 144.131 134.999 161.309 1.00 500.00 ? 87  THR A CA  1 
ATOM 416   C C   . THR A 1 87  ? 143.652 133.537 161.357 1.00 500.00 ? 87  THR A C   1 
ATOM 417   O O   . THR A 1 87  ? 144.397 132.629 160.981 1.00 500.00 ? 87  THR A O   1 
ATOM 418   C CB  . THR A 1 87  ? 144.435 135.595 162.736 1.00 500.00 ? 87  THR A CB  1 
ATOM 419   O OG1 . THR A 1 87  ? 145.763 135.235 163.140 1.00 500.00 ? 87  THR A OG1 1 
ATOM 420   C CG2 . THR A 1 87  ? 143.447 135.145 163.845 1.00 500.00 ? 87  THR A CG2 1 
ATOM 421   N N   . ASP A 1 88  ? 142.406 133.319 161.769 1.00 500.00 ? 88  ASP A N   1 
ATOM 422   C CA  . ASP A 1 88  ? 141.928 131.977 162.079 1.00 500.00 ? 88  ASP A CA  1 
ATOM 423   C C   . ASP A 1 88  ? 141.446 131.267 160.809 1.00 500.00 ? 88  ASP A C   1 
ATOM 424   O O   . ASP A 1 88  ? 142.134 130.363 160.335 1.00 500.00 ? 88  ASP A O   1 
ATOM 425   C CB  . ASP A 1 88  ? 140.857 132.030 163.177 1.00 500.00 ? 88  ASP A CB  1 
ATOM 426   C CG  . ASP A 1 88  ? 140.811 130.766 164.010 1.00 500.00 ? 88  ASP A CG  1 
ATOM 427   O OD1 . ASP A 1 88  ? 140.854 129.661 163.431 1.00 500.00 ? 88  ASP A OD1 1 
ATOM 428   O OD2 . ASP A 1 88  ? 140.734 130.882 165.252 1.00 500.00 ? 88  ASP A OD2 1 
ATOM 429   N N   . GLY A 1 89  ? 140.300 131.687 160.261 1.00 495.19 ? 89  GLY A N   1 
ATOM 430   C CA  . GLY A 1 89  ? 139.742 131.173 158.998 1.00 500.00 ? 89  GLY A CA  1 
ATOM 431   C C   . GLY A 1 89  ? 140.064 129.734 158.587 1.00 491.88 ? 89  GLY A C   1 
ATOM 432   O O   . GLY A 1 89  ? 141.044 129.505 157.868 1.00 430.62 ? 89  GLY A O   1 
ATOM 433   N N   . PRO A 1 90  ? 139.240 128.756 159.027 1.00 484.02 ? 90  PRO A N   1 
ATOM 434   C CA  . PRO A 1 90  ? 139.392 127.374 158.547 1.00 481.09 ? 90  PRO A CA  1 
ATOM 435   C C   . PRO A 1 90  ? 139.055 127.179 157.056 1.00 486.46 ? 90  PRO A C   1 
ATOM 436   O O   . PRO A 1 90  ? 139.473 126.182 156.454 1.00 468.88 ? 90  PRO A O   1 
ATOM 437   C CB  . PRO A 1 90  ? 138.398 126.575 159.416 1.00 468.81 ? 90  PRO A CB  1 
ATOM 438   C CG  . PRO A 1 90  ? 137.956 127.485 160.504 1.00 445.74 ? 90  PRO A CG  1 
ATOM 439   C CD  . PRO A 1 90  ? 138.126 128.878 159.985 1.00 480.42 ? 90  PRO A CD  1 
ATOM 440   N N   . ASN A 1 91  ? 138.291 128.117 156.487 1.00 465.77 ? 91  ASN A N   1 
ATOM 441   C CA  . ASN A 1 91  ? 137.715 128.000 155.150 1.00 414.91 ? 91  ASN A CA  1 
ATOM 442   C C   . ASN A 1 91  ? 137.981 129.296 154.348 1.00 412.71 ? 91  ASN A C   1 
ATOM 443   O O   . ASN A 1 91  ? 137.091 129.792 153.669 1.00 390.26 ? 91  ASN A O   1 
ATOM 444   C CB  . ASN A 1 91  ? 136.222 127.729 155.322 1.00 427.75 ? 91  ASN A CB  1 
ATOM 445   C CG  . ASN A 1 91  ? 135.920 126.904 156.572 1.00 432.09 ? 91  ASN A CG  1 
ATOM 446   O OD1 . ASN A 1 91  ? 136.296 125.738 156.658 1.00 442.56 ? 91  ASN A OD1 1 
ATOM 447   N ND2 . ASN A 1 91  ? 135.270 127.520 157.558 1.00 416.91 ? 91  ASN A ND2 1 
ATOM 448   N N   . PRO A 1 92  ? 139.245 129.797 154.378 1.00 500.00 ? 92  PRO A N   1 
ATOM 449   C CA  . PRO A 1 92  ? 139.752 131.183 154.145 1.00 500.00 ? 92  PRO A CA  1 
ATOM 450   C C   . PRO A 1 92  ? 139.082 132.126 153.124 1.00 492.12 ? 92  PRO A C   1 
ATOM 451   O O   . PRO A 1 92  ? 138.932 133.318 153.422 1.00 447.71 ? 92  PRO A O   1 
ATOM 452   C CB  . PRO A 1 92  ? 141.231 130.970 153.749 1.00 500.00 ? 92  PRO A CB  1 
ATOM 453   C CG  . PRO A 1 92  ? 141.414 129.510 153.577 1.00 500.00 ? 92  PRO A CG  1 
ATOM 454   C CD  . PRO A 1 92  ? 140.376 128.850 154.429 1.00 500.00 ? 92  PRO A CD  1 
ATOM 455   N N   . PRO A 1 93  ? 138.745 131.634 151.915 1.00 455.97 ? 93  PRO A N   1 
ATOM 456   C CA  . PRO A 1 93  ? 137.936 132.477 151.051 1.00 446.54 ? 93  PRO A CA  1 
ATOM 457   C C   . PRO A 1 93  ? 136.618 132.803 151.733 1.00 470.56 ? 93  PRO A C   1 
ATOM 458   O O   . PRO A 1 93  ? 135.659 132.031 151.655 1.00 500.00 ? 93  PRO A O   1 
ATOM 459   C CB  . PRO A 1 93  ? 137.735 131.609 149.802 1.00 491.21 ? 93  PRO A CB  1 
ATOM 460   C CG  . PRO A 1 93  ? 137.927 130.216 150.284 1.00 500.00 ? 93  PRO A CG  1 
ATOM 461   C CD  . PRO A 1 93  ? 139.063 130.363 151.244 1.00 496.62 ? 93  PRO A CD  1 
ATOM 462   N N   . TYR A 1 94  ? 136.607 133.930 152.440 1.00 418.54 ? 94  TYR A N   1 
ATOM 463   C CA  . TYR A 1 94  ? 135.419 134.389 153.128 1.00 408.37 ? 94  TYR A CA  1 
ATOM 464   C C   . TYR A 1 94  ? 134.759 135.527 152.363 1.00 409.61 ? 94  TYR A C   1 
ATOM 465   O O   . TYR A 1 94  ? 135.440 136.388 151.788 1.00 374.14 ? 94  TYR A O   1 
ATOM 466   C CB  . TYR A 1 94  ? 135.756 134.817 154.555 1.00 443.27 ? 94  TYR A CB  1 
ATOM 467   C CG  . TYR A 1 94  ? 135.665 133.687 155.545 1.00 487.71 ? 94  TYR A CG  1 
ATOM 468   C CD1 . TYR A 1 94  ? 134.443 133.345 156.123 1.00 500.00 ? 94  TYR A CD1 1 
ATOM 469   C CD2 . TYR A 1 94  ? 136.793 132.944 155.899 1.00 500.00 ? 94  TYR A CD2 1 
ATOM 470   C CE1 . TYR A 1 94  ? 134.346 132.304 157.035 1.00 500.00 ? 94  TYR A CE1 1 
ATOM 471   C CE2 . TYR A 1 94  ? 136.710 131.898 156.809 1.00 500.00 ? 94  TYR A CE2 1 
ATOM 472   C CZ  . TYR A 1 94  ? 135.486 131.580 157.374 1.00 500.00 ? 94  TYR A CZ  1 
ATOM 473   O OH  . TYR A 1 94  ? 135.398 130.543 158.275 1.00 500.00 ? 94  TYR A OH  1 
ATOM 474   N N   . MET A 1 95  ? 133.430 135.480 152.321 1.00 415.35 ? 95  MET A N   1 
ATOM 475   C CA  . MET A 1 95  ? 132.619 136.630 151.956 1.00 441.55 ? 95  MET A CA  1 
ATOM 476   C C   . MET A 1 95  ? 132.209 137.275 153.263 1.00 429.66 ? 95  MET A C   1 
ATOM 477   O O   . MET A 1 95  ? 131.778 136.584 154.179 1.00 450.65 ? 95  MET A O   1 
ATOM 478   C CB  . MET A 1 95  ? 131.386 136.217 151.151 1.00 464.13 ? 95  MET A CB  1 
ATOM 479   C CG  . MET A 1 95  ? 131.622 136.219 149.650 1.00 500.00 ? 95  MET A CG  1 
ATOM 480   S SD  . MET A 1 95  ? 131.584 137.881 148.943 1.00 500.00 ? 95  MET A SD  1 
ATOM 481   C CE  . MET A 1 95  ? 131.987 137.519 147.237 1.00 500.00 ? 95  MET A CE  1 
ATOM 482   N N   . VAL A 1 96  ? 132.359 138.591 153.357 1.00 421.57 ? 96  VAL A N   1 
ATOM 483   C CA  . VAL A 1 96  ? 132.080 139.283 154.613 1.00 427.82 ? 96  VAL A CA  1 
ATOM 484   C C   . VAL A 1 96  ? 130.916 140.226 154.472 1.00 409.64 ? 96  VAL A C   1 
ATOM 485   O O   . VAL A 1 96  ? 130.666 140.781 153.388 1.00 423.08 ? 96  VAL A O   1 
ATOM 486   C CB  . VAL A 1 96  ? 133.292 140.058 155.187 1.00 459.76 ? 96  VAL A CB  1 
ATOM 487   C CG1 . VAL A 1 96  ? 134.424 139.101 155.512 1.00 482.14 ? 96  VAL A CG1 1 
ATOM 488   C CG2 . VAL A 1 96  ? 133.762 141.171 154.257 1.00 480.84 ? 96  VAL A CG2 1 
ATOM 489   N N   . LEU A 1 97  ? 130.213 140.400 155.588 1.00 390.74 ? 97  LEU A N   1 
ATOM 490   C CA  . LEU A 1 97  ? 129.142 141.364 155.674 1.00 446.98 ? 97  LEU A CA  1 
ATOM 491   C C   . LEU A 1 97  ? 129.516 142.391 156.737 1.00 474.88 ? 97  LEU A C   1 
ATOM 492   O O   . LEU A 1 97  ? 129.709 142.051 157.920 1.00 500.00 ? 97  LEU A O   1 
ATOM 493   C CB  . LEU A 1 97  ? 127.802 140.675 155.972 1.00 464.02 ? 97  LEU A CB  1 
ATOM 494   C CG  . LEU A 1 97  ? 126.561 141.339 155.333 1.00 466.72 ? 97  LEU A CG  1 
ATOM 495   C CD1 . LEU A 1 97  ? 125.647 140.308 154.695 1.00 452.14 ? 97  LEU A CD1 1 
ATOM 496   C CD2 . LEU A 1 97  ? 125.775 142.189 156.320 1.00 489.46 ? 97  LEU A CD2 1 
ATOM 497   N N   . LEU A 1 98  ? 129.676 143.633 156.279 1.00 462.27 ? 98  LEU A N   1 
ATOM 498   C CA  . LEU A 1 98  ? 129.797 144.793 157.144 1.00 443.78 ? 98  LEU A CA  1 
ATOM 499   C C   . LEU A 1 98  ? 128.496 145.546 157.096 1.00 416.50 ? 98  LEU A C   1 
ATOM 500   O O   . LEU A 1 98  ? 127.899 145.708 156.028 1.00 389.63 ? 98  LEU A O   1 
ATOM 501   C CB  . LEU A 1 98  ? 130.885 145.739 156.646 1.00 449.04 ? 98  LEU A CB  1 
ATOM 502   C CG  . LEU A 1 98  ? 132.225 145.113 156.295 1.00 500.00 ? 98  LEU A CG  1 
ATOM 503   C CD1 . LEU A 1 98  ? 133.144 146.164 155.702 1.00 500.00 ? 98  LEU A CD1 1 
ATOM 504   C CD2 . LEU A 1 98  ? 132.840 144.473 157.526 1.00 500.00 ? 98  LEU A CD2 1 
ATOM 505   N N   . GLU A 1 99  ? 128.062 146.027 158.252 1.00 414.27 ? 99  GLU A N   1 
ATOM 506   C CA  . GLU A 1 99  ? 127.192 147.182 158.263 1.00 491.55 ? 99  GLU A CA  1 
ATOM 507   C C   . GLU A 1 99  ? 128.010 148.330 157.688 1.00 462.69 ? 99  GLU A C   1 
ATOM 508   O O   . GLU A 1 99  ? 129.248 148.321 157.754 1.00 469.76 ? 99  GLU A O   1 
ATOM 509   C CB  . GLU A 1 99  ? 126.702 147.512 159.673 1.00 500.00 ? 99  GLU A CB  1 
ATOM 510   C CG  . GLU A 1 99  ? 125.475 146.711 160.098 1.00 500.00 ? 99  GLU A CG  1 
ATOM 511   C CD  . GLU A 1 99  ? 124.148 147.318 159.622 1.00 500.00 ? 99  GLU A CD  1 
ATOM 512   O OE1 . GLU A 1 99  ? 123.735 148.366 160.172 1.00 500.00 ? 99  GLU A OE1 1 
ATOM 513   O OE2 . GLU A 1 99  ? 123.498 146.738 158.716 1.00 500.00 ? 99  GLU A OE2 1 
ATOM 514   N N   . SER A 1 100 ? 127.319 149.315 157.129 1.00 410.83 ? 100 SER A N   1 
ATOM 515   C CA  . SER A 1 100 ? 127.994 150.427 156.468 1.00 423.06 ? 100 SER A CA  1 
ATOM 516   C C   . SER A 1 100 ? 128.927 151.200 157.423 1.00 423.00 ? 100 SER A C   1 
ATOM 517   O O   . SER A 1 100 ? 130.014 151.622 157.023 1.00 378.70 ? 100 SER A O   1 
ATOM 518   C CB  . SER A 1 100 ? 126.979 151.360 155.798 1.00 450.84 ? 100 SER A CB  1 
ATOM 519   O OG  . SER A 1 100 ? 127.381 151.669 154.476 1.00 500.00 ? 100 SER A OG  1 
ATOM 520   N N   . LYS A 1 101 ? 128.511 151.324 158.688 1.00 456.40 ? 101 LYS A N   1 
ATOM 521   C CA  . LYS A 1 101 ? 129.262 152.038 159.749 1.00 471.05 ? 101 LYS A CA  1 
ATOM 522   C C   . LYS A 1 101 ? 130.760 151.768 159.804 1.00 450.87 ? 101 LYS A C   1 
ATOM 523   O O   . LYS A 1 101 ? 131.553 152.690 159.976 1.00 481.44 ? 101 LYS A O   1 
ATOM 524   C CB  . LYS A 1 101 ? 128.689 151.694 161.126 1.00 480.52 ? 101 LYS A CB  1 
ATOM 525   C CG  . LYS A 1 101 ? 127.338 152.327 161.399 1.00 500.00 ? 101 LYS A CG  1 
ATOM 526   C CD  . LYS A 1 101 ? 126.751 151.874 162.725 1.00 500.00 ? 101 LYS A CD  1 
ATOM 527   C CE  . LYS A 1 101 ? 126.319 150.414 162.698 1.00 500.00 ? 101 LYS A CE  1 
ATOM 528   N NZ  . LYS A 1 101 ? 125.403 150.077 163.826 1.00 500.00 ? 101 LYS A NZ  1 
ATOM 529   N N   . HIS A 1 102 ? 131.134 150.504 159.665 1.00 447.79 ? 102 HIS A N   1 
ATOM 530   C CA  . HIS A 1 102 ? 132.528 150.100 159.799 1.00 453.18 ? 102 HIS A CA  1 
ATOM 531   C C   . HIS A 1 102 ? 133.343 150.269 158.528 1.00 456.13 ? 102 HIS A C   1 
ATOM 532   O O   . HIS A 1 102 ? 134.572 150.242 158.595 1.00 460.18 ? 102 HIS A O   1 
ATOM 533   C CB  . HIS A 1 102 ? 132.599 148.660 160.291 1.00 455.79 ? 102 HIS A CB  1 
ATOM 534   C CG  . HIS A 1 102 ? 131.915 148.472 161.600 1.00 475.60 ? 102 HIS A CG  1 
ATOM 535   N ND1 . HIS A 1 102 ? 130.579 148.157 161.696 1.00 500.00 ? 102 HIS A ND1 1 
ATOM 536   C CD2 . HIS A 1 102 ? 132.360 148.630 162.865 1.00 495.72 ? 102 HIS A CD2 1 
ATOM 537   C CE1 . HIS A 1 102 ? 130.237 148.092 162.968 1.00 500.00 ? 102 HIS A CE1 1 
ATOM 538   N NE2 . HIS A 1 102 ? 131.300 148.375 163.700 1.00 500.00 ? 102 HIS A NE2 1 
ATOM 539   N N   . PHE A 1 103 ? 132.676 150.466 157.388 1.00 440.32 ? 103 PHE A N   1 
ATOM 540   C CA  . PHE A 1 103 ? 133.345 150.513 156.082 1.00 471.55 ? 103 PHE A CA  1 
ATOM 541   C C   . PHE A 1 103 ? 134.286 151.709 155.951 1.00 426.27 ? 103 PHE A C   1 
ATOM 542   O O   . PHE A 1 103 ? 133.966 152.708 155.300 1.00 412.63 ? 103 PHE A O   1 
ATOM 543   C CB  . PHE A 1 103 ? 132.302 150.502 154.958 1.00 500.00 ? 103 PHE A CB  1 
ATOM 544   C CG  . PHE A 1 103 ? 132.888 150.346 153.581 1.00 487.63 ? 103 PHE A CG  1 
ATOM 545   C CD1 . PHE A 1 103 ? 133.490 149.157 153.204 1.00 455.00 ? 103 PHE A CD1 1 
ATOM 546   C CD2 . PHE A 1 103 ? 132.818 151.383 152.654 1.00 487.78 ? 103 PHE A CD2 1 
ATOM 547   C CE1 . PHE A 1 103 ? 134.019 149.006 151.941 1.00 434.89 ? 103 PHE A CE1 1 
ATOM 548   C CE2 . PHE A 1 103 ? 133.344 151.236 151.384 1.00 454.00 ? 103 PHE A CE2 1 
ATOM 549   C CZ  . PHE A 1 103 ? 133.944 150.043 151.028 1.00 444.60 ? 103 PHE A CZ  1 
ATOM 550   N N   . THR A 1 104 ? 135.455 151.579 156.574 1.00 433.60 ? 104 THR A N   1 
ATOM 551   C CA  . THR A 1 104 ? 136.420 152.671 156.699 1.00 474.15 ? 104 THR A CA  1 
ATOM 552   C C   . THR A 1 104 ? 137.682 152.352 155.913 1.00 442.54 ? 104 THR A C   1 
ATOM 553   O O   . THR A 1 104 ? 137.722 151.366 155.178 1.00 419.88 ? 104 THR A O   1 
ATOM 554   C CB  . THR A 1 104 ? 136.740 153.003 158.182 1.00 500.00 ? 104 THR A CB  1 
ATOM 555   O OG1 . THR A 1 104 ? 137.441 154.252 158.251 1.00 500.00 ? 104 THR A OG1 1 
ATOM 556   C CG2 . THR A 1 104 ? 137.587 151.928 158.844 1.00 495.69 ? 104 THR A CG2 1 
ATOM 557   N N   . ARG A 1 105 ? 138.698 153.198 156.069 1.00 450.04 ? 105 ARG A N   1 
ATOM 558   C CA  . ARG A 1 105 ? 139.875 153.150 155.232 1.00 487.38 ? 105 ARG A CA  1 
ATOM 559   C C   . ARG A 1 105 ? 140.778 152.056 155.792 1.00 500.00 ? 105 ARG A C   1 
ATOM 560   O O   . ARG A 1 105 ? 141.275 151.230 155.022 1.00 500.00 ? 105 ARG A O   1 
ATOM 561   C CB  . ARG A 1 105 ? 140.612 154.504 155.261 1.00 483.71 ? 105 ARG A CB  1 
ATOM 562   C CG  . ARG A 1 105 ? 141.801 154.653 154.308 1.00 454.55 ? 105 ARG A CG  1 
ATOM 563   C CD  . ARG A 1 105 ? 141.343 154.741 152.862 1.00 478.57 ? 105 ARG A CD  1 
ATOM 564   N NE  . ARG A 1 105 ? 142.263 155.484 151.990 1.00 486.68 ? 105 ARG A NE  1 
ATOM 565   C CZ  . ARG A 1 105 ? 143.306 154.975 151.326 1.00 474.24 ? 105 ARG A CZ  1 
ATOM 566   N NH1 . ARG A 1 105 ? 143.634 153.684 151.432 1.00 456.12 ? 105 ARG A NH1 1 
ATOM 567   N NH2 . ARG A 1 105 ? 144.039 155.777 150.548 1.00 434.49 ? 105 ARG A NH2 1 
ATOM 568   N N   . ASP A 1 106 ? 141.059 152.164 157.088 1.00 500.00 ? 106 ASP A N   1 
ATOM 569   C CA  . ASP A 1 106 ? 142.045 151.332 157.758 1.00 500.00 ? 106 ASP A CA  1 
ATOM 570   C C   . ASP A 1 106 ? 141.699 149.858 157.603 1.00 500.00 ? 106 ASP A C   1 
ATOM 571   O O   . ASP A 1 106 ? 142.545 149.013 157.252 1.00 467.31 ? 106 ASP A O   1 
ATOM 572   C CB  . ASP A 1 106 ? 142.078 151.640 159.265 1.00 500.00 ? 106 ASP A CB  1 
ATOM 573   C CG  . ASP A 1 106 ? 142.540 153.057 159.580 1.00 500.00 ? 106 ASP A CG  1 
ATOM 574   O OD1 . ASP A 1 106 ? 143.569 153.499 159.018 1.00 500.00 ? 106 ASP A OD1 1 
ATOM 575   O OD2 . ASP A 1 106 ? 141.876 153.719 160.406 1.00 500.00 ? 106 ASP A OD2 1 
ATOM 576   N N   . LEU A 1 107 ? 140.428 149.588 157.885 1.00 500.00 ? 107 LEU A N   1 
ATOM 577   C CA  . LEU A 1 107 ? 139.869 148.222 157.809 1.00 498.85 ? 107 LEU A CA  1 
ATOM 578   C C   . LEU A 1 107 ? 140.051 147.667 156.412 1.00 492.28 ? 107 LEU A C   1 
ATOM 579   O O   . LEU A 1 107 ? 140.480 146.517 156.238 1.00 436.77 ? 107 LEU A O   1 
ATOM 580   C CB  . LEU A 1 107 ? 138.358 148.197 158.120 1.00 500.00 ? 107 LEU A CB  1 
ATOM 581   C CG  . LEU A 1 107 ? 137.407 147.305 157.275 1.00 500.00 ? 107 LEU A CG  1 
ATOM 582   C CD1 . LEU A 1 107 ? 137.669 145.810 157.438 1.00 500.00 ? 107 LEU A CD1 1 
ATOM 583   C CD2 . LEU A 1 107 ? 135.958 147.638 157.592 1.00 500.00 ? 107 LEU A CD2 1 
ATOM 584   N N   . MET A 1 108 ? 139.705 148.507 155.436 1.00 500.00 ? 108 MET A N   1 
ATOM 585   C CA  . MET A 1 108 ? 139.796 148.146 154.015 1.00 500.00 ? 108 MET A CA  1 
ATOM 586   C C   . MET A 1 108 ? 141.232 147.767 153.666 1.00 494.59 ? 108 MET A C   1 
ATOM 587   O O   . MET A 1 108 ? 141.474 146.748 153.002 1.00 479.23 ? 108 MET A O   1 
ATOM 588   C CB  . MET A 1 108 ? 139.291 149.272 153.112 1.00 500.00 ? 108 MET A CB  1 
ATOM 589   C CG  . MET A 1 108 ? 138.879 148.799 151.731 1.00 500.00 ? 108 MET A CG  1 
ATOM 590   S SD  . MET A 1 108 ? 137.338 147.864 151.745 1.00 500.00 ? 108 MET A SD  1 
ATOM 591   C CE  . MET A 1 108 ? 137.149 147.526 149.997 1.00 457.96 ? 108 MET A CE  1 
ATOM 592   N N   . GLU A 1 109 ? 142.149 148.605 154.129 1.00 473.00 ? 109 GLU A N   1 
ATOM 593   C CA  . GLU A 1 109 ? 143.583 148.414 153.893 1.00 500.00 ? 109 GLU A CA  1 
ATOM 594   C C   . GLU A 1 109 ? 144.035 147.070 154.450 1.00 500.00 ? 109 GLU A C   1 
ATOM 595   O O   . GLU A 1 109 ? 144.752 146.313 153.781 1.00 500.00 ? 109 GLU A O   1 
ATOM 596   C CB  . GLU A 1 109 ? 144.432 149.580 154.397 1.00 500.00 ? 109 GLU A CB  1 
ATOM 597   C CG  . GLU A 1 109 ? 145.530 149.964 153.412 1.00 500.00 ? 109 GLU A CG  1 
ATOM 598   C CD  . GLU A 1 109 ? 145.008 150.274 152.007 1.00 500.00 ? 109 GLU A CD  1 
ATOM 599   O OE1 . GLU A 1 109 ? 143.878 150.804 151.873 1.00 500.00 ? 109 GLU A OE1 1 
ATOM 600   O OE2 . GLU A 1 109 ? 145.733 149.978 151.032 1.00 500.00 ? 109 GLU A OE2 1 
ATOM 601   N N   . LYS A 1 110 ? 143.591 146.808 155.670 1.00 500.00 ? 110 LYS A N   1 
ATOM 602   C CA  . LYS A 1 110 ? 143.905 145.564 156.384 1.00 496.31 ? 110 LYS A CA  1 
ATOM 603   C C   . LYS A 1 110 ? 143.438 144.360 155.569 1.00 478.76 ? 110 LYS A C   1 
ATOM 604   O O   . LYS A 1 110 ? 144.174 143.380 155.390 1.00 420.31 ? 110 LYS A O   1 
ATOM 605   C CB  . LYS A 1 110 ? 143.218 145.570 157.747 1.00 500.00 ? 110 LYS A CB  1 
ATOM 606   C CG  . LYS A 1 110 ? 143.943 144.801 158.832 1.00 500.00 ? 110 LYS A CG  1 
ATOM 607   C CD  . LYS A 1 110 ? 143.202 144.936 160.158 1.00 500.00 ? 110 LYS A CD  1 
ATOM 608   C CE  . LYS A 1 110 ? 143.366 146.315 160.804 1.00 500.00 ? 110 LYS A CE  1 
ATOM 609   N NZ  . LYS A 1 110 ? 142.109 146.801 161.446 1.00 500.00 ? 110 LYS A NZ  1 
ATOM 610   N N   . LEU A 1 111 ? 142.208 144.474 155.094 1.00 469.66 ? 111 LEU A N   1 
ATOM 611   C CA  . LEU A 1 111 ? 141.561 143.434 154.287 1.00 437.59 ? 111 LEU A CA  1 
ATOM 612   C C   . LEU A 1 111 ? 142.395 143.144 153.039 1.00 407.94 ? 111 LEU A C   1 
ATOM 613   O O   . LEU A 1 111 ? 142.656 141.983 152.694 1.00 412.54 ? 111 LEU A O   1 
ATOM 614   C CB  . LEU A 1 111 ? 140.159 143.917 153.931 1.00 460.11 ? 111 LEU A CB  1 
ATOM 615   C CG  . LEU A 1 111 ? 139.089 142.849 153.779 1.00 500.00 ? 111 LEU A CG  1 
ATOM 616   C CD1 . LEU A 1 111 ? 137.799 143.267 154.484 1.00 500.00 ? 111 LEU A CD1 1 
ATOM 617   C CD2 . LEU A 1 111 ? 138.879 142.571 152.297 1.00 500.00 ? 111 LEU A CD2 1 
ATOM 618   N N   . LYS A 1 112 ? 142.795 144.229 152.395 1.00 450.90 ? 112 LYS A N   1 
ATOM 619   C CA  . LYS A 1 112 ? 143.605 144.179 151.172 1.00 494.19 ? 112 LYS A CA  1 
ATOM 620   C C   . LYS A 1 112 ? 144.907 143.431 151.436 1.00 500.00 ? 112 LYS A C   1 
ATOM 621   O O   . LYS A 1 112 ? 145.311 142.566 150.654 1.00 500.00 ? 112 LYS A O   1 
ATOM 622   C CB  . LYS A 1 112 ? 143.862 145.599 150.659 1.00 500.00 ? 112 LYS A CB  1 
ATOM 623   C CG  . LYS A 1 112 ? 144.201 145.705 149.187 1.00 500.00 ? 112 LYS A CG  1 
ATOM 624   C CD  . LYS A 1 112 ? 144.107 147.156 148.745 1.00 500.00 ? 112 LYS A CD  1 
ATOM 625   C CE  . LYS A 1 112 ? 144.580 147.338 147.318 1.00 500.00 ? 112 LYS A CE  1 
ATOM 626   N NZ  . LYS A 1 112 ? 144.632 148.778 146.944 1.00 500.00 ? 112 LYS A NZ  1 
ATOM 627   N N   . GLY A 1 113 ? 145.533 143.791 152.552 1.00 500.00 ? 113 GLY A N   1 
ATOM 628   C CA  . GLY A 1 113 ? 146.793 143.193 152.995 1.00 500.00 ? 113 GLY A CA  1 
ATOM 629   C C   . GLY A 1 113 ? 146.817 141.668 153.032 1.00 500.00 ? 113 GLY A C   1 
ATOM 630   O O   . GLY A 1 113 ? 147.836 141.069 152.689 1.00 500.00 ? 113 GLY A O   1 
ATOM 631   N N   . ARG A 1 114 ? 145.707 141.041 153.437 1.00 500.00 ? 114 ARG A N   1 
ATOM 632   C CA  . ARG A 1 114 ? 145.508 139.586 153.283 1.00 500.00 ? 114 ARG A CA  1 
ATOM 633   C C   . ARG A 1 114 ? 144.424 139.303 152.221 1.00 500.00 ? 114 ARG A C   1 
ATOM 634   O O   . ARG A 1 114 ? 143.513 138.491 152.427 1.00 462.22 ? 114 ARG A O   1 
ATOM 635   C CB  . ARG A 1 114 ? 145.132 138.950 154.622 1.00 500.00 ? 114 ARG A CB  1 
ATOM 636   C CG  . ARG A 1 114 ? 146.276 138.693 155.587 1.00 500.00 ? 114 ARG A CG  1 
ATOM 637   C CD  . ARG A 1 114 ? 145.673 138.324 156.936 1.00 500.00 ? 114 ARG A CD  1 
ATOM 638   N NE  . ARG A 1 114 ? 146.544 137.563 157.841 1.00 500.00 ? 114 ARG A NE  1 
ATOM 639   C CZ  . ARG A 1 114 ? 146.708 136.231 157.850 1.00 500.00 ? 114 ARG A CZ  1 
ATOM 640   N NH1 . ARG A 1 114 ? 146.094 135.439 156.964 1.00 500.00 ? 114 ARG A NH1 1 
ATOM 641   N NH2 . ARG A 1 114 ? 147.526 135.680 158.753 1.00 500.00 ? 114 ARG A NH2 1 
ATOM 642   N N   . THR A 1 115 ? 144.536 139.982 151.081 1.00 500.00 ? 115 THR A N   1 
ATOM 643   C CA  . THR A 1 115 ? 143.576 139.825 149.983 1.00 500.00 ? 115 THR A CA  1 
ATOM 644   C C   . THR A 1 115 ? 143.505 138.383 149.482 1.00 500.00 ? 115 THR A C   1 
ATOM 645   O O   . THR A 1 115 ? 142.428 137.911 149.114 1.00 500.00 ? 115 THR A O   1 
ATOM 646   C CB  . THR A 1 115 ? 143.850 140.786 148.790 1.00 500.00 ? 115 THR A CB  1 
ATOM 647   O OG1 . THR A 1 115 ? 142.848 140.600 147.782 1.00 500.00 ? 115 THR A OG1 1 
ATOM 648   C CG2 . THR A 1 115 ? 145.245 140.574 148.163 1.00 500.00 ? 115 THR A CG2 1 
ATOM 649   N N   . SER A 1 116 ? 144.645 137.693 149.482 1.00 500.00 ? 116 SER A N   1 
ATOM 650   C CA  . SER A 1 116 ? 144.725 136.292 149.056 1.00 500.00 ? 116 SER A CA  1 
ATOM 651   C C   . SER A 1 116 ? 143.720 135.400 149.776 1.00 496.88 ? 116 SER A C   1 
ATOM 652   O O   . SER A 1 116 ? 143.157 134.478 149.183 1.00 500.00 ? 116 SER A O   1 
ATOM 653   C CB  . SER A 1 116 ? 146.136 135.747 149.290 1.00 500.00 ? 116 SER A CB  1 
ATOM 654   O OG  . SER A 1 116 ? 147.120 136.612 148.747 1.00 500.00 ? 116 SER A OG  1 
ATOM 655   N N   . ARG A 1 117 ? 143.501 135.690 151.054 1.00 489.61 ? 117 ARG A N   1 
ATOM 656   C CA  . ARG A 1 117 ? 142.605 134.907 151.883 1.00 500.00 ? 117 ARG A CA  1 
ATOM 657   C C   . ARG A 1 117 ? 141.144 135.217 151.570 1.00 494.13 ? 117 ARG A C   1 
ATOM 658   O O   . ARG A 1 117 ? 140.400 134.338 151.146 1.00 452.18 ? 117 ARG A O   1 
ATOM 659   C CB  . ARG A 1 117 ? 142.909 135.176 153.357 1.00 500.00 ? 117 ARG A CB  1 
ATOM 660   C CG  . ARG A 1 117 ? 142.402 134.103 154.291 1.00 500.00 ? 117 ARG A CG  1 
ATOM 661   C CD  . ARG A 1 117 ? 142.647 134.506 155.727 1.00 500.00 ? 117 ARG A CD  1 
ATOM 662   N NE  . ARG A 1 117 ? 142.461 133.401 156.675 1.00 500.00 ? 117 ARG A NE  1 
ATOM 663   C CZ  . ARG A 1 117 ? 143.328 132.399 156.876 1.00 500.00 ? 117 ARG A CZ  1 
ATOM 664   N NH1 . ARG A 1 117 ? 144.476 132.326 156.196 1.00 500.00 ? 117 ARG A NH1 1 
ATOM 665   N NH2 . ARG A 1 117 ? 143.050 131.451 157.768 1.00 500.00 ? 117 ARG A NH2 1 
ATOM 666   N N   . ILE A 1 118 ? 140.762 136.479 151.754 1.00 471.08 ? 118 ILE A N   1 
ATOM 667   C CA  . ILE A 1 118 ? 139.359 136.914 151.683 1.00 451.29 ? 118 ILE A CA  1 
ATOM 668   C C   . ILE A 1 118 ? 138.850 137.193 150.272 1.00 426.15 ? 118 ILE A C   1 
ATOM 669   O O   . ILE A 1 118 ? 139.593 137.680 149.420 1.00 434.32 ? 118 ILE A O   1 
ATOM 670   C CB  . ILE A 1 118 ? 139.142 138.191 152.509 1.00 500.00 ? 118 ILE A CB  1 
ATOM 671   C CG1 . ILE A 1 118 ? 137.642 138.437 152.721 1.00 500.00 ? 118 ILE A CG1 1 
ATOM 672   C CG2 . ILE A 1 118 ? 139.819 139.401 151.858 1.00 500.00 ? 118 ILE A CG2 1 
ATOM 673   C CD1 . ILE A 1 118 ? 137.318 139.479 153.769 1.00 500.00 ? 118 ILE A CD1 1 
ATOM 674   N N   . ALA A 1 119 ? 137.569 136.912 150.045 1.00 404.86 ? 119 ALA A N   1 
ATOM 675   C CA  . ALA A 1 119 ? 136.953 137.128 148.738 1.00 434.34 ? 119 ALA A CA  1 
ATOM 676   C C   . ALA A 1 119 ? 135.675 137.917 148.882 1.00 453.18 ? 119 ALA A C   1 
ATOM 677   O O   . ALA A 1 119 ? 134.606 137.349 149.078 1.00 426.43 ? 119 ALA A O   1 
ATOM 678   C CB  . ALA A 1 119 ? 136.682 135.807 148.033 1.00 456.75 ? 119 ALA A CB  1 
ATOM 679   N N   . GLY A 1 120 ? 135.816 139.237 148.817 1.00 485.20 ? 120 GLY A N   1 
ATOM 680   C CA  . GLY A 1 120 ? 134.710 140.138 148.523 1.00 478.82 ? 120 GLY A CA  1 
ATOM 681   C C   . GLY A 1 120 ? 133.818 140.512 149.681 1.00 471.34 ? 120 GLY A C   1 
ATOM 682   O O   . GLY A 1 120 ? 133.720 139.764 150.656 1.00 500.00 ? 120 GLY A O   1 
ATOM 683   N N   . LEU A 1 121 ? 133.167 141.673 149.579 1.00 436.01 ? 121 LEU A N   1 
ATOM 684   C CA  . LEU A 1 121 ? 132.390 142.221 150.714 1.00 400.40 ? 121 LEU A CA  1 
ATOM 685   C C   . LEU A 1 121 ? 130.999 142.719 150.365 1.00 401.82 ? 121 LEU A C   1 
ATOM 686   O O   . LEU A 1 121 ? 130.824 143.599 149.507 1.00 409.62 ? 121 LEU A O   1 
ATOM 687   C CB  . LEU A 1 121 ? 133.121 143.389 151.373 1.00 405.71 ? 121 LEU A CB  1 
ATOM 688   C CG  . LEU A 1 121 ? 134.560 143.713 150.990 1.00 453.57 ? 121 LEU A CG  1 
ATOM 689   C CD1 . LEU A 1 121 ? 134.953 145.007 151.693 1.00 494.70 ? 121 LEU A CD1 1 
ATOM 690   C CD2 . LEU A 1 121 ? 135.532 142.593 151.335 1.00 468.61 ? 121 LEU A CD2 1 
ATOM 691   N N   . ALA A 1 122 ? 130.001 142.174 151.049 1.00 424.93 ? 122 ALA A N   1 
ATOM 692   C CA  . ALA A 1 122 ? 128.705 142.825 151.075 1.00 459.76 ? 122 ALA A CA  1 
ATOM 693   C C   . ALA A 1 122 ? 128.807 143.949 152.107 1.00 465.11 ? 122 ALA A C   1 
ATOM 694   O O   . ALA A 1 122 ? 129.453 143.797 153.151 1.00 446.82 ? 122 ALA A O   1 
ATOM 695   C CB  . ALA A 1 122 ? 127.599 141.848 151.429 1.00 493.46 ? 122 ALA A CB  1 
ATOM 696   N N   . VAL A 1 123 ? 128.205 145.086 151.778 1.00 455.80 ? 123 VAL A N   1 
ATOM 697   C CA  . VAL A 1 123 ? 128.085 146.213 152.689 1.00 424.26 ? 123 VAL A CA  1 
ATOM 698   C C   . VAL A 1 123 ? 126.593 146.493 152.805 1.00 396.00 ? 123 VAL A C   1 
ATOM 699   O O   . VAL A 1 123 ? 125.939 146.875 151.820 1.00 364.83 ? 123 VAL A O   1 
ATOM 700   C CB  . VAL A 1 123 ? 128.866 147.441 152.175 1.00 425.72 ? 123 VAL A CB  1 
ATOM 701   C CG1 . VAL A 1 123 ? 128.563 148.677 153.009 1.00 436.72 ? 123 VAL A CG1 1 
ATOM 702   C CG2 . VAL A 1 123 ? 130.362 147.156 152.187 1.00 423.51 ? 123 VAL A CG2 1 
ATOM 703   N N   . SER A 1 124 ? 126.049 146.239 153.994 1.00 420.01 ? 124 SER A N   1 
ATOM 704   C CA  . SER A 1 124 ? 124.655 146.563 154.292 1.00 455.52 ? 124 SER A CA  1 
ATOM 705   C C   . SER A 1 124 ? 124.578 148.043 154.514 1.00 429.22 ? 124 SER A C   1 
ATOM 706   O O   . SER A 1 124 ? 125.466 148.617 155.150 1.00 414.02 ? 124 SER A O   1 
ATOM 707   C CB  . SER A 1 124 ? 124.166 145.867 155.561 1.00 500.00 ? 124 SER A CB  1 
ATOM 708   O OG  . SER A 1 124 ? 122.841 146.273 155.887 1.00 477.46 ? 124 SER A OG  1 
ATOM 709   N N   . LEU A 1 125 ? 123.513 148.656 154.020 1.00 405.57 ? 125 LEU A N   1 
ATOM 710   C CA  . LEU A 1 125 ? 123.361 150.085 154.166 1.00 425.46 ? 125 LEU A CA  1 
ATOM 711   C C   . LEU A 1 125 ? 122.769 150.372 155.531 1.00 442.49 ? 125 LEU A C   1 
ATOM 712   O O   . LEU A 1 125 ? 121.771 149.755 155.917 1.00 422.85 ? 125 LEU A O   1 
ATOM 713   C CB  . LEU A 1 125 ? 122.480 150.655 153.066 1.00 464.69 ? 125 LEU A CB  1 
ATOM 714   C CG  . LEU A 1 125 ? 122.441 152.182 152.993 1.00 500.00 ? 125 LEU A CG  1 
ATOM 715   C CD1 . LEU A 1 125 ? 123.833 152.797 152.870 1.00 494.72 ? 125 LEU A CD1 1 
ATOM 716   C CD2 . LEU A 1 125 ? 121.556 152.604 151.828 1.00 500.00 ? 125 LEU A CD2 1 
ATOM 717   N N   . THR A 1 126 ? 123.392 151.319 156.240 1.00 472.54 ? 126 THR A N   1 
ATOM 718   C CA  . THR A 1 126 ? 123.049 151.662 157.619 1.00 492.12 ? 126 THR A CA  1 
ATOM 719   C C   . THR A 1 126 ? 122.118 152.878 157.618 1.00 500.00 ? 126 THR A C   1 
ATOM 720   O O   . THR A 1 126 ? 122.535 153.992 157.284 1.00 500.00 ? 126 THR A O   1 
ATOM 721   C CB  . THR A 1 126 ? 124.313 151.976 158.454 1.00 469.72 ? 126 THR A CB  1 
ATOM 722   O OG1 . THR A 1 126 ? 125.334 151.009 158.182 1.00 426.67 ? 126 THR A OG1 1 
ATOM 723   C CG2 . THR A 1 126 ? 124.002 151.958 159.946 1.00 473.99 ? 126 THR A CG2 1 
ATOM 724   N N   . LYS A 1 127 ? 120.862 152.652 157.995 1.00 500.00 ? 127 LYS A N   1 
ATOM 725   C CA  . LYS A 1 127 ? 119.806 153.674 157.900 1.00 500.00 ? 127 LYS A CA  1 
ATOM 726   C C   . LYS A 1 127 ? 119.963 154.902 158.812 1.00 493.50 ? 127 LYS A C   1 
ATOM 727   O O   . LYS A 1 127 ? 119.456 155.976 158.477 1.00 440.24 ? 127 LYS A O   1 
ATOM 728   C CB  . LYS A 1 127 ? 118.420 153.035 158.113 1.00 500.00 ? 127 LYS A CB  1 
ATOM 729   C CG  . LYS A 1 127 ? 118.037 151.973 157.077 1.00 500.00 ? 127 LYS A CG  1 
ATOM 730   C CD  . LYS A 1 127 ? 117.784 152.547 155.680 1.00 500.00 ? 127 LYS A CD  1 
ATOM 731   C CE  . LYS A 1 127 ? 117.762 151.459 154.608 1.00 500.00 ? 127 LYS A CE  1 
ATOM 732   N NZ  . LYS A 1 127 ? 116.599 150.529 154.724 1.00 500.00 ? 127 LYS A NZ  1 
ATOM 733   N N   . PRO A 1 128 ? 120.628 154.751 159.972 1.00 475.59 ? 128 PRO A N   1 
ATOM 734   C CA  . PRO A 1 128 ? 120.965 155.946 160.747 1.00 461.25 ? 128 PRO A CA  1 
ATOM 735   C C   . PRO A 1 128 ? 122.103 156.794 160.192 1.00 434.67 ? 128 PRO A C   1 
ATOM 736   O O   . PRO A 1 128 ? 122.237 157.934 160.623 1.00 489.87 ? 128 PRO A O   1 
ATOM 737   C CB  . PRO A 1 128 ? 121.381 155.375 162.110 1.00 483.30 ? 128 PRO A CB  1 
ATOM 738   C CG  . PRO A 1 128 ? 121.774 153.975 161.822 1.00 500.00 ? 128 PRO A CG  1 
ATOM 739   C CD  . PRO A 1 128 ? 120.764 153.546 160.804 1.00 500.00 ? 128 PRO A CD  1 
ATOM 740   N N   . SER A 1 129 ? 122.926 156.249 159.293 1.00 413.86 ? 129 SER A N   1 
ATOM 741   C CA  . SER A 1 129 ? 124.070 156.966 158.705 1.00 438.34 ? 129 SER A CA  1 
ATOM 742   C C   . SER A 1 129 ? 125.237 157.045 159.711 1.00 443.94 ? 129 SER A C   1 
ATOM 743   O O   . SER A 1 129 ? 125.002 156.995 160.924 1.00 405.74 ? 129 SER A O   1 
ATOM 744   C CB  . SER A 1 129 ? 123.663 158.373 158.214 1.00 429.88 ? 129 SER A CB  1 
ATOM 745   O OG  . SER A 1 129 ? 124.552 158.877 157.240 1.00 451.66 ? 129 SER A OG  1 
ATOM 746   N N   . PRO A 1 130 ? 126.499 157.139 159.218 1.00 471.26 ? 130 PRO A N   1 
ATOM 747   C CA  . PRO A 1 130 ? 127.614 157.327 160.160 1.00 470.83 ? 130 PRO A CA  1 
ATOM 748   C C   . PRO A 1 130 ? 127.589 158.718 160.764 1.00 463.70 ? 130 PRO A C   1 
ATOM 749   O O   . PRO A 1 130 ? 127.408 159.697 160.037 1.00 436.87 ? 130 PRO A O   1 
ATOM 750   C CB  . PRO A 1 130 ? 128.869 157.147 159.289 1.00 471.63 ? 130 PRO A CB  1 
ATOM 751   C CG  . PRO A 1 130 ? 128.394 156.523 158.021 1.00 475.02 ? 130 PRO A CG  1 
ATOM 752   C CD  . PRO A 1 130 ? 126.991 157.002 157.834 1.00 476.85 ? 130 PRO A CD  1 
ATOM 753   N N   . ALA A 1 131 ? 127.760 158.795 162.080 1.00 492.00 ? 131 ALA A N   1 
ATOM 754   C CA  . ALA A 1 131 ? 127.645 160.067 162.792 1.00 500.00 ? 131 ALA A CA  1 
ATOM 755   C C   . ALA A 1 131 ? 128.743 161.042 162.352 1.00 500.00 ? 131 ALA A C   1 
ATOM 756   O O   . ALA A 1 131 ? 128.457 162.019 161.645 1.00 500.00 ? 131 ALA A O   1 
ATOM 757   C CB  . ALA A 1 131 ? 127.658 159.845 164.303 1.00 500.00 ? 131 ALA A CB  1 
ATOM 758   N N   . SER A 1 132 ? 129.987 160.776 162.755 1.00 500.00 ? 132 SER A N   1 
ATOM 759   C CA  . SER A 1 132 ? 131.134 161.436 162.154 1.00 500.00 ? 132 SER A CA  1 
ATOM 760   C C   . SER A 1 132 ? 131.169 160.872 160.754 1.00 495.93 ? 132 SER A C   1 
ATOM 761   O O   . SER A 1 132 ? 131.364 159.667 160.568 1.00 497.52 ? 132 SER A O   1 
ATOM 762   C CB  . SER A 1 132 ? 132.427 161.114 162.897 1.00 500.00 ? 132 SER A CB  1 
ATOM 763   O OG  . SER A 1 132 ? 132.635 159.716 162.963 1.00 500.00 ? 132 SER A OG  1 
ATOM 764   N N   . GLY A 1 133 ? 130.929 161.740 159.778 1.00 500.00 ? 133 GLY A N   1 
ATOM 765   C CA  . GLY A 1 133 ? 130.643 161.307 158.423 1.00 500.00 ? 133 GLY A CA  1 
ATOM 766   C C   . GLY A 1 133 ? 131.744 160.542 157.724 1.00 495.76 ? 133 GLY A C   1 
ATOM 767   O O   . GLY A 1 133 ? 132.888 160.493 158.176 1.00 467.53 ? 133 GLY A O   1 
ATOM 768   N N   . PHE A 1 134 ? 131.363 159.915 156.623 1.00 477.29 ? 134 PHE A N   1 
ATOM 769   C CA  . PHE A 1 134 ? 132.281 159.170 155.789 1.00 473.27 ? 134 PHE A CA  1 
ATOM 770   C C   . PHE A 1 134 ? 132.064 159.609 154.350 1.00 433.94 ? 134 PHE A C   1 
ATOM 771   O O   . PHE A 1 134 ? 130.928 159.687 153.887 1.00 418.11 ? 134 PHE A O   1 
ATOM 772   C CB  . PHE A 1 134 ? 132.041 157.662 155.974 1.00 500.00 ? 134 PHE A CB  1 
ATOM 773   C CG  . PHE A 1 134 ? 132.168 156.856 154.712 1.00 473.22 ? 134 PHE A CG  1 
ATOM 774   C CD1 . PHE A 1 134 ? 133.406 156.431 154.255 1.00 499.29 ? 134 PHE A CD1 1 
ATOM 775   C CD2 . PHE A 1 134 ? 131.041 156.523 153.987 1.00 404.10 ? 134 PHE A CD2 1 
ATOM 776   C CE1 . PHE A 1 134 ? 133.514 155.690 153.088 1.00 485.27 ? 134 PHE A CE1 1 
ATOM 777   C CE2 . PHE A 1 134 ? 131.139 155.787 152.822 1.00 414.45 ? 134 PHE A CE2 1 
ATOM 778   C CZ  . PHE A 1 134 ? 132.377 155.367 152.369 1.00 440.57 ? 134 PHE A CZ  1 
ATOM 779   N N   . SER A 1 135 ? 133.162 159.927 153.669 1.00 433.73 ? 135 SER A N   1 
ATOM 780   C CA  . SER A 1 135 ? 133.166 160.090 152.223 1.00 433.02 ? 135 SER A CA  1 
ATOM 781   C C   . SER A 1 135 ? 134.242 159.204 151.629 1.00 425.99 ? 135 SER A C   1 
ATOM 782   O O   . SER A 1 135 ? 135.395 159.237 152.087 1.00 451.17 ? 135 SER A O   1 
ATOM 783   C CB  . SER A 1 135 ? 133.439 161.533 151.821 1.00 453.56 ? 135 SER A CB  1 
ATOM 784   O OG  . SER A 1 135 ? 133.453 161.672 150.402 1.00 409.53 ? 135 SER A OG  1 
ATOM 785   N N   . PRO A 1 136 ? 133.879 158.414 150.605 1.00 409.12 ? 136 PRO A N   1 
ATOM 786   C CA  . PRO A 1 136 ? 134.903 157.650 149.917 1.00 412.86 ? 136 PRO A CA  1 
ATOM 787   C C   . PRO A 1 136 ? 135.831 158.584 149.151 1.00 408.30 ? 136 PRO A C   1 
ATOM 788   O O   . PRO A 1 136 ? 137.045 158.461 149.290 1.00 425.53 ? 136 PRO A O   1 
ATOM 789   C CB  . PRO A 1 136 ? 134.106 156.729 148.995 1.00 432.04 ? 136 PRO A CB  1 
ATOM 790   C CG  . PRO A 1 136 ? 132.790 157.394 148.799 1.00 426.66 ? 136 PRO A CG  1 
ATOM 791   C CD  . PRO A 1 136 ? 132.558 158.301 149.958 1.00 413.60 ? 136 PRO A CD  1 
ATOM 792   N N   . SER A 1 137 ? 135.273 159.552 148.422 1.00 393.71 ? 137 SER A N   1 
ATOM 793   C CA  . SER A 1 137 ? 136.085 160.492 147.651 1.00 427.51 ? 137 SER A CA  1 
ATOM 794   C C   . SER A 1 137 ? 137.239 161.108 148.460 1.00 428.64 ? 137 SER A C   1 
ATOM 795   O O   . SER A 1 137 ? 137.116 161.378 149.657 1.00 430.93 ? 137 SER A O   1 
ATOM 796   C CB  . SER A 1 137 ? 135.222 161.609 147.080 1.00 458.77 ? 137 SER A CB  1 
ATOM 797   O OG  . SER A 1 137 ? 136.018 162.498 146.309 1.00 485.47 ? 137 SER A OG  1 
ATOM 798   N N   . VAL A 1 138 ? 138.351 161.324 147.770 1.00 402.07 ? 138 VAL A N   1 
ATOM 799   C CA  . VAL A 1 138 ? 139.582 161.811 148.381 1.00 408.09 ? 138 VAL A CA  1 
ATOM 800   C C   . VAL A 1 138 ? 139.420 163.250 148.892 1.00 437.03 ? 138 VAL A C   1 
ATOM 801   O O   . VAL A 1 138 ? 138.501 163.960 148.477 1.00 457.95 ? 138 VAL A O   1 
ATOM 802   C CB  . VAL A 1 138 ? 140.768 161.666 147.378 1.00 456.23 ? 138 VAL A CB  1 
ATOM 803   C CG1 . VAL A 1 138 ? 140.649 162.627 146.197 1.00 479.10 ? 138 VAL A CG1 1 
ATOM 804   C CG2 . VAL A 1 138 ? 142.119 161.808 148.071 1.00 493.26 ? 138 VAL A CG2 1 
ATOM 805   N N   . GLN A 1 139 ? 140.288 163.642 149.826 1.00 465.81 ? 139 GLN A N   1 
ATOM 806   C CA  . GLN A 1 139 ? 140.373 165.026 150.340 1.00 482.90 ? 139 GLN A CA  1 
ATOM 807   C C   . GLN A 1 139 ? 140.395 166.138 149.275 1.00 453.82 ? 139 GLN A C   1 
ATOM 808   O O   . GLN A 1 139 ? 139.735 167.168 149.437 1.00 432.79 ? 139 GLN A O   1 
ATOM 809   C CB  . GLN A 1 139 ? 141.619 165.199 151.233 1.00 500.00 ? 139 GLN A CB  1 
ATOM 810   C CG  . GLN A 1 139 ? 141.386 165.154 152.740 1.00 498.21 ? 139 GLN A CG  1 
ATOM 811   C CD  . GLN A 1 139 ? 141.230 163.761 153.317 1.00 495.87 ? 139 GLN A CD  1 
ATOM 812   O OE1 . GLN A 1 139 ? 140.323 163.513 154.106 1.00 500.00 ? 139 GLN A OE1 1 
ATOM 813   N NE2 . GLN A 1 139 ? 142.130 162.856 152.952 1.00 497.00 ? 139 GLN A NE2 1 
ATOM 814   N N   . CYS A 1 140 ? 141.166 165.919 148.211 1.00 436.65 ? 140 CYS A N   1 
ATOM 815   C CA  . CYS A 1 140 ? 141.461 166.936 147.200 1.00 460.37 ? 140 CYS A CA  1 
ATOM 816   C C   . CYS A 1 140 ? 140.917 166.484 145.832 1.00 472.24 ? 140 CYS A C   1 
ATOM 817   O O   . CYS A 1 140 ? 141.676 166.006 144.988 1.00 467.22 ? 140 CYS A O   1 
ATOM 818   C CB  . CYS A 1 140 ? 142.985 167.140 147.166 1.00 500.00 ? 140 CYS A CB  1 
ATOM 819   S SG  . CYS A 1 140 ? 143.552 168.846 146.968 1.00 500.00 ? 140 CYS A SG  1 
ATOM 820   N N   . PRO A 1 141 ? 139.587 166.608 145.613 1.00 476.63 ? 141 PRO A N   1 
ATOM 821   C CA  . PRO A 1 141 ? 138.993 166.017 144.404 1.00 452.66 ? 141 PRO A CA  1 
ATOM 822   C C   . PRO A 1 141 ? 139.321 166.793 143.142 1.00 392.33 ? 141 PRO A C   1 
ATOM 823   O O   . PRO A 1 141 ? 139.581 167.997 143.204 1.00 389.73 ? 141 PRO A O   1 
ATOM 824   C CB  . PRO A 1 141 ? 137.485 166.044 144.692 1.00 400.25 ? 141 PRO A CB  1 
ATOM 825   C CG  . PRO A 1 141 ? 137.321 167.197 145.605 1.00 439.67 ? 141 PRO A CG  1 
ATOM 826   C CD  . PRO A 1 141 ? 138.565 167.257 146.451 1.00 465.78 ? 141 PRO A CD  1 
ATOM 827   N N   . ASN A 1 142 ? 139.346 166.078 142.023 1.00 369.43 ? 142 ASN A N   1 
ATOM 828   C CA  . ASN A 1 142 ? 139.535 166.668 140.701 1.00 429.05 ? 142 ASN A CA  1 
ATOM 829   C C   . ASN A 1 142 ? 140.837 167.480 140.561 1.00 442.14 ? 142 ASN A C   1 
ATOM 830   O O   . ASN A 1 142 ? 140.984 168.294 139.645 1.00 397.63 ? 142 ASN A O   1 
ATOM 831   C CB  . ASN A 1 142 ? 138.304 167.522 140.333 1.00 443.55 ? 142 ASN A CB  1 
ATOM 832   C CG  . ASN A 1 142 ? 136.972 166.786 140.532 1.00 429.14 ? 142 ASN A CG  1 
ATOM 833   O OD1 . ASN A 1 142 ? 135.940 167.415 140.759 1.00 409.13 ? 142 ASN A OD1 1 
ATOM 834   N ND2 . ASN A 1 142 ? 136.988 165.462 140.426 1.00 431.00 ? 142 ASN A ND2 1 
ATOM 835   N N   . ASP A 1 143 ? 141.797 167.187 141.437 1.00 491.58 ? 143 ASP A N   1 
ATOM 836   C CA  . ASP A 1 143 ? 142.906 168.104 141.741 1.00 500.00 ? 143 ASP A CA  1 
ATOM 837   C C   . ASP A 1 143 ? 143.944 168.250 140.629 1.00 500.00 ? 143 ASP A C   1 
ATOM 838   O O   . ASP A 1 143 ? 144.422 169.359 140.368 1.00 476.42 ? 143 ASP A O   1 
ATOM 839   C CB  . ASP A 1 143 ? 143.598 167.720 143.064 1.00 500.00 ? 143 ASP A CB  1 
ATOM 840   C CG  . ASP A 1 143 ? 144.068 166.263 143.100 1.00 500.00 ? 143 ASP A CG  1 
ATOM 841   O OD1 . ASP A 1 143 ? 143.647 165.462 142.230 1.00 500.00 ? 143 ASP A OD1 1 
ATOM 842   O OD2 . ASP A 1 143 ? 144.847 165.918 144.018 1.00 500.00 ? 143 ASP A OD2 1 
ATOM 843   N N   . GLY A 1 144 ? 144.286 167.140 139.975 1.00 444.95 ? 144 GLY A N   1 
ATOM 844   C CA  . GLY A 1 144 ? 145.209 167.176 138.846 1.00 472.75 ? 144 GLY A CA  1 
ATOM 845   C C   . GLY A 1 144 ? 144.690 167.989 137.667 1.00 480.24 ? 144 GLY A C   1 
ATOM 846   O O   . GLY A 1 144 ? 145.472 168.518 136.869 1.00 484.45 ? 144 GLY A O   1 
ATOM 847   N N   . PHE A 1 145 ? 143.367 168.098 137.575 1.00 445.60 ? 145 PHE A N   1 
ATOM 848   C CA  . PHE A 1 145 ? 142.703 168.675 136.418 1.00 454.89 ? 145 PHE A CA  1 
ATOM 849   C C   . PHE A 1 145 ? 142.255 170.118 136.607 1.00 463.61 ? 145 PHE A C   1 
ATOM 850   O O   . PHE A 1 145 ? 141.829 170.765 135.647 1.00 452.09 ? 145 PHE A O   1 
ATOM 851   C CB  . PHE A 1 145 ? 141.547 167.762 136.042 1.00 440.72 ? 145 PHE A CB  1 
ATOM 852   C CG  . PHE A 1 145 ? 142.010 166.412 135.596 1.00 468.80 ? 145 PHE A CG  1 
ATOM 853   C CD1 . PHE A 1 145 ? 142.296 165.430 136.526 1.00 467.59 ? 145 PHE A CD1 1 
ATOM 854   C CD2 . PHE A 1 145 ? 142.237 166.145 134.246 1.00 500.00 ? 145 PHE A CD2 1 
ATOM 855   C CE1 . PHE A 1 145 ? 142.752 164.188 136.122 1.00 472.66 ? 145 PHE A CE1 1 
ATOM 856   C CE2 . PHE A 1 145 ? 142.697 164.903 133.832 1.00 462.70 ? 145 PHE A CE2 1 
ATOM 857   C CZ  . PHE A 1 145 ? 142.951 163.920 134.773 1.00 464.89 ? 145 PHE A CZ  1 
ATOM 858   N N   . GLY A 1 146 ? 142.383 170.632 137.828 1.00 472.28 ? 146 GLY A N   1 
ATOM 859   C CA  . GLY A 1 146 ? 142.148 172.041 138.094 1.00 500.00 ? 146 GLY A CA  1 
ATOM 860   C C   . GLY A 1 146 ? 143.257 172.916 137.545 1.00 500.00 ? 146 GLY A C   1 
ATOM 861   O O   . GLY A 1 146 ? 144.330 172.418 137.194 1.00 500.00 ? 146 GLY A O   1 
ATOM 862   N N   . VAL A 1 147 ? 142.991 174.219 137.457 1.00 456.10 ? 147 VAL A N   1 
ATOM 863   C CA  . VAL A 1 147 ? 144.025 175.194 137.063 1.00 457.58 ? 147 VAL A CA  1 
ATOM 864   C C   . VAL A 1 147 ? 145.238 175.269 137.996 1.00 478.59 ? 147 VAL A C   1 
ATOM 865   O O   . VAL A 1 147 ? 146.356 175.509 137.531 1.00 493.99 ? 147 VAL A O   1 
ATOM 866   C CB  . VAL A 1 147 ? 143.486 176.637 136.927 1.00 452.26 ? 147 VAL A CB  1 
ATOM 867   C CG1 . VAL A 1 147 ? 142.849 176.857 135.563 1.00 451.71 ? 147 VAL A CG1 1 
ATOM 868   C CG2 . VAL A 1 147 ? 142.558 177.008 138.080 1.00 454.84 ? 147 VAL A CG2 1 
ATOM 869   N N   . TYR A 1 148 ? 145.022 175.063 139.293 1.00 467.35 ? 148 TYR A N   1 
ATOM 870   C CA  . TYR A 1 148 ? 146.075 175.262 140.294 1.00 458.78 ? 148 TYR A CA  1 
ATOM 871   C C   . TYR A 1 148 ? 147.125 174.171 140.235 1.00 465.35 ? 148 TYR A C   1 
ATOM 872   O O   . TYR A 1 148 ? 147.061 173.172 140.952 1.00 472.21 ? 148 TYR A O   1 
ATOM 873   C CB  . TYR A 1 148 ? 145.470 175.369 141.682 1.00 465.93 ? 148 TYR A CB  1 
ATOM 874   C CG  . TYR A 1 148 ? 144.504 176.512 141.749 1.00 500.00 ? 148 TYR A CG  1 
ATOM 875   C CD1 . TYR A 1 148 ? 144.956 177.823 141.625 1.00 500.00 ? 148 TYR A CD1 1 
ATOM 876   C CD2 . TYR A 1 148 ? 143.133 176.296 141.883 1.00 500.00 ? 148 TYR A CD2 1 
ATOM 877   C CE1 . TYR A 1 148 ? 144.080 178.894 141.664 1.00 500.00 ? 148 TYR A CE1 1 
ATOM 878   C CE2 . TYR A 1 148 ? 142.243 177.362 141.926 1.00 500.00 ? 148 TYR A CE2 1 
ATOM 879   C CZ  . TYR A 1 148 ? 142.723 178.662 141.813 1.00 500.00 ? 148 TYR A CZ  1 
ATOM 880   O OH  . TYR A 1 148 ? 141.856 179.727 141.865 1.00 481.29 ? 148 TYR A OH  1 
ATOM 881   N N   . SER A 1 149 ? 148.072 174.377 139.328 1.00 463.87 ? 149 SER A N   1 
ATOM 882   C CA  . SER A 1 149 ? 149.198 173.485 139.132 1.00 479.95 ? 149 SER A CA  1 
ATOM 883   C C   . SER A 1 149 ? 150.385 174.128 139.846 1.00 481.97 ? 149 SER A C   1 
ATOM 884   O O   . SER A 1 149 ? 150.190 175.021 140.677 1.00 414.62 ? 149 SER A O   1 
ATOM 885   C CB  . SER A 1 149 ? 149.432 173.288 137.623 1.00 489.27 ? 149 SER A CB  1 
ATOM 886   O OG  . SER A 1 149 ? 149.504 174.527 136.939 1.00 483.89 ? 149 SER A OG  1 
ATOM 887   N N   . ASN A 1 150 ? 151.598 173.665 139.547 1.00 500.00 ? 150 ASN A N   1 
ATOM 888   C CA  . ASN A 1 150 ? 152.827 174.273 140.070 1.00 500.00 ? 150 ASN A CA  1 
ATOM 889   C C   . ASN A 1 150 ? 153.428 175.392 139.198 1.00 500.00 ? 150 ASN A C   1 
ATOM 890   O O   . ASN A 1 150 ? 154.400 176.031 139.608 1.00 500.00 ? 150 ASN A O   1 
ATOM 891   C CB  . ASN A 1 150 ? 153.868 173.186 140.321 1.00 500.00 ? 150 ASN A CB  1 
ATOM 892   C CG  . ASN A 1 150 ? 153.369 172.122 141.287 1.00 500.00 ? 150 ASN A CG  1 
ATOM 893   O OD1 . ASN A 1 150 ? 152.803 172.434 142.336 1.00 500.00 ? 150 ASN A OD1 1 
ATOM 894   N ND2 . ASN A 1 150 ? 153.571 170.855 140.930 1.00 500.00 ? 150 ASN A ND2 1 
ATOM 895   N N   . SER A 1 151 ? 152.860 175.620 138.009 1.00 500.00 ? 151 SER A N   1 
ATOM 896   C CA  . SER A 1 151 ? 153.215 176.765 137.154 1.00 493.97 ? 151 SER A CA  1 
ATOM 897   C C   . SER A 1 151 ? 152.253 177.959 137.287 1.00 490.69 ? 151 SER A C   1 
ATOM 898   O O   . SER A 1 151 ? 152.619 179.082 136.935 1.00 483.87 ? 151 SER A O   1 
ATOM 899   C CB  . SER A 1 151 ? 153.270 176.325 135.686 1.00 453.04 ? 151 SER A CB  1 
ATOM 900   O OG  . SER A 1 151 ? 151.981 176.014 135.186 1.00 434.02 ? 151 SER A OG  1 
ATOM 901   N N   . TYR A 1 152 ? 151.041 177.713 137.797 1.00 500.00 ? 152 TYR A N   1 
ATOM 902   C CA  . TYR A 1 152 ? 149.948 178.694 137.785 1.00 500.00 ? 152 TYR A CA  1 
ATOM 903   C C   . TYR A 1 152 ? 149.747 179.398 139.140 1.00 500.00 ? 152 TYR A C   1 
ATOM 904   O O   . TYR A 1 152 ? 149.761 180.630 139.211 1.00 500.00 ? 152 TYR A O   1 
ATOM 905   C CB  . TYR A 1 152 ? 148.654 178.001 137.342 1.00 495.91 ? 152 TYR A CB  1 
ATOM 906   C CG  . TYR A 1 152 ? 147.591 178.933 136.799 1.00 464.16 ? 152 TYR A CG  1 
ATOM 907   C CD1 . TYR A 1 152 ? 147.720 179.508 135.529 1.00 429.14 ? 152 TYR A CD1 1 
ATOM 908   C CD2 . TYR A 1 152 ? 146.440 179.223 137.543 1.00 444.13 ? 152 TYR A CD2 1 
ATOM 909   C CE1 . TYR A 1 152 ? 146.740 180.357 135.024 1.00 466.25 ? 152 TYR A CE1 1 
ATOM 910   C CE2 . TYR A 1 152 ? 145.453 180.067 137.047 1.00 460.29 ? 152 TYR A CE2 1 
ATOM 911   C CZ  . TYR A 1 152 ? 145.603 180.634 135.788 1.00 481.49 ? 152 TYR A CZ  1 
ATOM 912   O OH  . TYR A 1 152 ? 144.626 181.478 135.299 1.00 471.72 ? 152 TYR A OH  1 
ATOM 913   N N   . GLY A 1 153 ? 149.552 178.617 140.201 1.00 492.81 ? 153 GLY A N   1 
ATOM 914   C CA  . GLY A 1 153 ? 149.379 179.160 141.556 1.00 455.16 ? 153 GLY A CA  1 
ATOM 915   C C   . GLY A 1 153 ? 149.900 178.194 142.608 1.00 448.16 ? 153 GLY A C   1 
ATOM 916   O O   . GLY A 1 153 ? 149.149 177.823 143.512 1.00 400.25 ? 153 GLY A O   1 
ATOM 917   N N   . PRO A 1 154 ? 151.202 177.817 142.514 1.00 467.68 ? 154 PRO A N   1 
ATOM 918   C CA  . PRO A 1 154 ? 151.838 176.646 143.179 1.00 471.03 ? 154 PRO A CA  1 
ATOM 919   C C   . PRO A 1 154 ? 151.553 176.506 144.676 1.00 486.90 ? 154 PRO A C   1 
ATOM 920   O O   . PRO A 1 154 ? 151.253 175.411 145.146 1.00 500.00 ? 154 PRO A O   1 
ATOM 921   C CB  . PRO A 1 154 ? 153.347 176.844 142.951 1.00 465.82 ? 154 PRO A CB  1 
ATOM 922   C CG  . PRO A 1 154 ? 153.520 178.152 142.272 1.00 494.49 ? 154 PRO A CG  1 
ATOM 923   C CD  . PRO A 1 154 ? 152.192 178.710 141.875 1.00 474.57 ? 154 PRO A CD  1 
ATOM 924   N N   . GLU A 1 155 ? 151.693 177.613 145.398 1.00 500.00 ? 155 GLU A N   1 
ATOM 925   C CA  . GLU A 1 155 ? 151.259 177.774 146.804 1.00 500.00 ? 155 GLU A CA  1 
ATOM 926   C C   . GLU A 1 155 ? 149.969 177.042 147.240 1.00 474.78 ? 155 GLU A C   1 
ATOM 927   O O   . GLU A 1 155 ? 149.888 176.537 148.367 1.00 367.62 ? 155 GLU A O   1 
ATOM 928   C CB  . GLU A 1 155 ? 151.140 179.276 147.135 1.00 500.00 ? 155 GLU A CB  1 
ATOM 929   C CG  . GLU A 1 155 ? 150.288 180.123 146.166 1.00 500.00 ? 155 GLU A CG  1 
ATOM 930   C CD  . GLU A 1 155 ? 151.037 180.731 144.963 1.00 500.00 ? 155 GLU A CD  1 
ATOM 931   O OE1 . GLU A 1 155 ? 150.362 181.062 143.956 1.00 500.00 ? 155 GLU A OE1 1 
ATOM 932   O OE2 . GLU A 1 155 ? 152.283 180.886 145.007 1.00 500.00 ? 155 GLU A OE2 1 
ATOM 933   N N   . PHE A 1 156 ? 148.980 177.003 146.344 1.00 500.00 ? 156 PHE A N   1 
ATOM 934   C CA  . PHE A 1 156 ? 147.701 176.305 146.554 1.00 500.00 ? 156 PHE A CA  1 
ATOM 935   C C   . PHE A 1 156 ? 147.716 174.896 145.959 1.00 500.00 ? 156 PHE A C   1 
ATOM 936   O O   . PHE A 1 156 ? 147.285 173.937 146.604 1.00 426.99 ? 156 PHE A O   1 
ATOM 937   C CB  . PHE A 1 156 ? 146.565 177.088 145.889 1.00 485.81 ? 156 PHE A CB  1 
ATOM 938   C CG  . PHE A 1 156 ? 146.590 178.561 146.176 1.00 497.82 ? 156 PHE A CG  1 
ATOM 939   C CD1 . PHE A 1 156 ? 146.292 179.041 147.454 1.00 500.00 ? 156 PHE A CD1 1 
ATOM 940   C CD2 . PHE A 1 156 ? 146.905 179.476 145.172 1.00 483.39 ? 156 PHE A CD2 1 
ATOM 941   C CE1 . PHE A 1 156 ? 146.309 180.404 147.728 1.00 500.00 ? 156 PHE A CE1 1 
ATOM 942   C CE2 . PHE A 1 156 ? 146.925 180.840 145.440 1.00 500.00 ? 156 PHE A CE2 1 
ATOM 943   C CZ  . PHE A 1 156 ? 146.627 181.305 146.720 1.00 500.00 ? 156 PHE A CZ  1 
ATOM 944   N N   . ALA A 1 157 ? 148.236 174.813 144.728 1.00 500.00 ? 157 ALA A N   1 
ATOM 945   C CA  . ALA A 1 157 ? 148.163 173.653 143.825 1.00 500.00 ? 157 ALA A CA  1 
ATOM 946   C C   . ALA A 1 157 ? 147.358 172.444 144.287 1.00 490.73 ? 157 ALA A C   1 
ATOM 947   O O   . ALA A 1 157 ? 146.230 172.251 143.826 1.00 500.00 ? 157 ALA A O   1 
ATOM 948   C CB  . ALA A 1 157 ? 149.565 173.233 143.377 1.00 500.00 ? 157 ALA A CB  1 
ATOM 949   N N   . HIS A 1 158 ? 147.924 171.650 145.198 1.00 484.71 ? 158 HIS A N   1 
ATOM 950   C CA  . HIS A 1 158 ? 147.335 170.371 145.605 1.00 500.00 ? 158 HIS A CA  1 
ATOM 951   C C   . HIS A 1 158 ? 146.790 170.484 147.018 1.00 500.00 ? 158 HIS A C   1 
ATOM 952   O O   . HIS A 1 158 ? 147.153 169.708 147.910 1.00 433.93 ? 158 HIS A O   1 
ATOM 953   C CB  . HIS A 1 158 ? 148.370 169.254 145.474 1.00 500.00 ? 158 HIS A CB  1 
ATOM 954   C CG  . HIS A 1 158 ? 148.744 168.964 144.054 1.00 500.00 ? 158 HIS A CG  1 
ATOM 955   N ND1 . HIS A 1 158 ? 149.661 169.723 143.356 1.00 500.00 ? 158 HIS A ND1 1 
ATOM 956   C CD2 . HIS A 1 158 ? 148.301 168.020 143.190 1.00 500.00 ? 158 HIS A CD2 1 
ATOM 957   C CE1 . HIS A 1 158 ? 149.776 169.248 142.127 1.00 500.00 ? 158 HIS A CE1 1 
ATOM 958   N NE2 . HIS A 1 158 ? 148.963 168.214 142.001 1.00 500.00 ? 158 HIS A NE2 1 
ATOM 959   N N   . CYS A 1 159 ? 145.879 171.452 147.170 1.00 500.00 ? 159 CYS A N   1 
ATOM 960   C CA  . CYS A 1 159 ? 145.320 171.918 148.455 1.00 500.00 ? 159 CYS A CA  1 
ATOM 961   C C   . CYS A 1 159 ? 146.298 171.828 149.627 1.00 500.00 ? 159 CYS A C   1 
ATOM 962   O O   . CYS A 1 159 ? 146.012 171.218 150.663 1.00 500.00 ? 159 CYS A O   1 
ATOM 963   C CB  . CYS A 1 159 ? 143.983 171.233 148.773 1.00 500.00 ? 159 CYS A CB  1 
ATOM 964   S SG  . CYS A 1 159 ? 144.039 169.430 148.868 1.00 500.00 ? 159 CYS A SG  1 
ATOM 965   N N   . ARG A 1 160 ? 147.463 172.441 149.426 1.00 500.00 ? 160 ARG A N   1 
ATOM 966   C CA  . ARG A 1 160 ? 148.462 172.635 150.480 1.00 500.00 ? 160 ARG A CA  1 
ATOM 967   C C   . ARG A 1 160 ? 147.883 173.535 151.568 1.00 500.00 ? 160 ARG A C   1 
ATOM 968   O O   . ARG A 1 160 ? 148.166 173.365 152.760 1.00 430.97 ? 160 ARG A O   1 
ATOM 969   C CB  . ARG A 1 160 ? 149.706 173.283 149.886 1.00 500.00 ? 160 ARG A CB  1 
ATOM 970   C CG  . ARG A 1 160 ? 150.926 173.267 150.788 1.00 500.00 ? 160 ARG A CG  1 
ATOM 971   C CD  . ARG A 1 160 ? 151.946 174.291 150.320 1.00 500.00 ? 160 ARG A CD  1 
ATOM 972   N NE  . ARG A 1 160 ? 152.252 174.173 148.888 1.00 500.00 ? 160 ARG A NE  1 
ATOM 973   C CZ  . ARG A 1 160 ? 153.022 175.021 148.197 1.00 500.00 ? 160 ARG A CZ  1 
ATOM 974   N NH1 . ARG A 1 160 ? 153.603 176.070 148.783 1.00 500.00 ? 160 ARG A NH1 1 
ATOM 975   N NH2 . ARG A 1 160 ? 153.225 174.815 146.895 1.00 500.00 ? 160 ARG A NH2 1 
ATOM 976   N N   . GLU A 1 161 ? 147.064 174.487 151.123 1.00 500.00 ? 161 GLU A N   1 
ATOM 977   C CA  . GLU A 1 161 ? 146.341 175.403 151.993 1.00 500.00 ? 161 GLU A CA  1 
ATOM 978   C C   . GLU A 1 161 ? 145.268 174.671 152.850 1.00 500.00 ? 161 GLU A C   1 
ATOM 979   O O   . GLU A 1 161 ? 145.534 174.340 154.014 1.00 414.07 ? 161 GLU A O   1 
ATOM 980   C CB  . GLU A 1 161 ? 145.739 176.552 151.131 1.00 500.00 ? 161 GLU A CB  1 
ATOM 981   C CG  . GLU A 1 161 ? 145.249 177.807 151.881 1.00 500.00 ? 161 GLU A CG  1 
ATOM 982   C CD  . GLU A 1 161 ? 146.086 179.075 151.681 1.00 500.00 ? 161 GLU A CD  1 
ATOM 983   O OE1 . GLU A 1 161 ? 146.801 179.202 150.657 1.00 500.00 ? 161 GLU A OE1 1 
ATOM 984   O OE2 . GLU A 1 161 ? 145.997 179.976 152.552 1.00 500.00 ? 161 GLU A OE2 1 
ATOM 985   N N   . ILE A 1 162 ? 144.105 174.368 152.263 1.00 500.00 ? 162 ILE A N   1 
ATOM 986   C CA  . ILE A 1 162 ? 142.857 174.192 153.042 1.00 500.00 ? 162 ILE A CA  1 
ATOM 987   C C   . ILE A 1 162 ? 142.349 172.756 153.287 1.00 500.00 ? 162 ILE A C   1 
ATOM 988   O O   . ILE A 1 162 ? 141.881 172.454 154.391 1.00 500.00 ? 162 ILE A O   1 
ATOM 989   C CB  . ILE A 1 162 ? 141.701 175.074 152.470 1.00 500.00 ? 162 ILE A CB  1 
ATOM 990   C CG1 . ILE A 1 162 ? 141.141 174.536 151.147 1.00 500.00 ? 162 ILE A CG1 1 
ATOM 991   C CG2 . ILE A 1 162 ? 142.154 176.511 152.273 1.00 500.00 ? 162 ILE A CG2 1 
ATOM 992   C CD1 . ILE A 1 162 ? 139.908 173.691 151.322 1.00 500.00 ? 162 ILE A CD1 1 
ATOM 993   N N   . GLN A 1 163 ? 142.431 171.888 152.276 1.00 500.00 ? 163 GLN A N   1 
ATOM 994   C CA  . GLN A 1 163 ? 141.893 170.511 152.331 1.00 482.36 ? 163 GLN A CA  1 
ATOM 995   C C   . GLN A 1 163 ? 140.354 170.486 152.328 1.00 477.43 ? 163 GLN A C   1 
ATOM 996   O O   . GLN A 1 163 ? 139.710 170.627 153.371 1.00 448.22 ? 163 GLN A O   1 
ATOM 997   C CB  . GLN A 1 163 ? 142.449 169.738 153.537 1.00 483.30 ? 163 GLN A CB  1 
ATOM 998   C CG  . GLN A 1 163 ? 142.747 168.286 153.225 1.00 500.00 ? 163 GLN A CG  1 
ATOM 999   C CD  . GLN A 1 163 ? 143.988 168.110 152.359 1.00 500.00 ? 163 GLN A CD  1 
ATOM 1000  O OE1 . GLN A 1 163 ? 143.956 167.421 151.344 1.00 500.00 ? 163 GLN A OE1 1 
ATOM 1001  N NE2 . GLN A 1 163 ? 145.087 168.736 152.759 1.00 500.00 ? 163 GLN A NE2 1 
ATOM 1002  N N   . TRP A 1 164 ? 139.790 170.263 151.142 1.00 462.86 ? 164 TRP A N   1 
ATOM 1003  C CA  . TRP A 1 164 ? 138.386 170.595 150.832 1.00 436.33 ? 164 TRP A CA  1 
ATOM 1004  C C   . TRP A 1 164 ? 137.369 169.653 151.443 1.00 410.54 ? 164 TRP A C   1 
ATOM 1005  O O   . TRP A 1 164 ? 136.394 170.084 152.090 1.00 402.26 ? 164 TRP A O   1 
ATOM 1006  C CB  . TRP A 1 164 ? 138.200 170.619 149.311 1.00 443.45 ? 164 TRP A CB  1 
ATOM 1007  C CG  . TRP A 1 164 ? 138.939 171.737 148.683 1.00 450.97 ? 164 TRP A CG  1 
ATOM 1008  C CD1 . TRP A 1 164 ? 140.216 171.723 148.210 1.00 479.66 ? 164 TRP A CD1 1 
ATOM 1009  C CD2 . TRP A 1 164 ? 138.455 173.058 148.500 1.00 422.84 ? 164 TRP A CD2 1 
ATOM 1010  N NE1 . TRP A 1 164 ? 140.557 172.962 147.730 1.00 459.68 ? 164 TRP A NE1 1 
ATOM 1011  C CE2 . TRP A 1 164 ? 139.489 173.802 147.900 1.00 438.60 ? 164 TRP A CE2 1 
ATOM 1012  C CE3 . TRP A 1 164 ? 137.246 173.693 148.795 1.00 437.32 ? 164 TRP A CE3 1 
ATOM 1013  C CZ2 . TRP A 1 164 ? 139.348 175.143 147.585 1.00 478.12 ? 164 TRP A CZ2 1 
ATOM 1014  C CZ3 . TRP A 1 164 ? 137.107 175.020 148.487 1.00 477.04 ? 164 TRP A CZ3 1 
ATOM 1015  C CH2 . TRP A 1 164 ? 138.156 175.740 147.896 1.00 497.01 ? 164 TRP A CH2 1 
ATOM 1016  N N   . ASN A 1 165 ? 137.597 168.371 151.188 1.00 419.46 ? 165 ASN A N   1 
ATOM 1017  C CA  . ASN A 1 165 ? 136.788 167.295 151.709 1.00 416.80 ? 165 ASN A CA  1 
ATOM 1018  C C   . ASN A 1 165 ? 137.607 166.600 152.776 1.00 433.88 ? 165 ASN A C   1 
ATOM 1019  O O   . ASN A 1 165 ? 137.973 165.434 152.652 1.00 457.39 ? 165 ASN A O   1 
ATOM 1020  C CB  . ASN A 1 165 ? 136.421 166.341 150.574 1.00 424.66 ? 165 ASN A CB  1 
ATOM 1021  C CG  . ASN A 1 165 ? 135.519 165.213 151.020 1.00 440.87 ? 165 ASN A CG  1 
ATOM 1022  O OD1 . ASN A 1 165 ? 134.895 165.272 152.086 1.00 431.43 ? 165 ASN A OD1 1 
ATOM 1023  N ND2 . ASN A 1 165 ? 135.450 164.168 150.203 1.00 455.23 ? 165 ASN A ND2 1 
ATOM 1024  N N   . SER A 1 166 ? 137.876 167.340 153.842 1.00 473.11 ? 166 SER A N   1 
ATOM 1025  C CA  . SER A 1 166 ? 138.671 166.845 154.967 1.00 500.00 ? 166 SER A CA  1 
ATOM 1026  C C   . SER A 1 166 ? 138.135 165.548 155.603 1.00 478.68 ? 166 SER A C   1 
ATOM 1027  O O   . SER A 1 166 ? 138.886 164.840 156.283 1.00 450.15 ? 166 SER A O   1 
ATOM 1028  C CB  . SER A 1 166 ? 138.795 167.939 156.028 1.00 500.00 ? 166 SER A CB  1 
ATOM 1029  O OG  . SER A 1 166 ? 137.518 168.440 156.388 1.00 500.00 ? 166 SER A OG  1 
ATOM 1030  N N   . LEU A 1 167 ? 136.858 165.230 155.372 1.00 432.63 ? 167 LEU A N   1 
ATOM 1031  C CA  . LEU A 1 167 ? 136.267 163.978 155.836 1.00 428.51 ? 167 LEU A CA  1 
ATOM 1032  C C   . LEU A 1 167 ? 136.431 162.836 154.825 1.00 441.90 ? 167 LEU A C   1 
ATOM 1033  O O   . LEU A 1 167 ? 135.559 161.976 154.704 1.00 451.86 ? 167 LEU A O   1 
ATOM 1034  C CB  . LEU A 1 167 ? 134.782 164.218 156.145 1.00 483.74 ? 167 LEU A CB  1 
ATOM 1035  C CG  . LEU A 1 167 ? 134.045 163.218 157.050 1.00 500.00 ? 167 LEU A CG  1 
ATOM 1036  C CD1 . LEU A 1 167 ? 134.883 162.841 158.273 1.00 500.00 ? 167 LEU A CD1 1 
ATOM 1037  C CD2 . LEU A 1 167 ? 132.683 163.773 157.457 1.00 500.00 ? 167 LEU A CD2 1 
ATOM 1038  N N   . GLY A 1 168 ? 137.574 162.804 154.136 1.00 476.86 ? 168 GLY A N   1 
ATOM 1039  C CA  . GLY A 1 168 ? 137.758 161.966 152.952 1.00 489.75 ? 168 GLY A CA  1 
ATOM 1040  C C   . GLY A 1 168 ? 138.587 160.736 153.243 1.00 459.60 ? 168 GLY A C   1 
ATOM 1041  O O   . GLY A 1 168 ? 139.687 160.838 153.788 1.00 456.98 ? 168 GLY A O   1 
ATOM 1042  N N   . ASN A 1 169 ? 138.061 159.568 152.885 1.00 442.49 ? 169 ASN A N   1 
ATOM 1043  C CA  . ASN A 1 169 ? 138.828 158.330 153.004 1.00 417.06 ? 169 ASN A CA  1 
ATOM 1044  C C   . ASN A 1 169 ? 139.867 158.216 151.902 1.00 422.59 ? 169 ASN A C   1 
ATOM 1045  O O   . ASN A 1 169 ? 141.002 157.822 152.171 1.00 382.68 ? 169 ASN A O   1 
ATOM 1046  C CB  . ASN A 1 169 ? 137.910 157.114 152.986 1.00 413.74 ? 169 ASN A CB  1 
ATOM 1047  C CG  . ASN A 1 169 ? 137.011 157.057 154.200 1.00 467.88 ? 169 ASN A CG  1 
ATOM 1048  O OD1 . ASN A 1 169 ? 136.438 158.068 154.610 1.00 491.04 ? 169 ASN A OD1 1 
ATOM 1049  N ND2 . ASN A 1 169 ? 136.889 155.877 154.790 1.00 500.00 ? 169 ASN A ND2 1 
ATOM 1050  N N   . GLY A 1 170 ? 139.478 158.588 150.677 1.00 458.46 ? 170 GLY A N   1 
ATOM 1051  C CA  . GLY A 1 170 ? 140.326 158.401 149.492 1.00 482.66 ? 170 GLY A CA  1 
ATOM 1052  C C   . GLY A 1 170 ? 140.177 157.001 148.934 1.00 459.41 ? 170 GLY A C   1 
ATOM 1053  O O   . GLY A 1 170 ? 141.099 156.453 148.318 1.00 429.43 ? 170 GLY A O   1 
ATOM 1054  N N   . LEU A 1 171 ? 138.981 156.454 149.130 1.00 422.96 ? 171 LEU A N   1 
ATOM 1055  C CA  . LEU A 1 171 ? 138.664 155.072 148.892 1.00 402.37 ? 171 LEU A CA  1 
ATOM 1056  C C   . LEU A 1 171 ? 138.268 154.925 147.455 1.00 368.99 ? 171 LEU A C   1 
ATOM 1057  O O   . LEU A 1 171 ? 138.918 154.203 146.716 1.00 371.87 ? 171 LEU A O   1 
ATOM 1058  C CB  . LEU A 1 171 ? 137.525 154.638 149.823 1.00 401.59 ? 171 LEU A CB  1 
ATOM 1059  C CG  . LEU A 1 171 ? 137.371 153.149 150.106 1.00 403.00 ? 171 LEU A CG  1 
ATOM 1060  C CD1 . LEU A 1 171 ? 138.652 152.546 150.674 1.00 373.56 ? 171 LEU A CD1 1 
ATOM 1061  C CD2 . LEU A 1 171 ? 136.210 152.956 151.070 1.00 447.89 ? 171 LEU A CD2 1 
ATOM 1062  N N   . ALA A 1 172 ? 137.229 155.652 147.052 1.00 377.30 ? 172 ALA A N   1 
ATOM 1063  C CA  . ALA A 1 172 ? 136.638 155.520 145.710 1.00 419.59 ? 172 ALA A CA  1 
ATOM 1064  C C   . ALA A 1 172 ? 137.671 155.344 144.615 1.00 415.74 ? 172 ALA A C   1 
ATOM 1065  O O   . ALA A 1 172 ? 137.488 154.534 143.706 1.00 440.54 ? 172 ALA A O   1 
ATOM 1066  C CB  . ALA A 1 172 ? 135.759 156.714 145.397 1.00 479.59 ? 172 ALA A CB  1 
ATOM 1067  N N   . TYR A 1 173 ? 138.762 156.094 144.734 1.00 393.85 ? 173 TYR A N   1 
ATOM 1068  C CA  . TYR A 1 173 ? 139.854 156.067 143.788 1.00 384.13 ? 173 TYR A CA  1 
ATOM 1069  C C   . TYR A 1 173 ? 140.918 155.125 144.344 1.00 376.48 ? 173 TYR A C   1 
ATOM 1070  O O   . TYR A 1 173 ? 142.043 155.533 144.619 1.00 428.29 ? 173 TYR A O   1 
ATOM 1071  C CB  . TYR A 1 173 ? 140.387 157.501 143.571 1.00 415.72 ? 173 TYR A CB  1 
ATOM 1072  C CG  . TYR A 1 173 ? 139.328 158.473 143.065 1.00 410.98 ? 173 TYR A CG  1 
ATOM 1073  C CD1 . TYR A 1 173 ? 138.391 159.040 143.934 1.00 428.45 ? 173 TYR A CD1 1 
ATOM 1074  C CD2 . TYR A 1 173 ? 139.254 158.815 141.717 1.00 441.08 ? 173 TYR A CD2 1 
ATOM 1075  C CE1 . TYR A 1 173 ? 137.411 159.908 143.476 1.00 422.40 ? 173 TYR A CE1 1 
ATOM 1076  C CE2 . TYR A 1 173 ? 138.276 159.685 141.250 1.00 461.99 ? 173 TYR A CE2 1 
ATOM 1077  C CZ  . TYR A 1 173 ? 137.355 160.226 142.134 1.00 443.56 ? 173 TYR A CZ  1 
ATOM 1078  O OH  . TYR A 1 173 ? 136.383 161.090 141.680 1.00 446.37 ? 173 TYR A OH  1 
ATOM 1079  N N   . GLU A 1 174 ? 140.537 153.860 144.517 1.00 390.98 ? 174 GLU A N   1 
ATOM 1080  C CA  . GLU A 1 174 ? 141.441 152.823 145.014 1.00 450.51 ? 174 GLU A CA  1 
ATOM 1081  C C   . GLU A 1 174 ? 141.005 151.472 144.444 1.00 444.19 ? 174 GLU A C   1 
ATOM 1082  O O   . GLU A 1 174 ? 139.834 151.090 144.533 1.00 416.28 ? 174 GLU A O   1 
ATOM 1083  C CB  . GLU A 1 174 ? 141.455 152.785 146.550 1.00 488.27 ? 174 GLU A CB  1 
ATOM 1084  C CG  . GLU A 1 174 ? 142.658 152.076 147.188 1.00 500.00 ? 174 GLU A CG  1 
ATOM 1085  C CD  . GLU A 1 174 ? 143.791 153.004 147.641 1.00 500.00 ? 174 GLU A CD  1 
ATOM 1086  O OE1 . GLU A 1 174 ? 143.551 154.197 147.939 1.00 500.00 ? 174 GLU A OE1 1 
ATOM 1087  O OE2 . GLU A 1 174 ? 144.942 152.522 147.722 1.00 490.76 ? 174 GLU A OE2 1 
ATOM 1088  N N   . ASP A 1 175 ? 141.966 150.755 143.874 1.00 456.76 ? 175 ASP A N   1 
ATOM 1089  C CA  . ASP A 1 175 ? 141.713 149.501 143.174 1.00 474.46 ? 175 ASP A CA  1 
ATOM 1090  C C   . ASP A 1 175 ? 141.555 148.345 144.176 1.00 456.69 ? 175 ASP A C   1 
ATOM 1091  O O   . ASP A 1 175 ? 142.035 148.443 145.309 1.00 448.19 ? 175 ASP A O   1 
ATOM 1092  C CB  . ASP A 1 175 ? 142.883 149.232 142.209 1.00 492.50 ? 175 ASP A CB  1 
ATOM 1093  C CG  . ASP A 1 175 ? 142.491 148.394 141.013 1.00 500.00 ? 175 ASP A CG  1 
ATOM 1094  O OD1 . ASP A 1 175 ? 141.345 148.517 140.531 1.00 500.00 ? 175 ASP A OD1 1 
ATOM 1095  O OD2 . ASP A 1 175 ? 143.347 147.620 140.534 1.00 500.00 ? 175 ASP A OD2 1 
ATOM 1096  N N   . PHE A 1 176 ? 140.876 147.269 143.763 1.00 443.54 ? 176 PHE A N   1 
ATOM 1097  C CA  . PHE A 1 176 ? 140.745 146.046 144.581 1.00 434.70 ? 176 PHE A CA  1 
ATOM 1098  C C   . PHE A 1 176 ? 140.747 144.769 143.743 1.00 443.86 ? 176 PHE A C   1 
ATOM 1099  O O   . PHE A 1 176 ? 140.158 144.729 142.662 1.00 499.90 ? 176 PHE A O   1 
ATOM 1100  C CB  . PHE A 1 176 ? 139.477 146.098 145.440 1.00 440.94 ? 176 PHE A CB  1 
ATOM 1101  C CG  . PHE A 1 176 ? 139.529 147.150 146.496 1.00 429.02 ? 176 PHE A CG  1 
ATOM 1102  C CD1 . PHE A 1 176 ? 140.157 146.895 147.703 1.00 454.84 ? 176 PHE A CD1 1 
ATOM 1103  C CD2 . PHE A 1 176 ? 139.013 148.416 146.264 1.00 429.62 ? 176 PHE A CD2 1 
ATOM 1104  C CE1 . PHE A 1 176 ? 140.250 147.872 148.676 1.00 457.86 ? 176 PHE A CE1 1 
ATOM 1105  C CE2 . PHE A 1 176 ? 139.097 149.398 147.234 1.00 467.22 ? 176 PHE A CE2 1 
ATOM 1106  C CZ  . PHE A 1 176 ? 139.717 149.125 148.443 1.00 464.21 ? 176 PHE A CZ  1 
ATOM 1107  N N   . SER A 1 177 ? 141.401 143.730 144.259 1.00 450.06 ? 177 SER A N   1 
ATOM 1108  C CA  . SER A 1 177 ? 141.448 142.414 143.603 1.00 495.17 ? 177 SER A CA  1 
ATOM 1109  C C   . SER A 1 177 ? 140.109 141.686 143.657 1.00 467.11 ? 177 SER A C   1 
ATOM 1110  O O   . SER A 1 177 ? 139.761 140.937 142.743 1.00 469.08 ? 177 SER A O   1 
ATOM 1111  C CB  . SER A 1 177 ? 142.486 141.522 144.285 1.00 500.00 ? 177 SER A CB  1 
ATOM 1112  O OG  . SER A 1 177 ? 142.001 141.040 145.528 1.00 500.00 ? 177 SER A OG  1 
ATOM 1113  N N   . PHE A 1 178 ? 139.391 141.919 144.749 1.00 420.33 ? 178 PHE A N   1 
ATOM 1114  C CA  . PHE A 1 178 ? 138.174 141.194 145.096 1.00 417.65 ? 178 PHE A CA  1 
ATOM 1115  C C   . PHE A 1 178 ? 137.003 142.114 144.814 1.00 388.55 ? 178 PHE A C   1 
ATOM 1116  O O   . PHE A 1 178 ? 137.221 143.279 144.489 1.00 447.95 ? 178 PHE A O   1 
ATOM 1117  C CB  . PHE A 1 178 ? 138.198 140.801 146.573 1.00 428.99 ? 178 PHE A CB  1 
ATOM 1118  C CG  . PHE A 1 178 ? 138.409 141.956 147.488 1.00 411.68 ? 178 PHE A CG  1 
ATOM 1119  C CD1 . PHE A 1 178 ? 137.351 142.762 147.857 1.00 390.44 ? 178 PHE A CD1 1 
ATOM 1120  C CD2 . PHE A 1 178 ? 139.685 142.262 147.947 1.00 445.99 ? 178 PHE A CD2 1 
ATOM 1121  C CE1 . PHE A 1 178 ? 137.559 143.850 148.682 1.00 442.78 ? 178 PHE A CE1 1 
ATOM 1122  C CE2 . PHE A 1 178 ? 139.900 143.346 148.779 1.00 447.39 ? 178 PHE A CE2 1 
ATOM 1123  C CZ  . PHE A 1 178 ? 138.833 144.141 149.146 1.00 443.93 ? 178 PHE A CZ  1 
ATOM 1124  N N   . PRO A 1 179 ? 135.760 141.611 144.940 1.00 381.74 ? 179 PRO A N   1 
ATOM 1125  C CA  . PRO A 1 179 ? 134.595 142.442 144.649 1.00 421.19 ? 179 PRO A CA  1 
ATOM 1126  C C   . PRO A 1 179 ? 133.803 142.909 145.871 1.00 414.02 ? 179 PRO A C   1 
ATOM 1127  O O   . PRO A 1 179 ? 133.801 142.240 146.908 1.00 403.70 ? 179 PRO A O   1 
ATOM 1128  C CB  . PRO A 1 179 ? 133.748 141.514 143.805 1.00 434.61 ? 179 PRO A CB  1 
ATOM 1129  C CG  . PRO A 1 179 ? 133.968 140.194 144.450 1.00 439.67 ? 179 PRO A CG  1 
ATOM 1130  C CD  . PRO A 1 179 ? 135.389 140.188 144.931 1.00 422.48 ? 179 PRO A CD  1 
ATOM 1131  N N   . ILE A 1 180 ? 133.139 144.060 145.732 1.00 391.38 ? 180 ILE A N   1 
ATOM 1132  C CA  . ILE A 1 180 ? 132.317 144.624 146.800 1.00 359.55 ? 180 ILE A CA  1 
ATOM 1133  C C   . ILE A 1 180 ? 130.942 144.968 146.280 1.00 356.60 ? 180 ILE A C   1 
ATOM 1134  O O   . ILE A 1 180 ? 130.810 145.405 145.150 1.00 367.61 ? 180 ILE A O   1 
ATOM 1135  C CB  . ILE A 1 180 ? 132.938 145.881 147.424 1.00 360.73 ? 180 ILE A CB  1 
ATOM 1136  C CG1 . ILE A 1 180 ? 134.414 145.664 147.774 1.00 445.94 ? 180 ILE A CG1 1 
ATOM 1137  C CG2 . ILE A 1 180 ? 132.226 146.235 148.723 1.00 421.46 ? 180 ILE A CG2 1 
ATOM 1138  C CD1 . ILE A 1 180 ? 135.409 146.243 146.795 1.00 476.84 ? 180 ILE A CD1 1 
ATOM 1139  N N   . PHE A 1 181 ? 129.925 144.754 147.116 1.00 387.56 ? 181 PHE A N   1 
ATOM 1140  C CA  . PHE A 1 181 ? 128.545 145.139 146.800 1.00 410.84 ? 181 PHE A CA  1 
ATOM 1141  C C   . PHE A 1 181 ? 127.911 145.951 147.915 1.00 428.08 ? 181 PHE A C   1 
ATOM 1142  O O   . PHE A 1 181 ? 128.283 145.818 149.079 1.00 431.93 ? 181 PHE A O   1 
ATOM 1143  C CB  . PHE A 1 181 ? 127.688 143.903 146.557 1.00 416.49 ? 181 PHE A CB  1 
ATOM 1144  C CG  . PHE A 1 181 ? 127.597 143.518 145.123 1.00 394.46 ? 181 PHE A CG  1 
ATOM 1145  C CD1 . PHE A 1 181 ? 128.728 143.127 144.438 1.00 402.26 ? 181 PHE A CD1 1 
ATOM 1146  C CD2 . PHE A 1 181 ? 126.387 143.568 144.452 1.00 421.78 ? 181 PHE A CD2 1 
ATOM 1147  C CE1 . PHE A 1 181 ? 128.661 142.771 143.104 1.00 473.43 ? 181 PHE A CE1 1 
ATOM 1148  C CE2 . PHE A 1 181 ? 126.308 143.213 143.116 1.00 483.72 ? 181 PHE A CE2 1 
ATOM 1149  C CZ  . PHE A 1 181 ? 127.447 142.803 142.443 1.00 496.43 ? 181 PHE A CZ  1 
ATOM 1150  N N   . LEU A 1 182 ? 126.929 146.768 147.537 1.00 405.59 ? 182 LEU A N   1 
ATOM 1151  C CA  . LEU A 1 182 ? 126.152 147.571 148.478 1.00 365.97 ? 182 LEU A CA  1 
ATOM 1152  C C   . LEU A 1 182 ? 124.730 147.053 148.487 1.00 382.89 ? 182 LEU A C   1 
ATOM 1153  O O   . LEU A 1 182 ? 124.011 147.218 147.501 1.00 396.35 ? 182 LEU A O   1 
ATOM 1154  C CB  . LEU A 1 182 ? 126.154 149.014 148.026 1.00 369.45 ? 182 LEU A CB  1 
ATOM 1155  C CG  . LEU A 1 182 ? 125.141 149.955 148.659 1.00 417.82 ? 182 LEU A CG  1 
ATOM 1156  C CD1 . LEU A 1 182 ? 125.435 150.119 150.142 1.00 484.00 ? 182 LEU A CD1 1 
ATOM 1157  C CD2 . LEU A 1 182 ? 125.205 151.281 147.924 1.00 473.90 ? 182 LEU A CD2 1 
ATOM 1158  N N   . LEU A 1 183 ? 124.310 146.429 149.582 1.00 391.38 ? 183 LEU A N   1 
ATOM 1159  C CA  . LEU A 1 183 ? 122.980 145.830 149.599 1.00 381.02 ? 183 LEU A CA  1 
ATOM 1160  C C   . LEU A 1 183 ? 121.950 146.871 149.980 1.00 393.25 ? 183 LEU A C   1 
ATOM 1161  O O   . LEU A 1 183 ? 121.598 147.009 151.155 1.00 431.75 ? 183 LEU A O   1 
ATOM 1162  C CB  . LEU A 1 183 ? 122.912 144.621 150.534 1.00 398.26 ? 183 LEU A CB  1 
ATOM 1163  C CG  . LEU A 1 183 ? 123.823 143.403 150.271 1.00 423.89 ? 183 LEU A CG  1 
ATOM 1164  C CD1 . LEU A 1 183 ? 123.123 142.135 150.738 1.00 412.45 ? 183 LEU A CD1 1 
ATOM 1165  C CD2 . LEU A 1 183 ? 124.253 143.236 148.819 1.00 447.70 ? 183 LEU A CD2 1 
ATOM 1166  N N   . GLU A 1 184 ? 121.489 147.620 148.976 1.00 409.44 ? 184 GLU A N   1 
ATOM 1167  C CA  . GLU A 1 184 ? 120.273 148.430 149.102 1.00 430.84 ? 184 GLU A CA  1 
ATOM 1168  C C   . GLU A 1 184 ? 119.197 147.454 149.512 1.00 401.35 ? 184 GLU A C   1 
ATOM 1169  O O   . GLU A 1 184 ? 119.277 146.288 149.154 1.00 393.30 ? 184 GLU A O   1 
ATOM 1170  C CB  . GLU A 1 184 ? 119.882 149.096 147.773 1.00 500.00 ? 184 GLU A CB  1 
ATOM 1171  C CG  . GLU A 1 184 ? 120.780 150.253 147.330 1.00 500.00 ? 184 GLU A CG  1 
ATOM 1172  C CD  . GLU A 1 184 ? 120.302 150.959 146.057 1.00 500.00 ? 184 GLU A CD  1 
ATOM 1173  O OE1 . GLU A 1 184 ? 119.711 150.294 145.177 1.00 500.00 ? 184 GLU A OE1 1 
ATOM 1174  O OE2 . GLU A 1 184 ? 120.528 152.187 145.929 1.00 436.59 ? 184 GLU A OE2 1 
ATOM 1175  N N   . ASP A 1 185 ? 118.210 147.917 150.270 1.00 475.58 ? 185 ASP A N   1 
ATOM 1176  C CA  . ASP A 1 185 ? 117.229 147.031 150.924 1.00 500.00 ? 185 ASP A CA  1 
ATOM 1177  C C   . ASP A 1 185 ? 117.891 146.231 152.048 1.00 500.00 ? 185 ASP A C   1 
ATOM 1178  O O   . ASP A 1 185 ? 118.777 145.405 151.817 1.00 481.88 ? 185 ASP A O   1 
ATOM 1179  C CB  . ASP A 1 185 ? 116.511 146.083 149.927 1.00 500.00 ? 185 ASP A CB  1 
ATOM 1180  C CG  . ASP A 1 185 ? 115.502 145.150 150.601 1.00 500.00 ? 185 ASP A CG  1 
ATOM 1181  O OD1 . ASP A 1 185 ? 114.909 145.520 151.641 1.00 500.00 ? 185 ASP A OD1 1 
ATOM 1182  O OD2 . ASP A 1 185 ? 115.302 144.032 150.077 1.00 500.00 ? 185 ASP A OD2 1 
ATOM 1183  N N   . GLU A 1 186 ? 117.428 146.481 153.265 1.00 500.00 ? 186 GLU A N   1 
ATOM 1184  C CA  . GLU A 1 186 ? 117.917 145.776 154.431 1.00 500.00 ? 186 GLU A CA  1 
ATOM 1185  C C   . GLU A 1 186 ? 117.430 144.326 154.506 1.00 499.22 ? 186 GLU A C   1 
ATOM 1186  O O   . GLU A 1 186 ? 118.016 143.556 155.273 1.00 500.00 ? 186 GLU A O   1 
ATOM 1187  C CB  . GLU A 1 186 ? 117.497 146.526 155.706 1.00 500.00 ? 186 GLU A CB  1 
ATOM 1188  C CG  . GLU A 1 186 ? 118.246 146.097 156.966 1.00 500.00 ? 186 GLU A CG  1 
ATOM 1189  C CD  . GLU A 1 186 ? 118.027 147.022 158.154 1.00 500.00 ? 186 GLU A CD  1 
ATOM 1190  O OE1 . GLU A 1 186 ? 116.892 147.529 158.318 1.00 500.00 ? 186 GLU A OE1 1 
ATOM 1191  O OE2 . GLU A 1 186 ? 118.989 147.228 158.935 1.00 500.00 ? 186 GLU A OE2 1 
ATOM 1192  N N   . ASN A 1 187 ? 116.331 144.011 153.817 1.00 481.88 ? 187 ASN A N   1 
ATOM 1193  C CA  . ASN A 1 187 ? 115.725 142.712 153.926 1.00 486.27 ? 187 ASN A CA  1 
ATOM 1194  C C   . ASN A 1 187 ? 116.682 141.612 153.487 1.00 443.45 ? 187 ASN A C   1 
ATOM 1195  O O   . ASN A 1 187 ? 116.791 140.582 154.171 1.00 469.17 ? 187 ASN A O   1 
ATOM 1196  C CB  . ASN A 1 187 ? 114.361 142.653 153.211 1.00 483.42 ? 187 ASN A CB  1 
ATOM 1197  C CG  . ASN A 1 187 ? 113.277 143.436 153.957 1.00 484.10 ? 187 ASN A CG  1 
ATOM 1198  O OD1 . ASN A 1 187 ? 113.571 144.259 154.834 1.00 459.12 ? 187 ASN A OD1 1 
ATOM 1199  N ND2 . ASN A 1 187 ? 112.016 143.179 153.611 1.00 495.92 ? 187 ASN A ND2 1 
ATOM 1200  N N   . GLU A 1 188 ? 117.380 141.872 152.389 1.00 431.68 ? 188 GLU A N   1 
ATOM 1201  C CA  . GLU A 1 188 ? 118.375 140.946 151.847 1.00 500.00 ? 188 GLU A CA  1 
ATOM 1202  C C   . GLU A 1 188 ? 119.456 140.659 152.892 1.00 459.58 ? 188 GLU A C   1 
ATOM 1203  O O   . GLU A 1 188 ? 119.833 139.497 153.131 1.00 495.61 ? 188 GLU A O   1 
ATOM 1204  C CB  . GLU A 1 188 ? 118.984 141.503 150.551 1.00 500.00 ? 188 GLU A CB  1 
ATOM 1205  C CG  . GLU A 1 188 ? 118.088 141.276 149.330 1.00 500.00 ? 188 GLU A CG  1 
ATOM 1206  C CD  . GLU A 1 188 ? 118.085 142.411 148.317 1.00 500.00 ? 188 GLU A CD  1 
ATOM 1207  O OE1 . GLU A 1 188 ? 119.154 142.992 148.036 1.00 500.00 ? 188 GLU A OE1 1 
ATOM 1208  O OE2 . GLU A 1 188 ? 117.001 142.707 147.770 1.00 500.00 ? 188 GLU A OE2 1 
ATOM 1209  N N   . THR A 1 189 ? 119.919 141.750 153.495 1.00 428.19 ? 189 THR A N   1 
ATOM 1210  C CA  . THR A 1 189 ? 120.963 141.691 154.530 1.00 486.46 ? 189 THR A CA  1 
ATOM 1211  C C   . THR A 1 189 ? 120.502 140.822 155.689 1.00 464.87 ? 189 THR A C   1 
ATOM 1212  O O   . THR A 1 189 ? 121.252 139.972 156.179 1.00 474.99 ? 189 THR A O   1 
ATOM 1213  C CB  . THR A 1 189 ? 121.434 143.065 155.064 1.00 500.00 ? 189 THR A CB  1 
ATOM 1214  O OG1 . THR A 1 189 ? 120.432 143.641 155.909 1.00 500.00 ? 189 THR A OG1 1 
ATOM 1215  C CG2 . THR A 1 189 ? 121.800 144.035 153.917 1.00 500.00 ? 189 THR A CG2 1 
ATOM 1216  N N   . LYS A 1 190 ? 119.267 141.062 156.101 1.00 498.62 ? 190 LYS A N   1 
ATOM 1217  C CA  . LYS A 1 190 ? 118.631 140.334 157.205 1.00 500.00 ? 190 LYS A CA  1 
ATOM 1218  C C   . LYS A 1 190 ? 118.615 138.840 156.899 1.00 480.85 ? 190 LYS A C   1 
ATOM 1219  O O   . LYS A 1 190 ? 118.963 138.014 157.753 1.00 441.88 ? 190 LYS A O   1 
ATOM 1220  C CB  . LYS A 1 190 ? 117.224 140.905 157.439 1.00 500.00 ? 190 LYS A CB  1 
ATOM 1221  C CG  . LYS A 1 190 ? 116.528 140.448 158.707 1.00 500.00 ? 190 LYS A CG  1 
ATOM 1222  C CD  . LYS A 1 190 ? 115.433 139.433 158.406 1.00 500.00 ? 190 LYS A CD  1 
ATOM 1223  C CE  . LYS A 1 190 ? 114.597 139.120 159.644 1.00 500.00 ? 190 LYS A CE  1 
ATOM 1224  N NZ  . LYS A 1 190 ? 113.435 138.226 159.351 1.00 500.00 ? 190 LYS A NZ  1 
ATOM 1225  N N   . VAL A 1 191 ? 118.205 138.533 155.677 1.00 470.57 ? 191 VAL A N   1 
ATOM 1226  C CA  . VAL A 1 191 ? 118.117 137.155 155.183 1.00 466.70 ? 191 VAL A CA  1 
ATOM 1227  C C   . VAL A 1 191 ? 119.486 136.476 155.283 1.00 410.99 ? 191 VAL A C   1 
ATOM 1228  O O   . VAL A 1 191 ? 119.604 135.336 155.769 1.00 416.75 ? 191 VAL A O   1 
ATOM 1229  C CB  . VAL A 1 191 ? 117.642 137.096 153.707 1.00 500.00 ? 191 VAL A CB  1 
ATOM 1230  C CG1 . VAL A 1 191 ? 117.974 135.754 153.044 1.00 500.00 ? 191 VAL A CG1 1 
ATOM 1231  C CG2 . VAL A 1 191 ? 116.148 137.392 153.617 1.00 500.00 ? 191 VAL A CG2 1 
ATOM 1232  N N   . ILE A 1 192 ? 120.488 137.211 154.813 1.00 375.66 ? 192 ILE A N   1 
ATOM 1233  C CA  . ILE A 1 192 ? 121.873 136.743 154.809 1.00 412.31 ? 192 ILE A CA  1 
ATOM 1234  C C   . ILE A 1 192 ? 122.320 136.409 156.240 1.00 432.65 ? 192 ILE A C   1 
ATOM 1235  O O   . ILE A 1 192 ? 122.923 135.355 156.492 1.00 423.66 ? 192 ILE A O   1 
ATOM 1236  C CB  . ILE A 1 192 ? 122.821 137.711 154.082 1.00 437.44 ? 192 ILE A CB  1 
ATOM 1237  C CG1 . ILE A 1 192 ? 122.504 137.707 152.585 1.00 446.60 ? 192 ILE A CG1 1 
ATOM 1238  C CG2 . ILE A 1 192 ? 124.275 137.298 154.274 1.00 434.85 ? 192 ILE A CG2 1 
ATOM 1239  C CD1 . ILE A 1 192 ? 123.112 138.859 151.816 1.00 478.64 ? 192 ILE A CD1 1 
ATOM 1240  N N   . LYS A 1 193 ? 122.003 137.328 157.136 1.00 447.32 ? 193 LYS A N   1 
ATOM 1241  C CA  . LYS A 1 193 ? 122.334 137.203 158.557 1.00 457.28 ? 193 LYS A CA  1 
ATOM 1242  C C   . LYS A 1 193 ? 121.717 135.937 159.132 1.00 465.93 ? 193 LYS A C   1 
ATOM 1243  O O   . LYS A 1 193 ? 122.378 135.172 159.845 1.00 420.25 ? 193 LYS A O   1 
ATOM 1244  C CB  . LYS A 1 193 ? 121.886 138.446 159.325 1.00 500.00 ? 193 LYS A CB  1 
ATOM 1245  C CG  . LYS A 1 193 ? 122.739 139.672 159.037 1.00 500.00 ? 193 LYS A CG  1 
ATOM 1246  C CD  . LYS A 1 193 ? 122.029 140.963 159.428 1.00 500.00 ? 193 LYS A CD  1 
ATOM 1247  C CE  . LYS A 1 193 ? 123.010 142.099 159.678 1.00 500.00 ? 193 LYS A CE  1 
ATOM 1248  N NZ  . LYS A 1 193 ? 122.387 143.220 160.437 1.00 500.00 ? 193 LYS A NZ  1 
ATOM 1249  N N   . GLN A 1 194 ? 120.448 135.747 158.802 1.00 495.68 ? 194 GLN A N   1 
ATOM 1250  C CA  . GLN A 1 194 ? 119.671 134.581 159.246 1.00 500.00 ? 194 GLN A CA  1 
ATOM 1251  C C   . GLN A 1 194 ? 120.349 133.299 158.792 1.00 481.00 ? 194 GLN A C   1 
ATOM 1252  O O   . GLN A 1 194 ? 120.509 132.351 159.575 1.00 481.27 ? 194 GLN A O   1 
ATOM 1253  C CB  . GLN A 1 194 ? 118.230 134.591 158.733 1.00 500.00 ? 194 GLN A CB  1 
ATOM 1254  C CG  . GLN A 1 194 ? 117.206 134.685 159.849 1.00 500.00 ? 194 GLN A CG  1 
ATOM 1255  C CD  . GLN A 1 194 ? 115.811 134.285 159.412 1.00 500.00 ? 194 GLN A CD  1 
ATOM 1256  O OE1 . GLN A 1 194 ? 115.491 134.267 158.217 1.00 500.00 ? 194 GLN A OE1 1 
ATOM 1257  N NE2 . GLN A 1 194 ? 114.966 133.960 160.386 1.00 500.00 ? 194 GLN A NE2 1 
ATOM 1258  N N   . CYS A 1 195 ? 120.732 133.303 157.520 1.00 450.50 ? 195 CYS A N   1 
ATOM 1259  C CA  . CYS A 1 195 ? 121.405 132.164 156.889 1.00 463.45 ? 195 CYS A CA  1 
ATOM 1260  C C   . CYS A 1 195 ? 122.687 131.825 157.648 1.00 473.47 ? 195 CYS A C   1 
ATOM 1261  O O   . CYS A 1 195 ? 122.963 130.656 157.953 1.00 500.00 ? 195 CYS A O   1 
ATOM 1262  C CB  . CYS A 1 195 ? 121.724 132.440 155.433 1.00 467.69 ? 195 CYS A CB  1 
ATOM 1263  S SG  . CYS A 1 195 ? 122.584 131.042 154.678 1.00 500.00 ? 195 CYS A SG  1 
ATOM 1264  N N   . TYR A 1 196 ? 123.444 132.876 157.930 1.00 427.79 ? 196 TYR A N   1 
ATOM 1265  C CA  . TYR A 1 196 ? 124.713 132.778 158.659 1.00 431.73 ? 196 TYR A CA  1 
ATOM 1266  C C   . TYR A 1 196 ? 124.494 132.116 160.014 1.00 447.01 ? 196 TYR A C   1 
ATOM 1267  O O   . TYR A 1 196 ? 125.231 131.205 160.416 1.00 480.31 ? 196 TYR A O   1 
ATOM 1268  C CB  . TYR A 1 196 ? 125.260 134.177 158.946 1.00 440.03 ? 196 TYR A CB  1 
ATOM 1269  C CG  . TYR A 1 196 ? 126.464 134.211 159.851 1.00 446.02 ? 196 TYR A CG  1 
ATOM 1270  C CD1 . TYR A 1 196 ? 127.740 133.962 159.352 1.00 485.02 ? 196 TYR A CD1 1 
ATOM 1271  C CD2 . TYR A 1 196 ? 126.336 134.514 161.201 1.00 446.27 ? 196 TYR A CD2 1 
ATOM 1272  C CE1 . TYR A 1 196 ? 128.855 133.997 160.175 1.00 500.00 ? 196 TYR A CE1 1 
ATOM 1273  C CE2 . TYR A 1 196 ? 127.448 134.554 162.036 1.00 500.00 ? 196 TYR A CE2 1 
ATOM 1274  C CZ  . TYR A 1 196 ? 128.708 134.297 161.518 1.00 500.00 ? 196 TYR A CZ  1 
ATOM 1275  O OH  . TYR A 1 196 ? 129.817 134.332 162.336 1.00 492.97 ? 196 TYR A OH  1 
ATOM 1276  N N   . GLN A 1 197 ? 123.470 132.611 160.692 1.00 474.36 ? 197 GLN A N   1 
ATOM 1277  C CA  . GLN A 1 197 ? 123.079 132.125 162.022 1.00 500.00 ? 197 GLN A CA  1 
ATOM 1278  C C   . GLN A 1 197 ? 122.778 130.633 161.967 1.00 499.10 ? 197 GLN A C   1 
ATOM 1279  O O   . GLN A 1 197 ? 123.236 129.858 162.816 1.00 455.70 ? 197 GLN A O   1 
ATOM 1280  C CB  . GLN A 1 197 ? 121.863 132.889 162.568 1.00 500.00 ? 197 GLN A CB  1 
ATOM 1281  C CG  . GLN A 1 197 ? 122.197 133.771 163.759 1.00 500.00 ? 197 GLN A CG  1 
ATOM 1282  C CD  . GLN A 1 197 ? 123.415 134.653 163.516 1.00 500.00 ? 197 GLN A CD  1 
ATOM 1283  O OE1 . GLN A 1 197 ? 123.395 135.539 162.662 1.00 500.00 ? 197 GLN A OE1 1 
ATOM 1284  N NE2 . GLN A 1 197 ? 124.487 134.402 164.266 1.00 500.00 ? 197 GLN A NE2 1 
ATOM 1285  N N   . ASP A 1 198 ? 122.004 130.266 160.953 1.00 483.11 ? 198 ASP A N   1 
ATOM 1286  C CA  . ASP A 1 198 ? 121.604 128.881 160.715 1.00 476.00 ? 198 ASP A CA  1 
ATOM 1287  C C   . ASP A 1 198 ? 122.829 127.990 160.560 1.00 420.66 ? 198 ASP A C   1 
ATOM 1288  O O   . ASP A 1 198 ? 122.724 126.848 160.954 1.00 463.73 ? 198 ASP A O   1 
ATOM 1289  C CB  . ASP A 1 198 ? 120.672 128.739 159.503 1.00 500.00 ? 198 ASP A CB  1 
ATOM 1290  C CG  . ASP A 1 198 ? 119.253 129.205 159.792 1.00 500.00 ? 198 ASP A CG  1 
ATOM 1291  O OD1 . ASP A 1 198 ? 119.056 130.066 160.681 1.00 500.00 ? 198 ASP A OD1 1 
ATOM 1292  O OD2 . ASP A 1 198 ? 118.330 128.700 159.113 1.00 500.00 ? 198 ASP A OD2 1 
ATOM 1293  N N   . HIS A 1 199 ? 123.988 128.452 160.074 1.00 395.68 ? 199 HIS A N   1 
ATOM 1294  C CA  . HIS A 1 199 ? 125.098 127.509 159.790 1.00 411.61 ? 199 HIS A CA  1 
ATOM 1295  C C   . HIS A 1 199 ? 126.527 127.813 160.263 1.00 433.24 ? 199 HIS A C   1 
ATOM 1296  O O   . HIS A 1 199 ? 127.212 126.896 160.723 1.00 442.05 ? 199 HIS A O   1 
ATOM 1297  C CB  . HIS A 1 199 ? 125.126 127.219 158.296 1.00 426.47 ? 199 HIS A CB  1 
ATOM 1298  C CG  . HIS A 1 199 ? 123.793 126.834 157.752 1.00 423.63 ? 199 HIS A CG  1 
ATOM 1299  N ND1 . HIS A 1 199 ? 123.164 125.661 158.100 1.00 446.71 ? 199 HIS A ND1 1 
ATOM 1300  C CD2 . HIS A 1 199 ? 122.943 127.489 156.928 1.00 457.78 ? 199 HIS A CD2 1 
ATOM 1301  C CE1 . HIS A 1 199 ? 121.991 125.598 157.496 1.00 488.34 ? 199 HIS A CE1 1 
ATOM 1302  N NE2 . HIS A 1 199 ? 121.833 126.696 156.777 1.00 475.40 ? 199 HIS A NE2 1 
ATOM 1303  N N   . ASN A 1 200 ? 126.987 129.058 160.151 1.00 433.44 ? 200 ASN A N   1 
ATOM 1304  C CA  . ASN A 1 200 ? 128.429 129.357 160.261 1.00 472.71 ? 200 ASN A CA  1 
ATOM 1305  C C   . ASN A 1 200 ? 128.957 129.771 161.649 1.00 500.00 ? 200 ASN A C   1 
ATOM 1306  O O   . ASN A 1 200 ? 129.625 130.807 161.780 1.00 500.00 ? 200 ASN A O   1 
ATOM 1307  C CB  . ASN A 1 200 ? 128.794 130.439 159.248 1.00 460.69 ? 200 ASN A CB  1 
ATOM 1308  C CG  . ASN A 1 200 ? 128.405 130.078 157.838 1.00 461.05 ? 200 ASN A CG  1 
ATOM 1309  O OD1 . ASN A 1 200 ? 127.885 128.996 157.576 1.00 467.75 ? 200 ASN A OD1 1 
ATOM 1310  N ND2 . ASN A 1 200 ? 128.662 130.990 156.912 1.00 500.00 ? 200 ASN A ND2 1 
ATOM 1311  N N   . LEU A 1 201 ? 128.697 128.951 162.671 1.00 500.00 ? 201 LEU A N   1 
ATOM 1312  C CA  . LEU A 1 201 ? 129.149 129.237 164.047 1.00 500.00 ? 201 LEU A CA  1 
ATOM 1313  C C   . LEU A 1 201 ? 130.230 128.261 164.525 1.00 500.00 ? 201 LEU A C   1 
ATOM 1314  O O   . LEU A 1 201 ? 130.160 127.060 164.237 1.00 500.00 ? 201 LEU A O   1 
ATOM 1315  C CB  . LEU A 1 201 ? 127.968 129.189 165.026 1.00 500.00 ? 201 LEU A CB  1 
ATOM 1316  C CG  . LEU A 1 201 ? 126.859 130.246 164.930 1.00 500.00 ? 201 LEU A CG  1 
ATOM 1317  C CD1 . LEU A 1 201 ? 127.403 131.648 164.684 1.00 500.00 ? 201 LEU A CD1 1 
ATOM 1318  C CD2 . LEU A 1 201 ? 125.847 129.897 163.862 1.00 500.00 ? 201 LEU A CD2 1 
ATOM 1319  N N   . SER A 1 202 ? 131.220 128.786 165.255 1.00 500.00 ? 202 SER A N   1 
ATOM 1320  C CA  . SER A 1 202 ? 132.196 127.961 165.969 1.00 500.00 ? 202 SER A CA  1 
ATOM 1321  C C   . SER A 1 202 ? 131.586 127.609 167.318 1.00 494.89 ? 202 SER A C   1 
ATOM 1322  O O   . SER A 1 202 ? 131.687 128.384 168.271 1.00 425.83 ? 202 SER A O   1 
ATOM 1323  C CB  . SER A 1 202 ? 133.514 128.714 166.157 1.00 492.91 ? 202 SER A CB  1 
ATOM 1324  O OG  . SER A 1 202 ? 133.313 129.942 166.830 1.00 482.90 ? 202 SER A OG  1 
ATOM 1325  N N   . GLN A 1 203 ? 130.940 126.444 167.383 1.00 500.00 ? 203 GLN A N   1 
ATOM 1326  C CA  . GLN A 1 203 ? 130.124 126.066 168.543 1.00 500.00 ? 203 GLN A CA  1 
ATOM 1327  C C   . GLN A 1 203 ? 130.995 125.607 169.691 1.00 500.00 ? 203 GLN A C   1 
ATOM 1328  O O   . GLN A 1 203 ? 131.797 124.686 169.531 1.00 500.00 ? 203 GLN A O   1 
ATOM 1329  C CB  . GLN A 1 203 ? 129.121 124.957 168.190 1.00 500.00 ? 203 GLN A CB  1 
ATOM 1330  C CG  . GLN A 1 203 ? 128.100 125.318 167.107 1.00 500.00 ? 203 GLN A CG  1 
ATOM 1331  C CD  . GLN A 1 203 ? 127.064 126.354 167.548 1.00 500.00 ? 203 GLN A CD  1 
ATOM 1332  O OE1 . GLN A 1 203 ? 127.393 127.512 167.824 1.00 500.00 ? 203 GLN A OE1 1 
ATOM 1333  N NE2 . GLN A 1 203 ? 125.796 125.943 167.588 1.00 500.00 ? 203 GLN A NE2 1 
ATOM 1334  N N   . ASN A 1 204 ? 130.813 126.257 170.843 1.00 500.00 ? 204 ASN A N   1 
ATOM 1335  C CA  . ASN A 1 204 ? 131.564 125.969 172.069 1.00 500.00 ? 204 ASN A CA  1 
ATOM 1336  C C   . ASN A 1 204 ? 133.079 126.226 171.917 1.00 480.54 ? 204 ASN A C   1 
ATOM 1337  O O   . ASN A 1 204 ? 133.910 125.566 172.559 1.00 383.97 ? 204 ASN A O   1 
ATOM 1338  C CB  . ASN A 1 204 ? 131.270 124.536 172.557 1.00 500.00 ? 204 ASN A CB  1 
ATOM 1339  C CG  . ASN A 1 204 ? 129.779 124.186 172.537 1.00 486.87 ? 204 ASN A CG  1 
ATOM 1340  O OD1 . ASN A 1 204 ? 128.953 124.882 171.930 1.00 395.50 ? 204 ASN A OD1 1 
ATOM 1341  N ND2 . ASN A 1 204 ? 129.434 123.087 173.198 1.00 483.67 ? 204 ASN A ND2 1 
ATOM 1342  N N   . GLY A 1 205 ? 133.416 127.202 171.071 1.00 500.00 ? 205 GLY A N   1 
ATOM 1343  C CA  . GLY A 1 205 ? 134.800 127.561 170.762 1.00 500.00 ? 205 GLY A CA  1 
ATOM 1344  C C   . GLY A 1 205 ? 135.581 126.562 169.916 1.00 500.00 ? 205 GLY A C   1 
ATOM 1345  O O   . GLY A 1 205 ? 136.804 126.462 170.063 1.00 500.00 ? 205 GLY A O   1 
ATOM 1346  N N   . SER A 1 206 ? 134.896 125.844 169.021 1.00 500.00 ? 206 SER A N   1 
ATOM 1347  C CA  . SER A 1 206 ? 135.531 124.796 168.203 1.00 500.00 ? 206 SER A CA  1 
ATOM 1348  C C   . SER A 1 206 ? 135.663 125.216 166.729 1.00 500.00 ? 206 SER A C   1 
ATOM 1349  O O   . SER A 1 206 ? 136.644 125.876 166.358 1.00 500.00 ? 206 SER A O   1 
ATOM 1350  C CB  . SER A 1 206 ? 134.784 123.457 168.363 1.00 500.00 ? 206 SER A CB  1 
ATOM 1351  O OG  . SER A 1 206 ? 135.005 122.899 169.650 1.00 500.00 ? 206 SER A OG  1 
ATOM 1352  N N   . ALA A 1 207 ? 134.677 124.860 165.905 1.00 500.00 ? 207 ALA A N   1 
ATOM 1353  C CA  . ALA A 1 207 ? 134.785 125.002 164.454 1.00 500.00 ? 207 ALA A CA  1 
ATOM 1354  C C   . ALA A 1 207 ? 133.438 124.666 163.797 1.00 500.00 ? 207 ALA A C   1 
ATOM 1355  O O   . ALA A 1 207 ? 132.563 124.072 164.443 1.00 451.12 ? 207 ALA A O   1 
ATOM 1356  C CB  . ALA A 1 207 ? 135.903 124.106 163.913 1.00 500.00 ? 207 ALA A CB  1 
ATOM 1357  N N   . PRO A 1 208 ? 133.265 125.048 162.513 1.00 500.00 ? 208 PRO A N   1 
ATOM 1358  C CA  . PRO A 1 208 ? 131.954 124.937 161.884 1.00 500.00 ? 208 PRO A CA  1 
ATOM 1359  C C   . PRO A 1 208 ? 131.661 123.595 161.203 1.00 500.00 ? 208 PRO A C   1 
ATOM 1360  O O   . PRO A 1 208 ? 132.571 122.931 160.682 1.00 404.41 ? 208 PRO A O   1 
ATOM 1361  C CB  . PRO A 1 208 ? 131.994 126.050 160.840 1.00 500.00 ? 208 PRO A CB  1 
ATOM 1362  C CG  . PRO A 1 208 ? 133.421 126.085 160.405 1.00 500.00 ? 208 PRO A CG  1 
ATOM 1363  C CD  . PRO A 1 208 ? 134.241 125.697 161.607 1.00 500.00 ? 208 PRO A CD  1 
ATOM 1364  N N   . THR A 1 209 ? 130.380 123.225 161.229 1.00 500.00 ? 209 THR A N   1 
ATOM 1365  C CA  . THR A 1 209 ? 129.827 122.173 160.364 1.00 500.00 ? 209 THR A CA  1 
ATOM 1366  C C   . THR A 1 209 ? 129.787 122.649 158.908 1.00 500.00 ? 209 THR A C   1 
ATOM 1367  O O   . THR A 1 209 ? 129.493 123.818 158.635 1.00 500.00 ? 209 THR A O   1 
ATOM 1368  C CB  . THR A 1 209 ? 128.409 121.734 160.815 1.00 500.00 ? 209 THR A CB  1 
ATOM 1369  O OG1 . THR A 1 209 ? 128.008 120.572 160.076 1.00 500.00 ? 209 THR A OG1 1 
ATOM 1370  C CG2 . THR A 1 209 ? 127.357 122.859 160.633 1.00 500.00 ? 209 THR A CG2 1 
ATOM 1371  N N   . PHE A 1 210 ? 130.057 121.733 157.981 1.00 500.00 ? 210 PHE A N   1 
ATOM 1372  C CA  . PHE A 1 210 ? 130.373 122.099 156.595 1.00 495.18 ? 210 PHE A CA  1 
ATOM 1373  C C   . PHE A 1 210 ? 129.229 122.020 155.554 1.00 470.42 ? 210 PHE A C   1 
ATOM 1374  O O   . PHE A 1 210 ? 129.489 121.869 154.360 1.00 469.91 ? 210 PHE A O   1 
ATOM 1375  C CB  . PHE A 1 210 ? 131.577 121.280 156.127 1.00 500.00 ? 210 PHE A CB  1 
ATOM 1376  C CG  . PHE A 1 210 ? 132.622 122.085 155.404 1.00 500.00 ? 210 PHE A CG  1 
ATOM 1377  C CD1 . PHE A 1 210 ? 132.293 122.933 154.338 1.00 500.00 ? 210 PHE A CD1 1 
ATOM 1378  C CD2 . PHE A 1 210 ? 133.957 121.987 155.779 1.00 500.00 ? 210 PHE A CD2 1 
ATOM 1379  C CE1 . PHE A 1 210 ? 133.271 123.662 153.674 1.00 500.00 ? 210 PHE A CE1 1 
ATOM 1380  C CE2 . PHE A 1 210 ? 134.941 122.713 155.113 1.00 500.00 ? 210 PHE A CE2 1 
ATOM 1381  C CZ  . PHE A 1 210 ? 134.599 123.552 154.059 1.00 500.00 ? 210 PHE A CZ  1 
ATOM 1382  N N   . PRO A 1 211 ? 127.963 122.075 155.993 1.00 441.69 ? 211 PRO A N   1 
ATOM 1383  C CA  . PRO A 1 211 ? 126.933 122.545 155.055 1.00 442.54 ? 211 PRO A CA  1 
ATOM 1384  C C   . PRO A 1 211 ? 126.829 124.073 155.123 1.00 458.55 ? 211 PRO A C   1 
ATOM 1385  O O   . PRO A 1 211 ? 125.800 124.608 155.543 1.00 499.02 ? 211 PRO A O   1 
ATOM 1386  C CB  . PRO A 1 211 ? 125.654 121.853 155.558 1.00 441.41 ? 211 PRO A CB  1 
ATOM 1387  C CG  . PRO A 1 211 ? 126.129 120.720 156.390 1.00 446.51 ? 211 PRO A CG  1 
ATOM 1388  C CD  . PRO A 1 211 ? 127.384 121.209 157.029 1.00 426.13 ? 211 PRO A CD  1 
ATOM 1389  N N   . LEU A 1 212 ? 127.882 124.773 154.701 1.00 430.14 ? 212 LEU A N   1 
ATOM 1390  C CA  . LEU A 1 212 ? 128.048 126.181 155.100 1.00 419.10 ? 212 LEU A CA  1 
ATOM 1391  C C   . LEU A 1 212 ? 127.139 127.122 154.341 1.00 390.87 ? 212 LEU A C   1 
ATOM 1392  O O   . LEU A 1 212 ? 126.602 126.747 153.319 1.00 400.63 ? 212 LEU A O   1 
ATOM 1393  C CB  . LEU A 1 212 ? 129.499 126.627 154.937 1.00 432.27 ? 212 LEU A CB  1 
ATOM 1394  C CG  . LEU A 1 212 ? 130.470 125.993 155.932 1.00 470.40 ? 212 LEU A CG  1 
ATOM 1395  C CD1 . LEU A 1 212 ? 131.910 126.089 155.451 1.00 470.81 ? 212 LEU A CD1 1 
ATOM 1396  C CD2 . LEU A 1 212 ? 130.327 126.618 157.314 1.00 500.00 ? 212 LEU A CD2 1 
ATOM 1397  N N   . CYS A 1 213 ? 126.976 128.336 154.868 1.00 423.91 ? 213 CYS A N   1 
ATOM 1398  C CA  . CYS A 1 213 ? 126.250 129.430 154.204 1.00 449.42 ? 213 CYS A CA  1 
ATOM 1399  C C   . CYS A 1 213 ? 127.240 130.341 153.470 1.00 421.62 ? 213 CYS A C   1 
ATOM 1400  O O   . CYS A 1 213 ? 128.196 130.835 154.063 1.00 406.44 ? 213 CYS A O   1 
ATOM 1401  C CB  . CYS A 1 213 ? 125.460 130.238 155.230 1.00 493.62 ? 213 CYS A CB  1 
ATOM 1402  S SG  . CYS A 1 213 ? 124.531 131.627 154.535 1.00 500.00 ? 213 CYS A SG  1 
ATOM 1403  N N   . ALA A 1 214 ? 126.994 130.572 152.187 1.00 398.24 ? 214 ALA A N   1 
ATOM 1404  C CA  . ALA A 1 214 ? 128.033 131.033 151.285 1.00 410.87 ? 214 ALA A CA  1 
ATOM 1405  C C   . ALA A 1 214 ? 127.472 131.852 150.156 1.00 428.88 ? 214 ALA A C   1 
ATOM 1406  O O   . ALA A 1 214 ? 126.502 131.460 149.508 1.00 377.49 ? 214 ALA A O   1 
ATOM 1407  C CB  . ALA A 1 214 ? 128.801 129.855 150.720 1.00 438.85 ? 214 ALA A CB  1 
ATOM 1408  N N   . MET A 1 215 ? 128.137 132.977 149.915 1.00 465.82 ? 215 MET A N   1 
ATOM 1409  C CA  . MET A 1 215 ? 127.754 133.944 148.913 1.00 451.22 ? 215 MET A CA  1 
ATOM 1410  C C   . MET A 1 215 ? 128.760 133.880 147.768 1.00 421.38 ? 215 MET A C   1 
ATOM 1411  O O   . MET A 1 215 ? 129.956 133.637 147.968 1.00 368.26 ? 215 MET A O   1 
ATOM 1412  C CB  . MET A 1 215 ? 127.740 135.338 149.547 1.00 480.74 ? 215 MET A CB  1 
ATOM 1413  C CG  . MET A 1 215 ? 126.962 136.415 148.809 1.00 496.58 ? 215 MET A CG  1 
ATOM 1414  S SD  . MET A 1 215 ? 126.519 137.801 149.892 1.00 490.87 ? 215 MET A SD  1 
ATOM 1415  C CE  . MET A 1 215 ? 128.066 138.179 150.721 1.00 435.87 ? 215 MET A CE  1 
ATOM 1416  N N   . GLN A 1 216 ? 128.232 134.041 146.567 1.00 427.57 ? 216 GLN A N   1 
ATOM 1417  C CA  . GLN A 1 216 ? 129.010 134.225 145.364 1.00 442.72 ? 216 GLN A CA  1 
ATOM 1418  C C   . GLN A 1 216 ? 128.464 135.503 144.768 1.00 439.27 ? 216 GLN A C   1 
ATOM 1419  O O   . GLN A 1 216 ? 127.326 135.900 145.061 1.00 417.10 ? 216 GLN A O   1 
ATOM 1420  C CB  . GLN A 1 216 ? 128.792 133.039 144.439 1.00 455.43 ? 216 GLN A CB  1 
ATOM 1421  C CG  . GLN A 1 216 ? 129.639 132.979 143.185 1.00 444.86 ? 216 GLN A CG  1 
ATOM 1422  C CD  . GLN A 1 216 ? 129.235 131.821 142.295 1.00 445.20 ? 216 GLN A CD  1 
ATOM 1423  O OE1 . GLN A 1 216 ? 128.232 131.146 142.545 1.00 428.14 ? 216 GLN A OE1 1 
ATOM 1424  N NE2 . GLN A 1 216 ? 129.997 131.599 141.236 1.00 468.66 ? 216 GLN A NE2 1 
ATOM 1425  N N   . LEU A 1 217 ? 129.271 136.159 143.946 1.00 420.49 ? 217 LEU A N   1 
ATOM 1426  C CA  . LEU A 1 217 ? 128.992 137.532 143.586 1.00 396.36 ? 217 LEU A CA  1 
ATOM 1427  C C   . LEU A 1 217 ? 129.730 137.928 142.295 1.00 388.81 ? 217 LEU A C   1 
ATOM 1428  O O   . LEU A 1 217 ? 130.945 138.149 142.294 1.00 368.87 ? 217 LEU A O   1 
ATOM 1429  C CB  . LEU A 1 217 ? 129.353 138.372 144.811 1.00 425.23 ? 217 LEU A CB  1 
ATOM 1430  C CG  . LEU A 1 217 ? 129.315 139.895 144.857 1.00 475.09 ? 217 LEU A CG  1 
ATOM 1431  C CD1 . LEU A 1 217 ? 128.965 140.348 146.272 1.00 500.00 ? 217 LEU A CD1 1 
ATOM 1432  C CD2 . LEU A 1 217 ? 130.641 140.475 144.394 1.00 475.04 ? 217 LEU A CD2 1 
ATOM 1433  N N   . PHE A 1 218 ? 128.970 137.979 141.196 1.00 403.29 ? 218 PHE A N   1 
ATOM 1434  C CA  . PHE A 1 218 ? 129.504 138.150 139.844 1.00 423.36 ? 218 PHE A CA  1 
ATOM 1435  C C   . PHE A 1 218 ? 129.613 139.617 139.580 1.00 384.42 ? 218 PHE A C   1 
ATOM 1436  O O   . PHE A 1 218 ? 128.579 140.321 139.552 1.00 425.22 ? 218 PHE A O   1 
ATOM 1437  C CB  . PHE A 1 218 ? 128.618 137.586 138.702 1.00 421.22 ? 218 PHE A CB  1 
ATOM 1438  C CG  . PHE A 1 218 ? 128.103 136.181 138.897 1.00 453.08 ? 218 PHE A CG  1 
ATOM 1439  C CD1 . PHE A 1 218 ? 128.391 135.389 140.018 1.00 472.15 ? 218 PHE A CD1 1 
ATOM 1440  C CD2 . PHE A 1 218 ? 127.327 135.630 137.892 1.00 448.41 ? 218 PHE A CD2 1 
ATOM 1441  C CE1 . PHE A 1 218 ? 127.886 134.105 140.127 1.00 445.12 ? 218 PHE A CE1 1 
ATOM 1442  C CE2 . PHE A 1 218 ? 126.832 134.343 137.998 1.00 452.44 ? 218 PHE A CE2 1 
ATOM 1443  C CZ  . PHE A 1 218 ? 127.108 133.579 139.116 1.00 452.12 ? 218 PHE A CZ  1 
ATOM 1444  N N   . SER A 1 219 ? 130.855 140.056 139.415 1.00 342.06 ? 219 SER A N   1 
ATOM 1445  C CA  . SER A 1 219 ? 131.166 141.328 138.806 1.00 383.50 ? 219 SER A CA  1 
ATOM 1446  C C   . SER A 1 219 ? 132.512 141.183 138.130 1.00 376.95 ? 219 SER A C   1 
ATOM 1447  O O   . SER A 1 219 ? 133.537 141.676 138.626 1.00 417.50 ? 219 SER A O   1 
ATOM 1448  C CB  . SER A 1 219 ? 131.188 142.455 139.847 1.00 410.53 ? 219 SER A CB  1 
ATOM 1449  O OG  . SER A 1 219 ? 132.197 142.241 140.818 1.00 435.61 ? 219 SER A OG  1 
ATOM 1450  N N   . HIS A 1 220 ? 132.516 140.475 137.008 1.00 357.39 ? 220 HIS A N   1 
ATOM 1451  C CA  . HIS A 1 220 ? 133.755 140.274 136.262 1.00 420.62 ? 220 HIS A CA  1 
ATOM 1452  C C   . HIS A 1 220 ? 133.975 141.432 135.317 1.00 403.96 ? 220 HIS A C   1 
ATOM 1453  O O   . HIS A 1 220 ? 133.603 141.366 134.147 1.00 423.25 ? 220 HIS A O   1 
ATOM 1454  C CB  . HIS A 1 220 ? 133.727 138.961 135.496 1.00 472.59 ? 220 HIS A CB  1 
ATOM 1455  C CG  . HIS A 1 220 ? 134.975 138.695 134.713 1.00 466.29 ? 220 HIS A CG  1 
ATOM 1456  N ND1 . HIS A 1 220 ? 135.081 138.970 133.370 1.00 466.71 ? 220 HIS A ND1 1 
ATOM 1457  C CD2 . HIS A 1 220 ? 136.169 138.181 135.087 1.00 458.81 ? 220 HIS A CD2 1 
ATOM 1458  C CE1 . HIS A 1 220 ? 136.284 138.625 132.946 1.00 482.06 ? 220 HIS A CE1 1 
ATOM 1459  N NE2 . HIS A 1 220 ? 136.963 138.141 133.970 1.00 457.92 ? 220 HIS A NE2 1 
ATOM 1460  N N   . MET A 1 221 ? 134.567 142.503 135.837 1.00 405.68 ? 221 MET A N   1 
ATOM 1461  C CA  . MET A 1 221 ? 134.790 143.701 135.035 1.00 390.50 ? 221 MET A CA  1 
ATOM 1462  C C   . MET A 1 221 ? 135.861 143.344 134.057 1.00 367.62 ? 221 MET A C   1 
ATOM 1463  O O   . MET A 1 221 ? 136.827 142.679 134.419 1.00 405.38 ? 221 MET A O   1 
ATOM 1464  C CB  . MET A 1 221 ? 135.239 144.879 135.884 1.00 392.32 ? 221 MET A CB  1 
ATOM 1465  C CG  . MET A 1 221 ? 134.201 145.336 136.895 1.00 453.68 ? 221 MET A CG  1 
ATOM 1466  S SD  . MET A 1 221 ? 132.770 146.157 136.164 1.00 469.99 ? 221 MET A SD  1 
ATOM 1467  C CE  . MET A 1 221 ? 131.473 144.971 136.503 1.00 471.84 ? 221 MET A CE  1 
ATOM 1468  N N   . HIS A 1 222 ? 135.683 143.761 132.816 1.00 360.31 ? 222 HIS A N   1 
ATOM 1469  C CA  . HIS A 1 222 ? 136.578 143.328 131.760 1.00 396.95 ? 222 HIS A CA  1 
ATOM 1470  C C   . HIS A 1 222 ? 137.889 144.098 131.795 1.00 436.50 ? 222 HIS A C   1 
ATOM 1471  O O   . HIS A 1 222 ? 138.939 143.525 132.056 1.00 472.87 ? 222 HIS A O   1 
ATOM 1472  C CB  . HIS A 1 222 ? 135.903 143.474 130.407 1.00 412.37 ? 222 HIS A CB  1 
ATOM 1473  C CG  . HIS A 1 222 ? 134.680 142.639 130.258 1.00 405.20 ? 222 HIS A CG  1 
ATOM 1474  N ND1 . HIS A 1 222 ? 133.799 142.787 129.210 1.00 422.04 ? 222 HIS A ND1 1 
ATOM 1475  C CD2 . HIS A 1 222 ? 134.179 141.654 131.037 1.00 439.96 ? 222 HIS A CD2 1 
ATOM 1476  C CE1 . HIS A 1 222 ? 132.816 141.916 129.342 1.00 463.43 ? 222 HIS A CE1 1 
ATOM 1477  N NE2 . HIS A 1 222 ? 133.021 141.218 130.445 1.00 460.41 ? 222 HIS A NE2 1 
ATOM 1478  N N   . ALA A 1 223 ? 137.803 145.405 131.585 1.00 430.77 ? 223 ALA A N   1 
ATOM 1479  C CA  . ALA A 1 223 ? 138.963 146.267 131.348 1.00 370.87 ? 223 ALA A CA  1 
ATOM 1480  C C   . ALA A 1 223 ? 140.043 146.195 132.417 1.00 363.18 ? 223 ALA A C   1 
ATOM 1481  O O   . ALA A 1 223 ? 139.763 145.980 133.599 1.00 333.67 ? 223 ALA A O   1 
ATOM 1482  C CB  . ALA A 1 223 ? 138.484 147.689 131.224 1.00 412.17 ? 223 ALA A CB  1 
ATOM 1483  N N   . VAL A 1 224 ? 141.280 146.413 131.986 1.00 378.24 ? 224 VAL A N   1 
ATOM 1484  C CA  . VAL A 1 224 ? 142.433 146.246 132.858 1.00 411.99 ? 224 VAL A CA  1 
ATOM 1485  C C   . VAL A 1 224 ? 143.506 147.299 132.634 1.00 436.32 ? 224 VAL A C   1 
ATOM 1486  O O   . VAL A 1 224 ? 143.534 147.985 131.602 1.00 428.98 ? 224 VAL A O   1 
ATOM 1487  C CB  . VAL A 1 224 ? 143.078 144.855 132.676 1.00 450.95 ? 224 VAL A CB  1 
ATOM 1488  C CG1 . VAL A 1 224 ? 142.252 143.787 133.379 1.00 476.24 ? 224 VAL A CG1 1 
ATOM 1489  C CG2 . VAL A 1 224 ? 143.258 144.522 131.196 1.00 474.15 ? 224 VAL A CG2 1 
ATOM 1490  N N   . ILE A 1 225 ? 144.394 147.386 133.622 1.00 431.65 ? 225 ILE A N   1 
ATOM 1491  C CA  . ILE A 1 225 ? 145.589 148.237 133.595 1.00 491.55 ? 225 ILE A CA  1 
ATOM 1492  C C   . ILE A 1 225 ? 145.332 149.741 133.465 1.00 423.62 ? 225 ILE A C   1 
ATOM 1493  O O   . ILE A 1 225 ? 145.398 150.464 134.463 1.00 392.84 ? 225 ILE A O   1 
ATOM 1494  C CB  . ILE A 1 225 ? 146.593 147.741 132.517 1.00 500.00 ? 225 ILE A CB  1 
ATOM 1495  C CG1 . ILE A 1 225 ? 147.016 146.296 132.821 1.00 500.00 ? 225 ILE A CG1 1 
ATOM 1496  C CG2 . ILE A 1 225 ? 147.820 148.647 132.421 1.00 500.00 ? 225 ILE A CG2 1 
ATOM 1497  C CD1 . ILE A 1 225 ? 147.654 146.086 134.187 1.00 500.00 ? 225 ILE A CD1 1 
ATOM 1498  N N   . SER A 1 226 ? 145.071 150.208 132.246 1.00 380.22 ? 226 SER A N   1 
ATOM 1499  C CA  . SER A 1 226 ? 145.002 151.640 131.982 1.00 413.20 ? 226 SER A CA  1 
ATOM 1500  C C   . SER A 1 226 ? 143.840 151.947 131.100 1.00 421.88 ? 226 SER A C   1 
ATOM 1501  O O   . SER A 1 226 ? 143.393 151.089 130.333 1.00 410.37 ? 226 SER A O   1 
ATOM 1502  C CB  . SER A 1 226 ? 146.262 152.137 131.273 1.00 466.81 ? 226 SER A CB  1 
ATOM 1503  O OG  . SER A 1 226 ? 146.114 152.144 129.860 1.00 421.28 ? 226 SER A OG  1 
ATOM 1504  N N   . THR A 1 227 ? 143.393 153.199 131.173 1.00 449.44 ? 227 THR A N   1 
ATOM 1505  C CA  . THR A 1 227 ? 142.384 153.675 130.238 1.00 429.41 ? 227 THR A CA  1 
ATOM 1506  C C   . THR A 1 227 ? 142.882 153.622 128.808 1.00 422.65 ? 227 THR A C   1 
ATOM 1507  O O   . THR A 1 227 ? 142.077 153.506 127.902 1.00 423.92 ? 227 THR A O   1 
ATOM 1508  C CB  . THR A 1 227 ? 141.917 155.108 130.539 1.00 449.47 ? 227 THR A CB  1 
ATOM 1509  O OG1 . THR A 1 227 ? 140.788 155.409 129.717 1.00 440.12 ? 227 THR A OG1 1 
ATOM 1510  C CG2 . THR A 1 227 ? 143.017 156.126 130.267 1.00 475.19 ? 227 THR A CG2 1 
ATOM 1511  N N   . ALA A 1 228 ? 144.199 153.709 128.619 1.00 445.46 ? 228 ALA A N   1 
ATOM 1512  C CA  . ALA A 1 228 ? 144.770 153.836 127.288 1.00 498.76 ? 228 ALA A CA  1 
ATOM 1513  C C   . ALA A 1 228 ? 144.952 152.476 126.659 1.00 479.66 ? 228 ALA A C   1 
ATOM 1514  O O   . ALA A 1 228 ? 144.645 152.292 125.466 1.00 448.66 ? 228 ALA A O   1 
ATOM 1515  C CB  . ALA A 1 228 ? 146.100 154.559 127.356 1.00 500.00 ? 228 ALA A CB  1 
ATOM 1516  N N   . THR A 1 229 ? 145.454 151.528 127.451 1.00 482.91 ? 229 THR A N   1 
ATOM 1517  C CA  . THR A 1 229 ? 145.767 150.183 126.994 1.00 489.55 ? 229 THR A CA  1 
ATOM 1518  C C   . THR A 1 229 ? 144.456 149.523 126.509 1.00 448.64 ? 229 THR A C   1 
ATOM 1519  O O   . THR A 1 229 ? 144.308 148.959 125.385 1.00 411.44 ? 229 THR A O   1 
ATOM 1520  C CB  . THR A 1 229 ? 146.333 149.297 128.151 1.00 468.02 ? 229 THR A CB  1 
ATOM 1521  O OG1 . THR A 1 229 ? 145.438 149.314 129.278 1.00 384.97 ? 229 THR A OG1 1 
ATOM 1522  C CG2 . THR A 1 229 ? 147.720 149.766 128.598 1.00 467.58 ? 229 THR A CG2 1 
ATOM 1523  N N   . CYS A 1 230 ? 143.532 149.522 127.466 1.00 404.34 ? 230 CYS A N   1 
ATOM 1524  C CA  . CYS A 1 230 ? 142.215 148.896 127.302 1.00 456.08 ? 230 CYS A CA  1 
ATOM 1525  C C   . CYS A 1 230 ? 141.493 149.507 126.106 1.00 469.02 ? 230 CYS A C   1 
ATOM 1526  O O   . CYS A 1 230 ? 140.925 148.785 125.271 1.00 488.04 ? 230 CYS A O   1 
ATOM 1527  C CB  . CYS A 1 230 ? 141.431 149.023 128.598 1.00 490.64 ? 230 CYS A CB  1 
ATOM 1528  S SG  . CYS A 1 230 ? 139.674 148.740 128.399 1.00 500.00 ? 230 CYS A SG  1 
ATOM 1529  N N   . MET A 1 231 ? 141.540 150.839 126.057 1.00 471.73 ? 231 MET A N   1 
ATOM 1530  C CA  . MET A 1 231 ? 140.914 151.615 124.979 1.00 484.81 ? 231 MET A CA  1 
ATOM 1531  C C   . MET A 1 231 ? 141.460 151.183 123.631 1.00 492.90 ? 231 MET A C   1 
ATOM 1532  O O   . MET A 1 231 ? 140.706 150.958 122.675 1.00 478.28 ? 231 MET A O   1 
ATOM 1533  C CB  . MET A 1 231 ? 141.253 153.114 125.077 1.00 454.83 ? 231 MET A CB  1 
ATOM 1534  C CG  . MET A 1 231 ? 140.121 154.003 125.528 1.00 452.95 ? 231 MET A CG  1 
ATOM 1535  S SD  . MET A 1 231 ? 138.842 154.062 124.260 1.00 472.64 ? 231 MET A SD  1 
ATOM 1536  C CE  . MET A 1 231 ? 137.513 153.169 125.071 1.00 447.86 ? 231 MET A CE  1 
ATOM 1537  N N   . ARG A 1 232 ? 142.778 151.088 123.586 1.00 490.69 ? 232 ARG A N   1 
ATOM 1538  C CA  . ARG A 1 232 ? 143.523 150.699 122.383 1.00 476.14 ? 232 ARG A CA  1 
ATOM 1539  C C   . ARG A 1 232 ? 143.049 149.332 121.902 1.00 417.25 ? 232 ARG A C   1 
ATOM 1540  O O   . ARG A 1 232 ? 142.772 149.136 120.700 1.00 416.10 ? 232 ARG A O   1 
ATOM 1541  C CB  . ARG A 1 232 ? 145.016 150.677 122.731 1.00 494.22 ? 232 ARG A CB  1 
ATOM 1542  C CG  . ARG A 1 232 ? 145.945 149.878 121.840 1.00 500.00 ? 232 ARG A CG  1 
ATOM 1543  C CD  . ARG A 1 232 ? 147.308 149.811 122.506 1.00 500.00 ? 232 ARG A CD  1 
ATOM 1544  N NE  . ARG A 1 232 ? 147.294 148.958 123.702 1.00 500.00 ? 232 ARG A NE  1 
ATOM 1545  C CZ  . ARG A 1 232 ? 148.284 148.858 124.597 1.00 500.00 ? 232 ARG A CZ  1 
ATOM 1546  N NH1 . ARG A 1 232 ? 149.410 149.569 124.476 1.00 500.00 ? 232 ARG A NH1 1 
ATOM 1547  N NH2 . ARG A 1 232 ? 148.143 148.037 125.638 1.00 500.00 ? 232 ARG A NH2 1 
ATOM 1548  N N   . ARG A 1 233 ? 142.970 148.415 122.873 1.00 409.55 ? 233 ARG A N   1 
ATOM 1549  C CA  . ARG A 1 233 ? 142.555 147.036 122.589 1.00 450.68 ? 233 ARG A CA  1 
ATOM 1550  C C   . ARG A 1 233 ? 141.148 147.025 121.992 1.00 446.40 ? 233 ARG A C   1 
ATOM 1551  O O   . ARG A 1 233 ? 140.899 146.323 120.993 1.00 491.76 ? 233 ARG A O   1 
ATOM 1552  C CB  . ARG A 1 233 ? 142.778 145.987 123.699 1.00 441.52 ? 233 ARG A CB  1 
ATOM 1553  C CG  . ARG A 1 233 ? 142.035 146.153 124.993 1.00 446.91 ? 233 ARG A CG  1 
ATOM 1554  C CD  . ARG A 1 233 ? 142.131 144.954 125.933 1.00 459.22 ? 233 ARG A CD  1 
ATOM 1555  N NE  . ARG A 1 233 ? 143.493 144.414 126.121 1.00 499.67 ? 233 ARG A NE  1 
ATOM 1556  C CZ  . ARG A 1 233 ? 143.845 143.486 127.026 1.00 500.00 ? 233 ARG A CZ  1 
ATOM 1557  N NH1 . ARG A 1 233 ? 145.112 143.073 127.097 1.00 489.85 ? 233 ARG A NH1 1 
ATOM 1558  N NH2 . ARG A 1 233 ? 142.959 142.966 127.873 1.00 500.00 ? 233 ARG A NH2 1 
ATOM 1559  N N   . SER A 1 234 ? 140.276 147.813 122.605 1.00 395.03 ? 234 SER A N   1 
ATOM 1560  C CA  . SER A 1 234 ? 138.885 147.933 122.173 1.00 470.88 ? 234 SER A CA  1 
ATOM 1561  C C   . SER A 1 234 ? 138.822 148.411 120.723 1.00 452.28 ? 234 SER A C   1 
ATOM 1562  O O   . SER A 1 234 ? 138.076 147.853 119.901 1.00 463.52 ? 234 SER A O   1 
ATOM 1563  C CB  . SER A 1 234 ? 138.124 148.870 123.098 1.00 500.00 ? 234 SER A CB  1 
ATOM 1564  O OG  . SER A 1 234 ? 136.741 148.612 123.021 1.00 500.00 ? 234 SER A OG  1 
ATOM 1565  N N   . SER A 1 235 ? 139.623 149.432 120.449 1.00 410.79 ? 235 SER A N   1 
ATOM 1566  C CA  . SER A 1 235 ? 139.709 150.037 119.118 1.00 427.56 ? 235 SER A CA  1 
ATOM 1567  C C   . SER A 1 235 ? 140.121 148.989 118.093 1.00 451.93 ? 235 SER A C   1 
ATOM 1568  O O   . SER A 1 235 ? 139.520 148.887 117.007 1.00 477.91 ? 235 SER A O   1 
ATOM 1569  C CB  . SER A 1 235 ? 140.681 151.214 119.110 1.00 488.83 ? 235 SER A CB  1 
ATOM 1570  O OG  . SER A 1 235 ? 142.025 150.784 119.222 1.00 490.90 ? 235 SER A OG  1 
ATOM 1571  N N   . ILE A 1 236 ? 141.144 148.230 118.470 1.00 468.75 ? 236 ILE A N   1 
ATOM 1572  C CA  . ILE A 1 236 ? 141.696 147.164 117.624 1.00 472.40 ? 236 ILE A CA  1 
ATOM 1573  C C   . ILE A 1 236 ? 140.604 146.151 117.286 1.00 447.36 ? 236 ILE A C   1 
ATOM 1574  O O   . ILE A 1 236 ? 140.446 145.750 116.116 1.00 408.27 ? 236 ILE A O   1 
ATOM 1575  C CB  . ILE A 1 236 ? 142.919 146.469 118.289 1.00 488.09 ? 236 ILE A CB  1 
ATOM 1576  C CG1 . ILE A 1 236 ? 144.137 147.394 118.247 1.00 475.53 ? 236 ILE A CG1 1 
ATOM 1577  C CG2 . ILE A 1 236 ? 143.263 145.146 117.611 1.00 494.66 ? 236 ILE A CG2 1 
ATOM 1578  C CD1 . ILE A 1 236 ? 145.209 147.038 119.257 1.00 468.34 ? 236 ILE A CD1 1 
ATOM 1579  N N   . GLN A 1 237 ? 139.876 145.767 118.327 1.00 446.89 ? 237 GLN A N   1 
ATOM 1580  C CA  . GLN A 1 237 ? 138.785 144.796 118.214 1.00 477.35 ? 237 GLN A CA  1 
ATOM 1581  C C   . GLN A 1 237 ? 137.740 145.293 117.218 1.00 490.80 ? 237 GLN A C   1 
ATOM 1582  O O   . GLN A 1 237 ? 137.289 144.541 116.330 1.00 500.00 ? 237 GLN A O   1 
ATOM 1583  C CB  . GLN A 1 237 ? 138.134 144.558 119.573 1.00 500.00 ? 237 GLN A CB  1 
ATOM 1584  C CG  . GLN A 1 237 ? 139.013 143.829 120.571 1.00 474.15 ? 237 GLN A CG  1 
ATOM 1585  C CD  . GLN A 1 237 ? 138.679 142.368 120.636 1.00 460.53 ? 237 GLN A CD  1 
ATOM 1586  O OE1 . GLN A 1 237 ? 137.977 141.928 121.545 1.00 402.05 ? 237 GLN A OE1 1 
ATOM 1587  N NE2 . GLN A 1 237 ? 139.148 141.607 119.652 1.00 497.11 ? 237 GLN A NE2 1 
ATOM 1588  N N   . SER A 1 238 ? 137.392 146.562 117.387 1.00 497.52 ? 238 SER A N   1 
ATOM 1589  C CA  . SER A 1 238 ? 136.397 147.228 116.541 1.00 500.00 ? 238 SER A CA  1 
ATOM 1590  C C   . SER A 1 238 ? 136.828 147.186 115.089 1.00 500.00 ? 238 SER A C   1 
ATOM 1591  O O   . SER A 1 238 ? 136.025 146.852 114.190 1.00 481.57 ? 238 SER A O   1 
ATOM 1592  C CB  . SER A 1 238 ? 136.125 148.661 117.011 1.00 500.00 ? 238 SER A CB  1 
ATOM 1593  O OG  . SER A 1 238 ? 137.255 149.494 116.882 1.00 500.00 ? 238 SER A OG  1 
ATOM 1594  N N   . THR A 1 239 ? 138.108 147.503 114.876 1.00 500.00 ? 239 THR A N   1 
ATOM 1595  C CA  . THR A 1 239 ? 138.711 147.491 113.539 1.00 500.00 ? 239 THR A CA  1 
ATOM 1596  C C   . THR A 1 239 ? 138.830 146.071 112.941 1.00 500.00 ? 239 THR A C   1 
ATOM 1597  O O   . THR A 1 239 ? 138.242 145.744 111.870 1.00 416.63 ? 239 THR A O   1 
ATOM 1598  C CB  . THR A 1 239 ? 140.086 148.185 113.479 1.00 487.10 ? 239 THR A CB  1 
ATOM 1599  O OG1 . THR A 1 239 ? 140.944 147.648 114.490 1.00 455.04 ? 239 THR A OG1 1 
ATOM 1600  C CG2 . THR A 1 239 ? 139.944 149.700 113.657 1.00 479.47 ? 239 THR A CG2 1 
ATOM 1601  N N   . PHE A 1 240 ? 139.654 145.262 113.596 1.00 500.00 ? 240 PHE A N   1 
ATOM 1602  C CA  . PHE A 1 240 ? 140.120 144.009 113.019 1.00 500.00 ? 240 PHE A CA  1 
ATOM 1603  C C   . PHE A 1 240 ? 139.163 142.838 113.291 1.00 500.00 ? 240 PHE A C   1 
ATOM 1604  O O   . PHE A 1 240 ? 138.541 142.327 112.352 1.00 500.00 ? 240 PHE A O   1 
ATOM 1605  C CB  . PHE A 1 240 ? 141.543 143.679 113.514 1.00 500.00 ? 240 PHE A CB  1 
ATOM 1606  C CG  . PHE A 1 240 ? 142.634 144.639 113.033 1.00 500.00 ? 240 PHE A CG  1 
ATOM 1607  C CD1 . PHE A 1 240 ? 142.660 145.140 111.718 1.00 500.00 ? 240 PHE A CD1 1 
ATOM 1608  C CD2 . PHE A 1 240 ? 143.687 144.989 113.891 1.00 500.00 ? 240 PHE A CD2 1 
ATOM 1609  C CE1 . PHE A 1 240 ? 143.685 145.993 111.300 1.00 500.00 ? 240 PHE A CE1 1 
ATOM 1610  C CE2 . PHE A 1 240 ? 144.712 145.835 113.473 1.00 500.00 ? 240 PHE A CE2 1 
ATOM 1611  C CZ  . PHE A 1 240 ? 144.710 146.338 112.177 1.00 500.00 ? 240 PHE A CZ  1 
ATOM 1612  N N   . SER A 1 241 ? 139.041 142.429 114.559 1.00 500.00 ? 241 SER A N   1 
ATOM 1613  C CA  . SER A 1 241 ? 138.303 141.199 114.926 1.00 500.00 ? 241 SER A CA  1 
ATOM 1614  C C   . SER A 1 241 ? 136.777 141.323 114.808 1.00 492.15 ? 241 SER A C   1 
ATOM 1615  O O   . SER A 1 241 ? 136.174 142.211 115.401 1.00 423.80 ? 241 SER A O   1 
ATOM 1616  C CB  . SER A 1 241 ? 138.665 140.748 116.347 1.00 500.00 ? 241 SER A CB  1 
ATOM 1617  O OG  . SER A 1 241 ? 138.047 139.502 116.661 1.00 500.00 ? 241 SER A OG  1 
ATOM 1618  N N   . ILE A 1 242 ? 136.160 140.403 114.071 1.00 461.65 ? 242 ILE A N   1 
ATOM 1619  C CA  . ILE A 1 242 ? 134.723 140.472 113.812 1.00 491.59 ? 242 ILE A CA  1 
ATOM 1620  C C   . ILE A 1 242 ? 134.019 139.894 115.049 1.00 500.00 ? 242 ILE A C   1 
ATOM 1621  O O   . ILE A 1 242 ? 134.567 139.013 115.732 1.00 433.08 ? 242 ILE A O   1 
ATOM 1622  C CB  . ILE A 1 242 ? 134.311 139.776 112.481 1.00 500.00 ? 242 ILE A CB  1 
ATOM 1623  C CG1 . ILE A 1 242 ? 135.228 140.179 111.303 1.00 500.00 ? 242 ILE A CG1 1 
ATOM 1624  C CG2 . ILE A 1 242 ? 132.864 140.101 112.107 1.00 500.00 ? 242 ILE A CG2 1 
ATOM 1625  C CD1 . ILE A 1 242 ? 135.227 141.656 110.950 1.00 491.29 ? 242 ILE A CD1 1 
ATOM 1626  N N   . ASN A 1 243 ? 132.815 140.418 115.320 1.00 500.00 ? 243 ASN A N   1 
ATOM 1627  C CA  . ASN A 1 243 ? 132.123 140.316 116.619 1.00 500.00 ? 243 ASN A CA  1 
ATOM 1628  C C   . ASN A 1 243 ? 133.072 140.738 117.736 1.00 500.00 ? 243 ASN A C   1 
ATOM 1629  O O   . ASN A 1 243 ? 133.531 139.909 118.529 1.00 500.00 ? 243 ASN A O   1 
ATOM 1630  C CB  . ASN A 1 243 ? 131.470 138.948 116.838 1.00 500.00 ? 243 ASN A CB  1 
ATOM 1631  C CG  . ASN A 1 243 ? 130.072 138.882 116.240 1.00 500.00 ? 243 ASN A CG  1 
ATOM 1632  O OD1 . ASN A 1 243 ? 129.144 139.530 116.732 1.00 500.00 ? 243 ASN A OD1 1 
ATOM 1633  N ND2 . ASN A 1 243 ? 129.916 138.111 115.166 1.00 500.00 ? 243 ASN A ND2 1 
ATOM 1634  N N   . PRO A 1 244 ? 133.377 142.051 117.774 1.00 500.00 ? 244 PRO A N   1 
ATOM 1635  C CA  . PRO A 1 244 ? 134.463 142.591 118.560 1.00 459.31 ? 244 PRO A CA  1 
ATOM 1636  C C   . PRO A 1 244 ? 134.050 142.920 119.987 1.00 458.89 ? 244 PRO A C   1 
ATOM 1637  O O   . PRO A 1 244 ? 132.998 143.536 120.211 1.00 418.80 ? 244 PRO A O   1 
ATOM 1638  C CB  . PRO A 1 244 ? 134.798 143.868 117.810 1.00 464.65 ? 244 PRO A CB  1 
ATOM 1639  C CG  . PRO A 1 244 ? 133.503 144.341 117.250 1.00 487.96 ? 244 PRO A CG  1 
ATOM 1640  C CD  . PRO A 1 244 ? 132.615 143.134 117.116 1.00 500.00 ? 244 PRO A CD  1 
ATOM 1641  N N   . GLU A 1 245 ? 134.883 142.515 120.940 1.00 495.27 ? 245 GLU A N   1 
ATOM 1642  C CA  . GLU A 1 245 ? 134.588 142.749 122.343 1.00 500.00 ? 245 GLU A CA  1 
ATOM 1643  C C   . GLU A 1 245 ? 135.124 144.118 122.759 1.00 500.00 ? 245 GLU A C   1 
ATOM 1644  O O   . GLU A 1 245 ? 136.312 144.288 123.045 1.00 458.93 ? 245 GLU A O   1 
ATOM 1645  C CB  . GLU A 1 245 ? 135.094 141.591 123.236 1.00 500.00 ? 245 GLU A CB  1 
ATOM 1646  C CG  . GLU A 1 245 ? 134.305 140.281 123.034 1.00 500.00 ? 245 GLU A CG  1 
ATOM 1647  C CD  . GLU A 1 245 ? 134.210 139.385 124.277 1.00 500.00 ? 245 GLU A CD  1 
ATOM 1648  O OE1 . GLU A 1 245 ? 135.255 138.896 124.752 1.00 500.00 ? 245 GLU A OE1 1 
ATOM 1649  O OE2 . GLU A 1 245 ? 133.080 139.145 124.763 1.00 500.00 ? 245 GLU A OE2 1 
ATOM 1650  N N   . ILE A 1 246 ? 134.208 145.088 122.766 1.00 455.89 ? 246 ILE A N   1 
ATOM 1651  C CA  . ILE A 1 246 ? 134.464 146.456 123.201 1.00 413.13 ? 246 ILE A CA  1 
ATOM 1652  C C   . ILE A 1 246 ? 134.511 146.510 124.734 1.00 406.99 ? 246 ILE A C   1 
ATOM 1653  O O   . ILE A 1 246 ? 133.572 146.933 125.406 1.00 406.70 ? 246 ILE A O   1 
ATOM 1654  C CB  . ILE A 1 246 ? 133.380 147.419 122.631 1.00 446.06 ? 246 ILE A CB  1 
ATOM 1655  C CG1 . ILE A 1 246 ? 133.441 147.443 121.104 1.00 471.07 ? 246 ILE A CG1 1 
ATOM 1656  C CG2 . ILE A 1 246 ? 133.477 148.843 123.191 1.00 472.22 ? 246 ILE A CG2 1 
ATOM 1657  C CD1 . ILE A 1 246 ? 134.726 148.001 120.527 1.00 495.92 ? 246 ILE A CD1 1 
ATOM 1658  N N   . VAL A 1 247 ? 135.621 146.051 125.283 1.00 371.60 ? 247 VAL A N   1 
ATOM 1659  C CA  . VAL A 1 247 ? 135.946 146.318 126.672 1.00 411.36 ? 247 VAL A CA  1 
ATOM 1660  C C   . VAL A 1 247 ? 136.244 147.825 126.754 1.00 420.74 ? 247 VAL A C   1 
ATOM 1661  O O   . VAL A 1 247 ? 136.522 148.430 125.720 1.00 407.53 ? 247 VAL A O   1 
ATOM 1662  C CB  . VAL A 1 247 ? 137.139 145.443 127.119 1.00 479.45 ? 247 VAL A CB  1 
ATOM 1663  C CG1 . VAL A 1 247 ? 138.360 145.614 126.206 1.00 500.00 ? 247 VAL A CG1 1 
ATOM 1664  C CG2 . VAL A 1 247 ? 137.493 145.711 128.565 1.00 480.73 ? 247 VAL A CG2 1 
ATOM 1665  N N   . CYS A 1 248 ? 136.165 148.429 127.944 1.00 404.04 ? 248 CYS A N   1 
ATOM 1666  C CA  . CYS A 1 248 ? 136.282 149.894 128.130 1.00 389.81 ? 248 CYS A CA  1 
ATOM 1667  C C   . CYS A 1 248 ? 135.102 150.625 127.573 1.00 405.92 ? 248 CYS A C   1 
ATOM 1668  O O   . CYS A 1 248 ? 134.441 150.162 126.649 1.00 434.39 ? 248 CYS A O   1 
ATOM 1669  C CB  . CYS A 1 248 ? 137.510 150.528 127.465 1.00 393.02 ? 248 CYS A CB  1 
ATOM 1670  S SG  . CYS A 1 248 ? 138.931 150.616 128.530 1.00 500.00 ? 248 CYS A SG  1 
ATOM 1671  N N   . ASP A 1 249 ? 134.874 151.804 128.125 1.00 404.55 ? 249 ASP A N   1 
ATOM 1672  C CA  . ASP A 1 249 ? 133.895 152.719 127.601 1.00 396.68 ? 249 ASP A CA  1 
ATOM 1673  C C   . ASP A 1 249 ? 134.240 154.088 128.083 1.00 400.24 ? 249 ASP A C   1 
ATOM 1674  O O   . ASP A 1 249 ? 134.589 154.241 129.262 1.00 440.71 ? 249 ASP A O   1 
ATOM 1675  C CB  . ASP A 1 249 ? 132.508 152.385 128.123 1.00 471.17 ? 249 ASP A CB  1 
ATOM 1676  C CG  . ASP A 1 249 ? 131.946 151.141 127.504 1.00 500.00 ? 249 ASP A CG  1 
ATOM 1677  O OD1 . ASP A 1 249 ? 131.646 151.167 126.293 1.00 500.00 ? 249 ASP A OD1 1 
ATOM 1678  O OD2 . ASP A 1 249 ? 131.835 150.126 128.218 1.00 500.00 ? 249 ASP A OD2 1 
ATOM 1679  N N   . PRO A 1 250 ? 134.085 155.089 127.211 1.00 391.96 ? 250 PRO A N   1 
ATOM 1680  C CA  . PRO A 1 250 ? 134.298 156.452 127.646 1.00 427.66 ? 250 PRO A CA  1 
ATOM 1681  C C   . PRO A 1 250 ? 133.158 156.898 128.559 1.00 456.81 ? 250 PRO A C   1 
ATOM 1682  O O   . PRO A 1 250 ? 131.979 156.695 128.241 1.00 435.30 ? 250 PRO A O   1 
ATOM 1683  C CB  . PRO A 1 250 ? 134.284 157.246 126.344 1.00 436.56 ? 250 PRO A CB  1 
ATOM 1684  C CG  . PRO A 1 250 ? 133.576 156.382 125.348 1.00 458.90 ? 250 PRO A CG  1 
ATOM 1685  C CD  . PRO A 1 250 ? 133.342 155.034 125.943 1.00 385.33 ? 250 PRO A CD  1 
ATOM 1686  N N   . LEU A 1 251 ? 133.527 157.477 129.696 1.00 443.68 ? 251 LEU A N   1 
ATOM 1687  C CA  . LEU A 1 251 ? 132.564 158.073 130.600 1.00 380.63 ? 251 LEU A CA  1 
ATOM 1688  C C   . LEU A 1 251 ? 132.195 159.398 129.969 1.00 411.14 ? 251 LEU A C   1 
ATOM 1689  O O   . LEU A 1 251 ? 133.067 160.212 129.644 1.00 399.01 ? 251 LEU A O   1 
ATOM 1690  C CB  . LEU A 1 251 ? 133.179 158.278 131.978 1.00 397.95 ? 251 LEU A CB  1 
ATOM 1691  C CG  . LEU A 1 251 ? 132.240 158.054 133.150 1.00 429.26 ? 251 LEU A CG  1 
ATOM 1692  C CD1 . LEU A 1 251 ? 131.682 156.633 133.126 1.00 461.82 ? 251 LEU A CD1 1 
ATOM 1693  C CD2 . LEU A 1 251 ? 132.992 158.342 134.441 1.00 432.37 ? 251 LEU A CD2 1 
ATOM 1694  N N   . SER A 1 252 ? 130.898 159.603 129.783 1.00 424.91 ? 252 SER A N   1 
ATOM 1695  C CA  . SER A 1 252 ? 130.404 160.617 128.867 1.00 406.47 ? 252 SER A CA  1 
ATOM 1696  C C   . SER A 1 252 ? 128.918 160.759 129.013 1.00 382.84 ? 252 SER A C   1 
ATOM 1697  O O   . SER A 1 252 ? 128.224 159.743 129.053 1.00 451.99 ? 252 SER A O   1 
ATOM 1698  C CB  . SER A 1 252 ? 130.649 160.121 127.448 1.00 447.52 ? 252 SER A CB  1 
ATOM 1699  O OG  . SER A 1 252 ? 129.997 158.877 127.228 1.00 479.49 ? 252 SER A OG  1 
ATOM 1700  N N   . ASP A 1 253 ? 128.412 161.979 129.111 1.00 329.37 ? 253 ASP A N   1 
ATOM 1701  C CA  . ASP A 1 253 ? 127.050 162.220 128.618 1.00 426.76 ? 253 ASP A CA  1 
ATOM 1702  C C   . ASP A 1 253 ? 126.810 163.644 128.126 1.00 372.91 ? 253 ASP A C   1 
ATOM 1703  O O   . ASP A 1 253 ? 127.475 164.055 127.200 1.00 343.69 ? 253 ASP A O   1 
ATOM 1704  C CB  . ASP A 1 253 ? 125.945 161.670 129.559 1.00 478.68 ? 253 ASP A CB  1 
ATOM 1705  C CG  . ASP A 1 253 ? 126.219 161.914 131.026 1.00 468.75 ? 253 ASP A CG  1 
ATOM 1706  O OD1 . ASP A 1 253 ? 127.057 162.780 131.349 1.00 500.00 ? 253 ASP A OD1 1 
ATOM 1707  O OD2 . ASP A 1 253 ? 125.589 161.224 131.855 1.00 429.79 ? 253 ASP A OD2 1 
ATOM 1708  N N   . TYR A 1 254 ? 125.855 164.379 128.681 1.00 360.50 ? 254 TYR A N   1 
ATOM 1709  C CA  . TYR A 1 254 ? 125.458 165.621 128.072 1.00 384.32 ? 254 TYR A CA  1 
ATOM 1710  C C   . TYR A 1 254 ? 125.416 166.730 129.088 1.00 412.03 ? 254 TYR A C   1 
ATOM 1711  O O   . TYR A 1 254 ? 125.068 166.523 130.254 1.00 397.39 ? 254 TYR A O   1 
ATOM 1712  C CB  . TYR A 1 254 ? 124.101 165.475 127.397 1.00 419.58 ? 254 TYR A CB  1 
ATOM 1713  C CG  . TYR A 1 254 ? 124.181 164.898 126.010 1.00 441.65 ? 254 TYR A CG  1 
ATOM 1714  C CD1 . TYR A 1 254 ? 124.434 165.713 124.912 1.00 469.60 ? 254 TYR A CD1 1 
ATOM 1715  C CD2 . TYR A 1 254 ? 123.995 163.536 125.789 1.00 432.10 ? 254 TYR A CD2 1 
ATOM 1716  C CE1 . TYR A 1 254 ? 124.503 165.190 123.629 1.00 500.00 ? 254 TYR A CE1 1 
ATOM 1717  C CE2 . TYR A 1 254 ? 124.057 163.000 124.510 1.00 442.48 ? 254 TYR A CE2 1 
ATOM 1718  C CZ  . TYR A 1 254 ? 124.313 163.827 123.435 1.00 497.16 ? 254 TYR A CZ  1 
ATOM 1719  O OH  . TYR A 1 254 ? 124.380 163.291 122.170 1.00 500.00 ? 254 TYR A OH  1 
ATOM 1720  N N   . ASN A 1 255 ? 125.791 167.912 128.613 1.00 424.74 ? 255 ASN A N   1 
ATOM 1721  C CA  . ASN A 1 255 ? 125.667 169.133 129.372 1.00 401.43 ? 255 ASN A CA  1 
ATOM 1722  C C   . ASN A 1 255 ? 124.415 169.802 128.860 1.00 349.10 ? 255 ASN A C   1 
ATOM 1723  O O   . ASN A 1 255 ? 124.312 170.084 127.648 1.00 389.96 ? 255 ASN A O   1 
ATOM 1724  C CB  . ASN A 1 255 ? 126.884 170.019 129.150 1.00 414.04 ? 255 ASN A CB  1 
ATOM 1725  C CG  . ASN A 1 255 ? 128.183 169.267 129.348 1.00 419.93 ? 255 ASN A CG  1 
ATOM 1726  O OD1 . ASN A 1 255 ? 128.408 168.655 130.395 1.00 384.75 ? 255 ASN A OD1 1 
ATOM 1727  N ND2 . ASN A 1 255 ? 129.037 169.289 128.330 1.00 440.82 ? 255 ASN A ND2 1 
ATOM 1728  N N   . VAL A 1 256 ? 123.446 169.984 129.757 1.00 345.51 ? 256 VAL A N   1 
ATOM 1729  C CA  . VAL A 1 256 ? 122.255 170.749 129.425 1.00 373.08 ? 256 VAL A CA  1 
ATOM 1730  C C   . VAL A 1 256 ? 122.691 172.181 129.589 1.00 368.65 ? 256 VAL A C   1 
ATOM 1731  O O   . VAL A 1 256 ? 123.630 172.512 130.335 1.00 394.17 ? 256 VAL A O   1 
ATOM 1732  C CB  . VAL A 1 256 ? 120.934 170.395 130.205 1.00 418.74 ? 256 VAL A CB  1 
ATOM 1733  C CG1 . VAL A 1 256 ? 120.834 168.907 130.518 1.00 482.85 ? 256 VAL A CG1 1 
ATOM 1734  C CG2 . VAL A 1 256 ? 120.729 171.218 131.467 1.00 418.72 ? 256 VAL A CG2 1 
ATOM 1735  N N   . TRP A 1 257 ? 121.934 173.029 128.926 1.00 356.40 ? 257 TRP A N   1 
ATOM 1736  C CA  . TRP A 1 257 ? 122.496 174.152 128.254 1.00 340.00 ? 257 TRP A CA  1 
ATOM 1737  C C   . TRP A 1 257 ? 121.326 174.961 127.778 1.00 339.43 ? 257 TRP A C   1 
ATOM 1738  O O   . TRP A 1 257 ? 120.461 174.431 127.079 1.00 438.79 ? 257 TRP A O   1 
ATOM 1739  C CB  . TRP A 1 257 ? 123.230 173.548 127.078 1.00 415.42 ? 257 TRP A CB  1 
ATOM 1740  C CG  . TRP A 1 257 ? 124.088 174.393 126.367 1.00 422.00 ? 257 TRP A CG  1 
ATOM 1741  C CD1 . TRP A 1 257 ? 125.418 174.466 126.512 1.00 438.43 ? 257 TRP A CD1 1 
ATOM 1742  C CD2 . TRP A 1 257 ? 123.735 175.255 125.301 1.00 400.28 ? 257 TRP A CD2 1 
ATOM 1743  N NE1 . TRP A 1 257 ? 125.931 175.343 125.624 1.00 437.48 ? 257 TRP A NE1 1 
ATOM 1744  C CE2 . TRP A 1 257 ? 124.919 175.852 124.857 1.00 413.58 ? 257 TRP A CE2 1 
ATOM 1745  C CE3 . TRP A 1 257 ? 122.530 175.587 124.682 1.00 401.85 ? 257 TRP A CE3 1 
ATOM 1746  C CZ2 . TRP A 1 257 ? 124.941 176.772 123.821 1.00 448.16 ? 257 TRP A CZ2 1 
ATOM 1747  C CZ3 . TRP A 1 257 ? 122.547 176.493 123.663 1.00 434.17 ? 257 TRP A CZ3 1 
ATOM 1748  C CH2 . TRP A 1 257 ? 123.746 177.083 123.236 1.00 476.39 ? 257 TRP A CH2 1 
ATOM 1749  N N   . SER A 1 258 ? 121.256 176.219 128.175 1.00 359.19 ? 258 SER A N   1 
ATOM 1750  C CA  . SER A 1 258 ? 120.120 177.059 127.805 1.00 412.37 ? 258 SER A CA  1 
ATOM 1751  C C   . SER A 1 258 ? 120.541 178.489 127.692 1.00 430.76 ? 258 SER A C   1 
ATOM 1752  O O   . SER A 1 258 ? 121.693 178.844 127.954 1.00 457.83 ? 258 SER A O   1 
ATOM 1753  C CB  . SER A 1 258 ? 118.971 176.934 128.817 1.00 413.21 ? 258 SER A CB  1 
ATOM 1754  O OG  . SER A 1 258 ? 117.864 177.758 128.464 1.00 380.81 ? 258 SER A OG  1 
ATOM 1755  N N   . MET A 1 259 ? 119.586 179.306 127.282 1.00 412.54 ? 259 MET A N   1 
ATOM 1756  C CA  . MET A 1 259 ? 119.798 180.715 127.177 1.00 431.27 ? 259 MET A CA  1 
ATOM 1757  C C   . MET A 1 259 ? 118.583 181.404 127.757 1.00 430.31 ? 259 MET A C   1 
ATOM 1758  O O   . MET A 1 259 ? 117.546 180.771 127.974 1.00 426.58 ? 259 MET A O   1 
ATOM 1759  C CB  . MET A 1 259 ? 120.026 181.088 125.709 1.00 440.31 ? 259 MET A CB  1 
ATOM 1760  C CG  . MET A 1 259 ? 121.146 182.091 125.476 1.00 462.83 ? 259 MET A CG  1 
ATOM 1761  S SD  . MET A 1 259 ? 122.780 181.578 126.062 1.00 466.86 ? 259 MET A SD  1 
ATOM 1762  C CE  . MET A 1 259 ? 123.065 180.074 125.140 1.00 442.32 ? 259 MET A CE  1 
ATOM 1763  N N   . LEU A 1 260 ? 118.735 182.692 128.046 1.00 450.84 ? 260 LEU A N   1 
ATOM 1764  C CA  . LEU A 1 260 ? 117.600 183.516 128.442 1.00 455.80 ? 260 LEU A CA  1 
ATOM 1765  C C   . LEU A 1 260 ? 116.913 184.064 127.179 1.00 463.55 ? 260 LEU A C   1 
ATOM 1766  O O   . LEU A 1 260 ? 115.802 183.634 126.855 1.00 453.40 ? 260 LEU A O   1 
ATOM 1767  C CB  . LEU A 1 260 ? 118.036 184.611 129.422 1.00 469.91 ? 260 LEU A CB  1 
ATOM 1768  C CG  . LEU A 1 260 ? 116.987 185.650 129.845 1.00 500.00 ? 260 LEU A CG  1 
ATOM 1769  C CD1 . LEU A 1 260 ? 115.641 185.021 130.209 1.00 500.00 ? 260 LEU A CD1 1 
ATOM 1770  C CD2 . LEU A 1 260 ? 117.537 186.530 130.965 1.00 500.00 ? 260 LEU A CD2 1 
ATOM 1771  N N   . LYS A 1 261 ? 117.555 184.992 126.463 1.00 474.44 ? 261 LYS A N   1 
ATOM 1772  C CA  . LYS A 1 261 ? 117.096 185.343 125.115 1.00 467.92 ? 261 LYS A CA  1 
ATOM 1773  C C   . LYS A 1 261 ? 117.562 184.224 124.209 1.00 468.78 ? 261 LYS A C   1 
ATOM 1774  O O   . LYS A 1 261 ? 118.691 183.754 124.357 1.00 491.51 ? 261 LYS A O   1 
ATOM 1775  C CB  . LYS A 1 261 ? 117.703 186.637 124.559 1.00 497.32 ? 261 LYS A CB  1 
ATOM 1776  C CG  . LYS A 1 261 ? 117.493 187.908 125.355 1.00 500.00 ? 261 LYS A CG  1 
ATOM 1777  C CD  . LYS A 1 261 ? 117.955 189.111 124.534 1.00 500.00 ? 261 LYS A CD  1 
ATOM 1778  C CE  . LYS A 1 261 ? 118.636 190.166 125.391 1.00 500.00 ? 261 LYS A CE  1 
ATOM 1779  N NZ  . LYS A 1 261 ? 119.953 189.726 125.936 1.00 500.00 ? 261 LYS A NZ  1 
ATOM 1780  N N   . PRO A 1 262 ? 116.717 183.797 123.261 1.00 460.54 ? 262 PRO A N   1 
ATOM 1781  C CA  . PRO A 1 262 ? 117.199 182.848 122.248 1.00 472.70 ? 262 PRO A CA  1 
ATOM 1782  C C   . PRO A 1 262 ? 118.228 183.463 121.275 1.00 460.14 ? 262 PRO A C   1 
ATOM 1783  O O   . PRO A 1 262 ? 118.206 184.685 121.040 1.00 367.28 ? 262 PRO A O   1 
ATOM 1784  C CB  . PRO A 1 262 ? 115.915 182.424 121.528 1.00 496.14 ? 262 PRO A CB  1 
ATOM 1785  C CG  . PRO A 1 262 ? 114.908 183.465 121.858 1.00 490.47 ? 262 PRO A CG  1 
ATOM 1786  C CD  . PRO A 1 262 ? 115.257 183.969 123.211 1.00 449.85 ? 262 PRO A CD  1 
ATOM 1787  N N   . ILE A 1 263 ? 119.107 182.610 120.725 1.00 454.13 ? 263 ILE A N   1 
ATOM 1788  C CA  . ILE A 1 263 ? 120.258 183.045 119.904 1.00 463.18 ? 263 ILE A CA  1 
ATOM 1789  C C   . ILE A 1 263 ? 120.448 182.280 118.576 1.00 473.47 ? 263 ILE A C   1 
ATOM 1790  O O   . ILE A 1 263 ? 119.744 181.306 118.302 1.00 437.66 ? 263 ILE A O   1 
ATOM 1791  C CB  . ILE A 1 263 ? 121.568 182.991 120.725 1.00 465.14 ? 263 ILE A CB  1 
ATOM 1792  C CG1 . ILE A 1 263 ? 121.884 181.571 121.198 1.00 458.58 ? 263 ILE A CG1 1 
ATOM 1793  C CG2 . ILE A 1 263 ? 121.474 183.926 121.917 1.00 494.02 ? 263 ILE A CG2 1 
ATOM 1794  C CD1 . ILE A 1 263 ? 123.318 181.417 121.663 1.00 473.70 ? 263 ILE A CD1 1 
ATOM 1795  N N   . ASN A 1 264 ? 121.410 182.749 117.771 1.00 500.00 ? 264 ASN A N   1 
ATOM 1796  C CA  . ASN A 1 264 ? 121.699 182.221 116.421 1.00 500.00 ? 264 ASN A CA  1 
ATOM 1797  C C   . ASN A 1 264 ? 121.875 180.697 116.380 1.00 500.00 ? 264 ASN A C   1 
ATOM 1798  O O   . ASN A 1 264 ? 121.272 180.041 115.536 1.00 493.47 ? 264 ASN A O   1 
ATOM 1799  C CB  . ASN A 1 264 ? 122.946 182.919 115.812 1.00 500.00 ? 264 ASN A CB  1 
ATOM 1800  C CG  . ASN A 1 264 ? 122.866 183.089 114.290 1.00 500.00 ? 264 ASN A CG  1 
ATOM 1801  O OD1 . ASN A 1 264 ? 123.290 184.116 113.752 1.00 484.20 ? 264 ASN A OD1 1 
ATOM 1802  N ND2 . ASN A 1 264 ? 122.331 182.089 113.595 1.00 500.00 ? 264 ASN A ND2 1 
ATOM 1803  N N   . THR A 1 265 ? 122.712 180.150 117.268 1.00 477.65 ? 265 THR A N   1 
ATOM 1804  C CA  . THR A 1 265 ? 122.863 178.685 117.473 1.00 486.52 ? 265 THR A CA  1 
ATOM 1805  C C   . THR A 1 265 ? 123.677 177.928 116.406 1.00 482.80 ? 265 THR A C   1 
ATOM 1806  O O   . THR A 1 265 ? 124.448 177.011 116.733 1.00 384.92 ? 265 THR A O   1 
ATOM 1807  C CB  . THR A 1 265 ? 121.496 177.981 117.622 1.00 500.00 ? 265 THR A CB  1 
ATOM 1808  O OG1 . THR A 1 265 ? 120.627 178.783 118.430 1.00 500.00 ? 265 THR A OG1 1 
ATOM 1809  C CG2 . THR A 1 265 ? 121.656 176.591 118.246 1.00 500.00 ? 265 THR A CG2 1 
ATOM 1810  N N   . THR A 1 266 ? 123.456 178.270 115.138 1.00 500.00 ? 266 THR A N   1 
ATOM 1811  C CA  . THR A 1 266 ? 124.281 177.781 114.032 1.00 500.00 ? 266 THR A CA  1 
ATOM 1812  C C   . THR A 1 266 ? 125.683 178.412 114.077 1.00 500.00 ? 266 THR A C   1 
ATOM 1813  O O   . THR A 1 266 ? 126.669 177.722 114.371 1.00 500.00 ? 266 THR A O   1 
ATOM 1814  C CB  . THR A 1 266 ? 123.607 178.066 112.664 1.00 500.00 ? 266 THR A CB  1 
ATOM 1815  O OG1 . THR A 1 266 ? 122.319 177.444 112.625 1.00 500.00 ? 266 THR A OG1 1 
ATOM 1816  C CG2 . THR A 1 266 ? 124.455 177.538 111.505 1.00 500.00 ? 266 THR A CG2 1 
ATOM 1817  N N   . GLY A 1 267 ? 125.754 179.721 113.812 1.00 500.00 ? 267 GLY A N   1 
ATOM 1818  C CA  . GLY A 1 267 ? 127.017 180.454 113.697 1.00 500.00 ? 267 GLY A CA  1 
ATOM 1819  C C   . GLY A 1 267 ? 127.367 181.226 114.957 1.00 500.00 ? 267 GLY A C   1 
ATOM 1820  O O   . GLY A 1 267 ? 126.476 181.692 115.680 1.00 440.92 ? 267 GLY A O   1 
ATOM 1821  N N   . THR A 1 268 ? 128.671 181.368 115.204 1.00 500.00 ? 268 THR A N   1 
ATOM 1822  C CA  . THR A 1 268 ? 129.196 182.058 116.392 1.00 500.00 ? 268 THR A CA  1 
ATOM 1823  C C   . THR A 1 268 ? 128.766 183.536 116.391 1.00 500.00 ? 268 THR A C   1 
ATOM 1824  O O   . THR A 1 268 ? 128.997 184.258 115.416 1.00 500.00 ? 268 THR A O   1 
ATOM 1825  C CB  . THR A 1 268 ? 130.751 181.955 116.483 1.00 500.00 ? 268 THR A CB  1 
ATOM 1826  O OG1 . THR A 1 268 ? 131.155 180.578 116.428 1.00 500.00 ? 268 THR A OG1 1 
ATOM 1827  C CG2 . THR A 1 268 ? 131.313 182.599 117.777 1.00 500.00 ? 268 THR A CG2 1 
ATOM 1828  N N   . LEU A 1 269 ? 128.129 183.960 117.484 1.00 500.00 ? 269 LEU A N   1 
ATOM 1829  C CA  . LEU A 1 269 ? 127.756 185.369 117.707 1.00 500.00 ? 269 LEU A CA  1 
ATOM 1830  C C   . LEU A 1 269 ? 128.963 186.305 117.702 1.00 500.00 ? 269 LEU A C   1 
ATOM 1831  O O   . LEU A 1 269 ? 130.114 185.856 117.771 1.00 500.00 ? 269 LEU A O   1 
ATOM 1832  C CB  . LEU A 1 269 ? 126.964 185.544 119.020 1.00 500.00 ? 269 LEU A CB  1 
ATOM 1833  C CG  . LEU A 1 269 ? 127.424 184.962 120.377 1.00 500.00 ? 269 LEU A CG  1 
ATOM 1834  C CD1 . LEU A 1 269 ? 126.638 183.695 120.724 1.00 500.00 ? 269 LEU A CD1 1 
ATOM 1835  C CD2 . LEU A 1 269 ? 128.934 184.731 120.503 1.00 500.00 ? 269 LEU A CD2 1 
ATOM 1836  N N   . LYS A 1 270 ? 128.686 187.603 117.640 1.00 467.35 ? 270 LYS A N   1 
ATOM 1837  C CA  . LYS A 1 270 ? 129.741 188.609 117.590 1.00 500.00 ? 270 LYS A CA  1 
ATOM 1838  C C   . LYS A 1 270 ? 130.600 188.616 118.874 1.00 500.00 ? 270 LYS A C   1 
ATOM 1839  O O   . LYS A 1 270 ? 130.036 188.623 119.971 1.00 500.00 ? 270 LYS A O   1 
ATOM 1840  C CB  . LYS A 1 270 ? 129.137 189.988 117.368 1.00 500.00 ? 270 LYS A CB  1 
ATOM 1841  C CG  . LYS A 1 270 ? 130.149 191.010 116.872 1.00 500.00 ? 270 LYS A CG  1 
ATOM 1842  C CD  . LYS A 1 270 ? 129.502 192.335 116.483 1.00 500.00 ? 270 LYS A CD  1 
ATOM 1843  C CE  . LYS A 1 270 ? 128.455 192.208 115.372 1.00 500.00 ? 270 LYS A CE  1 
ATOM 1844  N NZ  . LYS A 1 270 ? 128.862 191.340 114.224 1.00 500.00 ? 270 LYS A NZ  1 
ATOM 1845  N N   . PRO A 1 271 ? 131.956 188.603 118.745 1.00 500.00 ? 271 PRO A N   1 
ATOM 1846  C CA  . PRO A 1 271 ? 132.848 188.595 119.929 1.00 500.00 ? 271 PRO A CA  1 
ATOM 1847  C C   . PRO A 1 271 ? 132.694 189.797 120.869 1.00 500.00 ? 271 PRO A C   1 
ATOM 1848  O O   . PRO A 1 271 ? 132.883 189.658 122.084 1.00 500.00 ? 271 PRO A O   1 
ATOM 1849  C CB  . PRO A 1 271 ? 134.257 188.599 119.316 1.00 500.00 ? 271 PRO A CB  1 
ATOM 1850  C CG  . PRO A 1 271 ? 134.086 188.062 117.944 1.00 500.00 ? 271 PRO A CG  1 
ATOM 1851  C CD  . PRO A 1 271 ? 132.736 188.530 117.491 1.00 500.00 ? 271 PRO A CD  1 
ATOM 1852  N N   . ASP A 1 272 ? 132.385 190.959 120.287 1.00 500.00 ? 272 ASP A N   1 
ATOM 1853  C CA  . ASP A 1 272 ? 132.116 192.201 121.030 1.00 500.00 ? 272 ASP A CA  1 
ATOM 1854  C C   . ASP A 1 272 ? 131.108 191.963 122.158 1.00 500.00 ? 272 ASP A C   1 
ATOM 1855  O O   . ASP A 1 272 ? 131.398 192.217 123.336 1.00 428.79 ? 272 ASP A O   1 
ATOM 1856  C CB  . ASP A 1 272 ? 131.568 193.295 120.079 1.00 500.00 ? 272 ASP A CB  1 
ATOM 1857  C CG  . ASP A 1 272 ? 132.619 193.828 119.097 1.00 500.00 ? 272 ASP A CG  1 
ATOM 1858  O OD1 . ASP A 1 272 ? 133.573 193.089 118.760 1.00 500.00 ? 272 ASP A OD1 1 
ATOM 1859  O OD2 . ASP A 1 272 ? 132.472 194.992 118.652 1.00 500.00 ? 272 ASP A OD2 1 
ATOM 1860  N N   . ASP A 1 273 ? 129.938 191.457 121.763 1.00 500.00 ? 273 ASP A N   1 
ATOM 1861  C CA  . ASP A 1 273 ? 128.851 191.131 122.680 1.00 500.00 ? 273 ASP A CA  1 
ATOM 1862  C C   . ASP A 1 273 ? 129.309 190.050 123.645 1.00 500.00 ? 273 ASP A C   1 
ATOM 1863  O O   . ASP A 1 273 ? 130.139 189.205 123.303 1.00 500.00 ? 273 ASP A O   1 
ATOM 1864  C CB  . ASP A 1 273 ? 127.614 190.660 121.897 1.00 500.00 ? 273 ASP A CB  1 
ATOM 1865  C CG  . ASP A 1 273 ? 126.418 190.357 122.796 1.00 500.00 ? 273 ASP A CG  1 
ATOM 1866  O OD1 . ASP A 1 273 ? 126.223 191.063 123.811 1.00 500.00 ? 273 ASP A OD1 1 
ATOM 1867  O OD2 . ASP A 1 273 ? 125.672 189.403 122.486 1.00 500.00 ? 273 ASP A OD2 1 
ATOM 1868  N N   . ARG A 1 274 ? 128.779 190.104 124.859 1.00 493.92 ? 274 ARG A N   1 
ATOM 1869  C CA  . ARG A 1 274 ? 129.238 189.265 125.953 1.00 496.11 ? 274 ARG A CA  1 
ATOM 1870  C C   . ARG A 1 274 ? 128.033 188.683 126.684 1.00 500.00 ? 274 ARG A C   1 
ATOM 1871  O O   . ARG A 1 274 ? 126.917 189.192 126.548 1.00 500.00 ? 274 ARG A O   1 
ATOM 1872  C CB  . ARG A 1 274 ? 130.136 190.101 126.866 1.00 500.00 ? 274 ARG A CB  1 
ATOM 1873  C CG  . ARG A 1 274 ? 131.136 190.941 126.070 1.00 484.37 ? 274 ARG A CG  1 
ATOM 1874  C CD  . ARG A 1 274 ? 132.359 191.383 126.851 1.00 500.00 ? 274 ARG A CD  1 
ATOM 1875  N NE  . ARG A 1 274 ? 133.590 191.261 126.057 1.00 500.00 ? 274 ARG A NE  1 
ATOM 1876  C CZ  . ARG A 1 274 ? 134.831 191.355 126.546 1.00 500.00 ? 274 ARG A CZ  1 
ATOM 1877  N NH1 . ARG A 1 274 ? 135.055 191.598 127.842 1.00 500.00 ? 274 ARG A NH1 1 
ATOM 1878  N NH2 . ARG A 1 274 ? 135.872 191.213 125.727 1.00 474.94 ? 274 ARG A NH2 1 
ATOM 1879  N N   . VAL A 1 275 ? 128.258 187.614 127.446 1.00 491.49 ? 275 VAL A N   1 
ATOM 1880  C CA  . VAL A 1 275 ? 127.165 186.800 128.003 1.00 469.71 ? 275 VAL A CA  1 
ATOM 1881  C C   . VAL A 1 275 ? 127.460 186.331 129.416 1.00 406.19 ? 275 VAL A C   1 
ATOM 1882  O O   . VAL A 1 275 ? 128.597 186.399 129.873 1.00 339.98 ? 275 VAL A O   1 
ATOM 1883  C CB  . VAL A 1 275 ? 126.854 185.572 127.114 1.00 484.47 ? 275 VAL A CB  1 
ATOM 1884  C CG1 . VAL A 1 275 ? 126.071 185.982 125.874 1.00 496.88 ? 275 VAL A CG1 1 
ATOM 1885  C CG2 . VAL A 1 275 ? 128.125 184.849 126.721 1.00 500.00 ? 275 VAL A CG2 1 
ATOM 1886  N N   . VAL A 1 276 ? 126.417 185.847 130.087 1.00 403.34 ? 276 VAL A N   1 
ATOM 1887  C CA  . VAL A 1 276 ? 126.476 185.545 131.514 1.00 404.05 ? 276 VAL A CA  1 
ATOM 1888  C C   . VAL A 1 276 ? 126.390 184.055 131.757 1.00 395.72 ? 276 VAL A C   1 
ATOM 1889  O O   . VAL A 1 276 ? 125.319 183.472 131.649 1.00 432.23 ? 276 VAL A O   1 
ATOM 1890  C CB  . VAL A 1 276 ? 125.322 186.230 132.259 1.00 438.65 ? 276 VAL A CB  1 
ATOM 1891  C CG1 . VAL A 1 276 ? 125.307 185.815 133.730 1.00 412.75 ? 276 VAL A CG1 1 
ATOM 1892  C CG2 . VAL A 1 276 ? 125.423 187.741 132.093 1.00 500.00 ? 276 VAL A CG2 1 
ATOM 1893  N N   . VAL A 1 277 ? 127.517 183.455 132.117 1.00 395.04 ? 277 VAL A N   1 
ATOM 1894  C CA  . VAL A 1 277 ? 127.594 182.020 132.379 1.00 374.00 ? 277 VAL A CA  1 
ATOM 1895  C C   . VAL A 1 277 ? 127.073 181.707 133.763 1.00 380.47 ? 277 VAL A C   1 
ATOM 1896  O O   . VAL A 1 277 ? 127.695 182.066 134.771 1.00 433.43 ? 277 VAL A O   1 
ATOM 1897  C CB  . VAL A 1 277 ? 129.037 181.498 132.255 1.00 409.67 ? 277 VAL A CB  1 
ATOM 1898  C CG1 . VAL A 1 277 ? 129.198 180.137 132.929 1.00 444.04 ? 277 VAL A CG1 1 
ATOM 1899  C CG2 . VAL A 1 277 ? 129.444 181.421 130.787 1.00 418.33 ? 277 VAL A CG2 1 
ATOM 1900  N N   . ALA A 1 278 ? 125.926 181.037 133.800 1.00 390.13 ? 278 ALA A N   1 
ATOM 1901  C CA  . ALA A 1 278 ? 125.359 180.514 135.031 1.00 394.30 ? 278 ALA A CA  1 
ATOM 1902  C C   . ALA A 1 278 ? 125.677 179.049 134.998 1.00 360.52 ? 278 ALA A C   1 
ATOM 1903  O O   . ALA A 1 278 ? 125.020 178.285 134.285 1.00 420.02 ? 278 ALA A O   1 
ATOM 1904  C CB  . ALA A 1 278 ? 123.857 180.739 135.079 1.00 419.83 ? 278 ALA A CB  1 
ATOM 1905  N N   . ALA A 1 279 ? 126.680 178.653 135.767 1.00 371.16 ? 279 ALA A N   1 
ATOM 1906  C CA  . ALA A 1 279 ? 127.199 177.289 135.705 1.00 401.01 ? 279 ALA A CA  1 
ATOM 1907  C C   . ALA A 1 279 ? 126.646 176.439 136.810 1.00 373.56 ? 279 ALA A C   1 
ATOM 1908  O O   . ALA A 1 279 ? 126.107 176.962 137.783 1.00 396.99 ? 279 ALA A O   1 
ATOM 1909  C CB  . ALA A 1 279 ? 128.705 177.307 135.790 1.00 435.17 ? 279 ALA A CB  1 
ATOM 1910  N N   . THR A 1 280 ? 126.785 175.122 136.658 1.00 370.19 ? 280 THR A N   1 
ATOM 1911  C CA  . THR A 1 280 ? 126.346 174.184 137.689 1.00 410.94 ? 280 THR A CA  1 
ATOM 1912  C C   . THR A 1 280 ? 126.942 172.772 137.568 1.00 431.64 ? 280 THR A C   1 
ATOM 1913  O O   . THR A 1 280 ? 126.994 172.198 136.479 1.00 451.41 ? 280 THR A O   1 
ATOM 1914  C CB  . THR A 1 280 ? 124.808 174.034 137.711 1.00 408.02 ? 280 THR A CB  1 
ATOM 1915  O OG1 . THR A 1 280 ? 124.176 175.313 137.620 1.00 360.47 ? 280 THR A OG1 1 
ATOM 1916  C CG2 . THR A 1 280 ? 124.355 173.358 138.998 1.00 414.84 ? 280 THR A CG2 1 
ATOM 1917  N N   . ARG A 1 281 ? 127.365 172.229 138.709 1.00 406.55 ? 281 ARG A N   1 
ATOM 1918  C CA  . ARG A 1 281 ? 127.691 170.811 138.846 1.00 385.56 ? 281 ARG A CA  1 
ATOM 1919  C C   . ARG A 1 281 ? 126.372 170.043 138.807 1.00 385.85 ? 281 ARG A C   1 
ATOM 1920  O O   . ARG A 1 281 ? 125.531 170.248 139.681 1.00 424.24 ? 281 ARG A O   1 
ATOM 1921  C CB  . ARG A 1 281 ? 128.439 170.567 140.177 1.00 412.47 ? 281 ARG A CB  1 
ATOM 1922  C CG  . ARG A 1 281 ? 128.524 169.115 140.653 1.00 416.63 ? 281 ARG A CG  1 
ATOM 1923  C CD  . ARG A 1 281 ? 129.467 168.935 141.835 1.00 378.28 ? 281 ARG A CD  1 
ATOM 1924  N NE  . ARG A 1 281 ? 130.860 168.804 141.409 1.00 473.48 ? 281 ARG A NE  1 
ATOM 1925  C CZ  . ARG A 1 281 ? 131.934 169.209 142.096 1.00 500.00 ? 281 ARG A CZ  1 
ATOM 1926  N NH1 . ARG A 1 281 ? 131.833 169.793 143.291 1.00 500.00 ? 281 ARG A NH1 1 
ATOM 1927  N NH2 . ARG A 1 281 ? 133.143 169.022 141.573 1.00 500.00 ? 281 ARG A NH2 1 
ATOM 1928  N N   . LEU A 1 282 ? 126.191 169.172 137.808 1.00 363.51 ? 282 LEU A N   1 
ATOM 1929  C CA  . LEU A 1 282 ? 124.952 168.374 137.650 1.00 371.70 ? 282 LEU A CA  1 
ATOM 1930  C C   . LEU A 1 282 ? 125.064 166.878 138.042 1.00 405.11 ? 282 LEU A C   1 
ATOM 1931  O O   . LEU A 1 282 ? 124.088 166.130 137.941 1.00 379.33 ? 282 LEU A O   1 
ATOM 1932  C CB  . LEU A 1 282 ? 124.496 168.472 136.200 1.00 390.06 ? 282 LEU A CB  1 
ATOM 1933  C CG  . LEU A 1 282 ? 123.040 168.125 135.880 1.00 431.50 ? 282 LEU A CG  1 
ATOM 1934  C CD1 . LEU A 1 282 ? 122.097 169.186 136.425 1.00 449.27 ? 282 LEU A CD1 1 
ATOM 1935  C CD2 . LEU A 1 282 ? 122.857 167.942 134.379 1.00 482.93 ? 282 LEU A CD2 1 
ATOM 1936  N N   . ASP A 1 283 ? 126.233 166.462 138.532 1.00 457.40 ? 283 ASP A N   1 
ATOM 1937  C CA  . ASP A 1 283 ? 126.594 165.042 138.660 1.00 428.23 ? 283 ASP A CA  1 
ATOM 1938  C C   . ASP A 1 283 ? 127.306 164.710 139.964 1.00 400.60 ? 283 ASP A C   1 
ATOM 1939  O O   . ASP A 1 283 ? 127.916 165.573 140.604 1.00 432.90 ? 283 ASP A O   1 
ATOM 1940  C CB  . ASP A 1 283 ? 127.551 164.670 137.533 1.00 455.95 ? 283 ASP A CB  1 
ATOM 1941  C CG  . ASP A 1 283 ? 128.869 165.438 137.611 1.00 448.90 ? 283 ASP A CG  1 
ATOM 1942  O OD1 . ASP A 1 283 ? 129.772 165.052 138.386 1.00 354.56 ? 283 ASP A OD1 1 
ATOM 1943  O OD2 . ASP A 1 283 ? 128.988 166.453 136.900 1.00 489.70 ? 283 ASP A OD2 1 
ATOM 1944  N N   . SER A 1 284 ? 127.269 163.438 140.318 1.00 359.66 ? 284 SER A N   1 
ATOM 1945  C CA  . SER A 1 284 ? 128.068 162.937 141.416 1.00 349.19 ? 284 SER A CA  1 
ATOM 1946  C C   . SER A 1 284 ? 128.400 161.491 141.136 1.00 341.67 ? 284 SER A C   1 
ATOM 1947  O O   . SER A 1 284 ? 128.203 161.003 140.030 1.00 405.47 ? 284 SER A O   1 
ATOM 1948  C CB  . SER A 1 284 ? 127.280 163.059 142.715 1.00 401.63 ? 284 SER A CB  1 
ATOM 1949  O OG  . SER A 1 284 ? 126.211 162.126 142.740 1.00 446.81 ? 284 SER A OG  1 
ATOM 1950  N N   . ARG A 1 285 ? 128.936 160.813 142.130 1.00 350.59 ? 285 ARG A N   1 
ATOM 1951  C CA  . ARG A 1 285 ? 129.097 159.382 142.079 1.00 362.97 ? 285 ARG A CA  1 
ATOM 1952  C C   . ARG A 1 285 ? 129.097 158.874 143.496 1.00 350.17 ? 285 ARG A C   1 
ATOM 1953  O O   . ARG A 1 285 ? 128.865 159.633 144.433 1.00 395.48 ? 285 ARG A O   1 
ATOM 1954  C CB  . ARG A 1 285 ? 130.395 159.017 141.346 1.00 406.70 ? 285 ARG A CB  1 
ATOM 1955  C CG  . ARG A 1 285 ? 131.685 159.525 141.994 1.00 450.28 ? 285 ARG A CG  1 
ATOM 1956  C CD  . ARG A 1 285 ? 132.319 158.552 142.979 1.00 437.56 ? 285 ARG A CD  1 
ATOM 1957  N NE  . ARG A 1 285 ? 132.560 157.230 142.396 1.00 417.47 ? 285 ARG A NE  1 
ATOM 1958  C CZ  . ARG A 1 285 ? 133.692 156.813 141.826 1.00 403.35 ? 285 ARG A CZ  1 
ATOM 1959  N NH1 . ARG A 1 285 ? 134.760 157.608 141.723 1.00 390.86 ? 285 ARG A NH1 1 
ATOM 1960  N NH2 . ARG A 1 285 ? 133.754 155.572 141.347 1.00 422.09 ? 285 ARG A NH2 1 
ATOM 1961  N N   . SER A 1 286 ? 129.322 157.580 143.646 1.00 365.18 ? 286 SER A N   1 
ATOM 1962  C CA  . SER A 1 286 ? 129.664 157.002 144.930 1.00 418.82 ? 286 SER A CA  1 
ATOM 1963  C C   . SER A 1 286 ? 130.666 155.903 144.701 1.00 430.45 ? 286 SER A C   1 
ATOM 1964  O O   . SER A 1 286 ? 130.977 155.562 143.559 1.00 475.28 ? 286 SER A O   1 
ATOM 1965  C CB  . SER A 1 286 ? 128.434 156.431 145.631 1.00 459.83 ? 286 SER A CB  1 
ATOM 1966  O OG  . SER A 1 286 ? 127.927 155.287 144.959 1.00 427.83 ? 286 SER A OG  1 
ATOM 1967  N N   . PHE A 1 287 ? 131.165 155.349 145.798 1.00 424.54 ? 287 PHE A N   1 
ATOM 1968  C CA  . PHE A 1 287 ? 132.038 154.187 145.745 1.00 411.85 ? 287 PHE A CA  1 
ATOM 1969  C C   . PHE A 1 287 ? 131.422 153.090 144.908 1.00 382.38 ? 287 PHE A C   1 
ATOM 1970  O O   . PHE A 1 287 ? 132.101 152.426 144.118 1.00 388.34 ? 287 PHE A O   1 
ATOM 1971  C CB  . PHE A 1 287 ? 132.263 153.652 147.146 1.00 410.49 ? 287 PHE A CB  1 
ATOM 1972  C CG  . PHE A 1 287 ? 133.186 152.501 147.183 1.00 376.79 ? 287 PHE A CG  1 
ATOM 1973  C CD1 . PHE A 1 287 ? 134.485 152.661 146.758 1.00 390.99 ? 287 PHE A CD1 1 
ATOM 1974  C CD2 . PHE A 1 287 ? 132.756 151.261 147.603 1.00 355.80 ? 287 PHE A CD2 1 
ATOM 1975  C CE1 . PHE A 1 287 ? 135.366 151.609 146.760 1.00 443.98 ? 287 PHE A CE1 1 
ATOM 1976  C CE2 . PHE A 1 287 ? 133.624 150.195 147.612 1.00 428.27 ? 287 PHE A CE2 1 
ATOM 1977  C CZ  . PHE A 1 287 ? 134.935 150.367 147.192 1.00 473.31 ? 287 PHE A CZ  1 
ATOM 1978  N N   . PHE A 1 288 ? 130.119 152.945 145.091 1.00 339.78 ? 288 PHE A N   1 
ATOM 1979  C CA  . PHE A 1 288 ? 129.338 151.958 144.400 1.00 397.34 ? 288 PHE A CA  1 
ATOM 1980  C C   . PHE A 1 288 ? 128.773 152.475 143.086 1.00 386.30 ? 288 PHE A C   1 
ATOM 1981  O O   . PHE A 1 288 ? 128.603 153.677 142.912 1.00 417.71 ? 288 PHE A O   1 
ATOM 1982  C CB  . PHE A 1 288 ? 128.256 151.478 145.341 1.00 409.44 ? 288 PHE A CB  1 
ATOM 1983  C CG  . PHE A 1 288 ? 128.812 150.868 146.590 1.00 369.37 ? 288 PHE A CG  1 
ATOM 1984  C CD1 . PHE A 1 288 ? 129.235 149.556 146.594 1.00 394.24 ? 288 PHE A CD1 1 
ATOM 1985  C CD2 . PHE A 1 288 ? 128.948 151.612 147.738 1.00 409.90 ? 288 PHE A CD2 1 
ATOM 1986  C CE1 . PHE A 1 288 ? 129.758 148.985 147.735 1.00 443.36 ? 288 PHE A CE1 1 
ATOM 1987  C CE2 . PHE A 1 288 ? 129.464 151.050 148.894 1.00 438.08 ? 288 PHE A CE2 1 
ATOM 1988  C CZ  . PHE A 1 288 ? 129.872 149.734 148.892 1.00 446.87 ? 288 PHE A CZ  1 
ATOM 1989  N N   . TRP A 1 289 ? 128.489 151.547 142.176 1.00 390.11 ? 289 TRP A N   1 
ATOM 1990  C CA  . TRP A 1 289 ? 128.250 151.888 140.775 1.00 399.55 ? 289 TRP A CA  1 
ATOM 1991  C C   . TRP A 1 289 ? 127.122 152.902 140.552 1.00 392.81 ? 289 TRP A C   1 
ATOM 1992  O O   . TRP A 1 289 ? 127.401 154.064 140.252 1.00 400.00 ? 289 TRP A O   1 
ATOM 1993  C CB  . TRP A 1 289 ? 128.018 150.615 139.946 1.00 435.41 ? 289 TRP A CB  1 
ATOM 1994  C CG  . TRP A 1 289 ? 127.501 150.854 138.547 1.00 403.59 ? 289 TRP A CG  1 
ATOM 1995  C CD1 . TRP A 1 289 ? 128.047 151.657 137.605 1.00 389.39 ? 289 TRP A CD1 1 
ATOM 1996  C CD2 . TRP A 1 289 ? 126.332 150.275 137.953 1.00 402.65 ? 289 TRP A CD2 1 
ATOM 1997  N NE1 . TRP A 1 289 ? 127.292 151.634 136.464 1.00 347.47 ? 289 TRP A NE1 1 
ATOM 1998  C CE2 . TRP A 1 289 ? 126.236 150.785 136.649 1.00 353.60 ? 289 TRP A CE2 1 
ATOM 1999  C CE3 . TRP A 1 289 ? 125.349 149.379 138.405 1.00 455.30 ? 289 TRP A CE3 1 
ATOM 2000  C CZ2 . TRP A 1 289 ? 125.201 150.429 135.779 1.00 457.79 ? 289 TRP A CZ2 1 
ATOM 2001  C CZ3 . TRP A 1 289 ? 124.316 149.021 137.541 1.00 443.25 ? 289 TRP A CZ3 1 
ATOM 2002  C CH2 . TRP A 1 289 ? 124.251 149.548 136.242 1.00 477.10 ? 289 TRP A CH2 1 
ATOM 2003  N N   . ASN A 1 290 ? 125.869 152.475 140.668 1.00 368.84 ? 290 ASN A N   1 
ATOM 2004  C CA  . ASN A 1 290 ? 124.763 153.356 140.339 1.00 369.94 ? 290 ASN A CA  1 
ATOM 2005  C C   . ASN A 1 290 ? 123.972 153.649 141.585 1.00 392.63 ? 290 ASN A C   1 
ATOM 2006  O O   . ASN A 1 290 ? 122.792 153.317 141.710 1.00 405.37 ? 290 ASN A O   1 
ATOM 2007  C CB  . ASN A 1 290 ? 123.896 152.799 139.202 1.00 440.47 ? 290 ASN A CB  1 
ATOM 2008  C CG  . ASN A 1 290 ? 123.435 153.886 138.233 1.00 475.02 ? 290 ASN A CG  1 
ATOM 2009  O OD1 . ASN A 1 290 ? 124.254 154.636 137.692 1.00 442.84 ? 290 ASN A OD1 1 
ATOM 2010  N ND2 . ASN A 1 290 ? 122.125 153.967 137.998 1.00 474.85 ? 290 ASN A ND2 1 
ATOM 2011  N N   . VAL A 1 291 ? 124.683 154.274 142.519 1.00 438.18 ? 291 VAL A N   1 
ATOM 2012  C CA  . VAL A 1 291 ? 124.092 155.011 143.620 1.00 471.10 ? 291 VAL A CA  1 
ATOM 2013  C C   . VAL A 1 291 ? 124.840 156.344 143.678 1.00 439.16 ? 291 VAL A C   1 
ATOM 2014  O O   . VAL A 1 291 ? 125.877 156.445 144.312 1.00 384.32 ? 291 VAL A O   1 
ATOM 2015  C CB  . VAL A 1 291 ? 124.208 154.239 144.948 1.00 496.20 ? 291 VAL A CB  1 
ATOM 2016  C CG1 . VAL A 1 291 ? 123.689 155.081 146.114 1.00 500.00 ? 291 VAL A CG1 1 
ATOM 2017  C CG2 . VAL A 1 291 ? 123.451 152.920 144.843 1.00 500.00 ? 291 VAL A CG2 1 
ATOM 2018  N N   . ALA A 1 292 ? 124.305 157.346 142.985 1.00 415.23 ? 292 ALA A N   1 
ATOM 2019  C CA  . ALA A 1 292 ? 124.906 158.673 142.887 1.00 406.07 ? 292 ALA A CA  1 
ATOM 2020  C C   . ALA A 1 292 ? 123.883 159.674 143.382 1.00 418.84 ? 292 ALA A C   1 
ATOM 2021  O O   . ALA A 1 292 ? 123.387 160.482 142.605 1.00 408.56 ? 292 ALA A O   1 
ATOM 2022  C CB  . ALA A 1 292 ? 125.295 158.975 141.449 1.00 417.46 ? 292 ALA A CB  1 
ATOM 2023  N N   . PRO A 1 293 ? 123.566 159.636 144.688 1.00 407.24 ? 293 PRO A N   1 
ATOM 2024  C CA  . PRO A 1 293 ? 122.462 160.459 145.163 1.00 368.50 ? 293 PRO A CA  1 
ATOM 2025  C C   . PRO A 1 293 ? 122.835 161.929 145.112 1.00 380.11 ? 293 PRO A C   1 
ATOM 2026  O O   . PRO A 1 293 ? 122.090 162.717 144.550 1.00 367.14 ? 293 PRO A O   1 
ATOM 2027  C CB  . PRO A 1 293 ? 122.242 159.974 146.587 1.00 391.06 ? 293 PRO A CB  1 
ATOM 2028  C CG  . PRO A 1 293 ? 123.517 159.319 146.999 1.00 419.00 ? 293 PRO A CG  1 
ATOM 2029  C CD  . PRO A 1 293 ? 124.370 159.091 145.795 1.00 401.67 ? 293 PRO A CD  1 
ATOM 2030  N N   . GLY A 1 294 ? 123.980 162.276 145.699 1.00 439.00 ? 294 GLY A N   1 
ATOM 2031  C CA  . GLY A 1 294 ? 124.641 163.565 145.500 1.00 466.54 ? 294 GLY A CA  1 
ATOM 2032  C C   . GLY A 1 294 ? 123.850 164.831 145.771 1.00 444.70 ? 294 GLY A C   1 
ATOM 2033  O O   . GLY A 1 294 ? 124.088 165.852 145.128 1.00 399.33 ? 294 GLY A O   1 
ATOM 2034  N N   . ALA A 1 295 ? 122.923 164.766 146.727 1.00 439.86 ? 295 ALA A N   1 
ATOM 2035  C CA  . ALA A 1 295 ? 121.971 165.848 146.956 1.00 405.55 ? 295 ALA A CA  1 
ATOM 2036  C C   . ALA A 1 295 ? 122.689 167.163 147.134 1.00 423.68 ? 295 ALA A C   1 
ATOM 2037  O O   . ALA A 1 295 ? 122.546 168.078 146.318 1.00 435.66 ? 295 ALA A O   1 
ATOM 2038  C CB  . ALA A 1 295 ? 121.086 165.559 148.159 1.00 431.53 ? 295 ALA A CB  1 
ATOM 2039  N N   . GLU A 1 296 ? 123.486 167.227 148.194 1.00 439.77 ? 296 GLU A N   1 
ATOM 2040  C CA  . GLU A 1 296 ? 124.287 168.394 148.512 1.00 453.62 ? 296 GLU A CA  1 
ATOM 2041  C C   . GLU A 1 296 ? 125.324 168.556 147.415 1.00 429.23 ? 296 GLU A C   1 
ATOM 2042  O O   . GLU A 1 296 ? 125.442 169.625 146.824 1.00 429.61 ? 296 GLU A O   1 
ATOM 2043  C CB  . GLU A 1 296 ? 124.974 168.225 149.874 1.00 476.78 ? 296 GLU A CB  1 
ATOM 2044  C CG  . GLU A 1 296 ? 125.025 169.458 150.761 1.00 500.00 ? 296 GLU A CG  1 
ATOM 2045  C CD  . GLU A 1 296 ? 125.684 170.680 150.133 1.00 500.00 ? 296 GLU A CD  1 
ATOM 2046  O OE1 . GLU A 1 296 ? 126.772 171.074 150.608 1.00 500.00 ? 296 GLU A OE1 1 
ATOM 2047  O OE2 . GLU A 1 296 ? 125.111 171.269 149.195 1.00 500.00 ? 296 GLU A OE2 1 
ATOM 2048  N N   . SER A 1 297 ? 126.018 167.459 147.108 1.00 428.39 ? 297 SER A N   1 
ATOM 2049  C CA  . SER A 1 297 ? 127.129 167.473 146.152 1.00 453.92 ? 297 SER A CA  1 
ATOM 2050  C C   . SER A 1 297 ? 126.728 167.744 144.705 1.00 414.47 ? 297 SER A C   1 
ATOM 2051  O O   . SER A 1 297 ? 127.601 167.874 143.850 1.00 356.68 ? 297 SER A O   1 
ATOM 2052  C CB  . SER A 1 297 ? 127.928 166.165 146.211 1.00 492.51 ? 297 SER A CB  1 
ATOM 2053  O OG  . SER A 1 297 ? 127.253 165.107 145.558 1.00 476.62 ? 297 SER A OG  1 
ATOM 2054  N N   . ALA A 1 298 ? 125.431 167.801 144.420 1.00 390.63 ? 298 ALA A N   1 
ATOM 2055  C CA  . ALA A 1 298 ? 124.975 168.165 143.092 1.00 420.97 ? 298 ALA A CA  1 
ATOM 2056  C C   . ALA A 1 298 ? 123.550 168.614 143.094 1.00 392.66 ? 298 ALA A C   1 
ATOM 2057  O O   . ALA A 1 298 ? 123.274 169.772 142.803 1.00 425.27 ? 298 ALA A O   1 
ATOM 2058  C CB  . ALA A 1 298 ? 125.128 166.990 142.143 1.00 498.58 ? 298 ALA A CB  1 
ATOM 2059  N N   . VAL A 1 299 ? 122.647 167.700 143.440 1.00 402.43 ? 299 VAL A N   1 
ATOM 2060  C CA  . VAL A 1 299 ? 121.217 167.893 143.140 1.00 408.39 ? 299 VAL A CA  1 
ATOM 2061  C C   . VAL A 1 299 ? 120.789 169.300 143.450 1.00 442.73 ? 299 VAL A C   1 
ATOM 2062  O O   . VAL A 1 299 ? 120.134 169.965 142.638 1.00 449.03 ? 299 VAL A O   1 
ATOM 2063  C CB  . VAL A 1 299 ? 120.294 166.964 143.942 1.00 414.92 ? 299 VAL A CB  1 
ATOM 2064  C CG1 . VAL A 1 299 ? 118.830 167.362 143.800 1.00 408.12 ? 299 VAL A CG1 1 
ATOM 2065  C CG2 . VAL A 1 299 ? 120.473 165.533 143.482 1.00 471.69 ? 299 VAL A CG2 1 
ATOM 2066  N N   . ALA A 1 300 ? 121.149 169.684 144.668 1.00 440.98 ? 300 ALA A N   1 
ATOM 2067  C CA  . ALA A 1 300 ? 120.632 170.870 145.285 1.00 410.53 ? 300 ALA A CA  1 
ATOM 2068  C C   . ALA A 1 300 ? 121.014 172.103 144.477 1.00 382.36 ? 300 ALA A C   1 
ATOM 2069  O O   . ALA A 1 300 ? 120.161 172.976 144.211 1.00 416.12 ? 300 ALA A O   1 
ATOM 2070  C CB  . ALA A 1 300 ? 121.177 171.004 146.692 1.00 439.19 ? 300 ALA A CB  1 
ATOM 2071  N N   . SER A 1 301 ? 122.291 172.151 144.104 1.00 345.67 ? 301 SER A N   1 
ATOM 2072  C CA  . SER A 1 301 ? 122.854 173.273 143.369 1.00 406.00 ? 301 SER A CA  1 
ATOM 2073  C C   . SER A 1 301 ? 122.091 173.418 142.017 1.00 398.03 ? 301 SER A C   1 
ATOM 2074  O O   . SER A 1 301 ? 121.700 174.533 141.620 1.00 418.91 ? 301 SER A O   1 
ATOM 2075  C CB  . SER A 1 301 ? 124.369 173.099 143.190 1.00 426.64 ? 301 SER A CB  1 
ATOM 2076  O OG  . SER A 1 301 ? 124.753 171.737 143.222 1.00 426.81 ? 301 SER A OG  1 
ATOM 2077  N N   . PHE A 1 302 ? 121.899 172.280 141.362 1.00 403.61 ? 302 PHE A N   1 
ATOM 2078  C CA  . PHE A 1 302 ? 121.223 172.362 140.068 1.00 412.09 ? 302 PHE A CA  1 
ATOM 2079  C C   . PHE A 1 302 ? 119.790 172.770 140.214 1.00 394.66 ? 302 PHE A C   1 
ATOM 2080  O O   . PHE A 1 302 ? 119.336 173.566 139.382 1.00 429.47 ? 302 PHE A O   1 
ATOM 2081  C CB  . PHE A 1 302 ? 121.500 171.210 139.087 1.00 460.27 ? 302 PHE A CB  1 
ATOM 2082  C CG  . PHE A 1 302 ? 120.755 169.942 139.342 1.00 474.18 ? 302 PHE A CG  1 
ATOM 2083  C CD1 . PHE A 1 302 ? 119.401 169.837 139.042 1.00 431.71 ? 302 PHE A CD1 1 
ATOM 2084  C CD2 . PHE A 1 302 ? 121.442 168.800 139.754 1.00 480.09 ? 302 PHE A CD2 1 
ATOM 2085  C CE1 . PHE A 1 302 ? 118.734 168.646 139.231 1.00 421.72 ? 302 PHE A CE1 1 
ATOM 2086  C CE2 . PHE A 1 302 ? 120.774 167.601 139.934 1.00 470.57 ? 302 PHE A CE2 1 
ATOM 2087  C CZ  . PHE A 1 302 ? 119.413 167.526 139.688 1.00 449.55 ? 302 PHE A CZ  1 
ATOM 2088  N N   . VAL A 1 303 ? 119.131 172.325 141.280 1.00 389.55 ? 303 VAL A N   1 
ATOM 2089  C CA  . VAL A 1 303 ? 117.757 172.746 141.590 1.00 415.73 ? 303 VAL A CA  1 
ATOM 2090  C C   . VAL A 1 303 ? 117.695 174.256 141.743 1.00 418.92 ? 303 VAL A C   1 
ATOM 2091  O O   . VAL A 1 303 ? 116.800 174.913 141.193 1.00 365.07 ? 303 VAL A O   1 
ATOM 2092  C CB  . VAL A 1 303 ? 117.170 172.082 142.865 1.00 411.68 ? 303 VAL A CB  1 
ATOM 2093  C CG1 . VAL A 1 303 ? 115.756 172.600 143.128 1.00 470.33 ? 303 VAL A CG1 1 
ATOM 2094  C CG2 . VAL A 1 303 ? 117.161 170.569 142.751 1.00 390.88 ? 303 VAL A CG2 1 
ATOM 2095  N N   . THR A 1 304 ? 118.661 174.774 142.495 1.00 429.11 ? 304 THR A N   1 
ATOM 2096  C CA  . THR A 1 304 ? 118.774 176.216 142.759 1.00 412.14 ? 304 THR A CA  1 
ATOM 2097  C C   . THR A 1 304 ? 118.898 176.978 141.451 1.00 363.43 ? 304 THR A C   1 
ATOM 2098  O O   . THR A 1 304 ? 118.218 177.994 141.243 1.00 383.29 ? 304 THR A O   1 
ATOM 2099  C CB  . THR A 1 304 ? 119.972 176.659 143.629 1.00 430.04 ? 304 THR A CB  1 
ATOM 2100  O OG1 . THR A 1 304 ? 121.163 176.028 143.181 1.00 441.49 ? 304 THR A OG1 1 
ATOM 2101  C CG2 . THR A 1 304 ? 119.746 176.331 145.073 1.00 477.20 ? 304 THR A CG2 1 
ATOM 2102  N N   . GLN A 1 305 ? 119.775 176.465 140.600 1.00 362.02 ? 305 GLN A N   1 
ATOM 2103  C CA  . GLN A 1 305 ? 120.049 177.055 139.287 1.00 367.42 ? 305 GLN A CA  1 
ATOM 2104  C C   . GLN A 1 305 ? 118.751 177.130 138.469 1.00 393.69 ? 305 GLN A C   1 
ATOM 2105  O O   . GLN A 1 305 ? 118.433 178.170 137.862 1.00 412.16 ? 305 GLN A O   1 
ATOM 2106  C CB  . GLN A 1 305 ? 121.153 176.259 138.590 1.00 366.24 ? 305 GLN A CB  1 
ATOM 2107  C CG  . GLN A 1 305 ? 121.513 176.741 137.202 1.00 422.41 ? 305 GLN A CG  1 
ATOM 2108  C CD  . GLN A 1 305 ? 122.417 177.938 137.228 1.00 438.30 ? 305 GLN A CD  1 
ATOM 2109  O OE1 . GLN A 1 305 ? 121.998 179.034 137.586 1.00 491.49 ? 305 GLN A OE1 1 
ATOM 2110  N NE2 . GLN A 1 305 ? 123.666 177.740 136.842 1.00 447.04 ? 305 GLN A NE2 1 
ATOM 2111  N N   . LEU A 1 306 ? 118.038 176.010 138.483 1.00 391.98 ? 306 LEU A N   1 
ATOM 2112  C CA  . LEU A 1 306 ? 116.770 175.872 137.765 1.00 406.07 ? 306 LEU A CA  1 
ATOM 2113  C C   . LEU A 1 306 ? 115.777 176.927 138.236 1.00 411.40 ? 306 LEU A C   1 
ATOM 2114  O O   . LEU A 1 306 ? 115.115 177.597 137.428 1.00 405.07 ? 306 LEU A O   1 
ATOM 2115  C CB  . LEU A 1 306 ? 116.179 174.475 137.950 1.00 419.03 ? 306 LEU A CB  1 
ATOM 2116  C CG  . LEU A 1 306 ? 116.901 173.390 137.160 1.00 439.00 ? 306 LEU A CG  1 
ATOM 2117  C CD1 . LEU A 1 306 ? 116.608 172.004 137.720 1.00 446.57 ? 306 LEU A CD1 1 
ATOM 2118  C CD2 . LEU A 1 306 ? 116.541 173.483 135.685 1.00 443.70 ? 306 LEU A CD2 1 
ATOM 2119  N N   . ALA A 1 307 ? 115.700 177.046 139.554 1.00 410.45 ? 307 ALA A N   1 
ATOM 2120  C CA  . ALA A 1 307 ? 114.805 178.003 140.217 1.00 447.25 ? 307 ALA A CA  1 
ATOM 2121  C C   . ALA A 1 307 ? 115.120 179.414 139.762 1.00 416.74 ? 307 ALA A C   1 
ATOM 2122  O O   . ALA A 1 307 ? 114.214 180.188 139.429 1.00 417.90 ? 307 ALA A O   1 
ATOM 2123  C CB  . ALA A 1 307 ? 114.896 177.848 141.722 1.00 468.79 ? 307 ALA A CB  1 
ATOM 2124  N N   . ALA A 1 308 ? 116.410 179.717 139.757 1.00 391.77 ? 308 ALA A N   1 
ATOM 2125  C CA  . ALA A 1 308 ? 116.924 181.031 139.344 1.00 452.09 ? 308 ALA A CA  1 
ATOM 2126  C C   . ALA A 1 308 ? 116.483 181.339 137.921 1.00 411.59 ? 308 ALA A C   1 
ATOM 2127  O O   . ALA A 1 308 ? 115.998 182.447 137.631 1.00 446.50 ? 308 ALA A O   1 
ATOM 2128  C CB  . ALA A 1 308 ? 118.443 181.073 139.438 1.00 491.99 ? 308 ALA A CB  1 
ATOM 2129  N N   . ALA A 1 309 ? 116.665 180.340 137.066 1.00 383.66 ? 309 ALA A N   1 
ATOM 2130  C CA  . ALA A 1 309 ? 116.304 180.439 135.648 1.00 434.11 ? 309 ALA A CA  1 
ATOM 2131  C C   . ALA A 1 309 ? 114.819 180.771 135.501 1.00 442.30 ? 309 ALA A C   1 
ATOM 2132  O O   . ALA A 1 309 ? 114.433 181.658 134.727 1.00 421.98 ? 309 ALA A O   1 
ATOM 2133  C CB  . ALA A 1 309 ? 116.658 179.173 134.895 1.00 467.70 ? 309 ALA A CB  1 
ATOM 2134  N N   . GLU A 1 310 ? 114.024 180.031 136.265 1.00 420.76 ? 310 GLU A N   1 
ATOM 2135  C CA  . GLU A 1 310 ? 112.567 180.183 136.277 1.00 418.05 ? 310 GLU A CA  1 
ATOM 2136  C C   . GLU A 1 310 ? 112.191 181.612 136.652 1.00 413.60 ? 310 GLU A C   1 
ATOM 2137  O O   . GLU A 1 310 ? 111.343 182.244 136.000 1.00 432.20 ? 310 GLU A O   1 
ATOM 2138  C CB  . GLU A 1 310 ? 111.949 179.203 137.286 1.00 484.00 ? 310 GLU A CB  1 
ATOM 2139  C CG  . GLU A 1 310 ? 110.462 179.382 137.617 1.00 500.00 ? 310 GLU A CG  1 
ATOM 2140  C CD  . GLU A 1 310 ? 109.511 179.116 136.446 1.00 500.00 ? 310 GLU A CD  1 
ATOM 2141  O OE1 . GLU A 1 310 ? 109.579 179.852 135.438 1.00 500.00 ? 310 GLU A OE1 1 
ATOM 2142  O OE2 . GLU A 1 310 ? 108.668 178.186 136.542 1.00 500.00 ? 310 GLU A OE2 1 
ATOM 2143  N N   . ALA A 1 311 ? 112.846 182.092 137.704 1.00 439.63 ? 311 ALA A N   1 
ATOM 2144  C CA  . ALA A 1 311 ? 112.620 183.432 138.239 1.00 474.28 ? 311 ALA A CA  1 
ATOM 2145  C C   . ALA A 1 311 ? 112.911 184.474 137.162 1.00 474.99 ? 311 ALA A C   1 
ATOM 2146  O O   . ALA A 1 311 ? 112.093 185.407 136.916 1.00 500.00 ? 311 ALA A O   1 
ATOM 2147  C CB  . ALA A 1 311 ? 113.474 183.682 139.473 1.00 479.70 ? 311 ALA A CB  1 
ATOM 2148  N N   . LEU A 1 312 ? 114.116 184.381 136.607 1.00 393.20 ? 312 LEU A N   1 
ATOM 2149  C CA  . LEU A 1 312 ? 114.604 185.412 135.687 1.00 431.82 ? 312 LEU A CA  1 
ATOM 2150  C C   . LEU A 1 312 ? 113.736 185.418 134.443 1.00 465.04 ? 312 LEU A C   1 
ATOM 2151  O O   . LEU A 1 312 ? 113.454 186.516 133.935 1.00 500.00 ? 312 LEU A O   1 
ATOM 2152  C CB  . LEU A 1 312 ? 116.118 185.415 135.487 1.00 424.07 ? 312 LEU A CB  1 
ATOM 2153  C CG  . LEU A 1 312 ? 116.951 184.436 134.691 1.00 464.87 ? 312 LEU A CG  1 
ATOM 2154  C CD1 . LEU A 1 312 ? 116.482 184.348 133.254 1.00 500.00 ? 312 LEU A CD1 1 
ATOM 2155  C CD2 . LEU A 1 312 ? 118.391 184.933 134.763 1.00 472.46 ? 312 LEU A CD2 1 
ATOM 2156  N N   . GLN A 1 313 ? 113.313 184.239 133.960 1.00 436.64 ? 313 GLN A N   1 
ATOM 2157  C CA  . GLN A 1 313 ? 112.458 184.236 132.778 1.00 455.83 ? 313 GLN A CA  1 
ATOM 2158  C C   . GLN A 1 313 ? 111.136 184.923 133.040 1.00 443.59 ? 313 GLN A C   1 
ATOM 2159  O O   . GLN A 1 313 ? 110.668 185.674 132.191 1.00 380.52 ? 313 GLN A O   1 
ATOM 2160  C CB  . GLN A 1 313 ? 112.233 182.817 132.268 1.00 500.00 ? 313 GLN A CB  1 
ATOM 2161  C CG  . GLN A 1 313 ? 111.528 182.768 130.918 1.00 500.00 ? 313 GLN A CG  1 
ATOM 2162  C CD  . GLN A 1 313 ? 112.252 183.532 129.818 1.00 500.00 ? 313 GLN A CD  1 
ATOM 2163  O OE1 . GLN A 1 313 ? 111.840 184.630 129.438 1.00 500.00 ? 313 GLN A OE1 1 
ATOM 2164  N NE2 . GLN A 1 313 ? 113.336 182.953 129.303 1.00 500.00 ? 313 GLN A NE2 1 
ATOM 2165  N N   . LYS A 1 314 ? 110.590 184.692 134.226 1.00 453.76 ? 314 LYS A N   1 
ATOM 2166  C CA  . LYS A 1 314 ? 109.336 185.305 134.668 1.00 430.90 ? 314 LYS A CA  1 
ATOM 2167  C C   . LYS A 1 314 ? 109.288 186.829 134.775 1.00 445.37 ? 314 LYS A C   1 
ATOM 2168  O O   . LYS A 1 314 ? 108.190 187.385 134.792 1.00 435.45 ? 314 LYS A O   1 
ATOM 2169  C CB  . LYS A 1 314 ? 108.841 184.714 136.000 1.00 458.50 ? 314 LYS A CB  1 
ATOM 2170  C CG  . LYS A 1 314 ? 108.109 183.385 135.852 1.00 500.00 ? 314 LYS A CG  1 
ATOM 2171  C CD  . LYS A 1 314 ? 107.049 183.170 136.926 1.00 500.00 ? 314 LYS A CD  1 
ATOM 2172  C CE  . LYS A 1 314 ? 107.626 183.173 138.336 1.00 500.00 ? 314 LYS A CE  1 
ATOM 2173  N NZ  . LYS A 1 314 ? 106.629 182.731 139.357 1.00 500.00 ? 314 LYS A NZ  1 
ATOM 2174  N N   . ALA A 1 315 ? 110.439 187.501 134.858 1.00 500.00 ? 315 ALA A N   1 
ATOM 2175  C CA  . ALA A 1 315 ? 110.474 188.974 134.776 1.00 500.00 ? 315 ALA A CA  1 
ATOM 2176  C C   . ALA A 1 315 ? 110.065 189.422 133.363 1.00 500.00 ? 315 ALA A C   1 
ATOM 2177  O O   . ALA A 1 315 ? 110.241 188.667 132.404 1.00 500.00 ? 315 ALA A O   1 
ATOM 2178  C CB  . ALA A 1 315 ? 111.852 189.522 135.134 1.00 500.00 ? 315 ALA A CB  1 
ATOM 2179  N N   . PRO A 1 316 ? 109.500 190.638 133.232 1.00 500.00 ? 316 PRO A N   1 
ATOM 2180  C CA  . PRO A 1 316 ? 109.051 191.097 131.910 1.00 500.00 ? 316 PRO A CA  1 
ATOM 2181  C C   . PRO A 1 316 ? 110.182 191.643 131.031 1.00 500.00 ? 316 PRO A C   1 
ATOM 2182  O O   . PRO A 1 316 ? 110.276 191.285 129.853 1.00 500.00 ? 316 PRO A O   1 
ATOM 2183  C CB  . PRO A 1 316 ? 108.040 192.198 132.248 1.00 500.00 ? 316 PRO A CB  1 
ATOM 2184  C CG  . PRO A 1 316 ? 108.467 192.722 133.578 1.00 500.00 ? 316 PRO A CG  1 
ATOM 2185  C CD  . PRO A 1 316 ? 109.229 191.634 134.288 1.00 500.00 ? 316 PRO A CD  1 
ATOM 2186  N N   . ASP A 1 317 ? 111.031 192.490 131.613 1.00 500.00 ? 317 ASP A N   1 
ATOM 2187  C CA  . ASP A 1 317 ? 112.031 193.257 130.875 1.00 500.00 ? 317 ASP A CA  1 
ATOM 2188  C C   . ASP A 1 317 ? 113.205 192.335 130.546 1.00 500.00 ? 317 ASP A C   1 
ATOM 2189  O O   . ASP A 1 317 ? 114.257 192.367 131.188 1.00 500.00 ? 317 ASP A O   1 
ATOM 2190  C CB  . ASP A 1 317 ? 112.448 194.480 131.718 1.00 500.00 ? 317 ASP A CB  1 
ATOM 2191  C CG  . ASP A 1 317 ? 113.123 195.582 130.901 1.00 500.00 ? 317 ASP A CG  1 
ATOM 2192  O OD1 . ASP A 1 317 ? 112.726 195.816 129.736 1.00 500.00 ? 317 ASP A OD1 1 
ATOM 2193  O OD2 . ASP A 1 317 ? 114.036 196.244 131.454 1.00 500.00 ? 317 ASP A OD2 1 
ATOM 2194  N N   . VAL A 1 318 ? 112.990 191.505 129.529 1.00 478.33 ? 318 VAL A N   1 
ATOM 2195  C CA  . VAL A 1 318 ? 113.856 190.370 129.239 1.00 474.83 ? 318 VAL A CA  1 
ATOM 2196  C C   . VAL A 1 318 ? 114.630 190.591 127.948 1.00 469.76 ? 318 VAL A C   1 
ATOM 2197  O O   . VAL A 1 318 ? 115.858 190.575 127.942 1.00 436.91 ? 318 VAL A O   1 
ATOM 2198  C CB  . VAL A 1 318 ? 113.015 189.071 129.175 1.00 477.15 ? 318 VAL A CB  1 
ATOM 2199  C CG1 . VAL A 1 318 ? 113.733 187.946 128.431 1.00 500.00 ? 318 VAL A CG1 1 
ATOM 2200  C CG2 . VAL A 1 318 ? 112.654 188.623 130.582 1.00 453.04 ? 318 VAL A CG2 1 
ATOM 2201  N N   . THR A 1 319 ? 113.901 190.780 126.857 1.00 500.00 ? 319 THR A N   1 
ATOM 2202  C CA  . THR A 1 319 ? 114.502 190.905 125.527 1.00 500.00 ? 319 THR A CA  1 
ATOM 2203  C C   . THR A 1 319 ? 115.420 192.122 125.361 1.00 500.00 ? 319 THR A C   1 
ATOM 2204  O O   . THR A 1 319 ? 116.377 192.073 124.582 1.00 491.50 ? 319 THR A O   1 
ATOM 2205  C CB  . THR A 1 319 ? 113.407 190.967 124.445 1.00 500.00 ? 319 THR A CB  1 
ATOM 2206  O OG1 . THR A 1 319 ? 112.421 191.944 124.812 1.00 500.00 ? 319 THR A OG1 1 
ATOM 2207  C CG2 . THR A 1 319 ? 112.737 189.613 124.297 1.00 500.00 ? 319 THR A CG2 1 
ATOM 2208  N N   . THR A 1 320 ? 115.117 193.200 126.090 1.00 500.00 ? 320 THR A N   1 
ATOM 2209  C CA  . THR A 1 320 ? 115.853 194.467 125.994 1.00 500.00 ? 320 THR A CA  1 
ATOM 2210  C C   . THR A 1 320 ? 117.005 194.524 126.999 1.00 500.00 ? 320 THR A C   1 
ATOM 2211  O O   . THR A 1 320 ? 116.935 195.231 128.008 1.00 500.00 ? 320 THR A O   1 
ATOM 2212  C CB  . THR A 1 320 ? 114.910 195.676 126.214 1.00 500.00 ? 320 THR A CB  1 
ATOM 2213  O OG1 . THR A 1 320 ? 114.215 195.531 127.461 1.00 500.00 ? 320 THR A OG1 1 
ATOM 2214  C CG2 . THR A 1 320 ? 113.887 195.784 125.084 1.00 500.00 ? 320 THR A CG2 1 
ATOM 2215  N N   . LEU A 1 321 ? 118.060 193.769 126.709 1.00 483.13 ? 321 LEU A N   1 
ATOM 2216  C CA  . LEU A 1 321 ? 119.249 193.714 127.556 1.00 463.38 ? 321 LEU A CA  1 
ATOM 2217  C C   . LEU A 1 321 ? 120.506 193.730 126.693 1.00 463.46 ? 321 LEU A C   1 
ATOM 2218  O O   . LEU A 1 321 ? 120.455 193.328 125.529 1.00 469.07 ? 321 LEU A O   1 
ATOM 2219  C CB  . LEU A 1 321 ? 119.234 192.439 128.398 1.00 459.70 ? 321 LEU A CB  1 
ATOM 2220  C CG  . LEU A 1 321 ? 118.081 192.287 129.391 1.00 460.88 ? 321 LEU A CG  1 
ATOM 2221  C CD1 . LEU A 1 321 ? 118.025 190.872 129.945 1.00 432.23 ? 321 LEU A CD1 1 
ATOM 2222  C CD2 . LEU A 1 321 ? 118.204 193.298 130.523 1.00 500.00 ? 321 LEU A CD2 1 
ATOM 2223  N N   . PRO A 1 322 ? 121.639 194.205 127.252 1.00 493.68 ? 322 PRO A N   1 
ATOM 2224  C CA  . PRO A 1 322 ? 122.907 194.011 126.540 1.00 500.00 ? 322 PRO A CA  1 
ATOM 2225  C C   . PRO A 1 322 ? 123.377 192.550 126.554 1.00 488.82 ? 322 PRO A C   1 
ATOM 2226  O O   . PRO A 1 322 ? 123.434 191.915 125.495 1.00 392.86 ? 322 PRO A O   1 
ATOM 2227  C CB  . PRO A 1 322 ? 123.896 194.930 127.286 1.00 500.00 ? 322 PRO A CB  1 
ATOM 2228  C CG  . PRO A 1 322 ? 123.233 195.303 128.566 1.00 500.00 ? 322 PRO A CG  1 
ATOM 2229  C CD  . PRO A 1 322 ? 121.754 195.200 128.336 1.00 500.00 ? 322 PRO A CD  1 
ATOM 2230  N N   . ARG A 1 323 ? 123.669 192.025 127.746 1.00 500.00 ? 323 ARG A N   1 
ATOM 2231  C CA  . ARG A 1 323 ? 124.297 190.711 127.894 1.00 500.00 ? 323 ARG A CA  1 
ATOM 2232  C C   . ARG A 1 323 ? 123.268 189.622 128.127 1.00 476.95 ? 323 ARG A C   1 
ATOM 2233  O O   . ARG A 1 323 ? 122.312 189.804 128.886 1.00 424.83 ? 323 ARG A O   1 
ATOM 2234  C CB  . ARG A 1 323 ? 125.294 190.713 129.045 1.00 500.00 ? 323 ARG A CB  1 
ATOM 2235  C CG  . ARG A 1 323 ? 126.465 191.654 128.834 1.00 500.00 ? 323 ARG A CG  1 
ATOM 2236  C CD  . ARG A 1 323 ? 127.312 191.766 130.091 1.00 500.00 ? 323 ARG A CD  1 
ATOM 2237  N NE  . ARG A 1 323 ? 127.728 193.139 130.352 1.00 500.00 ? 323 ARG A NE  1 
ATOM 2238  C CZ  . ARG A 1 323 ? 126.916 194.127 130.736 1.00 498.08 ? 323 ARG A CZ  1 
ATOM 2239  N NH1 . ARG A 1 323 ? 125.600 193.936 130.898 1.00 417.34 ? 323 ARG A NH1 1 
ATOM 2240  N NH2 . ARG A 1 323 ? 127.428 195.336 130.945 1.00 500.00 ? 323 ARG A NH2 1 
ATOM 2241  N N   . ASN A 1 324 ? 123.501 188.485 127.478 1.00 474.80 ? 324 ASN A N   1 
ATOM 2242  C CA  . ASN A 1 324 ? 122.557 187.381 127.442 1.00 449.90 ? 324 ASN A CA  1 
ATOM 2243  C C   . ASN A 1 324 ? 123.020 186.207 128.297 1.00 412.24 ? 324 ASN A C   1 
ATOM 2244  O O   . ASN A 1 324 ? 124.205 185.883 128.368 1.00 373.64 ? 324 ASN A O   1 
ATOM 2245  C CB  . ASN A 1 324 ? 122.345 186.940 125.995 1.00 445.99 ? 324 ASN A CB  1 
ATOM 2246  C CG  . ASN A 1 324 ? 121.065 186.158 125.796 1.00 431.41 ? 324 ASN A CG  1 
ATOM 2247  O OD1 . ASN A 1 324 ? 120.208 186.080 126.677 1.00 406.40 ? 324 ASN A OD1 1 
ATOM 2248  N ND2 . ASN A 1 324 ? 120.927 185.574 124.619 1.00 464.51 ? 324 ASN A ND2 1 
ATOM 2249  N N   . VAL A 1 325 ? 122.060 185.557 128.933 1.00 388.30 ? 325 VAL A N   1 
ATOM 2250  C CA  . VAL A 1 325 ? 122.376 184.658 130.022 1.00 408.35 ? 325 VAL A CA  1 
ATOM 2251  C C   . VAL A 1 325 ? 122.308 183.212 129.575 1.00 464.90 ? 325 VAL A C   1 
ATOM 2252  O O   . VAL A 1 325 ? 121.432 182.832 128.797 1.00 500.00 ? 325 VAL A O   1 
ATOM 2253  C CB  . VAL A 1 325 ? 121.435 184.873 131.207 1.00 411.42 ? 325 VAL A CB  1 
ATOM 2254  C CG1 . VAL A 1 325 ? 122.039 184.270 132.469 1.00 424.16 ? 325 VAL A CG1 1 
ATOM 2255  C CG2 . VAL A 1 325 ? 121.156 186.355 131.396 1.00 460.54 ? 325 VAL A CG2 1 
ATOM 2256  N N   . MET A 1 326 ? 123.208 182.418 130.146 1.00 443.13 ? 326 MET A N   1 
ATOM 2257  C CA  . MET A 1 326 ? 123.585 181.105 129.666 1.00 394.86 ? 326 MET A CA  1 
ATOM 2258  C C   . MET A 1 326 ? 123.553 180.140 130.849 1.00 367.79 ? 326 MET A C   1 
ATOM 2259  O O   . MET A 1 326 ? 124.525 180.022 131.598 1.00 374.67 ? 326 MET A O   1 
ATOM 2260  C CB  . MET A 1 326 ? 124.980 181.250 129.031 1.00 419.08 ? 326 MET A CB  1 
ATOM 2261  C CG  . MET A 1 326 ? 125.938 180.070 129.048 1.00 439.36 ? 326 MET A CG  1 
ATOM 2262  S SD  . MET A 1 326 ? 125.359 178.590 128.220 1.00 500.00 ? 326 MET A SD  1 
ATOM 2263  C CE  . MET A 1 326 ? 126.958 177.885 127.833 1.00 500.00 ? 326 MET A CE  1 
ATOM 2264  N N   . PHE A 1 327 ? 122.408 179.492 131.045 1.00 391.12 ? 327 PHE A N   1 
ATOM 2265  C CA  . PHE A 1 327 ? 122.263 178.477 132.098 1.00 408.06 ? 327 PHE A CA  1 
ATOM 2266  C C   . PHE A 1 327 ? 122.800 177.152 131.641 1.00 379.90 ? 327 PHE A C   1 
ATOM 2267  O O   . PHE A 1 327 ? 122.212 176.500 130.789 1.00 391.40 ? 327 PHE A O   1 
ATOM 2268  C CB  . PHE A 1 327 ? 120.814 178.262 132.473 1.00 426.27 ? 327 PHE A CB  1 
ATOM 2269  C CG  . PHE A 1 327 ? 120.223 179.397 133.202 1.00 423.13 ? 327 PHE A CG  1 
ATOM 2270  C CD1 . PHE A 1 327 ? 120.616 179.649 134.501 1.00 425.45 ? 327 PHE A CD1 1 
ATOM 2271  C CD2 . PHE A 1 327 ? 119.279 180.217 132.600 1.00 417.45 ? 327 PHE A CD2 1 
ATOM 2272  C CE1 . PHE A 1 327 ? 120.073 180.697 135.208 1.00 462.67 ? 327 PHE A CE1 1 
ATOM 2273  C CE2 . PHE A 1 327 ? 118.730 181.267 133.296 1.00 452.38 ? 327 PHE A CE2 1 
ATOM 2274  C CZ  . PHE A 1 327 ? 119.137 181.512 134.602 1.00 477.22 ? 327 PHE A CZ  1 
ATOM 2275  N N   . VAL A 1 328 ? 123.905 176.743 132.231 1.00 360.39 ? 328 VAL A N   1 
ATOM 2276  C CA  . VAL A 1 328 ? 124.545 175.529 131.819 1.00 358.74 ? 328 VAL A CA  1 
ATOM 2277  C C   . VAL A 1 328 ? 124.726 174.678 133.043 1.00 371.10 ? 328 VAL A C   1 
ATOM 2278  O O   . VAL A 1 328 ? 125.000 175.176 134.136 1.00 420.82 ? 328 VAL A O   1 
ATOM 2279  C CB  . VAL A 1 328 ? 125.875 175.785 131.082 1.00 375.40 ? 328 VAL A CB  1 
ATOM 2280  C CG1 . VAL A 1 328 ? 126.835 176.619 131.906 1.00 412.98 ? 328 VAL A CG1 1 
ATOM 2281  C CG2 . VAL A 1 328 ? 126.515 174.475 130.662 1.00 397.95 ? 328 VAL A CG2 1 
ATOM 2282  N N   . PHE A 1 329 ? 124.524 173.388 132.843 1.00 356.31 ? 329 PHE A N   1 
ATOM 2283  C CA  . PHE A 1 329 ? 124.621 172.430 133.902 1.00 346.57 ? 329 PHE A CA  1 
ATOM 2284  C C   . PHE A 1 329 ? 125.489 171.360 133.306 1.00 373.64 ? 329 PHE A C   1 
ATOM 2285  O O   . PHE A 1 329 ? 125.161 170.827 132.246 1.00 419.99 ? 329 PHE A O   1 
ATOM 2286  C CB  . PHE A 1 329 ? 123.256 171.849 134.241 1.00 341.58 ? 329 PHE A CB  1 
ATOM 2287  C CG  . PHE A 1 329 ? 122.167 172.869 134.449 1.00 390.81 ? 329 PHE A CG  1 
ATOM 2288  C CD1 . PHE A 1 329 ? 121.758 173.733 133.426 1.00 431.63 ? 329 PHE A CD1 1 
ATOM 2289  C CD2 . PHE A 1 329 ? 121.495 172.923 135.657 1.00 430.54 ? 329 PHE A CD2 1 
ATOM 2290  C CE1 . PHE A 1 329 ? 120.736 174.650 133.619 1.00 428.30 ? 329 PHE A CE1 1 
ATOM 2291  C CE2 . PHE A 1 329 ? 120.464 173.831 135.854 1.00 480.80 ? 329 PHE A CE2 1 
ATOM 2292  C CZ  . PHE A 1 329 ? 120.081 174.697 134.833 1.00 451.61 ? 329 PHE A CZ  1 
ATOM 2293  N N   . PHE A 1 330 ? 126.598 171.050 133.958 1.00 373.61 ? 330 PHE A N   1 
ATOM 2294  C CA  . PHE A 1 330 ? 127.531 170.092 133.401 1.00 419.07 ? 330 PHE A CA  1 
ATOM 2295  C C   . PHE A 1 330 ? 127.393 168.780 134.133 1.00 444.74 ? 330 PHE A C   1 
ATOM 2296  O O   . PHE A 1 330 ? 127.488 168.745 135.363 1.00 478.11 ? 330 PHE A O   1 
ATOM 2297  C CB  . PHE A 1 330 ? 128.944 170.617 133.523 1.00 424.24 ? 330 PHE A CB  1 
ATOM 2298  C CG  . PHE A 1 330 ? 129.109 171.977 132.961 1.00 400.20 ? 330 PHE A CG  1 
ATOM 2299  C CD1 . PHE A 1 330 ? 128.880 173.092 133.746 1.00 421.88 ? 330 PHE A CD1 1 
ATOM 2300  C CD2 . PHE A 1 330 ? 129.456 172.148 131.639 1.00 428.84 ? 330 PHE A CD2 1 
ATOM 2301  C CE1 . PHE A 1 330 ? 129.025 174.361 133.229 1.00 443.29 ? 330 PHE A CE1 1 
ATOM 2302  C CE2 . PHE A 1 330 ? 129.608 173.416 131.110 1.00 455.34 ? 330 PHE A CE2 1 
ATOM 2303  C CZ  . PHE A 1 330 ? 129.395 174.526 131.906 1.00 450.42 ? 330 PHE A CZ  1 
ATOM 2304  N N   . GLN A 1 331 ? 127.143 167.713 133.378 1.00 392.33 ? 331 GLN A N   1 
ATOM 2305  C CA  . GLN A 1 331 ? 127.220 166.374 133.913 1.00 387.45 ? 331 GLN A CA  1 
ATOM 2306  C C   . GLN A 1 331 ? 128.623 165.874 133.575 1.00 336.61 ? 331 GLN A C   1 
ATOM 2307  O O   . GLN A 1 331 ? 128.869 165.335 132.506 1.00 389.41 ? 331 GLN A O   1 
ATOM 2308  C CB  . GLN A 1 331 ? 126.100 165.490 133.343 1.00 460.13 ? 331 GLN A CB  1 
ATOM 2309  C CG  . GLN A 1 331 ? 125.826 164.206 134.139 1.00 500.00 ? 331 GLN A CG  1 
ATOM 2310  C CD  . GLN A 1 331 ? 124.648 164.273 135.117 1.00 496.76 ? 331 GLN A CD  1 
ATOM 2311  O OE1 . GLN A 1 331 ? 124.745 163.819 136.264 1.00 418.01 ? 331 GLN A OE1 1 
ATOM 2312  N NE2 . GLN A 1 331 ? 123.521 164.800 134.655 1.00 495.40 ? 331 GLN A NE2 1 
ATOM 2313  N N   . GLY A 1 332 ? 129.554 166.141 134.477 1.00 350.29 ? 332 GLY A N   1 
ATOM 2314  C CA  . GLY A 1 332 ? 130.902 165.615 134.396 1.00 368.73 ? 332 GLY A CA  1 
ATOM 2315  C C   . GLY A 1 332 ? 131.657 165.774 135.703 1.00 415.01 ? 332 GLY A C   1 
ATOM 2316  O O   . GLY A 1 332 ? 131.854 164.804 136.425 1.00 425.45 ? 332 GLY A O   1 
ATOM 2317  N N   . GLU A 1 333 ? 132.069 167.011 135.991 1.00 452.88 ? 333 GLU A N   1 
ATOM 2318  C CA  . GLU A 1 333 ? 132.738 167.425 137.249 1.00 480.05 ? 333 GLU A CA  1 
ATOM 2319  C C   . GLU A 1 333 ? 133.358 166.363 138.179 1.00 459.97 ? 333 GLU A C   1 
ATOM 2320  O O   . GLU A 1 333 ? 134.579 166.344 138.359 1.00 434.51 ? 333 GLU A O   1 
ATOM 2321  C CB  . GLU A 1 333 ? 131.789 168.306 138.077 1.00 500.00 ? 333 GLU A CB  1 
ATOM 2322  C CG  . GLU A 1 333 ? 131.933 169.810 137.875 1.00 500.00 ? 333 GLU A CG  1 
ATOM 2323  C CD  . GLU A 1 333 ? 131.231 170.305 136.629 1.00 500.00 ? 333 GLU A CD  1 
ATOM 2324  O OE1 . GLU A 1 333 ? 131.514 169.780 135.530 1.00 500.00 ? 333 GLU A OE1 1 
ATOM 2325  O OE2 . GLU A 1 333 ? 130.394 171.223 136.751 1.00 500.00 ? 333 GLU A OE2 1 
ATOM 2326  N N   . THR A 1 334 ? 132.519 165.508 138.777 1.00 439.07 ? 334 THR A N   1 
ATOM 2327  C CA  . THR A 1 334 ? 132.981 164.504 139.752 1.00 434.59 ? 334 THR A CA  1 
ATOM 2328  C C   . THR A 1 334 ? 134.135 163.678 139.200 1.00 387.64 ? 334 THR A C   1 
ATOM 2329  O O   . THR A 1 334 ? 135.092 163.385 139.910 1.00 386.30 ? 334 THR A O   1 
ATOM 2330  C CB  . THR A 1 334 ? 131.840 163.585 140.273 1.00 457.37 ? 334 THR A CB  1 
ATOM 2331  O OG1 . THR A 1 334 ? 132.343 162.744 141.318 1.00 495.06 ? 334 THR A OG1 1 
ATOM 2332  C CG2 . THR A 1 334 ? 131.258 162.692 139.191 1.00 466.02 ? 334 THR A CG2 1 
ATOM 2333  N N   . PHE A 1 335 ? 134.030 163.328 137.925 1.00 402.25 ? 335 PHE A N   1 
ATOM 2334  C CA  . PHE A 1 335 ? 135.130 162.792 137.161 1.00 426.38 ? 335 PHE A CA  1 
ATOM 2335  C C   . PHE A 1 335 ? 135.610 163.977 136.364 1.00 398.60 ? 335 PHE A C   1 
ATOM 2336  O O   . PHE A 1 335 ? 134.818 164.761 135.844 1.00 445.15 ? 335 PHE A O   1 
ATOM 2337  C CB  . PHE A 1 335 ? 134.673 161.625 136.296 1.00 454.12 ? 335 PHE A CB  1 
ATOM 2338  C CG  . PHE A 1 335 ? 134.075 160.514 137.094 1.00 389.60 ? 335 PHE A CG  1 
ATOM 2339  C CD1 . PHE A 1 335 ? 134.877 159.756 137.927 1.00 375.73 ? 335 PHE A CD1 1 
ATOM 2340  C CD2 . PHE A 1 335 ? 132.711 160.270 137.066 1.00 389.18 ? 335 PHE A CD2 1 
ATOM 2341  C CE1 . PHE A 1 335 ? 134.337 158.754 138.698 1.00 428.50 ? 335 PHE A CE1 1 
ATOM 2342  C CE2 . PHE A 1 335 ? 132.158 159.265 137.832 1.00 424.57 ? 335 PHE A CE2 1 
ATOM 2343  C CZ  . PHE A 1 335 ? 132.974 158.502 138.652 1.00 465.01 ? 335 PHE A CZ  1 
ATOM 2344  N N   . ASP A 1 336 ? 136.916 164.071 136.236 1.00 374.44 ? 336 ASP A N   1 
ATOM 2345  C CA  . ASP A 1 336 ? 137.590 165.344 136.390 1.00 424.01 ? 336 ASP A CA  1 
ATOM 2346  C C   . ASP A 1 336 ? 137.262 166.376 135.312 1.00 389.02 ? 336 ASP A C   1 
ATOM 2347  O O   . ASP A 1 336 ? 138.024 166.593 134.380 1.00 393.63 ? 336 ASP A O   1 
ATOM 2348  C CB  . ASP A 1 336 ? 139.089 165.095 136.583 1.00 485.94 ? 336 ASP A CB  1 
ATOM 2349  C CG  . ASP A 1 336 ? 139.374 164.050 137.689 1.00 500.00 ? 336 ASP A CG  1 
ATOM 2350  O OD1 . ASP A 1 336 ? 138.602 163.986 138.670 1.00 500.00 ? 336 ASP A OD1 1 
ATOM 2351  O OD2 . ASP A 1 336 ? 140.341 163.269 137.568 1.00 500.00 ? 336 ASP A OD2 1 
ATOM 2352  N N   . TYR A 1 337 ? 136.101 167.007 135.502 1.00 396.17 ? 337 TYR A N   1 
ATOM 2353  C CA  . TYR A 1 337 ? 135.550 168.064 134.648 1.00 401.69 ? 337 TYR A CA  1 
ATOM 2354  C C   . TYR A 1 337 ? 135.077 167.605 133.277 1.00 392.83 ? 337 TYR A C   1 
ATOM 2355  O O   . TYR A 1 337 ? 134.871 168.417 132.374 1.00 379.22 ? 337 TYR A O   1 
ATOM 2356  C CB  . TYR A 1 337 ? 136.534 169.224 134.536 1.00 405.96 ? 337 TYR A CB  1 
ATOM 2357  C CG  . TYR A 1 337 ? 136.915 169.723 135.886 1.00 410.37 ? 337 TYR A CG  1 
ATOM 2358  C CD1 . TYR A 1 337 ? 135.980 170.385 136.679 1.00 459.50 ? 337 TYR A CD1 1 
ATOM 2359  C CD2 . TYR A 1 337 ? 138.182 169.506 136.403 1.00 443.31 ? 337 TYR A CD2 1 
ATOM 2360  C CE1 . TYR A 1 337 ? 136.299 170.845 137.943 1.00 459.48 ? 337 TYR A CE1 1 
ATOM 2361  C CE2 . TYR A 1 337 ? 138.517 169.966 137.668 1.00 493.19 ? 337 TYR A CE2 1 
ATOM 2362  C CZ  . TYR A 1 337 ? 137.569 170.635 138.434 1.00 465.93 ? 337 TYR A CZ  1 
ATOM 2363  O OH  . TYR A 1 337 ? 137.882 171.095 139.690 1.00 458.86 ? 337 TYR A OH  1 
ATOM 2364  N N   . ILE A 1 338 ? 134.798 166.318 133.150 1.00 389.33 ? 338 ILE A N   1 
ATOM 2365  C CA  . ILE A 1 338 ? 134.713 165.701 131.836 1.00 412.72 ? 338 ILE A CA  1 
ATOM 2366  C C   . ILE A 1 338 ? 133.686 166.352 130.885 1.00 370.55 ? 338 ILE A C   1 
ATOM 2367  O O   . ILE A 1 338 ? 133.813 166.194 129.677 1.00 442.50 ? 338 ILE A O   1 
ATOM 2368  C CB  . ILE A 1 338 ? 134.546 164.153 131.916 1.00 475.40 ? 338 ILE A CB  1 
ATOM 2369  C CG1 . ILE A 1 338 ? 133.142 163.750 132.397 1.00 500.00 ? 338 ILE A CG1 1 
ATOM 2370  C CG2 . ILE A 1 338 ? 135.639 163.533 132.797 1.00 472.83 ? 338 ILE A CG2 1 
ATOM 2371  C CD1 . ILE A 1 338 ? 132.079 163.695 131.316 1.00 500.00 ? 338 ILE A CD1 1 
ATOM 2372  N N   . GLY A 1 339 ? 132.696 167.074 131.404 1.00 350.48 ? 339 GLY A N   1 
ATOM 2373  C CA  . GLY A 1 339 ? 131.681 167.707 130.559 1.00 428.88 ? 339 GLY A CA  1 
ATOM 2374  C C   . GLY A 1 339 ? 132.013 169.177 130.344 1.00 428.96 ? 339 GLY A C   1 
ATOM 2375  O O   . GLY A 1 339 ? 132.021 169.702 129.208 1.00 453.20 ? 339 GLY A O   1 
ATOM 2376  N N   . SER A 1 340 ? 132.307 169.821 131.475 1.00 403.26 ? 340 SER A N   1 
ATOM 2377  C CA  . SER A 1 340 ? 132.691 171.246 131.490 1.00 401.67 ? 340 SER A CA  1 
ATOM 2378  C C   . SER A 1 340 ? 133.932 171.448 130.644 1.00 398.29 ? 340 SER A C   1 
ATOM 2379  O O   . SER A 1 340 ? 133.981 172.404 129.851 1.00 378.78 ? 340 SER A O   1 
ATOM 2380  C CB  . SER A 1 340 ? 132.849 171.762 132.928 1.00 370.12 ? 340 SER A CB  1 
ATOM 2381  O OG  . SER A 1 340 ? 133.358 170.757 133.782 1.00 416.46 ? 340 SER A OG  1 
ATOM 2382  N N   . SER A 1 341 ? 134.902 170.546 130.814 1.00 388.59 ? 341 SER A N   1 
ATOM 2383  C CA  . SER A 1 341 ? 136.161 170.608 130.064 1.00 366.20 ? 341 SER A CA  1 
ATOM 2384  C C   . SER A 1 341 ? 135.893 170.541 128.575 1.00 360.70 ? 341 SER A C   1 
ATOM 2385  O O   . SER A 1 341 ? 136.460 171.326 127.796 1.00 439.83 ? 341 SER A O   1 
ATOM 2386  C CB  . SER A 1 341 ? 137.132 169.515 130.483 1.00 376.44 ? 341 SER A CB  1 
ATOM 2387  O OG  . SER A 1 341 ? 136.511 168.251 130.376 1.00 433.12 ? 341 SER A OG  1 
ATOM 2388  N N   . ARG A 1 342 ? 135.026 169.603 128.211 1.00 342.26 ? 342 ARG A N   1 
ATOM 2389  C CA  . ARG A 1 342 ? 134.637 169.394 126.806 1.00 389.22 ? 342 ARG A CA  1 
ATOM 2390  C C   . ARG A 1 342 ? 134.036 170.664 126.234 1.00 395.09 ? 342 ARG A C   1 
ATOM 2391  O O   . ARG A 1 342 ? 134.385 171.080 125.118 1.00 437.85 ? 342 ARG A O   1 
ATOM 2392  C CB  . ARG A 1 342 ? 133.692 168.217 126.596 1.00 442.10 ? 342 ARG A CB  1 
ATOM 2393  C CG  . ARG A 1 342 ? 133.257 168.028 125.140 1.00 443.92 ? 342 ARG A CG  1 
ATOM 2394  C CD  . ARG A 1 342 ? 134.438 167.888 124.189 1.00 435.22 ? 342 ARG A CD  1 
ATOM 2395  N NE  . ARG A 1 342 ? 134.192 166.914 123.126 1.00 435.53 ? 342 ARG A NE  1 
ATOM 2396  C CZ  . ARG A 1 342 ? 133.328 167.062 122.116 1.00 455.07 ? 342 ARG A CZ  1 
ATOM 2397  N NH1 . ARG A 1 342 ? 132.579 168.153 121.988 1.00 458.86 ? 342 ARG A NH1 1 
ATOM 2398  N NH2 . ARG A 1 342 ? 133.210 166.093 121.215 1.00 498.19 ? 342 ARG A NH2 1 
ATOM 2399  N N   . MET A 1 343 ? 133.143 171.255 127.018 1.00 378.07 ? 343 MET A N   1 
ATOM 2400  C CA  . MET A 1 343 ? 132.453 172.495 126.646 1.00 406.08 ? 343 MET A CA  1 
ATOM 2401  C C   . MET A 1 343 ? 133.471 173.598 126.366 1.00 404.43 ? 343 MET A C   1 
ATOM 2402  O O   . MET A 1 343 ? 133.382 174.312 125.355 1.00 461.98 ? 343 MET A O   1 
ATOM 2403  C CB  . MET A 1 343 ? 131.497 172.957 127.754 1.00 439.03 ? 343 MET A CB  1 
ATOM 2404  C CG  . MET A 1 343 ? 130.026 172.850 127.366 1.00 495.98 ? 343 MET A CG  1 
ATOM 2405  S SD  . MET A 1 343 ? 129.489 174.025 126.100 1.00 500.00 ? 343 MET A SD  1 
ATOM 2406  C CE  . MET A 1 343 ? 129.948 175.605 126.815 1.00 500.00 ? 343 MET A CE  1 
ATOM 2407  N N   . VAL A 1 344 ? 134.419 173.705 127.287 1.00 388.98 ? 344 VAL A N   1 
ATOM 2408  C CA  . VAL A 1 344 ? 135.495 174.700 127.211 1.00 412.13 ? 344 VAL A CA  1 
ATOM 2409  C C   . VAL A 1 344 ? 136.277 174.531 125.914 1.00 423.27 ? 344 VAL A C   1 
ATOM 2410  O O   . VAL A 1 344 ? 136.555 175.508 125.203 1.00 423.40 ? 344 VAL A O   1 
ATOM 2411  C CB  . VAL A 1 344 ? 136.471 174.622 128.412 1.00 449.12 ? 344 VAL A CB  1 
ATOM 2412  C CG1 . VAL A 1 344 ? 137.943 174.853 128.022 1.00 401.33 ? 344 VAL A CG1 1 
ATOM 2413  C CG2 . VAL A 1 344 ? 136.027 175.609 129.477 1.00 483.74 ? 344 VAL A CG2 1 
ATOM 2414  N N   . TYR A 1 345 ? 136.614 173.278 125.643 1.00 434.38 ? 345 TYR A N   1 
ATOM 2415  C CA  . TYR A 1 345 ? 137.372 172.895 124.447 1.00 430.64 ? 345 TYR A CA  1 
ATOM 2416  C C   . TYR A 1 345 ? 136.624 173.341 123.191 1.00 395.91 ? 345 TYR A C   1 
ATOM 2417  O O   . TYR A 1 345 ? 137.214 173.928 122.270 1.00 403.72 ? 345 TYR A O   1 
ATOM 2418  C CB  . TYR A 1 345 ? 137.665 171.385 124.463 1.00 415.39 ? 345 TYR A CB  1 
ATOM 2419  C CG  . TYR A 1 345 ? 138.215 170.818 123.179 1.00 423.70 ? 345 TYR A CG  1 
ATOM 2420  C CD1 . TYR A 1 345 ? 137.358 170.504 122.112 1.00 461.73 ? 345 TYR A CD1 1 
ATOM 2421  C CD2 . TYR A 1 345 ? 139.579 170.566 123.030 1.00 387.46 ? 345 TYR A CD2 1 
ATOM 2422  C CE1 . TYR A 1 345 ? 137.845 169.976 120.928 1.00 458.10 ? 345 TYR A CE1 1 
ATOM 2423  C CE2 . TYR A 1 345 ? 140.077 170.034 121.846 1.00 446.56 ? 345 TYR A CE2 1 
ATOM 2424  C CZ  . TYR A 1 345 ? 139.206 169.740 120.799 1.00 472.30 ? 345 TYR A CZ  1 
ATOM 2425  O OH  . TYR A 1 345 ? 139.685 169.215 119.619 1.00 451.41 ? 345 TYR A OH  1 
ATOM 2426  N N   . ASP A 1 346 ? 135.332 173.045 123.194 1.00 383.43 ? 346 ASP A N   1 
ATOM 2427  C CA  . ASP A 1 346 ? 134.437 173.385 122.084 1.00 486.35 ? 346 ASP A CA  1 
ATOM 2428  C C   . ASP A 1 346 ? 134.451 174.890 121.836 1.00 469.61 ? 346 ASP A C   1 
ATOM 2429  O O   . ASP A 1 346 ? 134.564 175.348 120.693 1.00 448.06 ? 346 ASP A O   1 
ATOM 2430  C CB  . ASP A 1 346 ? 133.000 172.907 122.338 1.00 500.00 ? 346 ASP A CB  1 
ATOM 2431  C CG  . ASP A 1 346 ? 132.857 171.392 122.289 1.00 500.00 ? 346 ASP A CG  1 
ATOM 2432  O OD1 . ASP A 1 346 ? 133.436 170.753 121.377 1.00 500.00 ? 346 ASP A OD1 1 
ATOM 2433  O OD2 . ASP A 1 346 ? 132.146 170.833 123.158 1.00 500.00 ? 346 ASP A OD2 1 
ATOM 2434  N N   . MET A 1 347 ? 134.337 175.622 122.937 1.00 482.19 ? 347 MET A N   1 
ATOM 2435  C CA  . MET A 1 347 ? 134.329 177.090 122.922 1.00 492.42 ? 347 MET A CA  1 
ATOM 2436  C C   . MET A 1 347 ? 135.610 177.612 122.281 1.00 495.38 ? 347 MET A C   1 
ATOM 2437  O O   . MET A 1 347 ? 135.578 178.503 121.409 1.00 500.00 ? 347 MET A O   1 
ATOM 2438  C CB  . MET A 1 347 ? 134.219 177.689 124.330 1.00 476.10 ? 347 MET A CB  1 
ATOM 2439  C CG  . MET A 1 347 ? 132.997 177.263 125.130 1.00 497.90 ? 347 MET A CG  1 
ATOM 2440  S SD  . MET A 1 347 ? 131.792 178.542 125.485 1.00 488.73 ? 347 MET A SD  1 
ATOM 2441  C CE  . MET A 1 347 ? 132.773 179.751 126.357 1.00 500.00 ? 347 MET A CE  1 
ATOM 2442  N N   . GLU A 1 348 ? 136.716 177.029 122.728 1.00 479.33 ? 348 GLU A N   1 
ATOM 2443  C CA  . GLU A 1 348 ? 138.052 177.389 122.245 1.00 488.72 ? 348 GLU A CA  1 
ATOM 2444  C C   . GLU A 1 348 ? 138.140 177.187 120.744 1.00 463.04 ? 348 GLU A C   1 
ATOM 2445  O O   . GLU A 1 348 ? 138.634 178.052 120.005 1.00 445.35 ? 348 GLU A O   1 
ATOM 2446  C CB  . GLU A 1 348 ? 139.164 176.581 122.922 1.00 500.00 ? 348 GLU A CB  1 
ATOM 2447  C CG  . GLU A 1 348 ? 139.759 177.230 124.160 1.00 500.00 ? 348 GLU A CG  1 
ATOM 2448  C CD  . GLU A 1 348 ? 141.033 176.532 124.620 1.00 500.00 ? 348 GLU A CD  1 
ATOM 2449  O OE1 . GLU A 1 348 ? 142.060 176.627 123.908 1.00 500.00 ? 348 GLU A OE1 1 
ATOM 2450  O OE2 . GLU A 1 348 ? 141.004 175.884 125.692 1.00 500.00 ? 348 GLU A OE2 1 
ATOM 2451  N N   . LYS A 1 349 ? 137.646 176.037 120.309 1.00 469.50 ? 349 LYS A N   1 
ATOM 2452  C CA  . LYS A 1 349 ? 137.808 175.759 118.899 1.00 480.87 ? 349 LYS A CA  1 
ATOM 2453  C C   . LYS A 1 349 ? 136.873 176.635 118.087 1.00 479.19 ? 349 LYS A C   1 
ATOM 2454  O O   . LYS A 1 349 ? 137.253 177.171 117.036 1.00 432.93 ? 349 LYS A O   1 
ATOM 2455  C CB  . LYS A 1 349 ? 137.625 174.278 118.597 1.00 500.00 ? 349 LYS A CB  1 
ATOM 2456  C CG  . LYS A 1 349 ? 138.645 173.375 119.296 1.00 500.00 ? 349 LYS A CG  1 
ATOM 2457  C CD  . LYS A 1 349 ? 140.024 174.019 119.481 1.00 500.00 ? 349 LYS A CD  1 
ATOM 2458  C CE  . LYS A 1 349 ? 141.056 173.039 120.007 1.00 500.00 ? 349 LYS A CE  1 
ATOM 2459  N NZ  . LYS A 1 349 ? 142.388 173.684 120.187 1.00 500.00 ? 349 LYS A NZ  1 
ATOM 2460  N N   . GLY A 1 350 ? 135.624 176.691 118.547 1.00 500.00 ? 350 GLY A N   1 
ATOM 2461  C CA  . GLY A 1 350 ? 134.527 177.320 117.826 1.00 500.00 ? 350 GLY A CA  1 
ATOM 2462  C C   . GLY A 1 350 ? 133.655 176.349 117.046 1.00 500.00 ? 350 GLY A C   1 
ATOM 2463  O O   . GLY A 1 350 ? 133.098 176.729 116.012 1.00 500.00 ? 350 GLY A O   1 
ATOM 2464  N N   . LYS A 1 351 ? 133.525 175.108 117.527 1.00 500.00 ? 351 LYS A N   1 
ATOM 2465  C CA  . LYS A 1 351 ? 132.483 174.180 117.047 1.00 500.00 ? 351 LYS A CA  1 
ATOM 2466  C C   . LYS A 1 351 ? 131.276 174.358 117.953 1.00 500.00 ? 351 LYS A C   1 
ATOM 2467  O O   . LYS A 1 351 ? 130.723 173.386 118.486 1.00 447.03 ? 351 LYS A O   1 
ATOM 2468  C CB  . LYS A 1 351 ? 132.949 172.714 117.082 1.00 500.00 ? 351 LYS A CB  1 
ATOM 2469  C CG  . LYS A 1 351 ? 133.997 172.337 116.042 1.00 500.00 ? 351 LYS A CG  1 
ATOM 2470  C CD  . LYS A 1 351 ? 135.423 172.386 116.581 1.00 500.00 ? 351 LYS A CD  1 
ATOM 2471  C CE  . LYS A 1 351 ? 136.364 171.539 115.732 1.00 500.00 ? 351 LYS A CE  1 
ATOM 2472  N NZ  . LYS A 1 351 ? 137.723 171.396 116.331 1.00 500.00 ? 351 LYS A NZ  1 
ATOM 2473  N N   . PHE A 1 352 ? 130.861 175.613 118.104 1.00 500.00 ? 352 PHE A N   1 
ATOM 2474  C CA  . PHE A 1 352 ? 130.017 176.024 119.211 1.00 500.00 ? 352 PHE A CA  1 
ATOM 2475  C C   . PHE A 1 352 ? 129.696 177.547 119.158 1.00 500.00 ? 352 PHE A C   1 
ATOM 2476  O O   . PHE A 1 352 ? 130.600 178.343 118.876 1.00 500.00 ? 352 PHE A O   1 
ATOM 2477  C CB  . PHE A 1 352 ? 130.719 175.665 120.524 1.00 478.21 ? 352 PHE A CB  1 
ATOM 2478  C CG  . PHE A 1 352 ? 129.887 175.931 121.714 1.00 500.00 ? 352 PHE A CG  1 
ATOM 2479  C CD1 . PHE A 1 352 ? 128.839 175.078 122.050 1.00 480.35 ? 352 PHE A CD1 1 
ATOM 2480  C CD2 . PHE A 1 352 ? 130.120 177.054 122.482 1.00 500.00 ? 352 PHE A CD2 1 
ATOM 2481  C CE1 . PHE A 1 352 ? 128.046 175.349 123.147 1.00 466.01 ? 352 PHE A CE1 1 
ATOM 2482  C CE2 . PHE A 1 352 ? 129.339 177.320 123.577 1.00 500.00 ? 352 PHE A CE2 1 
ATOM 2483  C CZ  . PHE A 1 352 ? 128.313 176.476 123.909 1.00 500.00 ? 352 PHE A CZ  1 
ATOM 2484  N N   . PRO A 1 353 ? 128.419 177.954 119.425 1.00 500.00 ? 353 PRO A N   1 
ATOM 2485  C CA  . PRO A 1 353 ? 128.009 179.373 119.275 1.00 423.97 ? 353 PRO A CA  1 
ATOM 2486  C C   . PRO A 1 353 ? 128.710 180.368 120.181 1.00 421.75 ? 353 PRO A C   1 
ATOM 2487  O O   . PRO A 1 353 ? 129.362 181.280 119.686 1.00 479.41 ? 353 PRO A O   1 
ATOM 2488  C CB  . PRO A 1 353 ? 126.507 179.358 119.599 1.00 428.13 ? 353 PRO A CB  1 
ATOM 2489  C CG  . PRO A 1 353 ? 126.251 178.055 120.274 1.00 458.12 ? 353 PRO A CG  1 
ATOM 2490  C CD  . PRO A 1 353 ? 127.247 177.099 119.703 1.00 494.73 ? 353 PRO A CD  1 
ATOM 2491  N N   . VAL A 1 354 ? 128.578 180.194 121.492 1.00 466.51 ? 354 VAL A N   1 
ATOM 2492  C CA  . VAL A 1 354 ? 129.117 181.149 122.464 1.00 490.63 ? 354 VAL A CA  1 
ATOM 2493  C C   . VAL A 1 354 ? 130.613 180.915 122.661 1.00 480.13 ? 354 VAL A C   1 
ATOM 2494  O O   . VAL A 1 354 ? 131.015 180.018 123.391 1.00 420.71 ? 354 VAL A O   1 
ATOM 2495  C CB  . VAL A 1 354 ? 128.390 181.043 123.822 1.00 470.61 ? 354 VAL A CB  1 
ATOM 2496  C CG1 . VAL A 1 354 ? 129.054 181.934 124.863 1.00 470.68 ? 354 VAL A CG1 1 
ATOM 2497  C CG2 . VAL A 1 354 ? 126.914 181.398 123.673 1.00 455.56 ? 354 VAL A CG2 1 
ATOM 2498  N N   . GLN A 1 355 ? 131.437 181.734 122.023 1.00 487.59 ? 355 GLN A N   1 
ATOM 2499  C CA  . GLN A 1 355 ? 132.874 181.558 122.131 1.00 483.69 ? 355 GLN A CA  1 
ATOM 2500  C C   . GLN A 1 355 ? 133.364 182.032 123.496 1.00 460.06 ? 355 GLN A C   1 
ATOM 2501  O O   . GLN A 1 355 ? 132.668 182.768 124.194 1.00 458.93 ? 355 GLN A O   1 
ATOM 2502  C CB  . GLN A 1 355 ? 133.590 182.289 121.000 1.00 500.00 ? 355 GLN A CB  1 
ATOM 2503  C CG  . GLN A 1 355 ? 135.018 181.808 120.793 1.00 500.00 ? 355 GLN A CG  1 
ATOM 2504  C CD  . GLN A 1 355 ? 135.536 182.012 119.384 1.00 500.00 ? 355 GLN A CD  1 
ATOM 2505  O OE1 . GLN A 1 355 ? 135.054 182.877 118.648 1.00 500.00 ? 355 GLN A OE1 1 
ATOM 2506  N NE2 . GLN A 1 355 ? 136.532 181.213 119.000 1.00 500.00 ? 355 GLN A NE2 1 
ATOM 2507  N N   . LEU A 1 356 ? 134.551 181.576 123.873 1.00 460.80 ? 356 LEU A N   1 
ATOM 2508  C CA  . LEU A 1 356 ? 135.200 181.968 125.125 1.00 458.20 ? 356 LEU A CA  1 
ATOM 2509  C C   . LEU A 1 356 ? 135.547 183.465 125.239 1.00 461.31 ? 356 LEU A C   1 
ATOM 2510  O O   . LEU A 1 356 ? 135.514 184.023 126.340 1.00 407.68 ? 356 LEU A O   1 
ATOM 2511  C CB  . LEU A 1 356 ? 136.466 181.143 125.304 1.00 451.21 ? 356 LEU A CB  1 
ATOM 2512  C CG  . LEU A 1 356 ? 137.104 181.225 126.681 1.00 460.21 ? 356 LEU A CG  1 
ATOM 2513  C CD1 . LEU A 1 356 ? 136.272 180.447 127.689 1.00 460.31 ? 356 LEU A CD1 1 
ATOM 2514  C CD2 . LEU A 1 356 ? 138.527 180.712 126.610 1.00 463.20 ? 356 LEU A CD2 1 
ATOM 2515  N N   . GLU A 1 357 ? 135.891 184.103 124.119 1.00 476.14 ? 357 GLU A N   1 
ATOM 2516  C CA  . GLU A 1 357 ? 136.122 185.554 124.096 1.00 500.00 ? 357 GLU A CA  1 
ATOM 2517  C C   . GLU A 1 357 ? 134.897 186.362 124.538 1.00 439.84 ? 357 GLU A C   1 
ATOM 2518  O O   . GLU A 1 357 ? 135.035 187.505 124.972 1.00 456.71 ? 357 GLU A O   1 
ATOM 2519  C CB  . GLU A 1 357 ? 136.596 186.032 122.711 1.00 500.00 ? 357 GLU A CB  1 
ATOM 2520  C CG  . GLU A 1 357 ? 138.019 185.593 122.334 1.00 500.00 ? 357 GLU A CG  1 
ATOM 2521  C CD  . GLU A 1 357 ? 138.772 186.569 121.407 1.00 500.00 ? 357 GLU A CD  1 
ATOM 2522  O OE1 . GLU A 1 357 ? 138.150 187.498 120.827 1.00 500.00 ? 357 GLU A OE1 1 
ATOM 2523  O OE2 . GLU A 1 357 ? 140.007 186.403 121.253 1.00 500.00 ? 357 GLU A OE2 1 
ATOM 2524  N N   . ASN A 1 358 ? 133.707 185.769 124.424 1.00 422.96 ? 358 ASN A N   1 
ATOM 2525  C CA  . ASN A 1 358 ? 132.508 186.294 125.080 1.00 414.91 ? 358 ASN A CA  1 
ATOM 2526  C C   . ASN A 1 358 ? 132.638 185.984 126.577 1.00 414.11 ? 358 ASN A C   1 
ATOM 2527  O O   . ASN A 1 358 ? 133.757 185.960 127.095 1.00 428.45 ? 358 ASN A O   1 
ATOM 2528  C CB  . ASN A 1 358 ? 131.235 185.701 124.462 1.00 423.59 ? 358 ASN A CB  1 
ATOM 2529  C CG  . ASN A 1 358 ? 131.227 185.772 122.939 1.00 483.03 ? 358 ASN A CG  1 
ATOM 2530  O OD1 . ASN A 1 358 ? 131.843 184.950 122.257 1.00 470.20 ? 358 ASN A OD1 1 
ATOM 2531  N ND2 . ASN A 1 358 ? 130.522 186.756 122.402 1.00 500.00 ? 358 ASN A ND2 1 
ATOM 2532  N N   . VAL A 1 359 ? 131.522 185.776 127.279 1.00 400.67 ? 359 VAL A N   1 
ATOM 2533  C CA  . VAL A 1 359 ? 131.532 185.339 128.689 1.00 457.26 ? 359 VAL A CA  1 
ATOM 2534  C C   . VAL A 1 359 ? 132.095 186.412 129.624 1.00 464.46 ? 359 VAL A C   1 
ATOM 2535  O O   . VAL A 1 359 ? 133.294 186.414 129.946 1.00 468.24 ? 359 VAL A O   1 
ATOM 2536  C CB  . VAL A 1 359 ? 132.323 184.012 128.920 1.00 500.00 ? 359 VAL A CB  1 
ATOM 2537  C CG1 . VAL A 1 359 ? 132.099 183.490 130.336 1.00 492.85 ? 359 VAL A CG1 1 
ATOM 2538  C CG2 . VAL A 1 359 ? 131.943 182.958 127.893 1.00 500.00 ? 359 VAL A CG2 1 
ATOM 2539  N N   . ASP A 1 360 ? 131.232 187.321 130.061 1.00 438.67 ? 360 ASP A N   1 
ATOM 2540  C CA  . ASP A 1 360 ? 131.624 188.332 131.034 1.00 481.07 ? 360 ASP A CA  1 
ATOM 2541  C C   . ASP A 1 360 ? 131.799 187.601 132.372 1.00 447.02 ? 360 ASP A C   1 
ATOM 2542  O O   . ASP A 1 360 ? 132.923 187.456 132.863 1.00 446.63 ? 360 ASP A O   1 
ATOM 2543  C CB  . ASP A 1 360 ? 130.578 189.478 131.113 1.00 500.00 ? 360 ASP A CB  1 
ATOM 2544  C CG  . ASP A 1 360 ? 131.196 190.854 131.471 1.00 500.00 ? 360 ASP A CG  1 
ATOM 2545  O OD1 . ASP A 1 360 ? 132.248 190.915 132.145 1.00 500.00 ? 360 ASP A OD1 1 
ATOM 2546  O OD2 . ASP A 1 360 ? 130.607 191.889 131.081 1.00 462.93 ? 360 ASP A OD2 1 
ATOM 2547  N N   . SER A 1 361 ? 130.694 187.078 132.901 1.00 408.33 ? 361 SER A N   1 
ATOM 2548  C CA  . SER A 1 361 ? 130.629 186.600 134.279 1.00 402.56 ? 361 SER A CA  1 
ATOM 2549  C C   . SER A 1 361 ? 130.308 185.117 134.390 1.00 424.08 ? 361 SER A C   1 
ATOM 2550  O O   . SER A 1 361 ? 129.247 184.675 133.947 1.00 433.03 ? 361 SER A O   1 
ATOM 2551  C CB  . SER A 1 361 ? 129.543 187.364 135.015 1.00 425.88 ? 361 SER A CB  1 
ATOM 2552  O OG  . SER A 1 361 ? 128.275 187.091 134.451 1.00 415.58 ? 361 SER A OG  1 
ATOM 2553  N N   . PHE A 1 362 ? 131.211 184.368 135.012 1.00 414.79 ? 362 PHE A N   1 
ATOM 2554  C CA  . PHE A 1 362 ? 130.972 182.975 135.355 1.00 394.72 ? 362 PHE A CA  1 
ATOM 2555  C C   . PHE A 1 362 ? 130.449 182.901 136.787 1.00 379.16 ? 362 PHE A C   1 
ATOM 2556  O O   . PHE A 1 362 ? 130.997 183.542 137.694 1.00 404.53 ? 362 PHE A O   1 
ATOM 2557  C CB  . PHE A 1 362 ? 132.270 182.191 135.232 1.00 426.83 ? 362 PHE A CB  1 
ATOM 2558  C CG  . PHE A 1 362 ? 132.087 180.695 135.197 1.00 454.29 ? 362 PHE A CG  1 
ATOM 2559  C CD1 . PHE A 1 362 ? 131.727 179.982 136.339 1.00 453.63 ? 362 PHE A CD1 1 
ATOM 2560  C CD2 . PHE A 1 362 ? 132.318 179.989 134.026 1.00 467.19 ? 362 PHE A CD2 1 
ATOM 2561  C CE1 . PHE A 1 362 ? 131.582 178.608 136.295 1.00 435.08 ? 362 PHE A CE1 1 
ATOM 2562  C CE2 . PHE A 1 362 ? 132.174 178.615 133.985 1.00 404.04 ? 362 PHE A CE2 1 
ATOM 2563  C CZ  . PHE A 1 362 ? 131.804 177.923 135.112 1.00 406.48 ? 362 PHE A CZ  1 
ATOM 2564  N N   . VAL A 1 363 ? 129.410 182.097 136.986 1.00 366.08 ? 363 VAL A N   1 
ATOM 2565  C CA  . VAL A 1 363 ? 128.779 181.947 138.285 1.00 355.73 ? 363 VAL A CA  1 
ATOM 2566  C C   . VAL A 1 363 ? 128.416 180.476 138.548 1.00 388.75 ? 363 VAL A C   1 
ATOM 2567  O O   . VAL A 1 363 ? 127.347 179.997 138.133 1.00 380.06 ? 363 VAL A O   1 
ATOM 2568  C CB  . VAL A 1 363 ? 127.516 182.819 138.366 1.00 401.46 ? 363 VAL A CB  1 
ATOM 2569  C CG1 . VAL A 1 363 ? 126.875 182.705 139.744 1.00 464.50 ? 363 VAL A CG1 1 
ATOM 2570  C CG2 . VAL A 1 363 ? 127.846 184.268 138.026 1.00 408.13 ? 363 VAL A CG2 1 
ATOM 2571  N N   . GLU A 1 364 ? 129.324 179.763 139.218 1.00 384.89 ? 364 GLU A N   1 
ATOM 2572  C CA  . GLU A 1 364 ? 129.061 178.386 139.664 1.00 388.79 ? 364 GLU A CA  1 
ATOM 2573  C C   . GLU A 1 364 ? 128.286 178.416 140.959 1.00 365.70 ? 364 GLU A C   1 
ATOM 2574  O O   . GLU A 1 364 ? 128.517 179.282 141.806 1.00 450.18 ? 364 GLU A O   1 
ATOM 2575  C CB  . GLU A 1 364 ? 130.371 177.595 139.861 1.00 452.30 ? 364 GLU A CB  1 
ATOM 2576  C CG  . GLU A 1 364 ? 130.381 176.453 140.905 1.00 500.00 ? 364 GLU A CG  1 
ATOM 2577  C CD  . GLU A 1 364 ? 129.906 175.093 140.390 1.00 500.00 ? 364 GLU A CD  1 
ATOM 2578  O OE1 . GLU A 1 364 ? 130.386 174.053 140.907 1.00 475.30 ? 364 GLU A OE1 1 
ATOM 2579  O OE2 . GLU A 1 364 ? 129.057 175.053 139.475 1.00 500.00 ? 364 GLU A OE2 1 
ATOM 2580  N N   . LEU A 1 365 ? 127.383 177.456 141.111 1.00 315.74 ? 365 LEU A N   1 
ATOM 2581  C CA  . LEU A 1 365 ? 126.803 177.125 142.404 1.00 370.06 ? 365 LEU A CA  1 
ATOM 2582  C C   . LEU A 1 365 ? 127.347 175.744 142.772 1.00 386.23 ? 365 LEU A C   1 
ATOM 2583  O O   . LEU A 1 365 ? 127.160 174.789 142.018 1.00 400.46 ? 365 LEU A O   1 
ATOM 2584  C CB  . LEU A 1 365 ? 125.284 177.088 142.317 1.00 402.25 ? 365 LEU A CB  1 
ATOM 2585  C CG  . LEU A 1 365 ? 124.530 178.359 141.927 1.00 428.82 ? 365 LEU A CG  1 
ATOM 2586  C CD1 . LEU A 1 365 ? 124.889 178.847 140.525 1.00 438.21 ? 365 LEU A CD1 1 
ATOM 2587  C CD2 . LEU A 1 365 ? 123.033 178.086 142.053 1.00 445.08 ? 365 LEU A CD2 1 
ATOM 2588  N N   . GLY A 1 366 ? 128.029 175.630 143.909 1.00 418.38 ? 366 GLY A N   1 
ATOM 2589  C CA  . GLY A 1 366 ? 128.736 174.373 144.217 1.00 393.20 ? 366 GLY A CA  1 
ATOM 2590  C C   . GLY A 1 366 ? 128.600 173.960 145.662 1.00 415.58 ? 366 GLY A C   1 
ATOM 2591  O O   . GLY A 1 366 ? 129.371 174.413 146.504 1.00 479.07 ? 366 GLY A O   1 
ATOM 2592  N N   . GLN A 1 367 ? 127.634 173.083 145.939 1.00 428.04 ? 367 GLN A N   1 
ATOM 2593  C CA  . GLN A 1 367 ? 127.346 172.580 147.296 1.00 441.12 ? 367 GLN A CA  1 
ATOM 2594  C C   . GLN A 1 367 ? 126.723 173.698 148.137 1.00 410.63 ? 367 GLN A C   1 
ATOM 2595  O O   . GLN A 1 367 ? 127.421 174.441 148.831 1.00 446.29 ? 367 GLN A O   1 
ATOM 2596  C CB  . GLN A 1 367 ? 128.592 171.963 147.973 1.00 488.72 ? 367 GLN A CB  1 
ATOM 2597  C CG  . GLN A 1 367 ? 129.506 171.147 147.052 1.00 500.00 ? 367 GLN A CG  1 
ATOM 2598  C CD  . GLN A 1 367 ? 130.612 170.381 147.777 1.00 496.46 ? 367 GLN A CD  1 
ATOM 2599  O OE1 . GLN A 1 367 ? 131.656 170.096 147.192 1.00 436.69 ? 367 GLN A OE1 1 
ATOM 2600  N NE2 . GLN A 1 367 ? 130.381 170.034 149.039 1.00 500.00 ? 367 GLN A NE2 1 
ATOM 2601  N N   . VAL A 1 368 ? 125.402 173.806 148.057 1.00 404.72 ? 368 VAL A N   1 
ATOM 2602  C CA  . VAL A 1 368 ? 124.689 175.044 148.374 1.00 407.48 ? 368 VAL A CA  1 
ATOM 2603  C C   . VAL A 1 368 ? 123.422 174.748 149.198 1.00 377.70 ? 368 VAL A C   1 
ATOM 2604  O O   . VAL A 1 368 ? 122.314 175.198 148.860 1.00 323.31 ? 368 VAL A O   1 
ATOM 2605  C CB  . VAL A 1 368 ? 124.317 175.787 147.055 1.00 438.83 ? 368 VAL A CB  1 
ATOM 2606  C CG1 . VAL A 1 368 ? 123.822 177.202 147.342 1.00 499.68 ? 368 VAL A CG1 1 
ATOM 2607  C CG2 . VAL A 1 368 ? 125.484 175.812 146.065 1.00 396.85 ? 368 VAL A CG2 1 
ATOM 2608  N N   . ALA A 1 369 ? 123.587 173.990 150.281 1.00 355.10 ? 369 ALA A N   1 
ATOM 2609  C CA  . ALA A 1 369 ? 122.434 173.405 150.973 1.00 379.00 ? 369 ALA A CA  1 
ATOM 2610  C C   . ALA A 1 369 ? 122.271 173.850 152.406 1.00 449.35 ? 369 ALA A C   1 
ATOM 2611  O O   . ALA A 1 369 ? 121.245 174.441 152.757 1.00 500.00 ? 369 ALA A O   1 
ATOM 2612  C CB  . ALA A 1 369 ? 122.521 171.898 150.936 1.00 406.18 ? 369 ALA A CB  1 
ATOM 2613  N N   . LEU A 1 370 ? 123.269 173.556 153.237 1.00 453.92 ? 370 LEU A N   1 
ATOM 2614  C CA  . LEU A 1 370 ? 123.109 173.651 154.687 1.00 482.58 ? 370 LEU A CA  1 
ATOM 2615  C C   . LEU A 1 370 ? 122.947 175.109 155.091 1.00 478.50 ? 370 LEU A C   1 
ATOM 2616  O O   . LEU A 1 370 ? 121.884 175.526 155.576 1.00 421.13 ? 370 LEU A O   1 
ATOM 2617  C CB  . LEU A 1 370 ? 124.298 173.021 155.435 1.00 474.82 ? 370 LEU A CB  1 
ATOM 2618  C CG  . LEU A 1 370 ? 124.608 171.522 155.305 1.00 500.00 ? 370 LEU A CG  1 
ATOM 2619  C CD1 . LEU A 1 370 ? 123.343 170.677 155.392 1.00 500.00 ? 370 LEU A CD1 1 
ATOM 2620  C CD2 . LEU A 1 370 ? 125.392 171.189 154.039 1.00 500.00 ? 370 LEU A CD2 1 
ATOM 2621  N N   . ARG A 1 371 ? 124.001 175.870 154.817 1.00 482.97 ? 371 ARG A N   1 
ATOM 2622  C CA  . ARG A 1 371 ? 124.147 177.256 155.216 1.00 500.00 ? 371 ARG A CA  1 
ATOM 2623  C C   . ARG A 1 371 ? 124.043 177.434 156.742 1.00 485.52 ? 371 ARG A C   1 
ATOM 2624  O O   . ARG A 1 371 ? 122.973 177.310 157.341 1.00 463.96 ? 371 ARG A O   1 
ATOM 2625  C CB  . ARG A 1 371 ? 123.210 178.175 154.409 1.00 490.83 ? 371 ARG A CB  1 
ATOM 2626  C CG  . ARG A 1 371 ? 123.725 178.427 152.990 1.00 433.46 ? 371 ARG A CG  1 
ATOM 2627  C CD  . ARG A 1 371 ? 123.023 179.582 152.305 1.00 383.46 ? 371 ARG A CD  1 
ATOM 2628  N NE  . ARG A 1 371 ? 121.609 179.258 152.083 1.00 439.70 ? 371 ARG A NE  1 
ATOM 2629  C CZ  . ARG A 1 371 ? 120.564 179.688 152.802 1.00 434.34 ? 371 ARG A CZ  1 
ATOM 2630  N NH1 . ARG A 1 371 ? 120.709 180.516 153.831 1.00 447.86 ? 371 ARG A NH1 1 
ATOM 2631  N NH2 . ARG A 1 371 ? 119.341 179.296 152.464 1.00 409.41 ? 371 ARG A NH2 1 
ATOM 2632  N N   . THR A 1 372 ? 125.195 177.724 157.340 1.00 472.51 ? 372 THR A N   1 
ATOM 2633  C CA  . THR A 1 372 ? 125.369 177.766 158.785 1.00 473.49 ? 372 THR A CA  1 
ATOM 2634  C C   . THR A 1 372 ? 124.533 178.874 159.433 1.00 489.41 ? 372 THR A C   1 
ATOM 2635  O O   . THR A 1 372 ? 123.479 178.597 160.013 1.00 425.48 ? 372 THR A O   1 
ATOM 2636  C CB  . THR A 1 372 ? 126.861 177.965 159.123 1.00 500.00 ? 372 THR A CB  1 
ATOM 2637  O OG1 . THR A 1 372 ? 127.394 179.041 158.333 1.00 480.09 ? 372 THR A OG1 1 
ATOM 2638  C CG2 . THR A 1 372 ? 127.639 176.709 158.817 1.00 500.00 ? 372 THR A CG2 1 
ATOM 2639  N N   . SER A 1 373 ? 125.004 180.117 159.307 1.00 500.00 ? 373 SER A N   1 
ATOM 2640  C CA  . SER A 1 373 ? 124.299 181.311 159.789 1.00 500.00 ? 373 SER A CA  1 
ATOM 2641  C C   . SER A 1 373 ? 123.754 182.048 158.571 1.00 500.00 ? 373 SER A C   1 
ATOM 2642  O O   . SER A 1 373 ? 123.954 183.256 158.409 1.00 477.19 ? 373 SER A O   1 
ATOM 2643  C CB  . SER A 1 373 ? 125.251 182.206 160.595 1.00 500.00 ? 373 SER A CB  1 
ATOM 2644  O OG  . SER A 1 373 ? 124.615 183.398 161.030 1.00 500.00 ? 373 SER A OG  1 
ATOM 2645  N N   . LEU A 1 374 ? 123.067 181.292 157.717 1.00 481.14 ? 374 LEU A N   1 
ATOM 2646  C CA  . LEU A 1 374 ? 122.580 181.760 156.422 1.00 498.63 ? 374 LEU A CA  1 
ATOM 2647  C C   . LEU A 1 374 ? 123.676 182.269 155.471 1.00 484.39 ? 374 LEU A C   1 
ATOM 2648  O O   . LEU A 1 374 ? 123.387 183.018 154.528 1.00 467.85 ? 374 LEU A O   1 
ATOM 2649  C CB  . LEU A 1 374 ? 121.491 182.815 156.614 1.00 500.00 ? 374 LEU A CB  1 
ATOM 2650  C CG  . LEU A 1 374 ? 120.462 182.500 157.709 1.00 500.00 ? 374 LEU A CG  1 
ATOM 2651  C CD1 . LEU A 1 374 ? 119.406 183.593 157.741 1.00 500.00 ? 374 LEU A CD1 1 
ATOM 2652  C CD2 . LEU A 1 374 ? 119.812 181.133 157.533 1.00 500.00 ? 374 LEU A CD2 1 
ATOM 2653  N N   . GLU A 1 375 ? 124.913 181.824 155.704 1.00 460.35 ? 375 GLU A N   1 
ATOM 2654  C CA  . GLU A 1 375 ? 126.084 182.366 155.031 1.00 469.94 ? 375 GLU A CA  1 
ATOM 2655  C C   . GLU A 1 375 ? 126.331 181.658 153.723 1.00 453.93 ? 375 GLU A C   1 
ATOM 2656  O O   . GLU A 1 375 ? 126.752 180.505 153.725 1.00 486.82 ? 375 GLU A O   1 
ATOM 2657  C CB  . GLU A 1 375 ? 127.316 182.214 155.910 1.00 500.00 ? 375 GLU A CB  1 
ATOM 2658  C CG  . GLU A 1 375 ? 127.251 182.955 157.234 1.00 500.00 ? 375 GLU A CG  1 
ATOM 2659  C CD  . GLU A 1 375 ? 128.527 182.807 158.059 1.00 500.00 ? 375 GLU A CD  1 
ATOM 2660  O OE1 . GLU A 1 375 ? 129.023 181.663 158.190 1.00 500.00 ? 375 GLU A OE1 1 
ATOM 2661  O OE2 . GLU A 1 375 ? 129.033 183.831 158.584 1.00 500.00 ? 375 GLU A OE2 1 
ATOM 2662  N N   . LEU A 1 376 ? 126.055 182.335 152.612 1.00 470.85 ? 376 LEU A N   1 
ATOM 2663  C CA  . LEU A 1 376 ? 126.430 181.814 151.299 1.00 467.69 ? 376 LEU A CA  1 
ATOM 2664  C C   . LEU A 1 376 ? 127.738 182.481 150.898 1.00 459.17 ? 376 LEU A C   1 
ATOM 2665  O O   . LEU A 1 376 ? 127.776 183.679 150.642 1.00 500.00 ? 376 LEU A O   1 
ATOM 2666  C CB  . LEU A 1 376 ? 125.342 182.075 150.257 1.00 456.34 ? 376 LEU A CB  1 
ATOM 2667  C CG  . LEU A 1 376 ? 125.606 181.482 148.867 1.00 445.71 ? 376 LEU A CG  1 
ATOM 2668  C CD1 . LEU A 1 376 ? 125.493 179.968 148.891 1.00 467.79 ? 376 LEU A CD1 1 
ATOM 2669  C CD2 . LEU A 1 376 ? 124.647 182.064 147.846 1.00 442.97 ? 376 LEU A CD2 1 
ATOM 2670  N N   . TRP A 1 377 ? 128.802 181.692 150.839 1.00 435.83 ? 377 TRP A N   1 
ATOM 2671  C CA  . TRP A 1 377 ? 130.146 182.197 150.622 1.00 437.76 ? 377 TRP A CA  1 
ATOM 2672  C C   . TRP A 1 377 ? 130.515 182.241 149.145 1.00 427.23 ? 377 TRP A C   1 
ATOM 2673  O O   . TRP A 1 377 ? 130.325 181.256 148.415 1.00 442.50 ? 377 TRP A O   1 
ATOM 2674  C CB  . TRP A 1 377 ? 131.151 181.321 151.358 1.00 457.85 ? 377 TRP A CB  1 
ATOM 2675  C CG  . TRP A 1 377 ? 130.991 181.385 152.814 1.00 462.65 ? 377 TRP A CG  1 
ATOM 2676  C CD1 . TRP A 1 377 ? 129.967 180.877 153.545 1.00 493.68 ? 377 TRP A CD1 1 
ATOM 2677  C CD2 . TRP A 1 377 ? 131.883 181.999 153.736 1.00 500.00 ? 377 TRP A CD2 1 
ATOM 2678  N NE1 . TRP A 1 377 ? 130.164 181.129 154.876 1.00 500.00 ? 377 TRP A NE1 1 
ATOM 2679  C CE2 . TRP A 1 377 ? 131.337 181.821 155.023 1.00 500.00 ? 377 TRP A CE2 1 
ATOM 2680  C CE3 . TRP A 1 377 ? 133.101 182.671 153.604 1.00 500.00 ? 377 TRP A CE3 1 
ATOM 2681  C CZ2 . TRP A 1 377 ? 131.963 182.301 156.181 1.00 500.00 ? 377 TRP A CZ2 1 
ATOM 2682  C CZ3 . TRP A 1 377 ? 133.728 183.154 154.758 1.00 500.00 ? 377 TRP A CZ3 1 
ATOM 2683  C CH2 . TRP A 1 377 ? 133.155 182.965 156.029 1.00 500.00 ? 377 TRP A CH2 1 
ATOM 2684  N N   . MET A 1 378 ? 131.052 183.384 148.721 1.00 421.27 ? 378 MET A N   1 
ATOM 2685  C CA  . MET A 1 378 ? 131.647 183.501 147.389 1.00 425.32 ? 378 MET A CA  1 
ATOM 2686  C C   . MET A 1 378 ? 133.042 182.929 147.402 1.00 408.60 ? 378 MET A C   1 
ATOM 2687  O O   . MET A 1 378 ? 133.637 182.776 148.467 1.00 426.66 ? 378 MET A O   1 
ATOM 2688  C CB  . MET A 1 378 ? 131.782 184.962 146.978 1.00 455.57 ? 378 MET A CB  1 
ATOM 2689  C CG  . MET A 1 378 ? 130.475 185.712 146.850 1.00 500.00 ? 378 MET A CG  1 
ATOM 2690  S SD  . MET A 1 378 ? 130.637 187.394 147.472 1.00 500.00 ? 378 MET A SD  1 
ATOM 2691  C CE  . MET A 1 378 ? 129.377 188.226 146.519 1.00 500.00 ? 378 MET A CE  1 
ATOM 2692  N N   . HIS A 1 379 ? 133.571 182.626 146.217 1.00 449.04 ? 379 HIS A N   1 
ATOM 2693  C CA  . HIS A 1 379 ? 135.032 182.456 146.048 1.00 433.83 ? 379 HIS A CA  1 
ATOM 2694  C C   . HIS A 1 379 ? 135.542 183.040 144.740 1.00 433.33 ? 379 HIS A C   1 
ATOM 2695  O O   . HIS A 1 379 ? 134.765 183.337 143.824 1.00 415.31 ? 379 HIS A O   1 
ATOM 2696  C CB  . HIS A 1 379 ? 135.428 180.987 146.147 1.00 435.83 ? 379 HIS A CB  1 
ATOM 2697  C CG  . HIS A 1 379 ? 135.056 180.370 147.450 1.00 427.34 ? 379 HIS A CG  1 
ATOM 2698  N ND1 . HIS A 1 379 ? 135.936 180.291 148.504 1.00 457.64 ? 379 HIS A ND1 1 
ATOM 2699  C CD2 . HIS A 1 379 ? 133.882 179.863 147.895 1.00 428.41 ? 379 HIS A CD2 1 
ATOM 2700  C CE1 . HIS A 1 379 ? 135.330 179.733 149.536 1.00 471.46 ? 379 HIS A CE1 1 
ATOM 2701  N NE2 . HIS A 1 379 ? 134.082 179.467 149.195 1.00 464.94 ? 379 HIS A NE2 1 
ATOM 2702  N N   . THR A 1 380 ? 136.861 183.198 144.670 1.00 442.87 ? 380 THR A N   1 
ATOM 2703  C CA  . THR A 1 380 ? 137.530 183.825 143.527 1.00 500.00 ? 380 THR A CA  1 
ATOM 2704  C C   . THR A 1 380 ? 138.940 183.293 143.356 1.00 479.30 ? 380 THR A C   1 
ATOM 2705  O O   . THR A 1 380 ? 139.477 182.650 144.257 1.00 488.29 ? 380 THR A O   1 
ATOM 2706  C CB  . THR A 1 380 ? 137.640 185.348 143.713 1.00 500.00 ? 380 THR A CB  1 
ATOM 2707  O OG1 . THR A 1 380 ? 138.155 185.637 145.021 1.00 500.00 ? 380 THR A OG1 1 
ATOM 2708  C CG2 . THR A 1 380 ? 136.292 186.014 143.553 1.00 500.00 ? 380 THR A CG2 1 
ATOM 2709  N N   . ASP A 1 381 ? 139.533 183.585 142.198 1.00 454.49 ? 381 ASP A N   1 
ATOM 2710  C CA  . ASP A 1 381 ? 140.873 183.111 141.855 1.00 482.68 ? 381 ASP A CA  1 
ATOM 2711  C C   . ASP A 1 381 ? 141.904 184.197 142.155 1.00 478.13 ? 381 ASP A C   1 
ATOM 2712  O O   . ASP A 1 381 ? 141.813 185.278 141.581 1.00 435.48 ? 381 ASP A O   1 
ATOM 2713  C CB  . ASP A 1 381 ? 140.935 182.745 140.369 1.00 500.00 ? 381 ASP A CB  1 
ATOM 2714  C CG  . ASP A 1 381 ? 142.317 182.251 139.926 1.00 489.34 ? 381 ASP A CG  1 
ATOM 2715  O OD1 . ASP A 1 381 ? 143.114 181.783 140.769 1.00 399.27 ? 381 ASP A OD1 1 
ATOM 2716  O OD2 . ASP A 1 381 ? 142.602 182.338 138.712 1.00 482.22 ? 381 ASP A OD2 1 
ATOM 2717  N N   . PRO A 1 382 ? 142.897 183.908 143.035 1.00 489.49 ? 382 PRO A N   1 
ATOM 2718  C CA  . PRO A 1 382 ? 143.982 184.822 143.365 1.00 500.00 ? 382 PRO A CA  1 
ATOM 2719  C C   . PRO A 1 382 ? 144.737 185.249 142.120 1.00 500.00 ? 382 PRO A C   1 
ATOM 2720  O O   . PRO A 1 382 ? 145.092 186.422 142.004 1.00 500.00 ? 382 PRO A O   1 
ATOM 2721  C CB  . PRO A 1 382 ? 144.887 183.980 144.269 1.00 466.94 ? 382 PRO A CB  1 
ATOM 2722  C CG  . PRO A 1 382 ? 143.947 183.063 144.954 1.00 452.25 ? 382 PRO A CG  1 
ATOM 2723  C CD  . PRO A 1 382 ? 142.905 182.732 143.932 1.00 457.70 ? 382 PRO A CD  1 
ATOM 2724  N N   . VAL A 1 383 ? 144.964 184.292 141.228 1.00 500.00 ? 383 VAL A N   1 
ATOM 2725  C CA  . VAL A 1 383 ? 145.697 184.523 139.991 1.00 500.00 ? 383 VAL A CA  1 
ATOM 2726  C C   . VAL A 1 383 ? 145.000 185.608 139.162 1.00 500.00 ? 383 VAL A C   1 
ATOM 2727  O O   . VAL A 1 383 ? 145.649 186.542 138.656 1.00 500.00 ? 383 VAL A O   1 
ATOM 2728  C CB  . VAL A 1 383 ? 145.886 183.202 139.220 1.00 500.00 ? 383 VAL A CB  1 
ATOM 2729  C CG1 . VAL A 1 383 ? 146.383 183.469 137.810 1.00 500.00 ? 383 VAL A CG1 1 
ATOM 2730  C CG2 . VAL A 1 383 ? 146.835 182.275 139.990 1.00 500.00 ? 383 VAL A CG2 1 
ATOM 2731  N N   . SER A 1 384 ? 143.687 185.452 139.056 1.00 474.54 ? 384 SER A N   1 
ATOM 2732  C CA  . SER A 1 384 ? 142.847 186.387 138.298 1.00 500.00 ? 384 SER A CA  1 
ATOM 2733  C C   . SER A 1 384 ? 142.977 187.794 138.874 1.00 500.00 ? 384 SER A C   1 
ATOM 2734  O O   . SER A 1 384 ? 143.146 188.775 138.129 1.00 458.62 ? 384 SER A O   1 
ATOM 2735  C CB  . SER A 1 384 ? 141.392 185.930 138.269 1.00 500.00 ? 384 SER A CB  1 
ATOM 2736  O OG  . SER A 1 384 ? 141.273 184.724 137.536 1.00 500.00 ? 384 SER A OG  1 
ATOM 2737  N N   . GLN A 1 385 ? 142.908 187.852 140.200 1.00 500.00 ? 385 GLN A N   1 
ATOM 2738  C CA  . GLN A 1 385 ? 143.015 189.112 140.945 1.00 500.00 ? 385 GLN A CA  1 
ATOM 2739  C C   . GLN A 1 385 ? 144.333 189.794 140.637 1.00 500.00 ? 385 GLN A C   1 
ATOM 2740  O O   . GLN A 1 385 ? 144.357 191.012 140.385 1.00 500.00 ? 385 GLN A O   1 
ATOM 2741  C CB  . GLN A 1 385 ? 142.879 188.897 142.466 1.00 500.00 ? 385 GLN A CB  1 
ATOM 2742  C CG  . GLN A 1 385 ? 141.664 188.107 142.965 1.00 500.00 ? 385 GLN A CG  1 
ATOM 2743  C CD  . GLN A 1 385 ? 140.418 188.249 142.099 1.00 500.00 ? 385 GLN A CD  1 
ATOM 2744  O OE1 . GLN A 1 385 ? 140.277 187.587 141.067 1.00 500.00 ? 385 GLN A OE1 1 
ATOM 2745  N NE2 . GLN A 1 385 ? 139.500 189.111 142.526 1.00 500.00 ? 385 GLN A NE2 1 
ATOM 2746  N N   . LYS A 1 386 ? 145.404 188.992 140.657 1.00 500.00 ? 386 LYS A N   1 
ATOM 2747  C CA  . LYS A 1 386 ? 146.745 189.488 140.308 1.00 500.00 ? 386 LYS A CA  1 
ATOM 2748  C C   . LYS A 1 386 ? 146.762 190.307 138.997 1.00 500.00 ? 386 LYS A C   1 
ATOM 2749  O O   . LYS A 1 386 ? 147.435 191.296 138.991 1.00 500.00 ? 386 LYS A O   1 
ATOM 2750  C CB  . LYS A 1 386 ? 147.801 188.380 140.298 1.00 500.00 ? 386 LYS A CB  1 
ATOM 2751  C CG  . LYS A 1 386 ? 148.235 187.968 141.696 1.00 500.00 ? 386 LYS A CG  1 
ATOM 2752  C CD  . LYS A 1 386 ? 149.275 186.857 141.662 1.00 500.00 ? 386 LYS A CD  1 
ATOM 2753  C CE  . LYS A 1 386 ? 150.652 187.359 141.235 1.00 500.00 ? 386 LYS A CE  1 
ATOM 2754  N NZ  . LYS A 1 386 ? 151.715 186.317 141.369 1.00 500.00 ? 386 LYS A NZ  1 
ATOM 2755  N N   . ASN A 1 387 ? 145.959 189.975 137.975 1.00 500.00 ? 387 ASN A N   1 
ATOM 2756  C CA  . ASN A 1 387 ? 145.702 190.945 136.883 1.00 500.00 ? 387 ASN A CA  1 
ATOM 2757  C C   . ASN A 1 387 ? 144.635 191.975 137.278 1.00 500.00 ? 387 ASN A C   1 
ATOM 2758  O O   . ASN A 1 387 ? 143.558 191.615 137.755 1.00 480.29 ? 387 ASN A O   1 
ATOM 2759  C CB  . ASN A 1 387 ? 145.315 190.290 135.549 1.00 500.00 ? 387 ASN A CB  1 
ATOM 2760  C CG  . ASN A 1 387 ? 145.599 191.204 134.352 1.00 500.00 ? 387 ASN A CG  1 
ATOM 2761  O OD1 . ASN A 1 387 ? 146.183 192.284 134.520 1.00 440.45 ? 387 ASN A OD1 1 
ATOM 2762  N ND2 . ASN A 1 387 ? 145.187 190.779 133.133 1.00 500.00 ? 387 ASN A ND2 1 
ATOM 2763  N N   . GLU A 1 388 ? 144.925 193.251 137.017 1.00 500.00 ? 388 GLU A N   1 
ATOM 2764  C CA  . GLU A 1 388 ? 144.268 194.359 137.720 1.00 500.00 ? 388 GLU A CA  1 
ATOM 2765  C C   . GLU A 1 388 ? 142.875 194.705 137.253 1.00 500.00 ? 388 GLU A C   1 
ATOM 2766  O O   . GLU A 1 388 ? 141.966 194.753 138.099 1.00 500.00 ? 388 GLU A O   1 
ATOM 2767  C CB  . GLU A 1 388 ? 145.173 195.606 137.746 1.00 500.00 ? 388 GLU A CB  1 
ATOM 2768  C CG  . GLU A 1 388 ? 146.366 195.494 138.703 1.00 500.00 ? 388 GLU A CG  1 
ATOM 2769  C CD  . GLU A 1 388 ? 145.968 195.309 140.170 1.00 500.00 ? 388 GLU A CD  1 
ATOM 2770  O OE1 . GLU A 1 388 ? 145.031 195.997 140.638 1.00 500.00 ? 388 GLU A OE1 1 
ATOM 2771  O OE2 . GLU A 1 388 ? 146.594 194.475 140.865 1.00 500.00 ? 388 GLU A OE2 1 
ATOM 2772  N N   . SER A 1 389 ? 142.698 194.868 135.943 1.00 500.00 ? 389 SER A N   1 
ATOM 2773  C CA  . SER A 1 389 ? 141.379 195.104 135.351 1.00 500.00 ? 389 SER A CA  1 
ATOM 2774  C C   . SER A 1 389 ? 140.430 193.957 135.700 1.00 500.00 ? 389 SER A C   1 
ATOM 2775  O O   . SER A 1 389 ? 139.280 194.182 136.102 1.00 468.52 ? 389 SER A O   1 
ATOM 2776  C CB  . SER A 1 389 ? 141.466 195.260 133.832 1.00 500.00 ? 389 SER A CB  1 
ATOM 2777  O OG  . SER A 1 389 ? 140.231 195.729 133.315 1.00 500.00 ? 389 SER A OG  1 
ATOM 2778  N N   . VAL A 1 390 ? 140.950 192.750 135.538 1.00 500.00 ? 390 VAL A N   1 
ATOM 2779  C CA  . VAL A 1 390 ? 140.215 191.515 135.821 1.00 500.00 ? 390 VAL A CA  1 
ATOM 2780  C C   . VAL A 1 390 ? 139.747 191.507 137.275 1.00 467.25 ? 390 VAL A C   1 
ATOM 2781  O O   . VAL A 1 390 ? 138.581 191.200 137.572 1.00 399.26 ? 390 VAL A O   1 
ATOM 2782  C CB  . VAL A 1 390 ? 141.115 190.301 135.512 1.00 500.00 ? 390 VAL A CB  1 
ATOM 2783  C CG1 . VAL A 1 390 ? 140.546 189.015 136.109 1.00 500.00 ? 390 VAL A CG1 1 
ATOM 2784  C CG2 . VAL A 1 390 ? 141.325 190.181 133.995 1.00 500.00 ? 390 VAL A CG2 1 
ATOM 2785  N N   . ARG A 1 391 ? 140.684 191.846 138.147 1.00 430.31 ? 391 ARG A N   1 
ATOM 2786  C CA  . ARG A 1 391 ? 140.444 191.909 139.596 1.00 449.10 ? 391 ARG A CA  1 
ATOM 2787  C C   . ARG A 1 391 ? 139.309 192.875 139.898 1.00 473.52 ? 391 ARG A C   1 
ATOM 2788  O O   . ARG A 1 391 ? 138.400 192.567 140.675 1.00 466.36 ? 391 ARG A O   1 
ATOM 2789  C CB  . ARG A 1 391 ? 141.677 192.437 140.321 1.00 500.00 ? 391 ARG A CB  1 
ATOM 2790  C CG  . ARG A 1 391 ? 141.604 192.403 141.845 1.00 500.00 ? 391 ARG A CG  1 
ATOM 2791  C CD  . ARG A 1 391 ? 142.887 192.941 142.485 1.00 500.00 ? 391 ARG A CD  1 
ATOM 2792  N NE  . ARG A 1 391 ? 142.866 194.400 142.680 1.00 500.00 ? 391 ARG A NE  1 
ATOM 2793  C CZ  . ARG A 1 391 ? 142.551 195.042 143.817 1.00 500.00 ? 391 ARG A CZ  1 
ATOM 2794  N NH1 . ARG A 1 391 ? 142.575 196.379 143.838 1.00 500.00 ? 391 ARG A NH1 1 
ATOM 2795  N NH2 . ARG A 1 391 ? 142.210 194.381 144.933 1.00 500.00 ? 391 ARG A NH2 1 
ATOM 2796  N N   . ASN A 1 392 ? 139.400 194.038 139.269 1.00 500.00 ? 392 ASN A N   1 
ATOM 2797  C CA  . ASN A 1 392 ? 138.410 195.110 139.427 1.00 500.00 ? 392 ASN A CA  1 
ATOM 2798  C C   . ASN A 1 392 ? 137.026 194.607 139.029 1.00 490.37 ? 392 ASN A C   1 
ATOM 2799  O O   . ASN A 1 392 ? 136.041 194.828 139.745 1.00 403.18 ? 392 ASN A O   1 
ATOM 2800  C CB  . ASN A 1 392 ? 138.851 196.394 138.719 1.00 500.00 ? 392 ASN A CB  1 
ATOM 2801  C CG  . ASN A 1 392 ? 140.094 197.022 139.363 1.00 500.00 ? 392 ASN A CG  1 
ATOM 2802  O OD1 . ASN A 1 392 ? 140.729 196.433 140.250 1.00 447.97 ? 392 ASN A OD1 1 
ATOM 2803  N ND2 . ASN A 1 392 ? 140.447 198.221 138.913 1.00 500.00 ? 392 ASN A ND2 1 
ATOM 2804  N N   . GLN A 1 393 ? 136.995 193.931 137.888 1.00 491.79 ? 393 GLN A N   1 
ATOM 2805  C CA  . GLN A 1 393 ? 135.766 193.358 137.332 1.00 488.79 ? 393 GLN A CA  1 
ATOM 2806  C C   . GLN A 1 393 ? 135.135 192.394 138.337 1.00 417.91 ? 393 GLN A C   1 
ATOM 2807  O O   . GLN A 1 393 ? 133.921 192.436 138.603 1.00 358.95 ? 393 GLN A O   1 
ATOM 2808  C CB  . GLN A 1 393 ? 136.008 192.542 136.046 1.00 500.00 ? 393 GLN A CB  1 
ATOM 2809  C CG  . GLN A 1 393 ? 136.240 193.307 134.750 1.00 500.00 ? 393 GLN A CG  1 
ATOM 2810  C CD  . GLN A 1 393 ? 136.059 192.418 133.514 1.00 500.00 ? 393 GLN A CD  1 
ATOM 2811  O OE1 . GLN A 1 393 ? 134.931 192.135 133.102 1.00 500.00 ? 393 GLN A OE1 1 
ATOM 2812  N NE2 . GLN A 1 393 ? 137.172 191.975 132.922 1.00 500.00 ? 393 GLN A NE2 1 
ATOM 2813  N N   . VAL A 1 394 ? 135.998 191.538 138.872 1.00 445.60 ? 394 VAL A N   1 
ATOM 2814  C CA  . VAL A 1 394 ? 135.604 190.523 139.854 1.00 478.86 ? 394 VAL A CA  1 
ATOM 2815  C C   . VAL A 1 394 ? 134.971 191.188 141.070 1.00 474.95 ? 394 VAL A C   1 
ATOM 2816  O O   . VAL A 1 394 ? 133.919 190.761 141.557 1.00 355.10 ? 394 VAL A O   1 
ATOM 2817  C CB  . VAL A 1 394 ? 136.791 189.610 140.260 1.00 499.50 ? 394 VAL A CB  1 
ATOM 2818  C CG1 . VAL A 1 394 ? 136.406 188.686 141.410 1.00 492.02 ? 394 VAL A CG1 1 
ATOM 2819  C CG2 . VAL A 1 394 ? 137.286 188.791 139.067 1.00 500.00 ? 394 VAL A CG2 1 
ATOM 2820  N N   . GLU A 1 395 ? 135.643 192.232 141.533 1.00 500.00 ? 395 GLU A N   1 
ATOM 2821  C CA  . GLU A 1 395 ? 135.205 193.019 142.695 1.00 500.00 ? 395 GLU A CA  1 
ATOM 2822  C C   . GLU A 1 395 ? 133.818 193.581 142.449 1.00 500.00 ? 395 GLU A C   1 
ATOM 2823  O O   . GLU A 1 395 ? 132.944 193.501 143.314 1.00 500.00 ? 395 GLU A O   1 
ATOM 2824  C CB  . GLU A 1 395 ? 136.186 194.162 143.029 1.00 500.00 ? 395 GLU A CB  1 
ATOM 2825  C CG  . GLU A 1 395 ? 137.459 193.725 143.751 1.00 500.00 ? 395 GLU A CG  1 
ATOM 2826  C CD  . GLU A 1 395 ? 137.235 193.373 145.213 1.00 500.00 ? 395 GLU A CD  1 
ATOM 2827  O OE1 . GLU A 1 395 ? 136.519 194.126 145.909 1.00 500.00 ? 395 GLU A OE1 1 
ATOM 2828  O OE2 . GLU A 1 395 ? 137.790 192.348 145.669 1.00 497.86 ? 395 GLU A OE2 1 
ATOM 2829  N N   . ASP A 1 396 ? 133.652 194.145 141.263 1.00 500.00 ? 396 ASP A N   1 
ATOM 2830  C CA  . ASP A 1 396 ? 132.386 194.747 140.824 1.00 500.00 ? 396 ASP A CA  1 
ATOM 2831  C C   . ASP A 1 396 ? 131.267 193.704 140.889 1.00 500.00 ? 396 ASP A C   1 
ATOM 2832  O O   . ASP A 1 396 ? 130.170 193.968 141.413 1.00 500.00 ? 396 ASP A O   1 
ATOM 2833  C CB  . ASP A 1 396 ? 132.534 195.273 139.390 1.00 500.00 ? 396 ASP A CB  1 
ATOM 2834  C CG  . ASP A 1 396 ? 131.346 196.112 138.942 1.00 500.00 ? 396 ASP A CG  1 
ATOM 2835  O OD1 . ASP A 1 396 ? 131.090 197.164 139.571 1.00 500.00 ? 396 ASP A OD1 1 
ATOM 2836  O OD2 . ASP A 1 396 ? 130.680 195.727 137.950 1.00 500.00 ? 396 ASP A OD2 1 
ATOM 2837  N N   . LEU A 1 397 ? 131.585 192.536 140.343 1.00 487.84 ? 397 LEU A N   1 
ATOM 2838  C CA  . LEU A 1 397 ? 130.660 191.407 140.291 1.00 467.91 ? 397 LEU A CA  1 
ATOM 2839  C C   . LEU A 1 397 ? 130.209 191.028 141.714 1.00 457.11 ? 397 LEU A C   1 
ATOM 2840  O O   . LEU A 1 397 ? 129.009 190.833 141.983 1.00 434.24 ? 397 LEU A O   1 
ATOM 2841  C CB  . LEU A 1 397 ? 131.340 190.238 139.555 1.00 461.28 ? 397 LEU A CB  1 
ATOM 2842  C CG  . LEU A 1 397 ? 130.887 188.787 139.701 1.00 480.35 ? 397 LEU A CG  1 
ATOM 2843  C CD1 . LEU A 1 397 ? 129.413 188.609 139.381 1.00 500.00 ? 397 LEU A CD1 1 
ATOM 2844  C CD2 . LEU A 1 397 ? 131.742 187.917 138.789 1.00 468.35 ? 397 LEU A CD2 1 
ATOM 2845  N N   . LEU A 1 398 ? 131.203 190.945 142.585 1.00 434.67 ? 398 LEU A N   1 
ATOM 2846  C CA  . LEU A 1 398 ? 130.991 190.598 143.989 1.00 426.25 ? 398 LEU A CA  1 
ATOM 2847  C C   . LEU A 1 398 ? 130.053 191.593 144.648 1.00 483.06 ? 398 LEU A C   1 
ATOM 2848  O O   . LEU A 1 398 ? 129.123 191.211 145.361 1.00 499.73 ? 398 LEU A O   1 
ATOM 2849  C CB  . LEU A 1 398 ? 132.303 190.449 144.736 1.00 440.76 ? 398 LEU A CB  1 
ATOM 2850  C CG  . LEU A 1 398 ? 133.110 189.252 144.222 1.00 495.10 ? 398 LEU A CG  1 
ATOM 2851  C CD1 . LEU A 1 398 ? 134.587 189.456 144.523 1.00 500.00 ? 398 LEU A CD1 1 
ATOM 2852  C CD2 . LEU A 1 398 ? 132.611 187.929 144.786 1.00 474.33 ? 398 LEU A CD2 1 
ATOM 2853  N N   . ALA A 1 399 ? 130.320 192.861 144.385 1.00 500.00 ? 399 ALA A N   1 
ATOM 2854  C CA  . ALA A 1 399 ? 129.525 193.983 144.914 1.00 500.00 ? 399 ALA A CA  1 
ATOM 2855  C C   . ALA A 1 399 ? 128.076 193.835 144.484 1.00 500.00 ? 399 ALA A C   1 
ATOM 2856  O O   . ALA A 1 399 ? 127.156 193.980 145.302 1.00 481.37 ? 399 ALA A O   1 
ATOM 2857  C CB  . ALA A 1 399 ? 130.081 195.326 144.448 1.00 500.00 ? 399 ALA A CB  1 
ATOM 2858  N N   . THR A 1 400 ? 127.910 193.547 143.198 1.00 475.65 ? 400 THR A N   1 
ATOM 2859  C CA  . THR A 1 400 ? 126.587 193.368 142.588 1.00 474.77 ? 400 THR A CA  1 
ATOM 2860  C C   . THR A 1 400 ? 125.829 192.248 143.309 1.00 433.50 ? 400 THR A C   1 
ATOM 2861  O O   . THR A 1 400 ? 124.645 192.398 143.660 1.00 415.76 ? 400 THR A O   1 
ATOM 2862  C CB  . THR A 1 400 ? 126.626 193.047 141.074 1.00 500.00 ? 400 THR A CB  1 
ATOM 2863  O OG1 . THR A 1 400 ? 127.284 191.797 140.847 1.00 485.73 ? 400 THR A OG1 1 
ATOM 2864  C CG2 . THR A 1 400 ? 127.307 194.159 140.262 1.00 500.00 ? 400 THR A CG2 1 
ATOM 2865  N N   . LEU A 1 401 ? 126.548 191.150 143.506 1.00 411.08 ? 401 LEU A N   1 
ATOM 2866  C CA  . LEU A 1 401 ? 126.011 189.962 144.177 1.00 443.64 ? 401 LEU A CA  1 
ATOM 2867  C C   . LEU A 1 401 ? 125.518 190.322 145.575 1.00 467.74 ? 401 LEU A C   1 
ATOM 2868  O O   . LEU A 1 401 ? 124.417 189.936 145.984 1.00 475.60 ? 401 LEU A O   1 
ATOM 2869  C CB  . LEU A 1 401 ? 127.062 188.862 144.290 1.00 449.68 ? 401 LEU A CB  1 
ATOM 2870  C CG  . LEU A 1 401 ? 126.988 187.782 143.219 1.00 485.02 ? 401 LEU A CG  1 
ATOM 2871  C CD1 . LEU A 1 401 ? 128.349 187.141 143.003 1.00 500.00 ? 401 LEU A CD1 1 
ATOM 2872  C CD2 . LEU A 1 401 ? 125.943 186.748 143.614 1.00 461.23 ? 401 LEU A CD2 1 
ATOM 2873  N N   . GLU A 1 402 ? 126.367 191.060 146.275 1.00 492.49 ? 402 GLU A N   1 
ATOM 2874  C CA  . GLU A 1 402 ? 126.093 191.521 147.643 1.00 486.58 ? 402 GLU A CA  1 
ATOM 2875  C C   . GLU A 1 402 ? 124.809 192.334 147.672 1.00 480.84 ? 402 GLU A C   1 
ATOM 2876  O O   . GLU A 1 402 ? 123.943 192.130 148.535 1.00 464.39 ? 402 GLU A O   1 
ATOM 2877  C CB  . GLU A 1 402 ? 127.233 192.391 148.198 1.00 478.17 ? 402 GLU A CB  1 
ATOM 2878  C CG  . GLU A 1 402 ? 128.446 191.629 148.701 1.00 495.20 ? 402 GLU A CG  1 
ATOM 2879  C CD  . GLU A 1 402 ? 129.556 192.553 149.178 1.00 488.02 ? 402 GLU A CD  1 
ATOM 2880  O OE1 . GLU A 1 402 ? 130.332 193.052 148.333 1.00 459.71 ? 402 GLU A OE1 1 
ATOM 2881  O OE2 . GLU A 1 402 ? 129.663 192.772 150.405 1.00 496.38 ? 402 GLU A OE2 1 
ATOM 2882  N N   . LYS A 1 403 ? 124.721 193.249 146.717 1.00 495.80 ? 403 LYS A N   1 
ATOM 2883  C CA  . LYS A 1 403 ? 123.568 194.144 146.569 1.00 500.00 ? 403 LYS A CA  1 
ATOM 2884  C C   . LYS A 1 403 ? 122.292 193.321 146.392 1.00 500.00 ? 403 LYS A C   1 
ATOM 2885  O O   . LYS A 1 403 ? 121.264 193.584 147.047 1.00 500.00 ? 403 LYS A O   1 
ATOM 2886  C CB  . LYS A 1 403 ? 123.787 195.086 145.387 1.00 500.00 ? 403 LYS A CB  1 
ATOM 2887  C CG  . LYS A 1 403 ? 122.873 196.287 145.407 1.00 500.00 ? 403 LYS A CG  1 
ATOM 2888  C CD  . LYS A 1 403 ? 123.155 197.198 144.227 1.00 500.00 ? 403 LYS A CD  1 
ATOM 2889  C CE  . LYS A 1 403 ? 122.019 198.190 144.009 1.00 500.00 ? 403 LYS A CE  1 
ATOM 2890  N NZ  . LYS A 1 403 ? 122.080 198.834 142.662 1.00 500.00 ? 403 LYS A NZ  1 
ATOM 2891  N N   . SER A 1 404 ? 122.397 192.336 145.508 1.00 500.00 ? 404 SER A N   1 
ATOM 2892  C CA  . SER A 1 404 ? 121.286 191.438 145.191 1.00 491.40 ? 404 SER A CA  1 
ATOM 2893  C C   . SER A 1 404 ? 120.809 190.722 146.453 1.00 494.84 ? 404 SER A C   1 
ATOM 2894  O O   . SER A 1 404 ? 119.603 190.642 146.729 1.00 404.35 ? 404 SER A O   1 
ATOM 2895  C CB  . SER A 1 404 ? 121.651 190.452 144.076 1.00 495.18 ? 404 SER A CB  1 
ATOM 2896  O OG  . SER A 1 404 ? 122.626 189.513 144.483 1.00 482.31 ? 404 SER A OG  1 
ATOM 2897  N N   . GLY A 1 405 ? 121.785 190.223 147.198 1.00 500.00 ? 405 GLY A N   1 
ATOM 2898  C CA  . GLY A 1 405 ? 121.549 189.499 148.450 1.00 500.00 ? 405 GLY A CA  1 
ATOM 2899  C C   . GLY A 1 405 ? 120.942 190.327 149.561 1.00 500.00 ? 405 GLY A C   1 
ATOM 2900  O O   . GLY A 1 405 ? 120.224 189.817 150.422 1.00 492.76 ? 405 GLY A O   1 
ATOM 2901  N N   . ALA A 1 406 ? 121.261 191.619 149.535 1.00 500.00 ? 406 ALA A N   1 
ATOM 2902  C CA  . ALA A 1 406 ? 120.673 192.621 150.430 1.00 500.00 ? 406 ALA A CA  1 
ATOM 2903  C C   . ALA A 1 406 ? 119.140 192.567 150.389 1.00 500.00 ? 406 ALA A C   1 
ATOM 2904  O O   . ALA A 1 406 ? 118.492 192.558 151.437 1.00 500.00 ? 406 ALA A O   1 
ATOM 2905  C CB  . ALA A 1 406 ? 121.187 194.033 150.139 1.00 500.00 ? 406 ALA A CB  1 
ATOM 2906  N N   . GLY A 1 407 ? 118.603 192.456 149.170 1.00 500.00 ? 407 GLY A N   1 
ATOM 2907  C CA  . GLY A 1 407 ? 117.180 192.236 148.930 1.00 500.00 ? 407 GLY A CA  1 
ATOM 2908  C C   . GLY A 1 407 ? 116.511 191.224 149.848 1.00 500.00 ? 407 GLY A C   1 
ATOM 2909  O O   . GLY A 1 407 ? 115.445 191.516 150.397 1.00 500.00 ? 407 GLY A O   1 
ATOM 2910  N N   . VAL A 1 408 ? 117.136 190.055 150.037 1.00 500.00 ? 408 VAL A N   1 
ATOM 2911  C CA  . VAL A 1 408 ? 116.579 189.010 150.925 1.00 500.00 ? 408 VAL A CA  1 
ATOM 2912  C C   . VAL A 1 408 ? 117.514 188.683 152.110 1.00 500.00 ? 408 VAL A C   1 
ATOM 2913  O O   . VAL A 1 408 ? 118.643 188.225 151.910 1.00 500.00 ? 408 VAL A O   1 
ATOM 2914  C CB  . VAL A 1 408 ? 116.153 187.734 150.150 1.00 500.00 ? 408 VAL A CB  1 
ATOM 2915  C CG1 . VAL A 1 408 ? 117.343 186.996 149.550 1.00 500.00 ? 408 VAL A CG1 1 
ATOM 2916  C CG2 . VAL A 1 408 ? 115.319 186.806 151.034 1.00 497.55 ? 408 VAL A CG2 1 
ATOM 2917  N N   . PRO A 1 409 ? 117.041 188.922 153.357 1.00 500.00 ? 409 PRO A N   1 
ATOM 2918  C CA  . PRO A 1 409 ? 117.884 188.721 154.546 1.00 500.00 ? 409 PRO A CA  1 
ATOM 2919  C C   . PRO A 1 409 ? 118.079 187.258 154.976 1.00 500.00 ? 409 PRO A C   1 
ATOM 2920  O O   . PRO A 1 409 ? 118.937 186.986 155.823 1.00 500.00 ? 409 PRO A O   1 
ATOM 2921  C CB  . PRO A 1 409 ? 117.131 189.496 155.630 1.00 500.00 ? 409 PRO A CB  1 
ATOM 2922  C CG  . PRO A 1 409 ? 115.699 189.372 155.234 1.00 500.00 ? 409 PRO A CG  1 
ATOM 2923  C CD  . PRO A 1 409 ? 115.679 189.364 153.732 1.00 500.00 ? 409 PRO A CD  1 
ATOM 2924  N N   . ALA A 1 410 ? 117.297 186.340 154.406 1.00 500.00 ? 410 ALA A N   1 
ATOM 2925  C CA  . ALA A 1 410 ? 117.474 184.900 154.629 1.00 500.00 ? 410 ALA A CA  1 
ATOM 2926  C C   . ALA A 1 410 ? 118.767 184.299 154.031 1.00 500.00 ? 410 ALA A C   1 
ATOM 2927  O O   . ALA A 1 410 ? 119.040 183.110 154.236 1.00 500.00 ? 410 ALA A O   1 
ATOM 2928  C CB  . ALA A 1 410 ? 116.256 184.141 154.111 1.00 500.00 ? 410 ALA A CB  1 
ATOM 2929  N N   . VAL A 1 411 ? 119.530 185.093 153.273 1.00 500.00 ? 411 VAL A N   1 
ATOM 2930  C CA  . VAL A 1 411 ? 120.849 184.696 152.784 1.00 499.33 ? 411 VAL A CA  1 
ATOM 2931  C C   . VAL A 1 411 ? 121.855 185.831 152.961 1.00 475.78 ? 411 VAL A C   1 
ATOM 2932  O O   . VAL A 1 411 ? 121.807 186.831 152.232 1.00 437.85 ? 411 VAL A O   1 
ATOM 2933  C CB  . VAL A 1 411 ? 120.803 184.328 151.287 1.00 500.00 ? 411 VAL A CB  1 
ATOM 2934  C CG1 . VAL A 1 411 ? 122.111 183.658 150.872 1.00 500.00 ? 411 VAL A CG1 1 
ATOM 2935  C CG2 . VAL A 1 411 ? 119.601 183.437 150.981 1.00 500.00 ? 411 VAL A CG2 1 
ATOM 2936  N N   . ILE A 1 412 ? 122.757 185.680 153.929 1.00 478.04 ? 412 ILE A N   1 
ATOM 2937  C CA  . ILE A 1 412 ? 123.885 186.610 154.055 1.00 491.05 ? 412 ILE A CA  1 
ATOM 2938  C C   . ILE A 1 412 ? 124.998 186.184 153.094 1.00 436.28 ? 412 ILE A C   1 
ATOM 2939  O O   . ILE A 1 412 ? 125.436 185.026 153.093 1.00 446.47 ? 412 ILE A O   1 
ATOM 2940  C CB  . ILE A 1 412 ? 124.394 186.798 155.512 1.00 500.00 ? 412 ILE A CB  1 
ATOM 2941  C CG1 . ILE A 1 412 ? 125.405 187.950 155.580 1.00 500.00 ? 412 ILE A CG1 1 
ATOM 2942  C CG2 . ILE A 1 412 ? 125.034 185.547 156.085 1.00 500.00 ? 412 ILE A CG2 1 
ATOM 2943  C CD1 . ILE A 1 412 ? 125.776 188.374 156.988 1.00 500.00 ? 412 ILE A CD1 1 
ATOM 2944  N N   . LEU A 1 413 ? 125.428 187.139 152.271 1.00 427.62 ? 413 LEU A N   1 
ATOM 2945  C CA  . LEU A 1 413 ? 126.385 186.894 151.203 1.00 472.39 ? 413 LEU A CA  1 
ATOM 2946  C C   . LEU A 1 413 ? 127.743 187.463 151.614 1.00 432.85 ? 413 LEU A C   1 
ATOM 2947  O O   . LEU A 1 413 ? 127.846 188.616 152.027 1.00 428.52 ? 413 LEU A O   1 
ATOM 2948  C CB  . LEU A 1 413 ? 125.880 187.514 149.895 1.00 500.00 ? 413 LEU A CB  1 
ATOM 2949  C CG  . LEU A 1 413 ? 125.972 186.593 148.667 1.00 500.00 ? 413 LEU A CG  1 
ATOM 2950  C CD1 . LEU A 1 413 ? 125.293 187.208 147.450 1.00 500.00 ? 413 LEU A CD1 1 
ATOM 2951  C CD2 . LEU A 1 413 ? 127.414 186.235 148.350 1.00 500.00 ? 413 LEU A CD2 1 
ATOM 2952  N N   . ARG A 1 414 ? 128.780 186.648 151.470 1.00 457.24 ? 414 ARG A N   1 
ATOM 2953  C CA  . ARG A 1 414 ? 130.027 186.845 152.190 1.00 434.51 ? 414 ARG A CA  1 
ATOM 2954  C C   . ARG A 1 414 ? 131.247 186.449 151.369 1.00 432.83 ? 414 ARG A C   1 
ATOM 2955  O O   . ARG A 1 414 ? 131.211 185.492 150.566 1.00 494.47 ? 414 ARG A O   1 
ATOM 2956  C CB  . ARG A 1 414 ? 129.972 186.002 153.465 1.00 460.48 ? 414 ARG A CB  1 
ATOM 2957  C CG  . ARG A 1 414 ? 130.880 186.471 154.580 1.00 471.00 ? 414 ARG A CG  1 
ATOM 2958  C CD  . ARG A 1 414 ? 130.470 185.847 155.905 1.00 467.25 ? 414 ARG A CD  1 
ATOM 2959  N NE  . ARG A 1 414 ? 131.243 186.389 157.018 1.00 499.27 ? 414 ARG A NE  1 
ATOM 2960  C CZ  . ARG A 1 414 ? 131.073 187.596 157.563 1.00 500.00 ? 414 ARG A CZ  1 
ATOM 2961  N NH1 . ARG A 1 414 ? 130.146 188.445 157.112 1.00 500.00 ? 414 ARG A NH1 1 
ATOM 2962  N NH2 . ARG A 1 414 ? 131.852 187.967 158.577 1.00 500.00 ? 414 ARG A NH2 1 
ATOM 2963  N N   . ARG A 1 415 ? 132.332 187.183 151.598 1.00 436.75 ? 415 ARG A N   1 
ATOM 2964  C CA  . ARG A 1 415 ? 133.643 186.869 151.027 1.00 467.29 ? 415 ARG A CA  1 
ATOM 2965  C C   . ARG A 1 415 ? 134.228 185.664 151.766 1.00 429.27 ? 415 ARG A C   1 
ATOM 2966  O O   . ARG A 1 415 ? 133.696 185.261 152.789 1.00 371.05 ? 415 ARG A O   1 
ATOM 2967  C CB  . ARG A 1 415 ? 134.611 188.059 151.193 1.00 476.17 ? 415 ARG A CB  1 
ATOM 2968  C CG  . ARG A 1 415 ? 134.187 189.374 150.557 1.00 438.62 ? 415 ARG A CG  1 
ATOM 2969  C CD  . ARG A 1 415 ? 134.310 189.333 149.049 1.00 459.25 ? 415 ARG A CD  1 
ATOM 2970  N NE  . ARG A 1 415 ? 133.794 190.561 148.443 1.00 500.00 ? 415 ARG A NE  1 
ATOM 2971  C CZ  . ARG A 1 415 ? 134.443 191.724 148.377 1.00 500.00 ? 415 ARG A CZ  1 
ATOM 2972  N NH1 . ARG A 1 415 ? 135.676 191.862 148.879 1.00 500.00 ? 415 ARG A NH1 1 
ATOM 2973  N NH2 . ARG A 1 415 ? 133.853 192.771 147.796 1.00 500.00 ? 415 ARG A NH2 1 
ATOM 2974  N N   . PRO A 1 416 ? 135.330 185.095 151.250 1.00 473.41 ? 416 PRO A N   1 
ATOM 2975  C CA  . PRO A 1 416 ? 136.159 184.202 152.044 1.00 499.45 ? 416 PRO A CA  1 
ATOM 2976  C C   . PRO A 1 416 ? 137.268 184.985 152.737 1.00 500.00 ? 416 PRO A C   1 
ATOM 2977  O O   . PRO A 1 416 ? 137.801 185.936 152.151 1.00 491.09 ? 416 PRO A O   1 
ATOM 2978  C CB  . PRO A 1 416 ? 136.746 183.267 150.994 1.00 500.00 ? 416 PRO A CB  1 
ATOM 2979  C CG  . PRO A 1 416 ? 136.870 184.113 149.772 1.00 500.00 ? 416 PRO A CG  1 
ATOM 2980  C CD  . PRO A 1 416 ? 135.779 185.147 149.845 1.00 500.00 ? 416 PRO A CD  1 
ATOM 2981  N N   . ASN A 1 417 ? 137.613 184.597 153.967 1.00 500.00 ? 417 ASN A N   1 
ATOM 2982  C CA  . ASN A 1 417 ? 138.746 185.213 154.674 1.00 500.00 ? 417 ASN A CA  1 
ATOM 2983  C C   . ASN A 1 417 ? 140.053 184.934 153.938 1.00 500.00 ? 417 ASN A C   1 
ATOM 2984  O O   . ASN A 1 417 ? 140.324 183.789 153.566 1.00 500.00 ? 417 ASN A O   1 
ATOM 2985  C CB  . ASN A 1 417 ? 138.865 184.728 156.134 1.00 500.00 ? 417 ASN A CB  1 
ATOM 2986  C CG  . ASN A 1 417 ? 137.962 185.498 157.092 1.00 500.00 ? 417 ASN A CG  1 
ATOM 2987  O OD1 . ASN A 1 417 ? 137.777 186.712 156.967 1.00 500.00 ? 417 ASN A OD1 1 
ATOM 2988  N ND2 . ASN A 1 417 ? 137.413 184.790 158.075 1.00 500.00 ? 417 ASN A ND2 1 
ATOM 2989  N N   . GLN A 1 418 ? 140.834 185.999 153.731 1.00 500.00 ? 418 GLN A N   1 
ATOM 2990  C CA  . GLN A 1 418 ? 142.162 185.943 153.101 1.00 500.00 ? 418 GLN A CA  1 
ATOM 2991  C C   . GLN A 1 418 ? 142.108 185.659 151.585 1.00 500.00 ? 418 GLN A C   1 
ATOM 2992  O O   . GLN A 1 418 ? 141.042 185.743 150.958 1.00 436.22 ? 418 GLN A O   1 
ATOM 2993  C CB  . GLN A 1 418 ? 143.075 184.921 153.818 1.00 500.00 ? 418 GLN A CB  1 
ATOM 2994  C CG  . GLN A 1 418 ? 143.056 184.962 155.343 1.00 500.00 ? 418 GLN A CG  1 
ATOM 2995  C CD  . GLN A 1 418 ? 144.058 183.998 155.958 1.00 500.00 ? 418 GLN A CD  1 
ATOM 2996  O OE1 . GLN A 1 418 ? 144.284 182.895 155.444 1.00 500.00 ? 418 GLN A OE1 1 
ATOM 2997  N NE2 . GLN A 1 418 ? 144.667 184.410 157.069 1.00 500.00 ? 418 GLN A NE2 1 
ATOM 2998  N N   . SER A 1 419 ? 143.284 185.380 151.016 1.00 500.00 ? 419 SER A N   1 
ATOM 2999  C CA  . SER A 1 419 ? 143.435 184.808 149.678 1.00 500.00 ? 419 SER A CA  1 
ATOM 3000  C C   . SER A 1 419 ? 143.317 183.269 149.716 1.00 500.00 ? 419 SER A C   1 
ATOM 3001  O O   . SER A 1 419 ? 144.318 182.565 149.928 1.00 500.00 ? 419 SER A O   1 
ATOM 3002  C CB  . SER A 1 419 ? 144.792 185.226 149.083 1.00 500.00 ? 419 SER A CB  1 
ATOM 3003  O OG  . SER A 1 419 ? 145.006 184.650 147.804 1.00 500.00 ? 419 SER A OG  1 
ATOM 3004  N N   . GLN A 1 420 ? 142.093 182.764 149.504 1.00 500.00 ? 420 GLN A N   1 
ATOM 3005  C CA  . GLN A 1 420 ? 141.819 181.317 149.510 1.00 500.00 ? 420 GLN A CA  1 
ATOM 3006  C C   . GLN A 1 420 ? 141.956 180.700 148.117 1.00 481.49 ? 420 GLN A C   1 
ATOM 3007  O O   . GLN A 1 420 ? 141.926 181.427 147.121 1.00 460.77 ? 420 GLN A O   1 
ATOM 3008  C CB  . GLN A 1 420 ? 140.438 181.003 150.118 1.00 500.00 ? 420 GLN A CB  1 
ATOM 3009  C CG  . GLN A 1 420 ? 140.494 180.757 151.621 1.00 500.00 ? 420 GLN A CG  1 
ATOM 3010  C CD  . GLN A 1 420 ? 139.298 179.997 152.169 1.00 500.00 ? 420 GLN A CD  1 
ATOM 3011  O OE1 . GLN A 1 420 ? 138.817 179.035 151.564 1.00 482.98 ? 420 GLN A OE1 1 
ATOM 3012  N NE2 . GLN A 1 420 ? 138.832 180.410 153.345 1.00 500.00 ? 420 GLN A NE2 1 
ATOM 3013  N N   . PRO A 1 421 ? 142.108 179.357 148.044 1.00 467.77 ? 421 PRO A N   1 
ATOM 3014  C CA  . PRO A 1 421 ? 142.411 178.691 146.765 1.00 498.24 ? 421 PRO A CA  1 
ATOM 3015  C C   . PRO A 1 421 ? 141.356 178.756 145.642 1.00 473.65 ? 421 PRO A C   1 
ATOM 3016  O O   . PRO A 1 421 ? 141.748 178.807 144.487 1.00 420.99 ? 421 PRO A O   1 
ATOM 3017  C CB  . PRO A 1 421 ? 142.652 177.229 147.170 1.00 500.00 ? 421 PRO A CB  1 
ATOM 3018  C CG  . PRO A 1 421 ? 142.963 177.270 148.622 1.00 500.00 ? 421 PRO A CG  1 
ATOM 3019  C CD  . PRO A 1 421 ? 142.148 178.398 149.166 1.00 465.06 ? 421 PRO A CD  1 
ATOM 3020  N N   . LEU A 1 422 ? 140.062 178.753 145.979 1.00 463.21 ? 422 LEU A N   1 
ATOM 3021  C CA  . LEU A 1 422 ? 138.943 178.573 145.024 1.00 433.75 ? 422 LEU A CA  1 
ATOM 3022  C C   . LEU A 1 422 ? 138.661 177.080 144.906 1.00 435.35 ? 422 LEU A C   1 
ATOM 3023  O O   . LEU A 1 422 ? 139.590 176.297 144.679 1.00 445.36 ? 422 LEU A O   1 
ATOM 3024  C CB  . LEU A 1 422 ? 139.202 179.168 143.624 1.00 443.03 ? 422 LEU A CB  1 
ATOM 3025  C CG  . LEU A 1 422 ? 138.030 179.281 142.628 1.00 441.41 ? 422 LEU A CG  1 
ATOM 3026  C CD1 . LEU A 1 422 ? 138.314 180.296 141.521 1.00 440.46 ? 422 LEU A CD1 1 
ATOM 3027  C CD2 . LEU A 1 422 ? 137.658 177.939 142.001 1.00 428.15 ? 422 LEU A CD2 1 
ATOM 3028  N N   . PRO A 1 423 ? 137.384 176.678 145.045 1.00 429.13 ? 423 PRO A N   1 
ATOM 3029  C CA  . PRO A 1 423 ? 137.023 175.253 145.117 1.00 439.98 ? 423 PRO A CA  1 
ATOM 3030  C C   . PRO A 1 423 ? 137.178 174.440 143.847 1.00 453.32 ? 423 PRO A C   1 
ATOM 3031  O O   . PRO A 1 423 ? 137.393 174.996 142.772 1.00 488.13 ? 423 PRO A O   1 
ATOM 3032  C CB  . PRO A 1 423 ? 135.544 175.285 145.525 1.00 441.38 ? 423 PRO A CB  1 
ATOM 3033  C CG  . PRO A 1 423 ? 135.062 176.612 145.074 1.00 445.78 ? 423 PRO A CG  1 
ATOM 3034  C CD  . PRO A 1 423 ? 136.213 177.546 145.258 1.00 406.34 ? 423 PRO A CD  1 
ATOM 3035  N N   . PRO A 1 424 ? 137.084 173.111 143.983 1.00 429.85 ? 424 PRO A N   1 
ATOM 3036  C CA  . PRO A 1 424 ? 136.853 172.288 142.819 1.00 440.95 ? 424 PRO A CA  1 
ATOM 3037  C C   . PRO A 1 424 ? 135.467 172.622 142.276 1.00 453.18 ? 424 PRO A C   1 
ATOM 3038  O O   . PRO A 1 424 ? 134.463 172.485 142.985 1.00 423.42 ? 424 PRO A O   1 
ATOM 3039  C CB  . PRO A 1 424 ? 136.919 170.867 143.374 1.00 500.00 ? 424 PRO A CB  1 
ATOM 3040  C CG  . PRO A 1 424 ? 136.562 171.009 144.807 1.00 500.00 ? 424 PRO A CG  1 
ATOM 3041  C CD  . PRO A 1 424 ? 137.150 172.314 145.218 1.00 481.72 ? 424 PRO A CD  1 
ATOM 3042  N N   . SER A 1 425 ? 135.433 173.088 141.030 1.00 461.78 ? 425 SER A N   1 
ATOM 3043  C CA  . SER A 1 425 ? 134.241 173.698 140.463 1.00 424.26 ? 425 SER A CA  1 
ATOM 3044  C C   . SER A 1 425 ? 134.395 173.990 138.986 1.00 392.52 ? 425 SER A C   1 
ATOM 3045  O O   . SER A 1 425 ? 135.419 174.542 138.553 1.00 314.07 ? 425 SER A O   1 
ATOM 3046  C CB  . SER A 1 425 ? 133.952 175.018 141.169 1.00 481.39 ? 425 SER A CB  1 
ATOM 3047  O OG  . SER A 1 425 ? 133.651 176.037 140.229 1.00 500.00 ? 425 SER A OG  1 
ATOM 3048  N N   . SER A 1 426 ? 133.332 173.678 138.245 1.00 424.96 ? 426 SER A N   1 
ATOM 3049  C CA  . SER A 1 426 ? 133.238 173.913 136.796 1.00 466.70 ? 426 SER A CA  1 
ATOM 3050  C C   . SER A 1 426 ? 134.038 175.120 136.302 1.00 451.16 ? 426 SER A C   1 
ATOM 3051  O O   . SER A 1 426 ? 134.748 175.032 135.301 1.00 440.65 ? 426 SER A O   1 
ATOM 3052  C CB  . SER A 1 426 ? 131.771 174.091 136.383 1.00 447.53 ? 426 SER A CB  1 
ATOM 3053  O OG  . SER A 1 426 ? 131.598 173.776 135.018 1.00 393.30 ? 426 SER A OG  1 
ATOM 3054  N N   . LEU A 1 427 ? 133.898 176.237 137.010 1.00 414.01 ? 427 LEU A N   1 
ATOM 3055  C CA  . LEU A 1 427 ? 134.645 177.446 136.731 1.00 406.67 ? 427 LEU A CA  1 
ATOM 3056  C C   . LEU A 1 427 ? 136.077 177.130 136.413 1.00 406.59 ? 427 LEU A C   1 
ATOM 3057  O O   . LEU A 1 427 ? 136.559 177.458 135.336 1.00 404.43 ? 427 LEU A O   1 
ATOM 3058  C CB  . LEU A 1 427 ? 134.591 178.383 137.944 1.00 500.00 ? 427 LEU A CB  1 
ATOM 3059  C CG  . LEU A 1 427 ? 135.458 179.655 137.953 1.00 500.00 ? 427 LEU A CG  1 
ATOM 3060  C CD1 . LEU A 1 427 ? 135.202 180.537 136.737 1.00 500.00 ? 427 LEU A CD1 1 
ATOM 3061  C CD2 . LEU A 1 427 ? 135.234 180.442 139.244 1.00 500.00 ? 427 LEU A CD2 1 
ATOM 3062  N N   . GLN A 1 428 ? 136.740 176.446 137.340 1.00 417.50 ? 428 GLN A N   1 
ATOM 3063  C CA  . GLN A 1 428 ? 138.200 176.344 137.318 1.00 437.67 ? 428 GLN A CA  1 
ATOM 3064  C C   . GLN A 1 428 ? 138.754 175.481 136.204 1.00 422.10 ? 428 GLN A C   1 
ATOM 3065  O O   . GLN A 1 428 ? 139.967 175.314 136.089 1.00 403.79 ? 428 GLN A O   1 
ATOM 3066  C CB  . GLN A 1 428 ? 138.736 175.895 138.672 1.00 451.60 ? 428 GLN A CB  1 
ATOM 3067  C CG  . GLN A 1 428 ? 138.822 174.397 138.913 1.00 460.08 ? 428 GLN A CG  1 
ATOM 3068  C CD  . GLN A 1 428 ? 140.017 174.057 139.778 1.00 500.00 ? 428 GLN A CD  1 
ATOM 3069  O OE1 . GLN A 1 428 ? 141.140 174.491 139.502 1.00 500.00 ? 428 GLN A OE1 1 
ATOM 3070  N NE2 . GLN A 1 428 ? 139.786 173.292 140.840 1.00 500.00 ? 428 GLN A NE2 1 
ATOM 3071  N N   . ARG A 1 429 ? 137.851 174.889 135.434 1.00 425.75 ? 429 ARG A N   1 
ATOM 3072  C CA  . ARG A 1 429 ? 138.156 174.395 134.109 1.00 427.46 ? 429 ARG A CA  1 
ATOM 3073  C C   . ARG A 1 429 ? 138.354 175.549 133.115 1.00 402.52 ? 429 ARG A C   1 
ATOM 3074  O O   . ARG A 1 429 ? 139.385 175.626 132.452 1.00 421.19 ? 429 ARG A O   1 
ATOM 3075  C CB  . ARG A 1 429 ? 137.022 173.479 133.666 1.00 409.42 ? 429 ARG A CB  1 
ATOM 3076  C CG  . ARG A 1 429 ? 137.124 172.890 132.277 1.00 433.77 ? 429 ARG A CG  1 
ATOM 3077  C CD  . ARG A 1 429 ? 138.501 172.419 131.844 1.00 383.34 ? 429 ARG A CD  1 
ATOM 3078  N NE  . ARG A 1 429 ? 139.075 171.492 132.798 1.00 375.21 ? 429 ARG A NE  1 
ATOM 3079  C CZ  . ARG A 1 429 ? 140.131 170.733 132.555 1.00 384.83 ? 429 ARG A CZ  1 
ATOM 3080  N NH1 . ARG A 1 429 ? 140.744 170.746 131.369 1.00 400.35 ? 429 ARG A NH1 1 
ATOM 3081  N NH2 . ARG A 1 429 ? 140.572 169.945 133.519 1.00 408.19 ? 429 ARG A NH2 1 
ATOM 3082  N N   . PHE A 1 430 ? 137.377 176.450 133.038 1.00 397.79 ? 430 PHE A N   1 
ATOM 3083  C CA  . PHE A 1 430 ? 137.401 177.589 132.094 1.00 389.25 ? 430 PHE A CA  1 
ATOM 3084  C C   . PHE A 1 430 ? 138.703 178.390 132.147 1.00 394.15 ? 430 PHE A C   1 
ATOM 3085  O O   . PHE A 1 430 ? 139.235 178.834 131.116 1.00 324.26 ? 430 PHE A O   1 
ATOM 3086  C CB  . PHE A 1 430 ? 136.223 178.538 132.370 1.00 396.11 ? 430 PHE A CB  1 
ATOM 3087  C CG  . PHE A 1 430 ? 134.941 178.132 131.706 1.00 386.71 ? 430 PHE A CG  1 
ATOM 3088  C CD1 . PHE A 1 430 ? 134.294 176.964 132.059 1.00 413.86 ? 430 PHE A CD1 1 
ATOM 3089  C CD2 . PHE A 1 430 ? 134.369 178.937 130.726 1.00 426.15 ? 430 PHE A CD2 1 
ATOM 3090  C CE1 . PHE A 1 430 ? 133.109 176.595 131.436 1.00 454.46 ? 430 PHE A CE1 1 
ATOM 3091  C CE2 . PHE A 1 430 ? 133.178 178.583 130.110 1.00 434.05 ? 430 PHE A CE2 1 
ATOM 3092  C CZ  . PHE A 1 430 ? 132.547 177.409 130.464 1.00 440.90 ? 430 PHE A CZ  1 
ATOM 3093  N N   . LEU A 1 431 ? 139.205 178.545 133.369 1.00 436.07 ? 431 LEU A N   1 
ATOM 3094  C CA  . LEU A 1 431 ? 140.394 179.341 133.653 1.00 440.47 ? 431 LEU A CA  1 
ATOM 3095  C C   . LEU A 1 431 ? 141.649 178.852 132.939 1.00 422.39 ? 431 LEU A C   1 
ATOM 3096  O O   . LEU A 1 431 ? 142.560 179.641 132.702 1.00 437.36 ? 431 LEU A O   1 
ATOM 3097  C CB  . LEU A 1 431 ? 140.634 179.420 135.166 1.00 453.71 ? 431 LEU A CB  1 
ATOM 3098  C CG  . LEU A 1 431 ? 139.804 180.441 135.958 1.00 468.32 ? 431 LEU A CG  1 
ATOM 3099  C CD1 . LEU A 1 431 ? 138.337 180.523 135.555 1.00 490.06 ? 431 LEU A CD1 1 
ATOM 3100  C CD2 . LEU A 1 431 ? 139.907 180.168 137.449 1.00 457.26 ? 431 LEU A CD2 1 
ATOM 3101  N N   . ARG A 1 432 ? 141.689 177.564 132.589 1.00 427.79 ? 432 ARG A N   1 
ATOM 3102  C CA  . ARG A 1 432 ? 142.752 177.012 131.733 1.00 439.49 ? 432 ARG A CA  1 
ATOM 3103  C C   . ARG A 1 432 ? 142.808 177.636 130.322 1.00 419.03 ? 432 ARG A C   1 
ATOM 3104  O O   . ARG A 1 432 ? 143.795 177.429 129.609 1.00 394.00 ? 432 ARG A O   1 
ATOM 3105  C CB  . ARG A 1 432 ? 142.605 175.483 131.584 1.00 471.76 ? 432 ARG A CB  1 
ATOM 3106  C CG  . ARG A 1 432 ? 142.837 174.663 132.848 1.00 474.14 ? 432 ARG A CG  1 
ATOM 3107  C CD  . ARG A 1 432 ? 142.422 173.210 132.654 1.00 470.17 ? 432 ARG A CD  1 
ATOM 3108  N NE  . ARG A 1 432 ? 143.071 172.288 133.594 1.00 470.19 ? 432 ARG A NE  1 
ATOM 3109  C CZ  . ARG A 1 432 ? 144.322 171.829 133.484 1.00 500.00 ? 432 ARG A CZ  1 
ATOM 3110  N NH1 . ARG A 1 432 ? 145.109 172.206 132.474 1.00 500.00 ? 432 ARG A NH1 1 
ATOM 3111  N NH2 . ARG A 1 432 ? 144.806 170.988 134.397 1.00 495.07 ? 432 ARG A NH2 1 
ATOM 3112  N N   . ALA A 1 433 ? 141.764 178.369 129.919 1.00 393.51 ? 433 ALA A N   1 
ATOM 3113  C CA  . ALA A 1 433 ? 141.684 178.955 128.582 1.00 423.55 ? 433 ALA A CA  1 
ATOM 3114  C C   . ALA A 1 433 ? 141.689 180.488 128.533 1.00 464.44 ? 433 ALA A C   1 
ATOM 3115  O O   . ALA A 1 433 ? 142.319 181.067 127.645 1.00 500.00 ? 433 ALA A O   1 
ATOM 3116  C CB  . ALA A 1 433 ? 140.458 178.417 127.882 1.00 473.10 ? 433 ALA A CB  1 
ATOM 3117  N N   . ARG A 1 434 ? 140.973 181.142 129.447 1.00 473.72 ? 434 ARG A N   1 
ATOM 3118  C CA  . ARG A 1 434 ? 141.015 182.612 129.579 1.00 496.14 ? 434 ARG A CA  1 
ATOM 3119  C C   . ARG A 1 434 ? 140.972 182.978 131.067 1.00 500.00 ? 434 ARG A C   1 
ATOM 3120  O O   . ARG A 1 434 ? 140.607 182.143 131.894 1.00 489.92 ? 434 ARG A O   1 
ATOM 3121  C CB  . ARG A 1 434 ? 139.856 183.251 128.801 1.00 484.57 ? 434 ARG A CB  1 
ATOM 3122  C CG  . ARG A 1 434 ? 139.903 184.768 128.649 1.00 452.92 ? 434 ARG A CG  1 
ATOM 3123  C CD  . ARG A 1 434 ? 138.808 185.262 127.712 1.00 475.40 ? 434 ARG A CD  1 
ATOM 3124  N NE  . ARG A 1 434 ? 138.963 186.676 127.343 1.00 500.00 ? 434 ARG A NE  1 
ATOM 3125  C CZ  . ARG A 1 434 ? 139.861 187.165 126.476 1.00 500.00 ? 434 ARG A CZ  1 
ATOM 3126  N NH1 . ARG A 1 434 ? 140.736 186.366 125.860 1.00 500.00 ? 434 ARG A NH1 1 
ATOM 3127  N NH2 . ARG A 1 434 ? 139.894 188.479 126.220 1.00 444.13 ? 434 ARG A NH2 1 
ATOM 3128  N N   . ASN A 1 435 ? 141.372 184.203 131.407 1.00 500.00 ? 435 ASN A N   1 
ATOM 3129  C CA  . ASN A 1 435 ? 141.399 184.653 132.808 1.00 500.00 ? 435 ASN A CA  1 
ATOM 3130  C C   . ASN A 1 435 ? 139.998 184.733 133.490 1.00 500.00 ? 435 ASN A C   1 
ATOM 3131  O O   . ASN A 1 435 ? 139.777 184.032 134.476 1.00 500.00 ? 435 ASN A O   1 
ATOM 3132  C CB  . ASN A 1 435 ? 142.180 185.972 132.936 1.00 500.00 ? 435 ASN A CB  1 
ATOM 3133  C CG  . ASN A 1 435 ? 143.682 185.808 132.667 1.00 492.44 ? 435 ASN A CG  1 
ATOM 3134  O OD1 . ASN A 1 435 ? 144.146 186.047 131.544 1.00 403.10 ? 435 ASN A OD1 1 
ATOM 3135  N ND2 . ASN A 1 435 ? 144.451 185.399 133.710 1.00 482.73 ? 435 ASN A ND2 1 
ATOM 3136  N N   . ILE A 1 436 ? 139.080 185.572 132.982 1.00 500.00 ? 436 ILE A N   1 
ATOM 3137  C CA  . ILE A 1 436 ? 137.620 185.562 133.347 1.00 479.49 ? 436 ILE A CA  1 
ATOM 3138  C C   . ILE A 1 436 ? 137.217 185.991 134.785 1.00 472.30 ? 436 ILE A C   1 
ATOM 3139  O O   . ILE A 1 436 ? 137.853 185.606 135.778 1.00 388.64 ? 436 ILE A O   1 
ATOM 3140  C CB  . ILE A 1 436 ? 136.970 184.171 133.117 1.00 500.00 ? 436 ILE A CB  1 
ATOM 3141  C CG1 . ILE A 1 436 ? 137.322 183.604 131.739 1.00 500.00 ? 436 ILE A CG1 1 
ATOM 3142  C CG2 . ILE A 1 436 ? 135.450 184.229 133.278 1.00 496.42 ? 436 ILE A CG2 1 
ATOM 3143  C CD1 . ILE A 1 436 ? 137.338 182.091 131.729 1.00 500.00 ? 436 ILE A CD1 1 
ATOM 3144  N N   . SER A 1 437 ? 136.116 186.743 134.878 1.00 474.34 ? 437 SER A N   1 
ATOM 3145  C CA  . SER A 1 437 ? 135.512 187.124 136.164 1.00 465.91 ? 437 SER A CA  1 
ATOM 3146  C C   . SER A 1 437 ? 134.719 185.959 136.763 1.00 441.43 ? 437 SER A C   1 
ATOM 3147  O O   . SER A 1 437 ? 133.525 185.811 136.492 1.00 431.97 ? 437 SER A O   1 
ATOM 3148  C CB  . SER A 1 437 ? 134.589 188.336 135.981 1.00 469.50 ? 437 SER A CB  1 
ATOM 3149  O OG  . SER A 1 437 ? 135.302 189.439 135.458 1.00 499.26 ? 437 SER A OG  1 
ATOM 3150  N N   . GLY A 1 438 ? 135.383 185.154 137.591 1.00 426.22 ? 438 GLY A N   1 
ATOM 3151  C CA  . GLY A 1 438 ? 134.812 183.895 138.090 1.00 453.32 ? 438 GLY A CA  1 
ATOM 3152  C C   . GLY A 1 438 ? 134.275 183.871 139.520 1.00 439.36 ? 438 GLY A C   1 
ATOM 3153  O O   . GLY A 1 438 ? 135.024 184.106 140.470 1.00 452.36 ? 438 GLY A O   1 
ATOM 3154  N N   . VAL A 1 439 ? 132.985 183.556 139.669 1.00 424.30 ? 439 VAL A N   1 
ATOM 3155  C CA  . VAL A 1 439 ? 132.357 183.353 140.982 1.00 400.20 ? 439 VAL A CA  1 
ATOM 3156  C C   . VAL A 1 439 ? 131.987 181.892 141.206 1.00 416.62 ? 439 VAL A C   1 
ATOM 3157  O O   . VAL A 1 439 ? 131.494 181.210 140.300 1.00 453.94 ? 439 VAL A O   1 
ATOM 3158  C CB  . VAL A 1 439 ? 131.060 184.181 141.112 1.00 417.22 ? 439 VAL A CB  1 
ATOM 3159  C CG1 . VAL A 1 439 ? 130.139 183.658 142.223 1.00 382.94 ? 439 VAL A CG1 1 
ATOM 3160  C CG2 . VAL A 1 439 ? 131.400 185.643 141.340 1.00 461.39 ? 439 VAL A CG2 1 
ATOM 3161  N N   . VAL A 1 440 ? 132.197 181.443 142.435 1.00 403.78 ? 440 VAL A N   1 
ATOM 3162  C CA  . VAL A 1 440 ? 131.603 180.219 142.937 1.00 383.50 ? 440 VAL A CA  1 
ATOM 3163  C C   . VAL A 1 440 ? 130.862 180.558 144.201 1.00 375.70 ? 440 VAL A C   1 
ATOM 3164  O O   . VAL A 1 440 ? 131.433 181.170 145.126 1.00 442.91 ? 440 VAL A O   1 
ATOM 3165  C CB  . VAL A 1 440 ? 132.662 179.187 143.317 1.00 414.59 ? 440 VAL A CB  1 
ATOM 3166  C CG1 . VAL A 1 440 ? 132.051 178.054 144.142 1.00 386.33 ? 440 VAL A CG1 1 
ATOM 3167  C CG2 . VAL A 1 440 ? 133.360 178.672 142.070 1.00 451.35 ? 440 VAL A CG2 1 
ATOM 3168  N N   . LEU A 1 441 ? 129.617 180.104 144.249 1.00 387.13 ? 441 LEU A N   1 
ATOM 3169  C CA  . LEU A 1 441 ? 128.766 180.268 145.405 1.00 405.12 ? 441 LEU A CA  1 
ATOM 3170  C C   . LEU A 1 441 ? 128.651 178.939 146.114 1.00 376.33 ? 441 LEU A C   1 
ATOM 3171  O O   . LEU A 1 441 ? 128.221 177.916 145.530 1.00 410.28 ? 441 LEU A O   1 
ATOM 3172  C CB  . LEU A 1 441 ? 127.412 180.807 144.985 1.00 427.44 ? 441 LEU A CB  1 
ATOM 3173  C CG  . LEU A 1 441 ? 127.576 182.089 144.153 1.00 479.10 ? 441 LEU A CG  1 
ATOM 3174  C CD1 . LEU A 1 441 ? 126.246 182.503 143.566 1.00 500.00 ? 441 LEU A CD1 1 
ATOM 3175  C CD2 . LEU A 1 441 ? 128.191 183.219 144.969 1.00 500.00 ? 441 LEU A CD2 1 
ATOM 3176  N N   . ALA A 1 442 ? 129.065 178.977 147.378 1.00 428.73 ? 442 ALA A N   1 
ATOM 3177  C CA  . ALA A 1 442 ? 129.293 177.791 148.179 1.00 471.72 ? 442 ALA A CA  1 
ATOM 3178  C C   . ALA A 1 442 ? 128.660 177.951 149.557 1.00 453.90 ? 442 ALA A C   1 
ATOM 3179  O O   . ALA A 1 442 ? 128.871 178.964 150.217 1.00 496.01 ? 442 ALA A O   1 
ATOM 3180  C CB  . ALA A 1 442 ? 130.792 177.577 148.323 1.00 491.68 ? 442 ALA A CB  1 
ATOM 3181  N N   . ASP A 1 443 ? 127.896 176.948 149.987 1.00 400.41 ? 443 ASP A N   1 
ATOM 3182  C CA  . ASP A 1 443 ? 127.445 176.884 151.376 1.00 416.12 ? 443 ASP A CA  1 
ATOM 3183  C C   . ASP A 1 443 ? 128.655 176.756 152.331 1.00 432.00 ? 443 ASP A C   1 
ATOM 3184  O O   . ASP A 1 443 ? 128.608 177.246 153.463 1.00 475.84 ? 443 ASP A O   1 
ATOM 3185  C CB  . ASP A 1 443 ? 126.404 175.759 151.577 1.00 481.58 ? 443 ASP A CB  1 
ATOM 3186  C CG  . ASP A 1 443 ? 126.734 174.839 152.737 1.00 500.00 ? 443 ASP A CG  1 
ATOM 3187  O OD1 . ASP A 1 443 ? 126.434 175.206 153.895 1.00 500.00 ? 443 ASP A OD1 1 
ATOM 3188  O OD2 . ASP A 1 443 ? 127.284 173.744 152.487 1.00 500.00 ? 443 ASP A OD2 1 
ATOM 3189  N N   . HIS A 1 444 ? 129.725 176.107 151.872 1.00 422.65 ? 444 HIS A N   1 
ATOM 3190  C CA  . HIS A 1 444 ? 130.933 175.944 152.688 1.00 445.60 ? 444 HIS A CA  1 
ATOM 3191  C C   . HIS A 1 444 ? 131.763 177.217 152.786 1.00 442.32 ? 444 HIS A C   1 
ATOM 3192  O O   . HIS A 1 444 ? 131.877 177.973 151.822 1.00 434.38 ? 444 HIS A O   1 
ATOM 3193  C CB  . HIS A 1 444 ? 131.804 174.779 152.188 1.00 451.98 ? 444 HIS A CB  1 
ATOM 3194  C CG  . HIS A 1 444 ? 132.328 174.948 150.796 1.00 442.29 ? 444 HIS A CG  1 
ATOM 3195  N ND1 . HIS A 1 444 ? 131.738 174.346 149.708 1.00 494.21 ? 444 HIS A ND1 1 
ATOM 3196  C CD2 . HIS A 1 444 ? 133.388 175.638 150.313 1.00 435.03 ? 444 HIS A CD2 1 
ATOM 3197  C CE1 . HIS A 1 444 ? 132.409 174.657 148.614 1.00 490.86 ? 444 HIS A CE1 1 
ATOM 3198  N NE2 . HIS A 1 444 ? 133.415 175.439 148.954 1.00 469.94 ? 444 HIS A NE2 1 
ATOM 3199  N N   . SER A 1 445 ? 132.333 177.437 153.969 1.00 456.60 ? 445 SER A N   1 
ATOM 3200  C CA  . SER A 1 445 ? 133.245 178.546 154.204 1.00 467.24 ? 445 SER A CA  1 
ATOM 3201  C C   . SER A 1 445 ? 134.581 178.207 153.579 1.00 445.50 ? 445 SER A C   1 
ATOM 3202  O O   . SER A 1 445 ? 135.032 178.888 152.657 1.00 398.68 ? 445 SER A O   1 
ATOM 3203  C CB  . SER A 1 445 ? 133.419 178.787 155.706 1.00 488.92 ? 445 SER A CB  1 
ATOM 3204  O OG  . SER A 1 445 ? 133.943 177.634 156.348 1.00 457.59 ? 445 SER A OG  1 
ATOM 3205  N N   . GLY A 1 446 ? 135.195 177.147 154.101 1.00 446.17 ? 446 GLY A N   1 
ATOM 3206  C CA  . GLY A 1 446 ? 136.432 176.589 153.574 1.00 471.00 ? 446 GLY A CA  1 
ATOM 3207  C C   . GLY A 1 446 ? 136.155 175.147 153.219 1.00 460.57 ? 446 GLY A C   1 
ATOM 3208  O O   . GLY A 1 446 ? 135.547 174.867 152.192 1.00 448.90 ? 446 GLY A O   1 
ATOM 3209  N N   . ALA A 1 447 ? 136.575 174.226 154.080 1.00 472.10 ? 447 ALA A N   1 
ATOM 3210  C CA  . ALA A 1 447 ? 136.277 172.810 153.880 1.00 500.00 ? 447 ALA A CA  1 
ATOM 3211  C C   . ALA A 1 447 ? 134.769 172.589 153.927 1.00 476.09 ? 447 ALA A C   1 
ATOM 3212  O O   . ALA A 1 447 ? 134.046 173.368 154.555 1.00 456.56 ? 447 ALA A O   1 
ATOM 3213  C CB  . ALA A 1 447 ? 136.976 171.963 154.930 1.00 500.00 ? 447 ALA A CB  1 
ATOM 3214  N N   . PHE A 1 448 ? 134.301 171.528 153.273 1.00 470.43 ? 448 PHE A N   1 
ATOM 3215  C CA  . PHE A 1 448 ? 132.855 171.346 153.073 1.00 455.94 ? 448 PHE A CA  1 
ATOM 3216  C C   . PHE A 1 448 ? 132.075 171.081 154.367 1.00 455.18 ? 448 PHE A C   1 
ATOM 3217  O O   . PHE A 1 448 ? 132.643 170.642 155.375 1.00 418.85 ? 448 PHE A O   1 
ATOM 3218  C CB  . PHE A 1 448 ? 132.560 170.201 152.100 1.00 472.67 ? 448 PHE A CB  1 
ATOM 3219  C CG  . PHE A 1 448 ? 133.241 170.320 150.766 1.00 475.01 ? 448 PHE A CG  1 
ATOM 3220  C CD1 . PHE A 1 448 ? 133.124 171.471 150.009 1.00 499.64 ? 448 PHE A CD1 1 
ATOM 3221  C CD2 . PHE A 1 448 ? 133.960 169.252 150.241 1.00 463.69 ? 448 PHE A CD2 1 
ATOM 3222  C CE1 . PHE A 1 448 ? 133.735 171.573 148.765 1.00 500.00 ? 448 PHE A CE1 1 
ATOM 3223  C CE2 . PHE A 1 448 ? 134.564 169.343 148.999 1.00 462.28 ? 448 PHE A CE2 1 
ATOM 3224  C CZ  . PHE A 1 448 ? 134.453 170.506 148.259 1.00 478.18 ? 448 PHE A CZ  1 
ATOM 3225  N N   . HIS A 1 449 ? 130.770 171.356 154.314 1.00 458.18 ? 449 HIS A N   1 
ATOM 3226  C CA  . HIS A 1 449 ? 129.815 170.926 155.348 1.00 488.99 ? 449 HIS A CA  1 
ATOM 3227  C C   . HIS A 1 449 ? 129.146 169.601 154.975 1.00 481.48 ? 449 HIS A C   1 
ATOM 3228  O O   . HIS A 1 449 ? 128.269 169.116 155.691 1.00 494.19 ? 449 HIS A O   1 
ATOM 3229  C CB  . HIS A 1 449 ? 128.702 171.962 155.529 1.00 500.00 ? 449 HIS A CB  1 
ATOM 3230  C CG  . HIS A 1 449 ? 129.156 173.245 156.133 1.00 481.17 ? 449 HIS A CG  1 
ATOM 3231  N ND1 . HIS A 1 449 ? 129.635 173.327 157.422 1.00 437.25 ? 449 HIS A ND1 1 
ATOM 3232  C CD2 . HIS A 1 449 ? 129.169 174.505 155.640 1.00 480.28 ? 449 HIS A CD2 1 
ATOM 3233  C CE1 . HIS A 1 449 ? 129.947 174.582 157.686 1.00 500.00 ? 449 HIS A CE1 1 
ATOM 3234  N NE2 . HIS A 1 449 ? 129.674 175.317 156.622 1.00 500.00 ? 449 HIS A NE2 1 
ATOM 3235  N N   . ASN A 1 450 ? 129.586 169.008 153.872 1.00 452.70 ? 450 ASN A N   1 
ATOM 3236  C CA  . ASN A 1 450 ? 128.835 167.980 153.183 1.00 420.91 ? 450 ASN A CA  1 
ATOM 3237  C C   . ASN A 1 450 ? 128.943 166.658 153.905 1.00 409.53 ? 450 ASN A C   1 
ATOM 3238  O O   . ASN A 1 450 ? 127.978 165.894 153.934 1.00 381.89 ? 450 ASN A O   1 
ATOM 3239  C CB  . ASN A 1 450 ? 129.383 167.818 151.765 1.00 451.55 ? 450 ASN A CB  1 
ATOM 3240  C CG  . ASN A 1 450 ? 128.351 167.331 150.770 1.00 446.15 ? 450 ASN A CG  1 
ATOM 3241  O OD1 . ASN A 1 450 ? 128.342 167.788 149.626 1.00 441.78 ? 450 ASN A OD1 1 
ATOM 3242  N ND2 . ASN A 1 450 ? 127.493 166.397 151.169 1.00 440.23 ? 450 ASN A ND2 1 
ATOM 3243  N N   . LYS A 1 451 ? 130.129 166.383 154.455 1.00 444.65 ? 451 LYS A N   1 
ATOM 3244  C CA  . LYS A 1 451 ? 130.431 165.155 155.193 1.00 479.88 ? 451 LYS A CA  1 
ATOM 3245  C C   . LYS A 1 451 ? 130.306 163.926 154.306 1.00 427.58 ? 451 LYS A C   1 
ATOM 3246  O O   . LYS A 1 451 ? 131.261 163.166 154.150 1.00 451.51 ? 451 LYS A O   1 
ATOM 3247  C CB  . LYS A 1 451 ? 129.564 165.017 156.456 1.00 500.00 ? 451 LYS A CB  1 
ATOM 3248  C CG  . LYS A 1 451 ? 129.724 166.175 157.436 1.00 500.00 ? 451 LYS A CG  1 
ATOM 3249  C CD  . LYS A 1 451 ? 129.191 165.850 158.834 1.00 500.00 ? 451 LYS A CD  1 
ATOM 3250  C CE  . LYS A 1 451 ? 127.665 165.873 158.906 1.00 500.00 ? 451 LYS A CE  1 
ATOM 3251  N NZ  . LYS A 1 451 ? 127.128 165.617 160.277 1.00 500.00 ? 451 LYS A NZ  1 
ATOM 3252  N N   . TYR A 1 452 ? 129.122 163.739 153.743 1.00 370.67 ? 452 TYR A N   1 
ATOM 3253  C CA  . TYR A 1 452 ? 128.905 162.755 152.712 1.00 416.15 ? 452 TYR A CA  1 
ATOM 3254  C C   . TYR A 1 452 ? 128.967 163.448 151.336 1.00 411.44 ? 452 TYR A C   1 
ATOM 3255  O O   . TYR A 1 452 ? 127.947 163.863 150.794 1.00 437.75 ? 452 TYR A O   1 
ATOM 3256  C CB  . TYR A 1 452 ? 127.562 162.051 152.943 1.00 434.72 ? 452 TYR A CB  1 
ATOM 3257  C CG  . TYR A 1 452 ? 127.198 161.842 154.403 1.00 431.15 ? 452 TYR A CG  1 
ATOM 3258  C CD1 . TYR A 1 452 ? 128.038 161.145 155.265 1.00 428.04 ? 452 TYR A CD1 1 
ATOM 3259  C CD2 . TYR A 1 452 ? 125.998 162.332 154.913 1.00 432.67 ? 452 TYR A CD2 1 
ATOM 3260  C CE1 . TYR A 1 452 ? 127.691 160.941 156.593 1.00 440.91 ? 452 TYR A CE1 1 
ATOM 3261  C CE2 . TYR A 1 452 ? 125.634 162.135 156.236 1.00 436.36 ? 452 TYR A CE2 1 
ATOM 3262  C CZ  . TYR A 1 452 ? 126.487 161.438 157.075 1.00 468.33 ? 452 TYR A CZ  1 
ATOM 3263  O OH  . TYR A 1 452 ? 126.144 161.239 158.391 1.00 487.31 ? 452 TYR A OH  1 
ATOM 3264  N N   . TYR A 1 453 ? 130.175 163.563 150.784 1.00 401.94 ? 453 TYR A N   1 
ATOM 3265  C CA  . TYR A 1 453 ? 130.416 164.204 149.477 1.00 397.48 ? 453 TYR A CA  1 
ATOM 3266  C C   . TYR A 1 453 ? 130.692 163.202 148.374 1.00 405.06 ? 453 TYR A C   1 
ATOM 3267  O O   . TYR A 1 453 ? 131.757 162.572 148.351 1.00 390.84 ? 453 TYR A O   1 
ATOM 3268  C CB  . TYR A 1 453 ? 131.615 165.132 149.566 1.00 437.24 ? 453 TYR A CB  1 
ATOM 3269  C CG  . TYR A 1 453 ? 132.040 165.739 148.245 1.00 407.82 ? 453 TYR A CG  1 
ATOM 3270  C CD1 . TYR A 1 453 ? 131.157 166.498 147.489 1.00 388.26 ? 453 TYR A CD1 1 
ATOM 3271  C CD2 . TYR A 1 453 ? 133.338 165.582 147.772 1.00 423.30 ? 453 TYR A CD2 1 
ATOM 3272  C CE1 . TYR A 1 453 ? 131.546 167.069 146.292 1.00 421.25 ? 453 TYR A CE1 1 
ATOM 3273  C CE2 . TYR A 1 453 ? 133.740 166.156 146.579 1.00 437.50 ? 453 TYR A CE2 1 
ATOM 3274  C CZ  . TYR A 1 453 ? 132.841 166.898 145.839 1.00 423.07 ? 453 TYR A CZ  1 
ATOM 3275  O OH  . TYR A 1 453 ? 133.238 167.460 144.646 1.00 416.21 ? 453 TYR A OH  1 
ATOM 3276  N N   . GLN A 1 454 ? 129.759 163.110 147.424 1.00 446.36 ? 454 GLN A N   1 
ATOM 3277  C CA  . GLN A 1 454 ? 129.747 162.045 146.413 1.00 481.39 ? 454 GLN A CA  1 
ATOM 3278  C C   . GLN A 1 454 ? 129.956 160.699 147.111 1.00 462.08 ? 454 GLN A C   1 
ATOM 3279  O O   . GLN A 1 454 ? 130.869 159.923 146.809 1.00 441.71 ? 454 GLN A O   1 
ATOM 3280  C CB  . GLN A 1 454 ? 130.704 162.317 145.229 1.00 495.41 ? 454 GLN A CB  1 
ATOM 3281  C CG  . GLN A 1 454 ? 131.608 163.540 145.325 1.00 499.21 ? 454 GLN A CG  1 
ATOM 3282  C CD  . GLN A 1 454 ? 131.812 164.207 143.981 1.00 500.00 ? 454 GLN A CD  1 
ATOM 3283  O OE1 . GLN A 1 454 ? 130.909 164.864 143.456 1.00 488.00 ? 454 GLN A OE1 1 
ATOM 3284  N NE2 . GLN A 1 454 ? 133.001 164.047 143.417 1.00 500.00 ? 454 GLN A NE2 1 
ATOM 3285  N N   . SER A 1 455 ? 129.074 160.482 148.079 1.00 428.23 ? 455 SER A N   1 
ATOM 3286  C CA  . SER A 1 455 ? 129.072 159.318 148.934 1.00 403.88 ? 455 SER A CA  1 
ATOM 3287  C C   . SER A 1 455 ? 127.670 158.798 148.885 1.00 373.76 ? 455 SER A C   1 
ATOM 3288  O O   . SER A 1 455 ? 126.812 159.381 148.221 1.00 404.94 ? 455 SER A O   1 
ATOM 3289  C CB  . SER A 1 455 ? 129.420 159.718 150.363 1.00 500.00 ? 455 SER A CB  1 
ATOM 3290  O OG  . SER A 1 455 ? 130.386 160.750 150.380 1.00 500.00 ? 455 SER A OG  1 
ATOM 3291  N N   . ILE A 1 456 ? 127.424 157.729 149.622 1.00 376.24 ? 456 ILE A N   1 
ATOM 3292  C CA  . ILE A 1 456 ? 126.208 156.945 149.447 1.00 407.31 ? 456 ILE A CA  1 
ATOM 3293  C C   . ILE A 1 456 ? 125.029 157.588 150.162 1.00 443.21 ? 456 ILE A C   1 
ATOM 3294  O O   . ILE A 1 456 ? 123.877 157.346 149.788 1.00 471.47 ? 456 ILE A O   1 
ATOM 3295  C CB  . ILE A 1 456 ? 126.414 155.494 149.934 1.00 414.00 ? 456 ILE A CB  1 
ATOM 3296  C CG1 . ILE A 1 456 ? 127.397 154.765 149.015 1.00 471.49 ? 456 ILE A CG1 1 
ATOM 3297  C CG2 . ILE A 1 456 ? 125.108 154.719 149.963 1.00 401.77 ? 456 ILE A CG2 1 
ATOM 3298  C CD1 . ILE A 1 456 ? 128.852 155.128 149.225 1.00 500.00 ? 456 ILE A CD1 1 
ATOM 3299  N N   . TYR A 1 457 ? 125.306 158.437 151.149 1.00 427.63 ? 457 TYR A N   1 
ATOM 3300  C CA  . TYR A 1 457 ? 124.273 158.913 152.059 1.00 441.22 ? 457 TYR A CA  1 
ATOM 3301  C C   . TYR A 1 457 ? 123.918 160.377 151.833 1.00 422.52 ? 457 TYR A C   1 
ATOM 3302  O O   . TYR A 1 457 ? 123.150 160.938 152.617 1.00 452.92 ? 457 TYR A O   1 
ATOM 3303  C CB  . TYR A 1 457 ? 124.707 158.727 153.509 1.00 483.69 ? 457 TYR A CB  1 
ATOM 3304  C CG  . TYR A 1 457 ? 125.474 157.461 153.796 1.00 473.99 ? 457 TYR A CG  1 
ATOM 3305  C CD1 . TYR A 1 457 ? 126.827 157.377 153.499 1.00 444.25 ? 457 TYR A CD1 1 
ATOM 3306  C CD2 . TYR A 1 457 ? 124.859 156.363 154.400 1.00 452.85 ? 457 TYR A CD2 1 
ATOM 3307  C CE1 . TYR A 1 457 ? 127.538 156.238 153.771 1.00 441.91 ? 457 TYR A CE1 1 
ATOM 3308  C CE2 . TYR A 1 457 ? 125.576 155.214 154.678 1.00 436.21 ? 457 TYR A CE2 1 
ATOM 3309  C CZ  . TYR A 1 457 ? 126.920 155.168 154.356 1.00 449.25 ? 457 TYR A CZ  1 
ATOM 3310  O OH  . TYR A 1 457 ? 127.676 154.064 154.606 1.00 487.23 ? 457 TYR A OH  1 
ATOM 3311  N N   . ASP A 1 458 ? 124.445 160.989 150.770 1.00 396.68 ? 458 ASP A N   1 
ATOM 3312  C CA  . ASP A 1 458 ? 124.140 162.384 150.415 1.00 384.66 ? 458 ASP A CA  1 
ATOM 3313  C C   . ASP A 1 458 ? 122.670 162.552 149.953 1.00 345.55 ? 458 ASP A C   1 
ATOM 3314  O O   . ASP A 1 458 ? 122.411 163.029 148.861 1.00 352.55 ? 458 ASP A O   1 
ATOM 3315  C CB  . ASP A 1 458 ? 125.130 162.844 149.323 1.00 406.48 ? 458 ASP A CB  1 
ATOM 3316  C CG  . ASP A 1 458 ? 125.095 164.348 149.060 1.00 425.58 ? 458 ASP A CG  1 
ATOM 3317  O OD1 . ASP A 1 458 ? 124.239 165.071 149.612 1.00 412.05 ? 458 ASP A OD1 1 
ATOM 3318  O OD2 . ASP A 1 458 ? 125.930 164.822 148.267 1.00 458.81 ? 458 ASP A OD2 1 
ATOM 3319  N N   . THR A 1 459 ? 121.723 162.193 150.817 1.00 380.24 ? 459 THR A N   1 
ATOM 3320  C CA  . THR A 1 459 ? 120.322 161.996 150.446 1.00 424.40 ? 459 THR A CA  1 
ATOM 3321  C C   . THR A 1 459 ? 119.452 163.020 151.179 1.00 455.72 ? 459 THR A C   1 
ATOM 3322  O O   . THR A 1 459 ? 119.977 163.928 151.842 1.00 433.58 ? 459 THR A O   1 
ATOM 3323  C CB  . THR A 1 459 ? 119.864 160.559 150.821 1.00 462.65 ? 459 THR A CB  1 
ATOM 3324  O OG1 . THR A 1 459 ? 120.034 160.344 152.226 1.00 493.87 ? 459 THR A OG1 1 
ATOM 3325  C CG2 . THR A 1 459 ? 120.670 159.512 150.084 1.00 486.95 ? 459 THR A CG2 1 
ATOM 3326  N N   . ALA A 1 460 ? 118.130 162.876 151.040 1.00 475.56 ? 460 ALA A N   1 
ATOM 3327  C CA  . ALA A 1 460 ? 117.129 163.550 151.892 1.00 471.15 ? 460 ALA A CA  1 
ATOM 3328  C C   . ALA A 1 460 ? 117.661 163.859 153.287 1.00 405.99 ? 460 ALA A C   1 
ATOM 3329  O O   . ALA A 1 460 ? 117.654 165.002 153.737 1.00 366.43 ? 460 ALA A O   1 
ATOM 3330  C CB  . ALA A 1 460 ? 115.879 162.683 152.006 1.00 453.44 ? 460 ALA A CB  1 
ATOM 3331  N N   . GLU A 1 461 ? 118.144 162.811 153.935 1.00 427.38 ? 461 GLU A N   1 
ATOM 3332  C CA  . GLU A 1 461 ? 118.716 162.903 155.263 1.00 500.00 ? 461 GLU A CA  1 
ATOM 3333  C C   . GLU A 1 461 ? 119.721 164.036 155.364 1.00 421.21 ? 461 GLU A C   1 
ATOM 3334  O O   . GLU A 1 461 ? 119.521 164.961 156.150 1.00 447.48 ? 461 GLU A O   1 
ATOM 3335  C CB  . GLU A 1 461 ? 119.376 161.576 155.655 1.00 500.00 ? 461 GLU A CB  1 
ATOM 3336  C CG  . GLU A 1 461 ? 118.381 160.431 155.886 1.00 500.00 ? 461 GLU A CG  1 
ATOM 3337  C CD  . GLU A 1 461 ? 119.028 159.133 156.376 1.00 500.00 ? 461 GLU A CD  1 
ATOM 3338  O OE1 . GLU A 1 461 ? 120.170 158.816 155.952 1.00 500.00 ? 461 GLU A OE1 1 
ATOM 3339  O OE2 . GLU A 1 461 ? 118.378 158.417 157.182 1.00 500.00 ? 461 GLU A OE2 1 
ATOM 3340  N N   . ASN A 1 462 ? 120.774 163.986 154.552 1.00 410.19 ? 462 ASN A N   1 
ATOM 3341  C CA  . ASN A 1 462 ? 121.894 164.913 154.723 1.00 481.37 ? 462 ASN A CA  1 
ATOM 3342  C C   . ASN A 1 462 ? 121.608 166.352 154.293 1.00 474.22 ? 462 ASN A C   1 
ATOM 3343  O O   . ASN A 1 462 ? 122.025 167.290 154.976 1.00 500.00 ? 462 ASN A O   1 
ATOM 3344  C CB  . ASN A 1 462 ? 123.148 164.416 154.019 1.00 500.00 ? 462 ASN A CB  1 
ATOM 3345  C CG  . ASN A 1 462 ? 124.382 165.217 154.410 1.00 500.00 ? 462 ASN A CG  1 
ATOM 3346  O OD1 . ASN A 1 462 ? 124.875 165.102 155.535 1.00 448.31 ? 462 ASN A OD1 1 
ATOM 3347  N ND2 . ASN A 1 462 ? 124.877 166.039 153.490 1.00 500.00 ? 462 ASN A ND2 1 
ATOM 3348  N N   . ILE A 1 463 ? 120.919 166.535 153.172 1.00 396.08 ? 463 ILE A N   1 
ATOM 3349  C CA  . ILE A 1 463 ? 120.472 167.874 152.790 1.00 404.22 ? 463 ILE A CA  1 
ATOM 3350  C C   . ILE A 1 463 ? 119.383 168.410 153.749 1.00 455.02 ? 463 ILE A C   1 
ATOM 3351  O O   . ILE A 1 463 ? 119.198 169.623 153.856 1.00 473.50 ? 463 ILE A O   1 
ATOM 3352  C CB  . ILE A 1 463 ? 119.958 167.903 151.342 1.00 437.88 ? 463 ILE A CB  1 
ATOM 3353  C CG1 . ILE A 1 463 ? 120.005 169.336 150.791 1.00 459.43 ? 463 ILE A CG1 1 
ATOM 3354  C CG2 . ILE A 1 463 ? 118.575 167.272 151.248 1.00 445.55 ? 463 ILE A CG2 1 
ATOM 3355  C CD1 . ILE A 1 463 ? 119.166 169.574 149.552 1.00 494.96 ? 463 ILE A CD1 1 
ATOM 3356  N N   . ASN A 1 464 ? 118.665 167.496 154.410 1.00 471.00 ? 464 ASN A N   1 
ATOM 3357  C CA  . ASN A 1 464 ? 117.663 167.788 155.459 1.00 471.37 ? 464 ASN A CA  1 
ATOM 3358  C C   . ASN A 1 464 ? 116.233 167.927 154.923 1.00 449.90 ? 464 ASN A C   1 
ATOM 3359  O O   . ASN A 1 464 ? 115.389 168.538 155.575 1.00 459.06 ? 464 ASN A O   1 
ATOM 3360  C CB  . ASN A 1 464 ? 118.046 169.007 156.331 1.00 468.00 ? 464 ASN A CB  1 
ATOM 3361  C CG  . ASN A 1 464 ? 117.571 168.879 157.771 1.00 482.19 ? 464 ASN A CG  1 
ATOM 3362  O OD1 . ASN A 1 464 ? 118.339 168.435 158.631 1.00 448.17 ? 464 ASN A OD1 1 
ATOM 3363  N ND2 . ASN A 1 464 ? 116.299 169.267 158.044 1.00 500.00 ? 464 ASN A ND2 1 
ATOM 3364  N N   . VAL A 1 465 ? 115.953 167.331 153.759 1.00 451.65 ? 465 VAL A N   1 
ATOM 3365  C CA  . VAL A 1 465 ? 114.578 167.244 153.257 1.00 455.01 ? 465 VAL A CA  1 
ATOM 3366  C C   . VAL A 1 465 ? 113.908 166.111 154.025 1.00 430.36 ? 465 VAL A C   1 
ATOM 3367  O O   . VAL A 1 465 ? 114.545 165.099 154.343 1.00 428.75 ? 465 VAL A O   1 
ATOM 3368  C CB  . VAL A 1 465 ? 114.474 166.941 151.732 1.00 451.55 ? 465 VAL A CB  1 
ATOM 3369  C CG1 . VAL A 1 465 ? 113.005 166.929 151.289 1.00 419.70 ? 465 VAL A CG1 1 
ATOM 3370  C CG2 . VAL A 1 465 ? 115.301 167.916 150.883 1.00 407.43 ? 465 VAL A CG2 1 
ATOM 3371  N N   . SER A 1 466 ? 112.626 166.283 154.316 1.00 419.67 ? 466 SER A N   1 
ATOM 3372  C CA  . SER A 1 466 ? 111.869 165.272 155.041 1.00 465.74 ? 466 SER A CA  1 
ATOM 3373  C C   . SER A 1 466 ? 110.366 165.567 154.975 1.00 483.16 ? 466 SER A C   1 
ATOM 3374  O O   . SER A 1 466 ? 109.872 166.480 155.646 1.00 486.09 ? 466 SER A O   1 
ATOM 3375  C CB  . SER A 1 466 ? 112.358 165.156 156.499 1.00 467.39 ? 466 SER A CB  1 
ATOM 3376  O OG  . SER A 1 466 ? 112.773 166.406 157.028 1.00 438.53 ? 466 SER A OG  1 
ATOM 3377  N N   . TYR A 1 467 ? 109.656 164.783 154.160 1.00 455.98 ? 467 TYR A N   1 
ATOM 3378  C CA  . TYR A 1 467 ? 108.216 164.940 153.979 1.00 471.55 ? 467 TYR A CA  1 
ATOM 3379  C C   . TYR A 1 467 ? 107.459 164.197 155.087 1.00 498.19 ? 467 TYR A C   1 
ATOM 3380  O O   . TYR A 1 467 ? 107.802 163.051 155.393 1.00 500.00 ? 467 TYR A O   1 
ATOM 3381  C CB  . TYR A 1 467 ? 107.797 164.442 152.596 1.00 451.97 ? 467 TYR A CB  1 
ATOM 3382  C CG  . TYR A 1 467 ? 108.379 165.276 151.475 1.00 475.66 ? 467 TYR A CG  1 
ATOM 3383  C CD1 . TYR A 1 467 ? 109.650 165.013 150.970 1.00 487.82 ? 467 TYR A CD1 1 
ATOM 3384  C CD2 . TYR A 1 467 ? 107.666 166.343 150.929 1.00 498.62 ? 467 TYR A CD2 1 
ATOM 3385  C CE1 . TYR A 1 467 ? 110.188 165.779 149.944 1.00 500.00 ? 467 TYR A CE1 1 
ATOM 3386  C CE2 . TYR A 1 467 ? 108.200 167.115 149.905 1.00 497.27 ? 467 TYR A CE2 1 
ATOM 3387  C CZ  . TYR A 1 467 ? 109.461 166.831 149.416 1.00 500.00 ? 467 TYR A CZ  1 
ATOM 3388  O OH  . TYR A 1 467 ? 109.994 167.591 148.403 1.00 500.00 ? 467 TYR A OH  1 
ATOM 3389  N N   . PRO A 1 468 ? 106.416 164.829 155.677 1.00 500.00 ? 468 PRO A N   1 
ATOM 3390  C CA  . PRO A 1 468 ? 105.846 164.304 156.920 1.00 486.05 ? 468 PRO A CA  1 
ATOM 3391  C C   . PRO A 1 468 ? 105.025 163.036 156.722 1.00 439.91 ? 468 PRO A C   1 
ATOM 3392  O O   . PRO A 1 468 ? 104.859 162.572 155.586 1.00 411.64 ? 468 PRO A O   1 
ATOM 3393  C CB  . PRO A 1 468 ? 104.951 165.459 157.416 1.00 500.00 ? 468 PRO A CB  1 
ATOM 3394  C CG  . PRO A 1 468 ? 105.038 166.544 156.382 1.00 489.75 ? 468 PRO A CG  1 
ATOM 3395  C CD  . PRO A 1 468 ? 105.556 165.893 155.138 1.00 500.00 ? 468 PRO A CD  1 
ATOM 3396  N N   . GLU A 1 469 ? 104.494 162.504 157.819 1.00 422.64 ? 469 GLU A N   1 
ATOM 3397  C CA  . GLU A 1 469 ? 103.889 161.175 157.803 1.00 500.00 ? 469 GLU A CA  1 
ATOM 3398  C C   . GLU A 1 469 ? 102.348 161.134 157.939 1.00 500.00 ? 469 GLU A C   1 
ATOM 3399  O O   . GLU A 1 469 ? 101.790 160.158 158.460 1.00 500.00 ? 469 GLU A O   1 
ATOM 3400  C CB  . GLU A 1 469 ? 104.592 160.293 158.849 1.00 500.00 ? 469 GLU A CB  1 
ATOM 3401  C CG  . GLU A 1 469 ? 105.104 158.963 158.288 1.00 500.00 ? 469 GLU A CG  1 
ATOM 3402  C CD  . GLU A 1 469 ? 106.260 159.111 157.288 1.00 500.00 ? 469 GLU A CD  1 
ATOM 3403  O OE1 . GLU A 1 469 ? 106.817 160.227 157.138 1.00 500.00 ? 469 GLU A OE1 1 
ATOM 3404  O OE2 . GLU A 1 469 ? 106.614 158.094 156.645 1.00 500.00 ? 469 GLU A OE2 1 
ATOM 3405  N N   . TRP A 1 470 ? 101.673 162.185 157.459 1.00 500.00 ? 470 TRP A N   1 
ATOM 3406  C CA  . TRP A 1 470 ? 100.225 162.123 157.103 1.00 500.00 ? 470 TRP A CA  1 
ATOM 3407  C C   . TRP A 1 470 ? 99.951  162.570 155.649 1.00 500.00 ? 470 TRP A C   1 
ATOM 3408  O O   . TRP A 1 470 ? 99.051  162.035 154.981 1.00 500.00 ? 470 TRP A O   1 
ATOM 3409  C CB  . TRP A 1 470 ? 99.347  162.892 158.101 1.00 500.00 ? 470 TRP A CB  1 
ATOM 3410  C CG  . TRP A 1 470 ? 99.749  164.292 158.321 1.00 500.00 ? 470 TRP A CG  1 
ATOM 3411  C CD1 . TRP A 1 470 ? 99.279  165.397 157.673 1.00 491.01 ? 470 TRP A CD1 1 
ATOM 3412  C CD2 . TRP A 1 470 ? 100.706 164.750 159.270 1.00 500.00 ? 470 TRP A CD2 1 
ATOM 3413  N NE1 . TRP A 1 470 ? 99.891  166.525 158.161 1.00 500.00 ? 470 TRP A NE1 1 
ATOM 3414  C CE2 . TRP A 1 470 ? 100.774 166.158 159.142 1.00 500.00 ? 470 TRP A CE2 1 
ATOM 3415  C CE3 . TRP A 1 470 ? 101.521 164.110 160.217 1.00 500.00 ? 470 TRP A CE3 1 
ATOM 3416  C CZ2 . TRP A 1 470 ? 101.628 166.944 159.933 1.00 500.00 ? 470 TRP A CZ2 1 
ATOM 3417  C CZ3 . TRP A 1 470 ? 102.372 164.888 161.004 1.00 500.00 ? 470 TRP A CZ3 1 
ATOM 3418  C CH2 . TRP A 1 470 ? 102.418 166.293 160.856 1.00 500.00 ? 470 TRP A CH2 1 
ATOM 3419  N N   . LEU A 1 471 ? 100.722 163.552 155.171 1.00 500.00 ? 471 LEU A N   1 
ATOM 3420  C CA  . LEU A 1 471 ? 100.958 163.710 153.736 1.00 500.00 ? 471 LEU A CA  1 
ATOM 3421  C C   . LEU A 1 471 ? 101.690 162.486 153.249 1.00 500.00 ? 471 LEU A C   1 
ATOM 3422  O O   . LEU A 1 471 ? 102.387 161.810 154.017 1.00 500.00 ? 471 LEU A O   1 
ATOM 3423  C CB  . LEU A 1 471 ? 101.822 164.928 153.421 1.00 500.00 ? 471 LEU A CB  1 
ATOM 3424  C CG  . LEU A 1 471 ? 101.234 166.299 153.723 1.00 500.00 ? 471 LEU A CG  1 
ATOM 3425  C CD1 . LEU A 1 471 ? 102.118 167.357 153.084 1.00 500.00 ? 471 LEU A CD1 1 
ATOM 3426  C CD2 . LEU A 1 471 ? 99.788  166.426 153.242 1.00 500.00 ? 471 LEU A CD2 1 
ATOM 3427  N N   . SER A 1 472 ? 101.575 162.236 151.953 1.00 500.00 ? 472 SER A N   1 
ATOM 3428  C CA  . SER A 1 472 ? 101.941 160.928 151.406 1.00 500.00 ? 472 SER A CA  1 
ATOM 3429  C C   . SER A 1 472 ? 102.245 160.918 149.894 1.00 500.00 ? 472 SER A C   1 
ATOM 3430  O O   . SER A 1 472 ? 103.378 160.605 149.498 1.00 500.00 ? 472 SER A O   1 
ATOM 3431  C CB  . SER A 1 472 ? 100.876 159.866 151.796 1.00 500.00 ? 472 SER A CB  1 
ATOM 3432  O OG  . SER A 1 472 ? 99.638  160.440 152.224 1.00 500.00 ? 472 SER A OG  1 
ATOM 3433  N N   . PRO A 1 473 ? 101.256 161.275 149.051 1.00 500.00 ? 473 PRO A N   1 
ATOM 3434  C CA  . PRO A 1 473 ? 101.397 160.949 147.645 1.00 500.00 ? 473 PRO A CA  1 
ATOM 3435  C C   . PRO A 1 473 ? 102.012 162.107 146.842 1.00 500.00 ? 473 PRO A C   1 
ATOM 3436  O O   . PRO A 1 473 ? 103.234 162.251 146.829 1.00 458.41 ? 473 PRO A O   1 
ATOM 3437  C CB  . PRO A 1 473 ? 99.946  160.605 147.255 1.00 500.00 ? 473 PRO A CB  1 
ATOM 3438  C CG  . PRO A 1 473 ? 99.082  161.397 148.220 1.00 500.00 ? 473 PRO A CG  1 
ATOM 3439  C CD  . PRO A 1 473 ? 99.983  161.982 149.276 1.00 500.00 ? 473 PRO A CD  1 
ATOM 3440  N N   . GLU A 1 474 ? 101.175 162.924 146.209 1.00 496.41 ? 474 GLU A N   1 
ATOM 3441  C CA  . GLU A 1 474 ? 101.607 164.037 145.375 1.00 500.00 ? 474 GLU A CA  1 
ATOM 3442  C C   . GLU A 1 474 ? 101.506 165.353 146.147 1.00 500.00 ? 474 GLU A C   1 
ATOM 3443  O O   . GLU A 1 474 ? 102.077 166.355 145.728 1.00 498.60 ? 474 GLU A O   1 
ATOM 3444  C CB  . GLU A 1 474 ? 100.798 164.107 144.066 1.00 491.94 ? 474 GLU A CB  1 
ATOM 3445  C CG  . GLU A 1 474 ? 99.276  164.161 144.198 1.00 500.00 ? 474 GLU A CG  1 
ATOM 3446  C CD  . GLU A 1 474 ? 98.610  162.797 144.326 1.00 500.00 ? 474 GLU A CD  1 
ATOM 3447  O OE1 . GLU A 1 474 ? 99.209  161.774 143.922 1.00 500.00 ? 474 GLU A OE1 1 
ATOM 3448  O OE2 . GLU A 1 474 ? 97.475  162.749 144.848 1.00 500.00 ? 474 GLU A OE2 1 
ATOM 3449  N N   . GLU A 1 475 ? 100.779 165.351 147.266 1.00 500.00 ? 475 GLU A N   1 
ATOM 3450  C CA  . GLU A 1 475 ? 100.806 166.455 148.238 1.00 500.00 ? 475 GLU A CA  1 
ATOM 3451  C C   . GLU A 1 475 ? 102.228 166.944 148.537 1.00 500.00 ? 475 GLU A C   1 
ATOM 3452  O O   . GLU A 1 475 ? 102.445 168.127 148.801 1.00 500.00 ? 475 GLU A O   1 
ATOM 3453  C CB  . GLU A 1 475 ? 100.112 166.030 149.551 1.00 500.00 ? 475 GLU A CB  1 
ATOM 3454  C CG  . GLU A 1 475 ? 98.592  166.282 149.609 1.00 500.00 ? 475 GLU A CG  1 
ATOM 3455  C CD  . GLU A 1 475 ? 97.716  165.170 148.997 1.00 500.00 ? 475 GLU A CD  1 
ATOM 3456  O OE1 . GLU A 1 475 ? 97.779  164.009 149.475 1.00 500.00 ? 475 GLU A OE1 1 
ATOM 3457  O OE2 . GLU A 1 475 ? 96.927  165.470 148.060 1.00 500.00 ? 475 GLU A OE2 1 
ATOM 3458  N N   . ASP A 1 476 ? 103.170 166.006 148.497 1.00 500.00 ? 476 ASP A N   1 
ATOM 3459  C CA  . ASP A 1 476 ? 104.606 166.273 148.634 1.00 500.00 ? 476 ASP A CA  1 
ATOM 3460  C C   . ASP A 1 476 ? 105.139 167.277 147.614 1.00 500.00 ? 476 ASP A C   1 
ATOM 3461  O O   . ASP A 1 476 ? 105.922 168.154 147.962 1.00 500.00 ? 476 ASP A O   1 
ATOM 3462  C CB  . ASP A 1 476 ? 105.391 164.972 148.482 1.00 500.00 ? 476 ASP A CB  1 
ATOM 3463  C CG  . ASP A 1 476 ? 104.809 163.833 149.305 1.00 500.00 ? 476 ASP A CG  1 
ATOM 3464  O OD1 . ASP A 1 476 ? 103.566 163.678 149.312 1.00 493.50 ? 476 ASP A OD1 1 
ATOM 3465  O OD2 . ASP A 1 476 ? 105.593 163.092 149.934 1.00 500.00 ? 476 ASP A OD2 1 
ATOM 3466  N N   . LEU A 1 477 ? 104.721 167.134 146.360 1.00 472.58 ? 477 LEU A N   1 
ATOM 3467  C CA  . LEU A 1 477 ? 105.069 168.090 145.299 1.00 469.20 ? 477 LEU A CA  1 
ATOM 3468  C C   . LEU A 1 477 ? 104.669 169.533 145.625 1.00 500.00 ? 477 LEU A C   1 
ATOM 3469  O O   . LEU A 1 477 ? 105.389 170.471 145.291 1.00 500.00 ? 477 LEU A O   1 
ATOM 3470  C CB  . LEU A 1 477 ? 104.395 167.696 143.990 1.00 498.19 ? 477 LEU A CB  1 
ATOM 3471  C CG  . LEU A 1 477 ? 104.881 166.411 143.325 1.00 500.00 ? 477 LEU A CG  1 
ATOM 3472  C CD1 . LEU A 1 477 ? 103.834 165.868 142.370 1.00 500.00 ? 477 LEU A CD1 1 
ATOM 3473  C CD2 . LEU A 1 477 ? 106.169 166.667 142.574 1.00 500.00 ? 477 LEU A CD2 1 
ATOM 3474  N N   . ASN A 1 478 ? 103.519 169.693 146.273 1.00 500.00 ? 478 ASN A N   1 
ATOM 3475  C CA  . ASN A 1 478 ? 102.970 171.009 146.611 1.00 500.00 ? 478 ASN A CA  1 
ATOM 3476  C C   . ASN A 1 478 ? 103.520 171.521 147.941 1.00 468.24 ? 478 ASN A C   1 
ATOM 3477  O O   . ASN A 1 478 ? 103.913 172.687 148.052 1.00 390.00 ? 478 ASN A O   1 
ATOM 3478  C CB  . ASN A 1 478 ? 101.439 170.930 146.669 1.00 500.00 ? 478 ASN A CB  1 
ATOM 3479  C CG  . ASN A 1 478 ? 100.839 170.297 145.415 1.00 500.00 ? 478 ASN A CG  1 
ATOM 3480  O OD1 . ASN A 1 478 ? 100.911 170.867 144.319 1.00 500.00 ? 478 ASN A OD1 1 
ATOM 3481  N ND2 . ASN A 1 478 ? 100.257 169.102 145.573 1.00 500.00 ? 478 ASN A ND2 1 
ATOM 3482  N N   . PHE A 1 479 ? 103.534 170.632 148.936 1.00 446.55 ? 479 PHE A N   1 
ATOM 3483  C CA  . PHE A 1 479 ? 104.048 170.936 150.269 1.00 442.95 ? 479 PHE A CA  1 
ATOM 3484  C C   . PHE A 1 479 ? 105.554 171.175 150.250 1.00 459.35 ? 479 PHE A C   1 
ATOM 3485  O O   . PHE A 1 479 ? 106.338 170.255 150.009 1.00 451.63 ? 479 PHE A O   1 
ATOM 3486  C CB  . PHE A 1 479 ? 103.727 169.802 151.247 1.00 464.14 ? 479 PHE A CB  1 
ATOM 3487  C CG  . PHE A 1 479 ? 104.409 169.942 152.583 1.00 500.00 ? 479 PHE A CG  1 
ATOM 3488  C CD1 . PHE A 1 479 ? 103.965 170.881 153.507 1.00 500.00 ? 479 PHE A CD1 1 
ATOM 3489  C CD2 . PHE A 1 479 ? 105.504 169.137 152.921 1.00 500.00 ? 479 PHE A CD2 1 
ATOM 3490  C CE1 . PHE A 1 479 ? 104.594 171.016 154.744 1.00 500.00 ? 479 PHE A CE1 1 
ATOM 3491  C CE2 . PHE A 1 479 ? 106.137 169.268 154.156 1.00 500.00 ? 479 PHE A CE2 1 
ATOM 3492  C CZ  . PHE A 1 479 ? 105.682 170.207 155.069 1.00 500.00 ? 479 PHE A CZ  1 
ATOM 3493  N N   . VAL A 1 480 ? 105.949 172.414 150.529 1.00 500.00 ? 480 VAL A N   1 
ATOM 3494  C CA  . VAL A 1 480 ? 107.365 172.788 150.642 1.00 500.00 ? 480 VAL A CA  1 
ATOM 3495  C C   . VAL A 1 480 ? 108.009 172.216 151.921 1.00 490.00 ? 480 VAL A C   1 
ATOM 3496  O O   . VAL A 1 480 ? 107.350 171.538 152.706 1.00 433.20 ? 480 VAL A O   1 
ATOM 3497  C CB  . VAL A 1 480 ? 107.561 174.336 150.571 1.00 500.00 ? 480 VAL A CB  1 
ATOM 3498  C CG1 . VAL A 1 480 ? 107.137 174.876 149.206 1.00 500.00 ? 480 VAL A CG1 1 
ATOM 3499  C CG2 . VAL A 1 480 ? 106.812 175.065 151.692 1.00 500.00 ? 480 VAL A CG2 1 
ATOM 3500  N N   . THR A 1 481 ? 109.300 172.471 152.105 1.00 493.70 ? 481 THR A N   1 
ATOM 3501  C CA  . THR A 1 481 ? 109.962 172.277 153.403 1.00 485.57 ? 481 THR A CA  1 
ATOM 3502  C C   . THR A 1 481 ? 111.074 173.311 153.615 1.00 457.45 ? 481 THR A C   1 
ATOM 3503  O O   . THR A 1 481 ? 111.518 173.969 152.672 1.00 436.78 ? 481 THR A O   1 
ATOM 3504  C CB  . THR A 1 481 ? 110.485 170.833 153.595 1.00 464.99 ? 481 THR A CB  1 
ATOM 3505  O OG1 . THR A 1 481 ? 111.352 170.780 154.738 1.00 438.92 ? 481 THR A OG1 1 
ATOM 3506  C CG2 . THR A 1 481 ? 111.217 170.329 152.348 1.00 433.78 ? 481 THR A CG2 1 
ATOM 3507  N N   . ASP A 1 482 ? 111.507 173.436 154.865 1.00 463.71 ? 482 ASP A N   1 
ATOM 3508  C CA  . ASP A 1 482 ? 112.369 174.533 155.317 1.00 500.00 ? 482 ASP A CA  1 
ATOM 3509  C C   . ASP A 1 482 ? 113.566 174.669 154.371 1.00 500.00 ? 482 ASP A C   1 
ATOM 3510  O O   . ASP A 1 482 ? 113.920 175.774 153.912 1.00 500.00 ? 482 ASP A O   1 
ATOM 3511  C CB  . ASP A 1 482 ? 112.838 174.260 156.773 1.00 500.00 ? 482 ASP A CB  1 
ATOM 3512  C CG  . ASP A 1 482 ? 113.269 175.537 157.532 1.00 500.00 ? 482 ASP A CG  1 
ATOM 3513  O OD1 . ASP A 1 482 ? 114.394 176.038 157.291 1.00 500.00 ? 482 ASP A OD1 1 
ATOM 3514  O OD2 . ASP A 1 482 ? 112.490 176.015 158.398 1.00 500.00 ? 482 ASP A OD2 1 
ATOM 3515  N N   . THR A 1 483 ? 114.176 173.506 154.117 1.00 441.97 ? 483 THR A N   1 
ATOM 3516  C CA  . THR A 1 483 ? 115.366 173.431 153.257 1.00 440.83 ? 483 THR A CA  1 
ATOM 3517  C C   . THR A 1 483 ? 115.033 173.943 151.870 1.00 396.36 ? 483 THR A C   1 
ATOM 3518  O O   . THR A 1 483 ? 115.819 174.720 151.302 1.00 425.36 ? 483 THR A O   1 
ATOM 3519  C CB  . THR A 1 483 ? 116.061 172.050 153.258 1.00 470.73 ? 483 THR A CB  1 
ATOM 3520  O OG1 . THR A 1 483 ? 117.329 172.151 152.595 1.00 447.48 ? 483 THR A OG1 1 
ATOM 3521  C CG2 . THR A 1 483 ? 115.225 170.993 152.581 1.00 500.00 ? 483 THR A CG2 1 
ATOM 3522  N N   . ALA A 1 484 ? 113.877 173.519 151.361 1.00 413.24 ? 484 ALA A N   1 
ATOM 3523  C CA  . ALA A 1 484 ? 113.418 173.931 150.030 1.00 437.48 ? 484 ALA A CA  1 
ATOM 3524  C C   . ALA A 1 484 ? 113.283 175.445 149.963 1.00 427.41 ? 484 ALA A C   1 
ATOM 3525  O O   . ALA A 1 484 ? 113.727 176.071 148.995 1.00 417.44 ? 484 ALA A O   1 
ATOM 3526  C CB  . ALA A 1 484 ? 112.104 173.271 149.649 1.00 479.51 ? 484 ALA A CB  1 
ATOM 3527  N N   . LYS A 1 485 ? 112.672 175.990 151.008 1.00 432.97 ? 485 LYS A N   1 
ATOM 3528  C CA  . LYS A 1 485 ? 112.456 177.439 151.129 1.00 450.16 ? 485 LYS A CA  1 
ATOM 3529  C C   . LYS A 1 485 ? 113.786 178.176 151.075 1.00 441.89 ? 485 LYS A C   1 
ATOM 3530  O O   . LYS A 1 485 ? 113.933 179.178 150.358 1.00 399.61 ? 485 LYS A O   1 
ATOM 3531  C CB  . LYS A 1 485 ? 111.685 177.798 152.402 1.00 478.74 ? 485 LYS A CB  1 
ATOM 3532  C CG  . LYS A 1 485 ? 110.206 177.473 152.288 1.00 500.00 ? 485 LYS A CG  1 
ATOM 3533  C CD  . LYS A 1 485 ? 109.404 177.979 153.478 1.00 500.00 ? 485 LYS A CD  1 
ATOM 3534  C CE  . LYS A 1 485 ? 109.543 177.071 154.689 1.00 500.00 ? 485 LYS A CE  1 
ATOM 3535  N NZ  . LYS A 1 485 ? 108.505 177.354 155.720 1.00 500.00 ? 485 LYS A NZ  1 
ATOM 3536  N N   . ALA A 1 486 ? 114.732 177.649 151.843 1.00 482.73 ? 486 ALA A N   1 
ATOM 3537  C CA  . ALA A 1 486 ? 116.089 178.207 151.932 1.00 500.00 ? 486 ALA A CA  1 
ATOM 3538  C C   . ALA A 1 486 ? 116.730 178.250 150.543 1.00 434.71 ? 486 ALA A C   1 
ATOM 3539  O O   . ALA A 1 486 ? 117.320 179.256 150.139 1.00 428.07 ? 486 ALA A O   1 
ATOM 3540  C CB  . ALA A 1 486 ? 116.952 177.375 152.883 1.00 500.00 ? 486 ALA A CB  1 
ATOM 3541  N N   . LEU A 1 487 ? 116.598 177.121 149.860 1.00 415.07 ? 487 LEU A N   1 
ATOM 3542  C CA  . LEU A 1 487 ? 117.142 176.945 148.508 1.00 440.26 ? 487 LEU A CA  1 
ATOM 3543  C C   . LEU A 1 487 ? 116.576 177.971 147.578 1.00 417.78 ? 487 LEU A C   1 
ATOM 3544  O O   . LEU A 1 487 ? 117.278 178.544 146.765 1.00 399.15 ? 487 LEU A O   1 
ATOM 3545  C CB  . LEU A 1 487 ? 116.898 175.541 147.937 1.00 453.07 ? 487 LEU A CB  1 
ATOM 3546  C CG  . LEU A 1 487 ? 118.193 174.764 147.693 1.00 467.85 ? 487 LEU A CG  1 
ATOM 3547  C CD1 . LEU A 1 487 ? 118.779 174.235 148.996 1.00 486.32 ? 487 LEU A CD1 1 
ATOM 3548  C CD2 . LEU A 1 487 ? 117.957 173.647 146.686 1.00 465.52 ? 487 LEU A CD2 1 
ATOM 3549  N N   . ALA A 1 488 ? 115.259 178.166 147.665 1.00 435.96 ? 488 ALA A N   1 
ATOM 3550  C CA  . ALA A 1 488 ? 114.501 179.118 146.853 1.00 476.18 ? 488 ALA A CA  1 
ATOM 3551  C C   . ALA A 1 488 ? 115.057 180.483 147.050 1.00 444.60 ? 488 ALA A C   1 
ATOM 3552  O O   . ALA A 1 488 ? 115.219 181.151 146.037 1.00 411.72 ? 488 ALA A O   1 
ATOM 3553  C CB  . ALA A 1 488 ? 113.027 179.115 147.245 1.00 500.00 ? 488 ALA A CB  1 
ATOM 3554  N N   . ASP A 1 489 ? 115.341 180.878 148.289 1.00 500.00 ? 489 ASP A N   1 
ATOM 3555  C CA  . ASP A 1 489 ? 115.891 182.199 148.588 1.00 500.00 ? 489 ASP A CA  1 
ATOM 3556  C C   . ASP A 1 489 ? 117.206 182.421 147.815 1.00 448.29 ? 489 ASP A C   1 
ATOM 3557  O O   . ASP A 1 489 ? 117.429 183.462 147.168 1.00 362.98 ? 489 ASP A O   1 
ATOM 3558  C CB  . ASP A 1 489 ? 116.085 182.406 150.109 1.00 500.00 ? 489 ASP A CB  1 
ATOM 3559  C CG  . ASP A 1 489 ? 114.759 182.339 150.907 1.00 500.00 ? 489 ASP A CG  1 
ATOM 3560  O OD1 . ASP A 1 489 ? 113.727 182.868 150.435 1.00 500.00 ? 489 ASP A OD1 1 
ATOM 3561  O OD2 . ASP A 1 489 ? 114.756 181.763 152.019 1.00 500.00 ? 489 ASP A OD2 1 
ATOM 3562  N N   . VAL A 1 490 ? 118.044 181.390 147.919 1.00 405.67 ? 490 VAL A N   1 
ATOM 3563  C CA  . VAL A 1 490 ? 119.360 181.378 147.273 1.00 433.57 ? 490 VAL A CA  1 
ATOM 3564  C C   . VAL A 1 490 ? 119.208 181.564 145.768 1.00 400.39 ? 490 VAL A C   1 
ATOM 3565  O O   . VAL A 1 490 ? 119.918 182.365 145.140 1.00 399.88 ? 490 VAL A O   1 
ATOM 3566  C CB  . VAL A 1 490 ? 120.096 180.029 147.477 1.00 436.98 ? 490 VAL A CB  1 
ATOM 3567  C CG1 . VAL A 1 490 ? 121.453 180.047 146.772 1.00 484.59 ? 490 VAL A CG1 1 
ATOM 3568  C CG2 . VAL A 1 490 ? 120.236 179.685 148.961 1.00 448.92 ? 490 VAL A CG2 1 
ATOM 3569  N N   . ALA A 1 491 ? 118.275 180.801 145.221 1.00 367.87 ? 491 ALA A N   1 
ATOM 3570  C CA  . ALA A 1 491 ? 117.963 180.817 143.788 1.00 458.86 ? 491 ALA A CA  1 
ATOM 3571  C C   . ALA A 1 491 ? 117.560 182.205 143.358 1.00 443.12 ? 491 ALA A C   1 
ATOM 3572  O O   . ALA A 1 491 ? 118.023 182.703 142.342 1.00 392.47 ? 491 ALA A O   1 
ATOM 3573  C CB  . ALA A 1 491 ? 116.865 179.826 143.478 1.00 500.00 ? 491 ALA A CB  1 
ATOM 3574  N N   . THR A 1 492 ? 116.688 182.805 144.151 1.00 438.16 ? 492 THR A N   1 
ATOM 3575  C CA  . THR A 1 492 ? 116.167 184.163 143.922 1.00 458.47 ? 492 THR A CA  1 
ATOM 3576  C C   . THR A 1 492 ? 117.325 185.148 143.845 1.00 425.51 ? 492 THR A C   1 
ATOM 3577  O O   . THR A 1 492 ? 117.393 185.986 142.919 1.00 478.74 ? 492 THR A O   1 
ATOM 3578  C CB  . THR A 1 492 ? 115.276 184.581 145.127 1.00 448.91 ? 492 THR A CB  1 
ATOM 3579  O OG1 . THR A 1 492 ? 114.085 183.784 145.155 1.00 461.67 ? 492 THR A OG1 1 
ATOM 3580  C CG2 . THR A 1 492 ? 114.895 186.056 145.088 1.00 497.89 ? 492 THR A CG2 1 
ATOM 3581  N N   . VAL A 1 493 ? 118.210 185.020 144.832 1.00 389.17 ? 493 VAL A N   1 
ATOM 3582  C CA  . VAL A 1 493 ? 119.393 185.878 144.947 1.00 432.38 ? 493 VAL A CA  1 
ATOM 3583  C C   . VAL A 1 493 ? 120.240 185.780 143.672 1.00 428.71 ? 493 VAL A C   1 
ATOM 3584  O O   . VAL A 1 493 ? 120.671 186.802 143.095 1.00 475.37 ? 493 VAL A O   1 
ATOM 3585  C CB  . VAL A 1 493 ? 120.272 185.481 146.163 1.00 459.05 ? 493 VAL A CB  1 
ATOM 3586  C CG1 . VAL A 1 493 ? 121.684 186.073 146.085 1.00 406.84 ? 493 VAL A CG1 1 
ATOM 3587  C CG2 . VAL A 1 493 ? 119.591 185.899 147.455 1.00 500.00 ? 493 VAL A CG2 1 
ATOM 3588  N N   . LEU A 1 494 ? 120.452 184.532 143.273 1.00 400.49 ? 494 LEU A N   1 
ATOM 3589  C CA  . LEU A 1 494 ? 121.242 184.205 142.085 1.00 444.62 ? 494 LEU A CA  1 
ATOM 3590  C C   . LEU A 1 494 ? 120.653 184.871 140.855 1.00 431.99 ? 494 LEU A C   1 
ATOM 3591  O O   . LEU A 1 494 ? 121.370 185.480 140.050 1.00 426.37 ? 494 LEU A O   1 
ATOM 3592  C CB  . LEU A 1 494 ? 121.250 182.694 141.869 1.00 423.58 ? 494 LEU A CB  1 
ATOM 3593  C CG  . LEU A 1 494 ? 122.364 182.273 140.910 1.00 452.64 ? 494 LEU A CG  1 
ATOM 3594  C CD1 . LEU A 1 494 ? 123.514 181.716 141.726 1.00 462.02 ? 494 LEU A CD1 1 
ATOM 3595  C CD2 . LEU A 1 494 ? 121.872 181.261 139.892 1.00 476.58 ? 494 LEU A CD2 1 
ATOM 3596  N N   . GLY A 1 495 ? 119.339 184.737 140.741 1.00 383.55 ? 495 GLY A N   1 
ATOM 3597  C CA  . GLY A 1 495 ? 118.569 185.303 139.624 1.00 448.14 ? 495 GLY A CA  1 
ATOM 3598  C C   . GLY A 1 495 ? 118.770 186.799 139.558 1.00 439.51 ? 495 GLY A C   1 
ATOM 3599  O O   . GLY A 1 495 ? 119.023 187.357 138.476 1.00 401.63 ? 495 GLY A O   1 
ATOM 3600  N N   . ARG A 1 496 ? 118.655 187.422 140.730 1.00 483.12 ? 496 ARG A N   1 
ATOM 3601  C CA  . ARG A 1 496 ? 118.807 188.877 140.869 1.00 495.36 ? 496 ARG A CA  1 
ATOM 3602  C C   . ARG A 1 496 ? 120.185 189.305 140.372 1.00 458.34 ? 496 ARG A C   1 
ATOM 3603  O O   . ARG A 1 496 ? 120.312 190.282 139.600 1.00 425.07 ? 496 ARG A O   1 
ATOM 3604  C CB  . ARG A 1 496 ? 118.539 189.369 142.298 1.00 500.00 ? 496 ARG A CB  1 
ATOM 3605  C CG  . ARG A 1 496 ? 117.063 189.582 142.555 1.00 466.23 ? 496 ARG A CG  1 
ATOM 3606  C CD  . ARG A 1 496 ? 116.723 189.743 144.015 1.00 473.41 ? 496 ARG A CD  1 
ATOM 3607  N NE  . ARG A 1 496 ? 115.271 189.772 144.201 1.00 500.00 ? 496 ARG A NE  1 
ATOM 3608  C CZ  . ARG A 1 496 ? 114.642 190.127 145.326 1.00 500.00 ? 496 ARG A CZ  1 
ATOM 3609  N NH1 . ARG A 1 496 ? 113.308 190.114 145.369 1.00 500.00 ? 496 ARG A NH1 1 
ATOM 3610  N NH2 . ARG A 1 496 ? 115.327 190.498 146.413 1.00 500.00 ? 496 ARG A NH2 1 
ATOM 3611  N N   . ALA A 1 497 ? 121.184 188.551 140.826 1.00 461.80 ? 497 ALA A N   1 
ATOM 3612  C CA  . ALA A 1 497 ? 122.582 188.803 140.472 1.00 495.44 ? 497 ALA A CA  1 
ATOM 3613  C C   . ALA A 1 497 ? 122.759 188.753 138.954 1.00 464.10 ? 497 ALA A C   1 
ATOM 3614  O O   . ALA A 1 497 ? 123.397 189.634 138.354 1.00 472.45 ? 497 ALA A O   1 
ATOM 3615  C CB  . ALA A 1 497 ? 123.497 187.790 141.144 1.00 500.00 ? 497 ALA A CB  1 
ATOM 3616  N N   . LEU A 1 498 ? 122.178 187.713 138.376 1.00 424.19 ? 498 LEU A N   1 
ATOM 3617  C CA  . LEU A 1 498 ? 122.239 187.472 136.932 1.00 447.83 ? 498 LEU A CA  1 
ATOM 3618  C C   . LEU A 1 498 ? 121.644 188.653 136.179 1.00 445.08 ? 498 LEU A C   1 
ATOM 3619  O O   . LEU A 1 498 ? 122.232 189.140 135.201 1.00 423.04 ? 498 LEU A O   1 
ATOM 3620  C CB  . LEU A 1 498 ? 121.625 186.115 136.605 1.00 435.42 ? 498 LEU A CB  1 
ATOM 3621  C CG  . LEU A 1 498 ? 122.451 184.978 137.250 1.00 425.80 ? 498 LEU A CG  1 
ATOM 3622  C CD1 . LEU A 1 498 ? 121.624 183.718 137.432 1.00 443.23 ? 498 LEU A CD1 1 
ATOM 3623  C CD2 . LEU A 1 498 ? 123.714 184.669 136.464 1.00 457.02 ? 498 LEU A CD2 1 
ATOM 3624  N N   . TYR A 1 499 ? 120.489 189.091 136.664 1.00 449.06 ? 499 TYR A N   1 
ATOM 3625  C CA  . TYR A 1 499 ? 119.757 190.219 136.077 1.00 482.09 ? 499 TYR A CA  1 
ATOM 3626  C C   . TYR A 1 499 ? 120.635 191.467 136.085 1.00 449.29 ? 499 TYR A C   1 
ATOM 3627  O O   . TYR A 1 499 ? 120.737 192.182 135.066 1.00 417.14 ? 499 TYR A O   1 
ATOM 3628  C CB  . TYR A 1 499 ? 118.421 190.444 136.800 1.00 500.00 ? 499 TYR A CB  1 
ATOM 3629  C CG  . TYR A 1 499 ? 117.519 191.491 136.159 1.00 500.00 ? 499 TYR A CG  1 
ATOM 3630  C CD1 . TYR A 1 499 ? 116.970 191.297 134.882 1.00 500.00 ? 499 TYR A CD1 1 
ATOM 3631  C CD2 . TYR A 1 499 ? 117.196 192.675 136.843 1.00 500.00 ? 499 TYR A CD2 1 
ATOM 3632  C CE1 . TYR A 1 499 ? 116.143 192.259 134.307 1.00 500.00 ? 499 TYR A CE1 1 
ATOM 3633  C CE2 . TYR A 1 499 ? 116.369 193.640 136.274 1.00 500.00 ? 499 TYR A CE2 1 
ATOM 3634  C CZ  . TYR A 1 499 ? 115.846 193.432 135.011 1.00 500.00 ? 499 TYR A CZ  1 
ATOM 3635  O OH  . TYR A 1 499 ? 115.029 194.400 134.469 1.00 500.00 ? 499 TYR A OH  1 
ATOM 3636  N N   . GLU A 1 500 ? 121.257 191.691 137.239 1.00 463.97 ? 500 GLU A N   1 
ATOM 3637  C CA  . GLU A 1 500 ? 122.138 192.842 137.443 1.00 500.00 ? 500 GLU A CA  1 
ATOM 3638  C C   . GLU A 1 500 ? 123.283 192.818 136.431 1.00 474.30 ? 500 GLU A C   1 
ATOM 3639  O O   . GLU A 1 500 ? 123.604 193.838 135.808 1.00 452.62 ? 500 GLU A O   1 
ATOM 3640  C CB  . GLU A 1 500 ? 122.634 192.924 138.892 1.00 500.00 ? 500 GLU A CB  1 
ATOM 3641  C CG  . GLU A 1 500 ? 122.771 194.354 139.422 1.00 500.00 ? 500 GLU A CG  1 
ATOM 3642  C CD  . GLU A 1 500 ? 122.551 194.459 140.927 1.00 500.00 ? 500 GLU A CD  1 
ATOM 3643  O OE1 . GLU A 1 500 ? 121.422 194.169 141.391 1.00 500.00 ? 500 GLU A OE1 1 
ATOM 3644  O OE2 . GLU A 1 500 ? 123.505 194.837 141.645 1.00 500.00 ? 500 GLU A OE2 1 
ATOM 3645  N N   . LEU A 1 501 ? 123.864 191.634 136.295 1.00 445.12 ? 501 LEU A N   1 
ATOM 3646  C CA  . LEU A 1 501 ? 124.979 191.396 135.372 1.00 446.31 ? 501 LEU A CA  1 
ATOM 3647  C C   . LEU A 1 501 ? 124.572 191.746 133.951 1.00 417.29 ? 501 LEU A C   1 
ATOM 3648  O O   . LEU A 1 501 ? 125.299 192.438 133.221 1.00 414.24 ? 501 LEU A O   1 
ATOM 3649  C CB  . LEU A 1 501 ? 125.465 189.940 135.444 1.00 479.32 ? 501 LEU A CB  1 
ATOM 3650  C CG  . LEU A 1 501 ? 126.656 189.623 136.359 1.00 500.00 ? 501 LEU A CG  1 
ATOM 3651  C CD1 . LEU A 1 501 ? 127.869 190.456 135.955 1.00 500.00 ? 501 LEU A CD1 1 
ATOM 3652  C CD2 . LEU A 1 501 ? 126.339 189.811 137.836 1.00 500.00 ? 501 LEU A CD2 1 
ATOM 3653  N N   . ALA A 1 502 ? 123.387 191.269 133.587 1.00 396.46 ? 502 ALA A N   1 
ATOM 3654  C CA  . ALA A 1 502 ? 122.810 191.476 132.256 1.00 444.98 ? 502 ALA A CA  1 
ATOM 3655  C C   . ALA A 1 502 ? 122.483 192.907 131.856 1.00 500.00 ? 502 ALA A C   1 
ATOM 3656  O O   . ALA A 1 502 ? 122.151 193.131 130.696 1.00 500.00 ? 502 ALA A O   1 
ATOM 3657  C CB  . ALA A 1 502 ? 121.571 190.611 132.104 1.00 491.63 ? 502 ALA A CB  1 
ATOM 3658  N N   . GLY A 1 503 ? 122.594 193.869 132.773 1.00 500.00 ? 503 GLY A N   1 
ATOM 3659  C CA  . GLY A 1 503 ? 122.124 195.241 132.543 1.00 500.00 ? 503 GLY A CA  1 
ATOM 3660  C C   . GLY A 1 503 ? 120.730 195.482 133.102 1.00 500.00 ? 503 GLY A C   1 
ATOM 3661  O O   . GLY A 1 503 ? 119.964 196.293 132.562 1.00 500.00 ? 503 GLY A O   1 
ATOM 3662  N N   . GLY A 1 504 ? 120.408 194.775 134.186 1.00 500.00 ? 504 GLY A N   1 
ATOM 3663  C CA  . GLY A 1 504 ? 119.141 194.932 134.872 1.00 500.00 ? 504 GLY A CA  1 
ATOM 3664  C C   . GLY A 1 504 ? 119.179 196.166 135.751 1.00 500.00 ? 504 GLY A C   1 
ATOM 3665  O O   . GLY A 1 504 ? 120.108 196.336 136.550 1.00 500.00 ? 504 GLY A O   1 
ATOM 3666  N N   . THR A 1 505 ? 118.165 197.021 135.593 1.00 500.00 ? 505 THR A N   1 
ATOM 3667  C CA  . THR A 1 505 ? 118.054 198.308 136.310 1.00 500.00 ? 505 THR A CA  1 
ATOM 3668  C C   . THR A 1 505 ? 116.670 198.500 136.946 1.00 500.00 ? 505 THR A C   1 
ATOM 3669  O O   . THR A 1 505 ? 116.551 198.663 138.168 1.00 500.00 ? 505 THR A O   1 
ATOM 3670  C CB  . THR A 1 505 ? 118.339 199.503 135.361 1.00 500.00 ? 505 THR A CB  1 
ATOM 3671  O OG1 . THR A 1 505 ? 117.430 199.482 134.250 1.00 500.00 ? 505 THR A OG1 1 
ATOM 3672  C CG2 . THR A 1 505 ? 119.771 199.443 134.845 1.00 500.00 ? 505 THR A CG2 1 
ATOM 3673  N N   . ASN A 1 506 ? 115.636 198.461 136.103 1.00 500.00 ? 506 ASN A N   1 
ATOM 3674  C CA  . ASN A 1 506 ? 114.286 198.881 136.488 1.00 500.00 ? 506 ASN A CA  1 
ATOM 3675  C C   . ASN A 1 506 ? 113.517 197.833 137.313 1.00 500.00 ? 506 ASN A C   1 
ATOM 3676  O O   . ASN A 1 506 ? 112.820 198.203 138.261 1.00 500.00 ? 506 ASN A O   1 
ATOM 3677  C CB  . ASN A 1 506 ? 113.483 199.302 135.232 1.00 500.00 ? 506 ASN A CB  1 
ATOM 3678  C CG  . ASN A 1 506 ? 112.667 200.587 135.438 1.00 500.00 ? 506 ASN A CG  1 
ATOM 3679  O OD1 . ASN A 1 506 ? 111.557 200.527 135.979 1.00 465.08 ? 506 ASN A OD1 1 
ATOM 3680  N ND2 . ASN A 1 506 ? 113.189 201.757 134.999 1.00 500.00 ? 506 ASN A ND2 1 
ATOM 3681  N N   . PHE A 1 507 ? 113.658 196.546 136.980 1.00 500.00 ? 507 PHE A N   1 
ATOM 3682  C CA  . PHE A 1 507 ? 112.793 195.503 137.555 1.00 500.00 ? 507 PHE A CA  1 
ATOM 3683  C C   . PHE A 1 507 ? 113.547 194.402 138.283 1.00 486.30 ? 507 PHE A C   1 
ATOM 3684  O O   . PHE A 1 507 ? 113.290 193.215 138.056 1.00 500.00 ? 507 PHE A O   1 
ATOM 3685  C CB  . PHE A 1 507 ? 111.919 194.897 136.455 1.00 500.00 ? 507 PHE A CB  1 
ATOM 3686  C CG  . PHE A 1 507 ? 111.068 195.905 135.740 1.00 500.00 ? 507 PHE A CG  1 
ATOM 3687  C CD1 . PHE A 1 507 ? 109.902 196.400 136.333 1.00 500.00 ? 507 PHE A CD1 1 
ATOM 3688  C CD2 . PHE A 1 507 ? 111.426 196.374 134.479 1.00 500.00 ? 507 PHE A CD2 1 
ATOM 3689  C CE1 . PHE A 1 507 ? 109.109 197.339 135.678 1.00 500.00 ? 507 PHE A CE1 1 
ATOM 3690  C CE2 . PHE A 1 507 ? 110.637 197.312 133.816 1.00 500.00 ? 507 PHE A CE2 1 
ATOM 3691  C CZ  . PHE A 1 507 ? 109.477 197.794 134.417 1.00 500.00 ? 507 PHE A CZ  1 
ATOM 3692  N N   . SER A 1 508 ? 114.448 194.788 139.186 1.00 478.35 ? 508 SER A N   1 
ATOM 3693  C CA  . SER A 1 508 ? 115.208 193.814 139.986 1.00 500.00 ? 508 SER A CA  1 
ATOM 3694  C C   . SER A 1 508 ? 114.466 193.285 141.236 1.00 459.82 ? 508 SER A C   1 
ATOM 3695  O O   . SER A 1 508 ? 115.018 192.463 141.970 1.00 421.99 ? 508 SER A O   1 
ATOM 3696  C CB  . SER A 1 508 ? 116.581 194.385 140.375 1.00 500.00 ? 508 SER A CB  1 
ATOM 3697  O OG  . SER A 1 508 ? 116.466 195.433 141.318 1.00 500.00 ? 508 SER A OG  1 
ATOM 3698  N N   . ASP A 1 509 ? 113.237 193.752 141.472 1.00 466.97 ? 509 ASP A N   1 
ATOM 3699  C CA  . ASP A 1 509 ? 112.402 193.282 142.592 1.00 500.00 ? 509 ASP A CA  1 
ATOM 3700  C C   . ASP A 1 509 ? 111.570 192.052 142.223 1.00 486.63 ? 509 ASP A C   1 
ATOM 3701  O O   . ASP A 1 509 ? 111.412 191.123 143.026 1.00 406.93 ? 509 ASP A O   1 
ATOM 3702  C CB  . ASP A 1 509 ? 111.444 194.390 143.049 1.00 500.00 ? 509 ASP A CB  1 
ATOM 3703  C CG  . ASP A 1 509 ? 112.170 195.647 143.503 1.00 500.00 ? 509 ASP A CG  1 
ATOM 3704  O OD1 . ASP A 1 509 ? 113.031 195.549 144.406 1.00 500.00 ? 509 ASP A OD1 1 
ATOM 3705  O OD2 . ASP A 1 509 ? 111.871 196.733 142.962 1.00 500.00 ? 509 ASP A OD2 1 
ATOM 3706  N N   . THR A 1 510 ? 111.022 192.082 141.010 1.00 500.00 ? 510 THR A N   1 
ATOM 3707  C CA  . THR A 1 510 ? 110.124 191.043 140.507 1.00 500.00 ? 510 THR A CA  1 
ATOM 3708  C C   . THR A 1 510 ? 110.767 189.662 140.619 1.00 500.00 ? 510 THR A C   1 
ATOM 3709  O O   . THR A 1 510 ? 110.226 188.751 141.264 1.00 429.54 ? 510 THR A O   1 
ATOM 3710  C CB  . THR A 1 510 ? 109.727 191.318 139.029 1.00 500.00 ? 510 THR A CB  1 
ATOM 3711  O OG1 . THR A 1 510 ? 110.903 191.526 138.230 1.00 500.00 ? 510 THR A OG1 1 
ATOM 3712  C CG2 . THR A 1 510 ? 108.819 192.550 138.916 1.00 500.00 ? 510 THR A CG2 1 
ATOM 3713  N N   . VAL A 1 511 ? 111.925 189.542 139.977 1.00 497.45 ? 511 VAL A N   1 
ATOM 3714  C CA  . VAL A 1 511 ? 112.754 188.341 140.026 1.00 472.93 ? 511 VAL A CA  1 
ATOM 3715  C C   . VAL A 1 511 ? 112.745 187.695 141.403 1.00 453.98 ? 511 VAL A C   1 
ATOM 3716  O O   . VAL A 1 511 ? 113.387 188.177 142.336 1.00 462.86 ? 511 VAL A O   1 
ATOM 3717  C CB  . VAL A 1 511 ? 114.216 188.621 139.559 1.00 477.97 ? 511 VAL A CB  1 
ATOM 3718  C CG1 . VAL A 1 511 ? 114.800 189.878 140.195 1.00 486.27 ? 511 VAL A CG1 1 
ATOM 3719  C CG2 . VAL A 1 511 ? 115.126 187.416 139.792 1.00 464.29 ? 511 VAL A CG2 1 
ATOM 3720  N N   . GLN A 1 512 ? 111.960 186.629 141.526 1.00 453.28 ? 512 GLN A N   1 
ATOM 3721  C CA  . GLN A 1 512 ? 112.135 185.681 142.617 1.00 478.55 ? 512 GLN A CA  1 
ATOM 3722  C C   . GLN A 1 512 ? 111.664 184.306 142.208 1.00 448.36 ? 512 GLN A C   1 
ATOM 3723  O O   . GLN A 1 512 ? 110.718 184.175 141.429 1.00 486.47 ? 512 GLN A O   1 
ATOM 3724  C CB  . GLN A 1 512 ? 111.425 186.129 143.896 1.00 499.07 ? 512 GLN A CB  1 
ATOM 3725  C CG  . GLN A 1 512 ? 109.903 186.123 143.871 1.00 492.58 ? 512 GLN A CG  1 
ATOM 3726  C CD  . GLN A 1 512 ? 109.313 186.079 145.268 1.00 500.00 ? 512 GLN A CD  1 
ATOM 3727  O OE1 . GLN A 1 512 ? 109.901 186.594 146.225 1.00 500.00 ? 512 GLN A OE1 1 
ATOM 3728  N NE2 . GLN A 1 512 ? 108.146 185.458 145.396 1.00 500.00 ? 512 GLN A NE2 1 
ATOM 3729  N N   . ALA A 1 513 ? 112.342 183.289 142.722 1.00 431.25 ? 513 ALA A N   1 
ATOM 3730  C CA  . ALA A 1 513 ? 111.947 181.914 142.486 1.00 468.40 ? 513 ALA A CA  1 
ATOM 3731  C C   . ALA A 1 513 ? 110.890 181.546 143.504 1.00 485.46 ? 513 ALA A C   1 
ATOM 3732  O O   . ALA A 1 513 ? 111.045 181.828 144.700 1.00 399.61 ? 513 ALA A O   1 
ATOM 3733  C CB  . ALA A 1 513 ? 113.132 180.985 142.612 1.00 500.00 ? 513 ALA A CB  1 
ATOM 3734  N N   . ASP A 1 514 ? 109.814 180.923 143.020 1.00 500.00 ? 514 ASP A N   1 
ATOM 3735  C CA  . ASP A 1 514 ? 108.770 180.420 143.907 1.00 500.00 ? 514 ASP A CA  1 
ATOM 3736  C C   . ASP A 1 514 ? 109.302 179.183 144.637 1.00 484.82 ? 514 ASP A C   1 
ATOM 3737  O O   . ASP A 1 514 ? 109.900 178.295 144.011 1.00 419.65 ? 514 ASP A O   1 
ATOM 3738  C CB  . ASP A 1 514 ? 107.424 180.162 143.186 1.00 500.00 ? 514 ASP A CB  1 
ATOM 3739  C CG  . ASP A 1 514 ? 107.486 179.041 142.171 1.00 500.00 ? 514 ASP A CG  1 
ATOM 3740  O OD1 . ASP A 1 514 ? 108.140 179.222 141.125 1.00 500.00 ? 514 ASP A OD1 1 
ATOM 3741  O OD2 . ASP A 1 514 ? 106.871 177.983 142.410 1.00 488.97 ? 514 ASP A OD2 1 
ATOM 3742  N N   . PRO A 1 515 ? 109.118 179.139 145.968 1.00 451.54 ? 515 PRO A N   1 
ATOM 3743  C CA  . PRO A 1 515 ? 109.603 177.987 146.713 1.00 478.12 ? 515 PRO A CA  1 
ATOM 3744  C C   . PRO A 1 515 ? 108.943 176.689 146.280 1.00 475.65 ? 515 PRO A C   1 
ATOM 3745  O O   . PRO A 1 515 ? 109.573 175.630 146.395 1.00 500.00 ? 515 PRO A O   1 
ATOM 3746  C CB  . PRO A 1 515 ? 109.218 178.293 148.169 1.00 496.99 ? 515 PRO A CB  1 
ATOM 3747  C CG  . PRO A 1 515 ? 108.829 179.727 148.201 1.00 500.00 ? 515 PRO A CG  1 
ATOM 3748  C CD  . PRO A 1 515 ? 108.365 180.072 146.829 1.00 464.17 ? 515 PRO A CD  1 
ATOM 3749  N N   . GLN A 1 516 ? 107.678 176.779 145.864 1.00 442.58 ? 516 GLN A N   1 
ATOM 3750  C CA  . GLN A 1 516 ? 106.884 175.637 145.478 1.00 486.97 ? 516 GLN A CA  1 
ATOM 3751  C C   . GLN A 1 516 ? 107.577 174.845 144.362 1.00 472.08 ? 516 GLN A C   1 
ATOM 3752  O O   . GLN A 1 516 ? 107.694 173.611 144.420 1.00 465.34 ? 516 GLN A O   1 
ATOM 3753  C CB  . GLN A 1 516 ? 105.513 176.130 145.007 1.00 500.00 ? 516 GLN A CB  1 
ATOM 3754  C CG  . GLN A 1 516 ? 104.447 175.063 144.823 1.00 500.00 ? 516 GLN A CG  1 
ATOM 3755  C CD  . GLN A 1 516 ? 103.158 175.619 144.218 1.00 500.00 ? 516 GLN A CD  1 
ATOM 3756  O OE1 . GLN A 1 516 ? 103.184 176.442 143.294 1.00 500.00 ? 516 GLN A OE1 1 
ATOM 3757  N NE2 . GLN A 1 516 ? 102.019 175.162 144.736 1.00 500.00 ? 516 GLN A NE2 1 
ATOM 3758  N N   . THR A 1 517 ? 108.018 175.603 143.370 1.00 440.32 ? 517 THR A N   1 
ATOM 3759  C CA  . THR A 1 517 ? 108.712 175.064 142.199 1.00 427.24 ? 517 THR A CA  1 
ATOM 3760  C C   . THR A 1 517 ? 109.950 174.282 142.631 1.00 409.14 ? 517 THR A C   1 
ATOM 3761  O O   . THR A 1 517 ? 110.198 173.152 142.173 1.00 445.27 ? 517 THR A O   1 
ATOM 3762  C CB  . THR A 1 517 ? 109.153 176.213 141.274 1.00 430.50 ? 517 THR A CB  1 
ATOM 3763  O OG1 . THR A 1 517 ? 108.083 176.519 140.370 1.00 432.50 ? 517 THR A OG1 1 
ATOM 3764  C CG2 . THR A 1 517 ? 110.413 175.887 140.478 1.00 465.14 ? 517 THR A CG2 1 
ATOM 3765  N N   . VAL A 1 518 ? 110.704 174.925 143.515 1.00 375.89 ? 518 VAL A N   1 
ATOM 3766  C CA  . VAL A 1 518 ? 111.945 174.361 144.062 1.00 408.84 ? 518 VAL A CA  1 
ATOM 3767  C C   . VAL A 1 518 ? 111.657 173.027 144.741 1.00 406.60 ? 518 VAL A C   1 
ATOM 3768  O O   . VAL A 1 518 ? 112.371 172.033 144.523 1.00 409.23 ? 518 VAL A O   1 
ATOM 3769  C CB  . VAL A 1 518 ? 112.602 175.327 145.066 1.00 454.85 ? 518 VAL A CB  1 
ATOM 3770  C CG1 . VAL A 1 518 ? 113.687 174.643 145.918 1.00 412.27 ? 518 VAL A CG1 1 
ATOM 3771  C CG2 . VAL A 1 518 ? 113.137 176.546 144.321 1.00 480.79 ? 518 VAL A CG2 1 
ATOM 3772  N N   . THR A 1 519 ? 110.605 173.047 145.554 1.00 430.33 ? 519 THR A N   1 
ATOM 3773  C CA  . THR A 1 519 ? 110.170 171.862 146.305 1.00 433.26 ? 519 THR A CA  1 
ATOM 3774  C C   . THR A 1 519 ? 109.848 170.727 145.356 1.00 382.36 ? 519 THR A C   1 
ATOM 3775  O O   . THR A 1 519 ? 110.266 169.582 145.575 1.00 419.85 ? 519 THR A O   1 
ATOM 3776  C CB  . THR A 1 519 ? 109.085 172.069 147.415 1.00 485.17 ? 519 THR A CB  1 
ATOM 3777  O OG1 . THR A 1 519 ? 109.221 171.027 148.393 1.00 460.16 ? 519 THR A OG1 1 
ATOM 3778  C CG2 . THR A 1 519 ? 107.622 172.073 146.919 1.00 466.72 ? 519 THR A CG2 1 
ATOM 3779  N N   . ARG A 1 520 ? 109.110 171.072 144.311 1.00 381.24 ? 520 ARG A N   1 
ATOM 3780  C CA  . ARG A 1 520 ? 108.689 170.125 143.268 1.00 435.03 ? 520 ARG A CA  1 
ATOM 3781  C C   . ARG A 1 520 ? 109.916 169.467 142.644 1.00 399.89 ? 520 ARG A C   1 
ATOM 3782  O O   . ARG A 1 520 ? 109.971 168.234 142.480 1.00 361.16 ? 520 ARG A O   1 
ATOM 3783  C CB  . ARG A 1 520 ? 107.932 170.924 142.170 1.00 454.45 ? 520 ARG A CB  1 
ATOM 3784  C CG  . ARG A 1 520 ? 106.774 170.213 141.479 1.00 494.18 ? 520 ARG A CG  1 
ATOM 3785  C CD  . ARG A 1 520 ? 105.379 170.687 141.898 1.00 480.69 ? 520 ARG A CD  1 
ATOM 3786  N NE  . ARG A 1 520 ? 104.755 171.575 140.912 1.00 484.59 ? 520 ARG A NE  1 
ATOM 3787  C CZ  . ARG A 1 520 ? 104.841 172.907 140.874 1.00 478.50 ? 520 ARG A CZ  1 
ATOM 3788  N NH1 . ARG A 1 520 ? 105.542 173.593 141.778 1.00 496.46 ? 520 ARG A NH1 1 
ATOM 3789  N NH2 . ARG A 1 520 ? 104.213 173.574 139.903 1.00 456.51 ? 520 ARG A NH2 1 
ATOM 3790  N N   . LEU A 1 521 ? 110.875 170.325 142.308 1.00 422.07 ? 521 LEU A N   1 
ATOM 3791  C CA  . LEU A 1 521 ? 112.130 169.898 141.681 1.00 416.29 ? 521 LEU A CA  1 
ATOM 3792  C C   . LEU A 1 521 ? 112.849 168.895 142.576 1.00 426.37 ? 521 LEU A C   1 
ATOM 3793  O O   . LEU A 1 521 ? 113.318 167.846 142.110 1.00 457.65 ? 521 LEU A O   1 
ATOM 3794  C CB  . LEU A 1 521 ? 113.071 171.070 141.369 1.00 428.30 ? 521 LEU A CB  1 
ATOM 3795  C CG  . LEU A 1 521 ? 112.771 171.893 140.113 1.00 437.54 ? 521 LEU A CG  1 
ATOM 3796  C CD1 . LEU A 1 521 ? 113.574 173.185 140.114 1.00 468.84 ? 521 LEU A CD1 1 
ATOM 3797  C CD2 . LEU A 1 521 ? 113.050 171.117 138.836 1.00 404.16 ? 521 LEU A CD2 1 
ATOM 3798  N N   . LEU A 1 522 ? 112.915 169.257 143.853 1.00 410.57 ? 522 LEU A N   1 
ATOM 3799  C CA  . LEU A 1 522 ? 113.567 168.434 144.879 1.00 423.65 ? 522 LEU A CA  1 
ATOM 3800  C C   . LEU A 1 522 ? 112.926 167.058 144.935 1.00 427.11 ? 522 LEU A C   1 
ATOM 3801  O O   . LEU A 1 522 ? 113.626 166.027 144.959 1.00 440.33 ? 522 LEU A O   1 
ATOM 3802  C CB  . LEU A 1 522 ? 113.525 169.097 146.261 1.00 429.46 ? 522 LEU A CB  1 
ATOM 3803  C CG  . LEU A 1 522 ? 114.825 169.691 146.826 1.00 468.25 ? 522 LEU A CG  1 
ATOM 3804  C CD1 . LEU A 1 522 ? 115.836 170.119 145.768 1.00 459.54 ? 522 LEU A CD1 1 
ATOM 3805  C CD2 . LEU A 1 522 ? 114.506 170.862 147.748 1.00 500.00 ? 522 LEU A CD2 1 
ATOM 3806  N N   . TYR A 1 523 ? 111.597 167.075 144.947 1.00 403.18 ? 523 TYR A N   1 
ATOM 3807  C CA  . TYR A 1 523 ? 110.791 165.851 145.007 1.00 388.76 ? 523 TYR A CA  1 
ATOM 3808  C C   . TYR A 1 523 ? 111.114 164.954 143.822 1.00 394.67 ? 523 TYR A C   1 
ATOM 3809  O O   . TYR A 1 523 ? 111.326 163.736 143.981 1.00 396.41 ? 523 TYR A O   1 
ATOM 3810  C CB  . TYR A 1 523 ? 109.288 166.158 145.085 1.00 408.66 ? 523 TYR A CB  1 
ATOM 3811  C CG  . TYR A 1 523 ? 108.457 164.955 145.488 1.00 446.81 ? 523 TYR A CG  1 
ATOM 3812  C CD1 . TYR A 1 523 ? 108.521 164.444 146.778 1.00 468.43 ? 523 TYR A CD1 1 
ATOM 3813  C CD2 . TYR A 1 523 ? 107.617 164.317 144.573 1.00 480.86 ? 523 TYR A CD2 1 
ATOM 3814  C CE1 . TYR A 1 523 ? 107.777 163.328 147.147 1.00 499.77 ? 523 TYR A CE1 1 
ATOM 3815  C CE2 . TYR A 1 523 ? 106.864 163.205 144.932 1.00 481.65 ? 523 TYR A CE2 1 
ATOM 3816  C CZ  . TYR A 1 523 ? 106.945 162.714 146.220 1.00 496.12 ? 523 TYR A CZ  1 
ATOM 3817  O OH  . TYR A 1 523 ? 106.198 161.618 146.578 1.00 500.00 ? 523 TYR A OH  1 
ATOM 3818  N N   . GLY A 1 524 ? 111.157 165.585 142.653 1.00 414.61 ? 524 GLY A N   1 
ATOM 3819  C CA  . GLY A 1 524 ? 111.450 164.900 141.391 1.00 432.61 ? 524 GLY A CA  1 
ATOM 3820  C C   . GLY A 1 524 ? 112.802 164.226 141.462 1.00 417.97 ? 524 GLY A C   1 
ATOM 3821  O O   . GLY A 1 524 ? 112.986 163.046 141.108 1.00 445.71 ? 524 GLY A O   1 
ATOM 3822  N N   . PHE A 1 525 ? 113.776 164.972 141.973 1.00 390.24 ? 525 PHE A N   1 
ATOM 3823  C CA  . PHE A 1 525 ? 115.114 164.345 142.189 1.00 385.66 ? 525 PHE A CA  1 
ATOM 3824  C C   . PHE A 1 525 ? 115.300 163.465 143.426 1.00 372.29 ? 525 PHE A C   1 
ATOM 3825  O O   . PHE A 1 525 ? 115.478 162.231 143.282 1.00 443.57 ? 525 PHE A O   1 
ATOM 3826  C CB  . PHE A 1 525 ? 116.218 165.335 141.899 1.00 364.36 ? 525 PHE A CB  1 
ATOM 3827  C CG  . PHE A 1 525 ? 116.034 166.001 140.560 1.00 380.10 ? 525 PHE A CG  1 
ATOM 3828  C CD1 . PHE A 1 525 ? 116.089 165.264 139.401 1.00 391.33 ? 525 PHE A CD1 1 
ATOM 3829  C CD2 . PHE A 1 525 ? 115.714 167.342 140.463 1.00 471.76 ? 525 PHE A CD2 1 
ATOM 3830  C CE1 . PHE A 1 525 ? 115.889 165.856 138.167 1.00 409.01 ? 525 PHE A CE1 1 
ATOM 3831  C CE2 . PHE A 1 525 ? 115.506 167.944 139.232 1.00 435.55 ? 525 PHE A CE2 1 
ATOM 3832  C CZ  . PHE A 1 525 ? 115.614 167.202 138.081 1.00 390.70 ? 525 PHE A CZ  1 
ATOM 3833  N N   . LEU A 1 526 ? 115.272 164.040 144.615 1.00 353.08 ? 526 LEU A N   1 
ATOM 3834  C CA  . LEU A 1 526 ? 115.661 163.269 145.798 1.00 419.97 ? 526 LEU A CA  1 
ATOM 3835  C C   . LEU A 1 526 ? 114.664 162.239 146.326 1.00 429.86 ? 526 LEU A C   1 
ATOM 3836  O O   . LEU A 1 526 ? 115.046 161.425 147.170 1.00 465.55 ? 526 LEU A O   1 
ATOM 3837  C CB  . LEU A 1 526 ? 116.082 164.196 146.935 1.00 433.43 ? 526 LEU A CB  1 
ATOM 3838  C CG  . LEU A 1 526 ? 117.320 165.023 146.631 1.00 459.89 ? 526 LEU A CG  1 
ATOM 3839  C CD1 . LEU A 1 526 ? 117.544 166.026 147.748 1.00 500.00 ? 526 LEU A CD1 1 
ATOM 3840  C CD2 . LEU A 1 526 ? 118.550 164.148 146.457 1.00 477.79 ? 526 LEU A CD2 1 
ATOM 3841  N N   . ILE A 1 527 ? 113.417 162.245 145.855 1.00 360.38 ? 527 ILE A N   1 
ATOM 3842  C CA  . ILE A 1 527 ? 112.441 161.287 146.366 1.00 401.66 ? 527 ILE A CA  1 
ATOM 3843  C C   . ILE A 1 527 ? 112.135 160.222 145.326 1.00 428.51 ? 527 ILE A C   1 
ATOM 3844  O O   . ILE A 1 527 ? 112.507 159.052 145.472 1.00 388.45 ? 527 ILE A O   1 
ATOM 3845  C CB  . ILE A 1 527 ? 111.138 161.989 146.841 1.00 437.80 ? 527 ILE A CB  1 
ATOM 3846  C CG1 . ILE A 1 527 ? 111.461 163.099 147.847 1.00 494.71 ? 527 ILE A CG1 1 
ATOM 3847  C CG2 . ILE A 1 527 ? 110.157 160.982 147.443 1.00 461.33 ? 527 ILE A CG2 1 
ATOM 3848  C CD1 . ILE A 1 527 ? 112.295 162.656 149.033 1.00 500.00 ? 527 ILE A CD1 1 
ATOM 3849  N N   . LYS A 1 528 ? 111.482 160.664 144.262 1.00 468.58 ? 528 LYS A N   1 
ATOM 3850  C CA  . LYS A 1 528 ? 110.763 159.795 143.352 1.00 456.32 ? 528 LYS A CA  1 
ATOM 3851  C C   . LYS A 1 528 ? 110.773 160.476 142.003 1.00 443.76 ? 528 LYS A C   1 
ATOM 3852  O O   . LYS A 1 528 ? 110.537 161.676 141.923 1.00 478.13 ? 528 LYS A O   1 
ATOM 3853  C CB  . LYS A 1 528 ? 109.335 159.645 143.857 1.00 477.82 ? 528 LYS A CB  1 
ATOM 3854  C CG  . LYS A 1 528 ? 108.424 158.779 143.020 1.00 500.00 ? 528 LYS A CG  1 
ATOM 3855  C CD  . LYS A 1 528 ? 107.039 158.760 143.641 1.00 500.00 ? 528 LYS A CD  1 
ATOM 3856  C CE  . LYS A 1 528 ? 106.137 157.750 142.952 1.00 500.00 ? 528 LYS A CE  1 
ATOM 3857  N NZ  . LYS A 1 528 ? 104.689 157.992 143.216 1.00 500.00 ? 528 LYS A NZ  1 
ATOM 3858  N N   . ALA A 1 529 ? 111.048 159.731 140.947 1.00 441.84 ? 529 ALA A N   1 
ATOM 3859  C CA  . ALA A 1 529 ? 111.101 160.311 139.620 1.00 440.80 ? 529 ALA A CA  1 
ATOM 3860  C C   . ALA A 1 529 ? 109.698 160.329 139.043 1.00 437.01 ? 529 ALA A C   1 
ATOM 3861  O O   . ALA A 1 529 ? 109.222 161.379 138.623 1.00 482.83 ? 529 ALA A O   1 
ATOM 3862  C CB  . ALA A 1 529 ? 112.046 159.523 138.734 1.00 470.24 ? 529 ALA A CB  1 
ATOM 3863  N N   . ASN A 1 530 ? 109.039 159.170 139.043 1.00 446.50 ? 530 ASN A N   1 
ATOM 3864  C CA  . ASN A 1 530 ? 107.721 159.004 138.416 1.00 472.17 ? 530 ASN A CA  1 
ATOM 3865  C C   . ASN A 1 530 ? 106.599 159.806 139.104 1.00 468.28 ? 530 ASN A C   1 
ATOM 3866  O O   . ASN A 1 530 ? 105.771 159.265 139.844 1.00 453.19 ? 530 ASN A O   1 
ATOM 3867  C CB  . ASN A 1 530 ? 107.375 157.510 138.352 1.00 500.00 ? 530 ASN A CB  1 
ATOM 3868  C CG  . ASN A 1 530 ? 106.210 157.207 137.434 1.00 495.84 ? 530 ASN A CG  1 
ATOM 3869  O OD1 . ASN A 1 530 ? 106.063 157.813 136.368 1.00 437.54 ? 530 ASN A OD1 1 
ATOM 3870  N ND2 . ASN A 1 530 ? 105.379 156.251 137.841 1.00 495.51 ? 530 ASN A ND2 1 
ATOM 3871  N N   . ASN A 1 531 ? 106.585 161.107 138.827 1.00 481.21 ? 531 ASN A N   1 
ATOM 3872  C CA  . ASN A 1 531 ? 105.670 162.056 139.458 1.00 453.05 ? 531 ASN A CA  1 
ATOM 3873  C C   . ASN A 1 531 ? 104.830 162.744 138.443 1.00 416.07 ? 531 ASN A C   1 
ATOM 3874  O O   . ASN A 1 531 ? 105.131 162.741 137.254 1.00 418.01 ? 531 ASN A O   1 
ATOM 3875  C CB  . ASN A 1 531 ? 106.448 163.104 140.224 1.00 416.98 ? 531 ASN A CB  1 
ATOM 3876  C CG  . ASN A 1 531 ? 107.473 162.477 141.127 1.00 448.27 ? 531 ASN A CG  1 
ATOM 3877  O OD1 . ASN A 1 531 ? 107.144 161.648 141.978 1.00 425.38 ? 531 ASN A OD1 1 
ATOM 3878  N ND2 . ASN A 1 531 ? 108.720 162.830 140.927 1.00 460.19 ? 531 ASN A ND2 1 
ATOM 3879  N N   . SER A 1 532 ? 103.771 163.356 138.930 1.00 430.36 ? 532 SER A N   1 
ATOM 3880  C CA  . SER A 1 532 ? 102.809 163.947 138.026 1.00 500.00 ? 532 SER A CA  1 
ATOM 3881  C C   . SER A 1 532 ? 103.514 165.039 137.196 1.00 500.00 ? 532 SER A C   1 
ATOM 3882  O O   . SER A 1 532 ? 103.405 165.079 135.929 1.00 500.00 ? 532 SER A O   1 
ATOM 3883  C CB  . SER A 1 532 ? 101.673 164.566 138.830 1.00 500.00 ? 532 SER A CB  1 
ATOM 3884  O OG  . SER A 1 532 ? 102.178 165.495 139.775 1.00 500.00 ? 532 SER A OG  1 
ATOM 3885  N N   . TRP A 1 533 ? 104.234 165.899 137.932 1.00 500.00 ? 533 TRP A N   1 
ATOM 3886  C CA  . TRP A 1 533 ? 104.848 167.069 137.327 1.00 484.46 ? 533 TRP A CA  1 
ATOM 3887  C C   . TRP A 1 533 ? 105.924 166.605 136.356 1.00 474.70 ? 533 TRP A C   1 
ATOM 3888  O O   . TRP A 1 533 ? 106.020 167.122 135.223 1.00 450.79 ? 533 TRP A O   1 
ATOM 3889  C CB  . TRP A 1 533 ? 105.444 168.052 138.327 1.00 439.14 ? 533 TRP A CB  1 
ATOM 3890  C CG  . TRP A 1 533 ? 105.799 169.333 137.627 1.00 452.91 ? 533 TRP A CG  1 
ATOM 3891  C CD1 . TRP A 1 533 ? 104.996 170.046 136.783 1.00 495.48 ? 533 TRP A CD1 1 
ATOM 3892  C CD2 . TRP A 1 533 ? 107.041 170.037 137.682 1.00 449.31 ? 533 TRP A CD2 1 
ATOM 3893  N NE1 . TRP A 1 533 ? 105.651 171.157 136.317 1.00 491.35 ? 533 TRP A NE1 1 
ATOM 3894  C CE2 . TRP A 1 533 ? 106.910 171.183 136.851 1.00 465.34 ? 533 TRP A CE2 1 
ATOM 3895  C CE3 . TRP A 1 533 ? 108.246 169.826 138.361 1.00 429.49 ? 533 TRP A CE3 1 
ATOM 3896  C CZ2 . TRP A 1 533 ? 107.941 172.110 136.682 1.00 417.50 ? 533 TRP A CZ2 1 
ATOM 3897  C CZ3 . TRP A 1 533 ? 109.267 170.746 138.197 1.00 429.56 ? 533 TRP A CZ3 1 
ATOM 3898  C CH2 . TRP A 1 533 ? 109.108 171.874 137.363 1.00 452.43 ? 533 TRP A CH2 1 
ATOM 3899  N N   . PHE A 1 534 ? 106.782 165.713 136.860 1.00 444.48 ? 534 PHE A N   1 
ATOM 3900  C CA  . PHE A 1 534 ? 107.945 165.243 136.112 1.00 440.03 ? 534 PHE A CA  1 
ATOM 3901  C C   . PHE A 1 534 ? 107.505 164.594 134.808 1.00 464.41 ? 534 PHE A C   1 
ATOM 3902  O O   . PHE A 1 534 ? 108.088 164.879 133.736 1.00 475.57 ? 534 PHE A O   1 
ATOM 3903  C CB  . PHE A 1 534 ? 108.831 164.326 136.959 1.00 417.65 ? 534 PHE A CB  1 
ATOM 3904  C CG  . PHE A 1 534 ? 110.084 164.976 137.480 1.00 412.97 ? 534 PHE A CG  1 
ATOM 3905  C CD1 . PHE A 1 534 ? 110.174 166.349 137.709 1.00 472.93 ? 534 PHE A CD1 1 
ATOM 3906  C CD2 . PHE A 1 534 ? 111.184 164.190 137.784 1.00 470.76 ? 534 PHE A CD2 1 
ATOM 3907  C CE1 . PHE A 1 534 ? 111.343 166.914 138.202 1.00 491.47 ? 534 PHE A CE1 1 
ATOM 3908  C CE2 . PHE A 1 534 ? 112.354 164.751 138.277 1.00 482.12 ? 534 PHE A CE2 1 
ATOM 3909  C CZ  . PHE A 1 534 ? 112.435 166.116 138.483 1.00 453.06 ? 534 PHE A CZ  1 
ATOM 3910  N N   . GLN A 1 535 ? 106.477 163.755 134.921 1.00 474.89 ? 535 GLN A N   1 
ATOM 3911  C CA  . GLN A 1 535 ? 105.930 163.045 133.756 1.00 469.98 ? 535 GLN A CA  1 
ATOM 3912  C C   . GLN A 1 535 ? 105.442 164.037 132.714 1.00 408.39 ? 535 GLN A C   1 
ATOM 3913  O O   . GLN A 1 535 ? 105.720 163.878 131.518 1.00 397.99 ? 535 GLN A O   1 
ATOM 3914  C CB  . GLN A 1 535 ? 104.824 162.043 134.123 1.00 500.00 ? 535 GLN A CB  1 
ATOM 3915  C CG  . GLN A 1 535 ? 105.351 160.655 134.488 1.00 500.00 ? 535 GLN A CG  1 
ATOM 3916  C CD  . GLN A 1 535 ? 104.262 159.592 134.537 1.00 500.00 ? 535 GLN A CD  1 
ATOM 3917  O OE1 . GLN A 1 535 ? 103.171 159.826 135.067 1.00 500.00 ? 535 GLN A OE1 1 
ATOM 3918  N NE2 . GLN A 1 535 ? 104.558 158.413 133.989 1.00 500.00 ? 535 GLN A NE2 1 
ATOM 3919  N N   . SER A 1 536 ? 104.732 165.052 133.195 1.00 424.00 ? 536 SER A N   1 
ATOM 3920  C CA  . SER A 1 536 ? 104.191 166.117 132.352 1.00 464.69 ? 536 SER A CA  1 
ATOM 3921  C C   . SER A 1 536 ? 105.298 166.807 131.580 1.00 454.46 ? 536 SER A C   1 
ATOM 3922  O O   . SER A 1 536 ? 104.976 167.399 130.562 1.00 451.37 ? 536 SER A O   1 
ATOM 3923  C CB  . SER A 1 536 ? 103.403 167.132 133.188 1.00 464.58 ? 536 SER A CB  1 
ATOM 3924  O OG  . SER A 1 536 ? 104.251 167.897 134.021 1.00 403.76 ? 536 SER A OG  1 
ATOM 3925  N N   . ILE A 1 537 ? 106.567 166.774 132.004 1.00 453.82 ? 537 ILE A N   1 
ATOM 3926  C CA  . ILE A 1 537 ? 107.649 167.326 131.153 1.00 474.86 ? 537 ILE A CA  1 
ATOM 3927  C C   . ILE A 1 537 ? 108.591 166.263 130.587 1.00 455.87 ? 537 ILE A C   1 
ATOM 3928  O O   . ILE A 1 537 ? 109.729 166.133 131.017 1.00 454.64 ? 537 ILE A O   1 
ATOM 3929  C CB  . ILE A 1 537 ? 108.498 168.455 131.811 1.00 493.39 ? 537 ILE A CB  1 
ATOM 3930  C CG1 . ILE A 1 537 ? 107.872 169.036 133.089 1.00 500.00 ? 537 ILE A CG1 1 
ATOM 3931  C CG2 . ILE A 1 537 ? 108.739 169.540 130.780 1.00 500.00 ? 537 ILE A CG2 1 
ATOM 3932  C CD1 . ILE A 1 537 ? 108.539 168.537 134.348 1.00 500.00 ? 537 ILE A CD1 1 
ATOM 3933  N N   . LEU A 1 538 ? 108.093 165.508 129.618 1.00 471.45 ? 538 LEU A N   1 
ATOM 3934  C CA  . LEU A 1 538 ? 108.914 164.603 128.813 1.00 476.13 ? 538 LEU A CA  1 
ATOM 3935  C C   . LEU A 1 538 ? 108.201 164.294 127.500 1.00 500.00 ? 538 LEU A C   1 
ATOM 3936  O O   . LEU A 1 538 ? 107.004 164.523 127.378 1.00 500.00 ? 538 LEU A O   1 
ATOM 3937  C CB  . LEU A 1 538 ? 109.116 163.273 129.540 1.00 491.24 ? 538 LEU A CB  1 
ATOM 3938  C CG  . LEU A 1 538 ? 109.778 163.159 130.911 1.00 454.00 ? 538 LEU A CG  1 
ATOM 3939  C CD1 . LEU A 1 538 ? 109.591 161.752 131.456 1.00 467.65 ? 538 LEU A CD1 1 
ATOM 3940  C CD2 . LEU A 1 538 ? 111.253 163.531 130.825 1.00 475.84 ? 538 LEU A CD2 1 
ATOM 3941  N N   . ARG A 1 539 ? 108.920 163.732 126.537 1.00 474.84 ? 539 ARG A N   1 
ATOM 3942  C CA  . ARG A 1 539 ? 108.263 163.107 125.392 1.00 485.11 ? 539 ARG A CA  1 
ATOM 3943  C C   . ARG A 1 539 ? 107.747 161.726 125.792 1.00 491.48 ? 539 ARG A C   1 
ATOM 3944  O O   . ARG A 1 539 ? 108.388 161.033 126.586 1.00 500.00 ? 539 ARG A O   1 
ATOM 3945  C CB  . ARG A 1 539 ? 109.223 162.972 124.233 1.00 487.97 ? 539 ARG A CB  1 
ATOM 3946  C CG  . ARG A 1 539 ? 109.741 164.297 123.736 1.00 498.55 ? 539 ARG A CG  1 
ATOM 3947  C CD  . ARG A 1 539 ? 110.413 164.179 122.378 1.00 500.00 ? 539 ARG A CD  1 
ATOM 3948  N NE  . ARG A 1 539 ? 111.791 163.695 122.489 1.00 500.00 ? 539 ARG A NE  1 
ATOM 3949  C CZ  . ARG A 1 539 ? 112.187 162.416 122.518 1.00 500.00 ? 539 ARG A CZ  1 
ATOM 3950  N NH1 . ARG A 1 539 ? 113.486 162.144 122.622 1.00 500.00 ? 539 ARG A NH1 1 
ATOM 3951  N NH2 . ARG A 1 539 ? 111.325 161.401 122.442 1.00 500.00 ? 539 ARG A NH2 1 
ATOM 3952  N N   . GLN A 1 540 ? 106.599 161.333 125.233 1.00 477.88 ? 540 GLN A N   1 
ATOM 3953  C CA  . GLN A 1 540 ? 105.984 160.019 125.494 1.00 461.67 ? 540 GLN A CA  1 
ATOM 3954  C C   . GLN A 1 540 ? 106.982 158.878 125.650 1.00 472.31 ? 540 GLN A C   1 
ATOM 3955  O O   . GLN A 1 540 ? 106.892 158.083 126.577 1.00 434.85 ? 540 GLN A O   1 
ATOM 3956  C CB  . GLN A 1 540 ? 105.011 159.636 124.368 1.00 500.00 ? 540 GLN A CB  1 
ATOM 3957  C CG  . GLN A 1 540 ? 103.571 160.079 124.576 1.00 500.00 ? 540 GLN A CG  1 
ATOM 3958  C CD  . GLN A 1 540 ? 102.570 159.074 124.019 1.00 500.00 ? 540 GLN A CD  1 
ATOM 3959  O OE1 . GLN A 1 540 ? 102.611 158.734 122.834 1.00 500.00 ? 540 GLN A OE1 1 
ATOM 3960  N NE2 . GLN A 1 540 ? 101.667 158.596 124.874 1.00 500.00 ? 540 GLN A NE2 1 
ATOM 3961  N N   . ASP A 1 541 ? 107.929 158.815 124.725 1.00 500.00 ? 541 ASP A N   1 
ATOM 3962  C CA  . ASP A 1 541 ? 108.897 157.726 124.660 1.00 500.00 ? 541 ASP A CA  1 
ATOM 3963  C C   . ASP A 1 541 ? 109.685 157.600 125.954 1.00 500.00 ? 541 ASP A C   1 
ATOM 3964  O O   . ASP A 1 541 ? 109.787 156.516 126.534 1.00 500.00 ? 541 ASP A O   1 
ATOM 3965  C CB  . ASP A 1 541 ? 109.859 157.960 123.492 1.00 500.00 ? 541 ASP A CB  1 
ATOM 3966  C CG  . ASP A 1 541 ? 109.130 158.140 122.157 1.00 500.00 ? 541 ASP A CG  1 
ATOM 3967  O OD1 . ASP A 1 541 ? 108.074 158.820 122.129 1.00 500.00 ? 541 ASP A OD1 1 
ATOM 3968  O OD2 . ASP A 1 541 ? 109.612 157.608 121.133 1.00 500.00 ? 541 ASP A OD2 1 
ATOM 3969  N N   . LEU A 1 542 ? 110.189 158.738 126.416 1.00 461.12 ? 542 LEU A N   1 
ATOM 3970  C CA  . LEU A 1 542 ? 111.091 158.792 127.556 1.00 445.01 ? 542 LEU A CA  1 
ATOM 3971  C C   . LEU A 1 542 ? 110.470 158.333 128.866 1.00 468.89 ? 542 LEU A C   1 
ATOM 3972  O O   . LEU A 1 542 ? 111.200 157.889 129.745 1.00 470.33 ? 542 LEU A O   1 
ATOM 3973  C CB  . LEU A 1 542 ? 111.626 160.207 127.744 1.00 462.84 ? 542 LEU A CB  1 
ATOM 3974  C CG  . LEU A 1 542 ? 112.792 160.592 126.849 1.00 470.23 ? 542 LEU A CG  1 
ATOM 3975  C CD1 . LEU A 1 542 ? 112.393 160.620 125.382 1.00 434.78 ? 542 LEU A CD1 1 
ATOM 3976  C CD2 . LEU A 1 542 ? 113.340 161.936 127.308 1.00 485.66 ? 542 LEU A CD2 1 
ATOM 3977  N N   . ARG A 1 543 ? 109.144 158.438 128.997 1.00 484.84 ? 543 ARG A N   1 
ATOM 3978  C CA  . ARG A 1 543 ? 108.408 158.102 130.237 1.00 480.90 ? 543 ARG A CA  1 
ATOM 3979  C C   . ARG A 1 543 ? 109.043 157.009 131.099 1.00 419.89 ? 543 ARG A C   1 
ATOM 3980  O O   . ARG A 1 543 ? 108.977 157.072 132.322 1.00 372.54 ? 543 ARG A O   1 
ATOM 3981  C CB  . ARG A 1 543 ? 106.952 157.724 129.910 1.00 500.00 ? 543 ARG A CB  1 
ATOM 3982  C CG  . ARG A 1 543 ? 106.770 156.417 129.133 1.00 500.00 ? 543 ARG A CG  1 
ATOM 3983  C CD  . ARG A 1 543 ? 105.367 156.292 128.534 1.00 500.00 ? 543 ARG A CD  1 
ATOM 3984  N NE  . ARG A 1 543 ? 104.297 156.241 129.546 1.00 500.00 ? 543 ARG A NE  1 
ATOM 3985  C CZ  . ARG A 1 543 ? 103.696 155.139 130.017 1.00 500.00 ? 543 ARG A CZ  1 
ATOM 3986  N NH1 . ARG A 1 543 ? 104.036 153.915 129.597 1.00 500.00 ? 543 ARG A NH1 1 
ATOM 3987  N NH2 . ARG A 1 543 ? 102.733 155.263 130.938 1.00 500.00 ? 543 ARG A NH2 1 
ATOM 3988  N N   . SER A 1 544 ? 109.626 156.006 130.439 1.00 429.17 ? 544 SER A N   1 
ATOM 3989  C CA  . SER A 1 544 ? 110.412 154.945 131.077 1.00 476.87 ? 544 SER A CA  1 
ATOM 3990  C C   . SER A 1 544 ? 111.510 155.434 132.042 1.00 476.83 ? 544 SER A C   1 
ATOM 3991  O O   . SER A 1 544 ? 111.720 154.816 133.088 1.00 500.00 ? 544 SER A O   1 
ATOM 3992  C CB  . SER A 1 544 ? 111.040 154.044 129.995 1.00 483.17 ? 544 SER A CB  1 
ATOM 3993  O OG  . SER A 1 544 ? 111.652 152.889 130.551 1.00 481.11 ? 544 SER A OG  1 
ATOM 3994  N N   . TYR A 1 545 ? 112.198 156.520 131.686 1.00 443.02 ? 545 TYR A N   1 
ATOM 3995  C CA  . TYR A 1 545 ? 113.325 157.053 132.478 1.00 417.25 ? 545 TYR A CA  1 
ATOM 3996  C C   . TYR A 1 545 ? 113.025 157.320 133.938 1.00 403.63 ? 545 TYR A C   1 
ATOM 3997  O O   . TYR A 1 545 ? 113.877 157.083 134.788 1.00 448.88 ? 545 TYR A O   1 
ATOM 3998  C CB  . TYR A 1 545 ? 113.878 158.348 131.867 1.00 433.59 ? 545 TYR A CB  1 
ATOM 3999  C CG  . TYR A 1 545 ? 114.812 158.103 130.719 1.00 434.92 ? 545 TYR A CG  1 
ATOM 4000  C CD1 . TYR A 1 545 ? 116.062 157.541 130.940 1.00 441.22 ? 545 TYR A CD1 1 
ATOM 4001  C CD2 . TYR A 1 545 ? 114.450 158.419 129.410 1.00 417.37 ? 545 TYR A CD2 1 
ATOM 4002  C CE1 . TYR A 1 545 ? 116.932 157.299 129.893 1.00 477.98 ? 545 TYR A CE1 1 
ATOM 4003  C CE2 . TYR A 1 545 ? 115.311 158.180 128.356 1.00 434.20 ? 545 TYR A CE2 1 
ATOM 4004  C CZ  . TYR A 1 545 ? 116.551 157.623 128.600 1.00 469.44 ? 545 TYR A CZ  1 
ATOM 4005  O OH  . TYR A 1 545 ? 117.415 157.384 127.557 1.00 499.77 ? 545 TYR A OH  1 
ATOM 4006  N N   . LEU A 1 546 ? 111.824 157.808 134.225 1.00 402.16 ? 546 LEU A N   1 
ATOM 4007  C CA  . LEU A 1 546 ? 111.443 158.166 135.592 1.00 406.98 ? 546 LEU A CA  1 
ATOM 4008  C C   . LEU A 1 546 ? 110.975 156.917 136.317 1.00 425.71 ? 546 LEU A C   1 
ATOM 4009  O O   . LEU A 1 546 ? 109.829 156.490 136.167 1.00 500.00 ? 546 LEU A O   1 
ATOM 4010  C CB  . LEU A 1 546 ? 110.327 159.205 135.596 1.00 421.42 ? 546 LEU A CB  1 
ATOM 4011  C CG  . LEU A 1 546 ? 110.499 160.371 134.637 1.00 456.75 ? 546 LEU A CG  1 
ATOM 4012  C CD1 . LEU A 1 546 ? 109.281 161.281 134.726 1.00 500.00 ? 546 LEU A CD1 1 
ATOM 4013  C CD2 . LEU A 1 546 ? 111.800 161.093 134.930 1.00 437.47 ? 546 LEU A CD2 1 
ATOM 4014  N N   . GLY A 1 547 ? 111.864 156.317 137.094 1.00 415.32 ? 547 GLY A N   1 
ATOM 4015  C CA  . GLY A 1 547 ? 111.506 155.133 137.846 1.00 445.70 ? 547 GLY A CA  1 
ATOM 4016  C C   . GLY A 1 547 ? 110.659 155.500 139.040 1.00 436.71 ? 547 GLY A C   1 
ATOM 4017  O O   . GLY A 1 547 ? 110.258 156.654 139.209 1.00 416.06 ? 547 GLY A O   1 
ATOM 4018  N N   . ASP A 1 548 ? 110.374 154.498 139.863 1.00 495.10 ? 548 ASP A N   1 
ATOM 4019  C CA  . ASP A 1 548 ? 110.066 154.755 141.256 1.00 500.00 ? 548 ASP A CA  1 
ATOM 4020  C C   . ASP A 1 548 ? 111.444 155.109 141.831 1.00 500.00 ? 548 ASP A C   1 
ATOM 4021  O O   . ASP A 1 548 ? 112.347 154.267 141.882 1.00 484.91 ? 548 ASP A O   1 
ATOM 4022  C CB  . ASP A 1 548 ? 109.420 153.539 141.932 1.00 500.00 ? 548 ASP A CB  1 
ATOM 4023  C CG  . ASP A 1 548 ? 108.581 153.919 143.157 1.00 500.00 ? 548 ASP A CG  1 
ATOM 4024  O OD1 . ASP A 1 548 ? 109.176 154.216 144.224 1.00 500.00 ? 548 ASP A OD1 1 
ATOM 4025  O OD2 . ASP A 1 548 ? 107.325 153.909 143.053 1.00 500.00 ? 548 ASP A OD2 1 
ATOM 4026  N N   . GLY A 1 549 ? 111.599 156.374 142.218 1.00 485.00 ? 549 GLY A N   1 
ATOM 4027  C CA  . GLY A 1 549 ? 112.912 156.988 142.367 1.00 428.61 ? 549 GLY A CA  1 
ATOM 4028  C C   . GLY A 1 549 ? 113.682 156.629 143.623 1.00 430.53 ? 549 GLY A C   1 
ATOM 4029  O O   . GLY A 1 549 ? 113.323 155.661 144.294 1.00 439.16 ? 549 GLY A O   1 
ATOM 4030  N N   . PRO A 1 550 ? 114.733 157.387 143.972 1.00 461.97 ? 550 PRO A N   1 
ATOM 4031  C CA  . PRO A 1 550 ? 115.134 158.666 143.338 1.00 475.30 ? 550 PRO A CA  1 
ATOM 4032  C C   . PRO A 1 550 ? 115.661 158.578 141.894 1.00 439.85 ? 550 PRO A C   1 
ATOM 4033  O O   . PRO A 1 550 ? 115.491 157.563 141.225 1.00 444.76 ? 550 PRO A O   1 
ATOM 4034  C CB  . PRO A 1 550 ? 116.277 159.165 144.261 1.00 474.30 ? 550 PRO A CB  1 
ATOM 4035  C CG  . PRO A 1 550 ? 116.354 158.216 145.410 1.00 458.56 ? 550 PRO A CG  1 
ATOM 4036  C CD  . PRO A 1 550 ? 115.736 156.936 144.950 1.00 474.67 ? 550 PRO A CD  1 
ATOM 4037  N N   . LEU A 1 551 ? 116.275 159.657 141.419 1.00 387.06 ? 551 LEU A N   1 
ATOM 4038  C CA  . LEU A 1 551 ? 117.232 159.552 140.331 1.00 372.17 ? 551 LEU A CA  1 
ATOM 4039  C C   . LEU A 1 551 ? 118.624 159.572 140.911 1.00 406.99 ? 551 LEU A C   1 
ATOM 4040  O O   . LEU A 1 551 ? 118.852 160.107 141.999 1.00 436.72 ? 551 LEU A O   1 
ATOM 4041  C CB  . LEU A 1 551 ? 117.087 160.682 139.331 1.00 386.34 ? 551 LEU A CB  1 
ATOM 4042  C CG  . LEU A 1 551 ? 115.810 160.697 138.504 1.00 394.05 ? 551 LEU A CG  1 
ATOM 4043  C CD1 . LEU A 1 551 ? 115.988 161.681 137.359 1.00 411.86 ? 551 LEU A CD1 1 
ATOM 4044  C CD2 . LEU A 1 551 ? 115.478 159.315 137.967 1.00 446.84 ? 551 LEU A CD2 1 
ATOM 4045  N N   . GLN A 1 552 ? 119.547 158.985 140.158 1.00 412.22 ? 552 GLN A N   1 
ATOM 4046  C CA  . GLN A 1 552 ? 120.924 158.801 140.575 1.00 410.78 ? 552 GLN A CA  1 
ATOM 4047  C C   . GLN A 1 552 ? 121.794 159.434 139.501 1.00 405.84 ? 552 GLN A C   1 
ATOM 4048  O O   . GLN A 1 552 ? 121.678 159.093 138.324 1.00 434.84 ? 552 GLN A O   1 
ATOM 4049  C CB  . GLN A 1 552 ? 121.203 157.306 140.715 1.00 437.05 ? 552 GLN A CB  1 
ATOM 4050  C CG  . GLN A 1 552 ? 120.332 156.582 141.741 1.00 436.53 ? 552 GLN A CG  1 
ATOM 4051  C CD  . GLN A 1 552 ? 120.477 157.139 143.150 1.00 476.86 ? 552 GLN A CD  1 
ATOM 4052  O OE1 . GLN A 1 552 ? 121.587 157.411 143.603 1.00 500.00 ? 552 GLN A OE1 1 
ATOM 4053  N NE2 . GLN A 1 552 ? 119.355 157.311 143.850 1.00 471.65 ? 552 GLN A NE2 1 
ATOM 4054  N N   . HIS A 1 553 ? 122.666 160.347 139.907 1.00 383.50 ? 553 HIS A N   1 
ATOM 4055  C CA  . HIS A 1 553 ? 123.298 161.305 139.000 1.00 412.53 ? 553 HIS A CA  1 
ATOM 4056  C C   . HIS A 1 553 ? 124.712 160.882 138.704 1.00 397.63 ? 553 HIS A C   1 
ATOM 4057  O O   . HIS A 1 553 ? 125.662 161.651 138.877 1.00 431.67 ? 553 HIS A O   1 
ATOM 4058  C CB  . HIS A 1 553 ? 123.212 162.698 139.613 1.00 426.48 ? 553 HIS A CB  1 
ATOM 4059  C CG  . HIS A 1 553 ? 121.896 162.944 140.277 1.00 468.99 ? 553 HIS A CG  1 
ATOM 4060  N ND1 . HIS A 1 553 ? 120.753 163.247 139.573 1.00 475.69 ? 553 HIS A ND1 1 
ATOM 4061  C CD2 . HIS A 1 553 ? 121.520 162.834 141.569 1.00 487.03 ? 553 HIS A CD2 1 
ATOM 4062  C CE1 . HIS A 1 553 ? 119.738 163.360 140.409 1.00 479.49 ? 553 HIS A CE1 1 
ATOM 4063  N NE2 . HIS A 1 553 ? 120.176 163.106 141.627 1.00 494.75 ? 553 HIS A NE2 1 
ATOM 4064  N N   . TYR A 1 554 ? 124.819 159.639 138.242 1.00 365.34 ? 554 TYR A N   1 
ATOM 4065  C CA  . TYR A 1 554 ? 126.067 159.039 137.823 1.00 365.50 ? 554 TYR A CA  1 
ATOM 4066  C C   . TYR A 1 554 ? 126.227 159.349 136.365 1.00 370.30 ? 554 TYR A C   1 
ATOM 4067  O O   . TYR A 1 554 ? 125.241 159.290 135.626 1.00 413.26 ? 554 TYR A O   1 
ATOM 4068  C CB  . TYR A 1 554 ? 126.005 157.522 137.994 1.00 365.35 ? 554 TYR A CB  1 
ATOM 4069  C CG  . TYR A 1 554 ? 127.330 156.853 137.799 1.00 382.53 ? 554 TYR A CG  1 
ATOM 4070  C CD1 . TYR A 1 554 ? 128.268 156.829 138.823 1.00 422.11 ? 554 TYR A CD1 1 
ATOM 4071  C CD2 . TYR A 1 554 ? 127.661 156.259 136.590 1.00 431.45 ? 554 TYR A CD2 1 
ATOM 4072  C CE1 . TYR A 1 554 ? 129.502 156.224 138.657 1.00 427.41 ? 554 TYR A CE1 1 
ATOM 4073  C CE2 . TYR A 1 554 ? 128.893 155.650 136.407 1.00 453.20 ? 554 TYR A CE2 1 
ATOM 4074  C CZ  . TYR A 1 554 ? 129.810 155.635 137.446 1.00 441.21 ? 554 TYR A CZ  1 
ATOM 4075  O OH  . TYR A 1 554 ? 131.033 155.031 137.288 1.00 408.55 ? 554 TYR A OH  1 
ATOM 4076  N N   . ILE A 1 555 ? 127.444 159.676 135.933 1.00 355.70 ? 555 ILE A N   1 
ATOM 4077  C CA  . ILE A 1 555 ? 127.697 159.799 134.504 1.00 379.30 ? 555 ILE A CA  1 
ATOM 4078  C C   . ILE A 1 555 ? 127.799 158.376 134.007 1.00 400.40 ? 555 ILE A C   1 
ATOM 4079  O O   . ILE A 1 555 ? 128.871 157.776 134.003 1.00 448.05 ? 555 ILE A O   1 
ATOM 4080  C CB  . ILE A 1 555 ? 128.953 160.622 134.147 1.00 399.97 ? 555 ILE A CB  1 
ATOM 4081  C CG1 . ILE A 1 555 ? 128.792 162.074 134.614 1.00 435.40 ? 555 ILE A CG1 1 
ATOM 4082  C CG2 . ILE A 1 555 ? 129.203 160.587 132.642 1.00 431.70 ? 555 ILE A CG2 1 
ATOM 4083  C CD1 . ILE A 1 555 ? 129.808 162.494 135.646 1.00 489.90 ? 555 ILE A CD1 1 
ATOM 4084  N N   . ALA A 1 556 ? 126.650 157.825 133.642 1.00 431.07 ? 556 ALA A N   1 
ATOM 4085  C CA  . ALA A 1 556 ? 126.590 156.489 133.099 1.00 466.82 ? 556 ALA A CA  1 
ATOM 4086  C C   . ALA A 1 556 ? 126.987 156.583 131.646 1.00 451.20 ? 556 ALA A C   1 
ATOM 4087  O O   . ALA A 1 556 ? 126.543 157.491 130.933 1.00 421.72 ? 556 ALA A O   1 
ATOM 4088  C CB  . ALA A 1 556 ? 125.191 155.920 133.229 1.00 500.00 ? 556 ALA A CB  1 
ATOM 4089  N N   . VAL A 1 557 ? 127.833 155.650 131.224 1.00 447.39 ? 557 VAL A N   1 
ATOM 4090  C CA  . VAL A 1 557 ? 128.215 155.496 129.815 1.00 459.31 ? 557 VAL A CA  1 
ATOM 4091  C C   . VAL A 1 557 ? 127.056 155.681 128.825 1.00 439.73 ? 557 VAL A C   1 
ATOM 4092  O O   . VAL A 1 557 ? 127.226 156.330 127.795 1.00 448.36 ? 557 VAL A O   1 
ATOM 4093  C CB  . VAL A 1 557 ? 128.894 154.128 129.548 1.00 485.12 ? 557 VAL A CB  1 
ATOM 4094  C CG1 . VAL A 1 557 ? 130.319 154.133 130.089 1.00 500.00 ? 557 VAL A CG1 1 
ATOM 4095  C CG2 . VAL A 1 557 ? 128.080 152.949 130.109 1.00 465.47 ? 557 VAL A CG2 1 
ATOM 4096  N N   . SER A 1 558 ? 125.891 155.126 129.167 1.00 475.52 ? 558 SER A N   1 
ATOM 4097  C CA  . SER A 1 558 ? 124.723 155.056 128.272 1.00 500.00 ? 558 SER A CA  1 
ATOM 4098  C C   . SER A 1 558 ? 124.446 156.311 127.464 1.00 500.00 ? 558 SER A C   1 
ATOM 4099  O O   . SER A 1 558 ? 124.291 156.236 126.245 1.00 500.00 ? 558 SER A O   1 
ATOM 4100  C CB  . SER A 1 558 ? 123.443 154.693 129.053 1.00 500.00 ? 558 SER A CB  1 
ATOM 4101  O OG  . SER A 1 558 ? 123.004 155.758 129.880 1.00 500.00 ? 558 SER A OG  1 
ATOM 4102  N N   . SER A 1 559 ? 124.375 157.447 128.154 1.00 433.32 ? 559 SER A N   1 
ATOM 4103  C CA  . SER A 1 559 ? 123.973 158.722 127.561 1.00 425.36 ? 559 SER A CA  1 
ATOM 4104  C C   . SER A 1 559 ? 122.461 158.767 127.243 1.00 421.00 ? 559 SER A C   1 
ATOM 4105  O O   . SER A 1 559 ? 121.879 157.749 126.853 1.00 401.21 ? 559 SER A O   1 
ATOM 4106  C CB  . SER A 1 559 ? 124.779 159.020 126.292 1.00 417.00 ? 559 SER A CB  1 
ATOM 4107  O OG  . SER A 1 559 ? 124.747 160.394 125.990 1.00 441.77 ? 559 SER A OG  1 
ATOM 4108  N N   . PRO A 1 560 ? 121.801 159.913 127.427 1.00 433.16 ? 560 PRO A N   1 
ATOM 4109  C CA  . PRO A 1 560 ? 122.297 161.066 128.177 1.00 462.29 ? 560 PRO A CA  1 
ATOM 4110  C C   . PRO A 1 560 ? 122.223 160.888 129.701 1.00 474.12 ? 560 PRO A C   1 
ATOM 4111  O O   . PRO A 1 560 ? 122.913 161.601 130.425 1.00 456.96 ? 560 PRO A O   1 
ATOM 4112  C CB  . PRO A 1 560 ? 121.358 162.181 127.721 1.00 471.73 ? 560 PRO A CB  1 
ATOM 4113  C CG  . PRO A 1 560 ? 121.057 161.838 126.305 1.00 440.56 ? 560 PRO A CG  1 
ATOM 4114  C CD  . PRO A 1 560 ? 121.126 160.335 126.186 1.00 452.98 ? 560 PRO A CD  1 
ATOM 4115  N N   . THR A 1 561 ? 121.362 159.967 130.144 1.00 466.53 ? 561 THR A N   1 
ATOM 4116  C CA  . THR A 1 561 ? 121.196 159.482 131.541 1.00 445.63 ? 561 THR A CA  1 
ATOM 4117  C C   . THR A 1 561 ? 119.910 160.035 132.148 1.00 368.34 ? 561 THR A C   1 
ATOM 4118  O O   . THR A 1 561 ? 119.508 161.160 131.850 1.00 339.31 ? 561 THR A O   1 
ATOM 4119  C CB  . THR A 1 561 ? 122.430 159.644 132.490 1.00 454.01 ? 561 THR A CB  1 
ATOM 4120  O OG1 . THR A 1 561 ? 122.406 158.605 133.479 1.00 435.86 ? 561 THR A OG1 1 
ATOM 4121  C CG2 . THR A 1 561 ? 122.461 160.997 133.212 1.00 479.96 ? 561 THR A CG2 1 
ATOM 4122  N N   . ASN A 1 562 ? 119.297 159.241 133.020 1.00 359.23 ? 562 ASN A N   1 
ATOM 4123  C CA  . ASN A 1 562 ? 117.950 159.497 133.517 1.00 408.58 ? 562 ASN A CA  1 
ATOM 4124  C C   . ASN A 1 562 ? 117.805 160.975 133.901 1.00 416.04 ? 562 ASN A C   1 
ATOM 4125  O O   . ASN A 1 562 ? 116.809 161.628 133.555 1.00 430.50 ? 562 ASN A O   1 
ATOM 4126  C CB  . ASN A 1 562 ? 117.641 158.635 134.754 1.00 427.11 ? 562 ASN A CB  1 
ATOM 4127  C CG  . ASN A 1 562 ? 117.815 157.146 134.505 1.00 437.80 ? 562 ASN A CG  1 
ATOM 4128  O OD1 . ASN A 1 562 ? 118.943 156.647 134.512 1.00 465.70 ? 562 ASN A OD1 1 
ATOM 4129  N ND2 . ASN A 1 562 ? 116.700 156.428 134.291 1.00 428.92 ? 562 ASN A ND2 1 
ATOM 4130  N N   . THR A 1 563 ? 118.793 161.430 134.659 1.00 425.33 ? 563 THR A N   1 
ATOM 4131  C CA  . THR A 1 563 ? 118.809 162.786 135.206 1.00 413.29 ? 563 THR A CA  1 
ATOM 4132  C C   . THR A 1 563 ? 118.712 163.820 134.094 1.00 376.25 ? 563 THR A C   1 
ATOM 4133  O O   . THR A 1 563 ? 117.941 164.769 134.209 1.00 381.91 ? 563 THR A O   1 
ATOM 4134  C CB  . THR A 1 563 ? 120.110 163.021 136.024 1.00 475.15 ? 563 THR A CB  1 
ATOM 4135  O OG1 . THR A 1 563 ? 120.015 162.335 137.279 1.00 433.11 ? 563 THR A OG1 1 
ATOM 4136  C CG2 . THR A 1 563 ? 120.388 164.516 136.281 1.00 500.00 ? 563 THR A CG2 1 
ATOM 4137  N N   . THR A 1 564 ? 119.547 163.591 133.094 1.00 367.01 ? 564 THR A N   1 
ATOM 4138  C CA  . THR A 1 564 ? 119.917 164.641 132.174 1.00 369.85 ? 564 THR A CA  1 
ATOM 4139  C C   . THR A 1 564 ? 118.707 165.106 131.379 1.00 357.74 ? 564 THR A C   1 
ATOM 4140  O O   . THR A 1 564 ? 118.453 166.320 131.231 1.00 403.36 ? 564 THR A O   1 
ATOM 4141  C CB  . THR A 1 564 ? 121.051 164.208 131.218 1.00 379.48 ? 564 THR A CB  1 
ATOM 4142  O OG1 . THR A 1 564 ? 122.303 164.217 131.919 1.00 379.17 ? 564 THR A OG1 1 
ATOM 4143  C CG2 . THR A 1 564 ? 121.167 165.144 130.025 1.00 385.67 ? 564 THR A CG2 1 
ATOM 4144  N N   . TYR A 1 565 ? 117.983 164.115 130.866 1.00 384.51 ? 565 TYR A N   1 
ATOM 4145  C CA  . TYR A 1 565 ? 116.775 164.352 130.061 1.00 417.99 ? 565 TYR A CA  1 
ATOM 4146  C C   . TYR A 1 565 ? 115.762 165.150 130.859 1.00 386.47 ? 565 TYR A C   1 
ATOM 4147  O O   . TYR A 1 565 ? 115.181 166.123 130.353 1.00 414.70 ? 565 TYR A O   1 
ATOM 4148  C CB  . TYR A 1 565 ? 116.105 163.041 129.617 1.00 437.68 ? 565 TYR A CB  1 
ATOM 4149  C CG  . TYR A 1 565 ? 116.689 162.463 128.357 1.00 448.48 ? 565 TYR A CG  1 
ATOM 4150  C CD1 . TYR A 1 565 ? 116.659 163.186 127.169 1.00 442.79 ? 565 TYR A CD1 1 
ATOM 4151  C CD2 . TYR A 1 565 ? 117.279 161.198 128.347 1.00 471.48 ? 565 TYR A CD2 1 
ATOM 4152  C CE1 . TYR A 1 565 ? 117.207 162.673 126.004 1.00 473.01 ? 565 TYR A CE1 1 
ATOM 4153  C CE2 . TYR A 1 565 ? 117.828 160.675 127.185 1.00 456.92 ? 565 TYR A CE2 1 
ATOM 4154  C CZ  . TYR A 1 565 ? 117.780 161.413 126.013 1.00 466.48 ? 565 TYR A CZ  1 
ATOM 4155  O OH  . TYR A 1 565 ? 118.312 160.909 124.848 1.00 482.04 ? 565 TYR A OH  1 
ATOM 4156  N N   . VAL A 1 566 ? 115.577 164.715 132.104 1.00 337.94 ? 566 VAL A N   1 
ATOM 4157  C CA  . VAL A 1 566 ? 114.633 165.360 133.029 1.00 357.57 ? 566 VAL A CA  1 
ATOM 4158  C C   . VAL A 1 566 ? 115.003 166.817 133.223 1.00 365.87 ? 566 VAL A C   1 
ATOM 4159  O O   . VAL A 1 566 ? 114.135 167.701 133.173 1.00 435.54 ? 566 VAL A O   1 
ATOM 4160  C CB  . VAL A 1 566 ? 114.523 164.707 134.402 1.00 394.64 ? 566 VAL A CB  1 
ATOM 4161  C CG1 . VAL A 1 566 ? 113.452 165.428 135.229 1.00 375.29 ? 566 VAL A CG1 1 
ATOM 4162  C CG2 . VAL A 1 566 ? 114.141 163.248 134.248 1.00 471.92 ? 566 VAL A CG2 1 
ATOM 4163  N N   . VAL A 1 567 ? 116.291 167.035 133.442 1.00 375.37 ? 567 VAL A N   1 
ATOM 4164  C CA  . VAL A 1 567 ? 116.845 168.377 133.656 1.00 407.36 ? 567 VAL A CA  1 
ATOM 4165  C C   . VAL A 1 567 ? 116.541 169.265 132.452 1.00 390.23 ? 567 VAL A C   1 
ATOM 4166  O O   . VAL A 1 567 ? 116.090 170.416 132.612 1.00 443.10 ? 567 VAL A O   1 
ATOM 4167  C CB  . VAL A 1 567 ? 118.330 168.336 134.041 1.00 439.79 ? 567 VAL A CB  1 
ATOM 4168  C CG1 . VAL A 1 567 ? 118.999 169.665 133.755 1.00 455.40 ? 567 VAL A CG1 1 
ATOM 4169  C CG2 . VAL A 1 567 ? 118.452 167.972 135.517 1.00 430.41 ? 567 VAL A CG2 1 
ATOM 4170  N N   . GLN A 1 568 ? 116.778 168.700 131.276 1.00 379.80 ? 568 GLN A N   1 
ATOM 4171  C CA  . GLN A 1 568 ? 116.557 169.390 130.007 1.00 407.38 ? 568 GLN A CA  1 
ATOM 4172  C C   . GLN A 1 568 ? 115.095 169.816 129.894 1.00 417.96 ? 568 GLN A C   1 
ATOM 4173  O O   . GLN A 1 568 ? 114.790 170.976 129.532 1.00 456.28 ? 568 GLN A O   1 
ATOM 4174  C CB  . GLN A 1 568 ? 116.898 168.496 128.819 1.00 434.29 ? 568 GLN A CB  1 
ATOM 4175  C CG  . GLN A 1 568 ? 116.747 169.171 127.459 1.00 443.48 ? 568 GLN A CG  1 
ATOM 4176  C CD  . GLN A 1 568 ? 115.958 168.338 126.464 1.00 466.02 ? 568 GLN A CD  1 
ATOM 4177  O OE1 . GLN A 1 568 ? 114.846 167.905 126.755 1.00 467.99 ? 568 GLN A OE1 1 
ATOM 4178  N NE2 . GLN A 1 568 ? 116.525 168.126 125.278 1.00 466.60 ? 568 GLN A NE2 1 
ATOM 4179  N N   . TYR A 1 569 ? 114.220 168.868 130.223 1.00 416.56 ? 569 TYR A N   1 
ATOM 4180  C CA  . TYR A 1 569 ? 112.777 169.061 130.093 1.00 440.43 ? 569 TYR A CA  1 
ATOM 4181  C C   . TYR A 1 569 ? 112.192 169.884 131.193 1.00 434.36 ? 569 TYR A C   1 
ATOM 4182  O O   . TYR A 1 569 ? 111.383 170.782 130.893 1.00 426.78 ? 569 TYR A O   1 
ATOM 4183  C CB  . TYR A 1 569 ? 112.010 167.753 129.914 1.00 455.27 ? 569 TYR A CB  1 
ATOM 4184  C CG  . TYR A 1 569 ? 112.099 167.238 128.510 1.00 435.48 ? 569 TYR A CG  1 
ATOM 4185  C CD1 . TYR A 1 569 ? 111.644 168.006 127.450 1.00 449.68 ? 569 TYR A CD1 1 
ATOM 4186  C CD2 . TYR A 1 569 ? 112.657 165.994 128.232 1.00 471.08 ? 569 TYR A CD2 1 
ATOM 4187  C CE1 . TYR A 1 569 ? 111.737 167.554 126.151 1.00 500.00 ? 569 TYR A CE1 1 
ATOM 4188  C CE2 . TYR A 1 569 ? 112.750 165.530 126.931 1.00 499.52 ? 569 TYR A CE2 1 
ATOM 4189  C CZ  . TYR A 1 569 ? 112.286 166.315 125.896 1.00 500.00 ? 569 TYR A CZ  1 
ATOM 4190  O OH  . TYR A 1 569 ? 112.381 165.873 124.600 1.00 500.00 ? 569 TYR A OH  1 
ATOM 4191  N N   . ALA A 1 570 ? 112.712 169.725 132.406 1.00 409.90 ? 570 ALA A N   1 
ATOM 4192  C CA  . ALA A 1 570 ? 112.398 170.636 133.534 1.00 406.57 ? 570 ALA A CA  1 
ATOM 4193  C C   . ALA A 1 570 ? 112.789 172.059 133.158 1.00 399.29 ? 570 ALA A C   1 
ATOM 4194  O O   . ALA A 1 570 ? 112.000 173.004 133.375 1.00 459.97 ? 570 ALA A O   1 
ATOM 4195  C CB  . ALA A 1 570 ? 113.127 170.215 134.790 1.00 434.02 ? 570 ALA A CB  1 
ATOM 4196  N N   . LEU A 1 571 ? 113.990 172.177 132.594 1.00 368.48 ? 571 LEU A N   1 
ATOM 4197  C CA  . LEU A 1 571 ? 114.518 173.485 132.181 1.00 379.57 ? 571 LEU A CA  1 
ATOM 4198  C C   . LEU A 1 571 ? 113.603 174.120 131.148 1.00 381.31 ? 571 LEU A C   1 
ATOM 4199  O O   . LEU A 1 571 ? 113.302 175.304 131.239 1.00 427.14 ? 571 LEU A O   1 
ATOM 4200  C CB  . LEU A 1 571 ? 115.957 173.375 131.686 1.00 430.24 ? 571 LEU A CB  1 
ATOM 4201  C CG  . LEU A 1 571 ? 116.717 174.654 131.343 1.00 452.19 ? 571 LEU A CG  1 
ATOM 4202  C CD1 . LEU A 1 571 ? 116.592 175.703 132.429 1.00 485.91 ? 571 LEU A CD1 1 
ATOM 4203  C CD2 . LEU A 1 571 ? 118.180 174.312 131.118 1.00 500.00 ? 571 LEU A CD2 1 
ATOM 4204  N N   . ALA A 1 572 ? 113.180 173.309 130.195 1.00 408.30 ? 572 ALA A N   1 
ATOM 4205  C CA  . ALA A 1 572 ? 112.280 173.728 129.115 1.00 430.29 ? 572 ALA A CA  1 
ATOM 4206  C C   . ALA A 1 572 ? 110.987 174.282 129.704 1.00 389.16 ? 572 ALA A C   1 
ATOM 4207  O O   . ALA A 1 572 ? 110.514 175.367 129.300 1.00 404.39 ? 572 ALA A O   1 
ATOM 4208  C CB  . ALA A 1 572 ? 111.973 172.557 128.192 1.00 468.96 ? 572 ALA A CB  1 
ATOM 4209  N N   . ASN A 1 573 ? 110.453 173.524 130.659 1.00 363.84 ? 573 ASN A N   1 
ATOM 4210  C CA  . ASN A 1 573 ? 109.206 173.898 131.340 1.00 383.45 ? 573 ASN A CA  1 
ATOM 4211  C C   . ASN A 1 573 ? 109.358 175.244 132.022 1.00 429.90 ? 573 ASN A C   1 
ATOM 4212  O O   . ASN A 1 573 ? 108.476 176.103 131.917 1.00 478.06 ? 573 ASN A O   1 
ATOM 4213  C CB  . ASN A 1 573 ? 108.554 172.920 132.326 1.00 400.13 ? 573 ASN A CB  1 
ATOM 4214  C CG  . ASN A 1 573 ? 107.015 172.993 132.255 1.00 425.69 ? 573 ASN A CG  1 
ATOM 4215  O OD1 . ASN A 1 573 ? 106.449 172.592 131.238 1.00 452.59 ? 573 ASN A OD1 1 
ATOM 4216  N ND2 . ASN A 1 573 ? 106.337 173.506 133.306 1.00 426.82 ? 573 ASN A ND2 1 
ATOM 4217  N N   . LEU A 1 574 ? 110.485 175.397 132.704 1.00 434.19 ? 574 LEU A N   1 
ATOM 4218  C CA  . LEU A 1 574 ? 110.823 176.630 133.425 1.00 450.08 ? 574 LEU A CA  1 
ATOM 4219  C C   . LEU A 1 574 ? 110.994 177.891 132.576 1.00 451.02 ? 574 LEU A C   1 
ATOM 4220  O O   . LEU A 1 574 ? 110.246 178.877 132.744 1.00 436.66 ? 574 LEU A O   1 
ATOM 4221  C CB  . LEU A 1 574 ? 112.045 176.388 134.307 1.00 474.06 ? 574 LEU A CB  1 
ATOM 4222  C CG  . LEU A 1 574 ? 111.800 175.563 135.582 1.00 491.74 ? 574 LEU A CG  1 
ATOM 4223  C CD1 . LEU A 1 574 ? 110.497 174.742 135.624 1.00 469.63 ? 574 LEU A CD1 1 
ATOM 4224  C CD2 . LEU A 1 574 ? 113.031 174.706 135.895 1.00 474.85 ? 574 LEU A CD2 1 
ATOM 4225  N N   . THR A 1 575 ? 111.996 177.846 131.698 1.00 448.54 ? 575 THR A N   1 
ATOM 4226  C CA  . THR A 1 575 ? 112.298 178.947 130.793 1.00 437.57 ? 575 THR A CA  1 
ATOM 4227  C C   . THR A 1 575 ? 111.241 178.994 129.715 1.00 450.86 ? 575 THR A C   1 
ATOM 4228  O O   . THR A 1 575 ? 110.539 179.995 129.553 1.00 495.74 ? 575 THR A O   1 
ATOM 4229  C CB  . THR A 1 575 ? 113.680 178.805 130.108 1.00 446.99 ? 575 THR A CB  1 
ATOM 4230  O OG1 . THR A 1 575 ? 113.760 177.560 129.401 1.00 434.23 ? 575 THR A OG1 1 
ATOM 4231  C CG2 . THR A 1 575 ? 114.800 178.876 131.128 1.00 484.54 ? 575 THR A CG2 1 
ATOM 4232  N N   . GLY A 1 576 ? 111.129 177.900 128.975 1.00 500.00 ? 576 GLY A N   1 
ATOM 4233  C CA  . GLY A 1 576 ? 110.289 177.852 127.791 1.00 500.00 ? 576 GLY A CA  1 
ATOM 4234  C C   . GLY A 1 576 ? 108.812 178.064 128.033 1.00 500.00 ? 576 GLY A C   1 
ATOM 4235  O O   . GLY A 1 576 ? 108.340 178.085 129.178 1.00 500.00 ? 576 GLY A O   1 
ATOM 4236  N N   . THR A 1 577 ? 108.092 178.224 126.927 1.00 500.00 ? 577 THR A N   1 
ATOM 4237  C CA  . THR A 1 577 ? 106.675 178.519 126.963 1.00 500.00 ? 577 THR A CA  1 
ATOM 4238  C C   . THR A 1 577 ? 105.948 177.866 125.782 1.00 499.83 ? 577 THR A C   1 
ATOM 4239  O O   . THR A 1 577 ? 106.478 177.759 124.669 1.00 428.22 ? 577 THR A O   1 
ATOM 4240  C CB  . THR A 1 577 ? 106.435 180.042 127.022 1.00 500.00 ? 577 THR A CB  1 
ATOM 4241  O OG1 . THR A 1 577 ? 105.065 180.306 127.344 1.00 500.00 ? 577 THR A OG1 1 
ATOM 4242  C CG2 . THR A 1 577 ? 106.811 180.711 125.700 1.00 500.00 ? 577 THR A CG2 1 
ATOM 4243  N N   . VAL A 1 578 ? 104.727 177.422 126.067 1.00 500.00 ? 578 VAL A N   1 
ATOM 4244  C CA  . VAL A 1 578 ? 103.856 176.734 125.108 1.00 500.00 ? 578 VAL A CA  1 
ATOM 4245  C C   . VAL A 1 578 ? 103.516 177.620 123.895 1.00 500.00 ? 578 VAL A C   1 
ATOM 4246  O O   . VAL A 1 578 ? 103.754 178.831 123.912 1.00 478.35 ? 578 VAL A O   1 
ATOM 4247  C CB  . VAL A 1 578 ? 102.569 176.226 125.841 1.00 500.00 ? 578 VAL A CB  1 
ATOM 4248  C CG1 . VAL A 1 578 ? 101.674 177.386 126.283 1.00 500.00 ? 578 VAL A CG1 1 
ATOM 4249  C CG2 . VAL A 1 578 ? 101.777 175.212 125.015 1.00 500.00 ? 578 VAL A CG2 1 
ATOM 4250  N N   . VAL A 1 579 ? 102.995 177.004 122.834 1.00 500.00 ? 579 VAL A N   1 
ATOM 4251  C CA  . VAL A 1 579 ? 102.564 177.737 121.638 1.00 500.00 ? 579 VAL A CA  1 
ATOM 4252  C C   . VAL A 1 579 ? 101.471 176.948 120.856 1.00 500.00 ? 579 VAL A C   1 
ATOM 4253  O O   . VAL A 1 579 ? 101.576 175.722 120.721 1.00 500.00 ? 579 VAL A O   1 
ATOM 4254  C CB  . VAL A 1 579 ? 103.812 178.102 120.790 1.00 500.00 ? 579 VAL A CB  1 
ATOM 4255  C CG1 . VAL A 1 579 ? 104.683 176.872 120.508 1.00 500.00 ? 579 VAL A CG1 1 
ATOM 4256  C CG2 . VAL A 1 579 ? 103.410 178.835 119.516 1.00 500.00 ? 579 VAL A CG2 1 
ATOM 4257  N N   . ASN A 1 580 ? 100.427 177.638 120.367 1.00 500.00 ? 580 ASN A N   1 
ATOM 4258  C CA  . ASN A 1 580 ? 99.185  176.961 119.884 1.00 500.00 ? 580 ASN A CA  1 
ATOM 4259  C C   . ASN A 1 580 ? 99.300  176.221 118.525 1.00 500.00 ? 580 ASN A C   1 
ATOM 4260  O O   . ASN A 1 580 ? 98.786  176.668 117.490 1.00 476.69 ? 580 ASN A O   1 
ATOM 4261  C CB  . ASN A 1 580 ? 97.928  177.883 119.972 1.00 500.00 ? 580 ASN A CB  1 
ATOM 4262  C CG  . ASN A 1 580 ? 97.902  179.006 118.935 1.00 474.65 ? 580 ASN A CG  1 
ATOM 4263  O OD1 . ASN A 1 580 ? 98.919  179.662 118.689 1.00 427.31 ? 580 ASN A OD1 1 
ATOM 4264  N ND2 . ASN A 1 580 ? 96.714  179.247 118.340 1.00 367.37 ? 580 ASN A ND2 1 
ATOM 4265  N N   . LEU A 1 581 ? 99.948  175.057 118.574 1.00 497.74 ? 581 LEU A N   1 
ATOM 4266  C CA  . LEU A 1 581 ? 100.328 174.295 117.383 1.00 500.00 ? 581 LEU A CA  1 
ATOM 4267  C C   . LEU A 1 581 ? 99.912  172.816 117.491 1.00 500.00 ? 581 LEU A C   1 
ATOM 4268  O O   . LEU A 1 581 ? 99.309  172.405 118.491 1.00 500.00 ? 581 LEU A O   1 
ATOM 4269  C CB  . LEU A 1 581 ? 101.851 174.379 117.184 1.00 500.00 ? 581 LEU A CB  1 
ATOM 4270  C CG  . LEU A 1 581 ? 102.583 175.709 117.394 1.00 500.00 ? 581 LEU A CG  1 
ATOM 4271  C CD1 . LEU A 1 581 ? 104.098 175.526 117.337 1.00 474.01 ? 581 LEU A CD1 1 
ATOM 4272  C CD2 . LEU A 1 581 ? 102.134 176.730 116.361 1.00 500.00 ? 581 LEU A CD2 1 
ATOM 4273  N N   . THR A 1 582 ? 100.236 172.039 116.447 1.00 500.00 ? 582 THR A N   1 
ATOM 4274  C CA  . THR A 1 582 ? 100.073 170.568 116.428 1.00 500.00 ? 582 THR A CA  1 
ATOM 4275  C C   . THR A 1 582 ? 101.408 169.832 116.452 1.00 482.42 ? 582 THR A C   1 
ATOM 4276  O O   . THR A 1 582 ? 102.470 170.445 116.403 1.00 454.31 ? 582 THR A O   1 
ATOM 4277  C CB  . THR A 1 582 ? 99.236  170.064 115.214 1.00 500.00 ? 582 THR A CB  1 
ATOM 4278  O OG1 . THR A 1 582 ? 98.886  168.688 115.423 1.00 500.00 ? 582 THR A OG1 1 
ATOM 4279  C CG2 . THR A 1 582 ? 99.981  170.176 113.887 1.00 500.00 ? 582 THR A CG2 1 
ATOM 4280  N N   . ARG A 1 583 ? 101.323 168.509 116.500 1.00 465.52 ? 583 ARG A N   1 
ATOM 4281  C CA  . ARG A 1 583 ? 102.488 167.656 116.677 1.00 477.18 ? 583 ARG A CA  1 
ATOM 4282  C C   . ARG A 1 583 ? 103.416 167.771 115.465 1.00 477.68 ? 583 ARG A C   1 
ATOM 4283  O O   . ARG A 1 583 ? 104.641 167.945 115.602 1.00 424.76 ? 583 ARG A O   1 
ATOM 4284  C CB  . ARG A 1 583 ? 102.018 166.212 116.847 1.00 486.67 ? 583 ARG A CB  1 
ATOM 4285  C CG  . ARG A 1 583 ? 103.130 165.228 117.141 1.00 500.00 ? 583 ARG A CG  1 
ATOM 4286  C CD  . ARG A 1 583 ? 102.639 163.792 117.102 1.00 500.00 ? 583 ARG A CD  1 
ATOM 4287  N NE  . ARG A 1 583 ? 103.768 162.895 116.852 1.00 500.00 ? 583 ARG A NE  1 
ATOM 4288  C CZ  . ARG A 1 583 ? 104.389 162.744 115.678 1.00 500.00 ? 583 ARG A CZ  1 
ATOM 4289  N NH1 . ARG A 1 583 ? 103.999 163.420 114.592 1.00 500.00 ? 583 ARG A NH1 1 
ATOM 4290  N NH2 . ARG A 1 583 ? 105.418 161.904 115.579 1.00 500.00 ? 583 ARG A NH2 1 
ATOM 4291  N N   . GLU A 1 584 ? 102.792 167.661 114.299 1.00 478.85 ? 584 GLU A N   1 
ATOM 4292  C CA  . GLU A 1 584 ? 103.493 167.730 113.015 1.00 500.00 ? 584 GLU A CA  1 
ATOM 4293  C C   . GLU A 1 584 ? 104.240 169.053 112.890 1.00 466.84 ? 584 GLU A C   1 
ATOM 4294  O O   . GLU A 1 584 ? 105.422 169.095 112.507 1.00 421.79 ? 584 GLU A O   1 
ATOM 4295  C CB  . GLU A 1 584 ? 102.495 167.611 111.869 1.00 500.00 ? 584 GLU A CB  1 
ATOM 4296  C CG  . GLU A 1 584 ? 101.925 166.206 111.696 1.00 500.00 ? 584 GLU A CG  1 
ATOM 4297  C CD  . GLU A 1 584 ? 102.882 165.225 111.004 1.00 500.00 ? 584 GLU A CD  1 
ATOM 4298  O OE1 . GLU A 1 584 ? 104.104 165.505 110.886 1.00 500.00 ? 584 GLU A OE1 1 
ATOM 4299  O OE2 . GLU A 1 584 ? 102.404 164.151 110.567 1.00 500.00 ? 584 GLU A OE2 1 
ATOM 4300  N N   . GLN A 1 585 ? 103.514 170.110 113.224 1.00 479.88 ? 585 GLN A N   1 
ATOM 4301  C CA  . GLN A 1 585 ? 104.039 171.485 113.169 1.00 500.00 ? 585 GLN A CA  1 
ATOM 4302  C C   . GLN A 1 585 ? 105.265 171.605 114.066 1.00 500.00 ? 585 GLN A C   1 
ATOM 4303  O O   . GLN A 1 585 ? 106.290 172.171 113.663 1.00 500.00 ? 585 GLN A O   1 
ATOM 4304  C CB  . GLN A 1 585 ? 102.962 172.497 113.574 1.00 494.21 ? 585 GLN A CB  1 
ATOM 4305  C CG  . GLN A 1 585 ? 101.899 172.717 112.506 1.00 474.45 ? 585 GLN A CG  1 
ATOM 4306  C CD  . GLN A 1 585 ? 100.701 173.519 112.999 1.00 470.71 ? 585 GLN A CD  1 
ATOM 4307  O OE1 . GLN A 1 585 ? 100.181 173.284 114.088 1.00 427.63 ? 585 GLN A OE1 1 
ATOM 4308  N NE2 . GLN A 1 585 ? 100.256 174.473 112.190 1.00 493.20 ? 585 GLN A NE2 1 
ATOM 4309  N N   . CYS A 1 586 ? 105.120 171.065 115.271 1.00 500.00 ? 586 CYS A N   1 
ATOM 4310  C CA  . CYS A 1 586 ? 106.189 171.080 116.279 1.00 500.00 ? 586 CYS A CA  1 
ATOM 4311  C C   . CYS A 1 586 ? 107.438 170.394 115.731 1.00 500.00 ? 586 CYS A C   1 
ATOM 4312  O O   . CYS A 1 586 ? 108.555 170.913 115.860 1.00 500.00 ? 586 CYS A O   1 
ATOM 4313  C CB  . CYS A 1 586 ? 105.748 170.446 117.614 1.00 500.00 ? 586 CYS A CB  1 
ATOM 4314  S SG  . CYS A 1 586 ? 106.040 171.524 119.055 1.00 500.00 ? 586 CYS A SG  1 
ATOM 4315  N N   . GLN A 1 587 ? 107.204 169.237 115.128 1.00 500.00 ? 587 GLN A N   1 
ATOM 4316  C CA  . GLN A 1 587 ? 108.268 168.427 114.529 1.00 500.00 ? 587 GLN A CA  1 
ATOM 4317  C C   . GLN A 1 587 ? 109.022 169.235 113.469 1.00 496.30 ? 587 GLN A C   1 
ATOM 4318  O O   . GLN A 1 587 ? 110.269 169.223 113.465 1.00 360.22 ? 587 GLN A O   1 
ATOM 4319  C CB  . GLN A 1 587 ? 107.718 167.113 113.956 1.00 500.00 ? 587 GLN A CB  1 
ATOM 4320  C CG  . GLN A 1 587 ? 108.538 165.898 114.364 1.00 500.00 ? 587 GLN A CG  1 
ATOM 4321  C CD  . GLN A 1 587 ? 108.597 165.727 115.873 1.00 500.00 ? 587 GLN A CD  1 
ATOM 4322  O OE1 . GLN A 1 587 ? 109.670 165.828 116.474 1.00 500.00 ? 587 GLN A OE1 1 
ATOM 4323  N NE2 . GLN A 1 587 ? 107.441 165.507 116.498 1.00 500.00 ? 587 GLN A NE2 1 
ATOM 4324  N N   . ASP A 1 588 ? 108.304 169.960 112.607 1.00 500.00 ? 588 ASP A N   1 
ATOM 4325  C CA  . ASP A 1 588 ? 108.950 170.844 111.618 1.00 500.00 ? 588 ASP A CA  1 
ATOM 4326  C C   . ASP A 1 588 ? 108.356 172.256 111.568 1.00 500.00 ? 588 ASP A C   1 
ATOM 4327  O O   . ASP A 1 588 ? 107.429 172.524 110.793 1.00 500.00 ? 588 ASP A O   1 
ATOM 4328  C CB  . ASP A 1 588 ? 108.973 170.196 110.234 1.00 500.00 ? 588 ASP A CB  1 
ATOM 4329  C CG  . ASP A 1 588 ? 110.251 169.412 109.997 1.00 500.00 ? 588 ASP A CG  1 
ATOM 4330  O OD1 . ASP A 1 588 ? 111.336 170.044 109.966 1.00 500.00 ? 588 ASP A OD1 1 
ATOM 4331  O OD2 . ASP A 1 588 ? 110.174 168.172 109.857 1.00 500.00 ? 588 ASP A OD2 1 
ATOM 4332  N N   . PRO A 1 589 ? 108.891 173.161 112.418 1.00 500.00 ? 589 PRO A N   1 
ATOM 4333  C CA  . PRO A 1 589 ? 108.622 174.602 112.372 1.00 500.00 ? 589 PRO A CA  1 
ATOM 4334  C C   . PRO A 1 589 ? 109.473 175.338 111.325 1.00 500.00 ? 589 PRO A C   1 
ATOM 4335  O O   . PRO A 1 589 ? 109.331 176.553 111.162 1.00 500.00 ? 589 PRO A O   1 
ATOM 4336  C CB  . PRO A 1 589 ? 108.956 175.072 113.795 1.00 500.00 ? 589 PRO A CB  1 
ATOM 4337  C CG  . PRO A 1 589 ? 109.894 174.051 114.348 1.00 500.00 ? 589 PRO A CG  1 
ATOM 4338  C CD  . PRO A 1 589 ? 109.862 172.830 113.476 1.00 500.00 ? 589 PRO A CD  1 
ATOM 4339  N N   . SER A 1 590 ? 110.365 174.609 110.652 1.00 500.00 ? 590 SER A N   1 
ATOM 4340  C CA  . SER A 1 590 ? 110.937 175.037 109.385 1.00 495.14 ? 590 SER A CA  1 
ATOM 4341  C C   . SER A 1 590 ? 109.818 175.284 108.373 1.00 500.00 ? 590 SER A C   1 
ATOM 4342  O O   . SER A 1 590 ? 109.860 176.256 107.615 1.00 500.00 ? 590 SER A O   1 
ATOM 4343  C CB  . SER A 1 590 ? 111.879 173.954 108.851 1.00 481.37 ? 590 SER A CB  1 
ATOM 4344  O OG  . SER A 1 590 ? 112.750 173.484 109.865 1.00 447.47 ? 590 SER A OG  1 
ATOM 4345  N N   . LYS A 1 591 ? 108.822 174.395 108.381 1.00 500.00 ? 591 LYS A N   1 
ATOM 4346  C CA  . LYS A 1 591 ? 107.641 174.513 107.515 1.00 500.00 ? 591 LYS A CA  1 
ATOM 4347  C C   . LYS A 1 591 ? 106.723 175.688 107.886 1.00 500.00 ? 591 LYS A C   1 
ATOM 4348  O O   . LYS A 1 591 ? 106.184 176.367 107.004 1.00 500.00 ? 591 LYS A O   1 
ATOM 4349  C CB  . LYS A 1 591 ? 106.835 173.205 107.531 1.00 500.00 ? 591 LYS A CB  1 
ATOM 4350  C CG  . LYS A 1 591 ? 105.786 173.111 106.424 1.00 500.00 ? 591 LYS A CG  1 
ATOM 4351  C CD  . LYS A 1 591 ? 105.207 171.708 106.271 1.00 500.00 ? 591 LYS A CD  1 
ATOM 4352  C CE  . LYS A 1 591 ? 104.517 171.210 107.538 1.00 500.00 ? 591 LYS A CE  1 
ATOM 4353  N NZ  . LYS A 1 591 ? 103.514 172.168 108.089 1.00 500.00 ? 591 LYS A NZ  1 
ATOM 4354  N N   . VAL A 1 592 ? 106.545 175.908 109.189 1.00 500.00 ? 592 VAL A N   1 
ATOM 4355  C CA  . VAL A 1 592 ? 105.721 177.010 109.692 1.00 500.00 ? 592 VAL A CA  1 
ATOM 4356  C C   . VAL A 1 592 ? 106.473 178.323 109.427 1.00 500.00 ? 592 VAL A C   1 
ATOM 4357  O O   . VAL A 1 592 ? 107.681 178.393 109.678 1.00 500.00 ? 592 VAL A O   1 
ATOM 4358  C CB  . VAL A 1 592 ? 105.411 176.848 111.201 1.00 500.00 ? 592 VAL A CB  1 
ATOM 4359  C CG1 . VAL A 1 592 ? 104.532 177.986 111.721 1.00 500.00 ? 592 VAL A CG1 1 
ATOM 4360  C CG2 . VAL A 1 592 ? 104.742 175.496 111.457 1.00 500.00 ? 592 VAL A CG2 1 
ATOM 4361  N N   . PRO A 1 593 ? 105.771 179.361 108.899 1.00 500.00 ? 593 PRO A N   1 
ATOM 4362  C CA  . PRO A 1 593 ? 106.451 180.646 108.558 1.00 500.00 ? 593 PRO A CA  1 
ATOM 4363  C C   . PRO A 1 593 ? 107.124 181.349 109.756 1.00 500.00 ? 593 PRO A C   1 
ATOM 4364  O O   . PRO A 1 593 ? 108.336 181.602 109.736 1.00 500.00 ? 593 PRO A O   1 
ATOM 4365  C CB  . PRO A 1 593 ? 105.320 181.514 107.947 1.00 500.00 ? 593 PRO A CB  1 
ATOM 4366  C CG  . PRO A 1 593 ? 104.032 180.784 108.197 1.00 500.00 ? 593 PRO A CG  1 
ATOM 4367  C CD  . PRO A 1 593 ? 104.363 179.337 108.436 1.00 500.00 ? 593 PRO A CD  1 
ATOM 4368  N N   . SER A 1 594 ? 106.323 181.641 110.778 1.00 500.00 ? 594 SER A N   1 
ATOM 4369  C CA  . SER A 1 594 ? 106.816 182.077 112.079 1.00 500.00 ? 594 SER A CA  1 
ATOM 4370  C C   . SER A 1 594 ? 107.470 180.877 112.795 1.00 500.00 ? 594 SER A C   1 
ATOM 4371  O O   . SER A 1 594 ? 107.427 179.749 112.287 1.00 500.00 ? 594 SER A O   1 
ATOM 4372  C CB  . SER A 1 594 ? 105.653 182.657 112.903 1.00 500.00 ? 594 SER A CB  1 
ATOM 4373  O OG  . SER A 1 594 ? 104.486 181.840 112.828 1.00 483.60 ? 594 SER A OG  1 
ATOM 4374  N N   . GLU A 1 595 ? 108.068 181.130 113.962 1.00 500.00 ? 595 GLU A N   1 
ATOM 4375  C CA  . GLU A 1 595 ? 108.696 180.088 114.807 1.00 500.00 ? 595 GLU A CA  1 
ATOM 4376  C C   . GLU A 1 595 ? 109.948 179.511 114.136 1.00 500.00 ? 595 GLU A C   1 
ATOM 4377  O O   . GLU A 1 595 ? 109.873 178.510 113.418 1.00 500.00 ? 595 GLU A O   1 
ATOM 4378  C CB  . GLU A 1 595 ? 107.705 178.945 115.187 1.00 500.00 ? 595 GLU A CB  1 
ATOM 4379  C CG  . GLU A 1 595 ? 106.340 179.372 115.735 1.00 500.00 ? 595 GLU A CG  1 
ATOM 4380  C CD  . GLU A 1 595 ? 106.401 180.116 117.066 1.00 500.00 ? 595 GLU A CD  1 
ATOM 4381  O OE1 . GLU A 1 595 ? 107.157 179.692 117.963 1.00 500.00 ? 595 GLU A OE1 1 
ATOM 4382  O OE2 . GLU A 1 595 ? 105.673 181.122 117.226 1.00 500.00 ? 595 GLU A OE2 1 
ATOM 4383  N N   . ASN A 1 596 ? 111.093 180.147 114.366 1.00 457.55 ? 596 ASN A N   1 
ATOM 4384  C CA  . ASN A 1 596 ? 112.357 179.666 113.809 1.00 460.13 ? 596 ASN A CA  1 
ATOM 4385  C C   . ASN A 1 596 ? 112.933 178.511 114.635 1.00 446.28 ? 596 ASN A C   1 
ATOM 4386  O O   . ASN A 1 596 ? 113.105 178.629 115.848 1.00 411.90 ? 596 ASN A O   1 
ATOM 4387  C CB  . ASN A 1 596 ? 113.368 180.807 113.705 1.00 482.38 ? 596 ASN A CB  1 
ATOM 4388  C CG  . ASN A 1 596 ? 114.617 180.427 112.919 1.00 499.96 ? 596 ASN A CG  1 
ATOM 4389  O OD1 . ASN A 1 596 ? 114.949 179.251 112.762 1.00 495.59 ? 596 ASN A OD1 1 
ATOM 4390  N ND2 . ASN A 1 596 ? 115.324 181.439 112.427 1.00 500.00 ? 596 ASN A ND2 1 
ATOM 4391  N N   . LYS A 1 597 ? 113.257 177.415 113.946 1.00 482.11 ? 597 LYS A N   1 
ATOM 4392  C CA  . LYS A 1 597 ? 113.768 176.191 114.575 1.00 500.00 ? 597 LYS A CA  1 
ATOM 4393  C C   . LYS A 1 597 ? 115.204 176.313 115.040 1.00 475.06 ? 597 LYS A C   1 
ATOM 4394  O O   . LYS A 1 597 ? 115.616 175.628 115.977 1.00 445.71 ? 597 LYS A O   1 
ATOM 4395  C CB  . LYS A 1 597 ? 113.657 175.004 113.619 1.00 500.00 ? 597 LYS A CB  1 
ATOM 4396  C CG  . LYS A 1 597 ? 113.673 173.654 114.331 1.00 500.00 ? 597 LYS A CG  1 
ATOM 4397  C CD  . LYS A 1 597 ? 113.491 172.488 113.356 1.00 500.00 ? 597 LYS A CD  1 
ATOM 4398  C CE  . LYS A 1 597 ? 112.916 171.225 114.015 1.00 500.00 ? 597 LYS A CE  1 
ATOM 4399  N NZ  . LYS A 1 597 ? 113.884 170.515 114.909 1.00 500.00 ? 597 LYS A NZ  1 
ATOM 4400  N N   . ASP A 1 598 ? 115.962 177.170 114.362 1.00 500.00 ? 598 ASP A N   1 
ATOM 4401  C CA  . ASP A 1 598 ? 117.335 177.485 114.750 1.00 500.00 ? 598 ASP A CA  1 
ATOM 4402  C C   . ASP A 1 598 ? 117.403 178.395 115.994 1.00 500.00 ? 598 ASP A C   1 
ATOM 4403  O O   . ASP A 1 598 ? 118.458 178.492 116.625 1.00 500.00 ? 598 ASP A O   1 
ATOM 4404  C CB  . ASP A 1 598 ? 118.065 178.145 113.567 1.00 500.00 ? 598 ASP A CB  1 
ATOM 4405  C CG  . ASP A 1 598 ? 119.585 178.138 113.712 1.00 500.00 ? 598 ASP A CG  1 
ATOM 4406  O OD1 . ASP A 1 598 ? 120.145 177.257 114.401 1.00 500.00 ? 598 ASP A OD1 1 
ATOM 4407  O OD2 . ASP A 1 598 ? 120.227 179.021 113.100 1.00 500.00 ? 598 ASP A OD2 1 
ATOM 4408  N N   . LEU A 1 599 ? 116.290 179.056 116.335 1.00 500.00 ? 599 LEU A N   1 
ATOM 4409  C CA  . LEU A 1 599 ? 116.212 179.926 117.519 1.00 479.88 ? 599 LEU A CA  1 
ATOM 4410  C C   . LEU A 1 599 ? 115.634 179.275 118.778 1.00 478.27 ? 599 LEU A C   1 
ATOM 4411  O O   . LEU A 1 599 ? 115.692 179.877 119.846 1.00 479.21 ? 599 LEU A O   1 
ATOM 4412  C CB  . LEU A 1 599 ? 115.415 181.191 117.199 1.00 480.63 ? 599 LEU A CB  1 
ATOM 4413  C CG  . LEU A 1 599 ? 116.264 182.341 116.658 1.00 500.00 ? 599 LEU A CG  1 
ATOM 4414  C CD1 . LEU A 1 599 ? 117.069 181.935 115.427 1.00 500.00 ? 599 LEU A CD1 1 
ATOM 4415  C CD2 . LEU A 1 599 ? 115.366 183.540 116.372 1.00 500.00 ? 599 LEU A CD2 1 
ATOM 4416  N N   . TYR A 1 600 ? 115.095 178.061 118.671 1.00 487.05 ? 600 TYR A N   1 
ATOM 4417  C CA  . TYR A 1 600 ? 114.563 177.345 119.835 1.00 459.73 ? 600 TYR A CA  1 
ATOM 4418  C C   . TYR A 1 600 ? 114.828 175.838 119.737 1.00 405.18 ? 600 TYR A C   1 
ATOM 4419  O O   . TYR A 1 600 ? 115.644 175.376 118.935 1.00 358.99 ? 600 TYR A O   1 
ATOM 4420  C CB  . TYR A 1 600 ? 113.055 177.602 119.952 1.00 486.28 ? 600 TYR A CB  1 
ATOM 4421  C CG  . TYR A 1 600 ? 112.656 179.024 120.276 1.00 500.00 ? 600 TYR A CG  1 
ATOM 4422  C CD1 . TYR A 1 600 ? 112.552 179.457 121.602 1.00 499.68 ? 600 TYR A CD1 1 
ATOM 4423  C CD2 . TYR A 1 600 ? 112.352 179.931 119.256 1.00 498.67 ? 600 TYR A CD2 1 
ATOM 4424  C CE1 . TYR A 1 600 ? 112.174 180.758 121.900 1.00 491.69 ? 600 TYR A CE1 1 
ATOM 4425  C CE2 . TYR A 1 600 ? 111.967 181.231 119.541 1.00 481.92 ? 600 TYR A CE2 1 
ATOM 4426  C CZ  . TYR A 1 600 ? 111.875 181.639 120.860 1.00 500.00 ? 600 TYR A CZ  1 
ATOM 4427  O OH  . TYR A 1 600 ? 111.496 182.930 121.132 1.00 500.00 ? 600 TYR A OH  1 
ATOM 4428  N N   . GLU A 1 601 ? 114.169 175.092 120.614 1.00 430.16 ? 601 GLU A N   1 
ATOM 4429  C CA  . GLU A 1 601 ? 113.961 173.673 120.444 1.00 483.57 ? 601 GLU A CA  1 
ATOM 4430  C C   . GLU A 1 601 ? 112.505 173.383 120.748 1.00 482.68 ? 601 GLU A C   1 
ATOM 4431  O O   . GLU A 1 601 ? 112.061 173.538 121.888 1.00 483.80 ? 601 GLU A O   1 
ATOM 4432  C CB  . GLU A 1 601 ? 114.848 172.883 121.389 1.00 500.00 ? 601 GLU A CB  1 
ATOM 4433  C CG  . GLU A 1 601 ? 116.223 172.584 120.829 1.00 500.00 ? 601 GLU A CG  1 
ATOM 4434  C CD  . GLU A 1 601 ? 116.808 171.322 121.428 1.00 500.00 ? 601 GLU A CD  1 
ATOM 4435  O OE1 . GLU A 1 601 ? 116.719 171.161 122.664 1.00 500.00 ? 601 GLU A OE1 1 
ATOM 4436  O OE2 . GLU A 1 601 ? 117.338 170.487 120.663 1.00 500.00 ? 601 GLU A OE2 1 
ATOM 4437  N N   . TYR A 1 602 ? 111.771 172.956 119.729 1.00 464.84 ? 602 TYR A N   1 
ATOM 4438  C CA  . TYR A 1 602 ? 110.342 172.732 119.855 1.00 444.33 ? 602 TYR A CA  1 
ATOM 4439  C C   . TYR A 1 602 ? 110.123 171.290 120.240 1.00 445.84 ? 602 TYR A C   1 
ATOM 4440  O O   . TYR A 1 602 ? 110.033 170.400 119.390 1.00 388.59 ? 602 TYR A O   1 
ATOM 4441  C CB  . TYR A 1 602 ? 109.626 173.089 118.568 1.00 459.38 ? 602 TYR A CB  1 
ATOM 4442  C CG  . TYR A 1 602 ? 109.815 174.534 118.206 1.00 500.00 ? 602 TYR A CG  1 
ATOM 4443  C CD1 . TYR A 1 602 ? 110.934 174.950 117.484 1.00 500.00 ? 602 TYR A CD1 1 
ATOM 4444  C CD2 . TYR A 1 602 ? 108.892 175.498 118.607 1.00 500.00 ? 602 TYR A CD2 1 
ATOM 4445  C CE1 . TYR A 1 602 ? 111.117 176.281 117.151 1.00 500.00 ? 602 TYR A CE1 1 
ATOM 4446  C CE2 . TYR A 1 602 ? 109.070 176.836 118.277 1.00 500.00 ? 602 TYR A CE2 1 
ATOM 4447  C CZ  . TYR A 1 602 ? 110.191 177.222 117.549 1.00 500.00 ? 602 TYR A CZ  1 
ATOM 4448  O OH  . TYR A 1 602 ? 110.397 178.538 117.208 1.00 500.00 ? 602 TYR A OH  1 
ATOM 4449  N N   . SER A 1 603 ? 110.091 171.076 121.550 1.00 490.00 ? 603 SER A N   1 
ATOM 4450  C CA  . SER A 1 603 ? 109.789 169.783 122.125 1.00 500.00 ? 603 SER A CA  1 
ATOM 4451  C C   . SER A 1 603 ? 108.285 169.621 122.181 1.00 474.93 ? 603 SER A C   1 
ATOM 4452  O O   . SER A 1 603 ? 107.584 170.437 122.805 1.00 480.25 ? 603 SER A O   1 
ATOM 4453  C CB  . SER A 1 603 ? 110.366 169.681 123.534 1.00 500.00 ? 603 SER A CB  1 
ATOM 4454  O OG  . SER A 1 603 ? 110.059 170.836 124.297 1.00 500.00 ? 603 SER A OG  1 
ATOM 4455  N N   . TRP A 1 604 ? 107.796 168.596 121.488 1.00 488.68 ? 604 TRP A N   1 
ATOM 4456  C CA  . TRP A 1 604 ? 106.436 168.135 121.671 1.00 500.00 ? 604 TRP A CA  1 
ATOM 4457  C C   . TRP A 1 604 ? 106.493 167.190 122.861 1.00 482.45 ? 604 TRP A C   1 
ATOM 4458  O O   . TRP A 1 604 ? 107.307 166.272 122.893 1.00 468.45 ? 604 TRP A O   1 
ATOM 4459  C CB  . TRP A 1 604 ? 105.889 167.440 120.418 1.00 500.00 ? 604 TRP A CB  1 
ATOM 4460  C CG  . TRP A 1 604 ? 104.373 167.424 120.349 1.00 500.00 ? 604 TRP A CG  1 
ATOM 4461  C CD1 . TRP A 1 604 ? 103.545 168.478 120.042 1.00 500.00 ? 604 TRP A CD1 1 
ATOM 4462  C CD2 . TRP A 1 604 ? 103.517 166.304 120.596 1.00 500.00 ? 604 TRP A CD2 1 
ATOM 4463  N NE1 . TRP A 1 604 ? 102.229 168.074 120.075 1.00 500.00 ? 604 TRP A NE1 1 
ATOM 4464  C CE2 . TRP A 1 604 ? 102.184 166.745 120.412 1.00 500.00 ? 604 TRP A CE2 1 
ATOM 4465  C CE3 . TRP A 1 604 ? 103.748 164.961 120.950 1.00 500.00 ? 604 TRP A CE3 1 
ATOM 4466  C CZ2 . TRP A 1 604 ? 101.082 165.890 120.572 1.00 500.00 ? 604 TRP A CZ2 1 
ATOM 4467  C CZ3 . TRP A 1 604 ? 102.649 164.108 121.111 1.00 500.00 ? 604 TRP A CZ3 1 
ATOM 4468  C CH2 . TRP A 1 604 ? 101.334 164.578 120.915 1.00 500.00 ? 604 TRP A CH2 1 
ATOM 4469  N N   . VAL A 1 605 ? 105.621 167.433 123.828 1.00 442.24 ? 605 VAL A N   1 
ATOM 4470  C CA  . VAL A 1 605 ? 105.734 166.857 125.157 1.00 416.09 ? 605 VAL A CA  1 
ATOM 4471  C C   . VAL A 1 605 ? 104.439 166.121 125.475 1.00 420.30 ? 605 VAL A C   1 
ATOM 4472  O O   . VAL A 1 605 ? 103.439 166.301 124.784 1.00 468.79 ? 605 VAL A O   1 
ATOM 4473  C CB  . VAL A 1 605 ? 105.934 167.994 126.179 1.00 465.77 ? 605 VAL A CB  1 
ATOM 4474  C CG1 . VAL A 1 605 ? 106.561 167.488 127.465 1.00 500.00 ? 605 VAL A CG1 1 
ATOM 4475  C CG2 . VAL A 1 605 ? 106.796 169.107 125.586 1.00 481.19 ? 605 VAL A CG2 1 
ATOM 4476  N N   . GLN A 1 606 ? 104.457 165.287 126.509 1.00 402.80 ? 606 GLN A N   1 
ATOM 4477  C CA  . GLN A 1 606 ? 103.229 164.900 127.198 1.00 421.02 ? 606 GLN A CA  1 
ATOM 4478  C C   . GLN A 1 606 ? 102.730 166.108 127.986 1.00 447.28 ? 606 GLN A C   1 
ATOM 4479  O O   . GLN A 1 606 ? 103.441 167.099 128.143 1.00 482.82 ? 606 GLN A O   1 
ATOM 4480  C CB  . GLN A 1 606 ? 103.469 163.750 128.174 1.00 464.15 ? 606 GLN A CB  1 
ATOM 4481  C CG  . GLN A 1 606 ? 103.718 162.381 127.552 1.00 500.00 ? 606 GLN A CG  1 
ATOM 4482  C CD  . GLN A 1 606 ? 103.845 161.286 128.609 1.00 500.00 ? 606 GLN A CD  1 
ATOM 4483  O OE1 . GLN A 1 606 ? 103.757 161.551 129.812 1.00 500.00 ? 606 GLN A OE1 1 
ATOM 4484  N NE2 . GLN A 1 606 ? 104.051 160.054 128.170 1.00 500.00 ? 606 GLN A NE2 1 
ATOM 4485  N N   . GLY A 1 607 ? 101.503 166.014 128.485 1.00 462.01 ? 607 GLY A N   1 
ATOM 4486  C CA  . GLY A 1 607 ? 100.917 167.053 129.332 1.00 464.20 ? 607 GLY A CA  1 
ATOM 4487  C C   . GLY A 1 607 ? 100.535 166.496 130.688 1.00 469.63 ? 607 GLY A C   1 
ATOM 4488  O O   . GLY A 1 607 ? 100.885 165.357 131.018 1.00 453.81 ? 607 GLY A O   1 
ATOM 4489  N N   . PRO A 1 608 ? 99.825  167.302 131.496 1.00 467.35 ? 608 PRO A N   1 
ATOM 4490  C CA  . PRO A 1 608 ? 99.251  166.773 132.722 1.00 478.51 ? 608 PRO A CA  1 
ATOM 4491  C C   . PRO A 1 608 ? 98.063  165.881 132.400 1.00 486.51 ? 608 PRO A C   1 
ATOM 4492  O O   . PRO A 1 608 ? 97.386  166.086 131.382 1.00 435.11 ? 608 PRO A O   1 
ATOM 4493  C CB  . PRO A 1 608 ? 98.796  168.028 133.468 1.00 500.00 ? 608 PRO A CB  1 
ATOM 4494  C CG  . PRO A 1 608 ? 98.518  169.022 132.399 1.00 486.21 ? 608 PRO A CG  1 
ATOM 4495  C CD  . PRO A 1 608 ? 99.519  168.733 131.318 1.00 487.74 ? 608 PRO A CD  1 
ATOM 4496  N N   . LEU A 1 609 ? 97.823  164.896 133.257 1.00 500.00 ? 609 LEU A N   1 
ATOM 4497  C CA  . LEU A 1 609 ? 96.651  164.042 133.118 1.00 500.00 ? 609 LEU A CA  1 
ATOM 4498  C C   . LEU A 1 609 ? 95.399  164.900 133.266 1.00 500.00 ? 609 LEU A C   1 
ATOM 4499  O O   . LEU A 1 609 ? 95.270  165.646 134.246 1.00 500.00 ? 609 LEU A O   1 
ATOM 4500  C CB  . LEU A 1 609 ? 96.650  162.932 134.177 1.00 500.00 ? 609 LEU A CB  1 
ATOM 4501  C CG  . LEU A 1 609 ? 97.750  161.870 134.061 1.00 500.00 ? 609 LEU A CG  1 
ATOM 4502  C CD1 . LEU A 1 609 ? 97.845  161.048 135.342 1.00 500.00 ? 609 LEU A CD1 1 
ATOM 4503  C CD2 . LEU A 1 609 ? 97.524  160.960 132.859 1.00 500.00 ? 609 LEU A CD2 1 
ATOM 4504  N N   . HIS A 1 610 ? 94.499  164.815 132.283 1.00 500.00 ? 610 HIS A N   1 
ATOM 4505  C CA  . HIS A 1 610 ? 93.213  165.510 132.357 1.00 500.00 ? 610 HIS A CA  1 
ATOM 4506  C C   . HIS A 1 610 ? 92.313  164.855 133.415 1.00 500.00 ? 610 HIS A C   1 
ATOM 4507  O O   . HIS A 1 610 ? 92.376  163.641 133.621 1.00 500.00 ? 610 HIS A O   1 
ATOM 4508  C CB  . HIS A 1 610 ? 92.510  165.552 130.995 1.00 500.00 ? 610 HIS A CB  1 
ATOM 4509  C CG  . HIS A 1 610 ? 91.483  166.635 130.898 1.00 500.00 ? 610 HIS A CG  1 
ATOM 4510  N ND1 . HIS A 1 610 ? 90.144  166.385 130.679 1.00 500.00 ? 610 HIS A ND1 1 
ATOM 4511  C CD2 . HIS A 1 610 ? 91.596  167.980 131.039 1.00 500.00 ? 610 HIS A CD2 1 
ATOM 4512  C CE1 . HIS A 1 610 ? 89.481  167.531 130.666 1.00 500.00 ? 610 HIS A CE1 1 
ATOM 4513  N NE2 . HIS A 1 610 ? 90.339  168.512 130.884 1.00 500.00 ? 610 HIS A NE2 1 
ATOM 4514  N N   . SER A 1 611 ? 91.484  165.667 134.076 1.00 500.00 ? 611 SER A N   1 
ATOM 4515  C CA  . SER A 1 611 ? 90.692  165.218 135.233 1.00 500.00 ? 611 SER A CA  1 
ATOM 4516  C C   . SER A 1 611 ? 89.759  164.049 134.858 1.00 500.00 ? 611 SER A C   1 
ATOM 4517  O O   . SER A 1 611 ? 89.455  163.844 133.671 1.00 500.00 ? 611 SER A O   1 
ATOM 4518  C CB  . SER A 1 611 ? 89.905  166.391 135.853 1.00 500.00 ? 611 SER A CB  1 
ATOM 4519  O OG  . SER A 1 611 ? 89.687  166.196 137.243 1.00 467.38 ? 611 SER A OG  1 
ATOM 4520  N N   . ASN A 1 612 ? 89.326  163.295 135.877 1.00 500.00 ? 612 ASN A N   1 
ATOM 4521  C CA  . ASN A 1 612 ? 88.601  162.001 135.732 1.00 500.00 ? 612 ASN A CA  1 
ATOM 4522  C C   . ASN A 1 612 ? 89.451  160.945 134.995 1.00 500.00 ? 612 ASN A C   1 
ATOM 4523  O O   . ASN A 1 612 ? 89.935  159.967 135.593 1.00 448.19 ? 612 ASN A O   1 
ATOM 4524  C CB  . ASN A 1 612 ? 87.205  162.151 135.032 1.00 500.00 ? 612 ASN A CB  1 
ATOM 4525  C CG  . ASN A 1 612 ? 86.083  162.646 135.964 1.00 500.00 ? 612 ASN A CG  1 
ATOM 4526  O OD1 . ASN A 1 612 ? 85.314  163.540 135.596 1.00 500.00 ? 612 ASN A OD1 1 
ATOM 4527  N ND2 . ASN A 1 612 ? 85.962  162.040 137.146 1.00 500.00 ? 612 ASN A ND2 1 
ATOM 4528  N N   . GLU A 1 613 ? 89.617  161.178 133.692 1.00 500.00 ? 613 GLU A N   1 
ATOM 4529  C CA  . GLU A 1 613 ? 90.222  160.226 132.777 1.00 500.00 ? 613 GLU A CA  1 
ATOM 4530  C C   . GLU A 1 613 ? 91.728  160.112 132.984 1.00 500.00 ? 613 GLU A C   1 
ATOM 4531  O O   . GLU A 1 613 ? 92.343  160.954 133.645 1.00 420.10 ? 613 GLU A O   1 
ATOM 4532  C CB  . GLU A 1 613 ? 89.872  160.600 131.318 1.00 500.00 ? 613 GLU A CB  1 
ATOM 4533  C CG  . GLU A 1 613 ? 88.369  160.509 131.020 1.00 500.00 ? 613 GLU A CG  1 
ATOM 4534  C CD  . GLU A 1 613 ? 87.998  160.739 129.561 1.00 500.00 ? 613 GLU A CD  1 
ATOM 4535  O OE1 . GLU A 1 613 ? 88.836  161.253 128.787 1.00 500.00 ? 613 GLU A OE1 1 
ATOM 4536  O OE2 . GLU A 1 613 ? 86.848  160.403 129.197 1.00 500.00 ? 613 GLU A OE2 1 
ATOM 4537  N N   . THR A 1 614 ? 92.291  159.031 132.443 1.00 500.00 ? 614 THR A N   1 
ATOM 4538  C CA  . THR A 1 614 ? 93.740  158.797 132.412 1.00 500.00 ? 614 THR A CA  1 
ATOM 4539  C C   . THR A 1 614 ? 94.294  159.154 131.013 1.00 500.00 ? 614 THR A C   1 
ATOM 4540  O O   . THR A 1 614 ? 94.839  158.294 130.301 1.00 500.00 ? 614 THR A O   1 
ATOM 4541  C CB  . THR A 1 614 ? 94.090  157.334 132.802 1.00 500.00 ? 614 THR A CB  1 
ATOM 4542  O OG1 . THR A 1 614 ? 93.478  156.415 131.887 1.00 500.00 ? 614 THR A OG1 1 
ATOM 4543  C CG2 . THR A 1 614 ? 93.619  157.023 134.226 1.00 500.00 ? 614 THR A CG2 1 
ATOM 4544  N N   . ASP A 1 615 ? 94.142  160.433 130.641 1.00 500.00 ? 615 ASP A N   1 
ATOM 4545  C CA  . ASP A 1 615 ? 94.542  160.949 129.321 1.00 500.00 ? 615 ASP A CA  1 
ATOM 4546  C C   . ASP A 1 615 ? 95.202  162.324 129.415 1.00 500.00 ? 615 ASP A C   1 
ATOM 4547  O O   . ASP A 1 615 ? 94.719  163.227 130.106 1.00 488.46 ? 615 ASP A O   1 
ATOM 4548  C CB  . ASP A 1 615 ? 93.334  161.028 128.376 1.00 500.00 ? 615 ASP A CB  1 
ATOM 4549  C CG  . ASP A 1 615 ? 92.861  159.653 127.902 1.00 500.00 ? 615 ASP A CG  1 
ATOM 4550  O OD1 . ASP A 1 615 ? 93.712  158.779 127.598 1.00 500.00 ? 615 ASP A OD1 1 
ATOM 4551  O OD2 . ASP A 1 615 ? 91.627  159.451 127.824 1.00 500.00 ? 615 ASP A OD2 1 
ATOM 4552  N N   . ARG A 1 616 ? 96.292  162.465 128.668 1.00 500.00 ? 616 ARG A N   1 
ATOM 4553  C CA  . ARG A 1 616 ? 97.148  163.637 128.715 1.00 500.00 ? 616 ARG A CA  1 
ATOM 4554  C C   . ARG A 1 616 ? 96.802  164.609 127.597 1.00 500.00 ? 616 ARG A C   1 
ATOM 4555  O O   . ARG A 1 616 ? 96.139  164.242 126.625 1.00 500.00 ? 616 ARG A O   1 
ATOM 4556  C CB  . ARG A 1 616 ? 98.607  163.195 128.593 1.00 500.00 ? 616 ARG A CB  1 
ATOM 4557  C CG  . ARG A 1 616 ? 99.019  162.168 129.640 1.00 500.00 ? 616 ARG A CG  1 
ATOM 4558  C CD  . ARG A 1 616 ? 100.507 161.877 129.603 1.00 500.00 ? 616 ARG A CD  1 
ATOM 4559  N NE  . ARG A 1 616 ? 100.907 160.959 130.670 1.00 500.00 ? 616 ARG A NE  1 
ATOM 4560  C CZ  . ARG A 1 616 ? 101.167 161.301 131.936 1.00 500.00 ? 616 ARG A CZ  1 
ATOM 4561  N NH1 . ARG A 1 616 ? 101.079 162.567 132.357 1.00 475.38 ? 616 ARG A NH1 1 
ATOM 4562  N NH2 . ARG A 1 616 ? 101.520 160.353 132.803 1.00 500.00 ? 616 ARG A NH2 1 
ATOM 4563  N N   . LEU A 1 617 ? 97.270  165.845 127.747 1.00 500.00 ? 617 LEU A N   1 
ATOM 4564  C CA  . LEU A 1 617 ? 97.032  166.925 126.792 1.00 500.00 ? 617 LEU A CA  1 
ATOM 4565  C C   . LEU A 1 617 ? 98.360  167.349 126.178 1.00 466.16 ? 617 LEU A C   1 
ATOM 4566  O O   . LEU A 1 617 ? 98.899  168.406 126.523 1.00 452.74 ? 617 LEU A O   1 
ATOM 4567  C CB  . LEU A 1 617 ? 96.388  168.113 127.507 1.00 500.00 ? 617 LEU A CB  1 
ATOM 4568  C CG  . LEU A 1 617 ? 94.940  167.920 127.959 1.00 500.00 ? 617 LEU A CG  1 
ATOM 4569  C CD1 . LEU A 1 617 ? 94.590  168.849 129.119 1.00 500.00 ? 617 LEU A CD1 1 
ATOM 4570  C CD2 . LEU A 1 617 ? 94.000  168.125 126.775 1.00 500.00 ? 617 LEU A CD2 1 
ATOM 4571  N N   . PRO A 1 618 ? 98.905  166.521 125.272 1.00 480.28 ? 618 PRO A N   1 
ATOM 4572  C CA  . PRO A 1 618 ? 100.238 166.806 124.746 1.00 500.00 ? 618 PRO A CA  1 
ATOM 4573  C C   . PRO A 1 618 ? 100.303 168.056 123.859 1.00 470.15 ? 618 PRO A C   1 
ATOM 4574  O O   . PRO A 1 618 ? 99.316  168.421 123.213 1.00 418.60 ? 618 PRO A O   1 
ATOM 4575  C CB  . PRO A 1 618 ? 100.576 165.544 123.962 1.00 500.00 ? 618 PRO A CB  1 
ATOM 4576  C CG  . PRO A 1 618 ? 99.255  165.020 123.531 1.00 500.00 ? 618 PRO A CG  1 
ATOM 4577  C CD  . PRO A 1 618 ? 98.369  165.266 124.714 1.00 493.85 ? 618 PRO A CD  1 
ATOM 4578  N N   . ARG A 1 619 ? 101.486 168.666 123.828 1.00 466.29 ? 619 ARG A N   1 
ATOM 4579  C CA  . ARG A 1 619 ? 101.647 170.077 123.492 1.00 450.79 ? 619 ARG A CA  1 
ATOM 4580  C C   . ARG A 1 619 ? 103.067 170.429 123.053 1.00 438.56 ? 619 ARG A C   1 
ATOM 4581  O O   . ARG A 1 619 ? 103.984 169.616 123.194 1.00 415.63 ? 619 ARG A O   1 
ATOM 4582  C CB  . ARG A 1 619 ? 101.293 170.911 124.726 1.00 433.20 ? 619 ARG A CB  1 
ATOM 4583  C CG  . ARG A 1 619 ? 102.070 170.512 125.978 1.00 462.83 ? 619 ARG A CG  1 
ATOM 4584  C CD  . ARG A 1 619 ? 101.615 171.287 127.194 1.00 500.00 ? 619 ARG A CD  1 
ATOM 4585  N NE  . ARG A 1 619 ? 100.217 171.015 127.525 1.00 500.00 ? 619 ARG A NE  1 
ATOM 4586  C CZ  . ARG A 1 619 ? 99.512  171.658 128.460 1.00 500.00 ? 619 ARG A CZ  1 
ATOM 4587  N NH1 . ARG A 1 619 ? 100.062 172.635 129.192 1.00 500.00 ? 619 ARG A NH1 1 
ATOM 4588  N NH2 . ARG A 1 619 ? 98.239  171.324 128.669 1.00 500.00 ? 619 ARG A NH2 1 
ATOM 4589  N N   . CYS A 1 620 ? 103.226 171.653 122.548 1.00 476.61 ? 620 CYS A N   1 
ATOM 4590  C CA  . CYS A 1 620 ? 104.536 172.211 122.172 1.00 500.00 ? 620 CYS A CA  1 
ATOM 4591  C C   . CYS A 1 620 ? 105.162 172.978 123.314 1.00 500.00 ? 620 CYS A C   1 
ATOM 4592  O O   . CYS A 1 620 ? 104.451 173.585 124.105 1.00 450.94 ? 620 CYS A O   1 
ATOM 4593  C CB  . CYS A 1 620 ? 104.408 173.178 120.994 1.00 500.00 ? 620 CYS A CB  1 
ATOM 4594  S SG  . CYS A 1 620 ? 104.214 172.352 119.411 1.00 500.00 ? 620 CYS A SG  1 
ATOM 4595  N N   . VAL A 1 621 ? 106.493 172.953 123.391 1.00 499.20 ? 621 VAL A N   1 
ATOM 4596  C CA  . VAL A 1 621 ? 107.217 173.832 124.313 1.00 478.75 ? 621 VAL A CA  1 
ATOM 4597  C C   . VAL A 1 621 ? 108.510 174.351 123.682 1.00 469.54 ? 621 VAL A C   1 
ATOM 4598  O O   . VAL A 1 621 ? 109.509 173.626 123.612 1.00 394.28 ? 621 VAL A O   1 
ATOM 4599  C CB  . VAL A 1 621 ? 107.551 173.123 125.645 1.00 500.00 ? 621 VAL A CB  1 
ATOM 4600  C CG1 . VAL A 1 621 ? 108.313 174.070 126.572 1.00 500.00 ? 621 VAL A CG1 1 
ATOM 4601  C CG2 . VAL A 1 621 ? 106.290 172.599 126.329 1.00 500.00 ? 621 VAL A CG2 1 
ATOM 4602  N N   . ARG A 1 622 ? 108.482 175.609 123.236 1.00 500.00 ? 622 ARG A N   1 
ATOM 4603  C CA  . ARG A 1 622 ? 109.684 176.293 122.733 1.00 500.00 ? 622 ARG A CA  1 
ATOM 4604  C C   . ARG A 1 622 ? 110.502 176.828 123.898 1.00 461.99 ? 622 ARG A C   1 
ATOM 4605  O O   . ARG A 1 622 ? 109.975 177.510 124.772 1.00 438.39 ? 622 ARG A O   1 
ATOM 4606  C CB  . ARG A 1 622 ? 109.343 177.402 121.737 1.00 500.00 ? 622 ARG A CB  1 
ATOM 4607  C CG  . ARG A 1 622 ? 108.478 178.551 122.231 1.00 500.00 ? 622 ARG A CG  1 
ATOM 4608  C CD  . ARG A 1 622 ? 108.540 179.674 121.217 1.00 500.00 ? 622 ARG A CD  1 
ATOM 4609  N NE  . ARG A 1 622 ? 107.729 180.823 121.599 1.00 500.00 ? 622 ARG A NE  1 
ATOM 4610  C CZ  . ARG A 1 622 ? 108.038 181.698 122.560 1.00 500.00 ? 622 ARG A CZ  1 
ATOM 4611  N NH1 . ARG A 1 622 ? 107.209 182.712 122.802 1.00 500.00 ? 622 ARG A NH1 1 
ATOM 4612  N NH2 . ARG A 1 622 ? 109.154 181.573 123.293 1.00 500.00 ? 622 ARG A NH2 1 
ATOM 4613  N N   . SER A 1 623 ? 111.800 176.544 123.868 1.00 423.93 ? 623 SER A N   1 
ATOM 4614  C CA  . SER A 1 623 ? 112.574 176.363 125.091 1.00 445.24 ? 623 SER A CA  1 
ATOM 4615  C C   . SER A 1 623 ? 113.962 176.993 125.139 1.00 419.89 ? 623 SER A C   1 
ATOM 4616  O O   . SER A 1 623 ? 114.278 177.711 126.086 1.00 421.02 ? 623 SER A O   1 
ATOM 4617  C CB  . SER A 1 623 ? 112.719 174.865 125.331 1.00 500.00 ? 623 SER A CB  1 
ATOM 4618  O OG  . SER A 1 623 ? 113.257 174.229 124.183 1.00 500.00 ? 623 SER A OG  1 
ATOM 4619  N N   . THR A 1 624 ? 114.783 176.679 124.142 1.00 416.02 ? 624 THR A N   1 
ATOM 4620  C CA  . THR A 1 624 ? 116.215 177.005 124.115 1.00 427.05 ? 624 THR A CA  1 
ATOM 4621  C C   . THR A 1 624 ? 117.049 176.000 124.923 1.00 409.42 ? 624 THR A C   1 
ATOM 4622  O O   . THR A 1 624 ? 118.244 176.206 125.102 1.00 429.88 ? 624 THR A O   1 
ATOM 4623  C CB  . THR A 1 624 ? 116.512 178.456 124.590 1.00 459.09 ? 624 THR A CB  1 
ATOM 4624  O OG1 . THR A 1 624 ? 115.483 179.340 124.125 1.00 491.65 ? 624 THR A OG1 1 
ATOM 4625  C CG2 . THR A 1 624 ? 117.859 178.958 124.072 1.00 491.06 ? 624 THR A CG2 1 
ATOM 4626  N N   . ALA A 1 625 ? 116.442 174.884 125.351 1.00 416.76 ? 625 ALA A N   1 
ATOM 4627  C CA  . ALA A 1 625 ? 117.061 173.953 126.313 1.00 412.41 ? 625 ALA A CA  1 
ATOM 4628  C C   . ALA A 1 625 ? 117.797 172.817 125.617 1.00 383.09 ? 625 ALA A C   1 
ATOM 4629  O O   . ALA A 1 625 ? 117.496 171.644 125.816 1.00 372.33 ? 625 ALA A O   1 
ATOM 4630  C CB  . ALA A 1 625 ? 116.017 173.404 127.279 1.00 395.50 ? 625 ALA A CB  1 
ATOM 4631  N N   . ARG A 1 626 ? 118.805 173.189 124.841 1.00 400.73 ? 626 ARG A N   1 
ATOM 4632  C CA  . ARG A 1 626 ? 119.589 172.245 124.050 1.00 416.74 ? 626 ARG A CA  1 
ATOM 4633  C C   . ARG A 1 626 ? 120.530 171.400 124.908 1.00 425.38 ? 626 ARG A C   1 
ATOM 4634  O O   . ARG A 1 626 ? 120.547 171.527 126.137 1.00 430.15 ? 626 ARG A O   1 
ATOM 4635  C CB  . ARG A 1 626 ? 120.367 173.017 122.983 1.00 433.32 ? 626 ARG A CB  1 
ATOM 4636  C CG  . ARG A 1 626 ? 119.441 173.719 122.002 1.00 462.94 ? 626 ARG A CG  1 
ATOM 4637  C CD  . ARG A 1 626 ? 120.043 174.969 121.402 1.00 455.25 ? 626 ARG A CD  1 
ATOM 4638  N NE  . ARG A 1 626 ? 118.992 175.847 120.899 1.00 474.52 ? 626 ARG A NE  1 
ATOM 4639  C CZ  . ARG A 1 626 ? 119.128 177.151 120.658 1.00 500.00 ? 626 ARG A CZ  1 
ATOM 4640  N NH1 . ARG A 1 626 ? 118.088 177.837 120.209 1.00 500.00 ? 626 ARG A NH1 1 
ATOM 4641  N NH2 . ARG A 1 626 ? 120.287 177.781 120.856 1.00 500.00 ? 626 ARG A NH2 1 
ATOM 4642  N N   . LEU A 1 627 ? 121.282 170.518 124.251 1.00 416.39 ? 627 LEU A N   1 
ATOM 4643  C CA  . LEU A 1 627 ? 122.302 169.700 124.901 1.00 432.09 ? 627 LEU A CA  1 
ATOM 4644  C C   . LEU A 1 627 ? 123.648 169.869 124.215 1.00 456.98 ? 627 LEU A C   1 
ATOM 4645  O O   . LEU A 1 627 ? 123.720 170.334 123.070 1.00 409.31 ? 627 LEU A O   1 
ATOM 4646  C CB  . LEU A 1 627 ? 121.910 168.234 124.845 1.00 420.72 ? 627 LEU A CB  1 
ATOM 4647  C CG  . LEU A 1 627 ? 120.485 167.910 125.275 1.00 446.51 ? 627 LEU A CG  1 
ATOM 4648  C CD1 . LEU A 1 627 ? 120.250 166.416 125.124 1.00 500.00 ? 627 LEU A CD1 1 
ATOM 4649  C CD2 . LEU A 1 627 ? 120.236 168.369 126.704 1.00 460.65 ? 627 LEU A CD2 1 
ATOM 4650  N N   . ALA A 1 628 ? 124.712 169.498 124.931 1.00 482.98 ? 628 ALA A N   1 
ATOM 4651  C CA  . ALA A 1 628 ? 126.052 169.422 124.329 1.00 470.55 ? 628 ALA A CA  1 
ATOM 4652  C C   . ALA A 1 628 ? 126.775 168.164 124.789 1.00 438.30 ? 628 ALA A C   1 
ATOM 4653  O O   . ALA A 1 628 ? 126.662 167.775 125.955 1.00 465.26 ? 628 ALA A O   1 
ATOM 4654  C CB  . ALA A 1 628 ? 126.863 170.657 124.682 1.00 497.84 ? 628 ALA A CB  1 
ATOM 4655  N N   . ARG A 1 629 ? 127.521 167.546 123.876 1.00 419.18 ? 629 ARG A N   1 
ATOM 4656  C CA  . ARG A 1 629 ? 128.226 166.292 124.160 1.00 443.27 ? 629 ARG A CA  1 
ATOM 4657  C C   . ARG A 1 629 ? 129.341 166.498 125.176 1.00 436.50 ? 629 ARG A C   1 
ATOM 4658  O O   . ARG A 1 629 ? 129.972 167.561 125.211 1.00 415.16 ? 629 ARG A O   1 
ATOM 4659  C CB  . ARG A 1 629 ? 128.809 165.691 122.867 1.00 470.07 ? 629 ARG A CB  1 
ATOM 4660  C CG  . ARG A 1 629 ? 129.349 164.261 122.962 1.00 446.70 ? 629 ARG A CG  1 
ATOM 4661  C CD  . ARG A 1 629 ? 128.271 163.268 123.378 1.00 485.21 ? 629 ARG A CD  1 
ATOM 4662  N NE  . ARG A 1 629 ? 128.555 161.885 122.972 1.00 500.00 ? 629 ARG A NE  1 
ATOM 4663  C CZ  . ARG A 1 629 ? 128.054 160.783 123.548 1.00 500.00 ? 629 ARG A CZ  1 
ATOM 4664  N NH1 . ARG A 1 629 ? 128.389 159.582 123.077 1.00 500.00 ? 629 ARG A NH1 1 
ATOM 4665  N NH2 . ARG A 1 629 ? 127.231 160.848 124.596 1.00 500.00 ? 629 ARG A NH2 1 
ATOM 4666  N N   . ALA A 1 630 ? 129.561 165.468 125.992 1.00 435.95 ? 630 ALA A N   1 
ATOM 4667  C CA  . ALA A 1 630 ? 130.575 165.446 127.040 1.00 449.20 ? 630 ALA A CA  1 
ATOM 4668  C C   . ALA A 1 630 ? 131.765 164.635 126.558 1.00 452.08 ? 630 ALA A C   1 
ATOM 4669  O O   . ALA A 1 630 ? 132.760 165.218 126.166 1.00 461.58 ? 630 ALA A O   1 
ATOM 4670  C CB  . ALA A 1 630 ? 130.019 164.885 128.337 1.00 395.86 ? 630 ALA A CB  1 
ATOM 4671  N N   . LEU A 1 631 ? 131.692 163.304 126.598 1.00 424.19 ? 631 LEU A N   1 
ATOM 4672  C CA  . LEU A 1 631 ? 132.707 162.450 125.960 1.00 418.67 ? 631 LEU A CA  1 
ATOM 4673  C C   . LEU A 1 631 ? 134.153 162.765 126.326 1.00 375.79 ? 631 LEU A C   1 
ATOM 4674  O O   . LEU A 1 631 ? 135.061 162.127 125.812 1.00 418.94 ? 631 LEU A O   1 
ATOM 4675  C CB  . LEU A 1 631 ? 132.542 162.545 124.433 1.00 456.47 ? 631 LEU A CB  1 
ATOM 4676  C CG  . LEU A 1 631 ? 133.256 161.528 123.524 1.00 490.91 ? 631 LEU A CG  1 
ATOM 4677  C CD1 . LEU A 1 631 ? 132.309 161.036 122.436 1.00 500.00 ? 631 LEU A CD1 1 
ATOM 4678  C CD2 . LEU A 1 631 ? 134.536 162.064 122.890 1.00 500.00 ? 631 LEU A CD2 1 
ATOM 4679  N N   . SER A 1 632 ? 134.362 163.711 127.241 1.00 363.05 ? 632 SER A N   1 
ATOM 4680  C CA  . SER A 1 632 ? 135.607 164.489 127.318 1.00 391.49 ? 632 SER A CA  1 
ATOM 4681  C C   . SER A 1 632 ? 136.002 165.102 125.975 1.00 372.64 ? 632 SER A C   1 
ATOM 4682  O O   . SER A 1 632 ? 135.237 165.065 125.019 1.00 385.93 ? 632 SER A O   1 
ATOM 4683  C CB  . SER A 1 632 ? 136.760 163.622 127.848 1.00 428.68 ? 632 SER A CB  1 
ATOM 4684  O OG  . SER A 1 632 ? 137.460 162.988 126.795 1.00 405.10 ? 632 SER A OG  1 
ATOM 4685  N N   . PRO A 1 633 ? 137.190 165.709 125.923 1.00 404.48 ? 633 PRO A N   1 
ATOM 4686  C CA  . PRO A 1 633 ? 137.972 165.833 124.700 1.00 456.17 ? 633 PRO A CA  1 
ATOM 4687  C C   . PRO A 1 633 ? 139.030 164.724 124.560 1.00 443.31 ? 633 PRO A C   1 
ATOM 4688  O O   . PRO A 1 633 ? 139.519 164.489 123.451 1.00 438.88 ? 633 PRO A O   1 
ATOM 4689  C CB  . PRO A 1 633 ? 138.638 167.192 124.861 1.00 463.30 ? 633 PRO A CB  1 
ATOM 4690  C CG  . PRO A 1 633 ? 138.833 167.299 126.319 1.00 457.08 ? 633 PRO A CG  1 
ATOM 4691  C CD  . PRO A 1 633 ? 137.627 166.676 126.937 1.00 428.10 ? 633 PRO A CD  1 
ATOM 4692  N N   . ALA A 1 634 ? 139.386 164.072 125.668 1.00 403.91 ? 634 ALA A N   1 
ATOM 4693  C CA  . ALA A 1 634 ? 140.296 162.924 125.639 1.00 444.40 ? 634 ALA A CA  1 
ATOM 4694  C C   . ALA A 1 634 ? 140.009 161.957 124.490 1.00 425.01 ? 634 ALA A C   1 
ATOM 4695  O O   . ALA A 1 634 ? 140.877 161.717 123.650 1.00 428.83 ? 634 ALA A O   1 
ATOM 4696  C CB  . ALA A 1 634 ? 140.278 162.178 126.975 1.00 464.56 ? 634 ALA A CB  1 
ATOM 4697  N N   . PHE A 1 635 ? 138.780 161.450 124.432 1.00 425.48 ? 635 PHE A N   1 
ATOM 4698  C CA  . PHE A 1 635 ? 138.408 160.390 123.476 1.00 450.36 ? 635 PHE A CA  1 
ATOM 4699  C C   . PHE A 1 635 ? 137.938 160.911 122.118 1.00 489.25 ? 635 PHE A C   1 
ATOM 4700  O O   . PHE A 1 635 ? 137.548 160.126 121.250 1.00 500.00 ? 635 PHE A O   1 
ATOM 4701  C CB  . PHE A 1 635 ? 137.343 159.478 124.093 1.00 418.51 ? 635 PHE A CB  1 
ATOM 4702  C CG  . PHE A 1 635 ? 137.672 159.051 125.488 1.00 422.83 ? 635 PHE A CG  1 
ATOM 4703  C CD1 . PHE A 1 635 ? 138.828 158.338 125.740 1.00 422.34 ? 635 PHE A CD1 1 
ATOM 4704  C CD2 . PHE A 1 635 ? 136.863 159.404 126.555 1.00 475.79 ? 635 PHE A CD2 1 
ATOM 4705  C CE1 . PHE A 1 635 ? 139.158 157.955 127.027 1.00 431.93 ? 635 PHE A CE1 1 
ATOM 4706  C CE2 . PHE A 1 635 ? 137.181 159.022 127.846 1.00 474.68 ? 635 PHE A CE2 1 
ATOM 4707  C CZ  . PHE A 1 635 ? 138.332 158.299 128.083 1.00 457.78 ? 635 PHE A CZ  1 
ATOM 4708  N N   . GLU A 1 636 ? 137.970 162.230 121.946 1.00 481.97 ? 636 GLU A N   1 
ATOM 4709  C CA  . GLU A 1 636 ? 137.658 162.888 120.688 1.00 484.08 ? 636 GLU A CA  1 
ATOM 4710  C C   . GLU A 1 636 ? 138.969 163.110 119.935 1.00 491.77 ? 636 GLU A C   1 
ATOM 4711  O O   . GLU A 1 636 ? 139.115 162.676 118.788 1.00 459.49 ? 636 GLU A O   1 
ATOM 4712  C CB  . GLU A 1 636 ? 136.966 164.215 120.994 1.00 500.00 ? 636 GLU A CB  1 
ATOM 4713  C CG  . GLU A 1 636 ? 136.442 165.000 119.799 1.00 500.00 ? 636 GLU A CG  1 
ATOM 4714  C CD  . GLU A 1 636 ? 136.397 166.508 120.056 1.00 500.00 ? 636 GLU A CD  1 
ATOM 4715  O OE1 . GLU A 1 636 ? 136.280 166.937 121.228 1.00 500.00 ? 636 GLU A OE1 1 
ATOM 4716  O OE2 . GLU A 1 636 ? 136.482 167.280 119.075 1.00 500.00 ? 636 GLU A OE2 1 
ATOM 4717  N N   . LEU A 1 637 ? 139.922 163.770 120.602 1.00 497.80 ? 637 LEU A N   1 
ATOM 4718  C CA  . LEU A 1 637 ? 141.299 163.913 120.098 1.00 475.00 ? 637 LEU A CA  1 
ATOM 4719  C C   . LEU A 1 637 ? 142.127 162.658 120.331 1.00 450.43 ? 637 LEU A C   1 
ATOM 4720  O O   . LEU A 1 637 ? 143.251 162.571 119.836 1.00 424.88 ? 637 LEU A O   1 
ATOM 4721  C CB  . LEU A 1 637 ? 142.008 165.128 120.719 1.00 500.00 ? 637 LEU A CB  1 
ATOM 4722  C CG  . LEU A 1 637 ? 142.462 166.220 119.742 1.00 500.00 ? 637 LEU A CG  1 
ATOM 4723  C CD1 . LEU A 1 637 ? 141.341 166.686 118.818 1.00 500.00 ? 637 LEU A CD1 1 
ATOM 4724  C CD2 . LEU A 1 637 ? 143.041 167.396 120.520 1.00 500.00 ? 637 LEU A CD2 1 
ATOM 4725  N N   . SER A 1 638 ? 141.584 161.715 121.105 1.00 463.87 ? 638 SER A N   1 
ATOM 4726  C CA  . SER A 1 638 ? 142.069 160.339 121.150 1.00 486.03 ? 638 SER A CA  1 
ATOM 4727  C C   . SER A 1 638 ? 143.527 160.273 121.601 1.00 500.00 ? 638 SER A C   1 
ATOM 4728  O O   . SER A 1 638 ? 144.402 159.798 120.873 1.00 500.00 ? 638 SER A O   1 
ATOM 4729  C CB  . SER A 1 638 ? 141.864 159.672 119.781 1.00 500.00 ? 638 SER A CB  1 
ATOM 4730  O OG  . SER A 1 638 ? 142.196 158.298 119.822 1.00 498.77 ? 638 SER A OG  1 
ATOM 4731  N N   . GLN A 1 639 ? 143.769 160.776 122.810 1.00 477.90 ? 639 GLN A N   1 
ATOM 4732  C CA  . GLN A 1 639 ? 145.114 160.865 123.388 1.00 451.72 ? 639 GLN A CA  1 
ATOM 4733  C C   . GLN A 1 639 ? 145.350 159.849 124.512 1.00 420.31 ? 639 GLN A C   1 
ATOM 4734  O O   . GLN A 1 639 ? 146.449 159.309 124.645 1.00 407.40 ? 639 GLN A O   1 
ATOM 4735  C CB  . GLN A 1 639 ? 145.337 162.272 123.909 1.00 442.64 ? 639 GLN A CB  1 
ATOM 4736  C CG  . GLN A 1 639 ? 145.108 163.378 122.897 1.00 443.35 ? 639 GLN A CG  1 
ATOM 4737  C CD  . GLN A 1 639 ? 145.533 164.725 123.446 1.00 459.17 ? 639 GLN A CD  1 
ATOM 4738  O OE1 . GLN A 1 639 ? 145.190 165.082 124.571 1.00 500.00 ? 639 GLN A OE1 1 
ATOM 4739  N NE2 . GLN A 1 639 ? 146.295 165.475 122.662 1.00 485.78 ? 639 GLN A NE2 1 
ATOM 4740  N N   . TRP A 1 640 ? 144.322 159.631 125.329 1.00 403.87 ? 640 TRP A N   1 
ATOM 4741  C CA  . TRP A 1 640 ? 144.234 158.511 126.284 1.00 428.80 ? 640 TRP A CA  1 
ATOM 4742  C C   . TRP A 1 640 ? 145.218 158.561 127.453 1.00 429.58 ? 640 TRP A C   1 
ATOM 4743  O O   . TRP A 1 640 ? 144.805 158.762 128.596 1.00 461.85 ? 640 TRP A O   1 
ATOM 4744  C CB  . TRP A 1 640 ? 144.291 157.145 125.576 1.00 419.27 ? 640 TRP A CB  1 
ATOM 4745  C CG  . TRP A 1 640 ? 143.283 157.000 124.503 1.00 412.55 ? 640 TRP A CG  1 
ATOM 4746  C CD1 . TRP A 1 640 ? 142.043 157.566 124.460 1.00 461.43 ? 640 TRP A CD1 1 
ATOM 4747  C CD2 . TRP A 1 640 ? 143.416 156.238 123.316 1.00 422.74 ? 640 TRP A CD2 1 
ATOM 4748  N NE1 . TRP A 1 640 ? 141.397 157.214 123.305 1.00 464.36 ? 640 TRP A NE1 1 
ATOM 4749  C CE2 . TRP A 1 640 ? 142.219 156.396 122.581 1.00 459.39 ? 640 TRP A CE2 1 
ATOM 4750  C CE3 . TRP A 1 640 ? 144.435 155.446 122.787 1.00 500.00 ? 640 TRP A CE3 1 
ATOM 4751  C CZ2 . TRP A 1 640 ? 142.008 155.781 121.345 1.00 500.00 ? 640 TRP A CZ2 1 
ATOM 4752  C CZ3 . TRP A 1 640 ? 144.228 154.834 121.550 1.00 500.00 ? 640 TRP A CZ3 1 
ATOM 4753  C CH2 . TRP A 1 640 ? 143.021 155.010 120.841 1.00 500.00 ? 640 TRP A CH2 1 
ATOM 4754  N N   . SER A 1 641 ? 146.502 158.362 127.185 1.00 438.43 ? 641 SER A N   1 
ATOM 4755  C CA  . SER A 1 641 ? 147.525 158.600 128.191 1.00 471.96 ? 641 SER A CA  1 
ATOM 4756  C C   . SER A 1 641 ? 147.839 160.077 128.066 1.00 444.13 ? 641 SER A C   1 
ATOM 4757  O O   . SER A 1 641 ? 148.810 160.466 127.417 1.00 500.00 ? 641 SER A O   1 
ATOM 4758  C CB  . SER A 1 641 ? 148.765 157.739 127.940 1.00 500.00 ? 641 SER A CB  1 
ATOM 4759  O OG  . SER A 1 641 ? 148.503 156.369 128.193 1.00 500.00 ? 641 SER A OG  1 
ATOM 4760  N N   . SER A 1 642 ? 146.983 160.898 128.657 1.00 434.29 ? 642 SER A N   1 
ATOM 4761  C CA  . SER A 1 642 ? 146.994 162.332 128.384 1.00 464.72 ? 642 SER A CA  1 
ATOM 4762  C C   . SER A 1 642 ? 146.278 163.113 129.466 1.00 465.06 ? 642 SER A C   1 
ATOM 4763  O O   . SER A 1 642 ? 145.056 163.332 129.410 1.00 418.63 ? 642 SER A O   1 
ATOM 4764  C CB  . SER A 1 642 ? 146.353 162.625 127.030 1.00 467.56 ? 642 SER A CB  1 
ATOM 4765  O OG  . SER A 1 642 ? 144.998 162.220 127.016 1.00 483.01 ? 642 SER A OG  1 
ATOM 4766  N N   . THR A 1 643 ? 147.070 163.516 130.451 1.00 479.97 ? 643 THR A N   1 
ATOM 4767  C CA  . THR A 1 643 ? 146.666 164.438 131.501 1.00 496.63 ? 643 THR A CA  1 
ATOM 4768  C C   . THR A 1 643 ? 145.832 165.601 130.940 1.00 454.32 ? 643 THR A C   1 
ATOM 4769  O O   . THR A 1 643 ? 145.640 165.724 129.722 1.00 368.72 ? 643 THR A O   1 
ATOM 4770  C CB  . THR A 1 643 ? 147.933 164.997 132.213 1.00 500.00 ? 643 THR A CB  1 
ATOM 4771  O OG1 . THR A 1 643 ? 148.967 164.002 132.219 1.00 498.75 ? 643 THR A OG1 1 
ATOM 4772  C CG2 . THR A 1 643 ? 147.658 165.424 133.648 1.00 500.00 ? 643 THR A CG2 1 
ATOM 4773  N N   . GLU A 1 644 ? 145.293 166.416 131.841 1.00 469.01 ? 644 GLU A N   1 
ATOM 4774  C CA  . GLU A 1 644 ? 144.721 167.720 131.503 1.00 500.00 ? 644 GLU A CA  1 
ATOM 4775  C C   . GLU A 1 644 ? 143.632 167.714 130.408 1.00 490.59 ? 644 GLU A C   1 
ATOM 4776  O O   . GLU A 1 644 ? 143.431 168.728 129.737 1.00 466.09 ? 644 GLU A O   1 
ATOM 4777  C CB  . GLU A 1 644 ? 145.843 168.733 131.176 1.00 500.00 ? 644 GLU A CB  1 
ATOM 4778  C CG  . GLU A 1 644 ? 146.630 168.487 129.884 1.00 500.00 ? 644 GLU A CG  1 
ATOM 4779  C CD  . GLU A 1 644 ? 147.519 169.646 129.477 1.00 500.00 ? 644 GLU A CD  1 
ATOM 4780  O OE1 . GLU A 1 644 ? 147.932 170.435 130.360 1.00 500.00 ? 644 GLU A OE1 1 
ATOM 4781  O OE2 . GLU A 1 644 ? 147.823 169.757 128.267 1.00 500.00 ? 644 GLU A OE2 1 
ATOM 4782  N N   . TYR A 1 645 ? 142.946 166.579 130.239 1.00 440.37 ? 645 TYR A N   1 
ATOM 4783  C CA  . TYR A 1 645 ? 141.700 166.525 129.456 1.00 397.67 ? 645 TYR A CA  1 
ATOM 4784  C C   . TYR A 1 645 ? 140.690 165.463 129.879 1.00 398.52 ? 645 TYR A C   1 
ATOM 4785  O O   . TYR A 1 645 ? 139.550 165.523 129.423 1.00 355.28 ? 645 TYR A O   1 
ATOM 4786  C CB  . TYR A 1 645 ? 142.003 166.405 127.965 1.00 409.79 ? 645 TYR A CB  1 
ATOM 4787  C CG  . TYR A 1 645 ? 142.300 167.735 127.306 1.00 432.22 ? 645 TYR A CG  1 
ATOM 4788  C CD1 . TYR A 1 645 ? 141.456 168.831 127.475 1.00 480.15 ? 645 TYR A CD1 1 
ATOM 4789  C CD2 . TYR A 1 645 ? 143.444 167.911 126.533 1.00 500.00 ? 645 TYR A CD2 1 
ATOM 4790  C CE1 . TYR A 1 645 ? 141.733 170.053 126.885 1.00 500.00 ? 645 TYR A CE1 1 
ATOM 4791  C CE2 . TYR A 1 645 ? 143.728 169.131 125.936 1.00 500.00 ? 645 TYR A CE2 1 
ATOM 4792  C CZ  . TYR A 1 645 ? 142.869 170.200 126.114 1.00 500.00 ? 645 TYR A CZ  1 
ATOM 4793  O OH  . TYR A 1 645 ? 143.140 171.414 125.527 1.00 500.00 ? 645 TYR A OH  1 
ATOM 4794  N N   . SER A 1 646 ? 141.120 164.488 130.693 1.00 406.89 ? 646 SER A N   1 
ATOM 4795  C CA  . SER A 1 646 ? 140.269 163.648 131.574 1.00 423.54 ? 646 SER A CA  1 
ATOM 4796  C C   . SER A 1 646 ? 140.058 162.261 130.996 1.00 395.77 ? 646 SER A C   1 
ATOM 4797  O O   . SER A 1 646 ? 139.238 162.048 130.102 1.00 390.21 ? 646 SER A O   1 
ATOM 4798  C CB  . SER A 1 646 ? 138.928 164.287 131.963 1.00 446.08 ? 646 SER A CB  1 
ATOM 4799  O OG  . SER A 1 646 ? 137.971 164.174 130.928 1.00 480.01 ? 646 SER A OG  1 
ATOM 4800  N N   . THR A 1 647 ? 140.787 161.314 131.565 1.00 398.78 ? 647 THR A N   1 
ATOM 4801  C CA  . THR A 1 647 ? 140.994 160.015 130.964 1.00 413.59 ? 647 THR A CA  1 
ATOM 4802  C C   . THR A 1 647 ? 140.156 158.985 131.709 1.00 432.00 ? 647 THR A C   1 
ATOM 4803  O O   . THR A 1 647 ? 140.673 157.973 132.182 1.00 421.67 ? 647 THR A O   1 
ATOM 4804  C CB  . THR A 1 647 ? 142.495 159.641 130.993 1.00 424.92 ? 647 THR A CB  1 
ATOM 4805  O OG1 . THR A 1 647 ? 142.856 159.093 132.266 1.00 398.37 ? 647 THR A OG1 1 
ATOM 4806  C CG2 . THR A 1 647 ? 143.366 160.867 130.715 1.00 489.17 ? 647 THR A CG2 1 
ATOM 4807  N N   . TRP A 1 648 ? 138.855 159.239 131.787 1.00 406.39 ? 648 TRP A N   1 
ATOM 4808  C CA  . TRP A 1 648 ? 137.968 158.377 132.546 1.00 404.05 ? 648 TRP A CA  1 
ATOM 4809  C C   . TRP A 1 648 ? 137.163 157.431 131.685 1.00 430.31 ? 648 TRP A C   1 
ATOM 4810  O O   . TRP A 1 648 ? 136.528 157.837 130.711 1.00 439.31 ? 648 TRP A O   1 
ATOM 4811  C CB  . TRP A 1 648 ? 137.056 159.215 133.412 1.00 422.93 ? 648 TRP A CB  1 
ATOM 4812  C CG  . TRP A 1 648 ? 137.783 159.666 134.563 1.00 409.51 ? 648 TRP A CG  1 
ATOM 4813  C CD1 . TRP A 1 648 ? 138.290 160.902 134.772 1.00 455.37 ? 648 TRP A CD1 1 
ATOM 4814  C CD2 . TRP A 1 648 ? 138.165 158.869 135.675 1.00 378.61 ? 648 TRP A CD2 1 
ATOM 4815  N NE1 . TRP A 1 648 ? 138.948 160.941 135.977 1.00 492.92 ? 648 TRP A NE1 1 
ATOM 4816  C CE2 . TRP A 1 648 ? 138.885 159.699 136.554 1.00 450.41 ? 648 TRP A CE2 1 
ATOM 4817  C CE3 . TRP A 1 648 ? 137.955 157.538 136.024 1.00 367.95 ? 648 TRP A CE3 1 
ATOM 4818  C CZ2 . TRP A 1 648 ? 139.411 159.235 137.766 1.00 425.49 ? 648 TRP A CZ2 1 
ATOM 4819  C CZ3 . TRP A 1 648 ? 138.473 157.076 137.224 1.00 388.34 ? 648 TRP A CZ3 1 
ATOM 4820  C CH2 . TRP A 1 648 ? 139.199 157.920 138.078 1.00 392.29 ? 648 TRP A CH2 1 
ATOM 4821  N N   . THR A 1 649 ? 137.196 156.160 132.079 1.00 407.78 ? 649 THR A N   1 
ATOM 4822  C CA  . THR A 1 649 ? 136.525 155.090 131.367 1.00 392.55 ? 649 THR A CA  1 
ATOM 4823  C C   . THR A 1 649 ? 135.930 154.104 132.339 1.00 386.58 ? 649 THR A C   1 
ATOM 4824  O O   . THR A 1 649 ? 136.440 153.948 133.422 1.00 392.85 ? 649 THR A O   1 
ATOM 4825  C CB  . THR A 1 649 ? 137.518 154.308 130.503 1.00 449.80 ? 649 THR A CB  1 
ATOM 4826  O OG1 . THR A 1 649 ? 138.758 154.181 131.213 1.00 396.24 ? 649 THR A OG1 1 
ATOM 4827  C CG2 . THR A 1 649 ? 137.756 155.019 129.190 1.00 498.12 ? 649 THR A CG2 1 
ATOM 4828  N N   . GLU A 1 650 ? 134.862 153.430 131.934 1.00 392.60 ? 650 GLU A N   1 
ATOM 4829  C CA  . GLU A 1 650 ? 134.218 152.399 132.766 1.00 374.01 ? 650 GLU A CA  1 
ATOM 4830  C C   . GLU A 1 650 ? 134.431 151.085 132.038 1.00 394.01 ? 650 GLU A C   1 
ATOM 4831  O O   . GLU A 1 650 ? 134.474 151.084 130.802 1.00 441.22 ? 650 GLU A O   1 
ATOM 4832  C CB  . GLU A 1 650 ? 132.724 152.730 132.858 1.00 421.33 ? 650 GLU A CB  1 
ATOM 4833  C CG  . GLU A 1 650 ? 131.803 151.776 133.613 1.00 419.48 ? 650 GLU A CG  1 
ATOM 4834  C CD  . GLU A 1 650 ? 130.367 151.784 133.059 1.00 453.93 ? 650 GLU A CD  1 
ATOM 4835  O OE1 . GLU A 1 650 ? 129.963 150.796 132.406 1.00 443.69 ? 650 GLU A OE1 1 
ATOM 4836  O OE2 . GLU A 1 650 ? 129.637 152.785 133.258 1.00 420.51 ? 650 GLU A OE2 1 
ATOM 4837  N N   . SER A 1 651 ? 134.588 149.969 132.751 1.00 383.56 ? 651 SER A N   1 
ATOM 4838  C CA  . SER A 1 651 ? 134.531 148.668 132.043 1.00 400.58 ? 651 SER A CA  1 
ATOM 4839  C C   . SER A 1 651 ? 133.079 148.416 131.732 1.00 428.85 ? 651 SER A C   1 
ATOM 4840  O O   . SER A 1 651 ? 132.228 148.829 132.501 1.00 460.91 ? 651 SER A O   1 
ATOM 4841  C CB  . SER A 1 651 ? 135.037 147.510 132.904 1.00 433.59 ? 651 SER A CB  1 
ATOM 4842  O OG  . SER A 1 651 ? 134.746 146.253 132.309 1.00 377.11 ? 651 SER A OG  1 
ATOM 4843  N N   . ARG A 1 652 ? 132.770 147.766 130.618 1.00 427.36 ? 652 ARG A N   1 
ATOM 4844  C CA  . ARG A 1 652 ? 131.435 147.175 130.507 1.00 421.73 ? 652 ARG A CA  1 
ATOM 4845  C C   . ARG A 1 652 ? 131.547 145.759 131.027 1.00 411.76 ? 652 ARG A C   1 
ATOM 4846  O O   . ARG A 1 652 ? 132.652 145.269 131.300 1.00 335.05 ? 652 ARG A O   1 
ATOM 4847  C CB  . ARG A 1 652 ? 130.807 147.264 129.109 1.00 421.83 ? 652 ARG A CB  1 
ATOM 4848  C CG  . ARG A 1 652 ? 131.668 146.855 127.926 1.00 453.95 ? 652 ARG A CG  1 
ATOM 4849  C CD  . ARG A 1 652 ? 130.774 146.420 126.766 1.00 500.00 ? 652 ARG A CD  1 
ATOM 4850  N NE  . ARG A 1 652 ? 129.759 147.417 126.409 1.00 487.26 ? 652 ARG A NE  1 
ATOM 4851  C CZ  . ARG A 1 652 ? 128.794 147.237 125.501 1.00 473.41 ? 652 ARG A CZ  1 
ATOM 4852  N NH1 . ARG A 1 652 ? 127.926 148.216 125.265 1.00 495.88 ? 652 ARG A NH1 1 
ATOM 4853  N NH2 . ARG A 1 652 ? 128.684 146.096 124.820 1.00 457.49 ? 652 ARG A NH2 1 
ATOM 4854  N N   . TRP A 1 653 ? 130.398 145.124 131.214 1.00 448.41 ? 653 TRP A N   1 
ATOM 4855  C CA  . TRP A 1 653 ? 130.357 143.813 131.837 1.00 464.58 ? 653 TRP A CA  1 
ATOM 4856  C C   . TRP A 1 653 ? 129.139 142.994 131.431 1.00 436.27 ? 653 TRP A C   1 
ATOM 4857  O O   . TRP A 1 653 ? 128.175 143.490 130.798 1.00 336.08 ? 653 TRP A O   1 
ATOM 4858  C CB  . TRP A 1 653 ? 130.403 143.960 133.368 1.00 478.75 ? 653 TRP A CB  1 
ATOM 4859  C CG  . TRP A 1 653 ? 129.269 144.754 133.876 1.00 470.62 ? 653 TRP A CG  1 
ATOM 4860  C CD1 . TRP A 1 653 ? 128.003 144.316 134.120 1.00 487.96 ? 653 TRP A CD1 1 
ATOM 4861  C CD2 . TRP A 1 653 ? 129.272 146.149 134.144 1.00 420.53 ? 653 TRP A CD2 1 
ATOM 4862  N NE1 . TRP A 1 653 ? 127.220 145.355 134.548 1.00 467.19 ? 653 TRP A NE1 1 
ATOM 4863  C CE2 . TRP A 1 653 ? 127.977 146.495 134.570 1.00 406.59 ? 653 TRP A CE2 1 
ATOM 4864  C CE3 . TRP A 1 653 ? 130.246 147.141 134.076 1.00 406.56 ? 653 TRP A CE3 1 
ATOM 4865  C CZ2 . TRP A 1 653 ? 127.633 147.791 134.919 1.00 396.00 ? 653 TRP A CZ2 1 
ATOM 4866  C CZ3 . TRP A 1 653 ? 129.905 148.424 134.427 1.00 420.22 ? 653 TRP A CZ3 1 
ATOM 4867  C CH2 . TRP A 1 653 ? 128.610 148.740 134.845 1.00 423.15 ? 653 TRP A CH2 1 
ATOM 4868  N N   . LYS A 1 654 ? 129.234 141.730 131.834 1.00 430.54 ? 654 LYS A N   1 
ATOM 4869  C CA  . LYS A 1 654 ? 128.226 140.722 131.619 1.00 439.82 ? 654 LYS A CA  1 
ATOM 4870  C C   . LYS A 1 654 ? 127.798 140.185 132.966 1.00 395.73 ? 654 LYS A C   1 
ATOM 4871  O O   . LYS A 1 654 ? 128.521 139.419 133.608 1.00 405.91 ? 654 LYS A O   1 
ATOM 4872  C CB  . LYS A 1 654 ? 128.739 139.598 130.701 1.00 486.04 ? 654 LYS A CB  1 
ATOM 4873  C CG  . LYS A 1 654 ? 130.038 138.886 131.091 1.00 500.00 ? 654 LYS A CG  1 
ATOM 4874  C CD  . LYS A 1 654 ? 130.813 138.472 129.842 1.00 500.00 ? 654 LYS A CD  1 
ATOM 4875  C CE  . LYS A 1 654 ? 132.044 137.621 130.137 1.00 500.00 ? 654 LYS A CE  1 
ATOM 4876  N NZ  . LYS A 1 654 ? 131.764 136.158 130.083 1.00 500.00 ? 654 LYS A NZ  1 
ATOM 4877  N N   . ASP A 1 655 ? 126.629 140.646 133.400 1.00 409.70 ? 655 ASP A N   1 
ATOM 4878  C CA  . ASP A 1 655 ? 125.883 140.039 134.500 1.00 491.43 ? 655 ASP A CA  1 
ATOM 4879  C C   . ASP A 1 655 ? 126.509 140.269 135.865 1.00 421.99 ? 655 ASP A C   1 
ATOM 4880  O O   . ASP A 1 655 ? 127.215 139.412 136.424 1.00 383.46 ? 655 ASP A O   1 
ATOM 4881  C CB  . ASP A 1 655 ? 125.641 138.539 134.262 1.00 500.00 ? 655 ASP A CB  1 
ATOM 4882  C CG  . ASP A 1 655 ? 124.869 138.264 132.972 1.00 500.00 ? 655 ASP A CG  1 
ATOM 4883  O OD1 . ASP A 1 655 ? 125.102 138.969 131.963 1.00 500.00 ? 655 ASP A OD1 1 
ATOM 4884  O OD2 . ASP A 1 655 ? 124.028 137.332 132.969 1.00 500.00 ? 655 ASP A OD2 1 
ATOM 4885  N N   . ILE A 1 656 ? 126.250 141.467 136.369 1.00 375.86 ? 656 ILE A N   1 
ATOM 4886  C CA  . ILE A 1 656 ? 126.489 141.782 137.762 1.00 399.58 ? 656 ILE A CA  1 
ATOM 4887  C C   . ILE A 1 656 ? 125.421 141.108 138.602 1.00 374.82 ? 656 ILE A C   1 
ATOM 4888  O O   . ILE A 1 656 ? 124.261 141.477 138.493 1.00 410.51 ? 656 ILE A O   1 
ATOM 4889  C CB  . ILE A 1 656 ? 126.535 143.312 138.031 1.00 451.43 ? 656 ILE A CB  1 
ATOM 4890  C CG1 . ILE A 1 656 ? 125.284 144.063 137.506 1.00 485.37 ? 656 ILE A CG1 1 
ATOM 4891  C CG2 . ILE A 1 656 ? 127.823 143.897 137.462 1.00 478.76 ? 656 ILE A CG2 1 
ATOM 4892  C CD1 . ILE A 1 656 ? 124.443 144.700 138.593 1.00 500.00 ? 656 ILE A CD1 1 
ATOM 4893  N N   . ARG A 1 657 ? 125.778 140.104 139.412 1.00 405.95 ? 657 ARG A N   1 
ATOM 4894  C CA  . ARG A 1 657 ? 124.733 139.432 140.259 1.00 419.03 ? 657 ARG A CA  1 
ATOM 4895  C C   . ARG A 1 657 ? 125.277 138.532 141.347 1.00 404.68 ? 657 ARG A C   1 
ATOM 4896  O O   . ARG A 1 657 ? 126.185 137.747 141.106 1.00 417.61 ? 657 ARG A O   1 
ATOM 4897  C CB  . ARG A 1 657 ? 123.694 138.632 139.434 1.00 435.95 ? 657 ARG A CB  1 
ATOM 4898  C CG  . ARG A 1 657 ? 123.978 137.152 139.183 1.00 413.70 ? 657 ARG A CG  1 
ATOM 4899  C CD  . ARG A 1 657 ? 122.761 136.475 138.591 1.00 433.67 ? 657 ARG A CD  1 
ATOM 4900  N NE  . ARG A 1 657 ? 123.002 135.055 138.339 1.00 463.90 ? 657 ARG A NE  1 
ATOM 4901  C CZ  . ARG A 1 657 ? 123.666 134.556 137.295 1.00 486.40 ? 657 ARG A CZ  1 
ATOM 4902  N NH1 . ARG A 1 657 ? 123.818 133.238 137.183 1.00 500.00 ? 657 ARG A NH1 1 
ATOM 4903  N NH2 . ARG A 1 657 ? 124.199 135.352 136.368 1.00 495.57 ? 657 ARG A NH2 1 
ATOM 4904  N N   . ALA A 1 658 ? 124.685 138.617 142.532 1.00 382.43 ? 658 ALA A N   1 
ATOM 4905  C CA  . ALA A 1 658 ? 125.199 137.902 143.689 1.00 390.92 ? 658 ALA A CA  1 
ATOM 4906  C C   . ALA A 1 658 ? 124.116 137.055 144.260 1.00 389.12 ? 658 ALA A C   1 
ATOM 4907  O O   . ALA A 1 658 ? 122.938 137.430 144.256 1.00 403.19 ? 658 ALA A O   1 
ATOM 4908  C CB  . ALA A 1 658 ? 125.718 138.857 144.749 1.00 437.92 ? 658 ALA A CB  1 
ATOM 4909  N N   . ARG A 1 659 ? 124.540 135.907 144.768 1.00 396.94 ? 659 ARG A N   1 
ATOM 4910  C CA  . ARG A 1 659 ? 123.623 134.907 145.254 1.00 399.47 ? 659 ARG A CA  1 
ATOM 4911  C C   . ARG A 1 659 ? 124.221 134.209 146.441 1.00 391.00 ? 659 ARG A C   1 
ATOM 4912  O O   . ARG A 1 659 ? 125.434 134.061 146.546 1.00 384.05 ? 659 ARG A O   1 
ATOM 4913  C CB  . ARG A 1 659 ? 123.292 133.905 144.154 1.00 424.24 ? 659 ARG A CB  1 
ATOM 4914  C CG  . ARG A 1 659 ? 124.478 133.388 143.348 1.00 429.71 ? 659 ARG A CG  1 
ATOM 4915  C CD  . ARG A 1 659 ? 123.965 132.616 142.144 1.00 425.66 ? 659 ARG A CD  1 
ATOM 4916  N NE  . ARG A 1 659 ? 124.930 131.644 141.643 1.00 402.48 ? 659 ARG A NE  1 
ATOM 4917  C CZ  . ARG A 1 659 ? 124.623 130.576 140.907 1.00 409.02 ? 659 ARG A CZ  1 
ATOM 4918  N NH1 . ARG A 1 659 ? 125.591 129.749 140.517 1.00 429.50 ? 659 ARG A NH1 1 
ATOM 4919  N NH2 . ARG A 1 659 ? 123.358 130.311 140.565 1.00 403.22 ? 659 ARG A NH2 1 
ATOM 4920  N N   . ILE A 1 660 ? 123.343 133.803 147.339 1.00 401.58 ? 660 ILE A N   1 
ATOM 4921  C CA  . ILE A 1 660 ? 123.712 133.071 148.509 1.00 396.87 ? 660 ILE A CA  1 
ATOM 4922  C C   . ILE A 1 660 ? 123.088 131.692 148.467 1.00 396.53 ? 660 ILE A C   1 
ATOM 4923  O O   . ILE A 1 660 ? 121.958 131.510 148.000 1.00 350.54 ? 660 ILE A O   1 
ATOM 4924  C CB  . ILE A 1 660 ? 123.294 133.824 149.777 1.00 447.34 ? 660 ILE A CB  1 
ATOM 4925  C CG1 . ILE A 1 660 ? 124.143 133.337 150.955 1.00 500.00 ? 660 ILE A CG1 1 
ATOM 4926  C CG2 . ILE A 1 660 ? 121.782 133.717 150.036 1.00 411.89 ? 660 ILE A CG2 1 
ATOM 4927  C CD1 . ILE A 1 660 ? 124.211 134.310 152.105 1.00 500.00 ? 660 ILE A CD1 1 
ATOM 4928  N N   . PHE A 1 661 ? 123.847 130.742 148.995 1.00 415.13 ? 661 PHE A N   1 
ATOM 4929  C CA  . PHE A 1 661 ? 123.557 129.327 148.882 1.00 429.00 ? 661 PHE A CA  1 
ATOM 4930  C C   . PHE A 1 661 ? 124.389 128.573 149.896 1.00 398.80 ? 661 PHE A C   1 
ATOM 4931  O O   . PHE A 1 661 ? 125.277 129.147 150.499 1.00 379.37 ? 661 PHE A O   1 
ATOM 4932  C CB  . PHE A 1 661 ? 123.955 128.854 147.499 1.00 433.63 ? 661 PHE A CB  1 
ATOM 4933  C CG  . PHE A 1 661 ? 125.357 129.233 147.110 1.00 412.90 ? 661 PHE A CG  1 
ATOM 4934  C CD1 . PHE A 1 661 ? 126.459 128.597 147.665 1.00 415.70 ? 661 PHE A CD1 1 
ATOM 4935  C CD2 . PHE A 1 661 ? 125.570 130.226 146.184 1.00 462.67 ? 661 PHE A CD2 1 
ATOM 4936  C CE1 . PHE A 1 661 ? 127.741 128.950 147.289 1.00 454.58 ? 661 PHE A CE1 1 
ATOM 4937  C CE2 . PHE A 1 661 ? 126.842 130.578 145.798 1.00 476.18 ? 661 PHE A CE2 1 
ATOM 4938  C CZ  . PHE A 1 661 ? 127.935 129.943 146.349 1.00 457.65 ? 661 PHE A CZ  1 
ATOM 4939  N N   . LEU A 1 662 ? 124.152 127.276 150.023 1.00 398.33 ? 662 LEU A N   1 
ATOM 4940  C CA  . LEU A 1 662 ? 124.955 126.460 150.924 1.00 425.74 ? 662 LEU A CA  1 
ATOM 4941  C C   . LEU A 1 662 ? 126.119 125.781 150.197 1.00 422.37 ? 662 LEU A C   1 
ATOM 4942  O O   . LEU A 1 662 ? 125.923 125.258 149.107 1.00 467.64 ? 662 LEU A O   1 
ATOM 4943  C CB  . LEU A 1 662 ? 124.075 125.444 151.653 1.00 451.07 ? 662 LEU A CB  1 
ATOM 4944  C CG  . LEU A 1 662 ? 123.397 126.052 152.890 1.00 475.75 ? 662 LEU A CG  1 
ATOM 4945  C CD1 . LEU A 1 662 ? 122.504 127.234 152.528 1.00 392.10 ? 662 LEU A CD1 1 
ATOM 4946  C CD2 . LEU A 1 662 ? 122.629 125.013 153.695 1.00 500.00 ? 662 LEU A CD2 1 
ATOM 4947  N N   . ILE A 1 663 ? 127.324 125.809 150.782 1.00 404.49 ? 663 ILE A N   1 
ATOM 4948  C CA  . ILE A 1 663 ? 128.494 125.129 150.189 1.00 394.10 ? 663 ILE A CA  1 
ATOM 4949  C C   . ILE A 1 663 ? 128.961 123.933 151.003 1.00 420.60 ? 663 ILE A C   1 
ATOM 4950  O O   . ILE A 1 663 ? 128.969 123.960 152.249 1.00 404.85 ? 663 ILE A O   1 
ATOM 4951  C CB  . ILE A 1 663 ? 129.706 126.052 149.954 1.00 465.47 ? 663 ILE A CB  1 
ATOM 4952  C CG1 . ILE A 1 663 ? 130.680 125.412 148.949 1.00 500.00 ? 663 ILE A CG1 1 
ATOM 4953  C CG2 . ILE A 1 663 ? 130.437 126.368 151.253 1.00 486.08 ? 663 ILE A CG2 1 
ATOM 4954  C CD1 . ILE A 1 663 ? 131.813 126.316 148.519 1.00 500.00 ? 663 ILE A CD1 1 
ATOM 4955  N N   . ALA A 1 664 ? 129.369 122.908 150.252 1.00 462.35 ? 664 ALA A N   1 
ATOM 4956  C CA  . ALA A 1 664 ? 129.767 121.612 150.773 1.00 499.30 ? 664 ALA A CA  1 
ATOM 4957  C C   . ALA A 1 664 ? 131.196 121.628 151.244 1.00 460.41 ? 664 ALA A C   1 
ATOM 4958  O O   . ALA A 1 664 ? 131.920 122.600 151.021 1.00 484.71 ? 664 ALA A O   1 
ATOM 4959  C CB  . ALA A 1 664 ? 129.616 120.561 149.684 1.00 500.00 ? 664 ALA A CB  1 
ATOM 4960  N N   . SER A 1 665 ? 131.600 120.528 151.877 1.00 442.43 ? 665 SER A N   1 
ATOM 4961  C CA  . SER A 1 665 ? 132.994 120.322 152.260 1.00 473.83 ? 665 SER A CA  1 
ATOM 4962  C C   . SER A 1 665 ? 133.763 119.782 151.065 1.00 464.08 ? 665 SER A C   1 
ATOM 4963  O O   . SER A 1 665 ? 133.239 118.945 150.329 1.00 478.87 ? 665 SER A O   1 
ATOM 4964  C CB  . SER A 1 665 ? 133.115 119.358 153.451 1.00 474.52 ? 665 SER A CB  1 
ATOM 4965  O OG  . SER A 1 665 ? 133.371 118.027 153.044 1.00 468.58 ? 665 SER A OG  1 
ATOM 4966  N N   . LYS A 1 666 ? 134.996 120.262 150.879 1.00 447.51 ? 666 LYS A N   1 
ATOM 4967  C CA  . LYS A 1 666 ? 135.935 119.676 149.920 1.00 448.90 ? 666 LYS A CA  1 
ATOM 4968  C C   . LYS A 1 666 ? 135.953 118.165 150.077 1.00 442.99 ? 666 LYS A C   1 
ATOM 4969  O O   . LYS A 1 666 ? 135.965 117.435 149.076 1.00 483.56 ? 666 LYS A O   1 
ATOM 4970  C CB  . LYS A 1 666 ? 137.364 120.187 150.143 1.00 500.00 ? 666 LYS A CB  1 
ATOM 4971  C CG  . LYS A 1 666 ? 137.751 121.391 149.297 1.00 500.00 ? 666 LYS A CG  1 
ATOM 4972  C CD  . LYS A 1 666 ? 139.237 121.748 149.440 1.00 500.00 ? 666 LYS A CD  1 
ATOM 4973  C CE  . LYS A 1 666 ? 140.149 120.991 148.471 1.00 500.00 ? 666 LYS A CE  1 
ATOM 4974  N NZ  . LYS A 1 666 ? 140.138 121.513 147.068 1.00 500.00 ? 666 LYS A NZ  1 
ATOM 4975  N N   . GLU A 1 667 ? 136.018 117.730 151.341 1.00 443.68 ? 667 GLU A N   1 
ATOM 4976  C CA  . GLU A 1 667 ? 136.126 116.316 151.683 1.00 482.65 ? 667 GLU A CA  1 
ATOM 4977  C C   . GLU A 1 667 ? 134.946 115.545 151.110 1.00 469.33 ? 667 GLU A C   1 
ATOM 4978  O O   . GLU A 1 667 ? 135.126 114.471 150.504 1.00 417.55 ? 667 GLU A O   1 
ATOM 4979  C CB  . GLU A 1 667 ? 136.204 116.100 153.203 1.00 500.00 ? 667 GLU A CB  1 
ATOM 4980  C CG  . GLU A 1 667 ? 137.425 116.757 153.858 1.00 500.00 ? 667 GLU A CG  1 
ATOM 4981  C CD  . GLU A 1 667 ? 137.876 116.109 155.174 1.00 500.00 ? 667 GLU A CD  1 
ATOM 4982  O OE1 . GLU A 1 667 ? 137.063 115.408 155.830 1.00 500.00 ? 667 GLU A OE1 1 
ATOM 4983  O OE2 . GLU A 1 667 ? 139.059 116.313 155.554 1.00 500.00 ? 667 GLU A OE2 1 
ATOM 4984  N N   . LEU A 1 668 ? 133.760 116.121 151.315 1.00 500.00 ? 668 LEU A N   1 
ATOM 4985  C CA  . LEU A 1 668 ? 132.512 115.502 150.837 1.00 500.00 ? 668 LEU A CA  1 
ATOM 4986  C C   . LEU A 1 668 ? 132.549 115.336 149.334 1.00 469.58 ? 668 LEU A C   1 
ATOM 4987  O O   . LEU A 1 668 ? 132.189 114.272 148.813 1.00 423.59 ? 668 LEU A O   1 
ATOM 4988  C CB  . LEU A 1 668 ? 131.247 116.250 151.254 1.00 500.00 ? 668 LEU A CB  1 
ATOM 4989  C CG  . LEU A 1 668 ? 130.016 115.326 151.222 1.00 500.00 ? 668 LEU A CG  1 
ATOM 4990  C CD1 . LEU A 1 668 ? 129.700 114.781 152.610 1.00 500.00 ? 668 LEU A CD1 1 
ATOM 4991  C CD2 . LEU A 1 668 ? 128.806 116.043 150.649 1.00 500.00 ? 668 LEU A CD2 1 
ATOM 4992  N N   . GLU A 1 669 ? 132.996 116.398 148.665 1.00 500.00 ? 669 GLU A N   1 
ATOM 4993  C CA  . GLU A 1 669 ? 133.117 116.424 147.199 1.00 500.00 ? 669 GLU A CA  1 
ATOM 4994  C C   . GLU A 1 669 ? 134.015 115.293 146.729 1.00 500.00 ? 669 GLU A C   1 
ATOM 4995  O O   . GLU A 1 669 ? 133.684 114.557 145.781 1.00 494.38 ? 669 GLU A O   1 
ATOM 4996  C CB  . GLU A 1 669 ? 133.853 117.678 146.650 1.00 500.00 ? 669 GLU A CB  1 
ATOM 4997  C CG  . GLU A 1 669 ? 133.278 119.079 146.842 1.00 500.00 ? 669 GLU A CG  1 
ATOM 4998  C CD  . GLU A 1 669 ? 134.260 120.175 146.377 1.00 500.00 ? 669 GLU A CD  1 
ATOM 4999  O OE1 . GLU A 1 669 ? 135.115 119.906 145.492 1.00 500.00 ? 669 GLU A OE1 1 
ATOM 5000  O OE2 . GLU A 1 669 ? 134.176 121.311 146.901 1.00 500.00 ? 669 GLU A OE2 1 
ATOM 5001  N N   . LEU A 1 670 ? 135.154 115.191 147.411 1.00 500.00 ? 670 LEU A N   1 
ATOM 5002  C CA  . LEU A 1 670 ? 136.173 114.173 147.117 1.00 500.00 ? 670 LEU A CA  1 
ATOM 5003  C C   . LEU A 1 670 ? 135.562 112.783 147.217 1.00 500.00 ? 670 LEU A C   1 
ATOM 5004  O O   . LEU A 1 670 ? 135.756 111.931 146.331 1.00 462.32 ? 670 LEU A O   1 
ATOM 5005  C CB  . LEU A 1 670 ? 137.374 114.302 148.103 1.00 500.00 ? 670 LEU A CB  1 
ATOM 5006  C CG  . LEU A 1 670 ? 138.342 113.141 148.505 1.00 500.00 ? 670 LEU A CG  1 
ATOM 5007  C CD1 . LEU A 1 670 ? 139.764 113.648 148.780 1.00 500.00 ? 670 LEU A CD1 1 
ATOM 5008  C CD2 . LEU A 1 670 ? 137.859 112.320 149.706 1.00 500.00 ? 670 LEU A CD2 1 
ATOM 5009  N N   . ILE A 1 671 ? 134.835 112.588 148.310 1.00 498.95 ? 671 ILE A N   1 
ATOM 5010  C CA  . ILE A 1 671 ? 134.168 111.313 148.604 1.00 500.00 ? 671 ILE A CA  1 
ATOM 5011  C C   . ILE A 1 671 ? 133.214 110.951 147.483 1.00 479.32 ? 671 ILE A C   1 
ATOM 5012  O O   . ILE A 1 671 ? 133.199 109.806 147.008 1.00 500.00 ? 671 ILE A O   1 
ATOM 5013  C CB  . ILE A 1 671 ? 133.458 111.322 149.982 1.00 500.00 ? 671 ILE A CB  1 
ATOM 5014  C CG1 . ILE A 1 671 ? 134.510 111.211 151.107 1.00 500.00 ? 671 ILE A CG1 1 
ATOM 5015  C CG2 . ILE A 1 671 ? 132.403 110.212 150.098 1.00 500.00 ? 671 ILE A CG2 1 
ATOM 5016  C CD1 . ILE A 1 671 ? 135.150 109.836 151.300 1.00 500.00 ? 671 ILE A CD1 1 
ATOM 5017  N N   . THR A 1 672 ? 132.433 111.946 147.083 1.00 460.78 ? 672 THR A N   1 
ATOM 5018  C CA  . THR A 1 672 ? 131.439 111.802 146.014 1.00 500.00 ? 672 THR A CA  1 
ATOM 5019  C C   . THR A 1 672 ? 132.119 111.343 144.727 1.00 486.39 ? 672 THR A C   1 
ATOM 5020  O O   . THR A 1 672 ? 131.650 110.405 144.052 1.00 454.18 ? 672 THR A O   1 
ATOM 5021  C CB  . THR A 1 672 ? 130.714 113.135 145.743 1.00 500.00 ? 672 THR A CB  1 
ATOM 5022  O OG1 . THR A 1 672 ? 130.280 113.719 146.980 1.00 500.00 ? 672 THR A OG1 1 
ATOM 5023  C CG2 . THR A 1 672 ? 129.517 112.923 144.814 1.00 500.00 ? 672 THR A CG2 1 
ATOM 5024  N N   . LEU A 1 673 ? 133.222 112.026 144.426 1.00 468.27 ? 673 LEU A N   1 
ATOM 5025  C CA  . LEU A 1 673 ? 134.009 111.746 143.224 1.00 500.00 ? 673 LEU A CA  1 
ATOM 5026  C C   . LEU A 1 673 ? 134.490 110.294 143.235 1.00 500.00 ? 673 LEU A C   1 
ATOM 5027  O O   . LEU A 1 673 ? 134.386 109.582 142.226 1.00 500.00 ? 673 LEU A O   1 
ATOM 5028  C CB  . LEU A 1 673 ? 135.150 112.746 142.997 1.00 500.00 ? 673 LEU A CB  1 
ATOM 5029  C CG  . LEU A 1 673 ? 135.798 112.639 141.591 1.00 500.00 ? 673 LEU A CG  1 
ATOM 5030  C CD1 . LEU A 1 673 ? 135.844 113.953 140.818 1.00 500.00 ? 673 LEU A CD1 1 
ATOM 5031  C CD2 . LEU A 1 673 ? 137.197 112.037 141.675 1.00 500.00 ? 673 LEU A CD2 1 
ATOM 5032  N N   . THR A 1 674 ? 135.000 109.899 144.395 1.00 500.00 ? 674 THR A N   1 
ATOM 5033  C CA  . THR A 1 674 ? 135.521 108.547 144.610 1.00 500.00 ? 674 THR A CA  1 
ATOM 5034  C C   . THR A 1 674 ? 134.427 107.518 144.347 1.00 496.54 ? 674 THR A C   1 
ATOM 5035  O O   . THR A 1 674 ? 134.655 106.512 143.653 1.00 459.15 ? 674 THR A O   1 
ATOM 5036  C CB  . THR A 1 674 ? 136.204 108.375 145.998 1.00 500.00 ? 674 THR A CB  1 
ATOM 5037  O OG1 . THR A 1 674 ? 137.254 109.343 146.145 1.00 432.08 ? 674 THR A OG1 1 
ATOM 5038  C CG2 . THR A 1 674 ? 136.814 106.982 146.149 1.00 500.00 ? 674 THR A CG2 1 
ATOM 5039  N N   . VAL A 1 675 ? 133.258 107.803 144.903 1.00 465.26 ? 675 VAL A N   1 
ATOM 5040  C CA  . VAL A 1 675 ? 132.084 106.937 144.770 1.00 495.10 ? 675 VAL A CA  1 
ATOM 5041  C C   . VAL A 1 675 ? 131.726 106.766 143.301 1.00 472.60 ? 675 VAL A C   1 
ATOM 5042  O O   . VAL A 1 675 ? 131.489 105.627 142.829 1.00 494.45 ? 675 VAL A O   1 
ATOM 5043  C CB  . VAL A 1 675 ? 130.891 107.419 145.638 1.00 500.00 ? 675 VAL A CB  1 
ATOM 5044  C CG1 . VAL A 1 675 ? 129.596 106.701 145.270 1.00 500.00 ? 675 VAL A CG1 1 
ATOM 5045  C CG2 . VAL A 1 675 ? 131.193 107.201 147.120 1.00 500.00 ? 675 VAL A CG2 1 
ATOM 5046  N N   . GLY A 1 676 ? 131.727 107.890 142.593 1.00 449.02 ? 676 GLY A N   1 
ATOM 5047  C CA  . GLY A 1 676 ? 131.415 107.929 141.165 1.00 477.88 ? 676 GLY A CA  1 
ATOM 5048  C C   . GLY A 1 676 ? 132.372 107.036 140.390 1.00 500.00 ? 676 GLY A C   1 
ATOM 5049  O O   . GLY A 1 676 ? 131.949 106.066 139.724 1.00 500.00 ? 676 GLY A O   1 
ATOM 5050  N N   . PHE A 1 677 ? 133.658 107.365 140.516 1.00 475.41 ? 677 PHE A N   1 
ATOM 5051  C CA  . PHE A 1 677 ? 134.733 106.594 139.886 1.00 483.00 ? 677 PHE A CA  1 
ATOM 5052  C C   . PHE A 1 677 ? 134.692 105.153 140.355 1.00 500.00 ? 677 PHE A C   1 
ATOM 5053  O O   . PHE A 1 677 ? 134.786 104.221 139.511 1.00 500.00 ? 677 PHE A O   1 
ATOM 5054  C CB  . PHE A 1 677 ? 136.126 107.191 140.117 1.00 480.74 ? 677 PHE A CB  1 
ATOM 5055  C CG  . PHE A 1 677 ? 136.718 107.796 138.881 1.00 500.00 ? 677 PHE A CG  1 
ATOM 5056  C CD1 . PHE A 1 677 ? 137.247 106.981 137.885 1.00 500.00 ? 677 PHE A CD1 1 
ATOM 5057  C CD2 . PHE A 1 677 ? 136.722 109.177 138.690 1.00 500.00 ? 677 PHE A CD2 1 
ATOM 5058  C CE1 . PHE A 1 677 ? 137.787 107.527 136.731 1.00 500.00 ? 677 PHE A CE1 1 
ATOM 5059  C CE2 . PHE A 1 677 ? 137.266 109.737 137.538 1.00 500.00 ? 677 PHE A CE2 1 
ATOM 5060  C CZ  . PHE A 1 677 ? 137.798 108.908 136.556 1.00 500.00 ? 677 PHE A CZ  1 
ATOM 5061  N N   . GLY A 1 678 ? 134.538 104.986 141.655 1.00 500.00 ? 678 GLY A N   1 
ATOM 5062  C CA  . GLY A 1 678 ? 134.396 103.649 142.264 1.00 500.00 ? 678 GLY A CA  1 
ATOM 5063  C C   . GLY A 1 678 ? 133.301 102.804 141.634 1.00 477.23 ? 678 GLY A C   1 
ATOM 5064  O O   . GLY A 1 678 ? 133.552 101.686 141.146 1.00 497.02 ? 678 GLY A O   1 
ATOM 5065  N N   . ILE A 1 679 ? 132.072 103.318 141.771 1.00 438.65 ? 679 ILE A N   1 
ATOM 5066  C CA  . ILE A 1 679 ? 130.866 102.575 141.355 1.00 468.57 ? 679 ILE A CA  1 
ATOM 5067  C C   . ILE A 1 679 ? 130.943 102.265 139.873 1.00 464.49 ? 679 ILE A C   1 
ATOM 5068  O O   . ILE A 1 679 ? 130.650 101.118 139.479 1.00 455.88 ? 679 ILE A O   1 
ATOM 5069  C CB  . ILE A 1 679 ? 129.524 103.271 141.740 1.00 495.73 ? 679 ILE A CB  1 
ATOM 5070  C CG1 . ILE A 1 679 ? 128.320 102.323 141.556 1.00 500.00 ? 679 ILE A CG1 1 
ATOM 5071  C CG2 . ILE A 1 679 ? 129.270 104.544 140.947 1.00 493.85 ? 679 ILE A CG2 1 
ATOM 5072  C CD1 . ILE A 1 679 ? 128.088 101.372 142.711 1.00 500.00 ? 679 ILE A CD1 1 
ATOM 5073  N N   . LEU A 1 680 ? 131.352 103.281 139.092 1.00 495.17 ? 680 LEU A N   1 
ATOM 5074  C CA  . LEU A 1 680 ? 131.468 103.126 137.640 1.00 500.00 ? 680 LEU A CA  1 
ATOM 5075  C C   . LEU A 1 680 ? 132.437 102.001 137.300 1.00 500.00 ? 680 LEU A C   1 
ATOM 5076  O O   . LEU A 1 680 ? 132.157 101.142 136.444 1.00 500.00 ? 680 LEU A O   1 
ATOM 5077  C CB  . LEU A 1 680 ? 132.009 104.406 136.982 1.00 498.45 ? 680 LEU A CB  1 
ATOM 5078  C CG  . LEU A 1 680 ? 132.598 104.299 135.561 1.00 470.07 ? 680 LEU A CG  1 
ATOM 5079  C CD1 . LEU A 1 680 ? 131.496 104.177 134.523 1.00 474.66 ? 680 LEU A CD1 1 
ATOM 5080  C CD2 . LEU A 1 680 ? 133.505 105.479 135.253 1.00 496.04 ? 680 LEU A CD2 1 
ATOM 5081  N N   . ILE A 1 681 ? 133.574 102.043 137.994 1.00 481.69 ? 681 ILE A N   1 
ATOM 5082  C CA  . ILE A 1 681 ? 134.646 101.056 137.814 1.00 500.00 ? 681 ILE A CA  1 
ATOM 5083  C C   . ILE A 1 681 ? 134.118 99.654  138.080 1.00 466.91 ? 681 ILE A C   1 
ATOM 5084  O O   . ILE A 1 681 ? 134.370 98.720  137.297 1.00 447.70 ? 681 ILE A O   1 
ATOM 5085  C CB  . ILE A 1 681 ? 135.869 101.361 138.718 1.00 500.00 ? 681 ILE A CB  1 
ATOM 5086  C CG1 . ILE A 1 681 ? 136.783 102.364 138.003 1.00 500.00 ? 681 ILE A CG1 1 
ATOM 5087  C CG2 . ILE A 1 681 ? 136.659 100.100 139.096 1.00 500.00 ? 681 ILE A CG2 1 
ATOM 5088  C CD1 . ILE A 1 681 ? 137.756 103.082 138.919 1.00 500.00 ? 681 ILE A CD1 1 
ATOM 5089  N N   . PHE A 1 682 ? 133.392 99.546  139.187 1.00 459.97 ? 682 PHE A N   1 
ATOM 5090  C CA  . PHE A 1 682 ? 132.800 98.279  139.624 1.00 492.91 ? 682 PHE A CA  1 
ATOM 5091  C C   . PHE A 1 682 ? 131.877 97.729  138.544 1.00 463.86 ? 682 PHE A C   1 
ATOM 5092  O O   . PHE A 1 682 ? 131.934 96.539  138.205 1.00 480.55 ? 682 PHE A O   1 
ATOM 5093  C CB  . PHE A 1 682 ? 132.059 98.498  140.929 1.00 500.00 ? 682 PHE A CB  1 
ATOM 5094  C CG  . PHE A 1 682 ? 131.456 97.260  141.489 1.00 500.00 ? 682 PHE A CG  1 
ATOM 5095  C CD1 . PHE A 1 682 ? 132.244 96.348  142.189 1.00 500.00 ? 682 PHE A CD1 1 
ATOM 5096  C CD2 . PHE A 1 682 ? 130.094 97.000  141.326 1.00 500.00 ? 682 PHE A CD2 1 
ATOM 5097  C CE1 . PHE A 1 682 ? 131.686 95.190  142.718 1.00 500.00 ? 682 PHE A CE1 1 
ATOM 5098  C CE2 . PHE A 1 682 ? 129.527 95.847  141.851 1.00 500.00 ? 682 PHE A CE2 1 
ATOM 5099  C CZ  . PHE A 1 682 ? 130.326 94.939  142.549 1.00 500.00 ? 682 PHE A CZ  1 
ATOM 5100  N N   . SER A 1 683 ? 131.044 98.629  138.031 1.00 484.43 ? 683 SER A N   1 
ATOM 5101  C CA  . SER A 1 683 ? 130.072 98.300  136.985 1.00 500.00 ? 683 SER A CA  1 
ATOM 5102  C C   . SER A 1 683 ? 130.790 97.748  135.759 1.00 500.00 ? 683 SER A C   1 
ATOM 5103  O O   . SER A 1 683 ? 130.383 96.710  135.195 1.00 500.00 ? 683 SER A O   1 
ATOM 5104  C CB  . SER A 1 683 ? 129.175 99.489  136.642 1.00 500.00 ? 683 SER A CB  1 
ATOM 5105  O OG  . SER A 1 683 ? 129.867 100.531 135.986 1.00 500.00 ? 683 SER A OG  1 
ATOM 5106  N N   . LEU A 1 684 ? 131.855 98.450  135.386 1.00 486.75 ? 684 LEU A N   1 
ATOM 5107  C CA  . LEU A 1 684 ? 132.672 98.079  134.228 1.00 500.00 ? 684 LEU A CA  1 
ATOM 5108  C C   . LEU A 1 684 ? 133.232 96.664  134.406 1.00 497.17 ? 684 LEU A C   1 
ATOM 5109  O O   . LEU A 1 684 ? 133.178 95.836  133.487 1.00 476.92 ? 684 LEU A O   1 
ATOM 5110  C CB  . LEU A 1 684 ? 133.775 99.100  133.912 1.00 500.00 ? 684 LEU A CB  1 
ATOM 5111  C CG  . LEU A 1 684 ? 133.342 100.317 133.069 1.00 500.00 ? 684 LEU A CG  1 
ATOM 5112  C CD1 . LEU A 1 684 ? 134.455 101.357 133.019 1.00 500.00 ? 684 LEU A CD1 1 
ATOM 5113  C CD2 . LEU A 1 684 ? 132.935 99.935  131.652 1.00 500.00 ? 684 LEU A CD2 1 
ATOM 5114  N N   . ILE A 1 685 ? 133.752 96.440  135.603 1.00 500.00 ? 685 ILE A N   1 
ATOM 5115  C CA  . ILE A 1 685 ? 134.343 95.150  135.978 1.00 500.00 ? 685 ILE A CA  1 
ATOM 5116  C C   . ILE A 1 685 ? 133.314 94.025  135.827 1.00 500.00 ? 685 ILE A C   1 
ATOM 5117  O O   . ILE A 1 685 ? 133.560 93.014  135.116 1.00 478.34 ? 685 ILE A O   1 
ATOM 5118  C CB  . ILE A 1 685 ? 134.971 95.234  137.410 1.00 500.00 ? 685 ILE A CB  1 
ATOM 5119  C CG1 . ILE A 1 685 ? 136.281 96.044  137.368 1.00 500.00 ? 685 ILE A CG1 1 
ATOM 5120  C CG2 . ILE A 1 685 ? 135.210 93.861  138.047 1.00 500.00 ? 685 ILE A CG2 1 
ATOM 5121  C CD1 . ILE A 1 685 ? 137.351 95.524  136.420 1.00 500.00 ? 685 ILE A CD1 1 
ATOM 5122  N N   . VAL A 1 686 ? 132.263 94.146  136.629 1.00 500.00 ? 686 VAL A N   1 
ATOM 5123  C CA  . VAL A 1 686 ? 131.271 93.066  136.787 1.00 500.00 ? 686 VAL A CA  1 
ATOM 5124  C C   . VAL A 1 686 ? 130.630 92.767  135.444 1.00 498.23 ? 686 VAL A C   1 
ATOM 5125  O O   . VAL A 1 686 ? 130.484 91.585  135.082 1.00 459.95 ? 686 VAL A O   1 
ATOM 5126  C CB  . VAL A 1 686 ? 130.246 93.380  137.906 1.00 500.00 ? 686 VAL A CB  1 
ATOM 5127  C CG1 . VAL A 1 686 ? 129.106 92.364  137.919 1.00 500.00 ? 686 VAL A CG1 1 
ATOM 5128  C CG2 . VAL A 1 686 ? 130.953 93.403  139.258 1.00 477.41 ? 686 VAL A CG2 1 
ATOM 5129  N N   . THR A 1 687 ? 130.274 93.839  134.729 1.00 500.00 ? 687 THR A N   1 
ATOM 5130  C CA  . THR A 1 687 ? 129.632 93.701  133.414 1.00 478.28 ? 687 THR A CA  1 
ATOM 5131  C C   . THR A 1 687 ? 130.550 92.956  132.460 1.00 446.92 ? 687 THR A C   1 
ATOM 5132  O O   . THR A 1 687 ? 130.093 92.050  131.742 1.00 446.42 ? 687 THR A O   1 
ATOM 5133  C CB  . THR A 1 687 ? 129.116 95.030  132.825 1.00 462.60 ? 687 THR A CB  1 
ATOM 5134  O OG1 . THR A 1 687 ? 128.172 95.614  133.735 1.00 448.37 ? 687 THR A OG1 1 
ATOM 5135  C CG2 . THR A 1 687 ? 128.414 94.793  131.489 1.00 419.05 ? 687 THR A CG2 1 
ATOM 5136  N N   . TYR A 1 688 ? 131.827 93.343  132.487 1.00 441.89 ? 688 TYR A N   1 
ATOM 5137  C CA  . TYR A 1 688 ? 132.853 92.723  131.638 1.00 494.95 ? 688 TYR A CA  1 
ATOM 5138  C C   . TYR A 1 688 ? 132.925 91.223  131.912 1.00 440.40 ? 688 TYR A C   1 
ATOM 5139  O O   . TYR A 1 688 ? 132.956 90.401  130.976 1.00 349.03 ? 688 TYR A O   1 
ATOM 5140  C CB  . TYR A 1 688 ? 134.254 93.347  131.874 1.00 500.00 ? 688 TYR A CB  1 
ATOM 5141  C CG  . TYR A 1 688 ? 135.330 93.171  130.773 1.00 500.00 ? 688 TYR A CG  1 
ATOM 5142  C CD1 . TYR A 1 688 ? 135.322 93.975  129.610 1.00 500.00 ? 688 TYR A CD1 1 
ATOM 5143  C CD2 . TYR A 1 688 ? 136.406 92.271  130.927 1.00 500.00 ? 688 TYR A CD2 1 
ATOM 5144  C CE1 . TYR A 1 688 ? 136.315 93.854  128.619 1.00 500.00 ? 688 TYR A CE1 1 
ATOM 5145  C CE2 . TYR A 1 688 ? 137.405 92.146  129.937 1.00 500.00 ? 688 TYR A CE2 1 
ATOM 5146  C CZ  . TYR A 1 688 ? 137.362 92.936  128.779 1.00 500.00 ? 688 TYR A CZ  1 
ATOM 5147  O OH  . TYR A 1 688 ? 138.339 92.828  127.784 1.00 393.60 ? 688 TYR A OH  1 
ATOM 5148  N N   . CYS A 1 689 ? 132.950 90.912  133.206 1.00 466.77 ? 689 CYS A N   1 
ATOM 5149  C CA  . CYS A 1 689 ? 133.029 89.526  133.679 1.00 500.00 ? 689 CYS A CA  1 
ATOM 5150  C C   . CYS A 1 689 ? 131.846 88.720  133.144 1.00 500.00 ? 689 CYS A C   1 
ATOM 5151  O O   . CYS A 1 689 ? 132.016 87.598  132.642 1.00 500.00 ? 689 CYS A O   1 
ATOM 5152  C CB  . CYS A 1 689 ? 133.120 89.435  135.218 1.00 500.00 ? 689 CYS A CB  1 
ATOM 5153  S SG  . CYS A 1 689 ? 134.807 89.441  135.895 1.00 500.00 ? 689 CYS A SG  1 
ATOM 5154  N N   . ILE A 1 690 ? 130.675 89.327  133.265 1.00 455.51 ? 690 ILE A N   1 
ATOM 5155  C CA  . ILE A 1 690 ? 129.420 88.715  132.819 1.00 498.84 ? 690 ILE A CA  1 
ATOM 5156  C C   . ILE A 1 690 ? 129.489 88.403  131.330 1.00 495.72 ? 690 ILE A C   1 
ATOM 5157  O O   . ILE A 1 690 ? 129.118 87.300  130.897 1.00 444.14 ? 690 ILE A O   1 
ATOM 5158  C CB  . ILE A 1 690 ? 128.189 89.526  133.254 1.00 500.00 ? 690 ILE A CB  1 
ATOM 5159  C CG1 . ILE A 1 690 ? 127.999 89.326  134.772 1.00 500.00 ? 690 ILE A CG1 1 
ATOM 5160  C CG2 . ILE A 1 690 ? 126.937 89.106  132.476 1.00 500.00 ? 690 ILE A CG2 1 
ATOM 5161  C CD1 . ILE A 1 690 ? 127.192 90.404  135.463 1.00 500.00 ? 690 ILE A CD1 1 
ATOM 5162  N N   . ASN A 1 691 ? 129.976 89.388  130.583 1.00 500.00 ? 691 ASN A N   1 
ATOM 5163  C CA  . ASN A 1 691 ? 130.116 89.274  129.128 1.00 500.00 ? 691 ASN A CA  1 
ATOM 5164  C C   . ASN A 1 691 ? 131.027 88.097  128.781 1.00 500.00 ? 691 ASN A C   1 
ATOM 5165  O O   . ASN A 1 691 ? 130.703 87.286  127.896 1.00 500.00 ? 691 ASN A O   1 
ATOM 5166  C CB  . ASN A 1 691 ? 130.530 90.573  128.407 1.00 500.00 ? 691 ASN A CB  1 
ATOM 5167  C CG  . ASN A 1 691 ? 130.094 90.590  126.930 1.00 500.00 ? 691 ASN A CG  1 
ATOM 5168  O OD1 . ASN A 1 691 ? 128.925 90.340  126.604 1.00 500.00 ? 691 ASN A OD1 1 
ATOM 5169  N ND2 . ASN A 1 691 ? 131.037 90.885  126.034 1.00 500.00 ? 691 ASN A ND2 1 
ATOM 5170  N N   . ALA A 1 692 ? 132.140 88.030  129.503 1.00 500.00 ? 692 ALA A N   1 
ATOM 5171  C CA  . ALA A 1 692 ? 133.135 86.972  129.321 1.00 500.00 ? 692 ALA A CA  1 
ATOM 5172  C C   . ALA A 1 692 ? 132.489 85.594  129.543 1.00 500.00 ? 692 ALA A C   1 
ATOM 5173  O O   . ALA A 1 692 ? 132.685 84.668  128.744 1.00 464.06 ? 692 ALA A O   1 
ATOM 5174  C CB  . ALA A 1 692 ? 134.348 87.173  130.229 1.00 500.00 ? 692 ALA A CB  1 
ATOM 5175  N N   . LYS A 1 693 ? 131.739 85.477  130.645 1.00 500.00 ? 693 LYS A N   1 
ATOM 5176  C CA  . LYS A 1 693 ? 131.042 84.247  131.048 1.00 500.00 ? 693 LYS A CA  1 
ATOM 5177  C C   . LYS A 1 693 ? 129.548 84.354  130.772 1.00 500.00 ? 693 LYS A C   1 
ATOM 5178  O O   . LYS A 1 693 ? 128.722 84.063  131.643 1.00 488.41 ? 693 LYS A O   1 
ATOM 5179  C CB  . LYS A 1 693 ? 131.265 83.974  132.554 1.00 500.00 ? 693 LYS A CB  1 
ATOM 5180  C CG  . LYS A 1 693 ? 132.716 83.961  133.028 1.00 500.00 ? 693 LYS A CG  1 
ATOM 5181  C CD  . LYS A 1 693 ? 133.630 83.187  132.078 1.00 500.00 ? 693 LYS A CD  1 
ATOM 5182  C CE  . LYS A 1 693 ? 134.842 82.573  132.771 1.00 500.00 ? 693 LYS A CE  1 
ATOM 5183  N NZ  . LYS A 1 693 ? 134.590 81.161  133.196 1.00 500.00 ? 693 LYS A NZ  1 
ATOM 5184  N N   . ALA A 1 694 ? 129.199 84.777  129.559 1.00 500.00 ? 694 ALA A N   1 
ATOM 5185  C CA  . ALA A 1 694 ? 127.796 84.982  129.205 1.00 500.00 ? 694 ALA A CA  1 
ATOM 5186  C C   . ALA A 1 694 ? 127.098 83.631  129.145 1.00 500.00 ? 694 ALA A C   1 
ATOM 5187  O O   . ALA A 1 694 ? 126.239 83.327  129.978 1.00 500.00 ? 694 ALA A O   1 
ATOM 5188  C CB  . ALA A 1 694 ? 127.660 85.732  127.880 1.00 500.00 ? 694 ALA A CB  1 
ATOM 5189  N N   . ASP A 1 695 ? 127.517 82.807  128.191 1.00 500.00 ? 695 ASP A N   1 
ATOM 5190  C CA  . ASP A 1 695 ? 126.857 81.529  127.921 1.00 500.00 ? 695 ASP A CA  1 
ATOM 5191  C C   . ASP A 1 695 ? 127.281 80.422  128.909 1.00 500.00 ? 695 ASP A C   1 
ATOM 5192  O O   . ASP A 1 695 ? 126.643 79.365  128.968 1.00 497.39 ? 695 ASP A O   1 
ATOM 5193  C CB  . ASP A 1 695 ? 127.081 81.121  126.449 1.00 500.00 ? 695 ASP A CB  1 
ATOM 5194  C CG  . ASP A 1 695 ? 126.420 82.106  125.440 1.00 500.00 ? 695 ASP A CG  1 
ATOM 5195  O OD1 . ASP A 1 695 ? 126.318 83.326  125.729 1.00 500.00 ? 695 ASP A OD1 1 
ATOM 5196  O OD2 . ASP A 1 695 ? 126.008 81.646  124.349 1.00 500.00 ? 695 ASP A OD2 1 
ATOM 5197  N N   . VAL A 1 696 ? 128.344 80.675  129.678 1.00 500.00 ? 696 VAL A N   1 
ATOM 5198  C CA  . VAL A 1 696 ? 128.732 79.822  130.812 1.00 500.00 ? 696 VAL A CA  1 
ATOM 5199  C C   . VAL A 1 696 ? 127.613 79.758  131.867 1.00 500.00 ? 696 VAL A C   1 
ATOM 5200  O O   . VAL A 1 696 ? 127.278 78.681  132.367 1.00 500.00 ? 696 VAL A O   1 
ATOM 5201  C CB  . VAL A 1 696 ? 130.069 80.311  131.453 1.00 500.00 ? 696 VAL A CB  1 
ATOM 5202  C CG1 . VAL A 1 696 ? 130.339 79.665  132.816 1.00 500.00 ? 696 VAL A CG1 1 
ATOM 5203  C CG2 . VAL A 1 696 ? 131.236 80.051  130.507 1.00 500.00 ? 696 VAL A CG2 1 
ATOM 5204  N N   . LEU A 1 697 ? 127.034 80.915  132.175 1.00 500.00 ? 697 LEU A N   1 
ATOM 5205  C CA  . LEU A 1 697 ? 126.065 81.044  133.264 1.00 500.00 ? 697 LEU A CA  1 
ATOM 5206  C C   . LEU A 1 697 ? 124.607 80.815  132.846 1.00 500.00 ? 697 LEU A C   1 
ATOM 5207  O O   . LEU A 1 697 ? 123.725 80.868  133.706 1.00 480.86 ? 697 LEU A O   1 
ATOM 5208  C CB  . LEU A 1 697 ? 126.220 82.425  133.904 1.00 500.00 ? 697 LEU A CB  1 
ATOM 5209  C CG  . LEU A 1 697 ? 127.649 82.711  134.398 1.00 500.00 ? 697 LEU A CG  1 
ATOM 5210  C CD1 . LEU A 1 697 ? 127.871 84.197  134.655 1.00 500.00 ? 697 LEU A CD1 1 
ATOM 5211  C CD2 . LEU A 1 697 ? 127.966 81.877  135.639 1.00 500.00 ? 697 LEU A CD2 1 
ATOM 5212  N N   . PHE A 1 698 ? 124.363 80.557  131.547 1.00 500.00 ? 698 PHE A N   1 
ATOM 5213  C CA  . PHE A 1 698 ? 123.017 80.280  130.985 1.00 500.00 ? 698 PHE A CA  1 
ATOM 5214  C C   . PHE A 1 698 ? 122.938 78.878  130.318 1.00 465.59 ? 698 PHE A C   1 
ATOM 5215  O O   . PHE A 1 698 ? 121.915 78.138  130.412 1.00 309.21 ? 698 PHE A O   1 
ATOM 5216  C CB  . PHE A 1 698 ? 122.623 81.365  129.948 1.00 500.00 ? 698 PHE A CB  1 
ATOM 5217  C CG  . PHE A 1 698 ? 122.779 82.811  130.424 1.00 500.00 ? 698 PHE A CG  1 
ATOM 5218  C CD1 . PHE A 1 698 ? 122.540 83.192  131.752 1.00 500.00 ? 698 PHE A CD1 1 
ATOM 5219  C CD2 . PHE A 1 698 ? 123.118 83.813  129.511 1.00 500.00 ? 698 PHE A CD2 1 
ATOM 5220  C CE1 . PHE A 1 698 ? 122.674 84.517  132.157 1.00 500.00 ? 698 PHE A CE1 1 
ATOM 5221  C CE2 . PHE A 1 698 ? 123.247 85.141  129.913 1.00 500.00 ? 698 PHE A CE2 1 
ATOM 5222  C CZ  . PHE A 1 698 ? 123.023 85.493  131.237 1.00 494.65 ? 698 PHE A CZ  1 
ATOM 5223  N N   . GLY B 2 78  ? 121.391 94.878  106.136 1.00 500.00 ? 78  GLY B N   1 
ATOM 5224  C CA  . GLY B 2 78  ? 121.481 94.550  107.594 1.00 500.00 ? 78  GLY B CA  1 
ATOM 5225  C C   . GLY B 2 78  ? 121.306 95.751  108.512 1.00 500.00 ? 78  GLY B C   1 
ATOM 5226  O O   . GLY B 2 78  ? 120.741 96.770  108.111 1.00 500.00 ? 78  GLY B O   1 
ATOM 5227  N N   . ALA B 2 79  ? 121.781 95.610  109.749 1.00 500.00 ? 79  ALA B N   1 
ATOM 5228  C CA  . ALA B 2 79  ? 121.797 96.700  110.749 1.00 500.00 ? 79  ALA B CA  1 
ATOM 5229  C C   . ALA B 2 79  ? 123.065 97.580  110.719 1.00 477.59 ? 79  ALA B C   1 
ATOM 5230  O O   . ALA B 2 79  ? 123.065 98.714  111.249 1.00 416.00 ? 79  ALA B O   1 
ATOM 5231  C CB  . ALA B 2 79  ? 121.616 96.109  112.137 1.00 481.72 ? 79  ALA B CB  1 
ATOM 5232  N N   . LYS B 2 80  ? 124.134 97.003  110.152 1.00 452.01 ? 80  LYS B N   1 
ATOM 5233  C CA  . LYS B 2 80  ? 125.421 97.648  110.081 1.00 465.65 ? 80  LYS B CA  1 
ATOM 5234  C C   . LYS B 2 80  ? 125.318 98.986  109.349 1.00 466.29 ? 80  LYS B C   1 
ATOM 5235  O O   . LYS B 2 80  ? 125.858 100.008 109.812 1.00 500.00 ? 80  LYS B O   1 
ATOM 5236  C CB  . LYS B 2 80  ? 126.476 96.738  109.429 1.00 464.36 ? 80  LYS B CB  1 
ATOM 5237  C CG  . LYS B 2 80  ? 127.914 97.248  109.588 1.00 500.00 ? 80  LYS B CG  1 
ATOM 5238  C CD  . LYS B 2 80  ? 128.926 96.154  109.940 1.00 500.00 ? 80  LYS B CD  1 
ATOM 5239  C CE  . LYS B 2 80  ? 128.975 95.824  111.438 1.00 496.64 ? 80  LYS B CE  1 
ATOM 5240  N NZ  . LYS B 2 80  ? 129.990 96.574  112.244 1.00 432.48 ? 80  LYS B NZ  1 
ATOM 5241  N N   . HIS B 2 81  ? 124.614 98.945  108.225 1.00 429.84 ? 81  HIS B N   1 
ATOM 5242  C CA  . HIS B 2 81  ? 124.396 100.118 107.380 1.00 470.40 ? 81  HIS B CA  1 
ATOM 5243  C C   . HIS B 2 81  ? 123.715 101.227 108.184 1.00 474.24 ? 81  HIS B C   1 
ATOM 5244  O O   . HIS B 2 81  ? 124.125 102.400 108.146 1.00 431.71 ? 81  HIS B O   1 
ATOM 5245  C CB  . HIS B 2 81  ? 123.502 99.769  106.177 1.00 500.00 ? 81  HIS B CB  1 
ATOM 5246  C CG  . HIS B 2 81  ? 124.009 98.638  105.329 1.00 500.00 ? 81  HIS B CG  1 
ATOM 5247  N ND1 . HIS B 2 81  ? 123.600 97.332  105.507 1.00 500.00 ? 81  HIS B ND1 1 
ATOM 5248  C CD2 . HIS B 2 81  ? 124.865 98.622  104.278 1.00 500.00 ? 81  HIS B CD2 1 
ATOM 5249  C CE1 . HIS B 2 81  ? 124.194 96.560  104.616 1.00 500.00 ? 81  HIS B CE1 1 
ATOM 5250  N NE2 . HIS B 2 81  ? 124.967 97.317  103.858 1.00 500.00 ? 81  HIS B NE2 1 
ATOM 5251  N N   . VAL B 2 82  ? 122.675 100.808 108.905 1.00 488.79 ? 82  VAL B N   1 
ATOM 5252  C CA  . VAL B 2 82  ? 121.872 101.714 109.730 1.00 469.10 ? 82  VAL B CA  1 
ATOM 5253  C C   . VAL B 2 82  ? 122.766 102.390 110.772 1.00 427.69 ? 82  VAL B C   1 
ATOM 5254  O O   . VAL B 2 82  ? 122.696 103.616 110.972 1.00 441.67 ? 82  VAL B O   1 
ATOM 5255  C CB  . VAL B 2 82  ? 120.693 101.044 110.475 1.00 500.00 ? 82  VAL B CB  1 
ATOM 5256  C CG1 . VAL B 2 82  ? 119.797 102.113 111.102 1.00 500.00 ? 82  VAL B CG1 1 
ATOM 5257  C CG2 . VAL B 2 82  ? 119.881 100.143 109.548 1.00 500.00 ? 82  VAL B CG2 1 
ATOM 5258  N N   . ILE B 2 83  ? 123.593 101.561 111.409 1.00 370.27 ? 83  ILE B N   1 
ATOM 5259  C CA  . ILE B 2 83  ? 124.481 102.064 112.458 1.00 391.38 ? 83  ILE B CA  1 
ATOM 5260  C C   . ILE B 2 83  ? 125.459 103.079 111.875 1.00 431.66 ? 83  ILE B C   1 
ATOM 5261  O O   . ILE B 2 83  ? 125.692 104.123 112.493 1.00 480.03 ? 83  ILE B O   1 
ATOM 5262  C CB  . ILE B 2 83  ? 125.242 101.017 113.305 1.00 478.20 ? 83  ILE B CB  1 
ATOM 5263  C CG1 . ILE B 2 83  ? 125.221 101.502 114.773 1.00 500.00 ? 83  ILE B CG1 1 
ATOM 5264  C CG2 . ILE B 2 83  ? 126.690 100.774 112.819 1.00 418.30 ? 83  ILE B CG2 1 
ATOM 5265  C CD1 . ILE B 2 83  ? 126.261 100.905 115.705 1.00 500.00 ? 83  ILE B CD1 1 
ATOM 5266  N N   . MET B 2 84  ? 125.984 102.772 110.696 1.00 489.56 ? 84  MET B N   1 
ATOM 5267  C CA  . MET B 2 84  ? 126.920 103.666 110.025 1.00 500.00 ? 84  MET B CA  1 
ATOM 5268  C C   . MET B 2 84  ? 126.256 105.003 109.726 1.00 500.00 ? 84  MET B C   1 
ATOM 5269  O O   . MET B 2 84  ? 126.872 106.053 109.933 1.00 500.00 ? 84  MET B O   1 
ATOM 5270  C CB  . MET B 2 84  ? 127.588 103.010 108.803 1.00 500.00 ? 84  MET B CB  1 
ATOM 5271  C CG  . MET B 2 84  ? 128.489 101.818 109.183 1.00 500.00 ? 84  MET B CG  1 
ATOM 5272  S SD  . MET B 2 84  ? 130.162 101.737 108.472 1.00 500.00 ? 84  MET B SD  1 
ATOM 5273  C CE  . MET B 2 84  ? 131.080 102.870 109.528 1.00 500.00 ? 84  MET B CE  1 
ATOM 5274  N N   . LEU B 2 85  ? 125.012 104.937 109.259 1.00 480.55 ? 85  LEU B N   1 
ATOM 5275  C CA  . LEU B 2 85  ? 124.217 106.123 108.958 1.00 500.00 ? 85  LEU B CA  1 
ATOM 5276  C C   . LEU B 2 85  ? 124.075 106.992 110.220 1.00 487.22 ? 85  LEU B C   1 
ATOM 5277  O O   . LEU B 2 85  ? 124.265 108.217 110.169 1.00 500.00 ? 85  LEU B O   1 
ATOM 5278  C CB  . LEU B 2 85  ? 122.851 105.765 108.362 1.00 500.00 ? 85  LEU B CB  1 
ATOM 5279  C CG  . LEU B 2 85  ? 122.421 106.828 107.337 1.00 500.00 ? 85  LEU B CG  1 
ATOM 5280  C CD1 . LEU B 2 85  ? 121.287 106.354 106.447 1.00 500.00 ? 85  LEU B CD1 1 
ATOM 5281  C CD2 . LEU B 2 85  ? 122.075 108.163 107.992 1.00 500.00 ? 85  LEU B CD2 1 
ATOM 5282  N N   . PHE B 2 86  ? 123.727 106.316 111.304 1.00 454.42 ? 86  PHE B N   1 
ATOM 5283  C CA  . PHE B 2 86  ? 123.533 106.950 112.603 1.00 466.49 ? 86  PHE B CA  1 
ATOM 5284  C C   . PHE B 2 86  ? 124.757 107.762 113.049 1.00 455.63 ? 86  PHE B C   1 
ATOM 5285  O O   . PHE B 2 86  ? 124.606 108.908 113.473 1.00 434.81 ? 86  PHE B O   1 
ATOM 5286  C CB  . PHE B 2 86  ? 123.373 105.903 113.731 1.00 498.87 ? 86  PHE B CB  1 
ATOM 5287  C CG  . PHE B 2 86  ? 121.982 105.400 113.978 1.00 497.77 ? 86  PHE B CG  1 
ATOM 5288  C CD1 . PHE B 2 86  ? 120.844 106.166 113.723 1.00 500.00 ? 86  PHE B CD1 1 
ATOM 5289  C CD2 . PHE B 2 86  ? 121.825 104.154 114.576 1.00 479.60 ? 86  PHE B CD2 1 
ATOM 5290  C CE1 . PHE B 2 86  ? 119.581 105.669 114.004 1.00 500.00 ? 86  PHE B CE1 1 
ATOM 5291  C CE2 . PHE B 2 86  ? 120.567 103.657 114.862 1.00 500.00 ? 86  PHE B CE2 1 
ATOM 5292  C CZ  . PHE B 2 86  ? 119.439 104.415 114.573 1.00 500.00 ? 86  PHE B CZ  1 
ATOM 5293  N N   . VAL B 2 87  ? 125.911 107.090 113.148 1.00 436.31 ? 87  VAL B N   1 
ATOM 5294  C CA  . VAL B 2 87  ? 126.949 107.458 114.163 1.00 460.35 ? 87  VAL B CA  1 
ATOM 5295  C C   . VAL B 2 87  ? 127.412 108.874 113.869 1.00 451.60 ? 87  VAL B C   1 
ATOM 5296  O O   . VAL B 2 87  ? 127.531 109.689 114.800 1.00 497.41 ? 87  VAL B O   1 
ATOM 5297  C CB  . VAL B 2 87  ? 128.136 106.446 114.237 1.00 500.00 ? 87  VAL B CB  1 
ATOM 5298  C CG1 . VAL B 2 87  ? 129.517 107.113 114.311 1.00 500.00 ? 87  VAL B CG1 1 
ATOM 5299  C CG2 . VAL B 2 87  ? 127.943 105.517 115.426 1.00 500.00 ? 87  VAL B CG2 1 
ATOM 5300  N N   . PRO B 2 88  ? 127.714 109.139 112.590 1.00 465.25 ? 88  PRO B N   1 
ATOM 5301  C CA  . PRO B 2 88  ? 128.229 110.464 112.243 1.00 472.76 ? 88  PRO B CA  1 
ATOM 5302  C C   . PRO B 2 88  ? 127.215 111.537 112.518 1.00 446.19 ? 88  PRO B C   1 
ATOM 5303  O O   . PRO B 2 88  ? 127.599 112.593 113.051 1.00 440.10 ? 88  PRO B O   1 
ATOM 5304  C CB  . PRO B 2 88  ? 128.538 110.336 110.760 1.00 500.00 ? 88  PRO B CB  1 
ATOM 5305  C CG  . PRO B 2 88  ? 128.868 108.893 110.617 1.00 500.00 ? 88  PRO B CG  1 
ATOM 5306  C CD  . PRO B 2 88  ? 127.809 108.244 111.434 1.00 493.76 ? 88  PRO B CD  1 
ATOM 5307  N N   . VAL B 2 89  ? 125.947 111.243 112.216 1.00 415.95 ? 89  VAL B N   1 
ATOM 5308  C CA  . VAL B 2 89  ? 124.841 112.170 112.487 1.00 429.21 ? 89  VAL B CA  1 
ATOM 5309  C C   . VAL B 2 89  ? 124.793 112.513 113.974 1.00 394.40 ? 89  VAL B C   1 
ATOM 5310  O O   . VAL B 2 89  ? 124.672 113.688 114.362 1.00 416.91 ? 89  VAL B O   1 
ATOM 5311  C CB  . VAL B 2 89  ? 123.461 111.547 112.129 1.00 461.48 ? 89  VAL B CB  1 
ATOM 5312  C CG1 . VAL B 2 89  ? 122.289 112.354 112.697 1.00 469.99 ? 89  VAL B CG1 1 
ATOM 5313  C CG2 . VAL B 2 89  ? 123.305 111.381 110.624 1.00 493.08 ? 89  VAL B CG2 1 
ATOM 5314  N N   . THR B 2 90  ? 124.888 111.454 114.771 1.00 375.84 ? 90  THR B N   1 
ATOM 5315  C CA  . THR B 2 90  ? 124.854 111.540 116.230 1.00 456.58 ? 90  THR B CA  1 
ATOM 5316  C C   . THR B 2 90  ? 125.971 112.470 116.720 1.00 451.06 ? 90  THR B C   1 
ATOM 5317  O O   . THR B 2 90  ? 125.747 113.363 117.560 1.00 500.00 ? 90  THR B O   1 
ATOM 5318  C CB  . THR B 2 90  ? 125.089 110.145 116.856 1.00 500.00 ? 90  THR B CB  1 
ATOM 5319  O OG1 . THR B 2 90  ? 124.178 109.198 116.283 1.00 500.00 ? 90  THR B OG1 1 
ATOM 5320  C CG2 . THR B 2 90  ? 124.940 110.168 118.385 1.00 500.00 ? 90  THR B CG2 1 
ATOM 5321  N N   . LEU B 2 91  ? 127.155 112.222 116.172 1.00 397.35 ? 91  LEU B N   1 
ATOM 5322  C CA  . LEU B 2 91  ? 128.359 112.983 116.514 1.00 413.99 ? 91  LEU B CA  1 
ATOM 5323  C C   . LEU B 2 91  ? 128.146 114.461 116.221 1.00 408.92 ? 91  LEU B C   1 
ATOM 5324  O O   . LEU B 2 91  ? 128.470 115.325 117.053 1.00 422.96 ? 91  LEU B O   1 
ATOM 5325  C CB  . LEU B 2 91  ? 129.589 112.422 115.789 1.00 500.00 ? 91  LEU B CB  1 
ATOM 5326  C CG  . LEU B 2 91  ? 130.791 112.075 116.682 1.00 500.00 ? 91  LEU B CG  1 
ATOM 5327  C CD1 . LEU B 2 91  ? 131.721 111.081 115.985 1.00 500.00 ? 91  LEU B CD1 1 
ATOM 5328  C CD2 . LEU B 2 91  ? 131.557 113.326 117.109 1.00 500.00 ? 91  LEU B CD2 1 
ATOM 5329  N N   . CYS B 2 92  ? 127.598 114.713 115.038 1.00 395.17 ? 92  CYS B N   1 
ATOM 5330  C CA  . CYS B 2 92  ? 127.314 116.076 114.571 1.00 426.47 ? 92  CYS B CA  1 
ATOM 5331  C C   . CYS B 2 92  ? 126.383 116.781 115.546 1.00 417.06 ? 92  CYS B C   1 
ATOM 5332  O O   . CYS B 2 92  ? 126.624 117.941 115.931 1.00 356.77 ? 92  CYS B O   1 
ATOM 5333  C CB  . CYS B 2 92  ? 126.693 116.120 113.185 1.00 456.03 ? 92  CYS B CB  1 
ATOM 5334  S SG  . CYS B 2 92  ? 126.059 117.760 112.755 1.00 473.07 ? 92  CYS B SG  1 
ATOM 5335  N N   . MET B 2 93  ? 125.338 116.051 115.924 1.00 423.08 ? 93  MET B N   1 
ATOM 5336  C CA  . MET B 2 93  ? 124.320 116.551 116.854 1.00 435.10 ? 93  MET B CA  1 
ATOM 5337  C C   . MET B 2 93  ? 124.973 116.950 118.176 1.00 435.08 ? 93  MET B C   1 
ATOM 5338  O O   . MET B 2 93  ? 124.699 118.035 118.723 1.00 479.77 ? 93  MET B O   1 
ATOM 5339  C CB  . MET B 2 93  ? 123.212 115.511 117.082 1.00 458.08 ? 93  MET B CB  1 
ATOM 5340  C CG  . MET B 2 93  ? 122.509 115.021 115.813 1.00 493.58 ? 93  MET B CG  1 
ATOM 5341  S SD  . MET B 2 93  ? 120.783 115.479 115.564 1.00 500.00 ? 93  MET B SD  1 
ATOM 5342  C CE  . MET B 2 93  ? 119.960 114.396 116.723 1.00 500.00 ? 93  MET B CE  1 
ATOM 5343  N N   . VAL B 2 94  ? 125.826 116.055 118.653 1.00 402.66 ? 94  VAL B N   1 
ATOM 5344  C CA  . VAL B 2 94  ? 126.553 116.246 119.914 1.00 431.59 ? 94  VAL B CA  1 
ATOM 5345  C C   . VAL B 2 94  ? 127.382 117.521 119.853 1.00 426.93 ? 94  VAL B C   1 
ATOM 5346  O O   . VAL B 2 94  ? 127.376 118.328 120.789 1.00 495.80 ? 94  VAL B O   1 
ATOM 5347  C CB  . VAL B 2 94  ? 127.397 114.995 120.281 1.00 500.00 ? 94  VAL B CB  1 
ATOM 5348  C CG1 . VAL B 2 94  ? 128.612 115.326 121.148 1.00 500.00 ? 94  VAL B CG1 1 
ATOM 5349  C CG2 . VAL B 2 94  ? 126.507 113.973 120.982 1.00 500.00 ? 94  VAL B CG2 1 
ATOM 5350  N N   . VAL B 2 95  ? 128.083 117.665 118.734 1.00 390.01 ? 95  VAL B N   1 
ATOM 5351  C CA  . VAL B 2 95  ? 128.957 118.815 118.488 1.00 460.08 ? 95  VAL B CA  1 
ATOM 5352  C C   . VAL B 2 95  ? 128.145 120.102 118.549 1.00 408.32 ? 95  VAL B C   1 
ATOM 5353  O O   . VAL B 2 95  ? 128.566 121.085 119.217 1.00 423.96 ? 95  VAL B O   1 
ATOM 5354  C CB  . VAL B 2 95  ? 129.760 118.708 117.181 1.00 500.00 ? 95  VAL B CB  1 
ATOM 5355  C CG1 . VAL B 2 95  ? 130.424 120.042 116.830 1.00 500.00 ? 95  VAL B CG1 1 
ATOM 5356  C CG2 . VAL B 2 95  ? 130.824 117.629 117.331 1.00 500.00 ? 95  VAL B CG2 1 
ATOM 5357  N N   . VAL B 2 96  ? 126.992 120.064 117.885 1.00 364.94 ? 96  VAL B N   1 
ATOM 5358  C CA  . VAL B 2 96  ? 126.125 121.235 117.791 1.00 383.95 ? 96  VAL B CA  1 
ATOM 5359  C C   . VAL B 2 96  ? 125.651 121.603 119.218 1.00 394.88 ? 96  VAL B C   1 
ATOM 5360  O O   . VAL B 2 96  ? 125.673 122.806 119.595 1.00 421.83 ? 96  VAL B O   1 
ATOM 5361  C CB  . VAL B 2 96  ? 124.965 121.045 116.806 1.00 413.96 ? 96  VAL B CB  1 
ATOM 5362  C CG1 . VAL B 2 96  ? 124.021 122.249 116.861 1.00 411.72 ? 96  VAL B CG1 1 
ATOM 5363  C CG2 . VAL B 2 96  ? 125.518 120.824 115.402 1.00 408.66 ? 96  VAL B CG2 1 
ATOM 5364  N N   . VAL B 2 97  ? 125.284 120.586 119.990 1.00 397.24 ? 97  VAL B N   1 
ATOM 5365  C CA  . VAL B 2 97  ? 124.546 120.781 121.211 1.00 394.64 ? 97  VAL B CA  1 
ATOM 5366  C C   . VAL B 2 97  ? 125.534 121.356 122.215 1.00 415.47 ? 97  VAL B C   1 
ATOM 5367  O O   . VAL B 2 97  ? 125.247 122.340 122.926 1.00 377.11 ? 97  VAL B O   1 
ATOM 5368  C CB  . VAL B 2 97  ? 123.941 119.468 121.758 1.00 445.59 ? 97  VAL B CB  1 
ATOM 5369  C CG1 . VAL B 2 97  ? 123.386 119.667 123.170 1.00 500.00 ? 97  VAL B CG1 1 
ATOM 5370  C CG2 . VAL B 2 97  ? 122.847 118.949 120.834 1.00 468.26 ? 97  VAL B CG2 1 
ATOM 5371  N N   . ALA B 2 98  ? 126.605 120.591 122.418 1.00 484.17 ? 98  ALA B N   1 
ATOM 5372  C CA  . ALA B 2 98  ? 127.588 120.827 123.476 1.00 500.00 ? 98  ALA B CA  1 
ATOM 5373  C C   . ALA B 2 98  ? 128.174 122.216 123.330 1.00 500.00 ? 98  ALA B C   1 
ATOM 5374  O O   . ALA B 2 98  ? 128.275 122.956 124.328 1.00 500.00 ? 98  ALA B O   1 
ATOM 5375  C CB  . ALA B 2 98  ? 128.698 119.784 123.440 1.00 500.00 ? 98  ALA B CB  1 
ATOM 5376  N N   . THR B 2 99  ? 128.547 122.541 122.088 1.00 461.37 ? 99  THR B N   1 
ATOM 5377  C CA  . THR B 2 99  ? 129.154 123.845 121.785 1.00 473.14 ? 99  THR B CA  1 
ATOM 5378  C C   . THR B 2 99  ? 128.188 124.968 122.159 1.00 449.49 ? 99  THR B C   1 
ATOM 5379  O O   . THR B 2 99  ? 128.592 125.961 122.781 1.00 439.14 ? 99  THR B O   1 
ATOM 5380  C CB  . THR B 2 99  ? 129.715 123.984 120.346 1.00 500.00 ? 99  THR B CB  1 
ATOM 5381  O OG1 . THR B 2 99  ? 130.613 125.099 120.303 1.00 500.00 ? 99  THR B OG1 1 
ATOM 5382  C CG2 . THR B 2 99  ? 128.638 124.197 119.315 1.00 500.00 ? 99  THR B CG2 1 
ATOM 5383  N N   . ILE B 2 100 ? 126.931 124.772 121.777 1.00 436.04 ? 100 ILE B N   1 
ATOM 5384  C CA  . ILE B 2 100 ? 125.861 125.729 122.042 1.00 457.76 ? 100 ILE B CA  1 
ATOM 5385  C C   . ILE B 2 100 ? 125.739 125.972 123.552 1.00 496.77 ? 100 ILE B C   1 
ATOM 5386  O O   . ILE B 2 100 ? 125.654 127.126 124.013 1.00 500.00 ? 100 ILE B O   1 
ATOM 5387  C CB  . ILE B 2 100 ? 124.527 125.270 121.410 1.00 450.80 ? 100 ILE B CB  1 
ATOM 5388  C CG1 . ILE B 2 100 ? 124.534 125.654 119.930 1.00 489.85 ? 100 ILE B CG1 1 
ATOM 5389  C CG2 . ILE B 2 100 ? 123.312 125.893 122.092 1.00 466.52 ? 100 ILE B CG2 1 
ATOM 5390  C CD1 . ILE B 2 100 ? 123.484 124.958 119.095 1.00 500.00 ? 100 ILE B CD1 1 
ATOM 5391  N N   . LYS B 2 101 ? 125.741 124.863 124.280 1.00 432.01 ? 101 LYS B N   1 
ATOM 5392  C CA  . LYS B 2 101 ? 125.626 124.880 125.738 1.00 439.96 ? 101 LYS B CA  1 
ATOM 5393  C C   . LYS B 2 101 ? 126.763 125.686 126.349 1.00 406.56 ? 101 LYS B C   1 
ATOM 5394  O O   . LYS B 2 101 ? 126.538 126.532 127.236 1.00 421.22 ? 101 LYS B O   1 
ATOM 5395  C CB  . LYS B 2 101 ? 125.528 123.477 126.330 1.00 480.90 ? 101 LYS B CB  1 
ATOM 5396  C CG  . LYS B 2 101 ? 124.130 122.870 126.226 1.00 500.00 ? 101 LYS B CG  1 
ATOM 5397  C CD  . LYS B 2 101 ? 123.046 123.650 126.978 1.00 500.00 ? 101 LYS B CD  1 
ATOM 5398  C CE  . LYS B 2 101 ? 123.447 124.032 128.400 1.00 500.00 ? 101 LYS B CE  1 
ATOM 5399  N NZ  . LYS B 2 101 ? 122.291 124.460 129.236 1.00 500.00 ? 101 LYS B NZ  1 
ATOM 5400  N N   . SER B 2 102 ? 127.960 125.418 125.844 1.00 441.27 ? 102 SER B N   1 
ATOM 5401  C CA  . SER B 2 102 ? 129.189 126.035 126.367 1.00 498.97 ? 102 SER B CA  1 
ATOM 5402  C C   . SER B 2 102 ? 129.294 127.533 126.082 1.00 500.00 ? 102 SER B C   1 
ATOM 5403  O O   . SER B 2 102 ? 129.379 128.376 127.005 1.00 500.00 ? 102 SER B O   1 
ATOM 5404  C CB  . SER B 2 102 ? 130.430 125.320 125.807 1.00 500.00 ? 102 SER B CB  1 
ATOM 5405  O OG  . SER B 2 102 ? 130.565 125.505 124.406 1.00 440.09 ? 102 SER B OG  1 
ATOM 5406  N N   . VAL B 2 103 ? 129.293 127.853 124.795 1.00 500.00 ? 103 VAL B N   1 
ATOM 5407  C CA  . VAL B 2 103 ? 129.540 129.212 124.335 1.00 500.00 ? 103 VAL B CA  1 
ATOM 5408  C C   . VAL B 2 103 ? 128.262 130.029 124.585 1.00 467.05 ? 103 VAL B C   1 
ATOM 5409  O O   . VAL B 2 103 ? 127.173 129.471 124.774 1.00 368.72 ? 103 VAL B O   1 
ATOM 5410  C CB  . VAL B 2 103 ? 130.020 129.202 122.845 1.00 500.00 ? 103 VAL B CB  1 
ATOM 5411  C CG1 . VAL B 2 103 ? 130.342 130.603 122.310 1.00 500.00 ? 103 VAL B CG1 1 
ATOM 5412  C CG2 . VAL B 2 103 ? 131.225 128.267 122.673 1.00 470.32 ? 103 VAL B CG2 1 
ATOM 5413  N N   . SER B 2 104 ? 128.417 131.347 124.688 1.00 474.45 ? 104 SER B N   1 
ATOM 5414  C CA  . SER B 2 104 ? 127.305 132.263 124.468 1.00 500.00 ? 104 SER B CA  1 
ATOM 5415  C C   . SER B 2 104 ? 127.254 132.458 122.953 1.00 432.06 ? 104 SER B C   1 
ATOM 5416  O O   . SER B 2 104 ? 127.352 131.484 122.214 1.00 328.38 ? 104 SER B O   1 
ATOM 5417  C CB  . SER B 2 104 ? 127.508 133.581 125.230 1.00 500.00 ? 104 SER B CB  1 
ATOM 5418  O OG  . SER B 2 104 ? 126.420 134.475 125.015 1.00 500.00 ? 104 SER B OG  1 
ATOM 5419  N N   . PHE B 2 105 ? 127.112 133.700 122.509 1.00 465.67 ? 105 PHE B N   1 
ATOM 5420  C CA  . PHE B 2 105 ? 127.066 133.981 121.086 1.00 481.43 ? 105 PHE B CA  1 
ATOM 5421  C C   . PHE B 2 105 ? 125.881 133.271 120.442 1.00 486.48 ? 105 PHE B C   1 
ATOM 5422  O O   . PHE B 2 105 ? 124.842 133.877 120.182 1.00 488.63 ? 105 PHE B O   1 
ATOM 5423  C CB  . PHE B 2 105 ? 128.366 133.533 120.426 1.00 447.23 ? 105 PHE B CB  1 
ATOM 5424  C CG  . PHE B 2 105 ? 128.398 133.750 118.945 1.00 470.56 ? 105 PHE B CG  1 
ATOM 5425  C CD1 . PHE B 2 105 ? 128.690 134.998 118.423 1.00 489.20 ? 105 PHE B CD1 1 
ATOM 5426  C CD2 . PHE B 2 105 ? 128.139 132.708 118.074 1.00 471.13 ? 105 PHE B CD2 1 
ATOM 5427  C CE1 . PHE B 2 105 ? 128.718 135.205 117.059 1.00 467.65 ? 105 PHE B CE1 1 
ATOM 5428  C CE2 . PHE B 2 105 ? 128.166 132.907 116.709 1.00 482.48 ? 105 PHE B CE2 1 
ATOM 5429  C CZ  . PHE B 2 105 ? 128.456 134.157 116.199 1.00 449.28 ? 105 PHE B CZ  1 
ATOM 5430  N N   . TYR B 2 106 ? 126.048 131.977 120.193 1.00 475.92 ? 106 TYR B N   1 
ATOM 5431  C CA  . TYR B 2 106 ? 125.077 131.198 119.422 1.00 495.37 ? 106 TYR B CA  1 
ATOM 5432  C C   . TYR B 2 106 ? 123.642 131.346 119.913 1.00 483.00 ? 106 TYR B C   1 
ATOM 5433  O O   . TYR B 2 106 ? 122.699 131.371 119.112 1.00 442.16 ? 106 TYR B O   1 
ATOM 5434  C CB  . TYR B 2 106 ? 125.499 129.729 119.424 1.00 500.00 ? 106 TYR B CB  1 
ATOM 5435  C CG  . TYR B 2 106 ? 126.843 129.564 118.768 1.00 500.00 ? 106 TYR B CG  1 
ATOM 5436  C CD1 . TYR B 2 106 ? 126.988 129.825 117.409 1.00 500.00 ? 106 TYR B CD1 1 
ATOM 5437  C CD2 . TYR B 2 106 ? 127.978 129.206 119.502 1.00 449.76 ? 106 TYR B CD2 1 
ATOM 5438  C CE1 . TYR B 2 106 ? 128.213 129.710 116.786 1.00 500.00 ? 106 TYR B CE1 1 
ATOM 5439  C CE2 . TYR B 2 106 ? 129.212 129.082 118.885 1.00 483.90 ? 106 TYR B CE2 1 
ATOM 5440  C CZ  . TYR B 2 106 ? 129.319 129.337 117.522 1.00 500.00 ? 106 TYR B CZ  1 
ATOM 5441  O OH  . TYR B 2 106 ? 130.514 129.239 116.859 1.00 500.00 ? 106 TYR B OH  1 
ATOM 5442  N N   . THR B 2 107 ? 123.507 131.525 121.220 1.00 487.74 ? 107 THR B N   1 
ATOM 5443  C CA  . THR B 2 107 ? 122.223 131.789 121.840 1.00 500.00 ? 107 THR B CA  1 
ATOM 5444  C C   . THR B 2 107 ? 121.652 133.082 121.288 1.00 500.00 ? 107 THR B C   1 
ATOM 5445  O O   . THR B 2 107 ? 120.448 133.187 121.056 1.00 500.00 ? 107 THR B O   1 
ATOM 5446  C CB  . THR B 2 107 ? 122.362 131.922 123.366 1.00 500.00 ? 107 THR B CB  1 
ATOM 5447  O OG1 . THR B 2 107 ? 121.144 132.440 123.913 1.00 500.00 ? 107 THR B OG1 1 
ATOM 5448  C CG2 . THR B 2 107 ? 123.503 132.866 123.708 1.00 500.00 ? 107 THR B CG2 1 
ATOM 5449  N N   . ARG B 2 108 ? 122.515 134.071 121.081 1.00 500.00 ? 108 ARG B N   1 
ATOM 5450  C CA  . ARG B 2 108 ? 122.050 135.436 120.894 1.00 500.00 ? 108 ARG B CA  1 
ATOM 5451  C C   . ARG B 2 108 ? 122.003 135.823 119.419 1.00 487.68 ? 108 ARG B C   1 
ATOM 5452  O O   . ARG B 2 108 ? 122.981 135.653 118.690 1.00 376.94 ? 108 ARG B O   1 
ATOM 5453  C CB  . ARG B 2 108 ? 122.918 136.426 121.675 1.00 500.00 ? 108 ARG B CB  1 
ATOM 5454  C CG  . ARG B 2 108 ? 122.364 137.840 121.651 1.00 500.00 ? 108 ARG B CG  1 
ATOM 5455  C CD  . ARG B 2 108 ? 120.874 137.817 121.941 1.00 500.00 ? 108 ARG B CD  1 
ATOM 5456  N NE  . ARG B 2 108 ? 120.141 138.786 121.135 1.00 500.00 ? 108 ARG B NE  1 
ATOM 5457  C CZ  . ARG B 2 108 ? 118.886 138.616 120.730 1.00 500.00 ? 108 ARG B CZ  1 
ATOM 5458  N NH1 . ARG B 2 108 ? 118.229 137.509 121.053 1.00 500.00 ? 108 ARG B NH1 1 
ATOM 5459  N NH2 . ARG B 2 108 ? 118.291 139.546 119.997 1.00 500.00 ? 108 ARG B NH2 1 
ATOM 5460  N N   . LYS B 2 109 ? 120.847 136.329 118.995 1.00 500.00 ? 109 LYS B N   1 
ATOM 5461  C CA  . LYS B 2 109 ? 120.719 137.663 118.400 1.00 500.00 ? 109 LYS B CA  1 
ATOM 5462  C C   . LYS B 2 109 ? 120.780 137.645 116.874 1.00 500.00 ? 109 LYS B C   1 
ATOM 5463  O O   . LYS B 2 109 ? 121.235 136.676 116.266 1.00 500.00 ? 109 LYS B O   1 
ATOM 5464  C CB  . LYS B 2 109 ? 121.776 138.626 118.957 1.00 500.00 ? 109 LYS B CB  1 
ATOM 5465  C CG  . LYS B 2 109 ? 123.187 138.339 118.476 1.00 500.00 ? 109 LYS B CG  1 
ATOM 5466  C CD  . LYS B 2 109 ? 124.221 139.081 119.304 1.00 500.00 ? 109 LYS B CD  1 
ATOM 5467  C CE  . LYS B 2 109 ? 125.629 138.631 118.950 1.00 500.00 ? 109 LYS B CE  1 
ATOM 5468  N NZ  . LYS B 2 109 ? 126.652 139.255 119.834 1.00 500.00 ? 109 LYS B NZ  1 
ATOM 5469  N N   . ASP B 2 110 ? 120.313 138.732 116.266 1.00 500.00 ? 110 ASP B N   1 
ATOM 5470  C CA  . ASP B 2 110 ? 121.160 139.562 115.422 1.00 500.00 ? 110 ASP B CA  1 
ATOM 5471  C C   . ASP B 2 110 ? 121.775 138.784 114.263 1.00 500.00 ? 110 ASP B C   1 
ATOM 5472  O O   . ASP B 2 110 ? 122.944 138.979 113.935 1.00 500.00 ? 110 ASP B O   1 
ATOM 5473  C CB  . ASP B 2 110 ? 122.269 140.211 116.252 1.00 500.00 ? 110 ASP B CB  1 
ATOM 5474  C CG  . ASP B 2 110 ? 121.729 141.025 117.410 1.00 500.00 ? 110 ASP B CG  1 
ATOM 5475  O OD1 . ASP B 2 110 ? 120.496 141.051 117.595 1.00 500.00 ? 110 ASP B OD1 1 
ATOM 5476  O OD2 . ASP B 2 110 ? 122.541 141.633 118.139 1.00 500.00 ? 110 ASP B OD2 1 
ATOM 5477  N N   . GLY B 2 111 ? 120.993 137.905 113.643 1.00 500.00 ? 111 GLY B N   1 
ATOM 5478  C CA  . GLY B 2 111 ? 121.161 137.653 112.224 1.00 500.00 ? 111 GLY B CA  1 
ATOM 5479  C C   . GLY B 2 111 ? 120.172 138.427 111.371 1.00 500.00 ? 111 GLY B C   1 
ATOM 5480  O O   . GLY B 2 111 ? 118.973 138.153 111.374 1.00 500.00 ? 111 GLY B O   1 
ATOM 5481  N N   . GLN B 2 112 ? 120.697 139.402 110.639 1.00 500.00 ? 112 GLN B N   1 
ATOM 5482  C CA  . GLN B 2 112 ? 121.342 140.527 111.306 1.00 500.00 ? 112 GLN B CA  1 
ATOM 5483  C C   . GLN B 2 112 ? 120.308 141.424 111.973 1.00 500.00 ? 112 GLN B C   1 
ATOM 5484  O O   . GLN B 2 112 ? 120.518 141.908 113.085 1.00 500.00 ? 112 GLN B O   1 
ATOM 5485  C CB  . GLN B 2 112 ? 122.173 141.342 110.312 1.00 30.00  ? 112 GLN B CB  1 
ATOM 5486  C CG  . GLN B 2 112 ? 123.356 140.595 109.720 1.00 30.00  ? 112 GLN B CG  1 
ATOM 5487  C CD  . GLN B 2 112 ? 124.402 140.239 110.756 1.00 30.00  ? 112 GLN B CD  1 
ATOM 5488  O OE1 . GLN B 2 112 ? 124.458 139.108 111.235 1.00 30.00  ? 112 GLN B OE1 1 
ATOM 5489  N NE2 . GLN B 2 112 ? 125.237 141.209 111.111 1.00 30.00  ? 112 GLN B NE2 1 
ATOM 5490  N N   . LEU B 2 113 ? 119.190 141.641 111.288 1.00 500.00 ? 113 LEU B N   1 
ATOM 5491  C CA  . LEU B 2 113 ? 119.190 141.775 109.836 1.00 500.00 ? 113 LEU B CA  1 
ATOM 5492  C C   . LEU B 2 113 ? 119.932 143.027 109.385 1.00 500.00 ? 113 LEU B C   1 
ATOM 5493  O O   . LEU B 2 113 ? 119.888 144.059 110.052 1.00 500.00 ? 113 LEU B O   1 
ATOM 5494  C CB  . LEU B 2 113 ? 117.761 141.789 109.294 1.00 500.00 ? 113 LEU B CB  1 
ATOM 5495  C CG  . LEU B 2 113 ? 116.803 142.834 109.869 1.00 500.00 ? 113 LEU B CG  1 
ATOM 5496  C CD1 . LEU B 2 113 ? 115.442 142.728 109.198 1.00 500.00 ? 113 LEU B CD1 1 
ATOM 5497  C CD2 . LEU B 2 113 ? 116.668 142.677 111.374 1.00 500.00 ? 113 LEU B CD2 1 
ATOM 5498  N N   . ILE B 2 114 ? 120.617 142.924 108.251 1.00 500.00 ? 114 ILE B N   1 
ATOM 5499  C CA  . ILE B 2 114 ? 120.059 142.263 107.079 1.00 500.00 ? 114 ILE B CA  1 
ATOM 5500  C C   . ILE B 2 114 ? 120.057 140.751 107.262 1.00 500.00 ? 114 ILE B C   1 
ATOM 5501  O O   . ILE B 2 114 ? 120.677 140.230 108.188 1.00 378.97 ? 114 ILE B O   1 
ATOM 5502  C CB  . ILE B 2 114 ? 120.840 142.648 105.832 1.00 500.00 ? 114 ILE B CB  1 
ATOM 5503  N N   . TYR B 2 115 ? 119.360 140.048 106.377 1.00 500.00 ? 115 TYR B N   1 
ATOM 5504  C CA  . TYR B 2 115 ? 118.829 140.633 105.153 1.00 500.00 ? 115 TYR B CA  1 
ATOM 5505  C C   . TYR B 2 115 ? 117.404 141.110 105.371 1.00 500.00 ? 115 TYR B C   1 
ATOM 5506  O O   . TYR B 2 115 ? 117.008 142.180 104.908 1.00 500.00 ? 115 TYR B O   1 
ATOM 5507  C CB  . TYR B 2 115 ? 118.871 139.601 104.028 1.00 500.00 ? 115 TYR B CB  1 
ATOM 5508  C CG  . TYR B 2 115 ? 120.042 138.655 104.132 1.00 500.00 ? 115 TYR B CG  1 
ATOM 5509  C CD1 . TYR B 2 115 ? 121.288 139.001 103.625 1.00 500.00 ? 115 TYR B CD1 1 
ATOM 5510  C CD2 . TYR B 2 115 ? 119.907 137.417 104.745 1.00 500.00 ? 115 TYR B CD2 1 
ATOM 5511  C CE1 . TYR B 2 115 ? 122.363 138.137 103.722 1.00 500.00 ? 115 TYR B CE1 1 
ATOM 5512  C CE2 . TYR B 2 115 ? 120.976 136.547 104.846 1.00 500.00 ? 115 TYR B CE2 1 
ATOM 5513  C CZ  . TYR B 2 115 ? 122.202 136.912 104.333 1.00 500.00 ? 115 TYR B CZ  1 
ATOM 5514  O OH  . TYR B 2 115 ? 123.269 136.048 104.431 1.00 333.07 ? 115 TYR B OH  1 
ATOM 5515  N N   . THR B 2 116 ? 116.612 140.300 106.059 1.00 500.00 ? 116 THR B N   1 
ATOM 5516  C CA  . THR B 2 116 ? 115.624 140.840 106.980 1.00 500.00 ? 116 THR B CA  1 
ATOM 5517  C C   . THR B 2 116 ? 115.257 139.835 108.061 1.00 500.00 ? 116 THR B C   1 
ATOM 5518  O O   . THR B 2 116 ? 115.876 139.861 109.131 1.00 493.11 ? 116 THR B O   1 
ATOM 5519  C CB  . THR B 2 116 ? 114.377 141.361 106.255 1.00 500.00 ? 116 THR B CB  1 
ATOM 5520  O OG1 . THR B 2 116 ? 114.771 142.238 105.193 1.00 500.00 ? 116 THR B OG1 1 
ATOM 5521  C CG2 . THR B 2 116 ? 113.475 142.114 107.220 1.00 500.00 ? 116 THR B CG2 1 
ATOM 5522  N N   . PRO B 2 117 ? 114.265 138.902 107.807 1.00 500.00 ? 117 PRO B N   1 
ATOM 5523  C CA  . PRO B 2 117 ? 113.506 138.588 109.006 1.00 500.00 ? 117 PRO B CA  1 
ATOM 5524  C C   . PRO B 2 117 ? 113.362 139.648 110.105 1.00 484.63 ? 117 PRO B C   1 
ATOM 5525  O O   . PRO B 2 117 ? 113.718 139.395 111.254 1.00 372.89 ? 117 PRO B O   1 
ATOM 5526  C CB  . PRO B 2 117 ? 114.062 137.219 109.373 1.00 500.00 ? 117 PRO B CB  1 
ATOM 5527  C CG  . PRO B 2 117 ? 114.108 136.562 107.982 1.00 500.00 ? 117 PRO B CG  1 
ATOM 5528  C CD  . PRO B 2 117 ? 113.980 137.675 106.929 1.00 500.00 ? 117 PRO B CD  1 
ATOM 5529  N N   . PHE B 2 118 ? 112.846 140.818 109.745 1.00 500.00 ? 118 PHE B N   1 
ATOM 5530  C CA  . PHE B 2 118 ? 111.405 141.054 109.754 1.00 500.00 ? 118 PHE B CA  1 
ATOM 5531  C C   . PHE B 2 118 ? 110.816 140.941 111.157 1.00 500.00 ? 118 PHE B C   1 
ATOM 5532  O O   . PHE B 2 118 ? 109.751 141.487 111.439 1.00 500.00 ? 118 PHE B O   1 
ATOM 5533  C CB  . PHE B 2 118 ? 110.695 140.079 108.814 1.00 500.00 ? 118 PHE B CB  1 
ATOM 5534  C CG  . PHE B 2 118 ? 110.847 140.423 107.362 1.00 500.00 ? 118 PHE B CG  1 
ATOM 5535  C CD1 . PHE B 2 118 ? 109.983 141.320 106.757 1.00 500.00 ? 118 PHE B CD1 1 
ATOM 5536  C CD2 . PHE B 2 118 ? 111.851 139.851 106.602 1.00 500.00 ? 118 PHE B CD2 1 
ATOM 5537  C CE1 . PHE B 2 118 ? 110.117 141.642 105.419 1.00 500.00 ? 118 PHE B CE1 1 
ATOM 5538  C CE2 . PHE B 2 118 ? 111.991 140.166 105.264 1.00 500.00 ? 118 PHE B CE2 1 
ATOM 5539  C CZ  . PHE B 2 118 ? 111.122 141.064 104.672 1.00 500.00 ? 118 PHE B CZ  1 
ATOM 5540  N N   . THR B 2 119 ? 111.517 140.228 112.032 1.00 500.00 ? 119 THR B N   1 
ATOM 5541  C CA  . THR B 2 119 ? 111.611 140.600 113.456 1.00 500.00 ? 119 THR B CA  1 
ATOM 5542  C C   . THR B 2 119 ? 110.527 140.014 114.393 1.00 500.00 ? 119 THR B C   1 
ATOM 5543  O O   . THR B 2 119 ? 109.541 139.445 113.928 1.00 500.00 ? 119 THR B O   1 
ATOM 5544  C CB  . THR B 2 119 ? 111.617 142.132 113.623 1.00 500.00 ? 119 THR B CB  1 
ATOM 5545  O OG1 . THR B 2 119 ? 110.332 142.654 113.260 1.00 500.00 ? 119 THR B OG1 1 
ATOM 5546  C CG2 . THR B 2 119 ? 112.680 142.756 112.734 1.00 500.00 ? 119 THR B CG2 1 
ATOM 5547  N N   . GLU B 2 120 ? 110.728 140.162 115.709 1.00 500.00 ? 120 GLU B N   1 
ATOM 5548  C CA  . GLU B 2 120 ? 109.675 139.983 116.730 1.00 499.13 ? 120 GLU B CA  1 
ATOM 5549  C C   . GLU B 2 120 ? 108.821 141.252 116.857 1.00 500.00 ? 120 GLU B C   1 
ATOM 5550  O O   . GLU B 2 120 ? 109.036 142.058 117.774 1.00 500.00 ? 120 GLU B O   1 
ATOM 5551  C CB  . GLU B 2 120 ? 110.312 139.685 118.088 1.00 390.29 ? 120 GLU B CB  1 
ATOM 5552  N N   . ASP B 2 121 ? 107.844 141.408 115.949 1.00 500.00 ? 121 ASP B N   1 
ATOM 5553  C CA  . ASP B 2 121 ? 107.160 142.708 115.699 1.00 500.00 ? 121 ASP B CA  1 
ATOM 5554  C C   . ASP B 2 121 ? 105.831 142.914 116.459 1.00 500.00 ? 121 ASP B C   1 
ATOM 5555  O O   . ASP B 2 121 ? 104.903 142.104 116.325 1.00 500.00 ? 121 ASP B O   1 
ATOM 5556  C CB  . ASP B 2 121 ? 106.919 142.903 114.195 1.00 500.00 ? 121 ASP B CB  1 
ATOM 5557  N N   . THR B 2 122 ? 105.769 144.041 117.194 1.00 500.00 ? 122 THR B N   1 
ATOM 5558  C CA  . THR B 2 122 ? 104.765 144.438 118.248 1.00 500.00 ? 122 THR B CA  1 
ATOM 5559  C C   . THR B 2 122 ? 105.239 144.271 119.770 1.00 500.00 ? 122 THR B C   1 
ATOM 5560  O O   . THR B 2 122 ? 105.557 145.294 120.399 1.00 500.00 ? 122 THR B O   1 
ATOM 5561  C CB  . THR B 2 122 ? 103.245 144.063 117.984 1.00 500.00 ? 122 THR B CB  1 
ATOM 5562  O OG1 . THR B 2 122 ? 103.083 143.125 116.907 1.00 425.06 ? 122 THR B OG1 1 
ATOM 5563  C CG2 . THR B 2 122 ? 102.429 145.315 117.635 1.00 500.00 ? 122 THR B CG2 1 
ATOM 5564  N N   . GLU B 2 123 ? 105.333 143.065 120.380 1.00 500.00 ? 123 GLU B N   1 
ATOM 5565  C CA  . GLU B 2 123 ? 105.127 141.720 119.768 1.00 500.00 ? 123 GLU B CA  1 
ATOM 5566  C C   . GLU B 2 123 ? 103.904 140.971 120.332 1.00 500.00 ? 123 GLU B C   1 
ATOM 5567  O O   . GLU B 2 123 ? 103.942 140.446 121.457 1.00 500.00 ? 123 GLU B O   1 
ATOM 5568  C CB  . GLU B 2 123 ? 106.383 140.849 119.931 1.00 500.00 ? 123 GLU B CB  1 
ATOM 5569  N N   . THR B 2 124 ? 102.836 140.927 119.531 1.00 500.00 ? 124 THR B N   1 
ATOM 5570  C CA  . THR B 2 124 ? 101.642 140.156 119.859 1.00 500.00 ? 124 THR B CA  1 
ATOM 5571  C C   . THR B 2 124 ? 101.773 138.788 119.176 1.00 500.00 ? 124 THR B C   1 
ATOM 5572  O O   . THR B 2 124 ? 102.750 138.518 118.456 1.00 500.00 ? 124 THR B O   1 
ATOM 5573  C CB  . THR B 2 124 ? 100.318 140.917 119.510 1.00 500.00 ? 124 THR B CB  1 
ATOM 5574  O OG1 . THR B 2 124 ? 99.177  140.103 119.828 1.00 500.00 ? 124 THR B OG1 1 
ATOM 5575  C CG2 . THR B 2 124 ? 100.252 141.356 118.033 1.00 500.00 ? 124 THR B CG2 1 
ATOM 5576  N N   . VAL B 2 125 ? 100.788 137.931 119.430 1.00 500.00 ? 125 VAL B N   1 
ATOM 5577  C CA  . VAL B 2 125 ? 100.825 136.530 119.012 1.00 500.00 ? 125 VAL B CA  1 
ATOM 5578  C C   . VAL B 2 125 ? 100.604 136.362 117.474 1.00 500.00 ? 125 VAL B C   1 
ATOM 5579  O O   . VAL B 2 125 ? 101.229 135.485 116.865 1.00 500.00 ? 125 VAL B O   1 
ATOM 5580  C CB  . VAL B 2 125 ? 99.827  135.676 119.873 1.00 500.00 ? 125 VAL B CB  1 
ATOM 5581  C CG1 . VAL B 2 125 ? 99.856  134.201 119.461 1.00 500.00 ? 125 VAL B CG1 1 
ATOM 5582  C CG2 . VAL B 2 125 ? 100.120 135.839 121.377 1.00 425.12 ? 125 VAL B CG2 1 
ATOM 5583  N N   . GLY B 2 126 ? 99.765  137.210 116.857 1.00 500.00 ? 126 GLY B N   1 
ATOM 5584  C CA  . GLY B 2 126 ? 99.307  137.015 115.484 1.00 500.00 ? 126 GLY B CA  1 
ATOM 5585  C C   . GLY B 2 126 ? 100.216 137.701 114.495 1.00 500.00 ? 126 GLY B C   1 
ATOM 5586  O O   . GLY B 2 126 ? 100.533 137.141 113.451 1.00 500.00 ? 126 GLY B O   1 
ATOM 5587  N N   . GLN B 2 127 ? 100.656 138.914 114.850 1.00 500.00 ? 127 GLN B N   1 
ATOM 5588  C CA  . GLN B 2 127 ? 101.284 139.847 113.891 1.00 500.00 ? 127 GLN B CA  1 
ATOM 5589  C C   . GLN B 2 127 ? 102.790 139.687 113.828 1.00 500.00 ? 127 GLN B C   1 
ATOM 5590  O O   . GLN B 2 127 ? 103.336 139.594 112.715 1.00 500.00 ? 127 GLN B O   1 
ATOM 5591  C CB  . GLN B 2 127 ? 100.832 141.330 114.120 1.00 500.00 ? 127 GLN B CB  1 
ATOM 5592  C CG  . GLN B 2 127 ? 99.760  141.882 113.135 1.00 500.00 ? 127 GLN B CG  1 
ATOM 5593  C CD  . GLN B 2 127 ? 98.310  141.410 113.390 1.00 500.00 ? 127 GLN B CD  1 
ATOM 5594  O OE1 . GLN B 2 127 ? 97.842  141.357 114.536 1.00 500.00 ? 127 GLN B OE1 1 
ATOM 5595  N NE2 . GLN B 2 127 ? 97.589  141.092 112.307 1.00 500.00 ? 127 GLN B NE2 1 
ATOM 5596  N N   . ARG B 2 128 ? 103.412 139.474 114.991 1.00 500.00 ? 128 ARG B N   1 
ATOM 5597  C CA  . ARG B 2 128 ? 104.820 139.059 115.072 1.00 500.00 ? 128 ARG B CA  1 
ATOM 5598  C C   . ARG B 2 128 ? 105.023 137.754 114.302 1.00 500.00 ? 128 ARG B C   1 
ATOM 5599  O O   . ARG B 2 128 ? 105.977 137.622 113.521 1.00 446.13 ? 128 ARG B O   1 
ATOM 5600  C CB  . ARG B 2 128 ? 105.279 138.911 116.539 1.00 421.96 ? 128 ARG B CB  1 
ATOM 5601  N N   . ALA B 2 129 ? 104.104 136.822 114.543 1.00 500.00 ? 129 ALA B N   1 
ATOM 5602  C CA  . ALA B 2 129 ? 104.122 135.507 113.899 1.00 500.00 ? 129 ALA B CA  1 
ATOM 5603  C C   . ALA B 2 129 ? 104.077 135.661 112.384 1.00 500.00 ? 129 ALA B C   1 
ATOM 5604  O O   . ALA B 2 129 ? 104.844 135.020 111.655 1.00 413.94 ? 129 ALA B O   1 
ATOM 5605  C CB  . ALA B 2 129 ? 102.947 134.659 114.371 1.00 500.00 ? 129 ALA B CB  1 
ATOM 5606  N N   . LEU B 2 130 ? 103.166 136.513 111.950 1.00 500.00 ? 130 LEU B N   1 
ATOM 5607  C CA  . LEU B 2 130 ? 102.952 136.813 110.527 1.00 500.00 ? 130 LEU B CA  1 
ATOM 5608  C C   . LEU B 2 130 ? 104.252 137.331 109.906 1.00 500.00 ? 130 LEU B C   1 
ATOM 5609  O O   . LEU B 2 130 ? 104.663 136.885 108.822 1.00 500.00 ? 130 LEU B O   1 
ATOM 5610  C CB  . LEU B 2 130 ? 101.771 137.811 110.359 1.00 500.00 ? 130 LEU B CB  1 
ATOM 5611  C CG  . LEU B 2 130 ? 101.222 138.366 109.016 1.00 500.00 ? 130 LEU B CG  1 
ATOM 5612  C CD1 . LEU B 2 130 ? 101.977 139.619 108.554 1.00 500.00 ? 130 LEU B CD1 1 
ATOM 5613  C CD2 . LEU B 2 130 ? 101.150 137.311 107.908 1.00 500.00 ? 130 LEU B CD2 1 
ATOM 5614  N N   . HIS B 2 131 ? 104.861 138.266 110.622 1.00 500.00 ? 131 HIS B N   1 
ATOM 5615  C CA  . HIS B 2 131 ? 106.116 138.894 110.200 1.00 500.00 ? 131 HIS B CA  1 
ATOM 5616  C C   . HIS B 2 131 ? 107.199 137.832 110.011 1.00 500.00 ? 131 HIS B C   1 
ATOM 5617  O O   . HIS B 2 131 ? 107.919 137.821 108.997 1.00 473.45 ? 131 HIS B O   1 
ATOM 5618  C CB  . HIS B 2 131 ? 106.568 140.007 111.165 1.00 500.00 ? 131 HIS B CB  1 
ATOM 5619  C CG  . HIS B 2 131 ? 106.003 141.360 110.842 1.00 500.00 ? 131 HIS B CG  1 
ATOM 5620  N ND1 . HIS B 2 131 ? 106.545 142.184 109.876 1.00 500.00 ? 131 HIS B ND1 1 
ATOM 5621  C CD2 . HIS B 2 131 ? 104.948 142.040 111.361 1.00 500.00 ? 131 HIS B CD2 1 
ATOM 5622  C CE1 . HIS B 2 131 ? 105.850 143.307 109.810 1.00 500.00 ? 131 HIS B CE1 1 
ATOM 5623  N NE2 . HIS B 2 131 ? 104.877 143.245 110.703 1.00 500.00 ? 131 HIS B NE2 1 
ATOM 5624  N N   . SER B 2 132 ? 107.276 136.954 111.005 1.00 500.00 ? 132 SER B N   1 
ATOM 5625  C CA  . SER B 2 132 ? 108.245 135.854 111.017 1.00 500.00 ? 132 SER B CA  1 
ATOM 5626  C C   . SER B 2 132 ? 108.062 134.974 109.787 1.00 500.00 ? 132 SER B C   1 
ATOM 5627  O O   . SER B 2 132 ? 109.030 134.614 109.107 1.00 462.80 ? 132 SER B O   1 
ATOM 5628  C CB  . SER B 2 132 ? 108.171 134.994 112.297 1.00 500.00 ? 132 SER B CB  1 
ATOM 5629  O OG  . SER B 2 132 ? 107.280 133.895 112.156 1.00 437.93 ? 132 SER B OG  1 
ATOM 5630  N N   . ILE B 2 133 ? 106.802 134.651 109.534 1.00 500.00 ? 133 ILE B N   1 
ATOM 5631  C CA  . ILE B 2 133 ? 106.396 133.811 108.399 1.00 500.00 ? 133 ILE B CA  1 
ATOM 5632  C C   . ILE B 2 133 ? 106.874 134.444 107.091 1.00 500.00 ? 133 ILE B C   1 
ATOM 5633  O O   . ILE B 2 133 ? 107.449 133.766 106.227 1.00 498.39 ? 133 ILE B O   1 
ATOM 5634  C CB  . ILE B 2 133 ? 104.822 133.587 108.442 1.00 500.00 ? 133 ILE B CB  1 
ATOM 5635  C CG1 . ILE B 2 133 ? 104.459 132.123 108.753 1.00 500.00 ? 133 ILE B CG1 1 
ATOM 5636  C CG2 . ILE B 2 133 ? 104.074 134.064 107.187 1.00 500.00 ? 133 ILE B CG2 1 
ATOM 5637  C CD1 . ILE B 2 133 ? 104.727 131.139 107.626 1.00 500.00 ? 133 ILE B CD1 1 
ATOM 5638  N N   . LEU B 2 134 ? 106.613 135.744 106.990 1.00 500.00 ? 134 LEU B N   1 
ATOM 5639  C CA  . LEU B 2 134 ? 106.977 136.534 105.812 1.00 500.00 ? 134 LEU B CA  1 
ATOM 5640  C C   . LEU B 2 134 ? 108.490 136.459 105.580 1.00 500.00 ? 134 LEU B C   1 
ATOM 5641  O O   . LEU B 2 134 ? 108.951 136.238 104.448 1.00 445.90 ? 134 LEU B O   1 
ATOM 5642  C CB  . LEU B 2 134 ? 106.484 138.006 105.884 1.00 500.00 ? 134 LEU B CB  1 
ATOM 5643  C CG  . LEU B 2 134 ? 106.424 138.826 104.559 1.00 500.00 ? 134 LEU B CG  1 
ATOM 5644  C CD1 . LEU B 2 134 ? 105.210 138.462 103.704 1.00 500.00 ? 134 LEU B CD1 1 
ATOM 5645  C CD2 . LEU B 2 134 ? 106.440 140.339 104.795 1.00 500.00 ? 134 LEU B CD2 1 
ATOM 5646  N N   . ASN B 2 135 ? 109.253 136.624 106.652 1.00 500.00 ? 135 ASN B N   1 
ATOM 5647  C CA  . ASN B 2 135 ? 110.702 136.633 106.545 1.00 500.00 ? 135 ASN B CA  1 
ATOM 5648  C C   . ASN B 2 135 ? 111.251 135.251 106.200 1.00 500.00 ? 135 ASN B C   1 
ATOM 5649  O O   . ASN B 2 135 ? 112.271 135.126 105.520 1.00 354.49 ? 135 ASN B O   1 
ATOM 5650  C CB  . ASN B 2 135 ? 111.323 137.174 107.835 1.00 500.00 ? 135 ASN B CB  1 
ATOM 5651  C CG  . ASN B 2 135 ? 111.203 136.212 108.997 1.00 500.00 ? 135 ASN B CG  1 
ATOM 5652  O OD1 . ASN B 2 135 ? 111.538 135.032 108.880 1.00 500.00 ? 135 ASN B OD1 1 
ATOM 5653  N ND2 . ASN B 2 135 ? 110.725 136.710 110.130 1.00 500.00 ? 135 ASN B ND2 1 
ATOM 5654  N N   . ALA B 2 136 ? 110.560 134.215 106.663 1.00 500.00 ? 136 ALA B N   1 
ATOM 5655  C CA  . ALA B 2 136 ? 110.886 132.837 106.298 1.00 494.18 ? 136 ALA B CA  1 
ATOM 5656  C C   . ALA B 2 136 ? 110.692 132.631 104.810 1.00 500.00 ? 136 ALA B C   1 
ATOM 5657  O O   . ALA B 2 136 ? 111.553 132.046 104.132 1.00 489.69 ? 136 ALA B O   1 
ATOM 5658  C CB  . ALA B 2 136 ? 110.035 131.849 107.087 1.00 467.58 ? 136 ALA B CB  1 
ATOM 5659  N N   . ALA B 2 137 ? 109.557 133.128 104.318 1.00 500.00 ? 137 ALA B N   1 
ATOM 5660  C CA  . ALA B 2 137 ? 109.156 132.974 102.921 1.00 500.00 ? 137 ALA B CA  1 
ATOM 5661  C C   . ALA B 2 137 ? 110.231 133.353 101.937 1.00 500.00 ? 137 ALA B C   1 
ATOM 5662  O O   . ALA B 2 137 ? 110.541 132.564 101.016 1.00 500.00 ? 137 ALA B O   1 
ATOM 5663  C CB  . ALA B 2 137 ? 107.873 133.755 102.635 1.00 500.00 ? 137 ALA B CB  1 
ATOM 5664  N N   . ILE B 2 138 ? 110.848 134.514 102.179 1.00 500.00 ? 138 ILE B N   1 
ATOM 5665  C CA  . ILE B 2 138 ? 111.971 134.989 101.348 1.00 500.00 ? 138 ILE B CA  1 
ATOM 5666  C C   . ILE B 2 138 ? 113.118 133.949 101.443 1.00 500.00 ? 138 ILE B C   1 
ATOM 5667  O O   . ILE B 2 138 ? 113.719 133.595 100.419 1.00 500.00 ? 138 ILE B O   1 
ATOM 5668  C CB  . ILE B 2 138 ? 112.442 136.467 101.666 1.00 500.00 ? 138 ILE B CB  1 
ATOM 5669  C CG1 . ILE B 2 138 ? 111.417 137.503 101.129 1.00 500.00 ? 138 ILE B CG1 1 
ATOM 5670  C CG2 . ILE B 2 138 ? 113.824 136.782 101.056 1.00 500.00 ? 138 ILE B CG2 1 
ATOM 5671  C CD1 . ILE B 2 138 ? 111.844 138.968 101.158 1.00 500.00 ? 138 ILE B CD1 1 
ATOM 5672  N N   . MET B 2 139 ? 113.383 133.494 102.656 1.00 500.00 ? 139 MET B N   1 
ATOM 5673  C CA  . MET B 2 139 ? 114.473 132.541 102.817 1.00 500.00 ? 139 MET B CA  1 
ATOM 5674  C C   . MET B 2 139 ? 114.165 131.229 102.132 1.00 500.00 ? 139 MET B C   1 
ATOM 5675  O O   . MET B 2 139 ? 115.075 130.675 101.501 1.00 488.56 ? 139 MET B O   1 
ATOM 5676  C CB  . MET B 2 139 ? 114.908 132.399 104.281 1.00 500.00 ? 139 MET B CB  1 
ATOM 5677  C CG  . MET B 2 139 ? 116.418 132.157 104.449 1.00 500.00 ? 139 MET B CG  1 
ATOM 5678  S SD  . MET B 2 139 ? 117.562 133.445 103.839 1.00 500.00 ? 139 MET B SD  1 
ATOM 5679  C CE  . MET B 2 139 ? 119.113 132.539 103.895 1.00 500.00 ? 139 MET B CE  1 
ATOM 5680  N N   . ILE B 2 140 ? 112.912 130.801 102.185 1.00 491.33 ? 140 ILE B N   1 
ATOM 5681  C CA  . ILE B 2 140 ? 112.453 129.600 101.485 1.00 500.00 ? 140 ILE B CA  1 
ATOM 5682  C C   . ILE B 2 140 ? 112.718 129.730 99.986  1.00 500.00 ? 140 ILE B C   1 
ATOM 5683  O O   . ILE B 2 140 ? 113.236 128.805 99.342  1.00 493.17 ? 140 ILE B O   1 
ATOM 5684  C CB  . ILE B 2 140 ? 110.959 129.327 101.737 1.00 500.00 ? 140 ILE B CB  1 
ATOM 5685  C CG1 . ILE B 2 140 ? 110.708 129.051 103.234 1.00 500.00 ? 140 ILE B CG1 1 
ATOM 5686  C CG2 . ILE B 2 140 ? 110.477 128.153 100.883 1.00 500.00 ? 140 ILE B CG2 1 
ATOM 5687  C CD1 . ILE B 2 140 ? 109.345 129.497 103.734 1.00 500.00 ? 140 ILE B CD1 1 
ATOM 5688  N N   . SER B 2 141 ? 112.349 130.895 99.470  1.00 500.00 ? 141 SER B N   1 
ATOM 5689  C CA  . SER B 2 141 ? 112.521 131.229 98.050  1.00 500.00 ? 141 SER B CA  1 
ATOM 5690  C C   . SER B 2 141 ? 113.990 131.117 97.659  1.00 500.00 ? 141 SER B C   1 
ATOM 5691  O O   . SER B 2 141 ? 114.332 130.524 96.628  1.00 500.00 ? 141 SER B O   1 
ATOM 5692  C CB  . SER B 2 141 ? 111.993 132.647 97.740  1.00 500.00 ? 141 SER B CB  1 
ATOM 5693  O OG  . SER B 2 141 ? 112.928 133.665 98.060  1.00 472.94 ? 141 SER B OG  1 
ATOM 5694  N N   . VAL B 2 142 ? 114.824 131.700 98.507  1.00 500.00 ? 142 VAL B N   1 
ATOM 5695  C CA  . VAL B 2 142 ? 116.279 131.708 98.316  1.00 500.00 ? 142 VAL B CA  1 
ATOM 5696  C C   . VAL B 2 142 ? 116.804 130.277 98.230  1.00 496.64 ? 142 VAL B C   1 
ATOM 5697  O O   . VAL B 2 142 ? 117.599 129.942 97.341  1.00 439.48 ? 142 VAL B O   1 
ATOM 5698  C CB  . VAL B 2 142 ? 117.030 132.480 99.433  1.00 500.00 ? 142 VAL B CB  1 
ATOM 5699  C CG1 . VAL B 2 142 ? 118.543 132.226 99.371  1.00 500.00 ? 142 VAL B CG1 1 
ATOM 5700  C CG2 . VAL B 2 142 ? 116.732 133.979 99.355  1.00 500.00 ? 142 VAL B CG2 1 
ATOM 5701  N N   . ILE B 2 143 ? 116.336 129.469 99.171  1.00 464.86 ? 143 ILE B N   1 
ATOM 5702  C CA  . ILE B 2 143 ? 116.718 128.057 99.267  1.00 500.00 ? 143 ILE B CA  1 
ATOM 5703  C C   . ILE B 2 143 ? 116.363 127.329 97.968  1.00 500.00 ? 143 ILE B C   1 
ATOM 5704  O O   . ILE B 2 143 ? 117.169 126.577 97.402  1.00 500.00 ? 143 ILE B O   1 
ATOM 5705  C CB  . ILE B 2 143 ? 116.081 127.366 100.488 1.00 500.00 ? 143 ILE B CB  1 
ATOM 5706  C CG1 . ILE B 2 143 ? 116.651 127.958 101.789 1.00 500.00 ? 143 ILE B CG1 1 
ATOM 5707  C CG2 . ILE B 2 143 ? 116.337 125.859 100.454 1.00 500.00 ? 143 ILE B CG2 1 
ATOM 5708  C CD1 . ILE B 2 143 ? 115.707 127.886 102.979 1.00 500.00 ? 143 ILE B CD1 1 
ATOM 5709  N N   . VAL B 2 144 ? 115.145 127.587 97.521  1.00 500.00 ? 144 VAL B N   1 
ATOM 5710  C CA  . VAL B 2 144 ? 114.634 127.083 96.241  1.00 500.00 ? 144 VAL B CA  1 
ATOM 5711  C C   . VAL B 2 144 ? 115.523 127.625 95.091  1.00 487.69 ? 144 VAL B C   1 
ATOM 5712  O O   . VAL B 2 144 ? 115.949 126.854 94.212  1.00 488.30 ? 144 VAL B O   1 
ATOM 5713  C CB  . VAL B 2 144 ? 113.132 127.429 96.070  1.00 500.00 ? 144 VAL B CB  1 
ATOM 5714  C CG1 . VAL B 2 144 ? 112.662 127.171 94.640  1.00 500.00 ? 144 VAL B CG1 1 
ATOM 5715  C CG2 . VAL B 2 144 ? 112.282 126.637 97.070  1.00 500.00 ? 144 VAL B CG2 1 
ATOM 5716  N N   . VAL B 2 145 ? 115.804 128.935 95.096  1.00 469.98 ? 145 VAL B N   1 
ATOM 5717  C CA  . VAL B 2 145 ? 116.561 129.614 94.011  1.00 475.58 ? 145 VAL B CA  1 
ATOM 5718  C C   . VAL B 2 145 ? 118.001 129.074 93.792  1.00 435.21 ? 145 VAL B C   1 
ATOM 5719  O O   . VAL B 2 145 ? 118.485 129.090 92.662  1.00 370.88 ? 145 VAL B O   1 
ATOM 5720  C CB  . VAL B 2 145 ? 116.559 131.179 94.182  1.00 500.00 ? 145 VAL B CB  1 
ATOM 5721  C CG1 . VAL B 2 145 ? 117.480 131.881 93.177  1.00 500.00 ? 145 VAL B CG1 1 
ATOM 5722  C CG2 . VAL B 2 145 ? 115.146 131.753 94.058  1.00 480.52 ? 145 VAL B CG2 1 
ATOM 5723  N N   . MET B 2 146 ? 118.668 128.591 94.846  1.00 452.68 ? 146 MET B N   1 
ATOM 5724  C CA  . MET B 2 146 ? 120.013 128.016 94.729  1.00 500.00 ? 146 MET B CA  1 
ATOM 5725  C C   . MET B 2 146 ? 120.008 126.788 93.841  1.00 500.00 ? 146 MET B C   1 
ATOM 5726  O O   . MET B 2 146 ? 120.919 126.617 93.037  1.00 500.00 ? 146 MET B O   1 
ATOM 5727  C CB  . MET B 2 146 ? 120.641 127.727 96.122  1.00 500.00 ? 146 MET B CB  1 
ATOM 5728  C CG  . MET B 2 146 ? 120.835 128.970 97.017  1.00 500.00 ? 146 MET B CG  1 
ATOM 5729  S SD  . MET B 2 146 ? 122.063 128.919 98.367  1.00 500.00 ? 146 MET B SD  1 
ATOM 5730  C CE  . MET B 2 146 ? 121.243 127.947 99.635  1.00 500.00 ? 146 MET B CE  1 
ATOM 5731  N N   . THR B 2 147 ? 118.952 125.974 93.976  1.00 500.00 ? 147 THR B N   1 
ATOM 5732  C CA  . THR B 2 147 ? 118.774 124.787 93.127  1.00 500.00 ? 147 THR B CA  1 
ATOM 5733  C C   . THR B 2 147 ? 118.711 125.202 91.659  1.00 500.00 ? 147 THR B C   1 
ATOM 5734  O O   . THR B 2 147 ? 119.360 124.576 90.809  1.00 500.00 ? 147 THR B O   1 
ATOM 5735  C CB  . THR B 2 147 ? 117.575 123.855 93.536  1.00 500.00 ? 147 THR B CB  1 
ATOM 5736  O OG1 . THR B 2 147 ? 116.318 124.512 93.333  1.00 500.00 ? 147 THR B OG1 1 
ATOM 5737  C CG2 . THR B 2 147 ? 117.693 123.375 95.009  1.00 500.00 ? 147 THR B CG2 1 
ATOM 5738  N N   . ILE B 2 148 ? 117.953 126.269 91.399  1.00 500.00 ? 148 ILE B N   1 
ATOM 5739  C CA  . ILE B 2 148 ? 117.779 126.808 90.056  1.00 500.00 ? 148 ILE B CA  1 
ATOM 5740  C C   . ILE B 2 148 ? 119.103 127.192 89.453  1.00 500.00 ? 148 ILE B C   1 
ATOM 5741  O O   . ILE B 2 148 ? 119.282 126.995 88.250  1.00 500.00 ? 148 ILE B O   1 
ATOM 5742  C CB  . ILE B 2 148 ? 116.778 128.005 89.989  1.00 500.00 ? 148 ILE B CB  1 
ATOM 5743  C CG1 . ILE B 2 148 ? 115.354 127.529 90.339  1.00 500.00 ? 148 ILE B CG1 1 
ATOM 5744  C CG2 . ILE B 2 148 ? 116.778 128.661 88.599  1.00 500.00 ? 148 ILE B CG2 1 
ATOM 5745  C CD1 . ILE B 2 148 ? 114.337 128.637 90.564  1.00 500.00 ? 148 ILE B CD1 1 
ATOM 5746  N N   . LEU B 2 149 ? 119.985 127.779 90.250  1.00 500.00 ? 149 LEU B N   1 
ATOM 5747  C CA  . LEU B 2 149 ? 121.349 128.108 89.831  1.00 500.00 ? 149 LEU B CA  1 
ATOM 5748  C C   . LEU B 2 149 ? 122.138 126.860 89.467  1.00 500.00 ? 149 LEU B C   1 
ATOM 5749  O O   . LEU B 2 149 ? 122.832 126.877 88.438  1.00 500.00 ? 149 LEU B O   1 
ATOM 5750  C CB  . LEU B 2 149 ? 122.013 129.066 90.837  1.00 500.00 ? 149 LEU B CB  1 
ATOM 5751  C CG  . LEU B 2 149 ? 121.221 130.407 90.997  1.00 500.00 ? 149 LEU B CG  1 
ATOM 5752  C CD1 . LEU B 2 149 ? 121.827 131.306 92.075  1.00 500.00 ? 149 LEU B CD1 1 
ATOM 5753  C CD2 . LEU B 2 149 ? 121.048 131.188 89.685  1.00 500.00 ? 149 LEU B CD2 1 
ATOM 5754  N N   . LEU B 2 150 ? 121.925 125.788 90.216  1.00 459.96 ? 150 LEU B N   1 
ATOM 5755  C CA  . LEU B 2 150 ? 122.510 124.482 89.913  1.00 500.00 ? 150 LEU B CA  1 
ATOM 5756  C C   . LEU B 2 150 ? 122.039 124.029 88.502  1.00 499.56 ? 150 LEU B C   1 
ATOM 5757  O O   . LEU B 2 150 ? 122.838 123.570 87.672  1.00 478.69 ? 150 LEU B O   1 
ATOM 5758  C CB  . LEU B 2 150 ? 122.143 123.485 91.039  1.00 500.00 ? 150 LEU B CB  1 
ATOM 5759  C CG  . LEU B 2 150 ? 123.013 122.283 91.466  1.00 500.00 ? 150 LEU B CG  1 
ATOM 5760  C CD1 . LEU B 2 150 ? 122.838 121.119 90.488  1.00 500.00 ? 150 LEU B CD1 1 
ATOM 5761  C CD2 . LEU B 2 150 ? 124.495 122.615 91.675  1.00 500.00 ? 150 LEU B CD2 1 
ATOM 5762  N N   . VAL B 2 151 ? 120.751 124.182 88.283  1.00 475.06 ? 151 VAL B N   1 
ATOM 5763  C CA  . VAL B 2 151 ? 120.155 123.782 87.010  1.00 455.45 ? 151 VAL B CA  1 
ATOM 5764  C C   . VAL B 2 151 ? 120.740 124.602 85.867  1.00 500.00 ? 151 VAL B C   1 
ATOM 5765  O O   . VAL B 2 151 ? 121.056 124.037 84.816  1.00 500.00 ? 151 VAL B O   1 
ATOM 5766  C CB  . VAL B 2 151 ? 118.596 123.850 87.068  1.00 466.12 ? 151 VAL B CB  1 
ATOM 5767  C CG1 . VAL B 2 151 ? 117.968 123.633 85.693  1.00 469.92 ? 151 VAL B CG1 1 
ATOM 5768  C CG2 . VAL B 2 151 ? 118.053 122.825 88.067  1.00 440.57 ? 151 VAL B CG2 1 
ATOM 5769  N N   . VAL B 2 152 ? 120.911 125.895 86.103  1.00 500.00 ? 152 VAL B N   1 
ATOM 5770  C CA  . VAL B 2 152 ? 121.509 126.820 85.139  1.00 500.00 ? 152 VAL B CA  1 
ATOM 5771  C C   . VAL B 2 152 ? 122.915 126.332 84.758  1.00 500.00 ? 152 VAL B C   1 
ATOM 5772  O O   . VAL B 2 152 ? 123.274 126.279 83.566  1.00 500.00 ? 152 VAL B O   1 
ATOM 5773  C CB  . VAL B 2 152 ? 121.573 128.297 85.662  1.00 500.00 ? 152 VAL B CB  1 
ATOM 5774  C CG1 . VAL B 2 152 ? 122.593 129.152 84.894  1.00 500.00 ? 152 VAL B CG1 1 
ATOM 5775  C CG2 . VAL B 2 152 ? 120.187 128.949 85.620  1.00 500.00 ? 152 VAL B CG2 1 
ATOM 5776  N N   . LEU B 2 153 ? 123.670 125.988 85.795  1.00 500.00 ? 153 LEU B N   1 
ATOM 5777  C CA  . LEU B 2 153 ? 125.039 125.499 85.641  1.00 500.00 ? 153 LEU B CA  1 
ATOM 5778  C C   . LEU B 2 153 ? 125.064 124.249 84.764  1.00 500.00 ? 153 LEU B C   1 
ATOM 5779  O O   . LEU B 2 153 ? 125.888 124.130 83.847  1.00 500.00 ? 153 LEU B O   1 
ATOM 5780  C CB  . LEU B 2 153 ? 125.787 125.292 86.975  1.00 500.00 ? 153 LEU B CB  1 
ATOM 5781  C CG  . LEU B 2 153 ? 125.689 124.081 87.930  1.00 500.00 ? 153 LEU B CG  1 
ATOM 5782  C CD1 . LEU B 2 153 ? 126.277 122.765 87.390  1.00 500.00 ? 153 LEU B CD1 1 
ATOM 5783  C CD2 . LEU B 2 153 ? 126.281 124.471 89.284  1.00 500.00 ? 153 LEU B CD2 1 
ATOM 5784  N N   . TYR B 2 154 ? 124.144 123.348 85.076  1.00 500.00 ? 154 TYR B N   1 
ATOM 5785  C CA  . TYR B 2 154 ? 123.986 122.079 84.356  1.00 500.00 ? 154 TYR B CA  1 
ATOM 5786  C C   . TYR B 2 154 ? 123.742 122.350 82.867  1.00 499.32 ? 154 TYR B C   1 
ATOM 5787  O O   . TYR B 2 154 ? 124.372 121.732 81.990  1.00 373.92 ? 154 TYR B O   1 
ATOM 5788  C CB  . TYR B 2 154 ? 122.816 121.232 84.962  1.00 500.00 ? 154 TYR B CB  1 
ATOM 5789  C CG  . TYR B 2 154 ? 121.681 120.728 84.011  1.00 500.00 ? 154 TYR B CG  1 
ATOM 5790  C CD1 . TYR B 2 154 ? 120.566 121.535 83.696  1.00 500.00 ? 154 TYR B CD1 1 
ATOM 5791  C CD2 . TYR B 2 154 ? 121.688 119.430 83.475  1.00 500.00 ? 154 TYR B CD2 1 
ATOM 5792  C CE1 . TYR B 2 154 ? 119.534 121.097 82.860  1.00 500.00 ? 154 TYR B CE1 1 
ATOM 5793  C CE2 . TYR B 2 154 ? 120.643 118.983 82.637  1.00 500.00 ? 154 TYR B CE2 1 
ATOM 5794  C CZ  . TYR B 2 154 ? 119.567 119.826 82.332  1.00 500.00 ? 154 TYR B CZ  1 
ATOM 5795  O OH  . TYR B 2 154 ? 118.524 119.424 81.517  1.00 500.00 ? 154 TYR B OH  1 
ATOM 5796  N N   . LYS B 2 155 ? 122.825 123.281 82.631  1.00 500.00 ? 155 LYS B N   1 
ATOM 5797  C CA  . LYS B 2 155 ? 122.441 123.683 81.279  1.00 500.00 ? 155 LYS B CA  1 
ATOM 5798  C C   . LYS B 2 155 ? 123.652 124.196 80.499  1.00 500.00 ? 155 LYS B C   1 
ATOM 5799  O O   . LYS B 2 155 ? 123.845 123.763 79.332  1.00 500.00 ? 155 LYS B O   1 
ATOM 5800  C CB  . LYS B 2 155 ? 121.296 124.712 81.240  1.00 500.00 ? 155 LYS B CB  1 
ATOM 5801  C CG  . LYS B 2 155 ? 119.892 124.116 81.333  1.00 500.00 ? 155 LYS B CG  1 
ATOM 5802  C CD  . LYS B 2 155 ? 118.814 125.178 81.103  1.00 500.00 ? 155 LYS B CD  1 
ATOM 5803  C CE  . LYS B 2 155 ? 117.444 124.763 81.644  1.00 500.00 ? 155 LYS B CE  1 
ATOM 5804  N NZ  . LYS B 2 155 ? 116.511 125.921 81.802  1.00 476.77 ? 155 LYS B NZ  1 
ATOM 5805  N N   . TYR B 2 156 ? 124.336 125.252 80.967  1.00 500.00 ? 156 TYR B N   1 
ATOM 5806  C CA  . TYR B 2 156 ? 125.459 125.859 80.175  1.00 500.00 ? 156 TYR B CA  1 
ATOM 5807  C C   . TYR B 2 156 ? 126.814 125.920 80.918  1.00 500.00 ? 156 TYR B C   1 
ATOM 5808  O O   . TYR B 2 156 ? 126.867 125.996 82.150  1.00 500.00 ? 156 TYR B O   1 
ATOM 5809  C CB  . TYR B 2 156 ? 125.090 127.180 79.427  1.00 500.00 ? 156 TYR B CB  1 
ATOM 5810  C CG  . TYR B 2 156 ? 124.298 128.263 80.157  1.00 500.00 ? 156 TYR B CG  1 
ATOM 5811  C CD1 . TYR B 2 156 ? 124.953 129.275 80.884  1.00 500.00 ? 156 TYR B CD1 1 
ATOM 5812  C CD2 . TYR B 2 156 ? 122.894 128.330 80.049  1.00 500.00 ? 156 TYR B CD2 1 
ATOM 5813  C CE1 . TYR B 2 156 ? 124.237 130.289 81.524  1.00 500.00 ? 156 TYR B CE1 1 
ATOM 5814  C CE2 . TYR B 2 156 ? 122.169 129.339 80.687  1.00 500.00 ? 156 TYR B CE2 1 
ATOM 5815  C CZ  . TYR B 2 156 ? 122.846 130.323 81.425  1.00 500.00 ? 156 TYR B CZ  1 
ATOM 5816  O OH  . TYR B 2 156 ? 122.137 131.328 82.060  1.00 465.29 ? 156 TYR B OH  1 
ATOM 5817  N N   . ARG B 2 157 ? 127.894 125.951 80.122  1.00 500.00 ? 157 ARG B N   1 
ATOM 5818  C CA  . ARG B 2 157 ? 129.129 125.145 80.379  1.00 500.00 ? 157 ARG B CA  1 
ATOM 5819  C C   . ARG B 2 157 ? 130.044 125.544 81.569  1.00 500.00 ? 157 ARG B C   1 
ATOM 5820  O O   . ARG B 2 157 ? 130.432 126.712 81.748  1.00 500.00 ? 157 ARG B O   1 
ATOM 5821  C CB  . ARG B 2 157 ? 129.932 124.930 79.069  1.00 500.00 ? 157 ARG B CB  1 
ATOM 5822  C CG  . ARG B 2 157 ? 129.042 124.509 77.896  1.00 500.00 ? 157 ARG B CG  1 
ATOM 5823  C CD  . ARG B 2 157 ? 129.615 123.420 77.008  1.00 500.00 ? 157 ARG B CD  1 
ATOM 5824  N NE  . ARG B 2 157 ? 128.548 122.871 76.165  1.00 500.00 ? 157 ARG B NE  1 
ATOM 5825  C CZ  . ARG B 2 157 ? 127.618 121.988 76.556  1.00 500.00 ? 157 ARG B CZ  1 
ATOM 5826  N NH1 . ARG B 2 157 ? 127.587 121.497 77.803  1.00 500.00 ? 157 ARG B NH1 1 
ATOM 5827  N NH2 . ARG B 2 157 ? 126.698 121.584 75.679  1.00 500.00 ? 157 ARG B NH2 1 
ATOM 5828  N N   . CYS B 2 158 ? 130.421 124.505 82.318  1.00 500.00 ? 158 CYS B N   1 
ATOM 5829  C CA  . CYS B 2 158 ? 130.573 124.574 83.765  1.00 500.00 ? 158 CYS B CA  1 
ATOM 5830  C C   . CYS B 2 158 ? 131.928 124.029 84.270  1.00 500.00 ? 158 CYS B C   1 
ATOM 5831  O O   . CYS B 2 158 ? 132.918 124.771 84.269  1.00 500.00 ? 158 CYS B O   1 
ATOM 5832  C CB  . CYS B 2 158 ? 129.343 123.872 84.410  1.00 500.00 ? 158 CYS B CB  1 
ATOM 5833  S SG  . CYS B 2 158 ? 128.514 122.580 83.433  1.00 500.00 ? 158 CYS B SG  1 
ATOM 5834  N N   . TYR B 2 159 ? 131.971 122.749 84.665  1.00 500.00 ? 159 TYR B N   1 
ATOM 5835  C CA  . TYR B 2 159 ? 133.126 122.136 85.348  1.00 500.00 ? 159 TYR B CA  1 
ATOM 5836  C C   . TYR B 2 159 ? 133.667 122.969 86.551  1.00 500.00 ? 159 TYR B C   1 
ATOM 5837  O O   . TYR B 2 159 ? 133.120 122.856 87.658  1.00 500.00 ? 159 TYR B O   1 
ATOM 5838  C CB  . TYR B 2 159 ? 134.217 121.760 84.315  1.00 500.00 ? 159 TYR B CB  1 
ATOM 5839  C CG  . TYR B 2 159 ? 135.488 121.063 84.850  1.00 500.00 ? 159 TYR B CG  1 
ATOM 5840  C CD1 . TYR B 2 159 ? 135.434 119.785 85.459  1.00 500.00 ? 159 TYR B CD1 1 
ATOM 5841  C CD2 . TYR B 2 159 ? 136.762 121.669 84.704  1.00 500.00 ? 159 TYR B CD2 1 
ATOM 5842  C CE1 . TYR B 2 159 ? 136.605 119.155 85.927  1.00 500.00 ? 159 TYR B CE1 1 
ATOM 5843  C CE2 . TYR B 2 159 ? 137.933 121.045 85.168  1.00 500.00 ? 159 TYR B CE2 1 
ATOM 5844  C CZ  . TYR B 2 159 ? 137.861 119.791 85.778  1.00 500.00 ? 159 TYR B CZ  1 
ATOM 5845  O OH  . TYR B 2 159 ? 139.034 119.191 86.228  1.00 358.81 ? 159 TYR B OH  1 
ATOM 5846  N N   . LYS B 2 160 ? 134.685 123.818 86.325  1.00 500.00 ? 160 LYS B N   1 
ATOM 5847  C CA  . LYS B 2 160 ? 135.518 124.393 87.383  1.00 500.00 ? 160 LYS B CA  1 
ATOM 5848  C C   . LYS B 2 160 ? 134.842 125.545 88.065  1.00 500.00 ? 160 LYS B C   1 
ATOM 5849  O O   . LYS B 2 160 ? 135.039 125.686 89.272  1.00 500.00 ? 160 LYS B O   1 
ATOM 5850  C CB  . LYS B 2 160 ? 136.914 124.804 86.850  1.00 500.00 ? 160 LYS B CB  1 
ATOM 5851  C CG  . LYS B 2 160 ? 138.039 124.876 87.899  1.00 500.00 ? 160 LYS B CG  1 
ATOM 5852  C CD  . LYS B 2 160 ? 139.426 124.904 87.233  1.00 500.00 ? 160 LYS B CD  1 
ATOM 5853  C CE  . LYS B 2 160 ? 140.586 125.131 88.205  1.00 500.00 ? 160 LYS B CE  1 
ATOM 5854  N NZ  . LYS B 2 160 ? 141.908 125.298 87.519  1.00 420.31 ? 160 LYS B NZ  1 
ATOM 5855  N N   . VAL B 2 161 ? 134.039 126.317 87.329  1.00 500.00 ? 161 VAL B N   1 
ATOM 5856  C CA  . VAL B 2 161 ? 133.284 127.434 87.876  1.00 500.00 ? 161 VAL B CA  1 
ATOM 5857  C C   . VAL B 2 161 ? 132.377 126.952 89.020  1.00 500.00 ? 161 VAL B C   1 
ATOM 5858  O O   . VAL B 2 161 ? 132.328 127.556 90.105  1.00 500.00 ? 161 VAL B O   1 
ATOM 5859  C CB  . VAL B 2 161 ? 132.438 128.155 86.765  1.00 500.00 ? 161 VAL B CB  1 
ATOM 5860  C CG1 . VAL B 2 161 ? 131.660 129.338 87.348  1.00 500.00 ? 161 VAL B CG1 1 
ATOM 5861  C CG2 . VAL B 2 161 ? 133.322 128.609 85.591  1.00 500.00 ? 161 VAL B CG2 1 
ATOM 5862  N N   . ILE B 2 162 ? 131.686 125.862 88.730  1.00 500.00 ? 162 ILE B N   1 
ATOM 5863  C CA  . ILE B 2 162 ? 130.754 125.235 89.671  1.00 491.42 ? 162 ILE B CA  1 
ATOM 5864  C C   . ILE B 2 162 ? 131.488 124.850 90.952  1.00 488.34 ? 162 ILE B C   1 
ATOM 5865  O O   . ILE B 2 162 ? 131.013 125.119 92.070  1.00 412.89 ? 162 ILE B O   1 
ATOM 5866  C CB  . ILE B 2 162 ? 130.125 123.991 89.026  1.00 474.17 ? 162 ILE B CB  1 
ATOM 5867  C CG1 . ILE B 2 162 ? 129.529 124.352 87.645  1.00 497.50 ? 162 ILE B CG1 1 
ATOM 5868  C CG2 . ILE B 2 162 ? 129.168 123.289 89.987  1.00 469.29 ? 162 ILE B CG2 1 
ATOM 5869  C CD1 . ILE B 2 162 ? 129.165 125.818 87.342  1.00 468.49 ? 162 ILE B CD1 1 
ATOM 5870  N N   . HIS B 2 163 ? 132.641 124.224 90.750  1.00 500.00 ? 163 HIS B N   1 
ATOM 5871  C CA  . HIS B 2 163 ? 133.500 123.772 91.855  1.00 500.00 ? 163 HIS B CA  1 
ATOM 5872  C C   . HIS B 2 163 ? 133.891 124.949 92.732  1.00 500.00 ? 163 HIS B C   1 
ATOM 5873  O O   . HIS B 2 163 ? 133.823 124.873 93.960  1.00 418.57 ? 163 HIS B O   1 
ATOM 5874  C CB  . HIS B 2 163 ? 134.721 122.966 91.376  1.00 500.00 ? 163 HIS B CB  1 
ATOM 5875  C CG  . HIS B 2 163 ? 134.371 121.606 90.852  1.00 500.00 ? 163 HIS B CG  1 
ATOM 5876  N ND1 . HIS B 2 163 ? 133.583 120.715 91.551  1.00 497.02 ? 163 HIS B ND1 1 
ATOM 5877  C CD2 . HIS B 2 163 ? 134.699 120.984 89.694  1.00 480.48 ? 163 HIS B CD2 1 
ATOM 5878  C CE1 . HIS B 2 163 ? 133.433 119.611 90.843  1.00 491.01 ? 163 HIS B CE1 1 
ATOM 5879  N NE2 . HIS B 2 163 ? 134.101 119.748 89.711  1.00 477.66 ? 163 HIS B NE2 1 
ATOM 5880  N N   . ALA B 2 164 ? 134.297 126.019 92.067  1.00 500.00 ? 164 ALA B N   1 
ATOM 5881  C CA  . ALA B 2 164 ? 134.712 127.267 92.725  1.00 500.00 ? 164 ALA B CA  1 
ATOM 5882  C C   . ALA B 2 164 ? 133.590 127.800 93.594  1.00 500.00 ? 164 ALA B C   1 
ATOM 5883  O O   . ALA B 2 164 ? 133.770 128.167 94.765  1.00 500.00 ? 164 ALA B O   1 
ATOM 5884  C CB  . ALA B 2 164 ? 135.157 128.322 91.709  1.00 500.00 ? 164 ALA B CB  1 
ATOM 5885  N N   . TRP B 2 165 ? 132.400 127.815 93.000  1.00 500.00 ? 165 TRP B N   1 
ATOM 5886  C CA  . TRP B 2 165 ? 131.150 128.210 93.682  1.00 500.00 ? 165 TRP B CA  1 
ATOM 5887  C C   . TRP B 2 165 ? 130.949 127.267 94.879  1.00 500.00 ? 165 TRP B C   1 
ATOM 5888  O O   . TRP B 2 165 ? 130.652 127.677 96.014  1.00 500.00 ? 165 TRP B O   1 
ATOM 5889  C CB  . TRP B 2 165 ? 129.917 128.124 92.754  1.00 500.00 ? 165 TRP B CB  1 
ATOM 5890  C CG  . TRP B 2 165 ? 128.568 128.224 93.488  1.00 500.00 ? 165 TRP B CG  1 
ATOM 5891  C CD1 . TRP B 2 165 ? 127.834 129.365 93.705  1.00 500.00 ? 165 TRP B CD1 1 
ATOM 5892  C CD2 . TRP B 2 165 ? 127.817 127.149 94.099  1.00 500.00 ? 165 TRP B CD2 1 
ATOM 5893  N NE1 . TRP B 2 165 ? 126.682 129.069 94.404  1.00 500.00 ? 165 TRP B NE1 1 
ATOM 5894  C CE2 . TRP B 2 165 ? 126.646 127.721 94.659  1.00 500.00 ? 165 TRP B CE2 1 
ATOM 5895  C CE3 . TRP B 2 165 ? 128.024 125.767 94.231  1.00 500.00 ? 165 TRP B CE3 1 
ATOM 5896  C CZ2 . TRP B 2 165 ? 125.683 126.957 95.340  1.00 500.00 ? 165 TRP B CZ2 1 
ATOM 5897  C CZ3 . TRP B 2 165 ? 127.069 125.007 94.913  1.00 500.00 ? 165 TRP B CZ3 1 
ATOM 5898  C CH2 . TRP B 2 165 ? 125.912 125.609 95.458  1.00 500.00 ? 165 TRP B CH2 1 
ATOM 5899  N N   . LEU B 2 166 ? 131.113 125.990 94.560  1.00 432.99 ? 166 LEU B N   1 
ATOM 5900  C CA  . LEU B 2 166 ? 131.050 124.923 95.509  1.00 437.73 ? 166 LEU B CA  1 
ATOM 5901  C C   . LEU B 2 166 ? 132.163 125.081 96.537  1.00 477.50 ? 166 LEU B C   1 
ATOM 5902  O O   . LEU B 2 166 ? 131.890 125.089 97.737  1.00 500.00 ? 166 LEU B O   1 
ATOM 5903  C CB  . LEU B 2 166 ? 131.148 123.584 94.764  1.00 467.64 ? 166 LEU B CB  1 
ATOM 5904  C CG  . LEU B 2 166 ? 130.972 122.250 95.474  1.00 500.00 ? 166 LEU B CG  1 
ATOM 5905  C CD1 . LEU B 2 166 ? 132.142 121.923 96.403  1.00 500.00 ? 166 LEU B CD1 1 
ATOM 5906  C CD2 . LEU B 2 166 ? 129.625 122.249 96.187  1.00 500.00 ? 166 LEU B CD2 1 
ATOM 5907  N N   . ILE B 2 167 ? 133.408 125.242 96.080  1.00 483.53 ? 167 ILE B N   1 
ATOM 5908  C CA  . ILE B 2 167 ? 134.555 125.210 96.981  1.00 500.00 ? 167 ILE B CA  1 
ATOM 5909  C C   . ILE B 2 167 ? 134.521 126.448 97.853  1.00 451.14 ? 167 ILE B C   1 
ATOM 5910  O O   . ILE B 2 167 ? 134.652 126.327 99.057  1.00 365.55 ? 167 ILE B O   1 
ATOM 5911  C CB  . ILE B 2 167 ? 135.948 124.975 96.292  1.00 500.00 ? 167 ILE B CB  1 
ATOM 5912  C CG1 . ILE B 2 167 ? 136.466 126.206 95.518  1.00 500.00 ? 167 ILE B CG1 1 
ATOM 5913  C CG2 . ILE B 2 167 ? 135.954 123.685 95.460  1.00 500.00 ? 167 ILE B CG2 1 
ATOM 5914  C CD1 . ILE B 2 167 ? 137.435 127.093 96.282  1.00 500.00 ? 167 ILE B CD1 1 
ATOM 5915  N N   . ILE B 2 168 ? 134.266 127.616 97.272  1.00 435.28 ? 168 ILE B N   1 
ATOM 5916  C CA  . ILE B 2 168 ? 134.149 128.819 98.076  1.00 500.00 ? 168 ILE B CA  1 
ATOM 5917  C C   . ILE B 2 168 ? 133.059 128.545 99.114  1.00 436.25 ? 168 ILE B C   1 
ATOM 5918  O O   . ILE B 2 168 ? 133.336 128.659 100.302 1.00 407.01 ? 168 ILE B O   1 
ATOM 5919  C CB  . ILE B 2 168 ? 133.938 130.130 97.248  1.00 500.00 ? 168 ILE B CB  1 
ATOM 5920  C CG1 . ILE B 2 168 ? 135.295 130.746 96.799  1.00 500.00 ? 168 ILE B CG1 1 
ATOM 5921  C CG2 . ILE B 2 168 ? 133.179 131.192 98.052  1.00 500.00 ? 168 ILE B CG2 1 
ATOM 5922  C CD1 . ILE B 2 168 ? 135.843 130.265 95.470  1.00 500.00 ? 168 ILE B CD1 1 
ATOM 5923  N N   . SER B 2 169 ? 131.870 128.115 98.675  1.00 435.69 ? 169 SER B N   1 
ATOM 5924  C CA  . SER B 2 169 ? 130.741 127.854 99.579  1.00 484.82 ? 169 SER B CA  1 
ATOM 5925  C C   . SER B 2 169 ? 131.184 127.064 100.788 1.00 480.05 ? 169 SER B C   1 
ATOM 5926  O O   . SER B 2 169 ? 130.742 127.367 101.895 1.00 489.24 ? 169 SER B O   1 
ATOM 5927  C CB  . SER B 2 169 ? 129.570 127.143 98.867  1.00 496.47 ? 169 SER B CB  1 
ATOM 5928  O OG  . SER B 2 169 ? 128.514 126.803 99.763  1.00 457.05 ? 169 SER B OG  1 
ATOM 5929  N N   . SER B 2 170 ? 132.066 126.087 100.558 1.00 463.95 ? 170 SER B N   1 
ATOM 5930  C CA  . SER B 2 170 ? 132.624 125.262 101.630 1.00 476.87 ? 170 SER B CA  1 
ATOM 5931  C C   . SER B 2 170 ? 133.820 125.983 102.249 1.00 483.44 ? 170 SER B C   1 
ATOM 5932  O O   . SER B 2 170 ? 133.967 125.995 103.472 1.00 457.11 ? 170 SER B O   1 
ATOM 5933  C CB  . SER B 2 170 ? 133.082 123.907 101.091 1.00 500.00 ? 170 SER B CB  1 
ATOM 5934  O OG  . SER B 2 170 ? 134.185 124.035 100.204 1.00 483.70 ? 170 SER B OG  1 
ATOM 5935  N N   . LEU B 2 171 ? 134.689 126.471 101.376 1.00 471.54 ? 171 LEU B N   1 
ATOM 5936  C CA  . LEU B 2 171 ? 135.962 127.063 101.753 1.00 461.51 ? 171 LEU B CA  1 
ATOM 5937  C C   . LEU B 2 171 ? 135.750 128.225 102.706 1.00 442.78 ? 171 LEU B C   1 
ATOM 5938  O O   . LEU B 2 171 ? 136.401 128.340 103.763 1.00 416.87 ? 171 LEU B O   1 
ATOM 5939  C CB  . LEU B 2 171 ? 136.689 127.558 100.505 1.00 482.22 ? 171 LEU B CB  1 
ATOM 5940  C CG  . LEU B 2 171 ? 137.747 128.656 100.580 1.00 500.00 ? 171 LEU B CG  1 
ATOM 5941  C CD1 . LEU B 2 171 ? 138.854 128.355 99.576  1.00 500.00 ? 171 LEU B CD1 1 
ATOM 5942  C CD2 . LEU B 2 171 ? 137.189 130.070 100.367 1.00 500.00 ? 171 LEU B CD2 1 
ATOM 5943  N N   . LEU B 2 172 ? 134.835 129.081 102.296 1.00 437.83 ? 172 LEU B N   1 
ATOM 5944  C CA  . LEU B 2 172 ? 134.465 130.291 103.069 1.00 459.18 ? 172 LEU B CA  1 
ATOM 5945  C C   . LEU B 2 172 ? 133.970 129.885 104.445 1.00 409.68 ? 172 LEU B C   1 
ATOM 5946  O O   . LEU B 2 172 ? 134.358 130.417 105.487 1.00 413.35 ? 172 LEU B O   1 
ATOM 5947  C CB  . LEU B 2 172 ? 133.411 131.121 102.321 1.00 500.00 ? 172 LEU B CB  1 
ATOM 5948  C CG  . LEU B 2 172 ? 132.657 132.249 103.062 1.00 500.00 ? 172 LEU B CG  1 
ATOM 5949  C CD1 . LEU B 2 172 ? 132.535 133.522 102.222 1.00 500.00 ? 172 LEU B CD1 1 
ATOM 5950  C CD2 . LEU B 2 172 ? 131.275 131.790 103.532 1.00 500.00 ? 172 LEU B CD2 1 
ATOM 5951  N N   . LEU B 2 173 ? 133.088 128.896 104.432 1.00 392.50 ? 173 LEU B N   1 
ATOM 5952  C CA  . LEU B 2 173 ? 132.573 128.223 105.638 1.00 460.13 ? 173 LEU B CA  1 
ATOM 5953  C C   . LEU B 2 173 ? 133.776 127.650 106.413 1.00 447.48 ? 173 LEU B C   1 
ATOM 5954  O O   . LEU B 2 173 ? 133.915 127.839 107.652 1.00 486.40 ? 173 LEU B O   1 
ATOM 5955  C CB  . LEU B 2 173 ? 131.609 127.096 105.219 1.00 500.00 ? 173 LEU B CB  1 
ATOM 5956  C CG  . LEU B 2 173 ? 130.399 126.666 106.057 1.00 500.00 ? 173 LEU B CG  1 
ATOM 5957  C CD1 . LEU B 2 173 ? 129.674 125.545 105.314 1.00 500.00 ? 173 LEU B CD1 1 
ATOM 5958  C CD2 . LEU B 2 173 ? 130.751 126.245 107.486 1.00 500.00 ? 173 LEU B CD2 1 
ATOM 5959  N N   . LEU B 2 174 ? 134.621 126.946 105.655 1.00 389.05 ? 174 LEU B N   1 
ATOM 5960  C CA  . LEU B 2 174 ? 135.746 126.217 106.216 1.00 413.07 ? 174 LEU B CA  1 
ATOM 5961  C C   . LEU B 2 174 ? 136.687 127.154 106.906 1.00 439.78 ? 174 LEU B C   1 
ATOM 5962  O O   . LEU B 2 174 ? 137.156 126.836 107.969 1.00 469.24 ? 174 LEU B O   1 
ATOM 5963  C CB  . LEU B 2 174 ? 136.494 125.358 105.202 1.00 500.00 ? 174 LEU B CB  1 
ATOM 5964  C CG  . LEU B 2 174 ? 136.302 123.878 105.536 1.00 500.00 ? 174 LEU B CG  1 
ATOM 5965  C CD1 . LEU B 2 174 ? 136.846 123.009 104.411 1.00 500.00 ? 174 LEU B CD1 1 
ATOM 5966  C CD2 . LEU B 2 174 ? 136.898 123.500 106.903 1.00 500.00 ? 174 LEU B CD2 1 
ATOM 5967  N N   . PHE B 2 175 ? 136.890 128.338 106.354 1.00 451.25 ? 175 PHE B N   1 
ATOM 5968  C CA  . PHE B 2 175 ? 137.642 129.352 107.056 1.00 451.91 ? 175 PHE B CA  1 
ATOM 5969  C C   . PHE B 2 175 ? 136.699 130.256 107.851 1.00 434.22 ? 175 PHE B C   1 
ATOM 5970  O O   . PHE B 2 175 ? 136.527 130.049 109.045 1.00 387.90 ? 175 PHE B O   1 
ATOM 5971  C CB  . PHE B 2 175 ? 138.526 130.104 106.072 1.00 462.39 ? 175 PHE B CB  1 
ATOM 5972  C CG  . PHE B 2 175 ? 139.442 129.200 105.293 1.00 470.04 ? 175 PHE B CG  1 
ATOM 5973  C CD1 . PHE B 2 175 ? 140.364 128.392 105.950 1.00 444.62 ? 175 PHE B CD1 1 
ATOM 5974  C CD2 . PHE B 2 175 ? 139.374 129.130 103.913 1.00 500.00 ? 175 PHE B CD2 1 
ATOM 5975  C CE1 . PHE B 2 175 ? 141.214 127.558 105.249 1.00 477.21 ? 175 PHE B CE1 1 
ATOM 5976  C CE2 . PHE B 2 175 ? 140.219 128.286 103.204 1.00 500.00 ? 175 PHE B CE2 1 
ATOM 5977  C CZ  . PHE B 2 175 ? 141.137 127.497 103.874 1.00 500.00 ? 175 PHE B CZ  1 
ATOM 5978  N N   . PHE B 2 176 ? 136.021 131.171 107.169 1.00 417.60 ? 176 PHE B N   1 
ATOM 5979  C CA  . PHE B 2 176 ? 135.458 132.372 107.740 1.00 398.22 ? 176 PHE B CA  1 
ATOM 5980  C C   . PHE B 2 176 ? 134.682 131.889 108.947 1.00 381.82 ? 176 PHE B C   1 
ATOM 5981  O O   . PHE B 2 176 ? 134.971 132.300 110.080 1.00 385.27 ? 176 PHE B O   1 
ATOM 5982  C CB  . PHE B 2 176 ? 134.553 133.022 106.674 1.00 447.54 ? 176 PHE B CB  1 
ATOM 5983  C CG  . PHE B 2 176 ? 133.871 134.295 107.076 1.00 500.00 ? 176 PHE B CG  1 
ATOM 5984  C CD1 . PHE B 2 176 ? 132.663 134.266 107.774 1.00 455.75 ? 176 PHE B CD1 1 
ATOM 5985  C CD2 . PHE B 2 176 ? 134.367 135.526 106.645 1.00 500.00 ? 176 PHE B CD2 1 
ATOM 5986  C CE1 . PHE B 2 176 ? 132.000 135.443 108.101 1.00 500.00 ? 176 PHE B CE1 1 
ATOM 5987  C CE2 . PHE B 2 176 ? 133.708 136.708 106.964 1.00 500.00 ? 176 PHE B CE2 1 
ATOM 5988  C CZ  . PHE B 2 176 ? 132.523 136.666 107.696 1.00 500.00 ? 176 PHE B CZ  1 
ATOM 5989  N N   . PHE B 2 177 ? 133.673 131.063 108.652 1.00 423.67 ? 177 PHE B N   1 
ATOM 5990  C CA  . PHE B 2 177 ? 132.730 130.604 109.697 1.00 446.98 ? 177 PHE B CA  1 
ATOM 5991  C C   . PHE B 2 177 ? 133.480 129.837 110.761 1.00 447.12 ? 177 PHE B C   1 
ATOM 5992  O O   . PHE B 2 177 ? 133.248 130.061 111.964 1.00 479.33 ? 177 PHE B O   1 
ATOM 5993  C CB  . PHE B 2 177 ? 131.530 129.783 109.178 1.00 392.67 ? 177 PHE B CB  1 
ATOM 5994  C CG  . PHE B 2 177 ? 130.475 130.607 108.466 1.00 500.00 ? 177 PHE B CG  1 
ATOM 5995  C CD1 . PHE B 2 177 ? 130.108 131.887 108.908 1.00 500.00 ? 177 PHE B CD1 1 
ATOM 5996  C CD2 . PHE B 2 177 ? 129.815 130.087 107.354 1.00 500.00 ? 177 PHE B CD2 1 
ATOM 5997  C CE1 . PHE B 2 177 ? 129.132 132.630 108.237 1.00 500.00 ? 177 PHE B CE1 1 
ATOM 5998  C CE2 . PHE B 2 177 ? 128.836 130.820 106.683 1.00 500.00 ? 177 PHE B CE2 1 
ATOM 5999  C CZ  . PHE B 2 177 ? 128.492 132.093 107.125 1.00 500.00 ? 177 PHE B CZ  1 
ATOM 6000  N N   . SER B 2 178 ? 134.373 128.954 110.302 1.00 390.63 ? 178 SER B N   1 
ATOM 6001  C CA  . SER B 2 178 ? 135.177 128.126 111.214 1.00 448.73 ? 178 SER B CA  1 
ATOM 6002  C C   . SER B 2 178 ? 136.007 129.005 112.129 1.00 380.28 ? 178 SER B C   1 
ATOM 6003  O O   . SER B 2 178 ? 136.069 128.770 113.344 1.00 377.66 ? 178 SER B O   1 
ATOM 6004  C CB  . SER B 2 178 ? 136.103 127.182 110.481 1.00 500.00 ? 178 SER B CB  1 
ATOM 6005  O OG  . SER B 2 178 ? 136.760 126.313 111.391 1.00 500.00 ? 178 SER B OG  1 
ATOM 6006  N N   . PHE B 2 179 ? 136.625 130.008 111.520 1.00 421.10 ? 179 PHE B N   1 
ATOM 6007  C CA  . PHE B 2 179 ? 137.475 130.973 112.228 1.00 448.26 ? 179 PHE B CA  1 
ATOM 6008  C C   . PHE B 2 179 ? 136.673 131.664 113.329 1.00 395.37 ? 179 PHE B C   1 
ATOM 6009  O O   . PHE B 2 179 ? 137.133 131.783 114.482 1.00 388.78 ? 179 PHE B O   1 
ATOM 6010  C CB  . PHE B 2 179 ? 138.046 131.937 111.183 1.00 430.84 ? 179 PHE B CB  1 
ATOM 6011  C CG  . PHE B 2 179 ? 138.493 133.221 111.727 1.00 434.23 ? 179 PHE B CG  1 
ATOM 6012  C CD1 . PHE B 2 179 ? 139.718 133.318 112.354 1.00 494.75 ? 179 PHE B CD1 1 
ATOM 6013  C CD2 . PHE B 2 179 ? 137.693 134.347 111.592 1.00 500.00 ? 179 PHE B CD2 1 
ATOM 6014  C CE1 . PHE B 2 179 ? 140.143 134.528 112.859 1.00 500.00 ? 179 PHE B CE1 1 
ATOM 6015  C CE2 . PHE B 2 179 ? 138.104 135.564 112.091 1.00 500.00 ? 179 PHE B CE2 1 
ATOM 6016  C CZ  . PHE B 2 179 ? 139.336 135.656 112.727 1.00 500.00 ? 179 PHE B CZ  1 
ATOM 6017  N N   . ILE B 2 180 ? 135.481 132.099 112.936 1.00 379.80 ? 180 ILE B N   1 
ATOM 6018  C CA  . ILE B 2 180 ? 134.550 132.792 113.836 1.00 423.49 ? 180 ILE B CA  1 
ATOM 6019  C C   . ILE B 2 180 ? 134.232 131.911 115.037 1.00 404.23 ? 180 ILE B C   1 
ATOM 6020  O O   . ILE B 2 180 ? 134.263 132.368 116.190 1.00 441.85 ? 180 ILE B O   1 
ATOM 6021  C CB  . ILE B 2 180 ? 133.212 133.178 113.119 1.00 479.40 ? 180 ILE B CB  1 
ATOM 6022  C CG1 . ILE B 2 180 ? 133.282 134.624 112.618 1.00 500.00 ? 180 ILE B CG1 1 
ATOM 6023  C CG2 . ILE B 2 180 ? 131.968 133.024 114.012 1.00 462.39 ? 180 ILE B CG2 1 
ATOM 6024  C CD1 . ILE B 2 180 ? 132.148 135.029 111.693 1.00 500.00 ? 180 ILE B CD1 1 
ATOM 6025  N N   . TYR B 2 181 ? 133.926 130.660 114.727 1.00 380.58 ? 181 TYR B N   1 
ATOM 6026  C CA  . TYR B 2 181 ? 133.579 129.649 115.733 1.00 392.46 ? 181 TYR B CA  1 
ATOM 6027  C C   . TYR B 2 181 ? 134.718 129.496 116.734 1.00 415.16 ? 181 TYR B C   1 
ATOM 6028  O O   . TYR B 2 181 ? 134.491 129.481 117.956 1.00 462.13 ? 181 TYR B O   1 
ATOM 6029  C CB  . TYR B 2 181 ? 133.222 128.307 115.062 1.00 433.63 ? 181 TYR B CB  1 
ATOM 6030  C CG  . TYR B 2 181 ? 133.248 127.064 115.947 1.00 418.17 ? 181 TYR B CG  1 
ATOM 6031  C CD1 . TYR B 2 181 ? 134.412 126.315 116.097 1.00 409.43 ? 181 TYR B CD1 1 
ATOM 6032  C CD2 . TYR B 2 181 ? 132.093 126.610 116.588 1.00 413.52 ? 181 TYR B CD2 1 
ATOM 6033  C CE1 . TYR B 2 181 ? 134.432 125.176 116.891 1.00 466.80 ? 181 TYR B CE1 1 
ATOM 6034  C CE2 . TYR B 2 181 ? 132.103 125.477 117.383 1.00 403.18 ? 181 TYR B CE2 1 
ATOM 6035  C CZ  . TYR B 2 181 ? 133.276 124.762 117.535 1.00 465.08 ? 181 TYR B CZ  1 
ATOM 6036  O OH  . TYR B 2 181 ? 133.286 123.630 118.324 1.00 500.00 ? 181 TYR B OH  1 
ATOM 6037  N N   . LEU B 2 182 ? 135.920 129.393 116.182 1.00 404.32 ? 182 LEU B N   1 
ATOM 6038  C CA  . LEU B 2 182 ? 137.144 129.232 116.969 1.00 408.51 ? 182 LEU B CA  1 
ATOM 6039  C C   . LEU B 2 182 ? 137.300 130.399 117.941 1.00 397.90 ? 182 LEU B C   1 
ATOM 6040  O O   . LEU B 2 182 ? 137.584 130.207 119.145 1.00 378.56 ? 182 LEU B O   1 
ATOM 6041  C CB  . LEU B 2 182 ? 138.366 129.157 116.071 1.00 445.25 ? 182 LEU B CB  1 
ATOM 6042  C CG  . LEU B 2 182 ? 139.550 128.493 116.762 1.00 500.00 ? 182 LEU B CG  1 
ATOM 6043  C CD1 . LEU B 2 182 ? 139.441 126.976 116.653 1.00 500.00 ? 182 LEU B CD1 1 
ATOM 6044  C CD2 . LEU B 2 182 ? 140.838 128.996 116.137 1.00 500.00 ? 182 LEU B CD2 1 
ATOM 6045  N N   . GLY B 2 183 ? 137.103 131.590 117.382 1.00 419.88 ? 183 GLY B N   1 
ATOM 6046  C CA  . GLY B 2 183 ? 137.210 132.839 118.142 1.00 481.56 ? 183 GLY B CA  1 
ATOM 6047  C C   . GLY B 2 183 ? 136.239 132.835 119.309 1.00 462.78 ? 183 GLY B C   1 
ATOM 6048  O O   . GLY B 2 183 ? 136.605 133.180 120.443 1.00 449.69 ? 183 GLY B O   1 
ATOM 6049  N N   . GLU B 2 184 ? 135.014 132.436 118.995 1.00 454.72 ? 184 GLU B N   1 
ATOM 6050  C CA  . GLU B 2 184 ? 133.930 132.372 119.983 1.00 487.60 ? 184 GLU B CA  1 
ATOM 6051  C C   . GLU B 2 184 ? 134.307 131.434 121.114 1.00 423.60 ? 184 GLU B C   1 
ATOM 6052  O O   . GLU B 2 184 ? 134.125 131.773 122.293 1.00 479.45 ? 184 GLU B O   1 
ATOM 6053  C CB  . GLU B 2 184 ? 132.583 132.135 119.314 1.00 500.00 ? 184 GLU B CB  1 
ATOM 6054  C CG  . GLU B 2 184 ? 131.862 133.446 118.937 1.00 500.00 ? 184 GLU B CG  1 
ATOM 6055  C CD  . GLU B 2 184 ? 132.750 134.682 118.667 1.00 500.00 ? 184 GLU B CD  1 
ATOM 6056  O OE1 . GLU B 2 184 ? 133.616 134.634 117.769 1.00 500.00 ? 184 GLU B OE1 1 
ATOM 6057  O OE2 . GLU B 2 184 ? 132.566 135.724 119.349 1.00 500.00 ? 184 GLU B OE2 1 
ATOM 6058  N N   . VAL B 2 185 ? 134.837 130.280 120.730 1.00 396.13 ? 185 VAL B N   1 
ATOM 6059  C CA  . VAL B 2 185 ? 135.268 129.248 121.679 1.00 428.69 ? 185 VAL B CA  1 
ATOM 6060  C C   . VAL B 2 185 ? 136.318 129.823 122.631 1.00 414.44 ? 185 VAL B C   1 
ATOM 6061  O O   . VAL B 2 185 ? 136.235 129.635 123.864 1.00 429.45 ? 185 VAL B O   1 
ATOM 6062  C CB  . VAL B 2 185 ? 135.844 127.997 120.983 1.00 500.00 ? 185 VAL B CB  1 
ATOM 6063  C CG1 . VAL B 2 185 ? 136.576 127.090 121.978 1.00 500.00 ? 185 VAL B CG1 1 
ATOM 6064  C CG2 . VAL B 2 185 ? 134.735 127.226 120.272 1.00 500.00 ? 185 VAL B CG2 1 
ATOM 6065  N N   . PHE B 2 186 ? 137.279 130.516 122.020 1.00 366.93 ? 186 PHE B N   1 
ATOM 6066  C CA  . PHE B 2 186 ? 138.377 131.129 122.765 1.00 388.88 ? 186 PHE B CA  1 
ATOM 6067  C C   . PHE B 2 186 ? 137.836 132.124 123.791 1.00 393.33 ? 186 PHE B C   1 
ATOM 6068  O O   . PHE B 2 186 ? 138.260 132.125 124.961 1.00 378.31 ? 186 PHE B O   1 
ATOM 6069  C CB  . PHE B 2 186 ? 139.474 131.675 121.863 1.00 419.20 ? 186 PHE B CB  1 
ATOM 6070  C CG  . PHE B 2 186 ? 140.393 130.612 121.344 1.00 430.47 ? 186 PHE B CG  1 
ATOM 6071  C CD1 . PHE B 2 186 ? 141.040 129.742 122.226 1.00 448.32 ? 186 PHE B CD1 1 
ATOM 6072  C CD2 . PHE B 2 186 ? 140.616 130.465 119.978 1.00 452.04 ? 186 PHE B CD2 1 
ATOM 6073  C CE1 . PHE B 2 186 ? 141.878 128.743 121.756 1.00 494.07 ? 186 PHE B CE1 1 
ATOM 6074  C CE2 . PHE B 2 186 ? 141.464 129.473 119.506 1.00 462.41 ? 186 PHE B CE2 1 
ATOM 6075  C CZ  . PHE B 2 186 ? 142.097 128.612 120.392 1.00 500.00 ? 186 PHE B CZ  1 
ATOM 6076  N N   . LYS B 2 187 ? 136.894 132.933 123.324 1.00 359.49 ? 187 LYS B N   1 
ATOM 6077  C CA  . LYS B 2 187 ? 136.248 133.955 124.152 1.00 374.52 ? 187 LYS B CA  1 
ATOM 6078  C C   . LYS B 2 187 ? 135.579 133.308 125.355 1.00 392.79 ? 187 LYS B C   1 
ATOM 6079  O O   . LYS B 2 187 ? 135.724 133.778 126.497 1.00 481.27 ? 187 LYS B O   1 
ATOM 6080  C CB  . LYS B 2 187 ? 135.252 134.797 123.343 1.00 409.95 ? 187 LYS B CB  1 
ATOM 6081  C CG  . LYS B 2 187 ? 135.878 135.619 122.220 1.00 460.05 ? 187 LYS B CG  1 
ATOM 6082  C CD  . LYS B 2 187 ? 136.405 136.975 122.661 1.00 471.20 ? 187 LYS B CD  1 
ATOM 6083  C CE  . LYS B 2 187 ? 137.534 137.478 121.759 1.00 495.56 ? 187 LYS B CE  1 
ATOM 6084  N NZ  . LYS B 2 187 ? 137.165 137.573 120.312 1.00 498.63 ? 187 LYS B NZ  1 
ATOM 6085  N N   . THR B 2 188 ? 134.858 132.229 125.067 1.00 416.85 ? 188 THR B N   1 
ATOM 6086  C CA  . THR B 2 188 ? 134.131 131.466 126.089 1.00 435.06 ? 188 THR B CA  1 
ATOM 6087  C C   . THR B 2 188 ? 135.093 130.963 127.146 1.00 372.45 ? 188 THR B C   1 
ATOM 6088  O O   . THR B 2 188 ? 134.808 131.088 128.356 1.00 440.80 ? 188 THR B O   1 
ATOM 6089  C CB  . THR B 2 188 ? 133.324 130.286 125.529 1.00 488.06 ? 188 THR B CB  1 
ATOM 6090  O OG1 . THR B 2 188 ? 132.472 130.755 124.479 1.00 500.00 ? 188 THR B OG1 1 
ATOM 6091  C CG2 . THR B 2 188 ? 132.473 129.632 126.643 1.00 462.06 ? 188 THR B CG2 1 
ATOM 6092  N N   . TYR B 2 189 ? 136.212 130.414 126.667 1.00 314.86 ? 189 TYR B N   1 
ATOM 6093  C CA  . TYR B 2 189 ? 137.262 129.912 127.568 1.00 415.48 ? 189 TYR B CA  1 
ATOM 6094  C C   . TYR B 2 189 ? 138.144 131.010 128.115 1.00 394.19 ? 189 TYR B C   1 
ATOM 6095  O O   . TYR B 2 189 ? 138.745 130.848 129.187 1.00 359.70 ? 189 TYR B O   1 
ATOM 6096  C CB  . TYR B 2 189 ? 137.984 128.664 127.043 1.00 500.00 ? 189 TYR B CB  1 
ATOM 6097  C CG  . TYR B 2 189 ? 137.296 127.395 127.555 1.00 500.00 ? 189 TYR B CG  1 
ATOM 6098  C CD1 . TYR B 2 189 ? 136.003 127.058 127.124 1.00 500.00 ? 189 TYR B CD1 1 
ATOM 6099  C CD2 . TYR B 2 189 ? 137.902 126.567 128.509 1.00 500.00 ? 189 TYR B CD2 1 
ATOM 6100  C CE1 . TYR B 2 189 ? 135.349 125.923 127.600 1.00 500.00 ? 189 TYR B CE1 1 
ATOM 6101  C CE2 . TYR B 2 189 ? 137.252 125.426 128.986 1.00 500.00 ? 189 TYR B CE2 1 
ATOM 6102  C CZ  . TYR B 2 189 ? 135.976 125.111 128.530 1.00 500.00 ? 189 TYR B CZ  1 
ATOM 6103  O OH  . TYR B 2 189 ? 135.319 123.991 128.991 1.00 500.00 ? 189 TYR B OH  1 
ATOM 6104  N N   . ASN B 2 190 ? 138.134 132.147 127.414 1.00 398.72 ? 190 ASN B N   1 
ATOM 6105  C CA  . ASN B 2 190 ? 138.741 133.397 127.859 1.00 441.22 ? 190 ASN B CA  1 
ATOM 6106  C C   . ASN B 2 190 ? 140.223 133.166 128.039 1.00 433.13 ? 190 ASN B C   1 
ATOM 6107  O O   . ASN B 2 190 ? 140.763 133.303 129.142 1.00 451.62 ? 190 ASN B O   1 
ATOM 6108  C CB  . ASN B 2 190 ? 138.070 133.918 129.145 1.00 477.80 ? 190 ASN B CB  1 
ATOM 6109  C CG  . ASN B 2 190 ? 138.317 135.406 129.390 1.00 457.71 ? 190 ASN B CG  1 
ATOM 6110  O OD1 . ASN B 2 190 ? 137.831 136.258 128.644 1.00 385.37 ? 190 ASN B OD1 1 
ATOM 6111  N ND2 . ASN B 2 190 ? 139.045 135.724 130.463 1.00 458.69 ? 190 ASN B ND2 1 
ATOM 6112  N N   . VAL B 2 191 ? 140.859 132.747 126.947 1.00 403.24 ? 191 VAL B N   1 
ATOM 6113  C CA  . VAL B 2 191 ? 142.291 132.492 126.937 1.00 422.73 ? 191 VAL B CA  1 
ATOM 6114  C C   . VAL B 2 191 ? 142.898 133.111 125.693 1.00 421.06 ? 191 VAL B C   1 
ATOM 6115  O O   . VAL B 2 191 ? 142.352 132.990 124.595 1.00 363.97 ? 191 VAL B O   1 
ATOM 6116  C CB  . VAL B 2 191 ? 142.635 130.991 126.996 1.00 479.62 ? 191 VAL B CB  1 
ATOM 6117  C CG1 . VAL B 2 191 ? 144.112 130.793 127.335 1.00 483.44 ? 191 VAL B CG1 1 
ATOM 6118  C CG2 . VAL B 2 191 ? 141.770 130.284 128.029 1.00 500.00 ? 191 VAL B CG2 1 
ATOM 6119  N N   . ALA B 2 192 ? 144.049 133.749 125.896 1.00 477.54 ? 192 ALA B N   1 
ATOM 6120  C CA  . ALA B 2 192 ? 144.719 134.539 124.878 1.00 474.47 ? 192 ALA B CA  1 
ATOM 6121  C C   . ALA B 2 192 ? 145.352 133.657 123.818 1.00 438.79 ? 192 ALA B C   1 
ATOM 6122  O O   . ALA B 2 192 ? 146.186 132.793 124.124 1.00 401.93 ? 192 ALA B O   1 
ATOM 6123  C CB  . ALA B 2 192 ? 145.784 135.418 125.519 1.00 500.00 ? 192 ALA B CB  1 
ATOM 6124  N N   . VAL B 2 193 ? 144.967 133.898 122.568 1.00 412.85 ? 193 VAL B N   1 
ATOM 6125  C CA  . VAL B 2 193 ? 145.556 133.220 121.426 1.00 423.54 ? 193 VAL B CA  1 
ATOM 6126  C C   . VAL B 2 193 ? 145.778 134.240 120.322 1.00 405.19 ? 193 VAL B C   1 
ATOM 6127  O O   . VAL B 2 193 ? 144.885 135.030 120.005 1.00 418.45 ? 193 VAL B O   1 
ATOM 6128  C CB  . VAL B 2 193 ? 144.662 132.088 120.915 1.00 500.00 ? 193 VAL B CB  1 
ATOM 6129  C CG1 . VAL B 2 193 ? 145.377 131.323 119.806 1.00 500.00 ? 193 VAL B CG1 1 
ATOM 6130  C CG2 . VAL B 2 193 ? 144.289 131.153 122.059 1.00 500.00 ? 193 VAL B CG2 1 
ATOM 6131  N N   . ASP B 2 194 ? 146.973 134.208 119.747 1.00 399.59 ? 194 ASP B N   1 
ATOM 6132  C CA  . ASP B 2 194 ? 147.416 135.244 118.808 1.00 444.75 ? 194 ASP B CA  1 
ATOM 6133  C C   . ASP B 2 194 ? 146.836 135.051 117.428 1.00 425.33 ? 194 ASP B C   1 
ATOM 6134  O O   . ASP B 2 194 ? 146.336 133.972 117.114 1.00 411.01 ? 194 ASP B O   1 
ATOM 6135  C CB  . ASP B 2 194 ? 148.945 135.317 118.721 1.00 496.97 ? 194 ASP B CB  1 
ATOM 6136  C CG  . ASP B 2 194 ? 149.595 133.972 118.480 1.00 500.00 ? 194 ASP B CG  1 
ATOM 6137  O OD1 . ASP B 2 194 ? 149.558 133.488 117.332 1.00 500.00 ? 194 ASP B OD1 1 
ATOM 6138  O OD2 . ASP B 2 194 ? 150.181 133.415 119.433 1.00 500.00 ? 194 ASP B OD2 1 
ATOM 6139  N N   . TYR B 2 195 ? 146.932 136.100 116.606 1.00 434.95 ? 195 TYR B N   1 
ATOM 6140  C CA  . TYR B 2 195 ? 146.398 136.062 115.244 1.00 459.30 ? 195 TYR B CA  1 
ATOM 6141  C C   . TYR B 2 195 ? 147.085 134.959 114.450 1.00 445.85 ? 195 TYR B C   1 
ATOM 6142  O O   . TYR B 2 195 ? 146.402 134.224 113.714 1.00 498.43 ? 195 TYR B O   1 
ATOM 6143  C CB  . TYR B 2 195 ? 146.550 137.388 114.479 1.00 464.85 ? 195 TYR B CB  1 
ATOM 6144  C CG  . TYR B 2 195 ? 145.254 138.143 114.437 1.00 500.00 ? 195 TYR B CG  1 
ATOM 6145  C CD1 . TYR B 2 195 ? 144.269 137.817 113.505 1.00 471.22 ? 195 TYR B CD1 1 
ATOM 6146  C CD2 . TYR B 2 195 ? 144.982 139.148 115.366 1.00 500.00 ? 195 TYR B CD2 1 
ATOM 6147  C CE1 . TYR B 2 195 ? 143.056 138.488 113.484 1.00 495.19 ? 195 TYR B CE1 1 
ATOM 6148  C CE2 . TYR B 2 195 ? 143.772 139.827 115.355 1.00 500.00 ? 195 TYR B CE2 1 
ATOM 6149  C CZ  . TYR B 2 195 ? 142.813 139.494 114.414 1.00 500.00 ? 195 TYR B CZ  1 
ATOM 6150  O OH  . TYR B 2 195 ? 141.616 140.174 114.406 1.00 500.00 ? 195 TYR B OH  1 
ATOM 6151  N N   . ILE B 2 196 ? 148.398 134.808 114.645 1.00 435.90 ? 196 ILE B N   1 
ATOM 6152  C CA  . ILE B 2 196 ? 149.229 133.997 113.802 1.00 448.95 ? 196 ILE B CA  1 
ATOM 6153  C C   . ILE B 2 196 ? 148.843 132.557 114.017 1.00 428.92 ? 196 ILE B C   1 
ATOM 6154  O O   . ILE B 2 196 ? 148.675 131.818 113.023 1.00 442.88 ? 196 ILE B O   1 
ATOM 6155  C CB  . ILE B 2 196 ? 150.732 134.261 114.049 1.00 491.83 ? 196 ILE B CB  1 
ATOM 6156  C CG1 . ILE B 2 196 ? 151.085 135.687 113.591 1.00 500.00 ? 196 ILE B CG1 1 
ATOM 6157  C CG2 . ILE B 2 196 ? 151.609 133.232 113.347 1.00 500.00 ? 196 ILE B CG2 1 
ATOM 6158  C CD1 . ILE B 2 196 ? 150.656 136.050 112.176 1.00 500.00 ? 196 ILE B CD1 1 
ATOM 6159  N N   . THR B 2 197 ? 148.802 132.136 115.276 1.00 386.66 ? 197 THR B N   1 
ATOM 6160  C CA  . THR B 2 197 ? 148.534 130.749 115.647 1.00 374.37 ? 197 THR B CA  1 
ATOM 6161  C C   . THR B 2 197 ? 147.197 130.295 115.077 1.00 396.39 ? 197 THR B C   1 
ATOM 6162  O O   . THR B 2 197 ? 147.068 129.215 114.472 1.00 410.90 ? 197 THR B O   1 
ATOM 6163  C CB  . THR B 2 197 ? 148.460 130.578 117.174 1.00 404.79 ? 197 THR B CB  1 
ATOM 6164  O OG1 . THR B 2 197 ? 149.741 130.849 117.744 1.00 450.43 ? 197 THR B OG1 1 
ATOM 6165  C CG2 . THR B 2 197 ? 148.039 129.157 117.567 1.00 440.14 ? 197 THR B CG2 1 
ATOM 6166  N N   . VAL B 2 198 ? 146.213 131.163 115.301 1.00 415.72 ? 198 VAL B N   1 
ATOM 6167  C CA  . VAL B 2 198 ? 144.828 130.904 114.842 1.00 440.04 ? 198 VAL B CA  1 
ATOM 6168  C C   . VAL B 2 198 ? 144.811 130.760 113.340 1.00 450.58 ? 198 VAL B C   1 
ATOM 6169  O O   . VAL B 2 198 ? 144.160 129.834 112.822 1.00 409.36 ? 198 VAL B O   1 
ATOM 6170  C CB  . VAL B 2 198 ? 143.798 131.945 115.340 1.00 483.60 ? 198 VAL B CB  1 
ATOM 6171  C CG1 . VAL B 2 198 ? 142.479 131.861 114.559 1.00 460.27 ? 198 VAL B CG1 1 
ATOM 6172  C CG2 . VAL B 2 198 ? 143.559 131.745 116.834 1.00 500.00 ? 198 VAL B CG2 1 
ATOM 6173  N N   . ALA B 2 199 ? 145.519 131.653 112.663 1.00 500.00 ? 199 ALA B N   1 
ATOM 6174  C CA  . ALA B 2 199 ? 145.619 131.645 111.198 1.00 500.00 ? 199 ALA B CA  1 
ATOM 6175  C C   . ALA B 2 199 ? 146.174 130.321 110.714 1.00 500.00 ? 199 ALA B C   1 
ATOM 6176  O O   . ALA B 2 199 ? 145.656 129.723 109.775 1.00 500.00 ? 199 ALA B O   1 
ATOM 6177  C CB  . ALA B 2 199 ? 146.474 132.795 110.690 1.00 500.00 ? 199 ALA B CB  1 
ATOM 6178  N N   . LEU B 2 200 ? 147.241 129.897 111.378 1.00 500.00 ? 200 LEU B N   1 
ATOM 6179  C CA  . LEU B 2 200 ? 147.941 128.641 111.069 1.00 489.34 ? 200 LEU B CA  1 
ATOM 6180  C C   . LEU B 2 200 ? 146.966 127.475 111.183 1.00 441.08 ? 200 LEU B C   1 
ATOM 6181  O O   . LEU B 2 200 ? 146.885 126.609 110.269 1.00 429.71 ? 200 LEU B O   1 
ATOM 6182  C CB  . LEU B 2 200 ? 149.125 128.467 112.039 1.00 472.47 ? 200 LEU B CB  1 
ATOM 6183  C CG  . LEU B 2 200 ? 149.847 127.127 112.243 1.00 467.08 ? 200 LEU B CG  1 
ATOM 6184  C CD1 . LEU B 2 200 ? 151.170 127.410 112.943 1.00 494.72 ? 200 LEU B CD1 1 
ATOM 6185  C CD2 . LEU B 2 200 ? 149.040 126.092 113.032 1.00 435.28 ? 200 LEU B CD2 1 
ATOM 6186  N N   . LEU B 2 201 ? 146.224 127.487 112.284 1.00 383.46 ? 201 LEU B N   1 
ATOM 6187  C CA  . LEU B 2 201 ? 145.287 126.414 112.609 1.00 449.68 ? 201 LEU B CA  1 
ATOM 6188  C C   . LEU B 2 201 ? 144.209 126.353 111.504 1.00 447.16 ? 201 LEU B C   1 
ATOM 6189  O O   . LEU B 2 201 ? 143.862 125.275 110.969 1.00 500.00 ? 201 LEU B O   1 
ATOM 6190  C CB  . LEU B 2 201 ? 144.710 126.648 114.023 1.00 500.00 ? 201 LEU B CB  1 
ATOM 6191  C CG  . LEU B 2 201 ? 144.171 125.522 114.944 1.00 500.00 ? 201 LEU B CG  1 
ATOM 6192  C CD1 . LEU B 2 201 ? 144.479 124.100 114.492 1.00 500.00 ? 201 LEU B CD1 1 
ATOM 6193  C CD2 . LEU B 2 201 ? 144.666 125.706 116.379 1.00 500.00 ? 201 LEU B CD2 1 
ATOM 6194  N N   . ILE B 2 202 ? 143.672 127.510 111.203 1.00 379.93 ? 202 ILE B N   1 
ATOM 6195  C CA  . ILE B 2 202 ? 142.615 127.595 110.189 1.00 424.71 ? 202 ILE B CA  1 
ATOM 6196  C C   . ILE B 2 202 ? 143.134 127.182 108.834 1.00 423.53 ? 202 ILE B C   1 
ATOM 6197  O O   . ILE B 2 202 ? 142.425 126.472 108.127 1.00 411.98 ? 202 ILE B O   1 
ATOM 6198  C CB  . ILE B 2 202 ? 141.891 128.961 110.318 1.00 478.39 ? 202 ILE B CB  1 
ATOM 6199  C CG1 . ILE B 2 202 ? 140.665 128.827 111.253 1.00 499.59 ? 202 ILE B CG1 1 
ATOM 6200  C CG2 . ILE B 2 202 ? 141.427 129.513 108.987 1.00 500.00 ? 202 ILE B CG2 1 
ATOM 6201  C CD1 . ILE B 2 202 ? 140.720 127.776 112.360 1.00 441.44 ? 202 ILE B CD1 1 
ATOM 6202  N N   . TRP B 2 203 ? 144.374 127.580 108.519 1.00 417.54 ? 203 TRP B N   1 
ATOM 6203  C CA  . TRP B 2 203 ? 145.036 127.197 107.277 1.00 428.44 ? 203 TRP B CA  1 
ATOM 6204  C C   . TRP B 2 203 ? 145.107 125.673 107.166 1.00 406.70 ? 203 TRP B C   1 
ATOM 6205  O O   . TRP B 2 203 ? 144.788 125.049 106.154 1.00 404.60 ? 203 TRP B O   1 
ATOM 6206  C CB  . TRP B 2 203 ? 146.446 127.805 107.221 1.00 472.86 ? 203 TRP B CB  1 
ATOM 6207  C CG  . TRP B 2 203 ? 147.164 127.695 105.903 1.00 476.86 ? 203 TRP B CG  1 
ATOM 6208  C CD1 . TRP B 2 203 ? 148.225 126.891 105.621 1.00 451.50 ? 203 TRP B CD1 1 
ATOM 6209  C CD2 . TRP B 2 203 ? 146.902 128.445 104.708 1.00 477.56 ? 203 TRP B CD2 1 
ATOM 6210  N NE1 . TRP B 2 203 ? 148.631 127.072 104.320 1.00 446.17 ? 203 TRP B NE1 1 
ATOM 6211  C CE2 . TRP B 2 203 ? 147.835 128.022 103.736 1.00 467.54 ? 203 TRP B CE2 1 
ATOM 6212  C CE3 . TRP B 2 203 ? 145.962 129.428 104.361 1.00 486.12 ? 203 TRP B CE3 1 
ATOM 6213  C CZ2 . TRP B 2 203 ? 147.858 128.546 102.437 1.00 484.83 ? 203 TRP B CZ2 1 
ATOM 6214  C CZ3 . TRP B 2 203 ? 145.984 129.950 103.068 1.00 479.95 ? 203 TRP B CZ3 1 
ATOM 6215  C CH2 . TRP B 2 203 ? 146.928 129.507 102.123 1.00 483.66 ? 203 TRP B CH2 1 
ATOM 6216  N N   . ASN B 2 204 ? 145.509 125.054 108.264 1.00 424.70 ? 204 ASN B N   1 
ATOM 6217  C CA  . ASN B 2 204 ? 145.571 123.593 108.337 1.00 462.21 ? 204 ASN B CA  1 
ATOM 6218  C C   . ASN B 2 204 ? 144.154 123.070 108.277 1.00 471.84 ? 204 ASN B C   1 
ATOM 6219  O O   . ASN B 2 204 ? 143.751 122.478 107.279 1.00 500.00 ? 204 ASN B O   1 
ATOM 6220  C CB  . ASN B 2 204 ? 146.318 123.110 109.564 1.00 466.17 ? 204 ASN B CB  1 
ATOM 6221  C CG  . ASN B 2 204 ? 147.808 123.086 109.342 1.00 456.22 ? 204 ASN B CG  1 
ATOM 6222  O OD1 . ASN B 2 204 ? 148.429 122.031 109.367 1.00 417.42 ? 204 ASN B OD1 1 
ATOM 6223  N ND2 . ASN B 2 204 ? 148.386 124.250 109.077 1.00 478.55 ? 204 ASN B ND2 1 
ATOM 6224  N N   . PHE B 2 205 ? 143.397 123.369 109.333 1.00 444.96 ? 205 PHE B N   1 
ATOM 6225  C CA  . PHE B 2 205 ? 142.048 122.854 109.515 1.00 459.98 ? 205 PHE B CA  1 
ATOM 6226  C C   . PHE B 2 205 ? 141.251 123.040 108.220 1.00 459.20 ? 205 PHE B C   1 
ATOM 6227  O O   . PHE B 2 205 ? 140.522 122.154 107.783 1.00 465.89 ? 205 PHE B O   1 
ATOM 6228  C CB  . PHE B 2 205 ? 141.302 123.601 110.622 1.00 487.25 ? 205 PHE B CB  1 
ATOM 6229  C CG  . PHE B 2 205 ? 139.887 123.130 110.809 1.00 500.00 ? 205 PHE B CG  1 
ATOM 6230  C CD1 . PHE B 2 205 ? 138.842 123.660 110.044 1.00 500.00 ? 205 PHE B CD1 1 
ATOM 6231  C CD2 . PHE B 2 205 ? 139.597 122.121 111.723 1.00 500.00 ? 205 PHE B CD2 1 
ATOM 6232  C CE1 . PHE B 2 205 ? 137.540 123.200 110.204 1.00 494.46 ? 205 PHE B CE1 1 
ATOM 6233  C CE2 . PHE B 2 205 ? 138.295 121.664 111.891 1.00 500.00 ? 205 PHE B CE2 1 
ATOM 6234  C CZ  . PHE B 2 205 ? 137.264 122.208 111.131 1.00 500.00 ? 205 PHE B CZ  1 
ATOM 6235  N N   . GLY B 2 206 ? 141.367 124.225 107.644 1.00 434.75 ? 206 GLY B N   1 
ATOM 6236  C CA  . GLY B 2 206 ? 140.628 124.517 106.419 1.00 434.84 ? 206 GLY B CA  1 
ATOM 6237  C C   . GLY B 2 206 ? 141.119 123.740 105.211 1.00 386.45 ? 206 GLY B C   1 
ATOM 6238  O O   . GLY B 2 206 ? 140.314 123.088 104.524 1.00 396.18 ? 206 GLY B O   1 
ATOM 6239  N N   . VAL B 2 207 ? 142.405 123.920 104.914 1.00 398.73 ? 207 VAL B N   1 
ATOM 6240  C CA  . VAL B 2 207 ? 142.982 123.392 103.659 1.00 500.00 ? 207 VAL B CA  1 
ATOM 6241  C C   . VAL B 2 207 ? 142.867 121.862 103.674 1.00 425.36 ? 207 VAL B C   1 
ATOM 6242  O O   . VAL B 2 207 ? 142.493 121.276 102.649 1.00 396.20 ? 207 VAL B O   1 
ATOM 6243  C CB  . VAL B 2 207 ? 144.417 123.890 103.373 1.00 500.00 ? 207 VAL B CB  1 
ATOM 6244  C CG1 . VAL B 2 207 ? 144.972 123.241 102.105 1.00 500.00 ? 207 VAL B CG1 1 
ATOM 6245  C CG2 . VAL B 2 207 ? 144.447 125.416 103.229 1.00 500.00 ? 207 VAL B CG2 1 
ATOM 6246  N N   . VAL B 2 208 ? 143.167 121.257 104.818 1.00 401.00 ? 208 VAL B N   1 
ATOM 6247  C CA  . VAL B 2 208 ? 143.094 119.800 104.893 1.00 431.40 ? 208 VAL B CA  1 
ATOM 6248  C C   . VAL B 2 208 ? 141.674 119.315 104.702 1.00 426.50 ? 208 VAL B C   1 
ATOM 6249  O O   . VAL B 2 208 ? 141.475 118.325 103.984 1.00 443.57 ? 208 VAL B O   1 
ATOM 6250  C CB  . VAL B 2 208 ? 143.770 119.182 106.147 1.00 475.97 ? 208 VAL B CB  1 
ATOM 6251  C CG1 . VAL B 2 208 ? 145.231 119.614 106.237 1.00 477.53 ? 208 VAL B CG1 1 
ATOM 6252  C CG2 . VAL B 2 208 ? 143.008 119.487 107.428 1.00 500.00 ? 208 VAL B CG2 1 
ATOM 6253  N N   . GLY B 2 209 ? 140.719 120.039 105.279 1.00 397.68 ? 209 GLY B N   1 
ATOM 6254  C CA  . GLY B 2 209 ? 139.295 119.733 105.115 1.00 427.55 ? 209 GLY B CA  1 
ATOM 6255  C C   . GLY B 2 209 ? 138.910 119.758 103.646 1.00 464.52 ? 209 GLY B C   1 
ATOM 6256  O O   . GLY B 2 209 ? 138.226 118.853 103.149 1.00 449.40 ? 209 GLY B O   1 
ATOM 6257  N N   . MET B 2 210 ? 139.374 120.809 102.976 1.00 444.69 ? 210 MET B N   1 
ATOM 6258  C CA  . MET B 2 210 ? 139.119 121.031 101.549 1.00 429.05 ? 210 MET B CA  1 
ATOM 6259  C C   . MET B 2 210 ? 139.637 119.833 100.748 1.00 430.02 ? 210 MET B C   1 
ATOM 6260  O O   . MET B 2 210 ? 138.938 119.300 99.863  1.00 391.35 ? 210 MET B O   1 
ATOM 6261  C CB  . MET B 2 210 ? 139.889 122.258 101.029 1.00 420.02 ? 210 MET B CB  1 
ATOM 6262  C CG  . MET B 2 210 ? 139.416 123.627 101.485 1.00 441.68 ? 210 MET B CG  1 
ATOM 6263  S SD  . MET B 2 210 ? 137.681 123.993 101.168 1.00 500.00 ? 210 MET B SD  1 
ATOM 6264  C CE  . MET B 2 210 ? 137.609 123.959 99.388  1.00 500.00 ? 210 MET B CE  1 
ATOM 6265  N N   . ILE B 2 211 ? 140.864 119.445 101.077 1.00 452.66 ? 211 ILE B N   1 
ATOM 6266  C CA  . ILE B 2 211 ? 141.471 118.332 100.337 1.00 500.00 ? 211 ILE B CA  1 
ATOM 6267  C C   . ILE B 2 211 ? 140.720 117.048 100.570 1.00 489.45 ? 211 ILE B C   1 
ATOM 6268  O O   . ILE B 2 211 ? 140.523 116.303 99.610  1.00 500.00 ? 211 ILE B O   1 
ATOM 6269  C CB  . ILE B 2 211 ? 143.018 118.204 100.444 1.00 500.00 ? 211 ILE B CB  1 
ATOM 6270  C CG1 . ILE B 2 211 ? 143.487 117.715 101.811 1.00 500.00 ? 211 ILE B CG1 1 
ATOM 6271  C CG2 . ILE B 2 211 ? 143.686 119.522 100.063 1.00 500.00 ? 211 ILE B CG2 1 
ATOM 6272  C CD1 . ILE B 2 211 ? 143.398 116.216 102.029 1.00 500.00 ? 211 ILE B CD1 1 
ATOM 6273  N N   . SER B 2 212 ? 140.268 116.833 101.799 1.00 435.61 ? 212 SER B N   1 
ATOM 6274  C CA  . SER B 2 212 ? 139.453 115.666 102.157 1.00 456.93 ? 212 SER B CA  1 
ATOM 6275  C C   . SER B 2 212 ? 138.192 115.624 101.299 1.00 496.99 ? 212 SER B C   1 
ATOM 6276  O O   . SER B 2 212 ? 137.832 114.569 100.736 1.00 500.00 ? 212 SER B O   1 
ATOM 6277  C CB  . SER B 2 212 ? 139.034 115.658 103.634 1.00 419.77 ? 212 SER B CB  1 
ATOM 6278  O OG  . SER B 2 212 ? 139.706 114.622 104.346 1.00 432.11 ? 212 SER B OG  1 
ATOM 6279  N N   . ILE B 2 213 ? 137.556 116.787 101.214 1.00 463.73 ? 213 ILE B N   1 
ATOM 6280  C CA  . ILE B 2 213 ? 136.323 116.947 100.436 1.00 458.39 ? 213 ILE B CA  1 
ATOM 6281  C C   . ILE B 2 213 ? 136.573 116.572 98.965  1.00 455.50 ? 213 ILE B C   1 
ATOM 6282  O O   . ILE B 2 213 ? 135.765 115.867 98.370  1.00 402.78 ? 213 ILE B O   1 
ATOM 6283  C CB  . ILE B 2 213 ? 135.591 118.297 100.541 1.00 474.72 ? 213 ILE B CB  1 
ATOM 6284  C CG1 . ILE B 2 213 ? 135.443 118.788 101.992 1.00 481.43 ? 213 ILE B CG1 1 
ATOM 6285  C CG2 . ILE B 2 213 ? 134.204 118.156 99.914  1.00 449.99 ? 213 ILE B CG2 1 
ATOM 6286  C CD1 . ILE B 2 213 ? 135.195 117.725 103.045 1.00 459.73 ? 213 ILE B CD1 1 
ATOM 6287  N N   . HIS B 2 214 ? 137.743 116.966 98.439  1.00 487.00 ? 214 HIS B N   1 
ATOM 6288  C CA  . HIS B 2 214 ? 138.032 116.989 96.993  1.00 500.00 ? 214 HIS B CA  1 
ATOM 6289  C C   . HIS B 2 214 ? 139.146 116.050 96.423  1.00 500.00 ? 214 HIS B C   1 
ATOM 6290  O O   . HIS B 2 214 ? 138.836 115.230 95.553  1.00 500.00 ? 214 HIS B O   1 
ATOM 6291  C CB  . HIS B 2 214 ? 138.264 118.449 96.600  1.00 481.28 ? 214 HIS B CB  1 
ATOM 6292  C CG  . HIS B 2 214 ? 137.169 119.354 97.074  1.00 487.37 ? 214 HIS B CG  1 
ATOM 6293  N ND1 . HIS B 2 214 ? 137.392 120.474 97.846  1.00 474.66 ? 214 HIS B ND1 1 
ATOM 6294  C CD2 . HIS B 2 214 ? 135.826 119.252 96.941  1.00 500.00 ? 214 HIS B CD2 1 
ATOM 6295  C CE1 . HIS B 2 214 ? 136.234 121.047 98.131  1.00 454.21 ? 214 HIS B CE1 1 
ATOM 6296  N NE2 . HIS B 2 214 ? 135.269 120.324 97.595  1.00 499.68 ? 214 HIS B NE2 1 
ATOM 6297  N N   . TRP B 2 215 ? 140.402 116.151 96.889  1.00 500.00 ? 215 TRP B N   1 
ATOM 6298  C CA  . TRP B 2 215 ? 141.558 115.405 96.284  1.00 482.12 ? 215 TRP B CA  1 
ATOM 6299  C C   . TRP B 2 215 ? 141.852 114.037 96.961  1.00 407.82 ? 215 TRP B C   1 
ATOM 6300  O O   . TRP B 2 215 ? 142.985 113.717 97.364  1.00 348.58 ? 215 TRP B O   1 
ATOM 6301  C CB  . TRP B 2 215 ? 142.808 116.304 96.237  1.00 500.00 ? 215 TRP B CB  1 
ATOM 6302  C CG  . TRP B 2 215 ? 143.883 115.909 95.202  1.00 500.00 ? 215 TRP B CG  1 
ATOM 6303  C CD1 . TRP B 2 215 ? 144.989 115.118 95.425  1.00 500.00 ? 215 TRP B CD1 1 
ATOM 6304  C CD2 . TRP B 2 215 ? 143.964 116.319 93.807  1.00 500.00 ? 215 TRP B CD2 1 
ATOM 6305  N NE1 . TRP B 2 215 ? 145.735 115.002 94.266  1.00 500.00 ? 215 TRP B NE1 1 
ATOM 6306  C CE2 . TRP B 2 215 ? 145.138 115.723 93.260  1.00 500.00 ? 215 TRP B CE2 1 
ATOM 6307  C CE3 . TRP B 2 215 ? 143.156 117.122 92.968  1.00 500.00 ? 215 TRP B CE3 1 
ATOM 6308  C CZ2 . TRP B 2 215 ? 145.528 115.904 91.902  1.00 485.92 ? 215 TRP B CZ2 1 
ATOM 6309  C CZ3 . TRP B 2 215 ? 143.545 117.298 91.608  1.00 491.79 ? 215 TRP B CZ3 1 
ATOM 6310  C CH2 . TRP B 2 215 ? 144.724 116.688 91.099  1.00 426.64 ? 215 TRP B CH2 1 
ATOM 6311  N N   . LYS B 2 216 ? 140.796 113.230 97.007  1.00 416.01 ? 216 LYS B N   1 
ATOM 6312  C CA  . LYS B 2 216 ? 140.742 111.941 97.700  1.00 469.29 ? 216 LYS B CA  1 
ATOM 6313  C C   . LYS B 2 216 ? 140.854 112.063 99.240  1.00 450.59 ? 216 LYS B C   1 
ATOM 6314  O O   . LYS B 2 216 ? 139.934 112.609 99.851  1.00 433.34 ? 216 LYS B O   1 
ATOM 6315  C CB  . LYS B 2 216 ? 141.669 110.876 97.056  1.00 493.81 ? 216 LYS B CB  1 
ATOM 6316  C CG  . LYS B 2 216 ? 141.427 109.458 97.598  1.00 500.00 ? 216 LYS B CG  1 
ATOM 6317  C CD  . LYS B 2 216 ? 141.480 108.340 96.552  1.00 500.00 ? 216 LYS B CD  1 
ATOM 6318  C CE  . LYS B 2 216 ? 141.391 106.939 97.184  1.00 481.63 ? 216 LYS B CE  1 
ATOM 6319  N NZ  . LYS B 2 216 ? 140.105 106.593 97.877  1.00 389.54 ? 216 LYS B NZ  1 
ATOM 6320  N N   . GLY B 2 217 ? 141.929 111.568 99.865  1.00 428.01 ? 217 GLY B N   1 
ATOM 6321  C CA  . GLY B 2 217 ? 142.006 111.469 101.333 1.00 423.23 ? 217 GLY B CA  1 
ATOM 6322  C C   . GLY B 2 217 ? 141.075 110.429 101.958 1.00 438.11 ? 217 GLY B C   1 
ATOM 6323  O O   . GLY B 2 217 ? 140.018 110.121 101.396 1.00 394.53 ? 217 GLY B O   1 
ATOM 6324  N N   . PRO B 2 218 ? 141.436 109.918 103.162 1.00 471.37 ? 218 PRO B N   1 
ATOM 6325  C CA  . PRO B 2 218 ? 140.799 108.734 103.749 1.00 451.70 ? 218 PRO B CA  1 
ATOM 6326  C C   . PRO B 2 218 ? 139.370 109.011 104.105 1.00 414.04 ? 218 PRO B C   1 
ATOM 6327  O O   . PRO B 2 218 ? 139.010 110.157 104.382 1.00 447.75 ? 218 PRO B O   1 
ATOM 6328  C CB  . PRO B 2 218 ? 141.604 108.488 105.018 1.00 450.46 ? 218 PRO B CB  1 
ATOM 6329  C CG  . PRO B 2 218 ? 142.017 109.848 105.435 1.00 500.00 ? 218 PRO B CG  1 
ATOM 6330  C CD  . PRO B 2 218 ? 142.183 110.673 104.181 1.00 500.00 ? 218 PRO B CD  1 
ATOM 6331  N N   . LEU B 2 219 ? 138.570 107.962 104.102 1.00 390.04 ? 219 LEU B N   1 
ATOM 6332  C CA  . LEU B 2 219 ? 137.134 108.135 104.117 1.00 482.05 ? 219 LEU B CA  1 
ATOM 6333  C C   . LEU B 2 219 ? 136.722 108.807 105.436 1.00 451.19 ? 219 LEU B C   1 
ATOM 6334  O O   . LEU B 2 219 ? 135.858 109.695 105.443 1.00 490.15 ? 219 LEU B O   1 
ATOM 6335  C CB  . LEU B 2 219 ? 136.438 106.776 104.034 1.00 500.00 ? 219 LEU B CB  1 
ATOM 6336  C CG  . LEU B 2 219 ? 134.896 106.743 104.132 1.00 500.00 ? 219 LEU B CG  1 
ATOM 6337  C CD1 . LEU B 2 219 ? 134.235 106.915 102.764 1.00 500.00 ? 219 LEU B CD1 1 
ATOM 6338  C CD2 . LEU B 2 219 ? 134.427 105.450 104.798 1.00 500.00 ? 219 LEU B CD2 1 
ATOM 6339  N N   . ARG B 2 220 ? 137.248 108.241 106.520 1.00 412.03 ? 220 ARG B N   1 
ATOM 6340  C CA  . ARG B 2 220 ? 136.844 108.577 107.868 1.00 489.22 ? 220 ARG B CA  1 
ATOM 6341  C C   . ARG B 2 220 ? 137.035 110.076 108.126 1.00 483.79 ? 220 ARG B C   1 
ATOM 6342  O O   . ARG B 2 220 ? 136.136 110.768 108.648 1.00 481.87 ? 220 ARG B O   1 
ATOM 6343  C CB  . ARG B 2 220 ? 137.679 107.756 108.876 1.00 500.00 ? 220 ARG B CB  1 
ATOM 6344  C CG  . ARG B 2 220 ? 137.302 106.269 108.991 1.00 500.00 ? 220 ARG B CG  1 
ATOM 6345  C CD  . ARG B 2 220 ? 136.418 106.001 110.219 1.00 500.00 ? 220 ARG B CD  1 
ATOM 6346  N NE  . ARG B 2 220 ? 135.769 104.667 110.274 1.00 500.00 ? 220 ARG B NE  1 
ATOM 6347  C CZ  . ARG B 2 220 ? 135.926 103.730 111.227 1.00 500.00 ? 220 ARG B CZ  1 
ATOM 6348  N NH1 . ARG B 2 220 ? 136.754 103.902 112.267 1.00 500.00 ? 220 ARG B NH1 1 
ATOM 6349  N NH2 . ARG B 2 220 ? 135.242 102.585 111.136 1.00 437.97 ? 220 ARG B NH2 1 
ATOM 6350  N N   . LEU B 2 221 ? 138.226 110.530 107.741 1.00 478.86 ? 221 LEU B N   1 
ATOM 6351  C CA  . LEU B 2 221 ? 138.613 111.936 107.924 1.00 466.07 ? 221 LEU B CA  1 
ATOM 6352  C C   . LEU B 2 221 ? 137.648 112.844 107.175 1.00 421.01 ? 221 LEU B C   1 
ATOM 6353  O O   . LEU B 2 221 ? 137.191 113.860 107.725 1.00 463.15 ? 221 LEU B O   1 
ATOM 6354  C CB  . LEU B 2 221 ? 140.058 112.200 107.519 1.00 489.92 ? 221 LEU B CB  1 
ATOM 6355  C CG  . LEU B 2 221 ? 140.676 113.376 108.285 1.00 500.00 ? 221 LEU B CG  1 
ATOM 6356  C CD1 . LEU B 2 221 ? 141.205 112.972 109.662 1.00 500.00 ? 221 LEU B CD1 1 
ATOM 6357  C CD2 . LEU B 2 221 ? 141.783 113.997 107.460 1.00 500.00 ? 221 LEU B CD2 1 
ATOM 6358  N N   . GLN B 2 222 ? 137.352 112.445 105.939 1.00 407.69 ? 222 GLN B N   1 
ATOM 6359  C CA  . GLN B 2 222 ? 136.436 113.191 105.069 1.00 397.79 ? 222 GLN B CA  1 
ATOM 6360  C C   . GLN B 2 222 ? 135.070 113.322 105.735 1.00 389.65 ? 222 GLN B C   1 
ATOM 6361  O O   . GLN B 2 222 ? 134.477 114.413 105.763 1.00 395.89 ? 222 GLN B O   1 
ATOM 6362  C CB  . GLN B 2 222 ? 136.280 112.519 103.703 1.00 474.73 ? 222 GLN B CB  1 
ATOM 6363  C CG  . GLN B 2 222 ? 135.398 113.289 102.715 1.00 500.00 ? 222 GLN B CG  1 
ATOM 6364  C CD  . GLN B 2 222 ? 134.360 112.426 102.000 1.00 500.00 ? 222 GLN B CD  1 
ATOM 6365  O OE1 . GLN B 2 222 ? 134.375 112.310 100.769 1.00 500.00 ? 222 GLN B OE1 1 
ATOM 6366  N NE2 . GLN B 2 222 ? 133.438 111.832 102.765 1.00 500.00 ? 222 GLN B NE2 1 
ATOM 6367  N N   . GLN B 2 223 ? 134.608 112.192 106.257 1.00 438.10 ? 223 GLN B N   1 
ATOM 6368  C CA  . GLN B 2 223 ? 133.313 112.103 106.939 1.00 485.36 ? 223 GLN B CA  1 
ATOM 6369  C C   . GLN B 2 223 ? 133.269 113.080 108.105 1.00 475.92 ? 223 GLN B C   1 
ATOM 6370  O O   . GLN B 2 223 ? 132.288 113.824 108.287 1.00 412.35 ? 223 GLN B O   1 
ATOM 6371  C CB  . GLN B 2 223 ? 133.060 110.710 107.536 1.00 500.00 ? 223 GLN B CB  1 
ATOM 6372  C CG  . GLN B 2 223 ? 132.733 109.577 106.581 1.00 500.00 ? 223 GLN B CG  1 
ATOM 6373  C CD  . GLN B 2 223 ? 132.574 108.248 107.314 1.00 496.05 ? 223 GLN B CD  1 
ATOM 6374  O OE1 . GLN B 2 223 ? 133.105 107.226 106.886 1.00 478.71 ? 223 GLN B OE1 1 
ATOM 6375  N NE2 . GLN B 2 223 ? 131.855 108.263 108.436 1.00 467.44 ? 223 GLN B NE2 1 
ATOM 6376  N N   . ALA B 2 224 ? 134.348 113.047 108.880 1.00 498.21 ? 224 ALA B N   1 
ATOM 6377  C CA  . ALA B 2 224 ? 134.505 113.905 110.061 1.00 500.00 ? 224 ALA B CA  1 
ATOM 6378  C C   . ALA B 2 224 ? 134.398 115.371 109.664 1.00 434.06 ? 224 ALA B C   1 
ATOM 6379  O O   . ALA B 2 224 ? 133.687 116.158 110.310 1.00 426.76 ? 224 ALA B O   1 
ATOM 6380  C CB  . ALA B 2 224 ? 135.832 113.632 110.765 1.00 500.00 ? 224 ALA B CB  1 
ATOM 6381  N N   . TYR B 2 225 ? 135.114 115.699 108.594 1.00 363.10 ? 225 TYR B N   1 
ATOM 6382  C CA  . TYR B 2 225 ? 135.143 117.062 108.053 1.00 387.52 ? 225 TYR B CA  1 
ATOM 6383  C C   . TYR B 2 225 ? 133.748 117.518 107.685 1.00 391.49 ? 225 TYR B C   1 
ATOM 6384  O O   . TYR B 2 225 ? 133.337 118.639 108.025 1.00 410.63 ? 225 TYR B O   1 
ATOM 6385  C CB  . TYR B 2 225 ? 136.135 117.275 106.900 1.00 405.85 ? 225 TYR B CB  1 
ATOM 6386  C CG  . TYR B 2 225 ? 137.321 118.000 107.430 1.00 392.98 ? 225 TYR B CG  1 
ATOM 6387  C CD1 . TYR B 2 225 ? 137.289 119.375 107.585 1.00 414.11 ? 225 TYR B CD1 1 
ATOM 6388  C CD2 . TYR B 2 225 ? 138.424 117.304 107.904 1.00 474.20 ? 225 TYR B CD2 1 
ATOM 6389  C CE1 . TYR B 2 225 ? 138.358 120.050 108.139 1.00 465.90 ? 225 TYR B CE1 1 
ATOM 6390  C CE2 . TYR B 2 225 ? 139.504 117.964 108.454 1.00 492.21 ? 225 TYR B CE2 1 
ATOM 6391  C CZ  . TYR B 2 225 ? 139.468 119.335 108.566 1.00 500.00 ? 225 TYR B CZ  1 
ATOM 6392  O OH  . TYR B 2 225 ? 140.539 119.981 109.119 1.00 500.00 ? 225 TYR B OH  1 
ATOM 6393  N N   . LEU B 2 226 ? 133.043 116.624 107.000 1.00 410.79 ? 226 LEU B N   1 
ATOM 6394  C CA  . LEU B 2 226 ? 131.665 116.863 106.549 1.00 475.77 ? 226 LEU B CA  1 
ATOM 6395  C C   . LEU B 2 226 ? 130.781 117.187 107.733 1.00 444.29 ? 226 LEU B C   1 
ATOM 6396  O O   . LEU B 2 226 ? 129.996 118.166 107.701 1.00 490.99 ? 226 LEU B O   1 
ATOM 6397  C CB  . LEU B 2 226 ? 131.059 115.598 105.937 1.00 500.00 ? 226 LEU B CB  1 
ATOM 6398  C CG  . LEU B 2 226 ? 130.821 115.503 104.437 1.00 500.00 ? 226 LEU B CG  1 
ATOM 6399  C CD1 . LEU B 2 226 ? 131.912 116.199 103.624 1.00 500.00 ? 226 LEU B CD1 1 
ATOM 6400  C CD2 . LEU B 2 226 ? 130.681 114.022 104.066 1.00 500.00 ? 226 LEU B CD2 1 
ATOM 6401  N N   . ILE B 2 227 ? 130.924 116.345 108.760 1.00 407.84 ? 227 ILE B N   1 
ATOM 6402  C CA  . ILE B 2 227 ? 130.101 116.499 109.974 1.00 440.72 ? 227 ILE B CA  1 
ATOM 6403  C C   . ILE B 2 227 ? 130.379 117.839 110.621 1.00 414.80 ? 227 ILE B C   1 
ATOM 6404  O O   . ILE B 2 227 ? 129.426 118.525 111.027 1.00 383.39 ? 227 ILE B O   1 
ATOM 6405  C CB  . ILE B 2 227 ? 130.040 115.314 110.973 1.00 446.83 ? 227 ILE B CB  1 
ATOM 6406  C CG1 . ILE B 2 227 ? 131.120 115.391 112.052 1.00 499.61 ? 227 ILE B CG1 1 
ATOM 6407  C CG2 . ILE B 2 227 ? 129.991 113.973 110.251 1.00 467.89 ? 227 ILE B CG2 1 
ATOM 6408  C CD1 . ILE B 2 227 ? 130.944 114.334 113.112 1.00 500.00 ? 227 ILE B CD1 1 
ATOM 6409  N N   . MET B 2 228 ? 131.655 118.202 110.681 1.00 385.72 ? 228 MET B N   1 
ATOM 6410  C CA  . MET B 2 228 ? 132.086 119.477 111.261 1.00 441.78 ? 228 MET B CA  1 
ATOM 6411  C C   . MET B 2 228 ? 131.432 120.638 110.522 1.00 466.43 ? 228 MET B C   1 
ATOM 6412  O O   . MET B 2 228 ? 130.909 121.574 111.149 1.00 499.52 ? 228 MET B O   1 
ATOM 6413  C CB  . MET B 2 228 ? 133.624 119.650 111.336 1.00 500.00 ? 228 MET B CB  1 
ATOM 6414  C CG  . MET B 2 228 ? 134.241 119.633 112.754 1.00 500.00 ? 228 MET B CG  1 
ATOM 6415  S SD  . MET B 2 228 ? 133.825 120.956 113.957 1.00 500.00 ? 228 MET B SD  1 
ATOM 6416  C CE  . MET B 2 228 ? 134.981 122.320 113.687 1.00 419.99 ? 228 MET B CE  1 
ATOM 6417  N N   . ILE B 2 229 ? 131.474 120.539 109.199 1.00 431.52 ? 229 ILE B N   1 
ATOM 6418  C CA  . ILE B 2 229 ? 130.906 121.555 108.310 1.00 438.44 ? 229 ILE B CA  1 
ATOM 6419  C C   . ILE B 2 229 ? 129.417 121.733 108.603 1.00 429.95 ? 229 ILE B C   1 
ATOM 6420  O O   . ILE B 2 229 ? 128.917 122.875 108.733 1.00 407.86 ? 229 ILE B O   1 
ATOM 6421  C CB  . ILE B 2 229 ? 131.185 121.187 106.829 1.00 492.10 ? 229 ILE B CB  1 
ATOM 6422  C CG1 . ILE B 2 229 ? 132.629 121.558 106.476 1.00 488.13 ? 229 ILE B CG1 1 
ATOM 6423  C CG2 . ILE B 2 229 ? 130.200 121.833 105.854 1.00 500.00 ? 229 ILE B CG2 1 
ATOM 6424  C CD1 . ILE B 2 229 ? 132.902 123.047 106.411 1.00 479.09 ? 229 ILE B CD1 1 
ATOM 6425  N N   . SER B 2 230 ? 128.748 120.584 108.708 1.00 407.50 ? 230 SER B N   1 
ATOM 6426  C CA  . SER B 2 230 ? 127.308 120.546 108.978 1.00 410.13 ? 230 SER B CA  1 
ATOM 6427  C C   . SER B 2 230 ? 126.998 121.245 110.288 1.00 442.25 ? 230 SER B C   1 
ATOM 6428  O O   . SER B 2 230 ? 126.062 122.052 110.373 1.00 449.22 ? 230 SER B O   1 
ATOM 6429  C CB  . SER B 2 230 ? 126.763 119.129 109.034 1.00 438.54 ? 230 SER B CB  1 
ATOM 6430  O OG  . SER B 2 230 ? 127.046 118.558 110.291 1.00 472.57 ? 230 SER B OG  1 
ATOM 6431  N N   . ALA B 2 231 ? 127.804 120.918 111.291 1.00 454.08 ? 231 ALA B N   1 
ATOM 6432  C CA  . ALA B 2 231 ? 127.670 121.486 112.640 1.00 463.78 ? 231 ALA B CA  1 
ATOM 6433  C C   . ALA B 2 231 ? 127.788 122.991 112.586 1.00 447.98 ? 231 ALA B C   1 
ATOM 6434  O O   . ALA B 2 231 ? 126.984 123.705 113.192 1.00 412.50 ? 231 ALA B O   1 
ATOM 6435  C CB  . ALA B 2 231 ? 128.715 120.900 113.574 1.00 487.50 ? 231 ALA B CB  1 
ATOM 6436  N N   . LEU B 2 232 ? 128.797 123.443 111.853 1.00 459.62 ? 232 LEU B N   1 
ATOM 6437  C CA  . LEU B 2 232 ? 129.081 124.877 111.674 1.00 447.18 ? 232 LEU B CA  1 
ATOM 6438  C C   . LEU B 2 232 ? 127.862 125.574 111.079 1.00 442.03 ? 232 LEU B C   1 
ATOM 6439  O O   . LEU B 2 232 ? 127.439 126.642 111.563 1.00 462.75 ? 232 LEU B O   1 
ATOM 6440  C CB  . LEU B 2 232 ? 130.276 125.117 110.747 1.00 427.40 ? 232 LEU B CB  1 
ATOM 6441  C CG  . LEU B 2 232 ? 131.665 125.232 111.371 1.00 489.65 ? 232 LEU B CG  1 
ATOM 6442  C CD1 . LEU B 2 232 ? 132.019 124.166 112.411 1.00 479.48 ? 232 LEU B CD1 1 
ATOM 6443  C CD2 . LEU B 2 232 ? 132.690 125.231 110.249 1.00 500.00 ? 232 LEU B CD2 1 
ATOM 6444  N N   . MET B 2 233 ? 127.330 124.939 110.033 1.00 409.37 ? 233 MET B N   1 
ATOM 6445  C CA  . MET B 2 233 ? 126.169 125.462 109.316 1.00 427.65 ? 233 MET B CA  1 
ATOM 6446  C C   . MET B 2 233 ? 124.982 125.614 110.279 1.00 446.12 ? 233 MET B C   1 
ATOM 6447  O O   . MET B 2 233 ? 124.295 126.649 110.288 1.00 443.00 ? 233 MET B O   1 
ATOM 6448  C CB  . MET B 2 233 ? 125.834 124.671 108.036 1.00 500.00 ? 233 MET B CB  1 
ATOM 6449  C CG  . MET B 2 233 ? 124.801 125.375 107.134 1.00 500.00 ? 233 MET B CG  1 
ATOM 6450  S SD  . MET B 2 233 ? 124.816 125.045 105.344 1.00 500.00 ? 233 MET B SD  1 
ATOM 6451  C CE  . MET B 2 233 ? 123.108 125.383 104.902 1.00 435.57 ? 233 MET B CE  1 
ATOM 6452  N N   . ALA B 2 234 ? 124.783 124.569 111.069 1.00 452.27 ? 234 ALA B N   1 
ATOM 6453  C CA  . ALA B 2 234 ? 123.706 124.515 112.058 1.00 487.74 ? 234 ALA B CA  1 
ATOM 6454  C C   . ALA B 2 234 ? 123.830 125.665 113.039 1.00 465.81 ? 234 ALA B C   1 
ATOM 6455  O O   . ALA B 2 234 ? 122.847 126.354 113.347 1.00 451.93 ? 234 ALA B O   1 
ATOM 6456  C CB  . ALA B 2 234 ? 123.719 123.182 112.789 1.00 500.00 ? 234 ALA B CB  1 
ATOM 6457  N N   . LEU B 2 235 ? 125.055 125.853 113.510 1.00 426.64 ? 235 LEU B N   1 
ATOM 6458  C CA  . LEU B 2 235 ? 125.395 126.919 114.465 1.00 435.48 ? 235 LEU B CA  1 
ATOM 6459  C C   . LEU B 2 235 ? 125.032 128.270 113.888 1.00 437.39 ? 235 LEU B C   1 
ATOM 6460  O O   . LEU B 2 235 ? 124.416 129.106 114.565 1.00 416.87 ? 235 LEU B O   1 
ATOM 6461  C CB  . LEU B 2 235 ? 126.893 126.918 114.756 1.00 478.09 ? 235 LEU B CB  1 
ATOM 6462  C CG  . LEU B 2 235 ? 127.410 125.816 115.670 1.00 500.00 ? 235 LEU B CG  1 
ATOM 6463  C CD1 . LEU B 2 235 ? 128.924 125.685 115.527 1.00 500.00 ? 235 LEU B CD1 1 
ATOM 6464  C CD2 . LEU B 2 235 ? 126.992 126.078 117.115 1.00 500.00 ? 235 LEU B CD2 1 
ATOM 6465  N N   . VAL B 2 236 ? 125.426 128.481 112.637 1.00 464.89 ? 236 VAL B N   1 
ATOM 6466  C CA  . VAL B 2 236 ? 124.897 129.569 111.829 1.00 500.00 ? 236 VAL B CA  1 
ATOM 6467  C C   . VAL B 2 236 ? 123.433 129.811 112.148 1.00 442.96 ? 236 VAL B C   1 
ATOM 6468  O O   . VAL B 2 236 ? 123.095 130.693 112.935 1.00 438.97 ? 236 VAL B O   1 
ATOM 6469  C CB  . VAL B 2 236 ? 125.016 129.253 110.331 1.00 500.00 ? 236 VAL B CB  1 
ATOM 6470  C CG1 . VAL B 2 236 ? 124.795 130.511 109.508 1.00 500.00 ? 236 VAL B CG1 1 
ATOM 6471  C CG2 . VAL B 2 236 ? 126.372 128.636 110.027 1.00 500.00 ? 236 VAL B CG2 1 
ATOM 6472  N N   . PHE B 2 237 ? 122.564 129.010 111.542 1.00 415.49 ? 237 PHE B N   1 
ATOM 6473  C CA  . PHE B 2 237 ? 121.186 129.420 111.357 1.00 446.72 ? 237 PHE B CA  1 
ATOM 6474  C C   . PHE B 2 237 ? 120.598 129.619 112.736 1.00 470.21 ? 237 PHE B C   1 
ATOM 6475  O O   . PHE B 2 237 ? 119.851 130.564 112.981 1.00 500.00 ? 237 PHE B O   1 
ATOM 6476  C CB  . PHE B 2 237 ? 120.400 128.343 110.615 1.00 432.31 ? 237 PHE B CB  1 
ATOM 6477  C CG  . PHE B 2 237 ? 121.007 127.943 109.305 1.00 416.06 ? 237 PHE B CG  1 
ATOM 6478  C CD1 . PHE B 2 237 ? 120.877 128.752 108.191 1.00 485.61 ? 237 PHE B CD1 1 
ATOM 6479  C CD2 . PHE B 2 237 ? 121.709 126.758 109.189 1.00 430.74 ? 237 PHE B CD2 1 
ATOM 6480  C CE1 . PHE B 2 237 ? 121.435 128.386 106.982 1.00 500.00 ? 237 PHE B CE1 1 
ATOM 6481  C CE2 . PHE B 2 237 ? 122.270 126.386 107.983 1.00 467.49 ? 237 PHE B CE2 1 
ATOM 6482  C CZ  . PHE B 2 237 ? 122.133 127.200 106.877 1.00 500.00 ? 237 PHE B CZ  1 
ATOM 6483  N N   . ILE B 2 238 ? 120.959 128.726 113.647 1.00 354.21 ? 238 ILE B N   1 
ATOM 6484  C CA  . ILE B 2 238 ? 120.512 128.839 115.019 1.00 374.46 ? 238 ILE B CA  1 
ATOM 6485  C C   . ILE B 2 238 ? 121.041 130.135 115.608 1.00 380.25 ? 238 ILE B C   1 
ATOM 6486  O O   . ILE B 2 238 ? 120.335 130.828 116.336 1.00 346.16 ? 238 ILE B O   1 
ATOM 6487  C CB  . ILE B 2 238 ? 120.995 127.652 115.862 1.00 427.26 ? 238 ILE B CB  1 
ATOM 6488  C CG1 . ILE B 2 238 ? 120.485 126.341 115.266 1.00 405.67 ? 238 ILE B CG1 1 
ATOM 6489  C CG2 . ILE B 2 238 ? 120.530 127.802 117.301 1.00 500.00 ? 238 ILE B CG2 1 
ATOM 6490  C CD1 . ILE B 2 238 ? 120.658 125.147 116.177 1.00 440.11 ? 238 ILE B CD1 1 
ATOM 6491  N N   . LYS B 2 239 ? 122.280 130.480 115.283 1.00 419.63 ? 239 LYS B N   1 
ATOM 6492  C CA  . LYS B 2 239 ? 122.755 131.826 115.561 1.00 482.83 ? 239 LYS B CA  1 
ATOM 6493  C C   . LYS B 2 239 ? 121.787 132.841 114.960 1.00 465.99 ? 239 LYS B C   1 
ATOM 6494  O O   . LYS B 2 239 ? 120.971 133.427 115.668 1.00 435.19 ? 239 LYS B O   1 
ATOM 6495  C CB  . LYS B 2 239 ? 124.166 132.042 115.015 1.00 480.66 ? 239 LYS B CB  1 
ATOM 6496  C CG  . LYS B 2 239 ? 124.868 133.259 115.591 1.00 493.11 ? 239 LYS B CG  1 
ATOM 6497  C CD  . LYS B 2 239 ? 125.291 133.013 117.030 1.00 500.00 ? 239 LYS B CD  1 
ATOM 6498  C CE  . LYS B 2 239 ? 125.794 134.290 117.685 1.00 500.00 ? 239 LYS B CE  1 
ATOM 6499  N NZ  . LYS B 2 239 ? 124.686 135.247 117.947 1.00 500.00 ? 239 LYS B NZ  1 
ATOM 6500  N N   . TYR B 2 240 ? 121.885 133.052 113.655 1.00 449.94 ? 240 TYR B N   1 
ATOM 6501  C CA  . TYR B 2 240 ? 121.183 134.161 113.026 1.00 458.89 ? 240 TYR B CA  1 
ATOM 6502  C C   . TYR B 2 240 ? 119.674 134.064 113.228 1.00 500.00 ? 240 TYR B C   1 
ATOM 6503  O O   . TYR B 2 240 ? 119.028 135.044 113.595 1.00 495.53 ? 240 TYR B O   1 
ATOM 6504  C CB  . TYR B 2 240 ? 121.524 134.237 111.541 1.00 481.12 ? 240 TYR B CB  1 
ATOM 6505  C CG  . TYR B 2 240 ? 122.838 134.925 111.270 1.00 488.17 ? 240 TYR B CG  1 
ATOM 6506  C CD1 . TYR B 2 240 ? 124.026 134.419 111.778 1.00 500.00 ? 240 TYR B CD1 1 
ATOM 6507  C CD2 . TYR B 2 240 ? 122.891 136.092 110.520 1.00 452.76 ? 240 TYR B CD2 1 
ATOM 6508  C CE1 . TYR B 2 240 ? 125.231 135.050 111.534 1.00 454.31 ? 240 TYR B CE1 1 
ATOM 6509  C CE2 . TYR B 2 240 ? 124.090 136.728 110.273 1.00 484.66 ? 240 TYR B CE2 1 
ATOM 6510  C CZ  . TYR B 2 240 ? 125.257 136.204 110.781 1.00 482.84 ? 240 TYR B CZ  1 
ATOM 6511  O OH  . TYR B 2 240 ? 126.451 136.839 110.536 1.00 477.36 ? 240 TYR B OH  1 
ATOM 6512  N N   . LEU B 2 241 ? 119.117 132.882 112.993 1.00 500.00 ? 241 LEU B N   1 
ATOM 6513  C CA  . LEU B 2 241 ? 117.668 132.720 112.928 1.00 479.64 ? 241 LEU B CA  1 
ATOM 6514  C C   . LEU B 2 241 ? 116.984 133.066 114.246 1.00 462.96 ? 241 LEU B C   1 
ATOM 6515  O O   . LEU B 2 241 ? 117.535 132.826 115.322 1.00 352.55 ? 241 LEU B O   1 
ATOM 6516  C CB  . LEU B 2 241 ? 117.295 131.303 112.498 1.00 468.32 ? 241 LEU B CB  1 
ATOM 6517  C CG  . LEU B 2 241 ? 117.509 130.990 111.017 1.00 469.54 ? 241 LEU B CG  1 
ATOM 6518  C CD1 . LEU B 2 241 ? 118.910 131.386 110.581 1.00 495.99 ? 241 LEU B CD1 1 
ATOM 6519  C CD2 . LEU B 2 241 ? 117.247 129.519 110.738 1.00 453.15 ? 241 LEU B CD2 1 
ATOM 6520  N N   . PRO B 2 242 ? 115.734 133.658 114.136 1.00 491.30 ? 242 PRO B N   1 
ATOM 6521  C CA  . PRO B 2 242 ? 115.036 133.842 115.410 1.00 500.00 ? 242 PRO B CA  1 
ATOM 6522  C C   . PRO B 2 242 ? 113.953 132.791 115.610 1.00 478.14 ? 242 PRO B C   1 
ATOM 6523  O O   . PRO B 2 242 ? 113.364 132.326 114.633 1.00 432.86 ? 242 PRO B O   1 
ATOM 6524  C CB  . PRO B 2 242 ? 114.391 135.214 115.239 1.00 500.00 ? 242 PRO B CB  1 
ATOM 6525  C CG  . PRO B 2 242 ? 114.007 135.263 113.793 1.00 500.00 ? 242 PRO B CG  1 
ATOM 6526  C CD  . PRO B 2 242 ? 114.812 134.223 113.056 1.00 500.00 ? 242 PRO B CD  1 
ATOM 6527  N N   . GLU B 2 243 ? 113.692 132.427 116.862 1.00 482.12 ? 243 GLU B N   1 
ATOM 6528  C CA  . GLU B 2 243 ? 113.250 131.078 117.176 1.00 481.41 ? 243 GLU B CA  1 
ATOM 6529  C C   . GLU B 2 243 ? 112.033 130.707 116.342 1.00 468.73 ? 243 GLU B C   1 
ATOM 6530  O O   . GLU B 2 243 ? 111.941 129.586 115.835 1.00 490.79 ? 243 GLU B O   1 
ATOM 6531  C CB  . GLU B 2 243 ? 112.914 130.971 118.656 1.00 489.17 ? 243 GLU B CB  1 
ATOM 6532  N N   . TRP B 2 244 ? 111.097 131.661 116.268 1.00 458.31 ? 244 TRP B N   1 
ATOM 6533  C CA  . TRP B 2 244 ? 109.834 131.460 115.565 1.00 500.00 ? 244 TRP B CA  1 
ATOM 6534  C C   . TRP B 2 244 ? 110.105 131.128 114.096 1.00 500.00 ? 244 TRP B C   1 
ATOM 6535  O O   . TRP B 2 244 ? 109.490 130.179 113.555 1.00 500.00 ? 244 TRP B O   1 
ATOM 6536  C CB  . TRP B 2 244 ? 108.828 132.622 115.818 1.00 500.00 ? 244 TRP B CB  1 
ATOM 6537  C CG  . TRP B 2 244 ? 107.519 132.243 116.639 1.00 500.00 ? 244 TRP B CG  1 
ATOM 6538  C CD1 . TRP B 2 244 ? 106.250 132.741 116.427 1.00 500.00 ? 244 TRP B CD1 1 
ATOM 6539  C CD2 . TRP B 2 244 ? 107.382 131.303 117.739 1.00 500.00 ? 244 TRP B CD2 1 
ATOM 6540  N NE1 . TRP B 2 244 ? 105.354 132.184 117.314 1.00 500.00 ? 244 TRP B NE1 1 
ATOM 6541  C CE2 . TRP B 2 244 ? 106.015 131.303 118.126 1.00 500.00 ? 244 TRP B CE2 1 
ATOM 6542  C CE3 . TRP B 2 244 ? 108.278 130.468 118.430 1.00 500.00 ? 244 TRP B CE3 1 
ATOM 6543  C CZ2 . TRP B 2 244 ? 105.527 130.506 119.174 1.00 497.84 ? 244 TRP B CZ2 1 
ATOM 6544  C CZ3 . TRP B 2 244 ? 107.787 129.672 119.479 1.00 500.00 ? 244 TRP B CZ3 1 
ATOM 6545  C CH2 . TRP B 2 244 ? 106.425 129.703 119.838 1.00 500.00 ? 244 TRP B CH2 1 
ATOM 6546  N N   . THR B 2 245 ? 111.035 131.881 113.499 1.00 493.71 ? 245 THR B N   1 
ATOM 6547  C CA  . THR B 2 245 ? 111.393 131.696 112.101 1.00 500.00 ? 245 THR B CA  1 
ATOM 6548  C C   . THR B 2 245 ? 111.921 130.280 111.876 1.00 447.43 ? 245 THR B C   1 
ATOM 6549  O O   . THR B 2 245 ? 111.546 129.634 110.903 1.00 423.59 ? 245 THR B O   1 
ATOM 6550  C CB  . THR B 2 245 ? 112.490 132.670 111.644 1.00 500.00 ? 245 THR B CB  1 
ATOM 6551  O OG1 . THR B 2 245 ? 112.070 134.014 111.905 1.00 500.00 ? 245 THR B OG1 1 
ATOM 6552  C CG2 . THR B 2 245 ? 112.791 132.506 110.148 1.00 500.00 ? 245 THR B CG2 1 
ATOM 6553  N N   . ALA B 2 246 ? 112.782 129.843 112.792 1.00 478.54 ? 246 ALA B N   1 
ATOM 6554  C CA  . ALA B 2 246 ? 113.512 128.598 112.672 1.00 500.00 ? 246 ALA B CA  1 
ATOM 6555  C C   . ALA B 2 246 ? 112.633 127.361 112.455 1.00 500.00 ? 246 ALA B C   1 
ATOM 6556  O O   . ALA B 2 246 ? 112.814 126.594 111.492 1.00 500.00 ? 246 ALA B O   1 
ATOM 6557  C CB  . ALA B 2 246 ? 114.408 128.394 113.889 1.00 500.00 ? 246 ALA B CB  1 
ATOM 6558  N N   . TRP B 2 247 ? 111.723 127.181 113.410 1.00 472.87 ? 247 TRP B N   1 
ATOM 6559  C CA  . TRP B 2 247 ? 110.822 126.018 113.423 1.00 456.99 ? 247 TRP B CA  1 
ATOM 6560  C C   . TRP B 2 247 ? 109.992 125.991 112.150 1.00 500.00 ? 247 TRP B C   1 
ATOM 6561  O O   . TRP B 2 247 ? 109.851 124.930 111.519 1.00 481.17 ? 247 TRP B O   1 
ATOM 6562  C CB  . TRP B 2 247 ? 109.970 126.014 114.688 1.00 418.21 ? 247 TRP B CB  1 
ATOM 6563  C CG  . TRP B 2 247 ? 110.850 125.888 115.870 1.00 440.69 ? 247 TRP B CG  1 
ATOM 6564  C CD1 . TRP B 2 247 ? 111.282 126.890 116.662 1.00 500.00 ? 247 TRP B CD1 1 
ATOM 6565  C CD2 . TRP B 2 247 ? 111.480 124.702 116.348 1.00 491.40 ? 247 TRP B CD2 1 
ATOM 6566  N NE1 . TRP B 2 247 ? 112.124 126.413 117.635 1.00 500.00 ? 247 TRP B NE1 1 
ATOM 6567  C CE2 . TRP B 2 247 ? 112.264 125.063 117.466 1.00 500.00 ? 247 TRP B CE2 1 
ATOM 6568  C CE3 . TRP B 2 247 ? 111.441 123.361 115.959 1.00 500.00 ? 247 TRP B CE3 1 
ATOM 6569  C CZ2 . TRP B 2 247 ? 113.012 124.135 118.196 1.00 500.00 ? 247 TRP B CZ2 1 
ATOM 6570  C CZ3 . TRP B 2 247 ? 112.180 122.428 116.689 1.00 500.00 ? 247 TRP B CZ3 1 
ATOM 6571  C CH2 . TRP B 2 247 ? 112.956 122.825 117.796 1.00 500.00 ? 247 TRP B CH2 1 
ATOM 6572  N N   . LEU B 2 248 ? 109.470 127.164 111.794 1.00 500.00 ? 248 LEU B N   1 
ATOM 6573  C CA  . LEU B 2 248 ? 108.649 127.326 110.588 1.00 500.00 ? 248 LEU B CA  1 
ATOM 6574  C C   . LEU B 2 248 ? 109.430 126.906 109.359 1.00 500.00 ? 248 LEU B C   1 
ATOM 6575  O O   . LEU B 2 248 ? 108.916 126.174 108.502 1.00 500.00 ? 248 LEU B O   1 
ATOM 6576  C CB  . LEU B 2 248 ? 108.226 128.775 110.388 1.00 500.00 ? 248 LEU B CB  1 
ATOM 6577  C CG  . LEU B 2 248 ? 107.175 129.303 111.352 1.00 500.00 ? 248 LEU B CG  1 
ATOM 6578  C CD1 . LEU B 2 248 ? 107.143 130.827 111.274 1.00 500.00 ? 248 LEU B CD1 1 
ATOM 6579  C CD2 . LEU B 2 248 ? 105.810 128.682 111.061 1.00 500.00 ? 248 LEU B CD2 1 
ATOM 6580  N N   . ILE B 2 249 ? 110.664 127.384 109.299 1.00 452.54 ? 249 ILE B N   1 
ATOM 6581  C CA  . ILE B 2 249 ? 111.583 127.095 108.188 1.00 451.60 ? 249 ILE B CA  1 
ATOM 6582  C C   . ILE B 2 249 ? 111.781 125.586 108.059 1.00 465.14 ? 249 ILE B C   1 
ATOM 6583  O O   . ILE B 2 249 ? 111.708 125.030 106.949 1.00 495.60 ? 249 ILE B O   1 
ATOM 6584  C CB  . ILE B 2 249 ? 112.938 127.881 108.267 1.00 467.35 ? 249 ILE B CB  1 
ATOM 6585  C CG1 . ILE B 2 249 ? 113.235 128.542 106.914 1.00 496.06 ? 249 ILE B CG1 1 
ATOM 6586  C CG2 . ILE B 2 249 ? 114.143 127.020 108.674 1.00 459.40 ? 249 ILE B CG2 1 
ATOM 6587  C CD1 . ILE B 2 249 ? 114.438 129.461 106.906 1.00 480.73 ? 249 ILE B CD1 1 
ATOM 6588  N N   . LEU B 2 250 ? 112.023 124.966 109.210 1.00 441.43 ? 250 LEU B N   1 
ATOM 6589  C CA  . LEU B 2 250 ? 112.244 123.522 109.296 1.00 476.92 ? 250 LEU B CA  1 
ATOM 6590  C C   . LEU B 2 250 ? 111.037 122.768 108.729 1.00 497.25 ? 250 LEU B C   1 
ATOM 6591  O O   . LEU B 2 250 ? 111.184 121.826 107.927 1.00 465.38 ? 250 LEU B O   1 
ATOM 6592  C CB  . LEU B 2 250 ? 112.477 123.073 110.739 1.00 494.85 ? 250 LEU B CB  1 
ATOM 6593  C CG  . LEU B 2 250 ? 113.877 123.305 111.299 1.00 500.00 ? 250 LEU B CG  1 
ATOM 6594  C CD1 . LEU B 2 250 ? 113.828 123.378 112.821 1.00 500.00 ? 250 LEU B CD1 1 
ATOM 6595  C CD2 . LEU B 2 250 ? 114.832 122.215 110.824 1.00 497.84 ? 250 LEU B CD2 1 
ATOM 6596  N N   . ALA B 2 251 ? 109.868 123.218 109.167 1.00 500.00 ? 251 ALA B N   1 
ATOM 6597  C CA  . ALA B 2 251 ? 108.589 122.637 108.753 1.00 500.00 ? 251 ALA B CA  1 
ATOM 6598  C C   . ALA B 2 251 ? 108.445 122.706 107.236 1.00 474.76 ? 251 ALA B C   1 
ATOM 6599  O O   . ALA B 2 251 ? 108.069 121.720 106.581 1.00 408.88 ? 251 ALA B O   1 
ATOM 6600  C CB  . ALA B 2 251 ? 107.417 123.337 109.427 1.00 500.00 ? 251 ALA B CB  1 
ATOM 6601  N N   . VAL B 2 252 ? 108.758 123.885 106.715 1.00 500.00 ? 252 VAL B N   1 
ATOM 6602  C CA  . VAL B 2 252 ? 108.683 124.163 105.277 1.00 500.00 ? 252 VAL B CA  1 
ATOM 6603  C C   . VAL B 2 252 ? 109.579 123.198 104.512 1.00 469.81 ? 252 VAL B C   1 
ATOM 6604  O O   . VAL B 2 252 ? 109.161 122.618 103.497 1.00 412.32 ? 252 VAL B O   1 
ATOM 6605  C CB  . VAL B 2 252 ? 108.996 125.638 104.947 1.00 500.00 ? 252 VAL B CB  1 
ATOM 6606  C CG1 . VAL B 2 252 ? 109.171 125.831 103.442 1.00 500.00 ? 252 VAL B CG1 1 
ATOM 6607  C CG2 . VAL B 2 252 ? 107.890 126.536 105.506 1.00 500.00 ? 252 VAL B CG2 1 
ATOM 6608  N N   . ILE B 2 253 ? 110.794 123.047 105.028 1.00 461.22 ? 253 ILE B N   1 
ATOM 6609  C CA  . ILE B 2 253 ? 111.802 122.167 104.434 1.00 444.29 ? 253 ILE B CA  1 
ATOM 6610  C C   . ILE B 2 253 ? 111.268 120.734 104.365 1.00 401.97 ? 253 ILE B C   1 
ATOM 6611  O O   . ILE B 2 253 ? 111.379 120.057 103.311 1.00 421.67 ? 253 ILE B O   1 
ATOM 6612  C CB  . ILE B 2 253 ? 113.149 122.221 105.163 1.00 460.33 ? 253 ILE B CB  1 
ATOM 6613  C CG1 . ILE B 2 253 ? 113.751 123.624 104.991 1.00 500.00 ? 253 ILE B CG1 1 
ATOM 6614  C CG2 . ILE B 2 253 ? 114.105 121.145 104.620 1.00 425.37 ? 253 ILE B CG2 1 
ATOM 6615  C CD1 . ILE B 2 253 ? 114.582 124.077 106.168 1.00 500.00 ? 253 ILE B CD1 1 
ATOM 6616  N N   . SER B 2 254 ? 110.691 120.315 105.488 1.00 427.23 ? 254 SER B N   1 
ATOM 6617  C CA  . SER B 2 254 ? 110.135 118.972 105.623 1.00 490.25 ? 254 SER B CA  1 
ATOM 6618  C C   . SER B 2 254 ? 109.044 118.747 104.572 1.00 477.63 ? 254 SER B C   1 
ATOM 6619  O O   . SER B 2 254 ? 109.013 117.699 103.901 1.00 474.69 ? 254 SER B O   1 
ATOM 6620  C CB  . SER B 2 254 ? 109.664 118.642 107.050 1.00 500.00 ? 254 SER B CB  1 
ATOM 6621  O OG  . SER B 2 254 ? 109.478 119.800 107.830 1.00 500.00 ? 254 SER B OG  1 
ATOM 6622  N N   . VAL B 2 255 ? 108.183 119.754 104.444 1.00 456.98 ? 255 VAL B N   1 
ATOM 6623  C CA  . VAL B 2 255 ? 107.066 119.691 103.504 1.00 479.41 ? 255 VAL B CA  1 
ATOM 6624  C C   . VAL B 2 255 ? 107.608 119.553 102.072 1.00 415.46 ? 255 VAL B C   1 
ATOM 6625  O O   . VAL B 2 255 ? 107.123 118.742 101.280 1.00 438.79 ? 255 VAL B O   1 
ATOM 6626  C CB  . VAL B 2 255 ? 105.946 120.782 103.622 1.00 500.00 ? 255 VAL B CB  1 
ATOM 6627  C CG1 . VAL B 2 255 ? 105.356 120.818 105.031 1.00 500.00 ? 255 VAL B CG1 1 
ATOM 6628  C CG2 . VAL B 2 255 ? 106.360 122.173 103.160 1.00 498.33 ? 255 VAL B CG2 1 
ATOM 6629  N N   . THR B 2 256 ? 108.572 120.439 101.793 1.00 391.17 ? 256 THR B N   1 
ATOM 6630  C CA  . THR B 2 256 ? 109.157 120.561 100.454 1.00 485.39 ? 256 THR B CA  1 
ATOM 6631  C C   . THR B 2 256 ? 109.704 119.294 99.956  1.00 467.05 ? 256 THR B C   1 
ATOM 6632  O O   . THR B 2 256 ? 109.436 118.875 98.804  1.00 417.30 ? 256 THR B O   1 
ATOM 6633  C CB  . THR B 2 256 ? 110.472 121.437 100.308 1.00 397.10 ? 256 THR B CB  1 
ATOM 6634  O OG1 . THR B 2 256 ? 111.639 120.823 100.951 1.00 379.52 ? 256 THR B OG1 1 
ATOM 6635  C CG2 . THR B 2 256 ? 110.270 122.966 100.749 1.00 404.33 ? 256 THR B CG2 1 
ATOM 6636  N N   . ASP B 2 257 ? 110.502 118.691 100.855 1.00 473.29 ? 257 ASP B N   1 
ATOM 6637  C CA  . ASP B 2 257 ? 111.188 117.457 100.488 1.00 500.00 ? 257 ASP B CA  1 
ATOM 6638  C C   . ASP B 2 257 ? 110.163 116.353 100.184 1.00 485.64 ? 257 ASP B C   1 
ATOM 6639  O O   . ASP B 2 257 ? 110.326 115.619 99.192  1.00 500.00 ? 257 ASP B O   1 
ATOM 6640  C CB  . ASP B 2 257 ? 112.337 117.058 101.427 1.00 500.00 ? 257 ASP B CB  1 
ATOM 6641  C CG  . ASP B 2 257 ? 113.680 116.889 100.670 1.00 500.00 ? 257 ASP B CG  1 
ATOM 6642  O OD1 . ASP B 2 257 ? 113.766 116.019 99.770  1.00 500.00 ? 257 ASP B OD1 1 
ATOM 6643  O OD2 . ASP B 2 257 ? 114.641 117.636 100.970 1.00 500.00 ? 257 ASP B OD2 1 
ATOM 6644  N N   . LEU B 2 258 ? 109.120 116.298 101.021 1.00 413.23 ? 258 LEU B N   1 
ATOM 6645  C CA  . LEU B 2 258 ? 108.051 115.322 100.857 1.00 464.79 ? 258 LEU B CA  1 
ATOM 6646  C C   . LEU B 2 258 ? 107.386 115.489 99.489  1.00 490.06 ? 258 LEU B C   1 
ATOM 6647  O O   . LEU B 2 258 ? 107.151 114.500 98.769  1.00 489.21 ? 258 LEU B O   1 
ATOM 6648  C CB  . LEU B 2 258 ? 107.035 115.385 102.008 1.00 500.00 ? 258 LEU B CB  1 
ATOM 6649  C CG  . LEU B 2 258 ? 106.114 114.166 102.226 1.00 500.00 ? 258 LEU B CG  1 
ATOM 6650  C CD1 . LEU B 2 258 ? 106.858 112.831 102.181 1.00 500.00 ? 258 LEU B CD1 1 
ATOM 6651  C CD2 . LEU B 2 258 ? 105.349 114.300 103.544 1.00 500.00 ? 258 LEU B CD2 1 
ATOM 6652  N N   . VAL B 2 259 ? 107.111 116.746 99.164  1.00 500.00 ? 259 VAL B N   1 
ATOM 6653  C CA  . VAL B 2 259 ? 106.471 117.110 97.900  1.00 500.00 ? 259 VAL B CA  1 
ATOM 6654  C C   . VAL B 2 259 ? 107.323 116.629 96.722  1.00 500.00 ? 259 VAL B C   1 
ATOM 6655  O O   . VAL B 2 259 ? 106.806 116.030 95.762  1.00 500.00 ? 259 VAL B O   1 
ATOM 6656  C CB  . VAL B 2 259 ? 106.073 118.605 97.833  1.00 500.00 ? 259 VAL B CB  1 
ATOM 6657  C CG1 . VAL B 2 259 ? 105.555 118.975 96.445  1.00 500.00 ? 259 VAL B CG1 1 
ATOM 6658  C CG2 . VAL B 2 259 ? 104.998 118.905 98.874  1.00 500.00 ? 259 VAL B CG2 1 
ATOM 6659  N N   . ALA B 2 260 ? 108.618 116.897 96.843  1.00 500.00 ? 260 ALA B N   1 
ATOM 6660  C CA  . ALA B 2 260 ? 109.600 116.519 95.820  1.00 500.00 ? 260 ALA B CA  1 
ATOM 6661  C C   . ALA B 2 260 ? 109.576 115.009 95.602  1.00 500.00 ? 260 ALA B C   1 
ATOM 6662  O O   . ALA B 2 260 ? 109.570 114.547 94.450  1.00 476.29 ? 260 ALA B O   1 
ATOM 6663  C CB  . ALA B 2 260 ? 111.006 117.013 96.168  1.00 500.00 ? 260 ALA B CB  1 
ATOM 6664  N N   . VAL B 2 261 ? 109.564 114.290 96.721  1.00 500.00 ? 261 VAL B N   1 
ATOM 6665  C CA  . VAL B 2 261 ? 109.516 112.828 96.713  1.00 500.00 ? 261 VAL B CA  1 
ATOM 6666  C C   . VAL B 2 261 ? 108.314 112.306 95.892  1.00 500.00 ? 261 VAL B C   1 
ATOM 6667  O O   . VAL B 2 261 ? 108.514 111.384 95.101  1.00 500.00 ? 261 VAL B O   1 
ATOM 6668  C CB  . VAL B 2 261 ? 109.530 112.217 98.143  1.00 500.00 ? 261 VAL B CB  1 
ATOM 6669  C CG1 . VAL B 2 261 ? 109.136 110.734 98.136  1.00 500.00 ? 261 VAL B CG1 1 
ATOM 6670  C CG2 . VAL B 2 261 ? 110.908 112.400 98.768  1.00 500.00 ? 261 VAL B CG2 1 
ATOM 6671  N N   . LEU B 2 262 ? 107.134 112.922 95.974  1.00 500.00 ? 262 LEU B N   1 
ATOM 6672  C CA  . LEU B 2 262 ? 105.954 112.441 95.203  1.00 500.00 ? 262 LEU B CA  1 
ATOM 6673  C C   . LEU B 2 262 ? 105.976 112.846 93.665  1.00 500.00 ? 262 LEU B C   1 
ATOM 6674  O O   . LEU B 2 262 ? 106.810 112.255 92.958  1.00 406.90 ? 262 LEU B O   1 
ATOM 6675  C CB  . LEU B 2 262 ? 104.649 112.701 95.993  1.00 500.00 ? 262 LEU B CB  1 
ATOM 6676  C CG  . LEU B 2 262 ? 104.583 112.192 97.446  1.00 500.00 ? 262 LEU B CG  1 
ATOM 6677  C CD1 . LEU B 2 262 ? 103.264 112.618 98.090  1.00 500.00 ? 262 LEU B CD1 1 
ATOM 6678  C CD2 . LEU B 2 262 ? 104.785 110.682 97.544  1.00 500.00 ? 262 LEU B CD2 1 
ATOM 6679  N N   . CYS B 2 263 ? 105.188 113.792 93.086  1.00 500.00 ? 263 CYS B N   1 
ATOM 6680  C CA  . CYS B 2 263 ? 104.264 114.812 93.688  1.00 500.00 ? 263 CYS B CA  1 
ATOM 6681  C C   . CYS B 2 263 ? 102.830 114.282 93.940  1.00 470.83 ? 263 CYS B C   1 
ATOM 6682  O O   . CYS B 2 263 ? 102.495 113.128 93.637  1.00 348.82 ? 263 CYS B O   1 
ATOM 6683  C CB  . CYS B 2 263 ? 104.137 116.077 92.777  1.00 500.00 ? 263 CYS B CB  1 
ATOM 6684  S SG  . CYS B 2 263 ? 105.600 117.104 92.368  1.00 403.28 ? 263 CYS B SG  1 
ATOM 6685  N N   . ASN B 2 279 ? 124.182 114.752 93.269  1.00 500.00 ? 279 ASN B N   1 
ATOM 6686  C CA  . ASN B 2 279 ? 125.625 114.983 93.164  1.00 500.00 ? 279 ASN B CA  1 
ATOM 6687  C C   . ASN B 2 279 ? 126.112 116.155 94.081  1.00 500.00 ? 279 ASN B C   1 
ATOM 6688  O O   . ASN B 2 279 ? 125.293 116.987 94.474  1.00 500.00 ? 279 ASN B O   1 
ATOM 6689  C CB  . ASN B 2 279 ? 126.015 115.179 91.676  1.00 500.00 ? 279 ASN B CB  1 
ATOM 6690  C CG  . ASN B 2 279 ? 125.684 116.575 91.136  1.00 500.00 ? 279 ASN B CG  1 
ATOM 6691  O OD1 . ASN B 2 279 ? 124.611 117.121 91.406  1.00 500.00 ? 279 ASN B OD1 1 
ATOM 6692  N ND2 . ASN B 2 279 ? 126.606 117.147 90.350  1.00 500.00 ? 279 ASN B ND2 1 
ATOM 6693  N N   . GLU B 2 280 ? 127.408 116.255 94.422  1.00 500.00 ? 280 GLU B N   1 
ATOM 6694  C CA  . GLU B 2 280 ? 128.504 115.443 93.868  1.00 500.00 ? 280 GLU B CA  1 
ATOM 6695  C C   . GLU B 2 280 ? 129.405 114.906 95.005  1.00 500.00 ? 280 GLU B C   1 
ATOM 6696  O O   . GLU B 2 280 ? 129.017 113.947 95.696  1.00 374.62 ? 280 GLU B O   1 
ATOM 6697  C CB  . GLU B 2 280 ? 129.249 116.266 92.770  1.00 500.00 ? 280 GLU B CB  1 
ATOM 6698  C CG  . GLU B 2 280 ? 130.272 115.495 91.915  1.00 500.00 ? 280 GLU B CG  1 
ATOM 6699  C CD  . GLU B 2 280 ? 130.699 116.206 90.619  1.00 500.00 ? 280 GLU B CD  1 
ATOM 6700  O OE1 . GLU B 2 280 ? 131.731 115.786 90.042  1.00 437.37 ? 280 GLU B OE1 1 
ATOM 6701  O OE2 . GLU B 2 280 ? 130.018 117.161 90.170  1.00 442.01 ? 280 GLU B OE2 1 
ATOM 6702  N N   . THR B 2 281 ? 130.578 115.513 95.195  1.00 500.00 ? 281 THR B N   1 
ATOM 6703  C CA  . THR B 2 281 ? 131.554 115.080 96.200  1.00 500.00 ? 281 THR B CA  1 
ATOM 6704  C C   . THR B 2 281 ? 131.658 116.046 97.408  1.00 500.00 ? 281 THR B C   1 
ATOM 6705  O O   . THR B 2 281 ? 132.382 115.749 98.371  1.00 500.00 ? 281 THR B O   1 
ATOM 6706  C CB  . THR B 2 281 ? 132.951 114.794 95.552  1.00 500.00 ? 281 THR B CB  1 
ATOM 6707  O OG1 . THR B 2 281 ? 133.859 114.288 96.544  1.00 500.00 ? 281 THR B OG1 1 
ATOM 6708  C CG2 . THR B 2 281 ? 133.571 116.040 94.867  1.00 500.00 ? 281 THR B CG2 1 
ATOM 6709  N N   . LEU B 2 282 ? 130.953 117.188 97.364  1.00 500.00 ? 282 LEU B N   1 
ATOM 6710  C CA  . LEU B 2 282 ? 130.774 118.005 98.568  1.00 500.00 ? 282 LEU B CA  1 
ATOM 6711  C C   . LEU B 2 282 ? 129.889 117.213 99.488  1.00 500.00 ? 282 LEU B C   1 
ATOM 6712  O O   . LEU B 2 282 ? 130.331 116.780 100.553 1.00 500.00 ? 282 LEU B O   1 
ATOM 6713  C CB  . LEU B 2 282 ? 130.149 119.382 98.296  1.00 500.00 ? 282 LEU B CB  1 
ATOM 6714  C CG  . LEU B 2 282 ? 129.730 120.168 99.572  1.00 500.00 ? 282 LEU B CG  1 
ATOM 6715  C CD1 . LEU B 2 282 ? 130.341 121.559 99.646  1.00 500.00 ? 282 LEU B CD1 1 
ATOM 6716  C CD2 . LEU B 2 282 ? 128.220 120.270 99.757  1.00 500.00 ? 282 LEU B CD2 1 
ATOM 6717  N N   . PHE B 2 283 ? 128.642 117.029 99.065  1.00 500.00 ? 283 PHE B N   1 
ATOM 6718  C CA  . PHE B 2 283 ? 127.754 116.136 99.759  1.00 500.00 ? 283 PHE B CA  1 
ATOM 6719  C C   . PHE B 2 283 ? 127.530 114.897 98.914  1.00 500.00 ? 283 PHE B C   1 
ATOM 6720  O O   . PHE B 2 283 ? 126.924 114.956 97.836  1.00 500.00 ? 283 PHE B O   1 
ATOM 6721  C CB  . PHE B 2 283 ? 126.458 116.815 100.268 1.00 500.00 ? 283 PHE B CB  1 
ATOM 6722  C CG  . PHE B 2 283 ? 125.425 117.191 99.215  1.00 500.00 ? 283 PHE B CG  1 
ATOM 6723  C CD1 . PHE B 2 283 ? 125.564 118.340 98.427  1.00 500.00 ? 283 PHE B CD1 1 
ATOM 6724  C CD2 . PHE B 2 283 ? 124.242 116.444 99.092  1.00 500.00 ? 283 PHE B CD2 1 
ATOM 6725  C CE1 . PHE B 2 283 ? 124.586 118.696 97.502  1.00 500.00 ? 283 PHE B CE1 1 
ATOM 6726  C CE2 . PHE B 2 283 ? 123.263 116.800 98.167  1.00 500.00 ? 283 PHE B CE2 1 
ATOM 6727  C CZ  . PHE B 2 283 ? 123.434 117.929 97.373  1.00 500.00 ? 283 PHE B CZ  1 
ATOM 6728  N N   . PRO B 2 284 ? 128.130 113.781 99.361  1.00 500.00 ? 284 PRO B N   1 
ATOM 6729  C CA  . PRO B 2 284 ? 127.444 112.543 99.082  1.00 500.00 ? 284 PRO B CA  1 
ATOM 6730  C C   . PRO B 2 284 ? 125.953 112.629 99.537  1.00 500.00 ? 284 PRO B C   1 
ATOM 6731  O O   . PRO B 2 284 ? 125.092 112.630 98.651  1.00 500.00 ? 284 PRO B O   1 
ATOM 6732  C CB  . PRO B 2 284 ? 128.286 111.475 99.818  1.00 500.00 ? 284 PRO B CB  1 
ATOM 6733  C CG  . PRO B 2 284 ? 129.542 112.160 100.284 1.00 500.00 ? 284 PRO B CG  1 
ATOM 6734  C CD  . PRO B 2 284 ? 129.535 113.563 99.755  1.00 500.00 ? 284 PRO B CD  1 
ATOM 6735  N N   . ALA B 2 285 ? 125.607 112.786 100.830 1.00 500.00 ? 285 ALA B N   1 
ATOM 6736  C CA  . ALA B 2 285 ? 126.490 113.049 101.986 1.00 500.00 ? 285 ALA B CA  1 
ATOM 6737  C C   . ALA B 2 285 ? 126.665 111.812 102.836 1.00 498.37 ? 285 ALA B C   1 
ATOM 6738  O O   . ALA B 2 285 ? 125.724 111.032 102.989 1.00 473.80 ? 285 ALA B O   1 
ATOM 6739  C CB  . ALA B 2 285 ? 125.901 114.142 102.853 1.00 500.00 ? 285 ALA B CB  1 
ATOM 6740  N N   . LEU B 2 286 ? 127.860 111.677 103.412 1.00 488.81 ? 286 LEU B N   1 
ATOM 6741  C CA  . LEU B 2 286 ? 128.198 110.588 104.317 1.00 500.00 ? 286 LEU B CA  1 
ATOM 6742  C C   . LEU B 2 286 ? 128.000 109.204 103.686 1.00 500.00 ? 286 LEU B C   1 
ATOM 6743  O O   . LEU B 2 286 ? 126.869 108.727 103.518 1.00 500.00 ? 286 LEU B O   1 
ATOM 6744  C CB  . LEU B 2 286 ? 127.365 110.703 105.596 1.00 500.00 ? 286 LEU B CB  1 
ATOM 6745  C CG  . LEU B 2 286 ? 127.740 109.743 106.717 1.00 500.00 ? 286 LEU B CG  1 
ATOM 6746  C CD1 . LEU B 2 286 ? 129.182 110.018 107.130 1.00 500.00 ? 286 LEU B CD1 1 
ATOM 6747  C CD2 . LEU B 2 286 ? 126.739 109.879 107.862 1.00 500.00 ? 286 LEU B CD2 1 
ATOM 6748  N N   . ILE B 2 287 ? 129.106 108.541 103.380 1.00 500.00 ? 287 ILE B N   1 
ATOM 6749  C CA  . ILE B 2 287 ? 129.058 107.346 102.545 1.00 500.00 ? 287 ILE B CA  1 
ATOM 6750  C C   . ILE B 2 287 ? 128.978 106.098 103.468 1.00 500.00 ? 287 ILE B C   1 
ATOM 6751  O O   . ILE B 2 287 ? 128.033 106.002 104.270 1.00 409.89 ? 287 ILE B O   1 
ATOM 6752  C CB  . ILE B 2 287 ? 130.206 107.356 101.483 1.00 500.00 ? 287 ILE B CB  1 
ATOM 6753  C CG1 . ILE B 2 287 ? 130.406 108.773 100.892 1.00 500.00 ? 287 ILE B CG1 1 
ATOM 6754  C CG2 . ILE B 2 287 ? 129.903 106.362 100.357 1.00 500.00 ? 287 ILE B CG2 1 
ATOM 6755  C CD1 . ILE B 2 287 ? 131.420 108.867 99.764  1.00 500.00 ? 287 ILE B CD1 1 
ATOM 6756  N N   . TYR B 2 288 ? 129.937 105.166 103.365 1.00 500.00 ? 288 TYR B N   1 
ATOM 6757  C CA  . TYR B 2 288 ? 129.929 103.908 104.126 1.00 500.00 ? 288 TYR B CA  1 
ATOM 6758  C C   . TYR B 2 288 ? 130.333 104.126 105.583 1.00 500.00 ? 288 TYR B C   1 
ATOM 6759  O O   . TYR B 2 288 ? 131.441 103.765 106.002 1.00 500.00 ? 288 TYR B O   1 
ATOM 6760  C CB  . TYR B 2 288 ? 130.873 102.887 103.470 1.00 405.01 ? 288 TYR B CB  1 
ATOM 6761  N N   . GLY B 2 378 ? 128.175 101.085 99.481  1.00 439.54 ? 378 GLY B N   1 
ATOM 6762  C CA  . GLY B 2 378 ? 127.236 101.076 100.600 1.00 484.68 ? 378 GLY B CA  1 
ATOM 6763  C C   . GLY B 2 378 ? 126.131 102.125 100.494 1.00 500.00 ? 378 GLY B C   1 
ATOM 6764  O O   . GLY B 2 378 ? 125.463 102.227 99.459  1.00 500.00 ? 378 GLY B O   1 
ATOM 6765  N N   . VAL B 2 379 ? 125.975 102.925 101.559 1.00 500.00 ? 379 VAL B N   1 
ATOM 6766  C CA  . VAL B 2 379 ? 124.792 103.803 101.790 1.00 500.00 ? 379 VAL B CA  1 
ATOM 6767  C C   . VAL B 2 379 ? 125.115 105.327 101.742 1.00 500.00 ? 379 VAL B C   1 
ATOM 6768  O O   . VAL B 2 379 ? 126.271 105.735 101.883 1.00 500.00 ? 379 VAL B O   1 
ATOM 6769  C CB  . VAL B 2 379 ? 124.081 103.401 103.136 1.00 500.00 ? 379 VAL B CB  1 
ATOM 6770  C CG1 . VAL B 2 379 ? 124.860 103.888 104.368 1.00 500.00 ? 379 VAL B CG1 1 
ATOM 6771  C CG2 . VAL B 2 379 ? 122.617 103.861 103.183 1.00 500.00 ? 379 VAL B CG2 1 
ATOM 6772  N N   . LYS B 2 380 ? 124.079 106.144 101.524 1.00 500.00 ? 380 LYS B N   1 
ATOM 6773  C CA  . LYS B 2 380 ? 124.202 107.594 101.341 1.00 484.69 ? 380 LYS B CA  1 
ATOM 6774  C C   . LYS B 2 380 ? 123.072 108.340 102.066 1.00 453.93 ? 380 LYS B C   1 
ATOM 6775  O O   . LYS B 2 380 ? 122.030 107.747 102.398 1.00 419.91 ? 380 LYS B O   1 
ATOM 6776  C CB  . LYS B 2 380 ? 124.161 107.877 99.844  1.00 500.00 ? 380 LYS B CB  1 
ATOM 6777  C CG  . LYS B 2 380 ? 124.504 109.291 99.430  1.00 500.00 ? 380 LYS B CG  1 
ATOM 6778  C CD  . LYS B 2 380 ? 124.683 109.410 97.914  1.00 500.00 ? 380 LYS B CD  1 
ATOM 6779  C CE  . LYS B 2 380 ? 126.113 109.131 97.445  1.00 500.00 ? 380 LYS B CE  1 
ATOM 6780  N NZ  . LYS B 2 380 ? 126.431 109.785 96.135  1.00 500.00 ? 380 LYS B NZ  1 
ATOM 6781  N N   . LEU B 2 381 ? 123.291 109.635 102.306 1.00 454.98 ? 381 LEU B N   1 
ATOM 6782  C CA  . LEU B 2 381 ? 122.390 110.479 103.110 1.00 491.63 ? 381 LEU B CA  1 
ATOM 6783  C C   . LEU B 2 381 ? 122.411 111.958 102.637 1.00 500.00 ? 381 LEU B C   1 
ATOM 6784  O O   . LEU B 2 381 ? 123.401 112.402 102.068 1.00 481.44 ? 381 LEU B O   1 
ATOM 6785  C CB  . LEU B 2 381 ? 122.810 110.314 104.578 1.00 476.25 ? 381 LEU B CB  1 
ATOM 6786  C CG  . LEU B 2 381 ? 122.607 111.333 105.703 1.00 487.48 ? 381 LEU B CG  1 
ATOM 6787  C CD1 . LEU B 2 381 ? 123.602 112.485 105.579 1.00 464.12 ? 381 LEU B CD1 1 
ATOM 6788  C CD2 . LEU B 2 381 ? 121.152 111.790 105.831 1.00 500.00 ? 381 LEU B CD2 1 
ATOM 6789  N N   . GLY B 2 382 ? 121.323 112.706 102.849 1.00 500.00 ? 382 GLY B N   1 
ATOM 6790  C CA  . GLY B 2 382 ? 121.260 114.148 102.497 1.00 500.00 ? 382 GLY B CA  1 
ATOM 6791  C C   . GLY B 2 382 ? 121.917 115.120 103.488 1.00 500.00 ? 382 GLY B C   1 
ATOM 6792  O O   . GLY B 2 382 ? 121.542 115.164 104.673 1.00 431.91 ? 382 GLY B O   1 
ATOM 6793  N N   . LEU B 2 383 ? 122.863 115.934 102.998 1.00 500.00 ? 383 LEU B N   1 
ATOM 6794  C CA  . LEU B 2 383 ? 123.726 116.753 103.872 1.00 489.79 ? 383 LEU B CA  1 
ATOM 6795  C C   . LEU B 2 383 ? 122.961 117.881 104.492 1.00 469.18 ? 383 LEU B C   1 
ATOM 6796  O O   . LEU B 2 383 ? 123.104 118.126 105.699 1.00 429.24 ? 383 LEU B O   1 
ATOM 6797  C CB  . LEU B 2 383 ? 124.915 117.348 103.125 1.00 470.46 ? 383 LEU B CB  1 
ATOM 6798  C CG  . LEU B 2 383 ? 125.923 118.142 103.978 1.00 464.58 ? 383 LEU B CG  1 
ATOM 6799  C CD1 . LEU B 2 383 ? 127.361 117.620 103.921 1.00 436.31 ? 383 LEU B CD1 1 
ATOM 6800  C CD2 . LEU B 2 383 ? 125.852 119.616 103.596 1.00 500.00 ? 383 LEU B CD2 1 
ATOM 6801  N N   . GLY B 2 384 ? 122.106 118.519 103.692 1.00 500.00 ? 384 GLY B N   1 
ATOM 6802  C CA  . GLY B 2 384 ? 121.207 119.583 104.172 1.00 500.00 ? 384 GLY B CA  1 
ATOM 6803  C C   . GLY B 2 384 ? 120.324 119.038 105.295 1.00 500.00 ? 384 GLY B C   1 
ATOM 6804  O O   . GLY B 2 384 ? 120.162 119.680 106.348 1.00 500.00 ? 384 GLY B O   1 
ATOM 6805  N N   . ASP B 2 385 ? 119.769 117.855 105.029 1.00 500.00 ? 385 ASP B N   1 
ATOM 6806  C CA  . ASP B 2 385 ? 118.876 117.202 105.996 1.00 500.00 ? 385 ASP B CA  1 
ATOM 6807  C C   . ASP B 2 385 ? 119.619 116.924 107.296 1.00 500.00 ? 385 ASP B C   1 
ATOM 6808  O O   . ASP B 2 385 ? 119.076 117.173 108.375 1.00 500.00 ? 385 ASP B O   1 
ATOM 6809  C CB  . ASP B 2 385 ? 118.131 116.015 105.386 1.00 500.00 ? 385 ASP B CB  1 
ATOM 6810  C CG  . ASP B 2 385 ? 116.944 116.472 104.509 1.00 500.00 ? 385 ASP B CG  1 
ATOM 6811  O OD1 . ASP B 2 385 ? 115.866 116.782 105.071 1.00 461.80 ? 385 ASP B OD1 1 
ATOM 6812  O OD2 . ASP B 2 385 ? 117.100 116.549 103.269 1.00 500.00 ? 385 ASP B OD2 1 
ATOM 6813  N N   . PHE B 2 386 ? 120.835 116.444 107.167 1.00 457.85 ? 386 PHE B N   1 
ATOM 6814  C CA  . PHE B 2 386 ? 121.723 116.138 108.289 1.00 468.99 ? 386 PHE B CA  1 
ATOM 6815  C C   . PHE B 2 386 ? 121.919 117.398 109.151 1.00 428.78 ? 386 PHE B C   1 
ATOM 6816  O O   . PHE B 2 386 ? 121.798 117.365 110.391 1.00 403.47 ? 386 PHE B O   1 
ATOM 6817  C CB  . PHE B 2 386 ? 123.022 115.720 107.591 1.00 491.73 ? 386 PHE B CB  1 
ATOM 6818  C CG  . PHE B 2 386 ? 124.119 115.247 108.474 1.00 500.00 ? 386 PHE B CG  1 
ATOM 6819  C CD1 . PHE B 2 386 ? 124.942 116.154 109.132 1.00 500.00 ? 386 PHE B CD1 1 
ATOM 6820  C CD2 . PHE B 2 386 ? 124.430 113.888 108.536 1.00 500.00 ? 386 PHE B CD2 1 
ATOM 6821  C CE1 . PHE B 2 386 ? 126.002 115.699 109.904 1.00 500.00 ? 386 PHE B CE1 1 
ATOM 6822  C CE2 . PHE B 2 386 ? 125.489 113.434 109.301 1.00 500.00 ? 386 PHE B CE2 1 
ATOM 6823  C CZ  . PHE B 2 386 ? 126.278 114.340 109.987 1.00 500.00 ? 386 PHE B CZ  1 
ATOM 6824  N N   . ILE B 2 387 ? 122.219 118.482 108.450 1.00 389.01 ? 387 ILE B N   1 
ATOM 6825  C CA  . ILE B 2 387 ? 122.453 119.790 109.068 1.00 380.91 ? 387 ILE B CA  1 
ATOM 6826  C C   . ILE B 2 387 ? 121.225 120.215 109.875 1.00 383.09 ? 387 ILE B C   1 
ATOM 6827  O O   . ILE B 2 387 ? 121.332 120.669 111.021 1.00 403.79 ? 387 ILE B O   1 
ATOM 6828  C CB  . ILE B 2 387 ? 122.677 120.881 108.003 1.00 433.25 ? 387 ILE B CB  1 
ATOM 6829  C CG1 . ILE B 2 387 ? 124.056 120.726 107.377 1.00 500.00 ? 387 ILE B CG1 1 
ATOM 6830  C CG2 . ILE B 2 387 ? 122.506 122.293 108.579 1.00 427.56 ? 387 ILE B CG2 1 
ATOM 6831  C CD1 . ILE B 2 387 ? 124.140 121.310 105.983 1.00 500.00 ? 387 ILE B CD1 1 
ATOM 6832  N N   . PHE B 2 388 ? 120.077 120.061 109.229 1.00 374.47 ? 388 PHE B N   1 
ATOM 6833  C CA  . PHE B 2 388 ? 118.786 120.417 109.822 1.00 425.69 ? 388 PHE B CA  1 
ATOM 6834  C C   . PHE B 2 388 ? 118.553 119.644 111.092 1.00 442.40 ? 388 PHE B C   1 
ATOM 6835  O O   . PHE B 2 388 ? 118.131 120.238 112.099 1.00 468.35 ? 388 PHE B O   1 
ATOM 6836  C CB  . PHE B 2 388 ? 117.645 120.429 108.808 1.00 423.14 ? 388 PHE B CB  1 
ATOM 6837  C CG  . PHE B 2 388 ? 117.681 121.656 107.951 1.00 500.00 ? 388 PHE B CG  1 
ATOM 6838  C CD1 . PHE B 2 388 ? 117.526 122.917 108.539 1.00 500.00 ? 388 PHE B CD1 1 
ATOM 6839  C CD2 . PHE B 2 388 ? 117.969 121.584 106.594 1.00 500.00 ? 388 PHE B CD2 1 
ATOM 6840  C CE1 . PHE B 2 388 ? 117.605 124.072 107.777 1.00 500.00 ? 388 PHE B CE1 1 
ATOM 6841  C CE2 . PHE B 2 388 ? 118.052 122.736 105.821 1.00 500.00 ? 388 PHE B CE2 1 
ATOM 6842  C CZ  . PHE B 2 388 ? 117.870 123.983 106.412 1.00 500.00 ? 388 PHE B CZ  1 
ATOM 6843  N N   . TYR B 2 389 ? 118.849 118.341 111.035 1.00 446.60 ? 389 TYR B N   1 
ATOM 6844  C CA  . TYR B 2 389 ? 118.745 117.468 112.218 1.00 489.42 ? 389 TYR B CA  1 
ATOM 6845  C C   . TYR B 2 389 ? 119.465 118.059 113.427 1.00 500.00 ? 389 TYR B C   1 
ATOM 6846  O O   . TYR B 2 389 ? 118.957 118.024 114.523 1.00 489.46 ? 389 TYR B O   1 
ATOM 6847  C CB  . TYR B 2 389 ? 119.332 116.062 112.012 1.00 500.00 ? 389 TYR B CB  1 
ATOM 6848  C CG  . TYR B 2 389 ? 118.627 115.124 111.062 1.00 476.90 ? 389 TYR B CG  1 
ATOM 6849  C CD1 . TYR B 2 389 ? 117.252 115.180 110.849 1.00 468.33 ? 389 TYR B CD1 1 
ATOM 6850  C CD2 . TYR B 2 389 ? 119.352 114.128 110.416 1.00 475.76 ? 389 TYR B CD2 1 
ATOM 6851  C CE1 . TYR B 2 389 ? 116.633 114.297 109.983 1.00 488.25 ? 389 TYR B CE1 1 
ATOM 6852  C CE2 . TYR B 2 389 ? 118.743 113.243 109.554 1.00 489.82 ? 389 TYR B CE2 1 
ATOM 6853  C CZ  . TYR B 2 389 ? 117.385 113.329 109.343 1.00 500.00 ? 389 TYR B CZ  1 
ATOM 6854  O OH  . TYR B 2 389 ? 116.793 112.437 108.487 1.00 500.00 ? 389 TYR B OH  1 
ATOM 6855  N N   . SER B 2 390 ? 120.624 118.661 113.142 1.00 490.17 ? 390 SER B N   1 
ATOM 6856  C CA  . SER B 2 390 ? 121.462 119.306 114.140 1.00 459.75 ? 390 SER B CA  1 
ATOM 6857  C C   . SER B 2 390 ? 120.852 120.621 114.558 1.00 386.70 ? 390 SER B C   1 
ATOM 6858  O O   . SER B 2 390 ? 120.936 120.943 115.758 1.00 349.98 ? 390 SER B O   1 
ATOM 6859  C CB  . SER B 2 390 ? 122.899 119.500 113.619 1.00 455.79 ? 390 SER B CB  1 
ATOM 6860  O OG  . SER B 2 390 ? 123.723 118.408 113.988 1.00 421.68 ? 390 SER B OG  1 
ATOM 6861  N N   . VAL B 2 391 ? 120.307 121.375 113.599 1.00 344.49 ? 391 VAL B N   1 
ATOM 6862  C CA  . VAL B 2 391 ? 119.777 122.702 113.862 1.00 395.28 ? 391 VAL B CA  1 
ATOM 6863  C C   . VAL B 2 391 ? 118.656 122.625 114.904 1.00 407.89 ? 391 VAL B C   1 
ATOM 6864  O O   . VAL B 2 391 ? 118.609 123.406 115.868 1.00 411.21 ? 391 VAL B O   1 
ATOM 6865  C CB  . VAL B 2 391 ? 119.229 123.427 112.601 1.00 468.21 ? 391 VAL B CB  1 
ATOM 6866  C CG1 . VAL B 2 391 ? 118.599 124.772 112.977 1.00 495.67 ? 391 VAL B CG1 1 
ATOM 6867  C CG2 . VAL B 2 391 ? 120.315 123.637 111.548 1.00 495.07 ? 391 VAL B CG2 1 
ATOM 6868  N N   . LEU B 2 392 ? 117.780 121.661 114.698 1.00 446.86 ? 392 LEU B N   1 
ATOM 6869  C CA  . LEU B 2 392 ? 116.572 121.462 115.479 1.00 468.23 ? 392 LEU B CA  1 
ATOM 6870  C C   . LEU B 2 392 ? 116.949 121.264 116.965 1.00 455.36 ? 392 LEU B C   1 
ATOM 6871  O O   . LEU B 2 392 ? 116.456 121.929 117.922 1.00 438.05 ? 392 LEU B O   1 
ATOM 6872  C CB  . LEU B 2 392 ? 115.890 120.194 114.925 1.00 455.83 ? 392 LEU B CB  1 
ATOM 6873  C CG  . LEU B 2 392 ? 114.898 119.336 115.714 1.00 459.89 ? 392 LEU B CG  1 
ATOM 6874  C CD1 . LEU B 2 392 ? 114.155 118.442 114.731 1.00 500.00 ? 392 LEU B CD1 1 
ATOM 6875  C CD2 . LEU B 2 392 ? 115.544 118.483 116.800 1.00 415.17 ? 392 LEU B CD2 1 
ATOM 6876  N N   . VAL B 2 393 ? 117.841 120.288 117.105 1.00 401.10 ? 393 VAL B N   1 
ATOM 6877  C CA  . VAL B 2 393 ? 118.340 119.883 118.434 1.00 376.06 ? 393 VAL B CA  1 
ATOM 6878  C C   . VAL B 2 393 ? 119.037 121.061 119.097 1.00 389.66 ? 393 VAL B C   1 
ATOM 6879  O O   . VAL B 2 393 ? 118.816 121.307 120.288 1.00 395.03 ? 393 VAL B O   1 
ATOM 6880  C CB  . VAL B 2 393 ? 119.115 118.564 118.357 1.00 398.31 ? 393 VAL B CB  1 
ATOM 6881  C CG1 . VAL B 2 393 ? 120.410 118.711 117.594 1.00 398.30 ? 393 VAL B CG1 1 
ATOM 6882  C CG2 . VAL B 2 393 ? 119.352 118.008 119.754 1.00 481.80 ? 393 VAL B CG2 1 
ATOM 6883  N N   . GLY B 2 394 ? 119.839 121.777 118.321 1.00 400.82 ? 394 GLY B N   1 
ATOM 6884  C CA  . GLY B 2 394 ? 120.572 122.950 118.798 1.00 422.70 ? 394 GLY B CA  1 
ATOM 6885  C C   . GLY B 2 394 ? 119.603 123.991 119.325 1.00 403.69 ? 394 GLY B C   1 
ATOM 6886  O O   . GLY B 2 394 ? 119.813 124.554 120.407 1.00 403.19 ? 394 GLY B O   1 
ATOM 6887  N N   . LYS B 2 395 ? 118.555 124.222 118.544 1.00 413.37 ? 395 LYS B N   1 
ATOM 6888  C CA  . LYS B 2 395 ? 117.502 125.191 118.891 1.00 441.63 ? 395 LYS B CA  1 
ATOM 6889  C C   . LYS B 2 395 ? 116.874 124.822 120.226 1.00 430.24 ? 395 LYS B C   1 
ATOM 6890  O O   . LYS B 2 395 ? 116.689 125.686 121.103 1.00 447.36 ? 395 LYS B O   1 
ATOM 6891  C CB  . LYS B 2 395 ? 116.418 125.293 117.811 1.00 498.73 ? 395 LYS B CB  1 
ATOM 6892  C CG  . LYS B 2 395 ? 116.655 126.420 116.817 1.00 500.00 ? 395 LYS B CG  1 
ATOM 6893  C CD  . LYS B 2 395 ? 116.284 127.780 117.400 1.00 500.00 ? 395 LYS B CD  1 
ATOM 6894  C CE  . LYS B 2 395 ? 116.890 128.928 116.598 1.00 500.00 ? 395 LYS B CE  1 
ATOM 6895  N NZ  . LYS B 2 395 ? 116.684 130.262 117.235 1.00 500.00 ? 395 LYS B NZ  1 
ATOM 6896  N N   . ALA B 2 396 ? 116.561 123.536 120.345 1.00 407.98 ? 396 ALA B N   1 
ATOM 6897  C CA  . ALA B 2 396 ? 115.950 122.981 121.558 1.00 427.21 ? 396 ALA B CA  1 
ATOM 6898  C C   . ALA B 2 396 ? 116.838 123.249 122.769 1.00 410.68 ? 396 ALA B C   1 
ATOM 6899  O O   . ALA B 2 396 ? 116.370 123.684 123.826 1.00 443.52 ? 396 ALA B O   1 
ATOM 6900  C CB  . ALA B 2 396 ? 115.719 121.489 121.404 1.00 470.29 ? 396 ALA B CB  1 
ATOM 6901  N N   . SER B 2 397 ? 118.116 122.968 122.573 1.00 399.83 ? 397 SER B N   1 
ATOM 6902  C CA  . SER B 2 397 ? 119.148 123.151 123.603 1.00 447.06 ? 397 SER B CA  1 
ATOM 6903  C C   . SER B 2 397 ? 119.169 124.604 124.072 1.00 439.90 ? 397 SER B C   1 
ATOM 6904  O O   . SER B 2 397 ? 119.194 124.889 125.275 1.00 435.90 ? 397 SER B O   1 
ATOM 6905  C CB  . SER B 2 397 ? 120.545 122.766 123.056 1.00 449.89 ? 397 SER B CB  1 
ATOM 6906  O OG  . SER B 2 397 ? 121.614 123.477 123.679 1.00 396.27 ? 397 SER B OG  1 
ATOM 6907  N N   . ALA B 2 398 ? 119.158 125.487 123.086 1.00 453.55 ? 398 ALA B N   1 
ATOM 6908  C CA  . ALA B 2 398 ? 119.192 126.937 123.311 1.00 478.38 ? 398 ALA B CA  1 
ATOM 6909  C C   . ALA B 2 398 ? 118.011 127.464 124.101 1.00 477.60 ? 398 ALA B C   1 
ATOM 6910  O O   . ALA B 2 398 ? 118.189 128.125 125.146 1.00 448.96 ? 398 ALA B O   1 
ATOM 6911  C CB  . ALA B 2 398 ? 119.305 127.673 121.983 1.00 500.00 ? 398 ALA B CB  1 
ATOM 6912  N N   . THR B 2 399 ? 116.813 127.206 123.599 1.00 500.00 ? 399 THR B N   1 
ATOM 6913  C CA  . THR B 2 399 ? 115.617 127.844 124.118 1.00 500.00 ? 399 THR B CA  1 
ATOM 6914  C C   . THR B 2 399 ? 114.590 126.785 124.479 1.00 500.00 ? 399 THR B C   1 
ATOM 6915  O O   . THR B 2 399 ? 113.777 126.367 123.648 1.00 500.00 ? 399 THR B O   1 
ATOM 6916  C CB  . THR B 2 399 ? 115.052 128.857 123.098 1.00 500.00 ? 399 THR B CB  1 
ATOM 6917  O OG1 . THR B 2 399 ? 116.061 129.829 122.776 1.00 500.00 ? 399 THR B OG1 1 
ATOM 6918  C CG2 . THR B 2 399 ? 113.799 129.574 123.651 1.00 500.00 ? 399 THR B CG2 1 
ATOM 6919  N N   . ALA B 2 400 ? 114.657 126.342 125.729 1.00 489.23 ? 400 ALA B N   1 
ATOM 6920  C CA  . ALA B 2 400 ? 113.650 125.454 126.285 1.00 494.11 ? 400 ALA B CA  1 
ATOM 6921  C C   . ALA B 2 400 ? 113.723 125.475 127.792 1.00 464.25 ? 400 ALA B C   1 
ATOM 6922  O O   . ALA B 2 400 ? 114.717 125.925 128.371 1.00 441.51 ? 400 ALA B O   1 
ATOM 6923  C CB  . ALA B 2 400 ? 113.839 124.039 125.769 1.00 500.00 ? 400 ALA B CB  1 
ATOM 6924  N N   . SER B 2 401 ? 112.651 124.994 128.412 1.00 499.77 ? 401 SER B N   1 
ATOM 6925  C CA  . SER B 2 401 ? 112.562 124.899 129.863 1.00 500.00 ? 401 SER B CA  1 
ATOM 6926  C C   . SER B 2 401 ? 113.090 123.549 130.338 1.00 500.00 ? 401 SER B C   1 
ATOM 6927  O O   . SER B 2 401 ? 113.805 123.474 131.348 1.00 500.00 ? 401 SER B O   1 
ATOM 6928  C CB  . SER B 2 401 ? 111.117 125.109 130.325 1.00 500.00 ? 401 SER B CB  1 
ATOM 6929  O OG  . SER B 2 401 ? 111.049 125.308 131.733 1.00 500.00 ? 401 SER B OG  1 
ATOM 6930  N N   . GLY B 2 402 ? 112.739 122.490 129.607 1.00 495.93 ? 402 GLY B N   1 
ATOM 6931  C CA  . GLY B 2 402 ? 113.276 121.155 129.872 1.00 496.86 ? 402 GLY B CA  1 
ATOM 6932  C C   . GLY B 2 402 ? 114.739 121.165 129.517 1.00 424.95 ? 402 GLY B C   1 
ATOM 6933  O O   . GLY B 2 402 ? 115.554 120.504 130.157 1.00 372.07 ? 402 GLY B O   1 
ATOM 6934  N N   . ASP B 2 403 ? 115.052 121.945 128.487 1.00 455.99 ? 403 ASP B N   1 
ATOM 6935  C CA  . ASP B 2 403 ? 116.407 122.360 128.183 1.00 500.00 ? 403 ASP B CA  1 
ATOM 6936  C C   . ASP B 2 403 ? 117.137 121.102 127.781 1.00 480.46 ? 403 ASP B C   1 
ATOM 6937  O O   . ASP B 2 403 ? 117.070 120.720 126.597 1.00 473.96 ? 403 ASP B O   1 
ATOM 6938  C CB  . ASP B 2 403 ? 117.027 123.140 129.369 1.00 500.00 ? 403 ASP B CB  1 
ATOM 6939  C CG  . ASP B 2 403 ? 118.368 123.757 129.033 1.00 500.00 ? 403 ASP B CG  1 
ATOM 6940  O OD1 . ASP B 2 403 ? 118.417 124.606 128.118 1.00 500.00 ? 403 ASP B OD1 1 
ATOM 6941  O OD2 . ASP B 2 403 ? 119.365 123.414 129.703 1.00 500.00 ? 403 ASP B OD2 1 
ATOM 6942  N N   . TRP B 2 404 ? 117.725 120.415 128.768 1.00 473.18 ? 404 TRP B N   1 
ATOM 6943  C CA  . TRP B 2 404 ? 118.444 119.165 128.520 1.00 451.85 ? 404 TRP B CA  1 
ATOM 6944  C C   . TRP B 2 404 ? 117.436 118.138 128.008 1.00 445.04 ? 404 TRP B C   1 
ATOM 6945  O O   . TRP B 2 404 ? 117.672 117.410 127.026 1.00 423.09 ? 404 TRP B O   1 
ATOM 6946  C CB  . TRP B 2 404 ? 119.076 118.604 129.800 1.00 397.33 ? 404 TRP B CB  1 
ATOM 6947  C CG  . TRP B 2 404 ? 120.463 118.961 129.930 1.00 413.91 ? 404 TRP B CG  1 
ATOM 6948  C CD1 . TRP B 2 404 ? 121.045 119.648 130.947 1.00 491.83 ? 404 TRP B CD1 1 
ATOM 6949  C CD2 . TRP B 2 404 ? 121.486 118.682 128.985 1.00 402.99 ? 404 TRP B CD2 1 
ATOM 6950  N NE1 . TRP B 2 404 ? 122.391 119.805 130.703 1.00 500.00 ? 404 TRP B NE1 1 
ATOM 6951  C CE2 . TRP B 2 404 ? 122.690 119.222 129.501 1.00 462.83 ? 404 TRP B CE2 1 
ATOM 6952  C CE3 . TRP B 2 404 ? 121.506 118.029 127.745 1.00 381.99 ? 404 TRP B CE3 1 
ATOM 6953  C CZ2 . TRP B 2 404 ? 123.909 119.119 128.829 1.00 477.34 ? 404 TRP B CZ2 1 
ATOM 6954  C CZ3 . TRP B 2 404 ? 122.714 117.925 127.073 1.00 494.28 ? 404 TRP B CZ3 1 
ATOM 6955  C CH2 . TRP B 2 404 ? 123.905 118.470 127.619 1.00 500.00 ? 404 TRP B CH2 1 
ATOM 6956  N N   . ASN B 2 405 ? 116.401 117.978 128.842 1.00 444.79 ? 405 ASN B N   1 
ATOM 6957  C CA  . ASN B 2 405 ? 115.409 116.896 128.671 1.00 436.86 ? 405 ASN B CA  1 
ATOM 6958  C C   . ASN B 2 405 ? 114.876 116.891 127.266 1.00 396.99 ? 405 ASN B C   1 
ATOM 6959  O O   . ASN B 2 405 ? 114.868 115.881 126.530 1.00 416.98 ? 405 ASN B O   1 
ATOM 6960  C CB  . ASN B 2 405 ? 114.170 117.100 129.583 1.00 432.77 ? 405 ASN B CB  1 
ATOM 6961  C CG  . ASN B 2 405 ? 114.337 116.550 130.989 1.00 449.57 ? 405 ASN B CG  1 
ATOM 6962  O OD1 . ASN B 2 405 ? 115.309 115.865 131.311 1.00 466.92 ? 405 ASN B OD1 1 
ATOM 6963  N ND2 . ASN B 2 405 ? 113.361 116.857 131.846 1.00 427.37 ? 405 ASN B ND2 1 
ATOM 6964  N N   . THR B 2 406 ? 114.370 118.085 126.955 1.00 393.87 ? 406 THR B N   1 
ATOM 6965  C CA  . THR B 2 406 ? 113.673 118.328 125.698 1.00 441.46 ? 406 THR B CA  1 
ATOM 6966  C C   . THR B 2 406 ? 114.598 118.039 124.524 1.00 400.63 ? 406 THR B C   1 
ATOM 6967  O O   . THR B 2 406 ? 114.181 117.363 123.558 1.00 393.54 ? 406 THR B O   1 
ATOM 6968  C CB  . THR B 2 406 ? 113.218 119.811 125.556 1.00 473.44 ? 406 THR B CB  1 
ATOM 6969  O OG1 . THR B 2 406 ? 112.814 120.336 126.828 1.00 479.20 ? 406 THR B OG1 1 
ATOM 6970  C CG2 . THR B 2 406 ? 112.058 119.966 124.541 1.00 439.32 ? 406 THR B CG2 1 
ATOM 6971  N N   . THR B 2 407 ? 115.847 118.543 124.656 1.00 405.91 ? 407 THR B N   1 
ATOM 6972  C CA  . THR B 2 407 ? 116.823 118.401 123.583 1.00 446.58 ? 407 THR B CA  1 
ATOM 6973  C C   . THR B 2 407 ? 117.092 116.897 123.340 1.00 447.68 ? 407 THR B C   1 
ATOM 6974  O O   . THR B 2 407 ? 117.136 116.445 122.180 1.00 435.77 ? 407 THR B O   1 
ATOM 6975  C CB  . THR B 2 407 ? 118.103 119.270 123.794 1.00 475.92 ? 407 THR B CB  1 
ATOM 6976  O OG1 . THR B 2 407 ? 118.674 119.582 122.520 1.00 500.00 ? 407 THR B OG1 1 
ATOM 6977  C CG2 . THR B 2 407 ? 119.192 118.621 124.690 1.00 457.65 ? 407 THR B CG2 1 
ATOM 6978  N N   . ILE B 2 408 ? 117.249 116.170 124.442 1.00 431.81 ? 408 ILE B N   1 
ATOM 6979  C CA  . ILE B 2 408 ? 117.555 114.747 124.309 1.00 427.63 ? 408 ILE B CA  1 
ATOM 6980  C C   . ILE B 2 408 ? 116.396 114.009 123.683 1.00 409.43 ? 408 ILE B C   1 
ATOM 6981  O O   . ILE B 2 408 ? 116.648 113.145 122.816 1.00 394.44 ? 408 ILE B O   1 
ATOM 6982  C CB  . ILE B 2 408 ? 118.121 114.124 125.613 1.00 469.39 ? 408 ILE B CB  1 
ATOM 6983  C CG1 . ILE B 2 408 ? 119.100 112.986 125.275 1.00 500.00 ? 408 ILE B CG1 1 
ATOM 6984  C CG2 . ILE B 2 408 ? 117.027 113.648 126.553 1.00 466.86 ? 408 ILE B CG2 1 
ATOM 6985  C CD1 . ILE B 2 408 ? 119.948 112.507 126.440 1.00 500.00 ? 408 ILE B CD1 1 
ATOM 6986  N N   . ALA B 2 409 ? 115.171 114.389 124.058 1.00 430.24 ? 409 ALA B N   1 
ATOM 6987  C CA  . ALA B 2 409 ? 113.963 113.795 123.476 1.00 415.30 ? 409 ALA B CA  1 
ATOM 6988  C C   . ALA B 2 409 ? 113.951 114.006 121.967 1.00 450.36 ? 409 ALA B C   1 
ATOM 6989  O O   . ALA B 2 409 ? 113.672 113.070 121.198 1.00 465.26 ? 409 ALA B O   1 
ATOM 6990  C CB  . ALA B 2 409 ? 112.699 114.366 124.114 1.00 404.25 ? 409 ALA B CB  1 
ATOM 6991  N N   . CYS B 2 410 ? 114.261 115.239 121.583 1.00 435.07 ? 410 CYS B N   1 
ATOM 6992  C CA  . CYS B 2 410 ? 114.300 115.637 120.170 1.00 401.68 ? 410 CYS B CA  1 
ATOM 6993  C C   . CYS B 2 410 ? 115.294 114.782 119.408 1.00 400.13 ? 410 CYS B C   1 
ATOM 6994  O O   . CYS B 2 410 ? 114.990 114.284 118.315 1.00 472.63 ? 410 CYS B O   1 
ATOM 6995  C CB  . CYS B 2 410 ? 114.596 117.110 120.046 1.00 419.57 ? 410 CYS B CB  1 
ATOM 6996  S SG  . CYS B 2 410 ? 113.345 118.053 120.924 1.00 483.71 ? 410 CYS B SG  1 
ATOM 6997  N N   . PHE B 2 411 ? 116.460 114.624 120.011 1.00 390.51 ? 411 PHE B N   1 
ATOM 6998  C CA  . PHE B 2 411 ? 117.562 113.836 119.447 1.00 427.66 ? 411 PHE B CA  1 
ATOM 6999  C C   . PHE B 2 411 ? 117.090 112.399 119.187 1.00 468.94 ? 411 PHE B C   1 
ATOM 7000  O O   . PHE B 2 411 ? 117.313 111.829 118.089 1.00 438.10 ? 411 PHE B O   1 
ATOM 7001  C CB  . PHE B 2 411 ? 118.704 113.976 120.487 1.00 437.25 ? 411 PHE B CB  1 
ATOM 7002  C CG  . PHE B 2 411 ? 119.838 113.005 120.369 1.00 401.01 ? 411 PHE B CG  1 
ATOM 7003  C CD1 . PHE B 2 411 ? 119.705 111.696 120.805 1.00 423.29 ? 411 PHE B CD1 1 
ATOM 7004  C CD2 . PHE B 2 411 ? 121.087 113.449 119.971 1.00 430.62 ? 411 PHE B CD2 1 
ATOM 7005  C CE1 . PHE B 2 411 ? 120.768 110.824 120.752 1.00 462.23 ? 411 PHE B CE1 1 
ATOM 7006  C CE2 . PHE B 2 411 ? 122.160 112.584 119.917 1.00 455.80 ? 411 PHE B CE2 1 
ATOM 7007  C CZ  . PHE B 2 411 ? 122.002 111.269 120.309 1.00 489.14 ? 411 PHE B CZ  1 
ATOM 7008  N N   . VAL B 2 412 ? 116.436 111.859 120.216 1.00 497.47 ? 412 VAL B N   1 
ATOM 7009  C CA  . VAL B 2 412 ? 115.922 110.490 120.173 1.00 461.81 ? 412 VAL B CA  1 
ATOM 7010  C C   . VAL B 2 412 ? 114.939 110.330 119.020 1.00 405.87 ? 412 VAL B C   1 
ATOM 7011  O O   . VAL B 2 412 ? 115.004 109.352 118.257 1.00 315.87 ? 412 VAL B O   1 
ATOM 7012  C CB  . VAL B 2 412 ? 115.303 110.024 121.499 1.00 449.86 ? 412 VAL B CB  1 
ATOM 7013  C CG1 . VAL B 2 412 ? 114.615 108.671 121.324 1.00 432.41 ? 412 VAL B CG1 1 
ATOM 7014  C CG2 . VAL B 2 412 ? 116.379 109.934 122.580 1.00 463.43 ? 412 VAL B CG2 1 
ATOM 7015  N N   . ALA B 2 413 ? 114.051 111.310 118.919 1.00 453.44 ? 413 ALA B N   1 
ATOM 7016  C CA  . ALA B 2 413 ? 113.019 111.343 117.877 1.00 500.00 ? 413 ALA B CA  1 
ATOM 7017  C C   . ALA B 2 413 ? 113.653 111.322 116.509 1.00 483.43 ? 413 ALA B C   1 
ATOM 7018  O O   . ALA B 2 413 ? 113.227 110.565 115.627 1.00 500.00 ? 413 ALA B O   1 
ATOM 7019  C CB  . ALA B 2 413 ? 112.158 112.568 118.034 1.00 500.00 ? 413 ALA B CB  1 
ATOM 7020  N N   . ILE B 2 414 ? 114.674 112.161 116.359 1.00 422.03 ? 414 ILE B N   1 
ATOM 7021  C CA  . ILE B 2 414 ? 115.425 112.286 115.098 1.00 473.58 ? 414 ILE B CA  1 
ATOM 7022  C C   . ILE B 2 414 ? 116.016 110.941 114.714 1.00 439.49 ? 414 ILE B C   1 
ATOM 7023  O O   . ILE B 2 414 ? 115.900 110.515 113.547 1.00 482.11 ? 414 ILE B O   1 
ATOM 7024  C CB  . ILE B 2 414 ? 116.571 113.333 115.113 1.00 500.00 ? 414 ILE B CB  1 
ATOM 7025  C CG1 . ILE B 2 414 ? 115.990 114.752 115.021 1.00 500.00 ? 414 ILE B CG1 1 
ATOM 7026  C CG2 . ILE B 2 414 ? 117.558 113.105 113.948 1.00 500.00 ? 414 ILE B CG2 1 
ATOM 7027  C CD1 . ILE B 2 414 ? 116.945 115.857 115.438 1.00 500.00 ? 414 ILE B CD1 1 
ATOM 7028  N N   . LEU B 2 415 ? 116.625 110.300 115.707 1.00 418.95 ? 415 LEU B N   1 
ATOM 7029  C CA  . LEU B 2 415 ? 117.256 108.992 115.524 1.00 469.59 ? 415 LEU B CA  1 
ATOM 7030  C C   . LEU B 2 415 ? 116.224 107.970 115.010 1.00 437.33 ? 415 LEU B C   1 
ATOM 7031  O O   . LEU B 2 415 ? 116.464 107.218 114.044 1.00 372.99 ? 415 LEU B O   1 
ATOM 7032  C CB  . LEU B 2 415 ? 117.918 108.484 116.807 1.00 500.00 ? 415 LEU B CB  1 
ATOM 7033  C CG  . LEU B 2 415 ? 119.440 108.638 116.795 1.00 500.00 ? 415 LEU B CG  1 
ATOM 7034  C CD1 . LEU B 2 415 ? 119.849 110.111 116.782 1.00 500.00 ? 415 LEU B CD1 1 
ATOM 7035  C CD2 . LEU B 2 415 ? 120.050 107.884 117.974 1.00 500.00 ? 415 LEU B CD2 1 
ATOM 7036  N N   . ILE B 2 416 ? 115.087 107.991 115.689 1.00 429.20 ? 416 ILE B N   1 
ATOM 7037  C CA  . ILE B 2 416 ? 113.975 107.087 115.372 1.00 401.15 ? 416 ILE B CA  1 
ATOM 7038  C C   . ILE B 2 416 ? 113.509 107.306 113.945 1.00 428.50 ? 416 ILE B C   1 
ATOM 7039  O O   . ILE B 2 416 ? 113.292 106.340 113.197 1.00 449.21 ? 416 ILE B O   1 
ATOM 7040  C CB  . ILE B 2 416 ? 112.813 107.124 116.395 1.00 466.02 ? 416 ILE B CB  1 
ATOM 7041  C CG1 . ILE B 2 416 ? 112.589 105.713 116.928 1.00 471.88 ? 416 ILE B CG1 1 
ATOM 7042  C CG2 . ILE B 2 416 ? 111.512 107.687 115.811 1.00 480.75 ? 416 ILE B CG2 1 
ATOM 7043  C CD1 . ILE B 2 416 ? 113.759 105.175 117.718 1.00 448.45 ? 416 ILE B CD1 1 
ATOM 7044  N N   . GLY B 2 417 ? 113.374 108.583 113.591 1.00 465.25 ? 417 GLY B N   1 
ATOM 7045  C CA  . GLY B 2 417 ? 112.946 108.996 112.252 1.00 462.42 ? 417 GLY B CA  1 
ATOM 7046  C C   . GLY B 2 417 ? 113.895 108.439 111.205 1.00 483.69 ? 417 GLY B C   1 
ATOM 7047  O O   . GLY B 2 417 ? 113.463 107.884 110.181 1.00 433.92 ? 417 GLY B O   1 
ATOM 7048  N N   . LEU B 2 418 ? 115.182 108.599 111.490 1.00 500.00 ? 418 LEU B N   1 
ATOM 7049  C CA  . LEU B 2 418 ? 116.255 108.130 110.601 1.00 494.48 ? 418 LEU B CA  1 
ATOM 7050  C C   . LEU B 2 418 ? 116.140 106.637 110.385 1.00 430.10 ? 418 LEU B C   1 
ATOM 7051  O O   . LEU B 2 418 ? 116.241 106.158 109.256 1.00 396.35 ? 418 LEU B O   1 
ATOM 7052  C CB  . LEU B 2 418 ? 117.634 108.517 111.119 1.00 500.00 ? 418 LEU B CB  1 
ATOM 7053  C CG  . LEU B 2 418 ? 118.724 108.509 110.034 1.00 500.00 ? 418 LEU B CG  1 
ATOM 7054  C CD1 . LEU B 2 418 ? 119.680 109.682 110.234 1.00 500.00 ? 418 LEU B CD1 1 
ATOM 7055  C CD2 . LEU B 2 418 ? 119.476 107.177 109.979 1.00 500.00 ? 418 LEU B CD2 1 
ATOM 7056  N N   . CYS B 2 419 ? 115.933 105.932 111.488 1.00 441.07 ? 419 CYS B N   1 
ATOM 7057  C CA  . CYS B 2 419 ? 115.785 104.468 111.494 1.00 482.69 ? 419 CYS B CA  1 
ATOM 7058  C C   . CYS B 2 419 ? 114.633 104.059 110.575 1.00 481.86 ? 419 CYS B C   1 
ATOM 7059  O O   . CYS B 2 419 ? 114.771 103.142 109.736 1.00 461.59 ? 419 CYS B O   1 
ATOM 7060  C CB  . CYS B 2 419 ? 115.501 103.955 112.923 1.00 485.27 ? 419 CYS B CB  1 
ATOM 7061  S SG  . CYS B 2 419 ? 114.018 102.917 113.100 1.00 500.00 ? 419 CYS B SG  1 
ATOM 7062  N N   . LEU B 2 420 ? 113.522 104.764 110.761 1.00 500.00 ? 420 LEU B N   1 
ATOM 7063  C CA  . LEU B 2 420 ? 112.303 104.522 109.984 1.00 500.00 ? 420 LEU B CA  1 
ATOM 7064  C C   . LEU B 2 420 ? 112.581 104.688 108.492 1.00 459.43 ? 420 LEU B C   1 
ATOM 7065  O O   . LEU B 2 420 ? 112.187 103.868 107.660 1.00 350.42 ? 420 LEU B O   1 
ATOM 7066  C CB  . LEU B 2 420 ? 111.111 105.413 110.399 1.00 500.00 ? 420 LEU B CB  1 
ATOM 7067  C CG  . LEU B 2 420 ? 110.115 104.975 111.502 1.00 500.00 ? 420 LEU B CG  1 
ATOM 7068  C CD1 . LEU B 2 420 ? 108.741 105.594 111.221 1.00 500.00 ? 420 LEU B CD1 1 
ATOM 7069  C CD2 . LEU B 2 420 ? 109.978 103.462 111.698 1.00 500.00 ? 420 LEU B CD2 1 
ATOM 7070  N N   . THR B 2 421 ? 113.262 105.777 108.193 1.00 458.98 ? 421 THR B N   1 
ATOM 7071  C CA  . THR B 2 421 ? 113.650 106.158 106.830 1.00 470.04 ? 421 THR B CA  1 
ATOM 7072  C C   . THR B 2 421 ? 114.482 105.049 106.211 1.00 415.29 ? 421 THR B C   1 
ATOM 7073  O O   . THR B 2 421 ? 114.243 104.637 105.066 1.00 412.84 ? 421 THR B O   1 
ATOM 7074  C CB  . THR B 2 421 ? 114.566 107.410 106.888 1.00 500.00 ? 421 THR B CB  1 
ATOM 7075  O OG1 . THR B 2 421 ? 113.949 108.439 107.673 1.00 500.00 ? 421 THR B OG1 1 
ATOM 7076  C CG2 . THR B 2 421 ? 114.913 107.933 105.492 1.00 500.00 ? 421 THR B CG2 1 
ATOM 7077  N N   . LEU B 2 422 ? 115.450 104.577 106.989 1.00 405.96 ? 422 LEU B N   1 
ATOM 7078  C CA  . LEU B 2 422 ? 116.385 103.539 106.568 1.00 459.69 ? 422 LEU B CA  1 
ATOM 7079  C C   . LEU B 2 422 ? 115.569 102.330 106.194 1.00 430.41 ? 422 LEU B C   1 
ATOM 7080  O O   . LEU B 2 422 ? 115.783 101.822 105.093 1.00 417.92 ? 422 LEU B O   1 
ATOM 7081  C CB  . LEU B 2 422 ? 117.443 103.217 107.630 1.00 500.00 ? 422 LEU B CB  1 
ATOM 7082  C CG  . LEU B 2 422 ? 118.784 102.697 107.065 1.00 500.00 ? 422 LEU B CG  1 
ATOM 7083  C CD1 . LEU B 2 422 ? 118.652 101.353 106.349 1.00 500.00 ? 422 LEU B CD1 1 
ATOM 7084  C CD2 . LEU B 2 422 ? 119.451 103.707 106.139 1.00 500.00 ? 422 LEU B CD2 1 
ATOM 7085  N N   . LEU B 2 423 ? 114.647 101.931 107.091 1.00 439.56 ? 423 LEU B N   1 
ATOM 7086  C CA  . LEU B 2 423 ? 113.859 100.715 106.829 1.00 500.00 ? 423 LEU B CA  1 
ATOM 7087  C C   . LEU B 2 423 ? 113.013 100.898 105.571 1.00 460.08 ? 423 LEU B C   1 
ATOM 7088  O O   . LEU B 2 423 ? 112.948 99.997  104.718 1.00 450.00 ? 423 LEU B O   1 
ATOM 7089  C CB  . LEU B 2 423 ? 113.105 100.175 108.063 1.00 500.00 ? 423 LEU B CB  1 
ATOM 7090  C CG  . LEU B 2 423 ? 113.925 99.369  109.126 1.00 500.00 ? 423 LEU B CG  1 
ATOM 7091  C CD1 . LEU B 2 423 ? 113.013 98.428  109.909 1.00 500.00 ? 423 LEU B CD1 1 
ATOM 7092  C CD2 . LEU B 2 423 ? 115.118 98.558  108.608 1.00 500.00 ? 423 LEU B CD2 1 
ATOM 7093  N N   . LEU B 2 424 ? 112.406 102.071 105.475 1.00 414.13 ? 424 LEU B N   1 
ATOM 7094  C CA  . LEU B 2 424 ? 111.558 102.434 104.330 1.00 485.44 ? 424 LEU B CA  1 
ATOM 7095  C C   . LEU B 2 424 ? 112.371 102.367 103.046 1.00 455.27 ? 424 LEU B C   1 
ATOM 7096  O O   . LEU B 2 424 ? 111.909 101.807 102.037 1.00 402.05 ? 424 LEU B O   1 
ATOM 7097  C CB  . LEU B 2 424 ? 110.982 103.837 104.534 1.00 500.00 ? 424 LEU B CB  1 
ATOM 7098  C CG  . LEU B 2 424 ? 110.114 104.450 103.422 1.00 500.00 ? 424 LEU B CG  1 
ATOM 7099  C CD1 . LEU B 2 424 ? 110.919 104.984 102.226 1.00 500.00 ? 424 LEU B CD1 1 
ATOM 7100  C CD2 . LEU B 2 424 ? 109.033 103.463 102.975 1.00 500.00 ? 424 LEU B CD2 1 
ATOM 7101  N N   . LEU B 2 425 ? 113.571 102.937 103.115 1.00 498.04 ? 425 LEU B N   1 
ATOM 7102  C CA  . LEU B 2 425 ? 114.498 102.968 101.977 1.00 500.00 ? 425 LEU B CA  1 
ATOM 7103  C C   . LEU B 2 425 ? 114.805 101.547 101.513 1.00 500.00 ? 425 LEU B C   1 
ATOM 7104  O O   . LEU B 2 425 ? 114.785 101.248 100.318 1.00 500.00 ? 425 LEU B O   1 
ATOM 7105  C CB  . LEU B 2 425 ? 115.806 103.738 102.306 1.00 500.00 ? 425 LEU B CB  1 
ATOM 7106  C CG  . LEU B 2 425 ? 116.817 104.137 101.188 1.00 500.00 ? 425 LEU B CG  1 
ATOM 7107  C CD1 . LEU B 2 425 ? 116.200 105.092 100.170 1.00 500.00 ? 425 LEU B CD1 1 
ATOM 7108  C CD2 . LEU B 2 425 ? 118.101 104.766 101.750 1.00 500.00 ? 425 LEU B CD2 1 
ATOM 7109  N N   . ALA B 2 426 ? 115.099 100.707 102.496 1.00 500.00 ? 426 ALA B N   1 
ATOM 7110  C CA  . ALA B 2 426 ? 115.429 99.294  102.267 1.00 500.00 ? 426 ALA B CA  1 
ATOM 7111  C C   . ALA B 2 426 ? 114.281 98.603  101.538 1.00 500.00 ? 426 ALA B C   1 
ATOM 7112  O O   . ALA B 2 426 ? 114.504 97.869  100.563 1.00 500.00 ? 426 ALA B O   1 
ATOM 7113  C CB  . ALA B 2 426 ? 115.758 98.578  103.576 1.00 500.00 ? 426 ALA B CB  1 
ATOM 7114  N N   . ILE B 2 427 ? 113.079 98.859  102.043 1.00 500.00 ? 427 ILE B N   1 
ATOM 7115  C CA  . ILE B 2 427 ? 111.848 98.301  101.474 1.00 500.00 ? 427 ILE B CA  1 
ATOM 7116  C C   . ILE B 2 427 ? 111.717 98.677  99.991  1.00 470.44 ? 427 ILE B C   1 
ATOM 7117  O O   . ILE B 2 427 ? 111.401 97.777  99.184  1.00 421.07 ? 427 ILE B O   1 
ATOM 7118  C CB  . ILE B 2 427 ? 110.556 98.658  102.286 1.00 483.53 ? 427 ILE B CB  1 
ATOM 7119  C CG1 . ILE B 2 427 ? 110.235 97.552  103.300 1.00 500.00 ? 427 ILE B CG1 1 
ATOM 7120  C CG2 . ILE B 2 427 ? 109.307 98.785  101.400 1.00 415.60 ? 427 ILE B CG2 1 
ATOM 7121  C CD1 . ILE B 2 427 ? 111.335 97.217  104.289 1.00 500.00 ? 427 ILE B CD1 1 
ATOM 7122  N N   . PHE B 2 428 ? 111.977 99.940  99.626  1.00 488.38 ? 428 PHE B N   1 
ATOM 7123  C CA  . PHE B 2 428 ? 111.826 100.406 98.221  1.00 500.00 ? 428 PHE B CA  1 
ATOM 7124  C C   . PHE B 2 428 ? 113.140 100.591 97.416  1.00 500.00 ? 428 PHE B C   1 
ATOM 7125  O O   . PHE B 2 428 ? 113.344 99.905  96.414  1.00 500.00 ? 428 PHE B O   1 
ATOM 7126  C CB  . PHE B 2 428 ? 110.923 101.650 98.172  1.00 490.71 ? 428 PHE B CB  1 
ATOM 7127  C CG  . PHE B 2 428 ? 109.508 101.392 98.657  1.00 500.00 ? 428 PHE B CG  1 
ATOM 7128  C CD1 . PHE B 2 428 ? 108.746 100.348 98.126  1.00 472.15 ? 428 PHE B CD1 1 
ATOM 7129  C CD2 . PHE B 2 428 ? 108.932 102.193 99.643  1.00 500.00 ? 428 PHE B CD2 1 
ATOM 7130  C CE1 . PHE B 2 428 ? 107.449 100.111 98.570  1.00 445.74 ? 428 PHE B CE1 1 
ATOM 7131  C CE2 . PHE B 2 428 ? 107.630 101.958 100.090 1.00 500.00 ? 428 PHE B CE2 1 
ATOM 7132  C CZ  . PHE B 2 428 ? 106.890 100.916 99.551  1.00 459.51 ? 428 PHE B CZ  1 
ATOM 7133  N N   . LYS B 2 429 ? 114.010 101.495 97.889  1.00 500.00 ? 429 LYS B N   1 
ATOM 7134  C CA  . LYS B 2 429 ? 115.274 102.010 97.230  1.00 500.00 ? 429 LYS B CA  1 
ATOM 7135  C C   . LYS B 2 429 ? 114.991 103.117 96.191  1.00 500.00 ? 429 LYS B C   1 
ATOM 7136  O O   . LYS B 2 429 ? 115.558 103.144 95.086  1.00 437.08 ? 429 LYS B O   1 
ATOM 7137  C CB  . LYS B 2 429 ? 116.248 100.913 96.706  1.00 500.00 ? 429 LYS B CB  1 
ATOM 7138  C CG  . LYS B 2 429 ? 116.994 100.113 97.796  1.00 500.00 ? 429 LYS B CG  1 
ATOM 7139  C CD  . LYS B 2 429 ? 118.047 100.895 98.623  1.00 500.00 ? 429 LYS B CD  1 
ATOM 7140  C CE  . LYS B 2 429 ? 118.786 99.988  99.632  1.00 500.00 ? 429 LYS B CE  1 
ATOM 7141  N NZ  . LYS B 2 429 ? 119.503 100.682 100.746 1.00 466.99 ? 429 LYS B NZ  1 
ATOM 7142  N N   . LYS B 2 430 ? 114.131 104.048 96.614  1.00 500.00 ? 430 LYS B N   1 
ATOM 7143  C CA  . LYS B 2 430 ? 113.661 105.148 95.784  1.00 500.00 ? 430 LYS B CA  1 
ATOM 7144  C C   . LYS B 2 430 ? 114.760 106.233 95.687  1.00 500.00 ? 430 LYS B C   1 
ATOM 7145  O O   . LYS B 2 430 ? 115.632 106.126 94.812  1.00 500.00 ? 430 LYS B O   1 
ATOM 7146  C CB  . LYS B 2 430 ? 112.299 105.673 96.312  1.00 500.00 ? 430 LYS B CB  1 
ATOM 7147  C CG  . LYS B 2 430 ? 111.613 106.715 95.417  1.00 500.00 ? 430 LYS B CG  1 
ATOM 7148  C CD  . LYS B 2 430 ? 110.252 107.197 95.939  1.00 500.00 ? 430 LYS B CD  1 
ATOM 7149  C CE  . LYS B 2 430 ? 109.111 106.205 95.678  1.00 500.00 ? 430 LYS B CE  1 
ATOM 7150  N NZ  . LYS B 2 430 ? 108.644 106.126 94.260  1.00 500.00 ? 430 LYS B NZ  1 
ATOM 7151  N N   . ALA B 2 431 ? 114.747 107.236 96.582  1.00 500.00 ? 431 ALA B N   1 
ATOM 7152  C CA  . ALA B 2 431 ? 115.675 108.400 96.514  1.00 500.00 ? 431 ALA B CA  1 
ATOM 7153  C C   . ALA B 2 431 ? 115.679 109.270 97.807  1.00 500.00 ? 431 ALA B C   1 
ATOM 7154  O O   . ALA B 2 431 ? 115.196 110.420 97.805  1.00 500.00 ? 431 ALA B O   1 
ATOM 7155  C CB  . ALA B 2 431 ? 115.372 109.267 95.279  1.00 500.00 ? 431 ALA B CB  1 
ATOM 7156  N N   . LEU B 2 432 ? 116.236 108.703 98.887  1.00 500.00 ? 432 LEU B N   1 
ATOM 7157  C CA  . LEU B 2 432 ? 116.387 109.362 100.209 1.00 500.00 ? 432 LEU B CA  1 
ATOM 7158  C C   . LEU B 2 432 ? 115.168 110.231 100.595 1.00 500.00 ? 432 LEU B C   1 
ATOM 7159  O O   . LEU B 2 432 ? 115.284 111.457 100.780 1.00 500.00 ? 432 LEU B O   1 
ATOM 7160  C CB  . LEU B 2 432 ? 117.713 110.148 100.267 1.00 500.00 ? 432 LEU B CB  1 
ATOM 7161  C CG  . LEU B 2 432 ? 118.998 109.355 99.923  1.00 500.00 ? 432 LEU B CG  1 
ATOM 7162  C CD1 . LEU B 2 432 ? 120.186 110.317 99.815  1.00 500.00 ? 432 LEU B CD1 1 
ATOM 7163  C CD2 . LEU B 2 432 ? 119.283 108.203 100.902 1.00 500.00 ? 432 LEU B CD2 1 
ATOM 7164  N N   . PRO B 2 433 ? 113.991 109.578 100.713 1.00 500.00 ? 433 PRO B N   1 
ATOM 7165  C CA  . PRO B 2 433 ? 112.759 110.344 100.790 1.00 500.00 ? 433 PRO B CA  1 
ATOM 7166  C C   . PRO B 2 433 ? 112.432 110.970 102.158 1.00 500.00 ? 433 PRO B C   1 
ATOM 7167  O O   . PRO B 2 433 ? 111.938 112.096 102.193 1.00 500.00 ? 433 PRO B O   1 
ATOM 7168  C CB  . PRO B 2 433 ? 111.684 109.318 100.365 1.00 500.00 ? 433 PRO B CB  1 
ATOM 7169  C CG  . PRO B 2 433 ? 112.272 107.962 100.592 1.00 461.45 ? 433 PRO B CG  1 
ATOM 7170  C CD  . PRO B 2 433 ? 113.748 108.119 100.809 1.00 500.00 ? 433 PRO B CD  1 
ATOM 7171  N N   . ALA B 2 434 ? 112.740 110.259 103.251 1.00 500.00 ? 434 ALA B N   1 
ATOM 7172  C CA  . ALA B 2 434 ? 112.099 110.467 104.574 1.00 500.00 ? 434 ALA B CA  1 
ATOM 7173  C C   . ALA B 2 434 ? 113.006 111.051 105.687 1.00 500.00 ? 434 ALA B C   1 
ATOM 7174  O O   . ALA B 2 434 ? 112.975 110.656 106.853 1.00 500.00 ? 434 ALA B O   1 
ATOM 7175  C CB  . ALA B 2 434 ? 111.459 109.154 105.026 1.00 500.00 ? 434 ALA B CB  1 
ATOM 7176  N N   . LEU B 2 435 ? 113.819 112.002 105.275 1.00 500.00 ? 435 LEU B N   1 
ATOM 7177  C CA  . LEU B 2 435 ? 114.462 112.933 106.149 1.00 500.00 ? 435 LEU B CA  1 
ATOM 7178  C C   . LEU B 2 435 ? 113.422 113.902 106.756 1.00 471.67 ? 435 LEU B C   1 
ATOM 7179  O O   . LEU B 2 435 ? 113.528 114.266 107.935 1.00 490.00 ? 435 LEU B O   1 
ATOM 7180  C CB  . LEU B 2 435 ? 115.551 113.640 105.347 1.00 500.00 ? 435 LEU B CB  1 
ATOM 7181  C CG  . LEU B 2 435 ? 116.501 112.692 104.544 1.00 500.00 ? 435 LEU B CG  1 
ATOM 7182  C CD1 . LEU B 2 435 ? 117.031 113.309 103.250 1.00 500.00 ? 435 LEU B CD1 1 
ATOM 7183  C CD2 . LEU B 2 435 ? 117.642 112.148 105.401 1.00 500.00 ? 435 LEU B CD2 1 
ATOM 7184  N N   . PRO B 2 436 ? 112.419 114.300 105.937 1.00 482.78 ? 436 PRO B N   1 
ATOM 7185  C CA  . PRO B 2 436 ? 111.426 115.203 106.472 1.00 492.77 ? 436 PRO B CA  1 
ATOM 7186  C C   . PRO B 2 436 ? 110.610 114.537 107.548 1.00 482.04 ? 436 PRO B C   1 
ATOM 7187  O O   . PRO B 2 436 ? 110.314 115.230 108.519 1.00 499.32 ? 436 PRO B O   1 
ATOM 7188  C CB  . PRO B 2 436 ? 110.559 115.537 105.262 1.00 500.00 ? 436 PRO B CB  1 
ATOM 7189  C CG  . PRO B 2 436 ? 110.794 114.440 104.303 1.00 500.00 ? 436 PRO B CG  1 
ATOM 7190  C CD  . PRO B 2 436 ? 112.250 114.181 104.480 1.00 500.00 ? 436 PRO B CD  1 
ATOM 7191  N N   . ILE B 2 437 ? 110.327 113.235 107.426 1.00 446.49 ? 437 ILE B N   1 
ATOM 7192  C CA  . ILE B 2 437 ? 109.606 112.552 108.494 1.00 500.00 ? 437 ILE B CA  1 
ATOM 7193  C C   . ILE B 2 437 ? 110.402 112.560 109.788 1.00 498.16 ? 437 ILE B C   1 
ATOM 7194  O O   . ILE B 2 437 ? 109.825 112.816 110.854 1.00 500.00 ? 437 ILE B O   1 
ATOM 7195  C CB  . ILE B 2 437 ? 109.129 111.109 108.161 1.00 500.00 ? 437 ILE B CB  1 
ATOM 7196  C CG1 . ILE B 2 437 ? 107.932 110.728 109.069 1.00 500.00 ? 437 ILE B CG1 1 
ATOM 7197  C CG2 . ILE B 2 437 ? 110.242 110.083 108.331 1.00 500.00 ? 437 ILE B CG2 1 
ATOM 7198  C CD1 . ILE B 2 437 ? 107.388 109.315 108.907 1.00 500.00 ? 437 ILE B CD1 1 
ATOM 7199  N N   . SER B 2 438 ? 111.705 112.340 109.665 1.00 445.54 ? 438 SER B N   1 
ATOM 7200  C CA  . SER B 2 438 ? 112.609 112.376 110.818 1.00 489.07 ? 438 SER B CA  1 
ATOM 7201  C C   . SER B 2 438 ? 112.560 113.740 111.494 1.00 495.90 ? 438 SER B C   1 
ATOM 7202  O O   . SER B 2 438 ? 112.465 113.839 112.724 1.00 438.19 ? 438 SER B O   1 
ATOM 7203  C CB  . SER B 2 438 ? 114.039 111.976 110.455 1.00 500.00 ? 438 SER B CB  1 
ATOM 7204  O OG  . SER B 2 438 ? 114.238 112.001 109.064 1.00 500.00 ? 438 SER B OG  1 
ATOM 7205  N N   . ILE B 2 439 ? 112.617 114.763 110.659 1.00 500.00 ? 439 ILE B N   1 
ATOM 7206  C CA  . ILE B 2 439 ? 112.578 116.164 111.100 1.00 500.00 ? 439 ILE B CA  1 
ATOM 7207  C C   . ILE B 2 439 ? 111.269 116.409 111.887 1.00 456.98 ? 439 ILE B C   1 
ATOM 7208  O O   . ILE B 2 439 ? 111.252 117.003 112.964 1.00 464.66 ? 439 ILE B O   1 
ATOM 7209  C CB  . ILE B 2 439 ? 112.665 117.134 109.885 1.00 500.00 ? 439 ILE B CB  1 
ATOM 7210  C CG1 . ILE B 2 439 ? 114.089 117.128 109.304 1.00 500.00 ? 439 ILE B CG1 1 
ATOM 7211  C CG2 . ILE B 2 439 ? 112.250 118.560 110.252 1.00 474.34 ? 439 ILE B CG2 1 
ATOM 7212  C CD1 . ILE B 2 439 ? 114.175 117.477 107.831 1.00 500.00 ? 439 ILE B CD1 1 
ATOM 7213  N N   . THR B 2 440 ? 110.197 115.968 111.242 1.00 455.51 ? 440 THR B N   1 
ATOM 7214  C CA  . THR B 2 440 ? 108.834 116.196 111.715 1.00 499.39 ? 440 THR B CA  1 
ATOM 7215  C C   . THR B 2 440 ? 108.659 115.586 113.097 1.00 462.30 ? 440 THR B C   1 
ATOM 7216  O O   . THR B 2 440 ? 108.111 116.237 114.010 1.00 441.16 ? 440 THR B O   1 
ATOM 7217  C CB  . THR B 2 440 ? 107.784 115.629 110.735 1.00 500.00 ? 440 THR B CB  1 
ATOM 7218  O OG1 . THR B 2 440 ? 108.012 116.164 109.424 1.00 500.00 ? 440 THR B OG1 1 
ATOM 7219  C CG2 . THR B 2 440 ? 106.361 115.990 111.178 1.00 500.00 ? 440 THR B CG2 1 
ATOM 7220  N N   . PHE B 2 441 ? 109.132 114.352 113.223 1.00 486.10 ? 441 PHE B N   1 
ATOM 7221  C CA  . PHE B 2 441 ? 109.034 113.609 114.491 1.00 500.00 ? 441 PHE B CA  1 
ATOM 7222  C C   . PHE B 2 441 ? 109.763 114.357 115.591 1.00 457.27 ? 441 PHE B C   1 
ATOM 7223  O O   . PHE B 2 441 ? 109.231 114.500 116.705 1.00 434.18 ? 441 PHE B O   1 
ATOM 7224  C CB  . PHE B 2 441 ? 109.494 112.152 114.356 1.00 500.00 ? 441 PHE B CB  1 
ATOM 7225  C CG  . PHE B 2 441 ? 108.376 111.215 114.000 1.00 500.00 ? 441 PHE B CG  1 
ATOM 7226  C CD1 . PHE B 2 441 ? 107.633 111.418 112.839 1.00 500.00 ? 441 PHE B CD1 1 
ATOM 7227  C CD2 . PHE B 2 441 ? 108.033 110.163 114.839 1.00 500.00 ? 441 PHE B CD2 1 
ATOM 7228  C CE1 . PHE B 2 441 ? 106.586 110.576 112.506 1.00 500.00 ? 441 PHE B CE1 1 
ATOM 7229  C CE2 . PHE B 2 441 ? 106.985 109.313 114.511 1.00 500.00 ? 441 PHE B CE2 1 
ATOM 7230  C CZ  . PHE B 2 441 ? 106.262 109.520 113.342 1.00 500.00 ? 441 PHE B CZ  1 
ATOM 7231  N N   . GLY B 2 442 ? 110.959 114.834 115.250 1.00 388.03 ? 442 GLY B N   1 
ATOM 7232  C CA  . GLY B 2 442 ? 111.798 115.595 116.184 1.00 467.66 ? 442 GLY B CA  1 
ATOM 7233  C C   . GLY B 2 442 ? 111.056 116.828 116.675 1.00 473.75 ? 442 GLY B C   1 
ATOM 7234  O O   . GLY B 2 442 ? 111.037 117.123 117.879 1.00 500.00 ? 442 GLY B O   1 
ATOM 7235  N N   . LEU B 2 443 ? 110.455 117.522 115.716 1.00 428.78 ? 443 LEU B N   1 
ATOM 7236  C CA  . LEU B 2 443 ? 109.688 118.746 115.980 1.00 434.69 ? 443 LEU B CA  1 
ATOM 7237  C C   . LEU B 2 443 ? 108.561 118.451 116.965 1.00 435.24 ? 443 LEU B C   1 
ATOM 7238  O O   . LEU B 2 443 ? 108.349 119.195 117.936 1.00 440.78 ? 443 LEU B O   1 
ATOM 7239  C CB  . LEU B 2 443 ? 109.105 119.386 114.716 1.00 446.43 ? 443 LEU B CB  1 
ATOM 7240  C CG  . LEU B 2 443 ? 109.976 119.774 113.517 1.00 473.52 ? 443 LEU B CG  1 
ATOM 7241  C CD1 . LEU B 2 443 ? 109.243 120.767 112.628 1.00 500.00 ? 443 LEU B CD1 1 
ATOM 7242  C CD2 . LEU B 2 443 ? 111.336 120.330 113.901 1.00 494.37 ? 443 LEU B CD2 1 
ATOM 7243  N N   . VAL B 2 444 ? 107.860 117.361 116.681 1.00 384.43 ? 444 VAL B N   1 
ATOM 7244  C CA  . VAL B 2 444 ? 106.729 116.904 117.491 1.00 459.05 ? 444 VAL B CA  1 
ATOM 7245  C C   . VAL B 2 444 ? 107.187 116.670 118.933 1.00 425.13 ? 444 VAL B C   1 
ATOM 7246  O O   . VAL B 2 444 ? 106.533 117.112 119.898 1.00 399.00 ? 444 VAL B O   1 
ATOM 7247  C CB  . VAL B 2 444 ? 106.156 115.582 116.919 1.00 500.00 ? 444 VAL B CB  1 
ATOM 7248  C CG1 . VAL B 2 444 ? 105.307 114.820 117.943 1.00 500.00 ? 444 VAL B CG1 1 
ATOM 7249  C CG2 . VAL B 2 444 ? 105.365 115.858 115.642 1.00 500.00 ? 444 VAL B CG2 1 
ATOM 7250  N N   . PHE B 2 445 ? 108.311 115.973 119.038 1.00 474.12 ? 445 PHE B N   1 
ATOM 7251  C CA  . PHE B 2 445 ? 108.852 115.654 120.365 1.00 500.00 ? 445 PHE B CA  1 
ATOM 7252  C C   . PHE B 2 445 ? 109.217 116.904 121.121 1.00 478.82 ? 445 PHE B C   1 
ATOM 7253  O O   . PHE B 2 445 ? 108.920 117.008 122.308 1.00 437.83 ? 445 PHE B O   1 
ATOM 7254  C CB  . PHE B 2 445 ? 109.989 114.650 120.327 1.00 500.00 ? 445 PHE B CB  1 
ATOM 7255  C CG  . PHE B 2 445 ? 109.499 113.261 120.390 1.00 500.00 ? 445 PHE B CG  1 
ATOM 7256  C CD1 . PHE B 2 445 ? 109.179 112.692 121.611 1.00 500.00 ? 445 PHE B CD1 1 
ATOM 7257  C CD2 . PHE B 2 445 ? 109.241 112.564 119.227 1.00 500.00 ? 445 PHE B CD2 1 
ATOM 7258  C CE1 . PHE B 2 445 ? 108.676 111.411 121.669 1.00 500.00 ? 445 PHE B CE1 1 
ATOM 7259  C CE2 . PHE B 2 445 ? 108.756 111.288 119.267 1.00 500.00 ? 445 PHE B CE2 1 
ATOM 7260  C CZ  . PHE B 2 445 ? 108.465 110.705 120.492 1.00 500.00 ? 445 PHE B CZ  1 
ATOM 7261  N N   . TYR B 2 446 ? 109.811 117.857 120.414 1.00 458.65 ? 446 TYR B N   1 
ATOM 7262  C CA  . TYR B 2 446 ? 110.209 119.150 120.959 1.00 456.44 ? 446 TYR B CA  1 
ATOM 7263  C C   . TYR B 2 446 ? 109.040 119.858 121.544 1.00 496.99 ? 446 TYR B C   1 
ATOM 7264  O O   . TYR B 2 446 ? 109.122 120.040 122.748 1.00 494.06 ? 446 TYR B O   1 
ATOM 7265  C CB  . TYR B 2 446 ? 110.851 120.040 119.882 1.00 449.70 ? 446 TYR B CB  1 
ATOM 7266  C CG  . TYR B 2 446 ? 111.169 121.431 120.382 1.00 472.73 ? 446 TYR B CG  1 
ATOM 7267  C CD1 . TYR B 2 446 ? 112.045 121.627 121.453 1.00 459.47 ? 446 TYR B CD1 1 
ATOM 7268  C CD2 . TYR B 2 446 ? 110.570 122.556 119.811 1.00 495.20 ? 446 TYR B CD2 1 
ATOM 7269  C CE1 . TYR B 2 446 ? 112.332 122.900 121.926 1.00 454.03 ? 446 TYR B CE1 1 
ATOM 7270  C CE2 . TYR B 2 446 ? 110.850 123.832 120.282 1.00 500.00 ? 446 TYR B CE2 1 
ATOM 7271  C CZ  . TYR B 2 446 ? 111.736 124.002 121.332 1.00 487.89 ? 446 TYR B CZ  1 
ATOM 7272  O OH  . TYR B 2 446 ? 112.011 125.269 121.794 1.00 494.14 ? 446 TYR B OH  1 
ATOM 7273  N N   . PHE B 2 447 ? 108.076 120.311 120.743 1.00 500.00 ? 447 PHE B N   1 
ATOM 7274  C CA  . PHE B 2 447 ? 107.039 121.235 121.230 1.00 500.00 ? 447 PHE B CA  1 
ATOM 7275  C C   . PHE B 2 447 ? 106.248 120.589 122.355 1.00 500.00 ? 447 PHE B C   1 
ATOM 7276  O O   . PHE B 2 447 ? 106.006 121.193 123.410 1.00 500.00 ? 447 PHE B O   1 
ATOM 7277  C CB  . PHE B 2 447 ? 106.067 121.615 120.120 1.00 500.00 ? 447 PHE B CB  1 
ATOM 7278  C CG  . PHE B 2 447 ? 106.708 122.393 119.025 1.00 500.00 ? 447 PHE B CG  1 
ATOM 7279  C CD1 . PHE B 2 447 ? 107.281 123.634 119.291 1.00 500.00 ? 447 PHE B CD1 1 
ATOM 7280  C CD2 . PHE B 2 447 ? 106.774 121.882 117.732 1.00 500.00 ? 447 PHE B CD2 1 
ATOM 7281  C CE1 . PHE B 2 447 ? 107.899 124.363 118.282 1.00 500.00 ? 447 PHE B CE1 1 
ATOM 7282  C CE2 . PHE B 2 447 ? 107.390 122.607 116.716 1.00 500.00 ? 447 PHE B CE2 1 
ATOM 7283  C CZ  . PHE B 2 447 ? 107.953 123.848 116.992 1.00 500.00 ? 447 PHE B CZ  1 
ATOM 7284  N N   . ALA B 2 448 ? 105.851 119.348 122.082 1.00 500.00 ? 448 ALA B N   1 
ATOM 7285  C CA  . ALA B 2 448 ? 105.060 118.543 123.029 1.00 500.00 ? 448 ALA B CA  1 
ATOM 7286  C C   . ALA B 2 448 ? 105.824 118.390 124.338 1.00 481.77 ? 448 ALA B C   1 
ATOM 7287  O O   . ALA B 2 448 ? 105.252 118.566 125.425 1.00 457.70 ? 448 ALA B O   1 
ATOM 7288  C CB  . ALA B 2 448 ? 104.755 117.178 122.437 1.00 500.00 ? 448 ALA B CB  1 
ATOM 7289  N N   . THR B 2 449 ? 107.114 118.069 124.193 1.00 465.86 ? 449 THR B N   1 
ATOM 7290  C CA  . THR B 2 449 ? 107.997 117.866 125.342 1.00 470.51 ? 449 THR B CA  1 
ATOM 7291  C C   . THR B 2 449 ? 108.049 119.132 126.192 1.00 472.58 ? 449 THR B C   1 
ATOM 7292  O O   . THR B 2 449 ? 107.935 119.073 127.432 1.00 473.41 ? 449 THR B O   1 
ATOM 7293  C CB  . THR B 2 449 ? 109.391 117.330 124.964 1.00 500.00 ? 449 THR B CB  1 
ATOM 7294  O OG1 . THR B 2 449 ? 109.242 116.061 124.314 1.00 472.96 ? 449 THR B OG1 1 
ATOM 7295  C CG2 . THR B 2 449 ? 110.257 117.126 126.192 1.00 500.00 ? 449 THR B CG2 1 
ATOM 7296  N N   . ASP B 2 450 ? 108.205 120.255 125.502 1.00 471.84 ? 450 ASP B N   1 
ATOM 7297  C CA  . ASP B 2 450 ? 108.324 121.562 126.143 1.00 500.00 ? 450 ASP B CA  1 
ATOM 7298  C C   . ASP B 2 450 ? 107.036 121.845 126.925 1.00 500.00 ? 450 ASP B C   1 
ATOM 7299  O O   . ASP B 2 450 ? 107.089 122.295 128.094 1.00 483.39 ? 450 ASP B O   1 
ATOM 7300  C CB  . ASP B 2 450 ? 108.636 122.666 125.110 1.00 500.00 ? 450 ASP B CB  1 
ATOM 7301  C CG  . ASP B 2 450 ? 109.741 123.623 125.563 1.00 500.00 ? 450 ASP B CG  1 
ATOM 7302  O OD1 . ASP B 2 450 ? 110.571 123.260 126.433 1.00 500.00 ? 450 ASP B OD1 1 
ATOM 7303  O OD2 . ASP B 2 450 ? 109.784 124.751 125.017 1.00 500.00 ? 450 ASP B OD2 1 
ATOM 7304  N N   . TYR B 2 451 ? 105.891 121.552 126.303 1.00 500.00 ? 451 TYR B N   1 
ATOM 7305  C CA  . TYR B 2 451 ? 104.629 122.091 126.839 1.00 500.00 ? 451 TYR B CA  1 
ATOM 7306  C C   . TYR B 2 451 ? 104.007 121.127 127.811 1.00 500.00 ? 451 TYR B C   1 
ATOM 7307  O O   . TYR B 2 451 ? 103.437 121.539 128.792 1.00 500.00 ? 451 TYR B O   1 
ATOM 7308  C CB  . TYR B 2 451 ? 103.661 122.468 125.691 1.00 500.00 ? 451 TYR B CB  1 
ATOM 7309  C CG  . TYR B 2 451 ? 104.086 123.710 124.903 1.00 500.00 ? 451 TYR B CG  1 
ATOM 7310  C CD1 . TYR B 2 451 ? 104.328 124.929 125.558 1.00 500.00 ? 451 TYR B CD1 1 
ATOM 7311  C CD2 . TYR B 2 451 ? 104.240 123.677 123.508 1.00 500.00 ? 451 TYR B CD2 1 
ATOM 7312  C CE1 . TYR B 2 451 ? 104.722 126.066 124.860 1.00 500.00 ? 451 TYR B CE1 1 
ATOM 7313  C CE2 . TYR B 2 451 ? 104.636 124.813 122.801 1.00 500.00 ? 451 TYR B CE2 1 
ATOM 7314  C CZ  . TYR B 2 451 ? 104.877 126.009 123.480 1.00 500.00 ? 451 TYR B CZ  1 
ATOM 7315  O OH  . TYR B 2 451 ? 105.268 127.158 122.812 1.00 500.00 ? 451 TYR B OH  1 
ATOM 7316  N N   . LEU B 2 452 ? 104.185 119.837 127.533 1.00 489.48 ? 452 LEU B N   1 
ATOM 7317  C CA  . LEU B 2 452 ? 103.400 118.771 128.128 1.00 481.51 ? 452 LEU B CA  1 
ATOM 7318  C C   . LEU B 2 452 ? 104.262 117.876 128.986 1.00 446.56 ? 452 LEU B C   1 
ATOM 7319  O O   . LEU B 2 452 ? 103.960 117.680 130.165 1.00 465.47 ? 452 LEU B O   1 
ATOM 7320  C CB  . LEU B 2 452 ? 102.727 117.949 127.022 1.00 492.34 ? 452 LEU B CB  1 
ATOM 7321  C CG  . LEU B 2 452 ? 102.155 118.795 125.869 1.00 500.00 ? 452 LEU B CG  1 
ATOM 7322  C CD1 . LEU B 2 452 ? 101.826 117.951 124.649 1.00 500.00 ? 452 LEU B CD1 1 
ATOM 7323  C CD2 . LEU B 2 452 ? 100.932 119.587 126.320 1.00 500.00 ? 452 LEU B CD2 1 
ATOM 7324  N N   . VAL B 2 453 ? 105.331 117.343 128.401 1.00 429.71 ? 453 VAL B N   1 
ATOM 7325  C CA  . VAL B 2 453 ? 106.230 116.433 129.108 1.00 482.51 ? 453 VAL B CA  1 
ATOM 7326  C C   . VAL B 2 453 ? 106.911 117.166 130.231 1.00 468.66 ? 453 VAL B C   1 
ATOM 7327  O O   . VAL B 2 453 ? 106.802 116.797 131.404 1.00 419.46 ? 453 VAL B O   1 
ATOM 7328  C CB  . VAL B 2 453 ? 107.325 115.850 128.190 1.00 500.00 ? 453 VAL B CB  1 
ATOM 7329  C CG1 . VAL B 2 453 ? 108.341 115.039 128.988 1.00 500.00 ? 453 VAL B CG1 1 
ATOM 7330  C CG2 . VAL B 2 453 ? 106.724 114.999 127.079 1.00 500.00 ? 453 VAL B CG2 1 
ATOM 7331  N N   . GLN B 2 454 ? 107.591 118.228 129.825 1.00 500.00 ? 454 GLN B N   1 
ATOM 7332  C CA  . GLN B 2 454 ? 108.553 118.920 130.657 1.00 500.00 ? 454 GLN B CA  1 
ATOM 7333  C C   . GLN B 2 454 ? 108.029 119.377 131.987 1.00 500.00 ? 454 GLN B C   1 
ATOM 7334  O O   . GLN B 2 454 ? 108.761 119.181 132.970 1.00 458.82 ? 454 GLN B O   1 
ATOM 7335  C CB  . GLN B 2 454 ? 109.153 120.104 129.892 1.00 500.00 ? 454 GLN B CB  1 
ATOM 7336  C CG  . GLN B 2 454 ? 110.007 121.052 130.709 1.00 500.00 ? 454 GLN B CG  1 
ATOM 7337  C CD  . GLN B 2 454 ? 109.213 122.154 131.374 1.00 500.00 ? 454 GLN B CD  1 
ATOM 7338  O OE1 . GLN B 2 454 ? 108.311 122.744 130.772 1.00 500.00 ? 454 GLN B OE1 1 
ATOM 7339  N NE2 . GLN B 2 454 ? 109.558 122.457 132.618 1.00 500.00 ? 454 GLN B NE2 1 
ATOM 7340  N N   . PRO B 2 455 ? 106.827 120.016 131.997 1.00 491.00 ? 455 PRO B N   1 
ATOM 7341  C CA  . PRO B 2 455 ? 106.357 120.658 133.234 1.00 500.00 ? 455 PRO B CA  1 
ATOM 7342  C C   . PRO B 2 455 ? 106.205 119.618 134.351 1.00 500.00 ? 455 PRO B C   1 
ATOM 7343  O O   . PRO B 2 455 ? 106.697 119.811 135.471 1.00 500.00 ? 455 PRO B O   1 
ATOM 7344  C CB  . PRO B 2 455 ? 104.990 121.247 132.863 1.00 500.00 ? 455 PRO B CB  1 
ATOM 7345  C CG  . PRO B 2 455 ? 104.819 121.063 131.409 1.00 483.97 ? 455 PRO B CG  1 
ATOM 7346  C CD  . PRO B 2 455 ? 105.819 120.083 130.924 1.00 432.06 ? 455 PRO B CD  1 
ATOM 7347  N N   . PHE B 2 456 ? 105.567 118.539 133.988 1.00 466.84 ? 456 PHE B N   1 
ATOM 7348  C CA  . PHE B 2 456 ? 105.305 117.400 134.875 1.00 449.13 ? 456 PHE B CA  1 
ATOM 7349  C C   . PHE B 2 456 ? 106.627 116.858 135.437 1.00 457.10 ? 456 PHE B C   1 
ATOM 7350  O O   . PHE B 2 456 ? 106.806 116.636 136.646 1.00 449.51 ? 456 PHE B O   1 
ATOM 7351  C CB  . PHE B 2 456 ? 104.606 116.363 133.982 1.00 446.07 ? 456 PHE B CB  1 
ATOM 7352  C CG  . PHE B 2 456 ? 104.555 114.985 134.533 1.00 465.59 ? 456 PHE B CG  1 
ATOM 7353  C CD1 . PHE B 2 456 ? 103.955 114.731 135.756 1.00 500.00 ? 456 PHE B CD1 1 
ATOM 7354  C CD2 . PHE B 2 456 ? 105.060 113.917 133.792 1.00 459.31 ? 456 PHE B CD2 1 
ATOM 7355  C CE1 . PHE B 2 456 ? 103.892 113.435 136.252 1.00 500.00 ? 456 PHE B CE1 1 
ATOM 7356  C CE2 . PHE B 2 456 ? 104.998 112.621 134.282 1.00 485.82 ? 456 PHE B CE2 1 
ATOM 7357  C CZ  . PHE B 2 456 ? 104.413 112.378 135.515 1.00 495.90 ? 456 PHE B CZ  1 
ATOM 7358  N N   . MET B 2 457 ? 107.538 116.661 134.480 1.00 470.73 ? 457 MET B N   1 
ATOM 7359  C CA  . MET B 2 457 ? 108.878 116.119 134.773 1.00 500.00 ? 457 MET B CA  1 
ATOM 7360  C C   . MET B 2 457 ? 109.595 117.042 135.750 1.00 500.00 ? 457 MET B C   1 
ATOM 7361  O O   . MET B 2 457 ? 110.201 116.568 136.727 1.00 500.00 ? 457 MET B O   1 
ATOM 7362  C CB  . MET B 2 457 ? 109.690 115.946 133.482 1.00 500.00 ? 457 MET B CB  1 
ATOM 7363  C CG  . MET B 2 457 ? 110.724 114.829 133.567 1.00 500.00 ? 457 MET B CG  1 
ATOM 7364  S SD  . MET B 2 457 ? 110.057 113.151 133.380 1.00 500.00 ? 457 MET B SD  1 
ATOM 7365  C CE  . MET B 2 457 ? 111.068 112.198 134.521 1.00 447.92 ? 457 MET B CE  1 
ATOM 7366  N N   . ASP B 2 458 ? 109.511 118.338 135.460 1.00 500.00 ? 458 ASP B N   1 
ATOM 7367  C CA  . ASP B 2 458 ? 110.148 119.363 136.292 1.00 500.00 ? 458 ASP B CA  1 
ATOM 7368  C C   . ASP B 2 458 ? 109.617 119.298 137.715 1.00 500.00 ? 458 ASP B C   1 
ATOM 7369  O O   . ASP B 2 458 ? 110.391 119.346 138.675 1.00 500.00 ? 458 ASP B O   1 
ATOM 7370  C CB  . ASP B 2 458 ? 110.097 120.770 135.671 1.00 500.00 ? 458 ASP B CB  1 
ATOM 7371  C CG  . ASP B 2 458 ? 111.357 121.087 134.844 1.00 500.00 ? 458 ASP B CG  1 
ATOM 7372  O OD1 . ASP B 2 458 ? 111.823 120.194 134.081 1.00 500.00 ? 458 ASP B OD1 1 
ATOM 7373  O OD2 . ASP B 2 458 ? 111.871 122.232 134.954 1.00 500.00 ? 458 ASP B OD2 1 
ATOM 7374  N N   . GLN B 2 459 ? 108.301 119.180 137.812 1.00 500.00 ? 459 GLN B N   1 
ATOM 7375  C CA  . GLN B 2 459 ? 107.597 119.087 139.100 1.00 473.04 ? 459 GLN B CA  1 
ATOM 7376  C C   . GLN B 2 459 ? 108.117 117.898 139.894 1.00 419.03 ? 459 GLN B C   1 
ATOM 7377  O O   . GLN B 2 459 ? 108.415 118.015 141.095 1.00 412.44 ? 459 GLN B O   1 
ATOM 7378  C CB  . GLN B 2 459 ? 106.074 118.976 138.905 1.00 452.87 ? 459 GLN B CB  1 
ATOM 7379  C CG  . GLN B 2 459 ? 105.287 120.221 139.325 1.00 500.00 ? 459 GLN B CG  1 
ATOM 7380  C CD  . GLN B 2 459 ? 105.618 121.503 138.549 1.00 500.00 ? 459 GLN B CD  1 
ATOM 7381  O OE1 . GLN B 2 459 ? 106.613 121.585 137.822 1.00 500.00 ? 459 GLN B OE1 1 
ATOM 7382  N NE2 . GLN B 2 459 ? 104.778 122.525 138.723 1.00 500.00 ? 459 GLN B NE2 1 
ATOM 7383  N N   . LEU B 2 460 ? 108.215 116.776 139.193 1.00 424.49 ? 460 LEU B N   1 
ATOM 7384  C CA  . LEU B 2 460 ? 108.694 115.516 139.771 1.00 443.82 ? 460 LEU B CA  1 
ATOM 7385  C C   . LEU B 2 460 ? 110.102 115.706 140.349 1.00 467.59 ? 460 LEU B C   1 
ATOM 7386  O O   . LEU B 2 460 ? 110.396 115.294 141.490 1.00 487.44 ? 460 LEU B O   1 
ATOM 7387  C CB  . LEU B 2 460 ? 108.735 114.408 138.713 1.00 435.71 ? 460 LEU B CB  1 
ATOM 7388  C CG  . LEU B 2 460 ? 107.531 113.480 138.677 1.00 474.17 ? 460 LEU B CG  1 
ATOM 7389  C CD1 . LEU B 2 460 ? 106.201 114.218 138.567 1.00 473.60 ? 460 LEU B CD1 1 
ATOM 7390  C CD2 . LEU B 2 460 ? 107.713 112.510 137.523 1.00 497.03 ? 460 LEU B CD2 1 
ATOM 7391  N N   . ALA B 2 461 ? 110.933 116.338 139.533 1.00 486.36 ? 461 ALA B N   1 
ATOM 7392  C CA  . ALA B 2 461 ? 112.329 116.615 139.888 1.00 471.17 ? 461 ALA B CA  1 
ATOM 7393  C C   . ALA B 2 461 ? 112.392 117.449 141.170 1.00 440.98 ? 461 ALA B C   1 
ATOM 7394  O O   . ALA B 2 461 ? 113.189 117.159 142.048 1.00 381.31 ? 461 ALA B O   1 
ATOM 7395  C CB  . ALA B 2 461 ? 113.067 117.312 138.754 1.00 500.00 ? 461 ALA B CB  1 
ATOM 7396  N N   . PHE B 2 462 ? 111.553 118.473 141.198 1.00 476.78 ? 462 PHE B N   1 
ATOM 7397  C CA  . PHE B 2 462 ? 111.463 119.397 142.322 1.00 496.41 ? 462 PHE B CA  1 
ATOM 7398  C C   . PHE B 2 462 ? 111.251 118.711 143.649 1.00 500.00 ? 462 PHE B C   1 
ATOM 7399  O O   . PHE B 2 462 ? 111.974 119.012 144.618 1.00 500.00 ? 462 PHE B O   1 
ATOM 7400  C CB  . PHE B 2 462 ? 110.368 120.440 142.028 1.00 500.00 ? 462 PHE B CB  1 
ATOM 7401  C CG  . PHE B 2 462 ? 110.240 121.516 143.060 1.00 500.00 ? 462 PHE B CG  1 
ATOM 7402  C CD1 . PHE B 2 462 ? 111.364 122.190 143.536 1.00 500.00 ? 462 PHE B CD1 1 
ATOM 7403  C CD2 . PHE B 2 462 ? 108.984 121.886 143.535 1.00 500.00 ? 462 PHE B CD2 1 
ATOM 7404  C CE1 . PHE B 2 462 ? 111.238 123.194 144.488 1.00 500.00 ? 462 PHE B CE1 1 
ATOM 7405  C CE2 . PHE B 2 462 ? 108.850 122.889 144.485 1.00 500.00 ? 462 PHE B CE2 1 
ATOM 7406  C CZ  . PHE B 2 462 ? 109.978 123.546 144.962 1.00 500.00 ? 462 PHE B CZ  1 
ATOM 7407  N N   . HIS B 2 463 ? 110.276 117.803 143.697 1.00 490.72 ? 463 HIS B N   1 
ATOM 7408  C CA  . HIS B 2 463 ? 109.909 117.090 144.913 1.00 481.89 ? 463 HIS B CA  1 
ATOM 7409  C C   . HIS B 2 463 ? 110.903 115.974 145.119 1.00 457.69 ? 463 HIS B C   1 
ATOM 7410  O O   . HIS B 2 463 ? 111.098 115.525 146.221 1.00 422.07 ? 463 HIS B O   1 
ATOM 7411  C CB  . HIS B 2 463 ? 108.483 116.556 144.846 1.00 491.60 ? 463 HIS B CB  1 
ATOM 7412  C CG  . HIS B 2 463 ? 107.440 117.619 144.977 1.00 500.00 ? 463 HIS B CG  1 
ATOM 7413  N ND1 . HIS B 2 463 ? 106.929 118.299 143.891 1.00 500.00 ? 463 HIS B ND1 1 
ATOM 7414  C CD2 . HIS B 2 463 ? 106.816 118.128 146.065 1.00 500.00 ? 463 HIS B CD2 1 
ATOM 7415  C CE1 . HIS B 2 463 ? 106.032 119.176 144.304 1.00 500.00 ? 463 HIS B CE1 1 
ATOM 7416  N NE2 . HIS B 2 463 ? 105.943 119.092 145.620 1.00 500.00 ? 463 HIS B NE2 1 
ATOM 7417  N N   . GLN B 2 464 ? 111.566 115.602 144.026 1.00 452.40 ? 464 GLN B N   1 
ATOM 7418  C CA  . GLN B 2 464 ? 112.663 114.644 143.966 1.00 457.52 ? 464 GLN B CA  1 
ATOM 7419  C C   . GLN B 2 464 ? 112.136 113.213 143.894 1.00 439.98 ? 464 GLN B C   1 
ATOM 7420  O O   . GLN B 2 464 ? 112.897 112.264 144.062 1.00 413.46 ? 464 GLN B O   1 
ATOM 7421  C CB  . GLN B 2 464 ? 113.725 114.822 145.067 1.00 457.84 ? 464 GLN B CB  1 
ATOM 7422  C CG  . GLN B 2 464 ? 115.106 114.326 144.611 1.00 500.00 ? 464 GLN B CG  1 
ATOM 7423  C CD  . GLN B 2 464 ? 116.046 113.937 145.743 1.00 500.00 ? 464 GLN B CD  1 
ATOM 7424  O OE1 . GLN B 2 464 ? 115.945 114.450 146.857 1.00 500.00 ? 464 GLN B OE1 1 
ATOM 7425  N NE2 . GLN B 2 464 ? 116.977 113.026 145.457 1.00 500.00 ? 464 GLN B NE2 1 
ATOM 7426  N N   . PHE B 2 465 ? 110.854 113.050 143.585 1.00 424.28 ? 465 PHE B N   1 
ATOM 7427  C CA  . PHE B 2 465 ? 110.335 111.732 143.287 1.00 417.35 ? 465 PHE B CA  1 
ATOM 7428  C C   . PHE B 2 465 ? 110.331 111.457 141.791 1.00 393.12 ? 465 PHE B C   1 
ATOM 7429  O O   . PHE B 2 465 ? 110.257 112.374 140.977 1.00 415.06 ? 465 PHE B O   1 
ATOM 7430  C CB  . PHE B 2 465 ? 108.992 111.485 143.953 1.00 481.70 ? 465 PHE B CB  1 
ATOM 7431  C CG  . PHE B 2 465 ? 107.890 112.432 143.566 1.00 500.00 ? 465 PHE B CG  1 
ATOM 7432  C CD1 . PHE B 2 465 ? 107.282 112.368 142.307 1.00 500.00 ? 465 PHE B CD1 1 
ATOM 7433  C CD2 . PHE B 2 465 ? 107.376 113.319 144.510 1.00 500.00 ? 465 PHE B CD2 1 
ATOM 7434  C CE1 . PHE B 2 465 ? 106.228 113.209 141.983 1.00 500.00 ? 465 PHE B CE1 1 
ATOM 7435  C CE2 . PHE B 2 465 ? 106.324 114.164 144.188 1.00 500.00 ? 465 PHE B CE2 1 
ATOM 7436  C CZ  . PHE B 2 465 ? 105.751 114.111 142.922 1.00 500.00 ? 465 PHE B CZ  1 
ATOM 7437  N N   . TYR B 2 466 ? 110.376 110.175 141.448 1.00 430.99 ? 466 TYR B N   1 
ATOM 7438  C CA  . TYR B 2 466 ? 110.884 109.699 140.167 1.00 455.12 ? 466 TYR B CA  1 
ATOM 7439  C C   . TYR B 2 466 ? 109.857 108.875 139.433 1.00 452.33 ? 466 TYR B C   1 
ATOM 7440  O O   . TYR B 2 466 ? 108.864 108.409 140.000 1.00 454.71 ? 466 TYR B O   1 
ATOM 7441  C CB  . TYR B 2 466 ? 112.114 108.816 140.389 1.00 484.31 ? 466 TYR B CB  1 
ATOM 7442  C CG  . TYR B 2 466 ? 113.466 109.494 140.335 1.00 500.00 ? 466 TYR B CG  1 
ATOM 7443  C CD1 . TYR B 2 466 ? 113.643 110.834 140.693 1.00 500.00 ? 466 TYR B CD1 1 
ATOM 7444  C CD2 . TYR B 2 466 ? 114.595 108.764 139.982 1.00 500.00 ? 466 TYR B CD2 1 
ATOM 7445  C CE1 . TYR B 2 466 ? 114.901 111.425 140.657 1.00 500.00 ? 466 TYR B CE1 1 
ATOM 7446  C CE2 . TYR B 2 466 ? 115.851 109.344 139.959 1.00 500.00 ? 466 TYR B CE2 1 
ATOM 7447  C CZ  . TYR B 2 466 ? 116.005 110.671 140.289 1.00 500.00 ? 466 TYR B CZ  1 
ATOM 7448  O OH  . TYR B 2 466 ? 117.260 111.233 140.249 1.00 500.00 ? 466 TYR B OH  1 
ATOM 7449  N N   . ILE B 2 467 ? 110.160 108.674 138.161 1.00 442.49 ? 467 ILE B N   1 
ATOM 7450  C CA  . ILE B 2 467 ? 109.272 108.024 137.233 1.00 482.13 ? 467 ILE B CA  1 
ATOM 7451  C C   . ILE B 2 467 ? 109.705 106.561 137.090 1.00 486.66 ? 467 ILE B C   1 
ATOM 7452  O O   . ILE B 2 467 ? 109.171 105.806 136.276 1.00 460.98 ? 467 ILE B O   1 
ATOM 7453  C CB  . ILE B 2 467 ? 109.292 108.805 135.894 1.00 500.00 ? 467 ILE B CB  1 
ATOM 7454  C CG1 . ILE B 2 467 ? 107.958 108.667 135.151 1.00 500.00 ? 467 ILE B CG1 1 
ATOM 7455  C CG2 . ILE B 2 467 ? 110.489 108.427 135.027 1.00 500.00 ? 467 ILE B CG2 1 
ATOM 7456  C CD1 . ILE B 2 467 ? 106.954 109.744 135.503 1.00 482.31 ? 467 ILE B CD1 1 
ATOM 7457  N N   . GLY C 3 2   ? 132.314 122.038 142.501 1.00 500.00 ? 2   GLY C N   1 
ATOM 7458  C CA  . GLY C 3 2   ? 131.004 121.816 141.839 1.00 500.00 ? 2   GLY C CA  1 
ATOM 7459  C C   . GLY C 3 2   ? 131.160 120.848 140.684 1.00 500.00 ? 2   GLY C C   1 
ATOM 7460  O O   . GLY C 3 2   ? 130.359 119.914 140.536 1.00 500.00 ? 2   GLY C O   1 
ATOM 7461  N N   . ALA C 3 3   ? 132.199 121.086 139.889 1.00 469.24 ? 3   ALA C N   1 
ATOM 7462  C CA  . ALA C 3 3   ? 132.533 120.249 138.736 1.00 494.67 ? 3   ALA C CA  1 
ATOM 7463  C C   . ALA C 3 3   ? 132.738 118.793 139.185 1.00 496.56 ? 3   ALA C C   1 
ATOM 7464  O O   . ALA C 3 3   ? 132.204 117.848 138.578 1.00 500.00 ? 3   ALA C O   1 
ATOM 7465  C CB  . ALA C 3 3   ? 133.790 120.810 138.064 1.00 456.01 ? 3   ALA C CB  1 
ATOM 7466  N N   . ALA C 3 4   ? 133.515 118.666 140.253 1.00 441.25 ? 4   ALA C N   1 
ATOM 7467  C CA  . ALA C 3 4   ? 133.845 117.371 140.846 1.00 446.62 ? 4   ALA C CA  1 
ATOM 7468  C C   . ALA C 3 4   ? 132.568 116.635 141.250 1.00 407.16 ? 4   ALA C C   1 
ATOM 7469  O O   . ALA C 3 4   ? 132.397 115.440 140.962 1.00 438.76 ? 4   ALA C O   1 
ATOM 7470  C CB  . ALA C 3 4   ? 134.751 117.581 142.056 1.00 469.14 ? 4   ALA C CB  1 
ATOM 7471  N N   . VAL C 3 5   ? 131.701 117.385 141.914 1.00 403.26 ? 5   VAL C N   1 
ATOM 7472  C CA  . VAL C 3 5   ? 130.408 116.878 142.393 1.00 436.21 ? 5   VAL C CA  1 
ATOM 7473  C C   . VAL C 3 5   ? 129.593 116.338 141.229 1.00 410.75 ? 5   VAL C C   1 
ATOM 7474  O O   . VAL C 3 5   ? 129.025 115.242 141.301 1.00 434.40 ? 5   VAL C O   1 
ATOM 7475  C CB  . VAL C 3 5   ? 129.594 117.987 143.118 1.00 500.00 ? 5   VAL C CB  1 
ATOM 7476  C CG1 . VAL C 3 5   ? 128.106 117.645 143.229 1.00 500.00 ? 5   VAL C CG1 1 
ATOM 7477  C CG2 . VAL C 3 5   ? 130.176 118.245 144.501 1.00 500.00 ? 5   VAL C CG2 1 
ATOM 7478  N N   . PHE C 3 6   ? 129.554 117.143 140.173 1.00 423.61 ? 6   PHE C N   1 
ATOM 7479  C CA  . PHE C 3 6   ? 128.816 116.808 138.945 1.00 418.14 ? 6   PHE C CA  1 
ATOM 7480  C C   . PHE C 3 6   ? 129.328 115.493 138.371 1.00 393.82 ? 6   PHE C C   1 
ATOM 7481  O O   . PHE C 3 6   ? 128.538 114.608 138.005 1.00 365.16 ? 6   PHE C O   1 
ATOM 7482  C CB  . PHE C 3 6   ? 128.890 117.918 137.886 1.00 455.31 ? 6   PHE C CB  1 
ATOM 7483  C CG  . PHE C 3 6   ? 128.598 117.460 136.468 1.00 419.05 ? 6   PHE C CG  1 
ATOM 7484  C CD1 . PHE C 3 6   ? 127.298 117.239 136.051 1.00 390.19 ? 6   PHE C CD1 1 
ATOM 7485  C CD2 . PHE C 3 6   ? 129.631 117.295 135.535 1.00 444.75 ? 6   PHE C CD2 1 
ATOM 7486  C CE1 . PHE C 3 6   ? 127.019 116.851 134.742 1.00 423.70 ? 6   PHE C CE1 1 
ATOM 7487  C CE2 . PHE C 3 6   ? 129.362 116.906 134.224 1.00 445.66 ? 6   PHE C CE2 1 
ATOM 7488  C CZ  . PHE C 3 6   ? 128.051 116.682 133.827 1.00 435.97 ? 6   PHE C CZ  1 
ATOM 7489  N N   . PHE C 3 7   ? 130.653 115.402 138.313 1.00 397.04 ? 7   PHE C N   1 
ATOM 7490  C CA  . PHE C 3 7   ? 131.341 114.218 137.789 1.00 435.46 ? 7   PHE C CA  1 
ATOM 7491  C C   . PHE C 3 7   ? 130.933 112.977 138.584 1.00 492.26 ? 7   PHE C C   1 
ATOM 7492  O O   . PHE C 3 7   ? 130.618 111.927 138.010 1.00 500.00 ? 7   PHE C O   1 
ATOM 7493  C CB  . PHE C 3 7   ? 132.881 114.352 137.791 1.00 470.69 ? 7   PHE C CB  1 
ATOM 7494  C CG  . PHE C 3 7   ? 133.500 114.711 136.453 1.00 487.93 ? 7   PHE C CG  1 
ATOM 7495  C CD1 . PHE C 3 7   ? 132.928 114.340 135.229 1.00 500.00 ? 7   PHE C CD1 1 
ATOM 7496  C CD2 . PHE C 3 7   ? 134.724 115.373 136.426 1.00 500.00 ? 7   PHE C CD2 1 
ATOM 7497  C CE1 . PHE C 3 7   ? 133.538 114.668 134.024 1.00 500.00 ? 7   PHE C CE1 1 
ATOM 7498  C CE2 . PHE C 3 7   ? 135.337 115.700 135.220 1.00 500.00 ? 7   PHE C CE2 1 
ATOM 7499  C CZ  . PHE C 3 7   ? 134.743 115.349 134.018 1.00 500.00 ? 7   PHE C CZ  1 
ATOM 7500  N N   . GLY C 3 8   ? 130.951 113.144 139.903 1.00 496.81 ? 8   GLY C N   1 
ATOM 7501  C CA  . GLY C 3 8   ? 130.601 112.083 140.844 1.00 443.72 ? 8   GLY C CA  1 
ATOM 7502  C C   . GLY C 3 8   ? 129.191 111.588 140.590 1.00 410.83 ? 8   GLY C C   1 
ATOM 7503  O O   . GLY C 3 8   ? 128.935 110.359 140.488 1.00 405.65 ? 8   GLY C O   1 
ATOM 7504  N N   . CYS C 3 9   ? 128.268 112.536 140.596 1.00 459.46 ? 9   CYS C N   1 
ATOM 7505  C CA  . CYS C 3 9   ? 126.824 112.245 140.485 1.00 500.00 ? 9   CYS C CA  1 
ATOM 7506  C C   . CYS C 3 9   ? 126.559 111.530 139.169 1.00 472.79 ? 9   CYS C C   1 
ATOM 7507  O O   . CYS C 3 9   ? 125.823 110.529 139.152 1.00 471.32 ? 9   CYS C O   1 
ATOM 7508  C CB  . CYS C 3 9   ? 125.995 113.514 140.642 1.00 500.00 ? 9   CYS C CB  1 
ATOM 7509  S SG  . CYS C 3 9   ? 126.102 114.172 142.327 1.00 500.00 ? 9   CYS C SG  1 
ATOM 7510  N N   . THR C 3 10  ? 127.169 112.047 138.103 1.00 432.17 ? 10  THR C N   1 
ATOM 7511  C CA  . THR C 3 10  ? 126.972 111.479 136.765 1.00 430.13 ? 10  THR C CA  1 
ATOM 7512  C C   . THR C 3 10  ? 127.485 110.037 136.753 1.00 474.50 ? 10  THR C C   1 
ATOM 7513  O O   . THR C 3 10  ? 126.802 109.151 136.202 1.00 487.26 ? 10  THR C O   1 
ATOM 7514  C CB  . THR C 3 10  ? 127.539 112.307 135.589 1.00 442.18 ? 10  THR C CB  1 
ATOM 7515  O OG1 . THR C 3 10  ? 127.130 111.709 134.354 1.00 500.00 ? 10  THR C OG1 1 
ATOM 7516  C CG2 . THR C 3 10  ? 129.034 112.396 135.586 1.00 441.56 ? 10  THR C CG2 1 
ATOM 7517  N N   . PHE C 3 11  ? 128.647 109.822 137.371 1.00 477.68 ? 11  PHE C N   1 
ATOM 7518  C CA  . PHE C 3 11  ? 129.187 108.457 137.385 1.00 455.06 ? 11  PHE C CA  1 
ATOM 7519  C C   . PHE C 3 11  ? 128.298 107.523 138.159 1.00 413.78 ? 11  PHE C C   1 
ATOM 7520  O O   . PHE C 3 11  ? 128.092 106.396 137.705 1.00 401.42 ? 11  PHE C O   1 
ATOM 7521  C CB  . PHE C 3 11  ? 130.612 108.383 137.924 1.00 469.98 ? 11  PHE C CB  1 
ATOM 7522  C CG  . PHE C 3 11  ? 131.675 108.882 136.979 1.00 471.68 ? 11  PHE C CG  1 
ATOM 7523  C CD1 . PHE C 3 11  ? 131.578 108.702 135.591 1.00 495.47 ? 11  PHE C CD1 1 
ATOM 7524  C CD2 . PHE C 3 11  ? 132.815 109.496 137.491 1.00 464.04 ? 11  PHE C CD2 1 
ATOM 7525  C CE1 . PHE C 3 11  ? 132.576 109.158 134.745 1.00 500.00 ? 11  PHE C CE1 1 
ATOM 7526  C CE2 . PHE C 3 11  ? 133.814 109.952 136.648 1.00 500.00 ? 11  PHE C CE2 1 
ATOM 7527  C CZ  . PHE C 3 11  ? 133.696 109.780 135.275 1.00 500.00 ? 11  PHE C CZ  1 
ATOM 7528  N N   . VAL C 3 12  ? 127.743 108.007 139.265 1.00 422.09 ? 12  VAL C N   1 
ATOM 7529  C CA  . VAL C 3 12  ? 126.805 107.231 140.080 1.00 434.97 ? 12  VAL C CA  1 
ATOM 7530  C C   . VAL C 3 12  ? 125.601 106.817 139.244 1.00 416.96 ? 12  VAL C C   1 
ATOM 7531  O O   . VAL C 3 12  ? 125.177 105.643 139.268 1.00 449.10 ? 12  VAL C O   1 
ATOM 7532  C CB  . VAL C 3 12  ? 126.439 107.940 141.412 1.00 476.58 ? 12  VAL C CB  1 
ATOM 7533  C CG1 . VAL C 3 12  ? 125.287 107.238 142.126 1.00 489.08 ? 12  VAL C CG1 1 
ATOM 7534  C CG2 . VAL C 3 12  ? 127.657 107.974 142.328 1.00 452.91 ? 12  VAL C CG2 1 
ATOM 7535  N N   . ALA C 3 13  ? 125.089 107.791 138.500 1.00 447.68 ? 13  ALA C N   1 
ATOM 7536  C CA  . ALA C 3 13  ? 123.855 107.608 137.715 1.00 480.34 ? 13  ALA C CA  1 
ATOM 7537  C C   . ALA C 3 13  ? 124.009 106.707 136.495 1.00 427.42 ? 13  ALA C C   1 
ATOM 7538  O O   . ALA C 3 13  ? 123.389 105.624 136.379 1.00 463.47 ? 13  ALA C O   1 
ATOM 7539  C CB  . ALA C 3 13  ? 123.283 108.962 137.297 1.00 490.23 ? 13  ALA C CB  1 
ATOM 7540  N N   . PHE C 3 14  ? 124.822 107.185 135.575 1.00 396.25 ? 14  PHE C N   1 
ATOM 7541  C CA  . PHE C 3 14  ? 124.976 106.523 134.321 1.00 422.04 ? 14  PHE C CA  1 
ATOM 7542  C C   . PHE C 3 14  ? 126.144 105.608 134.334 1.00 470.38 ? 14  PHE C C   1 
ATOM 7543  O O   . PHE C 3 14  ? 126.304 104.873 133.384 1.00 500.00 ? 14  PHE C O   1 
ATOM 7544  C CB  . PHE C 3 14  ? 125.116 107.523 133.195 1.00 461.54 ? 14  PHE C CB  1 
ATOM 7545  C CG  . PHE C 3 14  ? 123.995 108.504 133.126 1.00 474.85 ? 14  PHE C CG  1 
ATOM 7546  C CD1 . PHE C 3 14  ? 122.724 108.202 133.647 1.00 435.08 ? 14  PHE C CD1 1 
ATOM 7547  C CD2 . PHE C 3 14  ? 124.205 109.736 132.523 1.00 500.00 ? 14  PHE C CD2 1 
ATOM 7548  C CE1 . PHE C 3 14  ? 121.704 109.124 133.566 1.00 500.00 ? 14  PHE C CE1 1 
ATOM 7549  C CE2 . PHE C 3 14  ? 123.185 110.660 132.442 1.00 500.00 ? 14  PHE C CE2 1 
ATOM 7550  C CZ  . PHE C 3 14  ? 121.934 110.355 132.962 1.00 500.00 ? 14  PHE C CZ  1 
ATOM 7551  N N   . GLY C 3 15  ? 126.952 105.627 135.390 1.00 468.33 ? 15  GLY C N   1 
ATOM 7552  C CA  . GLY C 3 15  ? 127.981 104.615 135.548 1.00 500.00 ? 15  GLY C CA  1 
ATOM 7553  C C   . GLY C 3 15  ? 127.544 103.266 135.022 1.00 500.00 ? 15  GLY C C   1 
ATOM 7554  O O   . GLY C 3 15  ? 128.100 102.838 134.007 1.00 500.00 ? 15  GLY C O   1 
ATOM 7555  N N   . PRO C 3 16  ? 126.628 102.603 135.760 1.00 467.02 ? 16  PRO C N   1 
ATOM 7556  C CA  . PRO C 3 16  ? 126.262 101.227 135.460 1.00 479.44 ? 16  PRO C CA  1 
ATOM 7557  C C   . PRO C 3 16  ? 125.704 101.112 134.053 1.00 445.37 ? 16  PRO C C   1 
ATOM 7558  O O   . PRO C 3 16  ? 126.085 100.212 133.280 1.00 483.02 ? 16  PRO C O   1 
ATOM 7559  C CB  . PRO C 3 16  ? 125.142 100.918 136.468 1.00 492.09 ? 16  PRO C CB  1 
ATOM 7560  C CG  . PRO C 3 16  ? 124.627 102.233 136.932 1.00 455.87 ? 16  PRO C CG  1 
ATOM 7561  C CD  . PRO C 3 16  ? 125.792 103.172 136.839 1.00 464.51 ? 16  PRO C CD  1 
ATOM 7562  N N   . ALA C 3 17  ? 124.801 102.042 133.753 1.00 452.79 ? 17  ALA C N   1 
ATOM 7563  C CA  . ALA C 3 17  ? 124.130 102.101 132.446 1.00 500.00 ? 17  ALA C CA  1 
ATOM 7564  C C   . ALA C 3 17  ? 125.162 102.239 131.336 1.00 446.34 ? 17  ALA C C   1 
ATOM 7565  O O   . ALA C 3 17  ? 125.099 101.532 130.317 1.00 481.31 ? 17  ALA C O   1 
ATOM 7566  C CB  . ALA C 3 17  ? 123.182 103.298 132.390 1.00 500.00 ? 17  ALA C CB  1 
ATOM 7567  N N   . PHE C 3 18  ? 126.094 103.156 131.570 1.00 436.97 ? 18  PHE C N   1 
ATOM 7568  C CA  . PHE C 3 18  ? 127.172 103.449 130.619 1.00 435.05 ? 18  PHE C CA  1 
ATOM 7569  C C   . PHE C 3 18  ? 127.983 102.189 130.343 1.00 425.15 ? 18  PHE C C   1 
ATOM 7570  O O   . PHE C 3 18  ? 128.279 101.865 129.180 1.00 424.78 ? 18  PHE C O   1 
ATOM 7571  C CB  . PHE C 3 18  ? 128.046 104.566 131.147 1.00 448.59 ? 18  PHE C CB  1 
ATOM 7572  C CG  . PHE C 3 18  ? 129.161 104.923 130.259 1.00 470.78 ? 18  PHE C CG  1 
ATOM 7573  C CD1 . PHE C 3 18  ? 128.908 105.365 128.971 1.00 500.00 ? 18  PHE C CD1 1 
ATOM 7574  C CD2 . PHE C 3 18  ? 130.469 104.851 130.718 1.00 500.00 ? 18  PHE C CD2 1 
ATOM 7575  C CE1 . PHE C 3 18  ? 129.948 105.718 128.136 1.00 500.00 ? 18  PHE C CE1 1 
ATOM 7576  C CE2 . PHE C 3 18  ? 131.521 105.205 129.895 1.00 500.00 ? 18  PHE C CE2 1 
ATOM 7577  C CZ  . PHE C 3 18  ? 131.262 105.641 128.600 1.00 500.00 ? 18  PHE C CZ  1 
ATOM 7578  N N   . ALA C 3 19  ? 128.318 101.506 131.433 1.00 452.74 ? 19  ALA C N   1 
ATOM 7579  C CA  . ALA C 3 19  ? 129.104 100.270 131.380 1.00 462.55 ? 19  ALA C CA  1 
ATOM 7580  C C   . ALA C 3 19  ? 128.386 99.231  130.523 1.00 476.53 ? 19  ALA C C   1 
ATOM 7581  O O   . ALA C 3 19  ? 129.000 98.583  129.659 1.00 459.91 ? 19  ALA C O   1 
ATOM 7582  C CB  . ALA C 3 19  ? 129.399 99.736  132.779 1.00 451.88 ? 19  ALA C CB  1 
ATOM 7583  N N   . LEU C 3 20  ? 127.090 99.106  130.789 1.00 456.53 ? 20  LEU C N   1 
ATOM 7584  C CA  . LEU C 3 20  ? 126.227 98.157  130.076 1.00 409.81 ? 20  LEU C CA  1 
ATOM 7585  C C   . LEU C 3 20  ? 126.250 98.449  128.582 1.00 423.15 ? 20  LEU C C   1 
ATOM 7586  O O   . LEU C 3 20  ? 126.393 97.534  127.756 1.00 442.56 ? 20  LEU C O   1 
ATOM 7587  C CB  . LEU C 3 20  ? 124.797 98.129  130.625 1.00 431.07 ? 20  LEU C CB  1 
ATOM 7588  C CG  . LEU C 3 20  ? 124.545 97.753  132.102 1.00 500.00 ? 20  LEU C CG  1 
ATOM 7589  C CD1 . LEU C 3 20  ? 123.226 97.000  132.247 1.00 500.00 ? 20  LEU C CD1 1 
ATOM 7590  C CD2 . LEU C 3 20  ? 125.669 96.945  132.745 1.00 484.14 ? 20  LEU C CD2 1 
ATOM 7591  N N   . PHE C 3 21  ? 126.112 99.730  128.270 1.00 461.04 ? 21  PHE C N   1 
ATOM 7592  C CA  . PHE C 3 21  ? 126.096 100.221 126.889 1.00 453.31 ? 21  PHE C CA  1 
ATOM 7593  C C   . PHE C 3 21  ? 127.394 99.834  126.190 1.00 424.51 ? 21  PHE C C   1 
ATOM 7594  O O   . PHE C 3 21  ? 127.378 99.325  125.048 1.00 420.11 ? 21  PHE C O   1 
ATOM 7595  C CB  . PHE C 3 21  ? 125.909 101.739 126.927 1.00 491.04 ? 21  PHE C CB  1 
ATOM 7596  C CG  . PHE C 3 21  ? 125.586 102.363 125.615 1.00 470.40 ? 21  PHE C CG  1 
ATOM 7597  C CD1 . PHE C 3 21  ? 126.600 102.705 124.732 1.00 500.00 ? 21  PHE C CD1 1 
ATOM 7598  C CD2 . PHE C 3 21  ? 124.273 102.681 125.290 1.00 440.06 ? 21  PHE C CD2 1 
ATOM 7599  C CE1 . PHE C 3 21  ? 126.308 103.314 123.522 1.00 500.00 ? 21  PHE C CE1 1 
ATOM 7600  C CE2 . PHE C 3 21  ? 123.972 103.293 124.084 1.00 500.00 ? 21  PHE C CE2 1 
ATOM 7601  C CZ  . PHE C 3 21  ? 124.989 103.609 123.195 1.00 500.00 ? 21  PHE C CZ  1 
ATOM 7602  N N   . LEU C 3 22  ? 128.496 100.070 126.900 1.00 470.33 ? 22  LEU C N   1 
ATOM 7603  C CA  . LEU C 3 22  ? 129.834 99.812  126.372 1.00 500.00 ? 22  LEU C CA  1 
ATOM 7604  C C   . LEU C 3 22  ? 129.981 98.341  126.066 1.00 491.39 ? 22  LEU C C   1 
ATOM 7605  O O   . LEU C 3 22  ? 130.471 97.928  124.995 1.00 457.95 ? 22  LEU C O   1 
ATOM 7606  C CB  . LEU C 3 22  ? 130.946 100.238 127.335 1.00 500.00 ? 22  LEU C CB  1 
ATOM 7607  C CG  . LEU C 3 22  ? 131.338 101.723 127.410 1.00 500.00 ? 22  LEU C CG  1 
ATOM 7608  C CD1 . LEU C 3 22  ? 132.719 101.844 128.062 1.00 500.00 ? 22  LEU C CD1 1 
ATOM 7609  C CD2 . LEU C 3 22  ? 131.328 102.427 126.048 1.00 500.00 ? 22  LEU C CD2 1 
ATOM 7610  N N   . ILE C 3 23  ? 129.605 97.535  127.023 1.00 472.46 ? 23  ILE C N   1 
ATOM 7611  C CA  . ILE C 3 23  ? 129.914 96.127  126.899 1.00 500.00 ? 23  ILE C CA  1 
ATOM 7612  C C   . ILE C 3 23  ? 128.886 95.371  126.041 1.00 490.80 ? 23  ILE C C   1 
ATOM 7613  O O   . ILE C 3 23  ? 129.195 94.779  124.966 1.00 486.62 ? 23  ILE C O   1 
ATOM 7614  C CB  . ILE C 3 23  ? 130.092 95.536  128.321 1.00 500.00 ? 23  ILE C CB  1 
ATOM 7615  C CG1 . ILE C 3 23  ? 131.411 96.064  128.916 1.00 500.00 ? 23  ILE C CG1 1 
ATOM 7616  C CG2 . ILE C 3 23  ? 130.079 94.011  128.311 1.00 500.00 ? 23  ILE C CG2 1 
ATOM 7617  C CD1 . ILE C 3 23  ? 131.476 96.040  130.421 1.00 500.00 ? 23  ILE C CD1 1 
ATOM 7618  N N   . THR C 3 24  ? 127.659 95.414  126.542 1.00 465.75 ? 24  THR C N   1 
ATOM 7619  C CA  . THR C 3 24  ? 126.555 94.664  125.984 1.00 489.54 ? 24  THR C CA  1 
ATOM 7620  C C   . THR C 3 24  ? 126.230 95.152  124.581 1.00 454.11 ? 24  THR C C   1 
ATOM 7621  O O   . THR C 3 24  ? 126.175 94.366  123.638 1.00 482.19 ? 24  THR C O   1 
ATOM 7622  C CB  . THR C 3 24  ? 125.303 94.784  126.884 1.00 500.00 ? 24  THR C CB  1 
ATOM 7623  O OG1 . THR C 3 24  ? 125.694 94.703  128.261 1.00 500.00 ? 24  THR C OG1 1 
ATOM 7624  C CG2 . THR C 3 24  ? 124.283 93.687  126.586 1.00 500.00 ? 24  THR C CG2 1 
ATOM 7625  N N   . VAL C 3 25  ? 126.064 96.455  124.435 1.00 421.29 ? 25  VAL C N   1 
ATOM 7626  C CA  . VAL C 3 25  ? 125.416 96.982  123.253 1.00 432.87 ? 25  VAL C CA  1 
ATOM 7627  C C   . VAL C 3 25  ? 126.407 97.449  122.183 1.00 497.66 ? 25  VAL C C   1 
ATOM 7628  O O   . VAL C 3 25  ? 126.043 97.490  121.009 1.00 500.00 ? 25  VAL C O   1 
ATOM 7629  C CB  . VAL C 3 25  ? 124.432 98.106  123.623 1.00 446.30 ? 25  VAL C CB  1 
ATOM 7630  C CG1 . VAL C 3 25  ? 123.413 98.304  122.514 1.00 475.79 ? 25  VAL C CG1 1 
ATOM 7631  C CG2 . VAL C 3 25  ? 123.685 97.764  124.907 1.00 472.52 ? 25  VAL C CG2 1 
ATOM 7632  N N   . ALA C 3 26  ? 127.649 97.772  122.558 1.00 500.00 ? 26  ALA C N   1 
ATOM 7633  C CA  . ALA C 3 26  ? 128.587 98.442  121.628 1.00 500.00 ? 26  ALA C CA  1 
ATOM 7634  C C   . ALA C 3 26  ? 129.048 97.615  120.423 1.00 500.00 ? 26  ALA C C   1 
ATOM 7635  O O   . ALA C 3 26  ? 129.331 98.180  119.362 1.00 500.00 ? 26  ALA C O   1 
ATOM 7636  C CB  . ALA C 3 26  ? 129.802 98.977  122.369 1.00 500.00 ? 26  ALA C CB  1 
ATOM 7637  N N   . GLY C 3 27  ? 129.137 96.296  120.583 1.00 500.00 ? 27  GLY C N   1 
ATOM 7638  C CA  . GLY C 3 27  ? 129.454 95.413  119.464 1.00 500.00 ? 27  GLY C CA  1 
ATOM 7639  C C   . GLY C 3 27  ? 128.367 95.401  118.396 1.00 500.00 ? 27  GLY C C   1 
ATOM 7640  O O   . GLY C 3 27  ? 128.593 95.850  117.266 1.00 500.00 ? 27  GLY C O   1 
ATOM 7641  N N   . ASP C 3 28  ? 127.179 94.917  118.773 1.00 500.00 ? 28  ASP C N   1 
ATOM 7642  C CA  . ASP C 3 28  ? 126.096 94.612  117.819 1.00 500.00 ? 28  ASP C CA  1 
ATOM 7643  C C   . ASP C 3 28  ? 125.165 95.796  117.506 1.00 500.00 ? 28  ASP C C   1 
ATOM 7644  O O   . ASP C 3 28  ? 124.457 96.268  118.395 1.00 471.68 ? 28  ASP C O   1 
ATOM 7645  C CB  . ASP C 3 28  ? 125.256 93.433  118.324 1.00 500.00 ? 28  ASP C CB  1 
ATOM 7646  C CG  . ASP C 3 28  ? 126.006 92.106  118.250 1.00 500.00 ? 28  ASP C CG  1 
ATOM 7647  O OD1 . ASP C 3 28  ? 127.120 92.016  118.820 1.00 500.00 ? 28  ASP C OD1 1 
ATOM 7648  O OD2 . ASP C 3 28  ? 125.481 91.152  117.624 1.00 500.00 ? 28  ASP C OD2 1 
ATOM 7649  N N   . PRO C 3 29  ? 125.138 96.250  116.232 1.00 491.22 ? 29  PRO C N   1 
ATOM 7650  C CA  . PRO C 3 29  ? 124.338 97.424  115.832 1.00 500.00 ? 29  PRO C CA  1 
ATOM 7651  C C   . PRO C 3 29  ? 122.821 97.239  116.026 1.00 456.81 ? 29  PRO C C   1 
ATOM 7652  O O   . PRO C 3 29  ? 122.079 98.191  116.344 1.00 419.91 ? 29  PRO C O   1 
ATOM 7653  C CB  . PRO C 3 29  ? 124.675 97.575  114.341 1.00 500.00 ? 29  PRO C CB  1 
ATOM 7654  C CG  . PRO C 3 29  ? 125.080 96.221  113.888 1.00 477.17 ? 29  PRO C CG  1 
ATOM 7655  C CD  . PRO C 3 29  ? 125.768 95.600  115.062 1.00 475.65 ? 29  PRO C CD  1 
ATOM 7656  N N   . LEU C 3 30  ? 122.405 95.989  115.842 1.00 419.68 ? 30  LEU C N   1 
ATOM 7657  C CA  . LEU C 3 30  ? 121.021 95.578  116.016 1.00 486.07 ? 30  LEU C CA  1 
ATOM 7658  C C   . LEU C 3 30  ? 120.541 95.909  117.428 1.00 462.44 ? 30  LEU C C   1 
ATOM 7659  O O   . LEU C 3 30  ? 119.447 96.470  117.622 1.00 464.16 ? 30  LEU C O   1 
ATOM 7660  C CB  . LEU C 3 30  ? 120.920 94.079  115.737 1.00 500.00 ? 30  LEU C CB  1 
ATOM 7661  C CG  . LEU C 3 30  ? 119.543 93.470  115.475 1.00 500.00 ? 30  LEU C CG  1 
ATOM 7662  C CD1 . LEU C 3 30  ? 118.664 94.335  114.568 1.00 500.00 ? 30  LEU C CD1 1 
ATOM 7663  C CD2 . LEU C 3 30  ? 119.741 92.083  114.875 1.00 500.00 ? 30  LEU C CD2 1 
ATOM 7664  N N   . ARG C 3 31  ? 121.394 95.549  118.387 1.00 460.30 ? 31  ARG C N   1 
ATOM 7665  C CA  . ARG C 3 31  ? 121.118 95.779  119.809 1.00 474.19 ? 31  ARG C CA  1 
ATOM 7666  C C   . ARG C 3 31  ? 120.908 97.262  120.070 1.00 464.81 ? 31  ARG C C   1 
ATOM 7667  O O   . ARG C 3 31  ? 119.962 97.654  120.763 1.00 418.52 ? 31  ARG C O   1 
ATOM 7668  C CB  . ARG C 3 31  ? 122.246 95.238  120.691 1.00 464.86 ? 31  ARG C CB  1 
ATOM 7669  C CG  . ARG C 3 31  ? 122.413 93.728  120.661 1.00 443.17 ? 31  ARG C CG  1 
ATOM 7670  C CD  . ARG C 3 31  ? 123.384 93.307  121.751 1.00 489.85 ? 31  ARG C CD  1 
ATOM 7671  N NE  . ARG C 3 31  ? 124.050 92.032  121.476 1.00 500.00 ? 31  ARG C NE  1 
ATOM 7672  C CZ  . ARG C 3 31  ? 124.939 91.439  122.282 1.00 500.00 ? 31  ARG C CZ  1 
ATOM 7673  N NH1 . ARG C 3 31  ? 125.276 91.984  123.446 1.00 500.00 ? 31  ARG C NH1 1 
ATOM 7674  N NH2 . ARG C 3 31  ? 125.494 90.278  121.932 1.00 500.00 ? 31  ARG C NH2 1 
ATOM 7675  N N   . VAL C 3 32  ? 121.803 98.056  119.505 1.00 470.38 ? 32  VAL C N   1 
ATOM 7676  C CA  . VAL C 3 32  ? 121.777 99.519  119.624 1.00 499.98 ? 32  VAL C CA  1 
ATOM 7677  C C   . VAL C 3 32  ? 120.444 100.061 119.121 1.00 442.31 ? 32  VAL C C   1 
ATOM 7678  O O   . VAL C 3 32  ? 119.800 100.898 119.778 1.00 440.25 ? 32  VAL C O   1 
ATOM 7679  C CB  . VAL C 3 32  ? 122.900 100.153 118.746 1.00 500.00 ? 32  VAL C CB  1 
ATOM 7680  C CG1 . VAL C 3 32  ? 122.647 101.632 118.424 1.00 500.00 ? 32  VAL C CG1 1 
ATOM 7681  C CG2 . VAL C 3 32  ? 124.267 99.955  119.393 1.00 500.00 ? 32  VAL C CG2 1 
ATOM 7682  N N   . ILE C 3 33  ? 120.071 99.563  117.944 1.00 406.61 ? 33  ILE C N   1 
ATOM 7683  C CA  . ILE C 3 33  ? 118.824 99.957  117.278 1.00 446.27 ? 33  ILE C CA  1 
ATOM 7684  C C   . ILE C 3 33  ? 117.629 99.674  118.190 1.00 447.07 ? 33  ILE C C   1 
ATOM 7685  O O   . ILE C 3 33  ? 116.737 100.524 118.369 1.00 429.09 ? 33  ILE C O   1 
ATOM 7686  C CB  . ILE C 3 33  ? 118.575 99.193  115.957 1.00 500.00 ? 33  ILE C CB  1 
ATOM 7687  C CG1 . ILE C 3 33  ? 119.539 99.668  114.880 1.00 500.00 ? 33  ILE C CG1 1 
ATOM 7688  C CG2 . ILE C 3 33  ? 117.140 99.386  115.449 1.00 500.00 ? 33  ILE C CG2 1 
ATOM 7689  C CD1 . ILE C 3 33  ? 119.655 98.711  113.707 1.00 500.00 ? 33  ILE C CD1 1 
ATOM 7690  N N   . ILE C 3 34  ? 117.652 98.467  118.742 1.00 437.88 ? 34  ILE C N   1 
ATOM 7691  C CA  . ILE C 3 34  ? 116.598 97.990  119.643 1.00 451.21 ? 34  ILE C CA  1 
ATOM 7692  C C   . ILE C 3 34  ? 116.470 98.922  120.843 1.00 421.92 ? 34  ILE C C   1 
ATOM 7693  O O   . ILE C 3 34  ? 115.362 99.314  121.228 1.00 413.62 ? 34  ILE C O   1 
ATOM 7694  C CB  . ILE C 3 34  ? 116.859 96.531  120.049 1.00 500.00 ? 34  ILE C CB  1 
ATOM 7695  C CG1 . ILE C 3 34  ? 116.740 95.620  118.812 1.00 500.00 ? 34  ILE C CG1 1 
ATOM 7696  C CG2 . ILE C 3 34  ? 115.860 96.055  121.100 1.00 500.00 ? 34  ILE C CG2 1 
ATOM 7697  C CD1 . ILE C 3 34  ? 117.552 94.343  118.897 1.00 500.00 ? 34  ILE C CD1 1 
ATOM 7698  N N   . LEU C 3 35  ? 117.621 99.255  121.403 1.00 442.18 ? 35  LEU C N   1 
ATOM 7699  C CA  . LEU C 3 35  ? 117.720 100.144 122.565 1.00 454.26 ? 35  LEU C CA  1 
ATOM 7700  C C   . LEU C 3 35  ? 117.081 101.490 122.251 1.00 431.96 ? 35  LEU C C   1 
ATOM 7701  O O   . LEU C 3 35  ? 116.294 102.024 123.048 1.00 416.23 ? 35  LEU C O   1 
ATOM 7702  C CB  . LEU C 3 35  ? 119.182 100.329 122.969 1.00 424.52 ? 35  LEU C CB  1 
ATOM 7703  C CG  . LEU C 3 35  ? 119.436 101.311 124.115 1.00 419.70 ? 35  LEU C CG  1 
ATOM 7704  C CD1 . LEU C 3 35  ? 120.325 100.688 125.186 1.00 430.26 ? 35  LEU C CD1 1 
ATOM 7705  C CD2 . LEU C 3 35  ? 119.996 102.628 123.597 1.00 463.32 ? 35  LEU C CD2 1 
ATOM 7706  N N   . VAL C 3 36  ? 117.445 102.005 121.083 1.00 432.28 ? 36  VAL C N   1 
ATOM 7707  C CA  . VAL C 3 36  ? 116.950 103.296 120.596 1.00 460.42 ? 36  VAL C CA  1 
ATOM 7708  C C   . VAL C 3 36  ? 115.410 103.266 120.516 1.00 420.52 ? 36  VAL C C   1 
ATOM 7709  O O   . VAL C 3 36  ? 114.727 104.204 120.979 1.00 433.92 ? 36  VAL C O   1 
ATOM 7710  C CB  . VAL C 3 36  ? 117.662 103.717 119.277 1.00 472.03 ? 36  VAL C CB  1 
ATOM 7711  C CG1 . VAL C 3 36  ? 116.977 104.895 118.594 1.00 488.73 ? 36  VAL C CG1 1 
ATOM 7712  C CG2 . VAL C 3 36  ? 119.122 104.069 119.554 1.00 479.91 ? 36  VAL C CG2 1 
ATOM 7713  N N   . ALA C 3 37  ? 114.922 102.177 119.936 1.00 388.79 ? 37  ALA C N   1 
ATOM 7714  C CA  . ALA C 3 37  ? 113.490 101.965 119.758 1.00 496.95 ? 37  ALA C CA  1 
ATOM 7715  C C   . ALA C 3 37  ? 112.776 101.986 121.114 1.00 476.68 ? 37  ALA C C   1 
ATOM 7716  O O   . ALA C 3 37  ? 111.732 102.634 121.278 1.00 395.61 ? 37  ALA C O   1 
ATOM 7717  C CB  . ALA C 3 37  ? 113.222 100.692 118.966 1.00 500.00 ? 37  ALA C CB  1 
ATOM 7718  N N   . GLY C 3 38  ? 113.374 101.271 122.055 1.00 500.00 ? 38  GLY C N   1 
ATOM 7719  C CA  . GLY C 3 38  ? 112.861 101.164 123.422 1.00 500.00 ? 38  GLY C CA  1 
ATOM 7720  C C   . GLY C 3 38  ? 112.750 102.541 124.054 1.00 500.00 ? 38  GLY C C   1 
ATOM 7721  O O   . GLY C 3 38  ? 111.726 102.881 124.667 1.00 500.00 ? 38  GLY C O   1 
ATOM 7722  N N   . ALA C 3 39  ? 113.822 103.307 123.883 1.00 476.83 ? 39  ALA C N   1 
ATOM 7723  C CA  . ALA C 3 39  ? 113.915 104.672 124.414 1.00 484.89 ? 39  ALA C CA  1 
ATOM 7724  C C   . ALA C 3 39  ? 112.775 105.526 123.860 1.00 455.99 ? 39  ALA C C   1 
ATOM 7725  O O   . ALA C 3 39  ? 112.103 106.253 124.607 1.00 472.42 ? 39  ALA C O   1 
ATOM 7726  C CB  . ALA C 3 39  ? 115.258 105.300 124.101 1.00 500.00 ? 39  ALA C CB  1 
ATOM 7727  N N   . PHE C 3 40  ? 112.594 105.407 122.552 1.00 433.54 ? 40  PHE C N   1 
ATOM 7728  C CA  . PHE C 3 40  ? 111.555 106.143 121.827 1.00 447.17 ? 40  PHE C CA  1 
ATOM 7729  C C   . PHE C 3 40  ? 110.174 105.817 122.409 1.00 436.61 ? 40  PHE C C   1 
ATOM 7730  O O   . PHE C 3 40  ? 109.359 106.715 122.661 1.00 394.18 ? 40  PHE C O   1 
ATOM 7731  C CB  . PHE C 3 40  ? 111.632 105.811 120.347 1.00 445.47 ? 40  PHE C CB  1 
ATOM 7732  C CG  . PHE C 3 40  ? 110.424 106.202 119.576 1.00 495.93 ? 40  PHE C CG  1 
ATOM 7733  C CD1 . PHE C 3 40  ? 110.255 107.508 119.150 1.00 500.00 ? 40  PHE C CD1 1 
ATOM 7734  C CD2 . PHE C 3 40  ? 109.463 105.256 119.245 1.00 500.00 ? 40  PHE C CD2 1 
ATOM 7735  C CE1 . PHE C 3 40  ? 109.135 107.867 118.416 1.00 500.00 ? 40  PHE C CE1 1 
ATOM 7736  C CE2 . PHE C 3 40  ? 108.342 105.605 118.511 1.00 500.00 ? 40  PHE C CE2 1 
ATOM 7737  C CZ  . PHE C 3 40  ? 108.177 106.915 118.091 1.00 500.00 ? 40  PHE C CZ  1 
ATOM 7738  N N   . PHE C 3 41  ? 109.961 104.525 122.605 1.00 412.22 ? 41  PHE C N   1 
ATOM 7739  C CA  . PHE C 3 41  ? 108.710 104.003 123.155 1.00 435.37 ? 41  PHE C CA  1 
ATOM 7740  C C   . PHE C 3 41  ? 108.435 104.615 124.528 1.00 431.86 ? 41  PHE C C   1 
ATOM 7741  O O   . PHE C 3 41  ? 107.315 105.070 124.819 1.00 461.65 ? 41  PHE C O   1 
ATOM 7742  C CB  . PHE C 3 41  ? 108.693 102.477 123.190 1.00 461.29 ? 41  PHE C CB  1 
ATOM 7743  C CG  . PHE C 3 41  ? 108.007 101.896 122.004 1.00 500.00 ? 41  PHE C CG  1 
ATOM 7744  C CD1 . PHE C 3 41  ? 108.525 102.121 120.733 1.00 500.00 ? 41  PHE C CD1 1 
ATOM 7745  C CD2 . PHE C 3 41  ? 106.805 101.204 122.129 1.00 500.00 ? 41  PHE C CD2 1 
ATOM 7746  C CE1 . PHE C 3 41  ? 107.890 101.633 119.605 1.00 500.00 ? 41  PHE C CE1 1 
ATOM 7747  C CE2 . PHE C 3 41  ? 106.157 100.712 121.007 1.00 500.00 ? 41  PHE C CE2 1 
ATOM 7748  C CZ  . PHE C 3 41  ? 106.701 100.929 119.742 1.00 500.00 ? 41  PHE C CZ  1 
ATOM 7749  N N   . TRP C 3 42  ? 109.486 104.613 125.338 1.00 428.68 ? 42  TRP C N   1 
ATOM 7750  C CA  . TRP C 3 42  ? 109.438 105.156 126.698 1.00 421.69 ? 42  TRP C CA  1 
ATOM 7751  C C   . TRP C 3 42  ? 109.024 106.624 126.664 1.00 410.16 ? 42  TRP C C   1 
ATOM 7752  O O   . TRP C 3 42  ? 108.157 107.063 127.436 1.00 387.97 ? 42  TRP C O   1 
ATOM 7753  C CB  . TRP C 3 42  ? 110.761 104.982 127.442 1.00 417.85 ? 42  TRP C CB  1 
ATOM 7754  C CG  . TRP C 3 42  ? 110.688 105.549 128.803 1.00 401.40 ? 42  TRP C CG  1 
ATOM 7755  C CD1 . TRP C 3 42  ? 110.273 104.915 129.920 1.00 447.12 ? 42  TRP C CD1 1 
ATOM 7756  C CD2 . TRP C 3 42  ? 110.985 106.892 129.188 1.00 399.66 ? 42  TRP C CD2 1 
ATOM 7757  N NE1 . TRP C 3 42  ? 110.312 105.767 130.991 1.00 450.39 ? 42  TRP C NE1 1 
ATOM 7758  C CE2 . TRP C 3 42  ? 110.752 106.990 130.564 1.00 387.51 ? 42  TRP C CE2 1 
ATOM 7759  C CE3 . TRP C 3 42  ? 111.441 108.021 128.499 1.00 463.43 ? 42  TRP C CE3 1 
ATOM 7760  C CZ2 . TRP C 3 42  ? 110.943 108.170 131.270 1.00 432.55 ? 42  TRP C CZ2 1 
ATOM 7761  C CZ3 . TRP C 3 42  ? 111.648 109.194 129.202 1.00 465.92 ? 42  TRP C CZ3 1 
ATOM 7762  C CH2 . TRP C 3 42  ? 111.400 109.257 130.575 1.00 466.34 ? 42  TRP C CH2 1 
ATOM 7763  N N   . LEU C 3 43  ? 109.665 107.349 125.756 1.00 414.86 ? 43  LEU C N   1 
ATOM 7764  C CA  . LEU C 3 43  ? 109.413 108.781 125.552 1.00 429.27 ? 43  LEU C CA  1 
ATOM 7765  C C   . LEU C 3 43  ? 107.946 109.012 125.221 1.00 450.31 ? 43  LEU C C   1 
ATOM 7766  O O   . LEU C 3 43  ? 107.300 109.902 125.782 1.00 499.01 ? 43  LEU C O   1 
ATOM 7767  C CB  . LEU C 3 43  ? 110.262 109.331 124.398 1.00 425.39 ? 43  LEU C CB  1 
ATOM 7768  C CG  . LEU C 3 43  ? 111.704 109.772 124.676 1.00 448.93 ? 43  LEU C CG  1 
ATOM 7769  C CD1 . LEU C 3 43  ? 112.483 109.965 123.389 1.00 414.08 ? 43  LEU C CD1 1 
ATOM 7770  C CD2 . LEU C 3 43  ? 111.748 111.060 125.489 1.00 473.95 ? 43  LEU C CD2 1 
ATOM 7771  N N   . VAL C 3 44  ? 107.460 108.194 124.299 1.00 421.99 ? 44  VAL C N   1 
ATOM 7772  C CA  . VAL C 3 44  ? 106.069 108.252 123.830 1.00 447.80 ? 44  VAL C CA  1 
ATOM 7773  C C   . VAL C 3 44  ? 105.113 108.066 125.015 1.00 420.50 ? 44  VAL C C   1 
ATOM 7774  O O   . VAL C 3 44  ? 104.141 108.813 125.170 1.00 329.01 ? 44  VAL C O   1 
ATOM 7775  C CB  . VAL C 3 44  ? 105.745 107.229 122.717 1.00 469.60 ? 44  VAL C CB  1 
ATOM 7776  C CG1 . VAL C 3 44  ? 104.297 107.391 122.254 1.00 500.00 ? 44  VAL C CG1 1 
ATOM 7777  C CG2 . VAL C 3 44  ? 106.688 107.375 121.526 1.00 458.73 ? 44  VAL C CG2 1 
ATOM 7778  N N   . SER C 3 45  ? 105.431 107.057 125.816 1.00 428.14 ? 45  SER C N   1 
ATOM 7779  C CA  . SER C 3 45  ? 104.649 106.708 127.004 1.00 451.65 ? 45  SER C CA  1 
ATOM 7780  C C   . SER C 3 45  ? 104.558 107.919 127.951 1.00 432.65 ? 45  SER C C   1 
ATOM 7781  O O   . SER C 3 45  ? 103.473 108.286 128.448 1.00 421.48 ? 45  SER C O   1 
ATOM 7782  C CB  . SER C 3 45  ? 105.277 105.524 127.763 1.00 465.39 ? 45  SER C CB  1 
ATOM 7783  O OG  . SER C 3 45  ? 106.325 105.933 128.635 1.00 419.20 ? 45  SER C OG  1 
ATOM 7784  N N   . LEU C 3 46  ? 105.733 108.500 128.164 1.00 440.53 ? 46  LEU C N   1 
ATOM 7785  C CA  . LEU C 3 46  ? 105.883 109.667 129.040 1.00 460.66 ? 46  LEU C CA  1 
ATOM 7786  C C   . LEU C 3 46  ? 105.003 110.814 128.552 1.00 427.20 ? 46  LEU C C   1 
ATOM 7787  O O   . LEU C 3 46  ? 104.301 111.469 129.306 1.00 430.83 ? 46  LEU C O   1 
ATOM 7788  C CB  . LEU C 3 46  ? 107.348 110.125 129.111 1.00 500.00 ? 46  LEU C CB  1 
ATOM 7789  C CG  . LEU C 3 46  ? 107.864 110.832 130.382 1.00 500.00 ? 46  LEU C CG  1 
ATOM 7790  C CD1 . LEU C 3 46  ? 109.168 111.568 130.084 1.00 500.00 ? 46  LEU C CD1 1 
ATOM 7791  C CD2 . LEU C 3 46  ? 106.868 111.796 131.019 1.00 500.00 ? 46  LEU C CD2 1 
ATOM 7792  N N   . LEU C 3 47  ? 105.066 111.038 127.252 1.00 418.65 ? 47  LEU C N   1 
ATOM 7793  C CA  . LEU C 3 47  ? 104.366 112.079 126.526 1.00 473.96 ? 47  LEU C CA  1 
ATOM 7794  C C   . LEU C 3 47  ? 102.878 111.884 126.750 1.00 413.57 ? 47  LEU C C   1 
ATOM 7795  O O   . LEU C 3 47  ? 102.206 112.863 127.012 1.00 428.72 ? 47  LEU C O   1 
ATOM 7796  C CB  . LEU C 3 47  ? 104.713 111.839 125.033 1.00 500.00 ? 47  LEU C CB  1 
ATOM 7797  C CG  . LEU C 3 47  ? 104.510 112.720 123.802 1.00 500.00 ? 47  LEU C CG  1 
ATOM 7798  C CD1 . LEU C 3 47  ? 103.032 112.906 123.482 1.00 500.00 ? 47  LEU C CD1 1 
ATOM 7799  C CD2 . LEU C 3 47  ? 105.257 114.039 123.948 1.00 500.00 ? 47  LEU C CD2 1 
ATOM 7800  N N   . LEU C 3 48  ? 102.396 110.646 126.621 1.00 390.49 ? 48  LEU C N   1 
ATOM 7801  C CA  . LEU C 3 48  ? 100.957 110.435 126.810 1.00 492.58 ? 48  LEU C CA  1 
ATOM 7802  C C   . LEU C 3 48  ? 100.552 110.745 128.255 1.00 455.10 ? 48  LEU C C   1 
ATOM 7803  O O   . LEU C 3 48  ? 99.539  111.454 128.530 1.00 408.90 ? 48  LEU C O   1 
ATOM 7804  C CB  . LEU C 3 48  ? 100.573 109.012 126.424 1.00 500.00 ? 48  LEU C CB  1 
ATOM 7805  C CG  . LEU C 3 48  ? 100.961 108.528 125.014 1.00 500.00 ? 48  LEU C CG  1 
ATOM 7806  C CD1 . LEU C 3 48  ? 99.993  107.431 124.573 1.00 500.00 ? 48  LEU C CD1 1 
ATOM 7807  C CD2 . LEU C 3 48  ? 101.022 109.642 123.966 1.00 500.00 ? 48  LEU C CD2 1 
ATOM 7808  N N   . ALA C 3 49  ? 101.388 110.201 129.165 1.00 439.82 ? 49  ALA C N   1 
ATOM 7809  C CA  . ALA C 3 49  ? 101.166 110.412 130.606 1.00 435.81 ? 49  ALA C CA  1 
ATOM 7810  C C   . ALA C 3 49  ? 101.205 111.899 130.933 1.00 433.82 ? 49  ALA C C   1 
ATOM 7811  O O   . ALA C 3 49  ? 100.352 112.403 131.682 1.00 379.54 ? 49  ALA C O   1 
ATOM 7812  C CB  . ALA C 3 49  ? 102.196 109.651 131.427 1.00 456.14 ? 49  ALA C CB  1 
ATOM 7813  N N   . SER C 3 50  ? 102.202 112.569 130.348 1.00 483.06 ? 50  SER C N   1 
ATOM 7814  C CA  . SER C 3 50  ? 102.394 114.010 130.552 1.00 500.00 ? 50  SER C CA  1 
ATOM 7815  C C   . SER C 3 50  ? 101.166 114.771 130.104 1.00 500.00 ? 50  SER C C   1 
ATOM 7816  O O   . SER C 3 50  ? 100.698 115.671 130.810 1.00 498.80 ? 50  SER C O   1 
ATOM 7817  C CB  . SER C 3 50  ? 103.597 114.529 129.799 1.00 500.00 ? 50  SER C CB  1 
ATOM 7818  O OG  . SER C 3 50  ? 103.298 114.818 128.441 1.00 500.00 ? 50  SER C OG  1 
ATOM 7819  N N   . VAL C 3 51  ? 100.666 114.397 128.938 1.00 500.00 ? 51  VAL C N   1 
ATOM 7820  C CA  . VAL C 3 51  ? 99.475  115.007 128.335 1.00 500.00 ? 51  VAL C CA  1 
ATOM 7821  C C   . VAL C 3 51  ? 98.290  114.879 129.287 1.00 470.69 ? 51  VAL C C   1 
ATOM 7822  O O   . VAL C 3 51  ? 97.557  115.855 129.528 1.00 420.19 ? 51  VAL C O   1 
ATOM 7823  C CB  . VAL C 3 51  ? 99.141  114.361 126.959 1.00 500.00 ? 51  VAL C CB  1 
ATOM 7824  C CG1 . VAL C 3 51  ? 97.743  114.734 126.469 1.00 500.00 ? 51  VAL C CG1 1 
ATOM 7825  C CG2 . VAL C 3 51  ? 100.177 114.760 125.918 1.00 500.00 ? 51  VAL C CG2 1 
ATOM 7826  N N   . VAL C 3 52  ? 98.135  113.663 129.802 1.00 433.80 ? 52  VAL C N   1 
ATOM 7827  C CA  . VAL C 3 52  ? 97.053  113.333 130.737 1.00 475.12 ? 52  VAL C CA  1 
ATOM 7828  C C   . VAL C 3 52  ? 97.126  114.244 131.968 1.00 422.94 ? 52  VAL C C   1 
ATOM 7829  O O   . VAL C 3 52  ? 96.110  114.807 132.410 1.00 415.93 ? 52  VAL C O   1 
ATOM 7830  C CB  . VAL C 3 52  ? 97.096  111.852 131.180 1.00 500.00 ? 52  VAL C CB  1 
ATOM 7831  C CG1 . VAL C 3 52  ? 96.210  111.597 132.403 1.00 500.00 ? 52  VAL C CG1 1 
ATOM 7832  C CG2 . VAL C 3 52  ? 96.681  110.945 130.024 1.00 500.00 ? 52  VAL C CG2 1 
ATOM 7833  N N   . TRP C 3 53  ? 98.342  114.354 132.483 1.00 437.06 ? 53  TRP C N   1 
ATOM 7834  C CA  . TRP C 3 53  ? 98.632  115.169 133.663 1.00 467.25 ? 53  TRP C CA  1 
ATOM 7835  C C   . TRP C 3 53  ? 98.218  116.624 133.415 1.00 444.39 ? 53  TRP C C   1 
ATOM 7836  O O   . TRP C 3 53  ? 97.565  117.257 134.257 1.00 405.31 ? 53  TRP C O   1 
ATOM 7837  C CB  . TRP C 3 53  ? 100.116 115.044 134.008 1.00 500.00 ? 53  TRP C CB  1 
ATOM 7838  C CG  . TRP C 3 53  ? 100.584 115.820 135.185 1.00 500.00 ? 53  TRP C CG  1 
ATOM 7839  C CD1 . TRP C 3 53  ? 100.570 115.431 136.498 1.00 496.23 ? 53  TRP C CD1 1 
ATOM 7840  C CD2 . TRP C 3 53  ? 101.190 117.108 135.154 1.00 500.00 ? 53  TRP C CD2 1 
ATOM 7841  N NE1 . TRP C 3 53  ? 101.116 116.412 137.288 1.00 471.27 ? 53  TRP C NE1 1 
ATOM 7842  C CE2 . TRP C 3 53  ? 101.509 117.455 136.490 1.00 500.00 ? 53  TRP C CE2 1 
ATOM 7843  C CE3 . TRP C 3 53  ? 101.482 118.018 134.124 1.00 500.00 ? 53  TRP C CE3 1 
ATOM 7844  C CZ2 . TRP C 3 53  ? 102.108 118.676 136.828 1.00 500.00 ? 53  TRP C CZ2 1 
ATOM 7845  C CZ3 . TRP C 3 53  ? 102.084 119.231 134.457 1.00 500.00 ? 53  TRP C CZ3 1 
ATOM 7846  C CH2 . TRP C 3 53  ? 102.388 119.550 135.803 1.00 500.00 ? 53  TRP C CH2 1 
ATOM 7847  N N   . PHE C 3 54  ? 98.615  117.107 132.248 1.00 442.04 ? 54  PHE C N   1 
ATOM 7848  C CA  . PHE C 3 54  ? 98.326  118.475 131.810 1.00 467.09 ? 54  PHE C CA  1 
ATOM 7849  C C   . PHE C 3 54  ? 96.817  118.712 131.791 1.00 449.66 ? 54  PHE C C   1 
ATOM 7850  O O   . PHE C 3 54  ? 96.326  119.734 132.291 1.00 394.42 ? 54  PHE C O   1 
ATOM 7851  C CB  . PHE C 3 54  ? 98.934  118.696 130.426 1.00 500.00 ? 54  PHE C CB  1 
ATOM 7852  C CG  . PHE C 3 54  ? 98.806  120.104 129.909 1.00 500.00 ? 54  PHE C CG  1 
ATOM 7853  C CD1 . PHE C 3 54  ? 99.475  121.162 130.539 1.00 500.00 ? 54  PHE C CD1 1 
ATOM 7854  C CD2 . PHE C 3 54  ? 98.048  120.380 128.761 1.00 500.00 ? 54  PHE C CD2 1 
ATOM 7855  C CE1 . PHE C 3 54  ? 99.373  122.468 130.049 1.00 500.00 ? 54  PHE C CE1 1 
ATOM 7856  C CE2 . PHE C 3 54  ? 97.946  121.684 128.266 1.00 500.00 ? 54  PHE C CE2 1 
ATOM 7857  C CZ  . PHE C 3 54  ? 98.608  122.729 128.913 1.00 500.00 ? 54  PHE C CZ  1 
ATOM 7858  N N   . ILE C 3 55  ? 96.123  117.744 131.210 1.00 434.79 ? 55  ILE C N   1 
ATOM 7859  C CA  . ILE C 3 55  ? 94.660  117.777 131.089 1.00 449.95 ? 55  ILE C CA  1 
ATOM 7860  C C   . ILE C 3 55  ? 94.021  117.891 132.470 1.00 431.64 ? 55  ILE C C   1 
ATOM 7861  O O   . ILE C 3 55  ? 93.116  118.701 132.691 1.00 468.54 ? 55  ILE C O   1 
ATOM 7862  C CB  . ILE C 3 55  ? 94.107  116.546 130.336 1.00 494.61 ? 55  ILE C CB  1 
ATOM 7863  C CG1 . ILE C 3 55  ? 94.450  116.646 128.852 1.00 500.00 ? 55  ILE C CG1 1 
ATOM 7864  C CG2 . ILE C 3 55  ? 92.588  116.441 130.479 1.00 500.00 ? 55  ILE C CG2 1 
ATOM 7865  C CD1 . ILE C 3 55  ? 94.242  115.357 128.085 1.00 500.00 ? 55  ILE C CD1 1 
ATOM 7866  N N   . LEU C 3 56  ? 94.526  117.052 133.369 1.00 433.81 ? 56  LEU C N   1 
ATOM 7867  C CA  . LEU C 3 56  ? 94.055  116.997 134.759 1.00 500.00 ? 56  LEU C CA  1 
ATOM 7868  C C   . LEU C 3 56  ? 94.208  118.368 135.418 1.00 453.10 ? 56  LEU C C   1 
ATOM 7869  O O   . LEU C 3 56  ? 93.285  118.869 136.077 1.00 445.25 ? 56  LEU C O   1 
ATOM 7870  C CB  . LEU C 3 56  ? 94.803  115.925 135.601 1.00 500.00 ? 56  LEU C CB  1 
ATOM 7871  C CG  . LEU C 3 56  ? 94.092  114.618 136.059 1.00 500.00 ? 56  LEU C CG  1 
ATOM 7872  C CD1 . LEU C 3 56  ? 93.291  114.783 137.356 1.00 500.00 ? 56  LEU C CD1 1 
ATOM 7873  C CD2 . LEU C 3 56  ? 93.208  114.014 134.968 1.00 500.00 ? 56  LEU C CD2 1 
ATOM 7874  N N   . VAL C 3 57  ? 95.389  118.941 135.212 1.00 447.60 ? 57  VAL C N   1 
ATOM 7875  C CA  . VAL C 3 57  ? 95.747  120.245 135.766 1.00 500.00 ? 57  VAL C CA  1 
ATOM 7876  C C   . VAL C 3 57  ? 94.761  121.303 135.278 1.00 500.00 ? 57  VAL C C   1 
ATOM 7877  O O   . VAL C 3 57  ? 94.262  122.121 136.084 1.00 500.00 ? 57  VAL C O   1 
ATOM 7878  C CB  . VAL C 3 57  ? 97.190  120.690 135.413 1.00 500.00 ? 57  VAL C CB  1 
ATOM 7879  C CG1 . VAL C 3 57  ? 97.452  122.145 135.834 1.00 500.00 ? 57  VAL C CG1 1 
ATOM 7880  C CG2 . VAL C 3 57  ? 98.212  119.757 136.059 1.00 500.00 ? 57  VAL C CG2 1 
ATOM 7881  N N   . HIS C 3 58  ? 94.491  121.256 133.971 1.00 476.62 ? 58  HIS C N   1 
ATOM 7882  C CA  . HIS C 3 58  ? 93.714  122.301 133.309 1.00 497.90 ? 58  HIS C CA  1 
ATOM 7883  C C   . HIS C 3 58  ? 92.221  122.212 133.557 1.00 498.74 ? 58  HIS C C   1 
ATOM 7884  O O   . HIS C 3 58  ? 91.626  123.252 133.719 1.00 420.10 ? 58  HIS C O   1 
ATOM 7885  C CB  . HIS C 3 58  ? 94.054  122.402 131.809 1.00 500.00 ? 58  HIS C CB  1 
ATOM 7886  C CG  . HIS C 3 58  ? 95.179  123.355 131.521 1.00 500.00 ? 58  HIS C CG  1 
ATOM 7887  N ND1 . HIS C 3 58  ? 95.057  124.422 130.652 1.00 500.00 ? 58  HIS C ND1 1 
ATOM 7888  C CD2 . HIS C 3 58  ? 96.434  123.431 132.030 1.00 500.00 ? 58  HIS C CD2 1 
ATOM 7889  C CE1 . HIS C 3 58  ? 96.195  125.094 130.617 1.00 500.00 ? 58  HIS C CE1 1 
ATOM 7890  N NE2 . HIS C 3 58  ? 97.047  124.516 131.446 1.00 500.00 ? 58  HIS C NE2 1 
ATOM 7891  N N   . VAL C 3 59  ? 91.642  121.021 133.588 1.00 500.00 ? 59  VAL C N   1 
ATOM 7892  C CA  . VAL C 3 59  ? 90.190  120.940 133.692 1.00 500.00 ? 59  VAL C CA  1 
ATOM 7893  C C   . VAL C 3 59  ? 89.778  121.394 135.094 1.00 500.00 ? 59  VAL C C   1 
ATOM 7894  O O   . VAL C 3 59  ? 88.809  122.168 135.261 1.00 448.41 ? 59  VAL C O   1 
ATOM 7895  C CB  . VAL C 3 59  ? 89.622  119.541 133.342 1.00 500.00 ? 59  VAL C CB  1 
ATOM 7896  C CG1 . VAL C 3 59  ? 88.173  119.377 133.822 1.00 500.00 ? 59  VAL C CG1 1 
ATOM 7897  C CG2 . VAL C 3 59  ? 89.706  119.309 131.835 1.00 500.00 ? 59  VAL C CG2 1 
ATOM 7898  N N   . THR C 3 60  ? 90.483  120.873 136.104 1.00 500.00 ? 60  THR C N   1 
ATOM 7899  C CA  . THR C 3 60  ? 90.042  120.909 137.489 1.00 500.00 ? 60  THR C CA  1 
ATOM 7900  C C   . THR C 3 60  ? 90.589  122.128 138.220 1.00 500.00 ? 60  THR C C   1 
ATOM 7901  O O   . THR C 3 60  ? 89.879  122.710 139.018 1.00 500.00 ? 60  THR C O   1 
ATOM 7902  C CB  . THR C 3 60  ? 90.414  119.615 138.275 1.00 500.00 ? 60  THR C CB  1 
ATOM 7903  O OG1 . THR C 3 60  ? 89.885  118.460 137.601 1.00 500.00 ? 60  THR C OG1 1 
ATOM 7904  C CG2 . THR C 3 60  ? 89.856  119.650 139.715 1.00 500.00 ? 60  THR C CG2 1 
ATOM 7905  N N   . ASP C 3 61  ? 91.853  122.471 137.956 1.00 500.00 ? 61  ASP C N   1 
ATOM 7906  C CA  . ASP C 3 61  ? 92.461  123.791 138.253 1.00 500.00 ? 61  ASP C CA  1 
ATOM 7907  C C   . ASP C 3 61  ? 93.314  123.818 139.553 1.00 500.00 ? 61  ASP C C   1 
ATOM 7908  O O   . ASP C 3 61  ? 93.038  123.095 140.523 1.00 500.00 ? 61  ASP C O   1 
ATOM 7909  C CB  . ASP C 3 61  ? 91.422  124.961 138.196 1.00 500.00 ? 61  ASP C CB  1 
ATOM 7910  C CG  . ASP C 3 61  ? 91.905  126.166 137.365 1.00 500.00 ? 61  ASP C CG  1 
ATOM 7911  O OD1 . ASP C 3 61  ? 92.269  125.980 136.177 1.00 500.00 ? 61  ASP C OD1 1 
ATOM 7912  O OD2 . ASP C 3 61  ? 91.885  127.302 137.894 1.00 500.00 ? 61  ASP C OD2 1 
ATOM 7913  N N   . ARG C 3 62  ? 94.370  124.650 139.509 1.00 500.00 ? 62  ARG C N   1 
ATOM 7914  C CA  . ARG C 3 62  ? 95.297  124.899 140.634 1.00 500.00 ? 62  ARG C CA  1 
ATOM 7915  C C   . ARG C 3 62  ? 94.557  125.602 141.767 1.00 500.00 ? 62  ARG C C   1 
ATOM 7916  O O   . ARG C 3 62  ? 94.249  126.800 141.679 1.00 500.00 ? 62  ARG C O   1 
ATOM 7917  C CB  . ARG C 3 62  ? 96.526  125.734 140.181 1.00 500.00 ? 62  ARG C CB  1 
ATOM 7918  C CG  . ARG C 3 62  ? 97.368  126.409 141.282 1.00 500.00 ? 62  ARG C CG  1 
ATOM 7919  C CD  . ARG C 3 62  ? 97.911  125.460 142.363 1.00 500.00 ? 62  ARG C CD  1 
ATOM 7920  N NE  . ARG C 3 62  ? 98.558  126.173 143.487 1.00 500.00 ? 62  ARG C NE  1 
ATOM 7921  C CZ  . ARG C 3 62  ? 99.809  126.675 143.501 1.00 500.00 ? 62  ARG C CZ  1 
ATOM 7922  N NH1 . ARG C 3 62  ? 100.624 126.579 142.439 1.00 500.00 ? 62  ARG C NH1 1 
ATOM 7923  N NH2 . ARG C 3 62  ? 100.259 127.295 144.599 1.00 500.00 ? 62  ARG C NH2 1 
ATOM 7924  N N   . SER C 3 63  ? 94.278  124.837 142.818 1.00 500.00 ? 63  SER C N   1 
ATOM 7925  C CA  . SER C 3 63  ? 93.580  125.339 143.986 1.00 500.00 ? 63  SER C CA  1 
ATOM 7926  C C   . SER C 3 63  ? 94.232  124.777 145.254 1.00 500.00 ? 63  SER C C   1 
ATOM 7927  O O   . SER C 3 63  ? 94.961  125.494 145.949 1.00 466.70 ? 63  SER C O   1 
ATOM 7928  C CB  . SER C 3 63  ? 92.085  124.977 143.897 1.00 500.00 ? 63  SER C CB  1 
ATOM 7929  O OG  . SER C 3 63  ? 91.500  125.433 142.682 1.00 500.00 ? 63  SER C OG  1 
ATOM 7930  N N   . ASP C 3 64  ? 94.007  123.487 145.505 1.00 500.00 ? 64  ASP C N   1 
ATOM 7931  C CA  . ASP C 3 64  ? 94.359  122.834 146.772 1.00 500.00 ? 64  ASP C CA  1 
ATOM 7932  C C   . ASP C 3 64  ? 95.755  122.208 146.630 1.00 500.00 ? 64  ASP C C   1 
ATOM 7933  O O   . ASP C 3 64  ? 96.037  121.579 145.605 1.00 450.63 ? 64  ASP C O   1 
ATOM 7934  C CB  . ASP C 3 64  ? 93.308  121.747 147.134 1.00 500.00 ? 64  ASP C CB  1 
ATOM 7935  C CG  . ASP C 3 64  ? 92.017  122.299 147.799 1.00 500.00 ? 64  ASP C CG  1 
ATOM 7936  O OD1 . ASP C 3 64  ? 91.828  123.534 147.889 1.00 500.00 ? 64  ASP C OD1 1 
ATOM 7937  O OD2 . ASP C 3 64  ? 91.173  121.466 148.220 1.00 500.00 ? 64  ASP C OD2 1 
ATOM 7938  N N   . ALA C 3 65  ? 96.604  122.374 147.656 1.00 500.00 ? 65  ALA C N   1 
ATOM 7939  C CA  . ALA C 3 65  ? 97.999  121.890 147.649 1.00 500.00 ? 65  ALA C CA  1 
ATOM 7940  C C   . ALA C 3 65  ? 98.050  120.369 147.742 1.00 500.00 ? 65  ALA C C   1 
ATOM 7941  O O   . ALA C 3 65  ? 98.704  119.684 146.930 1.00 500.00 ? 65  ALA C O   1 
ATOM 7942  C CB  . ALA C 3 65  ? 98.788  122.527 148.791 1.00 500.00 ? 65  ALA C CB  1 
ATOM 7943  N N   . ARG C 3 66  ? 97.255  119.870 148.685 1.00 500.00 ? 66  ARG C N   1 
ATOM 7944  C CA  . ARG C 3 66  ? 97.057  118.409 148.860 1.00 500.00 ? 66  ARG C CA  1 
ATOM 7945  C C   . ARG C 3 66  ? 96.498  117.820 147.572 1.00 500.00 ? 66  ARG C C   1 
ATOM 7946  O O   . ARG C 3 66  ? 96.972  116.768 147.114 1.00 500.00 ? 66  ARG C O   1 
ATOM 7947  C CB  . ARG C 3 66  ? 96.130  118.108 150.063 1.00 500.00 ? 66  ARG C CB  1 
ATOM 7948  C CG  . ARG C 3 66  ? 96.148  116.663 150.563 1.00 500.00 ? 66  ARG C CG  1 
ATOM 7949  C CD  . ARG C 3 66  ? 95.072  115.769 149.931 1.00 500.00 ? 66  ARG C CD  1 
ATOM 7950  N NE  . ARG C 3 66  ? 93.697  116.118 150.334 1.00 500.00 ? 66  ARG C NE  1 
ATOM 7951  C CZ  . ARG C 3 66  ? 92.595  115.392 150.088 1.00 500.00 ? 66  ARG C CZ  1 
ATOM 7952  N NH1 . ARG C 3 66  ? 92.651  114.228 149.425 1.00 458.08 ? 66  ARG C NH1 1 
ATOM 7953  N NH2 . ARG C 3 66  ? 91.411  115.831 150.520 1.00 475.64 ? 66  ARG C NH2 1 
ATOM 7954  N N   . LEU C 3 67  ? 95.503  118.514 147.015 1.00 500.00 ? 67  LEU C N   1 
ATOM 7955  C CA  . LEU C 3 67  ? 94.851  118.079 145.775 1.00 500.00 ? 67  LEU C CA  1 
ATOM 7956  C C   . LEU C 3 67  ? 95.872  117.986 144.650 1.00 477.39 ? 67  LEU C C   1 
ATOM 7957  O O   . LEU C 3 67  ? 95.887  117.003 143.904 1.00 453.80 ? 67  LEU C O   1 
ATOM 7958  C CB  . LEU C 3 67  ? 93.700  118.999 145.382 1.00 500.00 ? 67  LEU C CB  1 
ATOM 7959  C CG  . LEU C 3 67  ? 92.815  118.593 144.190 1.00 500.00 ? 67  LEU C CG  1 
ATOM 7960  C CD1 . LEU C 3 67  ? 91.329  118.712 144.530 1.00 500.00 ? 67  LEU C CD1 1 
ATOM 7961  C CD2 . LEU C 3 67  ? 93.159  119.417 142.952 1.00 500.00 ? 67  LEU C CD2 1 
ATOM 7962  N N   . GLN C 3 68  ? 96.704  119.010 144.562 1.00 446.70 ? 68  GLN C N   1 
ATOM 7963  C CA  . GLN C 3 68  ? 97.762  119.094 143.547 1.00 493.27 ? 68  GLN C CA  1 
ATOM 7964  C C   . GLN C 3 68  ? 98.699  117.891 143.667 1.00 471.29 ? 68  GLN C C   1 
ATOM 7965  O O   . GLN C 3 68  ? 99.041  117.254 142.663 1.00 457.99 ? 68  GLN C O   1 
ATOM 7966  C CB  . GLN C 3 68  ? 98.527  120.433 143.584 1.00 500.00 ? 68  GLN C CB  1 
ATOM 7967  C CG  . GLN C 3 68  ? 98.754  121.080 142.211 1.00 500.00 ? 68  GLN C CG  1 
ATOM 7968  C CD  . GLN C 3 68  ? 97.481  121.590 141.519 1.00 500.00 ? 68  GLN C CD  1 
ATOM 7969  O OE1 . GLN C 3 68  ? 97.495  121.866 140.317 1.00 500.00 ? 68  GLN C OE1 1 
ATOM 7970  N NE2 . GLN C 3 68  ? 96.386  121.716 142.270 1.00 500.00 ? 68  GLN C NE2 1 
ATOM 7971  N N   . TYR C 3 69  ? 99.083  117.624 144.903 1.00 466.06 ? 69  TYR C N   1 
ATOM 7972  C CA  . TYR C 3 69  ? 99.983  116.518 145.244 1.00 473.56 ? 69  TYR C CA  1 
ATOM 7973  C C   . TYR C 3 69  ? 99.373  115.184 144.748 1.00 452.11 ? 69  TYR C C   1 
ATOM 7974  O O   . TYR C 3 69  ? 100.056 114.354 144.106 1.00 429.08 ? 69  TYR C O   1 
ATOM 7975  C CB  . TYR C 3 69  ? 100.219 116.684 146.789 1.00 483.46 ? 69  TYR C CB  1 
ATOM 7976  C CG  . TYR C 3 69  ? 100.901 115.655 147.688 1.00 500.00 ? 69  TYR C CG  1 
ATOM 7977  C CD1 . TYR C 3 69  ? 100.163 114.614 148.271 1.00 500.00 ? 69  TYR C CD1 1 
ATOM 7978  C CD2 . TYR C 3 69  ? 102.239 115.816 148.105 1.00 500.00 ? 69  TYR C CD2 1 
ATOM 7979  C CE1 . TYR C 3 69  ? 100.754 113.701 149.151 1.00 500.00 ? 69  TYR C CE1 1 
ATOM 7980  C CE2 . TYR C 3 69  ? 102.841 114.908 148.991 1.00 494.40 ? 69  TYR C CE2 1 
ATOM 7981  C CZ  . TYR C 3 69  ? 102.087 113.846 149.511 1.00 493.56 ? 69  TYR C CZ  1 
ATOM 7982  O OH  . TYR C 3 69  ? 102.631 112.921 150.381 1.00 343.93 ? 69  TYR C OH  1 
ATOM 7983  N N   . GLY C 3 70  ? 98.093  115.034 145.065 1.00 418.71 ? 70  GLY C N   1 
ATOM 7984  C CA  . GLY C 3 70  ? 97.326  113.847 144.691 1.00 397.26 ? 70  GLY C CA  1 
ATOM 7985  C C   . GLY C 3 70  ? 97.332  113.656 143.187 1.00 409.83 ? 70  GLY C C   1 
ATOM 7986  O O   . GLY C 3 70  ? 97.554  112.553 142.678 1.00 448.94 ? 70  GLY C O   1 
ATOM 7987  N N   . LEU C 3 71  ? 97.082  114.756 142.497 1.00 442.61 ? 71  LEU C N   1 
ATOM 7988  C CA  . LEU C 3 71  ? 97.051  114.808 141.025 1.00 500.00 ? 71  LEU C CA  1 
ATOM 7989  C C   . LEU C 3 71  ? 98.369  114.333 140.462 1.00 468.83 ? 71  LEU C C   1 
ATOM 7990  O O   . LEU C 3 71  ? 98.406  113.518 139.536 1.00 453.18 ? 71  LEU C O   1 
ATOM 7991  C CB  . LEU C 3 71  ? 96.849  116.263 140.541 1.00 500.00 ? 71  LEU C CB  1 
ATOM 7992  C CG  . LEU C 3 71  ? 95.471  116.803 140.135 1.00 500.00 ? 71  LEU C CG  1 
ATOM 7993  C CD1 . LEU C 3 71  ? 94.354  116.464 141.120 1.00 500.00 ? 71  LEU C CD1 1 
ATOM 7994  C CD2 . LEU C 3 71  ? 95.550  118.314 139.921 1.00 500.00 ? 71  LEU C CD2 1 
ATOM 7995  N N   . LEU C 3 72  ? 99.438  114.869 141.040 1.00 488.09 ? 72  LEU C N   1 
ATOM 7996  C CA  . LEU C 3 72  ? 100.815 114.544 140.637 1.00 500.00 ? 72  LEU C CA  1 
ATOM 7997  C C   . LEU C 3 72  ? 101.050 113.037 140.760 1.00 500.00 ? 72  LEU C C   1 
ATOM 7998  O O   . LEU C 3 72  ? 101.590 112.394 139.837 1.00 430.86 ? 72  LEU C O   1 
ATOM 7999  C CB  . LEU C 3 72  ? 101.860 115.279 141.490 1.00 500.00 ? 72  LEU C CB  1 
ATOM 8000  C CG  . LEU C 3 72  ? 102.342 116.646 140.982 1.00 500.00 ? 72  LEU C CG  1 
ATOM 8001  C CD1 . LEU C 3 72  ? 102.865 117.507 142.132 1.00 500.00 ? 72  LEU C CD1 1 
ATOM 8002  C CD2 . LEU C 3 72  ? 103.406 116.496 139.894 1.00 500.00 ? 72  LEU C CD2 1 
ATOM 8003  N N   . ILE C 3 73  ? 100.631 112.521 141.914 1.00 500.00 ? 73  ILE C N   1 
ATOM 8004  C CA  . ILE C 3 73  ? 100.773 111.097 142.231 1.00 500.00 ? 73  ILE C CA  1 
ATOM 8005  C C   . ILE C 3 73  ? 100.064 110.246 141.176 1.00 500.00 ? 73  ILE C C   1 
ATOM 8006  O O   . ILE C 3 73  ? 100.618 109.254 140.667 1.00 500.00 ? 73  ILE C O   1 
ATOM 8007  C CB  . ILE C 3 73  ? 100.280 110.693 143.666 1.00 500.00 ? 73  ILE C CB  1 
ATOM 8008  C CG1 . ILE C 3 73  ? 101.377 110.993 144.703 1.00 500.00 ? 73  ILE C CG1 1 
ATOM 8009  C CG2 . ILE C 3 73  ? 99.883  109.205 143.754 1.00 500.00 ? 73  ILE C CG2 1 
ATOM 8010  C CD1 . ILE C 3 73  ? 100.997 110.712 146.148 1.00 500.00 ? 73  ILE C CD1 1 
ATOM 8011  N N   . PHE C 3 74  ? 98.844  110.669 140.875 1.00 500.00 ? 74  PHE C N   1 
ATOM 8012  C CA  . PHE C 3 74  ? 97.987  109.999 139.893 1.00 500.00 ? 74  PHE C CA  1 
ATOM 8013  C C   . PHE C 3 74  ? 98.681  109.945 138.541 1.00 500.00 ? 74  PHE C C   1 
ATOM 8014  O O   . PHE C 3 74  ? 98.712  108.896 137.882 1.00 500.00 ? 74  PHE C O   1 
ATOM 8015  C CB  . PHE C 3 74  ? 96.642  110.733 139.785 1.00 500.00 ? 74  PHE C CB  1 
ATOM 8016  C CG  . PHE C 3 74  ? 95.680  110.115 138.805 1.00 500.00 ? 74  PHE C CG  1 
ATOM 8017  C CD1 . PHE C 3 74  ? 94.894  109.012 139.174 1.00 500.00 ? 74  PHE C CD1 1 
ATOM 8018  C CD2 . PHE C 3 74  ? 95.541  110.639 137.512 1.00 500.00 ? 74  PHE C CD2 1 
ATOM 8019  C CE1 . PHE C 3 74  ? 93.997  108.439 138.271 1.00 500.00 ? 74  PHE C CE1 1 
ATOM 8020  C CE2 . PHE C 3 74  ? 94.645  110.071 136.608 1.00 500.00 ? 74  PHE C CE2 1 
ATOM 8021  C CZ  . PHE C 3 74  ? 93.872  108.970 136.988 1.00 500.00 ? 74  PHE C CZ  1 
ATOM 8022  N N   . GLY C 3 75  ? 99.227  111.092 138.161 1.00 492.65 ? 75  GLY C N   1 
ATOM 8023  C CA  . GLY C 3 75  ? 99.945  111.255 136.890 1.00 500.00 ? 75  GLY C CA  1 
ATOM 8024  C C   . GLY C 3 75  ? 101.101 110.274 136.816 1.00 459.76 ? 75  GLY C C   1 
ATOM 8025  O O   . GLY C 3 75  ? 101.294 109.598 135.794 1.00 432.39 ? 75  GLY C O   1 
ATOM 8026  N N   . ALA C 3 76  ? 101.850 110.226 137.913 1.00 449.02 ? 76  ALA C N   1 
ATOM 8027  C CA  . ALA C 3 76  ? 103.018 109.349 138.039 1.00 483.66 ? 76  ALA C CA  1 
ATOM 8028  C C   . ALA C 3 76  ? 102.602 107.890 137.822 1.00 496.79 ? 76  ALA C C   1 
ATOM 8029  O O   . ALA C 3 76  ? 103.257 107.142 137.067 1.00 500.00 ? 76  ALA C O   1 
ATOM 8030  C CB  . ALA C 3 76  ? 103.706 109.537 139.380 1.00 482.48 ? 76  ALA C CB  1 
ATOM 8031  N N   . ALA C 3 77  ? 101.512 107.534 138.496 1.00 500.00 ? 77  ALA C N   1 
ATOM 8032  C CA  . ALA C 3 77  ? 100.956 106.183 138.431 1.00 500.00 ? 77  ALA C CA  1 
ATOM 8033  C C   . ALA C 3 77  ? 100.611 105.822 136.985 1.00 493.48 ? 77  ALA C C   1 
ATOM 8034  O O   . ALA C 3 77  ? 100.946 104.726 136.499 1.00 475.00 ? 77  ALA C O   1 
ATOM 8035  C CB  . ALA C 3 77  ? 99.742  106.025 139.344 1.00 500.00 ? 77  ALA C CB  1 
ATOM 8036  N N   . VAL C 3 78  ? 99.953  106.771 136.335 1.00 470.86 ? 78  VAL C N   1 
ATOM 8037  C CA  . VAL C 3 78  ? 99.524  106.625 134.938 1.00 466.57 ? 78  VAL C CA  1 
ATOM 8038  C C   . VAL C 3 78  ? 100.725 106.364 134.046 1.00 445.27 ? 78  VAL C C   1 
ATOM 8039  O O   . VAL C 3 78  ? 100.702 105.467 133.194 1.00 448.35 ? 78  VAL C O   1 
ATOM 8040  C CB  . VAL C 3 78  ? 98.746  107.868 134.443 1.00 498.44 ? 78  VAL C CB  1 
ATOM 8041  C CG1 . VAL C 3 78  ? 98.461  107.775 132.948 1.00 500.00 ? 78  VAL C CG1 1 
ATOM 8042  C CG2 . VAL C 3 78  ? 97.450  108.050 135.234 1.00 500.00 ? 78  VAL C CG2 1 
ATOM 8043  N N   . SER C 3 79  ? 101.759 107.167 134.269 1.00 448.39 ? 79  SER C N   1 
ATOM 8044  C CA  . SER C 3 79  ? 103.012 107.080 133.511 1.00 463.61 ? 79  SER C CA  1 
ATOM 8045  C C   . SER C 3 79  ? 103.616 105.699 133.661 1.00 458.03 ? 79  SER C C   1 
ATOM 8046  O O   . SER C 3 79  ? 104.031 105.080 132.659 1.00 460.30 ? 79  SER C O   1 
ATOM 8047  C CB  . SER C 3 79  ? 104.005 108.163 133.919 1.00 500.00 ? 79  SER C CB  1 
ATOM 8048  O OG  . SER C 3 79  ? 104.505 107.929 135.219 1.00 500.00 ? 79  SER C OG  1 
ATOM 8049  N N   . VAL C 3 80  ? 103.636 105.226 134.906 1.00 456.67 ? 80  VAL C N   1 
ATOM 8050  C CA  . VAL C 3 80  ? 104.175 103.903 135.237 1.00 479.90 ? 80  VAL C CA  1 
ATOM 8051  C C   . VAL C 3 80  ? 103.423 102.812 134.450 1.00 447.80 ? 80  VAL C C   1 
ATOM 8052  O O   . VAL C 3 80  ? 104.022 101.931 133.768 1.00 476.85 ? 80  VAL C O   1 
ATOM 8053  C CB  . VAL C 3 80  ? 104.144 103.575 136.742 1.00 500.00 ? 80  VAL C CB  1 
ATOM 8054  C CG1 . VAL C 3 80  ? 104.457 102.097 136.985 1.00 500.00 ? 80  VAL C CG1 1 
ATOM 8055  C CG2 . VAL C 3 80  ? 105.144 104.452 137.486 1.00 500.00 ? 80  VAL C CG2 1 
ATOM 8056  N N   . LEU C 3 81  ? 102.114 102.948 134.518 1.00 427.15 ? 81  LEU C N   1 
ATOM 8057  C CA  . LEU C 3 81  ? 101.195 102.005 133.849 1.00 446.30 ? 81  LEU C CA  1 
ATOM 8058  C C   . LEU C 3 81  ? 101.411 102.055 132.361 1.00 432.79 ? 81  LEU C C   1 
ATOM 8059  O O   . LEU C 3 81  ? 101.521 101.033 131.663 1.00 424.24 ? 81  LEU C O   1 
ATOM 8060  C CB  . LEU C 3 81  ? 99.757  102.305 134.239 1.00 500.00 ? 81  LEU C CB  1 
ATOM 8061  C CG  . LEU C 3 81  ? 99.529  101.974 135.724 1.00 500.00 ? 81  LEU C CG  1 
ATOM 8062  C CD1 . LEU C 3 81  ? 98.361  102.765 136.301 1.00 500.00 ? 81  LEU C CD1 1 
ATOM 8063  C CD2 . LEU C 3 81  ? 99.347  100.473 135.936 1.00 500.00 ? 81  LEU C CD2 1 
ATOM 8064  N N   . LEU C 3 82  ? 101.461 103.285 131.847 1.00 483.96 ? 82  LEU C N   1 
ATOM 8065  C CA  . LEU C 3 82  ? 101.702 103.581 130.426 1.00 500.00 ? 82  LEU C CA  1 
ATOM 8066  C C   . LEU C 3 82  ? 103.013 103.001 130.026 1.00 463.70 ? 82  LEU C C   1 
ATOM 8067  O O   . LEU C 3 82  ? 103.060 102.396 128.953 1.00 411.12 ? 82  LEU C O   1 
ATOM 8068  C CB  . LEU C 3 82  ? 101.684 105.086 130.132 1.00 500.00 ? 82  LEU C CB  1 
ATOM 8069  C CG  . LEU C 3 82  ? 100.372 105.656 129.567 1.00 500.00 ? 82  LEU C CG  1 
ATOM 8070  C CD1 . LEU C 3 82  ? 99.106  105.072 130.205 1.00 500.00 ? 82  LEU C CD1 1 
ATOM 8071  C CD2 . LEU C 3 82  ? 100.392 107.175 129.688 1.00 500.00 ? 82  LEU C CD2 1 
ATOM 8072  N N   . GLN C 3 83  ? 104.045 103.172 130.844 1.00 462.16 ? 83  GLN C N   1 
ATOM 8073  C CA  . GLN C 3 83  ? 105.386 102.645 130.562 1.00 490.15 ? 83  GLN C CA  1 
ATOM 8074  C C   . GLN C 3 83  ? 105.320 101.128 130.370 1.00 500.00 ? 83  GLN C C   1 
ATOM 8075  O O   . GLN C 3 83  ? 105.887 100.579 129.411 1.00 500.00 ? 83  GLN C O   1 
ATOM 8076  C CB  . GLN C 3 83  ? 106.359 102.894 131.724 1.00 463.14 ? 83  GLN C CB  1 
ATOM 8077  C CG  . GLN C 3 83  ? 106.976 104.271 131.805 1.00 488.14 ? 83  GLN C CG  1 
ATOM 8078  C CD  . GLN C 3 83  ? 107.600 104.532 133.170 1.00 481.12 ? 83  GLN C CD  1 
ATOM 8079  O OE1 . GLN C 3 83  ? 108.609 103.927 133.534 1.00 417.05 ? 83  GLN C OE1 1 
ATOM 8080  N NE2 . GLN C 3 83  ? 107.001 105.438 133.932 1.00 500.00 ? 83  GLN C NE2 1 
ATOM 8081  N N   . GLU C 3 84  ? 104.620 100.496 131.309 1.00 500.00 ? 84  GLU C N   1 
ATOM 8082  C CA  . GLU C 3 84  ? 104.454 99.042  131.307 1.00 500.00 ? 84  GLU C CA  1 
ATOM 8083  C C   . GLU C 3 84  ? 103.781 98.585  130.001 1.00 486.72 ? 84  GLU C C   1 
ATOM 8084  O O   . GLU C 3 84  ? 104.219 97.621  129.364 1.00 356.03 ? 84  GLU C O   1 
ATOM 8085  C CB  . GLU C 3 84  ? 103.793 98.505  132.589 1.00 500.00 ? 84  GLU C CB  1 
ATOM 8086  C CG  . GLU C 3 84  ? 104.649 98.679  133.860 1.00 500.00 ? 84  GLU C CG  1 
ATOM 8087  C CD  . GLU C 3 84  ? 105.900 97.786  133.951 1.00 500.00 ? 84  GLU C CD  1 
ATOM 8088  O OE1 . GLU C 3 84  ? 106.202 97.307  135.070 1.00 500.00 ? 84  GLU C OE1 1 
ATOM 8089  O OE2 . GLU C 3 84  ? 106.607 97.574  132.939 1.00 500.00 ? 84  GLU C OE2 1 
ATOM 8090  N N   . VAL C 3 85  ? 102.733 99.315  129.651 1.00 449.05 ? 85  VAL C N   1 
ATOM 8091  C CA  . VAL C 3 85  ? 101.955 99.046  128.443 1.00 439.85 ? 85  VAL C CA  1 
ATOM 8092  C C   . VAL C 3 85  ? 102.861 99.121  127.205 1.00 462.65 ? 85  VAL C C   1 
ATOM 8093  O O   . VAL C 3 85  ? 102.822 98.246  126.328 1.00 481.86 ? 85  VAL C O   1 
ATOM 8094  C CB  . VAL C 3 85  ? 100.689 99.923  128.377 1.00 500.00 ? 85  VAL C CB  1 
ATOM 8095  C CG1 . VAL C 3 85  ? 100.017 99.821  127.013 1.00 500.00 ? 85  VAL C CG1 1 
ATOM 8096  C CG2 . VAL C 3 85  ? 99.716  99.520  129.491 1.00 500.00 ? 85  VAL C CG2 1 
ATOM 8097  N N   . PHE C 3 86  ? 103.661 100.173 127.181 1.00 493.36 ? 86  PHE C N   1 
ATOM 8098  C CA  . PHE C 3 86  ? 104.607 100.419 126.089 1.00 500.00 ? 86  PHE C CA  1 
ATOM 8099  C C   . PHE C 3 86  ? 105.577 99.272  125.959 1.00 500.00 ? 86  PHE C C   1 
ATOM 8100  O O   . PHE C 3 86  ? 105.849 98.799  124.859 1.00 476.24 ? 86  PHE C O   1 
ATOM 8101  C CB  . PHE C 3 86  ? 105.225 101.809 126.150 1.00 500.00 ? 86  PHE C CB  1 
ATOM 8102  C CG  . PHE C 3 86  ? 104.411 102.792 125.389 1.00 500.00 ? 86  PHE C CG  1 
ATOM 8103  C CD1 . PHE C 3 86  ? 103.120 103.091 125.809 1.00 500.00 ? 86  PHE C CD1 1 
ATOM 8104  C CD2 . PHE C 3 86  ? 104.860 103.306 124.183 1.00 500.00 ? 86  PHE C CD2 1 
ATOM 8105  C CE1 . PHE C 3 86  ? 102.318 103.952 125.079 1.00 500.00 ? 86  PHE C CE1 1 
ATOM 8106  C CE2 . PHE C 3 86  ? 104.066 104.176 123.447 1.00 500.00 ? 86  PHE C CE2 1 
ATOM 8107  C CZ  . PHE C 3 86  ? 102.792 104.499 123.896 1.00 500.00 ? 86  PHE C CZ  1 
ATOM 8108  N N   . ARG C 3 87  ? 106.085 98.825  127.097 1.00 500.00 ? 87  ARG C N   1 
ATOM 8109  C CA  . ARG C 3 87  ? 107.025 97.703  127.192 1.00 500.00 ? 87  ARG C CA  1 
ATOM 8110  C C   . ARG C 3 87  ? 106.403 96.464  126.588 1.00 462.97 ? 87  ARG C C   1 
ATOM 8111  O O   . ARG C 3 87  ? 107.057 95.782  125.859 1.00 402.97 ? 87  ARG C O   1 
ATOM 8112  C CB  . ARG C 3 87  ? 107.399 97.510  128.665 1.00 475.82 ? 87  ARG C CB  1 
ATOM 8113  C CG  . ARG C 3 87  ? 108.246 96.298  128.969 1.00 496.58 ? 87  ARG C CG  1 
ATOM 8114  C CD  . ARG C 3 87  ? 108.873 96.420  130.343 1.00 479.94 ? 87  ARG C CD  1 
ATOM 8115  N NE  . ARG C 3 87  ? 110.216 96.986  130.273 1.00 442.68 ? 87  ARG C NE  1 
ATOM 8116  C CZ  . ARG C 3 87  ? 110.833 97.626  131.264 1.00 449.17 ? 87  ARG C CZ  1 
ATOM 8117  N NH1 . ARG C 3 87  ? 110.246 97.824  132.447 1.00 459.33 ? 87  ARG C NH1 1 
ATOM 8118  N NH2 . ARG C 3 87  ? 112.058 98.085  131.061 1.00 467.12 ? 87  ARG C NH2 1 
ATOM 8119  N N   . PHE C 3 88  ? 105.159 96.215  126.974 1.00 483.48 ? 88  PHE C N   1 
ATOM 8120  C CA  . PHE C 3 88  ? 104.396 95.054  126.442 1.00 500.00 ? 88  PHE C CA  1 
ATOM 8121  C C   . PHE C 3 88  ? 104.350 95.087  124.892 1.00 489.29 ? 88  PHE C C   1 
ATOM 8122  O O   . PHE C 3 88  ? 104.651 94.139  124.125 1.00 428.26 ? 88  PHE C O   1 
ATOM 8123  C CB  . PHE C 3 88  ? 102.954 94.998  126.999 1.00 500.00 ? 88  PHE C CB  1 
ATOM 8124  C CG  . PHE C 3 88  ? 102.187 93.724  126.649 1.00 500.00 ? 88  PHE C CG  1 
ATOM 8125  C CD1 . PHE C 3 88  ? 102.635 92.470  127.072 1.00 500.00 ? 88  PHE C CD1 1 
ATOM 8126  C CD2 . PHE C 3 88  ? 100.986 93.787  125.926 1.00 500.00 ? 88  PHE C CD2 1 
ATOM 8127  C CE1 . PHE C 3 88  ? 101.918 91.313  126.760 1.00 500.00 ? 88  PHE C CE1 1 
ATOM 8128  C CE2 . PHE C 3 88  ? 100.270 92.633  125.614 1.00 500.00 ? 88  PHE C CE2 1 
ATOM 8129  C CZ  . PHE C 3 88  ? 100.736 91.395  126.032 1.00 500.00 ? 88  PHE C CZ  1 
ATOM 8130  N N   . ALA C 3 89  ? 103.945 96.287  124.481 1.00 500.00 ? 89  ALA C N   1 
ATOM 8131  C CA  . ALA C 3 89  ? 103.820 96.622  123.034 1.00 500.00 ? 89  ALA C CA  1 
ATOM 8132  C C   . ALA C 3 89  ? 105.173 96.462  122.367 1.00 500.00 ? 89  ALA C C   1 
ATOM 8133  O O   . ALA C 3 89  ? 105.237 95.887  121.268 1.00 500.00 ? 89  ALA C O   1 
ATOM 8134  C CB  . ALA C 3 89  ? 103.277 98.035  122.842 1.00 500.00 ? 89  ALA C CB  1 
ATOM 8135  N N   . TYR C 3 90  ? 106.214 96.959  123.030 1.00 460.85 ? 90  TYR C N   1 
ATOM 8136  C CA  . TYR C 3 90  ? 107.577 96.880  122.516 1.00 467.92 ? 90  TYR C CA  1 
ATOM 8137  C C   . TYR C 3 90  ? 107.978 95.429  122.283 1.00 463.43 ? 90  TYR C C   1 
ATOM 8138  O O   . TYR C 3 90  ? 108.537 95.080  121.240 1.00 421.84 ? 90  TYR C O   1 
ATOM 8139  C CB  . TYR C 3 90  ? 108.527 97.585  123.462 1.00 461.17 ? 90  TYR C CB  1 
ATOM 8140  C CG  . TYR C 3 90  ? 109.846 97.714  122.828 1.00 431.61 ? 90  TYR C CG  1 
ATOM 8141  C CD1 . TYR C 3 90  ? 110.048 98.656  121.845 1.00 419.45 ? 90  TYR C CD1 1 
ATOM 8142  C CD2 . TYR C 3 90  ? 110.873 96.839  123.139 1.00 436.79 ? 90  TYR C CD2 1 
ATOM 8143  C CE1 . TYR C 3 90  ? 111.258 98.762  121.217 1.00 500.00 ? 90  TYR C CE1 1 
ATOM 8144  C CE2 . TYR C 3 90  ? 112.093 96.941  122.526 1.00 455.93 ? 90  TYR C CE2 1 
ATOM 8145  C CZ  . TYR C 3 90  ? 112.277 97.907  121.566 1.00 500.00 ? 90  TYR C CZ  1 
ATOM 8146  O OH  . TYR C 3 90  ? 113.482 98.002  120.946 1.00 500.00 ? 90  TYR C OH  1 
ATOM 8147  N N   . TYR C 3 91  ? 107.671 94.611  123.278 1.00 446.71 ? 91  TYR C N   1 
ATOM 8148  C CA  . TYR C 3 91  ? 107.956 93.165  123.251 1.00 472.29 ? 91  TYR C CA  1 
ATOM 8149  C C   . TYR C 3 91  ? 107.288 92.528  122.054 1.00 442.58 ? 91  TYR C C   1 
ATOM 8150  O O   . TYR C 3 91  ? 107.909 91.743  121.325 1.00 455.36 ? 91  TYR C O   1 
ATOM 8151  C CB  . TYR C 3 91  ? 107.431 92.451  124.522 1.00 500.00 ? 91  TYR C CB  1 
ATOM 8152  C CG  . TYR C 3 91  ? 106.892 91.025  124.284 1.00 500.00 ? 91  TYR C CG  1 
ATOM 8153  C CD1 . TYR C 3 91  ? 107.759 89.925  124.197 1.00 500.00 ? 91  TYR C CD1 1 
ATOM 8154  C CD2 . TYR C 3 91  ? 105.512 90.781  124.138 1.00 500.00 ? 91  TYR C CD2 1 
ATOM 8155  C CE1 . TYR C 3 91  ? 107.275 88.632  123.975 1.00 500.00 ? 91  TYR C CE1 1 
ATOM 8156  C CE2 . TYR C 3 91  ? 105.024 89.489  123.909 1.00 500.00 ? 91  TYR C CE2 1 
ATOM 8157  C CZ  . TYR C 3 91  ? 105.907 88.416  123.832 1.00 500.00 ? 91  TYR C CZ  1 
ATOM 8158  O OH  . TYR C 3 91  ? 105.437 87.137  123.614 1.00 454.34 ? 91  TYR C OH  1 
ATOM 8159  N N   . LYS C 3 92  ? 106.015 92.879  121.883 1.00 460.44 ? 92  LYS C N   1 
ATOM 8160  C CA  . LYS C 3 92  ? 105.192 92.363  120.779 1.00 500.00 ? 92  LYS C CA  1 
ATOM 8161  C C   . LYS C 3 92  ? 105.847 92.704  119.438 1.00 485.21 ? 92  LYS C C   1 
ATOM 8162  O O   . LYS C 3 92  ? 105.963 91.843  118.548 1.00 472.00 ? 92  LYS C O   1 
ATOM 8163  C CB  . LYS C 3 92  ? 103.735 92.874  120.802 1.00 500.00 ? 92  LYS C CB  1 
ATOM 8164  C CG  . LYS C 3 92  ? 102.735 91.968  121.526 1.00 500.00 ? 92  LYS C CG  1 
ATOM 8165  C CD  . LYS C 3 92  ? 102.499 90.596  120.862 1.00 500.00 ? 92  LYS C CD  1 
ATOM 8166  C CE  . LYS C 3 92  ? 101.630 90.629  119.600 1.00 500.00 ? 92  LYS C CE  1 
ATOM 8167  N NZ  . LYS C 3 92  ? 101.193 89.264  119.165 1.00 478.22 ? 92  LYS C NZ  1 
ATOM 8168  N N   . LEU C 3 93  ? 106.257 93.961  119.338 1.00 493.01 ? 93  LEU C N   1 
ATOM 8169  C CA  . LEU C 3 93  ? 106.908 94.490  118.136 1.00 500.00 ? 93  LEU C CA  1 
ATOM 8170  C C   . LEU C 3 93  ? 108.163 93.679  117.816 1.00 500.00 ? 93  LEU C C   1 
ATOM 8171  O O   . LEU C 3 93  ? 108.392 93.281  116.662 1.00 500.00 ? 93  LEU C O   1 
ATOM 8172  C CB  . LEU C 3 93  ? 107.278 95.983  118.281 1.00 500.00 ? 93  LEU C CB  1 
ATOM 8173  C CG  . LEU C 3 93  ? 106.322 97.076  117.737 1.00 500.00 ? 93  LEU C CG  1 
ATOM 8174  C CD1 . LEU C 3 93  ? 106.654 97.486  116.295 1.00 500.00 ? 93  LEU C CD1 1 
ATOM 8175  C CD2 . LEU C 3 93  ? 104.840 96.702  117.867 1.00 500.00 ? 93  LEU C CD2 1 
ATOM 8176  N N   . LEU C 3 94  ? 108.945 93.457  118.861 1.00 458.35 ? 94  LEU C N   1 
ATOM 8177  C CA  . LEU C 3 94  ? 110.199 92.699  118.772 1.00 485.77 ? 94  LEU C CA  1 
ATOM 8178  C C   . LEU C 3 94  ? 109.930 91.299  118.235 1.00 483.52 ? 94  LEU C C   1 
ATOM 8179  O O   . LEU C 3 94  ? 110.633 90.816  117.340 1.00 500.00 ? 94  LEU C O   1 
ATOM 8180  C CB  . LEU C 3 94  ? 110.912 92.601  120.122 1.00 494.64 ? 94  LEU C CB  1 
ATOM 8181  C CG  . LEU C 3 94  ? 111.324 93.895  120.841 1.00 498.84 ? 94  LEU C CG  1 
ATOM 8182  C CD1 . LEU C 3 94  ? 112.536 93.676  121.755 1.00 496.02 ? 94  LEU C CD1 1 
ATOM 8183  C CD2 . LEU C 3 94  ? 111.566 95.025  119.837 1.00 493.59 ? 94  LEU C CD2 1 
ATOM 8184  N N   . LYS C 3 95  ? 108.906 90.684  118.806 1.00 474.15 ? 95  LYS C N   1 
ATOM 8185  C CA  . LYS C 3 95  ? 108.483 89.330  118.432 1.00 494.35 ? 95  LYS C CA  1 
ATOM 8186  C C   . LYS C 3 95  ? 108.135 89.282  116.948 1.00 471.54 ? 95  LYS C C   1 
ATOM 8187  O O   . LYS C 3 95  ? 108.558 88.368  116.224 1.00 396.94 ? 95  LYS C O   1 
ATOM 8188  C CB  . LYS C 3 95  ? 107.318 88.868  119.299 1.00 500.00 ? 95  LYS C CB  1 
ATOM 8189  C CG  . LYS C 3 95  ? 107.168 87.362  119.349 1.00 500.00 ? 95  LYS C CG  1 
ATOM 8190  C CD  . LYS C 3 95  ? 108.356 86.682  120.022 1.00 500.00 ? 95  LYS C CD  1 
ATOM 8191  C CE  . LYS C 3 95  ? 108.090 85.198  120.211 1.00 500.00 ? 95  LYS C CE  1 
ATOM 8192  N NZ  . LYS C 3 95  ? 107.856 84.489  118.916 1.00 500.00 ? 95  LYS C NZ  1 
ATOM 8193  N N   . LYS C 3 96  ? 107.366 90.282  116.533 1.00 500.00 ? 96  LYS C N   1 
ATOM 8194  C CA  . LYS C 3 96  ? 106.922 90.415  115.140 1.00 500.00 ? 96  LYS C CA  1 
ATOM 8195  C C   . LYS C 3 96  ? 108.137 90.493  114.209 1.00 500.00 ? 96  LYS C C   1 
ATOM 8196  O O   . LYS C 3 96  ? 108.194 89.815  113.174 1.00 500.00 ? 96  LYS C O   1 
ATOM 8197  C CB  . LYS C 3 96  ? 105.887 91.550  114.873 1.00 500.00 ? 96  LYS C CB  1 
ATOM 8198  C CG  . LYS C 3 96  ? 104.532 91.071  114.298 1.00 500.00 ? 96  LYS C CG  1 
ATOM 8199  C CD  . LYS C 3 96  ? 103.687 92.193  113.654 1.00 500.00 ? 96  LYS C CD  1 
ATOM 8200  C CE  . LYS C 3 96  ? 102.292 91.721  113.190 1.00 489.67 ? 96  LYS C CE  1 
ATOM 8201  N NZ  . LYS C 3 96  ? 101.396 92.735  112.519 1.00 375.86 ? 96  LYS C NZ  1 
ATOM 8202  N N   . ALA C 3 97  ? 109.081 91.326  114.620 1.00 500.00 ? 97  ALA C N   1 
ATOM 8203  C CA  . ALA C 3 97  ? 110.325 91.543  113.872 1.00 500.00 ? 97  ALA C CA  1 
ATOM 8204  C C   . ALA C 3 97  ? 111.076 90.218  113.693 1.00 500.00 ? 97  ALA C C   1 
ATOM 8205  O O   . ALA C 3 97  ? 111.553 89.924  112.617 1.00 500.00 ? 97  ALA C O   1 
ATOM 8206  C CB  . ALA C 3 97  ? 111.213 92.584  114.545 1.00 500.00 ? 97  ALA C CB  1 
ATOM 8207  N N   . ASP C 3 98  ? 111.162 89.493  114.798 1.00 500.00 ? 98  ASP C N   1 
ATOM 8208  C CA  . ASP C 3 98  ? 111.838 88.199  114.865 1.00 500.00 ? 98  ASP C CA  1 
ATOM 8209  C C   . ASP C 3 98  ? 111.513 87.208  113.774 1.00 500.00 ? 98  ASP C C   1 
ATOM 8210  O O   . ASP C 3 98  ? 112.450 86.698  113.150 1.00 500.00 ? 98  ASP C O   1 
ATOM 8211  C CB  . ASP C 3 98  ? 111.493 87.566  116.248 1.00 500.00 ? 98  ASP C CB  1 
ATOM 8212  C CG  . ASP C 3 98  ? 112.518 86.560  116.736 1.00 500.00 ? 98  ASP C CG  1 
ATOM 8213  O OD1 . ASP C 3 98  ? 113.720 86.684  116.408 1.00 500.00 ? 98  ASP C OD1 1 
ATOM 8214  O OD2 . ASP C 3 98  ? 112.109 85.643  117.483 1.00 500.00 ? 98  ASP C OD2 1 
ATOM 8215  N N   . GLU C 3 99  ? 110.214 86.947  113.569 1.00 500.00 ? 99  GLU C N   1 
ATOM 8216  C CA  . GLU C 3 99  ? 109.761 85.993  112.563 1.00 500.00 ? 99  GLU C CA  1 
ATOM 8217  C C   . GLU C 3 99  ? 110.262 86.394  111.182 1.00 500.00 ? 99  GLU C C   1 
ATOM 8218  O O   . GLU C 3 99  ? 110.777 85.540  110.430 1.00 500.00 ? 99  GLU C O   1 
ATOM 8219  C CB  . GLU C 3 99  ? 108.200 85.764  112.570 1.00 500.00 ? 99  GLU C CB  1 
ATOM 8220  C CG  . GLU C 3 99  ? 107.257 86.979  112.323 1.00 500.00 ? 99  GLU C CG  1 
ATOM 8221  C CD  . GLU C 3 99  ? 105.829 86.654  111.808 1.00 500.00 ? 99  GLU C CD  1 
ATOM 8222  O OE1 . GLU C 3 99  ? 104.916 87.505  111.974 1.00 405.87 ? 99  GLU C OE1 1 
ATOM 8223  O OE2 . GLU C 3 99  ? 105.606 85.571  111.220 1.00 500.00 ? 99  GLU C OE2 1 
ATOM 8224  N N   . GLY C 3 100 ? 110.124 87.684  110.884 1.00 500.00 ? 100 GLY C N   1 
ATOM 8225  C CA  . GLY C 3 100 ? 110.602 88.255  109.624 1.00 500.00 ? 100 GLY C CA  1 
ATOM 8226  C C   . GLY C 3 100 ? 112.102 88.132  109.407 1.00 500.00 ? 100 GLY C C   1 
ATOM 8227  O O   . GLY C 3 100 ? 112.548 87.582  108.379 1.00 478.56 ? 100 GLY C O   1 
ATOM 8228  N N   . LEU C 3 101 ? 112.852 88.702  110.349 1.00 500.00 ? 101 LEU C N   1 
ATOM 8229  C CA  . LEU C 3 101 ? 114.311 88.839  110.207 1.00 500.00 ? 101 LEU C CA  1 
ATOM 8230  C C   . LEU C 3 101 ? 115.043 87.467  110.244 1.00 500.00 ? 101 LEU C C   1 
ATOM 8231  O O   . LEU C 3 101 ? 115.786 87.143  109.306 1.00 473.82 ? 101 LEU C O   1 
ATOM 8232  C CB  . LEU C 3 101 ? 114.943 89.909  111.140 1.00 500.00 ? 101 LEU C CB  1 
ATOM 8233  C CG  . LEU C 3 101 ? 114.925 91.406  110.686 1.00 500.00 ? 101 LEU C CG  1 
ATOM 8234  C CD1 . LEU C 3 101 ? 115.518 92.307  111.767 1.00 500.00 ? 101 LEU C CD1 1 
ATOM 8235  C CD2 . LEU C 3 101 ? 115.629 91.694  109.356 1.00 500.00 ? 101 LEU C CD2 1 
ATOM 8236  N N   . ALA C 3 102 ? 114.779 86.660  111.275 1.00 500.00 ? 102 ALA C N   1 
ATOM 8237  C CA  . ALA C 3 102 ? 115.426 85.340  111.458 1.00 500.00 ? 102 ALA C CA  1 
ATOM 8238  C C   . ALA C 3 102 ? 115.563 84.484  110.188 1.00 500.00 ? 102 ALA C C   1 
ATOM 8239  O O   . ALA C 3 102 ? 116.667 84.087  109.822 1.00 476.13 ? 102 ALA C O   1 
ATOM 8240  C CB  . ALA C 3 102 ? 114.690 84.537  112.525 1.00 500.00 ? 102 ALA C CB  1 
ATOM 8241  N N   . SER C 3 103 ? 114.436 84.214  109.530 1.00 500.00 ? 103 SER C N   1 
ATOM 8242  C CA  . SER C 3 103 ? 114.385 83.321  108.355 1.00 500.00 ? 103 SER C CA  1 
ATOM 8243  C C   . SER C 3 103 ? 115.065 83.882  107.089 1.00 500.00 ? 103 SER C C   1 
ATOM 8244  O O   . SER C 3 103 ? 115.645 83.121  106.303 1.00 438.46 ? 103 SER C O   1 
ATOM 8245  C CB  . SER C 3 103 ? 112.921 82.957  108.031 1.00 500.00 ? 103 SER C CB  1 
ATOM 8246  O OG  . SER C 3 103 ? 112.822 82.098  106.904 1.00 500.00 ? 103 SER C OG  1 
ATOM 8247  N N   . LEU C 3 104 ? 114.978 85.202  106.892 1.00 500.00 ? 104 LEU C N   1 
ATOM 8248  C CA  . LEU C 3 104 ? 115.401 85.851  105.628 1.00 500.00 ? 104 LEU C CA  1 
ATOM 8249  C C   . LEU C 3 104 ? 116.947 86.018  105.522 1.00 500.00 ? 104 LEU C C   1 
ATOM 8250  O O   . LEU C 3 104 ? 117.603 85.213  104.846 1.00 500.00 ? 104 LEU C O   1 
ATOM 8251  C CB  . LEU C 3 104 ? 114.648 87.209  105.391 1.00 500.00 ? 104 LEU C CB  1 
ATOM 8252  C CG  . LEU C 3 104 ? 113.195 87.389  104.820 1.00 500.00 ? 104 LEU C CG  1 
ATOM 8253  C CD1 . LEU C 3 104 ? 113.149 87.467  103.286 1.00 500.00 ? 104 LEU C CD1 1 
ATOM 8254  C CD2 . LEU C 3 104 ? 112.169 86.369  105.334 1.00 500.00 ? 104 LEU C CD2 1 
ATOM 8255  N N   . SER C 3 105 ? 117.512 87.041  106.185 1.00 500.00 ? 105 SER C N   1 
ATOM 8256  C CA  . SER C 3 105 ? 118.942 87.428  106.009 1.00 500.00 ? 105 SER C CA  1 
ATOM 8257  C C   . SER C 3 105 ? 119.966 86.467  106.676 1.00 500.00 ? 105 SER C C   1 
ATOM 8258  O O   . SER C 3 105 ? 121.144 86.475  106.292 1.00 500.00 ? 105 SER C O   1 
ATOM 8259  C CB  . SER C 3 105 ? 119.181 88.885  106.482 1.00 486.43 ? 105 SER C CB  1 
ATOM 8260  O OG  . SER C 3 105 ? 120.421 89.420  106.013 1.00 351.63 ? 105 SER C OG  1 
ATOM 8261  N N   . GLU C 3 106 ? 119.516 85.658  107.652 1.00 500.00 ? 106 GLU C N   1 
ATOM 8262  C CA  . GLU C 3 106 ? 120.372 84.680  108.395 1.00 500.00 ? 106 GLU C CA  1 
ATOM 8263  C C   . GLU C 3 106 ? 120.157 83.183  108.043 1.00 500.00 ? 106 GLU C C   1 
ATOM 8264  O O   . GLU C 3 106 ? 121.084 82.373  108.203 1.00 500.00 ? 106 GLU C O   1 
ATOM 8265  C CB  . GLU C 3 106 ? 120.199 84.880  109.901 1.00 500.00 ? 106 GLU C CB  1 
ATOM 8266  N N   . ASP C 3 107 ? 118.940 82.834  107.599 1.00 500.00 ? 107 ASP C N   1 
ATOM 8267  C CA  . ASP C 3 107 ? 118.541 81.460  107.222 1.00 500.00 ? 107 ASP C CA  1 
ATOM 8268  C C   . ASP C 3 107 ? 118.542 80.459  108.400 1.00 500.00 ? 107 ASP C C   1 
ATOM 8269  O O   . ASP C 3 107 ? 119.592 79.921  108.785 1.00 500.00 ? 107 ASP C O   1 
ATOM 8270  C CB  . ASP C 3 107 ? 119.355 80.940  106.018 1.00 500.00 ? 107 ASP C CB  1 
ATOM 8271  C CG  . ASP C 3 107 ? 119.095 81.743  104.739 1.00 500.00 ? 107 ASP C CG  1 
ATOM 8272  O OD1 . ASP C 3 107 ? 117.914 81.977  104.390 1.00 500.00 ? 107 ASP C OD1 1 
ATOM 8273  O OD2 . ASP C 3 107 ? 120.081 82.136  104.078 1.00 500.00 ? 107 ASP C OD2 1 
ATOM 8274  N N   . GLY C 3 108 ? 117.343 80.233  108.951 1.00 500.00 ? 108 GLY C N   1 
ATOM 8275  C CA  . GLY C 3 108 ? 117.106 79.297  110.054 1.00 500.00 ? 108 GLY C CA  1 
ATOM 8276  C C   . GLY C 3 108 ? 116.975 80.007  111.392 1.00 500.00 ? 108 GLY C C   1 
ATOM 8277  O O   . GLY C 3 108 ? 115.876 80.090  111.961 1.00 500.00 ? 108 GLY C O   1 
ATOM 8278  N N   . ARG C 3 109 ? 118.109 80.531  111.871 1.00 500.00 ? 109 ARG C N   1 
ATOM 8279  C CA  . ARG C 3 109 ? 118.244 81.094  113.227 1.00 500.00 ? 109 ARG C CA  1 
ATOM 8280  C C   . ARG C 3 109 ? 118.099 82.627  113.238 1.00 500.00 ? 109 ARG C C   1 
ATOM 8281  O O   . ARG C 3 109 ? 118.606 83.316  112.343 1.00 500.00 ? 109 ARG C O   1 
ATOM 8282  C CB  . ARG C 3 109 ? 119.612 80.679  113.834 1.00 500.00 ? 109 ARG C CB  1 
ATOM 8283  C CG  . ARG C 3 109 ? 119.692 80.664  115.368 1.00 500.00 ? 109 ARG C CG  1 
ATOM 8284  C CD  . ARG C 3 109 ? 119.315 79.315  116.004 1.00 500.00 ? 109 ARG C CD  1 
ATOM 8285  N NE  . ARG C 3 109 ? 117.936 78.883  115.710 1.00 500.00 ? 109 ARG C NE  1 
ATOM 8286  C CZ  . ARG C 3 109 ? 116.818 79.344  116.294 1.00 500.00 ? 109 ARG C CZ  1 
ATOM 8287  N NH1 . ARG C 3 109 ? 116.859 80.284  117.243 1.00 500.00 ? 109 ARG C NH1 1 
ATOM 8288  N NH2 . ARG C 3 109 ? 115.632 78.858  115.919 1.00 500.00 ? 109 ARG C NH2 1 
ATOM 8289  N N   . SER C 3 110 ? 117.401 83.142  114.256 1.00 500.00 ? 110 SER C N   1 
ATOM 8290  C CA  . SER C 3 110 ? 117.382 84.576  114.539 1.00 500.00 ? 110 SER C CA  1 
ATOM 8291  C C   . SER C 3 110 ? 118.768 85.018  115.049 1.00 500.00 ? 110 SER C C   1 
ATOM 8292  O O   . SER C 3 110 ? 119.479 84.222  115.682 1.00 500.00 ? 110 SER C O   1 
ATOM 8293  C CB  . SER C 3 110 ? 116.288 84.932  115.556 1.00 500.00 ? 110 SER C CB  1 
ATOM 8294  O OG  . SER C 3 110 ? 116.569 84.410  116.845 1.00 500.00 ? 110 SER C OG  1 
ATOM 8295  N N   . PRO C 3 111 ? 119.163 86.279  114.778 1.00 500.00 ? 111 PRO C N   1 
ATOM 8296  C CA  . PRO C 3 111 ? 120.556 86.683  115.110 1.00 500.00 ? 111 PRO C CA  1 
ATOM 8297  C C   . PRO C 3 111 ? 120.949 86.898  116.599 1.00 500.00 ? 111 PRO C C   1 
ATOM 8298  O O   . PRO C 3 111 ? 122.148 86.913  116.897 1.00 500.00 ? 111 PRO C O   1 
ATOM 8299  C CB  . PRO C 3 111 ? 120.744 87.998  114.321 1.00 500.00 ? 111 PRO C CB  1 
ATOM 8300  C CG  . PRO C 3 111 ? 119.589 88.094  113.373 1.00 500.00 ? 111 PRO C CG  1 
ATOM 8301  C CD  . PRO C 3 111 ? 118.467 87.288  113.949 1.00 500.00 ? 111 PRO C CD  1 
ATOM 8302  N N   . ILE C 3 112 ? 119.976 87.029  117.508 1.00 500.00 ? 112 ILE C N   1 
ATOM 8303  C CA  . ILE C 3 112 ? 120.210 87.609  118.862 1.00 500.00 ? 112 ILE C CA  1 
ATOM 8304  C C   . ILE C 3 112 ? 119.815 86.749  120.069 1.00 500.00 ? 112 ILE C C   1 
ATOM 8305  O O   . ILE C 3 112 ? 120.476 86.834  121.102 1.00 500.00 ? 112 ILE C O   1 
ATOM 8306  C CB  . ILE C 3 112 ? 119.499 88.986  119.082 1.00 500.00 ? 112 ILE C CB  1 
ATOM 8307  C CG1 . ILE C 3 112 ? 118.071 88.998  118.496 1.00 477.29 ? 112 ILE C CG1 1 
ATOM 8308  C CG2 . ILE C 3 112 ? 120.364 90.158  118.619 1.00 468.95 ? 112 ILE C CG2 1 
ATOM 8309  C CD1 . ILE C 3 112 ? 117.909 89.056  116.990 1.00 460.78 ? 112 ILE C CD1 1 
ATOM 8310  N N   . SER C 3 113 ? 118.746 85.954  119.949 1.00 500.00 ? 113 SER C N   1 
ATOM 8311  C CA  . SER C 3 113 ? 118.052 85.313  121.087 1.00 500.00 ? 113 SER C CA  1 
ATOM 8312  C C   . SER C 3 113 ? 117.174 86.346  121.766 1.00 476.64 ? 113 SER C C   1 
ATOM 8313  O O   . SER C 3 113 ? 117.643 87.443  122.079 1.00 478.86 ? 113 SER C O   1 
ATOM 8314  C CB  . SER C 3 113 ? 119.009 84.675  122.117 1.00 500.00 ? 113 SER C CB  1 
ATOM 8315  O OG  . SER C 3 113 ? 119.410 85.593  123.128 1.00 500.00 ? 113 SER C OG  1 
ATOM 8316  N N   . ILE C 3 114 ? 115.916 85.993  122.021 1.00 422.66 ? 114 ILE C N   1 
ATOM 8317  C CA  . ILE C 3 114 ? 114.959 86.976  122.507 1.00 476.57 ? 114 ILE C CA  1 
ATOM 8318  C C   . ILE C 3 114 ? 115.310 87.535  123.867 1.00 485.63 ? 114 ILE C C   1 
ATOM 8319  O O   . ILE C 3 114 ? 114.967 88.695  124.128 1.00 496.53 ? 114 ILE C O   1 
ATOM 8320  C CB  . ILE C 3 114 ? 113.498 86.471  122.508 1.00 500.00 ? 114 ILE C CB  1 
ATOM 8321  C CG1 . ILE C 3 114 ? 112.517 87.672  122.626 1.00 500.00 ? 114 ILE C CG1 1 
ATOM 8322  C CG2 . ILE C 3 114 ? 113.294 85.425  123.605 1.00 493.01 ? 114 ILE C CG2 1 
ATOM 8323  C CD1 . ILE C 3 114 ? 111.394 87.691  121.603 1.00 500.00 ? 114 ILE C CD1 1 
ATOM 8324  N N   . ARG C 3 115 ? 116.000 86.743  124.688 1.00 468.15 ? 115 ARG C N   1 
ATOM 8325  C CA  . ARG C 3 115 ? 116.444 87.146  126.004 1.00 485.12 ? 115 ARG C CA  1 
ATOM 8326  C C   . ARG C 3 115 ? 117.297 88.422  125.917 1.00 494.12 ? 115 ARG C C   1 
ATOM 8327  O O   . ARG C 3 115 ? 117.105 89.404  126.657 1.00 500.00 ? 115 ARG C O   1 
ATOM 8328  C CB  . ARG C 3 115 ? 117.370 86.081  126.631 1.00 480.11 ? 115 ARG C CB  1 
ATOM 8329  C CG  . ARG C 3 115 ? 116.810 84.690  126.891 1.00 500.00 ? 115 ARG C CG  1 
ATOM 8330  C CD  . ARG C 3 115 ? 117.780 83.902  127.783 1.00 500.00 ? 115 ARG C CD  1 
ATOM 8331  N NE  . ARG C 3 115 ? 117.557 82.438  127.808 1.00 500.00 ? 115 ARG C NE  1 
ATOM 8332  C CZ  . ARG C 3 115 ? 118.319 81.495  127.225 1.00 500.00 ? 115 ARG C CZ  1 
ATOM 8333  N NH1 . ARG C 3 115 ? 119.405 81.805  126.508 1.00 500.00 ? 115 ARG C NH1 1 
ATOM 8334  N NH2 . ARG C 3 115 ? 117.982 80.203  127.358 1.00 459.22 ? 115 ARG C NH2 1 
ATOM 8335  N N   . GLN C 3 116 ? 118.245 88.342  124.985 1.00 472.62 ? 116 GLN C N   1 
ATOM 8336  C CA  . GLN C 3 116 ? 119.194 89.441  124.752 1.00 488.10 ? 116 GLN C CA  1 
ATOM 8337  C C   . GLN C 3 116 ? 118.440 90.702  124.353 1.00 476.90 ? 116 GLN C C   1 
ATOM 8338  O O   . GLN C 3 116 ? 118.736 91.791  124.871 1.00 468.14 ? 116 GLN C O   1 
ATOM 8339  C CB  . GLN C 3 116 ? 120.325 89.016  123.808 1.00 500.00 ? 116 GLN C CB  1 
ATOM 8340  C CG  . GLN C 3 116 ? 121.260 88.010  124.496 1.00 500.00 ? 116 GLN C CG  1 
ATOM 8341  C CD  . GLN C 3 116 ? 122.405 87.495  123.629 1.00 500.00 ? 116 GLN C CD  1 
ATOM 8342  O OE1 . GLN C 3 116 ? 122.681 88.024  122.551 1.00 500.00 ? 116 GLN C OE1 1 
ATOM 8343  N NE2 . GLN C 3 116 ? 123.089 86.453  124.111 1.00 500.00 ? 116 GLN C NE2 1 
ATOM 8344  N N   . MET C 3 117 ? 117.475 90.526  123.459 1.00 492.82 ? 117 MET C N   1 
ATOM 8345  C CA  . MET C 3 117 ? 116.631 91.620  122.971 1.00 500.00 ? 117 MET C CA  1 
ATOM 8346  C C   . MET C 3 117 ? 115.919 92.297  124.133 1.00 454.75 ? 117 MET C C   1 
ATOM 8347  O O   . MET C 3 117 ? 115.897 93.538  124.241 1.00 457.84 ? 117 MET C O   1 
ATOM 8348  C CB  . MET C 3 117 ? 115.551 91.121  121.999 1.00 500.00 ? 117 MET C CB  1 
ATOM 8349  C CG  . MET C 3 117 ? 116.090 90.606  120.676 1.00 500.00 ? 117 MET C CG  1 
ATOM 8350  S SD  . MET C 3 117 ? 114.863 90.400  119.352 1.00 500.00 ? 117 MET C SD  1 
ATOM 8351  C CE  . MET C 3 117 ? 114.588 88.624  119.309 1.00 500.00 ? 117 MET C CE  1 
ATOM 8352  N N   . ALA C 3 118 ? 115.349 91.451  124.981 1.00 432.47 ? 118 ALA C N   1 
ATOM 8353  C CA  . ALA C 3 118 ? 114.611 91.891  126.173 1.00 461.32 ? 118 ALA C CA  1 
ATOM 8354  C C   . ALA C 3 118 ? 115.501 92.742  127.059 1.00 461.29 ? 118 ALA C C   1 
ATOM 8355  O O   . ALA C 3 118 ? 115.107 93.824  127.524 1.00 424.22 ? 118 ALA C O   1 
ATOM 8356  C CB  . ALA C 3 118 ? 114.172 90.682  126.973 1.00 488.61 ? 118 ALA C CB  1 
ATOM 8357  N N   . TYR C 3 119 ? 116.704 92.219  127.273 1.00 455.17 ? 119 TYR C N   1 
ATOM 8358  C CA  . TYR C 3 119 ? 117.729 92.862  128.109 1.00 431.94 ? 119 TYR C CA  1 
ATOM 8359  C C   . TYR C 3 119 ? 118.029 94.252  127.574 1.00 409.96 ? 119 TYR C C   1 
ATOM 8360  O O   . TYR C 3 119 ? 118.074 95.237  128.341 1.00 463.86 ? 119 TYR C O   1 
ATOM 8361  C CB  . TYR C 3 119 ? 119.003 92.005  127.970 1.00 437.59 ? 119 TYR C CB  1 
ATOM 8362  C CG  . TYR C 3 119 ? 120.243 92.316  128.792 1.00 454.62 ? 119 TYR C CG  1 
ATOM 8363  C CD1 . TYR C 3 119 ? 121.068 93.405  128.502 1.00 406.60 ? 119 TYR C CD1 1 
ATOM 8364  C CD2 . TYR C 3 119 ? 120.660 91.428  129.792 1.00 500.00 ? 119 TYR C CD2 1 
ATOM 8365  C CE1 . TYR C 3 119 ? 122.234 93.636  129.241 1.00 443.31 ? 119 TYR C CE1 1 
ATOM 8366  C CE2 . TYR C 3 119 ? 121.816 91.646  130.528 1.00 500.00 ? 119 TYR C CE2 1 
ATOM 8367  C CZ  . TYR C 3 119 ? 122.604 92.743  130.256 1.00 480.51 ? 119 TYR C CZ  1 
ATOM 8368  O OH  . TYR C 3 119 ? 123.741 92.917  131.015 1.00 433.04 ? 119 TYR C OH  1 
ATOM 8369  N N   . VAL C 3 120 ? 118.235 94.292  126.256 1.00 424.67 ? 120 VAL C N   1 
ATOM 8370  C CA  . VAL C 3 120 ? 118.592 95.553  125.594 1.00 471.41 ? 120 VAL C CA  1 
ATOM 8371  C C   . VAL C 3 120 ? 117.461 96.562  125.765 1.00 424.04 ? 120 VAL C C   1 
ATOM 8372  O O   . VAL C 3 120 ? 117.742 97.738  126.070 1.00 465.12 ? 120 VAL C O   1 
ATOM 8373  C CB  . VAL C 3 120 ? 119.185 95.492  124.155 1.00 500.00 ? 120 VAL C CB  1 
ATOM 8374  C CG1 . VAL C 3 120 ? 120.072 94.267  123.935 1.00 500.00 ? 120 VAL C CG1 1 
ATOM 8375  C CG2 . VAL C 3 120 ? 118.125 95.675  123.082 1.00 500.00 ? 120 VAL C CG2 1 
ATOM 8376  N N   . SER C 3 121 ? 116.229 96.087  125.599 1.00 355.35 ? 121 SER C N   1 
ATOM 8377  C CA  . SER C 3 121 ? 115.047 96.931  125.749 1.00 401.95 ? 121 SER C CA  1 
ATOM 8378  C C   . SER C 3 121 ? 114.997 97.532  127.150 1.00 453.95 ? 121 SER C C   1 
ATOM 8379  O O   . SER C 3 121 ? 114.751 98.743  127.318 1.00 468.08 ? 121 SER C O   1 
ATOM 8380  C CB  . SER C 3 121 ? 113.766 96.169  125.473 1.00 484.27 ? 121 SER C CB  1 
ATOM 8381  O OG  . SER C 3 121 ? 112.654 97.044  125.579 1.00 500.00 ? 121 SER C OG  1 
ATOM 8382  N N   . GLY C 3 122 ? 115.247 96.665  128.126 1.00 454.08 ? 122 GLY C N   1 
ATOM 8383  C CA  . GLY C 3 122 ? 115.251 97.048  129.541 1.00 446.87 ? 122 GLY C CA  1 
ATOM 8384  C C   . GLY C 3 122 ? 116.266 98.150  129.785 1.00 441.96 ? 122 GLY C C   1 
ATOM 8385  O O   . GLY C 3 122 ? 115.972 99.157  130.454 1.00 448.41 ? 122 GLY C O   1 
ATOM 8386  N N   . LEU C 3 123 ? 117.451 97.929  129.226 1.00 421.19 ? 123 LEU C N   1 
ATOM 8387  C CA  . LEU C 3 123 ? 118.573 98.871  129.346 1.00 397.84 ? 123 LEU C CA  1 
ATOM 8388  C C   . LEU C 3 123 ? 118.176 100.227 128.796 1.00 429.27 ? 123 LEU C C   1 
ATOM 8389  O O   . LEU C 3 123 ? 118.430 101.263 129.423 1.00 470.81 ? 123 LEU C O   1 
ATOM 8390  C CB  . LEU C 3 123 ? 119.826 98.344  128.629 1.00 413.77 ? 123 LEU C CB  1 
ATOM 8391  C CG  . LEU C 3 123 ? 121.218 98.515  129.256 1.00 428.96 ? 123 LEU C CG  1 
ATOM 8392  C CD1 . LEU C 3 123 ? 122.209 98.927  128.173 1.00 461.45 ? 123 LEU C CD1 1 
ATOM 8393  C CD2 . LEU C 3 123 ? 121.274 99.510  130.404 1.00 466.56 ? 123 LEU C CD2 1 
ATOM 8394  N N   . SER C 3 124 ? 117.560 100.187 127.623 1.00 435.54 ? 124 SER C N   1 
ATOM 8395  C CA  . SER C 3 124 ? 117.091 101.392 126.921 1.00 449.19 ? 124 SER C CA  1 
ATOM 8396  C C   . SER C 3 124 ? 116.131 102.169 127.803 1.00 413.46 ? 124 SER C C   1 
ATOM 8397  O O   . SER C 3 124 ? 116.249 103.401 127.947 1.00 446.56 ? 124 SER C O   1 
ATOM 8398  C CB  . SER C 3 124 ? 116.325 101.016 125.663 1.00 465.43 ? 124 SER C CB  1 
ATOM 8399  O OG  . SER C 3 124 ? 115.012 100.564 125.923 1.00 435.19 ? 124 SER C OG  1 
ATOM 8400  N N   . PHE C 3 125 ? 115.192 101.418 128.373 1.00 386.87 ? 125 PHE C N   1 
ATOM 8401  C CA  . PHE C 3 125 ? 114.163 101.988 129.246 1.00 425.80 ? 125 PHE C CA  1 
ATOM 8402  C C   . PHE C 3 125 ? 114.814 102.692 130.438 1.00 439.98 ? 125 PHE C C   1 
ATOM 8403  O O   . PHE C 3 125 ? 114.445 103.830 130.788 1.00 453.86 ? 125 PHE C O   1 
ATOM 8404  C CB  . PHE C 3 125 ? 113.069 100.988 129.615 1.00 486.57 ? 125 PHE C CB  1 
ATOM 8405  C CG  . PHE C 3 125 ? 111.961 100.918 128.600 1.00 483.02 ? 125 PHE C CG  1 
ATOM 8406  C CD1 . PHE C 3 125 ? 112.174 100.338 127.358 1.00 445.29 ? 125 PHE C CD1 1 
ATOM 8407  C CD2 . PHE C 3 125 ? 110.710 101.451 128.876 1.00 500.00 ? 125 PHE C CD2 1 
ATOM 8408  C CE1 . PHE C 3 125 ? 111.168 100.266 126.416 1.00 463.75 ? 125 PHE C CE1 1 
ATOM 8409  C CE2 . PHE C 3 125 ? 109.692 101.388 127.935 1.00 500.00 ? 125 PHE C CE2 1 
ATOM 8410  C CZ  . PHE C 3 125 ? 109.923 100.796 126.700 1.00 500.00 ? 125 PHE C CZ  1 
ATOM 8411  N N   . GLY C 3 126 ? 115.786 102.003 131.018 1.00 437.00 ? 126 GLY C N   1 
ATOM 8412  C CA  . GLY C 3 126 ? 116.534 102.506 132.171 1.00 436.53 ? 126 GLY C CA  1 
ATOM 8413  C C   . GLY C 3 126 ? 117.214 103.824 131.824 1.00 428.33 ? 126 GLY C C   1 
ATOM 8414  O O   . GLY C 3 126 ? 117.162 104.768 132.601 1.00 478.45 ? 126 GLY C O   1 
ATOM 8415  N N   . ILE C 3 127 ? 117.845 103.826 130.660 1.00 410.14 ? 127 ILE C N   1 
ATOM 8416  C CA  . ILE C 3 127 ? 118.788 104.878 130.268 1.00 443.17 ? 127 ILE C CA  1 
ATOM 8417  C C   . ILE C 3 127 ? 118.013 106.181 130.150 1.00 443.73 ? 127 ILE C C   1 
ATOM 8418  O O   . ILE C 3 127 ? 118.439 107.262 130.710 1.00 430.62 ? 127 ILE C O   1 
ATOM 8419  C CB  . ILE C 3 127 ? 119.543 104.541 128.921 1.00 463.51 ? 127 ILE C CB  1 
ATOM 8420  C CG1 . ILE C 3 127 ? 121.058 104.367 129.153 1.00 479.45 ? 127 ILE C CG1 1 
ATOM 8421  C CG2 . ILE C 3 127 ? 119.346 105.587 127.802 1.00 452.41 ? 127 ILE C CG2 1 
ATOM 8422  C CD1 . ILE C 3 127 ? 121.494 102.933 129.332 1.00 466.21 ? 127 ILE C CD1 1 
ATOM 8423  N N   . ILE C 3 128 ? 116.864 106.092 129.475 1.00 440.48 ? 128 ILE C N   1 
ATOM 8424  C CA  . ILE C 3 128 ? 116.117 107.296 129.087 1.00 418.97 ? 128 ILE C CA  1 
ATOM 8425  C C   . ILE C 3 128 ? 115.367 107.866 130.278 1.00 431.24 ? 128 ILE C C   1 
ATOM 8426  O O   . ILE C 3 128 ? 115.435 109.085 130.535 1.00 463.99 ? 128 ILE C O   1 
ATOM 8427  C CB  . ILE C 3 128 ? 115.259 107.093 127.822 1.00 412.07 ? 128 ILE C CB  1 
ATOM 8428  C CG1 . ILE C 3 128 ? 114.801 108.450 127.306 1.00 428.10 ? 128 ILE C CG1 1 
ATOM 8429  C CG2 . ILE C 3 128 ? 114.083 106.156 128.047 1.00 432.71 ? 128 ILE C CG2 1 
ATOM 8430  C CD1 . ILE C 3 128 ? 115.950 109.384 126.993 1.00 481.76 ? 128 ILE C CD1 1 
ATOM 8431  N N   . SER C 3 129 ? 114.721 106.972 131.015 1.00 407.26 ? 129 SER C N   1 
ATOM 8432  C CA  . SER C 3 129 ? 113.999 107.324 132.243 1.00 452.49 ? 129 SER C CA  1 
ATOM 8433  C C   . SER C 3 129 ? 114.947 107.995 133.237 1.00 451.94 ? 129 SER C C   1 
ATOM 8434  O O   . SER C 3 129 ? 114.643 109.045 133.824 1.00 466.26 ? 129 SER C O   1 
ATOM 8435  C CB  . SER C 3 129 ? 113.424 106.046 132.860 1.00 482.36 ? 129 SER C CB  1 
ATOM 8436  O OG  . SER C 3 129 ? 112.813 106.292 134.112 1.00 500.00 ? 129 SER C OG  1 
ATOM 8437  N N   . GLY C 3 130 ? 116.090 107.350 133.395 1.00 425.85 ? 130 GLY C N   1 
ATOM 8438  C CA  . GLY C 3 130 ? 117.150 107.809 134.305 1.00 446.88 ? 130 GLY C CA  1 
ATOM 8439  C C   . GLY C 3 130 ? 117.596 109.204 133.921 1.00 444.19 ? 130 GLY C C   1 
ATOM 8440  O O   . GLY C 3 130 ? 117.733 110.082 134.785 1.00 449.73 ? 130 GLY C O   1 
ATOM 8441  N N   . VAL C 3 131 ? 117.815 109.380 132.624 1.00 419.25 ? 131 VAL C N   1 
ATOM 8442  C CA  . VAL C 3 131 ? 118.245 110.661 132.046 1.00 441.05 ? 131 VAL C CA  1 
ATOM 8443  C C   . VAL C 3 131 ? 117.242 111.754 132.397 1.00 406.98 ? 131 VAL C C   1 
ATOM 8444  O O   . VAL C 3 131 ? 117.621 112.855 132.834 1.00 413.40 ? 131 VAL C O   1 
ATOM 8445  C CB  . VAL C 3 131 ? 118.376 110.581 130.488 1.00 483.40 ? 131 VAL C CB  1 
ATOM 8446  C CG1 . VAL C 3 131 ? 117.815 111.801 129.747 1.00 457.53 ? 131 VAL C CG1 1 
ATOM 8447  C CG2 . VAL C 3 131 ? 119.827 110.373 130.084 1.00 500.00 ? 131 VAL C CG2 1 
ATOM 8448  N N   . PHE C 3 132 ? 115.976 111.414 132.188 1.00 397.35 ? 132 PHE C N   1 
ATOM 8449  C CA  . PHE C 3 132 ? 114.879 112.343 132.446 1.00 384.58 ? 132 PHE C CA  1 
ATOM 8450  C C   . PHE C 3 132 ? 114.865 112.757 133.914 1.00 396.76 ? 132 PHE C C   1 
ATOM 8451  O O   . PHE C 3 132 ? 114.728 113.954 134.227 1.00 439.88 ? 132 PHE C O   1 
ATOM 8452  C CB  . PHE C 3 132 ? 113.576 111.917 131.829 1.00 420.90 ? 132 PHE C CB  1 
ATOM 8453  C CG  . PHE C 3 132 ? 113.469 112.374 130.417 1.00 405.50 ? 132 PHE C CG  1 
ATOM 8454  C CD1 . PHE C 3 132 ? 114.238 111.780 129.439 1.00 359.30 ? 132 PHE C CD1 1 
ATOM 8455  C CD2 . PHE C 3 132 ? 112.693 113.476 130.084 1.00 432.24 ? 132 PHE C CD2 1 
ATOM 8456  C CE1 . PHE C 3 132 ? 114.173 112.212 128.139 1.00 445.57 ? 132 PHE C CE1 1 
ATOM 8457  C CE2 . PHE C 3 132 ? 112.627 113.924 128.781 1.00 455.22 ? 132 PHE C CE2 1 
ATOM 8458  C CZ  . PHE C 3 132 ? 113.369 113.287 127.806 1.00 477.51 ? 132 PHE C CZ  1 
ATOM 8459  N N   . SER C 3 133 ? 115.044 111.766 134.775 1.00 385.42 ? 133 SER C N   1 
ATOM 8460  C CA  . SER C 3 133 ? 115.050 111.969 136.221 1.00 435.33 ? 133 SER C CA  1 
ATOM 8461  C C   . SER C 3 133 ? 116.189 112.938 136.591 1.00 442.31 ? 133 SER C C   1 
ATOM 8462  O O   . SER C 3 133 ? 115.995 113.881 137.376 1.00 476.76 ? 133 SER C O   1 
ATOM 8463  C CB  . SER C 3 133 ? 115.157 110.634 136.956 1.00 446.25 ? 133 SER C CB  1 
ATOM 8464  O OG  . SER C 3 133 ? 116.492 110.167 136.995 1.00 462.49 ? 133 SER C OG  1 
ATOM 8465  N N   . VAL C 3 134 ? 117.358 112.706 135.991 1.00 379.09 ? 134 VAL C N   1 
ATOM 8466  C CA  . VAL C 3 134 ? 118.624 113.178 136.564 1.00 378.91 ? 134 VAL C CA  1 
ATOM 8467  C C   . VAL C 3 134 ? 119.314 114.302 135.809 1.00 414.52 ? 134 VAL C C   1 
ATOM 8468  O O   . VAL C 3 134 ? 119.710 115.257 136.421 1.00 437.43 ? 134 VAL C O   1 
ATOM 8469  C CB  . VAL C 3 134 ? 119.577 111.992 136.780 1.00 448.85 ? 134 VAL C CB  1 
ATOM 8470  C CG1 . VAL C 3 134 ? 120.385 111.673 135.529 1.00 497.99 ? 134 VAL C CG1 1 
ATOM 8471  C CG2 . VAL C 3 134 ? 120.492 112.256 137.967 1.00 500.00 ? 134 VAL C CG2 1 
ATOM 8472  N N   . ILE C 3 135 ? 119.382 114.219 134.480 1.00 397.72 ? 135 ILE C N   1 
ATOM 8473  C CA  . ILE C 3 135 ? 120.243 115.080 133.683 1.00 416.74 ? 135 ILE C CA  1 
ATOM 8474  C C   . ILE C 3 135 ? 120.088 116.534 134.088 1.00 449.14 ? 135 ILE C C   1 
ATOM 8475  O O   . ILE C 3 135 ? 121.106 117.241 134.201 1.00 480.79 ? 135 ILE C O   1 
ATOM 8476  C CB  . ILE C 3 135 ? 119.997 114.906 132.164 1.00 446.44 ? 135 ILE C CB  1 
ATOM 8477  C CG1 . ILE C 3 135 ? 121.206 115.382 131.352 1.00 488.41 ? 135 ILE C CG1 1 
ATOM 8478  C CG2 . ILE C 3 135 ? 118.729 115.625 131.707 1.00 472.47 ? 135 ILE C CG2 1 
ATOM 8479  C CD1 . ILE C 3 135 ? 122.341 114.383 131.293 1.00 495.26 ? 135 ILE C CD1 1 
ATOM 8480  N N   . ASN C 3 136 ? 118.851 116.941 134.374 1.00 441.08 ? 136 ASN C N   1 
ATOM 8481  C CA  . ASN C 3 136 ? 118.538 118.300 134.774 1.00 395.03 ? 136 ASN C CA  1 
ATOM 8482  C C   . ASN C 3 136 ? 119.276 118.644 136.054 1.00 371.12 ? 136 ASN C C   1 
ATOM 8483  O O   . ASN C 3 136 ? 120.026 119.630 136.103 1.00 404.97 ? 136 ASN C O   1 
ATOM 8484  C CB  . ASN C 3 136 ? 117.030 118.464 134.990 1.00 432.09 ? 136 ASN C CB  1 
ATOM 8485  C CG  . ASN C 3 136 ? 116.217 118.166 133.744 1.00 468.99 ? 136 ASN C CG  1 
ATOM 8486  O OD1 . ASN C 3 136 ? 115.077 117.701 133.837 1.00 462.02 ? 136 ASN C OD1 1 
ATOM 8487  N ND2 . ASN C 3 136 ? 116.799 118.425 132.570 1.00 449.20 ? 136 ASN C ND2 1 
ATOM 8488  N N   . ILE C 3 137 ? 118.978 117.858 137.088 1.00 382.65 ? 137 ILE C N   1 
ATOM 8489  C CA  . ILE C 3 137 ? 119.620 118.020 138.406 1.00 456.90 ? 137 ILE C CA  1 
ATOM 8490  C C   . ILE C 3 137 ? 121.159 117.995 138.294 1.00 415.54 ? 137 ILE C C   1 
ATOM 8491  O O   . ILE C 3 137 ? 121.890 118.738 138.986 1.00 366.80 ? 137 ILE C O   1 
ATOM 8492  C CB  . ILE C 3 137 ? 119.075 117.002 139.491 1.00 477.90 ? 137 ILE C CB  1 
ATOM 8493  C CG1 . ILE C 3 137 ? 119.728 115.608 139.427 1.00 500.00 ? 137 ILE C CG1 1 
ATOM 8494  C CG2 . ILE C 3 137 ? 117.545 116.847 139.426 1.00 425.91 ? 137 ILE C CG2 1 
ATOM 8495  C CD1 . ILE C 3 137 ? 121.108 115.475 140.048 1.00 500.00 ? 137 ILE C CD1 1 
ATOM 8496  N N   . LEU C 3 138 ? 121.614 117.083 137.433 1.00 401.47 ? 138 LEU C N   1 
ATOM 8497  C CA  . LEU C 3 138 ? 123.031 116.876 137.171 1.00 440.97 ? 138 LEU C CA  1 
ATOM 8498  C C   . LEU C 3 138 ? 123.684 118.174 136.700 1.00 424.65 ? 138 LEU C C   1 
ATOM 8499  O O   . LEU C 3 138 ? 124.760 118.547 137.174 1.00 471.95 ? 138 LEU C O   1 
ATOM 8500  C CB  . LEU C 3 138 ? 123.211 115.750 136.136 1.00 467.70 ? 138 LEU C CB  1 
ATOM 8501  C CG  . LEU C 3 138 ? 124.206 114.626 136.452 1.00 498.22 ? 138 LEU C CG  1 
ATOM 8502  C CD1 . LEU C 3 138 ? 123.940 113.877 137.757 1.00 447.49 ? 138 LEU C CD1 1 
ATOM 8503  C CD2 . LEU C 3 138 ? 124.182 113.649 135.288 1.00 500.00 ? 138 LEU C CD2 1 
ATOM 8504  N N   . ALA C 3 139 ? 122.987 118.835 135.766 1.00 400.69 ? 139 ALA C N   1 
ATOM 8505  C CA  . ALA C 3 139 ? 123.436 120.093 135.190 1.00 491.64 ? 139 ALA C CA  1 
ATOM 8506  C C   . ALA C 3 139 ? 123.644 121.139 136.292 1.00 491.77 ? 139 ALA C C   1 
ATOM 8507  O O   . ALA C 3 139 ? 124.684 121.832 136.345 1.00 500.00 ? 139 ALA C O   1 
ATOM 8508  C CB  . ALA C 3 139 ? 122.448 120.620 134.154 1.00 500.00 ? 139 ALA C CB  1 
ATOM 8509  N N   . ASP C 3 140 ? 122.637 121.212 137.151 1.00 444.10 ? 140 ASP C N   1 
ATOM 8510  C CA  . ASP C 3 140 ? 122.638 122.157 138.274 1.00 454.93 ? 140 ASP C CA  1 
ATOM 8511  C C   . ASP C 3 140 ? 123.837 121.903 139.180 1.00 421.17 ? 140 ASP C C   1 
ATOM 8512  O O   . ASP C 3 140 ? 124.541 122.846 139.578 1.00 380.88 ? 140 ASP C O   1 
ATOM 8513  C CB  . ASP C 3 140 ? 121.296 122.209 139.016 1.00 485.84 ? 140 ASP C CB  1 
ATOM 8514  C CG  . ASP C 3 140 ? 120.307 123.187 138.375 1.00 469.23 ? 140 ASP C CG  1 
ATOM 8515  O OD1 . ASP C 3 140 ? 120.460 123.528 137.181 1.00 491.87 ? 140 ASP C OD1 1 
ATOM 8516  O OD2 . ASP C 3 140 ? 119.375 123.622 139.076 1.00 397.87 ? 140 ASP C OD2 1 
ATOM 8517  N N   . ALA C 3 141 ? 124.052 120.624 139.465 1.00 406.43 ? 141 ALA C N   1 
ATOM 8518  C CA  . ALA C 3 141 ? 125.164 120.180 140.302 1.00 410.47 ? 141 ALA C CA  1 
ATOM 8519  C C   . ALA C 3 141 ? 126.501 120.630 139.730 1.00 422.79 ? 141 ALA C C   1 
ATOM 8520  O O   . ALA C 3 141 ? 127.473 120.470 140.464 1.00 404.94 ? 141 ALA C O   1 
ATOM 8521  C CB  . ALA C 3 141 ? 125.148 118.671 140.483 1.00 453.15 ? 141 ALA C CB  1 
ATOM 8522  N N   . LEU C 3 142 ? 126.636 121.149 138.499 1.00 413.60 ? 142 LEU C N   1 
ATOM 8523  C CA  . LEU C 3 142 ? 127.935 121.725 138.040 1.00 413.13 ? 142 LEU C CA  1 
ATOM 8524  C C   . LEU C 3 142 ? 128.472 122.886 138.871 1.00 496.74 ? 142 LEU C C   1 
ATOM 8525  O O   . LEU C 3 142 ? 129.688 123.040 138.996 1.00 500.00 ? 142 LEU C O   1 
ATOM 8526  C CB  . LEU C 3 142 ? 127.866 122.236 136.600 1.00 499.02 ? 142 LEU C CB  1 
ATOM 8527  C CG  . LEU C 3 142 ? 128.191 121.270 135.462 1.00 500.00 ? 142 LEU C CG  1 
ATOM 8528  C CD1 . LEU C 3 142 ? 127.786 121.885 134.120 1.00 500.00 ? 142 LEU C CD1 1 
ATOM 8529  C CD2 . LEU C 3 142 ? 129.670 120.909 135.462 1.00 500.00 ? 142 LEU C CD2 1 
ATOM 8530  N N   . GLY C 3 143 ? 127.572 123.722 139.390 1.00 500.00 ? 143 GLY C N   1 
ATOM 8531  C CA  . GLY C 3 143 ? 127.958 124.961 140.073 1.00 500.00 ? 143 GLY C CA  1 
ATOM 8532  C C   . GLY C 3 143 ? 128.551 124.776 141.465 1.00 500.00 ? 143 GLY C C   1 
ATOM 8533  O O   . GLY C 3 143 ? 128.463 123.691 142.040 1.00 500.00 ? 143 GLY C O   1 
ATOM 8534  N N   . PRO C 3 144 ? 129.112 125.857 142.037 1.00 500.00 ? 144 PRO C N   1 
ATOM 8535  C CA  . PRO C 3 144 ? 129.906 125.817 143.269 1.00 458.36 ? 144 PRO C CA  1 
ATOM 8536  C C   . PRO C 3 144 ? 129.131 125.479 144.523 1.00 385.14 ? 144 PRO C C   1 
ATOM 8537  O O   . PRO C 3 144 ? 129.744 125.073 145.506 1.00 386.00 ? 144 PRO C O   1 
ATOM 8538  C CB  . PRO C 3 144 ? 130.404 127.252 143.393 1.00 500.00 ? 144 PRO C CB  1 
ATOM 8539  C CG  . PRO C 3 144 ? 129.292 128.056 142.814 1.00 500.00 ? 144 PRO C CG  1 
ATOM 8540  C CD  . PRO C 3 144 ? 128.796 127.245 141.646 1.00 500.00 ? 144 PRO C CD  1 
ATOM 8541  N N   . GLY C 3 145 ? 127.811 125.684 144.497 1.00 372.72 ? 145 GLY C N   1 
ATOM 8542  C CA  . GLY C 3 145 ? 126.949 125.444 145.649 1.00 422.84 ? 145 GLY C CA  1 
ATOM 8543  C C   . GLY C 3 145 ? 126.199 124.120 145.642 1.00 426.42 ? 145 GLY C C   1 
ATOM 8544  O O   . GLY C 3 145 ? 125.808 123.629 144.579 1.00 426.85 ? 145 GLY C O   1 
ATOM 8545  N N   . VAL C 3 146 ? 125.989 123.573 146.845 1.00 398.56 ? 146 VAL C N   1 
ATOM 8546  C CA  . VAL C 3 146 ? 125.204 122.347 147.076 1.00 386.27 ? 146 VAL C CA  1 
ATOM 8547  C C   . VAL C 3 146 ? 123.868 122.668 147.764 1.00 388.21 ? 146 VAL C C   1 
ATOM 8548  O O   . VAL C 3 146 ? 123.783 123.647 148.506 1.00 419.21 ? 146 VAL C O   1 
ATOM 8549  C CB  . VAL C 3 146 ? 126.013 121.358 147.931 1.00 396.26 ? 146 VAL C CB  1 
ATOM 8550  C CG1 . VAL C 3 146 ? 125.946 121.713 149.413 1.00 441.05 ? 146 VAL C CG1 1 
ATOM 8551  C CG2 . VAL C 3 146 ? 125.527 119.934 147.707 1.00 485.61 ? 146 VAL C CG2 1 
ATOM 8552  N N   . VAL C 3 147 ? 122.838 121.847 147.557 1.00 371.56 ? 147 VAL C N   1 
ATOM 8553  C CA  . VAL C 3 147 ? 121.481 122.243 147.986 1.00 426.08 ? 147 VAL C CA  1 
ATOM 8554  C C   . VAL C 3 147 ? 121.421 122.362 149.503 1.00 484.67 ? 147 VAL C C   1 
ATOM 8555  O O   . VAL C 3 147 ? 122.131 121.645 150.207 1.00 495.79 ? 147 VAL C O   1 
ATOM 8556  C CB  . VAL C 3 147 ? 120.365 121.256 147.574 1.00 448.68 ? 147 VAL C CB  1 
ATOM 8557  C CG1 . VAL C 3 147 ? 118.982 121.861 147.859 1.00 436.43 ? 147 VAL C CG1 1 
ATOM 8558  C CG2 . VAL C 3 147 ? 120.466 120.832 146.110 1.00 491.86 ? 147 VAL C CG2 1 
ATOM 8559  N N   . GLY C 3 148 ? 120.575 123.264 150.001 1.00 500.00 ? 148 GLY C N   1 
ATOM 8560  C CA  . GLY C 3 148 ? 120.353 123.367 151.442 1.00 500.00 ? 148 GLY C CA  1 
ATOM 8561  C C   . GLY C 3 148 ? 119.501 124.518 151.935 1.00 458.14 ? 148 GLY C C   1 
ATOM 8562  O O   . GLY C 3 148 ? 118.627 124.325 152.772 1.00 399.79 ? 148 GLY C O   1 
ATOM 8563  N N   . ILE C 3 149 ? 119.774 125.712 151.419 1.00 431.34 ? 149 ILE C N   1 
ATOM 8564  C CA  . ILE C 3 149 ? 119.177 126.978 151.877 1.00 421.15 ? 149 ILE C CA  1 
ATOM 8565  C C   . ILE C 3 149 ? 117.726 126.943 152.409 1.00 414.85 ? 149 ILE C C   1 
ATOM 8566  O O   . ILE C 3 149 ? 117.353 127.791 153.216 1.00 439.09 ? 149 ILE C O   1 
ATOM 8567  C CB  . ILE C 3 149 ? 119.296 128.039 150.756 1.00 462.86 ? 149 ILE C CB  1 
ATOM 8568  C CG1 . ILE C 3 149 ? 119.397 129.451 151.323 1.00 464.29 ? 149 ILE C CG1 1 
ATOM 8569  C CG2 . ILE C 3 149 ? 118.145 127.940 149.761 1.00 500.00 ? 149 ILE C CG2 1 
ATOM 8570  C CD1 . ILE C 3 149 ? 120.749 129.790 151.886 1.00 476.19 ? 149 ILE C CD1 1 
ATOM 8571  N N   . HIS C 3 150 ? 116.914 125.993 151.944 1.00 421.90 ? 150 HIS C N   1 
ATOM 8572  C CA  . HIS C 3 150 ? 115.566 125.774 152.487 1.00 483.33 ? 150 HIS C CA  1 
ATOM 8573  C C   . HIS C 3 150 ? 115.380 124.430 153.198 1.00 500.00 ? 150 HIS C C   1 
ATOM 8574  O O   . HIS C 3 150 ? 114.343 123.767 153.038 1.00 500.00 ? 150 HIS C O   1 
ATOM 8575  C CB  . HIS C 3 150 ? 114.554 125.914 151.366 1.00 457.59 ? 150 HIS C CB  1 
ATOM 8576  C CG  . HIS C 3 150 ? 114.672 127.206 150.642 1.00 439.87 ? 150 HIS C CG  1 
ATOM 8577  N ND1 . HIS C 3 150 ? 114.698 127.295 149.268 1.00 476.88 ? 150 HIS C ND1 1 
ATOM 8578  C CD2 . HIS C 3 150 ? 114.813 128.466 151.107 1.00 457.08 ? 150 HIS C CD2 1 
ATOM 8579  C CE1 . HIS C 3 150 ? 114.824 128.561 148.916 1.00 477.90 ? 150 HIS C CE1 1 
ATOM 8580  N NE2 . HIS C 3 150 ? 114.894 129.291 150.014 1.00 500.00 ? 150 HIS C NE2 1 
ATOM 8581  N N   . GLY C 3 151 ? 116.380 124.032 153.984 1.00 500.00 ? 151 GLY C N   1 
ATOM 8582  C CA  . GLY C 3 151 ? 116.285 122.848 154.848 1.00 500.00 ? 151 GLY C CA  1 
ATOM 8583  C C   . GLY C 3 151 ? 116.512 121.472 154.225 1.00 500.00 ? 151 GLY C C   1 
ATOM 8584  O O   . GLY C 3 151 ? 116.791 120.511 154.956 1.00 500.00 ? 151 GLY C O   1 
ATOM 8585  N N   . ASP C 3 152 ? 116.406 121.361 152.896 1.00 500.00 ? 152 ASP C N   1 
ATOM 8586  C CA  . ASP C 3 152 ? 116.560 120.069 152.210 1.00 500.00 ? 152 ASP C CA  1 
ATOM 8587  C C   . ASP C 3 152 ? 118.000 119.577 152.287 1.00 417.10 ? 152 ASP C C   1 
ATOM 8588  O O   . ASP C 3 152 ? 118.913 120.315 152.651 1.00 394.08 ? 152 ASP C O   1 
ATOM 8589  C CB  . ASP C 3 152 ? 116.074 120.136 150.750 1.00 500.00 ? 152 ASP C CB  1 
ATOM 8590  C CG  . ASP C 3 152 ? 114.558 119.972 150.624 1.00 500.00 ? 152 ASP C CG  1 
ATOM 8591  O OD1 . ASP C 3 152 ? 113.812 120.846 151.119 1.00 480.77 ? 152 ASP C OD1 1 
ATOM 8592  O OD2 . ASP C 3 152 ? 114.116 118.970 150.020 1.00 469.86 ? 152 ASP C OD2 1 
ATOM 8593  N N   . SER C 3 153 ? 118.190 118.313 151.950 1.00 387.91 ? 153 SER C N   1 
ATOM 8594  C CA  . SER C 3 153 ? 119.447 117.657 152.226 1.00 408.83 ? 153 SER C CA  1 
ATOM 8595  C C   . SER C 3 153 ? 120.624 118.279 151.460 1.00 373.43 ? 153 SER C C   1 
ATOM 8596  O O   . SER C 3 153 ? 120.445 118.796 150.361 1.00 366.98 ? 153 SER C O   1 
ATOM 8597  C CB  . SER C 3 153 ? 119.329 116.164 151.909 1.00 468.45 ? 153 SER C CB  1 
ATOM 8598  O OG  . SER C 3 153 ? 120.492 115.456 152.302 1.00 500.00 ? 153 SER C OG  1 
ATOM 8599  N N   . PRO C 3 154 ? 121.822 118.257 152.059 1.00 397.51 ? 154 PRO C N   1 
ATOM 8600  C CA  . PRO C 3 154 ? 123.052 118.524 151.312 1.00 431.78 ? 154 PRO C CA  1 
ATOM 8601  C C   . PRO C 3 154 ? 123.507 117.342 150.473 1.00 397.80 ? 154 PRO C C   1 
ATOM 8602  O O   . PRO C 3 154 ? 124.128 117.531 149.432 1.00 455.94 ? 154 PRO C O   1 
ATOM 8603  C CB  . PRO C 3 154 ? 124.076 118.808 152.408 1.00 487.71 ? 154 PRO C CB  1 
ATOM 8604  C CG  . PRO C 3 154 ? 123.575 118.063 153.588 1.00 500.00 ? 154 PRO C CG  1 
ATOM 8605  C CD  . PRO C 3 154 ? 122.079 118.123 153.504 1.00 455.40 ? 154 PRO C CD  1 
ATOM 8606  N N   . TYR C 3 155 ? 123.209 116.133 150.933 1.00 423.64 ? 155 TYR C N   1 
ATOM 8607  C CA  . TYR C 3 155 ? 123.446 114.934 150.146 1.00 477.67 ? 155 TYR C CA  1 
ATOM 8608  C C   . TYR C 3 155 ? 122.645 114.981 148.832 1.00 469.84 ? 155 TYR C C   1 
ATOM 8609  O O   . TYR C 3 155 ? 123.151 114.544 147.802 1.00 478.12 ? 155 TYR C O   1 
ATOM 8610  C CB  . TYR C 3 155 ? 123.099 113.666 150.963 1.00 500.00 ? 155 TYR C CB  1 
ATOM 8611  C CG  . TYR C 3 155 ? 123.876 113.520 152.276 1.00 500.00 ? 155 TYR C CG  1 
ATOM 8612  C CD1 . TYR C 3 155 ? 125.257 113.290 152.269 1.00 500.00 ? 155 TYR C CD1 1 
ATOM 8613  C CD2 . TYR C 3 155 ? 123.235 113.611 153.521 1.00 500.00 ? 155 TYR C CD2 1 
ATOM 8614  C CE1 . TYR C 3 155 ? 125.979 113.162 153.456 1.00 500.00 ? 155 TYR C CE1 1 
ATOM 8615  C CE2 . TYR C 3 155 ? 123.952 113.484 154.714 1.00 500.00 ? 155 TYR C CE2 1 
ATOM 8616  C CZ  . TYR C 3 155 ? 125.327 113.261 154.678 1.00 500.00 ? 155 TYR C CZ  1 
ATOM 8617  O OH  . TYR C 3 155 ? 126.067 113.130 155.840 1.00 471.22 ? 155 TYR C OH  1 
ATOM 8618  N N   . TYR C 3 156 ? 121.436 115.564 148.879 1.00 457.64 ? 156 TYR C N   1 
ATOM 8619  C CA  . TYR C 3 156 ? 120.426 115.546 147.791 1.00 438.80 ? 156 TYR C CA  1 
ATOM 8620  C C   . TYR C 3 156 ? 120.875 114.964 146.465 1.00 400.17 ? 156 TYR C C   1 
ATOM 8621  O O   . TYR C 3 156 ? 120.239 114.027 145.983 1.00 416.07 ? 156 TYR C O   1 
ATOM 8622  C CB  . TYR C 3 156 ? 119.847 116.951 147.515 1.00 458.22 ? 156 TYR C CB  1 
ATOM 8623  C CG  . TYR C 3 156 ? 118.838 117.049 146.343 1.00 429.95 ? 156 TYR C CG  1 
ATOM 8624  C CD1 . TYR C 3 156 ? 119.258 117.038 144.993 1.00 390.64 ? 156 TYR C CD1 1 
ATOM 8625  C CD2 . TYR C 3 156 ? 117.469 117.199 146.589 1.00 410.80 ? 156 TYR C CD2 1 
ATOM 8626  C CE1 . TYR C 3 156 ? 118.356 117.144 143.950 1.00 379.96 ? 156 TYR C CE1 1 
ATOM 8627  C CE2 . TYR C 3 156 ? 116.558 117.310 145.545 1.00 406.89 ? 156 TYR C CE2 1 
ATOM 8628  C CZ  . TYR C 3 156 ? 117.005 117.283 144.232 1.00 421.42 ? 156 TYR C CZ  1 
ATOM 8629  O OH  . TYR C 3 156 ? 116.091 117.385 143.207 1.00 451.38 ? 156 TYR C OH  1 
ATOM 8630  N N   . PHE C 3 157 ? 121.841 115.632 145.841 1.00 397.26 ? 157 PHE C N   1 
ATOM 8631  C CA  . PHE C 3 157 ? 122.260 115.333 144.471 1.00 404.34 ? 157 PHE C CA  1 
ATOM 8632  C C   . PHE C 3 157 ? 122.697 113.884 144.353 1.00 405.46 ? 157 PHE C C   1 
ATOM 8633  O O   . PHE C 3 157 ? 122.296 113.158 143.430 1.00 407.68 ? 157 PHE C O   1 
ATOM 8634  C CB  . PHE C 3 157 ? 123.489 116.164 144.104 1.00 432.70 ? 157 PHE C CB  1 
ATOM 8635  C CG  . PHE C 3 157 ? 123.184 117.528 143.581 1.00 459.58 ? 157 PHE C CG  1 
ATOM 8636  C CD1 . PHE C 3 157 ? 122.148 117.735 142.669 1.00 441.38 ? 157 PHE C CD1 1 
ATOM 8637  C CD2 . PHE C 3 157 ? 123.987 118.606 143.945 1.00 464.45 ? 157 PHE C CD2 1 
ATOM 8638  C CE1 . PHE C 3 157 ? 121.897 118.991 142.168 1.00 465.25 ? 157 PHE C CE1 1 
ATOM 8639  C CE2 . PHE C 3 157 ? 123.740 119.869 143.443 1.00 460.15 ? 157 PHE C CE2 1 
ATOM 8640  C CZ  . PHE C 3 157 ? 122.694 120.058 142.556 1.00 500.00 ? 157 PHE C CZ  1 
ATOM 8641  N N   . LEU C 3 158 ? 123.533 113.502 145.305 1.00 434.31 ? 158 LEU C N   1 
ATOM 8642  C CA  . LEU C 3 158 ? 124.092 112.142 145.386 1.00 449.69 ? 158 LEU C CA  1 
ATOM 8643  C C   . LEU C 3 158 ? 122.964 111.121 145.463 1.00 368.79 ? 158 LEU C C   1 
ATOM 8644  O O   . LEU C 3 158 ? 122.967 110.105 144.750 1.00 347.66 ? 158 LEU C O   1 
ATOM 8645  C CB  . LEU C 3 158 ? 124.974 112.057 146.640 1.00 500.00 ? 158 LEU C CB  1 
ATOM 8646  C CG  . LEU C 3 158 ? 125.591 110.733 147.084 1.00 500.00 ? 158 LEU C CG  1 
ATOM 8647  C CD1 . LEU C 3 158 ? 126.323 110.061 145.933 1.00 500.00 ? 158 LEU C CD1 1 
ATOM 8648  C CD2 . LEU C 3 158 ? 126.519 110.984 148.271 1.00 500.00 ? 158 LEU C CD2 1 
ATOM 8649  N N   . THR C 3 159 ? 122.019 111.424 146.347 1.00 393.60 ? 159 THR C N   1 
ATOM 8650  C CA  . THR C 3 159 ? 120.849 110.574 146.588 1.00 455.30 ? 159 THR C CA  1 
ATOM 8651  C C   . THR C 3 159 ? 120.072 110.374 145.285 1.00 426.98 ? 159 THR C C   1 
ATOM 8652  O O   . THR C 3 159 ? 119.693 109.243 144.929 1.00 464.85 ? 159 THR C O   1 
ATOM 8653  C CB  . THR C 3 159 ? 119.915 111.203 147.666 1.00 478.42 ? 159 THR C CB  1 
ATOM 8654  O OG1 . THR C 3 159 ? 120.490 112.412 148.171 1.00 500.00 ? 159 THR C OG1 1 
ATOM 8655  C CG2 . THR C 3 159 ? 119.697 110.255 148.842 1.00 500.00 ? 159 THR C CG2 1 
ATOM 8656  N N   . SER C 3 160 ? 119.861 111.491 144.606 1.00 410.65 ? 160 SER C N   1 
ATOM 8657  C CA  . SER C 3 160 ? 119.130 111.523 143.336 1.00 440.81 ? 160 SER C CA  1 
ATOM 8658  C C   . SER C 3 160 ? 119.815 110.623 142.315 1.00 389.13 ? 160 SER C C   1 
ATOM 8659  O O   . SER C 3 160 ? 119.161 109.831 141.627 1.00 396.93 ? 160 SER C O   1 
ATOM 8660  C CB  . SER C 3 160 ? 118.969 112.963 142.827 1.00 500.00 ? 160 SER C CB  1 
ATOM 8661  O OG  . SER C 3 160 ? 117.743 113.119 142.132 1.00 500.00 ? 160 SER C OG  1 
ATOM 8662  N N   . ALA C 3 161 ? 121.129 110.772 142.248 1.00 364.58 ? 161 ALA C N   1 
ATOM 8663  C CA  . ALA C 3 161 ? 121.976 109.998 141.332 1.00 430.62 ? 161 ALA C CA  1 
ATOM 8664  C C   . ALA C 3 161 ? 121.806 108.512 141.593 1.00 418.61 ? 161 ALA C C   1 
ATOM 8665  O O   . ALA C 3 161 ? 121.632 107.713 140.658 1.00 381.16 ? 161 ALA C O   1 
ATOM 8666  C CB  . ALA C 3 161 ? 123.436 110.398 141.483 1.00 475.45 ? 161 ALA C CB  1 
ATOM 8667  N N   . PHE C 3 162 ? 121.863 108.173 142.876 1.00 433.93 ? 162 PHE C N   1 
ATOM 8668  C CA  . PHE C 3 162 ? 121.723 106.785 143.342 1.00 405.65 ? 162 PHE C CA  1 
ATOM 8669  C C   . PHE C 3 162 ? 120.391 106.213 142.877 1.00 338.71 ? 162 PHE C C   1 
ATOM 8670  O O   . PHE C 3 162 ? 120.321 105.088 142.355 1.00 352.77 ? 162 PHE C O   1 
ATOM 8671  C CB  . PHE C 3 162 ? 121.749 106.647 144.882 1.00 471.43 ? 162 PHE C CB  1 
ATOM 8672  C CG  . PHE C 3 162 ? 123.088 106.285 145.475 1.00 458.86 ? 162 PHE C CG  1 
ATOM 8673  C CD1 . PHE C 3 162 ? 123.814 105.207 144.998 1.00 455.69 ? 162 PHE C CD1 1 
ATOM 8674  C CD2 . PHE C 3 162 ? 123.584 106.989 146.577 1.00 453.24 ? 162 PHE C CD2 1 
ATOM 8675  C CE1 . PHE C 3 162 ? 125.031 104.867 145.564 1.00 496.78 ? 162 PHE C CE1 1 
ATOM 8676  C CE2 . PHE C 3 162 ? 124.796 106.655 147.149 1.00 456.78 ? 162 PHE C CE2 1 
ATOM 8677  C CZ  . PHE C 3 162 ? 125.523 105.593 146.642 1.00 500.00 ? 162 PHE C CZ  1 
ATOM 8678  N N   . LEU C 3 163 ? 119.354 107.015 143.089 1.00 381.89 ? 163 LEU C N   1 
ATOM 8679  C CA  . LEU C 3 163 ? 117.979 106.657 142.720 1.00 406.80 ? 163 LEU C CA  1 
ATOM 8680  C C   . LEU C 3 163 ? 117.896 106.353 141.235 1.00 414.88 ? 163 LEU C C   1 
ATOM 8681  O O   . LEU C 3 163 ? 117.307 105.347 140.818 1.00 416.66 ? 163 LEU C O   1 
ATOM 8682  C CB  . LEU C 3 163 ? 117.063 107.834 143.044 1.00 427.24 ? 163 LEU C CB  1 
ATOM 8683  C CG  . LEU C 3 163 ? 115.569 107.597 143.032 1.00 434.44 ? 163 LEU C CG  1 
ATOM 8684  C CD1 . LEU C 3 163 ? 115.213 106.592 144.110 1.00 493.70 ? 163 LEU C CD1 1 
ATOM 8685  C CD2 . LEU C 3 163 ? 114.853 108.913 143.278 1.00 458.32 ? 163 LEU C CD2 1 
ATOM 8686  N N   . THR C 3 164 ? 118.495 107.249 140.462 1.00 424.44 ? 164 THR C N   1 
ATOM 8687  C CA  . THR C 3 164 ? 118.540 107.151 138.997 1.00 439.63 ? 164 THR C CA  1 
ATOM 8688  C C   . THR C 3 164 ? 119.177 105.842 138.581 1.00 457.54 ? 164 THR C C   1 
ATOM 8689  O O   . THR C 3 164 ? 118.660 105.126 137.711 1.00 500.00 ? 164 THR C O   1 
ATOM 8690  C CB  . THR C 3 164 ? 119.432 108.263 138.412 1.00 434.64 ? 164 THR C CB  1 
ATOM 8691  O OG1 . THR C 3 164 ? 119.053 109.530 138.965 1.00 438.55 ? 164 THR C OG1 1 
ATOM 8692  C CG2 . THR C 3 164 ? 119.329 108.299 136.905 1.00 462.01 ? 164 THR C CG2 1 
ATOM 8693  N N   . ALA C 3 165 ? 120.307 105.562 139.217 1.00 456.17 ? 165 ALA C N   1 
ATOM 8694  C CA  . ALA C 3 165 ? 121.091 104.345 138.960 1.00 478.66 ? 165 ALA C CA  1 
ATOM 8695  C C   . ALA C 3 165 ? 120.229 103.112 139.200 1.00 431.22 ? 165 ALA C C   1 
ATOM 8696  O O   . ALA C 3 165 ? 120.199 102.179 138.374 1.00 367.10 ? 165 ALA C O   1 
ATOM 8697  C CB  . ALA C 3 165 ? 122.330 104.303 139.842 1.00 493.28 ? 165 ALA C CB  1 
ATOM 8698  N N   . ALA C 3 166 ? 119.541 103.142 140.337 1.00 424.10 ? 166 ALA C N   1 
ATOM 8699  C CA  . ALA C 3 166 ? 118.659 102.051 140.759 1.00 414.29 ? 166 ALA C CA  1 
ATOM 8700  C C   . ALA C 3 166 ? 117.584 101.807 139.703 1.00 393.11 ? 166 ALA C C   1 
ATOM 8701  O O   . ALA C 3 166 ? 117.320 100.656 139.313 1.00 392.62 ? 166 ALA C O   1 
ATOM 8702  C CB  . ALA C 3 166 ? 118.036 102.337 142.125 1.00 379.72 ? 166 ALA C CB  1 
ATOM 8703  N N   . ILE C 3 167 ? 116.996 102.907 139.262 1.00 376.42 ? 167 ILE C N   1 
ATOM 8704  C CA  . ILE C 3 167 ? 115.934 102.895 138.252 1.00 385.14 ? 167 ILE C CA  1 
ATOM 8705  C C   . ILE C 3 167 ? 116.435 102.239 136.975 1.00 391.66 ? 167 ILE C C   1 
ATOM 8706  O O   . ILE C 3 167 ? 115.753 101.383 136.391 1.00 446.91 ? 167 ILE C O   1 
ATOM 8707  C CB  . ILE C 3 167 ? 115.390 104.337 138.046 1.00 445.49 ? 167 ILE C CB  1 
ATOM 8708  C CG1 . ILE C 3 167 ? 114.304 104.641 139.099 1.00 448.97 ? 167 ILE C CG1 1 
ATOM 8709  C CG2 . ILE C 3 167 ? 114.883 104.602 136.633 1.00 471.67 ? 167 ILE C CG2 1 
ATOM 8710  C CD1 . ILE C 3 167 ? 112.935 104.055 138.822 1.00 434.10 ? 167 ILE C CD1 1 
ATOM 8711  N N   . ILE C 3 168 ? 117.627 102.655 136.574 1.00 398.52 ? 168 ILE C N   1 
ATOM 8712  C CA  . ILE C 3 168 ? 118.285 102.150 135.364 1.00 435.65 ? 168 ILE C CA  1 
ATOM 8713  C C   . ILE C 3 168 ? 118.459 100.625 135.471 1.00 456.06 ? 168 ILE C C   1 
ATOM 8714  O O   . ILE C 3 168 ? 118.156 99.845  134.566 1.00 474.62 ? 168 ILE C O   1 
ATOM 8715  C CB  . ILE C 3 168 ? 119.656 102.836 135.109 1.00 473.93 ? 168 ILE C CB  1 
ATOM 8716  C CG1 . ILE C 3 168 ? 119.462 104.232 134.503 1.00 491.35 ? 168 ILE C CG1 1 
ATOM 8717  C CG2 . ILE C 3 168 ? 120.553 102.008 134.194 1.00 479.61 ? 168 ILE C CG2 1 
ATOM 8718  C CD1 . ILE C 3 168 ? 120.582 105.215 134.792 1.00 493.70 ? 168 ILE C CD1 1 
ATOM 8719  N N   . LEU C 3 169 ? 118.952 100.225 136.625 1.00 433.89 ? 169 LEU C N   1 
ATOM 8720  C CA  . LEU C 3 169 ? 119.208 98.807  136.898 1.00 420.26 ? 169 LEU C CA  1 
ATOM 8721  C C   . LEU C 3 169 ? 117.874 98.087  136.933 1.00 378.50 ? 169 LEU C C   1 
ATOM 8722  O O   . LEU C 3 169 ? 117.680 96.998  136.361 1.00 412.87 ? 169 LEU C O   1 
ATOM 8723  C CB  . LEU C 3 169 ? 119.992 98.638  138.188 1.00 500.00 ? 169 LEU C CB  1 
ATOM 8724  C CG  . LEU C 3 169 ? 121.420 99.215  138.085 1.00 500.00 ? 169 LEU C CG  1 
ATOM 8725  C CD1 . LEU C 3 169 ? 122.041 99.396  139.472 1.00 500.00 ? 169 LEU C CD1 1 
ATOM 8726  C CD2 . LEU C 3 169 ? 122.316 98.369  137.180 1.00 500.00 ? 169 LEU C CD2 1 
ATOM 8727  N N   . LEU C 3 170 ? 116.983 98.744  137.666 1.00 425.05 ? 170 LEU C N   1 
ATOM 8728  C CA  . LEU C 3 170 ? 115.644 98.178  137.933 1.00 447.77 ? 170 LEU C CA  1 
ATOM 8729  C C   . LEU C 3 170 ? 114.900 97.983  136.631 1.00 429.21 ? 170 LEU C C   1 
ATOM 8730  O O   . LEU C 3 170 ? 114.285 96.923  136.426 1.00 394.03 ? 170 LEU C O   1 
ATOM 8731  C CB  . LEU C 3 170 ? 114.866 99.017  138.924 1.00 444.99 ? 170 LEU C CB  1 
ATOM 8732  C CG  . LEU C 3 170 ? 113.665 98.367  139.592 1.00 500.00 ? 170 LEU C CG  1 
ATOM 8733  C CD1 . LEU C 3 170 ? 113.577 96.845  139.534 1.00 500.00 ? 170 LEU C CD1 1 
ATOM 8734  C CD2 . LEU C 3 170 ? 113.629 98.797  141.042 1.00 500.00 ? 170 LEU C CD2 1 
ATOM 8735  N N   . HIS C 3 171 ? 114.981 98.995  135.772 1.00 429.17 ? 171 HIS C N   1 
ATOM 8736  C CA  . HIS C 3 171 ? 114.315 98.959  134.457 1.00 411.50 ? 171 HIS C CA  1 
ATOM 8737  C C   . HIS C 3 171 ? 114.827 97.782  133.647 1.00 417.36 ? 171 HIS C C   1 
ATOM 8738  O O   . HIS C 3 171 ? 114.034 97.047  133.042 1.00 482.57 ? 171 HIS C O   1 
ATOM 8739  C CB  . HIS C 3 171 ? 114.456 100.268 133.665 1.00 440.44 ? 171 HIS C CB  1 
ATOM 8740  C CG  . HIS C 3 171 ? 113.287 101.200 133.802 1.00 458.49 ? 171 HIS C CG  1 
ATOM 8741  N ND1 . HIS C 3 171 ? 112.154 101.103 133.020 1.00 452.68 ? 171 HIS C ND1 1 
ATOM 8742  C CD2 . HIS C 3 171 ? 113.086 102.261 134.615 1.00 458.51 ? 171 HIS C CD2 1 
ATOM 8743  C CE1 . HIS C 3 171 ? 111.306 102.059 133.352 1.00 453.94 ? 171 HIS C CE1 1 
ATOM 8744  N NE2 . HIS C 3 171 ? 111.847 102.777 134.319 1.00 438.32 ? 171 HIS C NE2 1 
ATOM 8745  N N   . THR C 3 172 ? 116.147 97.627  133.662 1.00 363.32 ? 172 THR C N   1 
ATOM 8746  C CA  . THR C 3 172 ? 116.832 96.549  132.942 1.00 416.97 ? 172 THR C CA  1 
ATOM 8747  C C   . THR C 3 172 ? 116.301 95.189  133.415 1.00 421.96 ? 172 THR C C   1 
ATOM 8748  O O   . THR C 3 172 ? 115.980 94.304  132.599 1.00 474.52 ? 172 THR C O   1 
ATOM 8749  C CB  . THR C 3 172 ? 118.352 96.544  133.248 1.00 407.30 ? 172 THR C CB  1 
ATOM 8750  O OG1 . THR C 3 172 ? 118.805 97.863  133.560 1.00 386.31 ? 172 THR C OG1 1 
ATOM 8751  C CG2 . THR C 3 172 ? 119.147 96.007  132.067 1.00 431.34 ? 172 THR C CG2 1 
ATOM 8752  N N   . PHE C 3 173 ? 116.231 95.072  134.736 1.00 415.72 ? 173 PHE C N   1 
ATOM 8753  C CA  . PHE C 3 173 ? 115.763 93.846  135.380 1.00 432.43 ? 173 PHE C CA  1 
ATOM 8754  C C   . PHE C 3 173 ? 114.340 93.518  134.940 1.00 436.99 ? 173 PHE C C   1 
ATOM 8755  O O   . PHE C 3 173 ? 114.034 92.369  134.602 1.00 416.34 ? 173 PHE C O   1 
ATOM 8756  C CB  . PHE C 3 173 ? 116.046 93.834  136.871 1.00 472.38 ? 173 PHE C CB  1 
ATOM 8757  C CG  . PHE C 3 173 ? 117.517 93.747  137.179 1.00 500.00 ? 173 PHE C CG  1 
ATOM 8758  C CD1 . PHE C 3 173 ? 118.374 92.927  136.411 1.00 478.15 ? 173 PHE C CD1 1 
ATOM 8759  C CD2 . PHE C 3 173 ? 118.066 94.477  138.233 1.00 500.00 ? 173 PHE C CD2 1 
ATOM 8760  C CE1 . PHE C 3 173 ? 119.724 92.843  136.697 1.00 500.00 ? 173 PHE C CE1 1 
ATOM 8761  C CE2 . PHE C 3 173 ? 119.424 94.394  138.522 1.00 500.00 ? 173 PHE C CE2 1 
ATOM 8762  C CZ  . PHE C 3 173 ? 120.252 93.574  137.754 1.00 500.00 ? 173 PHE C CZ  1 
ATOM 8763  N N   . TRP C 3 174 ? 113.513 94.552  134.937 1.00 433.42 ? 174 TRP C N   1 
ATOM 8764  C CA  . TRP C 3 174 ? 112.107 94.445  134.528 1.00 437.35 ? 174 TRP C CA  1 
ATOM 8765  C C   . TRP C 3 174 ? 112.012 93.928  133.106 1.00 436.75 ? 174 TRP C C   1 
ATOM 8766  O O   . TRP C 3 174 ? 111.221 93.025  132.811 1.00 467.52 ? 174 TRP C O   1 
ATOM 8767  C CB  . TRP C 3 174 ? 111.350 95.769  134.667 1.00 427.18 ? 174 TRP C CB  1 
ATOM 8768  C CG  . TRP C 3 174 ? 111.080 96.154  136.066 1.00 435.64 ? 174 TRP C CG  1 
ATOM 8769  C CD1 . TRP C 3 174 ? 110.809 95.320  137.112 1.00 500.00 ? 174 TRP C CD1 1 
ATOM 8770  C CD2 . TRP C 3 174 ? 111.018 97.480  136.587 1.00 436.82 ? 174 TRP C CD2 1 
ATOM 8771  N NE1 . TRP C 3 174 ? 110.594 96.044  138.252 1.00 500.00 ? 174 TRP C NE1 1 
ATOM 8772  C CE2 . TRP C 3 174 ? 110.710 97.375  137.957 1.00 488.13 ? 174 TRP C CE2 1 
ATOM 8773  C CE3 . TRP C 3 174 ? 111.184 98.746  136.030 1.00 463.84 ? 174 TRP C CE3 1 
ATOM 8774  C CZ2 . TRP C 3 174 ? 110.577 98.490  138.779 1.00 458.79 ? 174 TRP C CZ2 1 
ATOM 8775  C CZ3 . TRP C 3 174 ? 111.054 99.856  136.848 1.00 500.00 ? 174 TRP C CZ3 1 
ATOM 8776  C CH2 . TRP C 3 174 ? 110.751 99.721  138.207 1.00 471.10 ? 174 TRP C CH2 1 
ATOM 8777  N N   . GLY C 3 175 ? 112.833 94.519  132.248 1.00 423.38 ? 175 GLY C N   1 
ATOM 8778  C CA  . GLY C 3 175 ? 112.902 94.161  130.826 1.00 426.47 ? 175 GLY C CA  1 
ATOM 8779  C C   . GLY C 3 175 ? 113.238 92.682  130.677 1.00 464.81 ? 175 GLY C C   1 
ATOM 8780  O O   . GLY C 3 175 ? 112.599 91.955  129.898 1.00 479.37 ? 175 GLY C O   1 
ATOM 8781  N N   . VAL C 3 176 ? 114.243 92.269  131.445 1.00 468.44 ? 176 VAL C N   1 
ATOM 8782  C CA  . VAL C 3 176 ? 114.733 90.890  131.437 1.00 467.29 ? 176 VAL C CA  1 
ATOM 8783  C C   . VAL C 3 176 ? 113.599 89.940  131.817 1.00 412.41 ? 176 VAL C C   1 
ATOM 8784  O O   . VAL C 3 176 ? 113.389 88.903  131.153 1.00 435.87 ? 176 VAL C O   1 
ATOM 8785  C CB  . VAL C 3 176 ? 115.941 90.620  132.377 1.00 500.00 ? 176 VAL C CB  1 
ATOM 8786  C CG1 . VAL C 3 176 ? 116.311 89.133  132.374 1.00 499.46 ? 176 VAL C CG1 1 
ATOM 8787  C CG2 . VAL C 3 176 ? 117.156 91.457  131.979 1.00 500.00 ? 176 VAL C CG2 1 
ATOM 8788  N N   . VAL C 3 177 ? 112.878 90.323  132.872 1.00 411.54 ? 177 VAL C N   1 
ATOM 8789  C CA  . VAL C 3 177 ? 111.877 89.460  133.489 1.00 484.14 ? 177 VAL C CA  1 
ATOM 8790  C C   . VAL C 3 177 ? 110.565 89.548  132.738 1.00 478.20 ? 177 VAL C C   1 
ATOM 8791  O O   . VAL C 3 177 ? 109.893 88.526  132.593 1.00 500.00 ? 177 VAL C O   1 
ATOM 8792  C CB  . VAL C 3 177 ? 111.653 89.840  134.987 1.00 474.50 ? 177 VAL C CB  1 
ATOM 8793  C CG1 . VAL C 3 177 ? 110.458 89.105  135.597 1.00 464.89 ? 177 VAL C CG1 1 
ATOM 8794  C CG2 . VAL C 3 177 ? 112.911 89.570  135.815 1.00 441.74 ? 177 VAL C CG2 1 
ATOM 8795  N N   . PHE C 3 178 ? 110.187 90.764  132.364 1.00 439.00 ? 178 PHE C N   1 
ATOM 8796  C CA  . PHE C 3 178 ? 108.902 91.048  131.747 1.00 442.75 ? 178 PHE C CA  1 
ATOM 8797  C C   . PHE C 3 178 ? 108.733 90.223  130.471 1.00 450.56 ? 178 PHE C C   1 
ATOM 8798  O O   . PHE C 3 178 ? 107.688 89.587  130.241 1.00 488.80 ? 178 PHE C O   1 
ATOM 8799  C CB  . PHE C 3 178 ? 108.825 92.533  131.411 1.00 500.00 ? 178 PHE C CB  1 
ATOM 8800  C CG  . PHE C 3 178 ? 107.581 92.933  130.702 1.00 500.00 ? 178 PHE C CG  1 
ATOM 8801  C CD1 . PHE C 3 178 ? 107.468 92.769  129.323 1.00 500.00 ? 178 PHE C CD1 1 
ATOM 8802  C CD2 . PHE C 3 178 ? 106.526 93.502  131.406 1.00 500.00 ? 178 PHE C CD2 1 
ATOM 8803  C CE1 . PHE C 3 178 ? 106.316 93.143  128.665 1.00 500.00 ? 178 PHE C CE1 1 
ATOM 8804  C CE2 . PHE C 3 178 ? 105.370 93.882  130.751 1.00 500.00 ? 178 PHE C CE2 1 
ATOM 8805  C CZ  . PHE C 3 178 ? 105.265 93.700  129.383 1.00 500.00 ? 178 PHE C CZ  1 
ATOM 8806  N N   . PHE C 3 179 ? 109.792 90.265  129.667 1.00 425.08 ? 179 PHE C N   1 
ATOM 8807  C CA  . PHE C 3 179 ? 109.816 89.543  128.384 1.00 471.06 ? 179 PHE C CA  1 
ATOM 8808  C C   . PHE C 3 179 ? 109.627 88.056  128.613 1.00 500.00 ? 179 PHE C C   1 
ATOM 8809  O O   . PHE C 3 179 ? 108.844 87.407  127.905 1.00 467.06 ? 179 PHE C O   1 
ATOM 8810  C CB  . PHE C 3 179 ? 111.087 89.811  127.618 1.00 500.00 ? 179 PHE C CB  1 
ATOM 8811  C CG  . PHE C 3 179 ? 110.991 91.005  126.726 1.00 500.00 ? 179 PHE C CG  1 
ATOM 8812  C CD1 . PHE C 3 179 ? 110.588 92.237  127.232 1.00 500.00 ? 179 PHE C CD1 1 
ATOM 8813  C CD2 . PHE C 3 179 ? 111.300 90.903  125.371 1.00 500.00 ? 179 PHE C CD2 1 
ATOM 8814  C CE1 . PHE C 3 179 ? 110.498 93.346  126.407 1.00 500.00 ? 179 PHE C CE1 1 
ATOM 8815  C CE2 . PHE C 3 179 ? 111.220 92.008  124.543 1.00 500.00 ? 179 PHE C CE2 1 
ATOM 8816  C CZ  . PHE C 3 179 ? 110.818 93.232  125.061 1.00 500.00 ? 179 PHE C CZ  1 
ATOM 8817  N N   . ASP C 3 180 ? 110.343 87.548  129.609 1.00 500.00 ? 180 ASP C N   1 
ATOM 8818  C CA  . ASP C 3 180 ? 110.289 86.132  129.995 1.00 500.00 ? 180 ASP C CA  1 
ATOM 8819  C C   . ASP C 3 180 ? 108.854 85.744  130.349 1.00 491.41 ? 180 ASP C C   1 
ATOM 8820  O O   . ASP C 3 180 ? 108.341 84.709  129.899 1.00 492.36 ? 180 ASP C O   1 
ATOM 8821  C CB  . ASP C 3 180 ? 111.209 85.907  131.208 1.00 500.00 ? 180 ASP C CB  1 
ATOM 8822  C CG  . ASP C 3 180 ? 111.507 84.453  131.465 1.00 500.00 ? 180 ASP C CG  1 
ATOM 8823  O OD1 . ASP C 3 180 ? 112.086 83.794  130.572 1.00 500.00 ? 180 ASP C OD1 1 
ATOM 8824  O OD2 . ASP C 3 180 ? 111.189 83.974  132.574 1.00 500.00 ? 180 ASP C OD2 1 
ATOM 8825  N N   . ALA C 3 181 ? 108.245 86.600  131.159 1.00 470.93 ? 181 ALA C N   1 
ATOM 8826  C CA  . ALA C 3 181 ? 106.868 86.412  131.625 1.00 469.83 ? 181 ALA C CA  1 
ATOM 8827  C C   . ALA C 3 181 ? 105.918 86.321  130.434 1.00 495.47 ? 181 ALA C C   1 
ATOM 8828  O O   . ALA C 3 181 ? 105.057 85.435  130.372 1.00 500.00 ? 181 ALA C O   1 
ATOM 8829  C CB  . ALA C 3 181 ? 106.440 87.531  132.561 1.00 500.00 ? 181 ALA C CB  1 
ATOM 8830  N N   . CYS C 3 182 ? 106.112 87.255  129.511 1.00 490.02 ? 182 CYS C N   1 
ATOM 8831  C CA  . CYS C 3 182 ? 105.310 87.344  128.283 1.00 497.32 ? 182 CYS C CA  1 
ATOM 8832  C C   . CYS C 3 182 ? 105.406 86.041  127.499 1.00 465.00 ? 182 CYS C C   1 
ATOM 8833  O O   . CYS C 3 182 ? 104.391 85.490  127.044 1.00 390.75 ? 182 CYS C O   1 
ATOM 8834  C CB  . CYS C 3 182 ? 105.804 88.457  127.354 1.00 500.00 ? 182 CYS C CB  1 
ATOM 8835  S SG  . CYS C 3 182 ? 106.012 90.083  128.091 1.00 461.91 ? 182 CYS C SG  1 
ATOM 8836  N N   . GLU C 3 183 ? 106.644 85.582  127.364 1.00 465.44 ? 183 GLU C N   1 
ATOM 8837  C CA  . GLU C 3 183 ? 106.954 84.344  126.641 1.00 500.00 ? 183 GLU C CA  1 
ATOM 8838  C C   . GLU C 3 183 ? 106.215 83.170  127.261 1.00 500.00 ? 183 GLU C C   1 
ATOM 8839  O O   . GLU C 3 183 ? 105.594 82.354  126.561 1.00 500.00 ? 183 GLU C O   1 
ATOM 8840  C CB  . GLU C 3 183 ? 108.461 84.071  126.589 1.00 500.00 ? 183 GLU C CB  1 
ATOM 8841  C CG  . GLU C 3 183 ? 109.129 84.709  125.387 1.00 500.00 ? 183 GLU C CG  1 
ATOM 8842  C CD  . GLU C 3 183 ? 108.650 84.120  124.067 1.00 500.00 ? 183 GLU C CD  1 
ATOM 8843  O OE1 . GLU C 3 183 ? 109.087 82.997  123.718 1.00 500.00 ? 183 GLU C OE1 1 
ATOM 8844  O OE2 . GLU C 3 183 ? 107.836 84.783  123.383 1.00 500.00 ? 183 GLU C OE2 1 
ATOM 8845  N N   . ARG C 3 184 ? 106.285 83.118  128.586 1.00 500.00 ? 184 ARG C N   1 
ATOM 8846  C CA  . ARG C 3 184 ? 105.655 82.060  129.385 1.00 500.00 ? 184 ARG C CA  1 
ATOM 8847  C C   . ARG C 3 184 ? 104.138 81.998  129.306 1.00 492.14 ? 184 ARG C C   1 
ATOM 8848  O O   . ARG C 3 184 ? 103.547 80.938  129.501 1.00 414.63 ? 184 ARG C O   1 
ATOM 8849  C CB  . ARG C 3 184 ? 106.077 82.151  130.863 1.00 497.13 ? 184 ARG C CB  1 
ATOM 8850  C CG  . ARG C 3 184 ? 107.566 81.943  131.128 1.00 493.78 ? 184 ARG C CG  1 
ATOM 8851  C CD  . ARG C 3 184 ? 107.992 80.492  131.007 1.00 500.00 ? 184 ARG C CD  1 
ATOM 8852  N NE  . ARG C 3 184 ? 109.453 80.356  130.921 1.00 500.00 ? 184 ARG C NE  1 
ATOM 8853  C CZ  . ARG C 3 184 ? 110.283 80.017  131.918 1.00 500.00 ? 184 ARG C CZ  1 
ATOM 8854  N NH1 . ARG C 3 184 ? 109.842 79.753  133.153 1.00 500.00 ? 184 ARG C NH1 1 
ATOM 8855  N NH2 . ARG C 3 184 ? 111.592 79.931  131.672 1.00 500.00 ? 184 ARG C NH2 1 
ATOM 8856  N N   . ARG C 3 185 ? 103.542 83.169  129.062 1.00 500.00 ? 185 ARG C N   1 
ATOM 8857  C CA  . ARG C 3 185 ? 102.109 83.402  129.168 1.00 500.00 ? 185 ARG C CA  1 
ATOM 8858  C C   . ARG C 3 185 ? 101.661 83.299  130.656 1.00 500.00 ? 185 ARG C C   1 
ATOM 8859  O O   . ARG C 3 185 ? 100.509 82.954  130.934 1.00 500.00 ? 185 ARG C O   1 
ATOM 8860  C CB  . ARG C 3 185 ? 101.333 82.456  128.215 1.00 500.00 ? 185 ARG C CB  1 
ATOM 8861  C CG  . ARG C 3 185 ? 100.020 83.009  127.654 1.00 500.00 ? 185 ARG C CG  1 
ATOM 8862  C CD  . ARG C 3 185 ? 99.428  82.127  126.543 1.00 500.00 ? 185 ARG C CD  1 
ATOM 8863  N NE  . ARG C 3 185 ? 97.956  81.997  126.615 1.00 500.00 ? 185 ARG C NE  1 
ATOM 8864  C CZ  . ARG C 3 185 ? 97.041  82.820  126.066 1.00 500.00 ? 185 ARG C CZ  1 
ATOM 8865  N NH1 . ARG C 3 185 ? 97.392  83.906  125.364 1.00 500.00 ? 185 ARG C NH1 1 
ATOM 8866  N NH2 . ARG C 3 185 ? 95.737  82.552  126.233 1.00 500.00 ? 185 ARG C NH2 1 
ATOM 8867  N N   . ARG C 3 186 ? 102.571 83.624  131.593 1.00 500.00 ? 186 ARG C N   1 
ATOM 8868  C CA  . ARG C 3 186 ? 102.275 83.623  133.042 1.00 452.77 ? 186 ARG C CA  1 
ATOM 8869  C C   . ARG C 3 186 ? 102.054 85.068  133.529 1.00 443.81 ? 186 ARG C C   1 
ATOM 8870  O O   . ARG C 3 186 ? 102.991 85.861  133.631 1.00 425.18 ? 186 ARG C O   1 
ATOM 8871  C CB  . ARG C 3 186 ? 103.350 82.863  133.852 1.00 429.04 ? 186 ARG C CB  1 
ATOM 8872  C CG  . ARG C 3 186 ? 104.723 83.518  133.985 1.00 500.00 ? 186 ARG C CG  1 
ATOM 8873  C CD  . ARG C 3 186 ? 105.856 82.526  134.296 1.00 500.00 ? 186 ARG C CD  1 
ATOM 8874  N NE  . ARG C 3 186 ? 105.831 81.952  135.663 1.00 500.00 ? 186 ARG C NE  1 
ATOM 8875  C CZ  . ARG C 3 186 ? 106.888 81.465  136.347 1.00 500.00 ? 186 ARG C CZ  1 
ATOM 8876  N NH1 . ARG C 3 186 ? 106.710 80.976  137.579 1.00 500.00 ? 186 ARG C NH1 1 
ATOM 8877  N NH2 . ARG C 3 186 ? 108.128 81.466  135.842 1.00 500.00 ? 186 ARG C NH2 1 
ATOM 8878  N N   . TYR C 3 187 ? 100.787 85.392  133.803 1.00 462.29 ? 187 TYR C N   1 
ATOM 8879  C CA  . TYR C 3 187 ? 100.328 86.773  134.055 1.00 479.81 ? 187 TYR C CA  1 
ATOM 8880  C C   . TYR C 3 187 ? 100.727 87.306  135.435 1.00 474.51 ? 187 TYR C C   1 
ATOM 8881  O O   . TYR C 3 187 ? 100.873 88.531  135.634 1.00 456.84 ? 187 TYR C O   1 
ATOM 8882  C CB  . TYR C 3 187 ? 98.792  86.859  133.883 1.00 454.22 ? 187 TYR C CB  1 
ATOM 8883  C CG  . TYR C 3 187 ? 98.345  86.771  132.434 1.00 500.00 ? 187 TYR C CG  1 
ATOM 8884  C CD1 . TYR C 3 187 ? 98.148  85.536  131.806 1.00 491.97 ? 187 TYR C CD1 1 
ATOM 8885  C CD2 . TYR C 3 187 ? 98.146  87.934  131.676 1.00 500.00 ? 187 TYR C CD2 1 
ATOM 8886  C CE1 . TYR C 3 187 ? 97.756  85.465  130.467 1.00 500.00 ? 187 TYR C CE1 1 
ATOM 8887  C CE2 . TYR C 3 187 ? 97.756  87.876  130.335 1.00 500.00 ? 187 TYR C CE2 1 
ATOM 8888  C CZ  . TYR C 3 187 ? 97.561  86.642  129.727 1.00 500.00 ? 187 TYR C CZ  1 
ATOM 8889  O OH  . TYR C 3 187 ? 97.171  86.597  128.397 1.00 500.00 ? 187 TYR C OH  1 
ATOM 8890  N N   . TRP C 3 188 ? 100.825 86.361  136.391 1.00 479.94 ? 188 TRP C N   1 
ATOM 8891  C CA  . TRP C 3 188 ? 101.126 86.700  137.770 1.00 478.96 ? 188 TRP C CA  1 
ATOM 8892  C C   . TRP C 3 188 ? 102.469 87.408  137.861 1.00 500.00 ? 188 TRP C C   1 
ATOM 8893  O O   . TRP C 3 188 ? 102.572 88.418  138.574 1.00 500.00 ? 188 TRP C O   1 
ATOM 8894  C CB  . TRP C 3 188 ? 100.928 85.533  138.789 1.00 440.65 ? 188 TRP C CB  1 
ATOM 8895  C CG  . TRP C 3 188 ? 101.954 84.392  138.832 1.00 500.00 ? 188 TRP C CG  1 
ATOM 8896  C CD1 . TRP C 3 188 ? 101.971 83.284  138.027 1.00 500.00 ? 188 TRP C CD1 1 
ATOM 8897  C CD2 . TRP C 3 188 ? 103.048 84.213  139.779 1.00 500.00 ? 188 TRP C CD2 1 
ATOM 8898  N NE1 . TRP C 3 188 ? 103.019 82.451  138.382 1.00 500.00 ? 188 TRP C NE1 1 
ATOM 8899  C CE2 . TRP C 3 188 ? 103.694 82.992  139.448 1.00 500.00 ? 188 TRP C CE2 1 
ATOM 8900  C CE3 . TRP C 3 188 ? 103.556 84.972  140.854 1.00 500.00 ? 188 TRP C CE3 1 
ATOM 8901  C CZ2 . TRP C 3 188 ? 104.835 82.508  140.160 1.00 500.00 ? 188 TRP C CZ2 1 
ATOM 8902  C CZ3 . TRP C 3 188 ? 104.698 84.483  141.567 1.00 465.65 ? 188 TRP C CZ3 1 
ATOM 8903  C CH2 . TRP C 3 188 ? 105.315 83.265  141.209 1.00 402.51 ? 188 TRP C CH2 1 
ATOM 8904  N N   . ALA C 3 189 ? 103.451 86.886  137.132 1.00 485.70 ? 189 ALA C N   1 
ATOM 8905  C CA  . ALA C 3 189 ? 104.794 87.459  137.102 1.00 442.88 ? 189 ALA C CA  1 
ATOM 8906  C C   . ALA C 3 189 ? 104.744 88.914  136.630 1.00 464.68 ? 189 ALA C C   1 
ATOM 8907  O O   . ALA C 3 189 ? 105.364 89.806  137.229 1.00 432.49 ? 189 ALA C O   1 
ATOM 8908  C CB  . ALA C 3 189 ? 105.699 86.634  136.203 1.00 472.01 ? 189 ALA C CB  1 
ATOM 8909  N N   . LEU C 3 190 ? 103.992 89.105  135.556 1.00 475.87 ? 190 LEU C N   1 
ATOM 8910  C CA  . LEU C 3 190 ? 103.799 90.418  134.932 1.00 495.76 ? 190 LEU C CA  1 
ATOM 8911  C C   . LEU C 3 190 ? 103.227 91.403  135.961 1.00 500.00 ? 190 LEU C C   1 
ATOM 8912  O O   . LEU C 3 190 ? 103.708 92.545  136.106 1.00 479.59 ? 190 LEU C O   1 
ATOM 8913  C CB  . LEU C 3 190 ? 102.777 90.263  133.786 1.00 500.00 ? 190 LEU C CB  1 
ATOM 8914  C CG  . LEU C 3 190 ? 102.822 91.163  132.550 1.00 500.00 ? 190 LEU C CG  1 
ATOM 8915  C CD1 . LEU C 3 190 ? 103.640 90.482  131.461 1.00 500.00 ? 190 LEU C CD1 1 
ATOM 8916  C CD2 . LEU C 3 190 ? 101.424 91.483  132.025 1.00 500.00 ? 190 LEU C CD2 1 
ATOM 8917  N N   . GLY C 3 191 ? 102.196 90.914  136.648 1.00 500.00 ? 191 GLY C N   1 
ATOM 8918  C CA  . GLY C 3 191 ? 101.497 91.690  137.674 1.00 500.00 ? 191 GLY C CA  1 
ATOM 8919  C C   . GLY C 3 191 ? 102.468 92.129  138.760 1.00 500.00 ? 191 GLY C C   1 
ATOM 8920  O O   . GLY C 3 191 ? 102.475 93.291  139.181 1.00 500.00 ? 191 GLY C O   1 
ATOM 8921  N N   . LEU C 3 192 ? 103.272 91.169  139.191 1.00 500.00 ? 192 LEU C N   1 
ATOM 8922  C CA  . LEU C 3 192 ? 104.285 91.381  140.237 1.00 500.00 ? 192 LEU C CA  1 
ATOM 8923  C C   . LEU C 3 192 ? 105.247 92.476  139.813 1.00 500.00 ? 192 LEU C C   1 
ATOM 8924  O O   . LEU C 3 192 ? 105.559 93.377  140.599 1.00 480.24 ? 192 LEU C O   1 
ATOM 8925  C CB  . LEU C 3 192 ? 105.047 90.084  140.558 1.00 500.00 ? 192 LEU C CB  1 
ATOM 8926  C CG  . LEU C 3 192 ? 105.556 89.957  142.008 1.00 500.00 ? 192 LEU C CG  1 
ATOM 8927  C CD1 . LEU C 3 192 ? 105.997 88.528  142.338 1.00 500.00 ? 192 LEU C CD1 1 
ATOM 8928  C CD2 . LEU C 3 192 ? 106.672 90.953  142.326 1.00 500.00 ? 192 LEU C CD2 1 
ATOM 8929  N N   . VAL C 3 193 ? 105.696 92.368  138.569 1.00 500.00 ? 193 VAL C N   1 
ATOM 8930  C CA  . VAL C 3 193 ? 106.636 93.324  137.973 1.00 500.00 ? 193 VAL C CA  1 
ATOM 8931  C C   . VAL C 3 193 ? 106.039 94.738  138.021 1.00 494.57 ? 193 VAL C C   1 
ATOM 8932  O O   . VAL C 3 193 ? 106.714 95.708  138.421 1.00 476.36 ? 193 VAL C O   1 
ATOM 8933  C CB  . VAL C 3 193 ? 107.036 92.915  136.532 1.00 500.00 ? 193 VAL C CB  1 
ATOM 8934  C CG1 . VAL C 3 193 ? 107.705 94.067  135.780 1.00 500.00 ? 193 VAL C CG1 1 
ATOM 8935  C CG2 . VAL C 3 193 ? 107.945 91.691  136.567 1.00 500.00 ? 193 VAL C CG2 1 
ATOM 8936  N N   . VAL C 3 194 ? 104.777 94.802  137.606 1.00 492.20 ? 194 VAL C N   1 
ATOM 8937  C CA  . VAL C 3 194 ? 104.027 96.057  137.565 1.00 500.00 ? 194 VAL C CA  1 
ATOM 8938  C C   . VAL C 3 194 ? 103.979 96.689  138.962 1.00 500.00 ? 194 VAL C C   1 
ATOM 8939  O O   . VAL C 3 194 ? 104.226 97.896  139.135 1.00 500.00 ? 194 VAL C O   1 
ATOM 8940  C CB  . VAL C 3 194 ? 102.600 95.875  136.966 1.00 500.00 ? 194 VAL C CB  1 
ATOM 8941  C CG1 . VAL C 3 194 ? 101.750 97.137  137.125 1.00 500.00 ? 194 VAL C CG1 1 
ATOM 8942  C CG2 . VAL C 3 194 ? 102.669 95.479  135.492 1.00 500.00 ? 194 VAL C CG2 1 
ATOM 8943  N N   . GLY C 3 195 ? 103.665 95.838  139.928 1.00 492.40 ? 195 GLY C N   1 
ATOM 8944  C CA  . GLY C 3 195 ? 103.566 96.232  141.335 1.00 500.00 ? 195 GLY C CA  1 
ATOM 8945  C C   . GLY C 3 195 ? 104.875 96.822  141.815 1.00 500.00 ? 195 GLY C C   1 
ATOM 8946  O O   . GLY C 3 195 ? 104.902 97.869  142.467 1.00 490.92 ? 195 GLY C O   1 
ATOM 8947  N N   . SER C 3 196 ? 105.948 96.122  141.474 1.00 484.68 ? 196 SER C N   1 
ATOM 8948  C CA  . SER C 3 196 ? 107.319 96.518  141.833 1.00 485.13 ? 196 SER C CA  1 
ATOM 8949  C C   . SER C 3 196 ? 107.617 97.897  141.288 1.00 428.57 ? 196 SER C C   1 
ATOM 8950  O O   . SER C 3 196 ? 108.142 98.767  142.015 1.00 368.84 ? 196 SER C O   1 
ATOM 8951  C CB  . SER C 3 196 ? 108.342 95.523  141.265 1.00 499.95 ? 196 SER C CB  1 
ATOM 8952  O OG  . SER C 3 196 ? 107.906 94.184  141.417 1.00 500.00 ? 196 SER C OG  1 
ATOM 8953  N N   . HIS C 3 197 ? 107.260 98.086  140.019 1.00 463.47 ? 197 HIS C N   1 
ATOM 8954  C CA  . HIS C 3 197 ? 107.465 99.361  139.322 1.00 482.12 ? 197 HIS C CA  1 
ATOM 8955  C C   . HIS C 3 197 ? 106.746 100.496 140.076 1.00 453.14 ? 197 HIS C C   1 
ATOM 8956  O O   . HIS C 3 197 ? 107.328 101.570 140.384 1.00 446.14 ? 197 HIS C O   1 
ATOM 8957  C CB  . HIS C 3 197 ? 106.995 99.318  137.867 1.00 500.00 ? 197 HIS C CB  1 
ATOM 8958  C CG  . HIS C 3 197 ? 107.602 100.382 137.000 1.00 500.00 ? 197 HIS C CG  1 
ATOM 8959  N ND1 . HIS C 3 197 ? 108.114 101.565 137.496 1.00 500.00 ? 197 HIS C ND1 1 
ATOM 8960  C CD2 . HIS C 3 197 ? 107.755 100.444 135.657 1.00 500.00 ? 197 HIS C CD2 1 
ATOM 8961  C CE1 . HIS C 3 197 ? 108.566 102.301 136.497 1.00 500.00 ? 197 HIS C CE1 1 
ATOM 8962  N NE2 . HIS C 3 197 ? 108.357 101.645 135.370 1.00 500.00 ? 197 HIS C NE2 1 
ATOM 8963  N N   . LEU C 3 198 ? 105.499 100.194 140.384 1.00 460.27 ? 198 LEU C N   1 
ATOM 8964  C CA  . LEU C 3 198 ? 104.617 101.140 141.086 1.00 500.00 ? 198 LEU C CA  1 
ATOM 8965  C C   . LEU C 3 198 ? 105.210 101.486 142.448 1.00 500.00 ? 198 LEU C C   1 
ATOM 8966  O O   . LEU C 3 198 ? 105.265 102.651 142.856 1.00 500.00 ? 198 LEU C O   1 
ATOM 8967  C CB  . LEU C 3 198 ? 103.170 100.622 141.200 1.00 500.00 ? 198 LEU C CB  1 
ATOM 8968  C CG  . LEU C 3 198 ? 102.188 101.086 140.097 1.00 500.00 ? 198 LEU C CG  1 
ATOM 8969  C CD1 . LEU C 3 198 ? 102.358 100.283 138.816 1.00 500.00 ? 198 LEU C CD1 1 
ATOM 8970  C CD2 . LEU C 3 198 ? 100.733 101.024 140.569 1.00 500.00 ? 198 LEU C CD2 1 
ATOM 8971  N N   . LEU C 3 199 ? 105.683 100.444 143.137 1.00 435.02 ? 199 LEU C N   1 
ATOM 8972  C CA  . LEU C 3 199 ? 106.251 100.527 144.460 1.00 500.00 ? 199 LEU C CA  1 
ATOM 8973  C C   . LEU C 3 199 ? 107.448 101.401 144.416 1.00 460.60 ? 199 LEU C C   1 
ATOM 8974  O O   . LEU C 3 199 ? 107.531 102.186 145.360 1.00 399.80 ? 199 LEU C O   1 
ATOM 8975  C CB  . LEU C 3 199 ? 106.588 99.144  144.998 1.00 500.00 ? 199 LEU C CB  1 
ATOM 8976  C CG  . LEU C 3 199 ? 106.960 99.086  146.485 1.00 500.00 ? 199 LEU C CG  1 
ATOM 8977  C CD1 . LEU C 3 199 ? 106.034 99.916  147.388 1.00 500.00 ? 199 LEU C CD1 1 
ATOM 8978  C CD2 . LEU C 3 199 ? 106.990 97.624  146.924 1.00 500.00 ? 199 LEU C CD2 1 
ATOM 8979  N N   . THR C 3 200 ? 108.305 101.314 143.398 1.00 470.76 ? 200 THR C N   1 
ATOM 8980  C CA  . THR C 3 200 ? 109.498 102.147 143.323 1.00 495.67 ? 200 THR C CA  1 
ATOM 8981  C C   . THR C 3 200 ? 109.121 103.638 143.339 1.00 500.00 ? 200 THR C C   1 
ATOM 8982  O O   . THR C 3 200 ? 109.684 104.460 144.073 1.00 500.00 ? 200 THR C O   1 
ATOM 8983  C CB  . THR C 3 200 ? 110.313 101.904 142.047 1.00 500.00 ? 200 THR C CB  1 
ATOM 8984  O OG1 . THR C 3 200 ? 109.524 102.222 140.891 1.00 500.00 ? 200 THR C OG1 1 
ATOM 8985  C CG2 . THR C 3 200 ? 110.774 100.483 141.969 1.00 500.00 ? 200 THR C CG2 1 
ATOM 8986  N N   . SER C 3 201 ? 108.142 103.926 142.491 1.00 500.00 ? 201 SER C N   1 
ATOM 8987  C CA  . SER C 3 201 ? 107.607 105.289 142.331 1.00 488.02 ? 201 SER C CA  1 
ATOM 8988  C C   . SER C 3 201 ? 107.077 105.800 143.664 1.00 492.23 ? 201 SER C C   1 
ATOM 8989  O O   . SER C 3 201 ? 107.358 106.939 144.055 1.00 441.55 ? 201 SER C O   1 
ATOM 8990  C CB  . SER C 3 201 ? 106.583 105.369 141.203 1.00 493.00 ? 201 SER C CB  1 
ATOM 8991  O OG  . SER C 3 201 ? 107.238 105.240 139.953 1.00 451.45 ? 201 SER C OG  1 
ATOM 8992  N N   . GLY C 3 202 ? 106.319 104.933 144.328 1.00 493.11 ? 202 GLY C N   1 
ATOM 8993  C CA  . GLY C 3 202 ? 105.724 105.232 145.631 1.00 478.78 ? 202 GLY C CA  1 
ATOM 8994  C C   . GLY C 3 202 ? 106.810 105.606 146.638 1.00 469.58 ? 202 GLY C C   1 
ATOM 8995  O O   . GLY C 3 202 ? 106.701 106.602 147.368 1.00 464.79 ? 202 GLY C O   1 
ATOM 8996  N N   . LEU C 3 203 ? 107.845 104.781 146.642 1.00 474.63 ? 203 LEU C N   1 
ATOM 8997  C CA  . LEU C 3 203 ? 109.000 104.948 147.531 1.00 500.00 ? 203 LEU C CA  1 
ATOM 8998  C C   . LEU C 3 203 ? 109.641 106.309 147.301 1.00 480.44 ? 203 LEU C C   1 
ATOM 8999  O O   . LEU C 3 203 ? 109.945 107.052 148.254 1.00 452.95 ? 203 LEU C O   1 
ATOM 9000  C CB  . LEU C 3 203 ? 110.025 103.837 147.285 1.00 500.00 ? 203 LEU C CB  1 
ATOM 9001  C CG  . LEU C 3 203 ? 109.560 102.408 147.599 1.00 500.00 ? 203 LEU C CG  1 
ATOM 9002  C CD1 . LEU C 3 203 ? 110.449 101.355 146.942 1.00 500.00 ? 203 LEU C CD1 1 
ATOM 9003  C CD2 . LEU C 3 203 ? 109.464 102.177 149.102 1.00 500.00 ? 203 LEU C CD2 1 
ATOM 9004  N N   . THR C 3 204 ? 109.828 106.615 146.024 1.00 489.78 ? 204 THR C N   1 
ATOM 9005  C CA  . THR C 3 204 ? 110.435 107.875 145.583 1.00 500.00 ? 204 THR C CA  1 
ATOM 9006  C C   . THR C 3 204 ? 109.641 109.043 146.090 1.00 474.51 ? 204 THR C C   1 
ATOM 9007  O O   . THR C 3 204 ? 110.242 110.003 146.590 1.00 440.75 ? 204 THR C O   1 
ATOM 9008  C CB  . THR C 3 204 ? 110.588 107.979 144.046 1.00 500.00 ? 204 THR C CB  1 
ATOM 9009  O OG1 . THR C 3 204 ? 109.307 107.988 143.408 1.00 500.00 ? 204 THR C OG1 1 
ATOM 9010  C CG2 . THR C 3 204 ? 111.436 106.852 143.480 1.00 500.00 ? 204 THR C CG2 1 
ATOM 9011  N N   . PHE C 3 205 ? 108.307 108.942 145.958 1.00 444.25 ? 205 PHE C N   1 
ATOM 9012  C CA  . PHE C 3 205 ? 107.403 109.979 146.507 1.00 426.97 ? 205 PHE C CA  1 
ATOM 9013  C C   . PHE C 3 205 ? 107.725 110.385 147.929 1.00 450.53 ? 205 PHE C C   1 
ATOM 9014  O O   . PHE C 3 205 ? 107.713 111.552 148.219 1.00 414.52 ? 205 PHE C O   1 
ATOM 9015  C CB  . PHE C 3 205 ? 105.926 109.577 146.505 1.00 473.50 ? 205 PHE C CB  1 
ATOM 9016  C CG  . PHE C 3 205 ? 105.347 109.298 145.149 1.00 500.00 ? 205 PHE C CG  1 
ATOM 9017  C CD1 . PHE C 3 205 ? 105.799 109.951 144.007 1.00 500.00 ? 205 PHE C CD1 1 
ATOM 9018  C CD2 . PHE C 3 205 ? 104.298 108.406 145.026 1.00 500.00 ? 205 PHE C CD2 1 
ATOM 9019  C CE1 . PHE C 3 205 ? 105.248 109.697 142.761 1.00 500.00 ? 205 PHE C CE1 1 
ATOM 9020  C CE2 . PHE C 3 205 ? 103.736 108.141 143.788 1.00 500.00 ? 205 PHE C CE2 1 
ATOM 9021  C CZ  . PHE C 3 205 ? 104.211 108.788 142.656 1.00 500.00 ? 205 PHE C CZ  1 
ATOM 9022  N N   . LEU C 3 206 ? 108.064 109.398 148.753 1.00 500.00 ? 206 LEU C N   1 
ATOM 9023  C CA  . LEU C 3 206 ? 108.440 109.594 150.153 1.00 500.00 ? 206 LEU C CA  1 
ATOM 9024  C C   . LEU C 3 206 ? 109.939 109.917 150.260 1.00 500.00 ? 206 LEU C C   1 
ATOM 9025  O O   . LEU C 3 206 ? 110.702 109.178 150.892 1.00 500.00 ? 206 LEU C O   1 
ATOM 9026  C CB  . LEU C 3 206 ? 108.091 108.327 150.953 1.00 500.00 ? 206 LEU C CB  1 
ATOM 9027  C CG  . LEU C 3 206 ? 106.610 107.963 151.227 1.00 500.00 ? 206 LEU C CG  1 
ATOM 9028  C CD1 . LEU C 3 206 ? 105.626 107.969 150.051 1.00 500.00 ? 206 LEU C CD1 1 
ATOM 9029  C CD2 . LEU C 3 206 ? 106.584 106.589 151.890 1.00 500.00 ? 206 LEU C CD2 1 
ATOM 9030  N N   . ASN C 3 207 ? 110.346 111.042 149.664 1.00 500.00 ? 207 ASN C N   1 
ATOM 9031  C CA  . ASN C 3 207 ? 111.767 111.277 149.347 1.00 500.00 ? 207 ASN C CA  1 
ATOM 9032  C C   . ASN C 3 207 ? 112.685 111.788 150.464 1.00 500.00 ? 207 ASN C C   1 
ATOM 9033  O O   . ASN C 3 207 ? 113.697 111.142 150.752 1.00 440.48 ? 207 ASN C O   1 
ATOM 9034  C CB  . ASN C 3 207 ? 111.918 112.179 148.116 1.00 500.00 ? 207 ASN C CB  1 
ATOM 9035  C CG  . ASN C 3 207 ? 113.136 111.814 147.303 1.00 500.00 ? 207 ASN C CG  1 
ATOM 9036  O OD1 . ASN C 3 207 ? 114.270 112.126 147.684 1.00 500.00 ? 207 ASN C OD1 1 
ATOM 9037  N ND2 . ASN C 3 207 ? 112.916 111.114 146.196 1.00 500.00 ? 207 ASN C ND2 1 
ATOM 9038  N N   . PRO C 3 208 ? 112.362 112.951 151.072 1.00 472.76 ? 208 PRO C N   1 
ATOM 9039  C CA  . PRO C 3 208 ? 113.229 113.524 152.116 1.00 467.16 ? 208 PRO C CA  1 
ATOM 9040  C C   . PRO C 3 208 ? 113.568 112.560 153.253 1.00 500.00 ? 208 PRO C C   1 
ATOM 9041  O O   . PRO C 3 208 ? 114.663 112.636 153.817 1.00 500.00 ? 208 PRO C O   1 
ATOM 9042  C CB  . PRO C 3 208 ? 112.405 114.696 152.653 1.00 467.72 ? 208 PRO C CB  1 
ATOM 9043  C CG  . PRO C 3 208 ? 111.497 115.053 151.530 1.00 500.00 ? 208 PRO C CG  1 
ATOM 9044  C CD  . PRO C 3 208 ? 111.130 113.748 150.909 1.00 476.83 ? 208 PRO C CD  1 
ATOM 9045  N N   . TRP C 3 209 ? 112.628 111.672 153.580 1.00 500.00 ? 209 TRP C N   1 
ATOM 9046  C CA  . TRP C 3 209 ? 112.870 110.557 154.493 1.00 500.00 ? 209 TRP C CA  1 
ATOM 9047  C C   . TRP C 3 209 ? 113.598 109.454 153.689 1.00 500.00 ? 209 TRP C C   1 
ATOM 9048  O O   . TRP C 3 209 ? 113.003 108.841 152.799 1.00 450.89 ? 209 TRP C O   1 
ATOM 9049  C CB  . TRP C 3 209 ? 111.527 110.091 155.098 1.00 492.09 ? 209 TRP C CB  1 
ATOM 9050  C CG  . TRP C 3 209 ? 111.602 109.351 156.427 1.00 500.00 ? 209 TRP C CG  1 
ATOM 9051  C CD1 . TRP C 3 209 ? 112.724 109.075 157.180 1.00 500.00 ? 209 TRP C CD1 1 
ATOM 9052  C CD2 . TRP C 3 209 ? 110.490 108.828 157.169 1.00 500.00 ? 209 TRP C CD2 1 
ATOM 9053  N NE1 . TRP C 3 209 ? 112.374 108.395 158.324 1.00 477.55 ? 209 TRP C NE1 1 
ATOM 9054  C CE2 . TRP C 3 209 ? 111.012 108.230 158.347 1.00 500.00 ? 209 TRP C CE2 1 
ATOM 9055  C CE3 . TRP C 3 209 ? 109.101 108.793 156.948 1.00 500.00 ? 209 TRP C CE3 1 
ATOM 9056  C CZ2 . TRP C 3 209 ? 110.190 107.602 159.302 1.00 500.00 ? 209 TRP C CZ2 1 
ATOM 9057  C CZ3 . TRP C 3 209 ? 108.282 108.168 157.901 1.00 496.39 ? 209 TRP C CZ3 1 
ATOM 9058  C CH2 . TRP C 3 209 ? 108.834 107.583 159.062 1.00 488.75 ? 209 TRP C CH2 1 
ATOM 9059  N N   . TYR C 3 210 ? 114.889 109.235 153.992 1.00 500.00 ? 210 TYR C N   1 
ATOM 9060  C CA  . TYR C 3 210 ? 115.799 108.436 153.133 1.00 496.13 ? 210 TYR C CA  1 
ATOM 9061  C C   . TYR C 3 210 ? 116.055 106.990 153.560 1.00 500.00 ? 210 TYR C C   1 
ATOM 9062  O O   . TYR C 3 210 ? 116.392 106.166 152.700 1.00 440.49 ? 210 TYR C O   1 
ATOM 9063  C CB  . TYR C 3 210 ? 117.142 109.159 152.920 1.00 486.35 ? 210 TYR C CB  1 
ATOM 9064  C CG  . TYR C 3 210 ? 117.076 110.249 151.873 1.00 500.00 ? 210 TYR C CG  1 
ATOM 9065  C CD1 . TYR C 3 210 ? 116.680 109.962 150.559 1.00 500.00 ? 210 TYR C CD1 1 
ATOM 9066  C CD2 . TYR C 3 210 ? 117.406 111.567 152.183 1.00 500.00 ? 210 TYR C CD2 1 
ATOM 9067  C CE1 . TYR C 3 210 ? 116.606 110.956 149.592 1.00 500.00 ? 210 TYR C CE1 1 
ATOM 9068  C CE2 . TYR C 3 210 ? 117.338 112.567 151.218 1.00 500.00 ? 210 TYR C CE2 1 
ATOM 9069  C CZ  . TYR C 3 210 ? 116.939 112.255 149.925 1.00 500.00 ? 210 TYR C CZ  1 
ATOM 9070  O OH  . TYR C 3 210 ? 116.872 113.236 148.966 1.00 500.00 ? 210 TYR C OH  1 
ATOM 9071  N N   . GLU C 3 211 ? 115.923 106.667 154.854 1.00 500.00 ? 211 GLU C N   1 
ATOM 9072  C CA  . GLU C 3 211 ? 115.711 105.254 155.250 1.00 500.00 ? 211 GLU C CA  1 
ATOM 9073  C C   . GLU C 3 211 ? 114.423 104.805 154.558 1.00 500.00 ? 211 GLU C C   1 
ATOM 9074  O O   . GLU C 3 211 ? 114.385 103.740 153.930 1.00 500.00 ? 211 GLU C O   1 
ATOM 9075  C CB  . GLU C 3 211 ? 115.583 105.032 156.779 1.00 500.00 ? 211 GLU C CB  1 
ATOM 9076  C CG  . GLU C 3 211 ? 115.479 103.537 157.222 1.00 500.00 ? 211 GLU C CG  1 
ATOM 9077  C CD  . GLU C 3 211 ? 114.071 103.028 157.638 1.00 500.00 ? 211 GLU C CD  1 
ATOM 9078  O OE1 . GLU C 3 211 ? 113.310 103.778 158.293 1.00 496.61 ? 211 GLU C OE1 1 
ATOM 9079  O OE2 . GLU C 3 211 ? 113.724 101.849 157.349 1.00 316.84 ? 211 GLU C OE2 1 
ATOM 9080  N N   . ALA C 3 212 ? 113.389 105.654 154.651 1.00 500.00 ? 212 ALA C N   1 
ATOM 9081  C CA  . ALA C 3 212 ? 112.087 105.432 153.998 1.00 500.00 ? 212 ALA C CA  1 
ATOM 9082  C C   . ALA C 3 212 ? 112.087 105.843 152.520 1.00 500.00 ? 212 ALA C C   1 
ATOM 9083  O O   . ALA C 3 212 ? 111.124 106.450 152.029 1.00 500.00 ? 212 ALA C O   1 
ATOM 9084  C CB  . ALA C 3 212 ? 110.977 106.161 154.763 1.00 500.00 ? 212 ALA C CB  1 
ATOM 9085  N N   . SER C 3 213 ? 113.173 105.524 151.821 1.00 500.00 ? 213 SER C N   1 
ATOM 9086  C CA  . SER C 3 213 ? 113.180 105.524 150.349 1.00 490.01 ? 213 SER C CA  1 
ATOM 9087  C C   . SER C 3 213 ? 114.308 104.677 149.653 1.00 453.49 ? 213 SER C C   1 
ATOM 9088  O O   . SER C 3 213 ? 114.046 103.619 149.057 1.00 472.51 ? 213 SER C O   1 
ATOM 9089  C CB  . SER C 3 213 ? 113.272 106.977 149.844 1.00 487.49 ? 213 SER C CB  1 
ATOM 9090  O OG  . SER C 3 213 ? 113.800 107.055 148.525 1.00 439.14 ? 213 SER C OG  1 
ATOM 9091  N N   . LEU C 3 214 ? 115.500 105.265 149.704 1.00 456.46 ? 214 LEU C N   1 
ATOM 9092  C CA  . LEU C 3 214 ? 116.568 104.905 148.766 1.00 500.00 ? 214 LEU C CA  1 
ATOM 9093  C C   . LEU C 3 214 ? 116.988 103.482 149.005 1.00 500.00 ? 214 LEU C C   1 
ATOM 9094  O O   . LEU C 3 214 ? 117.144 102.706 148.039 1.00 444.72 ? 214 LEU C O   1 
ATOM 9095  C CB  . LEU C 3 214 ? 117.793 105.806 148.939 1.00 500.00 ? 214 LEU C CB  1 
ATOM 9096  C CG  . LEU C 3 214 ? 118.892 105.575 147.880 1.00 500.00 ? 214 LEU C CG  1 
ATOM 9097  C CD1 . LEU C 3 214 ? 118.617 106.426 146.639 1.00 500.00 ? 214 LEU C CD1 1 
ATOM 9098  C CD2 . LEU C 3 214 ? 120.297 105.804 148.442 1.00 500.00 ? 214 LEU C CD2 1 
ATOM 9099  N N   . LEU C 3 215 ? 117.197 103.155 150.282 1.00 500.00 ? 215 LEU C N   1 
ATOM 9100  C CA  . LEU C 3 215 ? 117.647 101.803 150.674 1.00 500.00 ? 215 LEU C CA  1 
ATOM 9101  C C   . LEU C 3 215 ? 116.631 100.773 150.219 1.00 492.45 ? 215 LEU C C   1 
ATOM 9102  O O   . LEU C 3 215 ? 117.020 99.731  149.669 1.00 474.34 ? 215 LEU C O   1 
ATOM 9103  C CB  . LEU C 3 215 ? 117.991 101.651 152.179 1.00 500.00 ? 215 LEU C CB  1 
ATOM 9104  C CG  . LEU C 3 215 ? 119.503 101.561 152.526 1.00 500.00 ? 215 LEU C CG  1 
ATOM 9105  C CD1 . LEU C 3 215 ? 120.186 102.937 152.464 1.00 500.00 ? 215 LEU C CD1 1 
ATOM 9106  C CD2 . LEU C 3 215 ? 119.756 100.895 153.882 1.00 500.00 ? 215 LEU C CD2 1 
ATOM 9107  N N   . PRO C 3 216 ? 115.349 101.088 150.451 1.00 436.79 ? 216 PRO C N   1 
ATOM 9108  C CA  . PRO C 3 216 ? 114.252 100.204 150.062 1.00 462.68 ? 216 PRO C CA  1 
ATOM 9109  C C   . PRO C 3 216 ? 114.284 99.935  148.565 1.00 475.54 ? 216 PRO C C   1 
ATOM 9110  O O   . PRO C 3 216 ? 114.157 98.777  148.120 1.00 500.00 ? 216 PRO C O   1 
ATOM 9111  C CB  . PRO C 3 216 ? 113.003 100.978 150.468 1.00 461.20 ? 216 PRO C CB  1 
ATOM 9112  C CG  . PRO C 3 216 ? 113.436 101.831 151.605 1.00 457.36 ? 216 PRO C CG  1 
ATOM 9113  C CD  . PRO C 3 216 ? 114.931 101.939 151.586 1.00 420.85 ? 216 PRO C CD  1 
ATOM 9114  N N   . ILE C 3 217 ? 114.463 101.024 147.824 1.00 475.34 ? 217 ILE C N   1 
ATOM 9115  C CA  . ILE C 3 217 ? 114.518 100.972 146.357 1.00 480.63 ? 217 ILE C CA  1 
ATOM 9116  C C   . ILE C 3 217 ? 115.649 100.055 145.908 1.00 459.35 ? 217 ILE C C   1 
ATOM 9117  O O   . ILE C 3 217 ? 115.464 99.211  145.019 1.00 430.70 ? 217 ILE C O   1 
ATOM 9118  C CB  . ILE C 3 217 ? 114.536 102.359 145.693 1.00 494.28 ? 217 ILE C CB  1 
ATOM 9119  C CG1 . ILE C 3 217 ? 113.176 103.031 145.916 1.00 498.52 ? 217 ILE C CG1 1 
ATOM 9120  C CG2 . ILE C 3 217 ? 114.796 102.243 144.193 1.00 478.18 ? 217 ILE C CG2 1 
ATOM 9121  C CD1 . ILE C 3 217 ? 113.205 104.532 145.819 1.00 500.00 ? 217 ILE C CD1 1 
ATOM 9122  N N   . TYR C 3 218 ? 116.797 100.242 146.542 1.00 466.14 ? 218 TYR C N   1 
ATOM 9123  C CA  . TYR C 3 218 ? 118.003 99.458  146.257 1.00 494.19 ? 218 TYR C CA  1 
ATOM 9124  C C   . TYR C 3 218 ? 117.729 97.977  146.469 1.00 468.14 ? 218 TYR C C   1 
ATOM 9125  O O   . TYR C 3 218 ? 118.087 97.143  145.629 1.00 443.08 ? 218 TYR C O   1 
ATOM 9126  C CB  . TYR C 3 218 ? 119.189 99.952  147.094 1.00 500.00 ? 218 TYR C CB  1 
ATOM 9127  C CG  . TYR C 3 218 ? 120.201 100.642 146.233 1.00 500.00 ? 218 TYR C CG  1 
ATOM 9128  C CD1 . TYR C 3 218 ? 120.021 101.962 145.820 1.00 500.00 ? 218 TYR C CD1 1 
ATOM 9129  C CD2 . TYR C 3 218 ? 121.316 99.952  145.776 1.00 500.00 ? 218 TYR C CD2 1 
ATOM 9130  C CE1 . TYR C 3 218 ? 120.954 102.584 144.998 1.00 500.00 ? 218 TYR C CE1 1 
ATOM 9131  C CE2 . TYR C 3 218 ? 122.251 100.555 144.953 1.00 500.00 ? 218 TYR C CE2 1 
ATOM 9132  C CZ  . TYR C 3 218 ? 122.076 101.868 144.567 1.00 500.00 ? 218 TYR C CZ  1 
ATOM 9133  O OH  . TYR C 3 218 ? 123.036 102.423 143.751 1.00 500.00 ? 218 TYR C OH  1 
ATOM 9134  N N   . ALA C 3 219 ? 117.092 97.693  147.596 1.00 490.78 ? 219 ALA C N   1 
ATOM 9135  C CA  . ALA C 3 219 ? 116.735 96.323  147.986 1.00 500.00 ? 219 ALA C CA  1 
ATOM 9136  C C   . ALA C 3 219 ? 115.853 95.689  146.910 1.00 485.09 ? 219 ALA C C   1 
ATOM 9137  O O   . ALA C 3 219 ? 116.082 94.541  146.490 1.00 500.00 ? 219 ALA C O   1 
ATOM 9138  C CB  . ALA C 3 219 ? 116.045 96.290  149.344 1.00 500.00 ? 219 ALA C CB  1 
ATOM 9139  N N   . VAL C 3 220 ? 114.860 96.470  146.493 1.00 435.59 ? 220 VAL C N   1 
ATOM 9140  C CA  . VAL C 3 220 ? 113.901 96.041  145.472 1.00 442.19 ? 220 VAL C CA  1 
ATOM 9141  C C   . VAL C 3 220 ? 114.634 95.684  144.180 1.00 478.84 ? 220 VAL C C   1 
ATOM 9142  O O   . VAL C 3 220 ? 114.370 94.639  143.563 1.00 422.73 ? 220 VAL C O   1 
ATOM 9143  C CB  . VAL C 3 220 ? 112.746 97.036  145.238 1.00 470.02 ? 220 VAL C CB  1 
ATOM 9144  C CG1 . VAL C 3 220 ? 111.835 96.545  144.105 1.00 455.23 ? 220 VAL C CG1 1 
ATOM 9145  C CG2 . VAL C 3 220 ? 111.942 97.227  146.524 1.00 500.00 ? 220 VAL C CG2 1 
ATOM 9146  N N   . THR C 3 221 ? 115.549 96.569  143.808 1.00 500.00 ? 221 THR C N   1 
ATOM 9147  C CA  . THR C 3 221 ? 116.367 96.410  142.600 1.00 500.00 ? 221 THR C CA  1 
ATOM 9148  C C   . THR C 3 221 ? 117.146 95.114  142.659 1.00 500.00 ? 221 THR C C   1 
ATOM 9149  O O   . THR C 3 221 ? 117.189 94.351  141.689 1.00 500.00 ? 221 THR C O   1 
ATOM 9150  C CB  . THR C 3 221 ? 117.407 97.542  142.401 1.00 500.00 ? 221 THR C CB  1 
ATOM 9151  O OG1 . THR C 3 221 ? 116.832 98.812  142.730 1.00 500.00 ? 221 THR C OG1 1 
ATOM 9152  C CG2 . THR C 3 221 ? 117.912 97.562  140.952 1.00 477.09 ? 221 THR C CG2 1 
ATOM 9153  N N   . VAL C 3 222 ? 117.755 94.892  143.814 1.00 500.00 ? 222 VAL C N   1 
ATOM 9154  C CA  . VAL C 3 222 ? 118.564 93.694  144.088 1.00 500.00 ? 222 VAL C CA  1 
ATOM 9155  C C   . VAL C 3 222 ? 117.715 92.444  143.886 1.00 500.00 ? 222 VAL C C   1 
ATOM 9156  O O   . VAL C 3 222 ? 118.148 91.482  143.215 1.00 478.95 ? 222 VAL C O   1 
ATOM 9157  C CB  . VAL C 3 222 ? 119.100 93.715  145.563 1.00 500.00 ? 222 VAL C CB  1 
ATOM 9158  C CG1 . VAL C 3 222 ? 119.615 92.345  146.024 1.00 500.00 ? 222 VAL C CG1 1 
ATOM 9159  C CG2 . VAL C 3 222 ? 120.173 94.792  145.747 1.00 500.00 ? 222 VAL C CG2 1 
ATOM 9160  N N   . SER C 3 223 ? 116.527 92.494  144.469 1.00 500.00 ? 223 SER C N   1 
ATOM 9161  C CA  . SER C 3 223 ? 115.565 91.388  144.393 1.00 500.00 ? 223 SER C CA  1 
ATOM 9162  C C   . SER C 3 223 ? 115.236 91.071  142.921 1.00 500.00 ? 223 SER C C   1 
ATOM 9163  O O   . SER C 3 223 ? 115.264 89.921  142.428 1.00 500.00 ? 223 SER C O   1 
ATOM 9164  C CB  . SER C 3 223 ? 114.273 91.721  145.160 1.00 500.00 ? 223 SER C CB  1 
ATOM 9165  O OG  . SER C 3 223 ? 113.324 90.660  145.097 1.00 500.00 ? 223 SER C OG  1 
ATOM 9166  N N   . MET C 3 224 ? 114.927 92.169  142.237 1.00 450.20 ? 224 MET C N   1 
ATOM 9167  C CA  . MET C 3 224 ? 114.558 92.134  140.806 1.00 479.84 ? 224 MET C CA  1 
ATOM 9168  C C   . MET C 3 224 ? 115.716 91.583  140.016 1.00 500.00 ? 224 MET C C   1 
ATOM 9169  O O   . MET C 3 224 ? 115.477 90.747  139.136 1.00 500.00 ? 224 MET C O   1 
ATOM 9170  C CB  . MET C 3 224 ? 114.126 93.507  140.284 1.00 489.17 ? 224 MET C CB  1 
ATOM 9171  C CG  . MET C 3 224 ? 112.972 93.439  139.285 1.00 500.00 ? 224 MET C CG  1 
ATOM 9172  S SD  . MET C 3 224 ? 111.382 92.827  139.911 1.00 500.00 ? 224 MET C SD  1 
ATOM 9173  C CE  . MET C 3 224 ? 111.271 93.615  141.520 1.00 500.00 ? 224 MET C CE  1 
ATOM 9174  N N   . GLY C 3 225 ? 116.932 92.027  140.332 1.00 500.00 ? 225 GLY C N   1 
ATOM 9175  C CA  . GLY C 3 225 ? 118.144 91.564  139.656 1.00 500.00 ? 225 GLY C CA  1 
ATOM 9176  C C   . GLY C 3 225 ? 118.279 90.054  139.779 1.00 481.58 ? 225 GLY C C   1 
ATOM 9177  O O   . GLY C 3 225 ? 118.550 89.350  138.791 1.00 431.94 ? 225 GLY C O   1 
ATOM 9178  N N   . LEU C 3 226 ? 118.079 89.593  141.007 1.00 477.38 ? 226 LEU C N   1 
ATOM 9179  C CA  . LEU C 3 226 ? 118.172 88.166  141.343 1.00 500.00 ? 226 LEU C CA  1 
ATOM 9180  C C   . LEU C 3 226 ? 117.172 87.370  140.500 1.00 485.98 ? 226 LEU C C   1 
ATOM 9181  O O   . LEU C 3 226 ? 117.518 86.323  139.922 1.00 470.69 ? 226 LEU C O   1 
ATOM 9182  C CB  . LEU C 3 226 ? 118.004 87.932  142.858 1.00 500.00 ? 226 LEU C CB  1 
ATOM 9183  C CG  . LEU C 3 226 ? 118.857 86.835  143.526 1.00 500.00 ? 226 LEU C CG  1 
ATOM 9184  C CD1 . LEU C 3 226 ? 120.350 87.151  143.487 1.00 500.00 ? 226 LEU C CD1 1 
ATOM 9185  C CD2 . LEU C 3 226 ? 118.413 86.618  144.970 1.00 500.00 ? 226 LEU C CD2 1 
ATOM 9186  N N   . TRP C 3 227 ? 115.954 87.901  140.451 1.00 492.82 ? 227 TRP C N   1 
ATOM 9187  C CA  . TRP C 3 227 ? 114.860 87.282  139.705 1.00 476.76 ? 227 TRP C CA  1 
ATOM 9188  C C   . TRP C 3 227 ? 115.236 87.148  138.227 1.00 459.93 ? 227 TRP C C   1 
ATOM 9189  O O   . TRP C 3 227 ? 115.039 86.087  137.613 1.00 455.13 ? 227 TRP C O   1 
ATOM 9190  C CB  . TRP C 3 227 ? 113.519 87.985  139.943 1.00 443.33 ? 227 TRP C CB  1 
ATOM 9191  C CG  . TRP C 3 227 ? 112.359 87.047  139.927 1.00 467.08 ? 227 TRP C CG  1 
ATOM 9192  C CD1 . TRP C 3 227 ? 112.386 85.669  140.025 1.00 461.69 ? 227 TRP C CD1 1 
ATOM 9193  C CD2 . TRP C 3 227 ? 110.986 87.408  139.842 1.00 500.00 ? 227 TRP C CD2 1 
ATOM 9194  N NE1 . TRP C 3 227 ? 111.115 85.167  139.980 1.00 500.00 ? 227 TRP C NE1 1 
ATOM 9195  C CE2 . TRP C 3 227 ? 110.231 86.209  139.871 1.00 500.00 ? 227 TRP C CE2 1 
ATOM 9196  C CE3 . TRP C 3 227 ? 110.312 88.633  139.730 1.00 500.00 ? 227 TRP C CE3 1 
ATOM 9197  C CZ2 . TRP C 3 227 ? 108.831 86.196  139.794 1.00 500.00 ? 227 TRP C CZ2 1 
ATOM 9198  C CZ3 . TRP C 3 227 ? 108.915 88.623  139.653 1.00 500.00 ? 227 TRP C CZ3 1 
ATOM 9199  C CH2 . TRP C 3 227 ? 108.192 87.408  139.686 1.00 500.00 ? 227 TRP C CH2 1 
ATOM 9200  N N   . ALA C 3 228 ? 115.781 88.236  137.703 1.00 493.97 ? 228 ALA C N   1 
ATOM 9201  C CA  . ALA C 3 228 ? 116.216 88.312  136.306 1.00 500.00 ? 228 ALA C CA  1 
ATOM 9202  C C   . ALA C 3 228 ? 117.252 87.235  136.020 1.00 495.91 ? 228 ALA C C   1 
ATOM 9203  O O   . ALA C 3 228 ? 117.172 86.526  135.005 1.00 451.37 ? 228 ALA C O   1 
ATOM 9204  C CB  . ALA C 3 228 ? 116.768 89.690  135.975 1.00 500.00 ? 228 ALA C CB  1 
ATOM 9205  N N   . PHE C 3 229 ? 118.209 87.138  136.936 1.00 474.34 ? 229 PHE C N   1 
ATOM 9206  C CA  . PHE C 3 229 ? 119.300 86.162  136.845 1.00 500.00 ? 229 PHE C CA  1 
ATOM 9207  C C   . PHE C 3 229 ? 118.734 84.750  136.777 1.00 500.00 ? 229 PHE C C   1 
ATOM 9208  O O   . PHE C 3 229 ? 119.152 83.935  135.944 1.00 458.24 ? 229 PHE C O   1 
ATOM 9209  C CB  . PHE C 3 229 ? 120.288 86.293  138.007 1.00 500.00 ? 229 PHE C CB  1 
ATOM 9210  C CG  . PHE C 3 229 ? 121.355 85.240  137.990 1.00 500.00 ? 229 PHE C CG  1 
ATOM 9211  C CD1 . PHE C 3 229 ? 122.459 85.376  137.162 1.00 500.00 ? 229 PHE C CD1 1 
ATOM 9212  C CD2 . PHE C 3 229 ? 121.235 84.084  138.767 1.00 500.00 ? 229 PHE C CD2 1 
ATOM 9213  C CE1 . PHE C 3 229 ? 123.440 84.391  137.121 1.00 500.00 ? 229 PHE C CE1 1 
ATOM 9214  C CE2 . PHE C 3 229 ? 122.213 83.097  138.731 1.00 500.00 ? 229 PHE C CE2 1 
ATOM 9215  C CZ  . PHE C 3 229 ? 123.317 83.250  137.907 1.00 500.00 ? 229 PHE C CZ  1 
ATOM 9216  N N   . ILE C 3 230 ? 117.785 84.499  137.672 1.00 500.00 ? 230 ILE C N   1 
ATOM 9217  C CA  . ILE C 3 230 ? 117.111 83.199  137.777 1.00 500.00 ? 230 ILE C CA  1 
ATOM 9218  C C   . ILE C 3 230 ? 116.451 82.847  136.444 1.00 500.00 ? 230 ILE C C   1 
ATOM 9219  O O   . ILE C 3 230 ? 116.586 81.716  135.940 1.00 500.00 ? 230 ILE C O   1 
ATOM 9220  C CB  . ILE C 3 230 ? 116.000 83.148  138.884 1.00 500.00 ? 230 ILE C CB  1 
ATOM 9221  C CG1 . ILE C 3 230 ? 116.606 83.172  140.295 1.00 500.00 ? 230 ILE C CG1 1 
ATOM 9222  C CG2 . ILE C 3 230 ? 115.117 81.895  138.750 1.00 500.00 ? 230 ILE C CG2 1 
ATOM 9223  C CD1 . ILE C 3 230 ? 115.618 83.536  141.395 1.00 500.00 ? 230 ILE C CD1 1 
ATOM 9224  N N   . THR C 3 231 ? 115.749 83.840  135.907 1.00 500.00 ? 231 THR C N   1 
ATOM 9225  C CA  . THR C 3 231 ? 115.033 83.697  134.637 1.00 500.00 ? 231 THR C CA  1 
ATOM 9226  C C   . THR C 3 231 ? 116.003 83.322  133.522 1.00 500.00 ? 231 THR C C   1 
ATOM 9227  O O   . THR C 3 231 ? 115.735 82.412  132.727 1.00 500.00 ? 231 THR C O   1 
ATOM 9228  C CB  . THR C 3 231 ? 114.124 84.884  134.264 1.00 500.00 ? 231 THR C CB  1 
ATOM 9229  O OG1 . THR C 3 231 ? 114.829 86.113  134.434 1.00 500.00 ? 231 THR C OG1 1 
ATOM 9230  C CG2 . THR C 3 231 ? 112.868 84.884  135.130 1.00 500.00 ? 231 THR C CG2 1 
ATOM 9231  N N   . ALA C 3 232 ? 117.125 84.033  133.506 1.00 494.94 ? 232 ALA C N   1 
ATOM 9232  C CA  . ALA C 3 232 ? 118.182 83.829  132.515 1.00 482.14 ? 232 ALA C CA  1 
ATOM 9233  C C   . ALA C 3 232 ? 118.867 82.451  132.549 1.00 500.00 ? 232 ALA C C   1 
ATOM 9234  O O   . ALA C 3 232 ? 118.842 81.702  131.563 1.00 500.00 ? 232 ALA C O   1 
ATOM 9235  C CB  . ALA C 3 232 ? 119.223 84.934  132.631 1.00 475.58 ? 232 ALA C CB  1 
ATOM 9236  N N   . GLY C 3 233 ? 119.462 82.141  133.705 1.00 500.00 ? 233 GLY C N   1 
ATOM 9237  C CA  . GLY C 3 233 ? 120.389 81.006  133.855 1.00 500.00 ? 233 GLY C CA  1 
ATOM 9238  C C   . GLY C 3 233 ? 120.208 80.130  135.083 1.00 500.00 ? 233 GLY C C   1 
ATOM 9239  O O   . GLY C 3 233 ? 119.107 80.039  135.639 1.00 500.00 ? 233 GLY C O   1 
ATOM 9240  N N   . GLY C 3 234 ? 121.304 79.486  135.505 1.00 500.00 ? 234 GLY C N   1 
ATOM 9241  C CA  . GLY C 3 234 ? 121.299 78.525  136.621 1.00 500.00 ? 234 GLY C CA  1 
ATOM 9242  C C   . GLY C 3 234 ? 121.238 79.173  137.994 1.00 500.00 ? 234 GLY C C   1 
ATOM 9243  O O   . GLY C 3 234 ? 120.833 80.335  138.115 1.00 500.00 ? 234 GLY C O   1 
ATOM 9244  N N   . SER C 3 235 ? 121.618 78.419  139.031 1.00 500.00 ? 235 SER C N   1 
ATOM 9245  C CA  . SER C 3 235 ? 121.664 78.941  140.415 1.00 500.00 ? 235 SER C CA  1 
ATOM 9246  C C   . SER C 3 235 ? 123.131 79.024  140.931 1.00 500.00 ? 235 SER C C   1 
ATOM 9247  O O   . SER C 3 235 ? 123.940 79.733  140.323 1.00 482.35 ? 235 SER C O   1 
ATOM 9248  C CB  . SER C 3 235 ? 120.653 78.211  141.359 1.00 492.82 ? 235 SER C CB  1 
ATOM 9249  O OG  . SER C 3 235 ? 120.774 76.792  141.391 1.00 362.55 ? 235 SER C OG  1 
ATOM 9250  N N   . LEU C 3 236 ? 123.470 78.315  142.016 1.00 500.00 ? 236 LEU C N   1 
ATOM 9251  C CA  . LEU C 3 236 ? 124.776 78.447  142.698 1.00 500.00 ? 236 LEU C CA  1 
ATOM 9252  C C   . LEU C 3 236 ? 125.888 77.726  141.955 1.00 500.00 ? 236 LEU C C   1 
ATOM 9253  O O   . LEU C 3 236 ? 127.050 78.161  142.001 1.00 500.00 ? 236 LEU C O   1 
ATOM 9254  C CB  . LEU C 3 236 ? 124.699 77.903  144.141 1.00 500.00 ? 236 LEU C CB  1 
ATOM 9255  C CG  . LEU C 3 236 ? 123.662 78.533  145.092 1.00 500.00 ? 236 LEU C CG  1 
ATOM 9256  C CD1 . LEU C 3 236 ? 123.441 77.651  146.318 1.00 500.00 ? 236 LEU C CD1 1 
ATOM 9257  C CD2 . LEU C 3 236 ? 124.049 79.956  145.496 1.00 500.00 ? 236 LEU C CD2 1 
ATOM 9258  N N   . ARG C 3 237 ? 125.524 76.600  141.321 1.00 500.00 ? 237 ARG C N   1 
ATOM 9259  C CA  . ARG C 3 237 ? 126.475 75.772  140.595 1.00 500.00 ? 237 ARG C CA  1 
ATOM 9260  C C   . ARG C 3 237 ? 127.152 76.584  139.497 1.00 500.00 ? 237 ARG C C   1 
ATOM 9261  O O   . ARG C 3 237 ? 128.380 76.506  139.347 1.00 500.00 ? 237 ARG C O   1 
ATOM 9262  C CB  . ARG C 3 237 ? 125.846 74.468  140.072 1.00 500.00 ? 237 ARG C CB  1 
ATOM 9263  C CG  . ARG C 3 237 ? 125.667 73.418  141.174 1.00 500.00 ? 237 ARG C CG  1 
ATOM 9264  C CD  . ARG C 3 237 ? 124.376 72.609  141.035 1.00 500.00 ? 237 ARG C CD  1 
ATOM 9265  N NE  . ARG C 3 237 ? 123.985 71.941  142.290 1.00 500.00 ? 237 ARG C NE  1 
ATOM 9266  C CZ  . ARG C 3 237 ? 122.827 71.299  142.507 1.00 500.00 ? 237 ARG C CZ  1 
ATOM 9267  N NH1 . ARG C 3 237 ? 121.894 71.209  141.555 1.00 500.00 ? 237 ARG C NH1 1 
ATOM 9268  N NH2 . ARG C 3 237 ? 122.597 70.735  143.695 1.00 500.00 ? 237 ARG C NH2 1 
ATOM 9269  N N   . SER C 3 238 ? 126.342 77.350  138.771 1.00 500.00 ? 238 SER C N   1 
ATOM 9270  C CA  . SER C 3 238 ? 126.823 78.199  137.685 1.00 500.00 ? 238 SER C CA  1 
ATOM 9271  C C   . SER C 3 238 ? 127.873 79.187  138.207 1.00 500.00 ? 238 SER C C   1 
ATOM 9272  O O   . SER C 3 238 ? 128.944 79.367  137.608 1.00 441.93 ? 238 SER C O   1 
ATOM 9273  C CB  . SER C 3 238 ? 125.643 78.926  136.986 1.00 500.00 ? 238 SER C CB  1 
ATOM 9274  O OG  . SER C 3 238 ? 124.554 79.190  137.866 1.00 428.29 ? 238 SER C OG  1 
ATOM 9275  N N   . ILE C 3 239 ? 127.517 79.800  139.329 1.00 500.00 ? 239 ILE C N   1 
ATOM 9276  C CA  . ILE C 3 239 ? 128.370 80.789  140.000 1.00 500.00 ? 239 ILE C CA  1 
ATOM 9277  C C   . ILE C 3 239 ? 129.721 80.156  140.349 1.00 500.00 ? 239 ILE C C   1 
ATOM 9278  O O   . ILE C 3 239 ? 130.784 80.746  140.108 1.00 500.00 ? 239 ILE C O   1 
ATOM 9279  C CB  . ILE C 3 239 ? 127.745 81.331  141.325 1.00 500.00 ? 239 ILE C CB  1 
ATOM 9280  C CG1 . ILE C 3 239 ? 126.381 82.022  141.082 1.00 500.00 ? 239 ILE C CG1 1 
ATOM 9281  C CG2 . ILE C 3 239 ? 128.707 82.308  142.022 1.00 500.00 ? 239 ILE C CG2 1 
ATOM 9282  C CD1 . ILE C 3 239 ? 125.502 82.172  142.320 1.00 500.00 ? 239 ILE C CD1 1 
ATOM 9283  N N   . GLN C 3 240 ? 129.628 78.963  140.922 1.00 500.00 ? 240 GLN C N   1 
ATOM 9284  C CA  . GLN C 3 240 ? 130.805 78.197  141.341 1.00 500.00 ? 240 GLN C CA  1 
ATOM 9285  C C   . GLN C 3 240 ? 131.720 77.937  140.141 1.00 500.00 ? 240 GLN C C   1 
ATOM 9286  O O   . GLN C 3 240 ? 132.941 78.124  140.219 1.00 491.16 ? 240 GLN C O   1 
ATOM 9287  C CB  . GLN C 3 240 ? 130.445 76.966  142.209 1.00 500.00 ? 240 GLN C CB  1 
ATOM 9288  C CG  . GLN C 3 240 ? 130.005 77.356  143.638 1.00 500.00 ? 240 GLN C CG  1 
ATOM 9289  C CD  . GLN C 3 240 ? 129.620 76.177  144.546 1.00 500.00 ? 240 GLN C CD  1 
ATOM 9290  O OE1 . GLN C 3 240 ? 129.004 75.199  144.104 1.00 500.00 ? 240 GLN C OE1 1 
ATOM 9291  N NE2 . GLN C 3 240 ? 129.968 76.282  145.828 1.00 500.00 ? 240 GLN C NE2 1 
ATOM 9292  N N   . ARG C 3 241 ? 131.089 77.523  139.053 1.00 500.00 ? 241 ARG C N   1 
ATOM 9293  C CA  . ARG C 3 241 ? 131.776 77.226  137.791 1.00 500.00 ? 241 ARG C CA  1 
ATOM 9294  C C   . ARG C 3 241 ? 132.536 78.448  137.307 1.00 500.00 ? 241 ARG C C   1 
ATOM 9295  O O   . ARG C 3 241 ? 133.706 78.365  136.917 1.00 500.00 ? 241 ARG C O   1 
ATOM 9296  C CB  . ARG C 3 241 ? 130.713 76.822  136.743 1.00 500.00 ? 241 ARG C CB  1 
ATOM 9297  C CG  . ARG C 3 241 ? 131.152 75.869  135.643 1.00 500.00 ? 241 ARG C CG  1 
ATOM 9298  C CD  . ARG C 3 241 ? 130.026 75.648  134.620 1.00 500.00 ? 241 ARG C CD  1 
ATOM 9299  N NE  . ARG C 3 241 ? 128.753 75.171  135.205 1.00 500.00 ? 241 ARG C NE  1 
ATOM 9300  C CZ  . ARG C 3 241 ? 127.589 75.029  134.545 1.00 500.00 ? 241 ARG C CZ  1 
ATOM 9301  N NH1 . ARG C 3 241 ? 127.483 75.310  133.244 1.00 500.00 ? 241 ARG C NH1 1 
ATOM 9302  N NH2 . ARG C 3 241 ? 126.510 74.593  135.200 1.00 500.00 ? 241 ARG C NH2 1 
ATOM 9303  N N   . SER C 3 242 ? 131.839 79.583  137.350 1.00 500.00 ? 242 SER C N   1 
ATOM 9304  C CA  . SER C 3 242 ? 132.379 80.880  136.934 1.00 500.00 ? 242 SER C CA  1 
ATOM 9305  C C   . SER C 3 242 ? 133.873 81.121  137.210 1.00 500.00 ? 242 SER C C   1 
ATOM 9306  O O   . SER C 3 242 ? 134.560 81.515  136.298 1.00 500.00 ? 242 SER C O   1 
ATOM 9307  C CB  . SER C 3 242 ? 131.593 82.045  137.574 1.00 500.00 ? 242 SER C CB  1 
ATOM 9308  O OG  . SER C 3 242 ? 131.912 83.293  136.966 1.00 500.00 ? 242 SER C OG  1 
ATOM 9309  N N   . LEU C 3 243 ? 134.347 80.864  138.435 1.00 500.00 ? 243 LEU C N   1 
ATOM 9310  C CA  . LEU C 3 243 ? 135.755 81.141  138.862 1.00 500.00 ? 243 LEU C CA  1 
ATOM 9311  C C   . LEU C 3 243 ? 136.829 81.111  137.725 1.00 500.00 ? 243 LEU C C   1 
ATOM 9312  O O   . LEU C 3 243 ? 137.439 82.148  137.417 1.00 500.00 ? 243 LEU C O   1 
ATOM 9313  C CB  . LEU C 3 243 ? 136.172 80.198  140.038 1.00 500.00 ? 243 LEU C CB  1 
ATOM 9314  C CG  . LEU C 3 243 ? 137.152 80.687  141.140 1.00 500.00 ? 243 LEU C CG  1 
ATOM 9315  C CD1 . LEU C 3 243 ? 137.136 79.760  142.354 1.00 485.59 ? 243 LEU C CD1 1 
ATOM 9316  C CD2 . LEU C 3 243 ? 138.589 80.874  140.653 1.00 500.00 ? 243 LEU C CD2 1 
ATOM 9317  N N   . LEU C 3 244 ? 137.009 79.935  137.099 1.00 500.00 ? 244 LEU C N   1 
ATOM 9318  C CA  . LEU C 3 244 ? 138.115 79.653  136.137 1.00 500.00 ? 244 LEU C CA  1 
ATOM 9319  C C   . LEU C 3 244 ? 137.939 80.387  134.795 1.00 500.00 ? 244 LEU C C   1 
ATOM 9320  O O   . LEU C 3 244 ? 138.585 81.411  134.536 1.00 500.00 ? 244 LEU C O   1 
ATOM 9321  C CB  . LEU C 3 244 ? 138.264 78.116  135.903 1.00 500.00 ? 244 LEU C CB  1 
ATOM 9322  C CG  . LEU C 3 244 ? 139.550 77.487  135.295 1.00 500.00 ? 244 LEU C CG  1 
ATOM 9323  C CD1 . LEU C 3 244 ? 139.769 76.053  135.784 1.00 500.00 ? 244 LEU C CD1 1 
ATOM 9324  C CD2 . LEU C 3 244 ? 139.565 77.523  133.765 1.00 500.00 ? 244 LEU C CD2 1 
ATOM 9325  N N   . ASN D 4 2   ? 137.554 103.898 98.891  1.00 500.00 ? 2   ASN D N   1 
ATOM 9326  C CA  . ASN D 4 2   ? 138.518 103.235 99.825  1.00 500.00 ? 2   ASN D CA  1 
ATOM 9327  C C   . ASN D 4 2   ? 139.950 103.253 99.286  1.00 500.00 ? 2   ASN D C   1 
ATOM 9328  O O   . ASN D 4 2   ? 140.196 103.710 98.166  1.00 452.44 ? 2   ASN D O   1 
ATOM 9329  C CB  . ASN D 4 2   ? 138.069 101.803 100.115 1.00 500.00 ? 2   ASN D CB  1 
ATOM 9330  N N   . LEU D 4 3   ? 140.881 102.758 100.103 1.00 500.00 ? 3   LEU D N   1 
ATOM 9331  C CA  . LEU D 4 3   ? 142.295 102.700 99.740  1.00 500.00 ? 3   LEU D CA  1 
ATOM 9332  C C   . LEU D 4 3   ? 142.684 101.371 99.089  1.00 500.00 ? 3   LEU D C   1 
ATOM 9333  O O   . LEU D 4 3   ? 143.440 101.364 98.118  1.00 500.00 ? 3   LEU D O   1 
ATOM 9334  C CB  . LEU D 4 3   ? 143.183 102.951 100.975 1.00 500.00 ? 3   LEU D CB  1 
ATOM 9335  C CG  . LEU D 4 3   ? 144.716 103.006 100.780 1.00 500.00 ? 3   LEU D CG  1 
ATOM 9336  C CD1 . LEU D 4 3   ? 145.133 104.104 99.803  1.00 500.00 ? 3   LEU D CD1 1 
ATOM 9337  C CD2 . LEU D 4 3   ? 145.432 103.183 102.116 1.00 500.00 ? 3   LEU D CD2 1 
ATOM 9338  N N   . GLU D 4 4   ? 142.163 100.257 99.601  1.00 500.00 ? 4   GLU D N   1 
ATOM 9339  C CA  . GLU D 4 4   ? 142.764 98.936  99.330  1.00 500.00 ? 4   GLU D CA  1 
ATOM 9340  C C   . GLU D 4 4   ? 142.559 98.391  97.907  1.00 500.00 ? 4   GLU D C   1 
ATOM 9341  O O   . GLU D 4 4   ? 143.287 97.480  97.489  1.00 500.00 ? 4   GLU D O   1 
ATOM 9342  C CB  . GLU D 4 4   ? 142.296 97.895  100.364 1.00 500.00 ? 4   GLU D CB  1 
ATOM 9343  C CG  . GLU D 4 4   ? 142.390 98.320  101.836 1.00 500.00 ? 4   GLU D CG  1 
ATOM 9344  C CD  . GLU D 4 4   ? 143.762 98.849  102.259 1.00 500.00 ? 4   GLU D CD  1 
ATOM 9345  O OE1 . GLU D 4 4   ? 143.805 99.693  103.187 1.00 500.00 ? 4   GLU D OE1 1 
ATOM 9346  O OE2 . GLU D 4 4   ? 144.794 98.427  101.681 1.00 500.00 ? 4   GLU D OE2 1 
ATOM 9347  N N   . ARG D 4 5   ? 141.587 98.949  97.172  1.00 500.00 ? 5   ARG D N   1 
ATOM 9348  C CA  . ARG D 4 5   ? 141.373 98.629  95.742  1.00 500.00 ? 5   ARG D CA  1 
ATOM 9349  C C   . ARG D 4 5   ? 142.423 99.257  94.804  1.00 500.00 ? 5   ARG D C   1 
ATOM 9350  O O   . ARG D 4 5   ? 142.594 98.806  93.668  1.00 500.00 ? 5   ARG D O   1 
ATOM 9351  C CB  . ARG D 4 5   ? 139.975 99.079  95.283  1.00 500.00 ? 5   ARG D CB  1 
ATOM 9352  C CG  . ARG D 4 5   ? 138.809 98.479  96.065  1.00 500.00 ? 5   ARG D CG  1 
ATOM 9353  C CD  . ARG D 4 5   ? 137.492 98.601  95.297  1.00 500.00 ? 5   ARG D CD  1 
ATOM 9354  N NE  . ARG D 4 5   ? 137.196 99.963  94.803  1.00 500.00 ? 5   ARG D NE  1 
ATOM 9355  C CZ  . ARG D 4 5   ? 136.477 100.907 95.436  1.00 500.00 ? 5   ARG D CZ  1 
ATOM 9356  N NH1 . ARG D 4 5   ? 135.944 100.702 96.649  1.00 500.00 ? 5   ARG D NH1 1 
ATOM 9357  N NH2 . ARG D 4 5   ? 136.291 102.091 94.845  1.00 500.00 ? 5   ARG D NH2 1 
ATOM 9358  N N   . VAL D 4 6   ? 143.119 100.284 95.287  1.00 500.00 ? 6   VAL D N   1 
ATOM 9359  C CA  . VAL D 4 6   ? 144.046 101.069 94.479  1.00 500.00 ? 6   VAL D CA  1 
ATOM 9360  C C   . VAL D 4 6   ? 145.397 100.333 94.340  1.00 492.76 ? 6   VAL D C   1 
ATOM 9361  O O   . VAL D 4 6   ? 145.753 99.492  95.175  1.00 408.69 ? 6   VAL D O   1 
ATOM 9362  C CB  . VAL D 4 6   ? 144.197 102.495 95.090  1.00 500.00 ? 6   VAL D CB  1 
ATOM 9363  C CG1 . VAL D 4 6   ? 145.147 103.362 94.280  1.00 500.00 ? 6   VAL D CG1 1 
ATOM 9364  C CG2 . VAL D 4 6   ? 142.830 103.180 95.196  1.00 500.00 ? 6   VAL D CG2 1 
ATOM 9365  N N   . SER D 4 7   ? 146.115 100.635 93.256  1.00 482.27 ? 7   SER D N   1 
ATOM 9366  C CA  . SER D 4 7   ? 147.466 100.115 93.002  1.00 468.59 ? 7   SER D CA  1 
ATOM 9367  C C   . SER D 4 7   ? 148.521 100.792 93.890  1.00 492.72 ? 7   SER D C   1 
ATOM 9368  O O   . SER D 4 7   ? 148.208 101.704 94.654  1.00 500.00 ? 7   SER D O   1 
ATOM 9369  C CB  . SER D 4 7   ? 147.826 100.307 91.521  1.00 437.06 ? 7   SER D CB  1 
ATOM 9370  O OG  . SER D 4 7   ? 147.964 101.682 91.193  1.00 412.31 ? 7   SER D OG  1 
ATOM 9371  N N   . ASN D 4 8   ? 149.772 100.347 93.772  1.00 480.19 ? 8   ASN D N   1 
ATOM 9372  C CA  . ASN D 4 8   ? 150.864 100.839 94.592  1.00 500.00 ? 8   ASN D CA  1 
ATOM 9373  C C   . ASN D 4 8   ? 151.252 102.252 94.128  1.00 500.00 ? 8   ASN D C   1 
ATOM 9374  O O   . ASN D 4 8   ? 151.541 103.116 94.959  1.00 500.00 ? 8   ASN D O   1 
ATOM 9375  C CB  . ASN D 4 8   ? 152.090 99.916  94.453  1.00 496.47 ? 8   ASN D CB  1 
ATOM 9376  C CG  . ASN D 4 8   ? 153.305 100.403 95.248  1.00 488.37 ? 8   ASN D CG  1 
ATOM 9377  O OD1 . ASN D 4 8   ? 153.184 100.906 96.368  1.00 474.87 ? 8   ASN D OD1 1 
ATOM 9378  N ND2 . ASN D 4 8   ? 154.487 100.240 94.665  1.00 460.53 ? 8   ASN D ND2 1 
ATOM 9379  N N   . GLU D 4 9   ? 151.390 102.377 92.809  1.00 500.00 ? 9   GLU D N   1 
ATOM 9380  C CA  . GLU D 4 9   ? 151.942 103.555 92.173  1.00 500.00 ? 9   GLU D CA  1 
ATOM 9381  C C   . GLU D 4 9   ? 151.146 104.801 92.566  1.00 492.47 ? 9   GLU D C   1 
ATOM 9382  O O   . GLU D 4 9   ? 151.702 105.845 92.951  1.00 434.98 ? 9   GLU D O   1 
ATOM 9383  C CB  . GLU D 4 9   ? 151.847 103.444 90.637  1.00 500.00 ? 9   GLU D CB  1 
ATOM 9384  C CG  . GLU D 4 9   ? 152.551 102.261 89.984  1.00 500.00 ? 9   GLU D CG  1 
ATOM 9385  C CD  . GLU D 4 9   ? 154.056 102.300 90.148  1.00 500.00 ? 9   GLU D CD  1 
ATOM 9386  O OE1 . GLU D 4 9   ? 154.632 101.297 90.630  1.00 500.00 ? 9   GLU D OE1 1 
ATOM 9387  O OE2 . GLU D 4 9   ? 154.663 103.335 89.793  1.00 500.00 ? 9   GLU D OE2 1 
ATOM 9388  N N   . GLU D 4 10  ? 149.833 104.639 92.441  1.00 493.05 ? 10  GLU D N   1 
ATOM 9389  C CA  . GLU D 4 10  ? 148.878 105.719 92.743  1.00 500.00 ? 10  GLU D CA  1 
ATOM 9390  C C   . GLU D 4 10  ? 149.034 106.158 94.192  1.00 459.97 ? 10  GLU D C   1 
ATOM 9391  O O   . GLU D 4 10  ? 149.079 107.363 94.480  1.00 456.17 ? 10  GLU D O   1 
ATOM 9392  C CB  . GLU D 4 10  ? 147.461 105.266 92.456  1.00 500.00 ? 10  GLU D CB  1 
ATOM 9393  C CG  . GLU D 4 10  ? 146.451 106.402 92.477  1.00 500.00 ? 10  GLU D CG  1 
ATOM 9394  C CD  . GLU D 4 10  ? 145.384 106.262 91.398  1.00 500.00 ? 10  GLU D CD  1 
ATOM 9395  O OE1 . GLU D 4 10  ? 145.065 107.291 90.752  1.00 500.00 ? 10  GLU D OE1 1 
ATOM 9396  O OE2 . GLU D 4 10  ? 144.875 105.131 91.189  1.00 500.00 ? 10  GLU D OE2 1 
ATOM 9397  N N   . LYS D 4 11  ? 149.120 105.160 95.068  1.00 436.26 ? 11  LYS D N   1 
ATOM 9398  C CA  . LYS D 4 11  ? 149.275 105.385 96.507  1.00 484.39 ? 11  LYS D CA  1 
ATOM 9399  C C   . LYS D 4 11  ? 150.536 106.207 96.779  1.00 457.72 ? 11  LYS D C   1 
ATOM 9400  O O   . LYS D 4 11  ? 150.511 107.184 97.552  1.00 473.96 ? 11  LYS D O   1 
ATOM 9401  C CB  . LYS D 4 11  ? 149.271 104.058 97.287  1.00 490.63 ? 11  LYS D CB  1 
ATOM 9402  C CG  . LYS D 4 11  ? 147.895 103.407 97.396  1.00 457.20 ? 11  LYS D CG  1 
ATOM 9403  C CD  . LYS D 4 11  ? 147.963 102.070 98.119  1.00 448.98 ? 11  LYS D CD  1 
ATOM 9404  C CE  . LYS D 4 11  ? 146.676 101.279 97.964  1.00 436.50 ? 11  LYS D CE  1 
ATOM 9405  N NZ  . LYS D 4 11  ? 146.734 99.926  98.591  1.00 428.73 ? 11  LYS D NZ  1 
ATOM 9406  N N   . LEU D 4 12  ? 151.608 105.783 96.124  1.00 431.41 ? 12  LEU D N   1 
ATOM 9407  C CA  . LEU D 4 12  ? 152.918 106.430 96.243  1.00 499.81 ? 12  LEU D CA  1 
ATOM 9408  C C   . LEU D 4 12  ? 152.817 107.900 95.847  1.00 486.84 ? 12  LEU D C   1 
ATOM 9409  O O   . LEU D 4 12  ? 153.324 108.790 96.546  1.00 495.41 ? 12  LEU D O   1 
ATOM 9410  C CB  . LEU D 4 12  ? 153.971 105.711 95.369  1.00 500.00 ? 12  LEU D CB  1 
ATOM 9411  C CG  . LEU D 4 12  ? 155.205 106.471 94.827  1.00 500.00 ? 12  LEU D CG  1 
ATOM 9412  C CD1 . LEU D 4 12  ? 156.158 106.875 95.952  1.00 500.00 ? 12  LEU D CD1 1 
ATOM 9413  C CD2 . LEU D 4 12  ? 155.946 105.661 93.765  1.00 500.00 ? 12  LEU D CD2 1 
ATOM 9414  N N   . ASN D 4 13  ? 152.155 108.110 94.718  1.00 482.39 ? 13  ASN D N   1 
ATOM 9415  C CA  . ASN D 4 13  ? 151.944 109.448 94.153  1.00 500.00 ? 13  ASN D CA  1 
ATOM 9416  C C   . ASN D 4 13  ? 151.216 110.332 95.159  1.00 500.00 ? 13  ASN D C   1 
ATOM 9417  O O   . ASN D 4 13  ? 151.608 111.485 95.398  1.00 500.00 ? 13  ASN D O   1 
ATOM 9418  C CB  . ASN D 4 13  ? 151.170 109.299 92.830  1.00 500.00 ? 13  ASN D CB  1 
ATOM 9419  C CG  . ASN D 4 13  ? 150.809 110.628 92.196  1.00 500.00 ? 13  ASN D CG  1 
ATOM 9420  O OD1 . ASN D 4 13  ? 151.663 111.506 92.034  1.00 500.00 ? 13  ASN D OD1 1 
ATOM 9421  N ND2 . ASN D 4 13  ? 149.537 110.781 91.814  1.00 500.00 ? 13  ASN D ND2 1 
ATOM 9422  N N   . LEU D 4 14  ? 150.163 109.757 95.728  1.00 500.00 ? 14  LEU D N   1 
ATOM 9423  C CA  . LEU D 4 14  ? 149.325 110.434 96.723  1.00 500.00 ? 14  LEU D CA  1 
ATOM 9424  C C   . LEU D 4 14  ? 150.175 110.877 97.910  1.00 441.16 ? 14  LEU D C   1 
ATOM 9425  O O   . LEU D 4 14  ? 150.079 112.031 98.375  1.00 439.76 ? 14  LEU D O   1 
ATOM 9426  C CB  . LEU D 4 14  ? 148.186 109.530 97.230  1.00 500.00 ? 14  LEU D CB  1 
ATOM 9427  C CG  . LEU D 4 14  ? 146.779 109.778 96.668  1.00 500.00 ? 14  LEU D CG  1 
ATOM 9428  C CD1 . LEU D 4 14  ? 146.234 111.144 97.092  1.00 500.00 ? 14  LEU D CD1 1 
ATOM 9429  C CD2 . LEU D 4 14  ? 146.719 109.624 95.150  1.00 500.00 ? 14  LEU D CD2 1 
ATOM 9430  N N   . CYS D 4 15  ? 150.992 109.936 98.368  1.00 468.75 ? 15  CYS D N   1 
ATOM 9431  C CA  . CYS D 4 15  ? 151.889 110.153 99.507  1.00 481.80 ? 15  CYS D CA  1 
ATOM 9432  C C   . CYS D 4 15  ? 152.824 111.329 99.224  1.00 469.44 ? 15  CYS D C   1 
ATOM 9433  O O   . CYS D 4 15  ? 153.009 112.218 100.072 1.00 464.14 ? 15  CYS D O   1 
ATOM 9434  C CB  . CYS D 4 15  ? 152.678 108.883 99.835  1.00 470.58 ? 15  CYS D CB  1 
ATOM 9435  S SG  . CYS D 4 15  ? 153.715 109.020 101.303 1.00 478.91 ? 15  CYS D SG  1 
ATOM 9436  N N   . ARG D 4 16  ? 153.385 111.296 98.023  1.00 441.93 ? 16  ARG D N   1 
ATOM 9437  C CA  . ARG D 4 16  ? 154.317 112.323 97.550  1.00 476.68 ? 16  ARG D CA  1 
ATOM 9438  C C   . ARG D 4 16  ? 153.649 113.693 97.590  1.00 480.32 ? 16  ARG D C   1 
ATOM 9439  O O   . ARG D 4 16  ? 154.234 114.678 98.077  1.00 471.60 ? 16  ARG D O   1 
ATOM 9440  C CB  . ARG D 4 16  ? 154.779 111.967 96.118  1.00 500.00 ? 16  ARG D CB  1 
ATOM 9441  C CG  . ARG D 4 16  ? 156.036 112.675 95.622  1.00 500.00 ? 16  ARG D CG  1 
ATOM 9442  C CD  . ARG D 4 16  ? 155.742 114.003 94.921  1.00 500.00 ? 16  ARG D CD  1 
ATOM 9443  N NE  . ARG D 4 16  ? 155.283 113.837 93.535  1.00 500.00 ? 16  ARG D NE  1 
ATOM 9444  C CZ  . ARG D 4 16  ? 156.019 114.012 92.430  1.00 500.00 ? 16  ARG D CZ  1 
ATOM 9445  N NH1 . ARG D 4 16  ? 155.446 113.825 91.240  1.00 500.00 ? 16  ARG D NH1 1 
ATOM 9446  N NH2 . ARG D 4 16  ? 157.308 114.367 92.481  1.00 500.00 ? 16  ARG D NH2 1 
ATOM 9447  N N   . LYS D 4 17  ? 152.426 113.717 97.070  1.00 499.25 ? 17  LYS D N   1 
ATOM 9448  C CA  . LYS D 4 17  ? 151.618 114.942 97.005  1.00 500.00 ? 17  LYS D CA  1 
ATOM 9449  C C   . LYS D 4 17  ? 151.413 115.506 98.407  1.00 472.93 ? 17  LYS D C   1 
ATOM 9450  O O   . LYS D 4 17  ? 151.582 116.717 98.633  1.00 370.15 ? 17  LYS D O   1 
ATOM 9451  C CB  . LYS D 4 17  ? 150.280 114.788 96.232  1.00 500.00 ? 17  LYS D CB  1 
ATOM 9452  C CG  . LYS D 4 17  ? 150.414 114.950 94.702  1.00 500.00 ? 17  LYS D CG  1 
ATOM 9453  C CD  . LYS D 4 17  ? 149.291 115.750 94.013  1.00 500.00 ? 17  LYS D CD  1 
ATOM 9454  C CE  . LYS D 4 17  ? 149.648 117.216 93.699  1.00 500.00 ? 17  LYS D CE  1 
ATOM 9455  N NZ  . LYS D 4 17  ? 150.211 117.490 92.338  1.00 393.84 ? 17  LYS D NZ  1 
ATOM 9456  N N   . TYR D 4 18  ? 151.060 114.602 99.316  1.00 485.87 ? 18  TYR D N   1 
ATOM 9457  C CA  . TYR D 4 18  ? 150.812 114.951 100.716 1.00 489.73 ? 18  TYR D CA  1 
ATOM 9458  C C   . TYR D 4 18  ? 152.060 115.592 101.328 1.00 465.19 ? 18  TYR D C   1 
ATOM 9459  O O   . TYR D 4 18  ? 151.973 116.633 102.003 1.00 500.00 ? 18  TYR D O   1 
ATOM 9460  C CB  . TYR D 4 18  ? 150.261 113.774 101.540 1.00 500.00 ? 18  TYR D CB  1 
ATOM 9461  C CG  . TYR D 4 18  ? 148.738 113.634 101.455 1.00 500.00 ? 18  TYR D CG  1 
ATOM 9462  C CD1 . TYR D 4 18  ? 148.074 113.705 100.222 1.00 500.00 ? 18  TYR D CD1 1 
ATOM 9463  C CD2 . TYR D 4 18  ? 147.955 113.433 102.600 1.00 500.00 ? 18  TYR D CD2 1 
ATOM 9464  C CE1 . TYR D 4 18  ? 146.688 113.584 100.133 1.00 500.00 ? 18  TYR D CE1 1 
ATOM 9465  C CE2 . TYR D 4 18  ? 146.569 113.307 102.517 1.00 500.00 ? 18  TYR D CE2 1 
ATOM 9466  C CZ  . TYR D 4 18  ? 145.938 113.381 101.282 1.00 500.00 ? 18  TYR D CZ  1 
ATOM 9467  O OH  . TYR D 4 18  ? 144.569 113.260 101.178 1.00 451.52 ? 18  TYR D OH  1 
ATOM 9468  N N   . TYR D 4 19  ? 153.190 114.950 101.060 1.00 428.70 ? 19  TYR D N   1 
ATOM 9469  C CA  . TYR D 4 19  ? 154.490 115.399 101.555 1.00 451.20 ? 19  TYR D CA  1 
ATOM 9470  C C   . TYR D 4 19  ? 154.774 116.822 101.068 1.00 447.21 ? 19  TYR D C   1 
ATOM 9471  O O   . TYR D 4 19  ? 155.194 117.695 101.851 1.00 414.03 ? 19  TYR D O   1 
ATOM 9472  C CB  . TYR D 4 19  ? 155.606 114.413 101.183 1.00 500.00 ? 19  TYR D CB  1 
ATOM 9473  C CG  . TYR D 4 19  ? 157.003 114.893 101.538 1.00 500.00 ? 19  TYR D CG  1 
ATOM 9474  C CD1 . TYR D 4 19  ? 157.534 114.703 102.822 1.00 500.00 ? 19  TYR D CD1 1 
ATOM 9475  C CD2 . TYR D 4 19  ? 157.803 115.538 100.584 1.00 500.00 ? 19  TYR D CD2 1 
ATOM 9476  C CE1 . TYR D 4 19  ? 158.821 115.151 103.143 1.00 500.00 ? 19  TYR D CE1 1 
ATOM 9477  C CE2 . TYR D 4 19  ? 159.088 115.985 100.893 1.00 500.00 ? 19  TYR D CE2 1 
ATOM 9478  C CZ  . TYR D 4 19  ? 159.598 115.793 102.168 1.00 500.00 ? 19  TYR D CZ  1 
ATOM 9479  O OH  . TYR D 4 19  ? 160.870 116.248 102.450 1.00 500.00 ? 19  TYR D OH  1 
ATOM 9480  N N   . LEU D 4 20  ? 154.525 117.015 99.777  1.00 458.39 ? 20  LEU D N   1 
ATOM 9481  C CA  . LEU D 4 20  ? 154.736 118.309 99.121  1.00 500.00 ? 20  LEU D CA  1 
ATOM 9482  C C   . LEU D 4 20  ? 153.899 119.386 99.798  1.00 500.00 ? 20  LEU D C   1 
ATOM 9483  O O   . LEU D 4 20  ? 154.393 120.487 100.095 1.00 459.95 ? 20  LEU D O   1 
ATOM 9484  C CB  . LEU D 4 20  ? 154.489 118.289 97.597  1.00 500.00 ? 20  LEU D CB  1 
ATOM 9485  C CG  . LEU D 4 20  ? 154.801 119.591 96.792  1.00 500.00 ? 20  LEU D CG  1 
ATOM 9486  C CD1 . LEU D 4 20  ? 156.218 120.133 97.007  1.00 500.00 ? 20  LEU D CD1 1 
ATOM 9487  C CD2 . LEU D 4 20  ? 154.545 119.400 95.297  1.00 500.00 ? 20  LEU D CD2 1 
ATOM 9488  N N   . GLY D 4 21  ? 152.642 119.033 100.034 1.00 500.00 ? 21  GLY D N   1 
ATOM 9489  C CA  . GLY D 4 21  ? 151.674 119.927 100.681 1.00 500.00 ? 21  GLY D CA  1 
ATOM 9490  C C   . GLY D 4 21  ? 152.179 120.347 102.050 1.00 500.00 ? 21  GLY D C   1 
ATOM 9491  O O   . GLY D 4 21  ? 152.132 121.533 102.407 1.00 494.06 ? 21  GLY D O   1 
ATOM 9492  N N   . GLY D 4 22  ? 152.658 119.351 102.792 1.00 490.18 ? 22  GLY D N   1 
ATOM 9493  C CA  . GLY D 4 22  ? 153.192 119.544 104.140 1.00 417.96 ? 22  GLY D CA  1 
ATOM 9494  C C   . GLY D 4 22  ? 154.211 120.653 104.308 1.00 409.47 ? 22  GLY D C   1 
ATOM 9495  O O   . GLY D 4 22  ? 154.299 121.236 105.389 1.00 384.90 ? 22  GLY D O   1 
ATOM 9496  N N   . PHE D 4 23  ? 154.942 120.971 103.231 1.00 467.46 ? 23  PHE D N   1 
ATOM 9497  C CA  . PHE D 4 23  ? 155.759 122.203 103.150 1.00 500.00 ? 23  PHE D CA  1 
ATOM 9498  C C   . PHE D 4 23  ? 154.985 123.408 102.552 1.00 500.00 ? 23  PHE D C   1 
ATOM 9499  O O   . PHE D 4 23  ? 155.522 124.177 101.744 1.00 500.00 ? 23  PHE D O   1 
ATOM 9500  C CB  . PHE D 4 23  ? 157.100 121.956 102.395 1.00 500.00 ? 23  PHE D CB  1 
ATOM 9501  C CG  . PHE D 4 23  ? 158.315 121.810 103.304 1.00 500.00 ? 23  PHE D CG  1 
ATOM 9502  C CD1 . PHE D 4 23  ? 158.727 122.863 104.143 1.00 500.00 ? 23  PHE D CD1 1 
ATOM 9503  C CD2 . PHE D 4 23  ? 159.075 120.630 103.303 1.00 500.00 ? 23  PHE D CD2 1 
ATOM 9504  C CE1 . PHE D 4 23  ? 159.843 122.726 104.971 1.00 500.00 ? 23  PHE D CE1 1 
ATOM 9505  C CE2 . PHE D 4 23  ? 160.195 120.495 104.131 1.00 500.00 ? 23  PHE D CE2 1 
ATOM 9506  C CZ  . PHE D 4 23  ? 160.577 121.543 104.964 1.00 500.00 ? 23  PHE D CZ  1 
ATOM 9507  N N   . ALA D 4 24  ? 153.722 123.557 102.951 1.00 500.00 ? 24  ALA D N   1 
ATOM 9508  C CA  . ALA D 4 24  ? 152.996 124.825 102.836 1.00 500.00 ? 24  ALA D CA  1 
ATOM 9509  C C   . ALA D 4 24  ? 152.480 125.213 104.232 1.00 500.00 ? 24  ALA D C   1 
ATOM 9510  O O   . ALA D 4 24  ? 151.416 125.825 104.367 1.00 476.87 ? 24  ALA D O   1 
ATOM 9511  C CB  . ALA D 4 24  ? 151.853 124.699 101.839 1.00 500.00 ? 24  ALA D CB  1 
ATOM 9512  N N   . PHE D 4 25  ? 153.285 124.888 105.248 1.00 499.07 ? 25  PHE D N   1 
ATOM 9513  C CA  . PHE D 4 25  ? 152.920 124.991 106.662 1.00 442.09 ? 25  PHE D CA  1 
ATOM 9514  C C   . PHE D 4 25  ? 151.617 124.265 106.929 1.00 411.17 ? 25  PHE D C   1 
ATOM 9515  O O   . PHE D 4 25  ? 150.689 124.835 107.497 1.00 450.70 ? 25  PHE D O   1 
ATOM 9516  C CB  . PHE D 4 25  ? 152.796 126.450 107.131 1.00 492.35 ? 25  PHE D CB  1 
ATOM 9517  C CG  . PHE D 4 25  ? 153.826 127.378 106.553 1.00 500.00 ? 25  PHE D CG  1 
ATOM 9518  C CD1 . PHE D 4 25  ? 155.184 127.048 106.546 1.00 500.00 ? 25  PHE D CD1 1 
ATOM 9519  C CD2 . PHE D 4 25  ? 153.433 128.611 106.017 1.00 500.00 ? 25  PHE D CD2 1 
ATOM 9520  C CE1 . PHE D 4 25  ? 156.125 127.920 106.008 1.00 500.00 ? 25  PHE D CE1 1 
ATOM 9521  C CE2 . PHE D 4 25  ? 154.369 129.486 105.474 1.00 500.00 ? 25  PHE D CE2 1 
ATOM 9522  C CZ  . PHE D 4 25  ? 155.717 129.140 105.470 1.00 500.00 ? 25  PHE D CZ  1 
ATOM 9523  N N   . LEU D 4 26  ? 151.527 123.016 106.497 1.00 387.56 ? 26  LEU D N   1 
ATOM 9524  C CA  . LEU D 4 26  ? 150.425 122.183 106.925 1.00 404.57 ? 26  LEU D CA  1 
ATOM 9525  C C   . LEU D 4 26  ? 150.962 120.975 107.647 1.00 431.19 ? 26  LEU D C   1 
ATOM 9526  O O   . LEU D 4 26  ? 151.164 119.919 107.042 1.00 461.39 ? 26  LEU D O   1 
ATOM 9527  C CB  . LEU D 4 26  ? 149.509 121.792 105.779 1.00 468.54 ? 26  LEU D CB  1 
ATOM 9528  C CG  . LEU D 4 26  ? 148.393 122.805 105.498 1.00 477.57 ? 26  LEU D CG  1 
ATOM 9529  C CD1 . LEU D 4 26  ? 148.929 123.921 104.618 1.00 465.96 ? 26  LEU D CD1 1 
ATOM 9530  C CD2 . LEU D 4 26  ? 147.167 122.140 104.870 1.00 500.00 ? 26  LEU D CD2 1 
ATOM 9531  N N   . PRO D 4 27  ? 151.236 121.140 108.950 1.00 490.22 ? 27  PRO D N   1 
ATOM 9532  C CA  . PRO D 4 27  ? 151.503 120.023 109.822 1.00 500.00 ? 27  PRO D CA  1 
ATOM 9533  C C   . PRO D 4 27  ? 150.308 119.082 109.870 1.00 479.23 ? 27  PRO D C   1 
ATOM 9534  O O   . PRO D 4 27  ? 150.528 117.875 109.965 1.00 463.14 ? 27  PRO D O   1 
ATOM 9535  C CB  . PRO D 4 27  ? 151.717 120.664 111.202 1.00 500.00 ? 27  PRO D CB  1 
ATOM 9536  C CG  . PRO D 4 27  ? 151.817 122.131 110.987 1.00 500.00 ? 27  PRO D CG  1 
ATOM 9537  C CD  . PRO D 4 27  ? 151.679 122.420 109.535 1.00 500.00 ? 27  PRO D CD  1 
ATOM 9538  N N   . PHE D 4 28  ? 149.092 119.620 109.827 1.00 422.77 ? 28  PHE D N   1 
ATOM 9539  C CA  . PHE D 4 28  ? 147.915 118.781 109.908 1.00 417.21 ? 28  PHE D CA  1 
ATOM 9540  C C   . PHE D 4 28  ? 147.841 117.821 108.738 1.00 417.46 ? 28  PHE D C   1 
ATOM 9541  O O   . PHE D 4 28  ? 147.533 116.635 108.943 1.00 453.02 ? 28  PHE D O   1 
ATOM 9542  C CB  . PHE D 4 28  ? 146.632 119.589 110.065 1.00 452.20 ? 28  PHE D CB  1 
ATOM 9543  C CG  . PHE D 4 28  ? 145.632 118.942 110.965 1.00 500.00 ? 28  PHE D CG  1 
ATOM 9544  C CD1 . PHE D 4 28  ? 145.709 119.127 112.346 1.00 500.00 ? 28  PHE D CD1 1 
ATOM 9545  C CD2 . PHE D 4 28  ? 144.628 118.124 110.446 1.00 500.00 ? 28  PHE D CD2 1 
ATOM 9546  C CE1 . PHE D 4 28  ? 144.793 118.520 113.193 1.00 500.00 ? 28  PHE D CE1 1 
ATOM 9547  C CE2 . PHE D 4 28  ? 143.707 117.512 111.288 1.00 500.00 ? 28  PHE D CE2 1 
ATOM 9548  C CZ  . PHE D 4 28  ? 143.789 117.712 112.663 1.00 500.00 ? 28  PHE D CZ  1 
ATOM 9549  N N   . LEU D 4 29  ? 148.173 118.326 107.552 1.00 432.92 ? 29  LEU D N   1 
ATOM 9550  C CA  . LEU D 4 29  ? 148.207 117.504 106.335 1.00 422.34 ? 29  LEU D CA  1 
ATOM 9551  C C   . LEU D 4 29  ? 149.180 116.348 106.506 1.00 396.81 ? 29  LEU D C   1 
ATOM 9552  O O   . LEU D 4 29  ? 148.864 115.199 106.171 1.00 397.82 ? 29  LEU D O   1 
ATOM 9553  C CB  . LEU D 4 29  ? 148.659 118.286 105.127 1.00 439.67 ? 29  LEU D CB  1 
ATOM 9554  C CG  . LEU D 4 29  ? 148.770 117.411 103.880 1.00 493.11 ? 29  LEU D CG  1 
ATOM 9555  C CD1 . LEU D 4 29  ? 147.405 116.887 103.458 1.00 500.00 ? 29  LEU D CD1 1 
ATOM 9556  C CD2 . LEU D 4 29  ? 149.405 118.218 102.779 1.00 500.00 ? 29  LEU D CD2 1 
ATOM 9557  N N   . TRP D 4 30  ? 150.350 116.692 107.026 1.00 405.70 ? 30  TRP D N   1 
ATOM 9558  C CA  . TRP D 4 30  ? 151.423 115.717 107.276 1.00 418.41 ? 30  TRP D CA  1 
ATOM 9559  C C   . TRP D 4 30  ? 150.931 114.623 108.208 1.00 429.07 ? 30  TRP D C   1 
ATOM 9560  O O   . TRP D 4 30  ? 151.152 113.433 107.962 1.00 451.69 ? 30  TRP D O   1 
ATOM 9561  C CB  . TRP D 4 30  ? 152.696 116.367 107.825 1.00 458.45 ? 30  TRP D CB  1 
ATOM 9562  C CG  . TRP D 4 30  ? 153.728 116.740 106.794 1.00 500.00 ? 30  TRP D CG  1 
ATOM 9563  C CD1 . TRP D 4 30  ? 153.858 116.249 105.523 1.00 500.00 ? 30  TRP D CD1 1 
ATOM 9564  C CD2 . TRP D 4 30  ? 154.824 117.650 106.982 1.00 500.00 ? 30  TRP D CD2 1 
ATOM 9565  N NE1 . TRP D 4 30  ? 154.948 116.815 104.908 1.00 500.00 ? 30  TRP D NE1 1 
ATOM 9566  C CE2 . TRP D 4 30  ? 155.559 117.677 105.782 1.00 500.00 ? 30  TRP D CE2 1 
ATOM 9567  C CE3 . TRP D 4 30  ? 155.250 118.452 108.051 1.00 500.00 ? 30  TRP D CE3 1 
ATOM 9568  C CZ2 . TRP D 4 30  ? 156.692 118.481 105.613 1.00 500.00 ? 30  TRP D CZ2 1 
ATOM 9569  C CZ3 . TRP D 4 30  ? 156.379 119.256 107.880 1.00 500.00 ? 30  TRP D CZ3 1 
ATOM 9570  C CH2 . TRP D 4 30  ? 157.088 119.255 106.675 1.00 500.00 ? 30  TRP D CH2 1 
ATOM 9571  N N   . LEU D 4 31  ? 150.271 115.060 109.270 1.00 401.80 ? 31  LEU D N   1 
ATOM 9572  C CA  . LEU D 4 31  ? 149.706 114.169 110.292 1.00 407.35 ? 31  LEU D CA  1 
ATOM 9573  C C   . LEU D 4 31  ? 148.736 113.187 109.645 1.00 392.25 ? 31  LEU D C   1 
ATOM 9574  O O   . LEU D 4 31  ? 148.782 111.975 109.906 1.00 472.48 ? 31  LEU D O   1 
ATOM 9575  C CB  . LEU D 4 31  ? 148.956 114.983 111.353 1.00 486.63 ? 31  LEU D CB  1 
ATOM 9576  C CG  . LEU D 4 31  ? 148.143 114.240 112.425 1.00 500.00 ? 31  LEU D CG  1 
ATOM 9577  C CD1 . LEU D 4 31  ? 149.085 113.524 113.381 1.00 500.00 ? 31  LEU D CD1 1 
ATOM 9578  C CD2 . LEU D 4 31  ? 147.218 115.185 113.184 1.00 500.00 ? 31  LEU D CD2 1 
ATOM 9579  N N   . VAL D 4 32  ? 147.870 113.749 108.814 1.00 414.99 ? 32  VAL D N   1 
ATOM 9580  C CA  . VAL D 4 32  ? 146.849 112.981 108.087 1.00 498.07 ? 32  VAL D CA  1 
ATOM 9581  C C   . VAL D 4 32  ? 147.510 111.902 107.238 1.00 459.85 ? 32  VAL D C   1 
ATOM 9582  O O   . VAL D 4 32  ? 147.085 110.741 107.236 1.00 441.61 ? 32  VAL D O   1 
ATOM 9583  C CB  . VAL D 4 32  ? 145.976 113.874 107.190 1.00 500.00 ? 32  VAL D CB  1 
ATOM 9584  C CG1 . VAL D 4 32  ? 145.178 113.044 106.185 1.00 500.00 ? 32  VAL D CG1 1 
ATOM 9585  C CG2 . VAL D 4 32  ? 145.035 114.699 108.054 1.00 500.00 ? 32  VAL D CG2 1 
ATOM 9586  N N   . ASN D 4 33  ? 148.542 112.327 106.528 1.00 473.30 ? 33  ASN D N   1 
ATOM 9587  C CA  . ASN D 4 33  ? 149.328 111.455 105.645 1.00 500.00 ? 33  ASN D CA  1 
ATOM 9588  C C   . ASN D 4 33  ? 149.892 110.281 106.437 1.00 436.17 ? 33  ASN D C   1 
ATOM 9589  O O   . ASN D 4 33  ? 149.805 109.117 106.017 1.00 428.78 ? 33  ASN D O   1 
ATOM 9590  C CB  . ASN D 4 33  ? 150.483 112.290 105.078 1.00 500.00 ? 33  ASN D CB  1 
ATOM 9591  C CG  . ASN D 4 33  ? 151.517 111.467 104.355 1.00 500.00 ? 33  ASN D CG  1 
ATOM 9592  O OD1 . ASN D 4 33  ? 151.434 111.272 103.141 1.00 500.00 ? 33  ASN D OD1 1 
ATOM 9593  N ND2 . ASN D 4 33  ? 152.523 111.006 105.092 1.00 500.00 ? 33  ASN D ND2 1 
ATOM 9594  N N   . ILE D 4 34  ? 150.471 110.629 107.577 1.00 388.24 ? 34  ILE D N   1 
ATOM 9595  C CA  . ILE D 4 34  ? 151.082 109.658 108.492 1.00 414.48 ? 34  ILE D CA  1 
ATOM 9596  C C   . ILE D 4 34  ? 150.052 108.621 108.922 1.00 445.14 ? 34  ILE D C   1 
ATOM 9597  O O   . ILE D 4 34  ? 150.318 107.409 108.905 1.00 500.00 ? 34  ILE D O   1 
ATOM 9598  C CB  . ILE D 4 34  ? 151.701 110.346 109.726 1.00 463.80 ? 34  ILE D CB  1 
ATOM 9599  C CG1 . ILE D 4 34  ? 152.969 111.090 109.305 1.00 500.00 ? 34  ILE D CG1 1 
ATOM 9600  C CG2 . ILE D 4 34  ? 152.019 109.360 110.853 1.00 442.22 ? 34  ILE D CG2 1 
ATOM 9601  C CD1 . ILE D 4 34  ? 153.286 112.262 110.195 1.00 500.00 ? 34  ILE D CD1 1 
ATOM 9602  N N   . PHE D 4 35  ? 148.888 109.133 109.297 1.00 418.88 ? 35  PHE D N   1 
ATOM 9603  C CA  . PHE D 4 35  ? 147.760 108.304 109.739 1.00 421.95 ? 35  PHE D CA  1 
ATOM 9604  C C   . PHE D 4 35  ? 147.370 107.316 108.656 1.00 458.42 ? 35  PHE D C   1 
ATOM 9605  O O   . PHE D 4 35  ? 147.178 106.120 108.895 1.00 462.68 ? 35  PHE D O   1 
ATOM 9606  C CB  . PHE D 4 35  ? 146.536 109.150 110.137 1.00 441.15 ? 35  PHE D CB  1 
ATOM 9607  C CG  . PHE D 4 35  ? 146.200 109.066 111.600 1.00 500.00 ? 35  PHE D CG  1 
ATOM 9608  C CD1 . PHE D 4 35  ? 147.191 109.243 112.573 1.00 500.00 ? 35  PHE D CD1 1 
ATOM 9609  C CD2 . PHE D 4 35  ? 144.899 108.804 112.018 1.00 500.00 ? 35  PHE D CD2 1 
ATOM 9610  C CE1 . PHE D 4 35  ? 146.890 109.162 113.929 1.00 500.00 ? 35  PHE D CE1 1 
ATOM 9611  C CE2 . PHE D 4 35  ? 144.592 108.725 113.374 1.00 500.00 ? 35  PHE D CE2 1 
ATOM 9612  C CZ  . PHE D 4 35  ? 145.586 108.906 114.331 1.00 500.00 ? 35  PHE D CZ  1 
ATOM 9613  N N   . TRP D 4 36  ? 147.264 107.865 107.451 1.00 477.42 ? 36  TRP D N   1 
ATOM 9614  C CA  . TRP D 4 36  ? 146.769 107.150 106.294 1.00 461.67 ? 36  TRP D CA  1 
ATOM 9615  C C   . TRP D 4 36  ? 147.805 106.243 105.651 1.00 406.40 ? 36  TRP D C   1 
ATOM 9616  O O   . TRP D 4 36  ? 147.454 105.356 104.880 1.00 411.33 ? 36  TRP D O   1 
ATOM 9617  C CB  . TRP D 4 36  ? 146.263 108.171 105.282 1.00 447.57 ? 36  TRP D CB  1 
ATOM 9618  C CG  . TRP D 4 36  ? 145.367 107.629 104.252 1.00 459.88 ? 36  TRP D CG  1 
ATOM 9619  C CD1 . TRP D 4 36  ? 144.553 106.524 104.339 1.00 439.72 ? 36  TRP D CD1 1 
ATOM 9620  C CD2 . TRP D 4 36  ? 145.148 108.192 102.965 1.00 489.31 ? 36  TRP D CD2 1 
ATOM 9621  N NE1 . TRP D 4 36  ? 143.860 106.365 103.167 1.00 492.07 ? 36  TRP D NE1 1 
ATOM 9622  C CE2 . TRP D 4 36  ? 144.207 107.375 102.305 1.00 500.00 ? 36  TRP D CE2 1 
ATOM 9623  C CE3 . TRP D 4 36  ? 145.668 109.309 102.295 1.00 489.42 ? 36  TRP D CE3 1 
ATOM 9624  C CZ2 . TRP D 4 36  ? 143.771 107.641 100.999 1.00 500.00 ? 36  TRP D CZ2 1 
ATOM 9625  C CZ3 . TRP D 4 36  ? 145.235 109.573 101.000 1.00 477.37 ? 36  TRP D CZ3 1 
ATOM 9626  C CH2 . TRP D 4 36  ? 144.298 108.743 100.367 1.00 495.63 ? 36  TRP D CH2 1 
ATOM 9627  N N   . PHE D 4 37  ? 149.073 106.474 105.968 1.00 417.50 ? 37  PHE D N   1 
ATOM 9628  C CA  . PHE D 4 37  ? 150.166 105.646 105.491 1.00 439.06 ? 37  PHE D CA  1 
ATOM 9629  C C   . PHE D 4 37  ? 150.991 105.125 106.677 1.00 420.23 ? 37  PHE D C   1 
ATOM 9630  O O   . PHE D 4 37  ? 152.130 105.541 106.906 1.00 399.60 ? 37  PHE D O   1 
ATOM 9631  C CB  . PHE D 4 37  ? 151.018 106.459 104.516 1.00 459.85 ? 37  PHE D CB  1 
ATOM 9632  C CG  . PHE D 4 37  ? 150.260 106.953 103.309 1.00 430.06 ? 37  PHE D CG  1 
ATOM 9633  C CD1 . PHE D 4 37  ? 149.614 106.062 102.462 1.00 454.19 ? 37  PHE D CD1 1 
ATOM 9634  C CD2 . PHE D 4 37  ? 150.212 108.301 103.007 1.00 437.22 ? 37  PHE D CD2 1 
ATOM 9635  C CE1 . PHE D 4 37  ? 148.927 106.510 101.344 1.00 478.50 ? 37  PHE D CE1 1 
ATOM 9636  C CE2 . PHE D 4 37  ? 149.528 108.760 101.892 1.00 475.15 ? 37  PHE D CE2 1 
ATOM 9637  C CZ  . PHE D 4 37  ? 148.883 107.863 101.057 1.00 480.24 ? 37  PHE D CZ  1 
ATOM 9638  N N   . PHE D 4 38  ? 150.381 104.216 107.432 1.00 410.68 ? 38  PHE D N   1 
ATOM 9639  C CA  . PHE D 4 38  ? 150.986 103.640 108.637 1.00 489.39 ? 38  PHE D CA  1 
ATOM 9640  C C   . PHE D 4 38  ? 151.042 102.122 108.483 1.00 500.00 ? 38  PHE D C   1 
ATOM 9641  O O   . PHE D 4 38  ? 152.129 101.531 108.508 1.00 477.40 ? 38  PHE D O   1 
ATOM 9642  C CB  . PHE D 4 38  ? 150.172 104.066 109.874 1.00 500.00 ? 38  PHE D CB  1 
ATOM 9643  C CG  . PHE D 4 38  ? 150.765 103.651 111.204 1.00 500.00 ? 38  PHE D CG  1 
ATOM 9644  C CD1 . PHE D 4 38  ? 152.105 103.919 111.516 1.00 500.00 ? 38  PHE D CD1 1 
ATOM 9645  C CD2 . PHE D 4 38  ? 149.960 103.037 112.175 1.00 500.00 ? 38  PHE D CD2 1 
ATOM 9646  C CE1 . PHE D 4 38  ? 152.634 103.548 112.749 1.00 500.00 ? 38  PHE D CE1 1 
ATOM 9647  C CE2 . PHE D 4 38  ? 150.486 102.670 113.405 1.00 499.87 ? 38  PHE D CE2 1 
ATOM 9648  C CZ  . PHE D 4 38  ? 151.823 102.923 113.693 1.00 500.00 ? 38  PHE D CZ  1 
ATOM 9649  N N   . ARG D 4 39  ? 149.868 101.504 108.304 1.00 500.00 ? 39  ARG D N   1 
ATOM 9650  C CA  . ARG D 4 39  ? 149.754 100.076 107.955 1.00 500.00 ? 39  ARG D CA  1 
ATOM 9651  C C   . ARG D 4 39  ? 150.700 99.804  106.779 1.00 484.33 ? 39  ARG D C   1 
ATOM 9652  O O   . ARG D 4 39  ? 151.508 98.879  106.827 1.00 434.02 ? 39  ARG D O   1 
ATOM 9653  C CB  . ARG D 4 39  ? 148.284 99.690  107.604 1.00 500.00 ? 39  ARG D CB  1 
ATOM 9654  C CG  . ARG D 4 39  ? 147.781 98.345  108.157 1.00 500.00 ? 39  ARG D CG  1 
ATOM 9655  C CD  . ARG D 4 39  ? 147.502 98.364  109.678 1.00 500.00 ? 39  ARG D CD  1 
ATOM 9656  N NE  . ARG D 4 39  ? 146.079 98.361  110.098 1.00 500.00 ? 39  ARG D NE  1 
ATOM 9657  C CZ  . ARG D 4 39  ? 145.633 98.492  111.363 1.00 500.00 ? 39  ARG D CZ  1 
ATOM 9658  N NH1 . ARG D 4 39  ? 146.483 98.652  112.384 1.00 464.79 ? 39  ARG D NH1 1 
ATOM 9659  N NH2 . ARG D 4 39  ? 144.317 98.471  111.620 1.00 368.36 ? 39  ARG D NH2 1 
ATOM 9660  N N   . GLU D 4 40  ? 150.635 100.678 105.773 1.00 489.23 ? 40  GLU D N   1 
ATOM 9661  C CA  . GLU D 4 40  ? 151.383 100.535 104.520 1.00 489.26 ? 40  GLU D CA  1 
ATOM 9662  C C   . GLU D 4 40  ? 152.873 100.825 104.667 1.00 451.55 ? 40  GLU D C   1 
ATOM 9663  O O   . GLU D 4 40  ? 153.688 100.241 103.951 1.00 470.44 ? 40  GLU D O   1 
ATOM 9664  C CB  . GLU D 4 40  ? 150.788 101.436 103.429 1.00 500.00 ? 40  GLU D CB  1 
ATOM 9665  C CG  . GLU D 4 40  ? 149.466 100.935 102.834 1.00 500.00 ? 40  GLU D CG  1 
ATOM 9666  C CD  . GLU D 4 40  ? 148.267 100.972 103.786 1.00 500.00 ? 40  GLU D CD  1 
ATOM 9667  O OE1 . GLU D 4 40  ? 147.236 100.334 103.469 1.00 500.00 ? 40  GLU D OE1 1 
ATOM 9668  O OE2 . GLU D 4 40  ? 148.339 101.636 104.846 1.00 500.00 ? 40  GLU D OE2 1 
ATOM 9669  N N   . ALA D 4 41  ? 153.220 101.734 105.572 1.00 446.87 ? 41  ALA D N   1 
ATOM 9670  C CA  . ALA D 4 41  ? 154.619 102.011 105.888 1.00 453.89 ? 41  ALA D CA  1 
ATOM 9671  C C   . ALA D 4 41  ? 155.249 100.861 106.654 1.00 455.59 ? 41  ALA D C   1 
ATOM 9672  O O   . ALA D 4 41  ? 156.174 100.228 106.157 1.00 472.87 ? 41  ALA D O   1 
ATOM 9673  C CB  . ALA D 4 41  ? 154.742 103.293 106.694 1.00 489.17 ? 41  ALA D CB  1 
ATOM 9674  N N   . PHE D 4 42  ? 154.725 100.588 107.850 1.00 500.00 ? 42  PHE D N   1 
ATOM 9675  C CA  . PHE D 4 42  ? 155.398 99.723  108.834 1.00 500.00 ? 42  PHE D CA  1 
ATOM 9676  C C   . PHE D 4 42  ? 154.877 98.269  108.833 1.00 500.00 ? 42  PHE D C   1 
ATOM 9677  O O   . PHE D 4 42  ? 155.674 97.330  108.705 1.00 500.00 ? 42  PHE D O   1 
ATOM 9678  C CB  . PHE D 4 42  ? 155.300 100.359 110.248 1.00 500.00 ? 42  PHE D CB  1 
ATOM 9679  C CG  . PHE D 4 42  ? 156.478 100.047 111.176 1.00 500.00 ? 42  PHE D CG  1 
ATOM 9680  C CD1 . PHE D 4 42  ? 157.639 100.843 111.165 1.00 500.00 ? 42  PHE D CD1 1 
ATOM 9681  C CD2 . PHE D 4 42  ? 156.420 98.976  112.095 1.00 500.00 ? 42  PHE D CD2 1 
ATOM 9682  C CE1 . PHE D 4 42  ? 158.712 100.559 112.023 1.00 500.00 ? 42  PHE D CE1 1 
ATOM 9683  C CE2 . PHE D 4 42  ? 157.490 98.696  112.955 1.00 500.00 ? 42  PHE D CE2 1 
ATOM 9684  C CZ  . PHE D 4 42  ? 158.637 99.489  112.918 1.00 500.00 ? 42  PHE D CZ  1 
ATOM 9685  N N   . LEU D 4 43  ? 153.560 98.087  108.959 1.00 500.00 ? 43  LEU D N   1 
ATOM 9686  C CA  . LEU D 4 43  ? 152.972 96.735  109.185 1.00 500.00 ? 43  LEU D CA  1 
ATOM 9687  C C   . LEU D 4 43  ? 152.888 95.829  107.935 1.00 500.00 ? 43  LEU D C   1 
ATOM 9688  O O   . LEU D 4 43  ? 153.024 94.601  108.062 1.00 500.00 ? 43  LEU D O   1 
ATOM 9689  C CB  . LEU D 4 43  ? 151.584 96.819  109.885 1.00 500.00 ? 43  LEU D CB  1 
ATOM 9690  C CG  . LEU D 4 43  ? 151.464 96.312  111.342 1.00 500.00 ? 43  LEU D CG  1 
ATOM 9691  C CD1 . LEU D 4 43  ? 152.250 97.186  112.312 1.00 500.00 ? 43  LEU D CD1 1 
ATOM 9692  C CD2 . LEU D 4 43  ? 150.011 96.208  111.803 1.00 500.00 ? 43  LEU D CD2 1 
ATOM 9693  N N   . VAL D 4 44  ? 152.662 96.430  106.757 1.00 500.00 ? 44  VAL D N   1 
ATOM 9694  C CA  . VAL D 4 44  ? 152.480 95.686  105.477 1.00 500.00 ? 44  VAL D CA  1 
ATOM 9695  C C   . VAL D 4 44  ? 153.768 94.938  105.069 1.00 500.00 ? 44  VAL D C   1 
ATOM 9696  O O   . VAL D 4 44  ? 154.853 95.532  105.090 1.00 500.00 ? 44  VAL D O   1 
ATOM 9697  C CB  . VAL D 4 44  ? 151.950 96.605  104.321 1.00 500.00 ? 44  VAL D CB  1 
ATOM 9698  C CG1 . VAL D 4 44  ? 152.277 96.069  102.915 1.00 500.00 ? 44  VAL D CG1 1 
ATOM 9699  C CG2 . VAL D 4 44  ? 150.445 96.810  104.467 1.00 500.00 ? 44  VAL D CG2 1 
ATOM 9700  N N   . PRO D 4 45  ? 153.642 93.634  104.693 1.00 500.00 ? 45  PRO D N   1 
ATOM 9701  C CA  . PRO D 4 45  ? 154.841 92.797  104.471 1.00 500.00 ? 45  PRO D CA  1 
ATOM 9702  C C   . PRO D 4 45  ? 155.649 93.109  103.196 1.00 500.00 ? 45  PRO D C   1 
ATOM 9703  O O   . PRO D 4 45  ? 156.882 93.204  103.264 1.00 500.00 ? 45  PRO D O   1 
ATOM 9704  C CB  . PRO D 4 45  ? 154.272 91.366  104.431 1.00 500.00 ? 45  PRO D CB  1 
ATOM 9705  C CG  . PRO D 4 45  ? 152.844 91.526  104.013 1.00 500.00 ? 45  PRO D CG  1 
ATOM 9706  C CD  . PRO D 4 45  ? 152.392 92.845  104.571 1.00 500.00 ? 45  PRO D CD  1 
ATOM 9707  N N   . ALA D 4 46  ? 154.961 93.266  102.061 1.00 500.00 ? 46  ALA D N   1 
ATOM 9708  C CA  . ALA D 4 46  ? 155.630 93.436  100.774 1.00 500.00 ? 46  ALA D CA  1 
ATOM 9709  C C   . ALA D 4 46  ? 154.918 94.425  99.870  1.00 500.00 ? 46  ALA D C   1 
ATOM 9710  O O   . ALA D 4 46  ? 153.798 94.178  99.405  1.00 394.60 ? 46  ALA D O   1 
ATOM 9711  C CB  . ALA D 4 46  ? 155.767 92.099  100.072 1.00 500.00 ? 46  ALA D CB  1 
ATOM 9712  N N   . TYR D 4 47  ? 155.573 95.571  99.699  1.00 500.00 ? 47  TYR D N   1 
ATOM 9713  C CA  . TYR D 4 47  ? 155.429 96.435  98.528  1.00 500.00 ? 47  TYR D CA  1 
ATOM 9714  C C   . TYR D 4 47  ? 156.828 96.565  97.902  1.00 500.00 ? 47  TYR D C   1 
ATOM 9715  O O   . TYR D 4 47  ? 157.838 96.151  98.495  1.00 443.04 ? 47  TYR D O   1 
ATOM 9716  C CB  . TYR D 4 47  ? 154.861 97.830  98.893  1.00 500.00 ? 47  TYR D CB  1 
ATOM 9717  C CG  . TYR D 4 47  ? 153.352 97.999  98.736  1.00 500.00 ? 47  TYR D CG  1 
ATOM 9718  C CD1 . TYR D 4 47  ? 152.731 97.857  97.486  1.00 500.00 ? 47  TYR D CD1 1 
ATOM 9719  C CD2 . TYR D 4 47  ? 152.541 98.337  99.835  1.00 500.00 ? 47  TYR D CD2 1 
ATOM 9720  C CE1 . TYR D 4 47  ? 151.350 98.015  97.339  1.00 500.00 ? 47  TYR D CE1 1 
ATOM 9721  C CE2 . TYR D 4 47  ? 151.161 98.501  99.693  1.00 500.00 ? 47  TYR D CE2 1 
ATOM 9722  C CZ  . TYR D 4 47  ? 150.566 98.339  98.445  1.00 500.00 ? 47  TYR D CZ  1 
ATOM 9723  O OH  . TYR D 4 47  ? 149.199 98.496  98.292  1.00 500.00 ? 47  TYR D OH  1 
ATOM 9724  N N   . THR D 4 48  ? 156.859 97.125  96.696  1.00 500.00 ? 48  THR D N   1 
ATOM 9725  C CA  . THR D 4 48  ? 158.093 97.370  95.937  1.00 500.00 ? 48  THR D CA  1 
ATOM 9726  C C   . THR D 4 48  ? 158.737 98.699  96.324  1.00 500.00 ? 48  THR D C   1 
ATOM 9727  O O   . THR D 4 48  ? 159.970 98.825  96.392  1.00 373.74 ? 48  THR D O   1 
ATOM 9728  C CB  . THR D 4 48  ? 157.792 97.417  94.426  1.00 500.00 ? 48  THR D CB  1 
ATOM 9729  O OG1 . THR D 4 48  ? 156.859 98.471  94.147  1.00 500.00 ? 48  THR D OG1 1 
ATOM 9730  C CG2 . THR D 4 48  ? 157.202 96.087  93.953  1.00 500.00 ? 48  THR D CG2 1 
ATOM 9731  N N   . GLU D 4 49  ? 157.866 99.687  96.534  1.00 500.00 ? 49  GLU D N   1 
ATOM 9732  C CA  . GLU D 4 49  ? 158.232 101.000 97.046  1.00 500.00 ? 49  GLU D CA  1 
ATOM 9733  C C   . GLU D 4 49  ? 157.943 101.108 98.533  1.00 485.42 ? 49  GLU D C   1 
ATOM 9734  O O   . GLU D 4 49  ? 157.834 102.214 99.057  1.00 450.21 ? 49  GLU D O   1 
ATOM 9735  C CB  . GLU D 4 49  ? 157.431 102.073 96.302  1.00 500.00 ? 49  GLU D CB  1 
ATOM 9736  C CG  . GLU D 4 49  ? 157.818 102.219 94.837  1.00 500.00 ? 49  GLU D CG  1 
ATOM 9737  C CD  . GLU D 4 49  ? 159.174 102.889 94.628  1.00 500.00 ? 49  GLU D CD  1 
ATOM 9738  O OE1 . GLU D 4 49  ? 159.530 103.808 95.403  1.00 500.00 ? 49  GLU D OE1 1 
ATOM 9739  O OE2 . GLU D 4 49  ? 159.883 102.506 93.669  1.00 500.00 ? 49  GLU D OE2 1 
ATOM 9740  N N   . GLN D 4 50  ? 157.849 99.972  99.226  1.00 481.69 ? 50  GLN D N   1 
ATOM 9741  C CA  . GLN D 4 50  ? 157.387 99.999  100.616 1.00 462.30 ? 50  GLN D CA  1 
ATOM 9742  C C   . GLN D 4 50  ? 158.352 100.846 101.437 1.00 499.61 ? 50  GLN D C   1 
ATOM 9743  O O   . GLN D 4 50  ? 157.925 101.694 102.239 1.00 500.00 ? 50  GLN D O   1 
ATOM 9744  C CB  . GLN D 4 50  ? 157.358 98.602  101.237 1.00 493.07 ? 50  GLN D CB  1 
ATOM 9745  C CG  . GLN D 4 50  ? 156.442 98.497  102.453 1.00 500.00 ? 50  GLN D CG  1 
ATOM 9746  C CD  . GLN D 4 50  ? 156.912 97.476  103.477 1.00 500.00 ? 50  GLN D CD  1 
ATOM 9747  O OE1 . GLN D 4 50  ? 156.782 97.693  104.682 1.00 500.00 ? 50  GLN D OE1 1 
ATOM 9748  N NE2 . GLN D 4 50  ? 157.471 96.361  103.003 1.00 500.00 ? 50  GLN D NE2 1 
ATOM 9749  N N   . SER D 4 51  ? 159.639 100.533 101.269 1.00 500.00 ? 51  SER D N   1 
ATOM 9750  C CA  . SER D 4 51  ? 160.704 101.164 102.048 1.00 500.00 ? 51  SER D CA  1 
ATOM 9751  C C   . SER D 4 51  ? 160.688 102.672 101.836 1.00 500.00 ? 51  SER D C   1 
ATOM 9752  O O   . SER D 4 51  ? 160.777 103.444 102.807 1.00 500.00 ? 51  SER D O   1 
ATOM 9753  C CB  . SER D 4 51  ? 162.094 100.596 101.716 1.00 500.00 ? 51  SER D CB  1 
ATOM 9754  O OG  . SER D 4 51  ? 163.074 101.064 102.640 1.00 500.00 ? 51  SER D OG  1 
ATOM 9755  N N   . GLN D 4 52  ? 160.565 103.050 100.565 1.00 500.00 ? 52  GLN D N   1 
ATOM 9756  C CA  . GLN D 4 52  ? 160.537 104.466 100.173 1.00 483.07 ? 52  GLN D CA  1 
ATOM 9757  C C   . GLN D 4 52  ? 159.381 105.176 100.857 1.00 469.42 ? 52  GLN D C   1 
ATOM 9758  O O   . GLN D 4 52  ? 159.548 106.280 101.401 1.00 445.39 ? 52  GLN D O   1 
ATOM 9759  C CB  . GLN D 4 52  ? 160.424 104.650 98.664  1.00 481.57 ? 52  GLN D CB  1 
ATOM 9760  C CG  . GLN D 4 52  ? 161.768 104.766 97.965  1.00 500.00 ? 52  GLN D CG  1 
ATOM 9761  C CD  . GLN D 4 52  ? 161.732 105.730 96.795  1.00 500.00 ? 52  GLN D CD  1 
ATOM 9762  O OE1 . GLN D 4 52  ? 161.327 106.888 96.936  1.00 500.00 ? 52  GLN D OE1 1 
ATOM 9763  N NE2 . GLN D 4 52  ? 162.167 105.259 95.627  1.00 500.00 ? 52  GLN D NE2 1 
ATOM 9764  N N   . ILE D 4 53  ? 158.227 104.514 100.815 1.00 475.50 ? 53  ILE D N   1 
ATOM 9765  C CA  . ILE D 4 53  ? 156.993 105.031 101.422 1.00 463.36 ? 53  ILE D CA  1 
ATOM 9766  C C   . ILE D 4 53  ? 157.206 105.283 102.905 1.00 490.54 ? 53  ILE D C   1 
ATOM 9767  O O   . ILE D 4 53  ? 156.832 106.341 103.437 1.00 471.19 ? 53  ILE D O   1 
ATOM 9768  C CB  . ILE D 4 53  ? 155.820 104.037 101.231 1.00 500.00 ? 53  ILE D CB  1 
ATOM 9769  C CG1 . ILE D 4 53  ? 155.345 104.052 99.773  1.00 500.00 ? 53  ILE D CG1 1 
ATOM 9770  C CG2 . ILE D 4 53  ? 154.659 104.317 102.182 1.00 500.00 ? 53  ILE D CG2 1 
ATOM 9771  C CD1 . ILE D 4 53  ? 154.571 105.287 99.360  1.00 500.00 ? 53  ILE D CD1 1 
ATOM 9772  N N   . LYS D 4 54  ? 157.805 104.286 103.545 1.00 500.00 ? 54  LYS D N   1 
ATOM 9773  C CA  . LYS D 4 54  ? 158.099 104.326 104.987 1.00 500.00 ? 54  LYS D CA  1 
ATOM 9774  C C   . LYS D 4 54  ? 158.975 105.525 105.304 1.00 500.00 ? 54  LYS D C   1 
ATOM 9775  O O   . LYS D 4 54  ? 158.712 106.263 106.259 1.00 500.00 ? 54  LYS D O   1 
ATOM 9776  C CB  . LYS D 4 54  ? 158.711 102.997 105.529 1.00 500.00 ? 54  LYS D CB  1 
ATOM 9777  C CG  . LYS D 4 54  ? 160.166 103.030 106.045 1.00 500.00 ? 54  LYS D CG  1 
ATOM 9778  C CD  . LYS D 4 54  ? 160.692 101.648 106.434 1.00 500.00 ? 54  LYS D CD  1 
ATOM 9779  C CE  . LYS D 4 54  ? 160.143 101.164 107.778 1.00 500.00 ? 54  LYS D CE  1 
ATOM 9780  N NZ  . LYS D 4 54  ? 160.625 99.804  108.170 1.00 500.00 ? 54  LYS D NZ  1 
ATOM 9781  N N   . GLY D 4 55  ? 160.006 105.689 104.487 1.00 500.00 ? 55  GLY D N   1 
ATOM 9782  C CA  . GLY D 4 55  ? 160.971 106.786 104.625 1.00 500.00 ? 55  GLY D CA  1 
ATOM 9783  C C   . GLY D 4 55  ? 160.253 108.127 104.560 1.00 500.00 ? 55  GLY D C   1 
ATOM 9784  O O   . GLY D 4 55  ? 160.490 109.022 105.387 1.00 500.00 ? 55  GLY D O   1 
ATOM 9785  N N   . TYR D 4 56  ? 159.383 108.226 103.557 1.00 500.00 ? 56  TYR D N   1 
ATOM 9786  C CA  . TYR D 4 56  ? 158.583 109.435 103.313 1.00 500.00 ? 56  TYR D CA  1 
ATOM 9787  C C   . TYR D 4 56  ? 157.760 109.774 104.549 1.00 460.41 ? 56  TYR D C   1 
ATOM 9788  O O   . TYR D 4 56  ? 157.720 110.935 105.007 1.00 415.35 ? 56  TYR D O   1 
ATOM 9789  C CB  . TYR D 4 56  ? 157.604 109.238 102.148 1.00 494.89 ? 56  TYR D CB  1 
ATOM 9790  C CG  . TYR D 4 56  ? 158.111 109.643 100.788 1.00 500.00 ? 56  TYR D CG  1 
ATOM 9791  C CD1 . TYR D 4 56  ? 159.403 109.322 100.368 1.00 500.00 ? 56  TYR D CD1 1 
ATOM 9792  C CD2 . TYR D 4 56  ? 157.277 110.322 99.894  1.00 500.00 ? 56  TYR D CD2 1 
ATOM 9793  C CE1 . TYR D 4 56  ? 159.858 109.686 99.105  1.00 500.00 ? 56  TYR D CE1 1 
ATOM 9794  C CE2 . TYR D 4 56  ? 157.718 110.688 98.628  1.00 500.00 ? 56  TYR D CE2 1 
ATOM 9795  C CZ  . TYR D 4 56  ? 159.007 110.371 98.232  1.00 500.00 ? 56  TYR D CZ  1 
ATOM 9796  O OH  . TYR D 4 56  ? 159.437 110.740 96.973  1.00 500.00 ? 56  TYR D OH  1 
ATOM 9797  N N   . VAL D 4 57  ? 157.111 108.735 105.061 1.00 453.55 ? 57  VAL D N   1 
ATOM 9798  C CA  . VAL D 4 57  ? 156.250 108.841 106.248 1.00 469.71 ? 57  VAL D CA  1 
ATOM 9799  C C   . VAL D 4 57  ? 157.046 109.369 107.425 1.00 467.84 ? 57  VAL D C   1 
ATOM 9800  O O   . VAL D 4 57  ? 156.597 110.266 108.138 1.00 484.60 ? 57  VAL D O   1 
ATOM 9801  C CB  . VAL D 4 57  ? 155.536 107.492 106.560 1.00 488.47 ? 57  VAL D CB  1 
ATOM 9802  C CG1 . VAL D 4 57  ? 154.945 107.449 107.967 1.00 500.00 ? 57  VAL D CG1 1 
ATOM 9803  C CG2 . VAL D 4 57  ? 154.443 107.230 105.530 1.00 490.28 ? 57  VAL D CG2 1 
ATOM 9804  N N   . TRP D 4 58  ? 158.217 108.792 107.604 1.00 493.79 ? 58  TRP D N   1 
ATOM 9805  C CA  . TRP D 4 58  ? 159.158 109.137 108.677 1.00 500.00 ? 58  TRP D CA  1 
ATOM 9806  C C   . TRP D 4 58  ? 159.494 110.629 108.598 1.00 500.00 ? 58  TRP D C   1 
ATOM 9807  O O   . TRP D 4 58  ? 159.448 111.356 109.614 1.00 500.00 ? 58  TRP D O   1 
ATOM 9808  C CB  . TRP D 4 58  ? 160.400 108.226 108.401 1.00 500.00 ? 58  TRP D CB  1 
ATOM 9809  C CG  . TRP D 4 58  ? 161.684 108.408 109.148 1.00 500.00 ? 58  TRP D CG  1 
ATOM 9810  C CD1 . TRP D 4 58  ? 162.870 108.907 108.653 1.00 447.88 ? 58  TRP D CD1 1 
ATOM 9811  C CD2 . TRP D 4 58  ? 161.950 107.998 110.495 1.00 500.00 ? 58  TRP D CD2 1 
ATOM 9812  N NE1 . TRP D 4 58  ? 163.838 108.880 109.636 1.00 457.67 ? 58  TRP D NE1 1 
ATOM 9813  C CE2 . TRP D 4 58  ? 163.304 108.328 110.775 1.00 500.00 ? 58  TRP D CE2 1 
ATOM 9814  C CE3 . TRP D 4 58  ? 161.162 107.411 111.511 1.00 500.00 ? 58  TRP D CE3 1 
ATOM 9815  C CZ2 . TRP D 4 58  ? 163.891 108.088 112.032 1.00 500.00 ? 58  TRP D CZ2 1 
ATOM 9816  C CZ3 . TRP D 4 58  ? 161.744 107.171 112.763 1.00 500.00 ? 58  TRP D CZ3 1 
ATOM 9817  C CH2 . TRP D 4 58  ? 163.100 107.512 113.010 1.00 500.00 ? 58  TRP D CH2 1 
ATOM 9818  N N   . ARG D 4 59  ? 159.825 111.041 107.376 1.00 500.00 ? 59  ARG D N   1 
ATOM 9819  C CA  . ARG D 4 59  ? 160.202 112.424 107.085 1.00 500.00 ? 59  ARG D CA  1 
ATOM 9820  C C   . ARG D 4 59  ? 159.065 113.374 107.488 1.00 467.28 ? 59  ARG D C   1 
ATOM 9821  O O   . ARG D 4 59  ? 159.289 114.407 108.158 1.00 430.66 ? 59  ARG D O   1 
ATOM 9822  C CB  . ARG D 4 59  ? 160.555 112.599 105.592 1.00 500.00 ? 59  ARG D CB  1 
ATOM 9823  C CG  . ARG D 4 59  ? 161.506 113.757 105.279 1.00 500.00 ? 59  ARG D CG  1 
ATOM 9824  C CD  . ARG D 4 59  ? 161.963 113.774 103.815 1.00 500.00 ? 59  ARG D CD  1 
ATOM 9825  N NE  . ARG D 4 59  ? 162.815 112.634 103.437 1.00 500.00 ? 59  ARG D NE  1 
ATOM 9826  C CZ  . ARG D 4 59  ? 164.135 112.662 103.195 1.00 500.00 ? 59  ARG D CZ  1 
ATOM 9827  N NH1 . ARG D 4 59  ? 164.854 113.786 103.270 1.00 500.00 ? 59  ARG D NH1 1 
ATOM 9828  N NH2 . ARG D 4 59  ? 164.753 111.524 102.866 1.00 500.00 ? 59  ARG D NH2 1 
ATOM 9829  N N   . SER D 4 60  ? 157.865 112.977 107.070 1.00 462.25 ? 60  SER D N   1 
ATOM 9830  C CA  . SER D 4 60  ? 156.650 113.746 107.339 1.00 498.36 ? 60  SER D CA  1 
ATOM 9831  C C   . SER D 4 60  ? 156.452 113.918 108.834 1.00 500.00 ? 60  SER D C   1 
ATOM 9832  O O   . SER D 4 60  ? 156.161 115.024 109.316 1.00 500.00 ? 60  SER D O   1 
ATOM 9833  C CB  . SER D 4 60  ? 155.440 113.077 106.688 1.00 500.00 ? 60  SER D CB  1 
ATOM 9834  O OG  . SER D 4 60  ? 155.708 112.788 105.322 1.00 500.00 ? 60  SER D OG  1 
ATOM 9835  N N   . ALA D 4 61  ? 156.621 112.807 109.542 1.00 500.00 ? 61  ALA D N   1 
ATOM 9836  C CA  . ALA D 4 61  ? 156.472 112.760 111.004 1.00 500.00 ? 61  ALA D CA  1 
ATOM 9837  C C   . ALA D 4 61  ? 157.432 113.726 111.653 1.00 500.00 ? 61  ALA D C   1 
ATOM 9838  O O   . ALA D 4 61  ? 157.043 114.491 112.552 1.00 460.36 ? 61  ALA D O   1 
ATOM 9839  C CB  . ALA D 4 61  ? 156.674 111.354 111.550 1.00 500.00 ? 61  ALA D CB  1 
ATOM 9840  N N   . VAL D 4 62  ? 158.675 113.673 111.183 1.00 500.00 ? 62  VAL D N   1 
ATOM 9841  C CA  . VAL D 4 62  ? 159.752 114.530 111.704 1.00 500.00 ? 62  VAL D CA  1 
ATOM 9842  C C   . VAL D 4 62  ? 159.371 115.998 111.528 1.00 500.00 ? 62  VAL D C   1 
ATOM 9843  O O   . VAL D 4 62  ? 159.520 116.804 112.467 1.00 500.00 ? 62  VAL D O   1 
ATOM 9844  C CB  . VAL D 4 62  ? 161.158 114.176 111.152 1.00 500.00 ? 62  VAL D CB  1 
ATOM 9845  C CG1 . VAL D 4 62  ? 162.204 115.208 111.597 1.00 500.00 ? 62  VAL D CG1 1 
ATOM 9846  C CG2 . VAL D 4 62  ? 161.576 112.777 111.618 1.00 500.00 ? 62  VAL D CG2 1 
ATOM 9847  N N   . GLY D 4 63  ? 158.883 116.302 110.326 1.00 500.00 ? 63  GLY D N   1 
ATOM 9848  C CA  . GLY D 4 63  ? 158.466 117.659 109.968 1.00 500.00 ? 63  GLY D CA  1 
ATOM 9849  C C   . GLY D 4 63  ? 157.385 118.150 110.926 1.00 500.00 ? 63  GLY D C   1 
ATOM 9850  O O   . GLY D 4 63  ? 157.443 119.281 111.438 1.00 500.00 ? 63  GLY D O   1 
ATOM 9851  N N   . PHE D 4 64  ? 156.417 117.272 111.143 1.00 500.00 ? 64  PHE D N   1 
ATOM 9852  C CA  . PHE D 4 64  ? 155.275 117.539 112.025 1.00 495.80 ? 64  PHE D CA  1 
ATOM 9853  C C   . PHE D 4 64  ? 155.769 117.875 113.428 1.00 457.43 ? 64  PHE D C   1 
ATOM 9854  O O   . PHE D 4 64  ? 155.316 118.852 114.047 1.00 457.50 ? 64  PHE D O   1 
ATOM 9855  C CB  . PHE D 4 64  ? 154.358 116.308 111.945 1.00 500.00 ? 64  PHE D CB  1 
ATOM 9856  C CG  . PHE D 4 64  ? 153.384 116.189 113.054 1.00 500.00 ? 64  PHE D CG  1 
ATOM 9857  C CD1 . PHE D 4 64  ? 152.185 116.893 113.013 1.00 500.00 ? 64  PHE D CD1 1 
ATOM 9858  C CD2 . PHE D 4 64  ? 153.643 115.339 114.132 1.00 500.00 ? 64  PHE D CD2 1 
ATOM 9859  C CE1 . PHE D 4 64  ? 151.263 116.775 114.044 1.00 500.00 ? 64  PHE D CE1 1 
ATOM 9860  C CE2 . PHE D 4 64  ? 152.725 115.212 115.168 1.00 500.00 ? 64  PHE D CE2 1 
ATOM 9861  C CZ  . PHE D 4 64  ? 151.530 115.932 115.124 1.00 500.00 ? 64  PHE D CZ  1 
ATOM 9862  N N   . LEU D 4 65  ? 156.692 117.044 113.893 1.00 453.48 ? 65  LEU D N   1 
ATOM 9863  C CA  . LEU D 4 65  ? 157.293 117.188 115.223 1.00 500.00 ? 65  LEU D CA  1 
ATOM 9864  C C   . LEU D 4 65  ? 157.953 118.553 115.354 1.00 465.22 ? 65  LEU D C   1 
ATOM 9865  O O   . LEU D 4 65  ? 157.770 119.256 116.359 1.00 416.82 ? 65  LEU D O   1 
ATOM 9866  C CB  . LEU D 4 65  ? 158.288 116.054 115.458 1.00 500.00 ? 65  LEU D CB  1 
ATOM 9867  C CG  . LEU D 4 65  ? 158.999 115.986 116.820 1.00 500.00 ? 65  LEU D CG  1 
ATOM 9868  C CD1 . LEU D 4 65  ? 159.106 114.525 117.269 1.00 500.00 ? 65  LEU D CD1 1 
ATOM 9869  C CD2 . LEU D 4 65  ? 160.377 116.670 116.825 1.00 500.00 ? 65  LEU D CD2 1 
ATOM 9870  N N   . PHE D 4 66  ? 158.712 118.891 114.323 1.00 454.11 ? 66  PHE D N   1 
ATOM 9871  C CA  . PHE D 4 66  ? 159.442 120.165 114.249 1.00 500.00 ? 66  PHE D CA  1 
ATOM 9872  C C   . PHE D 4 66  ? 158.463 121.332 114.373 1.00 463.94 ? 66  PHE D C   1 
ATOM 9873  O O   . PHE D 4 66  ? 158.696 122.283 115.141 1.00 488.07 ? 66  PHE D O   1 
ATOM 9874  C CB  . PHE D 4 66  ? 160.298 120.147 112.948 1.00 500.00 ? 66  PHE D CB  1 
ATOM 9875  C CG  . PHE D 4 66  ? 160.556 121.492 112.299 1.00 500.00 ? 66  PHE D CG  1 
ATOM 9876  C CD1 . PHE D 4 66  ? 161.679 122.256 112.647 1.00 500.00 ? 66  PHE D CD1 1 
ATOM 9877  C CD2 . PHE D 4 66  ? 159.734 121.948 111.248 1.00 500.00 ? 66  PHE D CD2 1 
ATOM 9878  C CE1 . PHE D 4 66  ? 161.935 123.471 112.012 1.00 500.00 ? 66  PHE D CE1 1 
ATOM 9879  C CE2 . PHE D 4 66  ? 159.989 123.164 110.612 1.00 500.00 ? 66  PHE D CE2 1 
ATOM 9880  C CZ  . PHE D 4 66  ? 161.091 123.927 110.994 1.00 500.00 ? 66  PHE D CZ  1 
ATOM 9881  N N   . TRP D 4 67  ? 157.386 121.220 113.605 1.00 437.53 ? 67  TRP D N   1 
ATOM 9882  C CA  . TRP D 4 67  ? 156.327 122.232 113.576 1.00 436.69 ? 67  TRP D CA  1 
ATOM 9883  C C   . TRP D 4 67  ? 155.747 122.434 114.966 1.00 444.42 ? 67  TRP D C   1 
ATOM 9884  O O   . TRP D 4 67  ? 155.573 123.576 115.432 1.00 470.95 ? 67  TRP D O   1 
ATOM 9885  C CB  . TRP D 4 67  ? 155.198 121.838 112.624 1.00 476.22 ? 67  TRP D CB  1 
ATOM 9886  C CG  . TRP D 4 67  ? 155.175 122.703 111.465 1.00 500.00 ? 67  TRP D CG  1 
ATOM 9887  C CD1 . TRP D 4 67  ? 155.287 122.345 110.150 1.00 500.00 ? 67  TRP D CD1 1 
ATOM 9888  C CD2 . TRP D 4 67  ? 155.050 124.110 111.496 1.00 500.00 ? 67  TRP D CD2 1 
ATOM 9889  N NE1 . TRP D 4 67  ? 155.228 123.463 109.353 1.00 500.00 ? 67  TRP D NE1 1 
ATOM 9890  C CE2 . TRP D 4 67  ? 155.088 124.564 110.158 1.00 500.00 ? 67  TRP D CE2 1 
ATOM 9891  C CE3 . TRP D 4 67  ? 154.912 125.041 112.530 1.00 500.00 ? 67  TRP D CE3 1 
ATOM 9892  C CZ2 . TRP D 4 67  ? 154.993 125.910 109.828 1.00 500.00 ? 67  TRP D CZ2 1 
ATOM 9893  C CZ3 . TRP D 4 67  ? 154.817 126.376 112.209 1.00 500.00 ? 67  TRP D CZ3 1 
ATOM 9894  C CH2 . TRP D 4 67  ? 154.856 126.805 110.860 1.00 500.00 ? 67  TRP D CH2 1 
ATOM 9895  N N   . VAL D 4 68  ? 155.466 121.305 115.603 1.00 451.67 ? 68  VAL D N   1 
ATOM 9896  C CA  . VAL D 4 68  ? 154.897 121.278 116.956 1.00 497.40 ? 68  VAL D CA  1 
ATOM 9897  C C   . VAL D 4 68  ? 155.814 122.005 117.926 1.00 478.82 ? 68  VAL D C   1 
ATOM 9898  O O   . VAL D 4 68  ? 155.362 122.816 118.737 1.00 482.17 ? 68  VAL D O   1 
ATOM 9899  C CB  . VAL D 4 68  ? 154.581 119.844 117.419 1.00 500.00 ? 68  VAL D CB  1 
ATOM 9900  C CG1 . VAL D 4 68  ? 154.225 119.800 118.907 1.00 500.00 ? 68  VAL D CG1 1 
ATOM 9901  C CG2 . VAL D 4 68  ? 153.440 119.276 116.583 1.00 500.00 ? 68  VAL D CG2 1 
ATOM 9902  N N   . ILE D 4 69  ? 157.095 121.681 117.816 1.00 474.17 ? 69  ILE D N   1 
ATOM 9903  C CA  . ILE D 4 69  ? 158.147 122.265 118.659 1.00 500.00 ? 69  ILE D CA  1 
ATOM 9904  C C   . ILE D 4 69  ? 158.151 123.777 118.506 1.00 500.00 ? 69  ILE D C   1 
ATOM 9905  O O   . ILE D 4 69  ? 158.184 124.535 119.502 1.00 500.00 ? 69  ILE D O   1 
ATOM 9906  C CB  . ILE D 4 69  ? 159.565 121.684 118.338 1.00 500.00 ? 69  ILE D CB  1 
ATOM 9907  C CG1 . ILE D 4 69  ? 160.000 120.703 119.430 1.00 500.00 ? 69  ILE D CG1 1 
ATOM 9908  C CG2 . ILE D 4 69  ? 160.672 122.747 118.256 1.00 500.00 ? 69  ILE D CG2 1 
ATOM 9909  C CD1 . ILE D 4 69  ? 159.070 119.525 119.620 1.00 500.00 ? 69  ILE D CD1 1 
ATOM 9910  N N   . VAL D 4 70  ? 158.095 124.199 117.245 1.00 500.00 ? 70  VAL D N   1 
ATOM 9911  C CA  . VAL D 4 70  ? 158.117 125.620 116.887 1.00 500.00 ? 70  VAL D CA  1 
ATOM 9912  C C   . VAL D 4 70  ? 156.838 126.259 117.467 1.00 500.00 ? 70  VAL D C   1 
ATOM 9913  O O   . VAL D 4 70  ? 156.872 127.333 118.104 1.00 500.00 ? 70  VAL D O   1 
ATOM 9914  C CB  . VAL D 4 70  ? 158.243 125.861 115.366 1.00 500.00 ? 70  VAL D CB  1 
ATOM 9915  C CG1 . VAL D 4 70  ? 158.043 127.339 115.026 1.00 500.00 ? 70  VAL D CG1 1 
ATOM 9916  C CG2 . VAL D 4 70  ? 159.606 125.397 114.866 1.00 500.00 ? 70  VAL D CG2 1 
ATOM 9917  N N   . LEU D 4 71  ? 155.727 125.632 117.084 1.00 500.00 ? 71  LEU D N   1 
ATOM 9918  C CA  . LEU D 4 71  ? 154.395 126.164 117.352 1.00 500.00 ? 71  LEU D CA  1 
ATOM 9919  C C   . LEU D 4 71  ? 154.188 126.345 118.850 1.00 420.92 ? 71  LEU D C   1 
ATOM 9920  O O   . LEU D 4 71  ? 153.708 127.392 119.320 1.00 413.71 ? 71  LEU D O   1 
ATOM 9921  C CB  . LEU D 4 71  ? 153.334 125.222 116.788 1.00 500.00 ? 71  LEU D CB  1 
ATOM 9922  C CG  . LEU D 4 71  ? 151.870 125.605 116.978 1.00 500.00 ? 71  LEU D CG  1 
ATOM 9923  C CD1 . LEU D 4 71  ? 151.621 127.040 116.528 1.00 500.00 ? 71  LEU D CD1 1 
ATOM 9924  C CD2 . LEU D 4 71  ? 150.982 124.617 116.227 1.00 500.00 ? 71  LEU D CD2 1 
ATOM 9925  N N   . THR D 4 72  ? 154.563 125.293 119.570 1.00 414.88 ? 72  THR D N   1 
ATOM 9926  C CA  . THR D 4 72  ? 154.432 125.257 121.039 1.00 500.00 ? 72  THR D CA  1 
ATOM 9927  C C   . THR D 4 72  ? 155.232 126.394 121.651 1.00 498.65 ? 72  THR D C   1 
ATOM 9928  O O   . THR D 4 72  ? 154.730 127.099 122.546 1.00 500.00 ? 72  THR D O   1 
ATOM 9929  C CB  . THR D 4 72  ? 154.843 123.898 121.635 1.00 500.00 ? 72  THR D CB  1 
ATOM 9930  O OG1 . THR D 4 72  ? 156.101 123.483 121.086 1.00 500.00 ? 72  THR D OG1 1 
ATOM 9931  C CG2 . THR D 4 72  ? 153.756 122.840 121.348 1.00 500.00 ? 72  THR D CG2 1 
ATOM 9932  N N   . SER D 4 73  ? 156.457 126.552 121.152 1.00 499.81 ? 73  SER D N   1 
ATOM 9933  C CA  . SER D 4 73  ? 157.371 127.599 121.622 1.00 500.00 ? 73  SER D CA  1 
ATOM 9934  C C   . SER D 4 73  ? 156.732 128.973 121.438 1.00 486.86 ? 73  SER D C   1 
ATOM 9935  O O   . SER D 4 73  ? 156.755 129.815 122.350 1.00 472.04 ? 73  SER D O   1 
ATOM 9936  C CB  . SER D 4 73  ? 158.772 127.529 120.959 1.00 500.00 ? 73  SER D CB  1 
ATOM 9937  O OG  . SER D 4 73  ? 159.715 126.805 121.753 1.00 436.44 ? 73  SER D OG  1 
ATOM 9938  N N   . TRP D 4 74  ? 156.175 129.160 120.251 1.00 445.87 ? 74  TRP D N   1 
ATOM 9939  C CA  . TRP D 4 74  ? 155.508 130.412 119.872 1.00 423.23 ? 74  TRP D CA  1 
ATOM 9940  C C   . TRP D 4 74  ? 154.378 130.720 120.842 1.00 411.37 ? 74  TRP D C   1 
ATOM 9941  O O   . TRP D 4 74  ? 154.241 131.853 121.324 1.00 397.46 ? 74  TRP D O   1 
ATOM 9942  C CB  . TRP D 4 74  ? 154.996 130.287 118.436 1.00 444.45 ? 74  TRP D CB  1 
ATOM 9943  C CG  . TRP D 4 74  ? 153.978 131.260 118.058 1.00 455.05 ? 74  TRP D CG  1 
ATOM 9944  C CD1 . TRP D 4 74  ? 152.736 130.995 117.588 1.00 476.06 ? 74  TRP D CD1 1 
ATOM 9945  C CD2 . TRP D 4 74  ? 154.099 132.671 118.111 1.00 473.53 ? 74  TRP D CD2 1 
ATOM 9946  N NE1 . TRP D 4 74  ? 152.066 132.165 117.331 1.00 453.05 ? 74  TRP D NE1 1 
ATOM 9947  C CE2 . TRP D 4 74  ? 152.883 133.212 117.650 1.00 438.08 ? 74  TRP D CE2 1 
ATOM 9948  C CE3 . TRP D 4 74  ? 155.123 133.540 118.507 1.00 500.00 ? 74  TRP D CE3 1 
ATOM 9949  C CZ2 . TRP D 4 74  ? 152.662 134.583 117.571 1.00 499.02 ? 74  TRP D CZ2 1 
ATOM 9950  C CZ3 . TRP D 4 74  ? 154.903 134.907 118.429 1.00 500.00 ? 74  TRP D CZ3 1 
ATOM 9951  C CH2 . TRP D 4 74  ? 153.681 135.414 117.967 1.00 500.00 ? 74  TRP D CH2 1 
ATOM 9952  N N   . ILE D 4 75  ? 153.588 129.685 121.103 1.00 428.59 ? 75  ILE D N   1 
ATOM 9953  C CA  . ILE D 4 75  ? 152.437 129.771 122.010 1.00 458.16 ? 75  ILE D CA  1 
ATOM 9954  C C   . ILE D 4 75  ? 152.898 130.224 123.396 1.00 491.02 ? 75  ILE D C   1 
ATOM 9955  O O   . ILE D 4 75  ? 152.294 131.123 124.005 1.00 481.11 ? 75  ILE D O   1 
ATOM 9956  C CB  . ILE D 4 75  ? 151.582 128.461 122.026 1.00 460.32 ? 75  ILE D CB  1 
ATOM 9957  C CG1 . ILE D 4 75  ? 150.368 128.643 121.090 1.00 451.03 ? 75  ILE D CG1 1 
ATOM 9958  C CG2 . ILE D 4 75  ? 151.166 128.036 123.448 1.00 453.48 ? 75  ILE D CG2 1 
ATOM 9959  C CD1 . ILE D 4 75  ? 149.296 127.571 121.173 1.00 483.69 ? 75  ILE D CD1 1 
ATOM 9960  N N   . THR D 4 76  ? 153.968 129.585 123.850 1.00 500.00 ? 76  THR D N   1 
ATOM 9961  C CA  . THR D 4 76  ? 154.564 129.870 125.159 1.00 500.00 ? 76  THR D CA  1 
ATOM 9962  C C   . THR D 4 76  ? 154.973 131.335 125.241 1.00 500.00 ? 76  THR D C   1 
ATOM 9963  O O   . THR D 4 76  ? 154.694 132.026 126.235 1.00 500.00 ? 76  THR D O   1 
ATOM 9964  C CB  . THR D 4 76  ? 155.737 128.922 125.525 1.00 500.00 ? 76  THR D CB  1 
ATOM 9965  O OG1 . THR D 4 76  ? 155.232 127.591 125.691 1.00 500.00 ? 76  THR D OG1 1 
ATOM 9966  C CG2 . THR D 4 76  ? 156.430 129.348 126.834 1.00 500.00 ? 76  THR D CG2 1 
ATOM 9967  N N   . ILE D 4 77  ? 155.632 131.776 124.179 1.00 480.98 ? 77  ILE D N   1 
ATOM 9968  C CA  . ILE D 4 77  ? 156.116 133.158 124.052 1.00 500.00 ? 77  ILE D CA  1 
ATOM 9969  C C   . ILE D 4 77  ? 154.951 134.130 124.178 1.00 500.00 ? 77  ILE D C   1 
ATOM 9970  O O   . ILE D 4 77  ? 155.037 135.125 124.887 1.00 461.35 ? 77  ILE D O   1 
ATOM 9971  C CB  . ILE D 4 77  ? 156.831 133.381 122.684 1.00 500.00 ? 77  ILE D CB  1 
ATOM 9972  C CG1 . ILE D 4 77  ? 158.208 132.696 122.679 1.00 500.00 ? 77  ILE D CG1 1 
ATOM 9973  C CG2 . ILE D 4 77  ? 156.993 134.872 122.361 1.00 500.00 ? 77  ILE D CG2 1 
ATOM 9974  C CD1 . ILE D 4 77  ? 158.811 132.488 121.301 1.00 500.00 ? 77  ILE D CD1 1 
ATOM 9975  N N   . PHE D 4 78  ? 153.887 133.809 123.453 1.00 481.32 ? 78  PHE D N   1 
ATOM 9976  C CA  . PHE D 4 78  ? 152.668 134.616 123.418 1.00 485.93 ? 78  PHE D CA  1 
ATOM 9977  C C   . PHE D 4 78  ? 152.102 134.751 124.841 1.00 440.05 ? 78  PHE D C   1 
ATOM 9978  O O   . PHE D 4 78  ? 151.764 135.878 125.305 1.00 448.84 ? 78  PHE D O   1 
ATOM 9979  C CB  . PHE D 4 78  ? 151.668 134.004 122.447 1.00 468.94 ? 78  PHE D CB  1 
ATOM 9980  C CG  . PHE D 4 78  ? 150.446 134.821 122.283 1.00 500.00 ? 78  PHE D CG  1 
ATOM 9981  C CD1 . PHE D 4 78  ? 150.537 136.148 121.868 1.00 500.00 ? 78  PHE D CD1 1 
ATOM 9982  C CD2 . PHE D 4 78  ? 149.209 134.293 122.576 1.00 500.00 ? 78  PHE D CD2 1 
ATOM 9983  C CE1 . PHE D 4 78  ? 149.401 136.931 121.741 1.00 500.00 ? 78  PHE D CE1 1 
ATOM 9984  C CE2 . PHE D 4 78  ? 148.084 135.071 122.443 1.00 500.00 ? 78  PHE D CE2 1 
ATOM 9985  C CZ  . PHE D 4 78  ? 148.168 136.382 122.018 1.00 500.00 ? 78  PHE D CZ  1 
ATOM 9986  N N   . GLN D 4 79  ? 152.036 133.604 125.498 1.00 413.85 ? 79  GLN D N   1 
ATOM 9987  C CA  . GLN D 4 79  ? 151.443 133.521 126.839 1.00 489.86 ? 79  GLN D CA  1 
ATOM 9988  C C   . GLN D 4 79  ? 152.263 134.371 127.804 1.00 476.07 ? 79  GLN D C   1 
ATOM 9989  O O   . GLN D 4 79  ? 151.707 135.130 128.613 1.00 465.64 ? 79  GLN D O   1 
ATOM 9990  C CB  . GLN D 4 79  ? 151.290 132.074 127.334 1.00 500.00 ? 79  GLN D CB  1 
ATOM 9991  C CG  . GLN D 4 79  ? 150.057 131.344 126.789 1.00 500.00 ? 79  GLN D CG  1 
ATOM 9992  C CD  . GLN D 4 79  ? 148.800 131.472 127.651 1.00 462.53 ? 79  GLN D CD  1 
ATOM 9993  O OE1 . GLN D 4 79  ? 148.862 131.532 128.888 1.00 379.30 ? 79  GLN D OE1 1 
ATOM 9994  N NE2 . GLN D 4 79  ? 147.643 131.482 126.992 1.00 433.26 ? 79  GLN D NE2 1 
ATOM 9995  N N   . ILE D 4 80  ? 153.580 134.277 127.692 1.00 474.34 ? 80  ILE D N   1 
ATOM 9996  C CA  . ILE D 4 80  ? 154.465 135.034 128.575 1.00 491.80 ? 80  ILE D CA  1 
ATOM 9997  C C   . ILE D 4 80  ? 154.504 136.538 128.201 1.00 492.68 ? 80  ILE D C   1 
ATOM 9998  O O   . ILE D 4 80  ? 154.165 137.443 129.007 1.00 500.00 ? 80  ILE D O   1 
ATOM 9999  C CB  . ILE D 4 80  ? 155.883 134.424 128.601 1.00 500.00 ? 80  ILE D CB  1 
ATOM 10000 C CG1 . ILE D 4 80  ? 155.815 133.017 129.215 1.00 500.00 ? 80  ILE D CG1 1 
ATOM 10001 C CG2 . ILE D 4 80  ? 156.853 135.302 129.395 1.00 480.17 ? 80  ILE D CG2 1 
ATOM 10002 C CD1 . ILE D 4 80  ? 157.025 132.152 128.939 1.00 500.00 ? 80  ILE D CD1 1 
ATOM 10003 N N   . TYR D 4 81  ? 154.997 136.773 126.985 1.00 460.73 ? 81  TYR D N   1 
ATOM 10004 C CA  . TYR D 4 81  ? 155.505 138.082 126.569 1.00 468.35 ? 81  TYR D CA  1 
ATOM 10005 C C   . TYR D 4 81  ? 154.479 139.011 125.888 1.00 499.53 ? 81  TYR D C   1 
ATOM 10006 O O   . TYR D 4 81  ? 154.866 140.060 125.391 1.00 435.61 ? 81  TYR D O   1 
ATOM 10007 C CB  . TYR D 4 81  ? 156.764 137.913 125.683 1.00 500.00 ? 81  TYR D CB  1 
ATOM 10008 C CG  . TYR D 4 81  ? 158.043 137.453 126.412 1.00 500.00 ? 81  TYR D CG  1 
ATOM 10009 C CD1 . TYR D 4 81  ? 158.576 138.187 127.480 1.00 500.00 ? 81  TYR D CD1 1 
ATOM 10010 C CD2 . TYR D 4 81  ? 158.752 136.308 125.998 1.00 500.00 ? 81  TYR D CD2 1 
ATOM 10011 C CE1 . TYR D 4 81  ? 159.751 137.783 128.136 1.00 500.00 ? 81  TYR D CE1 1 
ATOM 10012 C CE2 . TYR D 4 81  ? 159.928 135.895 126.646 1.00 500.00 ? 81  TYR D CE2 1 
ATOM 10013 C CZ  . TYR D 4 81  ? 160.428 136.631 127.715 1.00 500.00 ? 81  TYR D CZ  1 
ATOM 10014 O OH  . TYR D 4 81  ? 161.588 136.223 128.357 1.00 446.76 ? 81  TYR D OH  1 
ATOM 10015 N N   . ARG D 4 82  ? 153.188 138.657 125.882 1.00 500.00 ? 82  ARG D N   1 
ATOM 10016 C CA  . ARG D 4 82  ? 152.115 139.619 125.500 1.00 500.00 ? 82  ARG D CA  1 
ATOM 10017 C C   . ARG D 4 82  ? 151.931 140.727 126.559 1.00 500.00 ? 82  ARG D C   1 
ATOM 10018 O O   . ARG D 4 82  ? 151.759 141.896 126.195 1.00 500.00 ? 82  ARG D O   1 
ATOM 10019 C CB  . ARG D 4 82  ? 150.767 138.912 125.214 1.00 500.00 ? 82  ARG D CB  1 
ATOM 10020 C CG  . ARG D 4 82  ? 149.576 139.847 124.910 1.00 500.00 ? 82  ARG D CG  1 
ATOM 10021 C CD  . ARG D 4 82  ? 148.235 139.117 124.878 1.00 500.00 ? 82  ARG D CD  1 
ATOM 10022 N NE  . ARG D 4 82  ? 148.048 138.225 126.028 1.00 500.00 ? 82  ARG D NE  1 
ATOM 10023 C CZ  . ARG D 4 82  ? 147.623 138.585 127.239 1.00 500.00 ? 82  ARG D CZ  1 
ATOM 10024 N NH1 . ARG D 4 82  ? 147.516 137.656 128.187 1.00 500.00 ? 82  ARG D NH1 1 
ATOM 10025 N NH2 . ARG D 4 82  ? 147.299 139.850 127.526 1.00 500.00 ? 82  ARG D NH2 1 
ATOM 10026 N N   . PRO D 4 83  ? 151.902 140.358 127.861 1.00 500.00 ? 83  PRO D N   1 
ATOM 10027 C CA  . PRO D 4 83  ? 152.054 141.375 128.878 1.00 474.60 ? 83  PRO D CA  1 
ATOM 10028 C C   . PRO D 4 83  ? 153.128 142.410 128.537 1.00 464.01 ? 83  PRO D C   1 
ATOM 10029 O O   . PRO D 4 83  ? 152.822 143.602 128.469 1.00 468.54 ? 83  PRO D O   1 
ATOM 10030 C CB  . PRO D 4 83  ? 152.436 140.543 130.103 1.00 470.45 ? 83  PRO D CB  1 
ATOM 10031 C CG  . PRO D 4 83  ? 151.622 139.298 129.946 1.00 448.18 ? 83  PRO D CG  1 
ATOM 10032 C CD  . PRO D 4 83  ? 151.392 139.107 128.465 1.00 493.14 ? 83  PRO D CD  1 
ATOM 10033 N N   . ARG D 4 84  ? 154.346 141.947 128.267 1.00 473.35 ? 84  ARG D N   1 
ATOM 10034 C CA  . ARG D 4 84  ? 155.506 142.834 128.117 1.00 500.00 ? 84  ARG D CA  1 
ATOM 10035 C C   . ARG D 4 84  ? 155.604 143.477 126.728 1.00 477.84 ? 84  ARG D C   1 
ATOM 10036 O O   . ARG D 4 84  ? 155.921 144.667 126.623 1.00 409.65 ? 84  ARG D O   1 
ATOM 10037 C CB  . ARG D 4 84  ? 156.793 142.089 128.485 1.00 500.00 ? 84  ARG D CB  1 
ATOM 10038 C CG  . ARG D 4 84  ? 156.827 141.636 129.942 1.00 500.00 ? 84  ARG D CG  1 
ATOM 10039 C CD  . ARG D 4 84  ? 158.031 140.752 130.253 1.00 500.00 ? 84  ARG D CD  1 
ATOM 10040 N NE  . ARG D 4 84  ? 157.931 140.085 131.560 1.00 500.00 ? 84  ARG D NE  1 
ATOM 10041 C CZ  . ARG D 4 84  ? 157.144 139.038 131.851 1.00 500.00 ? 84  ARG D CZ  1 
ATOM 10042 N NH1 . ARG D 4 84  ? 156.329 138.493 130.937 1.00 500.00 ? 84  ARG D NH1 1 
ATOM 10043 N NH2 . ARG D 4 84  ? 157.163 138.529 133.090 1.00 500.00 ? 84  ARG D NH2 1 
ATOM 10044 N N   . TRP D 4 85  ? 155.352 142.699 125.670 1.00 500.00 ? 85  TRP D N   1 
ATOM 10045 C CA  . TRP D 4 85  ? 155.136 143.278 124.337 1.00 500.00 ? 85  TRP D CA  1 
ATOM 10046 C C   . TRP D 4 85  ? 153.770 143.963 124.409 1.00 500.00 ? 85  TRP D C   1 
ATOM 10047 O O   . TRP D 4 85  ? 152.736 143.312 124.275 1.00 464.24 ? 85  TRP D O   1 
ATOM 10048 C CB  . TRP D 4 85  ? 155.132 142.233 123.193 1.00 500.00 ? 85  TRP D CB  1 
ATOM 10049 C CG  . TRP D 4 85  ? 156.383 141.349 122.991 1.00 500.00 ? 85  TRP D CG  1 
ATOM 10050 C CD1 . TRP D 4 85  ? 156.385 139.985 122.806 1.00 500.00 ? 85  TRP D CD1 1 
ATOM 10051 C CD2 . TRP D 4 85  ? 157.777 141.761 122.910 1.00 500.00 ? 85  TRP D CD2 1 
ATOM 10052 N NE1 . TRP D 4 85  ? 157.675 139.527 122.644 1.00 500.00 ? 85  TRP D NE1 1 
ATOM 10053 C CE2 . TRP D 4 85  ? 158.548 140.586 122.700 1.00 500.00 ? 85  TRP D CE2 1 
ATOM 10054 C CE3 . TRP D 4 85  ? 158.445 142.999 123.008 1.00 500.00 ? 85  TRP D CE3 1 
ATOM 10055 C CZ2 . TRP D 4 85  ? 159.960 140.614 122.586 1.00 500.00 ? 85  TRP D CZ2 1 
ATOM 10056 C CZ3 . TRP D 4 85  ? 159.857 143.023 122.893 1.00 464.70 ? 85  TRP D CZ3 1 
ATOM 10057 C CH2 . TRP D 4 85  ? 160.589 141.836 122.684 1.00 428.23 ? 85  TRP D CH2 1 
ATOM 10058 N N   . GLY D 4 86  ? 153.776 145.274 124.635 1.00 500.00 ? 86  GLY D N   1 
ATOM 10059 C CA  . GLY D 4 86  ? 152.548 146.021 124.926 1.00 500.00 ? 86  GLY D CA  1 
ATOM 10060 C C   . GLY D 4 86  ? 151.594 146.157 123.753 1.00 457.20 ? 86  GLY D C   1 
ATOM 10061 O O   . GLY D 4 86  ? 150.908 145.192 123.404 1.00 435.24 ? 86  GLY D O   1 
ATOM 10062 N N   . ALA D 4 87  ? 151.558 147.354 123.157 1.00 430.94 ? 87  ALA D N   1 
ATOM 10063 C CA  . ALA D 4 87  ? 150.748 147.671 121.980 1.00 452.34 ? 87  ALA D CA  1 
ATOM 10064 C C   . ALA D 4 87  ? 150.882 146.608 120.918 1.00 447.18 ? 87  ALA D C   1 
ATOM 10065 O O   . ALA D 4 87  ? 149.876 146.229 120.306 1.00 469.96 ? 87  ALA D O   1 
ATOM 10066 C CB  . ALA D 4 87  ? 151.132 149.025 121.398 1.00 463.40 ? 87  ALA D CB  1 
ATOM 10067 N N   . LEU D 4 88  ? 152.111 146.120 120.737 1.00 478.23 ? 88  LEU D N   1 
ATOM 10068 C CA  . LEU D 4 88  ? 152.400 145.055 119.773 1.00 500.00 ? 88  LEU D CA  1 
ATOM 10069 C C   . LEU D 4 88  ? 151.576 143.813 120.111 1.00 489.36 ? 88  LEU D C   1 
ATOM 10070 O O   . LEU D 4 88  ? 150.978 143.205 119.210 1.00 500.00 ? 88  LEU D O   1 
ATOM 10071 C CB  . LEU D 4 88  ? 153.926 144.808 119.674 1.00 500.00 ? 88  LEU D CB  1 
ATOM 10072 C CG  . LEU D 4 88  ? 154.819 146.018 119.239 1.00 500.00 ? 88  LEU D CG  1 
ATOM 10073 C CD1 . LEU D 4 88  ? 156.316 145.727 119.357 1.00 500.00 ? 88  LEU D CD1 1 
ATOM 10074 C CD2 . LEU D 4 88  ? 154.502 146.528 117.831 1.00 500.00 ? 88  LEU D CD2 1 
ATOM 10075 N N   . GLY D 4 89  ? 151.555 143.480 121.399 1.00 463.69 ? 89  GLY D N   1 
ATOM 10076 C CA  . GLY D 4 89  ? 150.808 142.330 121.903 1.00 473.30 ? 89  GLY D CA  1 
ATOM 10077 C C   . GLY D 4 89  ? 149.330 142.451 121.549 1.00 455.33 ? 89  GLY D C   1 
ATOM 10078 O O   . GLY D 4 89  ? 148.701 141.502 121.065 1.00 454.56 ? 89  GLY D O   1 
ATOM 10079 N N   . ASP D 4 90  ? 148.815 143.646 121.807 1.00 500.00 ? 90  ASP D N   1 
ATOM 10080 C CA  . ASP D 4 90  ? 147.404 143.969 121.536 1.00 500.00 ? 90  ASP D CA  1 
ATOM 10081 C C   . ASP D 4 90  ? 147.094 143.771 120.061 1.00 483.51 ? 90  ASP D C   1 
ATOM 10082 O O   . ASP D 4 90  ? 146.074 143.170 119.706 1.00 431.54 ? 90  ASP D O   1 
ATOM 10083 C CB  . ASP D 4 90  ? 146.971 145.355 122.053 1.00 500.00 ? 90  ASP D CB  1 
ATOM 10084 C CG  . ASP D 4 90  ? 146.570 145.345 123.538 1.00 500.00 ? 90  ASP D CG  1 
ATOM 10085 O OD1 . ASP D 4 90  ? 146.728 144.301 124.218 1.00 500.00 ? 90  ASP D OD1 1 
ATOM 10086 O OD2 . ASP D 4 90  ? 146.103 146.404 124.021 1.00 500.00 ? 90  ASP D OD2 1 
ATOM 10087 N N   . TYR D 4 91  ? 147.995 144.284 119.233 1.00 451.48 ? 91  TYR D N   1 
ATOM 10088 C CA  . TYR D 4 91  ? 147.882 144.199 117.773 1.00 434.35 ? 91  TYR D CA  1 
ATOM 10089 C C   . TYR D 4 91  ? 147.798 142.747 117.341 1.00 432.28 ? 91  TYR D C   1 
ATOM 10090 O O   . TYR D 4 91  ? 146.930 142.381 116.516 1.00 436.62 ? 91  TYR D O   1 
ATOM 10091 C CB  . TYR D 4 91  ? 149.082 144.865 117.047 1.00 438.53 ? 91  TYR D CB  1 
ATOM 10092 C CG  . TYR D 4 91  ? 148.835 146.258 116.458 1.00 495.47 ? 91  TYR D CG  1 
ATOM 10093 C CD1 . TYR D 4 91  ? 148.730 147.381 117.283 1.00 500.00 ? 91  TYR D CD1 1 
ATOM 10094 C CD2 . TYR D 4 91  ? 148.745 146.463 115.067 1.00 484.22 ? 91  TYR D CD2 1 
ATOM 10095 C CE1 . TYR D 4 91  ? 148.519 148.659 116.756 1.00 500.00 ? 91  TYR D CE1 1 
ATOM 10096 C CE2 . TYR D 4 91  ? 148.535 147.742 114.529 1.00 490.49 ? 91  TYR D CE2 1 
ATOM 10097 C CZ  . TYR D 4 91  ? 148.419 148.850 115.376 1.00 500.00 ? 91  TYR D CZ  1 
ATOM 10098 O OH  . TYR D 4 91  ? 148.205 150.148 114.888 1.00 353.00 ? 91  TYR D OH  1 
ATOM 10099 N N   . LEU D 4 92  ? 148.694 141.940 117.917 1.00 466.92 ? 92  LEU D N   1 
ATOM 10100 C CA  . LEU D 4 92  ? 148.917 140.564 117.401 1.00 500.00 ? 92  LEU D CA  1 
ATOM 10101 C C   . LEU D 4 92  ? 147.983 139.514 118.012 1.00 483.40 ? 92  LEU D C   1 
ATOM 10102 O O   . LEU D 4 92  ? 147.714 138.478 117.407 1.00 452.26 ? 92  LEU D O   1 
ATOM 10103 C CB  . LEU D 4 92  ? 150.391 140.161 117.553 1.00 500.00 ? 92  LEU D CB  1 
ATOM 10104 C CG  . LEU D 4 92  ? 150.979 139.847 118.949 1.00 500.00 ? 92  LEU D CG  1 
ATOM 10105 C CD1 . LEU D 4 92  ? 150.940 138.353 119.235 1.00 500.00 ? 92  LEU D CD1 1 
ATOM 10106 C CD2 . LEU D 4 92  ? 152.423 140.338 119.137 1.00 500.00 ? 92  LEU D CD2 1 
ATOM 10107 N N   . SER D 4 93  ? 147.532 139.792 119.237 1.00 471.28 ? 93  SER D N   1 
ATOM 10108 C CA  . SER D 4 93  ? 146.507 139.004 119.910 1.00 449.25 ? 93  SER D CA  1 
ATOM 10109 C C   . SER D 4 93  ? 145.168 139.166 119.198 1.00 414.19 ? 93  SER D C   1 
ATOM 10110 O O   . SER D 4 93  ? 144.788 140.272 118.810 1.00 401.48 ? 93  SER D O   1 
ATOM 10111 C CB  . SER D 4 93  ? 146.374 139.427 121.379 1.00 481.14 ? 93  SER D CB  1 
ATOM 10112 O OG  . SER D 4 93  ? 146.188 140.825 121.504 1.00 489.66 ? 93  SER D OG  1 
ATOM 10113 N N   . PHE D 4 94  ? 144.468 138.053 119.030 1.00 404.81 ? 94  PHE D N   1 
ATOM 10114 C CA  . PHE D 4 94  ? 143.176 138.023 118.347 1.00 431.01 ? 94  PHE D CA  1 
ATOM 10115 C C   . PHE D 4 94  ? 142.037 137.735 119.328 1.00 475.78 ? 94  PHE D C   1 
ATOM 10116 O O   . PHE D 4 94  ? 140.977 138.364 119.260 1.00 466.69 ? 94  PHE D O   1 
ATOM 10117 C CB  . PHE D 4 94  ? 143.238 136.998 117.223 1.00 425.55 ? 94  PHE D CB  1 
ATOM 10118 C CG  . PHE D 4 94  ? 142.083 136.063 117.172 1.00 430.87 ? 94  PHE D CG  1 
ATOM 10119 C CD1 . PHE D 4 94  ? 140.889 136.447 116.577 1.00 460.97 ? 94  PHE D CD1 1 
ATOM 10120 C CD2 . PHE D 4 94  ? 142.193 134.788 117.699 1.00 410.66 ? 94  PHE D CD2 1 
ATOM 10121 C CE1 . PHE D 4 94  ? 139.821 135.575 116.514 1.00 459.13 ? 94  PHE D CE1 1 
ATOM 10122 C CE2 . PHE D 4 94  ? 141.137 133.908 117.631 1.00 430.98 ? 94  PHE D CE2 1 
ATOM 10123 C CZ  . PHE D 4 94  ? 139.952 134.304 117.033 1.00 455.42 ? 94  PHE D CZ  1 
ATOM 10124 N N   . THR D 4 95  ? 142.248 136.756 120.205 1.00 498.13 ? 95  THR D N   1 
ATOM 10125 C CA  . THR D 4 95  ? 141.427 136.607 121.389 1.00 500.00 ? 95  THR D CA  1 
ATOM 10126 C C   . THR D 4 95  ? 142.107 137.416 122.471 1.00 500.00 ? 95  THR D C   1 
ATOM 10127 O O   . THR D 4 95  ? 143.208 137.076 122.919 1.00 492.16 ? 95  THR D O   1 
ATOM 10128 C CB  . THR D 4 95  ? 141.312 135.152 121.868 1.00 500.00 ? 95  THR D CB  1 
ATOM 10129 O OG1 . THR D 4 95  ? 141.143 134.281 120.742 1.00 500.00 ? 95  THR D OG1 1 
ATOM 10130 C CG2 . THR D 4 95  ? 140.133 135.007 122.849 1.00 500.00 ? 95  THR D CG2 1 
ATOM 10131 N N   . ILE D 4 96  ? 141.466 138.505 122.865 1.00 480.43 ? 96  ILE D N   1 
ATOM 10132 C CA  . ILE D 4 96  ? 141.926 139.266 123.998 1.00 452.72 ? 96  ILE D CA  1 
ATOM 10133 C C   . ILE D 4 96  ? 141.227 138.655 125.205 1.00 402.24 ? 96  ILE D C   1 
ATOM 10134 O O   . ILE D 4 96  ? 140.012 138.460 125.189 1.00 409.32 ? 96  ILE D O   1 
ATOM 10135 C CB  . ILE D 4 96  ? 141.617 140.766 123.846 1.00 500.00 ? 96  ILE D CB  1 
ATOM 10136 C CG1 . ILE D 4 96  ? 142.475 141.370 122.719 1.00 500.00 ? 96  ILE D CG1 1 
ATOM 10137 C CG2 . ILE D 4 96  ? 141.874 141.497 125.152 1.00 500.00 ? 96  ILE D CG2 1 
ATOM 10138 C CD1 . ILE D 4 96  ? 141.816 141.407 121.356 1.00 500.00 ? 96  ILE D CD1 1 
ATOM 10139 N N   . PRO D 4 97  ? 141.996 138.324 126.246 1.00 397.76 ? 97  PRO D N   1 
ATOM 10140 C CA  . PRO D 4 97  ? 141.393 137.819 127.461 1.00 406.50 ? 97  PRO D CA  1 
ATOM 10141 C C   . PRO D 4 97  ? 140.859 138.968 128.299 1.00 394.76 ? 97  PRO D C   1 
ATOM 10142 O O   . PRO D 4 97  ? 141.643 139.790 128.778 1.00 375.54 ? 97  PRO D O   1 
ATOM 10143 C CB  . PRO D 4 97  ? 142.563 137.143 128.163 1.00 459.12 ? 97  PRO D CB  1 
ATOM 10144 C CG  . PRO D 4 97  ? 143.752 137.936 127.748 1.00 462.26 ? 97  PRO D CG  1 
ATOM 10145 C CD  . PRO D 4 97  ? 143.466 138.408 126.355 1.00 440.66 ? 97  PRO D CD  1 
ATOM 10146 N N   . LEU D 4 98  ? 139.540 139.009 128.482 1.00 394.62 ? 98  LEU D N   1 
ATOM 10147 C CA  . LEU D 4 98  ? 138.875 140.131 129.151 1.00 374.91 ? 98  LEU D CA  1 
ATOM 10148 C C   . LEU D 4 98  ? 139.449 140.476 130.517 1.00 429.60 ? 98  LEU D C   1 
ATOM 10149 O O   . LEU D 4 98  ? 140.132 141.489 130.641 1.00 500.00 ? 98  LEU D O   1 
ATOM 10150 C CB  . LEU D 4 98  ? 137.373 139.894 129.248 1.00 421.93 ? 98  LEU D CB  1 
ATOM 10151 C CG  . LEU D 4 98  ? 136.540 140.363 128.050 1.00 494.88 ? 98  LEU D CG  1 
ATOM 10152 C CD1 . LEU D 4 98  ? 137.277 140.347 126.710 1.00 493.08 ? 98  LEU D CD1 1 
ATOM 10153 C CD2 . LEU D 4 98  ? 135.264 139.532 127.977 1.00 500.00 ? 98  LEU D CD2 1 
ATOM 10154 N N   . GLY D 4 99  ? 139.238 139.639 131.530 1.00 434.65 ? 99  GLY D N   1 
ATOM 10155 C CA  . GLY D 4 99  ? 139.605 140.020 132.904 1.00 447.61 ? 99  GLY D CA  1 
ATOM 10156 C C   . GLY D 4 99  ? 141.077 139.940 133.257 1.00 391.33 ? 99  GLY D C   1 
ATOM 10157 O O   . GLY D 4 99  ? 141.445 139.907 134.433 1.00 371.82 ? 99  GLY D O   1 
ATOM 10158 N N   . THR D 4 100 ? 141.930 139.964 132.247 1.00 417.47 ? 100 THR D N   1 
ATOM 10159 C CA  . THR D 4 100 ? 143.274 139.499 132.413 1.00 493.55 ? 100 THR D CA  1 
ATOM 10160 C C   . THR D 4 100 ? 144.248 140.585 132.007 1.00 451.66 ? 100 THR D C   1 
ATOM 10161 O O   . THR D 4 100 ? 144.058 141.240 130.971 1.00 392.25 ? 100 THR D O   1 
ATOM 10162 C CB  . THR D 4 100 ? 143.513 138.235 131.574 1.00 500.00 ? 100 THR D CB  1 
ATOM 10163 O OG1 . THR D 4 100 ? 142.425 137.317 131.774 1.00 500.00 ? 100 THR D OG1 1 
ATOM 10164 C CG2 . THR D 4 100 ? 144.833 137.557 131.969 1.00 500.00 ? 100 THR D CG2 1 
ATOM 10165 N N   . PRO D 4 101 ? 145.281 140.794 132.837 1.00 444.19 ? 101 PRO D N   1 
ATOM 10166 C CA  . PRO D 4 101 ? 146.381 141.651 132.408 1.00 488.43 ? 101 PRO D CA  1 
ATOM 10167 C C   . PRO D 4 101 ? 147.088 141.148 131.139 1.00 467.93 ? 101 PRO D C   1 
ATOM 10168 O O   . PRO D 4 101 ? 146.835 141.667 130.047 1.00 427.56 ? 101 PRO D O   1 
ATOM 10169 C CB  . PRO D 4 101 ? 147.337 141.644 133.612 1.00 500.00 ? 101 PRO D CB  1 
ATOM 10170 C CG  . PRO D 4 101 ? 146.731 140.762 134.656 1.00 485.18 ? 101 PRO D CG  1 
ATOM 10171 C CD  . PRO D 4 101 ? 145.314 140.520 134.288 1.00 415.71 ? 101 PRO D CD  1 
ATOM 10172 N N   . ALA E 5 1   ? 135.729 147.617 96.816  1.00 30.00  ? 5   ALA G N   1 
ATOM 10173 C CA  . ALA E 5 1   ? 135.555 147.229 98.210  1.00 30.00  ? 5   ALA G CA  1 
ATOM 10174 C C   . ALA E 5 1   ? 134.255 147.789 98.778  1.00 30.00  ? 5   ALA G C   1 
ATOM 10175 O O   . ALA E 5 1   ? 133.326 147.042 99.081  1.00 30.00  ? 5   ALA G O   1 
ATOM 10176 C CB  . ALA E 5 1   ? 136.741 147.689 99.042  1.00 30.00  ? 5   ALA G CB  1 
ATOM 10177 N N   . ALA E 5 2   ? 134.198 149.109 98.922  1.00 30.00  ? 6   ALA G N   1 
ATOM 10178 C CA  . ALA E 5 2   ? 133.890 149.725 100.205 1.00 30.00  ? 6   ALA G CA  1 
ATOM 10179 C C   . ALA E 5 2   ? 132.489 149.350 100.676 1.00 30.00  ? 6   ALA G C   1 
ATOM 10180 O O   . ALA E 5 2   ? 132.273 149.082 101.858 1.00 30.00  ? 6   ALA G O   1 
ATOM 10181 C CB  . ALA E 5 2   ? 134.034 151.237 100.115 1.00 30.00  ? 6   ALA G CB  1 
ATOM 10182 N N   . ALA E 5 3   ? 131.542 149.326 99.744  1.00 30.00  ? 7   ALA G N   1 
ATOM 10183 C CA  . ALA E 5 3   ? 130.206 148.807 100.019 1.00 30.00  ? 7   ALA G CA  1 
ATOM 10184 C C   . ALA E 5 3   ? 130.263 147.328 100.381 1.00 30.00  ? 7   ALA G C   1 
ATOM 10185 O O   . ALA E 5 3   ? 129.555 146.869 101.279 1.00 30.00  ? 7   ALA G O   1 
ATOM 10186 C CB  . ALA E 5 3   ? 129.291 149.031 98.824  1.00 30.00  ? 7   ALA G CB  1 
ATOM 10187 N N   . ALA E 5 4   ? 131.112 146.588 99.677  1.00 30.00  ? 8   ALA G N   1 
ATOM 10188 C CA  . ALA E 5 4   ? 131.350 145.185 99.992  1.00 30.00  ? 8   ALA G CA  1 
ATOM 10189 C C   . ALA E 5 4   ? 131.945 145.044 101.387 1.00 30.00  ? 8   ALA G C   1 
ATOM 10190 O O   . ALA E 5 4   ? 131.595 144.130 102.131 1.00 30.00  ? 8   ALA G O   1 
ATOM 10191 C CB  . ALA E 5 4   ? 132.263 144.551 98.954  1.00 30.00  ? 8   ALA G CB  1 
ATOM 10192 N N   . ALA E 5 5   ? 132.847 145.955 101.736 1.00 30.00  ? 9   ALA G N   1 
ATOM 10193 C CA  . ALA E 5 5   ? 133.435 145.975 103.070 1.00 30.00  ? 9   ALA G CA  1 
ATOM 10194 C C   . ALA E 5 5   ? 132.369 146.220 104.131 1.00 30.00  ? 9   ALA G C   1 
ATOM 10195 O O   . ALA E 5 5   ? 132.387 145.607 105.197 1.00 30.00  ? 9   ALA G O   1 
ATOM 10196 C CB  . ALA E 5 5   ? 134.526 147.031 103.156 1.00 30.00  ? 9   ALA G CB  1 
ATOM 10197 N N   . ALA E 5 6   ? 131.437 147.119 103.829 1.00 30.00  ? 10  ALA G N   1 
ATOM 10198 C CA  . ALA E 5 6   ? 130.312 147.379 104.708 1.00 30.00  ? 10  ALA G CA  1 
ATOM 10199 C C   . ALA E 5 6   ? 129.430 146.159 104.881 1.00 30.00  ? 10  ALA G C   1 
ATOM 10200 O O   . ALA E 5 6   ? 128.955 145.874 105.981 1.00 30.00  ? 10  ALA G O   1 
ATOM 10201 C CB  . ALA E 5 6   ? 129.494 148.548 104.181 1.00 30.00  ? 10  ALA G CB  1 
ATOM 10202 N N   . ALA E 5 7   ? 129.215 145.431 103.790 1.00 30.00  ? 11  ALA G N   1 
ATOM 10203 C CA  . ALA E 5 7   ? 128.463 144.185 103.839 1.00 30.00  ? 11  ALA G CA  1 
ATOM 10204 C C   . ALA E 5 7   ? 129.169 143.161 104.723 1.00 30.00  ? 11  ALA G C   1 
ATOM 10205 O O   . ALA E 5 7   ? 128.528 142.433 105.478 1.00 30.00  ? 11  ALA G O   1 
ATOM 10206 C CB  . ALA E 5 7   ? 128.258 143.629 102.438 1.00 30.00  ? 11  ALA G CB  1 
ATOM 10207 N N   . ALA E 5 8   ? 130.493 143.114 104.622 1.00 30.00  ? 12  ALA G N   1 
ATOM 10208 C CA  . ALA E 5 8   ? 131.296 142.251 105.480 1.00 30.00  ? 12  ALA G CA  1 
ATOM 10209 C C   . ALA E 5 8   ? 131.170 142.629 106.951 1.00 30.00  ? 12  ALA G C   1 
ATOM 10210 O O   . ALA E 5 8   ? 131.097 141.761 107.820 1.00 30.00  ? 12  ALA G O   1 
ATOM 10211 C CB  . ALA E 5 8   ? 132.754 142.292 105.049 1.00 30.00  ? 12  ALA G CB  1 
ATOM 10212 N N   . ALA E 5 9   ? 131.148 143.930 107.222 1.00 30.00  ? 13  ALA G N   1 
ATOM 10213 C CA  . ALA E 5 9   ? 130.820 144.431 108.552 1.00 30.00  ? 13  ALA G CA  1 
ATOM 10214 C C   . ALA E 5 9   ? 129.686 143.627 109.177 1.00 30.00  ? 13  ALA G C   1 
ATOM 10215 O O   . ALA E 5 9   ? 128.590 144.145 109.389 1.00 30.00  ? 13  ALA G O   1 
ATOM 10216 C CB  . ALA E 5 9   ? 130.455 145.906 108.487 1.00 30.00  ? 13  ALA G CB  1 
ATOM 10217 N N   . ALA E 5 10  ? 129.957 142.359 109.467 1.00 30.00  ? 14  ALA G N   1 
ATOM 10218 C CA  . ALA E 5 10  ? 129.471 141.270 108.644 1.00 30.00  ? 14  ALA G CA  1 
ATOM 10219 C C   . ALA E 5 10  ? 128.468 140.399 109.375 1.00 30.00  ? 14  ALA G C   1 
ATOM 10220 O O   . ALA E 5 10  ? 128.729 139.915 110.476 1.00 30.00  ? 14  ALA G O   1 
ATOM 10221 C CB  . ALA E 5 10  ? 130.637 140.425 108.152 1.00 30.00  ? 14  ALA G CB  1 
ATOM 10222 N N   . ALA E 5 11  ? 127.284 140.248 108.789 1.00 30.00  ? 15  ALA G N   1 
ATOM 10223 C CA  . ALA E 5 11  ? 126.700 138.933 108.554 1.00 30.00  ? 15  ALA G CA  1 
ATOM 10224 C C   . ALA E 5 11  ? 127.095 138.370 107.192 1.00 30.00  ? 15  ALA G C   1 
ATOM 10225 O O   . ALA E 5 11  ? 126.752 137.234 106.856 1.00 30.00  ? 15  ALA G O   1 
ATOM 10226 C CB  . ALA E 5 11  ? 125.185 139.000 108.677 1.00 30.00  ? 15  ALA G CB  1 
ATOM 10227 N N   . ALA E 5 12  ? 127.810 139.158 106.398 1.00 30.00  ? 16  ALA G N   1 
ATOM 10228 C CA  . ALA E 5 12  ? 127.586 139.139 104.961 1.00 30.00  ? 16  ALA G CA  1 
ATOM 10229 C C   . ALA E 5 12  ? 127.873 137.754 104.379 1.00 30.00  ? 16  ALA G C   1 
ATOM 10230 O O   . ALA E 5 12  ? 127.119 137.271 103.532 1.00 30.00  ? 16  ALA G O   1 
ATOM 10231 C CB  . ALA E 5 12  ? 128.444 140.193 104.276 1.00 30.00  ? 16  ALA G CB  1 
ATOM 10232 N N   . ALA E 5 13  ? 128.948 137.108 104.828 1.00 30.00  ? 17  ALA G N   1 
ATOM 10233 C CA  . ALA E 5 13  ? 128.882 136.103 105.894 1.00 30.00  ? 17  ALA G CA  1 
ATOM 10234 C C   . ALA E 5 13  ? 127.858 135.010 105.561 1.00 30.00  ? 17  ALA G C   1 
ATOM 10235 O O   . ALA E 5 13  ? 127.837 134.497 104.446 1.00 30.00  ? 17  ALA G O   1 
ATOM 10236 C CB  . ALA E 5 13  ? 128.547 136.760 107.224 1.00 30.00  ? 17  ALA G CB  1 
ATOM 10237 N N   . ALA E 5 14  ? 126.982 134.701 106.516 1.00 30.00  ? 18  ALA G N   1 
ATOM 10238 C CA  . ALA E 5 14  ? 125.682 135.338 106.537 1.00 30.00  ? 18  ALA G CA  1 
ATOM 10239 C C   . ALA E 5 14  ? 124.928 135.002 105.269 1.00 30.00  ? 18  ALA G C   1 
ATOM 10240 O O   . ALA E 5 14  ? 124.672 133.834 104.971 1.00 30.00  ? 18  ALA G O   1 
ATOM 10241 C CB  . ALA E 5 14  ? 125.821 136.844 106.702 1.00 30.00  ? 18  ALA G CB  1 
ATOM 10242 N N   . ALA E 5 15  ? 124.548 136.037 104.529 1.00 30.00  ? 19  ALA G N   1 
ATOM 10243 C CA  . ALA E 5 15  ? 123.697 135.867 103.365 1.00 30.00  ? 19  ALA G CA  1 
ATOM 10244 C C   . ALA E 5 15  ? 124.376 134.978 102.330 1.00 30.00  ? 19  ALA G C   1 
ATOM 10245 O O   . ALA E 5 15  ? 123.716 134.174 101.678 1.00 30.00  ? 19  ALA G O   1 
ATOM 10246 C CB  . ALA E 5 15  ? 123.341 137.218 102.762 1.00 30.00  ? 19  ALA G CB  1 
ATOM 10247 N N   . ALA E 5 16  ? 125.686 135.133 102.159 1.00 30.00  ? 20  ALA G N   1 
ATOM 10248 C CA  . ALA E 5 16  ? 126.409 134.329 101.175 1.00 30.00  ? 20  ALA G CA  1 
ATOM 10249 C C   . ALA E 5 16  ? 126.371 132.835 101.506 1.00 30.00  ? 20  ALA G C   1 
ATOM 10250 O O   . ALA E 5 16  ? 126.178 131.997 100.626 1.00 30.00  ? 20  ALA G O   1 
ATOM 10251 C CB  . ALA E 5 16  ? 127.849 134.806 101.065 1.00 30.00  ? 20  ALA G CB  1 
ATOM 10252 N N   . ALA E 5 17  ? 126.544 132.517 102.786 1.00 30.00  ? 21  ALA G N   1 
ATOM 10253 C CA  . ALA E 5 17  ? 126.416 131.156 103.294 1.00 30.00  ? 21  ALA G CA  1 
ATOM 10254 C C   . ALA E 5 17  ? 125.001 130.623 103.120 1.00 30.00  ? 21  ALA G C   1 
ATOM 10255 O O   . ALA E 5 17  ? 124.801 129.454 102.791 1.00 30.00  ? 21  ALA G O   1 
ATOM 10256 C CB  . ALA E 5 17  ? 126.826 131.099 104.759 1.00 30.00  ? 21  ALA G CB  1 
ATOM 10257 N N   . ALA E 5 18  ? 124.019 131.490 103.344 1.00 30.00  ? 22  ALA G N   1 
ATOM 10258 C CA  . ALA E 5 18  ? 122.624 131.126 103.146 1.00 30.00  ? 22  ALA G CA  1 
ATOM 10259 C C   . ALA E 5 18  ? 122.394 130.760 101.685 1.00 30.00  ? 22  ALA G C   1 
ATOM 10260 O O   . ALA E 5 18  ? 121.652 129.828 101.377 1.00 30.00  ? 22  ALA G O   1 
ATOM 10261 C CB  . ALA E 5 18  ? 121.703 132.259 103.573 1.00 30.00  ? 22  ALA G CB  1 
ATOM 10262 N N   . ALA E 5 19  ? 123.039 131.500 100.792 1.00 30.00  ? 23  ALA G N   1 
ATOM 10263 C CA  . ALA E 5 19  ? 123.019 131.186 99.377  1.00 30.00  ? 23  ALA G CA  1 
ATOM 10264 C C   . ALA E 5 19  ? 123.641 129.835 99.086  1.00 30.00  ? 23  ALA G C   1 
ATOM 10265 O O   . ALA E 5 19  ? 123.142 129.087 98.246  1.00 30.00  ? 23  ALA G O   1 
ATOM 10266 C CB  . ALA E 5 19  ? 123.731 132.274 98.588  1.00 30.00  ? 23  ALA G CB  1 
ATOM 10267 N N   . ALA E 5 20  ? 124.730 129.515 99.780  1.00 30.00  ? 24  ALA G N   1 
ATOM 10268 C CA  . ALA E 5 20  ? 125.133 128.127 99.926  1.00 30.00  ? 24  ALA G CA  1 
ATOM 10269 C C   . ALA E 5 20  ? 124.386 127.423 101.044 1.00 30.00  ? 24  ALA G C   1 
ATOM 10270 O O   . ALA E 5 20  ? 124.960 127.087 102.078 1.00 30.00  ? 24  ALA G O   1 
ATOM 10271 C CB  . ALA E 5 20  ? 126.633 128.041 100.165 1.00 30.00  ? 24  ALA G CB  1 
ATOM 10272 N N   . ALA E 5 21  ? 123.097 127.192 100.820 1.00 30.00  ? 25  ALA G N   1 
ATOM 10273 C CA  . ALA E 5 21  ? 122.432 125.951 101.224 1.00 30.00  ? 25  ALA G CA  1 
ATOM 10274 C C   . ALA E 5 21  ? 122.489 124.826 100.183 1.00 30.00  ? 25  ALA G C   1 
ATOM 10275 O O   . ALA E 5 21  ? 122.585 125.074 98.981  1.00 30.00  ? 25  ALA G O   1 
ATOM 10276 C CB  . ALA E 5 21  ? 120.982 126.246 101.576 1.00 30.00  ? 25  ALA G CB  1 
ATOM 10277 N N   . ALA E 5 22  ? 122.427 123.589 100.672 1.00 30.00  ? 26  ALA G N   1 
ATOM 10278 C CA  . ALA E 5 22  ? 122.740 122.390 99.903  1.00 30.00  ? 26  ALA G CA  1 
ATOM 10279 C C   . ALA E 5 22  ? 121.493 121.548 99.654  1.00 30.00  ? 26  ALA G C   1 
ATOM 10280 O O   . ALA E 5 22  ? 120.735 121.257 100.579 1.00 30.00  ? 26  ALA G O   1 
ATOM 10281 C CB  . ALA E 5 22  ? 123.803 121.568 100.615 1.00 30.00  ? 26  ALA G CB  1 
ATOM 10282 N N   . ALA E 5 23  ? 121.287 121.161 98.400  1.00 30.00  ? 27  ALA G N   1 
ATOM 10283 C CA  . ALA E 5 23  ? 120.040 120.527 97.987  1.00 30.00  ? 27  ALA G CA  1 
ATOM 10284 C C   . ALA E 5 23  ? 120.280 119.108 97.486  1.00 30.00  ? 27  ALA G C   1 
ATOM 10285 O O   . ALA E 5 23  ? 121.158 118.872 96.655  1.00 30.00  ? 27  ALA G O   1 
ATOM 10286 C CB  . ALA E 5 23  ? 119.352 121.359 96.916  1.00 30.00  ? 27  ALA G CB  1 
ATOM 10287 N N   . ALA E 5 24  ? 119.494 118.163 97.995  1.00 30.00  ? 28  ALA G N   1 
ATOM 10288 C CA  . ALA E 5 24  ? 118.968 117.080 97.174  1.00 30.00  ? 28  ALA G CA  1 
ATOM 10289 C C   . ALA E 5 24  ? 118.240 117.618 95.947  1.00 30.00  ? 28  ALA G C   1 
ATOM 10290 O O   . ALA E 5 24  ? 117.576 116.870 95.228  1.00 30.00  ? 28  ALA G O   1 
ATOM 10291 C CB  . ALA E 5 24  ? 118.043 116.195 97.995  1.00 30.00  ? 28  ALA G CB  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   THR 3   3   ?   ?   ?   A . n 
A 1 4   ALA 4   4   ?   ?   ?   A . n 
A 1 5   GLY 5   5   ?   ?   ?   A . n 
A 1 6   GLY 6   6   ?   ?   ?   A . n 
A 1 7   GLY 7   7   ?   ?   ?   A . n 
A 1 8   SER 8   8   ?   ?   ?   A . n 
A 1 9   GLY 9   9   ?   ?   ?   A . n 
A 1 10  ALA 10  10  ?   ?   ?   A . n 
A 1 11  ASP 11  11  ?   ?   ?   A . n 
A 1 12  PRO 12  12  ?   ?   ?   A . n 
A 1 13  GLY 13  13  ?   ?   ?   A . n 
A 1 14  SER 14  14  ?   ?   ?   A . n 
A 1 15  ARG 15  15  ?   ?   ?   A . n 
A 1 16  GLY 16  16  ?   ?   ?   A . n 
A 1 17  LEU 17  17  ?   ?   ?   A . n 
A 1 18  LEU 18  18  ?   ?   ?   A . n 
A 1 19  ARG 19  19  ?   ?   ?   A . n 
A 1 20  LEU 20  20  ?   ?   ?   A . n 
A 1 21  LEU 21  21  ?   ?   ?   A . n 
A 1 22  SER 22  22  ?   ?   ?   A . n 
A 1 23  PHE 23  23  ?   ?   ?   A . n 
A 1 24  CYS 24  24  ?   ?   ?   A . n 
A 1 25  VAL 25  25  ?   ?   ?   A . n 
A 1 26  LEU 26  26  ?   ?   ?   A . n 
A 1 27  LEU 27  27  ?   ?   ?   A . n 
A 1 28  ALA 28  28  ?   ?   ?   A . n 
A 1 29  GLY 29  29  ?   ?   ?   A . n 
A 1 30  LEU 30  30  ?   ?   ?   A . n 
A 1 31  CYS 31  31  ?   ?   ?   A . n 
A 1 32  ARG 32  32  ?   ?   ?   A . n 
A 1 33  GLY 33  33  ?   ?   ?   A . n 
A 1 34  ASN 34  34  34  ASN ASN A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  VAL 36  36  36  VAL VAL A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  ARG 38  38  38  ARG ARG A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  ILE 40  40  40  ILE ILE A . n 
A 1 41  TYR 41  41  41  TYR TYR A . n 
A 1 42  ILE 42  42  42  ILE ILE A . n 
A 1 43  PRO 43  43  43  PRO PRO A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  ASN 45  45  45  ASN ASN A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  THR 47  47  47  THR THR A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  CYS 50  50  50  CYS CYS A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  ARG 52  52  52  ARG ARG A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  ASN 55  55  55  ASN ASN A . n 
A 1 56  ALA 56  56  56  ALA ALA A . n 
A 1 57  THR 57  57  57  THR THR A . n 
A 1 58  HIS 58  58  58  HIS HIS A . n 
A 1 59  GLN 59  59  59  GLN GLN A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  CYS 62  62  62  CYS CYS A . n 
A 1 63  GLN 63  63  63  GLN GLN A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  ILE 66  66  66  ILE ILE A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  ASP 69  69  69  ASP ASP A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  HIS 74  74  74  HIS HIS A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  VAL 76  76  76  VAL VAL A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  ASP 81  81  81  ASP ASP A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  GLN 83  83  83  GLN GLN A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  THR 87  87  87  THR THR A . n 
A 1 88  ASP 88  88  88  ASP ASP A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  PRO 90  90  90  PRO PRO A . n 
A 1 91  ASN 91  91  91  ASN ASN A . n 
A 1 92  PRO 92  92  92  PRO PRO A . n 
A 1 93  PRO 93  93  93  PRO PRO A . n 
A 1 94  TYR 94  94  94  TYR TYR A . n 
A 1 95  MET 95  95  95  MET MET A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  GLU 99  99  99  GLU GLU A . n 
A 1 100 SER 100 100 100 SER SER A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 HIS 102 102 102 HIS HIS A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 THR 104 104 104 THR THR A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 ASP 106 106 106 ASP ASP A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 MET 108 108 108 MET MET A . n 
A 1 109 GLU 109 109 109 GLU GLU A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 LYS 112 112 112 LYS LYS A . n 
A 1 113 GLY 113 113 113 GLY GLY A . n 
A 1 114 ARG 114 114 114 ARG ARG A . n 
A 1 115 THR 115 115 115 THR THR A . n 
A 1 116 SER 116 116 116 SER SER A . n 
A 1 117 ARG 117 117 117 ARG ARG A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 ALA 119 119 119 ALA ALA A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 VAL 123 123 123 VAL VAL A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LYS 127 127 127 LYS LYS A . n 
A 1 128 PRO 128 128 128 PRO PRO A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 PRO 130 130 130 PRO PRO A . n 
A 1 131 ALA 131 131 131 ALA ALA A . n 
A 1 132 SER 132 132 132 SER SER A . n 
A 1 133 GLY 133 133 133 GLY GLY A . n 
A 1 134 PHE 134 134 134 PHE PHE A . n 
A 1 135 SER 135 135 135 SER SER A . n 
A 1 136 PRO 136 136 136 PRO PRO A . n 
A 1 137 SER 137 137 137 SER SER A . n 
A 1 138 VAL 138 138 138 VAL VAL A . n 
A 1 139 GLN 139 139 139 GLN GLN A . n 
A 1 140 CYS 140 140 140 CYS CYS A . n 
A 1 141 PRO 141 141 141 PRO PRO A . n 
A 1 142 ASN 142 142 142 ASN ASN A . n 
A 1 143 ASP 143 143 143 ASP ASP A . n 
A 1 144 GLY 144 144 144 GLY GLY A . n 
A 1 145 PHE 145 145 145 PHE PHE A . n 
A 1 146 GLY 146 146 146 GLY GLY A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 SER 149 149 149 SER SER A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 SER 151 151 151 SER SER A . n 
A 1 152 TYR 152 152 152 TYR TYR A . n 
A 1 153 GLY 153 153 153 GLY GLY A . n 
A 1 154 PRO 154 154 154 PRO PRO A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 HIS 158 158 158 HIS HIS A . n 
A 1 159 CYS 159 159 159 CYS CYS A . n 
A 1 160 ARG 160 160 160 ARG ARG A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 ILE 162 162 162 ILE ILE A . n 
A 1 163 GLN 163 163 163 GLN GLN A . n 
A 1 164 TRP 164 164 164 TRP TRP A . n 
A 1 165 ASN 165 165 165 ASN ASN A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 LEU 167 167 167 LEU LEU A . n 
A 1 168 GLY 168 168 168 GLY GLY A . n 
A 1 169 ASN 169 169 169 ASN ASN A . n 
A 1 170 GLY 170 170 170 GLY GLY A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 TYR 173 173 173 TYR TYR A . n 
A 1 174 GLU 174 174 174 GLU GLU A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 PHE 176 176 176 PHE PHE A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 PHE 178 178 178 PHE PHE A . n 
A 1 179 PRO 179 179 179 PRO PRO A . n 
A 1 180 ILE 180 180 180 ILE ILE A . n 
A 1 181 PHE 181 181 181 PHE PHE A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 LEU 183 183 183 LEU LEU A . n 
A 1 184 GLU 184 184 184 GLU GLU A . n 
A 1 185 ASP 185 185 185 ASP ASP A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 ASN 187 187 187 ASN ASN A . n 
A 1 188 GLU 188 188 188 GLU GLU A . n 
A 1 189 THR 189 189 189 THR THR A . n 
A 1 190 LYS 190 190 190 LYS LYS A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 ILE 192 192 192 ILE ILE A . n 
A 1 193 LYS 193 193 193 LYS LYS A . n 
A 1 194 GLN 194 194 194 GLN GLN A . n 
A 1 195 CYS 195 195 195 CYS CYS A . n 
A 1 196 TYR 196 196 196 TYR TYR A . n 
A 1 197 GLN 197 197 197 GLN GLN A . n 
A 1 198 ASP 198 198 198 ASP ASP A . n 
A 1 199 HIS 199 199 199 HIS HIS A . n 
A 1 200 ASN 200 200 200 ASN ASN A . n 
A 1 201 LEU 201 201 201 LEU LEU A . n 
A 1 202 SER 202 202 202 SER SER A . n 
A 1 203 GLN 203 203 203 GLN GLN A . n 
A 1 204 ASN 204 204 204 ASN ASN A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 SER 206 206 206 SER SER A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 PRO 208 208 208 PRO PRO A . n 
A 1 209 THR 209 209 209 THR THR A . n 
A 1 210 PHE 210 210 210 PHE PHE A . n 
A 1 211 PRO 211 211 211 PRO PRO A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 CYS 213 213 213 CYS CYS A . n 
A 1 214 ALA 214 214 214 ALA ALA A . n 
A 1 215 MET 215 215 215 MET MET A . n 
A 1 216 GLN 216 216 216 GLN GLN A . n 
A 1 217 LEU 217 217 217 LEU LEU A . n 
A 1 218 PHE 218 218 218 PHE PHE A . n 
A 1 219 SER 219 219 219 SER SER A . n 
A 1 220 HIS 220 220 220 HIS HIS A . n 
A 1 221 MET 221 221 221 MET MET A . n 
A 1 222 HIS 222 222 222 HIS HIS A . n 
A 1 223 ALA 223 223 223 ALA ALA A . n 
A 1 224 VAL 224 224 224 VAL VAL A . n 
A 1 225 ILE 225 225 225 ILE ILE A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 THR 227 227 227 THR THR A . n 
A 1 228 ALA 228 228 228 ALA ALA A . n 
A 1 229 THR 229 229 229 THR THR A . n 
A 1 230 CYS 230 230 230 CYS CYS A . n 
A 1 231 MET 231 231 231 MET MET A . n 
A 1 232 ARG 232 232 232 ARG ARG A . n 
A 1 233 ARG 233 233 233 ARG ARG A . n 
A 1 234 SER 234 234 234 SER SER A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 ILE 236 236 236 ILE ILE A . n 
A 1 237 GLN 237 237 237 GLN GLN A . n 
A 1 238 SER 238 238 238 SER SER A . n 
A 1 239 THR 239 239 239 THR THR A . n 
A 1 240 PHE 240 240 240 PHE PHE A . n 
A 1 241 SER 241 241 241 SER SER A . n 
A 1 242 ILE 242 242 242 ILE ILE A . n 
A 1 243 ASN 243 243 243 ASN ASN A . n 
A 1 244 PRO 244 244 244 PRO PRO A . n 
A 1 245 GLU 245 245 245 GLU GLU A . n 
A 1 246 ILE 246 246 246 ILE ILE A . n 
A 1 247 VAL 247 247 247 VAL VAL A . n 
A 1 248 CYS 248 248 248 CYS CYS A . n 
A 1 249 ASP 249 249 249 ASP ASP A . n 
A 1 250 PRO 250 250 250 PRO PRO A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 SER 252 252 252 SER SER A . n 
A 1 253 ASP 253 253 253 ASP ASP A . n 
A 1 254 TYR 254 254 254 TYR TYR A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 VAL 256 256 256 VAL VAL A . n 
A 1 257 TRP 257 257 257 TRP TRP A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 MET 259 259 259 MET MET A . n 
A 1 260 LEU 260 260 260 LEU LEU A . n 
A 1 261 LYS 261 261 261 LYS LYS A . n 
A 1 262 PRO 262 262 262 PRO PRO A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 ASN 264 264 264 ASN ASN A . n 
A 1 265 THR 265 265 265 THR THR A . n 
A 1 266 THR 266 266 266 THR THR A . n 
A 1 267 GLY 267 267 267 GLY GLY A . n 
A 1 268 THR 268 268 268 THR THR A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 ASP 272 272 272 ASP ASP A . n 
A 1 273 ASP 273 273 273 ASP ASP A . n 
A 1 274 ARG 274 274 274 ARG ARG A . n 
A 1 275 VAL 275 275 275 VAL VAL A . n 
A 1 276 VAL 276 276 276 VAL VAL A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 ALA 279 279 279 ALA ALA A . n 
A 1 280 THR 280 280 280 THR THR A . n 
A 1 281 ARG 281 281 281 ARG ARG A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 ASP 283 283 283 ASP ASP A . n 
A 1 284 SER 284 284 284 SER SER A . n 
A 1 285 ARG 285 285 285 ARG ARG A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 PHE 287 287 287 PHE PHE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 TRP 289 289 289 TRP TRP A . n 
A 1 290 ASN 290 290 290 ASN ASN A . n 
A 1 291 VAL 291 291 291 VAL VAL A . n 
A 1 292 ALA 292 292 292 ALA ALA A . n 
A 1 293 PRO 293 293 293 PRO PRO A . n 
A 1 294 GLY 294 294 294 GLY GLY A . n 
A 1 295 ALA 295 295 295 ALA ALA A . n 
A 1 296 GLU 296 296 296 GLU GLU A . n 
A 1 297 SER 297 297 297 SER SER A . n 
A 1 298 ALA 298 298 298 ALA ALA A . n 
A 1 299 VAL 299 299 299 VAL VAL A . n 
A 1 300 ALA 300 300 300 ALA ALA A . n 
A 1 301 SER 301 301 301 SER SER A . n 
A 1 302 PHE 302 302 302 PHE PHE A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 THR 304 304 304 THR THR A . n 
A 1 305 GLN 305 305 305 GLN GLN A . n 
A 1 306 LEU 306 306 306 LEU LEU A . n 
A 1 307 ALA 307 307 307 ALA ALA A . n 
A 1 308 ALA 308 308 308 ALA ALA A . n 
A 1 309 ALA 309 309 309 ALA ALA A . n 
A 1 310 GLU 310 310 310 GLU GLU A . n 
A 1 311 ALA 311 311 311 ALA ALA A . n 
A 1 312 LEU 312 312 312 LEU LEU A . n 
A 1 313 GLN 313 313 313 GLN GLN A . n 
A 1 314 LYS 314 314 314 LYS LYS A . n 
A 1 315 ALA 315 315 315 ALA ALA A . n 
A 1 316 PRO 316 316 316 PRO PRO A . n 
A 1 317 ASP 317 317 317 ASP ASP A . n 
A 1 318 VAL 318 318 318 VAL VAL A . n 
A 1 319 THR 319 319 319 THR THR A . n 
A 1 320 THR 320 320 320 THR THR A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 PRO 322 322 322 PRO PRO A . n 
A 1 323 ARG 323 323 323 ARG ARG A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 VAL 325 325 325 VAL VAL A . n 
A 1 326 MET 326 326 326 MET MET A . n 
A 1 327 PHE 327 327 327 PHE PHE A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 PHE 329 329 329 PHE PHE A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 GLN 331 331 331 GLN GLN A . n 
A 1 332 GLY 332 332 332 GLY GLY A . n 
A 1 333 GLU 333 333 333 GLU GLU A . n 
A 1 334 THR 334 334 334 THR THR A . n 
A 1 335 PHE 335 335 335 PHE PHE A . n 
A 1 336 ASP 336 336 336 ASP ASP A . n 
A 1 337 TYR 337 337 337 TYR TYR A . n 
A 1 338 ILE 338 338 338 ILE ILE A . n 
A 1 339 GLY 339 339 339 GLY GLY A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 SER 341 341 341 SER SER A . n 
A 1 342 ARG 342 342 342 ARG ARG A . n 
A 1 343 MET 343 343 343 MET MET A . n 
A 1 344 VAL 344 344 344 VAL VAL A . n 
A 1 345 TYR 345 345 345 TYR TYR A . n 
A 1 346 ASP 346 346 346 ASP ASP A . n 
A 1 347 MET 347 347 347 MET MET A . n 
A 1 348 GLU 348 348 348 GLU GLU A . n 
A 1 349 LYS 349 349 349 LYS LYS A . n 
A 1 350 GLY 350 350 350 GLY GLY A . n 
A 1 351 LYS 351 351 351 LYS LYS A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 PRO 353 353 353 PRO PRO A . n 
A 1 354 VAL 354 354 354 VAL VAL A . n 
A 1 355 GLN 355 355 355 GLN GLN A . n 
A 1 356 LEU 356 356 356 LEU LEU A . n 
A 1 357 GLU 357 357 357 GLU GLU A . n 
A 1 358 ASN 358 358 358 ASN ASN A . n 
A 1 359 VAL 359 359 359 VAL VAL A . n 
A 1 360 ASP 360 360 360 ASP ASP A . n 
A 1 361 SER 361 361 361 SER SER A . n 
A 1 362 PHE 362 362 362 PHE PHE A . n 
A 1 363 VAL 363 363 363 VAL VAL A . n 
A 1 364 GLU 364 364 364 GLU GLU A . n 
A 1 365 LEU 365 365 365 LEU LEU A . n 
A 1 366 GLY 366 366 366 GLY GLY A . n 
A 1 367 GLN 367 367 367 GLN GLN A . n 
A 1 368 VAL 368 368 368 VAL VAL A . n 
A 1 369 ALA 369 369 369 ALA ALA A . n 
A 1 370 LEU 370 370 370 LEU LEU A . n 
A 1 371 ARG 371 371 371 ARG ARG A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 SER 373 373 373 SER SER A . n 
A 1 374 LEU 374 374 374 LEU LEU A . n 
A 1 375 GLU 375 375 375 GLU GLU A . n 
A 1 376 LEU 376 376 376 LEU LEU A . n 
A 1 377 TRP 377 377 377 TRP TRP A . n 
A 1 378 MET 378 378 378 MET MET A . n 
A 1 379 HIS 379 379 379 HIS HIS A . n 
A 1 380 THR 380 380 380 THR THR A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 PRO 382 382 382 PRO PRO A . n 
A 1 383 VAL 383 383 383 VAL VAL A . n 
A 1 384 SER 384 384 384 SER SER A . n 
A 1 385 GLN 385 385 385 GLN GLN A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 GLU 388 388 388 GLU GLU A . n 
A 1 389 SER 389 389 389 SER SER A . n 
A 1 390 VAL 390 390 390 VAL VAL A . n 
A 1 391 ARG 391 391 391 ARG ARG A . n 
A 1 392 ASN 392 392 392 ASN ASN A . n 
A 1 393 GLN 393 393 393 GLN GLN A . n 
A 1 394 VAL 394 394 394 VAL VAL A . n 
A 1 395 GLU 395 395 395 GLU GLU A . n 
A 1 396 ASP 396 396 396 ASP ASP A . n 
A 1 397 LEU 397 397 397 LEU LEU A . n 
A 1 398 LEU 398 398 398 LEU LEU A . n 
A 1 399 ALA 399 399 399 ALA ALA A . n 
A 1 400 THR 400 400 400 THR THR A . n 
A 1 401 LEU 401 401 401 LEU LEU A . n 
A 1 402 GLU 402 402 402 GLU GLU A . n 
A 1 403 LYS 403 403 403 LYS LYS A . n 
A 1 404 SER 404 404 404 SER SER A . n 
A 1 405 GLY 405 405 405 GLY GLY A . n 
A 1 406 ALA 406 406 406 ALA ALA A . n 
A 1 407 GLY 407 407 407 GLY GLY A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 PRO 409 409 409 PRO PRO A . n 
A 1 410 ALA 410 410 410 ALA ALA A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 ILE 412 412 412 ILE ILE A . n 
A 1 413 LEU 413 413 413 LEU LEU A . n 
A 1 414 ARG 414 414 414 ARG ARG A . n 
A 1 415 ARG 415 415 415 ARG ARG A . n 
A 1 416 PRO 416 416 416 PRO PRO A . n 
A 1 417 ASN 417 417 417 ASN ASN A . n 
A 1 418 GLN 418 418 418 GLN GLN A . n 
A 1 419 SER 419 419 419 SER SER A . n 
A 1 420 GLN 420 420 420 GLN GLN A . n 
A 1 421 PRO 421 421 421 PRO PRO A . n 
A 1 422 LEU 422 422 422 LEU LEU A . n 
A 1 423 PRO 423 423 423 PRO PRO A . n 
A 1 424 PRO 424 424 424 PRO PRO A . n 
A 1 425 SER 425 425 425 SER SER A . n 
A 1 426 SER 426 426 426 SER SER A . n 
A 1 427 LEU 427 427 427 LEU LEU A . n 
A 1 428 GLN 428 428 428 GLN GLN A . n 
A 1 429 ARG 429 429 429 ARG ARG A . n 
A 1 430 PHE 430 430 430 PHE PHE A . n 
A 1 431 LEU 431 431 431 LEU LEU A . n 
A 1 432 ARG 432 432 432 ARG ARG A . n 
A 1 433 ALA 433 433 433 ALA ALA A . n 
A 1 434 ARG 434 434 434 ARG ARG A . n 
A 1 435 ASN 435 435 435 ASN ASN A . n 
A 1 436 ILE 436 436 436 ILE ILE A . n 
A 1 437 SER 437 437 437 SER SER A . n 
A 1 438 GLY 438 438 438 GLY GLY A . n 
A 1 439 VAL 439 439 439 VAL VAL A . n 
A 1 440 VAL 440 440 440 VAL VAL A . n 
A 1 441 LEU 441 441 441 LEU LEU A . n 
A 1 442 ALA 442 442 442 ALA ALA A . n 
A 1 443 ASP 443 443 443 ASP ASP A . n 
A 1 444 HIS 444 444 444 HIS HIS A . n 
A 1 445 SER 445 445 445 SER SER A . n 
A 1 446 GLY 446 446 446 GLY GLY A . n 
A 1 447 ALA 447 447 447 ALA ALA A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 HIS 449 449 449 HIS HIS A . n 
A 1 450 ASN 450 450 450 ASN ASN A . n 
A 1 451 LYS 451 451 451 LYS LYS A . n 
A 1 452 TYR 452 452 452 TYR TYR A . n 
A 1 453 TYR 453 453 453 TYR TYR A . n 
A 1 454 GLN 454 454 454 GLN GLN A . n 
A 1 455 SER 455 455 455 SER SER A . n 
A 1 456 ILE 456 456 456 ILE ILE A . n 
A 1 457 TYR 457 457 457 TYR TYR A . n 
A 1 458 ASP 458 458 458 ASP ASP A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 ASN 462 462 462 ASN ASN A . n 
A 1 463 ILE 463 463 463 ILE ILE A . n 
A 1 464 ASN 464 464 464 ASN ASN A . n 
A 1 465 VAL 465 465 465 VAL VAL A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 TYR 467 467 467 TYR TYR A . n 
A 1 468 PRO 468 468 468 PRO PRO A . n 
A 1 469 GLU 469 469 469 GLU GLU A . n 
A 1 470 TRP 470 470 470 TRP TRP A . n 
A 1 471 LEU 471 471 471 LEU LEU A . n 
A 1 472 SER 472 472 472 SER SER A . n 
A 1 473 PRO 473 473 473 PRO PRO A . n 
A 1 474 GLU 474 474 474 GLU GLU A . n 
A 1 475 GLU 475 475 475 GLU GLU A . n 
A 1 476 ASP 476 476 476 ASP ASP A . n 
A 1 477 LEU 477 477 477 LEU LEU A . n 
A 1 478 ASN 478 478 478 ASN ASN A . n 
A 1 479 PHE 479 479 479 PHE PHE A . n 
A 1 480 VAL 480 480 480 VAL VAL A . n 
A 1 481 THR 481 481 481 THR THR A . n 
A 1 482 ASP 482 482 482 ASP ASP A . n 
A 1 483 THR 483 483 483 THR THR A . n 
A 1 484 ALA 484 484 484 ALA ALA A . n 
A 1 485 LYS 485 485 485 LYS LYS A . n 
A 1 486 ALA 486 486 486 ALA ALA A . n 
A 1 487 LEU 487 487 487 LEU LEU A . n 
A 1 488 ALA 488 488 488 ALA ALA A . n 
A 1 489 ASP 489 489 489 ASP ASP A . n 
A 1 490 VAL 490 490 490 VAL VAL A . n 
A 1 491 ALA 491 491 491 ALA ALA A . n 
A 1 492 THR 492 492 492 THR THR A . n 
A 1 493 VAL 493 493 493 VAL VAL A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 GLY 495 495 495 GLY GLY A . n 
A 1 496 ARG 496 496 496 ARG ARG A . n 
A 1 497 ALA 497 497 497 ALA ALA A . n 
A 1 498 LEU 498 498 498 LEU LEU A . n 
A 1 499 TYR 499 499 499 TYR TYR A . n 
A 1 500 GLU 500 500 500 GLU GLU A . n 
A 1 501 LEU 501 501 501 LEU LEU A . n 
A 1 502 ALA 502 502 502 ALA ALA A . n 
A 1 503 GLY 503 503 503 GLY GLY A . n 
A 1 504 GLY 504 504 504 GLY GLY A . n 
A 1 505 THR 505 505 505 THR THR A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 PHE 507 507 507 PHE PHE A . n 
A 1 508 SER 508 508 508 SER SER A . n 
A 1 509 ASP 509 509 509 ASP ASP A . n 
A 1 510 THR 510 510 510 THR THR A . n 
A 1 511 VAL 511 511 511 VAL VAL A . n 
A 1 512 GLN 512 512 512 GLN GLN A . n 
A 1 513 ALA 513 513 513 ALA ALA A . n 
A 1 514 ASP 514 514 514 ASP ASP A . n 
A 1 515 PRO 515 515 515 PRO PRO A . n 
A 1 516 GLN 516 516 516 GLN GLN A . n 
A 1 517 THR 517 517 517 THR THR A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 THR 519 519 519 THR THR A . n 
A 1 520 ARG 520 520 520 ARG ARG A . n 
A 1 521 LEU 521 521 521 LEU LEU A . n 
A 1 522 LEU 522 522 522 LEU LEU A . n 
A 1 523 TYR 523 523 523 TYR TYR A . n 
A 1 524 GLY 524 524 524 GLY GLY A . n 
A 1 525 PHE 525 525 525 PHE PHE A . n 
A 1 526 LEU 526 526 526 LEU LEU A . n 
A 1 527 ILE 527 527 527 ILE ILE A . n 
A 1 528 LYS 528 528 528 LYS LYS A . n 
A 1 529 ALA 529 529 529 ALA ALA A . n 
A 1 530 ASN 530 530 530 ASN ASN A . n 
A 1 531 ASN 531 531 531 ASN ASN A . n 
A 1 532 SER 532 532 532 SER SER A . n 
A 1 533 TRP 533 533 533 TRP TRP A . n 
A 1 534 PHE 534 534 534 PHE PHE A . n 
A 1 535 GLN 535 535 535 GLN GLN A . n 
A 1 536 SER 536 536 536 SER SER A . n 
A 1 537 ILE 537 537 537 ILE ILE A . n 
A 1 538 LEU 538 538 538 LEU LEU A . n 
A 1 539 ARG 539 539 539 ARG ARG A . n 
A 1 540 GLN 540 540 540 GLN GLN A . n 
A 1 541 ASP 541 541 541 ASP ASP A . n 
A 1 542 LEU 542 542 542 LEU LEU A . n 
A 1 543 ARG 543 543 543 ARG ARG A . n 
A 1 544 SER 544 544 544 SER SER A . n 
A 1 545 TYR 545 545 545 TYR TYR A . n 
A 1 546 LEU 546 546 546 LEU LEU A . n 
A 1 547 GLY 547 547 547 GLY GLY A . n 
A 1 548 ASP 548 548 548 ASP ASP A . n 
A 1 549 GLY 549 549 549 GLY GLY A . n 
A 1 550 PRO 550 550 550 PRO PRO A . n 
A 1 551 LEU 551 551 551 LEU LEU A . n 
A 1 552 GLN 552 552 552 GLN GLN A . n 
A 1 553 HIS 553 553 553 HIS HIS A . n 
A 1 554 TYR 554 554 554 TYR TYR A . n 
A 1 555 ILE 555 555 555 ILE ILE A . n 
A 1 556 ALA 556 556 556 ALA ALA A . n 
A 1 557 VAL 557 557 557 VAL VAL A . n 
A 1 558 SER 558 558 558 SER SER A . n 
A 1 559 SER 559 559 559 SER SER A . n 
A 1 560 PRO 560 560 560 PRO PRO A . n 
A 1 561 THR 561 561 561 THR THR A . n 
A 1 562 ASN 562 562 562 ASN ASN A . n 
A 1 563 THR 563 563 563 THR THR A . n 
A 1 564 THR 564 564 564 THR THR A . n 
A 1 565 TYR 565 565 565 TYR TYR A . n 
A 1 566 VAL 566 566 566 VAL VAL A . n 
A 1 567 VAL 567 567 567 VAL VAL A . n 
A 1 568 GLN 568 568 568 GLN GLN A . n 
A 1 569 TYR 569 569 569 TYR TYR A . n 
A 1 570 ALA 570 570 570 ALA ALA A . n 
A 1 571 LEU 571 571 571 LEU LEU A . n 
A 1 572 ALA 572 572 572 ALA ALA A . n 
A 1 573 ASN 573 573 573 ASN ASN A . n 
A 1 574 LEU 574 574 574 LEU LEU A . n 
A 1 575 THR 575 575 575 THR THR A . n 
A 1 576 GLY 576 576 576 GLY GLY A . n 
A 1 577 THR 577 577 577 THR THR A . n 
A 1 578 VAL 578 578 578 VAL VAL A . n 
A 1 579 VAL 579 579 579 VAL VAL A . n 
A 1 580 ASN 580 580 580 ASN ASN A . n 
A 1 581 LEU 581 581 581 LEU LEU A . n 
A 1 582 THR 582 582 582 THR THR A . n 
A 1 583 ARG 583 583 583 ARG ARG A . n 
A 1 584 GLU 584 584 584 GLU GLU A . n 
A 1 585 GLN 585 585 585 GLN GLN A . n 
A 1 586 CYS 586 586 586 CYS CYS A . n 
A 1 587 GLN 587 587 587 GLN GLN A . n 
A 1 588 ASP 588 588 588 ASP ASP A . n 
A 1 589 PRO 589 589 589 PRO PRO A . n 
A 1 590 SER 590 590 590 SER SER A . n 
A 1 591 LYS 591 591 591 LYS LYS A . n 
A 1 592 VAL 592 592 592 VAL VAL A . n 
A 1 593 PRO 593 593 593 PRO PRO A . n 
A 1 594 SER 594 594 594 SER SER A . n 
A 1 595 GLU 595 595 595 GLU GLU A . n 
A 1 596 ASN 596 596 596 ASN ASN A . n 
A 1 597 LYS 597 597 597 LYS LYS A . n 
A 1 598 ASP 598 598 598 ASP ASP A . n 
A 1 599 LEU 599 599 599 LEU LEU A . n 
A 1 600 TYR 600 600 600 TYR TYR A . n 
A 1 601 GLU 601 601 601 GLU GLU A . n 
A 1 602 TYR 602 602 602 TYR TYR A . n 
A 1 603 SER 603 603 603 SER SER A . n 
A 1 604 TRP 604 604 604 TRP TRP A . n 
A 1 605 VAL 605 605 605 VAL VAL A . n 
A 1 606 GLN 606 606 606 GLN GLN A . n 
A 1 607 GLY 607 607 607 GLY GLY A . n 
A 1 608 PRO 608 608 608 PRO PRO A . n 
A 1 609 LEU 609 609 609 LEU LEU A . n 
A 1 610 HIS 610 610 610 HIS HIS A . n 
A 1 611 SER 611 611 611 SER SER A . n 
A 1 612 ASN 612 612 612 ASN ASN A . n 
A 1 613 GLU 613 613 613 GLU GLU A . n 
A 1 614 THR 614 614 614 THR THR A . n 
A 1 615 ASP 615 615 615 ASP ASP A . n 
A 1 616 ARG 616 616 616 ARG ARG A . n 
A 1 617 LEU 617 617 617 LEU LEU A . n 
A 1 618 PRO 618 618 618 PRO PRO A . n 
A 1 619 ARG 619 619 619 ARG ARG A . n 
A 1 620 CYS 620 620 620 CYS CYS A . n 
A 1 621 VAL 621 621 621 VAL VAL A . n 
A 1 622 ARG 622 622 622 ARG ARG A . n 
A 1 623 SER 623 623 623 SER SER A . n 
A 1 624 THR 624 624 624 THR THR A . n 
A 1 625 ALA 625 625 625 ALA ALA A . n 
A 1 626 ARG 626 626 626 ARG ARG A . n 
A 1 627 LEU 627 627 627 LEU LEU A . n 
A 1 628 ALA 628 628 628 ALA ALA A . n 
A 1 629 ARG 629 629 629 ARG ARG A . n 
A 1 630 ALA 630 630 630 ALA ALA A . n 
A 1 631 LEU 631 631 631 LEU LEU A . n 
A 1 632 SER 632 632 632 SER SER A . n 
A 1 633 PRO 633 633 633 PRO PRO A . n 
A 1 634 ALA 634 634 634 ALA ALA A . n 
A 1 635 PHE 635 635 635 PHE PHE A . n 
A 1 636 GLU 636 636 636 GLU GLU A . n 
A 1 637 LEU 637 637 637 LEU LEU A . n 
A 1 638 SER 638 638 638 SER SER A . n 
A 1 639 GLN 639 639 639 GLN GLN A . n 
A 1 640 TRP 640 640 640 TRP TRP A . n 
A 1 641 SER 641 641 641 SER SER A . n 
A 1 642 SER 642 642 642 SER SER A . n 
A 1 643 THR 643 643 643 THR THR A . n 
A 1 644 GLU 644 644 644 GLU GLU A . n 
A 1 645 TYR 645 645 645 TYR TYR A . n 
A 1 646 SER 646 646 646 SER SER A . n 
A 1 647 THR 647 647 647 THR THR A . n 
A 1 648 TRP 648 648 648 TRP TRP A . n 
A 1 649 THR 649 649 649 THR THR A . n 
A 1 650 GLU 650 650 650 GLU GLU A . n 
A 1 651 SER 651 651 651 SER SER A . n 
A 1 652 ARG 652 652 652 ARG ARG A . n 
A 1 653 TRP 653 653 653 TRP TRP A . n 
A 1 654 LYS 654 654 654 LYS LYS A . n 
A 1 655 ASP 655 655 655 ASP ASP A . n 
A 1 656 ILE 656 656 656 ILE ILE A . n 
A 1 657 ARG 657 657 657 ARG ARG A . n 
A 1 658 ALA 658 658 658 ALA ALA A . n 
A 1 659 ARG 659 659 659 ARG ARG A . n 
A 1 660 ILE 660 660 660 ILE ILE A . n 
A 1 661 PHE 661 661 661 PHE PHE A . n 
A 1 662 LEU 662 662 662 LEU LEU A . n 
A 1 663 ILE 663 663 663 ILE ILE A . n 
A 1 664 ALA 664 664 664 ALA ALA A . n 
A 1 665 SER 665 665 665 SER SER A . n 
A 1 666 LYS 666 666 666 LYS LYS A . n 
A 1 667 GLU 667 667 667 GLU GLU A . n 
A 1 668 LEU 668 668 668 LEU LEU A . n 
A 1 669 GLU 669 669 669 GLU GLU A . n 
A 1 670 LEU 670 670 670 LEU LEU A . n 
A 1 671 ILE 671 671 671 ILE ILE A . n 
A 1 672 THR 672 672 672 THR THR A . n 
A 1 673 LEU 673 673 673 LEU LEU A . n 
A 1 674 THR 674 674 674 THR THR A . n 
A 1 675 VAL 675 675 675 VAL VAL A . n 
A 1 676 GLY 676 676 676 GLY GLY A . n 
A 1 677 PHE 677 677 677 PHE PHE A . n 
A 1 678 GLY 678 678 678 GLY GLY A . n 
A 1 679 ILE 679 679 679 ILE ILE A . n 
A 1 680 LEU 680 680 680 LEU LEU A . n 
A 1 681 ILE 681 681 681 ILE ILE A . n 
A 1 682 PHE 682 682 682 PHE PHE A . n 
A 1 683 SER 683 683 683 SER SER A . n 
A 1 684 LEU 684 684 684 LEU LEU A . n 
A 1 685 ILE 685 685 685 ILE ILE A . n 
A 1 686 VAL 686 686 686 VAL VAL A . n 
A 1 687 THR 687 687 687 THR THR A . n 
A 1 688 TYR 688 688 688 TYR TYR A . n 
A 1 689 CYS 689 689 689 CYS CYS A . n 
A 1 690 ILE 690 690 690 ILE ILE A . n 
A 1 691 ASN 691 691 691 ASN ASN A . n 
A 1 692 ALA 692 692 692 ALA ALA A . n 
A 1 693 LYS 693 693 693 LYS LYS A . n 
A 1 694 ALA 694 694 694 ALA ALA A . n 
A 1 695 ASP 695 695 695 ASP ASP A . n 
A 1 696 VAL 696 696 696 VAL VAL A . n 
A 1 697 LEU 697 697 697 LEU LEU A . n 
A 1 698 PHE 698 698 698 PHE PHE A . n 
A 1 699 ILE 699 699 ?   ?   ?   A . n 
A 1 700 ALA 700 700 ?   ?   ?   A . n 
A 1 701 PRO 701 701 ?   ?   ?   A . n 
A 1 702 ARG 702 702 ?   ?   ?   A . n 
A 1 703 GLU 703 703 ?   ?   ?   A . n 
A 1 704 PRO 704 704 ?   ?   ?   A . n 
A 1 705 GLY 705 705 ?   ?   ?   A . n 
A 1 706 ALA 706 706 ?   ?   ?   A . n 
A 1 707 VAL 707 707 ?   ?   ?   A . n 
A 1 708 SER 708 708 ?   ?   ?   A . n 
A 1 709 TYR 709 709 ?   ?   ?   A . n 
B 2 1   MET 1   1   ?   ?   ?   B . n 
B 2 2   THR 2   2   ?   ?   ?   B . n 
B 2 3   GLU 3   3   ?   ?   ?   B . n 
B 2 4   LEU 4   4   ?   ?   ?   B . n 
B 2 5   PRO 5   5   ?   ?   ?   B . n 
B 2 6   ALA 6   6   ?   ?   ?   B . n 
B 2 7   PRO 7   7   ?   ?   ?   B . n 
B 2 8   LEU 8   8   ?   ?   ?   B . n 
B 2 9   SER 9   9   ?   ?   ?   B . n 
B 2 10  TYR 10  10  ?   ?   ?   B . n 
B 2 11  PHE 11  11  ?   ?   ?   B . n 
B 2 12  GLN 12  12  ?   ?   ?   B . n 
B 2 13  ASN 13  13  ?   ?   ?   B . n 
B 2 14  ALA 14  14  ?   ?   ?   B . n 
B 2 15  GLN 15  15  ?   ?   ?   B . n 
B 2 16  MET 16  16  ?   ?   ?   B . n 
B 2 17  SER 17  17  ?   ?   ?   B . n 
B 2 18  GLU 18  18  ?   ?   ?   B . n 
B 2 19  ASP 19  19  ?   ?   ?   B . n 
B 2 20  ASN 20  20  ?   ?   ?   B . n 
B 2 21  HIS 21  21  ?   ?   ?   B . n 
B 2 22  LEU 22  22  ?   ?   ?   B . n 
B 2 23  SER 23  23  ?   ?   ?   B . n 
B 2 24  ASN 24  24  ?   ?   ?   B . n 
B 2 25  THR 25  25  ?   ?   ?   B . n 
B 2 26  VAL 26  26  ?   ?   ?   B . n 
B 2 27  ARG 27  27  ?   ?   ?   B . n 
B 2 28  SER 28  28  ?   ?   ?   B . n 
B 2 29  GLN 29  29  ?   ?   ?   B . n 
B 2 30  ASN 30  30  ?   ?   ?   B . n 
B 2 31  ASP 31  31  ?   ?   ?   B . n 
B 2 32  ASN 32  32  ?   ?   ?   B . n 
B 2 33  ARG 33  33  ?   ?   ?   B . n 
B 2 34  GLU 34  34  ?   ?   ?   B . n 
B 2 35  ARG 35  35  ?   ?   ?   B . n 
B 2 36  GLN 36  36  ?   ?   ?   B . n 
B 2 37  GLU 37  37  ?   ?   ?   B . n 
B 2 38  HIS 38  38  ?   ?   ?   B . n 
B 2 39  ASN 39  39  ?   ?   ?   B . n 
B 2 40  ASP 40  40  ?   ?   ?   B . n 
B 2 41  ARG 41  41  ?   ?   ?   B . n 
B 2 42  ARG 42  42  ?   ?   ?   B . n 
B 2 43  SER 43  43  ?   ?   ?   B . n 
B 2 44  LEU 44  44  ?   ?   ?   B . n 
B 2 45  GLY 45  45  ?   ?   ?   B . n 
B 2 46  HIS 46  46  ?   ?   ?   B . n 
B 2 47  PRO 47  47  ?   ?   ?   B . n 
B 2 48  GLU 48  48  ?   ?   ?   B . n 
B 2 49  PRO 49  49  ?   ?   ?   B . n 
B 2 50  LEU 50  50  ?   ?   ?   B . n 
B 2 51  SER 51  51  ?   ?   ?   B . n 
B 2 52  ASN 52  52  ?   ?   ?   B . n 
B 2 53  GLY 53  53  ?   ?   ?   B . n 
B 2 54  ARG 54  54  ?   ?   ?   B . n 
B 2 55  PRO 55  55  ?   ?   ?   B . n 
B 2 56  GLN 56  56  ?   ?   ?   B . n 
B 2 57  GLY 57  57  ?   ?   ?   B . n 
B 2 58  ASN 58  58  ?   ?   ?   B . n 
B 2 59  SER 59  59  ?   ?   ?   B . n 
B 2 60  ARG 60  60  ?   ?   ?   B . n 
B 2 61  GLN 61  61  ?   ?   ?   B . n 
B 2 62  VAL 62  62  ?   ?   ?   B . n 
B 2 63  VAL 63  63  ?   ?   ?   B . n 
B 2 64  GLU 64  64  ?   ?   ?   B . n 
B 2 65  GLN 65  65  ?   ?   ?   B . n 
B 2 66  ASP 66  66  ?   ?   ?   B . n 
B 2 67  GLU 67  67  ?   ?   ?   B . n 
B 2 68  GLU 68  68  ?   ?   ?   B . n 
B 2 69  GLU 69  69  ?   ?   ?   B . n 
B 2 70  ASP 70  70  ?   ?   ?   B . n 
B 2 71  GLU 71  71  ?   ?   ?   B . n 
B 2 72  GLU 72  72  ?   ?   ?   B . n 
B 2 73  LEU 73  73  ?   ?   ?   B . n 
B 2 74  THR 74  74  ?   ?   ?   B . n 
B 2 75  LEU 75  75  ?   ?   ?   B . n 
B 2 76  LYS 76  76  ?   ?   ?   B . n 
B 2 77  TYR 77  77  ?   ?   ?   B . n 
B 2 78  GLY 78  78  78  GLY GLY B . n 
B 2 79  ALA 79  79  79  ALA ALA B . n 
B 2 80  LYS 80  80  80  LYS LYS B . n 
B 2 81  HIS 81  81  81  HIS HIS B . n 
B 2 82  VAL 82  82  82  VAL VAL B . n 
B 2 83  ILE 83  83  83  ILE ILE B . n 
B 2 84  MET 84  84  84  MET MET B . n 
B 2 85  LEU 85  85  85  LEU LEU B . n 
B 2 86  PHE 86  86  86  PHE PHE B . n 
B 2 87  VAL 87  87  87  VAL VAL B . n 
B 2 88  PRO 88  88  88  PRO PRO B . n 
B 2 89  VAL 89  89  89  VAL VAL B . n 
B 2 90  THR 90  90  90  THR THR B . n 
B 2 91  LEU 91  91  91  LEU LEU B . n 
B 2 92  CYS 92  92  92  CYS CYS B . n 
B 2 93  MET 93  93  93  MET MET B . n 
B 2 94  VAL 94  94  94  VAL VAL B . n 
B 2 95  VAL 95  95  95  VAL VAL B . n 
B 2 96  VAL 96  96  96  VAL VAL B . n 
B 2 97  VAL 97  97  97  VAL VAL B . n 
B 2 98  ALA 98  98  98  ALA ALA B . n 
B 2 99  THR 99  99  99  THR THR B . n 
B 2 100 ILE 100 100 100 ILE ILE B . n 
B 2 101 LYS 101 101 101 LYS LYS B . n 
B 2 102 SER 102 102 102 SER SER B . n 
B 2 103 VAL 103 103 103 VAL VAL B . n 
B 2 104 SER 104 104 104 SER SER B . n 
B 2 105 PHE 105 105 105 PHE PHE B . n 
B 2 106 TYR 106 106 106 TYR TYR B . n 
B 2 107 THR 107 107 107 THR THR B . n 
B 2 108 ARG 108 108 108 ARG ARG B . n 
B 2 109 LYS 109 109 109 LYS LYS B . n 
B 2 110 ASP 110 110 110 ASP ASP B . n 
B 2 111 GLY 111 111 111 GLY GLY B . n 
B 2 112 GLN 112 112 112 GLN GLN B . n 
B 2 113 LEU 113 113 113 LEU LEU B . n 
B 2 114 ILE 114 114 114 ILE ILE B . n 
B 2 115 TYR 115 115 115 TYR TYR B . n 
B 2 116 THR 116 116 116 THR THR B . n 
B 2 117 PRO 117 117 117 PRO PRO B . n 
B 2 118 PHE 118 118 118 PHE PHE B . n 
B 2 119 THR 119 119 119 THR THR B . n 
B 2 120 GLU 120 120 120 GLU GLU B . n 
B 2 121 ASP 121 121 121 ASP ASP B . n 
B 2 122 THR 122 122 122 THR THR B . n 
B 2 123 GLU 123 123 123 GLU GLU B . n 
B 2 124 THR 124 124 124 THR THR B . n 
B 2 125 VAL 125 125 125 VAL VAL B . n 
B 2 126 GLY 126 126 126 GLY GLY B . n 
B 2 127 GLN 127 127 127 GLN GLN B . n 
B 2 128 ARG 128 128 128 ARG ARG B . n 
B 2 129 ALA 129 129 129 ALA ALA B . n 
B 2 130 LEU 130 130 130 LEU LEU B . n 
B 2 131 HIS 131 131 131 HIS HIS B . n 
B 2 132 SER 132 132 132 SER SER B . n 
B 2 133 ILE 133 133 133 ILE ILE B . n 
B 2 134 LEU 134 134 134 LEU LEU B . n 
B 2 135 ASN 135 135 135 ASN ASN B . n 
B 2 136 ALA 136 136 136 ALA ALA B . n 
B 2 137 ALA 137 137 137 ALA ALA B . n 
B 2 138 ILE 138 138 138 ILE ILE B . n 
B 2 139 MET 139 139 139 MET MET B . n 
B 2 140 ILE 140 140 140 ILE ILE B . n 
B 2 141 SER 141 141 141 SER SER B . n 
B 2 142 VAL 142 142 142 VAL VAL B . n 
B 2 143 ILE 143 143 143 ILE ILE B . n 
B 2 144 VAL 144 144 144 VAL VAL B . n 
B 2 145 VAL 145 145 145 VAL VAL B . n 
B 2 146 MET 146 146 146 MET MET B . n 
B 2 147 THR 147 147 147 THR THR B . n 
B 2 148 ILE 148 148 148 ILE ILE B . n 
B 2 149 LEU 149 149 149 LEU LEU B . n 
B 2 150 LEU 150 150 150 LEU LEU B . n 
B 2 151 VAL 151 151 151 VAL VAL B . n 
B 2 152 VAL 152 152 152 VAL VAL B . n 
B 2 153 LEU 153 153 153 LEU LEU B . n 
B 2 154 TYR 154 154 154 TYR TYR B . n 
B 2 155 LYS 155 155 155 LYS LYS B . n 
B 2 156 TYR 156 156 156 TYR TYR B . n 
B 2 157 ARG 157 157 157 ARG ARG B . n 
B 2 158 CYS 158 158 158 CYS CYS B . n 
B 2 159 TYR 159 159 159 TYR TYR B . n 
B 2 160 LYS 160 160 160 LYS LYS B . n 
B 2 161 VAL 161 161 161 VAL VAL B . n 
B 2 162 ILE 162 162 162 ILE ILE B . n 
B 2 163 HIS 163 163 163 HIS HIS B . n 
B 2 164 ALA 164 164 164 ALA ALA B . n 
B 2 165 TRP 165 165 165 TRP TRP B . n 
B 2 166 LEU 166 166 166 LEU LEU B . n 
B 2 167 ILE 167 167 167 ILE ILE B . n 
B 2 168 ILE 168 168 168 ILE ILE B . n 
B 2 169 SER 169 169 169 SER SER B . n 
B 2 170 SER 170 170 170 SER SER B . n 
B 2 171 LEU 171 171 171 LEU LEU B . n 
B 2 172 LEU 172 172 172 LEU LEU B . n 
B 2 173 LEU 173 173 173 LEU LEU B . n 
B 2 174 LEU 174 174 174 LEU LEU B . n 
B 2 175 PHE 175 175 175 PHE PHE B . n 
B 2 176 PHE 176 176 176 PHE PHE B . n 
B 2 177 PHE 177 177 177 PHE PHE B . n 
B 2 178 SER 178 178 178 SER SER B . n 
B 2 179 PHE 179 179 179 PHE PHE B . n 
B 2 180 ILE 180 180 180 ILE ILE B . n 
B 2 181 TYR 181 181 181 TYR TYR B . n 
B 2 182 LEU 182 182 182 LEU LEU B . n 
B 2 183 GLY 183 183 183 GLY GLY B . n 
B 2 184 GLU 184 184 184 GLU GLU B . n 
B 2 185 VAL 185 185 185 VAL VAL B . n 
B 2 186 PHE 186 186 186 PHE PHE B . n 
B 2 187 LYS 187 187 187 LYS LYS B . n 
B 2 188 THR 188 188 188 THR THR B . n 
B 2 189 TYR 189 189 189 TYR TYR B . n 
B 2 190 ASN 190 190 190 ASN ASN B . n 
B 2 191 VAL 191 191 191 VAL VAL B . n 
B 2 192 ALA 192 192 192 ALA ALA B . n 
B 2 193 VAL 193 193 193 VAL VAL B . n 
B 2 194 ASP 194 194 194 ASP ASP B . n 
B 2 195 TYR 195 195 195 TYR TYR B . n 
B 2 196 ILE 196 196 196 ILE ILE B . n 
B 2 197 THR 197 197 197 THR THR B . n 
B 2 198 VAL 198 198 198 VAL VAL B . n 
B 2 199 ALA 199 199 199 ALA ALA B . n 
B 2 200 LEU 200 200 200 LEU LEU B . n 
B 2 201 LEU 201 201 201 LEU LEU B . n 
B 2 202 ILE 202 202 202 ILE ILE B . n 
B 2 203 TRP 203 203 203 TRP TRP B . n 
B 2 204 ASN 204 204 204 ASN ASN B . n 
B 2 205 PHE 205 205 205 PHE PHE B . n 
B 2 206 GLY 206 206 206 GLY GLY B . n 
B 2 207 VAL 207 207 207 VAL VAL B . n 
B 2 208 VAL 208 208 208 VAL VAL B . n 
B 2 209 GLY 209 209 209 GLY GLY B . n 
B 2 210 MET 210 210 210 MET MET B . n 
B 2 211 ILE 211 211 211 ILE ILE B . n 
B 2 212 SER 212 212 212 SER SER B . n 
B 2 213 ILE 213 213 213 ILE ILE B . n 
B 2 214 HIS 214 214 214 HIS HIS B . n 
B 2 215 TRP 215 215 215 TRP TRP B . n 
B 2 216 LYS 216 216 216 LYS LYS B . n 
B 2 217 GLY 217 217 217 GLY GLY B . n 
B 2 218 PRO 218 218 218 PRO PRO B . n 
B 2 219 LEU 219 219 219 LEU LEU B . n 
B 2 220 ARG 220 220 220 ARG ARG B . n 
B 2 221 LEU 221 221 221 LEU LEU B . n 
B 2 222 GLN 222 222 222 GLN GLN B . n 
B 2 223 GLN 223 223 223 GLN GLN B . n 
B 2 224 ALA 224 224 224 ALA ALA B . n 
B 2 225 TYR 225 225 225 TYR TYR B . n 
B 2 226 LEU 226 226 226 LEU LEU B . n 
B 2 227 ILE 227 227 227 ILE ILE B . n 
B 2 228 MET 228 228 228 MET MET B . n 
B 2 229 ILE 229 229 229 ILE ILE B . n 
B 2 230 SER 230 230 230 SER SER B . n 
B 2 231 ALA 231 231 231 ALA ALA B . n 
B 2 232 LEU 232 232 232 LEU LEU B . n 
B 2 233 MET 233 233 233 MET MET B . n 
B 2 234 ALA 234 234 234 ALA ALA B . n 
B 2 235 LEU 235 235 235 LEU LEU B . n 
B 2 236 VAL 236 236 236 VAL VAL B . n 
B 2 237 PHE 237 237 237 PHE PHE B . n 
B 2 238 ILE 238 238 238 ILE ILE B . n 
B 2 239 LYS 239 239 239 LYS LYS B . n 
B 2 240 TYR 240 240 240 TYR TYR B . n 
B 2 241 LEU 241 241 241 LEU LEU B . n 
B 2 242 PRO 242 242 242 PRO PRO B . n 
B 2 243 GLU 243 243 243 GLU GLU B . n 
B 2 244 TRP 244 244 244 TRP TRP B . n 
B 2 245 THR 245 245 245 THR THR B . n 
B 2 246 ALA 246 246 246 ALA ALA B . n 
B 2 247 TRP 247 247 247 TRP TRP B . n 
B 2 248 LEU 248 248 248 LEU LEU B . n 
B 2 249 ILE 249 249 249 ILE ILE B . n 
B 2 250 LEU 250 250 250 LEU LEU B . n 
B 2 251 ALA 251 251 251 ALA ALA B . n 
B 2 252 VAL 252 252 252 VAL VAL B . n 
B 2 253 ILE 253 253 253 ILE ILE B . n 
B 2 254 SER 254 254 254 SER SER B . n 
B 2 255 VAL 255 255 255 VAL VAL B . n 
B 2 256 THR 256 256 256 THR THR B . n 
B 2 257 ASP 257 257 257 ASP ASP B . n 
B 2 258 LEU 258 258 258 LEU LEU B . n 
B 2 259 VAL 259 259 259 VAL VAL B . n 
B 2 260 ALA 260 260 260 ALA ALA B . n 
B 2 261 VAL 261 261 261 VAL VAL B . n 
B 2 262 LEU 262 262 262 LEU LEU B . n 
B 2 263 CYS 263 263 263 CYS CYS B . n 
B 2 264 PRO 264 264 ?   ?   ?   B . n 
B 2 265 LYS 265 265 ?   ?   ?   B . n 
B 2 266 GLY 266 266 ?   ?   ?   B . n 
B 2 267 PRO 267 267 ?   ?   ?   B . n 
B 2 268 LEU 268 268 ?   ?   ?   B . n 
B 2 269 ARG 269 269 ?   ?   ?   B . n 
B 2 270 MET 270 270 ?   ?   ?   B . n 
B 2 271 LEU 271 271 ?   ?   ?   B . n 
B 2 272 VAL 272 272 ?   ?   ?   B . n 
B 2 273 GLU 273 273 ?   ?   ?   B . n 
B 2 274 THR 274 274 ?   ?   ?   B . n 
B 2 275 ALA 275 275 ?   ?   ?   B . n 
B 2 276 GLN 276 276 ?   ?   ?   B . n 
B 2 277 GLU 277 277 ?   ?   ?   B . n 
B 2 278 ARG 278 278 ?   ?   ?   B . n 
B 2 279 ASN 279 279 279 ASN ASN B . n 
B 2 280 GLU 280 280 280 GLU GLU B . n 
B 2 281 THR 281 281 281 THR THR B . n 
B 2 282 LEU 282 282 282 LEU LEU B . n 
B 2 283 PHE 283 283 283 PHE PHE B . n 
B 2 284 PRO 284 284 284 PRO PRO B . n 
B 2 285 ALA 285 285 285 ALA ALA B . n 
B 2 286 LEU 286 286 286 LEU LEU B . n 
B 2 287 ILE 287 287 287 ILE ILE B . n 
B 2 288 TYR 288 288 288 TYR TYR B . n 
B 2 289 SER 289 289 ?   ?   ?   B . n 
B 2 290 SER 290 290 ?   ?   ?   B . n 
B 2 291 THR 291 291 ?   ?   ?   B . n 
B 2 292 MET 292 292 ?   ?   ?   B . n 
B 2 293 VAL 293 293 ?   ?   ?   B . n 
B 2 294 TRP 294 294 ?   ?   ?   B . n 
B 2 295 LEU 295 295 ?   ?   ?   B . n 
B 2 296 VAL 296 296 ?   ?   ?   B . n 
B 2 297 ASN 297 297 ?   ?   ?   B . n 
B 2 298 MET 298 298 ?   ?   ?   B . n 
B 2 299 ALA 299 299 ?   ?   ?   B . n 
B 2 300 GLU 300 300 ?   ?   ?   B . n 
B 2 301 GLY 301 301 ?   ?   ?   B . n 
B 2 302 ASP 302 302 ?   ?   ?   B . n 
B 2 303 PRO 303 303 ?   ?   ?   B . n 
B 2 304 GLU 304 304 ?   ?   ?   B . n 
B 2 305 ALA 305 305 ?   ?   ?   B . n 
B 2 306 GLN 306 306 ?   ?   ?   B . n 
B 2 307 ARG 307 307 ?   ?   ?   B . n 
B 2 308 ARG 308 308 ?   ?   ?   B . n 
B 2 309 VAL 309 309 ?   ?   ?   B . n 
B 2 310 SER 310 310 ?   ?   ?   B . n 
B 2 311 LYS 311 311 ?   ?   ?   B . n 
B 2 312 ASN 312 312 ?   ?   ?   B . n 
B 2 313 SER 313 313 ?   ?   ?   B . n 
B 2 314 LYS 314 314 ?   ?   ?   B . n 
B 2 315 TYR 315 315 ?   ?   ?   B . n 
B 2 316 ASN 316 316 ?   ?   ?   B . n 
B 2 317 ALA 317 317 ?   ?   ?   B . n 
B 2 318 GLU 318 318 ?   ?   ?   B . n 
B 2 319 SER 319 319 ?   ?   ?   B . n 
B 2 320 THR 320 320 ?   ?   ?   B . n 
B 2 321 GLU 321 321 ?   ?   ?   B . n 
B 2 322 ARG 322 322 ?   ?   ?   B . n 
B 2 323 GLU 323 323 ?   ?   ?   B . n 
B 2 324 SER 324 324 ?   ?   ?   B . n 
B 2 325 GLN 325 325 ?   ?   ?   B . n 
B 2 326 ASP 326 326 ?   ?   ?   B . n 
B 2 327 THR 327 327 ?   ?   ?   B . n 
B 2 328 VAL 328 328 ?   ?   ?   B . n 
B 2 329 ALA 329 329 ?   ?   ?   B . n 
B 2 330 GLU 330 330 ?   ?   ?   B . n 
B 2 331 ASN 331 331 ?   ?   ?   B . n 
B 2 332 ASP 332 332 ?   ?   ?   B . n 
B 2 333 ASP 333 333 ?   ?   ?   B . n 
B 2 334 GLY 334 334 ?   ?   ?   B . n 
B 2 335 GLY 335 335 ?   ?   ?   B . n 
B 2 336 PHE 336 336 ?   ?   ?   B . n 
B 2 337 SER 337 337 ?   ?   ?   B . n 
B 2 338 GLU 338 338 ?   ?   ?   B . n 
B 2 339 GLU 339 339 ?   ?   ?   B . n 
B 2 340 TRP 340 340 ?   ?   ?   B . n 
B 2 341 GLU 341 341 ?   ?   ?   B . n 
B 2 342 ALA 342 342 ?   ?   ?   B . n 
B 2 343 GLN 343 343 ?   ?   ?   B . n 
B 2 344 ARG 344 344 ?   ?   ?   B . n 
B 2 345 ASP 345 345 ?   ?   ?   B . n 
B 2 346 SER 346 346 ?   ?   ?   B . n 
B 2 347 HIS 347 347 ?   ?   ?   B . n 
B 2 348 LEU 348 348 ?   ?   ?   B . n 
B 2 349 GLY 349 349 ?   ?   ?   B . n 
B 2 350 PRO 350 350 ?   ?   ?   B . n 
B 2 351 HIS 351 351 ?   ?   ?   B . n 
B 2 352 ARG 352 352 ?   ?   ?   B . n 
B 2 353 SER 353 353 ?   ?   ?   B . n 
B 2 354 THR 354 354 ?   ?   ?   B . n 
B 2 355 PRO 355 355 ?   ?   ?   B . n 
B 2 356 GLU 356 356 ?   ?   ?   B . n 
B 2 357 SER 357 357 ?   ?   ?   B . n 
B 2 358 ARG 358 358 ?   ?   ?   B . n 
B 2 359 ALA 359 359 ?   ?   ?   B . n 
B 2 360 ALA 360 360 ?   ?   ?   B . n 
B 2 361 VAL 361 361 ?   ?   ?   B . n 
B 2 362 GLN 362 362 ?   ?   ?   B . n 
B 2 363 GLU 363 363 ?   ?   ?   B . n 
B 2 364 LEU 364 364 ?   ?   ?   B . n 
B 2 365 SER 365 365 ?   ?   ?   B . n 
B 2 366 SER 366 366 ?   ?   ?   B . n 
B 2 367 SER 367 367 ?   ?   ?   B . n 
B 2 368 ILE 368 368 ?   ?   ?   B . n 
B 2 369 LEU 369 369 ?   ?   ?   B . n 
B 2 370 ALA 370 370 ?   ?   ?   B . n 
B 2 371 GLY 371 371 ?   ?   ?   B . n 
B 2 372 GLU 372 372 ?   ?   ?   B . n 
B 2 373 ASP 373 373 ?   ?   ?   B . n 
B 2 374 PRO 374 374 ?   ?   ?   B . n 
B 2 375 GLU 375 375 ?   ?   ?   B . n 
B 2 376 GLU 376 376 ?   ?   ?   B . n 
B 2 377 ARG 377 377 ?   ?   ?   B . n 
B 2 378 GLY 378 378 378 GLY GLY B . n 
B 2 379 VAL 379 379 379 VAL VAL B . n 
B 2 380 LYS 380 380 380 LYS LYS B . n 
B 2 381 LEU 381 381 381 LEU LEU B . n 
B 2 382 GLY 382 382 382 GLY GLY B . n 
B 2 383 LEU 383 383 383 LEU LEU B . n 
B 2 384 GLY 384 384 384 GLY GLY B . n 
B 2 385 ASP 385 385 385 ASP ASP B . n 
B 2 386 PHE 386 386 386 PHE PHE B . n 
B 2 387 ILE 387 387 387 ILE ILE B . n 
B 2 388 PHE 388 388 388 PHE PHE B . n 
B 2 389 TYR 389 389 389 TYR TYR B . n 
B 2 390 SER 390 390 390 SER SER B . n 
B 2 391 VAL 391 391 391 VAL VAL B . n 
B 2 392 LEU 392 392 392 LEU LEU B . n 
B 2 393 VAL 393 393 393 VAL VAL B . n 
B 2 394 GLY 394 394 394 GLY GLY B . n 
B 2 395 LYS 395 395 395 LYS LYS B . n 
B 2 396 ALA 396 396 396 ALA ALA B . n 
B 2 397 SER 397 397 397 SER SER B . n 
B 2 398 ALA 398 398 398 ALA ALA B . n 
B 2 399 THR 399 399 399 THR THR B . n 
B 2 400 ALA 400 400 400 ALA ALA B . n 
B 2 401 SER 401 401 401 SER SER B . n 
B 2 402 GLY 402 402 402 GLY GLY B . n 
B 2 403 ASP 403 403 403 ASP ASP B . n 
B 2 404 TRP 404 404 404 TRP TRP B . n 
B 2 405 ASN 405 405 405 ASN ASN B . n 
B 2 406 THR 406 406 406 THR THR B . n 
B 2 407 THR 407 407 407 THR THR B . n 
B 2 408 ILE 408 408 408 ILE ILE B . n 
B 2 409 ALA 409 409 409 ALA ALA B . n 
B 2 410 CYS 410 410 410 CYS CYS B . n 
B 2 411 PHE 411 411 411 PHE PHE B . n 
B 2 412 VAL 412 412 412 VAL VAL B . n 
B 2 413 ALA 413 413 413 ALA ALA B . n 
B 2 414 ILE 414 414 414 ILE ILE B . n 
B 2 415 LEU 415 415 415 LEU LEU B . n 
B 2 416 ILE 416 416 416 ILE ILE B . n 
B 2 417 GLY 417 417 417 GLY GLY B . n 
B 2 418 LEU 418 418 418 LEU LEU B . n 
B 2 419 CYS 419 419 419 CYS CYS B . n 
B 2 420 LEU 420 420 420 LEU LEU B . n 
B 2 421 THR 421 421 421 THR THR B . n 
B 2 422 LEU 422 422 422 LEU LEU B . n 
B 2 423 LEU 423 423 423 LEU LEU B . n 
B 2 424 LEU 424 424 424 LEU LEU B . n 
B 2 425 LEU 425 425 425 LEU LEU B . n 
B 2 426 ALA 426 426 426 ALA ALA B . n 
B 2 427 ILE 427 427 427 ILE ILE B . n 
B 2 428 PHE 428 428 428 PHE PHE B . n 
B 2 429 LYS 429 429 429 LYS LYS B . n 
B 2 430 LYS 430 430 430 LYS LYS B . n 
B 2 431 ALA 431 431 431 ALA ALA B . n 
B 2 432 LEU 432 432 432 LEU LEU B . n 
B 2 433 PRO 433 433 433 PRO PRO B . n 
B 2 434 ALA 434 434 434 ALA ALA B . n 
B 2 435 LEU 435 435 435 LEU LEU B . n 
B 2 436 PRO 436 436 436 PRO PRO B . n 
B 2 437 ILE 437 437 437 ILE ILE B . n 
B 2 438 SER 438 438 438 SER SER B . n 
B 2 439 ILE 439 439 439 ILE ILE B . n 
B 2 440 THR 440 440 440 THR THR B . n 
B 2 441 PHE 441 441 441 PHE PHE B . n 
B 2 442 GLY 442 442 442 GLY GLY B . n 
B 2 443 LEU 443 443 443 LEU LEU B . n 
B 2 444 VAL 444 444 444 VAL VAL B . n 
B 2 445 PHE 445 445 445 PHE PHE B . n 
B 2 446 TYR 446 446 446 TYR TYR B . n 
B 2 447 PHE 447 447 447 PHE PHE B . n 
B 2 448 ALA 448 448 448 ALA ALA B . n 
B 2 449 THR 449 449 449 THR THR B . n 
B 2 450 ASP 450 450 450 ASP ASP B . n 
B 2 451 TYR 451 451 451 TYR TYR B . n 
B 2 452 LEU 452 452 452 LEU LEU B . n 
B 2 453 VAL 453 453 453 VAL VAL B . n 
B 2 454 GLN 454 454 454 GLN GLN B . n 
B 2 455 PRO 455 455 455 PRO PRO B . n 
B 2 456 PHE 456 456 456 PHE PHE B . n 
B 2 457 MET 457 457 457 MET MET B . n 
B 2 458 ASP 458 458 458 ASP ASP B . n 
B 2 459 GLN 459 459 459 GLN GLN B . n 
B 2 460 LEU 460 460 460 LEU LEU B . n 
B 2 461 ALA 461 461 461 ALA ALA B . n 
B 2 462 PHE 462 462 462 PHE PHE B . n 
B 2 463 HIS 463 463 463 HIS HIS B . n 
B 2 464 GLN 464 464 464 GLN GLN B . n 
B 2 465 PHE 465 465 465 PHE PHE B . n 
B 2 466 TYR 466 466 466 TYR TYR B . n 
B 2 467 ILE 467 467 467 ILE ILE B . n 
C 3 1   MET 1   1   ?   ?   ?   C . n 
C 3 2   GLY 2   2   2   GLY GLY C . n 
C 3 3   ALA 3   3   3   ALA ALA C . n 
C 3 4   ALA 4   4   4   ALA ALA C . n 
C 3 5   VAL 5   5   5   VAL VAL C . n 
C 3 6   PHE 6   6   6   PHE PHE C . n 
C 3 7   PHE 7   7   7   PHE PHE C . n 
C 3 8   GLY 8   8   8   GLY GLY C . n 
C 3 9   CYS 9   9   9   CYS CYS C . n 
C 3 10  THR 10  10  10  THR THR C . n 
C 3 11  PHE 11  11  11  PHE PHE C . n 
C 3 12  VAL 12  12  12  VAL VAL C . n 
C 3 13  ALA 13  13  13  ALA ALA C . n 
C 3 14  PHE 14  14  14  PHE PHE C . n 
C 3 15  GLY 15  15  15  GLY GLY C . n 
C 3 16  PRO 16  16  16  PRO PRO C . n 
C 3 17  ALA 17  17  17  ALA ALA C . n 
C 3 18  PHE 18  18  18  PHE PHE C . n 
C 3 19  ALA 19  19  19  ALA ALA C . n 
C 3 20  LEU 20  20  20  LEU LEU C . n 
C 3 21  PHE 21  21  21  PHE PHE C . n 
C 3 22  LEU 22  22  22  LEU LEU C . n 
C 3 23  ILE 23  23  23  ILE ILE C . n 
C 3 24  THR 24  24  24  THR THR C . n 
C 3 25  VAL 25  25  25  VAL VAL C . n 
C 3 26  ALA 26  26  26  ALA ALA C . n 
C 3 27  GLY 27  27  27  GLY GLY C . n 
C 3 28  ASP 28  28  28  ASP ASP C . n 
C 3 29  PRO 29  29  29  PRO PRO C . n 
C 3 30  LEU 30  30  30  LEU LEU C . n 
C 3 31  ARG 31  31  31  ARG ARG C . n 
C 3 32  VAL 32  32  32  VAL VAL C . n 
C 3 33  ILE 33  33  33  ILE ILE C . n 
C 3 34  ILE 34  34  34  ILE ILE C . n 
C 3 35  LEU 35  35  35  LEU LEU C . n 
C 3 36  VAL 36  36  36  VAL VAL C . n 
C 3 37  ALA 37  37  37  ALA ALA C . n 
C 3 38  GLY 38  38  38  GLY GLY C . n 
C 3 39  ALA 39  39  39  ALA ALA C . n 
C 3 40  PHE 40  40  40  PHE PHE C . n 
C 3 41  PHE 41  41  41  PHE PHE C . n 
C 3 42  TRP 42  42  42  TRP TRP C . n 
C 3 43  LEU 43  43  43  LEU LEU C . n 
C 3 44  VAL 44  44  44  VAL VAL C . n 
C 3 45  SER 45  45  45  SER SER C . n 
C 3 46  LEU 46  46  46  LEU LEU C . n 
C 3 47  LEU 47  47  47  LEU LEU C . n 
C 3 48  LEU 48  48  48  LEU LEU C . n 
C 3 49  ALA 49  49  49  ALA ALA C . n 
C 3 50  SER 50  50  50  SER SER C . n 
C 3 51  VAL 51  51  51  VAL VAL C . n 
C 3 52  VAL 52  52  52  VAL VAL C . n 
C 3 53  TRP 53  53  53  TRP TRP C . n 
C 3 54  PHE 54  54  54  PHE PHE C . n 
C 3 55  ILE 55  55  55  ILE ILE C . n 
C 3 56  LEU 56  56  56  LEU LEU C . n 
C 3 57  VAL 57  57  57  VAL VAL C . n 
C 3 58  HIS 58  58  58  HIS HIS C . n 
C 3 59  VAL 59  59  59  VAL VAL C . n 
C 3 60  THR 60  60  60  THR THR C . n 
C 3 61  ASP 61  61  61  ASP ASP C . n 
C 3 62  ARG 62  62  62  ARG ARG C . n 
C 3 63  SER 63  63  63  SER SER C . n 
C 3 64  ASP 64  64  64  ASP ASP C . n 
C 3 65  ALA 65  65  65  ALA ALA C . n 
C 3 66  ARG 66  66  66  ARG ARG C . n 
C 3 67  LEU 67  67  67  LEU LEU C . n 
C 3 68  GLN 68  68  68  GLN GLN C . n 
C 3 69  TYR 69  69  69  TYR TYR C . n 
C 3 70  GLY 70  70  70  GLY GLY C . n 
C 3 71  LEU 71  71  71  LEU LEU C . n 
C 3 72  LEU 72  72  72  LEU LEU C . n 
C 3 73  ILE 73  73  73  ILE ILE C . n 
C 3 74  PHE 74  74  74  PHE PHE C . n 
C 3 75  GLY 75  75  75  GLY GLY C . n 
C 3 76  ALA 76  76  76  ALA ALA C . n 
C 3 77  ALA 77  77  77  ALA ALA C . n 
C 3 78  VAL 78  78  78  VAL VAL C . n 
C 3 79  SER 79  79  79  SER SER C . n 
C 3 80  VAL 80  80  80  VAL VAL C . n 
C 3 81  LEU 81  81  81  LEU LEU C . n 
C 3 82  LEU 82  82  82  LEU LEU C . n 
C 3 83  GLN 83  83  83  GLN GLN C . n 
C 3 84  GLU 84  84  84  GLU GLU C . n 
C 3 85  VAL 85  85  85  VAL VAL C . n 
C 3 86  PHE 86  86  86  PHE PHE C . n 
C 3 87  ARG 87  87  87  ARG ARG C . n 
C 3 88  PHE 88  88  88  PHE PHE C . n 
C 3 89  ALA 89  89  89  ALA ALA C . n 
C 3 90  TYR 90  90  90  TYR TYR C . n 
C 3 91  TYR 91  91  91  TYR TYR C . n 
C 3 92  LYS 92  92  92  LYS LYS C . n 
C 3 93  LEU 93  93  93  LEU LEU C . n 
C 3 94  LEU 94  94  94  LEU LEU C . n 
C 3 95  LYS 95  95  95  LYS LYS C . n 
C 3 96  LYS 96  96  96  LYS LYS C . n 
C 3 97  ALA 97  97  97  ALA ALA C . n 
C 3 98  ASP 98  98  98  ASP ASP C . n 
C 3 99  GLU 99  99  99  GLU GLU C . n 
C 3 100 GLY 100 100 100 GLY GLY C . n 
C 3 101 LEU 101 101 101 LEU LEU C . n 
C 3 102 ALA 102 102 102 ALA ALA C . n 
C 3 103 SER 103 103 103 SER SER C . n 
C 3 104 LEU 104 104 104 LEU LEU C . n 
C 3 105 SER 105 105 105 SER SER C . n 
C 3 106 GLU 106 106 106 GLU GLU C . n 
C 3 107 ASP 107 107 107 ASP ASP C . n 
C 3 108 GLY 108 108 108 GLY GLY C . n 
C 3 109 ARG 109 109 109 ARG ARG C . n 
C 3 110 SER 110 110 110 SER SER C . n 
C 3 111 PRO 111 111 111 PRO PRO C . n 
C 3 112 ILE 112 112 112 ILE ILE C . n 
C 3 113 SER 113 113 113 SER SER C . n 
C 3 114 ILE 114 114 114 ILE ILE C . n 
C 3 115 ARG 115 115 115 ARG ARG C . n 
C 3 116 GLN 116 116 116 GLN GLN C . n 
C 3 117 MET 117 117 117 MET MET C . n 
C 3 118 ALA 118 118 118 ALA ALA C . n 
C 3 119 TYR 119 119 119 TYR TYR C . n 
C 3 120 VAL 120 120 120 VAL VAL C . n 
C 3 121 SER 121 121 121 SER SER C . n 
C 3 122 GLY 122 122 122 GLY GLY C . n 
C 3 123 LEU 123 123 123 LEU LEU C . n 
C 3 124 SER 124 124 124 SER SER C . n 
C 3 125 PHE 125 125 125 PHE PHE C . n 
C 3 126 GLY 126 126 126 GLY GLY C . n 
C 3 127 ILE 127 127 127 ILE ILE C . n 
C 3 128 ILE 128 128 128 ILE ILE C . n 
C 3 129 SER 129 129 129 SER SER C . n 
C 3 130 GLY 130 130 130 GLY GLY C . n 
C 3 131 VAL 131 131 131 VAL VAL C . n 
C 3 132 PHE 132 132 132 PHE PHE C . n 
C 3 133 SER 133 133 133 SER SER C . n 
C 3 134 VAL 134 134 134 VAL VAL C . n 
C 3 135 ILE 135 135 135 ILE ILE C . n 
C 3 136 ASN 136 136 136 ASN ASN C . n 
C 3 137 ILE 137 137 137 ILE ILE C . n 
C 3 138 LEU 138 138 138 LEU LEU C . n 
C 3 139 ALA 139 139 139 ALA ALA C . n 
C 3 140 ASP 140 140 140 ASP ASP C . n 
C 3 141 ALA 141 141 141 ALA ALA C . n 
C 3 142 LEU 142 142 142 LEU LEU C . n 
C 3 143 GLY 143 143 143 GLY GLY C . n 
C 3 144 PRO 144 144 144 PRO PRO C . n 
C 3 145 GLY 145 145 145 GLY GLY C . n 
C 3 146 VAL 146 146 146 VAL VAL C . n 
C 3 147 VAL 147 147 147 VAL VAL C . n 
C 3 148 GLY 148 148 148 GLY GLY C . n 
C 3 149 ILE 149 149 149 ILE ILE C . n 
C 3 150 HIS 150 150 150 HIS HIS C . n 
C 3 151 GLY 151 151 151 GLY GLY C . n 
C 3 152 ASP 152 152 152 ASP ASP C . n 
C 3 153 SER 153 153 153 SER SER C . n 
C 3 154 PRO 154 154 154 PRO PRO C . n 
C 3 155 TYR 155 155 155 TYR TYR C . n 
C 3 156 TYR 156 156 156 TYR TYR C . n 
C 3 157 PHE 157 157 157 PHE PHE C . n 
C 3 158 LEU 158 158 158 LEU LEU C . n 
C 3 159 THR 159 159 159 THR THR C . n 
C 3 160 SER 160 160 160 SER SER C . n 
C 3 161 ALA 161 161 161 ALA ALA C . n 
C 3 162 PHE 162 162 162 PHE PHE C . n 
C 3 163 LEU 163 163 163 LEU LEU C . n 
C 3 164 THR 164 164 164 THR THR C . n 
C 3 165 ALA 165 165 165 ALA ALA C . n 
C 3 166 ALA 166 166 166 ALA ALA C . n 
C 3 167 ILE 167 167 167 ILE ILE C . n 
C 3 168 ILE 168 168 168 ILE ILE C . n 
C 3 169 LEU 169 169 169 LEU LEU C . n 
C 3 170 LEU 170 170 170 LEU LEU C . n 
C 3 171 HIS 171 171 171 HIS HIS C . n 
C 3 172 THR 172 172 172 THR THR C . n 
C 3 173 PHE 173 173 173 PHE PHE C . n 
C 3 174 TRP 174 174 174 TRP TRP C . n 
C 3 175 GLY 175 175 175 GLY GLY C . n 
C 3 176 VAL 176 176 176 VAL VAL C . n 
C 3 177 VAL 177 177 177 VAL VAL C . n 
C 3 178 PHE 178 178 178 PHE PHE C . n 
C 3 179 PHE 179 179 179 PHE PHE C . n 
C 3 180 ASP 180 180 180 ASP ASP C . n 
C 3 181 ALA 181 181 181 ALA ALA C . n 
C 3 182 CYS 182 182 182 CYS CYS C . n 
C 3 183 GLU 183 183 183 GLU GLU C . n 
C 3 184 ARG 184 184 184 ARG ARG C . n 
C 3 185 ARG 185 185 185 ARG ARG C . n 
C 3 186 ARG 186 186 186 ARG ARG C . n 
C 3 187 TYR 187 187 187 TYR TYR C . n 
C 3 188 TRP 188 188 188 TRP TRP C . n 
C 3 189 ALA 189 189 189 ALA ALA C . n 
C 3 190 LEU 190 190 190 LEU LEU C . n 
C 3 191 GLY 191 191 191 GLY GLY C . n 
C 3 192 LEU 192 192 192 LEU LEU C . n 
C 3 193 VAL 193 193 193 VAL VAL C . n 
C 3 194 VAL 194 194 194 VAL VAL C . n 
C 3 195 GLY 195 195 195 GLY GLY C . n 
C 3 196 SER 196 196 196 SER SER C . n 
C 3 197 HIS 197 197 197 HIS HIS C . n 
C 3 198 LEU 198 198 198 LEU LEU C . n 
C 3 199 LEU 199 199 199 LEU LEU C . n 
C 3 200 THR 200 200 200 THR THR C . n 
C 3 201 SER 201 201 201 SER SER C . n 
C 3 202 GLY 202 202 202 GLY GLY C . n 
C 3 203 LEU 203 203 203 LEU LEU C . n 
C 3 204 THR 204 204 204 THR THR C . n 
C 3 205 PHE 205 205 205 PHE PHE C . n 
C 3 206 LEU 206 206 206 LEU LEU C . n 
C 3 207 ASN 207 207 207 ASN ASN C . n 
C 3 208 PRO 208 208 208 PRO PRO C . n 
C 3 209 TRP 209 209 209 TRP TRP C . n 
C 3 210 TYR 210 210 210 TYR TYR C . n 
C 3 211 GLU 211 211 211 GLU GLU C . n 
C 3 212 ALA 212 212 212 ALA ALA C . n 
C 3 213 SER 213 213 213 SER SER C . n 
C 3 214 LEU 214 214 214 LEU LEU C . n 
C 3 215 LEU 215 215 215 LEU LEU C . n 
C 3 216 PRO 216 216 216 PRO PRO C . n 
C 3 217 ILE 217 217 217 ILE ILE C . n 
C 3 218 TYR 218 218 218 TYR TYR C . n 
C 3 219 ALA 219 219 219 ALA ALA C . n 
C 3 220 VAL 220 220 220 VAL VAL C . n 
C 3 221 THR 221 221 221 THR THR C . n 
C 3 222 VAL 222 222 222 VAL VAL C . n 
C 3 223 SER 223 223 223 SER SER C . n 
C 3 224 MET 224 224 224 MET MET C . n 
C 3 225 GLY 225 225 225 GLY GLY C . n 
C 3 226 LEU 226 226 226 LEU LEU C . n 
C 3 227 TRP 227 227 227 TRP TRP C . n 
C 3 228 ALA 228 228 228 ALA ALA C . n 
C 3 229 PHE 229 229 229 PHE PHE C . n 
C 3 230 ILE 230 230 230 ILE ILE C . n 
C 3 231 THR 231 231 231 THR THR C . n 
C 3 232 ALA 232 232 232 ALA ALA C . n 
C 3 233 GLY 233 233 233 GLY GLY C . n 
C 3 234 GLY 234 234 234 GLY GLY C . n 
C 3 235 SER 235 235 235 SER SER C . n 
C 3 236 LEU 236 236 236 LEU LEU C . n 
C 3 237 ARG 237 237 237 ARG ARG C . n 
C 3 238 SER 238 238 238 SER SER C . n 
C 3 239 ILE 239 239 239 ILE ILE C . n 
C 3 240 GLN 240 240 240 GLN GLN C . n 
C 3 241 ARG 241 241 241 ARG ARG C . n 
C 3 242 SER 242 242 242 SER SER C . n 
C 3 243 LEU 243 243 243 LEU LEU C . n 
C 3 244 LEU 244 244 244 LEU LEU C . n 
C 3 245 CYS 245 245 ?   ?   ?   C . n 
C 3 246 ARG 246 246 ?   ?   ?   C . n 
C 3 247 ARG 247 247 ?   ?   ?   C . n 
C 3 248 GLN 248 248 ?   ?   ?   C . n 
C 3 249 GLU 249 249 ?   ?   ?   C . n 
C 3 250 ASP 250 250 ?   ?   ?   C . n 
C 3 251 SER 251 251 ?   ?   ?   C . n 
C 3 252 ARG 252 252 ?   ?   ?   C . n 
C 3 253 VAL 253 253 ?   ?   ?   C . n 
C 3 254 MET 254 254 ?   ?   ?   C . n 
C 3 255 VAL 255 255 ?   ?   ?   C . n 
C 3 256 TYR 256 256 ?   ?   ?   C . n 
C 3 257 SER 257 257 ?   ?   ?   C . n 
C 3 258 ALA 258 258 ?   ?   ?   C . n 
C 3 259 LEU 259 259 ?   ?   ?   C . n 
C 3 260 ARG 260 260 ?   ?   ?   C . n 
C 3 261 ILE 261 261 ?   ?   ?   C . n 
C 3 262 PRO 262 262 ?   ?   ?   C . n 
C 3 263 PRO 263 263 ?   ?   ?   C . n 
C 3 264 GLU 264 264 ?   ?   ?   C . n 
C 3 265 ASP 265 265 ?   ?   ?   C . n 
D 4 1   MET 1   1   ?   ?   ?   D . n 
D 4 2   ASN 2   2   2   ASN ASN D . n 
D 4 3   LEU 3   3   3   LEU LEU D . n 
D 4 4   GLU 4   4   4   GLU GLU D . n 
D 4 5   ARG 5   5   5   ARG ARG D . n 
D 4 6   VAL 6   6   6   VAL VAL D . n 
D 4 7   SER 7   7   7   SER SER D . n 
D 4 8   ASN 8   8   8   ASN ASN D . n 
D 4 9   GLU 9   9   9   GLU GLU D . n 
D 4 10  GLU 10  10  10  GLU GLU D . n 
D 4 11  LYS 11  11  11  LYS LYS D . n 
D 4 12  LEU 12  12  12  LEU LEU D . n 
D 4 13  ASN 13  13  13  ASN ASN D . n 
D 4 14  LEU 14  14  14  LEU LEU D . n 
D 4 15  CYS 15  15  15  CYS CYS D . n 
D 4 16  ARG 16  16  16  ARG ARG D . n 
D 4 17  LYS 17  17  17  LYS LYS D . n 
D 4 18  TYR 18  18  18  TYR TYR D . n 
D 4 19  TYR 19  19  19  TYR TYR D . n 
D 4 20  LEU 20  20  20  LEU LEU D . n 
D 4 21  GLY 21  21  21  GLY GLY D . n 
D 4 22  GLY 22  22  22  GLY GLY D . n 
D 4 23  PHE 23  23  23  PHE PHE D . n 
D 4 24  ALA 24  24  24  ALA ALA D . n 
D 4 25  PHE 25  25  25  PHE PHE D . n 
D 4 26  LEU 26  26  26  LEU LEU D . n 
D 4 27  PRO 27  27  27  PRO PRO D . n 
D 4 28  PHE 28  28  28  PHE PHE D . n 
D 4 29  LEU 29  29  29  LEU LEU D . n 
D 4 30  TRP 30  30  30  TRP TRP D . n 
D 4 31  LEU 31  31  31  LEU LEU D . n 
D 4 32  VAL 32  32  32  VAL VAL D . n 
D 4 33  ASN 33  33  33  ASN ASN D . n 
D 4 34  ILE 34  34  34  ILE ILE D . n 
D 4 35  PHE 35  35  35  PHE PHE D . n 
D 4 36  TRP 36  36  36  TRP TRP D . n 
D 4 37  PHE 37  37  37  PHE PHE D . n 
D 4 38  PHE 38  38  38  PHE PHE D . n 
D 4 39  ARG 39  39  39  ARG ARG D . n 
D 4 40  GLU 40  40  40  GLU GLU D . n 
D 4 41  ALA 41  41  41  ALA ALA D . n 
D 4 42  PHE 42  42  42  PHE PHE D . n 
D 4 43  LEU 43  43  43  LEU LEU D . n 
D 4 44  VAL 44  44  44  VAL VAL D . n 
D 4 45  PRO 45  45  45  PRO PRO D . n 
D 4 46  ALA 46  46  46  ALA ALA D . n 
D 4 47  TYR 47  47  47  TYR TYR D . n 
D 4 48  THR 48  48  48  THR THR D . n 
D 4 49  GLU 49  49  49  GLU GLU D . n 
D 4 50  GLN 50  50  50  GLN GLN D . n 
D 4 51  SER 51  51  51  SER SER D . n 
D 4 52  GLN 52  52  52  GLN GLN D . n 
D 4 53  ILE 53  53  53  ILE ILE D . n 
D 4 54  LYS 54  54  54  LYS LYS D . n 
D 4 55  GLY 55  55  55  GLY GLY D . n 
D 4 56  TYR 56  56  56  TYR TYR D . n 
D 4 57  VAL 57  57  57  VAL VAL D . n 
D 4 58  TRP 58  58  58  TRP TRP D . n 
D 4 59  ARG 59  59  59  ARG ARG D . n 
D 4 60  SER 60  60  60  SER SER D . n 
D 4 61  ALA 61  61  61  ALA ALA D . n 
D 4 62  VAL 62  62  62  VAL VAL D . n 
D 4 63  GLY 63  63  63  GLY GLY D . n 
D 4 64  PHE 64  64  64  PHE PHE D . n 
D 4 65  LEU 65  65  65  LEU LEU D . n 
D 4 66  PHE 66  66  66  PHE PHE D . n 
D 4 67  TRP 67  67  67  TRP TRP D . n 
D 4 68  VAL 68  68  68  VAL VAL D . n 
D 4 69  ILE 69  69  69  ILE ILE D . n 
D 4 70  VAL 70  70  70  VAL VAL D . n 
D 4 71  LEU 71  71  71  LEU LEU D . n 
D 4 72  THR 72  72  72  THR THR D . n 
D 4 73  SER 73  73  73  SER SER D . n 
D 4 74  TRP 74  74  74  TRP TRP D . n 
D 4 75  ILE 75  75  75  ILE ILE D . n 
D 4 76  THR 76  76  76  THR THR D . n 
D 4 77  ILE 77  77  77  ILE ILE D . n 
D 4 78  PHE 78  78  78  PHE PHE D . n 
D 4 79  GLN 79  79  79  GLN GLN D . n 
D 4 80  ILE 80  80  80  ILE ILE D . n 
D 4 81  TYR 81  81  81  TYR TYR D . n 
D 4 82  ARG 82  82  82  ARG ARG D . n 
D 4 83  PRO 83  83  83  PRO PRO D . n 
D 4 84  ARG 84  84  84  ARG ARG D . n 
D 4 85  TRP 85  85  85  TRP TRP D . n 
D 4 86  GLY 86  86  86  GLY GLY D . n 
D 4 87  ALA 87  87  87  ALA ALA D . n 
D 4 88  LEU 88  88  88  LEU LEU D . n 
D 4 89  GLY 89  89  89  GLY GLY D . n 
D 4 90  ASP 90  90  90  ASP ASP D . n 
D 4 91  TYR 91  91  91  TYR TYR D . n 
D 4 92  LEU 92  92  92  LEU LEU D . n 
D 4 93  SER 93  93  93  SER SER D . n 
D 4 94  PHE 94  94  94  PHE PHE D . n 
D 4 95  THR 95  95  95  THR THR D . n 
D 4 96  ILE 96  96  96  ILE ILE D . n 
D 4 97  PRO 97  97  97  PRO PRO D . n 
D 4 98  LEU 98  98  98  LEU LEU D . n 
D 4 99  GLY 99  99  99  GLY GLY D . n 
D 4 100 THR 100 100 100 THR THR D . n 
D 4 101 PRO 101 101 101 PRO PRO D . n 
E 5 1   ALA 1   5   5   ALA ALA G . n 
E 5 2   ALA 2   6   6   ALA ALA G . n 
E 5 3   ALA 3   7   7   ALA ALA G . n 
E 5 4   ALA 4   8   8   ALA ALA G . n 
E 5 5   ALA 5   9   9   ALA ALA G . n 
E 5 6   ALA 6   10  10  ALA ALA G . n 
E 5 7   ALA 7   11  11  ALA ALA G . n 
E 5 8   ALA 8   12  12  ALA ALA G . n 
E 5 9   ALA 9   13  13  ALA ALA G . n 
E 5 10  ALA 10  14  14  ALA ALA G . n 
E 5 11  ALA 11  15  15  ALA ALA G . n 
E 5 12  ALA 12  16  16  ALA ALA G . n 
E 5 13  ALA 13  17  17  ALA ALA G . n 
E 5 14  ALA 14  18  18  ALA ALA G . n 
E 5 15  ALA 15  19  19  ALA ALA G . n 
E 5 16  ALA 16  20  20  ALA ALA G . n 
E 5 17  ALA 17  21  21  ALA ALA G . n 
E 5 18  ALA 18  22  22  ALA ALA G . n 
E 5 19  ALA 19  23  23  ALA ALA G . n 
E 5 20  ALA 20  24  24  ALA ALA G . n 
E 5 21  ALA 21  25  25  ALA ALA G . n 
E 5 22  ALA 22  26  26  ALA ALA G . n 
E 5 23  ALA 23  27  27  ALA ALA G . n 
E 5 24  ALA 24  28  28  ALA ALA G . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   pentameric 
_pdbx_struct_assembly.oligomeric_count     5 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-12-16 
2 'Structure model' 1 1 2016-12-21 
3 'Structure model' 1 2 2019-09-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Data collection'     
3 3 'Structure model' 'Database references' 
4 3 'Structure model' 'Source and taxonomy' 
5 3 'Structure model' 'Structure summary'   
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' entity          
2 3 'Structure model' entity_name_com 
3 3 'Structure model' entity_src_gen  
4 3 'Structure model' struct_ref      
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_entity.pdbx_description'                      
2 3 'Structure model' '_entity_src_gen.gene_src_common_name'          
3 3 'Structure model' '_entity_src_gen.pdbx_beg_seq_num'              
4 3 'Structure model' '_entity_src_gen.pdbx_end_seq_num'              
5 3 'Structure model' '_entity_src_gen.pdbx_gene_src_gene'            
6 3 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name' 
7 3 'Structure model' '_entity_src_gen.pdbx_seq_type'                 
8 3 'Structure model' '_struct_ref.pdbx_align_begin'                  
9 3 'Structure model' '_struct_ref.pdbx_seq_one_letter_code'          
# 
_em_3d_reconstruction.entry_id                    5FN3 
_em_3d_reconstruction.id                          1 
_em_3d_reconstruction.resolution_method           'FSC 0.143 CUT-OFF' 
_em_3d_reconstruction.refinement_type             'HALF-MAPS REFINED INDEPENDENTLY' 
_em_3d_reconstruction.resolution                  4.1 
_em_3d_reconstruction.symmetry_type               POINT 
_em_3d_reconstruction.num_particles               63873 
_em_3d_reconstruction.image_processing_id         1 
_em_3d_reconstruction.method                      ? 
_em_3d_reconstruction.algorithm                   ? 
_em_3d_reconstruction.nominal_pixel_size          ? 
_em_3d_reconstruction.actual_pixel_size           ? 
_em_3d_reconstruction.num_class_averages          ? 
_em_3d_reconstruction.magnification_calibration   ? 
_em_3d_reconstruction.details                     ? 
# 
_em_buffer.id            1 
_em_buffer.specimen_id   1 
_em_buffer.name          '25 MM HEPES, PH 7.4, 150 MM NACL AND AMPHIPOL A8-35' 
_em_buffer.pH            7.4 
_em_buffer.details       '25 MM HEPES, PH 7.4, 150 MM NACL AND AMPHIPOL A8-35' 
# 
_em_entity_assembly.id                   1 
_em_entity_assembly.name                 'GAMMA SECRETASE' 
_em_entity_assembly.type                 COMPLEX 
_em_entity_assembly.parent_id            0 
_em_entity_assembly.synonym              ? 
_em_entity_assembly.details              ? 
_em_entity_assembly.oligomeric_details   ? 
# 
_em_image_scans.entry_id                5FN3 
_em_image_scans.id                      1 
_em_image_scans.image_recording_id      1 
_em_image_scans.number_digital_images   2000 
_em_image_scans.citation_id             ? 
_em_image_scans.od_range                ? 
_em_image_scans.quant_bit_size          ? 
_em_image_scans.sampling_size           ? 
_em_image_scans.scanner_model           ? 
_em_image_scans.details                 ? 
# 
_em_imaging.entry_id                        5FN3 
_em_imaging.id                              1 
_em_imaging.microscope_model                'FEI TITAN KRIOS' 
_em_imaging.specimen_id                     1 
_em_imaging.date                            2014-10-25 
_em_imaging.temperature                     85 
_em_imaging.nominal_defocus_min             700 
_em_imaging.nominal_defocus_max             3200 
_em_imaging.tilt_angle_min                  ? 
_em_imaging.tilt_angle_max                  ? 
_em_imaging.nominal_cs                      2.7 
_em_imaging.mode                            'BRIGHT FIELD' 
_em_imaging.illumination_mode               'FLOOD BEAM' 
_em_imaging.nominal_magnification           81000 
_em_imaging.calibrated_magnification        35714 
_em_imaging.electron_source                 'FIELD EMISSION GUN' 
_em_imaging.accelerating_voltage            300 
_em_imaging.details                         ? 
_em_imaging.specimen_holder_type            . 
_em_imaging.specimen_holder_model           . 
_em_imaging.citation_id                     ? 
_em_imaging.astigmatism                     ? 
_em_imaging.detector_distance               ? 
_em_imaging.electron_beam_tilt_params       ? 
_em_imaging.recording_temperature_maximum   ? 
_em_imaging.recording_temperature_minimum   ? 
# 
_em_sample_support.id               1 
_em_sample_support.specimen_id      1 
_em_sample_support.details          'HOLEY CARBON' 
_em_sample_support.method           ? 
_em_sample_support.film_material    ? 
_em_sample_support.grid_material    ? 
_em_sample_support.grid_mesh_size   ? 
_em_sample_support.grid_type        ? 
# 
_em_vitrification.entry_id              5FN3 
_em_vitrification.id                    1 
_em_vitrification.instrument            'FEI VITROBOT MARK IV' 
_em_vitrification.cryogen_name          ETHANE 
_em_vitrification.specimen_id           1 
_em_vitrification.details               'LIQUID ETHANE' 
_em_vitrification.citation_id           ? 
_em_vitrification.humidity              ? 
_em_vitrification.method                ? 
_em_vitrification.temp                  ? 
_em_vitrification.time_resolved_state   ? 
# 
_em_experiment.entry_id                5FN3 
_em_experiment.id                      1 
_em_experiment.aggregation_state       PARTICLE 
_em_experiment.entity_assembly_id      1 
_em_experiment.reconstruction_method   'SINGLE PARTICLE' 
# 
_em_single_particle_entity.entry_id              5FN3 
_em_single_particle_entity.id                    1 
_em_single_particle_entity.point_symmetry        C1 
_em_single_particle_entity.image_processing_id   1 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O   G ALA 15  ? ? CB G ALA 18  ? ? 1.02 
2  1 SD  B MET 146 ? ? O  G ALA 23  ? ? 1.10 
3  1 OH  B TYR 115 ? ? CA G ALA 19  ? ? 1.16 
4  1 OH  B TYR 115 ? ? N  G ALA 19  ? ? 1.28 
5  1 O   G ALA 12  ? ? CB G ALA 14  ? ? 1.45 
6  1 CE1 B TYR 115 ? ? CB G ALA 19  ? ? 1.65 
7  1 O   G ALA 12  ? ? CA G ALA 14  ? ? 1.89 
8  1 O   G ALA 15  ? ? CB G ALA 17  ? ? 1.89 
9  1 O   B ARG 108 ? ? NZ B LYS 239 ? ? 1.90 
10 1 SD  B MET 146 ? ? C  G ALA 23  ? ? 1.96 
11 1 CZ  B TYR 115 ? ? CB G ALA 19  ? ? 1.96 
12 1 OH  B TYR 115 ? ? CB G ALA 19  ? ? 2.04 
13 1 C   G ALA 15  ? ? CB G ALA 18  ? ? 2.05 
14 1 CZ  B TYR 115 ? ? CA G ALA 19  ? ? 2.06 
15 1 O   G ALA 12  ? ? N  G ALA 14  ? ? 2.09 
16 1 OH  B TYR 115 ? ? C  G ALA 18  ? ? 2.13 
17 1 C   G ALA 15  ? ? CB G ALA 17  ? ? 2.17 
18 1 O   B HIS 163 ? ? N  B ILE 167 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C  A ASN 91  ? ? N  A PRO 92  ? ? CA A PRO 92  ? ? 130.82 119.30 11.52  1.50 Y 
2 1 CA B PRO 117 ? ? N  B PRO 117 ? ? CD B PRO 117 ? ? 101.66 111.70 -10.04 1.40 N 
3 1 CA B CYS 263 ? ? CB B CYS 263 ? ? SG B CYS 263 ? ? 121.21 114.20 7.01   1.10 N 
4 1 CA C LEU 47  ? ? CB C LEU 47  ? ? CG C LEU 47  ? ? 131.04 115.30 15.74  2.30 N 
5 1 CA C TYR 69  ? ? CB C TYR 69  ? ? CG C TYR 69  ? ? 125.07 113.40 11.67  1.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 ASN A 45  ? ? -106.43 -65.21  
2   1 ILE A 66  ? ? -48.18  153.74  
3   1 HIS A 74  ? ? -160.48 113.81  
4   1 ASP A 88  ? ? -84.87  -71.80  
5   1 PRO A 93  ? ? -59.71  92.33   
6   1 PHE A 103 ? ? -65.45  77.47   
7   1 SER A 129 ? ? 76.17   152.83  
8   1 ALA A 131 ? ? -64.59  -71.65  
9   1 CYS A 140 ? ? -117.84 77.56   
10  1 SER A 149 ? ? -100.46 -164.51 
11  1 GLU A 155 ? ? -34.98  -37.94  
12  1 ALA A 157 ? ? 3.52    -76.60  
13  1 HIS A 158 ? ? -108.90 57.51   
14  1 CYS A 159 ? ? 31.99   54.14   
15  1 GLU A 161 ? ? -66.70  -79.65  
16  1 GLN A 163 ? ? 70.31   97.88   
17  1 ASN A 165 ? ? -107.43 65.26   
18  1 LEU A 167 ? ? -88.70  36.40   
19  1 ASP A 185 ? ? 69.68   116.38  
20  1 HIS A 199 ? ? -132.91 -41.41  
21  1 ASN A 200 ? ? -94.26  53.95   
22  1 SER A 206 ? ? -108.68 -93.02  
23  1 LEU A 217 ? ? -160.24 103.47  
24  1 SER A 219 ? ? -150.19 73.81   
25  1 ILE A 225 ? ? 61.19   -80.15  
26  1 CYS A 248 ? ? 69.42   155.17  
27  1 SER A 252 ? ? -171.67 132.98  
28  1 ASP A 253 ? ? -150.97 -121.65 
29  1 TRP A 257 ? ? -172.91 122.94  
30  1 LEU A 260 ? ? -86.22  -70.27  
31  1 THR A 265 ? ? 76.40   -41.85  
32  1 TRP A 289 ? ? -56.80  -75.71  
33  1 ASN A 290 ? ? -114.55 61.74   
34  1 ALA A 298 ? ? -160.74 -64.21  
35  1 GLU A 333 ? ? 16.89   -66.18  
36  1 ASP A 336 ? ? -66.42  80.02   
37  1 LYS A 351 ? ? -91.84  51.81   
38  1 PHE A 352 ? ? 179.21  137.29  
39  1 ASN A 358 ? ? -73.74  -149.45 
40  1 VAL A 359 ? ? 67.22   85.86   
41  1 GLN A 367 ? ? 70.75   87.74   
42  1 ARG A 371 ? ? 57.69   108.25  
43  1 THR A 372 ? ? -64.34  -76.78  
44  1 SER A 373 ? ? -106.96 50.25   
45  1 GLN A 418 ? ? 71.70   -169.35 
46  1 LEU A 422 ? ? 89.00   130.11  
47  1 SER A 425 ? ? -172.85 136.94  
48  1 ILE A 436 ? ? 68.21   139.88  
49  1 LYS A 451 ? ? 62.63   -58.30  
50  1 ASP A 458 ? ? -68.16  58.52   
51  1 ALA A 460 ? ? -27.65  -54.71  
52  1 ASN A 464 ? ? 92.57   23.26   
53  1 SER A 466 ? ? -167.41 105.57  
54  1 SER A 472 ? ? -159.03 -61.47  
55  1 PRO A 473 ? ? -93.79  -96.24  
56  1 THR A 505 ? ? -131.05 -58.39  
57  1 VAL A 511 ? ? -37.58  101.46  
58  1 ILE A 527 ? ? -107.97 -68.05  
59  1 ASN A 530 ? ? -66.12  77.22   
60  1 ILE A 537 ? ? -110.87 72.92   
61  1 ARG A 543 ? ? -29.83  -36.97  
62  1 PRO A 550 ? ? -68.19  -166.52 
63  1 HIS A 553 ? ? -102.96 54.23   
64  1 SER A 559 ? ? 72.19   142.80  
65  1 THR A 561 ? ? 106.62  147.31  
66  1 GLU A 595 ? ? 68.15   87.64   
67  1 ASN A 612 ? ? 60.97   -71.20  
68  1 THR A 614 ? ? -100.65 61.72   
69  1 LEU A 617 ? ? -115.49 74.18   
70  1 SER A 623 ? ? -137.68 -53.56  
71  1 THR A 624 ? ? 81.31   10.24   
72  1 ALA A 630 ? ? -102.14 -79.05  
73  1 LEU A 631 ? ? 51.40   4.19    
74  1 SER A 632 ? ? 50.94   -173.33 
75  1 TRP A 640 ? ? 67.96   -69.88  
76  1 SER A 642 ? ? -161.23 90.98   
77  1 THR A 643 ? ? -42.00  172.89  
78  1 TYR A 645 ? ? -150.53 -14.96  
79  1 SER A 646 ? ? 103.15  103.04  
80  1 THR A 647 ? ? -105.67 55.67   
81  1 ASP A 655 ? ? 71.81   79.71   
82  1 LYS A 693 ? ? -104.50 48.92   
83  1 SER B 104 ? ? -83.91  -134.59 
84  1 PHE B 105 ? ? 60.98   -79.03  
85  1 LYS B 109 ? ? 94.75   162.28  
86  1 THR B 116 ? ? -155.68 -85.80  
87  1 PRO B 117 ? ? 28.72   56.22   
88  1 PHE B 118 ? ? 62.82   -22.46  
89  1 THR B 119 ? ? 89.62   169.31  
90  1 THR B 122 ? ? 101.59  -74.39  
91  1 CYS B 158 ? ? -129.37 -94.70  
92  1 TYR B 159 ? ? 48.86   -94.37  
93  1 PHE B 175 ? ? -93.00  -76.88  
94  1 TRP B 215 ? ? -93.07  54.55   
95  1 LYS B 216 ? ? 66.17   -113.67 
96  1 VAL B 236 ? ? -35.08  -82.15  
97  1 LYS B 239 ? ? -53.22  -78.68  
98  1 LEU B 262 ? ? -77.72  -107.06 
99  1 GLU B 280 ? ? -132.97 -103.19 
100 1 LEU B 286 ? ? 57.10   107.85  
101 1 ILE B 287 ? ? -94.04  -121.68 
102 1 ASP B 403 ? ? 66.76   -89.30  
103 1 PHE B 428 ? ? -103.93 -61.36  
104 1 LYS B 429 ? ? 81.35   45.45   
105 1 LYS B 430 ? ? -77.14  -91.92  
106 1 ALA B 431 ? ? -167.82 70.07   
107 1 LEU B 432 ? ? 38.85   61.38   
108 1 GLN B 464 ? ? 83.64   15.24   
109 1 ASP C 61  ? ? 99.50   146.97  
110 1 SER C 63  ? ? -138.59 -72.91  
111 1 LEU C 104 ? ? -78.27  -79.56  
112 1 ASP C 107 ? ? 65.05   98.44   
113 1 SER C 113 ? ? 77.96   131.58  
114 1 ILE C 149 ? ? -32.58  -27.48  
115 1 TYR C 156 ? ? -7.85   -64.44  
116 1 ALA C 212 ? ? -81.61  41.11   
117 1 SER C 213 ? ? -159.43 -75.48  
118 1 SER C 235 ? ? -112.59 -119.79 
119 1 LEU C 243 ? ? -27.71  -63.20  
120 1 PHE D 23  ? ? -90.69  41.19   
121 1 PHE D 38  ? ? -122.78 -59.41  
122 1 LEU D 98  ? ? -52.92  -70.98  
123 1 ALA G 13  ? ? -39.79  66.53   
124 1 ALA G 17  ? ? 53.98   -131.09 
125 1 ALA G 18  ? ? 61.45   -121.65 
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1  1 THR A 57  ? ? HIS A 58  ? ? -149.06 
2  1 CYS A 62  ? ? GLN A 63  ? ? 142.71  
3  1 VAL A 256 ? ? TRP A 257 ? ? -140.80 
4  1 PHE A 335 ? ? ASP A 336 ? ? -136.69 
5  1 ARG A 622 ? ? SER A 623 ? ? -148.89 
6  1 PHE B 86  ? ? VAL B 87  ? ? -147.97 
7  1 ARG B 108 ? ? LYS B 109 ? ? 121.04  
8  1 LYS B 109 ? ? ASP B 110 ? ? 118.68  
9  1 ASP B 110 ? ? GLY B 111 ? ? 147.56  
10 1 GLY B 111 ? ? GLN B 112 ? ? -62.79  
11 1 GLN B 112 ? ? LEU B 113 ? ? -36.12  
12 1 LEU B 113 ? ? ILE B 114 ? ? 43.80   
13 1 TYR B 115 ? ? THR B 116 ? ? 143.38  
14 1 THR B 116 ? ? PRO B 117 ? ? -146.33 
15 1 PRO B 117 ? ? PHE B 118 ? ? 87.92   
16 1 PHE B 118 ? ? THR B 119 ? ? 143.37  
17 1 TYR B 156 ? ? ARG B 157 ? ? -136.83 
18 1 ARG B 157 ? ? CYS B 158 ? ? -143.55 
19 1 PRO B 242 ? ? GLU B 243 ? ? -148.57 
20 1 PHE B 283 ? ? PRO B 284 ? ? 148.39  
21 1 ALA G 5   ? ? ALA G 6   ? ? -124.45 
22 1 ALA G 13  ? ? ALA G 14  ? ? -103.75 
23 1 ALA G 14  ? ? ALA G 15  ? ? 128.27  
24 1 ALA G 15  ? ? ALA G 16  ? ? -143.44 
25 1 ALA G 16  ? ? ALA G 17  ? ? 96.58   
26 1 ALA G 17  ? ? ALA G 18  ? ? 94.37   
27 1 ALA G 24  ? ? ALA G 25  ? ? 140.52  
28 1 ALA G 27  ? ? ALA G 28  ? ? 140.40  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 B ILE 114 ? CG1 ? B ILE 114 CG1 
2  1 Y 1 B ILE 114 ? CG2 ? B ILE 114 CG2 
3  1 Y 1 B ILE 114 ? CD1 ? B ILE 114 CD1 
4  1 Y 1 B GLU 120 ? CG  ? B GLU 120 CG  
5  1 Y 1 B GLU 120 ? CD  ? B GLU 120 CD  
6  1 Y 1 B GLU 120 ? OE1 ? B GLU 120 OE1 
7  1 Y 1 B GLU 120 ? OE2 ? B GLU 120 OE2 
8  1 Y 1 B ASP 121 ? CG  ? B ASP 121 CG  
9  1 Y 1 B ASP 121 ? OD1 ? B ASP 121 OD1 
10 1 Y 1 B ASP 121 ? OD2 ? B ASP 121 OD2 
11 1 Y 1 B GLU 123 ? CG  ? B GLU 123 CG  
12 1 Y 1 B GLU 123 ? CD  ? B GLU 123 CD  
13 1 Y 1 B GLU 123 ? OE1 ? B GLU 123 OE1 
14 1 Y 1 B GLU 123 ? OE2 ? B GLU 123 OE2 
15 1 Y 1 B ARG 128 ? CG  ? B ARG 128 CG  
16 1 Y 1 B ARG 128 ? CD  ? B ARG 128 CD  
17 1 Y 1 B ARG 128 ? NE  ? B ARG 128 NE  
18 1 Y 1 B ARG 128 ? CZ  ? B ARG 128 CZ  
19 1 Y 1 B ARG 128 ? NH1 ? B ARG 128 NH1 
20 1 Y 1 B ARG 128 ? NH2 ? B ARG 128 NH2 
21 1 Y 1 B GLU 243 ? CG  ? B GLU 243 CG  
22 1 Y 1 B GLU 243 ? CD  ? B GLU 243 CD  
23 1 Y 1 B GLU 243 ? OE1 ? B GLU 243 OE1 
24 1 Y 1 B GLU 243 ? OE2 ? B GLU 243 OE2 
25 1 Y 1 B TYR 288 ? CG  ? B TYR 288 CG  
26 1 Y 1 B TYR 288 ? CD1 ? B TYR 288 CD1 
27 1 Y 1 B TYR 288 ? CD2 ? B TYR 288 CD2 
28 1 Y 1 B TYR 288 ? CE1 ? B TYR 288 CE1 
29 1 Y 1 B TYR 288 ? CE2 ? B TYR 288 CE2 
30 1 Y 1 B TYR 288 ? CZ  ? B TYR 288 CZ  
31 1 Y 1 B TYR 288 ? OH  ? B TYR 288 OH  
32 1 Y 1 C GLU 106 ? CG  ? C GLU 106 CG  
33 1 Y 1 C GLU 106 ? CD  ? C GLU 106 CD  
34 1 Y 1 C GLU 106 ? OE1 ? C GLU 106 OE1 
35 1 Y 1 C GLU 106 ? OE2 ? C GLU 106 OE2 
36 1 Y 1 D ASN 2   ? CG  ? D ASN 2   CG  
37 1 Y 1 D ASN 2   ? OD1 ? D ASN 2   OD1 
38 1 Y 1 D ASN 2   ? ND2 ? D ASN 2   ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1   ? A MET 1   
2   1 Y 1 A ALA 2   ? A ALA 2   
3   1 Y 1 A THR 3   ? A THR 3   
4   1 Y 1 A ALA 4   ? A ALA 4   
5   1 Y 1 A GLY 5   ? A GLY 5   
6   1 Y 1 A GLY 6   ? A GLY 6   
7   1 Y 1 A GLY 7   ? A GLY 7   
8   1 Y 1 A SER 8   ? A SER 8   
9   1 Y 1 A GLY 9   ? A GLY 9   
10  1 Y 1 A ALA 10  ? A ALA 10  
11  1 Y 1 A ASP 11  ? A ASP 11  
12  1 Y 1 A PRO 12  ? A PRO 12  
13  1 Y 1 A GLY 13  ? A GLY 13  
14  1 Y 1 A SER 14  ? A SER 14  
15  1 Y 1 A ARG 15  ? A ARG 15  
16  1 Y 1 A GLY 16  ? A GLY 16  
17  1 Y 1 A LEU 17  ? A LEU 17  
18  1 Y 1 A LEU 18  ? A LEU 18  
19  1 Y 1 A ARG 19  ? A ARG 19  
20  1 Y 1 A LEU 20  ? A LEU 20  
21  1 Y 1 A LEU 21  ? A LEU 21  
22  1 Y 1 A SER 22  ? A SER 22  
23  1 Y 1 A PHE 23  ? A PHE 23  
24  1 Y 1 A CYS 24  ? A CYS 24  
25  1 Y 1 A VAL 25  ? A VAL 25  
26  1 Y 1 A LEU 26  ? A LEU 26  
27  1 Y 1 A LEU 27  ? A LEU 27  
28  1 Y 1 A ALA 28  ? A ALA 28  
29  1 Y 1 A GLY 29  ? A GLY 29  
30  1 Y 1 A LEU 30  ? A LEU 30  
31  1 Y 1 A CYS 31  ? A CYS 31  
32  1 Y 1 A ARG 32  ? A ARG 32  
33  1 Y 1 A GLY 33  ? A GLY 33  
34  1 Y 1 A ILE 699 ? A ILE 699 
35  1 Y 1 A ALA 700 ? A ALA 700 
36  1 Y 1 A PRO 701 ? A PRO 701 
37  1 Y 1 A ARG 702 ? A ARG 702 
38  1 Y 1 A GLU 703 ? A GLU 703 
39  1 Y 1 A PRO 704 ? A PRO 704 
40  1 Y 1 A GLY 705 ? A GLY 705 
41  1 Y 1 A ALA 706 ? A ALA 706 
42  1 Y 1 A VAL 707 ? A VAL 707 
43  1 Y 1 A SER 708 ? A SER 708 
44  1 Y 1 A TYR 709 ? A TYR 709 
45  1 Y 1 B MET 1   ? B MET 1   
46  1 Y 1 B THR 2   ? B THR 2   
47  1 Y 1 B GLU 3   ? B GLU 3   
48  1 Y 1 B LEU 4   ? B LEU 4   
49  1 Y 1 B PRO 5   ? B PRO 5   
50  1 Y 1 B ALA 6   ? B ALA 6   
51  1 Y 1 B PRO 7   ? B PRO 7   
52  1 Y 1 B LEU 8   ? B LEU 8   
53  1 Y 1 B SER 9   ? B SER 9   
54  1 Y 1 B TYR 10  ? B TYR 10  
55  1 Y 1 B PHE 11  ? B PHE 11  
56  1 Y 1 B GLN 12  ? B GLN 12  
57  1 Y 1 B ASN 13  ? B ASN 13  
58  1 Y 1 B ALA 14  ? B ALA 14  
59  1 Y 1 B GLN 15  ? B GLN 15  
60  1 Y 1 B MET 16  ? B MET 16  
61  1 Y 1 B SER 17  ? B SER 17  
62  1 Y 1 B GLU 18  ? B GLU 18  
63  1 Y 1 B ASP 19  ? B ASP 19  
64  1 Y 1 B ASN 20  ? B ASN 20  
65  1 Y 1 B HIS 21  ? B HIS 21  
66  1 Y 1 B LEU 22  ? B LEU 22  
67  1 Y 1 B SER 23  ? B SER 23  
68  1 Y 1 B ASN 24  ? B ASN 24  
69  1 Y 1 B THR 25  ? B THR 25  
70  1 Y 1 B VAL 26  ? B VAL 26  
71  1 Y 1 B ARG 27  ? B ARG 27  
72  1 Y 1 B SER 28  ? B SER 28  
73  1 Y 1 B GLN 29  ? B GLN 29  
74  1 Y 1 B ASN 30  ? B ASN 30  
75  1 Y 1 B ASP 31  ? B ASP 31  
76  1 Y 1 B ASN 32  ? B ASN 32  
77  1 Y 1 B ARG 33  ? B ARG 33  
78  1 Y 1 B GLU 34  ? B GLU 34  
79  1 Y 1 B ARG 35  ? B ARG 35  
80  1 Y 1 B GLN 36  ? B GLN 36  
81  1 Y 1 B GLU 37  ? B GLU 37  
82  1 Y 1 B HIS 38  ? B HIS 38  
83  1 Y 1 B ASN 39  ? B ASN 39  
84  1 Y 1 B ASP 40  ? B ASP 40  
85  1 Y 1 B ARG 41  ? B ARG 41  
86  1 Y 1 B ARG 42  ? B ARG 42  
87  1 Y 1 B SER 43  ? B SER 43  
88  1 Y 1 B LEU 44  ? B LEU 44  
89  1 Y 1 B GLY 45  ? B GLY 45  
90  1 Y 1 B HIS 46  ? B HIS 46  
91  1 Y 1 B PRO 47  ? B PRO 47  
92  1 Y 1 B GLU 48  ? B GLU 48  
93  1 Y 1 B PRO 49  ? B PRO 49  
94  1 Y 1 B LEU 50  ? B LEU 50  
95  1 Y 1 B SER 51  ? B SER 51  
96  1 Y 1 B ASN 52  ? B ASN 52  
97  1 Y 1 B GLY 53  ? B GLY 53  
98  1 Y 1 B ARG 54  ? B ARG 54  
99  1 Y 1 B PRO 55  ? B PRO 55  
100 1 Y 1 B GLN 56  ? B GLN 56  
101 1 Y 1 B GLY 57  ? B GLY 57  
102 1 Y 1 B ASN 58  ? B ASN 58  
103 1 Y 1 B SER 59  ? B SER 59  
104 1 Y 1 B ARG 60  ? B ARG 60  
105 1 Y 1 B GLN 61  ? B GLN 61  
106 1 Y 1 B VAL 62  ? B VAL 62  
107 1 Y 1 B VAL 63  ? B VAL 63  
108 1 Y 1 B GLU 64  ? B GLU 64  
109 1 Y 1 B GLN 65  ? B GLN 65  
110 1 Y 1 B ASP 66  ? B ASP 66  
111 1 Y 1 B GLU 67  ? B GLU 67  
112 1 Y 1 B GLU 68  ? B GLU 68  
113 1 Y 1 B GLU 69  ? B GLU 69  
114 1 Y 1 B ASP 70  ? B ASP 70  
115 1 Y 1 B GLU 71  ? B GLU 71  
116 1 Y 1 B GLU 72  ? B GLU 72  
117 1 Y 1 B LEU 73  ? B LEU 73  
118 1 Y 1 B THR 74  ? B THR 74  
119 1 Y 1 B LEU 75  ? B LEU 75  
120 1 Y 1 B LYS 76  ? B LYS 76  
121 1 Y 1 B TYR 77  ? B TYR 77  
122 1 Y 1 B PRO 264 ? B PRO 264 
123 1 Y 1 B LYS 265 ? B LYS 265 
124 1 Y 1 B GLY 266 ? B GLY 266 
125 1 Y 1 B PRO 267 ? B PRO 267 
126 1 Y 1 B LEU 268 ? B LEU 268 
127 1 Y 1 B ARG 269 ? B ARG 269 
128 1 Y 1 B MET 270 ? B MET 270 
129 1 Y 1 B LEU 271 ? B LEU 271 
130 1 Y 1 B VAL 272 ? B VAL 272 
131 1 Y 1 B GLU 273 ? B GLU 273 
132 1 Y 1 B THR 274 ? B THR 274 
133 1 Y 1 B ALA 275 ? B ALA 275 
134 1 Y 1 B GLN 276 ? B GLN 276 
135 1 Y 1 B GLU 277 ? B GLU 277 
136 1 Y 1 B ARG 278 ? B ARG 278 
137 1 Y 1 B SER 289 ? B SER 289 
138 1 Y 1 B SER 290 ? B SER 290 
139 1 Y 1 B THR 291 ? B THR 291 
140 1 Y 1 B MET 292 ? B MET 292 
141 1 Y 1 B VAL 293 ? B VAL 293 
142 1 Y 1 B TRP 294 ? B TRP 294 
143 1 Y 1 B LEU 295 ? B LEU 295 
144 1 Y 1 B VAL 296 ? B VAL 296 
145 1 Y 1 B ASN 297 ? B ASN 297 
146 1 Y 1 B MET 298 ? B MET 298 
147 1 Y 1 B ALA 299 ? B ALA 299 
148 1 Y 1 B GLU 300 ? B GLU 300 
149 1 Y 1 B GLY 301 ? B GLY 301 
150 1 Y 1 B ASP 302 ? B ASP 302 
151 1 Y 1 B PRO 303 ? B PRO 303 
152 1 Y 1 B GLU 304 ? B GLU 304 
153 1 Y 1 B ALA 305 ? B ALA 305 
154 1 Y 1 B GLN 306 ? B GLN 306 
155 1 Y 1 B ARG 307 ? B ARG 307 
156 1 Y 1 B ARG 308 ? B ARG 308 
157 1 Y 1 B VAL 309 ? B VAL 309 
158 1 Y 1 B SER 310 ? B SER 310 
159 1 Y 1 B LYS 311 ? B LYS 311 
160 1 Y 1 B ASN 312 ? B ASN 312 
161 1 Y 1 B SER 313 ? B SER 313 
162 1 Y 1 B LYS 314 ? B LYS 314 
163 1 Y 1 B TYR 315 ? B TYR 315 
164 1 Y 1 B ASN 316 ? B ASN 316 
165 1 Y 1 B ALA 317 ? B ALA 317 
166 1 Y 1 B GLU 318 ? B GLU 318 
167 1 Y 1 B SER 319 ? B SER 319 
168 1 Y 1 B THR 320 ? B THR 320 
169 1 Y 1 B GLU 321 ? B GLU 321 
170 1 Y 1 B ARG 322 ? B ARG 322 
171 1 Y 1 B GLU 323 ? B GLU 323 
172 1 Y 1 B SER 324 ? B SER 324 
173 1 Y 1 B GLN 325 ? B GLN 325 
174 1 Y 1 B ASP 326 ? B ASP 326 
175 1 Y 1 B THR 327 ? B THR 327 
176 1 Y 1 B VAL 328 ? B VAL 328 
177 1 Y 1 B ALA 329 ? B ALA 329 
178 1 Y 1 B GLU 330 ? B GLU 330 
179 1 Y 1 B ASN 331 ? B ASN 331 
180 1 Y 1 B ASP 332 ? B ASP 332 
181 1 Y 1 B ASP 333 ? B ASP 333 
182 1 Y 1 B GLY 334 ? B GLY 334 
183 1 Y 1 B GLY 335 ? B GLY 335 
184 1 Y 1 B PHE 336 ? B PHE 336 
185 1 Y 1 B SER 337 ? B SER 337 
186 1 Y 1 B GLU 338 ? B GLU 338 
187 1 Y 1 B GLU 339 ? B GLU 339 
188 1 Y 1 B TRP 340 ? B TRP 340 
189 1 Y 1 B GLU 341 ? B GLU 341 
190 1 Y 1 B ALA 342 ? B ALA 342 
191 1 Y 1 B GLN 343 ? B GLN 343 
192 1 Y 1 B ARG 344 ? B ARG 344 
193 1 Y 1 B ASP 345 ? B ASP 345 
194 1 Y 1 B SER 346 ? B SER 346 
195 1 Y 1 B HIS 347 ? B HIS 347 
196 1 Y 1 B LEU 348 ? B LEU 348 
197 1 Y 1 B GLY 349 ? B GLY 349 
198 1 Y 1 B PRO 350 ? B PRO 350 
199 1 Y 1 B HIS 351 ? B HIS 351 
200 1 Y 1 B ARG 352 ? B ARG 352 
201 1 Y 1 B SER 353 ? B SER 353 
202 1 Y 1 B THR 354 ? B THR 354 
203 1 Y 1 B PRO 355 ? B PRO 355 
204 1 Y 1 B GLU 356 ? B GLU 356 
205 1 Y 1 B SER 357 ? B SER 357 
206 1 Y 1 B ARG 358 ? B ARG 358 
207 1 Y 1 B ALA 359 ? B ALA 359 
208 1 Y 1 B ALA 360 ? B ALA 360 
209 1 Y 1 B VAL 361 ? B VAL 361 
210 1 Y 1 B GLN 362 ? B GLN 362 
211 1 Y 1 B GLU 363 ? B GLU 363 
212 1 Y 1 B LEU 364 ? B LEU 364 
213 1 Y 1 B SER 365 ? B SER 365 
214 1 Y 1 B SER 366 ? B SER 366 
215 1 Y 1 B SER 367 ? B SER 367 
216 1 Y 1 B ILE 368 ? B ILE 368 
217