data_5FPP
# 
_entry.id   5FPP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5FPP         
PDBE  EBI-65683    
WWPDB D_1290065683 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 5FOQ unspecified 'ACETYLCHOLINESTERASE IN COMPLEX WITH C7653'                              
PDB 5FPQ unspecified 'STRUCTURE OF HOMO SAPIENS ACETYLCHOLINESTERASE PHOSPHONYLATED BY SARIN.' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        5FPP 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2015-12-02 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Allgardsson, A.' 1 
'Berg, L.'        2 
'Akfur, C.'       3 
'Hornberg, A.'    4 
'Worek, F.'       5 
'Linusson, A.'    6 
'Ekstrom, F.'     7 
# 
_citation.id                        primary 
_citation.title                     
;Structure of a Prereaction Complex between the Nerve Agent Sarin, its Biological Target Acetylcholinesterase, and the Antidote Hi-6.
;
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            113 
_citation.page_first                5514 
_citation.page_last                 ? 
_citation.year                      2016 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   27140636 
_citation.pdbx_database_id_DOI      10.1073/PNAS.1523362113 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Allgardsson, A.' 1 ? 
primary 'Berg, L.'        2 ? 
primary 'Akfur, C.'       3 ? 
primary 'Hornberg, A.'    4 ? 
primary 'Worek, F.'       5 ? 
primary 'Linusson, A.'    6 ? 
primary 'Ekstrom, F.J.'   7 ? 
# 
_cell.entry_id           5FPP 
_cell.length_a           78.825 
_cell.length_b           111.552 
_cell.length_c           227.556 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5FPP 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE                                                                           60354.070 2   
3.1.1.7 ? 'CATALYTIC DOMAIN, UNP RESIDUES 32-574' 'SARIN PHOSPHONYLATION PRODUCT COVALENTLY ATTACHED TO SER203' 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                       221.208   1   ? ? 
?                                       ?                                                             
3 non-polymer syn 'CARBONATE ION'                                                                                60.009    2   ? ? 
?                                       ?                                                             
4 non-polymer syn 'HEXAETHYLENE GLYCOL'                                                                          282.331   1   ? ? 
?                                       ?                                                             
5 non-polymer syn '2-(2-ETHOXYETHOXY)ETHANOL'                                                                    134.174   2   ? ? 
?                                       ?                                                             
6 non-polymer syn '4-(AMINOCARBONYL)-1-[({2-[(E)-(HYDROXYIMINO)METHYL]PYRIDINIUM-1-YL}METHOXY)METHYL]PYRIDINIUM' 288.302   2   ? ? 
?                                       ?                                                             
7 water       nat water                                                                                          18.015    457 ? ? 
?                                       ?                                                             
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGE(SGB)AGAASVGMHILSLPSRSLFHRAVLQSGTPNGPW
ATVSAGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALI
NTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRD
AMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRL
MKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SGB n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
1 544 ALA n 
1 545 THR n 
1 546 GLU n 
1 547 ALA n 
1 548 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'HOUSE MOUSE' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'MUS MUSCULUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               HUMAN 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293F 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5FPP A 1 ? 543 ? P21836 32 ? 574 ? 1 543 
2 1 5FPP B 1 ? 543 ? P21836 32 ? 574 ? 1 543 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5FPP ALA A 544 ? UNP P21836 ? ? 'expression tag' 544 1  
1 5FPP THR A 545 ? UNP P21836 ? ? 'expression tag' 545 2  
1 5FPP GLU A 546 ? UNP P21836 ? ? 'expression tag' 546 3  
1 5FPP ALA A 547 ? UNP P21836 ? ? 'expression tag' 547 4  
1 5FPP PRO A 548 ? UNP P21836 ? ? 'expression tag' 548 5  
2 5FPP ALA B 544 ? UNP P21836 ? ? 'expression tag' 544 6  
2 5FPP THR B 545 ? UNP P21836 ? ? 'expression tag' 545 7  
2 5FPP GLU B 546 ? UNP P21836 ? ? 'expression tag' 546 8  
2 5FPP ALA B 547 ? UNP P21836 ? ? 'expression tag' 547 9  
2 5FPP PRO B 548 ? UNP P21836 ? ? 'expression tag' 548 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
AE3 non-polymer                  . '2-(2-ETHOXYETHOXY)ETHANOL'                                                                    
? 'C6 H14 O3'       134.174 
ALA 'L-peptide linking'          y ALANINE                                                                                        
? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking'          y ARGININE                                                                                       
? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                                                     
? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                                                
? 'C4 H7 N O4'      133.103 
CO3 non-polymer                  . 'CARBONATE ION'                                                                                
? 'C O3 -2'         60.009  
CYS 'L-peptide linking'          y CYSTEINE                                                                                       
? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                                                                      
? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                                                
? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'            y GLYCINE                                                                                        
? 'C2 H5 N O2'      75.067  
HI6 non-polymer                  . '4-(AMINOCARBONYL)-1-[({2-[(E)-(HYDROXYIMINO)METHYL]PYRIDINIUM-1-YL}METHOXY)METHYL]PYRIDINIUM' 
'1-(2-HYDROXY-IMINOMETHYLPYRIDINIUM)-1-(4-CARBOXYAMINO)-PYRIDINIUM DIMETHYLETHER' 'C14 H16 N4 O3 2' 288.302 
HIS 'L-peptide linking'          y HISTIDINE                                                                                      
? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer                  . WATER                                                                                          
? 'H2 O'            18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                                                     
? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking'          y LEUCINE                                                                                        
? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking'          y LYSINE                                                                                         
? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking'          y METHIONINE                                                                                     
? 'C5 H11 N O2 S'   149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                                                       
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'     221.208 
P6G non-polymer                  . 'HEXAETHYLENE GLYCOL'                                                                          
'POLYETHYLENE GLYCOL PEG400' 'C12 H26 O7'      282.331 
PHE 'L-peptide linking'          y PHENYLALANINE                                                                                  
? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking'          y PROLINE                                                                                        
? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking'          y SERINE                                                                                         
? 'C3 H7 N O3'      105.093 
SGB 'L-peptide linking'          n 'O-[(S)-METHYL(1-METHYLETHOXY)PHOSPHORYL]-L-SERINE'                                            
? 'C7 H16 N O5 P'   225.179 
THR 'L-peptide linking'          y THREONINE                                                                                      
? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                                                     
? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking'          y TYROSINE                                                                                       
? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking'          y VALINE                                                                                         
? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          5FPP 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.14 
_exptl_crystal.density_percent_sol   70.32 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 7' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.039 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I911-3' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I911-3 
_diffrn_source.pdbx_wavelength             1.039 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5FPP 
_reflns.observed_criterion_sigma_I   2.7 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             29.00 
_reflns.d_resolution_high            2.40 
_reflns.number_obs                   77695 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.1 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.10 
_reflns.B_iso_Wilson_estimate        48.86 
_reflns.pdbx_redundancy              3.2 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              ? 
_reflns_shell.percent_possible_all   97.2 
_reflns_shell.Rmerge_I_obs           0.68 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.70 
_reflns_shell.pdbx_redundancy        2.0 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5FPP 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     77689 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.950 
_refine.ls_d_res_high                            2.400 
_refine.ls_percent_reflns_obs                    98.04 
_refine.ls_R_factor_obs                          0.1763 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1756 
_refine.ls_R_factor_R_free                       0.2133 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1541 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;SOME REGIONS OF THE CATALYTIC SITE IS DISORDERED. THE REFINEMENT INCLUDED AN INTEGRATED METHODOLOGY CYCLING BETWEEN A CONVENTIONAL CRYSTALLOGRAPHIC REFINEMENT AND A QUANTUM CHEMICAL CLUSTER APPROACH USING IMPLICIT DISPERSION- CORRECTED DENSITY FUNCTIONAL THEORY (DFT) CALCULATIONS
;
_refine.pdbx_starting_model                      'PDB ENTRY 1J06' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.32 
_refine.pdbx_overall_phase_error                 23.00 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8369 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         98 
_refine_hist.number_atoms_solvent             457 
_refine_hist.number_atoms_total               8924 
_refine_hist.d_res_high                       2.400 
_refine_hist.d_res_low                        28.950 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.008  ? ? 8867  'X-RAY DIFFRACTION' ? 
f_angle_d          1.103  ? ? 12100 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 15.961 ? ? 3222  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.076  ? ? 1286  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 1597  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.4000 2.4774  6793 0.2732 97.00 0.3321 . . 123 . . 
'X-RAY DIFFRACTION' . 2.4774 2.5659  6812 0.2392 98.00 0.2723 . . 144 . . 
'X-RAY DIFFRACTION' . 2.5659 2.6686  6878 0.2243 99.00 0.2777 . . 151 . . 
'X-RAY DIFFRACTION' . 2.6686 2.7899  6923 0.2199 99.00 0.2718 . . 141 . . 
'X-RAY DIFFRACTION' . 2.7899 2.9369  6900 0.2182 99.00 0.2879 . . 140 . . 
'X-RAY DIFFRACTION' . 2.9369 3.1207  6929 0.2129 99.00 0.2510 . . 154 . . 
'X-RAY DIFFRACTION' . 3.1207 3.3613  6943 0.1958 99.00 0.2425 . . 132 . . 
'X-RAY DIFFRACTION' . 3.3613 3.6990  6969 0.1741 99.00 0.2145 . . 139 . . 
'X-RAY DIFFRACTION' . 3.6990 4.2328  6926 0.1477 98.00 0.1829 . . 134 . . 
'X-RAY DIFFRACTION' . 4.2328 5.3275  6996 0.1311 97.00 0.1653 . . 141 . . 
'X-RAY DIFFRACTION' . 5.3275 28.9520 7079 0.1621 96.00 0.1814 . . 142 . . 
# 
_struct.entry_id                  5FPP 
_struct.title                     'Structure of a pre-reaction ternary complex between sarin- acetylcholinesterase and HI-6' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        5FPP 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, SARIN, HI-6, QM, DENSITY FUNCTIONAL THEORY CALCULATIONS, MICHAELIS COMPLEX.' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
I N N 5 ? 
J N N 3 ? 
K N N 7 ? 
L N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 5   ? GLN A 7   ? ASP A 5   GLN A 7   5 ? 3  
HELX_P HELX_P2  2  VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P6  6  VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  SGB A 203 ? SER A 215 ? SGB A 203 SER A 215 1 ? 13 
HELX_P HELX_P10 10 SER A 215 ? SER A 220 ? SER A 215 SER A 220 1 ? 6  
HELX_P HELX_P11 11 SER A 240 ? VAL A 255 ? SER A 240 VAL A 255 1 ? 16 
HELX_P HELX_P12 12 ASN A 265 ? THR A 275 ? ASN A 265 THR A 275 1 ? 11 
HELX_P HELX_P13 13 PRO A 277 ? TRP A 286 ? PRO A 277 TRP A 286 1 ? 10 
HELX_P HELX_P14 14 HIS A 287 ? LEU A 289 ? HIS A 287 LEU A 289 5 ? 3  
HELX_P HELX_P15 15 THR A 311 ? GLY A 319 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 16 GLY A 335 ? VAL A 343 ? GLY A 335 VAL A 343 1 ? 9  
HELX_P HELX_P17 17 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 21 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 456 ? ASP A 460 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 24 ASP A 460 ? ASN A 464 ? ASP A 460 ASN A 464 5 ? 5  
HELX_P HELX_P25 25 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P26 26 ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P27 27 ARG A 534 ? ALA A 542 ? ARG A 534 ALA A 542 1 ? 9  
HELX_P HELX_P28 28 ASP B 5   ? GLN B 7   ? ASP B 5   GLN B 7   5 ? 3  
HELX_P HELX_P29 29 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P30 30 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P31 31 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P32 32 GLY B 135 ? GLY B 143 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P33 33 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P34 34 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P35 35 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P36 36 SGB B 203 ? SER B 215 ? SGB B 203 SER B 215 1 ? 13 
HELX_P HELX_P37 37 SER B 215 ? SER B 220 ? SER B 215 SER B 220 1 ? 6  
HELX_P HELX_P38 38 SER B 240 ? VAL B 255 ? SER B 240 VAL B 255 1 ? 16 
HELX_P HELX_P39 39 ASN B 265 ? ARG B 276 ? ASN B 265 ARG B 276 1 ? 12 
HELX_P HELX_P40 40 PRO B 277 ? TRP B 286 ? PRO B 277 TRP B 286 1 ? 10 
HELX_P HELX_P41 41 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P42 42 GLY B 335 ? VAL B 343 ? GLY B 335 VAL B 343 1 ? 9  
HELX_P HELX_P43 43 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 44 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P45 45 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 46 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 47 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 48 GLU B 450 ? PHE B 455 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 49 GLY B 456 ? ASP B 460 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P50 50 ASP B 460 ? ASN B 464 ? ASP B 460 ASN B 464 5 ? 5  
HELX_P HELX_P51 51 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P52 52 ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P53 53 ARG B 534 ? THR B 543 ? ARG B 534 THR B 543 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 69  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.020 ? ?               
disulf2 disulf ?    ? A CYS 257 SG  ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.060 ? ?               
disulf3 disulf ?    ? A CYS 409 SG  ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf4 disulf ?    ? B CYS 69  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf5 disulf ?    ? B CYS 257 SG  ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.057 ? ?               
disulf6 disulf ?    ? B CYS 409 SG  ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
covale1 covale one  ? A GLU 202 C   ? ? ? 1_555 A SGB 203 N  ? ? A GLU 202 A SGB 203 1_555 ? ? ? ? ? ? ? 1.337 ? ?               
covale2 covale both ? A SGB 203 C   ? ? ? 1_555 A ALA 204 N  ? ? A SGB 203 A ALA 204 1_555 ? ? ? ? ? ? ? 1.336 ? ?               
covale3 covale one  ? A ASN 350 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 A NAG 601 1_555 ? ? ? ? ? ? ? 1.466 ? N-Glycosylation 
covale4 covale one  ? B GLU 202 C   ? ? ? 1_555 B SGB 203 N  ? ? B GLU 202 B SGB 203 1_555 ? ? ? ? ? ? ? 1.336 ? ?               
covale5 covale both ? B SGB 203 C   ? ? ? 1_555 B ALA 204 N  ? ? B SGB 203 B ALA 204 1_555 ? ? ? ? ? ? ? 1.336 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 -3.56 
2 THR 545 A . ? THR 545 A GLU 546 A ? GLU 546 A 1 -1.21 
3 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 6.86  
4 SER 497 B . ? SER 497 B PRO 498 B ? PRO 498 B 1 2.14  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
BA ? 3  ? 
BB ? 11 ? 
BC ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
BA 1  2  ? anti-parallel 
BA 2  3  ? parallel      
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? parallel      
BB 5  6  ? parallel      
BB 6  7  ? parallel      
BB 7  8  ? parallel      
BB 8  9  ? parallel      
BB 9  10 ? parallel      
BB 10 11 ? anti-parallel 
BC 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
AA 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
AA 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
AB 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
AB 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
AB 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
AB 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
AB 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
AB 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
AB 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
AB 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
AB 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
AB 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
AB 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
AC 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
AC 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
BA 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
BA 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
BA 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
BB 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
BB 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
BB 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
BB 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
BB 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
BB 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
BB 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
BB 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
BB 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
BB 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
BB 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
BC 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
BC 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N VAL A 12  ? N VAL A 12  O GLY A 15  ? O GLY A 15  
AA 2  3  N ARG A 18  ? N ARG A 18  O LEU A 60  ? O LEU A 60  
AB 1  2  N ALA A 24  ? N ALA A 24  O GLY A 27  ? O GLY A 27  
AB 2  3  N ILE A 35  ? N ILE A 35  O LEU A 99  ? O LEU A 99  
AB 3  4  N TRP A 102 ? N TRP A 102 O LEU A 146 ? O LEU A 146 
AB 4  5  N VAL A 145 ? N VAL A 145 O PRO A 113 ? O PRO A 113 
AB 5  6  O THR A 112 ? O THR A 112 N ASP A 193 ? N ASP A 193 
AB 6  7  N LEU A 199 ? N LEU A 199 O ARG A 224 ? O ARG A 224 
AB 7  8  N ALA A 225 ? N ALA A 225 O GLN A 325 ? O GLN A 325 
AB 8  9  N VAL A 326 ? N VAL A 326 O ARG A 424 ? O ARG A 424 
AB 9  10 N ILE A 429 ? N ILE A 429 O VAL A 511 ? O VAL A 511 
AB 10 11 N SER A 512 ? N SER A 512 O GLU A 519 ? O GLU A 519 
AC 1  2  O VAL A 68  ? O VAL A 68  N SER A 93  ? N SER A 93  
BA 1  2  N VAL B 12  ? N VAL B 12  O GLY B 15  ? O GLY B 15  
BA 2  3  N ARG B 18  ? N ARG B 18  O LEU B 60  ? O LEU B 60  
BB 1  2  N ALA B 24  ? N ALA B 24  O GLY B 27  ? O GLY B 27  
BB 2  3  N ILE B 35  ? N ILE B 35  O LEU B 99  ? O LEU B 99  
BB 3  4  N TRP B 102 ? N TRP B 102 O LEU B 146 ? O LEU B 146 
BB 4  5  N VAL B 145 ? N VAL B 145 O PRO B 113 ? O PRO B 113 
BB 5  6  O THR B 112 ? O THR B 112 N ASP B 193 ? N ASP B 193 
BB 6  7  N LEU B 199 ? N LEU B 199 O ARG B 224 ? O ARG B 224 
BB 7  8  N ALA B 225 ? N ALA B 225 O GLN B 325 ? O GLN B 325 
BB 8  9  N VAL B 326 ? N VAL B 326 O ARG B 424 ? O ARG B 424 
BB 9  10 N ILE B 429 ? N ILE B 429 O VAL B 511 ? O VAL B 511 
BB 10 11 N SER B 512 ? N SER B 512 O GLU B 519 ? O GLU B 519 
BC 1  2  O VAL B 68  ? O VAL B 68  N SER B 93  ? N SER B 93  
# 
_database_PDB_matrix.entry_id          5FPP 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5FPP 
_atom_sites.fract_transf_matrix[1][1]   0.012686 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008964 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004395 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? 31.934  15.046  55.372  1.00 86.82  ? 1    GLU A N   1 
ATOM   2    C CA  . GLU A 1 1   ? 30.625  14.410  55.367  1.00 83.21  ? 1    GLU A CA  1 
ATOM   3    C C   . GLU A 1 1   ? 29.946  14.590  56.714  1.00 81.25  ? 1    GLU A C   1 
ATOM   4    O O   . GLU A 1 1   ? 30.564  14.390  57.760  1.00 83.13  ? 1    GLU A O   1 
ATOM   5    C CB  . GLU A 1 1   ? 30.752  12.921  55.032  1.00 81.04  ? 1    GLU A CB  1 
ATOM   6    C CG  . GLU A 1 1   ? 29.428  12.171  55.043  1.00 75.20  ? 1    GLU A CG  1 
ATOM   7    C CD  . GLU A 1 1   ? 29.544  10.760  54.509  1.00 68.21  ? 1    GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? 30.607  10.425  53.934  1.00 66.60  ? 1    GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? 28.568  9.991   54.662  1.00 64.38  ? 1    GLU A OE2 1 
ATOM   10   N N   . GLY A 1 2   ? 28.675  14.976  56.687  1.00 77.96  ? 2    GLY A N   1 
ATOM   11   C CA  . GLY A 1 2   ? 27.935  15.198  57.915  1.00 74.43  ? 2    GLY A CA  1 
ATOM   12   C C   . GLY A 1 2   ? 26.627  15.930  57.703  1.00 70.41  ? 2    GLY A C   1 
ATOM   13   O O   . GLY A 1 2   ? 25.565  15.445  58.104  1.00 61.53  ? 2    GLY A O   1 
ATOM   14   N N   . ARG A 1 3   ? 26.700  17.099  57.069  1.00 75.52  ? 3    ARG A N   1 
ATOM   15   C CA  . ARG A 1 3   ? 25.514  17.930  56.880  1.00 71.98  ? 3    ARG A CA  1 
ATOM   16   C C   . ARG A 1 3   ? 25.077  18.035  55.424  1.00 69.01  ? 3    ARG A C   1 
ATOM   17   O O   . ARG A 1 3   ? 24.118  18.732  55.118  1.00 74.53  ? 3    ARG A O   1 
ATOM   18   C CB  . ARG A 1 3   ? 25.720  19.326  57.464  1.00 70.62  ? 3    ARG A CB  1 
ATOM   19   C CG  . ARG A 1 3   ? 24.433  19.953  57.989  1.00 75.67  ? 3    ARG A CG  1 
ATOM   20   C CD  . ARG A 1 3   ? 24.032  19.378  59.347  1.00 75.49  ? 3    ARG A CD  1 
ATOM   21   N NE  . ARG A 1 3   ? 25.042  19.662  60.365  1.00 75.82  ? 3    ARG A NE  1 
ATOM   22   C CZ  . ARG A 1 3   ? 24.833  19.598  61.676  1.00 77.37  ? 3    ARG A CZ  1 
ATOM   23   N NH1 . ARG A 1 3   ? 23.642  19.254  62.153  1.00 70.84  ? 3    ARG A NH1 1 
ATOM   24   N NH2 . ARG A 1 3   ? 25.823  19.882  62.514  1.00 83.33  ? 3    ARG A NH2 1 
ATOM   25   N N   . GLU A 1 4   ? 25.770  17.339  54.530  1.00 62.13  ? 4    GLU A N   1 
ATOM   26   C CA  . GLU A 1 4   ? 25.367  17.321  53.134  1.00 61.90  ? 4    GLU A CA  1 
ATOM   27   C C   . GLU A 1 4   ? 24.180  16.399  52.906  1.00 57.65  ? 4    GLU A C   1 
ATOM   28   O O   . GLU A 1 4   ? 23.783  15.662  53.803  1.00 61.03  ? 4    GLU A O   1 
ATOM   29   C CB  . GLU A 1 4   ? 26.528  16.941  52.217  1.00 68.96  ? 4    GLU A CB  1 
ATOM   30   C CG  . GLU A 1 4   ? 27.635  16.139  52.863  1.00 80.44  ? 4    GLU A CG  1 
ATOM   31   C CD  . GLU A 1 4   ? 28.886  16.157  52.005  1.00 88.51  ? 4    GLU A CD  1 
ATOM   32   O OE1 . GLU A 1 4   ? 28.949  17.018  51.104  1.00 86.35  ? 4    GLU A OE1 1 
ATOM   33   O OE2 . GLU A 1 4   ? 29.796  15.324  52.223  1.00 93.79  ? 4    GLU A OE2 1 
ATOM   34   N N   . ASP A 1 5   ? 23.609  16.474  51.707  1.00 49.04  ? 5    ASP A N   1 
ATOM   35   C CA  . ASP A 1 5   ? 22.453  15.675  51.321  1.00 42.10  ? 5    ASP A CA  1 
ATOM   36   C C   . ASP A 1 5   ? 22.898  14.226  51.166  1.00 44.44  ? 5    ASP A C   1 
ATOM   37   O O   . ASP A 1 5   ? 23.719  13.911  50.312  1.00 43.98  ? 5    ASP A O   1 
ATOM   38   C CB  . ASP A 1 5   ? 21.877  16.216  50.003  1.00 38.34  ? 5    ASP A CB  1 
ATOM   39   C CG  . ASP A 1 5   ? 20.689  15.405  49.481  1.00 44.45  ? 5    ASP A CG  1 
ATOM   40   O OD1 . ASP A 1 5   ? 20.370  14.331  50.034  1.00 47.54  ? 5    ASP A OD1 1 
ATOM   41   O OD2 . ASP A 1 5   ? 20.065  15.849  48.491  1.00 45.22  ? 5    ASP A OD2 1 
ATOM   42   N N   . PRO A 1 6   ? 22.343  13.329  51.992  1.00 50.19  ? 6    PRO A N   1 
ATOM   43   C CA  . PRO A 1 6   ? 22.753  11.923  51.982  1.00 46.57  ? 6    PRO A CA  1 
ATOM   44   C C   . PRO A 1 6   ? 22.416  11.218  50.668  1.00 44.07  ? 6    PRO A C   1 
ATOM   45   O O   . PRO A 1 6   ? 22.934  10.140  50.391  1.00 42.53  ? 6    PRO A O   1 
ATOM   46   C CB  . PRO A 1 6   ? 21.945  11.328  53.141  1.00 52.38  ? 6    PRO A CB  1 
ATOM   47   C CG  . PRO A 1 6   ? 20.764  12.237  53.273  1.00 47.87  ? 6    PRO A CG  1 
ATOM   48   C CD  . PRO A 1 6   ? 21.317  13.591  53.016  1.00 48.73  ? 6    PRO A CD  1 
ATOM   49   N N   . GLN A 1 7   ? 21.577  11.836  49.852  1.00 43.99  ? 7    GLN A N   1 
ATOM   50   C CA  . GLN A 1 7   ? 21.162  11.231  48.595  1.00 45.07  ? 7    GLN A CA  1 
ATOM   51   C C   . GLN A 1 7   ? 22.143  11.532  47.443  1.00 43.12  ? 7    GLN A C   1 
ATOM   52   O O   . GLN A 1 7   ? 22.005  11.007  46.338  1.00 45.64  ? 7    GLN A O   1 
ATOM   53   C CB  . GLN A 1 7   ? 19.729  11.680  48.273  1.00 61.07  ? 7    GLN A CB  1 
ATOM   54   C CG  . GLN A 1 7   ? 19.117  11.102  46.992  1.00 70.47  ? 7    GLN A CG  1 
ATOM   55   C CD  . GLN A 1 7   ? 19.030  9.584   46.991  1.00 68.63  ? 7    GLN A CD  1 
ATOM   56   O OE1 . GLN A 1 7   ? 19.334  8.940   45.985  1.00 62.79  ? 7    GLN A OE1 1 
ATOM   57   N NE2 . GLN A 1 7   ? 18.591  9.008   48.111  1.00 69.91  ? 7    GLN A NE2 1 
ATOM   58   N N   . LEU A 1 8   ? 23.164  12.345  47.710  1.00 42.50  ? 8    LEU A N   1 
ATOM   59   C CA  . LEU A 1 8   ? 24.110  12.743  46.657  1.00 40.41  ? 8    LEU A CA  1 
ATOM   60   C C   . LEU A 1 8   ? 25.523  12.175  46.826  1.00 42.92  ? 8    LEU A C   1 
ATOM   61   O O   . LEU A 1 8   ? 26.452  12.586  46.133  1.00 42.42  ? 8    LEU A O   1 
ATOM   62   C CB  . LEU A 1 8   ? 24.184  14.270  46.558  1.00 38.79  ? 8    LEU A CB  1 
ATOM   63   C CG  . LEU A 1 8   ? 22.855  14.927  46.182  1.00 41.35  ? 8    LEU A CG  1 
ATOM   64   C CD1 . LEU A 1 8   ? 22.968  16.425  46.282  1.00 32.83  ? 8    LEU A CD1 1 
ATOM   65   C CD2 . LEU A 1 8   ? 22.438  14.487  44.770  1.00 36.05  ? 8    LEU A CD2 1 
ATOM   66   N N   . LEU A 1 9   ? 25.683  11.237  47.751  1.00 38.85  ? 9    LEU A N   1 
ATOM   67   C CA  . LEU A 1 9   ? 26.986  10.657  48.011  1.00 33.71  ? 9    LEU A CA  1 
ATOM   68   C C   . LEU A 1 9   ? 26.993  9.220   47.516  1.00 36.14  ? 9    LEU A C   1 
ATOM   69   O O   . LEU A 1 9   ? 26.154  8.413   47.922  1.00 40.50  ? 9    LEU A O   1 
ATOM   70   C CB  . LEU A 1 9   ? 27.316  10.729  49.506  1.00 33.76  ? 9    LEU A CB  1 
ATOM   71   C CG  . LEU A 1 9   ? 27.195  12.124  50.141  1.00 45.64  ? 9    LEU A CG  1 
ATOM   72   C CD1 . LEU A 1 9   ? 27.347  12.081  51.681  1.00 46.19  ? 9    LEU A CD1 1 
ATOM   73   C CD2 . LEU A 1 9   ? 28.189  13.101  49.533  1.00 41.62  ? 9    LEU A CD2 1 
ATOM   74   N N   . VAL A 1 10  ? 27.931  8.913   46.622  1.00 31.67  ? 10   VAL A N   1 
ATOM   75   C CA  . VAL A 1 10  ? 28.028  7.596   45.991  1.00 31.07  ? 10   VAL A CA  1 
ATOM   76   C C   . VAL A 1 10  ? 29.509  7.208   45.866  1.00 37.28  ? 10   VAL A C   1 
ATOM   77   O O   . VAL A 1 10  ? 30.376  8.065   45.683  1.00 41.00  ? 10   VAL A O   1 
ATOM   78   C CB  . VAL A 1 10  ? 27.376  7.619   44.579  1.00 37.34  ? 10   VAL A CB  1 
ATOM   79   C CG1 . VAL A 1 10  ? 27.577  6.300   43.849  1.00 40.28  ? 10   VAL A CG1 1 
ATOM   80   C CG2 . VAL A 1 10  ? 25.884  7.954   44.672  1.00 36.20  ? 10   VAL A CG2 1 
ATOM   81   N N   . ARG A 1 11  ? 29.806  5.923   45.986  1.00 34.79  ? 11   ARG A N   1 
ATOM   82   C CA  . ARG A 1 11  ? 31.167  5.449   45.792  1.00 30.57  ? 11   ARG A CA  1 
ATOM   83   C C   . ARG A 1 11  ? 31.265  4.685   44.475  1.00 37.66  ? 11   ARG A C   1 
ATOM   84   O O   . ARG A 1 11  ? 30.420  3.841   44.189  1.00 39.19  ? 11   ARG A O   1 
ATOM   85   C CB  . ARG A 1 11  ? 31.602  4.545   46.958  1.00 32.21  ? 11   ARG A CB  1 
ATOM   86   C CG  . ARG A 1 11  ? 32.912  3.800   46.704  1.00 32.53  ? 11   ARG A CG  1 
ATOM   87   C CD  . ARG A 1 11  ? 33.387  3.055   47.928  1.00 34.37  ? 11   ARG A CD  1 
ATOM   88   N NE  . ARG A 1 11  ? 33.830  3.936   49.016  1.00 41.67  ? 11   ARG A NE  1 
ATOM   89   C CZ  . ARG A 1 11  ? 35.083  4.360   49.174  1.00 41.79  ? 11   ARG A CZ  1 
ATOM   90   N NH1 . ARG A 1 11  ? 36.018  4.003   48.302  1.00 42.68  ? 11   ARG A NH1 1 
ATOM   91   N NH2 . ARG A 1 11  ? 35.405  5.146   50.197  1.00 41.82  ? 11   ARG A NH2 1 
ATOM   92   N N   . VAL A 1 12  ? 32.284  4.996   43.674  1.00 34.20  ? 12   VAL A N   1 
ATOM   93   C CA  . VAL A 1 12  ? 32.621  4.188   42.506  1.00 31.65  ? 12   VAL A CA  1 
ATOM   94   C C   . VAL A 1 12  ? 33.985  3.533   42.691  1.00 33.69  ? 12   VAL A C   1 
ATOM   95   O O   . VAL A 1 12  ? 34.638  3.728   43.719  1.00 39.71  ? 12   VAL A O   1 
ATOM   96   C CB  . VAL A 1 12  ? 32.604  5.011   41.201  1.00 29.09  ? 12   VAL A CB  1 
ATOM   97   C CG1 . VAL A 1 12  ? 31.190  5.418   40.862  1.00 27.22  ? 12   VAL A CG1 1 
ATOM   98   C CG2 . VAL A 1 12  ? 33.487  6.226   41.343  1.00 34.74  ? 12   VAL A CG2 1 
ATOM   99   N N   . ARG A 1 13  ? 34.410  2.760   41.697  1.00 34.08  ? 13   ARG A N   1 
ATOM   100  C CA  . ARG A 1 13  ? 35.648  1.984   41.791  1.00 35.89  ? 13   ARG A CA  1 
ATOM   101  C C   . ARG A 1 13  ? 36.853  2.840   42.172  1.00 34.21  ? 13   ARG A C   1 
ATOM   102  O O   . ARG A 1 13  ? 37.738  2.391   42.885  1.00 36.15  ? 13   ARG A O   1 
ATOM   103  C CB  . ARG A 1 13  ? 35.932  1.258   40.464  1.00 31.45  ? 13   ARG A CB  1 
ATOM   104  C CG  . ARG A 1 13  ? 37.249  0.475   40.461  1.00 31.77  ? 13   ARG A CG  1 
ATOM   105  C CD  . ARG A 1 13  ? 37.254  -0.595  41.536  1.00 32.16  ? 13   ARG A CD  1 
ATOM   106  N NE  . ARG A 1 13  ? 38.475  -1.400  41.541  1.00 38.72  ? 13   ARG A NE  1 
ATOM   107  C CZ  . ARG A 1 13  ? 39.633  -1.018  42.079  1.00 41.23  ? 13   ARG A CZ  1 
ATOM   108  N NH1 . ARG A 1 13  ? 39.753  0.180   42.638  1.00 37.80  ? 13   ARG A NH1 1 
ATOM   109  N NH2 . ARG A 1 13  ? 40.682  -1.835  42.048  1.00 42.37  ? 13   ARG A NH2 1 
ATOM   110  N N   . GLY A 1 14  ? 36.883  4.074   41.682  1.00 30.76  ? 14   GLY A N   1 
ATOM   111  C CA  . GLY A 1 14  ? 37.988  4.959   41.970  1.00 32.86  ? 14   GLY A CA  1 
ATOM   112  C C   . GLY A 1 14  ? 37.857  5.797   43.228  1.00 39.07  ? 14   GLY A C   1 
ATOM   113  O O   . GLY A 1 14  ? 38.794  6.496   43.593  1.00 44.08  ? 14   GLY A O   1 
ATOM   114  N N   . GLY A 1 15  ? 36.703  5.756   43.888  1.00 37.93  ? 15   GLY A N   1 
ATOM   115  C CA  . GLY A 1 15  ? 36.531  6.514   45.116  1.00 40.32  ? 15   GLY A CA  1 
ATOM   116  C C   . GLY A 1 15  ? 35.153  7.108   45.344  1.00 35.75  ? 15   GLY A C   1 
ATOM   117  O O   . GLY A 1 15  ? 34.188  6.718   44.698  1.00 37.25  ? 15   GLY A O   1 
ATOM   118  N N   . GLN A 1 16  ? 35.067  8.054   46.276  1.00 36.64  ? 16   GLN A N   1 
ATOM   119  C CA  . GLN A 1 16  ? 33.799  8.707   46.622  1.00 36.96  ? 16   GLN A CA  1 
ATOM   120  C C   . GLN A 1 16  ? 33.460  9.922   45.752  1.00 32.37  ? 16   GLN A C   1 
ATOM   121  O O   . GLN A 1 16  ? 34.332  10.719  45.427  1.00 38.59  ? 16   GLN A O   1 
ATOM   122  C CB  . GLN A 1 16  ? 33.806  9.120   48.096  1.00 34.80  ? 16   GLN A CB  1 
ATOM   123  C CG  . GLN A 1 16  ? 33.668  7.965   49.049  1.00 36.59  ? 16   GLN A CG  1 
ATOM   124  C CD  . GLN A 1 16  ? 33.894  8.371   50.478  1.00 43.16  ? 16   GLN A CD  1 
ATOM   125  O OE1 . GLN A 1 16  ? 35.035  8.600   50.896  1.00 52.85  ? 16   GLN A OE1 1 
ATOM   126  N NE2 . GLN A 1 16  ? 32.814  8.461   51.245  1.00 40.29  ? 16   GLN A NE2 1 
ATOM   127  N N   . LEU A 1 17  ? 32.184  10.063  45.398  1.00 31.88  ? 17   LEU A N   1 
ATOM   128  C CA  . LEU A 1 17  ? 31.701  11.215  44.633  1.00 29.48  ? 17   LEU A CA  1 
ATOM   129  C C   . LEU A 1 17  ? 30.643  11.996  45.403  1.00 33.83  ? 17   LEU A C   1 
ATOM   130  O O   . LEU A 1 17  ? 29.840  11.412  46.124  1.00 39.59  ? 17   LEU A O   1 
ATOM   131  C CB  . LEU A 1 17  ? 31.065  10.747  43.330  1.00 27.12  ? 17   LEU A CB  1 
ATOM   132  C CG  . LEU A 1 17  ? 31.896  9.876   42.400  1.00 35.36  ? 17   LEU A CG  1 
ATOM   133  C CD1 . LEU A 1 17  ? 31.002  9.248   41.353  1.00 31.90  ? 17   LEU A CD1 1 
ATOM   134  C CD2 . LEU A 1 17  ? 32.999  10.706  41.755  1.00 34.35  ? 17   LEU A CD2 1 
ATOM   135  N N   . ARG A 1 18  ? 30.631  13.312  45.235  1.00 33.80  ? 18   ARG A N   1 
ATOM   136  C CA  . ARG A 1 18  ? 29.500  14.121  45.673  1.00 32.36  ? 18   ARG A CA  1 
ATOM   137  C C   . ARG A 1 18  ? 28.827  14.727  44.442  1.00 38.23  ? 18   ARG A C   1 
ATOM   138  O O   . ARG A 1 18  ? 29.464  15.443  43.666  1.00 41.34  ? 18   ARG A O   1 
ATOM   139  C CB  . ARG A 1 18  ? 29.942  15.223  46.635  1.00 31.05  ? 18   ARG A CB  1 
ATOM   140  C CG  . ARG A 1 18  ? 28.807  16.152  47.101  1.00 39.36  ? 18   ARG A CG  1 
ATOM   141  C CD  . ARG A 1 18  ? 29.307  17.205  48.105  1.00 49.43  ? 18   ARG A CD  1 
ATOM   142  N NE  . ARG A 1 18  ? 30.674  17.617  47.800  1.00 58.62  ? 18   ARG A NE  1 
ATOM   143  C CZ  . ARG A 1 18  ? 31.734  17.349  48.559  1.00 57.79  ? 18   ARG A CZ  1 
ATOM   144  N NH1 . ARG A 1 18  ? 31.598  16.690  49.701  1.00 48.58  ? 18   ARG A NH1 1 
ATOM   145  N NH2 . ARG A 1 18  ? 32.936  17.752  48.172  1.00 66.12  ? 18   ARG A NH2 1 
ATOM   146  N N   . GLY A 1 19  ? 27.547  14.420  44.256  1.00 28.62  ? 19   GLY A N   1 
ATOM   147  C CA  . GLY A 1 19  ? 26.795  14.935  43.131  1.00 28.38  ? 19   GLY A CA  1 
ATOM   148  C C   . GLY A 1 19  ? 25.950  16.143  43.516  1.00 35.34  ? 19   GLY A C   1 
ATOM   149  O O   . GLY A 1 19  ? 26.052  16.669  44.636  1.00 31.21  ? 19   GLY A O   1 
ATOM   150  N N   . ILE A 1 20  ? 25.107  16.582  42.588  1.00 30.25  ? 20   ILE A N   1 
ATOM   151  C CA  . ILE A 1 20  ? 24.279  17.755  42.826  1.00 33.77  ? 20   ILE A CA  1 
ATOM   152  C C   . ILE A 1 20  ? 22.800  17.461  42.537  1.00 32.75  ? 20   ILE A C   1 
ATOM   153  O O   . ILE A 1 20  ? 22.465  16.619  41.693  1.00 35.71  ? 20   ILE A O   1 
ATOM   154  C CB  . ILE A 1 20  ? 24.806  18.960  42.008  1.00 37.14  ? 20   ILE A CB  1 
ATOM   155  C CG1 . ILE A 1 20  ? 23.995  20.225  42.291  1.00 39.64  ? 20   ILE A CG1 1 
ATOM   156  C CG2 . ILE A 1 20  ? 24.825  18.633  40.519  1.00 27.85  ? 20   ILE A CG2 1 
ATOM   157  C CD1 . ILE A 1 20  ? 24.472  21.427  41.505  1.00 30.58  ? 20   ILE A CD1 1 
ATOM   158  N N   . ARG A 1 21  ? 21.921  18.116  43.277  1.00 31.32  ? 21   ARG A N   1 
ATOM   159  C CA  . ARG A 1 21  ? 20.495  17.970  43.066  1.00 31.98  ? 21   ARG A CA  1 
ATOM   160  C C   . ARG A 1 21  ? 20.046  19.029  42.059  1.00 32.84  ? 21   ARG A C   1 
ATOM   161  O O   . ARG A 1 21  ? 20.063  20.225  42.351  1.00 38.24  ? 21   ARG A O   1 
ATOM   162  C CB  . ARG A 1 21  ? 19.766  18.146  44.396  1.00 33.78  ? 21   ARG A CB  1 
ATOM   163  C CG  . ARG A 1 21  ? 18.257  18.000  44.335  1.00 34.84  ? 21   ARG A CG  1 
ATOM   164  C CD  . ARG A 1 21  ? 17.602  18.425  45.656  1.00 38.92  ? 21   ARG A CD  1 
ATOM   165  N NE  . ARG A 1 21  ? 16.436  19.280  45.425  1.00 52.48  ? 21   ARG A NE  1 
ATOM   166  C CZ  . ARG A 1 21  ? 15.206  19.031  45.873  1.00 62.80  ? 21   ARG A CZ  1 
ATOM   167  N NH1 . ARG A 1 21  ? 14.964  17.952  46.608  1.00 69.35  ? 21   ARG A NH1 1 
ATOM   168  N NH2 . ARG A 1 21  ? 14.214  19.872  45.595  1.00 62.39  ? 21   ARG A NH2 1 
ATOM   169  N N   . LEU A 1 22  ? 19.654  18.601  40.869  1.00 32.76  ? 22   LEU A N   1 
ATOM   170  C CA  . LEU A 1 22  ? 19.251  19.547  39.834  1.00 33.06  ? 22   LEU A CA  1 
ATOM   171  C C   . LEU A 1 22  ? 17.743  19.715  39.774  1.00 35.13  ? 22   LEU A C   1 
ATOM   172  O O   . LEU A 1 22  ? 16.988  18.807  40.112  1.00 38.29  ? 22   LEU A O   1 
ATOM   173  C CB  . LEU A 1 22  ? 19.764  19.108  38.464  1.00 32.13  ? 22   LEU A CB  1 
ATOM   174  C CG  . LEU A 1 22  ? 21.274  19.143  38.275  1.00 31.75  ? 22   LEU A CG  1 
ATOM   175  C CD1 . LEU A 1 22  ? 21.609  18.841  36.837  1.00 28.25  ? 22   LEU A CD1 1 
ATOM   176  C CD2 . LEU A 1 22  ? 21.839  20.479  38.700  1.00 31.20  ? 22   LEU A CD2 1 
ATOM   177  N N   . LYS A 1 23  ? 17.313  20.883  39.319  1.00 39.29  ? 23   LYS A N   1 
ATOM   178  C CA  . LYS A 1 23  ? 15.900  21.166  39.148  1.00 44.93  ? 23   LYS A CA  1 
ATOM   179  C C   . LYS A 1 23  ? 15.461  20.852  37.710  1.00 46.48  ? 23   LYS A C   1 
ATOM   180  O O   . LYS A 1 23  ? 16.034  21.364  36.752  1.00 43.48  ? 23   LYS A O   1 
ATOM   181  C CB  . LYS A 1 23  ? 15.636  22.628  39.499  1.00 50.44  ? 23   LYS A CB  1 
ATOM   182  C CG  . LYS A 1 23  ? 14.202  23.070  39.337  1.00 62.49  ? 23   LYS A CG  1 
ATOM   183  C CD  . LYS A 1 23  ? 13.264  22.193  40.142  1.00 71.58  ? 23   LYS A CD  1 
ATOM   184  C CE  . LYS A 1 23  ? 11.807  22.536  39.854  1.00 71.46  ? 23   LYS A CE  1 
ATOM   185  N NZ  . LYS A 1 23  ? 10.949  21.380  40.229  1.00 70.55  ? 23   LYS A NZ  1 
ATOM   186  N N   . ALA A 1 24  ? 14.467  19.980  37.567  1.00 41.62  ? 24   ALA A N   1 
ATOM   187  C CA  . ALA A 1 24  ? 13.820  19.759  36.280  1.00 44.44  ? 24   ALA A CA  1 
ATOM   188  C C   . ALA A 1 24  ? 12.369  20.220  36.400  1.00 50.39  ? 24   ALA A C   1 
ATOM   189  O O   . ALA A 1 24  ? 11.851  20.323  37.511  1.00 51.75  ? 24   ALA A O   1 
ATOM   190  C CB  . ALA A 1 24  ? 13.895  18.291  35.874  1.00 33.50  ? 24   ALA A CB  1 
ATOM   191  N N   . PRO A 1 25  ? 11.709  20.504  35.262  1.00 50.85  ? 25   PRO A N   1 
ATOM   192  C CA  . PRO A 1 25  ? 10.341  21.038  35.309  1.00 45.36  ? 25   PRO A CA  1 
ATOM   193  C C   . PRO A 1 25  ? 9.388   20.269  36.228  1.00 42.92  ? 25   PRO A C   1 
ATOM   194  O O   . PRO A 1 25  ? 8.609   20.898  36.939  1.00 48.56  ? 25   PRO A O   1 
ATOM   195  C CB  . PRO A 1 25  ? 9.884   20.928  33.856  1.00 45.26  ? 25   PRO A CB  1 
ATOM   196  C CG  . PRO A 1 25  ? 11.146  21.097  33.074  1.00 47.53  ? 25   PRO A CG  1 
ATOM   197  C CD  . PRO A 1 25  ? 12.206  20.396  33.876  1.00 45.91  ? 25   PRO A CD  1 
ATOM   198  N N   . GLY A 1 26  ? 9.459   18.941  36.226  1.00 40.09  ? 26   GLY A N   1 
ATOM   199  C CA  . GLY A 1 26  ? 8.553   18.122  37.015  1.00 41.44  ? 26   GLY A CA  1 
ATOM   200  C C   . GLY A 1 26  ? 9.080   17.639  38.363  1.00 55.66  ? 26   GLY A C   1 
ATOM   201  O O   . GLY A 1 26  ? 8.338   17.012  39.119  1.00 42.43  ? 26   GLY A O   1 
ATOM   202  N N   . GLY A 1 27  ? 10.348  17.923  38.668  1.00 50.98  ? 27   GLY A N   1 
ATOM   203  C CA  . GLY A 1 27  ? 10.931  17.566  39.950  1.00 39.37  ? 27   GLY A CA  1 
ATOM   204  C C   . GLY A 1 27  ? 12.449  17.499  39.935  1.00 49.53  ? 27   GLY A C   1 
ATOM   205  O O   . GLY A 1 27  ? 13.087  17.763  38.914  1.00 43.20  ? 27   GLY A O   1 
ATOM   206  N N   . PRO A 1 28  ? 13.048  17.131  41.076  1.00 51.41  ? 28   PRO A N   1 
ATOM   207  C CA  . PRO A 1 28  ? 14.513  17.046  41.193  1.00 35.48  ? 28   PRO A CA  1 
ATOM   208  C C   . PRO A 1 28  ? 15.114  15.851  40.451  1.00 42.89  ? 28   PRO A C   1 
ATOM   209  O O   . PRO A 1 28  ? 14.422  14.848  40.279  1.00 38.61  ? 28   PRO A O   1 
ATOM   210  C CB  . PRO A 1 28  ? 14.734  16.886  42.696  1.00 37.41  ? 28   PRO A CB  1 
ATOM   211  C CG  . PRO A 1 28  ? 13.445  16.266  43.209  1.00 44.05  ? 28   PRO A CG  1 
ATOM   212  C CD  . PRO A 1 28  ? 12.354  16.835  42.345  1.00 38.86  ? 28   PRO A CD  1 
ATOM   213  N N   . VAL A 1 29  ? 16.369  15.972  40.005  1.00 32.22  ? 29   VAL A N   1 
ATOM   214  C CA  . VAL A 1 29  ? 17.143  14.825  39.517  1.00 36.66  ? 29   VAL A CA  1 
ATOM   215  C C   . VAL A 1 29  ? 18.536  14.827  40.145  1.00 34.85  ? 29   VAL A C   1 
ATOM   216  O O   . VAL A 1 29  ? 19.026  15.856  40.607  1.00 30.20  ? 29   VAL A O   1 
ATOM   217  C CB  . VAL A 1 29  ? 17.328  14.823  37.972  1.00 38.76  ? 29   VAL A CB  1 
ATOM   218  C CG1 . VAL A 1 29  ? 16.001  14.884  37.267  1.00 30.52  ? 29   VAL A CG1 1 
ATOM   219  C CG2 . VAL A 1 29  ? 18.210  15.978  37.533  1.00 28.88  ? 29   VAL A CG2 1 
ATOM   220  N N   . SER A 1 30  ? 19.186  13.676  40.156  1.00 32.10  ? 30   SER A N   1 
ATOM   221  C CA  . SER A 1 30  ? 20.556  13.621  40.640  1.00 36.20  ? 30   SER A CA  1 
ATOM   222  C C   . SER A 1 30  ? 21.522  13.749  39.462  1.00 31.84  ? 30   SER A C   1 
ATOM   223  O O   . SER A 1 30  ? 21.364  13.077  38.451  1.00 33.81  ? 30   SER A O   1 
ATOM   224  C CB  . SER A 1 30  ? 20.813  12.314  41.399  1.00 36.31  ? 30   SER A CB  1 
ATOM   225  O OG  . SER A 1 30  ? 19.828  12.089  42.405  1.00 46.23  ? 30   SER A OG  1 
ATOM   226  N N   . ALA A 1 31  ? 22.516  14.618  39.588  1.00 30.23  ? 31   ALA A N   1 
ATOM   227  C CA  . ALA A 1 31  ? 23.556  14.720  38.571  1.00 29.64  ? 31   ALA A CA  1 
ATOM   228  C C   . ALA A 1 31  ? 24.934  14.511  39.171  1.00 30.54  ? 31   ALA A C   1 
ATOM   229  O O   . ALA A 1 31  ? 25.255  15.071  40.222  1.00 38.07  ? 31   ALA A O   1 
ATOM   230  C CB  . ALA A 1 31  ? 23.497  16.062  37.882  1.00 25.95  ? 31   ALA A CB  1 
ATOM   231  N N   . PHE A 1 32  ? 25.742  13.707  38.492  1.00 27.52  ? 32   PHE A N   1 
ATOM   232  C CA  . PHE A 1 32  ? 27.139  13.514  38.851  1.00 24.04  ? 32   PHE A CA  1 
ATOM   233  C C   . PHE A 1 32  ? 27.958  13.891  37.627  1.00 27.78  ? 32   PHE A C   1 
ATOM   234  O O   . PHE A 1 32  ? 28.022  13.146  36.643  1.00 30.85  ? 32   PHE A O   1 
ATOM   235  C CB  . PHE A 1 32  ? 27.404  12.064  39.303  1.00 24.13  ? 32   PHE A CB  1 
ATOM   236  C CG  . PHE A 1 32  ? 26.622  11.666  40.532  1.00 25.62  ? 32   PHE A CG  1 
ATOM   237  C CD1 . PHE A 1 32  ? 25.293  11.284  40.433  1.00 26.55  ? 32   PHE A CD1 1 
ATOM   238  C CD2 . PHE A 1 32  ? 27.206  11.707  41.788  1.00 28.13  ? 32   PHE A CD2 1 
ATOM   239  C CE1 . PHE A 1 32  ? 24.560  10.937  41.569  1.00 30.53  ? 32   PHE A CE1 1 
ATOM   240  C CE2 . PHE A 1 32  ? 26.486  11.366  42.922  1.00 28.79  ? 32   PHE A CE2 1 
ATOM   241  C CZ  . PHE A 1 32  ? 25.162  10.972  42.813  1.00 31.80  ? 32   PHE A CZ  1 
ATOM   242  N N   . LEU A 1 33  ? 28.563  15.072  37.693  1.00 25.81  ? 33   LEU A N   1 
ATOM   243  C CA  . LEU A 1 33  ? 29.234  15.671  36.551  1.00 26.43  ? 33   LEU A CA  1 
ATOM   244  C C   . LEU A 1 33  ? 30.762  15.719  36.712  1.00 29.39  ? 33   LEU A C   1 
ATOM   245  O O   . LEU A 1 33  ? 31.272  15.955  37.811  1.00 29.28  ? 33   LEU A O   1 
ATOM   246  C CB  . LEU A 1 33  ? 28.691  17.079  36.342  1.00 28.51  ? 33   LEU A CB  1 
ATOM   247  C CG  . LEU A 1 33  ? 27.167  17.185  36.325  1.00 29.47  ? 33   LEU A CG  1 
ATOM   248  C CD1 . LEU A 1 33  ? 26.762  18.651  36.193  1.00 25.72  ? 33   LEU A CD1 1 
ATOM   249  C CD2 . LEU A 1 33  ? 26.535  16.340  35.204  1.00 26.92  ? 33   LEU A CD2 1 
ATOM   250  N N   . GLY A 1 34  ? 31.486  15.484  35.616  1.00 23.38  ? 34   GLY A N   1 
ATOM   251  C CA  . GLY A 1 34  ? 32.934  15.565  35.631  1.00 23.37  ? 34   GLY A CA  1 
ATOM   252  C C   . GLY A 1 34  ? 33.607  14.436  36.399  1.00 29.81  ? 34   GLY A C   1 
ATOM   253  O O   . GLY A 1 34  ? 34.602  14.652  37.090  1.00 25.32  ? 34   GLY A O   1 
ATOM   254  N N   . ILE A 1 35  ? 33.066  13.226  36.289  1.00 33.58  ? 35   ILE A N   1 
ATOM   255  C CA  . ILE A 1 35  ? 33.727  12.059  36.868  1.00 30.26  ? 35   ILE A CA  1 
ATOM   256  C C   . ILE A 1 35  ? 34.844  11.596  35.938  1.00 31.51  ? 35   ILE A C   1 
ATOM   257  O O   . ILE A 1 35  ? 34.573  11.158  34.817  1.00 30.54  ? 35   ILE A O   1 
ATOM   258  C CB  . ILE A 1 35  ? 32.757  10.871  37.003  1.00 28.16  ? 35   ILE A CB  1 
ATOM   259  C CG1 . ILE A 1 35  ? 31.480  11.262  37.738  1.00 26.61  ? 35   ILE A CG1 1 
ATOM   260  C CG2 . ILE A 1 35  ? 33.438  9.710   37.673  1.00 27.19  ? 35   ILE A CG2 1 
ATOM   261  C CD1 . ILE A 1 35  ? 30.438  10.160  37.704  1.00 26.22  ? 35   ILE A CD1 1 
ATOM   262  N N   . PRO A 1 36  ? 36.101  11.662  36.399  1.00 32.77  ? 36   PRO A N   1 
ATOM   263  C CA  . PRO A 1 36  ? 37.221  11.181  35.568  1.00 27.06  ? 36   PRO A CA  1 
ATOM   264  C C   . PRO A 1 36  ? 37.109  9.676   35.301  1.00 36.11  ? 36   PRO A C   1 
ATOM   265  O O   . PRO A 1 36  ? 36.787  8.938   36.235  1.00 34.75  ? 36   PRO A O   1 
ATOM   266  C CB  . PRO A 1 36  ? 38.455  11.464  36.441  1.00 28.25  ? 36   PRO A CB  1 
ATOM   267  C CG  . PRO A 1 36  ? 37.917  11.508  37.873  1.00 24.63  ? 36   PRO A CG  1 
ATOM   268  C CD  . PRO A 1 36  ? 36.517  12.058  37.761  1.00 26.91  ? 36   PRO A CD  1 
ATOM   269  N N   . PHE A 1 37  ? 37.344  9.233   34.064  1.00 35.10  ? 37   PHE A N   1 
ATOM   270  C CA  . PHE A 1 37  ? 37.352  7.796   33.768  1.00 32.77  ? 37   PHE A CA  1 
ATOM   271  C C   . PHE A 1 37  ? 38.683  7.330   33.169  1.00 35.87  ? 37   PHE A C   1 
ATOM   272  O O   . PHE A 1 37  ? 38.895  6.137   32.971  1.00 38.22  ? 37   PHE A O   1 
ATOM   273  C CB  . PHE A 1 37  ? 36.169  7.388   32.883  1.00 32.26  ? 37   PHE A CB  1 
ATOM   274  C CG  . PHE A 1 37  ? 36.170  8.025   31.514  1.00 30.10  ? 37   PHE A CG  1 
ATOM   275  C CD1 . PHE A 1 37  ? 36.791  7.403   30.449  1.00 25.55  ? 37   PHE A CD1 1 
ATOM   276  C CD2 . PHE A 1 37  ? 35.518  9.234   31.294  1.00 32.17  ? 37   PHE A CD2 1 
ATOM   277  C CE1 . PHE A 1 37  ? 36.801  7.991   29.190  1.00 28.72  ? 37   PHE A CE1 1 
ATOM   278  C CE2 . PHE A 1 37  ? 35.515  9.818   30.043  1.00 32.19  ? 37   PHE A CE2 1 
ATOM   279  C CZ  . PHE A 1 37  ? 36.172  9.193   28.986  1.00 27.97  ? 37   PHE A CZ  1 
ATOM   280  N N   . ALA A 1 38  ? 39.573  8.284   32.899  1.00 30.35  ? 38   ALA A N   1 
ATOM   281  C CA  . ALA A 1 38  ? 40.909  8.000   32.384  1.00 26.39  ? 38   ALA A CA  1 
ATOM   282  C C   . ALA A 1 38  ? 41.942  8.843   33.102  1.00 28.27  ? 38   ALA A C   1 
ATOM   283  O O   . ALA A 1 38  ? 41.628  9.913   33.629  1.00 32.13  ? 38   ALA A O   1 
ATOM   284  C CB  . ALA A 1 38  ? 40.986  8.285   30.880  1.00 22.88  ? 38   ALA A CB  1 
ATOM   285  N N   . GLU A 1 39  ? 43.181  8.369   33.108  1.00 27.71  ? 39   GLU A N   1 
ATOM   286  C CA  . GLU A 1 39  ? 44.301  9.253   33.378  1.00 28.02  ? 39   GLU A CA  1 
ATOM   287  C C   . GLU A 1 39  ? 44.327  10.326  32.286  1.00 28.84  ? 39   GLU A C   1 
ATOM   288  O O   . GLU A 1 39  ? 44.089  10.027  31.112  1.00 26.55  ? 39   GLU A O   1 
ATOM   289  C CB  . GLU A 1 39  ? 45.609  8.468   33.381  1.00 28.55  ? 39   GLU A CB  1 
ATOM   290  C CG  . GLU A 1 39  ? 45.819  7.654   34.654  1.00 40.06  ? 39   GLU A CG  1 
ATOM   291  C CD  . GLU A 1 39  ? 45.920  8.520   35.895  1.00 44.01  ? 39   GLU A CD  1 
ATOM   292  O OE1 . GLU A 1 39  ? 46.900  9.280   36.004  1.00 58.68  ? 39   GLU A OE1 1 
ATOM   293  O OE2 . GLU A 1 39  ? 45.030  8.448   36.762  1.00 42.53  ? 39   GLU A OE2 1 
ATOM   294  N N   . PRO A 1 40  ? 44.618  11.577  32.667  1.00 29.43  ? 40   PRO A N   1 
ATOM   295  C CA  . PRO A 1 40  ? 44.643  12.673  31.697  1.00 27.20  ? 40   PRO A CA  1 
ATOM   296  C C   . PRO A 1 40  ? 45.605  12.376  30.544  1.00 30.86  ? 40   PRO A C   1 
ATOM   297  O O   . PRO A 1 40  ? 46.786  12.132  30.776  1.00 34.62  ? 40   PRO A O   1 
ATOM   298  C CB  . PRO A 1 40  ? 45.148  13.861  32.530  1.00 29.19  ? 40   PRO A CB  1 
ATOM   299  C CG  . PRO A 1 40  ? 44.832  13.504  33.946  1.00 29.63  ? 40   PRO A CG  1 
ATOM   300  C CD  . PRO A 1 40  ? 45.042  12.019  34.010  1.00 27.47  ? 40   PRO A CD  1 
ATOM   301  N N   . PRO A 1 41  ? 45.103  12.396  29.301  1.00 28.40  ? 41   PRO A N   1 
ATOM   302  C CA  . PRO A 1 41  ? 45.948  11.991  28.173  1.00 31.20  ? 41   PRO A CA  1 
ATOM   303  C C   . PRO A 1 41  ? 46.894  13.112  27.732  1.00 32.39  ? 41   PRO A C   1 
ATOM   304  O O   . PRO A 1 41  ? 46.859  13.513  26.573  1.00 28.77  ? 41   PRO A O   1 
ATOM   305  C CB  . PRO A 1 41  ? 44.928  11.686  27.074  1.00 28.57  ? 41   PRO A CB  1 
ATOM   306  C CG  . PRO A 1 41  ? 43.813  12.660  27.351  1.00 33.05  ? 41   PRO A CG  1 
ATOM   307  C CD  . PRO A 1 41  ? 43.751  12.797  28.873  1.00 30.70  ? 41   PRO A CD  1 
ATOM   308  N N   . VAL A 1 42  ? 47.738  13.588  28.641  1.00 27.83  ? 42   VAL A N   1 
ATOM   309  C CA  . VAL A 1 42  ? 48.585  14.747  28.369  1.00 34.11  ? 42   VAL A CA  1 
ATOM   310  C C   . VAL A 1 42  ? 50.067  14.357  28.329  1.00 32.71  ? 42   VAL A C   1 
ATOM   311  O O   . VAL A 1 42  ? 50.421  13.259  28.731  1.00 32.18  ? 42   VAL A O   1 
ATOM   312  C CB  . VAL A 1 42  ? 48.381  15.851  29.436  1.00 36.25  ? 42   VAL A CB  1 
ATOM   313  C CG1 . VAL A 1 42  ? 46.886  16.103  29.686  1.00 29.58  ? 42   VAL A CG1 1 
ATOM   314  C CG2 . VAL A 1 42  ? 49.080  15.475  30.729  1.00 30.69  ? 42   VAL A CG2 1 
ATOM   315  N N   . GLY A 1 43  ? 50.924  15.255  27.839  1.00 33.20  ? 43   GLY A N   1 
ATOM   316  C CA  . GLY A 1 43  ? 52.347  14.993  27.729  1.00 33.74  ? 43   GLY A CA  1 
ATOM   317  C C   . GLY A 1 43  ? 52.645  13.755  26.904  1.00 44.21  ? 43   GLY A C   1 
ATOM   318  O O   . GLY A 1 43  ? 52.106  13.586  25.806  1.00 40.84  ? 43   GLY A O   1 
ATOM   319  N N   . SER A 1 44  ? 53.482  12.871  27.449  1.00 43.34  ? 44   SER A N   1 
ATOM   320  C CA  . SER A 1 44  ? 53.882  11.628  26.782  1.00 40.28  ? 44   SER A CA  1 
ATOM   321  C C   . SER A 1 44  ? 52.705  10.708  26.427  1.00 41.27  ? 44   SER A C   1 
ATOM   322  O O   . SER A 1 44  ? 52.869  9.731   25.682  1.00 39.18  ? 44   SER A O   1 
ATOM   323  C CB  . SER A 1 44  ? 54.854  10.860  27.663  1.00 37.98  ? 44   SER A CB  1 
ATOM   324  O OG  . SER A 1 44  ? 54.179  10.363  28.802  1.00 45.06  ? 44   SER A OG  1 
ATOM   325  N N   . ARG A 1 45  ? 51.524  11.017  26.958  1.00 33.27  ? 45   ARG A N   1 
ATOM   326  C CA  . ARG A 1 45  ? 50.334  10.220  26.669  1.00 31.79  ? 45   ARG A CA  1 
ATOM   327  C C   . ARG A 1 45  ? 49.482  10.766  25.520  1.00 34.04  ? 45   ARG A C   1 
ATOM   328  O O   . ARG A 1 45  ? 48.475  10.143  25.131  1.00 31.96  ? 45   ARG A O   1 
ATOM   329  C CB  . ARG A 1 45  ? 49.463  10.095  27.914  1.00 30.43  ? 45   ARG A CB  1 
ATOM   330  C CG  . ARG A 1 45  ? 50.095  9.417   29.105  1.00 31.10  ? 45   ARG A CG  1 
ATOM   331  C CD  . ARG A 1 45  ? 49.008  9.290   30.159  1.00 87.35  ? 45   ARG A CD  1 
ATOM   332  N NE  . ARG A 1 45  ? 49.494  9.102   31.521  1.00 86.76  ? 45   ARG A NE  1 
ATOM   333  C CZ  . ARG A 1 45  ? 49.544  7.926   32.132  1.00 84.61  ? 45   ARG A CZ  1 
ATOM   334  N NH1 . ARG A 1 45  ? 49.156  6.830   31.488  1.00 82.11  ? 45   ARG A NH1 1 
ATOM   335  N NH2 . ARG A 1 45  ? 49.983  7.845   33.382  1.00 84.71  ? 45   ARG A NH2 1 
ATOM   336  N N   . ARG A 1 46  ? 49.845  11.930  24.985  1.00 33.82  ? 46   ARG A N   1 
ATOM   337  C CA  . ARG A 1 46  ? 49.124  12.441  23.812  1.00 32.42  ? 46   ARG A CA  1 
ATOM   338  C C   . ARG A 1 46  ? 49.229  11.418  22.679  1.00 36.69  ? 46   ARG A C   1 
ATOM   339  O O   . ARG A 1 46  ? 50.307  10.842  22.461  1.00 29.46  ? 46   ARG A O   1 
ATOM   340  C CB  . ARG A 1 46  ? 49.654  13.814  23.373  1.00 31.92  ? 46   ARG A CB  1 
ATOM   341  C CG  . ARG A 1 46  ? 48.954  14.388  22.141  1.00 31.37  ? 46   ARG A CG  1 
ATOM   342  C CD  . ARG A 1 46  ? 49.650  15.629  21.598  1.00 28.81  ? 46   ARG A CD  1 
ATOM   343  N NE  . ARG A 1 46  ? 49.496  16.807  22.440  1.00 29.03  ? 46   ARG A NE  1 
ATOM   344  C CZ  . ARG A 1 46  ? 50.154  17.943  22.232  1.00 35.21  ? 46   ARG A CZ  1 
ATOM   345  N NH1 . ARG A 1 46  ? 51.000  18.030  21.220  1.00 31.25  ? 46   ARG A NH1 1 
ATOM   346  N NH2 . ARG A 1 46  ? 49.986  18.988  23.032  1.00 31.09  ? 46   ARG A NH2 1 
ATOM   347  N N   . PHE A 1 47  ? 48.095  11.179  22.008  1.00 26.69  ? 47   PHE A N   1 
ATOM   348  C CA  . PHE A 1 47  ? 47.955  10.233  20.889  1.00 26.59  ? 47   PHE A CA  1 
ATOM   349  C C   . PHE A 1 47  ? 47.863  8.779   21.337  1.00 33.14  ? 47   PHE A C   1 
ATOM   350  O O   . PHE A 1 47  ? 47.682  7.891   20.505  1.00 32.01  ? 47   PHE A O   1 
ATOM   351  C CB  . PHE A 1 47  ? 49.081  10.353  19.855  1.00 27.87  ? 47   PHE A CB  1 
ATOM   352  C CG  . PHE A 1 47  ? 49.286  11.731  19.336  1.00 30.39  ? 47   PHE A CG  1 
ATOM   353  C CD1 . PHE A 1 47  ? 48.224  12.461  18.826  1.00 30.62  ? 47   PHE A CD1 1 
ATOM   354  C CD2 . PHE A 1 47  ? 50.540  12.307  19.365  1.00 29.52  ? 47   PHE A CD2 1 
ATOM   355  C CE1 . PHE A 1 47  ? 48.419  13.745  18.331  1.00 31.37  ? 47   PHE A CE1 1 
ATOM   356  C CE2 . PHE A 1 47  ? 50.735  13.585  18.890  1.00 32.70  ? 47   PHE A CE2 1 
ATOM   357  C CZ  . PHE A 1 47  ? 49.668  14.306  18.373  1.00 28.57  ? 47   PHE A CZ  1 
ATOM   358  N N   . MET A 1 48  ? 48.004  8.539   22.640  1.00 33.12  ? 48   MET A N   1 
ATOM   359  C CA  . MET A 1 48  ? 48.037  7.180   23.180  1.00 30.54  ? 48   MET A CA  1 
ATOM   360  C C   . MET A 1 48  ? 46.643  6.699   23.585  1.00 34.42  ? 48   MET A C   1 
ATOM   361  O O   . MET A 1 48  ? 45.749  7.516   23.856  1.00 25.77  ? 48   MET A O   1 
ATOM   362  C CB  . MET A 1 48  ? 48.943  7.119   24.396  1.00 34.65  ? 48   MET A CB  1 
ATOM   363  C CG  . MET A 1 48  ? 50.371  7.554   24.151  1.00 44.04  ? 48   MET A CG  1 
ATOM   364  S SD  . MET A 1 48  ? 51.459  6.133   24.130  1.00 68.46  ? 48   MET A SD  1 
ATOM   365  C CE  . MET A 1 48  ? 51.064  5.517   22.516  1.00 32.07  ? 48   MET A CE  1 
ATOM   366  N N   . PRO A 1 49  ? 46.454  5.367   23.603  1.00 33.01  ? 49   PRO A N   1 
ATOM   367  C CA  . PRO A 1 49  ? 45.230  4.784   24.163  1.00 29.77  ? 49   PRO A CA  1 
ATOM   368  C C   . PRO A 1 49  ? 45.044  5.294   25.586  1.00 25.68  ? 49   PRO A C   1 
ATOM   369  O O   . PRO A 1 49  ? 46.012  5.465   26.308  1.00 28.97  ? 49   PRO A O   1 
ATOM   370  C CB  . PRO A 1 49  ? 45.526  3.276   24.193  1.00 27.57  ? 49   PRO A CB  1 
ATOM   371  C CG  . PRO A 1 49  ? 46.636  3.069   23.169  1.00 28.19  ? 49   PRO A CG  1 
ATOM   372  C CD  . PRO A 1 49  ? 47.417  4.347   23.126  1.00 35.28  ? 49   PRO A CD  1 
ATOM   373  N N   . PRO A 1 50  ? 43.803  5.545   25.986  1.00 24.52  ? 50   PRO A N   1 
ATOM   374  C CA  . PRO A 1 50  ? 43.559  6.008   27.354  1.00 31.64  ? 50   PRO A CA  1 
ATOM   375  C C   . PRO A 1 50  ? 43.918  4.931   28.381  1.00 36.38  ? 50   PRO A C   1 
ATOM   376  O O   . PRO A 1 50  ? 43.681  3.737   28.156  1.00 39.12  ? 50   PRO A O   1 
ATOM   377  C CB  . PRO A 1 50  ? 42.052  6.252   27.371  1.00 26.78  ? 50   PRO A CB  1 
ATOM   378  C CG  . PRO A 1 50  ? 41.516  5.275   26.378  1.00 31.59  ? 50   PRO A CG  1 
ATOM   379  C CD  . PRO A 1 50  ? 42.561  5.204   25.278  1.00 23.53  ? 50   PRO A CD  1 
ATOM   380  N N   . GLU A 1 51  ? 44.504  5.366   29.488  1.00 36.06  ? 51   GLU A N   1 
ATOM   381  C CA  . GLU A 1 51  ? 44.753  4.512   30.642  1.00 40.15  ? 51   GLU A CA  1 
ATOM   382  C C   . GLU A 1 51  ? 43.668  4.800   31.690  1.00 40.08  ? 51   GLU A C   1 
ATOM   383  O O   . GLU A 1 51  ? 43.304  5.957   31.912  1.00 43.05  ? 51   GLU A O   1 
ATOM   384  C CB  . GLU A 1 51  ? 46.152  4.791   31.192  1.00 53.30  ? 51   GLU A CB  1 
ATOM   385  C CG  . GLU A 1 51  ? 46.422  4.218   32.573  1.00 81.36  ? 51   GLU A CG  1 
ATOM   386  C CD  . GLU A 1 51  ? 47.850  4.469   33.046  1.00 99.32  ? 51   GLU A CD  1 
ATOM   387  O OE1 . GLU A 1 51  ? 48.729  4.664   32.172  1.00 108.15 ? 51   GLU A OE1 1 
ATOM   388  O OE2 . GLU A 1 51  ? 48.087  4.475   34.281  1.00 98.32  ? 51   GLU A OE2 1 
ATOM   389  N N   . PRO A 1 52  ? 43.120  3.746   32.316  1.00 43.10  ? 52   PRO A N   1 
ATOM   390  C CA  . PRO A 1 52  ? 42.046  3.897   33.311  1.00 38.37  ? 52   PRO A CA  1 
ATOM   391  C C   . PRO A 1 52  ? 42.446  4.795   34.490  1.00 32.94  ? 52   PRO A C   1 
ATOM   392  O O   . PRO A 1 52  ? 43.584  4.713   34.948  1.00 31.70  ? 52   PRO A O   1 
ATOM   393  C CB  . PRO A 1 52  ? 41.826  2.465   33.792  1.00 36.07  ? 52   PRO A CB  1 
ATOM   394  C CG  . PRO A 1 52  ? 42.278  1.625   32.658  1.00 35.85  ? 52   PRO A CG  1 
ATOM   395  C CD  . PRO A 1 52  ? 43.458  2.331   32.094  1.00 37.23  ? 52   PRO A CD  1 
ATOM   396  N N   . LYS A 1 53  ? 41.524  5.638   34.956  1.00 27.88  ? 53   LYS A N   1 
ATOM   397  C CA  . LYS A 1 53  ? 41.796  6.567   36.050  1.00 29.28  ? 53   LYS A CA  1 
ATOM   398  C C   . LYS A 1 53  ? 42.186  5.849   37.330  1.00 36.45  ? 53   LYS A C   1 
ATOM   399  O O   . LYS A 1 53  ? 41.446  4.991   37.812  1.00 41.60  ? 53   LYS A O   1 
ATOM   400  C CB  . LYS A 1 53  ? 40.574  7.444   36.324  1.00 29.13  ? 53   LYS A CB  1 
ATOM   401  C CG  . LYS A 1 53  ? 40.716  8.351   37.541  1.00 30.33  ? 53   LYS A CG  1 
ATOM   402  C CD  . LYS A 1 53  ? 41.625  9.535   37.237  1.00 31.36  ? 53   LYS A CD  1 
ATOM   403  C CE  . LYS A 1 53  ? 41.794  10.449  38.450  1.00 33.34  ? 53   LYS A CE  1 
ATOM   404  N NZ  . LYS A 1 53  ? 42.980  11.335  38.282  1.00 38.05  ? 53   LYS A NZ  1 
ATOM   405  N N   . ARG A 1 54  ? 43.349  6.206   37.870  1.00 33.81  ? 54   ARG A N   1 
ATOM   406  C CA  . ARG A 1 54  ? 43.814  5.668   39.139  1.00 34.78  ? 54   ARG A CA  1 
ATOM   407  C C   . ARG A 1 54  ? 42.984  6.263   40.271  1.00 40.28  ? 54   ARG A C   1 
ATOM   408  O O   . ARG A 1 54  ? 42.673  7.450   40.239  1.00 46.45  ? 54   ARG A O   1 
ATOM   409  C CB  . ARG A 1 54  ? 45.300  5.986   39.346  1.00 41.64  ? 54   ARG A CB  1 
ATOM   410  C CG  . ARG A 1 54  ? 46.223  5.308   38.355  1.00 51.38  ? 54   ARG A CG  1 
ATOM   411  C CD  . ARG A 1 54  ? 47.645  5.264   38.880  1.00 64.68  ? 54   ARG A CD  1 
ATOM   412  N NE  . ARG A 1 54  ? 48.202  6.602   39.047  1.00 76.90  ? 54   ARG A NE  1 
ATOM   413  C CZ  . ARG A 1 54  ? 48.898  7.243   38.112  1.00 85.49  ? 54   ARG A CZ  1 
ATOM   414  N NH1 . ARG A 1 54  ? 49.133  6.665   36.936  1.00 84.99  ? 54   ARG A NH1 1 
ATOM   415  N NH2 . ARG A 1 54  ? 49.360  8.464   38.353  1.00 88.30  ? 54   ARG A NH2 1 
ATOM   416  N N   . PRO A 1 55  ? 42.613  5.431   41.263  1.00 42.85  ? 55   PRO A N   1 
ATOM   417  C CA  . PRO A 1 55  ? 41.766  5.814   42.405  1.00 42.01  ? 55   PRO A CA  1 
ATOM   418  C C   . PRO A 1 55  ? 42.195  7.111   43.082  1.00 44.74  ? 55   PRO A C   1 
ATOM   419  O O   . PRO A 1 55  ? 43.389  7.377   43.209  1.00 33.74  ? 55   PRO A O   1 
ATOM   420  C CB  . PRO A 1 55  ? 41.952  4.640   43.386  1.00 37.44  ? 55   PRO A CB  1 
ATOM   421  C CG  . PRO A 1 55  ? 42.201  3.478   42.506  1.00 36.77  ? 55   PRO A CG  1 
ATOM   422  C CD  . PRO A 1 55  ? 42.984  4.003   41.314  1.00 32.93  ? 55   PRO A CD  1 
ATOM   423  N N   . TRP A 1 56  ? 41.225  7.902   43.528  1.00 32.04  ? 56   TRP A N   1 
ATOM   424  C CA  . TRP A 1 56  ? 41.533  9.117   44.276  1.00 32.81  ? 56   TRP A CA  1 
ATOM   425  C C   . TRP A 1 56  ? 41.201  8.974   45.755  1.00 36.88  ? 56   TRP A C   1 
ATOM   426  O O   . TRP A 1 56  ? 40.531  8.023   46.171  1.00 35.39  ? 56   TRP A O   1 
ATOM   427  C CB  . TRP A 1 56  ? 40.779  10.304  43.702  1.00 33.02  ? 56   TRP A CB  1 
ATOM   428  C CG  . TRP A 1 56  ? 39.314  10.062  43.645  1.00 41.94  ? 56   TRP A CG  1 
ATOM   429  C CD1 . TRP A 1 56  ? 38.396  10.351  44.610  1.00 40.69  ? 56   TRP A CD1 1 
ATOM   430  C CD2 . TRP A 1 56  ? 38.588  9.459   42.565  1.00 40.34  ? 56   TRP A CD2 1 
ATOM   431  N NE1 . TRP A 1 56  ? 37.143  9.975   44.196  1.00 44.53  ? 56   TRP A NE1 1 
ATOM   432  C CE2 . TRP A 1 56  ? 37.232  9.423   42.944  1.00 43.14  ? 56   TRP A CE2 1 
ATOM   433  C CE3 . TRP A 1 56  ? 38.956  8.940   41.320  1.00 37.07  ? 56   TRP A CE3 1 
ATOM   434  C CZ2 . TRP A 1 56  ? 36.238  8.895   42.117  1.00 42.19  ? 56   TRP A CZ2 1 
ATOM   435  C CZ3 . TRP A 1 56  ? 37.960  8.415   40.493  1.00 41.35  ? 56   TRP A CZ3 1 
ATOM   436  C CH2 . TRP A 1 56  ? 36.621  8.397   40.897  1.00 41.71  ? 56   TRP A CH2 1 
ATOM   437  N N   . SER A 1 57  ? 41.679  9.920   46.554  1.00 41.36  ? 57   SER A N   1 
ATOM   438  C CA  . SER A 1 57  ? 41.354  9.923   47.970  1.00 49.78  ? 57   SER A CA  1 
ATOM   439  C C   . SER A 1 57  ? 40.397  11.064  48.275  1.00 46.73  ? 57   SER A C   1 
ATOM   440  O O   . SER A 1 57  ? 40.411  12.096  47.601  1.00 46.49  ? 57   SER A O   1 
ATOM   441  C CB  . SER A 1 57  ? 42.616  10.033  48.833  1.00 54.93  ? 57   SER A CB  1 
ATOM   442  O OG  . SER A 1 57  ? 43.223  11.302  48.679  1.00 56.29  ? 57   SER A OG  1 
ATOM   443  N N   . GLY A 1 58  ? 39.570  10.867  49.295  1.00 42.60  ? 58   GLY A N   1 
ATOM   444  C CA  . GLY A 1 58  ? 38.621  11.876  49.699  1.00 39.94  ? 58   GLY A CA  1 
ATOM   445  C C   . GLY A 1 58  ? 37.425  11.878  48.779  1.00 42.59  ? 58   GLY A C   1 
ATOM   446  O O   . GLY A 1 58  ? 37.239  10.957  47.983  1.00 41.67  ? 58   GLY A O   1 
ATOM   447  N N   . VAL A 1 59  ? 36.618  12.926  48.881  1.00 42.07  ? 59   VAL A N   1 
ATOM   448  C CA  . VAL A 1 59  ? 35.384  12.996  48.119  1.00 38.07  ? 59   VAL A CA  1 
ATOM   449  C C   . VAL A 1 59  ? 35.580  13.896  46.913  1.00 37.29  ? 59   VAL A C   1 
ATOM   450  O O   . VAL A 1 59  ? 35.784  15.101  47.056  1.00 44.44  ? 59   VAL A O   1 
ATOM   451  C CB  . VAL A 1 59  ? 34.221  13.508  48.998  1.00 39.19  ? 59   VAL A CB  1 
ATOM   452  C CG1 . VAL A 1 59  ? 32.908  13.449  48.235  1.00 37.23  ? 59   VAL A CG1 1 
ATOM   453  C CG2 . VAL A 1 59  ? 34.139  12.703  50.292  1.00 35.44  ? 59   VAL A CG2 1 
ATOM   454  N N   . LEU A 1 60  ? 35.552  13.299  45.730  1.00 30.74  ? 60   LEU A N   1 
ATOM   455  C CA  . LEU A 1 60  ? 35.660  14.047  44.490  1.00 35.69  ? 60   LEU A CA  1 
ATOM   456  C C   . LEU A 1 60  ? 34.366  14.853  44.236  1.00 40.34  ? 60   LEU A C   1 
ATOM   457  O O   . LEU A 1 60  ? 33.266  14.292  44.201  1.00 38.30  ? 60   LEU A O   1 
ATOM   458  C CB  . LEU A 1 60  ? 35.955  13.101  43.315  1.00 29.70  ? 60   LEU A CB  1 
ATOM   459  C CG  . LEU A 1 60  ? 36.162  13.726  41.923  1.00 32.51  ? 60   LEU A CG  1 
ATOM   460  C CD1 . LEU A 1 60  ? 37.228  12.976  41.181  1.00 31.24  ? 60   LEU A CD1 1 
ATOM   461  C CD2 . LEU A 1 60  ? 34.898  13.710  41.093  1.00 32.93  ? 60   LEU A CD2 1 
ATOM   462  N N   . ASP A 1 61  ? 34.497  16.167  44.088  1.00 34.16  ? 61   ASP A N   1 
ATOM   463  C CA  . ASP A 1 61  ? 33.341  16.993  43.799  1.00 36.99  ? 61   ASP A CA  1 
ATOM   464  C C   . ASP A 1 61  ? 32.907  16.761  42.355  1.00 36.16  ? 61   ASP A C   1 
ATOM   465  O O   . ASP A 1 61  ? 33.686  16.949  41.425  1.00 40.94  ? 61   ASP A O   1 
ATOM   466  C CB  . ASP A 1 61  ? 33.635  18.474  44.043  1.00 41.49  ? 61   ASP A CB  1 
ATOM   467  C CG  . ASP A 1 61  ? 32.381  19.346  43.937  1.00 46.65  ? 61   ASP A CG  1 
ATOM   468  O OD1 . ASP A 1 61  ? 31.983  19.675  42.793  1.00 39.71  ? 61   ASP A OD1 1 
ATOM   469  O OD2 . ASP A 1 61  ? 31.791  19.687  44.994  1.00 50.11  ? 61   ASP A OD2 1 
ATOM   470  N N   . ALA A 1 62  ? 31.659  16.336  42.193  1.00 29.83  ? 62   ALA A N   1 
ATOM   471  C CA  . ALA A 1 62  ? 31.109  16.002  40.896  1.00 27.39  ? 62   ALA A CA  1 
ATOM   472  C C   . ALA A 1 62  ? 29.856  16.825  40.648  1.00 32.98  ? 62   ALA A C   1 
ATOM   473  O O   . ALA A 1 62  ? 28.827  16.286  40.220  1.00 32.09  ? 62   ALA A O   1 
ATOM   474  C CB  . ALA A 1 62  ? 30.785  14.531  40.835  1.00 28.36  ? 62   ALA A CB  1 
ATOM   475  N N   . THR A 1 63  ? 29.950  18.129  40.914  1.00 27.71  ? 63   THR A N   1 
ATOM   476  C CA  . THR A 1 63  ? 28.801  19.020  40.824  1.00 28.69  ? 63   THR A CA  1 
ATOM   477  C C   . THR A 1 63  ? 28.841  19.966  39.615  1.00 34.03  ? 63   THR A C   1 
ATOM   478  O O   . THR A 1 63  ? 27.893  20.709  39.383  1.00 35.76  ? 63   THR A O   1 
ATOM   479  C CB  . THR A 1 63  ? 28.645  19.864  42.111  1.00 33.39  ? 63   THR A CB  1 
ATOM   480  O OG1 . THR A 1 63  ? 29.686  20.843  42.168  1.00 33.31  ? 63   THR A OG1 1 
ATOM   481  C CG2 . THR A 1 63  ? 28.689  18.974  43.383  1.00 29.50  ? 63   THR A CG2 1 
ATOM   482  N N   . THR A 1 64  ? 29.939  19.954  38.862  1.00 33.25  ? 64   THR A N   1 
ATOM   483  C CA  . THR A 1 64  ? 30.073  20.816  37.682  1.00 29.82  ? 64   THR A CA  1 
ATOM   484  C C   . THR A 1 64  ? 30.720  20.084  36.513  1.00 32.93  ? 64   THR A C   1 
ATOM   485  O O   . THR A 1 64  ? 31.493  19.149  36.696  1.00 34.37  ? 64   THR A O   1 
ATOM   486  C CB  . THR A 1 64  ? 30.936  22.045  37.958  1.00 29.75  ? 64   THR A CB  1 
ATOM   487  O OG1 . THR A 1 64  ? 32.289  21.627  38.187  1.00 36.28  ? 64   THR A OG1 1 
ATOM   488  C CG2 . THR A 1 64  ? 30.419  22.813  39.177  1.00 29.29  ? 64   THR A CG2 1 
ATOM   489  N N   . PHE A 1 65  ? 30.390  20.515  35.304  1.00 34.13  ? 65   PHE A N   1 
ATOM   490  C CA  . PHE A 1 65  ? 30.997  19.951  34.116  1.00 28.75  ? 65   PHE A CA  1 
ATOM   491  C C   . PHE A 1 65  ? 32.501  20.180  34.090  1.00 27.60  ? 65   PHE A C   1 
ATOM   492  O O   . PHE A 1 65  ? 32.997  21.212  34.537  1.00 32.06  ? 65   PHE A O   1 
ATOM   493  C CB  . PHE A 1 65  ? 30.363  20.553  32.883  1.00 30.94  ? 65   PHE A CB  1 
ATOM   494  C CG  . PHE A 1 65  ? 28.977  20.056  32.621  1.00 31.40  ? 65   PHE A CG  1 
ATOM   495  C CD1 . PHE A 1 65  ? 28.749  18.705  32.364  1.00 23.49  ? 65   PHE A CD1 1 
ATOM   496  C CD2 . PHE A 1 65  ? 27.902  20.932  32.616  1.00 26.47  ? 65   PHE A CD2 1 
ATOM   497  C CE1 . PHE A 1 65  ? 27.465  18.240  32.119  1.00 26.80  ? 65   PHE A CE1 1 
ATOM   498  C CE2 . PHE A 1 65  ? 26.616  20.477  32.363  1.00 30.98  ? 65   PHE A CE2 1 
ATOM   499  C CZ  . PHE A 1 65  ? 26.393  19.132  32.116  1.00 28.30  ? 65   PHE A CZ  1 
ATOM   500  N N   . GLN A 1 66  ? 33.218  19.196  33.568  1.00 24.73  ? 66   GLN A N   1 
ATOM   501  C CA  . GLN A 1 66  ? 34.653  19.295  33.399  1.00 22.75  ? 66   GLN A CA  1 
ATOM   502  C C   . GLN A 1 66  ? 35.087  19.891  32.062  1.00 30.92  ? 66   GLN A C   1 
ATOM   503  O O   . GLN A 1 66  ? 34.251  20.213  31.201  1.00 26.73  ? 66   GLN A O   1 
ATOM   504  C CB  . GLN A 1 66  ? 35.299  17.927  33.582  1.00 27.11  ? 66   GLN A CB  1 
ATOM   505  C CG  . GLN A 1 66  ? 35.825  17.705  34.980  1.00 29.64  ? 66   GLN A CG  1 
ATOM   506  C CD  . GLN A 1 66  ? 37.028  18.582  35.316  1.00 37.39  ? 66   GLN A CD  1 
ATOM   507  O OE1 . GLN A 1 66  ? 37.435  19.449  34.530  1.00 41.60  ? 66   GLN A OE1 1 
ATOM   508  N NE2 . GLN A 1 66  ? 37.616  18.344  36.488  1.00 34.55  ? 66   GLN A NE2 1 
ATOM   509  N N   . ASN A 1 67  ? 36.404  20.046  31.907  1.00 27.59  ? 67   ASN A N   1 
ATOM   510  C CA  . ASN A 1 67  ? 36.981  20.575  30.678  1.00 26.73  ? 67   ASN A CA  1 
ATOM   511  C C   . ASN A 1 67  ? 36.479  19.881  29.420  1.00 26.26  ? 67   ASN A C   1 
ATOM   512  O O   . ASN A 1 67  ? 36.217  18.683  29.406  1.00 24.02  ? 67   ASN A O   1 
ATOM   513  C CB  . ASN A 1 67  ? 38.500  20.475  30.704  1.00 30.20  ? 67   ASN A CB  1 
ATOM   514  C CG  . ASN A 1 67  ? 39.111  21.250  31.842  1.00 26.98  ? 67   ASN A CG  1 
ATOM   515  O OD1 . ASN A 1 67  ? 38.618  22.310  32.241  1.00 26.93  ? 67   ASN A OD1 1 
ATOM   516  N ND2 . ASN A 1 67  ? 40.195  20.728  32.370  1.00 30.94  ? 67   ASN A ND2 1 
ATOM   517  N N   . VAL A 1 68  ? 36.344  20.671  28.370  1.00 22.85  ? 68   VAL A N   1 
ATOM   518  C CA  . VAL A 1 68  ? 36.043  20.172  27.047  1.00 25.86  ? 68   VAL A CA  1 
ATOM   519  C C   . VAL A 1 68  ? 37.353  19.825  26.316  1.00 25.68  ? 68   VAL A C   1 
ATOM   520  O O   . VAL A 1 68  ? 38.365  20.524  26.468  1.00 26.51  ? 68   VAL A O   1 
ATOM   521  C CB  . VAL A 1 68  ? 35.268  21.257  26.293  1.00 33.18  ? 68   VAL A CB  1 
ATOM   522  C CG1 . VAL A 1 68  ? 35.186  20.946  24.811  1.00 29.92  ? 68   VAL A CG1 1 
ATOM   523  C CG2 . VAL A 1 68  ? 33.880  21.465  26.955  1.00 21.44  ? 68   VAL A CG2 1 
ATOM   524  N N   . CYS A 1 69  ? 37.347  18.738  25.552  1.00 22.40  ? 69   CYS A N   1 
ATOM   525  C CA  . CYS A 1 69  ? 38.544  18.329  24.819  1.00 24.66  ? 69   CYS A CA  1 
ATOM   526  C C   . CYS A 1 69  ? 39.029  19.370  23.803  1.00 27.99  ? 69   CYS A C   1 
ATOM   527  O O   . CYS A 1 69  ? 38.231  20.014  23.101  1.00 23.21  ? 69   CYS A O   1 
ATOM   528  C CB  . CYS A 1 69  ? 38.333  16.976  24.159  1.00 19.94  ? 69   CYS A CB  1 
ATOM   529  S SG  . CYS A 1 69  ? 38.217  15.650  25.355  1.00 28.41  ? 69   CYS A SG  1 
ATOM   530  N N   . TYR A 1 70  ? 40.346  19.543  23.746  1.00 25.76  ? 70   TYR A N   1 
ATOM   531  C CA  . TYR A 1 70  ? 40.921  20.559  22.882  1.00 31.46  ? 70   TYR A CA  1 
ATOM   532  C C   . TYR A 1 70  ? 40.427  20.445  21.445  1.00 33.61  ? 70   TYR A C   1 
ATOM   533  O O   . TYR A 1 70  ? 40.583  19.406  20.811  1.00 27.33  ? 70   TYR A O   1 
ATOM   534  C CB  . TYR A 1 70  ? 42.435  20.514  22.911  1.00 30.71  ? 70   TYR A CB  1 
ATOM   535  C CG  . TYR A 1 70  ? 42.991  21.891  23.077  1.00 33.32  ? 70   TYR A CG  1 
ATOM   536  C CD1 . TYR A 1 70  ? 43.007  22.780  22.013  1.00 36.04  ? 70   TYR A CD1 1 
ATOM   537  C CD2 . TYR A 1 70  ? 43.449  22.330  24.314  1.00 33.88  ? 70   TYR A CD2 1 
ATOM   538  C CE1 . TYR A 1 70  ? 43.495  24.060  22.165  1.00 40.89  ? 70   TYR A CE1 1 
ATOM   539  C CE2 . TYR A 1 70  ? 43.945  23.615  24.473  1.00 41.12  ? 70   TYR A CE2 1 
ATOM   540  C CZ  . TYR A 1 70  ? 43.967  24.471  23.397  1.00 44.23  ? 70   TYR A CZ  1 
ATOM   541  O OH  . TYR A 1 70  ? 44.457  25.750  23.556  1.00 60.99  ? 70   TYR A OH  1 
ATOM   542  N N   . GLN A 1 71  ? 39.819  21.517  20.943  1.00 30.22  ? 71   GLN A N   1 
ATOM   543  C CA  . GLN A 1 71  ? 39.188  21.448  19.637  1.00 29.35  ? 71   GLN A CA  1 
ATOM   544  C C   . GLN A 1 71  ? 39.129  22.781  18.924  1.00 30.37  ? 71   GLN A C   1 
ATOM   545  O O   . GLN A 1 71  ? 39.162  23.850  19.549  1.00 29.17  ? 71   GLN A O   1 
ATOM   546  C CB  . GLN A 1 71  ? 37.778  20.868  19.759  1.00 29.28  ? 71   GLN A CB  1 
ATOM   547  C CG  . GLN A 1 71  ? 36.779  21.771  20.473  1.00 23.57  ? 71   GLN A CG  1 
ATOM   548  C CD  . GLN A 1 71  ? 35.545  21.006  20.898  1.00 25.46  ? 71   GLN A CD  1 
ATOM   549  O OE1 . GLN A 1 71  ? 34.430  21.324  20.470  1.00 24.54  ? 71   GLN A OE1 1 
ATOM   550  N NE2 . GLN A 1 71  ? 35.734  19.969  21.729  1.00 21.71  ? 71   GLN A NE2 1 
ATOM   551  N N   . TYR A 1 72  ? 39.051  22.698  17.601  1.00 34.79  ? 72   TYR A N   1 
ATOM   552  C CA  . TYR A 1 72  ? 38.805  23.857  16.756  1.00 39.81  ? 72   TYR A CA  1 
ATOM   553  C C   . TYR A 1 72  ? 37.442  24.447  17.098  1.00 36.77  ? 72   TYR A C   1 
ATOM   554  O O   . TYR A 1 72  ? 36.494  23.714  17.386  1.00 31.31  ? 72   TYR A O   1 
ATOM   555  C CB  . TYR A 1 72  ? 38.839  23.432  15.288  1.00 43.68  ? 72   TYR A CB  1 
ATOM   556  C CG  . TYR A 1 72  ? 38.496  24.536  14.320  1.00 45.27  ? 72   TYR A CG  1 
ATOM   557  C CD1 . TYR A 1 72  ? 39.481  25.406  13.862  1.00 46.21  ? 72   TYR A CD1 1 
ATOM   558  C CD2 . TYR A 1 72  ? 37.191  24.711  13.857  1.00 41.91  ? 72   TYR A CD2 1 
ATOM   559  C CE1 . TYR A 1 72  ? 39.186  26.423  12.971  1.00 47.71  ? 72   TYR A CE1 1 
ATOM   560  C CE2 . TYR A 1 72  ? 36.882  25.731  12.961  1.00 44.47  ? 72   TYR A CE2 1 
ATOM   561  C CZ  . TYR A 1 72  ? 37.889  26.584  12.520  1.00 51.45  ? 72   TYR A CZ  1 
ATOM   562  O OH  . TYR A 1 72  ? 37.611  27.604  11.629  1.00 56.47  ? 72   TYR A OH  1 
ATOM   563  N N   . VAL A 1 73  ? 37.339  25.767  17.068  1.00 38.19  ? 73   VAL A N   1 
ATOM   564  C CA  . VAL A 1 73  ? 36.088  26.437  17.428  1.00 43.71  ? 73   VAL A CA  1 
ATOM   565  C C   . VAL A 1 73  ? 35.528  27.241  16.250  1.00 47.63  ? 73   VAL A C   1 
ATOM   566  O O   . VAL A 1 73  ? 36.191  28.138  15.743  1.00 44.58  ? 73   VAL A O   1 
ATOM   567  C CB  . VAL A 1 73  ? 36.297  27.350  18.661  1.00 42.94  ? 73   VAL A CB  1 
ATOM   568  C CG1 . VAL A 1 73  ? 35.119  28.292  18.860  1.00 40.36  ? 73   VAL A CG1 1 
ATOM   569  C CG2 . VAL A 1 73  ? 36.549  26.498  19.898  1.00 38.44  ? 73   VAL A CG2 1 
ATOM   570  N N   . ASP A 1 74  ? 34.309  26.910  15.823  1.00 60.74  ? 74   ASP A N   1 
ATOM   571  C CA  . ASP A 1 74  ? 33.696  27.534  14.646  1.00 67.87  ? 74   ASP A CA  1 
ATOM   572  C C   . ASP A 1 74  ? 33.268  28.982  14.906  1.00 68.10  ? 74   ASP A C   1 
ATOM   573  O O   . ASP A 1 74  ? 32.612  29.282  15.901  1.00 68.22  ? 74   ASP A O   1 
ATOM   574  C CB  . ASP A 1 74  ? 32.529  26.686  14.112  1.00 74.84  ? 74   ASP A CB  1 
ATOM   575  C CG  . ASP A 1 74  ? 33.000  25.395  13.416  1.00 79.79  ? 74   ASP A CG  1 
ATOM   576  O OD1 . ASP A 1 74  ? 33.557  25.490  12.296  1.00 83.25  ? 74   ASP A OD1 1 
ATOM   577  O OD2 . ASP A 1 74  ? 32.807  24.288  13.980  1.00 76.20  ? 74   ASP A OD2 1 
ATOM   578  N N   . THR A 1 75  ? 33.658  29.875  14.002  1.00 73.66  ? 75   THR A N   1 
ATOM   579  C CA  . THR A 1 75  ? 33.479  31.315  14.203  1.00 85.90  ? 75   THR A CA  1 
ATOM   580  C C   . THR A 1 75  ? 32.818  32.006  13.015  1.00 87.51  ? 75   THR A C   1 
ATOM   581  O O   . THR A 1 75  ? 32.904  33.232  12.880  1.00 87.83  ? 75   THR A O   1 
ATOM   582  C CB  . THR A 1 75  ? 34.836  32.029  14.447  1.00 77.64  ? 75   THR A CB  1 
ATOM   583  O OG1 . THR A 1 75  ? 35.799  31.572  13.484  1.00 71.93  ? 75   THR A OG1 1 
ATOM   584  C CG2 . THR A 1 75  ? 35.346  31.762  15.863  1.00 76.57  ? 75   THR A CG2 1 
ATOM   585  N N   . LEU A 1 76  ? 32.159  31.224  12.162  1.00 83.01  ? 76   LEU A N   1 
ATOM   586  C CA  . LEU A 1 76  ? 31.584  31.754  10.932  1.00 80.23  ? 76   LEU A CA  1 
ATOM   587  C C   . LEU A 1 76  ? 30.475  32.782  11.174  1.00 81.11  ? 76   LEU A C   1 
ATOM   588  O O   . LEU A 1 76  ? 30.404  33.793  10.476  1.00 86.92  ? 76   LEU A O   1 
ATOM   589  C CB  . LEU A 1 76  ? 31.080  30.627  10.031  1.00 82.34  ? 76   LEU A CB  1 
ATOM   590  C CG  . LEU A 1 76  ? 30.916  31.039  8.564   1.00 91.34  ? 76   LEU A CG  1 
ATOM   591  C CD1 . LEU A 1 76  ? 32.276  31.250  7.892   1.00 92.02  ? 76   LEU A CD1 1 
ATOM   592  C CD2 . LEU A 1 76  ? 30.069  30.037  7.783   1.00 93.69  ? 76   LEU A CD2 1 
ATOM   593  N N   . TYR A 1 77  ? 29.612  32.531  12.154  1.00 75.18  ? 77   TYR A N   1 
ATOM   594  C CA  . TYR A 1 77  ? 28.568  33.499  12.495  1.00 71.14  ? 77   TYR A CA  1 
ATOM   595  C C   . TYR A 1 77  ? 28.608  33.877  13.971  1.00 75.19  ? 77   TYR A C   1 
ATOM   596  O O   . TYR A 1 77  ? 27.850  33.336  14.770  1.00 73.30  ? 77   TYR A O   1 
ATOM   597  C CB  . TYR A 1 77  ? 27.178  32.971  12.127  1.00 65.54  ? 77   TYR A CB  1 
ATOM   598  C CG  . TYR A 1 77  ? 26.967  32.726  10.645  1.00 67.40  ? 77   TYR A CG  1 
ATOM   599  C CD1 . TYR A 1 77  ? 26.739  33.781  9.767   1.00 65.01  ? 77   TYR A CD1 1 
ATOM   600  C CD2 . TYR A 1 77  ? 26.975  31.434  10.125  1.00 71.94  ? 77   TYR A CD2 1 
ATOM   601  C CE1 . TYR A 1 77  ? 26.536  33.559  8.418   1.00 67.70  ? 77   TYR A CE1 1 
ATOM   602  C CE2 . TYR A 1 77  ? 26.772  31.203  8.774   1.00 74.48  ? 77   TYR A CE2 1 
ATOM   603  C CZ  . TYR A 1 77  ? 26.552  32.268  7.924   1.00 74.61  ? 77   TYR A CZ  1 
ATOM   604  O OH  . TYR A 1 77  ? 26.350  32.041  6.577   1.00 79.87  ? 77   TYR A OH  1 
ATOM   605  N N   . PRO A 1 78  ? 29.495  34.818  14.329  1.00 84.92  ? 78   PRO A N   1 
ATOM   606  C CA  . PRO A 1 78  ? 29.751  35.300  15.695  1.00 83.78  ? 78   PRO A CA  1 
ATOM   607  C C   . PRO A 1 78  ? 28.519  35.780  16.472  1.00 76.88  ? 78   PRO A C   1 
ATOM   608  O O   . PRO A 1 78  ? 27.947  36.820  16.140  1.00 74.00  ? 78   PRO A O   1 
ATOM   609  C CB  . PRO A 1 78  ? 30.699  36.481  15.466  1.00 89.43  ? 78   PRO A CB  1 
ATOM   610  C CG  . PRO A 1 78  ? 31.419  36.132  14.213  1.00 90.88  ? 78   PRO A CG  1 
ATOM   611  C CD  . PRO A 1 78  ? 30.399  35.451  13.350  1.00 89.16  ? 78   PRO A CD  1 
ATOM   612  N N   . GLY A 1 79  ? 28.142  35.041  17.513  1.00 74.10  ? 79   GLY A N   1 
ATOM   613  C CA  . GLY A 1 79  ? 27.068  35.458  18.402  1.00 72.89  ? 79   GLY A CA  1 
ATOM   614  C C   . GLY A 1 79  ? 25.719  34.895  18.006  1.00 67.06  ? 79   GLY A C   1 
ATOM   615  O O   . GLY A 1 79  ? 24.735  35.040  18.727  1.00 60.78  ? 79   GLY A O   1 
ATOM   616  N N   . PHE A 1 80  ? 25.688  34.252  16.844  1.00 64.72  ? 80   PHE A N   1 
ATOM   617  C CA  . PHE A 1 80  ? 24.489  33.630  16.302  1.00 57.98  ? 80   PHE A CA  1 
ATOM   618  C C   . PHE A 1 80  ? 24.208  32.308  17.012  1.00 59.36  ? 80   PHE A C   1 
ATOM   619  O O   . PHE A 1 80  ? 25.067  31.420  17.043  1.00 57.06  ? 80   PHE A O   1 
ATOM   620  C CB  . PHE A 1 80  ? 24.699  33.399  14.807  1.00 55.23  ? 80   PHE A CB  1 
ATOM   621  C CG  . PHE A 1 80  ? 23.589  32.652  14.142  1.00 57.52  ? 80   PHE A CG  1 
ATOM   622  C CD1 . PHE A 1 80  ? 22.312  33.196  14.072  1.00 58.06  ? 80   PHE A CD1 1 
ATOM   623  C CD2 . PHE A 1 80  ? 23.823  31.416  13.561  1.00 55.24  ? 80   PHE A CD2 1 
ATOM   624  C CE1 . PHE A 1 80  ? 21.290  32.517  13.453  1.00 55.95  ? 80   PHE A CE1 1 
ATOM   625  C CE2 . PHE A 1 80  ? 22.803  30.732  12.932  1.00 54.96  ? 80   PHE A CE2 1 
ATOM   626  C CZ  . PHE A 1 80  ? 21.533  31.282  12.882  1.00 57.27  ? 80   PHE A CZ  1 
ATOM   627  N N   . GLU A 1 81  ? 23.008  32.174  17.578  1.00 57.96  ? 81   GLU A N   1 
ATOM   628  C CA  . GLU A 1 81  ? 22.669  31.004  18.399  1.00 58.49  ? 81   GLU A CA  1 
ATOM   629  C C   . GLU A 1 81  ? 22.809  29.685  17.634  1.00 48.76  ? 81   GLU A C   1 
ATOM   630  O O   . GLU A 1 81  ? 23.116  28.634  18.219  1.00 37.19  ? 81   GLU A O   1 
ATOM   631  C CB  . GLU A 1 81  ? 21.252  31.132  18.978  1.00 69.45  ? 81   GLU A CB  1 
ATOM   632  C CG  . GLU A 1 81  ? 20.861  30.026  19.961  1.00 81.94  ? 81   GLU A CG  1 
ATOM   633  C CD  . GLU A 1 81  ? 21.606  30.117  21.293  1.00 94.60  ? 81   GLU A CD  1 
ATOM   634  O OE1 . GLU A 1 81  ? 21.742  31.246  21.820  1.00 101.07 ? 81   GLU A OE1 1 
ATOM   635  O OE2 . GLU A 1 81  ? 22.046  29.062  21.817  1.00 93.23  ? 81   GLU A OE2 1 
ATOM   636  N N   . GLY A 1 82  ? 22.582  29.748  16.326  1.00 44.23  ? 82   GLY A N   1 
ATOM   637  C CA  . GLY A 1 82  ? 22.648  28.566  15.489  1.00 46.87  ? 82   GLY A CA  1 
ATOM   638  C C   . GLY A 1 82  ? 24.022  27.920  15.503  1.00 46.07  ? 82   GLY A C   1 
ATOM   639  O O   . GLY A 1 82  ? 24.119  26.695  15.450  1.00 48.98  ? 82   GLY A O   1 
ATOM   640  N N   . THR A 1 83  ? 25.081  28.732  15.568  1.00 42.20  ? 83   THR A N   1 
ATOM   641  C CA  . THR A 1 83  ? 26.436  28.197  15.721  1.00 44.89  ? 83   THR A CA  1 
ATOM   642  C C   . THR A 1 83  ? 26.877  28.059  17.195  1.00 46.96  ? 83   THR A C   1 
ATOM   643  O O   . THR A 1 83  ? 27.557  27.094  17.546  1.00 47.10  ? 83   THR A O   1 
ATOM   644  C CB  . THR A 1 83  ? 27.490  29.017  14.940  1.00 44.94  ? 83   THR A CB  1 
ATOM   645  O OG1 . THR A 1 83  ? 27.671  30.287  15.572  1.00 54.75  ? 83   THR A OG1 1 
ATOM   646  C CG2 . THR A 1 83  ? 27.065  29.219  13.490  1.00 44.99  ? 83   THR A CG2 1 
ATOM   647  N N   . GLU A 1 84  ? 26.475  28.998  18.053  1.00 49.37  ? 84   GLU A N   1 
ATOM   648  C CA  . GLU A 1 84  ? 26.947  29.023  19.442  1.00 52.23  ? 84   GLU A CA  1 
ATOM   649  C C   . GLU A 1 84  ? 26.536  27.810  20.281  1.00 51.20  ? 84   GLU A C   1 
ATOM   650  O O   . GLU A 1 84  ? 27.307  27.344  21.122  1.00 55.09  ? 84   GLU A O   1 
ATOM   651  C CB  . GLU A 1 84  ? 26.521  30.311  20.156  1.00 64.17  ? 84   GLU A CB  1 
ATOM   652  C CG  . GLU A 1 84  ? 26.988  31.619  19.495  1.00 74.06  ? 84   GLU A CG  1 
ATOM   653  C CD  . GLU A 1 84  ? 28.499  31.831  19.505  1.00 76.71  ? 84   GLU A CD  1 
ATOM   654  O OE1 . GLU A 1 84  ? 29.236  31.014  20.108  1.00 79.34  ? 84   GLU A OE1 1 
ATOM   655  O OE2 . GLU A 1 84  ? 28.948  32.832  18.899  1.00 76.93  ? 84   GLU A OE2 1 
ATOM   656  N N   . MET A 1 85  ? 25.330  27.300  20.057  1.00 44.27  ? 85   MET A N   1 
ATOM   657  C CA  . MET A 1 85  ? 24.843  26.138  20.796  1.00 39.24  ? 85   MET A CA  1 
ATOM   658  C C   . MET A 1 85  ? 25.763  24.923  20.684  1.00 36.63  ? 85   MET A C   1 
ATOM   659  O O   . MET A 1 85  ? 25.730  24.054  21.549  1.00 37.92  ? 85   MET A O   1 
ATOM   660  C CB  . MET A 1 85  ? 23.423  25.762  20.362  1.00 41.64  ? 85   MET A CB  1 
ATOM   661  C CG  . MET A 1 85  ? 23.278  25.409  18.876  1.00 43.79  ? 85   MET A CG  1 
ATOM   662  S SD  . MET A 1 85  ? 21.553  25.046  18.413  1.00 45.96  ? 85   MET A SD  1 
ATOM   663  C CE  . MET A 1 85  ? 21.374  23.438  19.191  1.00 26.72  ? 85   MET A CE  1 
ATOM   664  N N   . TRP A 1 86  ? 26.590  24.874  19.636  1.00 27.90  ? 86   TRP A N   1 
ATOM   665  C CA  . TRP A 1 86  ? 27.488  23.743  19.428  1.00 29.28  ? 86   TRP A CA  1 
ATOM   666  C C   . TRP A 1 86  ? 28.900  23.973  19.982  1.00 27.59  ? 86   TRP A C   1 
ATOM   667  O O   . TRP A 1 86  ? 29.666  23.020  20.147  1.00 25.82  ? 86   TRP A O   1 
ATOM   668  C CB  . TRP A 1 86  ? 27.557  23.371  17.942  1.00 32.10  ? 86   TRP A CB  1 
ATOM   669  C CG  . TRP A 1 86  ? 26.219  23.142  17.329  1.00 25.24  ? 86   TRP A CG  1 
ATOM   670  C CD1 . TRP A 1 86  ? 25.571  23.962  16.459  1.00 30.98  ? 86   TRP A CD1 1 
ATOM   671  C CD2 . TRP A 1 86  ? 25.347  22.026  17.556  1.00 28.20  ? 86   TRP A CD2 1 
ATOM   672  N NE1 . TRP A 1 86  ? 24.345  23.427  16.123  1.00 37.64  ? 86   TRP A NE1 1 
ATOM   673  C CE2 . TRP A 1 86  ? 24.184  22.241  16.788  1.00 32.41  ? 86   TRP A CE2 1 
ATOM   674  C CE3 . TRP A 1 86  ? 25.436  20.867  18.333  1.00 33.39  ? 86   TRP A CE3 1 
ATOM   675  C CZ2 . TRP A 1 86  ? 23.126  21.337  16.768  1.00 31.60  ? 86   TRP A CZ2 1 
ATOM   676  C CZ3 . TRP A 1 86  ? 24.367  19.972  18.324  1.00 26.81  ? 86   TRP A CZ3 1 
ATOM   677  C CH2 . TRP A 1 86  ? 23.237  20.211  17.547  1.00 27.50  ? 86   TRP A CH2 1 
ATOM   678  N N   . ASN A 1 87  ? 29.234  25.226  20.272  1.00 24.10  ? 87   ASN A N   1 
ATOM   679  C CA  . ASN A 1 87  ? 30.561  25.591  20.772  1.00 37.53  ? 87   ASN A CA  1 
ATOM   680  C C   . ASN A 1 87  ? 30.833  25.138  22.212  1.00 38.49  ? 87   ASN A C   1 
ATOM   681  O O   . ASN A 1 87  ? 29.899  25.013  23.007  1.00 33.26  ? 87   ASN A O   1 
ATOM   682  C CB  . ASN A 1 87  ? 30.771  27.105  20.656  1.00 30.68  ? 87   ASN A CB  1 
ATOM   683  C CG  . ASN A 1 87  ? 31.166  27.531  19.254  1.00 36.48  ? 87   ASN A CG  1 
ATOM   684  O OD1 . ASN A 1 87  ? 31.669  26.726  18.472  1.00 44.95  ? 87   ASN A OD1 1 
ATOM   685  N ND2 . ASN A 1 87  ? 30.954  28.804  18.935  1.00 35.27  ? 87   ASN A ND2 1 
ATOM   686  N N   . PRO A 1 88  ? 32.119  24.899  22.550  1.00 36.89  ? 88   PRO A N   1 
ATOM   687  C CA  . PRO A 1 88  ? 32.525  24.513  23.916  1.00 32.85  ? 88   PRO A CA  1 
ATOM   688  C C   . PRO A 1 88  ? 32.036  25.496  24.965  1.00 32.32  ? 88   PRO A C   1 
ATOM   689  O O   . PRO A 1 88  ? 32.164  26.706  24.780  1.00 30.29  ? 88   PRO A O   1 
ATOM   690  C CB  . PRO A 1 88  ? 34.055  24.560  23.864  1.00 25.08  ? 88   PRO A CB  1 
ATOM   691  C CG  . PRO A 1 88  ? 34.387  24.313  22.421  1.00 33.89  ? 88   PRO A CG  1 
ATOM   692  C CD  . PRO A 1 88  ? 33.259  24.921  21.612  1.00 32.72  ? 88   PRO A CD  1 
ATOM   693  N N   . ASN A 1 89  ? 31.485  24.972  26.053  1.00 28.16  ? 89   ASN A N   1 
ATOM   694  C CA  . ASN A 1 89  ? 30.951  25.805  27.116  1.00 31.59  ? 89   ASN A CA  1 
ATOM   695  C C   . ASN A 1 89  ? 31.742  25.618  28.425  1.00 33.11  ? 89   ASN A C   1 
ATOM   696  O O   . ASN A 1 89  ? 31.302  26.031  29.496  1.00 36.09  ? 89   ASN A O   1 
ATOM   697  C CB  . ASN A 1 89  ? 29.459  25.511  27.313  1.00 26.25  ? 89   ASN A CB  1 
ATOM   698  C CG  . ASN A 1 89  ? 29.206  24.086  27.762  1.00 30.54  ? 89   ASN A CG  1 
ATOM   699  O OD1 . ASN A 1 89  ? 30.069  23.216  27.609  1.00 28.64  ? 89   ASN A OD1 1 
ATOM   700  N ND2 . ASN A 1 89  ? 28.015  23.833  28.321  1.00 30.07  ? 89   ASN A ND2 1 
ATOM   701  N N   . ARG A 1 90  ? 32.908  24.987  28.317  1.00 27.05  ? 90   ARG A N   1 
ATOM   702  C CA  . ARG A 1 90  ? 33.857  24.858  29.421  1.00 28.86  ? 90   ARG A CA  1 
ATOM   703  C C   . ARG A 1 90  ? 35.244  25.065  28.842  1.00 32.38  ? 90   ARG A C   1 
ATOM   704  O O   . ARG A 1 90  ? 35.410  25.105  27.625  1.00 33.59  ? 90   ARG A O   1 
ATOM   705  C CB  . ARG A 1 90  ? 33.784  23.473  30.076  1.00 28.95  ? 90   ARG A CB  1 
ATOM   706  C CG  . ARG A 1 90  ? 32.483  23.188  30.780  1.00 32.69  ? 90   ARG A CG  1 
ATOM   707  C CD  . ARG A 1 90  ? 32.144  24.288  31.763  1.00 34.37  ? 90   ARG A CD  1 
ATOM   708  N NE  . ARG A 1 90  ? 32.337  23.870  33.135  1.00 50.05  ? 90   ARG A NE  1 
ATOM   709  C CZ  . ARG A 1 90  ? 32.395  24.718  34.155  1.00 65.58  ? 90   ARG A CZ  1 
ATOM   710  N NH1 . ARG A 1 90  ? 32.274  26.029  33.932  1.00 69.08  ? 90   ARG A NH1 1 
ATOM   711  N NH2 . ARG A 1 90  ? 32.579  24.259  35.391  1.00 61.09  ? 90   ARG A NH2 1 
ATOM   712  N N   . GLU A 1 91  ? 36.238  25.189  29.709  1.00 28.88  ? 91   GLU A N   1 
ATOM   713  C CA  . GLU A 1 91  ? 37.611  25.393  29.269  1.00 30.08  ? 91   GLU A CA  1 
ATOM   714  C C   . GLU A 1 91  ? 38.139  24.239  28.392  1.00 32.71  ? 91   GLU A C   1 
ATOM   715  O O   . GLU A 1 91  ? 37.860  23.054  28.648  1.00 32.64  ? 91   GLU A O   1 
ATOM   716  C CB  . GLU A 1 91  ? 38.504  25.571  30.488  1.00 30.55  ? 91   GLU A CB  1 
ATOM   717  C CG  . GLU A 1 91  ? 39.973  25.670  30.168  1.00 37.72  ? 91   GLU A CG  1 
ATOM   718  C CD  . GLU A 1 91  ? 40.825  25.741  31.419  1.00 43.94  ? 91   GLU A CD  1 
ATOM   719  O OE1 . GLU A 1 91  ? 40.266  26.072  32.484  1.00 37.74  ? 91   GLU A OE1 1 
ATOM   720  O OE2 . GLU A 1 91  ? 42.045  25.465  31.342  1.00 49.46  ? 91   GLU A OE2 1 
ATOM   721  N N   . LEU A 1 92  ? 38.892  24.596  27.354  1.00 25.62  ? 92   LEU A N   1 
ATOM   722  C CA  . LEU A 1 92  ? 39.543  23.617  26.491  1.00 30.22  ? 92   LEU A CA  1 
ATOM   723  C C   . LEU A 1 92  ? 40.816  23.079  27.141  1.00 28.46  ? 92   LEU A C   1 
ATOM   724  O O   . LEU A 1 92  ? 41.650  23.839  27.615  1.00 27.19  ? 92   LEU A O   1 
ATOM   725  C CB  . LEU A 1 92  ? 39.889  24.232  25.133  1.00 27.83  ? 92   LEU A CB  1 
ATOM   726  C CG  . LEU A 1 92  ? 38.748  24.787  24.274  1.00 30.33  ? 92   LEU A CG  1 
ATOM   727  C CD1 . LEU A 1 92  ? 39.288  25.227  22.931  1.00 25.48  ? 92   LEU A CD1 1 
ATOM   728  C CD2 . LEU A 1 92  ? 37.661  23.730  24.091  1.00 27.65  ? 92   LEU A CD2 1 
ATOM   729  N N   . SER A 1 93  ? 40.961  21.760  27.151  1.00 26.99  ? 93   SER A N   1 
ATOM   730  C CA  . SER A 1 93  ? 42.138  21.141  27.724  1.00 27.58  ? 93   SER A CA  1 
ATOM   731  C C   . SER A 1 93  ? 42.300  19.735  27.168  1.00 33.82  ? 93   SER A C   1 
ATOM   732  O O   . SER A 1 93  ? 41.312  19.086  26.801  1.00 30.96  ? 93   SER A O   1 
ATOM   733  C CB  . SER A 1 93  ? 42.020  21.080  29.253  1.00 27.24  ? 93   SER A CB  1 
ATOM   734  O OG  . SER A 1 93  ? 43.165  20.481  29.836  1.00 26.27  ? 93   SER A OG  1 
ATOM   735  N N   . GLU A 1 94  ? 43.544  19.266  27.107  1.00 27.04  ? 94   GLU A N   1 
ATOM   736  C CA  . GLU A 1 94  ? 43.787  17.867  26.801  1.00 25.82  ? 94   GLU A CA  1 
ATOM   737  C C   . GLU A 1 94  ? 43.366  17.021  27.990  1.00 28.53  ? 94   GLU A C   1 
ATOM   738  O O   . GLU A 1 94  ? 42.993  15.855  27.826  1.00 29.27  ? 94   GLU A O   1 
ATOM   739  C CB  . GLU A 1 94  ? 45.247  17.617  26.435  1.00 31.24  ? 94   GLU A CB  1 
ATOM   740  C CG  . GLU A 1 94  ? 45.627  18.191  25.079  1.00 34.51  ? 94   GLU A CG  1 
ATOM   741  C CD  . GLU A 1 94  ? 47.055  17.894  24.692  1.00 32.82  ? 94   GLU A CD  1 
ATOM   742  O OE1 . GLU A 1 94  ? 47.319  16.790  24.193  1.00 34.40  ? 94   GLU A OE1 1 
ATOM   743  O OE2 . GLU A 1 94  ? 47.916  18.766  24.874  1.00 37.15  ? 94   GLU A OE2 1 
ATOM   744  N N   . ASP A 1 95  ? 43.405  17.615  29.183  1.00 27.43  ? 95   ASP A N   1 
ATOM   745  C CA  . ASP A 1 95  ? 42.891  16.948  30.385  1.00 33.11  ? 95   ASP A CA  1 
ATOM   746  C C   . ASP A 1 95  ? 41.370  17.040  30.367  1.00 29.00  ? 95   ASP A C   1 
ATOM   747  O O   . ASP A 1 95  ? 40.797  17.957  30.959  1.00 24.69  ? 95   ASP A O   1 
ATOM   748  C CB  . ASP A 1 95  ? 43.439  17.627  31.646  1.00 29.32  ? 95   ASP A CB  1 
ATOM   749  C CG  . ASP A 1 95  ? 43.007  16.938  32.935  1.00 31.07  ? 95   ASP A CG  1 
ATOM   750  O OD1 . ASP A 1 95  ? 42.181  16.004  32.910  1.00 29.73  ? 95   ASP A OD1 1 
ATOM   751  O OD2 . ASP A 1 95  ? 43.503  17.347  34.000  1.00 44.43  ? 95   ASP A OD2 1 
ATOM   752  N N   . CYS A 1 96  ? 40.718  16.087  29.707  1.00 22.42  ? 96   CYS A N   1 
ATOM   753  C CA  . CYS A 1 96  ? 39.291  16.227  29.404  1.00 23.41  ? 96   CYS A CA  1 
ATOM   754  C C   . CYS A 1 96  ? 38.512  14.910  29.427  1.00 26.29  ? 96   CYS A C   1 
ATOM   755  O O   . CYS A 1 96  ? 37.349  14.861  29.003  1.00 24.40  ? 96   CYS A O   1 
ATOM   756  C CB  . CYS A 1 96  ? 39.124  16.852  28.016  1.00 27.00  ? 96   CYS A CB  1 
ATOM   757  S SG  . CYS A 1 96  ? 39.752  15.781  26.661  1.00 26.03  ? 96   CYS A SG  1 
ATOM   758  N N   . LEU A 1 97  ? 39.148  13.841  29.888  1.00 21.05  ? 97   LEU A N   1 
ATOM   759  C CA  . LEU A 1 97  ? 38.487  12.541  29.884  1.00 31.45  ? 97   LEU A CA  1 
ATOM   760  C C   . LEU A 1 97  ? 37.597  12.333  31.127  1.00 28.46  ? 97   LEU A C   1 
ATOM   761  O O   . LEU A 1 97  ? 37.972  11.671  32.091  1.00 30.12  ? 97   LEU A O   1 
ATOM   762  C CB  . LEU A 1 97  ? 39.504  11.414  29.661  1.00 22.52  ? 97   LEU A CB  1 
ATOM   763  C CG  . LEU A 1 97  ? 40.093  11.463  28.238  1.00 29.06  ? 97   LEU A CG  1 
ATOM   764  C CD1 . LEU A 1 97  ? 41.063  10.315  27.946  1.00 28.30  ? 97   LEU A CD1 1 
ATOM   765  C CD2 . LEU A 1 97  ? 38.995  11.512  27.158  1.00 24.69  ? 97   LEU A CD2 1 
ATOM   766  N N   . TYR A 1 98  ? 36.412  12.928  31.076  1.00 25.03  ? 98   TYR A N   1 
ATOM   767  C CA  . TYR A 1 98  ? 35.458  12.904  32.178  1.00 28.49  ? 98   TYR A CA  1 
ATOM   768  C C   . TYR A 1 98  ? 34.092  12.511  31.640  1.00 26.93  ? 98   TYR A C   1 
ATOM   769  O O   . TYR A 1 98  ? 33.824  12.673  30.452  1.00 26.39  ? 98   TYR A O   1 
ATOM   770  C CB  . TYR A 1 98  ? 35.386  14.288  32.851  1.00 30.98  ? 98   TYR A CB  1 
ATOM   771  C CG  . TYR A 1 98  ? 36.715  14.728  33.409  1.00 28.45  ? 98   TYR A CG  1 
ATOM   772  C CD1 . TYR A 1 98  ? 37.633  15.407  32.615  1.00 27.04  ? 98   TYR A CD1 1 
ATOM   773  C CD2 . TYR A 1 98  ? 37.068  14.435  34.725  1.00 25.74  ? 98   TYR A CD2 1 
ATOM   774  C CE1 . TYR A 1 98  ? 38.865  15.788  33.114  1.00 29.10  ? 98   TYR A CE1 1 
ATOM   775  C CE2 . TYR A 1 98  ? 38.301  14.812  35.236  1.00 33.02  ? 98   TYR A CE2 1 
ATOM   776  C CZ  . TYR A 1 98  ? 39.191  15.489  34.424  1.00 35.44  ? 98   TYR A CZ  1 
ATOM   777  O OH  . TYR A 1 98  ? 40.412  15.861  34.916  1.00 33.82  ? 98   TYR A OH  1 
ATOM   778  N N   . LEU A 1 99  ? 33.232  11.991  32.503  1.00 26.60  ? 99   LEU A N   1 
ATOM   779  C CA  . LEU A 1 99  ? 31.880  11.629  32.083  1.00 25.85  ? 99   LEU A CA  1 
ATOM   780  C C   . LEU A 1 99  ? 30.840  12.139  33.080  1.00 27.63  ? 99   LEU A C   1 
ATOM   781  O O   . LEU A 1 99  ? 31.176  12.537  34.195  1.00 30.99  ? 99   LEU A O   1 
ATOM   782  C CB  . LEU A 1 99  ? 31.755  10.111  31.853  1.00 21.70  ? 99   LEU A CB  1 
ATOM   783  C CG  . LEU A 1 99  ? 32.063  9.116   32.988  1.00 25.68  ? 99   LEU A CG  1 
ATOM   784  C CD1 . LEU A 1 99  ? 30.942  9.034   34.036  1.00 20.68  ? 99   LEU A CD1 1 
ATOM   785  C CD2 . LEU A 1 99  ? 32.337  7.723   32.435  1.00 26.46  ? 99   LEU A CD2 1 
ATOM   786  N N   . ASN A 1 100 ? 29.578  12.084  32.679  1.00 28.32  ? 100  ASN A N   1 
ATOM   787  C CA  . ASN A 1 100 ? 28.483  12.648  33.451  1.00 27.50  ? 100  ASN A CA  1 
ATOM   788  C C   . ASN A 1 100 ? 27.376  11.628  33.613  1.00 28.76  ? 100  ASN A C   1 
ATOM   789  O O   . ASN A 1 100 ? 27.122  10.836  32.712  1.00 30.36  ? 100  ASN A O   1 
ATOM   790  C CB  . ASN A 1 100 ? 27.908  13.875  32.737  1.00 20.43  ? 100  ASN A CB  1 
ATOM   791  C CG  . ASN A 1 100 ? 28.988  14.839  32.263  1.00 33.52  ? 100  ASN A CG  1 
ATOM   792  O OD1 . ASN A 1 100 ? 29.668  15.481  33.070  1.00 32.05  ? 100  ASN A OD1 1 
ATOM   793  N ND2 . ASN A 1 100 ? 29.132  14.965  30.945  1.00 29.83  ? 100  ASN A ND2 1 
ATOM   794  N N   . VAL A 1 101 ? 26.706  11.665  34.760  1.00 29.47  ? 101  VAL A N   1 
ATOM   795  C CA  . VAL A 1 101 ? 25.598  10.767  35.033  1.00 29.01  ? 101  VAL A CA  1 
ATOM   796  C C   . VAL A 1 101 ? 24.410  11.527  35.596  1.00 31.44  ? 101  VAL A C   1 
ATOM   797  O O   . VAL A 1 101 ? 24.564  12.290  36.542  1.00 33.99  ? 101  VAL A O   1 
ATOM   798  C CB  . VAL A 1 101 ? 25.990  9.704   36.074  1.00 28.89  ? 101  VAL A CB  1 
ATOM   799  C CG1 . VAL A 1 101 ? 24.757  8.872   36.473  1.00 24.40  ? 101  VAL A CG1 1 
ATOM   800  C CG2 . VAL A 1 101 ? 27.116  8.829   35.550  1.00 22.00  ? 101  VAL A CG2 1 
ATOM   801  N N   . TRP A 1 102 ? 23.230  11.309  35.022  1.00 28.67  ? 102  TRP A N   1 
ATOM   802  C CA  . TRP A 1 102 ? 21.992  11.848  35.572  1.00 26.47  ? 102  TRP A CA  1 
ATOM   803  C C   . TRP A 1 102 ? 21.106  10.676  35.960  1.00 31.48  ? 102  TRP A C   1 
ATOM   804  O O   . TRP A 1 102 ? 20.992  9.700   35.206  1.00 32.16  ? 102  TRP A O   1 
ATOM   805  C CB  . TRP A 1 102 ? 21.228  12.677  34.538  1.00 28.47  ? 102  TRP A CB  1 
ATOM   806  C CG  . TRP A 1 102 ? 21.798  14.007  34.132  1.00 30.07  ? 102  TRP A CG  1 
ATOM   807  C CD1 . TRP A 1 102 ? 21.449  15.237  34.627  1.00 32.07  ? 102  TRP A CD1 1 
ATOM   808  C CD2 . TRP A 1 102 ? 22.752  14.255  33.087  1.00 29.20  ? 102  TRP A CD2 1 
ATOM   809  N NE1 . TRP A 1 102 ? 22.146  16.229  33.971  1.00 31.22  ? 102  TRP A NE1 1 
ATOM   810  C CE2 . TRP A 1 102 ? 22.951  15.654  33.022  1.00 30.96  ? 102  TRP A CE2 1 
ATOM   811  C CE3 . TRP A 1 102 ? 23.452  13.434  32.200  1.00 27.16  ? 102  TRP A CE3 1 
ATOM   812  C CZ2 . TRP A 1 102 ? 23.831  16.246  32.110  1.00 31.75  ? 102  TRP A CZ2 1 
ATOM   813  C CZ3 . TRP A 1 102 ? 24.330  14.020  31.299  1.00 30.72  ? 102  TRP A CZ3 1 
ATOM   814  C CH2 . TRP A 1 102 ? 24.512  15.415  31.261  1.00 35.09  ? 102  TRP A CH2 1 
ATOM   815  N N   . THR A 1 103 ? 20.473  10.768  37.128  1.00 28.49  ? 103  THR A N   1 
ATOM   816  C CA  . THR A 1 103 ? 19.566  9.728   37.598  1.00 27.34  ? 103  THR A CA  1 
ATOM   817  C C   . THR A 1 103 ? 18.380  10.403  38.271  1.00 32.74  ? 103  THR A C   1 
ATOM   818  O O   . THR A 1 103 ? 18.474  11.569  38.659  1.00 30.18  ? 103  THR A O   1 
ATOM   819  C CB  . THR A 1 103 ? 20.218  8.821   38.673  1.00 30.87  ? 103  THR A CB  1 
ATOM   820  O OG1 . THR A 1 103 ? 20.376  9.567   39.886  1.00 31.61  ? 103  THR A OG1 1 
ATOM   821  C CG2 . THR A 1 103 ? 21.567  8.312   38.233  1.00 33.71  ? 103  THR A CG2 1 
ATOM   822  N N   . PRO A 1 104 ? 17.261  9.672   38.410  1.00 31.49  ? 104  PRO A N   1 
ATOM   823  C CA  . PRO A 1 104 ? 16.143  10.099  39.253  1.00 37.27  ? 104  PRO A CA  1 
ATOM   824  C C   . PRO A 1 104 ? 16.604  10.526  40.646  1.00 39.19  ? 104  PRO A C   1 
ATOM   825  O O   . PRO A 1 104 ? 17.627  10.048  41.119  1.00 43.83  ? 104  PRO A O   1 
ATOM   826  C CB  . PRO A 1 104 ? 15.294  8.828   39.360  1.00 32.11  ? 104  PRO A CB  1 
ATOM   827  C CG  . PRO A 1 104 ? 15.499  8.163   38.044  1.00 38.23  ? 104  PRO A CG  1 
ATOM   828  C CD  . PRO A 1 104 ? 16.938  8.445   37.656  1.00 33.68  ? 104  PRO A CD  1 
ATOM   829  N N   . TYR A 1 105 ? 15.864  11.432  41.276  1.00 36.23  ? 105  TYR A N   1 
ATOM   830  C CA  . TYR A 1 105 ? 16.122  11.799  42.659  1.00 35.75  ? 105  TYR A CA  1 
ATOM   831  C C   . TYR A 1 105 ? 14.869  11.522  43.456  1.00 40.46  ? 105  TYR A C   1 
ATOM   832  O O   . TYR A 1 105 ? 13.800  12.066  43.147  1.00 39.30  ? 105  TYR A O   1 
ATOM   833  C CB  . TYR A 1 105 ? 16.473  13.273  42.770  1.00 35.17  ? 105  TYR A CB  1 
ATOM   834  C CG  . TYR A 1 105 ? 16.820  13.765  44.160  1.00 34.40  ? 105  TYR A CG  1 
ATOM   835  C CD1 . TYR A 1 105 ? 15.826  14.037  45.104  1.00 36.28  ? 105  TYR A CD1 1 
ATOM   836  C CD2 . TYR A 1 105 ? 18.140  14.002  44.515  1.00 41.96  ? 105  TYR A CD2 1 
ATOM   837  C CE1 . TYR A 1 105 ? 16.145  14.515  46.372  1.00 37.28  ? 105  TYR A CE1 1 
ATOM   838  C CE2 . TYR A 1 105 ? 18.470  14.482  45.780  1.00 34.62  ? 105  TYR A CE2 1 
ATOM   839  C CZ  . TYR A 1 105 ? 17.471  14.737  46.700  1.00 37.17  ? 105  TYR A CZ  1 
ATOM   840  O OH  . TYR A 1 105 ? 17.813  15.213  47.946  1.00 37.57  ? 105  TYR A OH  1 
ATOM   841  N N   . PRO A 1 106 ? 14.983  10.667  44.482  1.00 44.33  ? 106  PRO A N   1 
ATOM   842  C CA  . PRO A 1 106 ? 16.191  9.918   44.861  1.00 39.82  ? 106  PRO A CA  1 
ATOM   843  C C   . PRO A 1 106 ? 16.502  8.825   43.849  1.00 41.97  ? 106  PRO A C   1 
ATOM   844  O O   . PRO A 1 106 ? 15.639  8.530   43.021  1.00 42.09  ? 106  PRO A O   1 
ATOM   845  C CB  . PRO A 1 106 ? 15.796  9.278   46.193  1.00 42.90  ? 106  PRO A CB  1 
ATOM   846  C CG  . PRO A 1 106 ? 14.304  9.173   46.128  1.00 43.70  ? 106  PRO A CG  1 
ATOM   847  C CD  . PRO A 1 106 ? 13.844  10.379  45.374  1.00 43.97  ? 106  PRO A CD  1 
ATOM   848  N N   . ARG A 1 107 ? 17.703  8.249   43.908  1.00 43.42  ? 107  ARG A N   1 
ATOM   849  C CA  . ARG A 1 107 ? 18.126  7.237   42.933  1.00 38.17  ? 107  ARG A CA  1 
ATOM   850  C C   . ARG A 1 107 ? 17.134  6.081   42.890  1.00 36.19  ? 107  ARG A C   1 
ATOM   851  O O   . ARG A 1 107 ? 16.425  5.848   43.852  1.00 45.75  ? 107  ARG A O   1 
ATOM   852  C CB  . ARG A 1 107 ? 19.553  6.757   43.219  1.00 36.26  ? 107  ARG A CB  1 
ATOM   853  C CG  . ARG A 1 107 ? 20.605  7.857   43.019  1.00 49.57  ? 107  ARG A CG  1 
ATOM   854  C CD  . ARG A 1 107 ? 22.011  7.296   43.089  1.00 52.22  ? 107  ARG A CD  1 
ATOM   855  N NE  . ARG A 1 107 ? 22.230  6.526   44.311  1.00 45.32  ? 107  ARG A NE  1 
ATOM   856  C CZ  . ARG A 1 107 ? 22.581  7.082   45.461  1.00 42.36  ? 107  ARG A CZ  1 
ATOM   857  N NH1 . ARG A 1 107 ? 22.748  8.393   45.517  1.00 35.18  ? 107  ARG A NH1 1 
ATOM   858  N NH2 . ARG A 1 107 ? 22.770  6.336   46.545  1.00 48.76  ? 107  ARG A NH2 1 
ATOM   859  N N   . PRO A 1 108 ? 17.049  5.386   41.748  1.00 42.77  ? 108  PRO A N   1 
ATOM   860  C CA  . PRO A 1 108 ? 16.027  4.350   41.570  1.00 45.40  ? 108  PRO A CA  1 
ATOM   861  C C   . PRO A 1 108 ? 16.194  3.163   42.519  1.00 50.33  ? 108  PRO A C   1 
ATOM   862  O O   . PRO A 1 108 ? 17.318  2.804   42.880  1.00 46.53  ? 108  PRO A O   1 
ATOM   863  C CB  . PRO A 1 108 ? 16.250  3.881   40.126  1.00 40.65  ? 108  PRO A CB  1 
ATOM   864  C CG  . PRO A 1 108 ? 16.996  4.970   39.468  1.00 38.18  ? 108  PRO A CG  1 
ATOM   865  C CD  . PRO A 1 108 ? 17.832  5.609   40.518  1.00 39.87  ? 108  PRO A CD  1 
ATOM   866  N N   . ALA A 1 109 ? 15.070  2.559   42.896  1.00 57.72  ? 109  ALA A N   1 
ATOM   867  C CA  . ALA A 1 109 ? 15.056  1.393   43.771  1.00 68.44  ? 109  ALA A CA  1 
ATOM   868  C C   . ALA A 1 109 ? 15.623  0.157   43.074  1.00 70.11  ? 109  ALA A C   1 
ATOM   869  O O   . ALA A 1 109 ? 16.517  -0.510  43.591  1.00 71.22  ? 109  ALA A O   1 
ATOM   870  C CB  . ALA A 1 109 ? 13.635  1.118   44.240  1.00 73.77  ? 109  ALA A CB  1 
ATOM   871  N N   . SER A 1 110 ? 15.083  -0.138  41.897  1.00 65.14  ? 110  SER A N   1 
ATOM   872  C CA  . SER A 1 110 ? 15.463  -1.310  41.123  1.00 55.55  ? 110  SER A CA  1 
ATOM   873  C C   . SER A 1 110 ? 16.381  -0.905  39.966  1.00 51.23  ? 110  SER A C   1 
ATOM   874  O O   . SER A 1 110 ? 16.430  0.265   39.594  1.00 48.15  ? 110  SER A O   1 
ATOM   875  C CB  . SER A 1 110 ? 14.195  -1.964  40.591  1.00 54.21  ? 110  SER A CB  1 
ATOM   876  O OG  . SER A 1 110 ? 13.244  -0.966  40.273  1.00 59.99  ? 110  SER A OG  1 
ATOM   877  N N   . PRO A 1 111 ? 17.119  -1.870  39.396  1.00 46.99  ? 111  PRO A N   1 
ATOM   878  C CA  . PRO A 1 111 ? 18.024  -1.541  38.287  1.00 41.05  ? 111  PRO A CA  1 
ATOM   879  C C   . PRO A 1 111 ? 17.288  -0.996  37.052  1.00 42.87  ? 111  PRO A C   1 
ATOM   880  O O   . PRO A 1 111 ? 16.347  -1.603  36.545  1.00 46.79  ? 111  PRO A O   1 
ATOM   881  C CB  . PRO A 1 111 ? 18.702  -2.881  37.975  1.00 43.08  ? 111  PRO A CB  1 
ATOM   882  C CG  . PRO A 1 111 ? 18.582  -3.667  39.244  1.00 42.08  ? 111  PRO A CG  1 
ATOM   883  C CD  . PRO A 1 111 ? 17.267  -3.270  39.835  1.00 42.85  ? 111  PRO A CD  1 
ATOM   884  N N   . THR A 1 112 ? 17.754  0.150   36.576  1.00 38.68  ? 112  THR A N   1 
ATOM   885  C CA  . THR A 1 112 ? 17.081  0.931   35.560  1.00 35.72  ? 112  THR A CA  1 
ATOM   886  C C   . THR A 1 112 ? 17.886  0.939   34.266  1.00 30.32  ? 112  THR A C   1 
ATOM   887  O O   . THR A 1 112 ? 19.102  1.141   34.297  1.00 30.17  ? 112  THR A O   1 
ATOM   888  C CB  . THR A 1 112 ? 16.953  2.388   36.050  1.00 38.86  ? 112  THR A CB  1 
ATOM   889  O OG1 . THR A 1 112 ? 16.231  2.411   37.286  1.00 47.51  ? 112  THR A OG1 1 
ATOM   890  C CG2 . THR A 1 112 ? 16.243  3.257   35.024  1.00 32.65  ? 112  THR A CG2 1 
ATOM   891  N N   . PRO A 1 113 ? 17.208  0.736   33.124  1.00 32.16  ? 113  PRO A N   1 
ATOM   892  C CA  . PRO A 1 113 ? 17.857  0.793   31.809  1.00 30.97  ? 113  PRO A CA  1 
ATOM   893  C C   . PRO A 1 113 ? 18.650  2.078   31.630  1.00 35.95  ? 113  PRO A C   1 
ATOM   894  O O   . PRO A 1 113 ? 18.177  3.158   31.988  1.00 35.26  ? 113  PRO A O   1 
ATOM   895  C CB  . PRO A 1 113 ? 16.680  0.743   30.839  1.00 33.17  ? 113  PRO A CB  1 
ATOM   896  C CG  . PRO A 1 113 ? 15.624  -0.030  31.585  1.00 33.74  ? 113  PRO A CG  1 
ATOM   897  C CD  . PRO A 1 113 ? 15.792  0.332   33.028  1.00 37.19  ? 113  PRO A CD  1 
ATOM   898  N N   . VAL A 1 114 ? 19.857  1.939   31.090  1.00 34.14  ? 114  VAL A N   1 
ATOM   899  C CA  . VAL A 1 114 ? 20.811  3.029   30.976  1.00 28.62  ? 114  VAL A CA  1 
ATOM   900  C C   . VAL A 1 114 ? 20.926  3.502   29.534  1.00 28.57  ? 114  VAL A C   1 
ATOM   901  O O   . VAL A 1 114 ? 20.954  2.684   28.621  1.00 27.24  ? 114  VAL A O   1 
ATOM   902  C CB  . VAL A 1 114 ? 22.215  2.551   31.413  1.00 31.03  ? 114  VAL A CB  1 
ATOM   903  C CG1 . VAL A 1 114 ? 23.252  3.683   31.261  1.00 23.60  ? 114  VAL A CG1 1 
ATOM   904  C CG2 . VAL A 1 114 ? 22.171  2.007   32.834  1.00 25.77  ? 114  VAL A CG2 1 
ATOM   905  N N   . LEU A 1 115 ? 20.998  4.815   29.330  1.00 28.01  ? 115  LEU A N   1 
ATOM   906  C CA  . LEU A 1 115 ? 21.267  5.377   28.008  1.00 23.28  ? 115  LEU A CA  1 
ATOM   907  C C   . LEU A 1 115 ? 22.620  6.058   28.023  1.00 26.68  ? 115  LEU A C   1 
ATOM   908  O O   . LEU A 1 115 ? 22.910  6.836   28.936  1.00 25.22  ? 115  LEU A O   1 
ATOM   909  C CB  . LEU A 1 115 ? 20.203  6.401   27.630  1.00 33.03  ? 115  LEU A CB  1 
ATOM   910  C CG  . LEU A 1 115 ? 18.815  5.879   27.289  1.00 41.65  ? 115  LEU A CG  1 
ATOM   911  C CD1 . LEU A 1 115 ? 17.881  7.039   27.064  1.00 40.44  ? 115  LEU A CD1 1 
ATOM   912  C CD2 . LEU A 1 115 ? 18.913  5.042   26.048  1.00 47.59  ? 115  LEU A CD2 1 
ATOM   913  N N   . ILE A 1 116 ? 23.452  5.762   27.027  1.00 24.68  ? 116  ILE A N   1 
ATOM   914  C CA  . ILE A 1 116 ? 24.760  6.395   26.930  1.00 26.11  ? 116  ILE A CA  1 
ATOM   915  C C   . ILE A 1 116 ? 24.843  7.218   25.661  1.00 33.19  ? 116  ILE A C   1 
ATOM   916  O O   . ILE A 1 116 ? 24.743  6.666   24.562  1.00 25.90  ? 116  ILE A O   1 
ATOM   917  C CB  . ILE A 1 116 ? 25.896  5.382   26.878  1.00 24.36  ? 116  ILE A CB  1 
ATOM   918  C CG1 . ILE A 1 116 ? 25.848  4.455   28.089  1.00 24.88  ? 116  ILE A CG1 1 
ATOM   919  C CG2 . ILE A 1 116 ? 27.211  6.117   26.829  1.00 24.23  ? 116  ILE A CG2 1 
ATOM   920  C CD1 . ILE A 1 116 ? 26.925  3.422   28.088  1.00 22.86  ? 116  ILE A CD1 1 
ATOM   921  N N   . TRP A 1 117 ? 25.018  8.531   25.818  1.00 19.75  ? 117  TRP A N   1 
ATOM   922  C CA  . TRP A 1 117 ? 25.068  9.436   24.689  1.00 21.71  ? 117  TRP A CA  1 
ATOM   923  C C   . TRP A 1 117 ? 26.490  9.609   24.176  1.00 27.78  ? 117  TRP A C   1 
ATOM   924  O O   . TRP A 1 117 ? 27.422  9.777   24.958  1.00 21.74  ? 117  TRP A O   1 
ATOM   925  C CB  . TRP A 1 117 ? 24.528  10.799  25.089  1.00 20.04  ? 117  TRP A CB  1 
ATOM   926  C CG  . TRP A 1 117 ? 24.652  11.864  24.001  1.00 26.43  ? 117  TRP A CG  1 
ATOM   927  C CD1 . TRP A 1 117 ? 25.509  12.933  23.984  1.00 28.42  ? 117  TRP A CD1 1 
ATOM   928  C CD2 . TRP A 1 117 ? 23.874  11.960  22.805  1.00 25.78  ? 117  TRP A CD2 1 
ATOM   929  N NE1 . TRP A 1 117 ? 25.311  13.686  22.851  1.00 32.74  ? 117  TRP A NE1 1 
ATOM   930  C CE2 . TRP A 1 117 ? 24.306  13.114  22.114  1.00 31.13  ? 117  TRP A CE2 1 
ATOM   931  C CE3 . TRP A 1 117 ? 22.846  11.185  22.252  1.00 25.24  ? 117  TRP A CE3 1 
ATOM   932  C CZ2 . TRP A 1 117 ? 23.745  13.510  20.896  1.00 28.11  ? 117  TRP A CZ2 1 
ATOM   933  C CZ3 . TRP A 1 117 ? 22.286  11.583  21.037  1.00 22.23  ? 117  TRP A CZ3 1 
ATOM   934  C CH2 . TRP A 1 117 ? 22.742  12.727  20.374  1.00 24.12  ? 117  TRP A CH2 1 
ATOM   935  N N   . ILE A 1 118 ? 26.653  9.587   22.859  1.00 25.00  ? 118  ILE A N   1 
ATOM   936  C CA  . ILE A 1 118 ? 27.937  9.940   22.273  1.00 23.66  ? 118  ILE A CA  1 
ATOM   937  C C   . ILE A 1 118 ? 27.754  11.102  21.301  1.00 25.13  ? 118  ILE A C   1 
ATOM   938  O O   . ILE A 1 118 ? 27.166  10.925  20.228  1.00 27.04  ? 118  ILE A O   1 
ATOM   939  C CB  . ILE A 1 118 ? 28.558  8.752   21.524  1.00 21.44  ? 118  ILE A CB  1 
ATOM   940  C CG1 . ILE A 1 118 ? 28.528  7.493   22.394  1.00 19.13  ? 118  ILE A CG1 1 
ATOM   941  C CG2 . ILE A 1 118 ? 29.985  9.090   21.112  1.00 21.73  ? 118  ILE A CG2 1 
ATOM   942  C CD1 . ILE A 1 118 ? 29.165  6.284   21.722  1.00 19.37  ? 118  ILE A CD1 1 
ATOM   943  N N   . TYR A 1 119 ? 28.256  12.282  21.665  1.00 18.11  ? 119  TYR A N   1 
ATOM   944  C CA  . TYR A 1 119 ? 28.089  13.471  20.815  1.00 20.70  ? 119  TYR A CA  1 
ATOM   945  C C   . TYR A 1 119 ? 28.773  13.397  19.435  1.00 24.46  ? 119  TYR A C   1 
ATOM   946  O O   . TYR A 1 119 ? 29.770  12.681  19.242  1.00 18.61  ? 119  TYR A O   1 
ATOM   947  C CB  . TYR A 1 119 ? 28.539  14.748  21.535  1.00 18.30  ? 119  TYR A CB  1 
ATOM   948  C CG  . TYR A 1 119 ? 30.005  14.762  21.945  1.00 31.53  ? 119  TYR A CG  1 
ATOM   949  C CD1 . TYR A 1 119 ? 31.026  15.008  21.010  1.00 25.43  ? 119  TYR A CD1 1 
ATOM   950  C CD2 . TYR A 1 119 ? 30.366  14.547  23.278  1.00 17.90  ? 119  TYR A CD2 1 
ATOM   951  C CE1 . TYR A 1 119 ? 32.376  15.020  21.403  1.00 26.01  ? 119  TYR A CE1 1 
ATOM   952  C CE2 . TYR A 1 119 ? 31.678  14.554  23.675  1.00 22.05  ? 119  TYR A CE2 1 
ATOM   953  C CZ  . TYR A 1 119 ? 32.685  14.792  22.745  1.00 27.78  ? 119  TYR A CZ  1 
ATOM   954  O OH  . TYR A 1 119 ? 33.983  14.779  23.192  1.00 25.21  ? 119  TYR A OH  1 
ATOM   955  N N   . GLY A 1 120 ? 28.228  14.170  18.495  1.00 20.27  ? 120  GLY A N   1 
ATOM   956  C CA  . GLY A 1 120 ? 28.831  14.384  17.190  1.00 22.59  ? 120  GLY A CA  1 
ATOM   957  C C   . GLY A 1 120 ? 29.632  15.683  17.105  1.00 24.73  ? 120  GLY A C   1 
ATOM   958  O O   . GLY A 1 120 ? 29.921  16.330  18.126  1.00 25.93  ? 120  GLY A O   1 
ATOM   959  N N   . GLY A 1 121 ? 29.973  16.075  15.881  1.00 23.49  ? 121  GLY A N   1 
ATOM   960  C CA  . GLY A 1 121 ? 30.887  17.182  15.646  1.00 28.78  ? 121  GLY A CA  1 
ATOM   961  C C   . GLY A 1 121 ? 32.073  16.831  14.755  1.00 30.36  ? 121  GLY A C   1 
ATOM   962  O O   . GLY A 1 121 ? 33.167  17.358  14.954  1.00 28.41  ? 121  GLY A O   1 
ATOM   963  N N   . GLY A 1 122 ? 31.860  15.921  13.804  1.00 23.63  ? 122  GLY A N   1 
ATOM   964  C CA  . GLY A 1 122 ? 32.821  15.624  12.753  1.00 27.17  ? 122  GLY A CA  1 
ATOM   965  C C   . GLY A 1 122 ? 34.129  15.035  13.245  1.00 30.92  ? 122  GLY A C   1 
ATOM   966  O O   . GLY A 1 122 ? 35.137  15.118  12.545  1.00 29.67  ? 122  GLY A O   1 
ATOM   967  N N   . PHE A 1 123 ? 34.111  14.462  14.452  1.00 22.87  ? 123  PHE A N   1 
ATOM   968  C CA  . PHE A 1 123 ? 35.316  13.934  15.108  1.00 21.98  ? 123  PHE A CA  1 
ATOM   969  C C   . PHE A 1 123 ? 36.385  15.019  15.379  1.00 21.84  ? 123  PHE A C   1 
ATOM   970  O O   . PHE A 1 123 ? 37.518  14.713  15.744  1.00 27.26  ? 123  PHE A O   1 
ATOM   971  C CB  . PHE A 1 123 ? 35.914  12.756  14.320  1.00 22.93  ? 123  PHE A CB  1 
ATOM   972  C CG  . PHE A 1 123 ? 35.017  11.537  14.247  1.00 20.17  ? 123  PHE A CG  1 
ATOM   973  C CD1 . PHE A 1 123 ? 34.850  10.709  15.355  1.00 19.79  ? 123  PHE A CD1 1 
ATOM   974  C CD2 . PHE A 1 123 ? 34.378  11.199  13.065  1.00 19.66  ? 123  PHE A CD2 1 
ATOM   975  C CE1 . PHE A 1 123 ? 34.044  9.582   15.291  1.00 24.73  ? 123  PHE A CE1 1 
ATOM   976  C CE2 . PHE A 1 123 ? 33.564  10.083  12.989  1.00 30.36  ? 123  PHE A CE2 1 
ATOM   977  C CZ  . PHE A 1 123 ? 33.392  9.270   14.101  1.00 31.81  ? 123  PHE A CZ  1 
ATOM   978  N N   . TYR A 1 124 ? 36.021  16.287  15.207  1.00 21.58  ? 124  TYR A N   1 
ATOM   979  C CA  . TYR A 1 124 ? 36.929  17.385  15.529  1.00 32.03  ? 124  TYR A CA  1 
ATOM   980  C C   . TYR A 1 124 ? 36.344  18.373  16.565  1.00 26.98  ? 124  TYR A C   1 
ATOM   981  O O   . TYR A 1 124 ? 36.948  19.393  16.879  1.00 26.86  ? 124  TYR A O   1 
ATOM   982  C CB  . TYR A 1 124 ? 37.328  18.138  14.251  1.00 34.17  ? 124  TYR A CB  1 
ATOM   983  C CG  . TYR A 1 124 ? 36.231  19.033  13.729  1.00 32.53  ? 124  TYR A CG  1 
ATOM   984  C CD1 . TYR A 1 124 ? 36.101  20.345  14.180  1.00 29.63  ? 124  TYR A CD1 1 
ATOM   985  C CD2 . TYR A 1 124 ? 35.309  18.560  12.795  1.00 32.03  ? 124  TYR A CD2 1 
ATOM   986  C CE1 . TYR A 1 124 ? 35.090  21.164  13.715  1.00 31.97  ? 124  TYR A CE1 1 
ATOM   987  C CE2 . TYR A 1 124 ? 34.297  19.373  12.316  1.00 32.10  ? 124  TYR A CE2 1 
ATOM   988  C CZ  . TYR A 1 124 ? 34.192  20.676  12.780  1.00 34.40  ? 124  TYR A CZ  1 
ATOM   989  O OH  . TYR A 1 124 ? 33.188  21.490  12.317  1.00 32.61  ? 124  TYR A OH  1 
ATOM   990  N N   . SER A 1 125 ? 35.161  18.090  17.084  1.00 24.37  ? 125  SER A N   1 
ATOM   991  C CA  . SER A 1 125 ? 34.548  19.012  18.025  1.00 23.25  ? 125  SER A CA  1 
ATOM   992  C C   . SER A 1 125 ? 33.465  18.308  18.800  1.00 24.94  ? 125  SER A C   1 
ATOM   993  O O   . SER A 1 125 ? 33.136  17.153  18.507  1.00 22.17  ? 125  SER A O   1 
ATOM   994  C CB  . SER A 1 125 ? 33.950  20.213  17.297  1.00 21.35  ? 125  SER A CB  1 
ATOM   995  O OG  . SER A 1 125 ? 32.972  19.781  16.364  1.00 27.23  ? 125  SER A OG  1 
ATOM   996  N N   . GLY A 1 126 ? 32.889  19.019  19.762  1.00 22.95  ? 126  GLY A N   1 
ATOM   997  C CA  . GLY A 1 126 ? 31.839  18.443  20.581  1.00 29.13  ? 126  GLY A CA  1 
ATOM   998  C C   . GLY A 1 126 ? 32.226  18.328  22.047  1.00 29.64  ? 126  GLY A C   1 
ATOM   999  O O   . GLY A 1 126 ? 33.404  18.449  22.422  1.00 27.56  ? 126  GLY A O   1 
ATOM   1000 N N   . ALA A 1 127 ? 31.212  18.089  22.868  1.00 25.71  ? 127  ALA A N   1 
ATOM   1001 C CA  . ALA A 1 127 ? 31.331  18.062  24.318  1.00 26.52  ? 127  ALA A CA  1 
ATOM   1002 C C   . ALA A 1 127 ? 30.038  17.502  24.904  1.00 25.29  ? 127  ALA A C   1 
ATOM   1003 O O   . ALA A 1 127 ? 28.944  17.766  24.387  1.00 24.17  ? 127  ALA A O   1 
ATOM   1004 C CB  . ALA A 1 127 ? 31.565  19.466  24.845  1.00 27.85  ? 127  ALA A CB  1 
ATOM   1005 N N   . ALA A 1 128 ? 30.153  16.752  25.994  1.00 20.58  ? 128  ALA A N   1 
ATOM   1006 C CA  . ALA A 1 128 ? 28.981  16.134  26.589  1.00 24.72  ? 128  ALA A CA  1 
ATOM   1007 C C   . ALA A 1 128 ? 28.256  17.147  27.470  1.00 29.19  ? 128  ALA A C   1 
ATOM   1008 O O   . ALA A 1 128 ? 27.158  16.894  27.961  1.00 28.43  ? 128  ALA A O   1 
ATOM   1009 C CB  . ALA A 1 128 ? 29.366  14.867  27.376  1.00 20.44  ? 128  ALA A CB  1 
ATOM   1010 N N   . SER A 1 129 ? 28.870  18.310  27.645  1.00 24.98  ? 129  SER A N   1 
ATOM   1011 C CA  . SER A 1 129 ? 28.350  19.303  28.575  1.00 29.12  ? 129  SER A CA  1 
ATOM   1012 C C   . SER A 1 129 ? 27.425  20.346  27.941  1.00 30.95  ? 129  SER A C   1 
ATOM   1013 O O   . SER A 1 129 ? 26.946  21.237  28.640  1.00 28.43  ? 129  SER A O   1 
ATOM   1014 C CB  . SER A 1 129 ? 29.507  20.014  29.289  1.00 23.90  ? 129  SER A CB  1 
ATOM   1015 O OG  . SER A 1 129 ? 30.368  20.626  28.348  1.00 24.60  ? 129  SER A OG  1 
ATOM   1016 N N   . LEU A 1 130 ? 27.188  20.251  26.632  1.00 25.73  ? 130  LEU A N   1 
ATOM   1017 C CA  . LEU A 1 130 ? 26.344  21.229  25.951  1.00 24.22  ? 130  LEU A CA  1 
ATOM   1018 C C   . LEU A 1 130 ? 24.904  21.144  26.454  1.00 31.03  ? 130  LEU A C   1 
ATOM   1019 O O   . LEU A 1 130 ? 24.436  20.076  26.866  1.00 29.60  ? 130  LEU A O   1 
ATOM   1020 C CB  . LEU A 1 130 ? 26.351  21.008  24.440  1.00 25.07  ? 130  LEU A CB  1 
ATOM   1021 C CG  . LEU A 1 130 ? 27.685  20.910  23.714  1.00 29.11  ? 130  LEU A CG  1 
ATOM   1022 C CD1 . LEU A 1 130 ? 27.442  20.737  22.228  1.00 26.80  ? 130  LEU A CD1 1 
ATOM   1023 C CD2 . LEU A 1 130 ? 28.523  22.159  23.989  1.00 31.30  ? 130  LEU A CD2 1 
ATOM   1024 N N   . ASP A 1 131 ? 24.200  22.267  26.392  1.00 26.12  ? 131  ASP A N   1 
ATOM   1025 C CA  . ASP A 1 131 ? 22.824  22.337  26.861  1.00 30.57  ? 131  ASP A CA  1 
ATOM   1026 C C   . ASP A 1 131 ? 21.903  21.362  26.138  1.00 35.09  ? 131  ASP A C   1 
ATOM   1027 O O   . ASP A 1 131 ? 20.988  20.816  26.760  1.00 42.11  ? 131  ASP A O   1 
ATOM   1028 C CB  . ASP A 1 131 ? 22.279  23.760  26.725  1.00 33.02  ? 131  ASP A CB  1 
ATOM   1029 C CG  . ASP A 1 131 ? 22.871  24.717  27.747  1.00 38.56  ? 131  ASP A CG  1 
ATOM   1030 O OD1 . ASP A 1 131 ? 23.509  24.248  28.718  1.00 33.17  ? 131  ASP A OD1 1 
ATOM   1031 O OD2 . ASP A 1 131 ? 22.681  25.945  27.587  1.00 51.16  ? 131  ASP A OD2 1 
ATOM   1032 N N   . VAL A 1 132 ? 22.141  21.126  24.843  1.00 30.19  ? 132  VAL A N   1 
ATOM   1033 C CA  . VAL A 1 132 ? 21.250  20.238  24.087  1.00 36.14  ? 132  VAL A CA  1 
ATOM   1034 C C   . VAL A 1 132 ? 21.418  18.779  24.460  1.00 32.60  ? 132  VAL A C   1 
ATOM   1035 O O   . VAL A 1 132 ? 20.641  17.940  24.012  1.00 25.91  ? 132  VAL A O   1 
ATOM   1036 C CB  . VAL A 1 132 ? 21.403  20.353  22.557  1.00 33.24  ? 132  VAL A CB  1 
ATOM   1037 C CG1 . VAL A 1 132 ? 20.688  21.568  22.066  1.00 42.99  ? 132  VAL A CG1 1 
ATOM   1038 C CG2 . VAL A 1 132 ? 22.871  20.360  22.168  1.00 27.49  ? 132  VAL A CG2 1 
ATOM   1039 N N   . TYR A 1 133 ? 22.430  18.475  25.262  1.00 22.46  ? 133  TYR A N   1 
ATOM   1040 C CA  . TYR A 1 133 ? 22.635  17.102  25.702  1.00 23.05  ? 133  TYR A CA  1 
ATOM   1041 C C   . TYR A 1 133 ? 22.298  16.942  27.189  1.00 22.61  ? 133  TYR A C   1 
ATOM   1042 O O   . TYR A 1 133 ? 22.695  15.969  27.801  1.00 26.64  ? 133  TYR A O   1 
ATOM   1043 C CB  . TYR A 1 133 ? 24.081  16.649  25.443  1.00 22.01  ? 133  TYR A CB  1 
ATOM   1044 C CG  . TYR A 1 133 ? 24.572  16.850  24.022  1.00 26.02  ? 133  TYR A CG  1 
ATOM   1045 C CD1 . TYR A 1 133 ? 23.705  16.723  22.934  1.00 27.37  ? 133  TYR A CD1 1 
ATOM   1046 C CD2 . TYR A 1 133 ? 25.909  17.173  23.768  1.00 20.69  ? 133  TYR A CD2 1 
ATOM   1047 C CE1 . TYR A 1 133 ? 24.157  16.907  21.638  1.00 26.10  ? 133  TYR A CE1 1 
ATOM   1048 C CE2 . TYR A 1 133 ? 26.370  17.359  22.482  1.00 20.28  ? 133  TYR A CE2 1 
ATOM   1049 C CZ  . TYR A 1 133 ? 25.495  17.218  21.417  1.00 25.18  ? 133  TYR A CZ  1 
ATOM   1050 O OH  . TYR A 1 133 ? 25.948  17.407  20.135  1.00 21.72  ? 133  TYR A OH  1 
ATOM   1051 N N   . ASP A 1 134 ? 21.573  17.903  27.758  1.00 29.67  ? 134  ASP A N   1 
ATOM   1052 C CA  . ASP A 1 134 ? 21.173  17.867  29.173  1.00 27.15  ? 134  ASP A CA  1 
ATOM   1053 C C   . ASP A 1 134 ? 20.308  16.632  29.484  1.00 28.38  ? 134  ASP A C   1 
ATOM   1054 O O   . ASP A 1 134 ? 19.202  16.502  28.991  1.00 27.05  ? 134  ASP A O   1 
ATOM   1055 C CB  . ASP A 1 134 ? 20.402  19.153  29.507  1.00 30.72  ? 134  ASP A CB  1 
ATOM   1056 C CG  . ASP A 1 134 ? 20.169  19.359  31.007  1.00 37.72  ? 134  ASP A CG  1 
ATOM   1057 O OD1 . ASP A 1 134 ? 20.197  18.385  31.795  1.00 36.07  ? 134  ASP A OD1 1 
ATOM   1058 O OD2 . ASP A 1 134 ? 19.933  20.525  31.393  1.00 38.26  ? 134  ASP A OD2 1 
ATOM   1059 N N   . GLY A 1 135 ? 20.810  15.741  30.328  1.00 33.43  ? 135  GLY A N   1 
ATOM   1060 C CA  . GLY A 1 135 ? 20.089  14.524  30.643  1.00 23.81  ? 135  GLY A CA  1 
ATOM   1061 C C   . GLY A 1 135 ? 18.992  14.638  31.693  1.00 32.65  ? 135  GLY A C   1 
ATOM   1062 O O   . GLY A 1 135 ? 18.345  13.644  32.009  1.00 25.56  ? 135  GLY A O   1 
ATOM   1063 N N   . ARG A 1 136 ? 18.758  15.834  32.224  1.00 28.61  ? 136  ARG A N   1 
ATOM   1064 C CA  . ARG A 1 136 ? 17.835  15.970  33.348  1.00 33.32  ? 136  ARG A CA  1 
ATOM   1065 C C   . ARG A 1 136 ? 16.387  15.582  32.993  1.00 40.13  ? 136  ARG A C   1 
ATOM   1066 O O   . ARG A 1 136 ? 15.694  14.962  33.807  1.00 32.36  ? 136  ARG A O   1 
ATOM   1067 C CB  . ARG A 1 136 ? 17.915  17.373  33.984  1.00 30.64  ? 136  ARG A CB  1 
ATOM   1068 C CG  . ARG A 1 136 ? 17.206  18.493  33.224  1.00 30.48  ? 136  ARG A CG  1 
ATOM   1069 C CD  . ARG A 1 136 ? 17.371  19.844  33.933  1.00 32.68  ? 136  ARG A CD  1 
ATOM   1070 N NE  . ARG A 1 136 ? 18.766  20.288  33.963  1.00 36.72  ? 136  ARG A NE  1 
ATOM   1071 C CZ  . ARG A 1 136 ? 19.246  21.256  34.748  1.00 39.82  ? 136  ARG A CZ  1 
ATOM   1072 N NH1 . ARG A 1 136 ? 18.459  21.905  35.608  1.00 33.80  ? 136  ARG A NH1 1 
ATOM   1073 N NH2 . ARG A 1 136 ? 20.530  21.578  34.680  1.00 36.84  ? 136  ARG A NH2 1 
ATOM   1074 N N   . PHE A 1 137 ? 15.945  15.912  31.776  1.00 39.39  ? 137  PHE A N   1 
ATOM   1075 C CA  . PHE A 1 137 ? 14.557  15.655  31.376  1.00 39.52  ? 137  PHE A CA  1 
ATOM   1076 C C   . PHE A 1 137 ? 14.244  14.168  31.212  1.00 36.22  ? 137  PHE A C   1 
ATOM   1077 O O   . PHE A 1 137 ? 13.192  13.693  31.672  1.00 34.09  ? 137  PHE A O   1 
ATOM   1078 C CB  . PHE A 1 137 ? 14.201  16.443  30.111  1.00 30.17  ? 137  PHE A CB  1 
ATOM   1079 C CG  . PHE A 1 137 ? 14.614  17.879  30.180  1.00 33.89  ? 137  PHE A CG  1 
ATOM   1080 C CD1 . PHE A 1 137 ? 13.843  18.800  30.875  1.00 34.53  ? 137  PHE A CD1 1 
ATOM   1081 C CD2 . PHE A 1 137 ? 15.796  18.303  29.589  1.00 28.99  ? 137  PHE A CD2 1 
ATOM   1082 C CE1 . PHE A 1 137 ? 14.233  20.129  30.963  1.00 39.56  ? 137  PHE A CE1 1 
ATOM   1083 C CE2 . PHE A 1 137 ? 16.195  19.621  29.667  1.00 29.28  ? 137  PHE A CE2 1 
ATOM   1084 C CZ  . PHE A 1 137 ? 15.419  20.541  30.357  1.00 38.86  ? 137  PHE A CZ  1 
ATOM   1085 N N   . LEU A 1 138 ? 15.144  13.452  30.547  1.00 28.39  ? 138  LEU A N   1 
ATOM   1086 C CA  . LEU A 1 138 ? 15.026  12.005  30.392  1.00 36.62  ? 138  LEU A CA  1 
ATOM   1087 C C   . LEU A 1 138 ? 15.053  11.310  31.748  1.00 38.16  ? 138  LEU A C   1 
ATOM   1088 O O   . LEU A 1 138 ? 14.217  10.440  32.036  1.00 36.64  ? 138  LEU A O   1 
ATOM   1089 C CB  . LEU A 1 138 ? 16.132  11.464  29.486  1.00 26.88  ? 138  LEU A CB  1 
ATOM   1090 C CG  . LEU A 1 138 ? 15.869  11.728  27.998  1.00 28.43  ? 138  LEU A CG  1 
ATOM   1091 C CD1 . LEU A 1 138 ? 17.092  11.493  27.157  1.00 25.50  ? 138  LEU A CD1 1 
ATOM   1092 C CD2 . LEU A 1 138 ? 14.709  10.874  27.513  1.00 28.19  ? 138  LEU A CD2 1 
ATOM   1093 N N   . ALA A 1 139 ? 16.000  11.718  32.587  1.00 27.88  ? 139  ALA A N   1 
ATOM   1094 C CA  . ALA A 1 139 ? 16.094  11.198  33.948  1.00 32.51  ? 139  ALA A CA  1 
ATOM   1095 C C   . ALA A 1 139 ? 14.810  11.441  34.738  1.00 34.30  ? 139  ALA A C   1 
ATOM   1096 O O   . ALA A 1 139 ? 14.291  10.534  35.372  1.00 38.62  ? 139  ALA A O   1 
ATOM   1097 C CB  . ALA A 1 139 ? 17.292  11.802  34.677  1.00 31.24  ? 139  ALA A CB  1 
ATOM   1098 N N   . GLN A 1 140 ? 14.293  12.663  34.689  1.00 36.48  ? 140  GLN A N   1 
ATOM   1099 C CA  . GLN A 1 140 ? 13.134  13.007  35.495  1.00 38.65  ? 140  GLN A CA  1 
ATOM   1100 C C   . GLN A 1 140 ? 11.840  12.402  34.952  1.00 43.24  ? 140  GLN A C   1 
ATOM   1101 O O   . GLN A 1 140 ? 11.084  11.775  35.693  1.00 41.13  ? 140  GLN A O   1 
ATOM   1102 C CB  . GLN A 1 140 ? 12.991  14.525  35.629  1.00 33.05  ? 140  GLN A CB  1 
ATOM   1103 C CG  . GLN A 1 140 ? 12.275  14.959  36.893  1.00 34.73  ? 140  GLN A CG  1 
ATOM   1104 C CD  . GLN A 1 140 ? 10.750  14.765  36.816  1.00 46.50  ? 140  GLN A CD  1 
ATOM   1105 O OE1 . GLN A 1 140 ? 10.144  14.927  35.748  1.00 38.65  ? 140  GLN A OE1 1 
ATOM   1106 N NE2 . GLN A 1 140 ? 10.132  14.411  37.949  1.00 38.11  ? 140  GLN A NE2 1 
ATOM   1107 N N   . VAL A 1 141 ? 11.577  12.594  33.665  1.00 38.79  ? 141  VAL A N   1 
ATOM   1108 C CA  . VAL A 1 141 ? 10.277  12.221  33.141  1.00 39.52  ? 141  VAL A CA  1 
ATOM   1109 C C   . VAL A 1 141 ? 10.171  10.721  32.875  1.00 40.56  ? 141  VAL A C   1 
ATOM   1110 O O   . VAL A 1 141 ? 9.132   10.118  33.142  1.00 38.57  ? 141  VAL A O   1 
ATOM   1111 C CB  . VAL A 1 141 ? 9.919   13.047  31.886  1.00 46.23  ? 141  VAL A CB  1 
ATOM   1112 C CG1 . VAL A 1 141 ? 8.544   12.682  31.384  1.00 37.58  ? 141  VAL A CG1 1 
ATOM   1113 C CG2 . VAL A 1 141 ? 9.980   14.526  32.215  1.00 35.91  ? 141  VAL A CG2 1 
ATOM   1114 N N   . GLU A 1 142 ? 11.248  10.122  32.366  1.00 38.90  ? 142  GLU A N   1 
ATOM   1115 C CA  . GLU A 1 142 ? 11.252  8.698   32.019  1.00 36.63  ? 142  GLU A CA  1 
ATOM   1116 C C   . GLU A 1 142 ? 11.930  7.793   33.057  1.00 39.43  ? 142  GLU A C   1 
ATOM   1117 O O   . GLU A 1 142 ? 11.951  6.566   32.912  1.00 39.44  ? 142  GLU A O   1 
ATOM   1118 C CB  . GLU A 1 142 ? 11.907  8.483   30.653  1.00 32.57  ? 142  GLU A CB  1 
ATOM   1119 C CG  . GLU A 1 142 ? 11.098  9.000   29.494  1.00 34.99  ? 142  GLU A CG  1 
ATOM   1120 C CD  . GLU A 1 142 ? 9.697   8.375   29.429  1.00 49.97  ? 142  GLU A CD  1 
ATOM   1121 O OE1 . GLU A 1 142 ? 9.511   7.219   29.881  1.00 48.93  ? 142  GLU A OE1 1 
ATOM   1122 O OE2 . GLU A 1 142 ? 8.782   9.049   28.913  1.00 54.51  ? 142  GLU A OE2 1 
ATOM   1123 N N   . GLY A 1 143 ? 12.503  8.396   34.091  1.00 40.00  ? 143  GLY A N   1 
ATOM   1124 C CA  . GLY A 1 143 ? 13.205  7.634   35.107  1.00 34.96  ? 143  GLY A CA  1 
ATOM   1125 C C   . GLY A 1 143 ? 14.520  7.067   34.617  1.00 35.92  ? 143  GLY A C   1 
ATOM   1126 O O   . GLY A 1 143 ? 15.084  6.185   35.249  1.00 45.48  ? 143  GLY A O   1 
ATOM   1127 N N   . ALA A 1 144 ? 15.021  7.571   33.494  1.00 34.23  ? 144  ALA A N   1 
ATOM   1128 C CA  . ALA A 1 144 ? 16.222  7.000   32.877  1.00 32.26  ? 144  ALA A CA  1 
ATOM   1129 C C   . ALA A 1 144 ? 17.498  7.266   33.665  1.00 36.43  ? 144  ALA A C   1 
ATOM   1130 O O   . ALA A 1 144 ? 17.630  8.285   34.341  1.00 39.02  ? 144  ALA A O   1 
ATOM   1131 C CB  . ALA A 1 144 ? 16.384  7.526   31.470  1.00 27.59  ? 144  ALA A CB  1 
ATOM   1132 N N   . VAL A 1 145 ? 18.445  6.347   33.570  1.00 34.42  ? 145  VAL A N   1 
ATOM   1133 C CA  . VAL A 1 145 ? 19.814  6.669   33.936  1.00 25.57  ? 145  VAL A CA  1 
ATOM   1134 C C   . VAL A 1 145 ? 20.561  7.044   32.656  1.00 34.38  ? 145  VAL A C   1 
ATOM   1135 O O   . VAL A 1 145 ? 20.637  6.254   31.713  1.00 33.68  ? 145  VAL A O   1 
ATOM   1136 C CB  . VAL A 1 145 ? 20.502  5.510   34.664  1.00 25.78  ? 145  VAL A CB  1 
ATOM   1137 C CG1 . VAL A 1 145 ? 21.990  5.796   34.841  1.00 24.74  ? 145  VAL A CG1 1 
ATOM   1138 C CG2 . VAL A 1 145 ? 19.818  5.271   36.028  1.00 27.04  ? 145  VAL A CG2 1 
ATOM   1139 N N   . LEU A 1 146 ? 21.085  8.263   32.617  1.00 33.54  ? 146  LEU A N   1 
ATOM   1140 C CA  . LEU A 1 146 ? 21.761  8.757   31.426  1.00 32.39  ? 146  LEU A CA  1 
ATOM   1141 C C   . LEU A 1 146 ? 23.251  9.053   31.669  1.00 33.09  ? 146  LEU A C   1 
ATOM   1142 O O   . LEU A 1 146 ? 23.632  9.700   32.657  1.00 32.54  ? 146  LEU A O   1 
ATOM   1143 C CB  . LEU A 1 146 ? 21.032  9.981   30.861  1.00 32.35  ? 146  LEU A CB  1 
ATOM   1144 C CG  . LEU A 1 146 ? 21.239  10.198  29.361  1.00 41.04  ? 146  LEU A CG  1 
ATOM   1145 C CD1 . LEU A 1 146 ? 20.059  10.914  28.779  1.00 40.75  ? 146  LEU A CD1 1 
ATOM   1146 C CD2 . LEU A 1 146 ? 22.509  10.986  29.084  1.00 42.28  ? 146  LEU A CD2 1 
ATOM   1147 N N   . VAL A 1 147 ? 24.083  8.559   30.756  1.00 22.27  ? 147  VAL A N   1 
ATOM   1148 C CA  . VAL A 1 147 ? 25.518  8.747   30.843  1.00 24.65  ? 147  VAL A CA  1 
ATOM   1149 C C   . VAL A 1 147 ? 26.004  9.388   29.555  1.00 29.18  ? 147  VAL A C   1 
ATOM   1150 O O   . VAL A 1 147 ? 25.593  9.003   28.463  1.00 27.41  ? 147  VAL A O   1 
ATOM   1151 C CB  . VAL A 1 147 ? 26.254  7.401   31.041  1.00 29.39  ? 147  VAL A CB  1 
ATOM   1152 C CG1 . VAL A 1 147 ? 27.740  7.623   31.120  1.00 22.21  ? 147  VAL A CG1 1 
ATOM   1153 C CG2 . VAL A 1 147 ? 25.761  6.691   32.302  1.00 30.36  ? 147  VAL A CG2 1 
ATOM   1154 N N   . SER A 1 148 ? 26.856  10.389  29.680  1.00 23.75  ? 148  SER A N   1 
ATOM   1155 C CA  . SER A 1 148 ? 27.540  10.923  28.513  1.00 26.18  ? 148  SER A CA  1 
ATOM   1156 C C   . SER A 1 148 ? 29.017  11.144  28.837  1.00 24.86  ? 148  SER A C   1 
ATOM   1157 O O   . SER A 1 148 ? 29.377  11.474  29.973  1.00 22.85  ? 148  SER A O   1 
ATOM   1158 C CB  . SER A 1 148 ? 26.905  12.230  28.077  1.00 26.99  ? 148  SER A CB  1 
ATOM   1159 O OG  . SER A 1 148 ? 27.128  13.227  29.053  1.00 32.09  ? 148  SER A OG  1 
ATOM   1160 N N   . MET A 1 149 ? 29.874  10.960  27.845  1.00 20.35  ? 149  MET A N   1 
ATOM   1161 C CA  . MET A 1 149 ? 31.316  11.070  28.078  1.00 19.82  ? 149  MET A CA  1 
ATOM   1162 C C   . MET A 1 149 ? 31.997  11.998  27.081  1.00 20.77  ? 149  MET A C   1 
ATOM   1163 O O   . MET A 1 149 ? 31.600  12.073  25.913  1.00 22.73  ? 149  MET A O   1 
ATOM   1164 C CB  . MET A 1 149 ? 31.965  9.693   27.995  1.00 21.37  ? 149  MET A CB  1 
ATOM   1165 C CG  . MET A 1 149 ? 32.383  9.267   26.570  1.00 23.67  ? 149  MET A CG  1 
ATOM   1166 S SD  . MET A 1 149 ? 31.006  8.904   25.458  1.00 30.26  ? 149  MET A SD  1 
ATOM   1167 C CE  . MET A 1 149 ? 30.593  7.219   25.914  1.00 18.61  ? 149  MET A CE  1 
ATOM   1168 N N   . ASN A 1 150 ? 33.002  12.729  27.550  1.00 22.82  ? 150  ASN A N   1 
ATOM   1169 C CA  . ASN A 1 150 ? 33.899  13.432  26.638  1.00 23.25  ? 150  ASN A CA  1 
ATOM   1170 C C   . ASN A 1 150 ? 34.833  12.394  26.033  1.00 22.51  ? 150  ASN A C   1 
ATOM   1171 O O   . ASN A 1 150 ? 35.241  11.464  26.718  1.00 22.62  ? 150  ASN A O   1 
ATOM   1172 C CB  . ASN A 1 150 ? 34.714  14.506  27.364  1.00 18.67  ? 150  ASN A CB  1 
ATOM   1173 C CG  . ASN A 1 150 ? 33.912  15.764  27.652  1.00 27.66  ? 150  ASN A CG  1 
ATOM   1174 O OD1 . ASN A 1 150 ? 32.714  15.827  27.381  1.00 29.91  ? 150  ASN A OD1 1 
ATOM   1175 N ND2 . ASN A 1 150 ? 34.580  16.781  28.200  1.00 28.36  ? 150  ASN A ND2 1 
ATOM   1176 N N   . TYR A 1 151 ? 35.144  12.530  24.748  1.00 22.56  ? 151  TYR A N   1 
ATOM   1177 C CA  . TYR A 1 151 ? 36.213  11.734  24.140  1.00 20.21  ? 151  TYR A CA  1 
ATOM   1178 C C   . TYR A 1 151 ? 37.101  12.667  23.335  1.00 25.09  ? 151  TYR A C   1 
ATOM   1179 O O   . TYR A 1 151 ? 36.647  13.726  22.868  1.00 25.33  ? 151  TYR A O   1 
ATOM   1180 C CB  . TYR A 1 151 ? 35.661  10.595  23.257  1.00 26.20  ? 151  TYR A CB  1 
ATOM   1181 C CG  . TYR A 1 151 ? 34.772  11.057  22.109  1.00 27.25  ? 151  TYR A CG  1 
ATOM   1182 C CD1 . TYR A 1 151 ? 33.404  11.267  22.294  1.00 25.70  ? 151  TYR A CD1 1 
ATOM   1183 C CD2 . TYR A 1 151 ? 35.303  11.281  20.844  1.00 19.34  ? 151  TYR A CD2 1 
ATOM   1184 C CE1 . TYR A 1 151 ? 32.593  11.687  21.242  1.00 23.54  ? 151  TYR A CE1 1 
ATOM   1185 C CE2 . TYR A 1 151 ? 34.503  11.705  19.792  1.00 17.90  ? 151  TYR A CE2 1 
ATOM   1186 C CZ  . TYR A 1 151 ? 33.161  11.908  19.996  1.00 21.54  ? 151  TYR A CZ  1 
ATOM   1187 O OH  . TYR A 1 151 ? 32.393  12.331  18.947  1.00 19.11  ? 151  TYR A OH  1 
ATOM   1188 N N   . ARG A 1 152 ? 38.364  12.288  23.171  1.00 19.01  ? 152  ARG A N   1 
ATOM   1189 C CA  . ARG A 1 152 ? 39.277  13.114  22.402  1.00 25.00  ? 152  ARG A CA  1 
ATOM   1190 C C   . ARG A 1 152 ? 38.846  13.272  20.941  1.00 27.74  ? 152  ARG A C   1 
ATOM   1191 O O   . ARG A 1 152 ? 38.430  12.305  20.283  1.00 25.30  ? 152  ARG A O   1 
ATOM   1192 C CB  . ARG A 1 152 ? 40.703  12.581  22.508  1.00 24.41  ? 152  ARG A CB  1 
ATOM   1193 C CG  . ARG A 1 152 ? 41.377  12.918  23.828  1.00 21.78  ? 152  ARG A CG  1 
ATOM   1194 C CD  . ARG A 1 152 ? 42.711  12.182  23.945  1.00 25.01  ? 152  ARG A CD  1 
ATOM   1195 N NE  . ARG A 1 152 ? 42.486  10.757  24.155  1.00 23.53  ? 152  ARG A NE  1 
ATOM   1196 C CZ  . ARG A 1 152 ? 43.445  9.841   24.193  1.00 28.71  ? 152  ARG A CZ  1 
ATOM   1197 N NH1 . ARG A 1 152 ? 44.713  10.188  24.014  1.00 23.57  ? 152  ARG A NH1 1 
ATOM   1198 N NH2 . ARG A 1 152 ? 43.124  8.570   24.397  1.00 25.82  ? 152  ARG A NH2 1 
ATOM   1199 N N   . VAL A 1 153 ? 38.919  14.507  20.445  1.00 19.41  ? 153  VAL A N   1 
ATOM   1200 C CA  . VAL A 1 153 ? 38.610  14.750  19.046  1.00 25.81  ? 153  VAL A CA  1 
ATOM   1201 C C   . VAL A 1 153 ? 39.827  15.289  18.295  1.00 29.90  ? 153  VAL A C   1 
ATOM   1202 O O   . VAL A 1 153 ? 40.877  15.555  18.901  1.00 26.88  ? 153  VAL A O   1 
ATOM   1203 C CB  . VAL A 1 153 ? 37.414  15.690  18.898  1.00 23.58  ? 153  VAL A CB  1 
ATOM   1204 C CG1 . VAL A 1 153 ? 36.172  15.044  19.481  1.00 19.71  ? 153  VAL A CG1 1 
ATOM   1205 C CG2 . VAL A 1 153 ? 37.690  17.026  19.583  1.00 23.95  ? 153  VAL A CG2 1 
ATOM   1206 N N   . GLY A 1 154 ? 39.683  15.425  16.977  1.00 30.46  ? 154  GLY A N   1 
ATOM   1207 C CA  . GLY A 1 154 ? 40.723  16.006  16.147  1.00 21.20  ? 154  GLY A CA  1 
ATOM   1208 C C   . GLY A 1 154 ? 41.978  15.159  16.153  1.00 31.67  ? 154  GLY A C   1 
ATOM   1209 O O   . GLY A 1 154 ? 41.900  13.929  16.273  1.00 29.56  ? 154  GLY A O   1 
ATOM   1210 N N   . THR A 1 155 ? 43.132  15.809  16.028  1.00 22.75  ? 155  THR A N   1 
ATOM   1211 C CA  . THR A 1 155 ? 44.404  15.104  16.062  1.00 32.15  ? 155  THR A CA  1 
ATOM   1212 C C   . THR A 1 155 ? 44.566  14.305  17.360  1.00 35.49  ? 155  THR A C   1 
ATOM   1213 O O   . THR A 1 155 ? 45.016  13.157  17.331  1.00 35.82  ? 155  THR A O   1 
ATOM   1214 C CB  . THR A 1 155 ? 45.616  16.059  15.914  1.00 30.34  ? 155  THR A CB  1 
ATOM   1215 O OG1 . THR A 1 155 ? 45.590  17.048  16.956  1.00 27.36  ? 155  THR A OG1 1 
ATOM   1216 C CG2 . THR A 1 155 ? 45.607  16.738  14.554  1.00 31.81  ? 155  THR A CG2 1 
ATOM   1217 N N   . PHE A 1 156 ? 44.185  14.909  18.485  1.00 27.07  ? 156  PHE A N   1 
ATOM   1218 C CA  . PHE A 1 156 ? 44.414  14.308  19.800  1.00 29.75  ? 156  PHE A CA  1 
ATOM   1219 C C   . PHE A 1 156 ? 43.701  12.971  19.910  1.00 26.31  ? 156  PHE A C   1 
ATOM   1220 O O   . PHE A 1 156 ? 44.153  12.065  20.605  1.00 28.85  ? 156  PHE A O   1 
ATOM   1221 C CB  . PHE A 1 156 ? 43.954  15.255  20.918  1.00 22.82  ? 156  PHE A CB  1 
ATOM   1222 C CG  . PHE A 1 156 ? 44.444  16.660  20.744  1.00 27.35  ? 156  PHE A CG  1 
ATOM   1223 C CD1 . PHE A 1 156 ? 45.724  17.023  21.172  1.00 24.87  ? 156  PHE A CD1 1 
ATOM   1224 C CD2 . PHE A 1 156 ? 43.644  17.614  20.126  1.00 23.24  ? 156  PHE A CD2 1 
ATOM   1225 C CE1 . PHE A 1 156 ? 46.194  18.318  20.999  1.00 25.80  ? 156  PHE A CE1 1 
ATOM   1226 C CE2 . PHE A 1 156 ? 44.098  18.911  19.952  1.00 26.57  ? 156  PHE A CE2 1 
ATOM   1227 C CZ  . PHE A 1 156 ? 45.386  19.264  20.388  1.00 32.15  ? 156  PHE A CZ  1 
ATOM   1228 N N   . GLY A 1 157 ? 42.588  12.855  19.199  1.00 27.72  ? 157  GLY A N   1 
ATOM   1229 C CA  . GLY A 1 157 ? 41.814  11.639  19.241  1.00 29.95  ? 157  GLY A CA  1 
ATOM   1230 C C   . GLY A 1 157 ? 42.017  10.715  18.060  1.00 27.40  ? 157  GLY A C   1 
ATOM   1231 O O   . GLY A 1 157 ? 41.738  9.528   18.165  1.00 30.43  ? 157  GLY A O   1 
ATOM   1232 N N   . PHE A 1 158 ? 42.493  11.244  16.935  1.00 21.80  ? 158  PHE A N   1 
ATOM   1233 C CA  . PHE A 1 158 ? 42.432  10.472  15.698  1.00 22.11  ? 158  PHE A CA  1 
ATOM   1234 C C   . PHE A 1 158 ? 43.635  10.531  14.782  1.00 26.74  ? 158  PHE A C   1 
ATOM   1235 O O   . PHE A 1 158 ? 43.671  9.818   13.783  1.00 28.34  ? 158  PHE A O   1 
ATOM   1236 C CB  . PHE A 1 158 ? 41.133  10.783  14.946  1.00 21.43  ? 158  PHE A CB  1 
ATOM   1237 C CG  . PHE A 1 158 ? 39.918  10.397  15.717  1.00 21.03  ? 158  PHE A CG  1 
ATOM   1238 C CD1 . PHE A 1 158 ? 39.508  9.076   15.763  1.00 20.64  ? 158  PHE A CD1 1 
ATOM   1239 C CD2 . PHE A 1 158 ? 39.230  11.334  16.461  1.00 30.55  ? 158  PHE A CD2 1 
ATOM   1240 C CE1 . PHE A 1 158 ? 38.410  8.706   16.510  1.00 26.53  ? 158  PHE A CE1 1 
ATOM   1241 C CE2 . PHE A 1 158 ? 38.115  10.966  17.207  1.00 30.38  ? 158  PHE A CE2 1 
ATOM   1242 C CZ  . PHE A 1 158 ? 37.716  9.654   17.238  1.00 21.10  ? 158  PHE A CZ  1 
ATOM   1243 N N   . LEU A 1 159 ? 44.618  11.366  15.110  1.00 30.03  ? 159  LEU A N   1 
ATOM   1244 C CA  . LEU A 1 159 ? 45.855  11.361  14.343  1.00 29.23  ? 159  LEU A CA  1 
ATOM   1245 C C   . LEU A 1 159 ? 46.484  9.991   14.483  1.00 28.67  ? 159  LEU A C   1 
ATOM   1246 O O   . LEU A 1 159 ? 46.601  9.469   15.579  1.00 33.07  ? 159  LEU A O   1 
ATOM   1247 C CB  . LEU A 1 159 ? 46.820  12.456  14.795  1.00 26.55  ? 159  LEU A CB  1 
ATOM   1248 C CG  . LEU A 1 159 ? 48.113  12.557  13.986  1.00 32.87  ? 159  LEU A CG  1 
ATOM   1249 C CD1 . LEU A 1 159 ? 48.543  14.007  13.839  1.00 32.86  ? 159  LEU A CD1 1 
ATOM   1250 C CD2 . LEU A 1 159 ? 49.219  11.732  14.637  1.00 28.55  ? 159  LEU A CD2 1 
ATOM   1251 N N   . ALA A 1 160 ? 46.892  9.419   13.360  1.00 31.59  ? 160  ALA A N   1 
ATOM   1252 C CA  . ALA A 1 160 ? 47.386  8.047   13.340  1.00 29.67  ? 160  ALA A CA  1 
ATOM   1253 C C   . ALA A 1 160 ? 48.587  7.882   12.424  1.00 34.27  ? 160  ALA A C   1 
ATOM   1254 O O   . ALA A 1 160 ? 48.628  8.403   11.315  1.00 36.11  ? 160  ALA A O   1 
ATOM   1255 C CB  . ALA A 1 160 ? 46.281  7.103   12.910  1.00 28.70  ? 160  ALA A CB  1 
ATOM   1256 N N   . LEU A 1 161 ? 49.587  7.172   12.910  1.00 36.57  ? 161  LEU A N   1 
ATOM   1257 C CA  . LEU A 1 161 ? 50.592  6.626   12.028  1.00 37.01  ? 161  LEU A CA  1 
ATOM   1258 C C   . LEU A 1 161 ? 50.395  5.129   12.135  1.00 34.02  ? 161  LEU A C   1 
ATOM   1259 O O   . LEU A 1 161 ? 50.989  4.487   12.996  1.00 36.14  ? 161  LEU A O   1 
ATOM   1260 C CB  . LEU A 1 161 ? 51.982  7.061   12.472  1.00 33.80  ? 161  LEU A CB  1 
ATOM   1261 C CG  . LEU A 1 161 ? 52.159  8.558   12.216  1.00 49.02  ? 161  LEU A CG  1 
ATOM   1262 C CD1 . LEU A 1 161 ? 53.323  9.075   12.981  1.00 54.77  ? 161  LEU A CD1 1 
ATOM   1263 C CD2 . LEU A 1 161 ? 52.376  8.816   10.739  1.00 34.36  ? 161  LEU A CD2 1 
ATOM   1264 N N   . PRO A 1 162 ? 49.508  4.578   11.291  1.00 35.21  ? 162  PRO A N   1 
ATOM   1265 C CA  . PRO A 1 162 ? 49.041  3.190   11.419  1.00 39.99  ? 162  PRO A CA  1 
ATOM   1266 C C   . PRO A 1 162 ? 50.209  2.225   11.528  1.00 44.56  ? 162  PRO A C   1 
ATOM   1267 O O   . PRO A 1 162 ? 51.173  2.364   10.768  1.00 38.38  ? 162  PRO A O   1 
ATOM   1268 C CB  . PRO A 1 162 ? 48.268  2.963   10.119  1.00 32.54  ? 162  PRO A CB  1 
ATOM   1269 C CG  . PRO A 1 162 ? 47.786  4.335   9.747   1.00 33.69  ? 162  PRO A CG  1 
ATOM   1270 C CD  . PRO A 1 162 ? 48.914  5.252   10.124  1.00 31.81  ? 162  PRO A CD  1 
ATOM   1271 N N   . GLY A 1 163 ? 50.138  1.302   12.489  1.00 43.85  ? 163  GLY A N   1 
ATOM   1272 C CA  . GLY A 1 163 ? 51.198  0.335   12.722  1.00 39.89  ? 163  GLY A CA  1 
ATOM   1273 C C   . GLY A 1 163 ? 52.193  0.730   13.799  1.00 44.27  ? 163  GLY A C   1 
ATOM   1274 O O   . GLY A 1 163 ? 52.906  -0.115  14.335  1.00 53.60  ? 163  GLY A O   1 
ATOM   1275 N N   . SER A 1 164 ? 52.252  2.018   14.116  1.00 42.51  ? 164  SER A N   1 
ATOM   1276 C CA  . SER A 1 164 ? 53.171  2.521   15.139  1.00 39.40  ? 164  SER A CA  1 
ATOM   1277 C C   . SER A 1 164 ? 52.685  2.183   16.545  1.00 42.31  ? 164  SER A C   1 
ATOM   1278 O O   . SER A 1 164 ? 51.537  1.789   16.746  1.00 42.48  ? 164  SER A O   1 
ATOM   1279 C CB  . SER A 1 164 ? 53.306  4.042   15.034  1.00 39.54  ? 164  SER A CB  1 
ATOM   1280 O OG  . SER A 1 164 ? 52.111  4.685   15.493  1.00 40.72  ? 164  SER A OG  1 
ATOM   1281 N N   . ARG A 1 165 ? 53.559  2.383   17.522  1.00 47.66  ? 165  ARG A N   1 
ATOM   1282 C CA  . ARG A 1 165 ? 53.221  2.119   18.909  1.00 49.78  ? 165  ARG A CA  1 
ATOM   1283 C C   . ARG A 1 165 ? 52.724  3.408   19.552  1.00 49.79  ? 165  ARG A C   1 
ATOM   1284 O O   . ARG A 1 165 ? 51.816  3.397   20.391  1.00 52.49  ? 165  ARG A O   1 
ATOM   1285 C CB  . ARG A 1 165 ? 54.459  1.608   19.646  1.00 55.29  ? 165  ARG A CB  1 
ATOM   1286 C CG  . ARG A 1 165 ? 54.165  0.691   20.815  1.00 69.24  ? 165  ARG A CG  1 
ATOM   1287 C CD  . ARG A 1 165 ? 55.208  0.868   21.908  1.00 81.65  ? 165  ARG A CD  1 
ATOM   1288 N NE  . ARG A 1 165 ? 54.950  2.092   22.662  1.00 88.79  ? 165  ARG A NE  1 
ATOM   1289 C CZ  . ARG A 1 165 ? 55.872  2.782   23.326  1.00 88.42  ? 165  ARG A CZ  1 
ATOM   1290 N NH1 . ARG A 1 165 ? 57.139  2.373   23.331  1.00 90.44  ? 165  ARG A NH1 1 
ATOM   1291 N NH2 . ARG A 1 165 ? 55.520  3.884   23.983  1.00 79.50  ? 165  ARG A NH2 1 
ATOM   1292 N N   . GLU A 1 166 ? 53.310  4.527   19.132  1.00 41.74  ? 166  GLU A N   1 
ATOM   1293 C CA  . GLU A 1 166 ? 53.063  5.805   19.790  1.00 39.50  ? 166  GLU A CA  1 
ATOM   1294 C C   . GLU A 1 166 ? 51.831  6.587   19.290  1.00 39.25  ? 166  GLU A C   1 
ATOM   1295 O O   . GLU A 1 166 ? 51.427  7.577   19.912  1.00 40.92  ? 166  GLU A O   1 
ATOM   1296 C CB  . GLU A 1 166 ? 54.320  6.677   19.751  1.00 42.89  ? 166  GLU A CB  1 
ATOM   1297 C CG  . GLU A 1 166 ? 55.607  5.958   20.181  1.00 47.94  ? 166  GLU A CG  1 
ATOM   1298 C CD  . GLU A 1 166 ? 56.297  5.218   19.027  1.00 58.82  ? 166  GLU A CD  1 
ATOM   1299 O OE1 . GLU A 1 166 ? 55.605  4.739   18.097  1.00 63.98  ? 166  GLU A OE1 1 
ATOM   1300 O OE2 . GLU A 1 166 ? 57.537  5.124   19.045  1.00 62.76  ? 166  GLU A OE2 1 
ATOM   1301 N N   . ALA A 1 167 ? 51.236  6.141   18.184  1.00 33.47  ? 167  ALA A N   1 
ATOM   1302 C CA  . ALA A 1 167 ? 50.073  6.821   17.604  1.00 32.21  ? 167  ALA A CA  1 
ATOM   1303 C C   . ALA A 1 167 ? 49.255  5.863   16.754  1.00 31.13  ? 167  ALA A C   1 
ATOM   1304 O O   . ALA A 1 167 ? 49.213  5.986   15.520  1.00 31.07  ? 167  ALA A O   1 
ATOM   1305 C CB  . ALA A 1 167 ? 50.533  7.998   16.749  1.00 33.60  ? 167  ALA A CB  1 
ATOM   1306 N N   . PRO A 1 168 ? 48.612  4.893   17.400  1.00 29.43  ? 168  PRO A N   1 
ATOM   1307 C CA  . PRO A 1 168 ? 48.022  3.774   16.656  1.00 29.54  ? 168  PRO A CA  1 
ATOM   1308 C C   . PRO A 1 168 ? 46.690  4.138   16.022  1.00 40.31  ? 168  PRO A C   1 
ATOM   1309 O O   . PRO A 1 168 ? 46.144  3.321   15.274  1.00 38.45  ? 168  PRO A O   1 
ATOM   1310 C CB  . PRO A 1 168 ? 47.810  2.720   17.742  1.00 31.43  ? 168  PRO A CB  1 
ATOM   1311 C CG  . PRO A 1 168 ? 47.559  3.533   18.985  1.00 31.14  ? 168  PRO A CG  1 
ATOM   1312 C CD  . PRO A 1 168 ? 48.456  4.746   18.857  1.00 29.16  ? 168  PRO A CD  1 
ATOM   1313 N N   . GLY A 1 169 ? 46.180  5.335   16.318  1.00 32.20  ? 169  GLY A N   1 
ATOM   1314 C CA  . GLY A 1 169 ? 44.911  5.785   15.775  1.00 30.82  ? 169  GLY A CA  1 
ATOM   1315 C C   . GLY A 1 169 ? 43.708  5.320   16.580  1.00 31.73  ? 169  GLY A C   1 
ATOM   1316 O O   . GLY A 1 169 ? 43.830  4.457   17.450  1.00 30.70  ? 169  GLY A O   1 
ATOM   1317 N N   . ASN A 1 170 ? 42.548  5.905   16.303  1.00 29.67  ? 170  ASN A N   1 
ATOM   1318 C CA  . ASN A 1 170 ? 41.304  5.498   16.954  1.00 28.67  ? 170  ASN A CA  1 
ATOM   1319 C C   . ASN A 1 170 ? 41.236  5.681   18.488  1.00 31.78  ? 170  ASN A C   1 
ATOM   1320 O O   . ASN A 1 170 ? 40.318  5.145   19.127  1.00 32.92  ? 170  ASN A O   1 
ATOM   1321 C CB  . ASN A 1 170 ? 40.973  4.044   16.597  1.00 27.22  ? 170  ASN A CB  1 
ATOM   1322 C CG  . ASN A 1 170 ? 40.771  3.844   15.111  1.00 38.71  ? 170  ASN A CG  1 
ATOM   1323 O OD1 . ASN A 1 170 ? 40.214  4.711   14.432  1.00 35.57  ? 170  ASN A OD1 1 
ATOM   1324 N ND2 . ASN A 1 170 ? 41.224  2.693   14.591  1.00 24.94  ? 170  ASN A ND2 1 
ATOM   1325 N N   . VAL A 1 171 ? 42.169  6.425   19.082  1.00 26.47  ? 171  VAL A N   1 
ATOM   1326 C CA  . VAL A 1 171 ? 42.190  6.531   20.547  1.00 26.41  ? 171  VAL A CA  1 
ATOM   1327 C C   . VAL A 1 171 ? 40.952  7.248   21.081  1.00 27.71  ? 171  VAL A C   1 
ATOM   1328 O O   . VAL A 1 171 ? 40.510  6.991   22.205  1.00 26.86  ? 171  VAL A O   1 
ATOM   1329 C CB  . VAL A 1 171 ? 43.488  7.141   21.110  1.00 30.05  ? 171  VAL A CB  1 
ATOM   1330 C CG1 . VAL A 1 171 ? 44.685  6.382   20.576  1.00 35.06  ? 171  VAL A CG1 1 
ATOM   1331 C CG2 . VAL A 1 171 ? 43.600  8.630   20.784  1.00 34.55  ? 171  VAL A CG2 1 
ATOM   1332 N N   . GLY A 1 172 ? 40.355  8.098   20.253  1.00 24.90  ? 172  GLY A N   1 
ATOM   1333 C CA  . GLY A 1 172 ? 39.079  8.708   20.606  1.00 20.36  ? 172  GLY A CA  1 
ATOM   1334 C C   . GLY A 1 172 ? 37.979  7.671   20.812  1.00 20.37  ? 172  GLY A C   1 
ATOM   1335 O O   . GLY A 1 172 ? 37.181  7.771   21.741  1.00 21.30  ? 172  GLY A O   1 
ATOM   1336 N N   . LEU A 1 173 ? 37.935  6.670   19.938  1.00 21.12  ? 173  LEU A N   1 
ATOM   1337 C CA  . LEU A 1 173 ? 37.002  5.560   20.091  1.00 21.21  ? 173  LEU A CA  1 
ATOM   1338 C C   . LEU A 1 173 ? 37.329  4.749   21.345  1.00 27.45  ? 173  LEU A C   1 
ATOM   1339 O O   . LEU A 1 173 ? 36.435  4.263   22.036  1.00 33.40  ? 173  LEU A O   1 
ATOM   1340 C CB  . LEU A 1 173 ? 37.040  4.668   18.856  1.00 23.32  ? 173  LEU A CB  1 
ATOM   1341 C CG  . LEU A 1 173 ? 36.472  5.298   17.580  1.00 26.20  ? 173  LEU A CG  1 
ATOM   1342 C CD1 . LEU A 1 173 ? 36.791  4.464   16.335  1.00 24.42  ? 173  LEU A CD1 1 
ATOM   1343 C CD2 . LEU A 1 173 ? 34.969  5.464   17.725  1.00 30.52  ? 173  LEU A CD2 1 
ATOM   1344 N N   . LEU A 1 174 ? 38.614  4.611   21.643  1.00 28.61  ? 174  LEU A N   1 
ATOM   1345 C CA  . LEU A 1 174 ? 39.023  3.891   22.839  1.00 29.49  ? 174  LEU A CA  1 
ATOM   1346 C C   . LEU A 1 174 ? 38.616  4.641   24.117  1.00 27.07  ? 174  LEU A C   1 
ATOM   1347 O O   . LEU A 1 174 ? 38.339  4.015   25.138  1.00 25.19  ? 174  LEU A O   1 
ATOM   1348 C CB  . LEU A 1 174 ? 40.526  3.576   22.805  1.00 22.75  ? 174  LEU A CB  1 
ATOM   1349 C CG  . LEU A 1 174 ? 40.924  2.514   21.764  1.00 32.53  ? 174  LEU A CG  1 
ATOM   1350 C CD1 . LEU A 1 174 ? 42.417  2.299   21.725  1.00 24.86  ? 174  LEU A CD1 1 
ATOM   1351 C CD2 . LEU A 1 174 ? 40.219  1.180   22.013  1.00 27.61  ? 174  LEU A CD2 1 
ATOM   1352 N N   . ASP A 1 175 ? 38.563  5.975   24.051  1.00 29.31  ? 175  ASP A N   1 
ATOM   1353 C CA  . ASP A 1 175 ? 38.062  6.767   25.178  1.00 30.50  ? 175  ASP A CA  1 
ATOM   1354 C C   . ASP A 1 175 ? 36.598  6.383   25.434  1.00 28.39  ? 175  ASP A C   1 
ATOM   1355 O O   . ASP A 1 175 ? 36.169  6.162   26.576  1.00 28.97  ? 175  ASP A O   1 
ATOM   1356 C CB  . ASP A 1 175 ? 38.178  8.277   24.908  1.00 19.62  ? 175  ASP A CB  1 
ATOM   1357 C CG  . ASP A 1 175 ? 39.628  8.752   24.728  1.00 28.06  ? 175  ASP A CG  1 
ATOM   1358 O OD1 . ASP A 1 175 ? 40.585  8.051   25.141  1.00 25.03  ? 175  ASP A OD1 1 
ATOM   1359 O OD2 . ASP A 1 175 ? 39.815  9.853   24.175  1.00 27.11  ? 175  ASP A OD2 1 
ATOM   1360 N N   . GLN A 1 176 ? 35.841  6.264   24.352  1.00 27.02  ? 176  GLN A N   1 
ATOM   1361 C CA  . GLN A 1 176 ? 34.439  5.906   24.454  1.00 29.89  ? 176  GLN A CA  1 
ATOM   1362 C C   . GLN A 1 176 ? 34.283  4.501   25.018  1.00 32.92  ? 176  GLN A C   1 
ATOM   1363 O O   . GLN A 1 176 ? 33.415  4.251   25.864  1.00 35.69  ? 176  GLN A O   1 
ATOM   1364 C CB  . GLN A 1 176 ? 33.752  6.029   23.093  1.00 26.52  ? 176  GLN A CB  1 
ATOM   1365 C CG  . GLN A 1 176 ? 33.877  7.417   22.461  1.00 24.51  ? 176  GLN A CG  1 
ATOM   1366 C CD  . GLN A 1 176 ? 33.317  7.450   21.042  1.00 29.40  ? 176  GLN A CD  1 
ATOM   1367 O OE1 . GLN A 1 176 ? 32.777  6.449   20.550  1.00 27.58  ? 176  GLN A OE1 1 
ATOM   1368 N NE2 . GLN A 1 176 ? 33.448  8.599   20.377  1.00 28.12  ? 176  GLN A NE2 1 
ATOM   1369 N N   . ARG A 1 177 ? 35.121  3.585   24.550  1.00 28.91  ? 177  ARG A N   1 
ATOM   1370 C CA  . ARG A 1 177 ? 35.054  2.217   25.026  1.00 31.48  ? 177  ARG A CA  1 
ATOM   1371 C C   . ARG A 1 177 ? 35.335  2.154   26.538  1.00 30.81  ? 177  ARG A C   1 
ATOM   1372 O O   . ARG A 1 177 ? 34.639  1.441   27.260  1.00 28.65  ? 177  ARG A O   1 
ATOM   1373 C CB  . ARG A 1 177 ? 36.014  1.324   24.237  1.00 33.20  ? 177  ARG A CB  1 
ATOM   1374 C CG  . ARG A 1 177 ? 36.087  -0.103  24.746  1.00 35.87  ? 177  ARG A CG  1 
ATOM   1375 C CD  . ARG A 1 177 ? 37.031  -0.930  23.893  1.00 35.17  ? 177  ARG A CD  1 
ATOM   1376 N NE  . ARG A 1 177 ? 36.418  -1.279  22.615  1.00 39.24  ? 177  ARG A NE  1 
ATOM   1377 C CZ  . ARG A 1 177 ? 37.085  -1.768  21.570  1.00 38.43  ? 177  ARG A CZ  1 
ATOM   1378 N NH1 . ARG A 1 177 ? 38.403  -1.954  21.647  1.00 34.04  ? 177  ARG A NH1 1 
ATOM   1379 N NH2 . ARG A 1 177 ? 36.433  -2.069  20.445  1.00 30.89  ? 177  ARG A NH2 1 
ATOM   1380 N N   . LEU A 1 178 ? 36.323  2.929   27.001  1.00 29.66  ? 178  LEU A N   1 
ATOM   1381 C CA  . LEU A 1 178 ? 36.713  2.962   28.416  1.00 27.28  ? 178  LEU A CA  1 
ATOM   1382 C C   . LEU A 1 178 ? 35.571  3.471   29.272  1.00 32.05  ? 178  LEU A C   1 
ATOM   1383 O O   . LEU A 1 178 ? 35.316  2.940   30.351  1.00 33.79  ? 178  LEU A O   1 
ATOM   1384 C CB  . LEU A 1 178 ? 37.945  3.839   28.637  1.00 23.88  ? 178  LEU A CB  1 
ATOM   1385 C CG  . LEU A 1 178 ? 38.524  3.947   30.056  1.00 25.41  ? 178  LEU A CG  1 
ATOM   1386 C CD1 . LEU A 1 178 ? 38.901  2.598   30.600  1.00 24.02  ? 178  LEU A CD1 1 
ATOM   1387 C CD2 . LEU A 1 178 ? 39.746  4.859   30.056  1.00 28.93  ? 178  LEU A CD2 1 
ATOM   1388 N N   . ALA A 1 179 ? 34.882  4.498   28.780  1.00 28.06  ? 179  ALA A N   1 
ATOM   1389 C CA  . ALA A 1 179 ? 33.668  4.981   29.435  1.00 26.50  ? 179  ALA A CA  1 
ATOM   1390 C C   . ALA A 1 179 ? 32.590  3.892   29.464  1.00 28.01  ? 179  ALA A C   1 
ATOM   1391 O O   . ALA A 1 179 ? 31.873  3.766   30.455  1.00 36.06  ? 179  ALA A O   1 
ATOM   1392 C CB  . ALA A 1 179 ? 33.145  6.285   28.772  1.00 19.57  ? 179  ALA A CB  1 
ATOM   1393 N N   . LEU A 1 180 ? 32.493  3.084   28.405  1.00 26.08  ? 180  LEU A N   1 
ATOM   1394 C CA  . LEU A 1 180 ? 31.514  1.996   28.405  1.00 28.40  ? 180  LEU A CA  1 
ATOM   1395 C C   . LEU A 1 180 ? 31.881  0.965   29.461  1.00 33.34  ? 180  LEU A C   1 
ATOM   1396 O O   . LEU A 1 180 ? 31.001  0.440   30.140  1.00 29.58  ? 180  LEU A O   1 
ATOM   1397 C CB  . LEU A 1 180 ? 31.334  1.320   27.035  1.00 25.28  ? 180  LEU A CB  1 
ATOM   1398 C CG  . LEU A 1 180 ? 31.004  2.164   25.790  1.00 30.98  ? 180  LEU A CG  1 
ATOM   1399 C CD1 . LEU A 1 180 ? 30.453  1.302   24.652  1.00 28.64  ? 180  LEU A CD1 1 
ATOM   1400 C CD2 . LEU A 1 180 ? 30.085  3.354   26.074  1.00 30.88  ? 180  LEU A CD2 1 
ATOM   1401 N N   . GLN A 1 181 ? 33.177  0.682   29.600  1.00 32.84  ? 181  GLN A N   1 
ATOM   1402 C CA  . GLN A 1 181 ? 33.642  -0.246  30.634  1.00 32.41  ? 181  GLN A CA  1 
ATOM   1403 C C   . GLN A 1 181 ? 33.343  0.288   32.027  1.00 39.01  ? 181  GLN A C   1 
ATOM   1404 O O   . GLN A 1 181 ? 32.867  -0.450  32.893  1.00 40.04  ? 181  GLN A O   1 
ATOM   1405 C CB  . GLN A 1 181 ? 35.132  -0.534  30.484  1.00 30.78  ? 181  GLN A CB  1 
ATOM   1406 C CG  . GLN A 1 181 ? 35.425  -1.526  29.363  1.00 44.49  ? 181  GLN A CG  1 
ATOM   1407 C CD  . GLN A 1 181 ? 36.843  -1.423  28.841  1.00 47.79  ? 181  GLN A CD  1 
ATOM   1408 O OE1 . GLN A 1 181 ? 37.570  -0.479  29.157  1.00 54.94  ? 181  GLN A OE1 1 
ATOM   1409 N NE2 . GLN A 1 181 ? 37.242  -2.389  28.025  1.00 42.35  ? 181  GLN A NE2 1 
ATOM   1410 N N   . TRP A 1 182 ? 33.609  1.582   32.218  1.00 38.14  ? 182  TRP A N   1 
ATOM   1411 C CA  . TRP A 1 182 ? 33.294  2.262   33.457  1.00 33.78  ? 182  TRP A CA  1 
ATOM   1412 C C   . TRP A 1 182 ? 31.818  2.105   33.798  1.00 31.48  ? 182  TRP A C   1 
ATOM   1413 O O   . TRP A 1 182 ? 31.460  1.957   34.964  1.00 30.60  ? 182  TRP A O   1 
ATOM   1414 C CB  . TRP A 1 182 ? 33.615  3.747   33.351  1.00 26.00  ? 182  TRP A CB  1 
ATOM   1415 C CG  . TRP A 1 182 ? 33.427  4.493   34.644  1.00 26.72  ? 182  TRP A CG  1 
ATOM   1416 C CD1 . TRP A 1 182 ? 34.396  4.799   35.558  1.00 24.79  ? 182  TRP A CD1 1 
ATOM   1417 C CD2 . TRP A 1 182 ? 32.205  5.045   35.162  1.00 27.64  ? 182  TRP A CD2 1 
ATOM   1418 N NE1 . TRP A 1 182 ? 33.853  5.503   36.608  1.00 28.28  ? 182  TRP A NE1 1 
ATOM   1419 C CE2 . TRP A 1 182 ? 32.514  5.668   36.391  1.00 33.40  ? 182  TRP A CE2 1 
ATOM   1420 C CE3 . TRP A 1 182 ? 30.886  5.078   34.705  1.00 26.20  ? 182  TRP A CE3 1 
ATOM   1421 C CZ2 . TRP A 1 182 ? 31.550  6.314   37.170  1.00 38.82  ? 182  TRP A CZ2 1 
ATOM   1422 C CZ3 . TRP A 1 182 ? 29.930  5.724   35.476  1.00 28.62  ? 182  TRP A CZ3 1 
ATOM   1423 C CH2 . TRP A 1 182 ? 30.266  6.327   36.698  1.00 38.17  ? 182  TRP A CH2 1 
ATOM   1424 N N   . VAL A 1 183 ? 30.960  2.148   32.786  1.00 24.60  ? 183  VAL A N   1 
ATOM   1425 C CA  . VAL A 1 183 ? 29.539  2.002   33.051  1.00 26.58  ? 183  VAL A CA  1 
ATOM   1426 C C   . VAL A 1 183 ? 29.250  0.584   33.547  1.00 31.16  ? 183  VAL A C   1 
ATOM   1427 O O   . VAL A 1 183 ? 28.542  0.408   34.539  1.00 28.00  ? 183  VAL A O   1 
ATOM   1428 C CB  . VAL A 1 183 ? 28.674  2.384   31.845  1.00 27.37  ? 183  VAL A CB  1 
ATOM   1429 C CG1 . VAL A 1 183 ? 27.239  1.932   32.057  1.00 25.68  ? 183  VAL A CG1 1 
ATOM   1430 C CG2 . VAL A 1 183 ? 28.739  3.906   31.612  1.00 23.57  ? 183  VAL A CG2 1 
ATOM   1431 N N   . GLN A 1 184 ? 29.835  -0.417  32.892  1.00 31.44  ? 184  GLN A N   1 
ATOM   1432 C CA  . GLN A 1 184 ? 29.674  -1.800  33.340  1.00 41.27  ? 184  GLN A CA  1 
ATOM   1433 C C   . GLN A 1 184 ? 30.067  -1.988  34.803  1.00 37.32  ? 184  GLN A C   1 
ATOM   1434 O O   . GLN A 1 184 ? 29.353  -2.641  35.561  1.00 37.57  ? 184  GLN A O   1 
ATOM   1435 C CB  . GLN A 1 184 ? 30.475  -2.763  32.468  1.00 26.94  ? 184  GLN A CB  1 
ATOM   1436 C CG  . GLN A 1 184 ? 29.886  -2.917  31.117  1.00 29.92  ? 184  GLN A CG  1 
ATOM   1437 C CD  . GLN A 1 184 ? 28.529  -3.572  31.165  1.00 34.31  ? 184  GLN A CD  1 
ATOM   1438 O OE1 . GLN A 1 184 ? 28.396  -4.704  31.627  1.00 35.78  ? 184  GLN A OE1 1 
ATOM   1439 N NE2 . GLN A 1 184 ? 27.506  -2.860  30.695  1.00 28.93  ? 184  GLN A NE2 1 
ATOM   1440 N N   . GLU A 1 185 ? 31.188  -1.404  35.205  1.00 28.87  ? 185  GLU A N   1 
ATOM   1441 C CA  . GLU A 1 185 ? 31.663  -1.621  36.560  1.00 32.85  ? 185  GLU A CA  1 
ATOM   1442 C C   . GLU A 1 185 ? 30.868  -0.843  37.592  1.00 32.52  ? 185  GLU A C   1 
ATOM   1443 O O   . GLU A 1 185 ? 30.594  -1.359  38.673  1.00 37.51  ? 185  GLU A O   1 
ATOM   1444 C CB  . GLU A 1 185 ? 33.151  -1.298  36.711  1.00 34.28  ? 185  GLU A CB  1 
ATOM   1445 C CG  . GLU A 1 185 ? 33.611  -1.431  38.149  1.00 46.23  ? 185  GLU A CG  1 
ATOM   1446 C CD  . GLU A 1 185 ? 34.988  -2.033  38.287  1.00 55.85  ? 185  GLU A CD  1 
ATOM   1447 O OE1 . GLU A 1 185 ? 35.826  -1.771  37.398  1.00 61.36  ? 185  GLU A OE1 1 
ATOM   1448 O OE2 . GLU A 1 185 ? 35.231  -2.755  39.286  1.00 53.33  ? 185  GLU A OE2 1 
ATOM   1449 N N   . ASN A 1 186 ? 30.468  0.378   37.239  1.00 32.07  ? 186  ASN A N   1 
ATOM   1450 C CA  . ASN A 1 186 ? 30.076  1.363   38.243  1.00 26.43  ? 186  ASN A CA  1 
ATOM   1451 C C   . ASN A 1 186 ? 28.624  1.812   38.246  1.00 31.06  ? 186  ASN A C   1 
ATOM   1452 O O   . ASN A 1 186 ? 28.162  2.383   39.242  1.00 34.61  ? 186  ASN A O   1 
ATOM   1453 C CB  . ASN A 1 186 ? 30.983  2.596   38.151  1.00 25.58  ? 186  ASN A CB  1 
ATOM   1454 C CG  . ASN A 1 186 ? 32.430  2.265   38.438  1.00 35.00  ? 186  ASN A CG  1 
ATOM   1455 O OD1 . ASN A 1 186 ? 32.771  1.896   39.557  1.00 32.63  ? 186  ASN A OD1 1 
ATOM   1456 N ND2 . ASN A 1 186 ? 33.293  2.384   37.420  1.00 30.21  ? 186  ASN A ND2 1 
ATOM   1457 N N   . ILE A 1 187 ? 27.899  1.569   37.159  1.00 25.84  ? 187  ILE A N   1 
ATOM   1458 C CA  . ILE A 1 187 ? 26.569  2.165   37.025  1.00 25.67  ? 187  ILE A CA  1 
ATOM   1459 C C   . ILE A 1 187 ? 25.565  1.658   38.076  1.00 32.10  ? 187  ILE A C   1 
ATOM   1460 O O   . ILE A 1 187 ? 24.644  2.379   38.464  1.00 34.14  ? 187  ILE A O   1 
ATOM   1461 C CB  . ILE A 1 187 ? 26.010  2.071   35.564  1.00 26.33  ? 187  ILE A CB  1 
ATOM   1462 C CG1 . ILE A 1 187 ? 25.067  3.257   35.269  1.00 25.67  ? 187  ILE A CG1 1 
ATOM   1463 C CG2 . ILE A 1 187 ? 25.369  0.711   35.288  1.00 29.39  ? 187  ILE A CG2 1 
ATOM   1464 C CD1 . ILE A 1 187 ? 25.753  4.625   35.354  1.00 23.66  ? 187  ILE A CD1 1 
ATOM   1465 N N   . ALA A 1 188 ? 25.765  0.442   38.565  1.00 28.05  ? 188  ALA A N   1 
ATOM   1466 C CA  . ALA A 1 188 ? 24.861  -0.115  39.557  1.00 30.51  ? 188  ALA A CA  1 
ATOM   1467 C C   . ALA A 1 188 ? 24.851  0.704   40.851  1.00 34.37  ? 188  ALA A C   1 
ATOM   1468 O O   . ALA A 1 188 ? 23.873  0.687   41.591  1.00 37.43  ? 188  ALA A O   1 
ATOM   1469 C CB  . ALA A 1 188 ? 25.180  -1.585  39.830  1.00 30.75  ? 188  ALA A CB  1 
ATOM   1470 N N   . ALA A 1 189 ? 25.922  1.451   41.099  1.00 36.88  ? 189  ALA A N   1 
ATOM   1471 C CA  . ALA A 1 189 ? 26.010  2.299   42.287  1.00 29.41  ? 189  ALA A CA  1 
ATOM   1472 C C   . ALA A 1 189 ? 25.043  3.464   42.199  1.00 32.41  ? 189  ALA A C   1 
ATOM   1473 O O   . ALA A 1 189 ? 24.740  4.102   43.198  1.00 37.20  ? 189  ALA A O   1 
ATOM   1474 C CB  . ALA A 1 189 ? 27.427  2.809   42.477  1.00 28.93  ? 189  ALA A CB  1 
ATOM   1475 N N   . PHE A 1 190 ? 24.564  3.747   40.995  1.00 34.85  ? 190  PHE A N   1 
ATOM   1476 C CA  . PHE A 1 190 ? 23.626  4.846   40.786  1.00 31.40  ? 190  PHE A CA  1 
ATOM   1477 C C   . PHE A 1 190 ? 22.217  4.303   40.562  1.00 31.91  ? 190  PHE A C   1 
ATOM   1478 O O   . PHE A 1 190 ? 21.283  5.065   40.371  1.00 39.60  ? 190  PHE A O   1 
ATOM   1479 C CB  . PHE A 1 190 ? 24.052  5.699   39.579  1.00 26.42  ? 190  PHE A CB  1 
ATOM   1480 C CG  . PHE A 1 190 ? 25.429  6.291   39.706  1.00 28.08  ? 190  PHE A CG  1 
ATOM   1481 C CD1 . PHE A 1 190 ? 26.551  5.562   39.352  1.00 25.42  ? 190  PHE A CD1 1 
ATOM   1482 C CD2 . PHE A 1 190 ? 25.601  7.584   40.172  1.00 32.09  ? 190  PHE A CD2 1 
ATOM   1483 C CE1 . PHE A 1 190 ? 27.824  6.119   39.457  1.00 34.26  ? 190  PHE A CE1 1 
ATOM   1484 C CE2 . PHE A 1 190 ? 26.870  8.144   40.287  1.00 32.27  ? 190  PHE A CE2 1 
ATOM   1485 C CZ  . PHE A 1 190 ? 27.979  7.414   39.930  1.00 24.92  ? 190  PHE A CZ  1 
ATOM   1486 N N   . GLY A 1 191 ? 22.062  2.984   40.586  1.00 29.41  ? 191  GLY A N   1 
ATOM   1487 C CA  . GLY A 1 191 ? 20.774  2.382   40.288  1.00 30.35  ? 191  GLY A CA  1 
ATOM   1488 C C   . GLY A 1 191 ? 20.619  1.980   38.829  1.00 35.53  ? 191  GLY A C   1 
ATOM   1489 O O   . GLY A 1 191 ? 19.553  1.534   38.409  1.00 32.20  ? 191  GLY A O   1 
ATOM   1490 N N   . GLY A 1 192 ? 21.682  2.136   38.045  1.00 35.51  ? 192  GLY A N   1 
ATOM   1491 C CA  . GLY A 1 192 ? 21.641  1.739   36.647  1.00 35.46  ? 192  GLY A CA  1 
ATOM   1492 C C   . GLY A 1 192 ? 21.810  0.238   36.469  1.00 36.29  ? 192  GLY A C   1 
ATOM   1493 O O   . GLY A 1 192 ? 22.508  -0.417  37.247  1.00 34.26  ? 192  GLY A O   1 
ATOM   1494 N N   . ASP A 1 193 ? 21.165  -0.305  35.444  1.00 33.88  ? 193  ASP A N   1 
ATOM   1495 C CA  . ASP A 1 193 ? 21.275  -1.715  35.100  1.00 35.79  ? 193  ASP A CA  1 
ATOM   1496 C C   . ASP A 1 193 ? 22.373  -1.907  34.054  1.00 35.23  ? 193  ASP A C   1 
ATOM   1497 O O   . ASP A 1 193 ? 22.186  -1.575  32.884  1.00 29.32  ? 193  ASP A O   1 
ATOM   1498 C CB  . ASP A 1 193 ? 19.927  -2.227  34.555  1.00 37.58  ? 193  ASP A CB  1 
ATOM   1499 C CG  . ASP A 1 193 ? 19.909  -3.731  34.321  1.00 39.87  ? 193  ASP A CG  1 
ATOM   1500 O OD1 . ASP A 1 193 ? 20.983  -4.365  34.333  1.00 47.19  ? 193  ASP A OD1 1 
ATOM   1501 O OD2 . ASP A 1 193 ? 18.808  -4.287  34.117  1.00 36.17  ? 193  ASP A OD2 1 
ATOM   1502 N N   . PRO A 1 194 ? 23.513  -2.482  34.465  1.00 38.21  ? 194  PRO A N   1 
ATOM   1503 C CA  . PRO A 1 194 ? 24.600  -2.738  33.514  1.00 28.66  ? 194  PRO A CA  1 
ATOM   1504 C C   . PRO A 1 194 ? 24.221  -3.770  32.454  1.00 39.93  ? 194  PRO A C   1 
ATOM   1505 O O   . PRO A 1 194 ? 24.903  -3.850  31.425  1.00 32.12  ? 194  PRO A O   1 
ATOM   1506 C CB  . PRO A 1 194 ? 25.729  -3.265  34.404  1.00 38.46  ? 194  PRO A CB  1 
ATOM   1507 C CG  . PRO A 1 194 ? 25.042  -3.828  35.610  1.00 30.52  ? 194  PRO A CG  1 
ATOM   1508 C CD  . PRO A 1 194 ? 23.824  -2.974  35.822  1.00 33.21  ? 194  PRO A CD  1 
ATOM   1509 N N   . MET A 1 195 ? 23.156  -4.538  32.698  1.00 30.96  ? 195  MET A N   1 
ATOM   1510 C CA  . MET A 1 195 ? 22.700  -5.557  31.745  1.00 32.10  ? 195  MET A CA  1 
ATOM   1511 C C   . MET A 1 195 ? 21.671  -5.007  30.766  1.00 39.10  ? 195  MET A C   1 
ATOM   1512 O O   . MET A 1 195 ? 21.202  -5.721  29.876  1.00 40.70  ? 195  MET A O   1 
ATOM   1513 C CB  . MET A 1 195 ? 22.136  -6.790  32.469  1.00 34.18  ? 195  MET A CB  1 
ATOM   1514 C CG  . MET A 1 195 ? 23.178  -7.592  33.223  1.00 34.89  ? 195  MET A CG  1 
ATOM   1515 S SD  . MET A 1 195 ? 22.555  -9.172  33.808  1.00 53.93  ? 195  MET A SD  1 
ATOM   1516 C CE  . MET A 1 195 ? 21.104  -8.650  34.716  1.00 56.25  ? 195  MET A CE  1 
ATOM   1517 N N   . SER A 1 196 ? 21.318  -3.737  30.928  1.00 33.95  ? 196  SER A N   1 
ATOM   1518 C CA  . SER A 1 196 ? 20.505  -3.061  29.927  1.00 35.46  ? 196  SER A CA  1 
ATOM   1519 C C   . SER A 1 196 ? 21.099  -1.701  29.536  1.00 36.35  ? 196  SER A C   1 
ATOM   1520 O O   . SER A 1 196 ? 20.717  -0.660  30.077  1.00 37.71  ? 196  SER A O   1 
ATOM   1521 C CB  . SER A 1 196 ? 19.072  -2.890  30.422  1.00 32.80  ? 196  SER A CB  1 
ATOM   1522 O OG  . SER A 1 196 ? 18.297  -2.227  29.439  1.00 31.23  ? 196  SER A OG  1 
ATOM   1523 N N   . VAL A 1 197 ? 22.040  -1.728  28.598  1.00 34.45  ? 197  VAL A N   1 
ATOM   1524 C CA  . VAL A 1 197 ? 22.732  -0.528  28.134  1.00 31.65  ? 197  VAL A CA  1 
ATOM   1525 C C   . VAL A 1 197 ? 22.460  -0.264  26.645  1.00 34.93  ? 197  VAL A C   1 
ATOM   1526 O O   . VAL A 1 197 ? 22.716  -1.116  25.778  1.00 34.91  ? 197  VAL A O   1 
ATOM   1527 C CB  . VAL A 1 197 ? 24.272  -0.612  28.363  1.00 34.69  ? 197  VAL A CB  1 
ATOM   1528 C CG1 . VAL A 1 197 ? 24.985  0.567   27.682  1.00 28.23  ? 197  VAL A CG1 1 
ATOM   1529 C CG2 . VAL A 1 197 ? 24.604  -0.643  29.859  1.00 31.89  ? 197  VAL A CG2 1 
ATOM   1530 N N   . THR A 1 198 ? 21.935  0.924   26.364  1.00 34.93  ? 198  THR A N   1 
ATOM   1531 C CA  . THR A 1 198 ? 21.638  1.361   25.002  1.00 32.31  ? 198  THR A CA  1 
ATOM   1532 C C   . THR A 1 198 ? 22.521  2.564   24.623  1.00 30.59  ? 198  THR A C   1 
ATOM   1533 O O   . THR A 1 198 ? 22.468  3.608   25.284  1.00 28.80  ? 198  THR A O   1 
ATOM   1534 C CB  . THR A 1 198 ? 20.168  1.764   24.896  1.00 25.94  ? 198  THR A CB  1 
ATOM   1535 O OG1 . THR A 1 198 ? 19.346  0.612   25.098  1.00 34.88  ? 198  THR A OG1 1 
ATOM   1536 C CG2 . THR A 1 198 ? 19.857  2.373   23.522  1.00 28.38  ? 198  THR A CG2 1 
ATOM   1537 N N   . LEU A 1 199 ? 23.349  2.413   23.589  1.00 23.29  ? 199  LEU A N   1 
ATOM   1538 C CA  . LEU A 1 199 ? 24.125  3.547   23.080  1.00 25.20  ? 199  LEU A CA  1 
ATOM   1539 C C   . LEU A 1 199 ? 23.263  4.401   22.155  1.00 33.18  ? 199  LEU A C   1 
ATOM   1540 O O   . LEU A 1 199 ? 22.421  3.878   21.410  1.00 34.52  ? 199  LEU A O   1 
ATOM   1541 C CB  . LEU A 1 199 ? 25.362  3.088   22.312  1.00 21.88  ? 199  LEU A CB  1 
ATOM   1542 C CG  . LEU A 1 199 ? 26.264  2.066   22.996  1.00 36.61  ? 199  LEU A CG  1 
ATOM   1543 C CD1 . LEU A 1 199 ? 27.475  1.759   22.126  1.00 27.18  ? 199  LEU A CD1 1 
ATOM   1544 C CD2 . LEU A 1 199 ? 26.674  2.541   24.387  1.00 37.02  ? 199  LEU A CD2 1 
ATOM   1545 N N   . PHE A 1 200 ? 23.457  5.714   22.215  1.00 28.52  ? 200  PHE A N   1 
ATOM   1546 C CA  . PHE A 1 200 ? 22.901  6.595   21.196  1.00 29.10  ? 200  PHE A CA  1 
ATOM   1547 C C   . PHE A 1 200 ? 23.792  7.793   20.966  1.00 29.71  ? 200  PHE A C   1 
ATOM   1548 O O   . PHE A 1 200 ? 24.535  8.215   21.864  1.00 24.02  ? 200  PHE A O   1 
ATOM   1549 C CB  . PHE A 1 200 ? 21.417  6.974   21.425  1.00 26.86  ? 200  PHE A CB  1 
ATOM   1550 C CG  . PHE A 1 200 ? 21.159  7.950   22.566  1.00 28.59  ? 200  PHE A CG  1 
ATOM   1551 C CD1 . PHE A 1 200 ? 21.771  7.805   23.808  1.00 29.46  ? 200  PHE A CD1 1 
ATOM   1552 C CD2 . PHE A 1 200 ? 20.242  8.987   22.399  1.00 25.76  ? 200  PHE A CD2 1 
ATOM   1553 C CE1 . PHE A 1 200 ? 21.492  8.690   24.864  1.00 25.90  ? 200  PHE A CE1 1 
ATOM   1554 C CE2 . PHE A 1 200 ? 19.960  9.874   23.444  1.00 29.12  ? 200  PHE A CE2 1 
ATOM   1555 C CZ  . PHE A 1 200 ? 20.600  9.728   24.679  1.00 26.71  ? 200  PHE A CZ  1 
ATOM   1556 N N   . GLY A 1 201 ? 23.733  8.304   19.737  1.00 27.04  ? 201  GLY A N   1 
ATOM   1557 C CA  . GLY A 1 201 ? 24.598  9.382   19.299  1.00 23.58  ? 201  GLY A CA  1 
ATOM   1558 C C   . GLY A 1 201 ? 24.082  9.940   17.987  1.00 27.09  ? 201  GLY A C   1 
ATOM   1559 O O   . GLY A 1 201 ? 23.278  9.319   17.289  1.00 27.06  ? 201  GLY A O   1 
ATOM   1560 N N   . GLU A 1 202 ? 24.532  11.134  17.654  1.00 20.35  ? 202  GLU A N   1 
ATOM   1561 C CA  . GLU A 1 202 ? 24.116  11.748  16.420  1.00 21.98  ? 202  GLU A CA  1 
ATOM   1562 C C   . GLU A 1 202 ? 25.345  12.133  15.593  1.00 22.88  ? 202  GLU A C   1 
ATOM   1563 O O   . GLU A 1 202 ? 26.385  12.482  16.157  1.00 22.18  ? 202  GLU A O   1 
ATOM   1564 C CB  . GLU A 1 202 ? 23.194  12.944  16.715  1.00 21.44  ? 202  GLU A CB  1 
ATOM   1565 C CG  . GLU A 1 202 ? 22.656  13.650  15.488  1.00 25.38  ? 202  GLU A CG  1 
ATOM   1566 C CD  . GLU A 1 202 ? 23.574  14.763  15.040  1.00 27.16  ? 202  GLU A CD  1 
ATOM   1567 O OE1 . GLU A 1 202 ? 24.495  15.106  15.813  1.00 24.47  ? 202  GLU A OE1 1 
ATOM   1568 O OE2 . GLU A 1 202 ? 23.378  15.287  13.922  1.00 23.59  ? 202  GLU A OE2 1 
HETATM 1569 N N   . SGB A 1 203 ? 25.219  12.017  14.267  1.00 28.56  ? 203  SGB A N   1 
HETATM 1570 C CA  . SGB A 1 203 ? 26.247  12.429  13.330  1.00 25.69  ? 203  SGB A CA  1 
HETATM 1571 C C   . SGB A 1 203 ? 27.495  11.612  13.562  1.00 33.25  ? 203  SGB A C   1 
HETATM 1572 O O   . SGB A 1 203 ? 27.447  10.393  13.564  1.00 24.66  ? 203  SGB A O   1 
HETATM 1573 C CB  . SGB A 1 203 ? 26.560  13.906  13.537  1.00 29.51  ? 203  SGB A CB  1 
HETATM 1574 O OG  . SGB A 1 203 ? 27.140  14.439  12.348  1.00 30.23  ? 203  SGB A OG  1 
HETATM 1575 O O1  . SGB A 1 203 ? 29.464  14.925  13.426  0.30 20.01  ? 203  SGB A O1  1 
HETATM 1576 P P1  . SGB A 1 203 ? 28.447  15.385  12.427  0.30 50.40  ? 203  SGB A P1  1 
HETATM 1577 C C1  . SGB A 1 203 ? 29.044  15.459  10.754  0.30 48.18  ? 203  SGB A C1  1 
HETATM 1578 O O2  . SGB A 1 203 ? 27.835  16.841  12.754  0.30 21.84  ? 203  SGB A O2  1 
HETATM 1579 C C2  . SGB A 1 203 ? 27.435  17.176  14.081  0.30 28.47  ? 203  SGB A C2  1 
HETATM 1580 C C4  . SGB A 1 203 ? 25.918  17.305  14.137  0.30 25.25  ? 203  SGB A C4  1 
HETATM 1581 C C3  . SGB A 1 203 ? 28.109  18.477  14.501  0.30 35.32  ? 203  SGB A C3  1 
ATOM   1582 N N   . ALA A 1 204 ? 28.634  12.245  13.856  1.00 19.83  ? 204  ALA A N   1 
ATOM   1583 C CA  . ALA A 1 204 ? 29.827  11.466  14.197  1.00 25.16  ? 204  ALA A CA  1 
ATOM   1584 C C   . ALA A 1 204 ? 29.628  10.574  15.433  1.00 31.82  ? 204  ALA A C   1 
ATOM   1585 O O   . ALA A 1 204 ? 30.272  9.526   15.556  1.00 29.33  ? 204  ALA A O   1 
ATOM   1586 C CB  . ALA A 1 204 ? 31.038  12.353  14.386  1.00 23.55  ? 204  ALA A CB  1 
ATOM   1587 N N   . GLY A 1 205 ? 28.750  10.995  16.347  1.00 32.52  ? 205  GLY A N   1 
ATOM   1588 C CA  . GLY A 1 205 ? 28.407  10.177  17.498  1.00 24.51  ? 205  GLY A CA  1 
ATOM   1589 C C   . GLY A 1 205 ? 27.727  8.889   17.033  1.00 28.60  ? 205  GLY A C   1 
ATOM   1590 O O   . GLY A 1 205 ? 28.041  7.804   17.523  1.00 28.68  ? 205  GLY A O   1 
ATOM   1591 N N   . ALA A 1 206 ? 26.816  9.018   16.067  1.00 22.01  ? 206  ALA A N   1 
ATOM   1592 C CA  . ALA A 1 206 ? 26.156  7.869   15.462  1.00 30.83  ? 206  ALA A CA  1 
ATOM   1593 C C   . ALA A 1 206 ? 27.165  6.932   14.795  1.00 31.69  ? 206  ALA A C   1 
ATOM   1594 O O   . ALA A 1 206 ? 27.134  5.722   15.041  1.00 28.07  ? 206  ALA A O   1 
ATOM   1595 C CB  . ALA A 1 206 ? 25.057  8.318   14.448  1.00 25.81  ? 206  ALA A CB  1 
ATOM   1596 N N   . ALA A 1 207 ? 28.047  7.487   13.956  1.00 24.71  ? 207  ALA A N   1 
ATOM   1597 C CA  . ALA A 1 207 ? 29.113  6.696   13.338  1.00 24.97  ? 207  ALA A CA  1 
ATOM   1598 C C   . ALA A 1 207 ? 29.905  5.935   14.413  1.00 33.27  ? 207  ALA A C   1 
ATOM   1599 O O   . ALA A 1 207 ? 30.182  4.729   14.261  1.00 30.87  ? 207  ALA A O   1 
ATOM   1600 C CB  . ALA A 1 207 ? 30.042  7.579   12.546  1.00 20.88  ? 207  ALA A CB  1 
ATOM   1601 N N   . SER A 1 208 ? 30.263  6.647   15.488  1.00 25.08  ? 208  SER A N   1 
ATOM   1602 C CA  . SER A 1 208 ? 30.926  6.033   16.649  1.00 27.80  ? 208  SER A CA  1 
ATOM   1603 C C   . SER A 1 208 ? 30.123  4.841   17.186  1.00 28.84  ? 208  SER A C   1 
ATOM   1604 O O   . SER A 1 208 ? 30.689  3.766   17.419  1.00 27.21  ? 208  SER A O   1 
ATOM   1605 C CB  . SER A 1 208 ? 31.161  7.051   17.773  1.00 22.36  ? 208  SER A CB  1 
ATOM   1606 O OG  . SER A 1 208 ? 32.113  8.031   17.396  1.00 29.30  ? 208  SER A OG  1 
ATOM   1607 N N   . VAL A 1 209 ? 28.813  5.027   17.368  1.00 24.09  ? 209  VAL A N   1 
ATOM   1608 C CA  . VAL A 1 209 ? 27.959  3.947   17.859  1.00 21.14  ? 209  VAL A CA  1 
ATOM   1609 C C   . VAL A 1 209 ? 28.080  2.755   16.918  1.00 32.66  ? 209  VAL A C   1 
ATOM   1610 O O   . VAL A 1 209 ? 28.232  1.613   17.358  1.00 32.98  ? 209  VAL A O   1 
ATOM   1611 C CB  . VAL A 1 209 ? 26.486  4.385   17.978  1.00 22.87  ? 209  VAL A CB  1 
ATOM   1612 C CG1 . VAL A 1 209 ? 25.550  3.163   18.077  1.00 22.49  ? 209  VAL A CG1 1 
ATOM   1613 C CG2 . VAL A 1 209 ? 26.303  5.317   19.170  1.00 20.70  ? 209  VAL A CG2 1 
ATOM   1614 N N   . GLY A 1 210 ? 28.058  3.039   15.617  1.00 31.00  ? 210  GLY A N   1 
ATOM   1615 C CA  . GLY A 1 210 ? 28.142  2.003   14.598  1.00 31.15  ? 210  GLY A CA  1 
ATOM   1616 C C   . GLY A 1 210 ? 29.452  1.252   14.663  1.00 33.80  ? 210  GLY A C   1 
ATOM   1617 O O   . GLY A 1 210 ? 29.501  0.045   14.430  1.00 38.58  ? 210  GLY A O   1 
ATOM   1618 N N   . MET A 1 211 ? 30.516  1.967   15.004  1.00 22.78  ? 211  MET A N   1 
ATOM   1619 C CA  . MET A 1 211 ? 31.821  1.343   15.150  1.00 31.67  ? 211  MET A CA  1 
ATOM   1620 C C   . MET A 1 211 ? 31.941  0.409   16.349  1.00 30.40  ? 211  MET A C   1 
ATOM   1621 O O   . MET A 1 211 ? 32.610  -0.621  16.259  1.00 30.99  ? 211  MET A O   1 
ATOM   1622 C CB  . MET A 1 211 ? 32.934  2.393   15.126  1.00 29.61  ? 211  MET A CB  1 
ATOM   1623 C CG  . MET A 1 211 ? 33.300  2.717   13.683  1.00 36.69  ? 211  MET A CG  1 
ATOM   1624 S SD  . MET A 1 211 ? 34.002  4.327   13.481  1.00 47.88  ? 211  MET A SD  1 
ATOM   1625 C CE  . MET A 1 211 ? 33.229  4.826   11.947  1.00 42.99  ? 211  MET A CE  1 
ATOM   1626 N N   . HIS A 1 212 ? 31.290  0.759   17.455  1.00 22.84  ? 212  HIS A N   1 
ATOM   1627 C CA  . HIS A 1 212 ? 31.192  -0.156  18.582  1.00 27.55  ? 212  HIS A CA  1 
ATOM   1628 C C   . HIS A 1 212 ? 30.435  -1.440  18.218  1.00 32.60  ? 212  HIS A C   1 
ATOM   1629 O O   . HIS A 1 212 ? 30.808  -2.532  18.653  1.00 36.98  ? 212  HIS A O   1 
ATOM   1630 C CB  . HIS A 1 212 ? 30.588  0.537   19.802  1.00 22.56  ? 212  HIS A CB  1 
ATOM   1631 C CG  . HIS A 1 212 ? 31.450  1.632   20.343  1.00 24.42  ? 212  HIS A CG  1 
ATOM   1632 N ND1 . HIS A 1 212 ? 32.709  1.399   20.853  1.00 26.20  ? 212  HIS A ND1 1 
ATOM   1633 C CD2 . HIS A 1 212 ? 31.252  2.970   20.425  1.00 20.64  ? 212  HIS A CD2 1 
ATOM   1634 C CE1 . HIS A 1 212 ? 33.248  2.545   21.235  1.00 25.46  ? 212  HIS A CE1 1 
ATOM   1635 N NE2 . HIS A 1 212 ? 32.382  3.514   20.991  1.00 33.44  ? 212  HIS A NE2 1 
ATOM   1636 N N   . ILE A 1 213 ? 29.397  -1.308  17.398  1.00 30.56  ? 213  ILE A N   1 
ATOM   1637 C CA  . ILE A 1 213 ? 28.690  -2.470  16.878  1.00 32.46  ? 213  ILE A CA  1 
ATOM   1638 C C   . ILE A 1 213 ? 29.651  -3.365  16.093  1.00 39.09  ? 213  ILE A C   1 
ATOM   1639 O O   . ILE A 1 213 ? 29.631  -4.592  16.212  1.00 40.83  ? 213  ILE A O   1 
ATOM   1640 C CB  . ILE A 1 213 ? 27.504  -2.040  15.985  1.00 35.83  ? 213  ILE A CB  1 
ATOM   1641 C CG1 . ILE A 1 213 ? 26.496  -1.236  16.813  1.00 32.50  ? 213  ILE A CG1 1 
ATOM   1642 C CG2 . ILE A 1 213 ? 26.844  -3.253  15.305  1.00 28.41  ? 213  ILE A CG2 1 
ATOM   1643 C CD1 . ILE A 1 213 ? 25.293  -0.793  16.044  1.00 26.34  ? 213  ILE A CD1 1 
ATOM   1644 N N   . LEU A 1 214 ? 30.512  -2.734  15.305  1.00 37.56  ? 214  LEU A N   1 
ATOM   1645 C CA  . LEU A 1 214 ? 31.401  -3.466  14.415  1.00 34.89  ? 214  LEU A CA  1 
ATOM   1646 C C   . LEU A 1 214 ? 32.697  -3.932  15.080  1.00 32.12  ? 214  LEU A C   1 
ATOM   1647 O O   . LEU A 1 214 ? 33.463  -4.662  14.469  1.00 34.09  ? 214  LEU A O   1 
ATOM   1648 C CB  . LEU A 1 214 ? 31.722  -2.615  13.178  1.00 33.75  ? 214  LEU A CB  1 
ATOM   1649 C CG  . LEU A 1 214 ? 30.491  -2.284  12.332  1.00 37.55  ? 214  LEU A CG  1 
ATOM   1650 C CD1 . LEU A 1 214 ? 30.839  -1.412  11.126  1.00 33.51  ? 214  LEU A CD1 1 
ATOM   1651 C CD2 . LEU A 1 214 ? 29.797  -3.575  11.895  1.00 36.91  ? 214  LEU A CD2 1 
ATOM   1652 N N   . SER A 1 215 ? 32.949  -3.508  16.315  1.00 29.03  ? 215  SER A N   1 
ATOM   1653 C CA  . SER A 1 215 ? 34.208  -3.844  16.978  1.00 32.68  ? 215  SER A CA  1 
ATOM   1654 C C   . SER A 1 215 ? 34.018  -4.773  18.179  1.00 39.43  ? 215  SER A C   1 
ATOM   1655 O O   . SER A 1 215 ? 33.548  -4.352  19.237  1.00 36.32  ? 215  SER A O   1 
ATOM   1656 C CB  . SER A 1 215 ? 34.946  -2.580  17.407  1.00 32.92  ? 215  SER A CB  1 
ATOM   1657 O OG  . SER A 1 215 ? 36.262  -2.895  17.834  1.00 33.74  ? 215  SER A OG  1 
ATOM   1658 N N   . LEU A 1 216 ? 34.413  -6.030  17.998  1.00 43.51  ? 216  LEU A N   1 
ATOM   1659 C CA  . LEU A 1 216 ? 34.187  -7.098  18.975  1.00 50.53  ? 216  LEU A CA  1 
ATOM   1660 C C   . LEU A 1 216 ? 34.334  -6.732  20.455  1.00 45.48  ? 216  LEU A C   1 
ATOM   1661 O O   . LEU A 1 216 ? 33.406  -6.954  21.236  1.00 38.85  ? 216  LEU A O   1 
ATOM   1662 C CB  . LEU A 1 216 ? 35.039  -8.328  18.631  1.00 61.61  ? 216  LEU A CB  1 
ATOM   1663 C CG  . LEU A 1 216 ? 34.476  -9.140  17.470  1.00 70.81  ? 216  LEU A CG  1 
ATOM   1664 C CD1 . LEU A 1 216 ? 35.565  -9.976  16.798  1.00 73.82  ? 216  LEU A CD1 1 
ATOM   1665 C CD2 . LEU A 1 216 ? 33.338  -10.011 17.987  1.00 72.54  ? 216  LEU A CD2 1 
ATOM   1666 N N   . PRO A 1 217 ? 35.482  -6.151  20.849  1.00 44.29  ? 217  PRO A N   1 
ATOM   1667 C CA  . PRO A 1 217 ? 35.624  -5.874  22.286  1.00 37.59  ? 217  PRO A CA  1 
ATOM   1668 C C   . PRO A 1 217 ? 34.602  -4.881  22.850  1.00 37.63  ? 217  PRO A C   1 
ATOM   1669 O O   . PRO A 1 217 ? 34.484  -4.781  24.071  1.00 44.96  ? 217  PRO A O   1 
ATOM   1670 C CB  . PRO A 1 217 ? 37.045  -5.302  22.395  1.00 29.18  ? 217  PRO A CB  1 
ATOM   1671 C CG  . PRO A 1 217 ? 37.745  -5.777  21.159  1.00 34.06  ? 217  PRO A CG  1 
ATOM   1672 C CD  . PRO A 1 217 ? 36.695  -5.778  20.099  1.00 32.69  ? 217  PRO A CD  1 
ATOM   1673 N N   . SER A 1 218 ? 33.882  -4.157  22.000  1.00 37.07  ? 218  SER A N   1 
ATOM   1674 C CA  . SER A 1 218 ? 32.861  -3.234  22.501  1.00 33.68  ? 218  SER A CA  1 
ATOM   1675 C C   . SER A 1 218 ? 31.551  -3.939  22.740  1.00 38.97  ? 218  SER A C   1 
ATOM   1676 O O   . SER A 1 218 ? 30.715  -3.483  23.521  1.00 38.04  ? 218  SER A O   1 
ATOM   1677 C CB  . SER A 1 218 ? 32.620  -2.085  21.527  1.00 30.98  ? 218  SER A CB  1 
ATOM   1678 O OG  . SER A 1 218 ? 33.654  -1.123  21.638  1.00 34.15  ? 218  SER A OG  1 
ATOM   1679 N N   . ARG A 1 219 ? 31.381  -5.059  22.055  1.00 41.29  ? 219  ARG A N   1 
ATOM   1680 C CA  . ARG A 1 219 ? 30.067  -5.654  21.914  1.00 45.89  ? 219  ARG A CA  1 
ATOM   1681 C C   . ARG A 1 219 ? 29.492  -6.158  23.223  1.00 42.60  ? 219  ARG A C   1 
ATOM   1682 O O   . ARG A 1 219 ? 28.281  -6.186  23.391  1.00 46.70  ? 219  ARG A O   1 
ATOM   1683 C CB  . ARG A 1 219 ? 30.086  -6.746  20.845  1.00 56.48  ? 219  ARG A CB  1 
ATOM   1684 C CG  . ARG A 1 219 ? 30.085  -6.188  19.419  1.00 58.44  ? 219  ARG A CG  1 
ATOM   1685 C CD  . ARG A 1 219 ? 28.872  -5.285  19.171  1.00 57.71  ? 219  ARG A CD  1 
ATOM   1686 N NE  . ARG A 1 219 ? 27.610  -5.950  19.489  1.00 62.10  ? 219  ARG A NE  1 
ATOM   1687 C CZ  . ARG A 1 219 ? 26.865  -6.613  18.609  1.00 61.94  ? 219  ARG A CZ  1 
ATOM   1688 N NH1 . ARG A 1 219 ? 27.246  -6.693  17.341  1.00 59.27  ? 219  ARG A NH1 1 
ATOM   1689 N NH2 . ARG A 1 219 ? 25.737  -7.197  19.002  1.00 63.01  ? 219  ARG A NH2 1 
ATOM   1690 N N   . SER A 1 220 ? 30.365  -6.533  24.152  1.00 41.82  ? 220  SER A N   1 
ATOM   1691 C CA  . SER A 1 220 ? 29.932  -6.974  25.471  1.00 45.20  ? 220  SER A CA  1 
ATOM   1692 C C   . SER A 1 220 ? 29.631  -5.809  26.415  1.00 38.46  ? 220  SER A C   1 
ATOM   1693 O O   . SER A 1 220 ? 29.362  -6.018  27.590  1.00 41.69  ? 220  SER A O   1 
ATOM   1694 C CB  . SER A 1 220 ? 30.990  -7.880  26.107  1.00 52.63  ? 220  SER A CB  1 
ATOM   1695 O OG  . SER A 1 220 ? 32.214  -7.191  26.288  1.00 53.46  ? 220  SER A OG  1 
ATOM   1696 N N   . LEU A 1 221 ? 29.671  -4.581  25.914  1.00 31.46  ? 221  LEU A N   1 
ATOM   1697 C CA  . LEU A 1 221 ? 29.498  -3.442  26.801  1.00 29.91  ? 221  LEU A CA  1 
ATOM   1698 C C   . LEU A 1 221 ? 28.155  -2.759  26.591  1.00 36.95  ? 221  LEU A C   1 
ATOM   1699 O O   . LEU A 1 221 ? 27.859  -1.755  27.250  1.00 34.68  ? 221  LEU A O   1 
ATOM   1700 C CB  . LEU A 1 221 ? 30.639  -2.443  26.627  1.00 30.35  ? 221  LEU A CB  1 
ATOM   1701 C CG  . LEU A 1 221 ? 32.052  -3.033  26.595  1.00 34.61  ? 221  LEU A CG  1 
ATOM   1702 C CD1 . LEU A 1 221 ? 33.079  -1.954  26.220  1.00 33.16  ? 221  LEU A CD1 1 
ATOM   1703 C CD2 . LEU A 1 221 ? 32.390  -3.706  27.941  1.00 27.16  ? 221  LEU A CD2 1 
ATOM   1704 N N   . PHE A 1 222 ? 27.340  -3.295  25.682  1.00 26.48  ? 222  PHE A N   1 
ATOM   1705 C CA  . PHE A 1 222 ? 26.044  -2.673  25.391  1.00 34.55  ? 222  PHE A CA  1 
ATOM   1706 C C   . PHE A 1 222 ? 25.091  -3.671  24.719  1.00 32.87  ? 222  PHE A C   1 
ATOM   1707 O O   . PHE A 1 222 ? 25.522  -4.722  24.272  1.00 35.10  ? 222  PHE A O   1 
ATOM   1708 C CB  . PHE A 1 222 ? 26.222  -1.378  24.566  1.00 25.96  ? 222  PHE A CB  1 
ATOM   1709 C CG  . PHE A 1 222 ? 26.639  -1.608  23.125  1.00 28.51  ? 222  PHE A CG  1 
ATOM   1710 C CD1 . PHE A 1 222 ? 27.977  -1.749  22.785  1.00 29.23  ? 222  PHE A CD1 1 
ATOM   1711 C CD2 . PHE A 1 222 ? 25.686  -1.664  22.110  1.00 31.77  ? 222  PHE A CD2 1 
ATOM   1712 C CE1 . PHE A 1 222 ? 28.363  -1.957  21.463  1.00 31.16  ? 222  PHE A CE1 1 
ATOM   1713 C CE2 . PHE A 1 222 ? 26.061  -1.875  20.780  1.00 33.26  ? 222  PHE A CE2 1 
ATOM   1714 C CZ  . PHE A 1 222 ? 27.399  -2.020  20.456  1.00 30.84  ? 222  PHE A CZ  1 
ATOM   1715 N N   . HIS A 1 223 ? 23.803  -3.353  24.648  1.00 33.82  ? 223  HIS A N   1 
ATOM   1716 C CA  . HIS A 1 223 ? 22.820  -4.336  24.162  1.00 38.36  ? 223  HIS A CA  1 
ATOM   1717 C C   . HIS A 1 223 ? 21.971  -3.860  22.987  1.00 39.98  ? 223  HIS A C   1 
ATOM   1718 O O   . HIS A 1 223 ? 21.473  -4.669  22.218  1.00 48.27  ? 223  HIS A O   1 
ATOM   1719 C CB  . HIS A 1 223 ? 21.917  -4.786  25.313  1.00 36.08  ? 223  HIS A CB  1 
ATOM   1720 C CG  . HIS A 1 223 ? 22.678  -5.110  26.562  1.00 43.22  ? 223  HIS A CG  1 
ATOM   1721 N ND1 . HIS A 1 223 ? 23.068  -4.143  27.466  1.00 40.67  ? 223  HIS A ND1 1 
ATOM   1722 C CD2 . HIS A 1 223 ? 23.172  -6.282  27.027  1.00 31.83  ? 223  HIS A CD2 1 
ATOM   1723 C CE1 . HIS A 1 223 ? 23.750  -4.709  28.444  1.00 43.25  ? 223  HIS A CE1 1 
ATOM   1724 N NE2 . HIS A 1 223 ? 23.820  -6.007  28.206  1.00 49.29  ? 223  HIS A NE2 1 
ATOM   1725 N N   . ARG A 1 224 ? 21.814  -2.548  22.859  1.00 37.76  ? 224  ARG A N   1 
ATOM   1726 C CA  . ARG A 1 224 ? 20.974  -1.951  21.829  1.00 31.62  ? 224  ARG A CA  1 
ATOM   1727 C C   . ARG A 1 224 ? 21.621  -0.643  21.412  1.00 33.20  ? 224  ARG A C   1 
ATOM   1728 O O   . ARG A 1 224 ? 22.385  -0.060  22.180  1.00 32.84  ? 224  ARG A O   1 
ATOM   1729 C CB  . ARG A 1 224 ? 19.581  -1.665  22.389  1.00 35.42  ? 224  ARG A CB  1 
ATOM   1730 C CG  . ARG A 1 224 ? 18.651  -2.848  22.335  1.00 43.59  ? 224  ARG A CG  1 
ATOM   1731 C CD  . ARG A 1 224 ? 17.479  -2.671  23.264  1.00 39.88  ? 224  ARG A CD  1 
ATOM   1732 N NE  . ARG A 1 224 ? 17.896  -2.749  24.653  1.00 45.82  ? 224  ARG A NE  1 
ATOM   1733 C CZ  . ARG A 1 224 ? 18.035  -3.882  25.328  1.00 51.10  ? 224  ARG A CZ  1 
ATOM   1734 N NH1 . ARG A 1 224 ? 17.785  -5.046  24.745  1.00 53.71  ? 224  ARG A NH1 1 
ATOM   1735 N NH2 . ARG A 1 224 ? 18.428  -3.847  26.591  1.00 55.16  ? 224  ARG A NH2 1 
ATOM   1736 N N   . ALA A 1 225 ? 21.306  -0.165  20.214  1.00 33.41  ? 225  ALA A N   1 
ATOM   1737 C CA  . ALA A 1 225 ? 21.958  1.032   19.708  1.00 30.29  ? 225  ALA A CA  1 
ATOM   1738 C C   . ALA A 1 225 ? 21.023  1.896   18.869  1.00 35.23  ? 225  ALA A C   1 
ATOM   1739 O O   . ALA A 1 225 ? 20.153  1.383   18.158  1.00 27.28  ? 225  ALA A O   1 
ATOM   1740 C CB  . ALA A 1 225 ? 23.181  0.649   18.905  1.00 34.27  ? 225  ALA A CB  1 
ATOM   1741 N N   . VAL A 1 226 ? 21.207  3.210   18.981  1.00 24.94  ? 226  VAL A N   1 
ATOM   1742 C CA  . VAL A 1 226 ? 20.484  4.179   18.169  1.00 39.50  ? 226  VAL A CA  1 
ATOM   1743 C C   . VAL A 1 226 ? 21.461  5.048   17.381  1.00 34.81  ? 226  VAL A C   1 
ATOM   1744 O O   . VAL A 1 226 ? 22.407  5.600   17.947  1.00 34.66  ? 226  VAL A O   1 
ATOM   1745 C CB  . VAL A 1 226 ? 19.612  5.102   19.028  1.00 39.77  ? 226  VAL A CB  1 
ATOM   1746 C CG1 . VAL A 1 226 ? 18.735  5.983   18.124  1.00 35.99  ? 226  VAL A CG1 1 
ATOM   1747 C CG2 . VAL A 1 226 ? 18.767  4.290   19.991  1.00 26.17  ? 226  VAL A CG2 1 
ATOM   1748 N N   . LEU A 1 227 ? 21.237  5.162   16.077  1.00 30.36  ? 227  LEU A N   1 
ATOM   1749 C CA  . LEU A 1 227 ? 22.119  5.948   15.217  1.00 30.23  ? 227  LEU A CA  1 
ATOM   1750 C C   . LEU A 1 227 ? 21.345  7.090   14.582  1.00 26.35  ? 227  LEU A C   1 
ATOM   1751 O O   . LEU A 1 227 ? 20.520  6.864   13.704  1.00 25.65  ? 227  LEU A O   1 
ATOM   1752 C CB  . LEU A 1 227 ? 22.768  5.073   14.132  1.00 24.48  ? 227  LEU A CB  1 
ATOM   1753 C CG  . LEU A 1 227 ? 23.836  4.070   14.593  1.00 31.80  ? 227  LEU A CG  1 
ATOM   1754 C CD1 . LEU A 1 227 ? 23.197  2.804   15.172  1.00 30.56  ? 227  LEU A CD1 1 
ATOM   1755 C CD2 . LEU A 1 227 ? 24.828  3.736   13.480  1.00 24.23  ? 227  LEU A CD2 1 
ATOM   1756 N N   . GLN A 1 228 ? 21.604  8.315   15.036  1.00 27.16  ? 228  GLN A N   1 
ATOM   1757 C CA  . GLN A 1 228 ? 20.879  9.482   14.517  1.00 30.12  ? 228  GLN A CA  1 
ATOM   1758 C C   . GLN A 1 228 ? 21.707  10.248  13.496  1.00 31.03  ? 228  GLN A C   1 
ATOM   1759 O O   . GLN A 1 228 ? 22.751  10.820  13.834  1.00 26.41  ? 228  GLN A O   1 
ATOM   1760 C CB  . GLN A 1 228 ? 20.465  10.411  15.661  1.00 23.96  ? 228  GLN A CB  1 
ATOM   1761 C CG  . GLN A 1 228 ? 19.739  9.680   16.791  1.00 24.30  ? 228  GLN A CG  1 
ATOM   1762 C CD  . GLN A 1 228 ? 19.493  10.560  18.003  1.00 27.86  ? 228  GLN A CD  1 
ATOM   1763 O OE1 . GLN A 1 228 ? 19.347  10.067  19.117  1.00 32.28  ? 228  GLN A OE1 1 
ATOM   1764 N NE2 . GLN A 1 228 ? 19.441  11.869  17.788  1.00 30.39  ? 228  GLN A NE2 1 
ATOM   1765 N N   . SER A 1 229 ? 21.257  10.245  12.247  1.00 28.50  ? 229  SER A N   1 
ATOM   1766 C CA  . SER A 1 229 ? 21.920  11.028  11.198  1.00 28.36  ? 229  SER A CA  1 
ATOM   1767 C C   . SER A 1 229 ? 23.417  10.751  11.044  1.00 20.96  ? 229  SER A C   1 
ATOM   1768 O O   . SER A 1 229 ? 24.202  11.675  10.919  1.00 28.48  ? 229  SER A O   1 
ATOM   1769 C CB  . SER A 1 229 ? 21.721  12.519  11.460  1.00 22.17  ? 229  SER A CB  1 
ATOM   1770 O OG  . SER A 1 229 ? 20.344  12.829  11.529  1.00 26.92  ? 229  SER A OG  1 
ATOM   1771 N N   . GLY A 1 230 ? 23.807  9.484   11.052  1.00 26.15  ? 230  GLY A N   1 
ATOM   1772 C CA  . GLY A 1 230 ? 25.203  9.111   10.892  1.00 24.08  ? 230  GLY A CA  1 
ATOM   1773 C C   . GLY A 1 230 ? 25.408  7.603   10.932  1.00 25.82  ? 230  GLY A C   1 
ATOM   1774 O O   . GLY A 1 230 ? 24.616  6.870   11.535  1.00 27.19  ? 230  GLY A O   1 
ATOM   1775 N N   . THR A 1 231 ? 26.484  7.141   10.300  1.00 22.24  ? 231  THR A N   1 
ATOM   1776 C CA  . THR A 1 231 ? 26.724  5.709   10.111  1.00 30.12  ? 231  THR A CA  1 
ATOM   1777 C C   . THR A 1 231 ? 28.224  5.440   10.065  1.00 28.62  ? 231  THR A C   1 
ATOM   1778 O O   . THR A 1 231 ? 29.001  6.313   9.722   1.00 27.57  ? 231  THR A O   1 
ATOM   1779 C CB  . THR A 1 231 ? 26.144  5.192   8.756   1.00 32.71  ? 231  THR A CB  1 
ATOM   1780 O OG1 . THR A 1 231 ? 26.756  5.908   7.684   1.00 34.06  ? 231  THR A OG1 1 
ATOM   1781 C CG2 . THR A 1 231 ? 24.644  5.354   8.670   1.00 28.07  ? 231  THR A CG2 1 
ATOM   1782 N N   . PRO A 1 232 ? 28.639  4.217   10.395  1.00 29.51  ? 232  PRO A N   1 
ATOM   1783 C CA  . PRO A 1 232 ? 30.088  3.986   10.320  1.00 26.51  ? 232  PRO A CA  1 
ATOM   1784 C C   . PRO A 1 232 ? 30.538  3.784   8.867   1.00 30.06  ? 232  PRO A C   1 
ATOM   1785 O O   . PRO A 1 232 ? 31.674  4.106   8.518   1.00 31.62  ? 232  PRO A O   1 
ATOM   1786 C CB  . PRO A 1 232 ? 30.275  2.713   11.153  1.00 23.80  ? 232  PRO A CB  1 
ATOM   1787 C CG  . PRO A 1 232 ? 28.949  1.970   10.983  1.00 26.04  ? 232  PRO A CG  1 
ATOM   1788 C CD  . PRO A 1 232 ? 27.901  3.055   10.936  1.00 25.60  ? 232  PRO A CD  1 
ATOM   1789 N N   . ASN A 1 233 ? 29.649  3.253   8.032   1.00 32.11  ? 233  ASN A N   1 
ATOM   1790 C CA  . ASN A 1 233 ? 29.893  3.186   6.596   1.00 35.91  ? 233  ASN A CA  1 
ATOM   1791 C C   . ASN A 1 233 ? 29.718  4.579   5.972   1.00 31.49  ? 233  ASN A C   1 
ATOM   1792 O O   . ASN A 1 233 ? 29.304  5.519   6.645   1.00 35.08  ? 233  ASN A O   1 
ATOM   1793 C CB  . ASN A 1 233 ? 28.953  2.165   5.934   1.00 27.38  ? 233  ASN A CB  1 
ATOM   1794 C CG  . ASN A 1 233 ? 27.479  2.439   6.249   1.00 35.01  ? 233  ASN A CG  1 
ATOM   1795 O OD1 . ASN A 1 233 ? 27.074  2.484   7.413   1.00 33.59  ? 233  ASN A OD1 1 
ATOM   1796 N ND2 . ASN A 1 233 ? 26.680  2.650   5.210   1.00 32.63  ? 233  ASN A ND2 1 
ATOM   1797 N N   . GLY A 1 234 ? 30.032  4.718   4.690   1.00 30.99  ? 234  GLY A N   1 
ATOM   1798 C CA  . GLY A 1 234 ? 29.863  5.995   4.021   1.00 29.65  ? 234  GLY A CA  1 
ATOM   1799 C C   . GLY A 1 234 ? 31.163  6.746   3.806   1.00 33.48  ? 234  GLY A C   1 
ATOM   1800 O O   . GLY A 1 234 ? 32.224  6.264   4.175   1.00 40.19  ? 234  GLY A O   1 
ATOM   1801 N N   . PRO A 1 235 ? 31.081  7.948   3.220   1.00 36.03  ? 235  PRO A N   1 
ATOM   1802 C CA  . PRO A 1 235 ? 32.283  8.607   2.689   1.00 29.19  ? 235  PRO A CA  1 
ATOM   1803 C C   . PRO A 1 235 ? 33.127  9.410   3.692   1.00 29.42  ? 235  PRO A C   1 
ATOM   1804 O O   . PRO A 1 235 ? 34.249  9.788   3.354   1.00 30.84  ? 235  PRO A O   1 
ATOM   1805 C CB  . PRO A 1 235 ? 31.719  9.514   1.588   1.00 27.02  ? 235  PRO A CB  1 
ATOM   1806 C CG  . PRO A 1 235 ? 30.309  9.833   2.043   1.00 35.29  ? 235  PRO A CG  1 
ATOM   1807 C CD  . PRO A 1 235 ? 29.833  8.641   2.832   1.00 36.13  ? 235  PRO A CD  1 
ATOM   1808 N N   . TRP A 1 236 ? 32.632  9.652   4.901   1.00 29.09  ? 236  TRP A N   1 
ATOM   1809 C CA  . TRP A 1 236 ? 33.348  10.549  5.812   1.00 27.07  ? 236  TRP A CA  1 
ATOM   1810 C C   . TRP A 1 236 ? 33.790  9.918   7.135   1.00 27.93  ? 236  TRP A C   1 
ATOM   1811 O O   . TRP A 1 236 ? 34.728  10.384  7.759   1.00 26.49  ? 236  TRP A O   1 
ATOM   1812 C CB  . TRP A 1 236 ? 32.516  11.799  6.095   1.00 25.60  ? 236  TRP A CB  1 
ATOM   1813 C CG  . TRP A 1 236 ? 31.141  11.493  6.654   1.00 29.12  ? 236  TRP A CG  1 
ATOM   1814 C CD1 . TRP A 1 236 ? 29.994  11.308  5.941   1.00 28.19  ? 236  TRP A CD1 1 
ATOM   1815 C CD2 . TRP A 1 236 ? 30.785  11.326  8.035   1.00 25.45  ? 236  TRP A CD2 1 
ATOM   1816 N NE1 . TRP A 1 236 ? 28.944  11.036  6.789   1.00 32.42  ? 236  TRP A NE1 1 
ATOM   1817 C CE2 . TRP A 1 236 ? 29.402  11.039  8.080   1.00 29.66  ? 236  TRP A CE2 1 
ATOM   1818 C CE3 . TRP A 1 236 ? 31.499  11.386  9.233   1.00 25.98  ? 236  TRP A CE3 1 
ATOM   1819 C CZ2 . TRP A 1 236 ? 28.715  10.825  9.281   1.00 26.79  ? 236  TRP A CZ2 1 
ATOM   1820 C CZ3 . TRP A 1 236 ? 30.816  11.174  10.431  1.00 26.37  ? 236  TRP A CZ3 1 
ATOM   1821 C CH2 . TRP A 1 236 ? 29.435  10.895  10.444  1.00 23.48  ? 236  TRP A CH2 1 
ATOM   1822 N N   . ALA A 1 237 ? 33.125  8.863   7.569   1.00 24.79  ? 237  ALA A N   1 
ATOM   1823 C CA  . ALA A 1 237 ? 33.361  8.370   8.936   1.00 28.90  ? 237  ALA A CA  1 
ATOM   1824 C C   . ALA A 1 237 ? 34.716  7.690   9.149   1.00 29.65  ? 237  ALA A C   1 
ATOM   1825 O O   . ALA A 1 237 ? 35.196  7.629   10.272  1.00 29.89  ? 237  ALA A O   1 
ATOM   1826 C CB  . ALA A 1 237 ? 32.219  7.460   9.402   1.00 20.63  ? 237  ALA A CB  1 
ATOM   1827 N N   . THR A 1 238 ? 35.324  7.174   8.085   1.00 22.16  ? 238  THR A N   1 
ATOM   1828 C CA  . THR A 1 238 ? 36.632  6.518   8.201   1.00 23.99  ? 238  THR A CA  1 
ATOM   1829 C C   . THR A 1 238 ? 37.594  6.928   7.085   1.00 30.61  ? 238  THR A C   1 
ATOM   1830 O O   . THR A 1 238 ? 37.177  7.490   6.071   1.00 35.30  ? 238  THR A O   1 
ATOM   1831 C CB  . THR A 1 238 ? 36.528  4.981   8.160   1.00 24.35  ? 238  THR A CB  1 
ATOM   1832 O OG1 . THR A 1 238 ? 35.900  4.581   6.941   1.00 25.77  ? 238  THR A OG1 1 
ATOM   1833 C CG2 . THR A 1 238 ? 35.728  4.457   9.323   1.00 23.87  ? 238  THR A CG2 1 
ATOM   1834 N N   . VAL A 1 239 ? 38.881  6.645   7.281   1.00 28.27  ? 239  VAL A N   1 
ATOM   1835 C CA  . VAL A 1 239 ? 39.876  6.813   6.227   1.00 25.81  ? 239  VAL A CA  1 
ATOM   1836 C C   . VAL A 1 239 ? 40.762  5.588   6.250   1.00 34.83  ? 239  VAL A C   1 
ATOM   1837 O O   . VAL A 1 239 ? 40.892  4.931   7.281   1.00 40.51  ? 239  VAL A O   1 
ATOM   1838 C CB  . VAL A 1 239 ? 40.763  8.072   6.407   1.00 25.58  ? 239  VAL A CB  1 
ATOM   1839 C CG1 . VAL A 1 239 ? 39.995  9.353   6.079   1.00 24.30  ? 239  VAL A CG1 1 
ATOM   1840 C CG2 . VAL A 1 239 ? 41.379  8.108   7.812   1.00 24.38  ? 239  VAL A CG2 1 
ATOM   1841 N N   . SER A 1 240 ? 41.364  5.278   5.113   1.00 29.29  ? 240  SER A N   1 
ATOM   1842 C CA  . SER A 1 240 ? 42.282  4.156   5.011   1.00 31.36  ? 240  SER A CA  1 
ATOM   1843 C C   . SER A 1 240 ? 43.527  4.411   5.854   1.00 32.06  ? 240  SER A C   1 
ATOM   1844 O O   . SER A 1 240 ? 43.775  5.530   6.285   1.00 30.28  ? 240  SER A O   1 
ATOM   1845 C CB  . SER A 1 240 ? 42.700  3.963   3.552   1.00 33.60  ? 240  SER A CB  1 
ATOM   1846 O OG  . SER A 1 240 ? 43.447  5.080   3.105   1.00 35.66  ? 240  SER A OG  1 
ATOM   1847 N N   . ALA A 1 241 ? 44.322  3.370   6.071   1.00 35.78  ? 241  ALA A N   1 
ATOM   1848 C CA  . ALA A 1 241 ? 45.579  3.529   6.788   1.00 37.60  ? 241  ALA A CA  1 
ATOM   1849 C C   . ALA A 1 241 ? 46.501  4.476   6.024   1.00 34.99  ? 241  ALA A C   1 
ATOM   1850 O O   . ALA A 1 241 ? 47.109  5.361   6.617   1.00 32.57  ? 241  ALA A O   1 
ATOM   1851 C CB  . ALA A 1 241 ? 46.251  2.176   7.016   1.00 35.75  ? 241  ALA A CB  1 
ATOM   1852 N N   . GLY A 1 242 ? 46.576  4.298   4.705   1.00 37.35  ? 242  GLY A N   1 
ATOM   1853 C CA  . GLY A 1 242 ? 47.443  5.107   3.861   1.00 36.18  ? 242  GLY A CA  1 
ATOM   1854 C C   . GLY A 1 242 ? 47.091  6.577   3.917   1.00 38.71  ? 242  GLY A C   1 
ATOM   1855 O O   . GLY A 1 242 ? 47.959  7.443   4.013   1.00 39.33  ? 242  GLY A O   1 
ATOM   1856 N N   . GLU A 1 243 ? 45.799  6.859   3.877   1.00 32.62  ? 243  GLU A N   1 
ATOM   1857 C CA  . GLU A 1 243 ? 45.342  8.228   3.934   1.00 30.95  ? 243  GLU A CA  1 
ATOM   1858 C C   . GLU A 1 243 ? 45.601  8.839   5.319   1.00 33.87  ? 243  GLU A C   1 
ATOM   1859 O O   . GLU A 1 243 ? 46.049  9.981   5.427   1.00 29.70  ? 243  GLU A O   1 
ATOM   1860 C CB  . GLU A 1 243 ? 43.860  8.306   3.531   1.00 35.96  ? 243  GLU A CB  1 
ATOM   1861 C CG  . GLU A 1 243 ? 43.238  9.688   3.626   1.00 28.72  ? 243  GLU A CG  1 
ATOM   1862 C CD  . GLU A 1 243 ? 43.859  10.708  2.679   1.00 35.48  ? 243  GLU A CD  1 
ATOM   1863 O OE1 . GLU A 1 243 ? 44.682  10.353  1.795   1.00 31.87  ? 243  GLU A OE1 1 
ATOM   1864 O OE2 . GLU A 1 243 ? 43.512  11.894  2.822   1.00 36.10  ? 243  GLU A OE2 1 
ATOM   1865 N N   . ALA A 1 244 ? 45.338  8.074   6.377   1.00 28.46  ? 244  ALA A N   1 
ATOM   1866 C CA  . ALA A 1 244 ? 45.585  8.560   7.729   1.00 27.12  ? 244  ALA A CA  1 
ATOM   1867 C C   . ALA A 1 244 ? 47.066  8.892   7.902   1.00 35.78  ? 244  ALA A C   1 
ATOM   1868 O O   . ALA A 1 244 ? 47.416  9.932   8.469   1.00 34.63  ? 244  ALA A O   1 
ATOM   1869 C CB  . ALA A 1 244 ? 45.132  7.551   8.762   1.00 26.81  ? 244  ALA A CB  1 
ATOM   1870 N N   A ARG A 1 245 ? 47.929  8.007   7.413   0.71 29.95  ? 245  ARG A N   1 
ATOM   1871 N N   B ARG A 1 245 ? 47.917  8.014   7.381   0.29 35.70  ? 245  ARG A N   1 
ATOM   1872 C CA  A ARG A 1 245 ? 49.373  8.238   7.439   0.71 35.61  ? 245  ARG A CA  1 
ATOM   1873 C CA  B ARG A 1 245 ? 49.366  8.189   7.412   0.29 36.07  ? 245  ARG A CA  1 
ATOM   1874 C C   A ARG A 1 245 ? 49.731  9.530   6.711   0.71 35.77  ? 245  ARG A C   1 
ATOM   1875 C C   B ARG A 1 245 ? 49.796  9.459   6.673   0.29 36.29  ? 245  ARG A C   1 
ATOM   1876 O O   A ARG A 1 245 ? 50.452  10.376  7.242   0.71 36.59  ? 245  ARG A O   1 
ATOM   1877 O O   B ARG A 1 245 ? 50.627  10.224  7.163   0.29 36.89  ? 245  ARG A O   1 
ATOM   1878 C CB  A ARG A 1 245 ? 50.145  7.052   6.827   0.71 33.72  ? 245  ARG A CB  1 
ATOM   1879 C CB  B ARG A 1 245 ? 50.056  6.955   6.805   0.29 33.74  ? 245  ARG A CB  1 
ATOM   1880 C CG  A ARG A 1 245 ? 51.668  7.301   6.674   0.71 35.38  ? 245  ARG A CG  1 
ATOM   1881 C CG  B ARG A 1 245 ? 51.571  6.894   7.011   0.29 45.61  ? 245  ARG A CG  1 
ATOM   1882 C CD  A ARG A 1 245 ? 52.487  6.008   6.474   0.71 38.07  ? 245  ARG A CD  1 
ATOM   1883 C CD  B ARG A 1 245 ? 52.152  5.522   6.627   0.29 46.54  ? 245  ARG A CD  1 
ATOM   1884 N NE  A ARG A 1 245 ? 52.418  5.139   7.644   0.71 38.05  ? 245  ARG A NE  1 
ATOM   1885 N NE  B ARG A 1 245 ? 51.497  4.417   7.330   0.29 44.58  ? 245  ARG A NE  1 
ATOM   1886 C CZ  A ARG A 1 245 ? 53.160  5.302   8.730   0.71 37.95  ? 245  ARG A CZ  1 
ATOM   1887 C CZ  B ARG A 1 245 ? 50.758  3.477   6.741   0.29 39.11  ? 245  ARG A CZ  1 
ATOM   1888 N NH1 A ARG A 1 245 ? 54.038  6.288   8.782   0.71 37.82  ? 245  ARG A NH1 1 
ATOM   1889 N NH1 B ARG A 1 245 ? 50.582  3.482   5.425   0.29 40.21  ? 245  ARG A NH1 1 
ATOM   1890 N NH2 A ARG A 1 245 ? 53.025  4.487   9.760   0.71 38.21  ? 245  ARG A NH2 1 
ATOM   1891 N NH2 B ARG A 1 245 ? 50.203  2.521   7.469   0.29 39.28  ? 245  ARG A NH2 1 
ATOM   1892 N N   . ARG A 1 246 ? 49.223  9.679   5.495   1.00 31.75  ? 246  ARG A N   1 
ATOM   1893 C CA  . ARG A 1 246 ? 49.555  10.841  4.688   1.00 36.61  ? 246  ARG A CA  1 
ATOM   1894 C C   . ARG A 1 246 ? 49.143  12.139  5.394   1.00 39.49  ? 246  ARG A C   1 
ATOM   1895 O O   . ARG A 1 246 ? 49.906  13.111  5.409   1.00 30.88  ? 246  ARG A O   1 
ATOM   1896 C CB  . ARG A 1 246 ? 48.898  10.743  3.318   1.00 33.33  ? 246  ARG A CB  1 
ATOM   1897 C CG  . ARG A 1 246 ? 49.199  11.923  2.415   1.00 38.94  ? 246  ARG A CG  1 
ATOM   1898 C CD  . ARG A 1 246 ? 48.223  11.990  1.248   1.00 41.84  ? 246  ARG A CD  1 
ATOM   1899 N NE  . ARG A 1 246 ? 46.901  12.500  1.620   1.00 46.41  ? 246  ARG A NE  1 
ATOM   1900 C CZ  . ARG A 1 246 ? 46.609  13.789  1.794   1.00 43.61  ? 246  ARG A CZ  1 
ATOM   1901 N NH1 . ARG A 1 246 ? 47.548  14.716  1.660   1.00 41.41  ? 246  ARG A NH1 1 
ATOM   1902 N NH2 . ARG A 1 246 ? 45.373  14.157  2.107   1.00 30.95  ? 246  ARG A NH2 1 
ATOM   1903 N N   . ARG A 1 247 ? 47.953  12.144  5.996   1.00 34.03  ? 247  ARG A N   1 
ATOM   1904 C CA  . ARG A 1 247 ? 47.476  13.322  6.725   1.00 38.14  ? 247  ARG A CA  1 
ATOM   1905 C C   . ARG A 1 247 ? 48.294  13.619  7.980   1.00 34.11  ? 247  ARG A C   1 
ATOM   1906 O O   . ARG A 1 247 ? 48.622  14.768  8.247   1.00 34.39  ? 247  ARG A O   1 
ATOM   1907 C CB  . ARG A 1 247 ? 45.997  13.199  7.094   1.00 33.02  ? 247  ARG A CB  1 
ATOM   1908 C CG  . ARG A 1 247 ? 45.101  12.977  5.906   1.00 30.64  ? 247  ARG A CG  1 
ATOM   1909 C CD  . ARG A 1 247 ? 43.641  12.985  6.321   1.00 30.52  ? 247  ARG A CD  1 
ATOM   1910 N NE  . ARG A 1 247 ? 42.766  12.824  5.169   1.00 29.31  ? 247  ARG A NE  1 
ATOM   1911 C CZ  . ARG A 1 247 ? 41.440  12.816  5.228   1.00 32.79  ? 247  ARG A CZ  1 
ATOM   1912 N NH1 . ARG A 1 247 ? 40.812  12.979  6.396   1.00 32.16  ? 247  ARG A NH1 1 
ATOM   1913 N NH2 . ARG A 1 247 ? 40.743  12.660  4.113   1.00 30.70  ? 247  ARG A NH2 1 
ATOM   1914 N N   . ALA A 1 248 ? 48.605  12.590  8.758   1.00 37.15  ? 248  ALA A N   1 
ATOM   1915 C CA  . ALA A 1 248 ? 49.450  12.776  9.933   1.00 35.42  ? 248  ALA A CA  1 
ATOM   1916 C C   . ALA A 1 248 ? 50.793  13.376  9.523   1.00 37.18  ? 248  ALA A C   1 
ATOM   1917 O O   . ALA A 1 248 ? 51.300  14.301  10.160  1.00 36.11  ? 248  ALA A O   1 
ATOM   1918 C CB  . ALA A 1 248 ? 49.660  11.461  10.662  1.00 27.57  ? 248  ALA A CB  1 
ATOM   1919 N N   . THR A 1 249 ? 51.352  12.868  8.435   1.00 29.67  ? 249  THR A N   1 
ATOM   1920 C CA  . THR A 1 249 ? 52.675  13.307  8.014   1.00 35.53  ? 249  THR A CA  1 
ATOM   1921 C C   . THR A 1 249 ? 52.642  14.757  7.553   1.00 32.83  ? 249  THR A C   1 
ATOM   1922 O O   . THR A 1 249 ? 53.536  15.533  7.893   1.00 33.33  ? 249  THR A O   1 
ATOM   1923 C CB  . THR A 1 249 ? 53.248  12.410  6.897   1.00 38.18  ? 249  THR A CB  1 
ATOM   1924 O OG1 . THR A 1 249 ? 53.207  11.040  7.322   1.00 37.11  ? 249  THR A OG1 1 
ATOM   1925 C CG2 . THR A 1 249 ? 54.669  12.808  6.590   1.00 35.10  ? 249  THR A CG2 1 
ATOM   1926 N N   . LEU A 1 250 ? 51.610  15.119  6.790   1.00 30.88  ? 250  LEU A N   1 
ATOM   1927 C CA  . LEU A 1 250 ? 51.473  16.490  6.310   1.00 37.70  ? 250  LEU A CA  1 
ATOM   1928 C C   . LEU A 1 250 ? 51.306  17.448  7.486   1.00 38.12  ? 250  LEU A C   1 
ATOM   1929 O O   . LEU A 1 250 ? 51.934  18.509  7.530   1.00 40.16  ? 250  LEU A O   1 
ATOM   1930 C CB  . LEU A 1 250 ? 50.307  16.639  5.322   1.00 31.19  ? 250  LEU A CB  1 
ATOM   1931 C CG  . LEU A 1 250 ? 50.047  18.053  4.772   1.00 31.99  ? 250  LEU A CG  1 
ATOM   1932 C CD1 . LEU A 1 250 ? 51.309  18.683  4.208   1.00 33.99  ? 250  LEU A CD1 1 
ATOM   1933 C CD2 . LEU A 1 250 ? 48.928  18.083  3.722   1.00 32.26  ? 250  LEU A CD2 1 
ATOM   1934 N N   . LEU A 1 251 ? 50.474  17.066  8.450   1.00 32.48  ? 251  LEU A N   1 
ATOM   1935 C CA  . LEU A 1 251 ? 50.222  17.949  9.574   1.00 33.07  ? 251  LEU A CA  1 
ATOM   1936 C C   . LEU A 1 251 ? 51.512  18.140  10.364  1.00 30.54  ? 251  LEU A C   1 
ATOM   1937 O O   . LEU A 1 251 ? 51.857  19.264  10.742  1.00 32.60  ? 251  LEU A O   1 
ATOM   1938 C CB  . LEU A 1 251 ? 49.106  17.420  10.472  1.00 33.23  ? 251  LEU A CB  1 
ATOM   1939 C CG  . LEU A 1 251 ? 49.048  18.305  11.713  1.00 34.85  ? 251  LEU A CG  1 
ATOM   1940 C CD1 . LEU A 1 251 ? 47.943  19.347  11.633  1.00 34.78  ? 251  LEU A CD1 1 
ATOM   1941 C CD2 . LEU A 1 251 ? 48.960  17.471  12.956  1.00 38.73  ? 251  LEU A CD2 1 
ATOM   1942 N N   . ALA A 1 252 ? 52.221  17.040  10.596  1.00 29.17  ? 252  ALA A N   1 
ATOM   1943 C CA  . ALA A 1 252 ? 53.570  17.095  11.166  1.00 31.95  ? 252  ALA A CA  1 
ATOM   1944 C C   . ALA A 1 252 ? 54.427  18.170  10.485  1.00 39.25  ? 252  ALA A C   1 
ATOM   1945 O O   . ALA A 1 252 ? 54.937  19.068  11.159  1.00 31.96  ? 252  ALA A O   1 
ATOM   1946 C CB  . ALA A 1 252 ? 54.243  15.733  11.087  1.00 30.67  ? 252  ALA A CB  1 
ATOM   1947 N N   . ARG A 1 253 ? 54.541  18.094  9.156   1.00 32.38  ? 253  ARG A N   1 
ATOM   1948 C CA  . ARG A 1 253 ? 55.293  19.086  8.379   1.00 34.10  ? 253  ARG A CA  1 
ATOM   1949 C C   . ARG A 1 253 ? 54.833  20.523  8.641   1.00 35.42  ? 253  ARG A C   1 
ATOM   1950 O O   . ARG A 1 253 ? 55.650  21.409  8.903   1.00 38.30  ? 253  ARG A O   1 
ATOM   1951 C CB  . ARG A 1 253 ? 55.218  18.795  6.878   1.00 35.21  ? 253  ARG A CB  1 
ATOM   1952 C CG  . ARG A 1 253 ? 56.095  17.666  6.402   1.00 50.65  ? 253  ARG A CG  1 
ATOM   1953 C CD  . ARG A 1 253 ? 56.297  17.735  4.882   1.00 59.38  ? 253  ARG A CD  1 
ATOM   1954 N NE  . ARG A 1 253 ? 56.684  16.442  4.312   1.00 73.09  ? 253  ARG A NE  1 
ATOM   1955 C CZ  . ARG A 1 253 ? 55.825  15.499  3.909   1.00 78.70  ? 253  ARG A CZ  1 
ATOM   1956 N NH1 . ARG A 1 253 ? 54.507  15.683  3.999   1.00 71.92  ? 253  ARG A NH1 1 
ATOM   1957 N NH2 . ARG A 1 253 ? 56.288  14.359  3.405   1.00 81.88  ? 253  ARG A NH2 1 
ATOM   1958 N N   . LEU A 1 254 ? 53.522  20.743  8.586   1.00 34.95  ? 254  LEU A N   1 
ATOM   1959 C CA  . LEU A 1 254 ? 52.947  22.074  8.786   1.00 37.56  ? 254  LEU A CA  1 
ATOM   1960 C C   . LEU A 1 254 ? 53.279  22.694  10.140  1.00 41.96  ? 254  LEU A C   1 
ATOM   1961 O O   . LEU A 1 254 ? 53.167  23.905  10.299  1.00 38.19  ? 254  LEU A O   1 
ATOM   1962 C CB  . LEU A 1 254 ? 51.427  22.046  8.593   1.00 32.08  ? 254  LEU A CB  1 
ATOM   1963 C CG  . LEU A 1 254 ? 50.961  21.717  7.172   1.00 38.77  ? 254  LEU A CG  1 
ATOM   1964 C CD1 . LEU A 1 254 ? 49.469  21.454  7.146   1.00 31.06  ? 254  LEU A CD1 1 
ATOM   1965 C CD2 . LEU A 1 254 ? 51.325  22.840  6.206   1.00 34.60  ? 254  LEU A CD2 1 
ATOM   1966 N N   . VAL A 1 255 ? 53.665  21.868  11.113  1.00 43.50  ? 255  VAL A N   1 
ATOM   1967 C CA  . VAL A 1 255 ? 54.032  22.371  12.434  1.00 40.24  ? 255  VAL A CA  1 
ATOM   1968 C C   . VAL A 1 255 ? 55.519  22.205  12.759  1.00 46.91  ? 255  VAL A C   1 
ATOM   1969 O O   . VAL A 1 255 ? 55.940  22.466  13.881  1.00 53.10  ? 255  VAL A O   1 
ATOM   1970 C CB  . VAL A 1 255 ? 53.180  21.747  13.572  1.00 41.50  ? 255  VAL A CB  1 
ATOM   1971 C CG1 . VAL A 1 255 ? 51.729  22.159  13.429  1.00 30.04  ? 255  VAL A CG1 1 
ATOM   1972 C CG2 . VAL A 1 255 ? 53.318  20.224  13.615  1.00 30.05  ? 255  VAL A CG2 1 
ATOM   1973 N N   . GLY A 1 256 ? 56.313  21.783  11.781  1.00 45.83  ? 256  GLY A N   1 
ATOM   1974 C CA  . GLY A 1 256 ? 57.754  21.727  11.961  1.00 45.94  ? 256  GLY A CA  1 
ATOM   1975 C C   . GLY A 1 256 ? 58.283  20.402  12.468  1.00 48.11  ? 256  GLY A C   1 
ATOM   1976 O O   . GLY A 1 256 ? 59.210  20.375  13.261  1.00 62.70  ? 256  GLY A O   1 
ATOM   1977 N N   . CYS A 1 257 ? 57.693  19.308  11.996  1.00 45.59  ? 257  CYS A N   1 
ATOM   1978 C CA  . CYS A 1 257 ? 58.078  17.961  12.380  1.00 42.28  ? 257  CYS A CA  1 
ATOM   1979 C C   . CYS A 1 257 ? 58.247  17.084  11.135  1.00 48.38  ? 257  CYS A C   1 
ATOM   1980 O O   . CYS A 1 257 ? 59.358  16.621  10.820  1.00 60.79  ? 257  CYS A O   1 
ATOM   1981 C CB  . CYS A 1 257 ? 57.018  17.349  13.306  1.00 44.37  ? 257  CYS A CB  1 
ATOM   1982 S SG  . CYS A 1 257 ? 56.804  18.096  14.979  1.00 38.34  ? 257  CYS A SG  1 
ATOM   1983 N N   . ASN A 1 265 ? 60.949  7.796   10.180  1.00 67.16  ? 265  ASN A N   1 
ATOM   1984 C CA  . ASN A 1 265 ? 60.833  7.116   11.471  1.00 64.77  ? 265  ASN A CA  1 
ATOM   1985 C C   . ASN A 1 265 ? 59.683  7.672   12.316  1.00 57.44  ? 265  ASN A C   1 
ATOM   1986 O O   . ASN A 1 265 ? 59.686  8.845   12.690  1.00 55.01  ? 265  ASN A O   1 
ATOM   1987 C CB  . ASN A 1 265 ? 62.160  7.197   12.231  1.00 64.84  ? 265  ASN A CB  1 
ATOM   1988 C CG  . ASN A 1 265 ? 62.064  6.656   13.651  1.00 65.80  ? 265  ASN A CG  1 
ATOM   1989 O OD1 . ASN A 1 265 ? 61.736  7.395   14.580  1.00 57.53  ? 265  ASN A OD1 1 
ATOM   1990 N ND2 . ASN A 1 265 ? 62.371  5.368   13.829  1.00 69.25  ? 265  ASN A ND2 1 
ATOM   1991 N N   . ASP A 1 266 ? 58.702  6.828   12.621  1.00 54.77  ? 266  ASP A N   1 
ATOM   1992 C CA  . ASP A 1 266 ? 57.480  7.297   13.288  1.00 51.99  ? 266  ASP A CA  1 
ATOM   1993 C C   . ASP A 1 266 ? 57.707  7.799   14.709  1.00 49.73  ? 266  ASP A C   1 
ATOM   1994 O O   . ASP A 1 266 ? 57.065  8.757   15.139  1.00 36.81  ? 266  ASP A O   1 
ATOM   1995 C CB  . ASP A 1 266 ? 56.403  6.210   13.297  1.00 51.96  ? 266  ASP A CB  1 
ATOM   1996 C CG  . ASP A 1 266 ? 55.833  5.942   11.919  1.00 50.15  ? 266  ASP A CG  1 
ATOM   1997 O OD1 . ASP A 1 266 ? 56.015  6.795   11.021  1.00 51.08  ? 266  ASP A OD1 1 
ATOM   1998 O OD2 . ASP A 1 266 ? 55.198  4.878   11.741  1.00 47.79  ? 266  ASP A OD2 1 
ATOM   1999 N N   . THR A 1 267 ? 58.624  7.155   15.428  1.00 50.69  ? 267  THR A N   1 
ATOM   2000 C CA  . THR A 1 267 ? 58.939  7.539   16.801  1.00 48.49  ? 267  THR A CA  1 
ATOM   2001 C C   . THR A 1 267 ? 59.372  9.003   16.917  1.00 45.58  ? 267  THR A C   1 
ATOM   2002 O O   . THR A 1 267 ? 58.873  9.725   17.770  1.00 38.76  ? 267  THR A O   1 
ATOM   2003 C CB  . THR A 1 267 ? 60.044  6.639   17.404  1.00 49.68  ? 267  THR A CB  1 
ATOM   2004 O OG1 . THR A 1 267 ? 59.659  5.263   17.308  1.00 49.91  ? 267  THR A OG1 1 
ATOM   2005 C CG2 . THR A 1 267 ? 60.274  6.986   18.862  1.00 44.27  ? 267  THR A CG2 1 
ATOM   2006 N N   . GLU A 1 268 ? 60.303  9.425   16.061  1.00 43.53  ? 268  GLU A N   1 
ATOM   2007 C CA  . GLU A 1 268 ? 60.827  10.795  16.081  1.00 47.62  ? 268  GLU A CA  1 
ATOM   2008 C C   . GLU A 1 268 ? 59.765  11.830  15.718  1.00 44.02  ? 268  GLU A C   1 
ATOM   2009 O O   . GLU A 1 268 ? 59.636  12.864  16.371  1.00 43.83  ? 268  GLU A O   1 
ATOM   2010 C CB  . GLU A 1 268 ? 62.010  10.933  15.124  1.00 52.53  ? 268  GLU A CB  1 
ATOM   2011 C CG  . GLU A 1 268 ? 63.205  10.079  15.490  1.00 71.09  ? 268  GLU A CG  1 
ATOM   2012 C CD  . GLU A 1 268 ? 64.378  10.287  14.541  1.00 85.27  ? 268  GLU A CD  1 
ATOM   2013 O OE1 . GLU A 1 268 ? 64.308  11.206  13.688  1.00 86.72  ? 268  GLU A OE1 1 
ATOM   2014 O OE2 . GLU A 1 268 ? 65.370  9.529   14.654  1.00 89.54  ? 268  GLU A OE2 1 
ATOM   2015 N N   . LEU A 1 269 ? 59.020  11.540  14.658  1.00 38.69  ? 269  LEU A N   1 
ATOM   2016 C CA  . LEU A 1 269 ? 57.891  12.355  14.242  1.00 40.51  ? 269  LEU A CA  1 
ATOM   2017 C C   . LEU A 1 269 ? 56.865  12.562  15.367  1.00 44.49  ? 269  LEU A C   1 
ATOM   2018 O O   . LEU A 1 269 ? 56.486  13.699  15.672  1.00 44.26  ? 269  LEU A O   1 
ATOM   2019 C CB  . LEU A 1 269 ? 57.228  11.718  13.015  1.00 40.16  ? 269  LEU A CB  1 
ATOM   2020 C CG  . LEU A 1 269 ? 56.214  12.518  12.197  1.00 45.16  ? 269  LEU A CG  1 
ATOM   2021 C CD1 . LEU A 1 269 ? 56.167  11.986  10.776  1.00 43.60  ? 269  LEU A CD1 1 
ATOM   2022 C CD2 . LEU A 1 269 ? 54.832  12.453  12.815  1.00 47.21  ? 269  LEU A CD2 1 
ATOM   2023 N N   . ILE A 1 270 ? 56.411  11.469  15.975  1.00 43.69  ? 270  ILE A N   1 
ATOM   2024 C CA  . ILE A 1 270 ? 55.367  11.567  16.986  1.00 43.49  ? 270  ILE A CA  1 
ATOM   2025 C C   . ILE A 1 270 ? 55.912  12.312  18.185  1.00 50.38  ? 270  ILE A C   1 
ATOM   2026 O O   . ILE A 1 270 ? 55.233  13.179  18.753  1.00 31.95  ? 270  ILE A O   1 
ATOM   2027 C CB  . ILE A 1 270 ? 54.854  10.189  17.418  1.00 41.72  ? 270  ILE A CB  1 
ATOM   2028 C CG1 . ILE A 1 270 ? 54.242  9.478   16.231  1.00 43.28  ? 270  ILE A CG1 1 
ATOM   2029 C CG2 . ILE A 1 270 ? 53.798  10.317  18.496  1.00 31.74  ? 270  ILE A CG2 1 
ATOM   2030 C CD1 . ILE A 1 270 ? 54.169  7.994   16.405  1.00 51.06  ? 270  ILE A CD1 1 
ATOM   2031 N N   . ALA A 1 271 ? 57.148  11.984  18.549  1.00 34.87  ? 271  ALA A N   1 
ATOM   2032 C CA  . ALA A 1 271 ? 57.785  12.621  19.688  1.00 35.81  ? 271  ALA A CA  1 
ATOM   2033 C C   . ALA A 1 271 ? 57.834  14.128  19.464  1.00 39.80  ? 271  ALA A C   1 
ATOM   2034 O O   . ALA A 1 271 ? 57.567  14.910  20.376  1.00 45.00  ? 271  ALA A O   1 
ATOM   2035 C CB  . ALA A 1 271 ? 59.178  12.053  19.928  1.00 38.18  ? 271  ALA A CB  1 
ATOM   2036 N N   . CYS A 1 272 ? 58.144  14.539  18.241  1.00 34.99  ? 272  CYS A N   1 
ATOM   2037 C CA  . CYS A 1 272 ? 58.163  15.958  17.938  1.00 40.21  ? 272  CYS A CA  1 
ATOM   2038 C C   . CYS A 1 272 ? 56.747  16.540  18.064  1.00 36.53  ? 272  CYS A C   1 
ATOM   2039 O O   . CYS A 1 272 ? 56.564  17.587  18.694  1.00 38.09  ? 272  CYS A O   1 
ATOM   2040 C CB  . CYS A 1 272 ? 58.779  16.229  16.560  1.00 35.19  ? 272  CYS A CB  1 
ATOM   2041 S SG  . CYS A 1 272 ? 58.600  17.952  15.977  1.00 40.89  ? 272  CYS A SG  1 
ATOM   2042 N N   . LEU A 1 273 ? 55.751  15.862  17.490  1.00 34.50  ? 273  LEU A N   1 
ATOM   2043 C CA  . LEU A 1 273 ? 54.345  16.283  17.664  1.00 33.39  ? 273  LEU A CA  1 
ATOM   2044 C C   . LEU A 1 273 ? 53.955  16.471  19.140  1.00 35.26  ? 273  LEU A C   1 
ATOM   2045 O O   . LEU A 1 273 ? 53.289  17.440  19.491  1.00 34.85  ? 273  LEU A O   1 
ATOM   2046 C CB  . LEU A 1 273 ? 53.385  15.298  17.002  1.00 35.36  ? 273  LEU A CB  1 
ATOM   2047 C CG  . LEU A 1 273 ? 53.322  15.391  15.477  1.00 38.91  ? 273  LEU A CG  1 
ATOM   2048 C CD1 . LEU A 1 273 ? 52.419  14.316  14.906  1.00 33.48  ? 273  LEU A CD1 1 
ATOM   2049 C CD2 . LEU A 1 273 ? 52.832  16.774  15.066  1.00 37.68  ? 273  LEU A CD2 1 
ATOM   2050 N N   . ARG A 1 274 ? 54.397  15.557  20.001  1.00 31.98  ? 274  ARG A N   1 
ATOM   2051 C CA  . ARG A 1 274 ? 54.107  15.662  21.424  1.00 35.40  ? 274  ARG A CA  1 
ATOM   2052 C C   . ARG A 1 274 ? 54.709  16.928  22.030  1.00 40.30  ? 274  ARG A C   1 
ATOM   2053 O O   . ARG A 1 274 ? 54.240  17.401  23.054  1.00 39.75  ? 274  ARG A O   1 
ATOM   2054 C CB  . ARG A 1 274 ? 54.558  14.412  22.201  1.00 32.75  ? 274  ARG A CB  1 
ATOM   2055 C CG  . ARG A 1 274 ? 53.781  13.167  21.836  1.00 35.01  ? 274  ARG A CG  1 
ATOM   2056 C CD  . ARG A 1 274 ? 53.907  12.103  22.908  1.00 40.19  ? 274  ARG A CD  1 
ATOM   2057 N NE  . ARG A 1 274 ? 55.313  11.834  23.156  1.00 51.32  ? 274  ARG A NE  1 
ATOM   2058 C CZ  . ARG A 1 274 ? 56.009  10.897  22.525  1.00 48.85  ? 274  ARG A CZ  1 
ATOM   2059 N NH1 . ARG A 1 274 ? 55.402  10.129  21.629  1.00 35.45  ? 274  ARG A NH1 1 
ATOM   2060 N NH2 . ARG A 1 274 ? 57.306  10.733  22.792  1.00 43.05  ? 274  ARG A NH2 1 
ATOM   2061 N N   . THR A 1 275 ? 55.728  17.502  21.399  1.00 33.38  ? 275  THR A N   1 
ATOM   2062 C CA  . THR A 1 275 ? 56.257  18.759  21.925  1.00 34.61  ? 275  THR A CA  1 
ATOM   2063 C C   . THR A 1 275 ? 55.482  19.999  21.471  1.00 37.11  ? 275  THR A C   1 
ATOM   2064 O O   . THR A 1 275 ? 55.767  21.090  21.938  1.00 41.34  ? 275  THR A O   1 
ATOM   2065 C CB  . THR A 1 275 ? 57.754  18.973  21.596  1.00 39.52  ? 275  THR A CB  1 
ATOM   2066 O OG1 . THR A 1 275 ? 57.894  19.306  20.209  1.00 41.31  ? 275  THR A OG1 1 
ATOM   2067 C CG2 . THR A 1 275 ? 58.561  17.739  21.926  1.00 37.09  ? 275  THR A CG2 1 
ATOM   2068 N N   . ARG A 1 276 ? 54.511  19.848  20.576  1.00 32.36  ? 276  ARG A N   1 
ATOM   2069 C CA  . ARG A 1 276 ? 53.786  21.016  20.079  1.00 32.06  ? 276  ARG A CA  1 
ATOM   2070 C C   . ARG A 1 276 ? 52.612  21.413  20.975  1.00 36.90  ? 276  ARG A C   1 
ATOM   2071 O O   . ARG A 1 276 ? 51.909  20.557  21.519  1.00 36.86  ? 276  ARG A O   1 
ATOM   2072 C CB  . ARG A 1 276 ? 53.307  20.798  18.639  1.00 35.89  ? 276  ARG A CB  1 
ATOM   2073 C CG  . ARG A 1 276 ? 54.433  20.753  17.616  1.00 31.55  ? 276  ARG A CG  1 
ATOM   2074 C CD  . ARG A 1 276 ? 55.103  22.102  17.477  1.00 54.36  ? 276  ARG A CD  1 
ATOM   2075 N NE  . ARG A 1 276 ? 56.318  22.011  16.669  1.00 61.26  ? 276  ARG A NE  1 
ATOM   2076 C CZ  . ARG A 1 276 ? 57.533  21.783  17.162  1.00 67.56  ? 276  ARG A CZ  1 
ATOM   2077 N NH1 . ARG A 1 276 ? 57.698  21.632  18.471  1.00 70.25  ? 276  ARG A NH1 1 
ATOM   2078 N NH2 . ARG A 1 276 ? 58.583  21.714  16.349  1.00 66.15  ? 276  ARG A NH2 1 
ATOM   2079 N N   . PRO A 1 277 ? 52.407  22.723  21.146  1.00 37.99  ? 277  PRO A N   1 
ATOM   2080 C CA  . PRO A 1 277 ? 51.242  23.239  21.871  1.00 32.98  ? 277  PRO A CA  1 
ATOM   2081 C C   . PRO A 1 277 ? 49.948  22.718  21.240  1.00 38.32  ? 277  PRO A C   1 
ATOM   2082 O O   . PRO A 1 277 ? 49.887  22.604  20.022  1.00 33.06  ? 277  PRO A O   1 
ATOM   2083 C CB  . PRO A 1 277 ? 51.344  24.751  21.656  1.00 50.93  ? 277  PRO A CB  1 
ATOM   2084 C CG  . PRO A 1 277 ? 52.791  25.014  21.361  1.00 35.67  ? 277  PRO A CG  1 
ATOM   2085 C CD  . PRO A 1 277 ? 53.315  23.791  20.683  1.00 40.99  ? 277  PRO A CD  1 
ATOM   2086 N N   . ALA A 1 278 ? 48.939  22.405  22.047  1.00 30.82  ? 278  ALA A N   1 
ATOM   2087 C CA  . ALA A 1 278 ? 47.671  21.919  21.518  1.00 38.63  ? 278  ALA A CA  1 
ATOM   2088 C C   . ALA A 1 278 ? 47.134  22.832  20.416  1.00 29.13  ? 278  ALA A C   1 
ATOM   2089 O O   . ALA A 1 278 ? 46.669  22.359  19.377  1.00 29.52  ? 278  ALA A O   1 
ATOM   2090 C CB  . ALA A 1 278 ? 46.642  21.769  22.637  1.00 29.49  ? 278  ALA A CB  1 
ATOM   2091 N N   . GLN A 1 279 ? 47.229  24.137  20.638  1.00 31.01  ? 279  GLN A N   1 
ATOM   2092 C CA  . GLN A 1 279 ? 46.697  25.105  19.681  1.00 31.22  ? 279  GLN A CA  1 
ATOM   2093 C C   . GLN A 1 279 ? 47.392  25.057  18.318  1.00 40.24  ? 279  GLN A C   1 
ATOM   2094 O O   . GLN A 1 279 ? 46.732  25.247  17.309  1.00 30.47  ? 279  GLN A O   1 
ATOM   2095 C CB  . GLN A 1 279 ? 46.699  26.526  20.247  1.00 33.57  ? 279  GLN A CB  1 
ATOM   2096 C CG  . GLN A 1 279 ? 45.740  27.456  19.516  1.00 37.92  ? 279  GLN A CG  1 
ATOM   2097 C CD  . GLN A 1 279 ? 44.290  27.044  19.685  1.00 42.60  ? 279  GLN A CD  1 
ATOM   2098 O OE1 . GLN A 1 279 ? 43.798  26.900  20.812  1.00 50.00  ? 279  GLN A OE1 1 
ATOM   2099 N NE2 . GLN A 1 279 ? 43.593  26.850  18.567  1.00 36.30  ? 279  GLN A NE2 1 
ATOM   2100 N N   . ASP A 1 280 ? 48.703  24.797  18.285  1.00 31.16  ? 280  ASP A N   1 
ATOM   2101 C CA  . ASP A 1 280 ? 49.414  24.669  17.017  1.00 31.03  ? 280  ASP A CA  1 
ATOM   2102 C C   . ASP A 1 280 ? 48.786  23.556  16.178  1.00 31.17  ? 280  ASP A C   1 
ATOM   2103 O O   . ASP A 1 280 ? 48.539  23.738  14.989  1.00 34.36  ? 280  ASP A O   1 
ATOM   2104 C CB  . ASP A 1 280 ? 50.909  24.378  17.227  1.00 53.52  ? 280  ASP A CB  1 
ATOM   2105 C CG  . ASP A 1 280 ? 51.735  25.632  17.458  1.00 62.28  ? 280  ASP A CG  1 
ATOM   2106 O OD1 . ASP A 1 280 ? 51.159  26.681  17.811  1.00 63.68  ? 280  ASP A OD1 1 
ATOM   2107 O OD2 . ASP A 1 280 ? 52.975  25.561  17.293  1.00 73.45  ? 280  ASP A OD2 1 
ATOM   2108 N N   . LEU A 1 281 ? 48.517  22.412  16.806  1.00 29.60  ? 281  LEU A N   1 
ATOM   2109 C CA  . LEU A 1 281 ? 47.891  21.291  16.117  1.00 29.14  ? 281  LEU A CA  1 
ATOM   2110 C C   . LEU A 1 281 ? 46.513  21.666  15.575  1.00 33.98  ? 281  LEU A C   1 
ATOM   2111 O O   . LEU A 1 281 ? 46.191  21.393  14.411  1.00 33.97  ? 281  LEU A O   1 
ATOM   2112 C CB  . LEU A 1 281 ? 47.777  20.078  17.038  1.00 27.82  ? 281  LEU A CB  1 
ATOM   2113 C CG  . LEU A 1 281 ? 49.096  19.538  17.614  1.00 30.68  ? 281  LEU A CG  1 
ATOM   2114 C CD1 . LEU A 1 281 ? 48.871  18.212  18.367  1.00 26.30  ? 281  LEU A CD1 1 
ATOM   2115 C CD2 . LEU A 1 281 ? 50.173  19.377  16.540  1.00 26.85  ? 281  LEU A CD2 1 
ATOM   2116 N N   . VAL A 1 282 ? 45.707  22.302  16.415  1.00 35.65  ? 282  VAL A N   1 
ATOM   2117 C CA  . VAL A 1 282 ? 44.341  22.653  16.035  1.00 35.64  ? 282  VAL A CA  1 
ATOM   2118 C C   . VAL A 1 282 ? 44.339  23.649  14.872  1.00 38.59  ? 282  VAL A C   1 
ATOM   2119 O O   . VAL A 1 282 ? 43.519  23.556  13.959  1.00 37.31  ? 282  VAL A O   1 
ATOM   2120 C CB  . VAL A 1 282 ? 43.566  23.223  17.244  1.00 32.81  ? 282  VAL A CB  1 
ATOM   2121 C CG1 . VAL A 1 282 ? 42.336  23.972  16.803  1.00 27.22  ? 282  VAL A CG1 1 
ATOM   2122 C CG2 . VAL A 1 282 ? 43.196  22.099  18.195  1.00 32.04  ? 282  VAL A CG2 1 
ATOM   2123 N N   . ASP A 1 283 ? 45.283  24.584  14.903  1.00 30.38  ? 283  ASP A N   1 
ATOM   2124 C CA  . ASP A 1 283 ? 45.357  25.642  13.899  1.00 34.00  ? 283  ASP A CA  1 
ATOM   2125 C C   . ASP A 1 283 ? 45.665  25.096  12.496  1.00 35.48  ? 283  ASP A C   1 
ATOM   2126 O O   . ASP A 1 283 ? 45.433  25.774  11.503  1.00 33.20  ? 283  ASP A O   1 
ATOM   2127 C CB  . ASP A 1 283 ? 46.400  26.703  14.289  1.00 32.13  ? 283  ASP A CB  1 
ATOM   2128 C CG  . ASP A 1 283 ? 45.907  27.664  15.380  1.00 40.50  ? 283  ASP A CG  1 
ATOM   2129 O OD1 . ASP A 1 283 ? 44.720  27.613  15.750  1.00 46.68  ? 283  ASP A OD1 1 
ATOM   2130 O OD2 . ASP A 1 283 ? 46.709  28.499  15.853  1.00 43.02  ? 283  ASP A OD2 1 
ATOM   2131 N N   . HIS A 1 284 ? 46.172  23.870  12.411  1.00 36.19  ? 284  HIS A N   1 
ATOM   2132 C CA  . HIS A 1 284 ? 46.560  23.329  11.116  1.00 38.51  ? 284  HIS A CA  1 
ATOM   2133 C C   . HIS A 1 284 ? 45.786  22.103  10.665  1.00 36.22  ? 284  HIS A C   1 
ATOM   2134 O O   . HIS A 1 284 ? 45.919  21.684  9.520   1.00 35.53  ? 284  HIS A O   1 
ATOM   2135 C CB  . HIS A 1 284 ? 48.056  23.026  11.088  1.00 34.92  ? 284  HIS A CB  1 
ATOM   2136 C CG  . HIS A 1 284 ? 48.904  24.251  11.076  1.00 36.23  ? 284  HIS A CG  1 
ATOM   2137 N ND1 . HIS A 1 284 ? 49.492  24.757  12.215  1.00 40.40  ? 284  HIS A ND1 1 
ATOM   2138 C CD2 . HIS A 1 284 ? 49.237  25.094  10.070  1.00 37.67  ? 284  HIS A CD2 1 
ATOM   2139 C CE1 . HIS A 1 284 ? 50.172  25.847  11.905  1.00 45.68  ? 284  HIS A CE1 1 
ATOM   2140 N NE2 . HIS A 1 284 ? 50.029  26.076  10.611  1.00 40.49  ? 284  HIS A NE2 1 
ATOM   2141 N N   . GLU A 1 285 ? 44.976  21.542  11.552  1.00 35.39  ? 285  GLU A N   1 
ATOM   2142 C CA  . GLU A 1 285 ? 44.348  20.255  11.278  1.00 35.40  ? 285  GLU A CA  1 
ATOM   2143 C C   . GLU A 1 285 ? 43.505  20.282  9.991   1.00 31.56  ? 285  GLU A C   1 
ATOM   2144 O O   . GLU A 1 285 ? 43.574  19.365  9.175   1.00 24.47  ? 285  GLU A O   1 
ATOM   2145 C CB  . GLU A 1 285 ? 43.540  19.767  12.486  1.00 32.54  ? 285  GLU A CB  1 
ATOM   2146 C CG  . GLU A 1 285 ? 42.328  20.627  12.830  1.00 37.23  ? 285  GLU A CG  1 
ATOM   2147 C CD  . GLU A 1 285 ? 41.444  19.992  13.898  1.00 39.25  ? 285  GLU A CD  1 
ATOM   2148 O OE1 . GLU A 1 285 ? 41.811  18.919  14.423  1.00 32.56  ? 285  GLU A OE1 1 
ATOM   2149 O OE2 . GLU A 1 285 ? 40.384  20.571  14.209  1.00 44.67  ? 285  GLU A OE2 1 
ATOM   2150 N N   . TRP A 1 286 ? 42.782  21.372  9.782   1.00 28.14  ? 286  TRP A N   1 
ATOM   2151 C CA  . TRP A 1 286 ? 41.845  21.476  8.671   1.00 36.64  ? 286  TRP A CA  1 
ATOM   2152 C C   . TRP A 1 286 ? 42.575  21.553  7.318   1.00 43.03  ? 286  TRP A C   1 
ATOM   2153 O O   . TRP A 1 286 ? 41.998  21.274  6.276   1.00 44.75  ? 286  TRP A O   1 
ATOM   2154 C CB  . TRP A 1 286 ? 40.965  22.703  8.894   1.00 39.21  ? 286  TRP A CB  1 
ATOM   2155 C CG  . TRP A 1 286 ? 39.664  22.696  8.198   1.00 46.27  ? 286  TRP A CG  1 
ATOM   2156 C CD1 . TRP A 1 286 ? 39.186  21.746  7.337   1.00 49.46  ? 286  TRP A CD1 1 
ATOM   2157 C CD2 . TRP A 1 286 ? 38.650  23.706  8.289   1.00 53.25  ? 286  TRP A CD2 1 
ATOM   2158 N NE1 . TRP A 1 286 ? 37.934  22.110  6.879   1.00 48.87  ? 286  TRP A NE1 1 
ATOM   2159 C CE2 . TRP A 1 286 ? 37.583  23.307  7.451   1.00 49.72  ? 286  TRP A CE2 1 
ATOM   2160 C CE3 . TRP A 1 286 ? 38.543  24.917  8.990   1.00 54.44  ? 286  TRP A CE3 1 
ATOM   2161 C CZ2 . TRP A 1 286 ? 36.429  24.070  7.304   1.00 48.06  ? 286  TRP A CZ2 1 
ATOM   2162 C CZ3 . TRP A 1 286 ? 37.395  25.671  8.839   1.00 55.10  ? 286  TRP A CZ3 1 
ATOM   2163 C CH2 . TRP A 1 286 ? 36.352  25.244  8.005   1.00 53.22  ? 286  TRP A CH2 1 
ATOM   2164 N N   . HIS A 1 287 ? 43.855  21.902  7.357   1.00 46.79  ? 287  HIS A N   1 
ATOM   2165 C CA  . HIS A 1 287 ? 44.663  22.102  6.151   1.00 46.38  ? 287  HIS A CA  1 
ATOM   2166 C C   . HIS A 1 287 ? 45.174  20.827  5.457   1.00 42.09  ? 287  HIS A C   1 
ATOM   2167 O O   . HIS A 1 287 ? 45.874  20.918  4.469   1.00 39.55  ? 287  HIS A O   1 
ATOM   2168 C CB  . HIS A 1 287 ? 45.863  22.995  6.480   1.00 41.76  ? 287  HIS A CB  1 
ATOM   2169 C CG  . HIS A 1 287 ? 45.489  24.391  6.870   1.00 53.41  ? 287  HIS A CG  1 
ATOM   2170 N ND1 . HIS A 1 287 ? 46.289  25.181  7.669   1.00 57.04  ? 287  HIS A ND1 1 
ATOM   2171 C CD2 . HIS A 1 287 ? 44.405  25.143  6.561   1.00 60.94  ? 287  HIS A CD2 1 
ATOM   2172 C CE1 . HIS A 1 287 ? 45.716  26.360  7.832   1.00 60.91  ? 287  HIS A CE1 1 
ATOM   2173 N NE2 . HIS A 1 287 ? 44.572  26.363  7.169   1.00 65.23  ? 287  HIS A NE2 1 
ATOM   2174 N N   . VAL A 1 288 ? 44.843  19.644  5.960   1.00 38.91  ? 288  VAL A N   1 
ATOM   2175 C CA  . VAL A 1 288 ? 45.360  18.431  5.336   1.00 35.11  ? 288  VAL A CA  1 
ATOM   2176 C C   . VAL A 1 288 ? 44.352  17.661  4.500   1.00 40.96  ? 288  VAL A C   1 
ATOM   2177 O O   . VAL A 1 288 ? 44.651  16.543  4.073   1.00 40.97  ? 288  VAL A O   1 
ATOM   2178 C CB  . VAL A 1 288 ? 45.957  17.445  6.361   1.00 37.20  ? 288  VAL A CB  1 
ATOM   2179 C CG1 . VAL A 1 288 ? 47.133  18.093  7.131   1.00 37.16  ? 288  VAL A CG1 1 
ATOM   2180 C CG2 . VAL A 1 288 ? 44.880  16.930  7.282   1.00 25.27  ? 288  VAL A CG2 1 
ATOM   2181 N N   . LEU A 1 289 ? 43.164  18.229  4.277   1.00 40.54  ? 289  LEU A N   1 
ATOM   2182 C CA  . LEU A 1 289 ? 42.174  17.581  3.413   1.00 34.55  ? 289  LEU A CA  1 
ATOM   2183 C C   . LEU A 1 289 ? 42.647  17.595  1.955   1.00 34.55  ? 289  LEU A C   1 
ATOM   2184 O O   . LEU A 1 289 ? 43.153  18.601  1.477   1.00 38.62  ? 289  LEU A O   1 
ATOM   2185 C CB  . LEU A 1 289 ? 40.791  18.229  3.540   1.00 27.75  ? 289  LEU A CB  1 
ATOM   2186 C CG  . LEU A 1 289 ? 39.990  17.979  4.818   1.00 29.69  ? 289  LEU A CG  1 
ATOM   2187 C CD1 . LEU A 1 289 ? 38.695  18.782  4.814   1.00 36.68  ? 289  LEU A CD1 1 
ATOM   2188 C CD2 . LEU A 1 289 ? 39.698  16.501  5.014   1.00 25.73  ? 289  LEU A CD2 1 
ATOM   2189 N N   . PRO A 1 290 ? 42.490  16.466  1.248   1.00 37.04  ? 290  PRO A N   1 
ATOM   2190 C CA  . PRO A 1 290 ? 43.006  16.320  -0.122  1.00 33.12  ? 290  PRO A CA  1 
ATOM   2191 C C   . PRO A 1 290 ? 42.275  17.171  -1.166  1.00 38.80  ? 290  PRO A C   1 
ATOM   2192 O O   . PRO A 1 290 ? 42.879  17.537  -2.173  1.00 37.11  ? 290  PRO A O   1 
ATOM   2193 C CB  . PRO A 1 290 ? 42.808  14.830  -0.410  1.00 36.13  ? 290  PRO A CB  1 
ATOM   2194 C CG  . PRO A 1 290 ? 41.645  14.421  0.489   1.00 36.99  ? 290  PRO A CG  1 
ATOM   2195 C CD  . PRO A 1 290 ? 41.826  15.240  1.734   1.00 36.37  ? 290  PRO A CD  1 
ATOM   2196 N N   . GLN A 1 291 ? 40.995  17.470  -0.951  1.00 38.77  ? 291  GLN A N   1 
ATOM   2197 C CA  . GLN A 1 291 ? 40.291  18.392  -1.853  1.00 45.38  ? 291  GLN A CA  1 
ATOM   2198 C C   . GLN A 1 291 ? 39.499  19.447  -1.059  1.00 41.53  ? 291  GLN A C   1 
ATOM   2199 O O   . GLN A 1 291 ? 39.284  19.294  0.141   1.00 43.48  ? 291  GLN A O   1 
ATOM   2200 C CB  . GLN A 1 291 ? 39.368  17.639  -2.845  1.00 46.32  ? 291  GLN A CB  1 
ATOM   2201 C CG  . GLN A 1 291 ? 39.980  16.406  -3.560  1.00 39.42  ? 291  GLN A CG  1 
ATOM   2202 C CD  . GLN A 1 291 ? 39.767  15.090  -2.765  1.00 68.00  ? 291  GLN A CD  1 
ATOM   2203 O OE1 . GLN A 1 291 ? 38.983  15.048  -1.807  1.00 63.07  ? 291  GLN A OE1 1 
ATOM   2204 N NE2 . GLN A 1 291 ? 40.466  14.019  -3.168  1.00 61.90  ? 291  GLN A NE2 1 
ATOM   2205 N N   . GLU A 1 292 ? 39.100  20.527  -1.724  1.00 44.45  ? 292  GLU A N   1 
ATOM   2206 C CA  . GLU A 1 292 ? 38.143  21.474  -1.155  1.00 46.96  ? 292  GLU A CA  1 
ATOM   2207 C C   . GLU A 1 292 ? 36.833  20.720  -0.973  1.00 40.13  ? 292  GLU A C   1 
ATOM   2208 O O   . GLU A 1 292 ? 36.305  20.159  -1.935  1.00 42.85  ? 292  GLU A O   1 
ATOM   2209 C CB  . GLU A 1 292 ? 37.947  22.661  -2.107  1.00 53.48  ? 292  GLU A CB  1 
ATOM   2210 C CG  . GLU A 1 292 ? 37.193  23.860  -1.535  1.00 65.69  ? 292  GLU A CG  1 
ATOM   2211 C CD  . GLU A 1 292 ? 36.963  24.967  -2.581  1.00 83.89  ? 292  GLU A CD  1 
ATOM   2212 O OE1 . GLU A 1 292 ? 37.795  25.109  -3.508  1.00 91.00  ? 292  GLU A OE1 1 
ATOM   2213 O OE2 . GLU A 1 292 ? 35.945  25.694  -2.481  1.00 85.38  ? 292  GLU A OE2 1 
ATOM   2214 N N   . SER A 1 293 ? 36.315  20.683  0.250   1.00 35.32  ? 293  SER A N   1 
ATOM   2215 C CA  . SER A 1 293 ? 35.113  19.887  0.520   1.00 36.40  ? 293  SER A CA  1 
ATOM   2216 C C   . SER A 1 293 ? 34.200  20.419  1.612   1.00 32.19  ? 293  SER A C   1 
ATOM   2217 O O   . SER A 1 293 ? 34.537  21.349  2.323   1.00 37.79  ? 293  SER A O   1 
ATOM   2218 C CB  . SER A 1 293 ? 35.486  18.437  0.861   1.00 33.17  ? 293  SER A CB  1 
ATOM   2219 O OG  . SER A 1 293 ? 36.844  18.337  1.215   1.00 33.71  ? 293  SER A OG  1 
ATOM   2220 N N   . ILE A 1 294 ? 33.028  19.805  1.713   1.00 31.33  ? 294  ILE A N   1 
ATOM   2221 C CA  . ILE A 1 294 ? 32.180  19.926  2.886   1.00 29.08  ? 294  ILE A CA  1 
ATOM   2222 C C   . ILE A 1 294 ? 31.831  18.505  3.309   1.00 33.71  ? 294  ILE A C   1 
ATOM   2223 O O   . ILE A 1 294 ? 31.947  17.576  2.511   1.00 27.53  ? 294  ILE A O   1 
ATOM   2224 C CB  . ILE A 1 294 ? 30.908  20.717  2.596   1.00 30.57  ? 294  ILE A CB  1 
ATOM   2225 C CG1 . ILE A 1 294 ? 30.117  20.033  1.498   1.00 31.45  ? 294  ILE A CG1 1 
ATOM   2226 C CG2 . ILE A 1 294 ? 31.244  22.160  2.231   1.00 32.74  ? 294  ILE A CG2 1 
ATOM   2227 C CD1 . ILE A 1 294 ? 28.883  20.804  1.098   1.00 43.40  ? 294  ILE A CD1 1 
ATOM   2228 N N   . PHE A 1 295 ? 31.436  18.331  4.567   1.00 26.95  ? 295  PHE A N   1 
ATOM   2229 C CA  . PHE A 1 295 ? 31.151  17.004  5.109   1.00 25.10  ? 295  PHE A CA  1 
ATOM   2230 C C   . PHE A 1 295 ? 32.353  16.056  4.973   1.00 28.80  ? 295  PHE A C   1 
ATOM   2231 O O   . PHE A 1 295 ? 32.193  14.856  4.729   1.00 30.46  ? 295  PHE A O   1 
ATOM   2232 C CB  . PHE A 1 295 ? 29.885  16.413  4.475   1.00 24.83  ? 295  PHE A CB  1 
ATOM   2233 C CG  . PHE A 1 295 ? 28.940  15.770  5.473   1.00 31.22  ? 295  PHE A CG  1 
ATOM   2234 C CD1 . PHE A 1 295 ? 29.418  14.879  6.434   1.00 29.62  ? 295  PHE A CD1 1 
ATOM   2235 C CD2 . PHE A 1 295 ? 27.570  16.062  5.453   1.00 27.76  ? 295  PHE A CD2 1 
ATOM   2236 C CE1 . PHE A 1 295 ? 28.550  14.267  7.351   1.00 30.26  ? 295  PHE A CE1 1 
ATOM   2237 C CE2 . PHE A 1 295 ? 26.693  15.462  6.366   1.00 27.58  ? 295  PHE A CE2 1 
ATOM   2238 C CZ  . PHE A 1 295 ? 27.183  14.559  7.315   1.00 28.20  ? 295  PHE A CZ  1 
ATOM   2239 N N   . ARG A 1 296 ? 33.552  16.620  5.113   1.00 24.52  ? 296  ARG A N   1 
ATOM   2240 C CA  . ARG A 1 296 ? 34.788  15.841  5.230   1.00 31.39  ? 296  ARG A CA  1 
ATOM   2241 C C   . ARG A 1 296 ? 35.582  16.349  6.420   1.00 29.91  ? 296  ARG A C   1 
ATOM   2242 O O   . ARG A 1 296 ? 35.692  17.553  6.649   1.00 32.65  ? 296  ARG A O   1 
ATOM   2243 C CB  . ARG A 1 296 ? 35.669  15.946  3.974   1.00 29.23  ? 296  ARG A CB  1 
ATOM   2244 C CG  . ARG A 1 296 ? 35.119  15.263  2.743   1.00 30.87  ? 296  ARG A CG  1 
ATOM   2245 C CD  . ARG A 1 296 ? 34.846  13.772  2.945   1.00 31.05  ? 296  ARG A CD  1 
ATOM   2246 N NE  . ARG A 1 296 ? 34.373  13.217  1.680   1.00 36.38  ? 296  ARG A NE  1 
ATOM   2247 C CZ  . ARG A 1 296 ? 33.094  13.067  1.354   1.00 29.81  ? 296  ARG A CZ  1 
ATOM   2248 N NH1 . ARG A 1 296 ? 32.138  13.389  2.211   1.00 31.11  ? 296  ARG A NH1 1 
ATOM   2249 N NH2 . ARG A 1 296 ? 32.774  12.581  0.171   1.00 31.58  ? 296  ARG A NH2 1 
ATOM   2250 N N   . PHE A 1 297 ? 36.171  15.432  7.165   1.00 23.23  ? 297  PHE A N   1 
ATOM   2251 C CA  . PHE A 1 297 ? 36.889  15.831  8.358   1.00 25.70  ? 297  PHE A CA  1 
ATOM   2252 C C   . PHE A 1 297 ? 38.278  15.221  8.381   1.00 27.77  ? 297  PHE A C   1 
ATOM   2253 O O   . PHE A 1 297 ? 38.471  14.083  7.955   1.00 34.66  ? 297  PHE A O   1 
ATOM   2254 C CB  . PHE A 1 297 ? 36.054  15.480  9.583   1.00 20.09  ? 297  PHE A CB  1 
ATOM   2255 C CG  . PHE A 1 297 ? 34.592  15.780  9.396   1.00 26.44  ? 297  PHE A CG  1 
ATOM   2256 C CD1 . PHE A 1 297 ? 34.138  17.099  9.368   1.00 24.62  ? 297  PHE A CD1 1 
ATOM   2257 C CD2 . PHE A 1 297 ? 33.678  14.759  9.194   1.00 21.08  ? 297  PHE A CD2 1 
ATOM   2258 C CE1 . PHE A 1 297 ? 32.799  17.388  9.166   1.00 31.38  ? 297  PHE A CE1 1 
ATOM   2259 C CE2 . PHE A 1 297 ? 32.331  15.043  8.991   1.00 26.09  ? 297  PHE A CE2 1 
ATOM   2260 C CZ  . PHE A 1 297 ? 31.889  16.358  8.984   1.00 20.87  ? 297  PHE A CZ  1 
ATOM   2261 N N   . SER A 1 298 ? 39.242  16.004  8.854   1.00 24.84  ? 298  SER A N   1 
ATOM   2262 C CA  . SER A 1 298 ? 40.664  15.679  8.741   1.00 23.76  ? 298  SER A CA  1 
ATOM   2263 C C   . SER A 1 298 ? 41.123  14.441  9.513   1.00 28.28  ? 298  SER A C   1 
ATOM   2264 O O   . SER A 1 298 ? 41.889  13.619  8.995   1.00 31.84  ? 298  SER A O   1 
ATOM   2265 C CB  . SER A 1 298 ? 41.479  16.874  9.197   1.00 22.21  ? 298  SER A CB  1 
ATOM   2266 O OG  . SER A 1 298 ? 41.387  17.896  8.233   1.00 42.80  ? 298  SER A OG  1 
ATOM   2267 N N   . PHE A 1 299 ? 40.652  14.320  10.749  1.00 27.08  ? 299  PHE A N   1 
ATOM   2268 C CA  . PHE A 1 299 ? 41.071  13.248  11.634  1.00 27.64  ? 299  PHE A CA  1 
ATOM   2269 C C   . PHE A 1 299 ? 39.881  12.508  12.217  1.00 33.88  ? 299  PHE A C   1 
ATOM   2270 O O   . PHE A 1 299 ? 39.146  13.021  13.088  1.00 27.90  ? 299  PHE A O   1 
ATOM   2271 C CB  . PHE A 1 299 ? 42.020  13.793  12.703  1.00 21.75  ? 299  PHE A CB  1 
ATOM   2272 C CG  . PHE A 1 299 ? 43.309  14.296  12.121  1.00 24.82  ? 299  PHE A CG  1 
ATOM   2273 C CD1 . PHE A 1 299 ? 44.347  13.418  11.867  1.00 21.90  ? 299  PHE A CD1 1 
ATOM   2274 C CD2 . PHE A 1 299 ? 43.446  15.624  11.751  1.00 21.55  ? 299  PHE A CD2 1 
ATOM   2275 C CE1 . PHE A 1 299 ? 45.525  13.866  11.303  1.00 22.82  ? 299  PHE A CE1 1 
ATOM   2276 C CE2 . PHE A 1 299 ? 44.610  16.084  11.173  1.00 31.97  ? 299  PHE A CE2 1 
ATOM   2277 C CZ  . PHE A 1 299 ? 45.667  15.205  10.958  1.00 27.44  ? 299  PHE A CZ  1 
ATOM   2278 N N   . VAL A 1 300 ? 39.709  11.291  11.704  1.00 27.30  ? 300  VAL A N   1 
ATOM   2279 C CA  . VAL A 1 300 ? 38.532  10.469  11.944  1.00 22.48  ? 300  VAL A CA  1 
ATOM   2280 C C   . VAL A 1 300 ? 38.999  9.030   12.167  1.00 26.19  ? 300  VAL A C   1 
ATOM   2281 O O   . VAL A 1 300 ? 40.178  8.731   11.978  1.00 22.73  ? 300  VAL A O   1 
ATOM   2282 C CB  . VAL A 1 300 ? 37.563  10.541  10.736  1.00 20.22  ? 300  VAL A CB  1 
ATOM   2283 C CG1 . VAL A 1 300 ? 37.186  12.005  10.412  1.00 19.47  ? 300  VAL A CG1 1 
ATOM   2284 C CG2 . VAL A 1 300 ? 38.149  9.812   9.503   1.00 20.77  ? 300  VAL A CG2 1 
ATOM   2285 N N   . PRO A 1 301 ? 38.086  8.135   12.584  1.00 28.23  ? 301  PRO A N   1 
ATOM   2286 C CA  . PRO A 1 301 ? 38.516  6.735   12.730  1.00 26.62  ? 301  PRO A CA  1 
ATOM   2287 C C   . PRO A 1 301 ? 39.225  6.175   11.494  1.00 30.83  ? 301  PRO A C   1 
ATOM   2288 O O   . PRO A 1 301 ? 38.849  6.441   10.352  1.00 27.03  ? 301  PRO A O   1 
ATOM   2289 C CB  . PRO A 1 301 ? 37.201  5.998   12.970  1.00 21.69  ? 301  PRO A CB  1 
ATOM   2290 C CG  . PRO A 1 301 ? 36.381  7.016   13.762  1.00 23.35  ? 301  PRO A CG  1 
ATOM   2291 C CD  . PRO A 1 301 ? 36.714  8.346   13.096  1.00 22.81  ? 301  PRO A CD  1 
ATOM   2292 N N   . VAL A 1 302 ? 40.272  5.405   11.743  1.00 26.01  ? 302  VAL A N   1 
ATOM   2293 C CA  . VAL A 1 302 ? 41.039  4.809   10.680  1.00 25.49  ? 302  VAL A CA  1 
ATOM   2294 C C   . VAL A 1 302 ? 40.789  3.292   10.637  1.00 30.35  ? 302  VAL A C   1 
ATOM   2295 O O   . VAL A 1 302 ? 40.636  2.649   11.679  1.00 30.18  ? 302  VAL A O   1 
ATOM   2296 C CB  . VAL A 1 302 ? 42.552  5.105   10.885  1.00 30.74  ? 302  VAL A CB  1 
ATOM   2297 C CG1 . VAL A 1 302 ? 43.016  4.623   12.262  1.00 26.53  ? 302  VAL A CG1 1 
ATOM   2298 C CG2 . VAL A 1 302 ? 43.387  4.461   9.795   1.00 28.00  ? 302  VAL A CG2 1 
ATOM   2299 N N   . VAL A 1 303 ? 40.752  2.727   9.431   1.00 29.52  ? 303  VAL A N   1 
ATOM   2300 C CA  . VAL A 1 303 ? 40.667  1.278   9.246   1.00 33.78  ? 303  VAL A CA  1 
ATOM   2301 C C   . VAL A 1 303 ? 42.034  0.655   9.543   1.00 40.07  ? 303  VAL A C   1 
ATOM   2302 O O   . VAL A 1 303 ? 42.865  0.474   8.644   1.00 37.05  ? 303  VAL A O   1 
ATOM   2303 C CB  . VAL A 1 303 ? 40.200  0.930   7.817   1.00 31.85  ? 303  VAL A CB  1 
ATOM   2304 C CG1 . VAL A 1 303 ? 39.953  -0.570  7.657   1.00 34.32  ? 303  VAL A CG1 1 
ATOM   2305 C CG2 . VAL A 1 303 ? 38.946  1.703   7.502   1.00 30.71  ? 303  VAL A CG2 1 
ATOM   2306 N N   . ASP A 1 304 ? 42.245  0.337   10.818  1.00 40.78  ? 304  ASP A N   1 
ATOM   2307 C CA  . ASP A 1 304 ? 43.558  -0.020  11.355  1.00 38.44  ? 304  ASP A CA  1 
ATOM   2308 C C   . ASP A 1 304 ? 43.847  -1.501  11.314  1.00 37.27  ? 304  ASP A C   1 
ATOM   2309 O O   . ASP A 1 304 ? 44.974  -1.905  11.518  1.00 39.12  ? 304  ASP A O   1 
ATOM   2310 C CB  . ASP A 1 304 ? 43.710  0.494   12.804  1.00 39.09  ? 304  ASP A CB  1 
ATOM   2311 C CG  . ASP A 1 304 ? 42.613  -0.037  13.760  1.00 42.38  ? 304  ASP A CG  1 
ATOM   2312 O OD1 . ASP A 1 304 ? 41.629  -0.665  13.302  1.00 36.41  ? 304  ASP A OD1 1 
ATOM   2313 O OD2 . ASP A 1 304 ? 42.735  0.190   14.986  1.00 41.70  ? 304  ASP A OD2 1 
ATOM   2314 N N   . GLY A 1 305 ? 42.828  -2.309  11.049  1.00 42.91  ? 305  GLY A N   1 
ATOM   2315 C CA  . GLY A 1 305 ? 42.973  -3.752  11.098  1.00 41.30  ? 305  GLY A CA  1 
ATOM   2316 C C   . GLY A 1 305 ? 42.966  -4.233  12.539  1.00 51.77  ? 305  GLY A C   1 
ATOM   2317 O O   . GLY A 1 305 ? 43.379  -5.348  12.838  1.00 44.95  ? 305  GLY A O   1 
ATOM   2318 N N   . ASP A 1 306 ? 42.493  -3.379  13.441  1.00 46.52  ? 306  ASP A N   1 
ATOM   2319 C CA  . ASP A 1 306 ? 42.532  -3.670  14.869  1.00 43.63  ? 306  ASP A CA  1 
ATOM   2320 C C   . ASP A 1 306 ? 41.168  -3.376  15.504  1.00 40.39  ? 306  ASP A C   1 
ATOM   2321 O O   . ASP A 1 306 ? 40.332  -4.271  15.639  1.00 40.17  ? 306  ASP A O   1 
ATOM   2322 C CB  . ASP A 1 306 ? 43.648  -2.851  15.526  1.00 44.50  ? 306  ASP A CB  1 
ATOM   2323 C CG  . ASP A 1 306 ? 43.823  -3.162  17.005  1.00 50.53  ? 306  ASP A CG  1 
ATOM   2324 O OD1 . ASP A 1 306 ? 43.328  -4.216  17.469  1.00 47.55  ? 306  ASP A OD1 1 
ATOM   2325 O OD2 . ASP A 1 306 ? 44.471  -2.343  17.698  1.00 53.98  ? 306  ASP A OD2 1 
ATOM   2326 N N   . PHE A 1 307 ? 40.950  -2.127  15.898  1.00 35.53  ? 307  PHE A N   1 
ATOM   2327 C CA  . PHE A 1 307 ? 39.631  -1.701  16.329  1.00 33.82  ? 307  PHE A CA  1 
ATOM   2328 C C   . PHE A 1 307 ? 38.631  -2.016  15.219  1.00 38.26  ? 307  PHE A C   1 
ATOM   2329 O O   . PHE A 1 307 ? 37.546  -2.540  15.467  1.00 38.49  ? 307  PHE A O   1 
ATOM   2330 C CB  . PHE A 1 307 ? 39.610  -0.196  16.642  1.00 31.14  ? 307  PHE A CB  1 
ATOM   2331 C CG  . PHE A 1 307 ? 38.365  0.242   17.369  1.00 41.71  ? 307  PHE A CG  1 
ATOM   2332 C CD1 . PHE A 1 307 ? 37.172  0.405   16.688  1.00 28.79  ? 307  PHE A CD1 1 
ATOM   2333 C CD2 . PHE A 1 307 ? 38.383  0.446   18.746  1.00 39.92  ? 307  PHE A CD2 1 
ATOM   2334 C CE1 . PHE A 1 307 ? 36.032  0.766   17.358  1.00 34.07  ? 307  PHE A CE1 1 
ATOM   2335 C CE2 . PHE A 1 307 ? 37.240  0.825   19.425  1.00 35.74  ? 307  PHE A CE2 1 
ATOM   2336 C CZ  . PHE A 1 307 ? 36.062  0.982   18.733  1.00 31.01  ? 307  PHE A CZ  1 
ATOM   2337 N N   . LEU A 1 308 ? 39.006  -1.671  13.993  1.00 34.85  ? 308  LEU A N   1 
ATOM   2338 C CA  . LEU A 1 308 ? 38.216  -2.003  12.816  1.00 33.41  ? 308  LEU A CA  1 
ATOM   2339 C C   . LEU A 1 308 ? 39.005  -3.016  12.003  1.00 39.92  ? 308  LEU A C   1 
ATOM   2340 O O   . LEU A 1 308 ? 40.009  -2.669  11.387  1.00 40.95  ? 308  LEU A O   1 
ATOM   2341 C CB  . LEU A 1 308 ? 37.958  -0.744  11.988  1.00 32.13  ? 308  LEU A CB  1 
ATOM   2342 C CG  . LEU A 1 308 ? 37.006  0.304   12.574  1.00 34.76  ? 308  LEU A CG  1 
ATOM   2343 C CD1 . LEU A 1 308 ? 36.820  1.439   11.595  1.00 27.12  ? 308  LEU A CD1 1 
ATOM   2344 C CD2 . LEU A 1 308 ? 35.652  -0.319  12.918  1.00 33.48  ? 308  LEU A CD2 1 
ATOM   2345 N N   . SER A 1 309 ? 38.567  -4.272  12.008  1.00 40.46  ? 309  SER A N   1 
ATOM   2346 C CA  . SER A 1 309 ? 39.324  -5.346  11.359  1.00 41.74  ? 309  SER A CA  1 
ATOM   2347 C C   . SER A 1 309 ? 39.301  -5.251  9.831   1.00 42.14  ? 309  SER A C   1 
ATOM   2348 O O   . SER A 1 309 ? 40.101  -5.877  9.145   1.00 44.69  ? 309  SER A O   1 
ATOM   2349 C CB  . SER A 1 309 ? 38.804  -6.718  11.809  1.00 44.56  ? 309  SER A CB  1 
ATOM   2350 O OG  . SER A 1 309 ? 37.432  -6.864  11.507  1.00 51.11  ? 309  SER A OG  1 
ATOM   2351 N N   . ASP A 1 310 ? 38.367  -4.468  9.313   1.00 39.92  ? 310  ASP A N   1 
ATOM   2352 C CA  . ASP A 1 310 ? 38.186  -4.287  7.882   1.00 40.30  ? 310  ASP A CA  1 
ATOM   2353 C C   . ASP A 1 310 ? 37.367  -3.007  7.729   1.00 37.14  ? 310  ASP A C   1 
ATOM   2354 O O   . ASP A 1 310 ? 37.040  -2.369  8.730   1.00 36.14  ? 310  ASP A O   1 
ATOM   2355 C CB  . ASP A 1 310 ? 37.446  -5.484  7.285   1.00 42.95  ? 310  ASP A CB  1 
ATOM   2356 C CG  . ASP A 1 310 ? 37.695  -5.640  5.796   1.00 53.01  ? 310  ASP A CG  1 
ATOM   2357 O OD1 . ASP A 1 310 ? 37.859  -4.610  5.111   1.00 53.05  ? 310  ASP A OD1 1 
ATOM   2358 O OD2 . ASP A 1 310 ? 37.732  -6.796  5.312   1.00 55.96  ? 310  ASP A OD2 1 
ATOM   2359 N N   . THR A 1 311 ? 37.042  -2.617  6.500   1.00 39.83  ? 311  THR A N   1 
ATOM   2360 C CA  . THR A 1 311 ? 36.267  -1.392  6.284   1.00 36.95  ? 311  THR A CA  1 
ATOM   2361 C C   . THR A 1 311 ? 34.876  -1.629  6.845   1.00 33.80  ? 311  THR A C   1 
ATOM   2362 O O   . THR A 1 311 ? 34.421  -2.777  6.895   1.00 38.09  ? 311  THR A O   1 
ATOM   2363 C CB  . THR A 1 311 ? 36.153  -1.049  4.778   1.00 40.86  ? 311  THR A CB  1 
ATOM   2364 O OG1 . THR A 1 311 ? 35.329  -2.023  4.122   1.00 45.71  ? 311  THR A OG1 1 
ATOM   2365 C CG2 . THR A 1 311 ? 37.531  -1.046  4.115   1.00 36.86  ? 311  THR A CG2 1 
ATOM   2366 N N   . PRO A 1 312 ? 34.198  -0.565  7.291   1.00 31.32  ? 312  PRO A N   1 
ATOM   2367 C CA  . PRO A 1 312 ? 32.805  -0.734  7.731   1.00 35.02  ? 312  PRO A CA  1 
ATOM   2368 C C   . PRO A 1 312 ? 31.913  -1.364  6.656   1.00 42.97  ? 312  PRO A C   1 
ATOM   2369 O O   . PRO A 1 312 ? 30.993  -2.113  6.976   1.00 50.12  ? 312  PRO A O   1 
ATOM   2370 C CB  . PRO A 1 312 ? 32.360  0.698   8.022   1.00 29.35  ? 312  PRO A CB  1 
ATOM   2371 C CG  . PRO A 1 312 ? 33.605  1.377   8.450   1.00 32.13  ? 312  PRO A CG  1 
ATOM   2372 C CD  . PRO A 1 312 ? 34.706  0.782   7.593   1.00 31.10  ? 312  PRO A CD  1 
ATOM   2373 N N   A GLU A 1 313 ? 32.198  -1.057  5.393   0.48 43.56  ? 313  GLU A N   1 
ATOM   2374 N N   B GLU A 1 313 ? 32.192  -1.063  5.395   0.52 43.54  ? 313  GLU A N   1 
ATOM   2375 C CA  A GLU A 1 313 ? 31.473  -1.631  4.263   0.48 46.19  ? 313  GLU A CA  1 
ATOM   2376 C CA  B GLU A 1 313 ? 31.419  -1.626  4.298   0.52 46.07  ? 313  GLU A CA  1 
ATOM   2377 C C   A GLU A 1 313 ? 31.560  -3.153  4.283   0.48 48.23  ? 313  GLU A C   1 
ATOM   2378 C C   B GLU A 1 313 ? 31.565  -3.156  4.218   0.52 48.33  ? 313  GLU A C   1 
ATOM   2379 O O   A GLU A 1 313 ? 30.549  -3.849  4.195   0.48 48.26  ? 313  GLU A O   1 
ATOM   2380 O O   B GLU A 1 313 ? 30.583  -3.866  4.011   0.52 48.29  ? 313  GLU A O   1 
ATOM   2381 C CB  A GLU A 1 313 ? 32.047  -1.100  2.943   0.48 46.74  ? 313  GLU A CB  1 
ATOM   2382 C CB  B GLU A 1 313 ? 31.785  -0.942  2.970   0.52 47.12  ? 313  GLU A CB  1 
ATOM   2383 C CG  A GLU A 1 313 ? 31.280  -1.518  1.694   0.48 47.92  ? 313  GLU A CG  1 
ATOM   2384 C CG  B GLU A 1 313 ? 31.138  0.446   2.771   0.52 45.46  ? 313  GLU A CG  1 
ATOM   2385 C CD  A GLU A 1 313 ? 32.025  -1.175  0.416   0.48 50.66  ? 313  GLU A CD  1 
ATOM   2386 C CD  B GLU A 1 313 ? 31.862  1.587   3.500   0.52 42.91  ? 313  GLU A CD  1 
ATOM   2387 O OE1 A GLU A 1 313 ? 33.194  -0.733  0.508   0.48 52.84  ? 313  GLU A OE1 1 
ATOM   2388 O OE1 B GLU A 1 313 ? 32.958  1.368   4.068   0.52 38.94  ? 313  GLU A OE1 1 
ATOM   2389 O OE2 A GLU A 1 313 ? 31.445  -1.347  -0.676  0.48 47.87  ? 313  GLU A OE2 1 
ATOM   2390 O OE2 B GLU A 1 313 ? 31.327  2.714   3.495   0.52 29.50  ? 313  GLU A OE2 1 
ATOM   2391 N N   . ALA A 1 314 ? 32.780  -3.666  4.403   1.00 46.78  ? 314  ALA A N   1 
ATOM   2392 C CA  . ALA A 1 314 ? 32.993  -5.109  4.402   1.00 42.14  ? 314  ALA A CA  1 
ATOM   2393 C C   . ALA A 1 314 ? 32.361  -5.739  5.633   1.00 42.03  ? 314  ALA A C   1 
ATOM   2394 O O   . ALA A 1 314 ? 31.711  -6.777  5.539   1.00 52.67  ? 314  ALA A O   1 
ATOM   2395 C CB  . ALA A 1 314 ? 34.480  -5.449  4.326   1.00 43.75  ? 314  ALA A CB  1 
ATOM   2396 N N   . LEU A 1 315 ? 32.547  -5.095  6.784   1.00 45.02  ? 315  LEU A N   1 
ATOM   2397 C CA  . LEU A 1 315 ? 32.061  -5.627  8.053   1.00 39.74  ? 315  LEU A CA  1 
ATOM   2398 C C   . LEU A 1 315 ? 30.536  -5.719  8.127   1.00 52.55  ? 315  LEU A C   1 
ATOM   2399 O O   . LEU A 1 315 ? 30.011  -6.728  8.594   1.00 55.48  ? 315  LEU A O   1 
ATOM   2400 C CB  . LEU A 1 315 ? 32.614  -4.827  9.240   1.00 37.51  ? 315  LEU A CB  1 
ATOM   2401 C CG  . LEU A 1 315 ? 34.124  -4.878  9.512   1.00 39.46  ? 315  LEU A CG  1 
ATOM   2402 C CD1 . LEU A 1 315 ? 34.471  -4.054  10.735  1.00 36.02  ? 315  LEU A CD1 1 
ATOM   2403 C CD2 . LEU A 1 315 ? 34.644  -6.313  9.645   1.00 41.64  ? 315  LEU A CD2 1 
ATOM   2404 N N   . ILE A 1 316 ? 29.824  -4.683  7.679   1.00 37.23  ? 316  ILE A N   1 
ATOM   2405 C CA  . ILE A 1 316 ? 28.362  -4.736  7.686   1.00 41.93  ? 316  ILE A CA  1 
ATOM   2406 C C   . ILE A 1 316 ? 27.813  -5.699  6.629   1.00 51.98  ? 316  ILE A C   1 
ATOM   2407 O O   . ILE A 1 316 ? 26.679  -6.151  6.744   1.00 52.85  ? 316  ILE A O   1 
ATOM   2408 C CB  . ILE A 1 316 ? 27.668  -3.346  7.514   1.00 35.87  ? 316  ILE A CB  1 
ATOM   2409 C CG1 . ILE A 1 316 ? 27.882  -2.777  6.110   1.00 48.02  ? 316  ILE A CG1 1 
ATOM   2410 C CG2 . ILE A 1 316 ? 28.105  -2.356  8.581   1.00 37.17  ? 316  ILE A CG2 1 
ATOM   2411 C CD1 . ILE A 1 316 ? 27.212  -1.402  5.893   1.00 45.46  ? 316  ILE A CD1 1 
ATOM   2412 N N   . ASN A 1 317 ? 28.611  -6.009  5.607   1.00 56.03  ? 317  ASN A N   1 
ATOM   2413 C CA  . ASN A 1 317 ? 28.181  -6.944  4.561   1.00 58.53  ? 317  ASN A CA  1 
ATOM   2414 C C   . ASN A 1 317 ? 28.236  -8.402  4.993   1.00 63.53  ? 317  ASN A C   1 
ATOM   2415 O O   . ASN A 1 317 ? 27.456  -9.224  4.513   1.00 69.77  ? 317  ASN A O   1 
ATOM   2416 C CB  . ASN A 1 317 ? 29.013  -6.792  3.277   1.00 60.07  ? 317  ASN A CB  1 
ATOM   2417 C CG  . ASN A 1 317 ? 28.680  -5.530  2.491   1.00 63.22  ? 317  ASN A CG  1 
ATOM   2418 O OD1 . ASN A 1 317 ? 27.717  -4.817  2.792   1.00 64.34  ? 317  ASN A OD1 1 
ATOM   2419 N ND2 . ASN A 1 317 ? 29.491  -5.248  1.473   1.00 64.74  ? 317  ASN A ND2 1 
ATOM   2420 N N   . THR A 1 318 ? 29.165  -8.728  5.885   1.00 61.61  ? 318  THR A N   1 
ATOM   2421 C CA  . THR A 1 318 ? 29.402  -10.123 6.249   1.00 63.68  ? 318  THR A CA  1 
ATOM   2422 C C   . THR A 1 318 ? 29.113  -10.432 7.715   1.00 62.68  ? 318  THR A C   1 
ATOM   2423 O O   . THR A 1 318 ? 29.087  -11.591 8.109   1.00 65.06  ? 318  THR A O   1 
ATOM   2424 C CB  . THR A 1 318 ? 30.852  -10.534 5.963   1.00 67.25  ? 318  THR A CB  1 
ATOM   2425 O OG1 . THR A 1 318 ? 31.733  -9.789  6.815   1.00 65.40  ? 318  THR A OG1 1 
ATOM   2426 C CG2 . THR A 1 318 ? 31.203  -10.268 4.506   1.00 68.77  ? 318  THR A CG2 1 
ATOM   2427 N N   . GLY A 1 319 ? 28.910  -9.401  8.525   1.00 59.65  ? 319  GLY A N   1 
ATOM   2428 C CA  . GLY A 1 319 ? 28.678  -9.610  9.942   1.00 62.68  ? 319  GLY A CA  1 
ATOM   2429 C C   . GLY A 1 319 ? 27.393  -10.360 10.258  1.00 64.53  ? 319  GLY A C   1 
ATOM   2430 O O   . GLY A 1 319 ? 26.442  -10.365 9.475   1.00 59.24  ? 319  GLY A O   1 
ATOM   2431 N N   . ASP A 1 320 ? 27.374  -11.013 11.415  1.00 68.88  ? 320  ASP A N   1 
ATOM   2432 C CA  . ASP A 1 320 ? 26.152  -11.583 11.961  1.00 67.74  ? 320  ASP A CA  1 
ATOM   2433 C C   . ASP A 1 320 ? 25.634  -10.621 13.037  1.00 68.65  ? 320  ASP A C   1 
ATOM   2434 O O   . ASP A 1 320 ? 26.376  -10.241 13.949  1.00 72.70  ? 320  ASP A O   1 
ATOM   2435 C CB  . ASP A 1 320 ? 26.433  -12.963 12.548  1.00 69.07  ? 320  ASP A CB  1 
ATOM   2436 C CG  . ASP A 1 320 ? 25.175  -13.698 12.942  1.00 74.94  ? 320  ASP A CG  1 
ATOM   2437 O OD1 . ASP A 1 320 ? 24.081  -13.110 12.832  1.00 77.46  ? 320  ASP A OD1 1 
ATOM   2438 O OD2 . ASP A 1 320 ? 25.277  -14.870 13.361  1.00 77.54  ? 320  ASP A OD2 1 
ATOM   2439 N N   . PHE A 1 321 ? 24.373  -10.211 12.919  1.00 58.88  ? 321  PHE A N   1 
ATOM   2440 C CA  . PHE A 1 321 ? 23.813  -9.225  13.837  1.00 56.27  ? 321  PHE A CA  1 
ATOM   2441 C C   . PHE A 1 321 ? 22.516  -9.675  14.515  1.00 60.67  ? 321  PHE A C   1 
ATOM   2442 O O   . PHE A 1 321 ? 21.642  -8.845  14.786  1.00 56.44  ? 321  PHE A O   1 
ATOM   2443 C CB  . PHE A 1 321 ? 23.573  -7.905  13.107  1.00 56.75  ? 321  PHE A CB  1 
ATOM   2444 C CG  . PHE A 1 321 ? 24.800  -7.349  12.431  1.00 56.36  ? 321  PHE A CG  1 
ATOM   2445 C CD1 . PHE A 1 321 ? 25.843  -6.826  13.180  1.00 50.01  ? 321  PHE A CD1 1 
ATOM   2446 C CD2 . PHE A 1 321 ? 24.906  -7.347  11.047  1.00 56.70  ? 321  PHE A CD2 1 
ATOM   2447 C CE1 . PHE A 1 321 ? 26.970  -6.310  12.564  1.00 47.01  ? 321  PHE A CE1 1 
ATOM   2448 C CE2 . PHE A 1 321 ? 26.032  -6.834  10.426  1.00 55.57  ? 321  PHE A CE2 1 
ATOM   2449 C CZ  . PHE A 1 321 ? 27.062  -6.311  11.185  1.00 51.47  ? 321  PHE A CZ  1 
ATOM   2450 N N   . GLN A 1 322 ? 22.403  -10.971 14.809  1.00 59.13  ? 322  GLN A N   1 
ATOM   2451 C CA  . GLN A 1 322 ? 21.159  -11.536 15.335  1.00 64.12  ? 322  GLN A CA  1 
ATOM   2452 C C   . GLN A 1 322 ? 20.716  -10.990 16.696  1.00 66.10  ? 322  GLN A C   1 
ATOM   2453 O O   . GLN A 1 322 ? 19.536  -10.705 16.901  1.00 72.62  ? 322  GLN A O   1 
ATOM   2454 C CB  . GLN A 1 322 ? 21.242  -13.060 15.400  1.00 69.27  ? 322  GLN A CB  1 
ATOM   2455 C CG  . GLN A 1 322 ? 21.007  -13.750 14.073  1.00 77.95  ? 322  GLN A CG  1 
ATOM   2456 C CD  . GLN A 1 322 ? 21.323  -15.230 14.133  1.00 88.08  ? 322  GLN A CD  1 
ATOM   2457 O OE1 . GLN A 1 322 ? 22.461  -15.620 14.407  1.00 89.86  ? 322  GLN A OE1 1 
ATOM   2458 N NE2 . GLN A 1 322 ? 20.314  -16.067 13.887  1.00 91.70  ? 322  GLN A NE2 1 
ATOM   2459 N N   . ASP A 1 323 ? 21.649  -10.846 17.626  1.00 60.31  ? 323  ASP A N   1 
ATOM   2460 C CA  . ASP A 1 323 ? 21.274  -10.455 18.984  1.00 68.08  ? 323  ASP A CA  1 
ATOM   2461 C C   . ASP A 1 323 ? 21.213  -8.923  19.161  1.00 65.28  ? 323  ASP A C   1 
ATOM   2462 O O   . ASP A 1 323 ? 21.400  -8.406  20.259  1.00 67.67  ? 323  ASP A O   1 
ATOM   2463 C CB  . ASP A 1 323 ? 22.249  -11.083 19.986  1.00 74.36  ? 323  ASP A CB  1 
ATOM   2464 C CG  . ASP A 1 323 ? 21.713  -11.090 21.410  1.00 84.83  ? 323  ASP A CG  1 
ATOM   2465 O OD1 . ASP A 1 323 ? 20.494  -11.314 21.598  1.00 86.33  ? 323  ASP A OD1 1 
ATOM   2466 O OD2 . ASP A 1 323 ? 22.521  -10.871 22.342  1.00 90.10  ? 323  ASP A OD2 1 
ATOM   2467 N N   . LEU A 1 324 ? 20.936  -8.202  18.081  1.00 60.30  ? 324  LEU A N   1 
ATOM   2468 C CA  . LEU A 1 324 ? 21.043  -6.740  18.094  1.00 56.19  ? 324  LEU A CA  1 
ATOM   2469 C C   . LEU A 1 324 ? 19.751  -6.037  17.672  1.00 50.13  ? 324  LEU A C   1 
ATOM   2470 O O   . LEU A 1 324 ? 19.129  -6.402  16.677  1.00 48.44  ? 324  LEU A O   1 
ATOM   2471 C CB  . LEU A 1 324 ? 22.189  -6.297  17.182  1.00 48.87  ? 324  LEU A CB  1 
ATOM   2472 C CG  . LEU A 1 324 ? 22.515  -4.813  17.190  1.00 50.66  ? 324  LEU A CG  1 
ATOM   2473 C CD1 . LEU A 1 324 ? 23.032  -4.410  18.554  1.00 54.07  ? 324  LEU A CD1 1 
ATOM   2474 C CD2 . LEU A 1 324 ? 23.527  -4.480  16.111  1.00 49.40  ? 324  LEU A CD2 1 
ATOM   2475 N N   . GLN A 1 325 ? 19.343  -5.038  18.443  1.00 46.99  ? 325  GLN A N   1 
ATOM   2476 C CA  . GLN A 1 325 ? 18.242  -4.177  18.030  1.00 46.89  ? 325  GLN A CA  1 
ATOM   2477 C C   . GLN A 1 325 ? 18.771  -2.770  17.821  1.00 42.95  ? 325  GLN A C   1 
ATOM   2478 O O   . GLN A 1 325 ? 19.517  -2.255  18.652  1.00 44.28  ? 325  GLN A O   1 
ATOM   2479 C CB  . GLN A 1 325 ? 17.110  -4.166  19.056  1.00 43.20  ? 325  GLN A CB  1 
ATOM   2480 C CG  . GLN A 1 325 ? 16.515  -5.505  19.311  1.00 47.56  ? 325  GLN A CG  1 
ATOM   2481 C CD  . GLN A 1 325 ? 17.095  -6.168  20.538  1.00 55.21  ? 325  GLN A CD  1 
ATOM   2482 O OE1 . GLN A 1 325 ? 17.332  -5.519  21.559  1.00 48.63  ? 325  GLN A OE1 1 
ATOM   2483 N NE2 . GLN A 1 325 ? 17.330  -7.473  20.444  1.00 63.20  ? 325  GLN A NE2 1 
ATOM   2484 N N   . VAL A 1 326 ? 18.384  -2.161  16.704  1.00 40.08  ? 326  VAL A N   1 
ATOM   2485 C CA  . VAL A 1 326 ? 18.930  -0.878  16.293  1.00 37.71  ? 326  VAL A CA  1 
ATOM   2486 C C   . VAL A 1 326 ? 17.806  0.048   15.851  1.00 41.99  ? 326  VAL A C   1 
ATOM   2487 O O   . VAL A 1 326 ? 16.871  -0.374  15.166  1.00 44.92  ? 326  VAL A O   1 
ATOM   2488 C CB  . VAL A 1 326 ? 19.934  -1.031  15.112  1.00 41.07  ? 326  VAL A CB  1 
ATOM   2489 C CG1 . VAL A 1 326 ? 20.519  0.301   14.727  1.00 32.34  ? 326  VAL A CG1 1 
ATOM   2490 C CG2 . VAL A 1 326 ? 21.052  -1.977  15.468  1.00 42.55  ? 326  VAL A CG2 1 
ATOM   2491 N N   . LEU A 1 327 ? 17.901  1.307   16.266  1.00 37.54  ? 327  LEU A N   1 
ATOM   2492 C CA  . LEU A 1 327 ? 17.018  2.355   15.796  1.00 33.03  ? 327  LEU A CA  1 
ATOM   2493 C C   . LEU A 1 327 ? 17.870  3.372   15.021  1.00 34.21  ? 327  LEU A C   1 
ATOM   2494 O O   . LEU A 1 327 ? 18.840  3.914   15.558  1.00 31.63  ? 327  LEU A O   1 
ATOM   2495 C CB  . LEU A 1 327 ? 16.300  3.009   16.983  1.00 34.83  ? 327  LEU A CB  1 
ATOM   2496 C CG  . LEU A 1 327 ? 15.632  4.365   16.729  1.00 38.39  ? 327  LEU A CG  1 
ATOM   2497 C CD1 . LEU A 1 327 ? 14.559  4.242   15.693  1.00 44.21  ? 327  LEU A CD1 1 
ATOM   2498 C CD2 . LEU A 1 327 ? 15.055  4.914   18.003  1.00 40.14  ? 327  LEU A CD2 1 
ATOM   2499 N N   . VAL A 1 328 ? 17.523  3.601   13.755  1.00 29.54  ? 328  VAL A N   1 
ATOM   2500 C CA  . VAL A 1 328 ? 18.243  4.541   12.894  1.00 30.73  ? 328  VAL A CA  1 
ATOM   2501 C C   . VAL A 1 328 ? 17.285  5.508   12.217  1.00 33.71  ? 328  VAL A C   1 
ATOM   2502 O O   . VAL A 1 328 ? 16.120  5.168   11.952  1.00 37.26  ? 328  VAL A O   1 
ATOM   2503 C CB  . VAL A 1 328 ? 19.010  3.818   11.766  1.00 33.85  ? 328  VAL A CB  1 
ATOM   2504 C CG1 . VAL A 1 328 ? 20.070  2.918   12.339  1.00 36.05  ? 328  VAL A CG1 1 
ATOM   2505 C CG2 . VAL A 1 328 ? 18.041  3.026   10.864  1.00 29.35  ? 328  VAL A CG2 1 
ATOM   2506 N N   . GLY A 1 329 ? 17.771  6.706   11.919  1.00 26.67  ? 329  GLY A N   1 
ATOM   2507 C CA  . GLY A 1 329 ? 16.976  7.659   11.164  1.00 25.28  ? 329  GLY A CA  1 
ATOM   2508 C C   . GLY A 1 329 ? 17.710  8.915   10.750  1.00 30.85  ? 329  GLY A C   1 
ATOM   2509 O O   . GLY A 1 329 ? 18.914  9.047   10.968  1.00 32.57  ? 329  GLY A O   1 
ATOM   2510 N N   . VAL A 1 330 ? 16.965  9.843   10.157  1.00 32.80  ? 330  VAL A N   1 
ATOM   2511 C CA  . VAL A 1 330 ? 17.526  11.042  9.539   1.00 25.40  ? 330  VAL A CA  1 
ATOM   2512 C C   . VAL A 1 330 ? 16.595  12.226  9.747   1.00 26.51  ? 330  VAL A C   1 
ATOM   2513 O O   . VAL A 1 330 ? 15.405  12.055  10.035  1.00 31.63  ? 330  VAL A O   1 
ATOM   2514 C CB  . VAL A 1 330 ? 17.721  10.850  8.004   1.00 32.03  ? 330  VAL A CB  1 
ATOM   2515 C CG1 . VAL A 1 330 ? 18.615  9.658   7.716   1.00 25.27  ? 330  VAL A CG1 1 
ATOM   2516 C CG2 . VAL A 1 330 ? 16.373  10.684  7.294   1.00 27.43  ? 330  VAL A CG2 1 
ATOM   2517 N N   . VAL A 1 331 ? 17.125  13.434  9.597   1.00 30.42  ? 331  VAL A N   1 
ATOM   2518 C CA  . VAL A 1 331 ? 16.259  14.611  9.564   1.00 28.25  ? 331  VAL A CA  1 
ATOM   2519 C C   . VAL A 1 331 ? 15.902  14.884  8.107   1.00 35.19  ? 331  VAL A C   1 
ATOM   2520 O O   . VAL A 1 331 ? 16.506  14.307  7.202   1.00 33.07  ? 331  VAL A O   1 
ATOM   2521 C CB  . VAL A 1 331 ? 16.908  15.843  10.220  1.00 30.90  ? 331  VAL A CB  1 
ATOM   2522 C CG1 . VAL A 1 331 ? 17.185  15.566  11.686  1.00 30.60  ? 331  VAL A CG1 1 
ATOM   2523 C CG2 . VAL A 1 331 ? 18.195  16.231  9.514   1.00 27.73  ? 331  VAL A CG2 1 
ATOM   2524 N N   . LYS A 1 332 ? 14.924  15.755  7.885   1.00 26.40  ? 332  LYS A N   1 
ATOM   2525 C CA  . LYS A 1 332 ? 14.416  16.000  6.550   1.00 24.90  ? 332  LYS A CA  1 
ATOM   2526 C C   . LYS A 1 332 ? 15.452  16.635  5.618   1.00 31.38  ? 332  LYS A C   1 
ATOM   2527 O O   . LYS A 1 332 ? 15.483  16.344  4.421   1.00 31.62  ? 332  LYS A O   1 
ATOM   2528 C CB  . LYS A 1 332 ? 13.140  16.852  6.615   1.00 34.93  ? 332  LYS A CB  1 
ATOM   2529 C CG  . LYS A 1 332 ? 12.444  17.045  5.262   1.00 34.61  ? 332  LYS A CG  1 
ATOM   2530 C CD  . LYS A 1 332 ? 11.107  17.785  5.390   1.00 43.12  ? 332  LYS A CD  1 
ATOM   2531 C CE  . LYS A 1 332 ? 11.245  19.202  5.993   1.00 51.31  ? 332  LYS A CE  1 
ATOM   2532 N NZ  . LYS A 1 332 ? 11.764  20.282  5.069   1.00 48.02  ? 332  LYS A NZ  1 
ATOM   2533 N N   . ASP A 1 333 ? 16.317  17.483  6.165   1.00 29.82  ? 333  ASP A N   1 
ATOM   2534 C CA  . ASP A 1 333 ? 17.257  18.234  5.331   1.00 25.69  ? 333  ASP A CA  1 
ATOM   2535 C C   . ASP A 1 333 ? 18.682  18.109  5.846   1.00 24.93  ? 333  ASP A C   1 
ATOM   2536 O O   . ASP A 1 333 ? 19.271  19.078  6.347   1.00 24.94  ? 333  ASP A O   1 
ATOM   2537 C CB  . ASP A 1 333 ? 16.834  19.708  5.252   1.00 21.61  ? 333  ASP A CB  1 
ATOM   2538 C CG  . ASP A 1 333 ? 15.401  19.881  4.715   1.00 37.77  ? 333  ASP A CG  1 
ATOM   2539 O OD1 . ASP A 1 333 ? 14.437  19.756  5.504   1.00 35.39  ? 333  ASP A OD1 1 
ATOM   2540 O OD2 . ASP A 1 333 ? 15.240  20.126  3.501   1.00 38.12  ? 333  ASP A OD2 1 
ATOM   2541 N N   . GLU A 1 334 ? 19.225  16.902  5.744   1.00 23.05  ? 334  GLU A N   1 
ATOM   2542 C CA  . GLU A 1 334 ? 20.565  16.623  6.252   1.00 23.96  ? 334  GLU A CA  1 
ATOM   2543 C C   . GLU A 1 334 ? 21.650  17.563  5.673   1.00 29.61  ? 334  GLU A C   1 
ATOM   2544 O O   . GLU A 1 334 ? 22.600  17.913  6.362   1.00 27.23  ? 334  GLU A O   1 
ATOM   2545 C CB  . GLU A 1 334 ? 20.927  15.155  5.984   1.00 23.94  ? 334  GLU A CB  1 
ATOM   2546 C CG  . GLU A 1 334 ? 20.046  14.152  6.701   1.00 22.93  ? 334  GLU A CG  1 
ATOM   2547 C CD  . GLU A 1 334 ? 20.417  14.003  8.172   1.00 27.66  ? 334  GLU A CD  1 
ATOM   2548 O OE1 . GLU A 1 334 ? 21.478  14.524  8.561   1.00 21.66  ? 334  GLU A OE1 1 
ATOM   2549 O OE2 . GLU A 1 334 ? 19.651  13.376  8.938   1.00 30.05  ? 334  GLU A OE2 1 
ATOM   2550 N N   . GLY A 1 335 ? 21.497  17.992  4.421   1.00 23.58  ? 335  GLY A N   1 
ATOM   2551 C CA  . GLY A 1 335 ? 22.567  18.697  3.743   1.00 19.53  ? 335  GLY A CA  1 
ATOM   2552 C C   . GLY A 1 335 ? 22.698  20.202  3.942   1.00 28.91  ? 335  GLY A C   1 
ATOM   2553 O O   . GLY A 1 335 ? 23.808  20.744  3.834   1.00 38.97  ? 335  GLY A O   1 
ATOM   2554 N N   . SER A 1 336 ? 21.593  20.884  4.231   1.00 24.64  ? 336  SER A N   1 
ATOM   2555 C CA  . SER A 1 336 ? 21.567  22.352  4.192   1.00 31.00  ? 336  SER A CA  1 
ATOM   2556 C C   . SER A 1 336 ? 22.631  23.025  5.065   1.00 32.52  ? 336  SER A C   1 
ATOM   2557 O O   . SER A 1 336 ? 23.347  23.910  4.605   1.00 36.97  ? 336  SER A O   1 
ATOM   2558 C CB  . SER A 1 336 ? 20.175  22.882  4.546   1.00 33.72  ? 336  SER A CB  1 
ATOM   2559 O OG  . SER A 1 336 ? 19.782  22.454  5.836   1.00 32.47  ? 336  SER A OG  1 
ATOM   2560 N N   . TYR A 1 337 ? 22.727  22.587  6.315   1.00 29.03  ? 337  TYR A N   1 
ATOM   2561 C CA  . TYR A 1 337 ? 23.728  23.074  7.262   1.00 31.12  ? 337  TYR A CA  1 
ATOM   2562 C C   . TYR A 1 337 ? 25.122  23.191  6.656   1.00 30.14  ? 337  TYR A C   1 
ATOM   2563 O O   . TYR A 1 337 ? 25.828  24.158  6.897   1.00 36.00  ? 337  TYR A O   1 
ATOM   2564 C CB  . TYR A 1 337 ? 23.776  22.127  8.467   1.00 37.93  ? 337  TYR A CB  1 
ATOM   2565 C CG  . TYR A 1 337 ? 24.500  22.646  9.668   1.00 38.49  ? 337  TYR A CG  1 
ATOM   2566 C CD1 . TYR A 1 337 ? 23.853  23.439  10.596  1.00 50.48  ? 337  TYR A CD1 1 
ATOM   2567 C CD2 . TYR A 1 337 ? 25.827  22.325  9.894   1.00 52.17  ? 337  TYR A CD2 1 
ATOM   2568 C CE1 . TYR A 1 337 ? 24.511  23.918  11.721  1.00 59.59  ? 337  TYR A CE1 1 
ATOM   2569 C CE2 . TYR A 1 337 ? 26.496  22.803  11.010  1.00 59.98  ? 337  TYR A CE2 1 
ATOM   2570 C CZ  . TYR A 1 337 ? 25.832  23.600  11.925  1.00 61.61  ? 337  TYR A CZ  1 
ATOM   2571 O OH  . TYR A 1 337 ? 26.473  24.084  13.044  1.00 63.27  ? 337  TYR A OH  1 
ATOM   2572 N N   . PHE A 1 338 ? 25.515  22.210  5.856   1.00 29.31  ? 338  PHE A N   1 
ATOM   2573 C CA  . PHE A 1 338 ? 26.891  22.157  5.369   1.00 28.06  ? 338  PHE A CA  1 
ATOM   2574 C C   . PHE A 1 338 ? 27.158  23.101  4.200   1.00 30.82  ? 338  PHE A C   1 
ATOM   2575 O O   . PHE A 1 338 ? 28.292  23.536  4.002   1.00 37.90  ? 338  PHE A O   1 
ATOM   2576 C CB  . PHE A 1 338 ? 27.285  20.714  5.041   1.00 23.21  ? 338  PHE A CB  1 
ATOM   2577 C CG  . PHE A 1 338 ? 27.223  19.810  6.231   1.00 26.19  ? 338  PHE A CG  1 
ATOM   2578 C CD1 . PHE A 1 338 ? 26.030  19.164  6.569   1.00 23.97  ? 338  PHE A CD1 1 
ATOM   2579 C CD2 . PHE A 1 338 ? 28.335  19.649  7.053   1.00 24.14  ? 338  PHE A CD2 1 
ATOM   2580 C CE1 . PHE A 1 338 ? 25.953  18.350  7.708   1.00 21.08  ? 338  PHE A CE1 1 
ATOM   2581 C CE2 . PHE A 1 338 ? 28.272  18.824  8.189   1.00 23.57  ? 338  PHE A CE2 1 
ATOM   2582 C CZ  . PHE A 1 338 ? 27.079  18.177  8.513   1.00 20.78  ? 338  PHE A CZ  1 
ATOM   2583 N N   . LEU A 1 339 ? 26.110  23.422  3.445   1.00 22.37  ? 339  LEU A N   1 
ATOM   2584 C CA  . LEU A 1 339 ? 26.229  24.341  2.324   1.00 28.71  ? 339  LEU A CA  1 
ATOM   2585 C C   . LEU A 1 339 ? 26.647  25.754  2.744   1.00 32.55  ? 339  LEU A C   1 
ATOM   2586 O O   . LEU A 1 339 ? 27.498  26.360  2.102   1.00 34.20  ? 339  LEU A O   1 
ATOM   2587 C CB  . LEU A 1 339 ? 24.913  24.405  1.548   1.00 28.40  ? 339  LEU A CB  1 
ATOM   2588 C CG  . LEU A 1 339 ? 24.411  23.053  1.062   1.00 31.62  ? 339  LEU A CG  1 
ATOM   2589 C CD1 . LEU A 1 339 ? 23.175  23.236  0.227   1.00 32.10  ? 339  LEU A CD1 1 
ATOM   2590 C CD2 . LEU A 1 339 ? 25.498  22.338  0.281   1.00 34.84  ? 339  LEU A CD2 1 
ATOM   2591 N N   . VAL A 1 340 ? 26.054  26.271  3.819   1.00 32.29  ? 340  VAL A N   1 
ATOM   2592 C CA  . VAL A 1 340 ? 26.276  27.665  4.208   1.00 35.39  ? 340  VAL A CA  1 
ATOM   2593 C C   . VAL A 1 340 ? 27.673  27.892  4.751   1.00 41.15  ? 340  VAL A C   1 
ATOM   2594 O O   . VAL A 1 340 ? 28.085  29.028  4.934   1.00 51.54  ? 340  VAL A O   1 
ATOM   2595 C CB  . VAL A 1 340 ? 25.245  28.175  5.250   1.00 44.19  ? 340  VAL A CB  1 
ATOM   2596 C CG1 . VAL A 1 340 ? 23.815  27.937  4.761   1.00 46.07  ? 340  VAL A CG1 1 
ATOM   2597 C CG2 . VAL A 1 340 ? 25.477  27.515  6.602   1.00 44.44  ? 340  VAL A CG2 1 
ATOM   2598 N N   . TYR A 1 341 ? 28.400  26.810  5.008   1.00 37.83  ? 341  TYR A N   1 
ATOM   2599 C CA  . TYR A 1 341 ? 29.777  26.921  5.457   1.00 43.21  ? 341  TYR A CA  1 
ATOM   2600 C C   . TYR A 1 341 ? 30.724  26.942  4.287   1.00 51.31  ? 341  TYR A C   1 
ATOM   2601 O O   . TYR A 1 341 ? 31.568  27.831  4.195   1.00 60.69  ? 341  TYR A O   1 
ATOM   2602 C CB  . TYR A 1 341 ? 30.144  25.800  6.435   1.00 52.16  ? 341  TYR A CB  1 
ATOM   2603 C CG  . TYR A 1 341 ? 29.795  26.158  7.861   1.00 62.49  ? 341  TYR A CG  1 
ATOM   2604 C CD1 . TYR A 1 341 ? 28.519  25.920  8.372   1.00 57.71  ? 341  TYR A CD1 1 
ATOM   2605 C CD2 . TYR A 1 341 ? 30.730  26.770  8.687   1.00 68.44  ? 341  TYR A CD2 1 
ATOM   2606 C CE1 . TYR A 1 341 ? 28.191  26.273  9.671   1.00 59.81  ? 341  TYR A CE1 1 
ATOM   2607 C CE2 . TYR A 1 341 ? 30.415  27.127  9.980   1.00 69.92  ? 341  TYR A CE2 1 
ATOM   2608 C CZ  . TYR A 1 341 ? 29.142  26.889  10.466  1.00 69.28  ? 341  TYR A CZ  1 
ATOM   2609 O OH  . TYR A 1 341 ? 28.844  27.227  11.769  1.00 76.88  ? 341  TYR A OH  1 
ATOM   2610 N N   . GLY A 1 342 ? 30.566  25.993  3.367   1.00 44.08  ? 342  GLY A N   1 
ATOM   2611 C CA  . GLY A 1 342 ? 31.578  25.814  2.343   1.00 46.04  ? 342  GLY A CA  1 
ATOM   2612 C C   . GLY A 1 342 ? 31.250  25.969  0.868   1.00 46.31  ? 342  GLY A C   1 
ATOM   2613 O O   . GLY A 1 342 ? 32.158  25.932  0.045   1.00 55.64  ? 342  GLY A O   1 
ATOM   2614 N N   . VAL A 1 343 ? 29.983  26.128  0.510   1.00 38.27  ? 343  VAL A N   1 
ATOM   2615 C CA  . VAL A 1 343 ? 29.631  26.214  -0.906  1.00 33.32  ? 343  VAL A CA  1 
ATOM   2616 C C   . VAL A 1 343 ? 29.284  27.648  -1.313  1.00 36.50  ? 343  VAL A C   1 
ATOM   2617 O O   . VAL A 1 343 ? 28.347  28.240  -0.784  1.00 40.72  ? 343  VAL A O   1 
ATOM   2618 C CB  . VAL A 1 343 ? 28.490  25.247  -1.268  1.00 34.24  ? 343  VAL A CB  1 
ATOM   2619 C CG1 . VAL A 1 343 ? 28.202  25.288  -2.760  1.00 32.76  ? 343  VAL A CG1 1 
ATOM   2620 C CG2 . VAL A 1 343 ? 28.854  23.832  -0.840  1.00 27.99  ? 343  VAL A CG2 1 
ATOM   2621 N N   . PRO A 1 344 ? 30.071  28.222  -2.231  1.00 39.76  ? 344  PRO A N   1 
ATOM   2622 C CA  . PRO A 1 344 ? 29.819  29.593  -2.687  1.00 40.29  ? 344  PRO A CA  1 
ATOM   2623 C C   . PRO A 1 344 ? 28.387  29.729  -3.202  1.00 41.80  ? 344  PRO A C   1 
ATOM   2624 O O   . PRO A 1 344 ? 27.907  28.845  -3.915  1.00 38.37  ? 344  PRO A O   1 
ATOM   2625 C CB  . PRO A 1 344 ? 30.811  29.766  -3.845  1.00 33.25  ? 344  PRO A CB  1 
ATOM   2626 C CG  . PRO A 1 344 ? 31.910  28.784  -3.555  1.00 32.61  ? 344  PRO A CG  1 
ATOM   2627 C CD  . PRO A 1 344 ? 31.264  27.625  -2.860  1.00 34.03  ? 344  PRO A CD  1 
ATOM   2628 N N   . GLY A 1 345 ? 27.721  30.820  -2.835  1.00 38.55  ? 345  GLY A N   1 
ATOM   2629 C CA  . GLY A 1 345 ? 26.346  31.055  -3.234  1.00 35.73  ? 345  GLY A CA  1 
ATOM   2630 C C   . GLY A 1 345 ? 25.394  30.821  -2.080  1.00 35.39  ? 345  GLY A C   1 
ATOM   2631 O O   . GLY A 1 345 ? 24.258  31.280  -2.103  1.00 46.00  ? 345  GLY A O   1 
ATOM   2632 N N   . PHE A 1 346 ? 25.862  30.116  -1.059  1.00 32.35  ? 346  PHE A N   1 
ATOM   2633 C CA  . PHE A 1 346 ? 25.025  29.768  0.087   1.00 34.32  ? 346  PHE A CA  1 
ATOM   2634 C C   . PHE A 1 346 ? 25.247  30.619  1.340   1.00 38.34  ? 346  PHE A C   1 
ATOM   2635 O O   . PHE A 1 346 ? 26.375  30.933  1.703   1.00 44.41  ? 346  PHE A O   1 
ATOM   2636 C CB  . PHE A 1 346 ? 25.157  28.286  0.389   1.00 28.50  ? 346  PHE A CB  1 
ATOM   2637 C CG  . PHE A 1 346 ? 24.595  27.426  -0.694  1.00 30.71  ? 346  PHE A CG  1 
ATOM   2638 C CD1 . PHE A 1 346 ? 25.373  27.072  -1.787  1.00 28.18  ? 346  PHE A CD1 1 
ATOM   2639 C CD2 . PHE A 1 346 ? 23.270  27.010  -0.648  1.00 29.25  ? 346  PHE A CD2 1 
ATOM   2640 C CE1 . PHE A 1 346 ? 24.852  26.282  -2.804  1.00 32.08  ? 346  PHE A CE1 1 
ATOM   2641 C CE2 . PHE A 1 346 ? 22.739  26.228  -1.657  1.00 28.96  ? 346  PHE A CE2 1 
ATOM   2642 C CZ  . PHE A 1 346 ? 23.528  25.863  -2.745  1.00 30.44  ? 346  PHE A CZ  1 
ATOM   2643 N N   . SER A 1 347 ? 24.149  30.996  1.985   1.00 41.94  ? 347  SER A N   1 
ATOM   2644 C CA  . SER A 1 347 ? 24.207  31.837  3.174   1.00 46.35  ? 347  SER A CA  1 
ATOM   2645 C C   . SER A 1 347 ? 22.986  31.653  4.054   1.00 43.39  ? 347  SER A C   1 
ATOM   2646 O O   . SER A 1 347 ? 21.916  31.272  3.578   1.00 45.74  ? 347  SER A O   1 
ATOM   2647 C CB  . SER A 1 347 ? 24.322  33.311  2.793   1.00 46.88  ? 347  SER A CB  1 
ATOM   2648 O OG  . SER A 1 347 ? 24.438  34.106  3.955   1.00 54.10  ? 347  SER A OG  1 
ATOM   2649 N N   . LYS A 1 348 ? 23.151  31.932  5.340   1.00 38.74  ? 348  LYS A N   1 
ATOM   2650 C CA  . LYS A 1 348 ? 22.040  31.826  6.271   1.00 39.99  ? 348  LYS A CA  1 
ATOM   2651 C C   . LYS A 1 348 ? 21.208  33.089  6.195   1.00 42.47  ? 348  LYS A C   1 
ATOM   2652 O O   . LYS A 1 348 ? 20.083  33.122  6.684   1.00 48.48  ? 348  LYS A O   1 
ATOM   2653 C CB  . LYS A 1 348 ? 22.538  31.613  7.708   1.00 38.95  ? 348  LYS A CB  1 
ATOM   2654 C CG  . LYS A 1 348 ? 22.888  32.885  8.459   1.00 43.65  ? 348  LYS A CG  1 
ATOM   2655 C CD  . LYS A 1 348 ? 23.232  32.580  9.922   1.00 48.81  ? 348  LYS A CD  1 
ATOM   2656 C CE  . LYS A 1 348 ? 23.397  33.857  10.738  1.00 49.77  ? 348  LYS A CE  1 
ATOM   2657 N NZ  . LYS A 1 348 ? 22.115  34.610  10.901  1.00 52.83  ? 348  LYS A NZ  1 
ATOM   2658 N N   . ASP A 1 349 ? 21.772  34.115  5.559   1.00 38.68  ? 349  ASP A N   1 
ATOM   2659 C CA  . ASP A 1 349 ? 21.218  35.467  5.570   1.00 39.04  ? 349  ASP A CA  1 
ATOM   2660 C C   . ASP A 1 349 ? 20.451  35.872  4.310   1.00 42.88  ? 349  ASP A C   1 
ATOM   2661 O O   . ASP A 1 349 ? 19.877  36.954  4.262   1.00 44.59  ? 349  ASP A O   1 
ATOM   2662 C CB  . ASP A 1 349 ? 22.333  36.480  5.838   1.00 39.88  ? 349  ASP A CB  1 
ATOM   2663 C CG  . ASP A 1 349 ? 22.886  36.378  7.253   1.00 49.50  ? 349  ASP A CG  1 
ATOM   2664 O OD1 . ASP A 1 349 ? 22.108  36.069  8.193   1.00 42.69  ? 349  ASP A OD1 1 
ATOM   2665 O OD2 . ASP A 1 349 ? 24.107  36.597  7.419   1.00 56.52  ? 349  ASP A OD2 1 
ATOM   2666 N N   . ASN A 1 350 ? 20.472  35.025  3.285   1.00 43.12  ? 350  ASN A N   1 
ATOM   2667 C CA  . ASN A 1 350 ? 19.623  35.223  2.117   1.00 42.89  ? 350  ASN A CA  1 
ATOM   2668 C C   . ASN A 1 350 ? 19.008  33.903  1.677   1.00 45.07  ? 350  ASN A C   1 
ATOM   2669 O O   . ASN A 1 350 ? 19.259  32.865  2.299   1.00 43.55  ? 350  ASN A O   1 
ATOM   2670 C CB  . ASN A 1 350 ? 20.335  35.973  0.964   1.00 40.15  ? 350  ASN A CB  1 
ATOM   2671 C CG  . ASN A 1 350 ? 21.597  35.281  0.462   1.00 54.36  ? 350  ASN A CG  1 
ATOM   2672 O OD1 . ASN A 1 350 ? 21.600  34.077  0.222   1.00 60.36  ? 350  ASN A OD1 1 
ATOM   2673 N ND2 . ASN A 1 350 ? 22.676  36.074  0.268   1.00 78.70  ? 350  ASN A ND2 1 
ATOM   2674 N N   . GLU A 1 351 ? 18.205  33.942  0.618   1.00 40.86  ? 351  GLU A N   1 
ATOM   2675 C CA  . GLU A 1 351 ? 17.507  32.752  0.139   1.00 41.02  ? 351  GLU A CA  1 
ATOM   2676 C C   . GLU A 1 351 ? 18.401  31.745  -0.610  1.00 40.91  ? 351  GLU A C   1 
ATOM   2677 O O   . GLU A 1 351 ? 17.960  30.636  -0.937  1.00 39.14  ? 351  GLU A O   1 
ATOM   2678 C CB  . GLU A 1 351 ? 16.288  33.153  -0.696  1.00 51.34  ? 351  GLU A CB  1 
ATOM   2679 C CG  . GLU A 1 351 ? 15.114  33.666  0.142   1.00 59.63  ? 351  GLU A CG  1 
ATOM   2680 C CD  . GLU A 1 351 ? 14.461  32.557  0.970   1.00 69.39  ? 351  GLU A CD  1 
ATOM   2681 O OE1 . GLU A 1 351 ? 13.760  31.705  0.372   1.00 73.09  ? 351  GLU A OE1 1 
ATOM   2682 O OE2 . GLU A 1 351 ? 14.647  32.531  2.213   1.00 70.14  ? 351  GLU A OE2 1 
ATOM   2683 N N   . SER A 1 352 ? 19.651  32.126  -0.869  1.00 34.26  ? 352  SER A N   1 
ATOM   2684 C CA  . SER A 1 352 ? 20.633  31.204  -1.436  1.00 31.90  ? 352  SER A CA  1 
ATOM   2685 C C   . SER A 1 352 ? 20.190  30.590  -2.771  1.00 32.86  ? 352  SER A C   1 
ATOM   2686 O O   . SER A 1 352 ? 20.495  29.442  -3.061  1.00 33.92  ? 352  SER A O   1 
ATOM   2687 C CB  . SER A 1 352 ? 20.973  30.093  -0.428  1.00 36.54  ? 352  SER A CB  1 
ATOM   2688 O OG  . SER A 1 352 ? 21.570  30.611  0.756   1.00 32.89  ? 352  SER A OG  1 
ATOM   2689 N N   . LEU A 1 353 ? 19.463  31.363  -3.574  1.00 33.01  ? 353  LEU A N   1 
ATOM   2690 C CA  . LEU A 1 353 ? 19.099  30.947  -4.918  1.00 37.54  ? 353  LEU A CA  1 
ATOM   2691 C C   . LEU A 1 353 ? 20.355  30.996  -5.770  1.00 44.13  ? 353  LEU A C   1 
ATOM   2692 O O   . LEU A 1 353 ? 20.948  32.050  -5.932  1.00 55.28  ? 353  LEU A O   1 
ATOM   2693 C CB  . LEU A 1 353 ? 18.036  31.886  -5.489  1.00 42.92  ? 353  LEU A CB  1 
ATOM   2694 C CG  . LEU A 1 353 ? 16.745  32.050  -4.677  1.00 42.23  ? 353  LEU A CG  1 
ATOM   2695 C CD1 . LEU A 1 353 ? 15.798  33.048  -5.333  1.00 44.94  ? 353  LEU A CD1 1 
ATOM   2696 C CD2 . LEU A 1 353 ? 16.057  30.716  -4.512  1.00 42.71  ? 353  LEU A CD2 1 
ATOM   2697 N N   . ILE A 1 354 ? 20.772  29.853  -6.298  1.00 37.99  ? 354  ILE A N   1 
ATOM   2698 C CA  . ILE A 1 354 ? 22.059  29.764  -6.970  1.00 33.50  ? 354  ILE A CA  1 
ATOM   2699 C C   . ILE A 1 354 ? 21.922  29.495  -8.462  1.00 37.37  ? 354  ILE A C   1 
ATOM   2700 O O   . ILE A 1 354 ? 20.847  29.136  -8.949  1.00 29.88  ? 354  ILE A O   1 
ATOM   2701 C CB  . ILE A 1 354 ? 22.941  28.674  -6.353  1.00 32.83  ? 354  ILE A CB  1 
ATOM   2702 C CG1 . ILE A 1 354 ? 22.230  27.321  -6.432  1.00 26.50  ? 354  ILE A CG1 1 
ATOM   2703 C CG2 . ILE A 1 354 ? 23.266  29.034  -4.920  1.00 29.82  ? 354  ILE A CG2 1 
ATOM   2704 C CD1 . ILE A 1 354 ? 23.132  26.155  -6.401  1.00 25.67  ? 354  ILE A CD1 1 
ATOM   2705 N N   . SER A 1 355 ? 23.026  29.680  -9.180  1.00 30.95  ? 355  SER A N   1 
ATOM   2706 C CA  . SER A 1 355 ? 23.058  29.463  -10.621 1.00 30.88  ? 355  SER A CA  1 
ATOM   2707 C C   . SER A 1 355 ? 23.414  28.020  -10.948 1.00 29.21  ? 355  SER A C   1 
ATOM   2708 O O   . SER A 1 355 ? 23.881  27.270  -10.094 1.00 33.89  ? 355  SER A O   1 
ATOM   2709 C CB  . SER A 1 355 ? 24.094  30.380  -11.261 1.00 31.31  ? 355  SER A CB  1 
ATOM   2710 O OG  . SER A 1 355 ? 25.407  30.024  -10.833 1.00 35.59  ? 355  SER A OG  1 
ATOM   2711 N N   . ARG A 1 356 ? 23.215  27.636  -12.200 1.00 33.63  ? 356  ARG A N   1 
ATOM   2712 C CA  . ARG A 1 356 ? 23.635  26.319  -12.633 1.00 32.93  ? 356  ARG A CA  1 
ATOM   2713 C C   . ARG A 1 356 ? 25.144  26.176  -12.450 1.00 34.47  ? 356  ARG A C   1 
ATOM   2714 O O   . ARG A 1 356 ? 25.615  25.135  -12.014 1.00 32.09  ? 356  ARG A O   1 
ATOM   2715 C CB  . ARG A 1 356 ? 23.242  26.065  -14.082 1.00 34.64  ? 356  ARG A CB  1 
ATOM   2716 C CG  . ARG A 1 356 ? 23.743  24.742  -14.591 1.00 38.70  ? 356  ARG A CG  1 
ATOM   2717 C CD  . ARG A 1 356 ? 22.782  24.108  -15.560 1.00 39.81  ? 356  ARG A CD  1 
ATOM   2718 N NE  . ARG A 1 356 ? 23.094  22.695  -15.756 1.00 45.79  ? 356  ARG A NE  1 
ATOM   2719 C CZ  . ARG A 1 356 ? 22.474  21.693  -15.137 1.00 45.15  ? 356  ARG A CZ  1 
ATOM   2720 N NH1 . ARG A 1 356 ? 21.485  21.937  -14.283 1.00 42.45  ? 356  ARG A NH1 1 
ATOM   2721 N NH2 . ARG A 1 356 ? 22.840  20.443  -15.385 1.00 42.42  ? 356  ARG A NH2 1 
ATOM   2722 N N   . ALA A 1 357 ? 25.897  27.226  -12.768 1.00 29.47  ? 357  ALA A N   1 
ATOM   2723 C CA  . ALA A 1 357 ? 27.344  27.184  -12.569 1.00 40.67  ? 357  ALA A CA  1 
ATOM   2724 C C   . ALA A 1 357 ? 27.657  26.879  -11.116 1.00 35.16  ? 357  ALA A C   1 
ATOM   2725 O O   . ALA A 1 357 ? 28.436  25.969  -10.825 1.00 35.83  ? 357  ALA A O   1 
ATOM   2726 C CB  . ALA A 1 357 ? 27.998  28.493  -12.982 1.00 30.63  ? 357  ALA A CB  1 
ATOM   2727 N N   . GLN A 1 358 ? 27.028  27.627  -10.209 1.00 31.50  ? 358  GLN A N   1 
ATOM   2728 C CA  . GLN A 1 358 ? 27.275  27.456  -8.783  1.00 29.31  ? 358  GLN A CA  1 
ATOM   2729 C C   . GLN A 1 358 ? 26.891  26.053  -8.322  1.00 30.58  ? 358  GLN A C   1 
ATOM   2730 O O   . GLN A 1 358 ? 27.490  25.511  -7.392  1.00 30.80  ? 358  GLN A O   1 
ATOM   2731 C CB  . GLN A 1 358 ? 26.543  28.516  -7.950  1.00 28.32  ? 358  GLN A CB  1 
ATOM   2732 C CG  . GLN A 1 358 ? 27.080  29.936  -8.109  1.00 32.06  ? 358  GLN A CG  1 
ATOM   2733 C CD  . GLN A 1 358 ? 26.238  30.958  -7.355  1.00 40.38  ? 358  GLN A CD  1 
ATOM   2734 O OE1 . GLN A 1 358 ? 25.002  30.985  -7.473  1.00 39.11  ? 358  GLN A OE1 1 
ATOM   2735 N NE2 . GLN A 1 358 ? 26.904  31.801  -6.562  1.00 39.10  ? 358  GLN A NE2 1 
ATOM   2736 N N   . PHE A 1 359 ? 25.897  25.465  -8.983  1.00 30.38  ? 359  PHE A N   1 
ATOM   2737 C CA  . PHE A 1 359 ? 25.506  24.092  -8.691  1.00 29.42  ? 359  PHE A CA  1 
ATOM   2738 C C   . PHE A 1 359 ? 26.578  23.058  -9.092  1.00 29.05  ? 359  PHE A C   1 
ATOM   2739 O O   . PHE A 1 359 ? 26.893  22.164  -8.308  1.00 30.06  ? 359  PHE A O   1 
ATOM   2740 C CB  . PHE A 1 359 ? 24.163  23.777  -9.337  1.00 30.66  ? 359  PHE A CB  1 
ATOM   2741 C CG  . PHE A 1 359 ? 23.710  22.366  -9.144  1.00 29.76  ? 359  PHE A CG  1 
ATOM   2742 C CD1 . PHE A 1 359 ? 23.398  21.888  -7.882  1.00 30.85  ? 359  PHE A CD1 1 
ATOM   2743 C CD2 . PHE A 1 359 ? 23.588  21.514  -10.227 1.00 34.04  ? 359  PHE A CD2 1 
ATOM   2744 C CE1 . PHE A 1 359 ? 22.968  20.568  -7.704  1.00 25.81  ? 359  PHE A CE1 1 
ATOM   2745 C CE2 . PHE A 1 359 ? 23.153  20.199  -10.055 1.00 34.18  ? 359  PHE A CE2 1 
ATOM   2746 C CZ  . PHE A 1 359 ? 22.845  19.732  -8.798  1.00 24.28  ? 359  PHE A CZ  1 
ATOM   2747 N N   . LEU A 1 360 ? 27.130  23.169  -10.301 1.00 25.66  ? 360  LEU A N   1 
ATOM   2748 C CA  . LEU A 1 360 ? 28.196  22.248  -10.718 1.00 38.61  ? 360  LEU A CA  1 
ATOM   2749 C C   . LEU A 1 360 ? 29.416  22.391  -9.809  1.00 35.71  ? 360  LEU A C   1 
ATOM   2750 O O   . LEU A 1 360 ? 30.062  21.410  -9.457  1.00 40.26  ? 360  LEU A O   1 
ATOM   2751 C CB  . LEU A 1 360 ? 28.625  22.474  -12.172 1.00 32.68  ? 360  LEU A CB  1 
ATOM   2752 C CG  . LEU A 1 360 ? 27.583  22.584  -13.295 1.00 44.28  ? 360  LEU A CG  1 
ATOM   2753 C CD1 . LEU A 1 360 ? 28.244  22.359  -14.668 1.00 47.21  ? 360  LEU A CD1 1 
ATOM   2754 C CD2 . LEU A 1 360 ? 26.399  21.665  -13.129 1.00 39.41  ? 360  LEU A CD2 1 
ATOM   2755 N N   . ALA A 1 361 ? 29.730  23.623  -9.435  1.00 31.34  ? 361  ALA A N   1 
ATOM   2756 C CA  . ALA A 1 361 ? 30.857  23.859  -8.550  1.00 34.95  ? 361  ALA A CA  1 
ATOM   2757 C C   . ALA A 1 361 ? 30.561  23.256  -7.174  1.00 35.31  ? 361  ALA A C   1 
ATOM   2758 O O   . ALA A 1 361 ? 31.438  22.658  -6.548  1.00 40.07  ? 361  ALA A O   1 
ATOM   2759 C CB  . ALA A 1 361 ? 31.183  25.365  -8.463  1.00 26.58  ? 361  ALA A CB  1 
ATOM   2760 N N   . GLY A 1 362 ? 29.313  23.374  -6.729  1.00 30.92  ? 362  GLY A N   1 
ATOM   2761 C CA  . GLY A 1 362 ? 28.909  22.822  -5.444  1.00 25.92  ? 362  GLY A CA  1 
ATOM   2762 C C   . GLY A 1 362 ? 28.959  21.299  -5.397  1.00 32.44  ? 362  GLY A C   1 
ATOM   2763 O O   . GLY A 1 362 ? 29.265  20.692  -4.359  1.00 27.25  ? 362  GLY A O   1 
ATOM   2764 N N   . VAL A 1 363 ? 28.655  20.669  -6.526  1.00 27.93  ? 363  VAL A N   1 
ATOM   2765 C CA  . VAL A 1 363 ? 28.737  19.227  -6.603  1.00 27.25  ? 363  VAL A CA  1 
ATOM   2766 C C   . VAL A 1 363 ? 30.191  18.746  -6.457  1.00 31.74  ? 363  VAL A C   1 
ATOM   2767 O O   . VAL A 1 363 ? 30.449  17.772  -5.764  1.00 37.10  ? 363  VAL A O   1 
ATOM   2768 C CB  . VAL A 1 363 ? 28.065  18.701  -7.889  1.00 26.37  ? 363  VAL A CB  1 
ATOM   2769 C CG1 . VAL A 1 363 ? 28.496  17.263  -8.197  1.00 23.64  ? 363  VAL A CG1 1 
ATOM   2770 C CG2 . VAL A 1 363 ? 26.541  18.796  -7.750  1.00 25.91  ? 363  VAL A CG2 1 
ATOM   2771 N N   . ARG A 1 364 ? 31.142  19.437  -7.082  1.00 30.67  ? 364  ARG A N   1 
ATOM   2772 C CA  . ARG A 1 364 ? 32.544  19.040  -6.949  1.00 31.89  ? 364  ARG A CA  1 
ATOM   2773 C C   . ARG A 1 364 ? 33.026  19.156  -5.506  1.00 31.95  ? 364  ARG A C   1 
ATOM   2774 O O   . ARG A 1 364 ? 33.859  18.386  -5.066  1.00 31.22  ? 364  ARG A O   1 
ATOM   2775 C CB  . ARG A 1 364 ? 33.462  19.861  -7.857  1.00 28.95  ? 364  ARG A CB  1 
ATOM   2776 C CG  . ARG A 1 364 ? 33.223  19.681  -9.348  1.00 40.61  ? 364  ARG A CG  1 
ATOM   2777 C CD  . ARG A 1 364 ? 32.970  18.229  -9.733  1.00 51.00  ? 364  ARG A CD  1 
ATOM   2778 N NE  . ARG A 1 364 ? 34.049  17.310  -9.359  1.00 64.22  ? 364  ARG A NE  1 
ATOM   2779 C CZ  . ARG A 1 364 ? 34.962  16.844  -10.208 1.00 65.65  ? 364  ARG A CZ  1 
ATOM   2780 N NH1 . ARG A 1 364 ? 34.938  17.224  -11.481 1.00 62.85  ? 364  ARG A NH1 1 
ATOM   2781 N NH2 . ARG A 1 364 ? 35.902  16.005  -9.783  1.00 65.19  ? 364  ARG A NH2 1 
ATOM   2782 N N   . ILE A 1 365 ? 32.498  20.130  -4.778  1.00 34.26  ? 365  ILE A N   1 
ATOM   2783 C CA  . ILE A 1 365 ? 32.897  20.353  -3.397  1.00 35.73  ? 365  ILE A CA  1 
ATOM   2784 C C   . ILE A 1 365 ? 32.208  19.342  -2.477  1.00 36.34  ? 365  ILE A C   1 
ATOM   2785 O O   . ILE A 1 365 ? 32.813  18.853  -1.526  1.00 39.16  ? 365  ILE A O   1 
ATOM   2786 C CB  . ILE A 1 365 ? 32.570  21.802  -2.968  1.00 31.93  ? 365  ILE A CB  1 
ATOM   2787 C CG1 . ILE A 1 365 ? 33.386  22.792  -3.794  1.00 28.34  ? 365  ILE A CG1 1 
ATOM   2788 C CG2 . ILE A 1 365 ? 32.838  22.032  -1.493  1.00 25.31  ? 365  ILE A CG2 1 
ATOM   2789 C CD1 . ILE A 1 365 ? 33.071  24.226  -3.450  1.00 24.89  ? 365  ILE A CD1 1 
ATOM   2790 N N   . GLY A 1 366 ? 30.955  19.018  -2.788  1.00 33.33  ? 366  GLY A N   1 
ATOM   2791 C CA  . GLY A 1 366 ? 30.168  18.083  -2.004  1.00 35.14  ? 366  GLY A CA  1 
ATOM   2792 C C   . GLY A 1 366 ? 30.445  16.614  -2.297  1.00 37.23  ? 366  GLY A C   1 
ATOM   2793 O O   . GLY A 1 366 ? 30.094  15.729  -1.509  1.00 29.40  ? 366  GLY A O   1 
ATOM   2794 N N   . VAL A 1 367 ? 31.047  16.341  -3.449  1.00 31.68  ? 367  VAL A N   1 
ATOM   2795 C CA  . VAL A 1 367 ? 31.449  14.988  -3.780  1.00 26.65  ? 367  VAL A CA  1 
ATOM   2796 C C   . VAL A 1 367 ? 32.911  15.055  -4.167  1.00 30.71  ? 367  VAL A C   1 
ATOM   2797 O O   . VAL A 1 367 ? 33.274  14.787  -5.309  1.00 36.42  ? 367  VAL A O   1 
ATOM   2798 C CB  . VAL A 1 367 ? 30.630  14.416  -4.945  1.00 28.03  ? 367  VAL A CB  1 
ATOM   2799 C CG1 . VAL A 1 367 ? 30.787  12.899  -5.008  1.00 23.51  ? 367  VAL A CG1 1 
ATOM   2800 C CG2 . VAL A 1 367 ? 29.159  14.780  -4.784  1.00 26.02  ? 367  VAL A CG2 1 
ATOM   2801 N N   . PRO A 1 368 ? 33.763  15.416  -3.203  1.00 28.93  ? 368  PRO A N   1 
ATOM   2802 C CA  . PRO A 1 368 ? 35.137  15.799  -3.526  1.00 26.07  ? 368  PRO A CA  1 
ATOM   2803 C C   . PRO A 1 368 ? 35.972  14.667  -4.103  1.00 33.29  ? 368  PRO A C   1 
ATOM   2804 O O   . PRO A 1 368 ? 36.952  14.948  -4.780  1.00 33.78  ? 368  PRO A O   1 
ATOM   2805 C CB  . PRO A 1 368 ? 35.692  16.240  -2.180  1.00 26.57  ? 368  PRO A CB  1 
ATOM   2806 C CG  . PRO A 1 368 ? 34.914  15.464  -1.181  1.00 24.56  ? 368  PRO A CG  1 
ATOM   2807 C CD  . PRO A 1 368 ? 33.523  15.389  -1.747  1.00 25.86  ? 368  PRO A CD  1 
ATOM   2808 N N   . GLN A 1 369 ? 35.584  13.419  -3.858  1.00 40.14  ? 369  GLN A N   1 
ATOM   2809 C CA  . GLN A 1 369 ? 36.332  12.262  -4.363  1.00 39.88  ? 369  GLN A CA  1 
ATOM   2810 C C   . GLN A 1 369 ? 35.906  11.838  -5.782  1.00 41.12  ? 369  GLN A C   1 
ATOM   2811 O O   . GLN A 1 369 ? 36.511  10.948  -6.376  1.00 41.18  ? 369  GLN A O   1 
ATOM   2812 C CB  . GLN A 1 369 ? 36.169  11.073  -3.410  1.00 33.83  ? 369  GLN A CB  1 
ATOM   2813 C CG  . GLN A 1 369 ? 34.871  10.282  -3.622  1.00 41.08  ? 369  GLN A CG  1 
ATOM   2814 C CD  . GLN A 1 369 ? 33.630  10.894  -2.938  1.00 47.10  ? 369  GLN A CD  1 
ATOM   2815 O OE1 . GLN A 1 369 ? 33.643  12.037  -2.453  1.00 35.11  ? 369  GLN A OE1 1 
ATOM   2816 N NE2 . GLN A 1 369 ? 32.550  10.115  -2.899  1.00 52.09  ? 369  GLN A NE2 1 
ATOM   2817 N N   . ALA A 1 370 ? 34.872  12.473  -6.324  1.00 36.85  ? 370  ALA A N   1 
ATOM   2818 C CA  . ALA A 1 370 ? 34.347  12.083  -7.635  1.00 36.31  ? 370  ALA A CA  1 
ATOM   2819 C C   . ALA A 1 370 ? 35.260  12.410  -8.812  1.00 37.05  ? 370  ALA A C   1 
ATOM   2820 O O   . ALA A 1 370 ? 35.831  13.491  -8.886  1.00 42.99  ? 370  ALA A O   1 
ATOM   2821 C CB  . ALA A 1 370 ? 32.975  12.716  -7.874  1.00 32.99  ? 370  ALA A CB  1 
ATOM   2822 N N   . SER A 1 371 ? 35.359  11.473  -9.749  1.00 37.99  ? 371  SER A N   1 
ATOM   2823 C CA  . SER A 1 371 ? 35.931  11.761  -11.052 1.00 40.08  ? 371  SER A CA  1 
ATOM   2824 C C   . SER A 1 371 ? 34.980  12.701  -11.782 1.00 41.13  ? 371  SER A C   1 
ATOM   2825 O O   . SER A 1 371 ? 33.863  12.953  -11.320 1.00 42.01  ? 371  SER A O   1 
ATOM   2826 C CB  . SER A 1 371 ? 36.098  10.477  -11.862 1.00 40.17  ? 371  SER A CB  1 
ATOM   2827 O OG  . SER A 1 371 ? 34.839  9.880   -12.128 1.00 44.02  ? 371  SER A OG  1 
ATOM   2828 N N   . ASP A 1 372 ? 35.415  13.209  -12.927 1.00 41.21  ? 372  ASP A N   1 
ATOM   2829 C CA  . ASP A 1 372 ? 34.597  14.141  -13.691 1.00 45.98  ? 372  ASP A CA  1 
ATOM   2830 C C   . ASP A 1 372 ? 33.289  13.493  -14.131 1.00 45.76  ? 372  ASP A C   1 
ATOM   2831 O O   . ASP A 1 372 ? 32.219  14.100  -14.026 1.00 42.63  ? 372  ASP A O   1 
ATOM   2832 C CB  . ASP A 1 372 ? 35.358  14.683  -14.906 1.00 48.43  ? 372  ASP A CB  1 
ATOM   2833 C CG  . ASP A 1 372 ? 36.455  15.649  -14.522 1.00 54.06  ? 372  ASP A CG  1 
ATOM   2834 O OD1 . ASP A 1 372 ? 36.555  16.003  -13.327 1.00 56.59  ? 372  ASP A OD1 1 
ATOM   2835 O OD2 . ASP A 1 372 ? 37.216  16.062  -15.420 1.00 61.18  ? 372  ASP A OD2 1 
ATOM   2836 N N   . LEU A 1 373 ? 33.380  12.257  -14.614 1.00 43.46  ? 373  LEU A N   1 
ATOM   2837 C CA  . LEU A 1 373 ? 32.192  11.536  -15.057 1.00 43.41  ? 373  LEU A CA  1 
ATOM   2838 C C   . LEU A 1 373 ? 31.215  11.284  -13.906 1.00 41.44  ? 373  LEU A C   1 
ATOM   2839 O O   . LEU A 1 373 ? 30.007  11.483  -14.056 1.00 40.40  ? 373  LEU A O   1 
ATOM   2840 C CB  . LEU A 1 373 ? 32.573  10.221  -15.732 1.00 41.73  ? 373  LEU A CB  1 
ATOM   2841 C CG  . LEU A 1 373 ? 31.384  9.487   -16.354 1.00 44.65  ? 373  LEU A CG  1 
ATOM   2842 C CD1 . LEU A 1 373 ? 30.686  10.374  -17.366 1.00 38.64  ? 373  LEU A CD1 1 
ATOM   2843 C CD2 . LEU A 1 373 ? 31.807  8.163   -16.988 1.00 48.21  ? 373  LEU A CD2 1 
ATOM   2844 N N   . ALA A 1 374 ? 31.744  10.859  -12.762 1.00 39.19  ? 374  ALA A N   1 
ATOM   2845 C CA  . ALA A 1 374 ? 30.917  10.593  -11.589 1.00 38.58  ? 374  ALA A CA  1 
ATOM   2846 C C   . ALA A 1 374 ? 30.155  11.848  -11.215 1.00 35.85  ? 374  ALA A C   1 
ATOM   2847 O O   . ALA A 1 374 ? 28.964  11.795  -10.906 1.00 37.96  ? 374  ALA A O   1 
ATOM   2848 C CB  . ALA A 1 374 ? 31.772  10.109  -10.407 1.00 36.30  ? 374  ALA A CB  1 
ATOM   2849 N N   . ALA A 1 375 ? 30.846  12.980  -11.268 1.00 35.68  ? 375  ALA A N   1 
ATOM   2850 C CA  . ALA A 1 375 ? 30.230  14.253  -10.936 1.00 33.15  ? 375  ALA A CA  1 
ATOM   2851 C C   . ALA A 1 375 ? 29.133  14.578  -11.945 1.00 38.60  ? 375  ALA A C   1 
ATOM   2852 O O   . ALA A 1 375 ? 28.034  14.990  -11.573 1.00 40.63  ? 375  ALA A O   1 
ATOM   2853 C CB  . ALA A 1 375 ? 31.259  15.340  -10.906 1.00 28.12  ? 375  ALA A CB  1 
ATOM   2854 N N   A GLU A 1 376 ? 29.419  14.397  -13.228 0.46 37.75  ? 376  GLU A N   1 
ATOM   2855 N N   B GLU A 1 376 ? 29.444  14.377  -13.222 0.54 37.63  ? 376  GLU A N   1 
ATOM   2856 C CA  A GLU A 1 376 ? 28.397  14.678  -14.224 0.46 39.26  ? 376  GLU A CA  1 
ATOM   2857 C CA  B GLU A 1 376 ? 28.478  14.598  -14.286 0.54 39.22  ? 376  GLU A CA  1 
ATOM   2858 C C   A GLU A 1 376 ? 27.186  13.761  -14.044 0.46 39.64  ? 376  GLU A C   1 
ATOM   2859 C C   B GLU A 1 376 ? 27.222  13.762  -14.050 0.54 39.69  ? 376  GLU A C   1 
ATOM   2860 O O   A GLU A 1 376 ? 26.059  14.185  -14.269 0.46 40.87  ? 376  GLU A O   1 
ATOM   2861 O O   B GLU A 1 376 ? 26.109  14.242  -14.242 0.54 40.88  ? 376  GLU A O   1 
ATOM   2862 C CB  A GLU A 1 376 ? 28.954  14.639  -15.652 0.46 41.09  ? 376  GLU A CB  1 
ATOM   2863 C CB  B GLU A 1 376 ? 29.102  14.299  -15.656 0.54 39.18  ? 376  GLU A CB  1 
ATOM   2864 C CG  A GLU A 1 376 ? 29.161  16.038  -16.253 0.46 44.27  ? 376  GLU A CG  1 
ATOM   2865 C CG  B GLU A 1 376 ? 30.161  15.316  -16.063 0.54 43.60  ? 376  GLU A CG  1 
ATOM   2866 C CD  A GLU A 1 376 ? 27.878  16.883  -16.266 0.46 43.81  ? 376  GLU A CD  1 
ATOM   2867 C CD  B GLU A 1 376 ? 30.528  15.248  -17.537 0.54 55.98  ? 376  GLU A CD  1 
ATOM   2868 O OE1 A GLU A 1 376 ? 26.820  16.359  -16.691 0.46 41.29  ? 376  GLU A OE1 1 
ATOM   2869 O OE1 B GLU A 1 376 ? 30.973  14.177  -18.003 0.54 57.74  ? 376  GLU A OE1 1 
ATOM   2870 O OE2 A GLU A 1 376 ? 27.931  18.069  -15.854 0.46 36.53  ? 376  GLU A OE2 1 
ATOM   2871 O OE2 B GLU A 1 376 ? 30.376  16.276  -18.229 0.54 61.31  ? 376  GLU A OE2 1 
ATOM   2872 N N   . ALA A 1 377 ? 27.415  12.526  -13.598 1.00 34.40  ? 377  ALA A N   1 
ATOM   2873 C CA  . ALA A 1 377 ? 26.310  11.634  -13.284 1.00 33.12  ? 377  ALA A CA  1 
ATOM   2874 C C   . ALA A 1 377 ? 25.463  12.217  -12.150 1.00 35.54  ? 377  ALA A C   1 
ATOM   2875 O O   . ALA A 1 377 ? 24.224  12.210  -12.226 1.00 31.25  ? 377  ALA A O   1 
ATOM   2876 C CB  . ALA A 1 377 ? 26.816  10.254  -12.916 1.00 29.93  ? 377  ALA A CB  1 
ATOM   2877 N N   . VAL A 1 378 ? 26.131  12.726  -11.111 1.00 31.32  ? 378  VAL A N   1 
ATOM   2878 C CA  . VAL A 1 378 ? 25.430  13.331  -9.982  1.00 29.17  ? 378  VAL A CA  1 
ATOM   2879 C C   . VAL A 1 378 ? 24.598  14.513  -10.477 1.00 34.82  ? 378  VAL A C   1 
ATOM   2880 O O   . VAL A 1 378 ? 23.398  14.600  -10.199 1.00 35.76  ? 378  VAL A O   1 
ATOM   2881 C CB  . VAL A 1 378 ? 26.405  13.815  -8.890  1.00 29.53  ? 378  VAL A CB  1 
ATOM   2882 C CG1 . VAL A 1 378 ? 25.685  14.709  -7.873  1.00 23.68  ? 378  VAL A CG1 1 
ATOM   2883 C CG2 . VAL A 1 378 ? 27.082  12.637  -8.211  1.00 25.73  ? 378  VAL A CG2 1 
ATOM   2884 N N   . VAL A 1 379 ? 25.242  15.403  -11.230 1.00 33.27  ? 379  VAL A N   1 
ATOM   2885 C CA  . VAL A 1 379 ? 24.583  16.577  -11.797 1.00 38.19  ? 379  VAL A CA  1 
ATOM   2886 C C   . VAL A 1 379 ? 23.409  16.194  -12.693 1.00 39.86  ? 379  VAL A C   1 
ATOM   2887 O O   . VAL A 1 379 ? 22.332  16.783  -12.599 1.00 32.35  ? 379  VAL A O   1 
ATOM   2888 C CB  . VAL A 1 379 ? 25.568  17.459  -12.596 1.00 35.80  ? 379  VAL A CB  1 
ATOM   2889 C CG1 . VAL A 1 379 ? 24.825  18.435  -13.476 1.00 29.77  ? 379  VAL A CG1 1 
ATOM   2890 C CG2 . VAL A 1 379 ? 26.500  18.204  -11.652 1.00 37.69  ? 379  VAL A CG2 1 
ATOM   2891 N N   . LEU A 1 380 ? 23.604  15.193  -13.542 1.00 41.32  ? 380  LEU A N   1 
ATOM   2892 C CA  . LEU A 1 380 ? 22.527  14.774  -14.429 1.00 43.06  ? 380  LEU A CA  1 
ATOM   2893 C C   . LEU A 1 380 ? 21.358  14.175  -13.646 1.00 39.09  ? 380  LEU A C   1 
ATOM   2894 O O   . LEU A 1 380 ? 20.200  14.404  -13.982 1.00 34.32  ? 380  LEU A O   1 
ATOM   2895 C CB  . LEU A 1 380 ? 23.033  13.823  -15.518 1.00 52.79  ? 380  LEU A CB  1 
ATOM   2896 C CG  . LEU A 1 380 ? 24.053  14.433  -16.501 1.00 61.30  ? 380  LEU A CG  1 
ATOM   2897 C CD1 . LEU A 1 380 ? 24.354  13.508  -17.658 1.00 66.29  ? 380  LEU A CD1 1 
ATOM   2898 C CD2 . LEU A 1 380 ? 23.645  15.798  -17.015 1.00 65.23  ? 380  LEU A CD2 1 
ATOM   2899 N N   . HIS A 1 381 ? 21.663  13.432  -12.590 1.00 38.30  ? 381  HIS A N   1 
ATOM   2900 C CA  . HIS A 1 381 ? 20.621  12.814  -11.780 1.00 36.70  ? 381  HIS A CA  1 
ATOM   2901 C C   . HIS A 1 381 ? 19.809  13.820  -10.963 1.00 34.47  ? 381  HIS A C   1 
ATOM   2902 O O   . HIS A 1 381 ? 18.596  13.670  -10.812 1.00 30.05  ? 381  HIS A O   1 
ATOM   2903 C CB  . HIS A 1 381 ? 21.213  11.775  -10.829 1.00 40.55  ? 381  HIS A CB  1 
ATOM   2904 C CG  . HIS A 1 381 ? 20.189  11.113  -9.962  1.00 40.57  ? 381  HIS A CG  1 
ATOM   2905 N ND1 . HIS A 1 381 ? 19.453  10.026  -10.381 1.00 42.42  ? 381  HIS A ND1 1 
ATOM   2906 C CD2 . HIS A 1 381 ? 19.752  11.406  -8.715  1.00 41.00  ? 381  HIS A CD2 1 
ATOM   2907 C CE1 . HIS A 1 381 ? 18.620  9.667   -9.422  1.00 43.66  ? 381  HIS A CE1 1 
ATOM   2908 N NE2 . HIS A 1 381 ? 18.782  10.487  -8.400  1.00 43.92  ? 381  HIS A NE2 1 
ATOM   2909 N N   . TYR A 1 382 ? 20.481  14.825  -10.412 1.00 28.46  ? 382  TYR A N   1 
ATOM   2910 C CA  . TYR A 1 382 ? 19.803  15.803  -9.572  1.00 28.95  ? 382  TYR A CA  1 
ATOM   2911 C C   . TYR A 1 382 ? 19.226  17.008  -10.324 1.00 31.99  ? 382  TYR A C   1 
ATOM   2912 O O   . TYR A 1 382 ? 18.449  17.765  -9.743  1.00 32.51  ? 382  TYR A O   1 
ATOM   2913 C CB  . TYR A 1 382 ? 20.713  16.273  -8.430  1.00 26.82  ? 382  TYR A CB  1 
ATOM   2914 C CG  . TYR A 1 382 ? 20.801  15.270  -7.315  1.00 29.98  ? 382  TYR A CG  1 
ATOM   2915 C CD1 . TYR A 1 382 ? 21.675  14.192  -7.391  1.00 28.19  ? 382  TYR A CD1 1 
ATOM   2916 C CD2 . TYR A 1 382 ? 19.999  15.393  -6.188  1.00 32.28  ? 382  TYR A CD2 1 
ATOM   2917 C CE1 . TYR A 1 382 ? 21.748  13.273  -6.374  1.00 36.54  ? 382  TYR A CE1 1 
ATOM   2918 C CE2 . TYR A 1 382 ? 20.062  14.483  -5.164  1.00 31.75  ? 382  TYR A CE2 1 
ATOM   2919 C CZ  . TYR A 1 382 ? 20.937  13.426  -5.258  1.00 35.62  ? 382  TYR A CZ  1 
ATOM   2920 O OH  . TYR A 1 382 ? 20.994  12.513  -4.236  1.00 33.08  ? 382  TYR A OH  1 
ATOM   2921 N N   . THR A 1 383 ? 19.610  17.199  -11.591 1.00 29.77  ? 383  THR A N   1 
ATOM   2922 C CA  . THR A 1 383 ? 19.035  18.282  -12.391 1.00 28.57  ? 383  THR A CA  1 
ATOM   2923 C C   . THR A 1 383 ? 17.557  18.024  -12.615 1.00 29.76  ? 383  THR A C   1 
ATOM   2924 O O   . THR A 1 383 ? 17.149  16.891  -12.847 1.00 40.33  ? 383  THR A O   1 
ATOM   2925 C CB  . THR A 1 383 ? 19.740  18.440  -13.758 1.00 36.23  ? 383  THR A CB  1 
ATOM   2926 O OG1 . THR A 1 383 ? 21.042  19.001  -13.553 1.00 35.29  ? 383  THR A OG1 1 
ATOM   2927 C CG2 . THR A 1 383 ? 18.940  19.362  -14.704 1.00 30.59  ? 383  THR A CG2 1 
ATOM   2928 N N   . ASP A 1 384 ? 16.752  19.070  -12.512 1.00 36.77  ? 384  ASP A N   1 
ATOM   2929 C CA  . ASP A 1 384 ? 15.367  18.990  -12.944 1.00 36.67  ? 384  ASP A CA  1 
ATOM   2930 C C   . ASP A 1 384 ? 15.320  19.380  -14.430 1.00 40.40  ? 384  ASP A C   1 
ATOM   2931 O O   . ASP A 1 384 ? 15.494  20.546  -14.773 1.00 35.87  ? 384  ASP A O   1 
ATOM   2932 C CB  . ASP A 1 384 ? 14.504  19.910  -12.073 1.00 41.56  ? 384  ASP A CB  1 
ATOM   2933 C CG  . ASP A 1 384 ? 13.051  19.971  -12.527 1.00 51.47  ? 384  ASP A CG  1 
ATOM   2934 O OD1 . ASP A 1 384 ? 12.641  19.184  -13.409 1.00 50.90  ? 384  ASP A OD1 1 
ATOM   2935 O OD2 . ASP A 1 384 ? 12.316  20.829  -11.994 1.00 57.08  ? 384  ASP A OD2 1 
ATOM   2936 N N   . TRP A 1 385 ? 15.099  18.408  -15.316 1.00 39.02  ? 385  TRP A N   1 
ATOM   2937 C CA  . TRP A 1 385 ? 15.248  18.664  -16.750 1.00 39.05  ? 385  TRP A CA  1 
ATOM   2938 C C   . TRP A 1 385 ? 14.101  19.444  -17.393 1.00 42.57  ? 385  TRP A C   1 
ATOM   2939 O O   . TRP A 1 385 ? 14.192  19.849  -18.554 1.00 41.97  ? 385  TRP A O   1 
ATOM   2940 C CB  . TRP A 1 385 ? 15.628  17.381  -17.510 1.00 40.23  ? 385  TRP A CB  1 
ATOM   2941 C CG  . TRP A 1 385 ? 16.998  16.948  -17.101 1.00 39.38  ? 385  TRP A CG  1 
ATOM   2942 C CD1 . TRP A 1 385 ? 17.318  15.976  -16.203 1.00 33.55  ? 385  TRP A CD1 1 
ATOM   2943 C CD2 . TRP A 1 385 ? 18.237  17.533  -17.518 1.00 33.85  ? 385  TRP A CD2 1 
ATOM   2944 N NE1 . TRP A 1 385 ? 18.683  15.902  -16.050 1.00 32.46  ? 385  TRP A NE1 1 
ATOM   2945 C CE2 . TRP A 1 385 ? 19.269  16.848  -16.845 1.00 32.64  ? 385  TRP A CE2 1 
ATOM   2946 C CE3 . TRP A 1 385 ? 18.574  18.576  -18.387 1.00 51.90  ? 385  TRP A CE3 1 
ATOM   2947 C CZ2 . TRP A 1 385 ? 20.615  17.167  -17.018 1.00 32.01  ? 385  TRP A CZ2 1 
ATOM   2948 C CZ3 . TRP A 1 385 ? 19.921  18.896  -18.561 1.00 33.71  ? 385  TRP A CZ3 1 
ATOM   2949 C CH2 . TRP A 1 385 ? 20.918  18.194  -17.883 1.00 32.57  ? 385  TRP A CH2 1 
ATOM   2950 N N   . LEU A 1 386 ? 13.045  19.693  -16.618 1.00 47.08  ? 386  LEU A N   1 
ATOM   2951 C CA  . LEU A 1 386 ? 11.967  20.582  -17.054 1.00 45.65  ? 386  LEU A CA  1 
ATOM   2952 C C   . LEU A 1 386 ? 12.334  22.024  -16.724 1.00 48.55  ? 386  LEU A C   1 
ATOM   2953 O O   . LEU A 1 386 ? 11.822  22.962  -17.333 1.00 56.92  ? 386  LEU A O   1 
ATOM   2954 C CB  . LEU A 1 386 ? 10.664  20.235  -16.340 1.00 43.06  ? 386  LEU A CB  1 
ATOM   2955 C CG  . LEU A 1 386 ? 9.450   19.883  -17.191 1.00 51.33  ? 386  LEU A CG  1 
ATOM   2956 C CD1 . LEU A 1 386 ? 8.197   19.981  -16.329 1.00 46.63  ? 386  LEU A CD1 1 
ATOM   2957 C CD2 . LEU A 1 386 ? 9.350   20.763  -18.462 1.00 53.76  ? 386  LEU A CD2 1 
ATOM   2958 N N   . HIS A 1 387 ? 13.208  22.185  -15.732 1.00 44.88  ? 387  HIS A N   1 
ATOM   2959 C CA  . HIS A 1 387 ? 13.685  23.500  -15.307 1.00 41.14  ? 387  HIS A CA  1 
ATOM   2960 C C   . HIS A 1 387 ? 15.160  23.420  -14.901 1.00 34.52  ? 387  HIS A C   1 
ATOM   2961 O O   . HIS A 1 387 ? 15.502  23.626  -13.738 1.00 33.31  ? 387  HIS A O   1 
ATOM   2962 C CB  . HIS A 1 387 ? 12.873  24.005  -14.111 1.00 40.63  ? 387  HIS A CB  1 
ATOM   2963 C CG  . HIS A 1 387 ? 11.386  23.915  -14.290 1.00 47.46  ? 387  HIS A CG  1 
ATOM   2964 N ND1 . HIS A 1 387 ? 10.619  22.945  -13.677 1.00 51.03  ? 387  HIS A ND1 1 
ATOM   2965 C CD2 . HIS A 1 387 ? 10.522  24.690  -14.989 1.00 47.84  ? 387  HIS A CD2 1 
ATOM   2966 C CE1 . HIS A 1 387 ? 9.350   23.123  -13.995 1.00 51.15  ? 387  HIS A CE1 1 
ATOM   2967 N NE2 . HIS A 1 387 ? 9.263   24.176  -14.789 1.00 48.85  ? 387  HIS A NE2 1 
ATOM   2968 N N   . PRO A 1 388 ? 16.041  23.120  -15.862 1.00 40.21  ? 388  PRO A N   1 
ATOM   2969 C CA  . PRO A 1 388 ? 17.451  22.867  -15.545 1.00 32.93  ? 388  PRO A CA  1 
ATOM   2970 C C   . PRO A 1 388 ? 18.226  24.039  -14.911 1.00 36.92  ? 388  PRO A C   1 
ATOM   2971 O O   . PRO A 1 388 ? 19.313  23.815  -14.375 1.00 33.08  ? 388  PRO A O   1 
ATOM   2972 C CB  . PRO A 1 388 ? 18.055  22.490  -16.904 1.00 33.61  ? 388  PRO A CB  1 
ATOM   2973 C CG  . PRO A 1 388 ? 17.105  23.042  -17.931 1.00 35.46  ? 388  PRO A CG  1 
ATOM   2974 C CD  . PRO A 1 388 ? 15.755  23.026  -17.310 1.00 41.15  ? 388  PRO A CD  1 
ATOM   2975 N N   . GLU A 1 389 ? 17.681  25.249  -14.955 1.00 33.22  ? 389  GLU A N   1 
ATOM   2976 C CA  . GLU A 1 389 ? 18.403  26.427  -14.481 1.00 48.38  ? 389  GLU A CA  1 
ATOM   2977 C C   . GLU A 1 389 ? 17.633  27.237  -13.446 1.00 42.34  ? 389  GLU A C   1 
ATOM   2978 O O   . GLU A 1 389 ? 18.008  28.359  -13.105 1.00 38.98  ? 389  GLU A O   1 
ATOM   2979 C CB  . GLU A 1 389 ? 18.803  27.313  -15.660 1.00 53.85  ? 389  GLU A CB  1 
ATOM   2980 C CG  . GLU A 1 389 ? 19.813  26.631  -16.551 1.00 63.34  ? 389  GLU A CG  1 
ATOM   2981 C CD  . GLU A 1 389 ? 20.484  27.574  -17.510 1.00 70.30  ? 389  GLU A CD  1 
ATOM   2982 O OE1 . GLU A 1 389 ? 19.820  28.001  -18.482 1.00 71.07  ? 389  GLU A OE1 1 
ATOM   2983 O OE2 . GLU A 1 389 ? 21.680  27.879  -17.287 1.00 69.99  ? 389  GLU A OE2 1 
ATOM   2984 N N   . ASP A 1 390 ? 16.550  26.661  -12.953 1.00 37.15  ? 390  ASP A N   1 
ATOM   2985 C CA  . ASP A 1 390 ? 15.810  27.286  -11.887 1.00 36.56  ? 390  ASP A CA  1 
ATOM   2986 C C   . ASP A 1 390 ? 16.638  27.325  -10.580 1.00 32.09  ? 390  ASP A C   1 
ATOM   2987 O O   . ASP A 1 390 ? 16.971  26.291  -10.007 1.00 30.73  ? 390  ASP A O   1 
ATOM   2988 C CB  . ASP A 1 390 ? 14.490  26.558  -11.677 1.00 37.99  ? 390  ASP A CB  1 
ATOM   2989 C CG  . ASP A 1 390 ? 13.644  27.218  -10.636 1.00 41.99  ? 390  ASP A CG  1 
ATOM   2990 O OD1 . ASP A 1 390 ? 13.111  28.297  -10.926 1.00 51.18  ? 390  ASP A OD1 1 
ATOM   2991 O OD2 . ASP A 1 390 ? 13.528  26.673  -9.529  1.00 50.79  ? 390  ASP A OD2 1 
ATOM   2992 N N   . PRO A 1 391 ? 16.952  28.540  -10.109 1.00 33.25  ? 391  PRO A N   1 
ATOM   2993 C CA  . PRO A 1 391 ? 17.736  28.777  -8.891  1.00 31.38  ? 391  PRO A CA  1 
ATOM   2994 C C   . PRO A 1 391 ? 17.165  28.076  -7.660  1.00 37.42  ? 391  PRO A C   1 
ATOM   2995 O O   . PRO A 1 391 ? 17.939  27.654  -6.803  1.00 44.66  ? 391  PRO A O   1 
ATOM   2996 C CB  . PRO A 1 391 ? 17.657  30.299  -8.706  1.00 32.76  ? 391  PRO A CB  1 
ATOM   2997 C CG  . PRO A 1 391 ? 17.306  30.831  -10.045 1.00 45.52  ? 391  PRO A CG  1 
ATOM   2998 C CD  . PRO A 1 391 ? 16.461  29.796  -10.705 1.00 34.38  ? 391  PRO A CD  1 
ATOM   2999 N N   . THR A 1 392 ? 15.848  27.944  -7.565  1.00 35.01  ? 392  THR A N   1 
ATOM   3000 C CA  . THR A 1 392 ? 15.274  27.307  -6.383  1.00 36.52  ? 392  THR A CA  1 
ATOM   3001 C C   . THR A 1 392 ? 15.514  25.796  -6.395  1.00 37.70  ? 392  THR A C   1 
ATOM   3002 O O   . THR A 1 392 ? 15.961  25.239  -5.384  1.00 28.29  ? 392  THR A O   1 
ATOM   3003 C CB  . THR A 1 392 ? 13.761  27.622  -6.178  1.00 44.87  ? 392  THR A CB  1 
ATOM   3004 O OG1 . THR A 1 392 ? 13.566  29.040  -6.078  1.00 33.89  ? 392  THR A OG1 1 
ATOM   3005 C CG2 . THR A 1 392 ? 13.274  26.979  -4.898  1.00 31.89  ? 392  THR A CG2 1 
ATOM   3006 N N   . HIS A 1 393 ? 15.216  25.129  -7.517  1.00 34.15  ? 393  HIS A N   1 
ATOM   3007 C CA  A HIS A 1 393 ? 15.480  23.700  -7.567  0.55 29.04  ? 393  HIS A CA  1 
ATOM   3008 C CA  B HIS A 1 393 ? 15.480  23.701  -7.678  0.45 35.81  ? 393  HIS A CA  1 
ATOM   3009 C C   . HIS A 1 393 ? 16.959  23.402  -7.418  1.00 34.63  ? 393  HIS A C   1 
ATOM   3010 O O   . HIS A 1 393 ? 17.317  22.436  -6.756  1.00 36.44  ? 393  HIS A O   1 
ATOM   3011 C CB  A HIS A 1 393 ? 14.982  23.008  -8.829  0.55 37.77  ? 393  HIS A CB  1 
ATOM   3012 C CB  B HIS A 1 393 ? 15.136  23.255  -9.108  0.45 30.12  ? 393  HIS A CB  1 
ATOM   3013 C CG  A HIS A 1 393 ? 15.458  21.591  -8.923  0.55 40.71  ? 393  HIS A CG  1 
ATOM   3014 C CG  B HIS A 1 393 ? 13.676  23.013  -9.353  0.45 37.44  ? 393  HIS A CG  1 
ATOM   3015 N ND1 A HIS A 1 393 ? 14.793  20.543  -8.319  0.55 29.09  ? 393  HIS A ND1 1 
ATOM   3016 N ND1 B HIS A 1 393 ? 12.876  23.906  -10.033 0.45 45.62  ? 393  HIS A ND1 1 
ATOM   3017 C CD2 A HIS A 1 393 ? 16.581  21.061  -9.467  0.55 28.39  ? 393  HIS A CD2 1 
ATOM   3018 C CD2 B HIS A 1 393 ? 12.881  21.962  -9.041  0.45 31.93  ? 393  HIS A CD2 1 
ATOM   3019 C CE1 A HIS A 1 393 ? 15.461  19.424  -8.533  0.55 39.78  ? 393  HIS A CE1 1 
ATOM   3020 C CE1 B HIS A 1 393 ? 11.648  23.425  -10.116 0.45 34.65  ? 393  HIS A CE1 1 
ATOM   3021 N NE2 A HIS A 1 393 ? 16.550  19.712  -9.226  0.55 37.41  ? 393  HIS A NE2 1 
ATOM   3022 N NE2 B HIS A 1 393 ? 11.624  22.246  -9.522  0.45 33.82  ? 393  HIS A NE2 1 
ATOM   3023 N N   . LEU A 1 394 ? 17.811  24.231  -8.012  1.00 30.33  ? 394  LEU A N   1 
ATOM   3024 C CA  . LEU A 1 394 ? 19.247  24.046  -7.914  1.00 26.60  ? 394  LEU A CA  1 
ATOM   3025 C C   . LEU A 1 394 ? 19.713  24.108  -6.451  1.00 31.42  ? 394  LEU A C   1 
ATOM   3026 O O   . LEU A 1 394 ? 20.499  23.265  -5.999  1.00 29.92  ? 394  LEU A O   1 
ATOM   3027 C CB  . LEU A 1 394 ? 19.973  25.073  -8.783  1.00 27.25  ? 394  LEU A CB  1 
ATOM   3028 C CG  . LEU A 1 394 ? 19.813  24.820  -10.284 1.00 32.10  ? 394  LEU A CG  1 
ATOM   3029 C CD1 . LEU A 1 394 ? 20.265  26.018  -11.110 1.00 31.21  ? 394  LEU A CD1 1 
ATOM   3030 C CD2 . LEU A 1 394 ? 20.544  23.561  -10.712 1.00 27.46  ? 394  LEU A CD2 1 
ATOM   3031 N N   . ARG A 1 395 ? 19.213  25.105  -5.723  1.00 28.47  ? 395  ARG A N   1 
ATOM   3032 C CA  . ARG A 1 395 ? 19.528  25.270  -4.317  1.00 25.30  ? 395  ARG A CA  1 
ATOM   3033 C C   . ARG A 1 395 ? 19.169  23.993  -3.561  1.00 32.73  ? 395  ARG A C   1 
ATOM   3034 O O   . ARG A 1 395 ? 20.007  23.409  -2.870  1.00 32.56  ? 395  ARG A O   1 
ATOM   3035 C CB  . ARG A 1 395 ? 18.761  26.461  -3.754  1.00 31.26  ? 395  ARG A CB  1 
ATOM   3036 C CG  . ARG A 1 395 ? 19.003  26.715  -2.276  1.00 33.19  ? 395  ARG A CG  1 
ATOM   3037 C CD  . ARG A 1 395 ? 17.704  26.581  -1.513  1.00 29.91  ? 395  ARG A CD  1 
ATOM   3038 N NE  . ARG A 1 395 ? 17.013  27.841  -1.420  1.00 31.93  ? 395  ARG A NE  1 
ATOM   3039 C CZ  . ARG A 1 395 ? 15.690  27.977  -1.358  1.00 39.85  ? 395  ARG A CZ  1 
ATOM   3040 N NH1 . ARG A 1 395 ? 14.892  26.914  -1.385  1.00 35.21  ? 395  ARG A NH1 1 
ATOM   3041 N NH2 . ARG A 1 395 ? 15.164  29.196  -1.289  1.00 36.11  ? 395  ARG A NH2 1 
ATOM   3042 N N   . ASP A 1 396 ? 17.932  23.536  -3.743  1.00 30.66  ? 396  ASP A N   1 
ATOM   3043 C CA  . ASP A 1 396 ? 17.422  22.370  -3.020  1.00 33.60  ? 396  ASP A CA  1 
ATOM   3044 C C   . ASP A 1 396 ? 18.104  21.069  -3.457  1.00 31.18  ? 396  ASP A C   1 
ATOM   3045 O O   . ASP A 1 396 ? 18.295  20.156  -2.650  1.00 29.05  ? 396  ASP A O   1 
ATOM   3046 C CB  . ASP A 1 396 ? 15.890  22.256  -3.160  1.00 34.39  ? 396  ASP A CB  1 
ATOM   3047 C CG  . ASP A 1 396 ? 15.144  23.475  -2.593  1.00 37.24  ? 396  ASP A CG  1 
ATOM   3048 O OD1 . ASP A 1 396 ? 15.732  24.230  -1.783  1.00 34.12  ? 396  ASP A OD1 1 
ATOM   3049 O OD2 . ASP A 1 396 ? 13.955  23.668  -2.943  1.00 46.66  ? 396  ASP A OD2 1 
ATOM   3050 N N   . ALA A 1 397 ? 18.462  20.979  -4.734  1.00 24.18  ? 397  ALA A N   1 
ATOM   3051 C CA  . ALA A 1 397 ? 19.168  19.797  -5.229  1.00 28.99  ? 397  ALA A CA  1 
ATOM   3052 C C   . ALA A 1 397 ? 20.567  19.710  -4.614  1.00 31.09  ? 397  ALA A C   1 
ATOM   3053 O O   . ALA A 1 397 ? 21.011  18.630  -4.231  1.00 29.41  ? 397  ALA A O   1 
ATOM   3054 C CB  . ALA A 1 397 ? 19.255  19.801  -6.735  1.00 24.55  ? 397  ALA A CB  1 
ATOM   3055 N N   . MET A 1 398 ? 21.246  20.849  -4.513  1.00 22.59  ? 398  MET A N   1 
ATOM   3056 C CA  . MET A 1 398 ? 22.561  20.897  -3.883  1.00 26.96  ? 398  MET A CA  1 
ATOM   3057 C C   . MET A 1 398 ? 22.459  20.367  -2.446  1.00 27.44  ? 398  MET A C   1 
ATOM   3058 O O   . MET A 1 398 ? 23.288  19.576  -2.006  1.00 22.32  ? 398  MET A O   1 
ATOM   3059 C CB  . MET A 1 398 ? 23.126  22.320  -3.897  1.00 22.17  ? 398  MET A CB  1 
ATOM   3060 C CG  . MET A 1 398 ? 24.585  22.414  -3.499  1.00 30.11  ? 398  MET A CG  1 
ATOM   3061 S SD  . MET A 1 398 ? 25.692  21.618  -4.697  1.00 28.90  ? 398  MET A SD  1 
ATOM   3062 C CE  . MET A 1 398 ? 26.106  20.094  -3.830  1.00 23.40  ? 398  MET A CE  1 
ATOM   3063 N N   . SER A 1 399 ? 21.418  20.785  -1.738  1.00 29.36  ? 399  SER A N   1 
ATOM   3064 C CA  . SER A 1 399 ? 21.172  20.301  -0.382  1.00 35.48  ? 399  SER A CA  1 
ATOM   3065 C C   . SER A 1 399 ? 21.002  18.783  -0.344  1.00 28.43  ? 399  SER A C   1 
ATOM   3066 O O   . SER A 1 399 ? 21.597  18.095  0.494   1.00 28.77  ? 399  SER A O   1 
ATOM   3067 C CB  . SER A 1 399 ? 19.925  20.976  0.209   1.00 35.79  ? 399  SER A CB  1 
ATOM   3068 O OG  . SER A 1 399 ? 19.639  20.458  1.494   1.00 37.04  ? 399  SER A OG  1 
ATOM   3069 N N   . ALA A 1 400 ? 20.191  18.277  -1.263  1.00 23.25  ? 400  ALA A N   1 
ATOM   3070 C CA  . ALA A 1 400 ? 19.887  16.852  -1.333  1.00 28.98  ? 400  ALA A CA  1 
ATOM   3071 C C   . ALA A 1 400 ? 21.125  16.019  -1.690  1.00 26.78  ? 400  ALA A C   1 
ATOM   3072 O O   . ALA A 1 400 ? 21.360  14.974  -1.088  1.00 27.92  ? 400  ALA A O   1 
ATOM   3073 C CB  . ALA A 1 400 ? 18.753  16.594  -2.313  1.00 24.77  ? 400  ALA A CB  1 
ATOM   3074 N N   . VAL A 1 401 ? 21.920  16.497  -2.647  1.00 22.65  ? 401  VAL A N   1 
ATOM   3075 C CA  . VAL A 1 401 ? 23.179  15.838  -3.004  1.00 27.85  ? 401  VAL A CA  1 
ATOM   3076 C C   . VAL A 1 401 ? 24.017  15.564  -1.755  1.00 20.23  ? 401  VAL A C   1 
ATOM   3077 O O   . VAL A 1 401 ? 24.474  14.455  -1.523  1.00 29.41  ? 401  VAL A O   1 
ATOM   3078 C CB  . VAL A 1 401 ? 24.033  16.708  -3.966  1.00 29.35  ? 401  VAL A CB  1 
ATOM   3079 C CG1 . VAL A 1 401 ? 25.465  16.172  -4.046  1.00 21.10  ? 401  VAL A CG1 1 
ATOM   3080 C CG2 . VAL A 1 401 ? 23.390  16.805  -5.337  1.00 22.00  ? 401  VAL A CG2 1 
ATOM   3081 N N   . VAL A 1 402 ? 24.203  16.598  -0.953  1.00 26.39  ? 402  VAL A N   1 
ATOM   3082 C CA  . VAL A 1 402 ? 25.020  16.516  0.235   1.00 26.37  ? 402  VAL A CA  1 
ATOM   3083 C C   . VAL A 1 402 ? 24.378  15.649  1.316   1.00 32.26  ? 402  VAL A C   1 
ATOM   3084 O O   . VAL A 1 402 ? 25.058  14.838  1.951   1.00 31.56  ? 402  VAL A O   1 
ATOM   3085 C CB  . VAL A 1 402 ? 25.318  17.914  0.754   1.00 26.66  ? 402  VAL A CB  1 
ATOM   3086 C CG1 . VAL A 1 402 ? 25.984  17.857  2.126   1.00 21.64  ? 402  VAL A CG1 1 
ATOM   3087 C CG2 . VAL A 1 402 ? 26.190  18.644  -0.251  1.00 24.83  ? 402  VAL A CG2 1 
ATOM   3088 N N   . GLY A 1 403 ? 23.068  15.803  1.504   1.00 28.98  ? 403  GLY A N   1 
ATOM   3089 C CA  . GLY A 1 403 ? 22.342  14.994  2.466   1.00 19.10  ? 403  GLY A CA  1 
ATOM   3090 C C   . GLY A 1 403 ? 22.302  13.520  2.081   1.00 30.30  ? 403  GLY A C   1 
ATOM   3091 O O   . GLY A 1 403 ? 22.559  12.650  2.922   1.00 23.98  ? 403  GLY A O   1 
ATOM   3092 N N   . ASP A 1 404 ? 22.002  13.240  0.808   1.00 20.16  ? 404  ASP A N   1 
ATOM   3093 C CA  . ASP A 1 404 ? 21.867  11.861  0.339   1.00 25.13  ? 404  ASP A CA  1 
ATOM   3094 C C   . ASP A 1 404 ? 23.190  11.127  0.378   1.00 30.30  ? 404  ASP A C   1 
ATOM   3095 O O   . ASP A 1 404 ? 23.266  9.997   0.861   1.00 34.07  ? 404  ASP A O   1 
ATOM   3096 C CB  . ASP A 1 404 ? 21.292  11.808  -1.079  1.00 23.25  ? 404  ASP A CB  1 
ATOM   3097 C CG  . ASP A 1 404 ? 19.897  12.379  -1.149  1.00 30.61  ? 404  ASP A CG  1 
ATOM   3098 O OD1 . ASP A 1 404 ? 19.306  12.592  -0.068  1.00 30.90  ? 404  ASP A OD1 1 
ATOM   3099 O OD2 . ASP A 1 404 ? 19.391  12.623  -2.265  1.00 36.43  ? 404  ASP A OD2 1 
ATOM   3100 N N   . HIS A 1 405 ? 24.227  11.785  -0.128  1.00 24.14  ? 405  HIS A N   1 
ATOM   3101 C CA  . HIS A 1 405 ? 25.534  11.164  -0.271  1.00 29.16  ? 405  HIS A CA  1 
ATOM   3102 C C   . HIS A 1 405 ? 26.131  10.859  1.109   1.00 27.51  ? 405  HIS A C   1 
ATOM   3103 O O   . HIS A 1 405 ? 26.771  9.836   1.298   1.00 28.55  ? 405  HIS A O   1 
ATOM   3104 C CB  . HIS A 1 405 ? 26.446  12.087  -1.095  1.00 25.83  ? 405  HIS A CB  1 
ATOM   3105 C CG  . HIS A 1 405 ? 27.885  11.667  -1.152  1.00 25.75  ? 405  HIS A CG  1 
ATOM   3106 N ND1 . HIS A 1 405 ? 28.280  10.372  -1.411  1.00 29.74  ? 405  HIS A ND1 1 
ATOM   3107 C CD2 . HIS A 1 405 ? 29.026  12.385  -1.004  1.00 26.35  ? 405  HIS A CD2 1 
ATOM   3108 C CE1 . HIS A 1 405 ? 29.600  10.311  -1.429  1.00 30.21  ? 405  HIS A CE1 1 
ATOM   3109 N NE2 . HIS A 1 405 ? 30.077  11.520  -1.184  1.00 31.40  ? 405  HIS A NE2 1 
ATOM   3110 N N   . ASN A 1 406 ? 25.892  11.746  2.069   1.00 24.62  ? 406  ASN A N   1 
ATOM   3111 C CA  . ASN A 1 406 ? 26.564  11.666  3.365   1.00 24.95  ? 406  ASN A CA  1 
ATOM   3112 C C   . ASN A 1 406 ? 25.772  10.960  4.462   1.00 27.43  ? 406  ASN A C   1 
ATOM   3113 O O   . ASN A 1 406 ? 26.356  10.334  5.330   1.00 25.85  ? 406  ASN A O   1 
ATOM   3114 C CB  . ASN A 1 406 ? 26.976  13.059  3.855   1.00 21.79  ? 406  ASN A CB  1 
ATOM   3115 C CG  . ASN A 1 406 ? 28.110  13.648  3.048   1.00 27.07  ? 406  ASN A CG  1 
ATOM   3116 O OD1 . ASN A 1 406 ? 29.207  13.078  2.992   1.00 25.98  ? 406  ASN A OD1 1 
ATOM   3117 N ND2 . ASN A 1 406 ? 27.860  14.804  2.418   1.00 28.11  ? 406  ASN A ND2 1 
ATOM   3118 N N   . VAL A 1 407 ? 24.447  11.058  4.427   1.00 29.64  ? 407  VAL A N   1 
ATOM   3119 C CA  . VAL A 1 407 ? 23.650  10.549  5.537   1.00 27.33  ? 407  VAL A CA  1 
ATOM   3120 C C   . VAL A 1 407 ? 22.548  9.608   5.093   1.00 30.44  ? 407  VAL A C   1 
ATOM   3121 O O   . VAL A 1 407 ? 22.546  8.446   5.480   1.00 33.88  ? 407  VAL A O   1 
ATOM   3122 C CB  . VAL A 1 407 ? 23.040  11.697  6.387   1.00 25.92  ? 407  VAL A CB  1 
ATOM   3123 C CG1 . VAL A 1 407 ? 22.162  11.138  7.499   1.00 26.33  ? 407  VAL A CG1 1 
ATOM   3124 C CG2 . VAL A 1 407 ? 24.150  12.559  6.975   1.00 21.21  ? 407  VAL A CG2 1 
ATOM   3125 N N   . VAL A 1 408 ? 21.618  10.107  4.279   1.00 30.72  ? 408  VAL A N   1 
ATOM   3126 C CA  . VAL A 1 408 ? 20.431  9.337   3.933   1.00 28.05  ? 408  VAL A CA  1 
ATOM   3127 C C   . VAL A 1 408 ? 20.745  7.989   3.288   1.00 32.79  ? 408  VAL A C   1 
ATOM   3128 O O   . VAL A 1 408 ? 20.193  6.959   3.692   1.00 30.51  ? 408  VAL A O   1 
ATOM   3129 C CB  . VAL A 1 408 ? 19.465  10.116  3.030   1.00 28.25  ? 408  VAL A CB  1 
ATOM   3130 C CG1 . VAL A 1 408 ? 18.237  9.260   2.741   1.00 22.99  ? 408  VAL A CG1 1 
ATOM   3131 C CG2 . VAL A 1 408 ? 19.062  11.432  3.688   1.00 22.20  ? 408  VAL A CG2 1 
ATOM   3132 N N   . CYS A 1 409 ? 21.641  7.983   2.306   1.00 31.26  ? 409  CYS A N   1 
ATOM   3133 C CA  . CYS A 1 409 ? 21.963  6.728   1.613   1.00 35.14  ? 409  CYS A CA  1 
ATOM   3134 C C   . CYS A 1 409 ? 22.903  5.797   2.396   1.00 33.64  ? 409  CYS A C   1 
ATOM   3135 O O   . CYS A 1 409 ? 22.713  4.578   2.377   1.00 35.12  ? 409  CYS A O   1 
ATOM   3136 C CB  . CYS A 1 409 ? 22.446  6.982   0.179   1.00 28.80  ? 409  CYS A CB  1 
ATOM   3137 S SG  . CYS A 1 409 ? 21.189  7.880   -0.812  1.00 33.95  ? 409  CYS A SG  1 
ATOM   3138 N N   . PRO A 1 410 ? 23.906  6.359   3.092   1.00 30.50  ? 410  PRO A N   1 
ATOM   3139 C CA  . PRO A 1 410 ? 24.623  5.469   4.020   1.00 32.22  ? 410  PRO A CA  1 
ATOM   3140 C C   . PRO A 1 410 ? 23.693  4.853   5.080   1.00 32.89  ? 410  PRO A C   1 
ATOM   3141 O O   . PRO A 1 410 ? 23.874  3.690   5.466   1.00 30.00  ? 410  PRO A O   1 
ATOM   3142 C CB  . PRO A 1 410 ? 25.655  6.394   4.670   1.00 27.29  ? 410  PRO A CB  1 
ATOM   3143 C CG  . PRO A 1 410 ? 25.913  7.459   3.607   1.00 29.30  ? 410  PRO A CG  1 
ATOM   3144 C CD  . PRO A 1 410 ? 24.592  7.662   2.918   1.00 30.12  ? 410  PRO A CD  1 
ATOM   3145 N N   . VAL A 1 411 ? 22.696  5.614   5.525   1.00 29.57  ? 411  VAL A N   1 
ATOM   3146 C CA  . VAL A 1 411 ? 21.728  5.094   6.487   1.00 32.42  ? 411  VAL A CA  1 
ATOM   3147 C C   . VAL A 1 411 ? 20.880  3.977   5.856   1.00 35.43  ? 411  VAL A C   1 
ATOM   3148 O O   . VAL A 1 411 ? 20.673  2.911   6.467   1.00 33.21  ? 411  VAL A O   1 
ATOM   3149 C CB  . VAL A 1 411 ? 20.841  6.216   7.094   1.00 34.20  ? 411  VAL A CB  1 
ATOM   3150 C CG1 . VAL A 1 411 ? 19.572  5.643   7.694   1.00 23.40  ? 411  VAL A CG1 1 
ATOM   3151 C CG2 . VAL A 1 411 ? 21.617  7.001   8.147   1.00 21.41  ? 411  VAL A CG2 1 
ATOM   3152 N N   . ALA A 1 412 ? 20.423  4.201   4.624   1.00 26.45  ? 412  ALA A N   1 
ATOM   3153 C CA  . ALA A 1 412 ? 19.662  3.172   3.928   1.00 31.16  ? 412  ALA A CA  1 
ATOM   3154 C C   . ALA A 1 412 ? 20.493  1.903   3.784   1.00 33.80  ? 412  ALA A C   1 
ATOM   3155 O O   . ALA A 1 412 ? 20.003  0.799   4.052   1.00 34.86  ? 412  ALA A O   1 
ATOM   3156 C CB  . ALA A 1 412 ? 19.190  3.659   2.570   1.00 34.29  ? 412  ALA A CB  1 
ATOM   3157 N N   . GLN A 1 413 ? 21.755  2.060   3.387   1.00 29.71  ? 413  GLN A N   1 
ATOM   3158 C CA  . GLN A 1 413 ? 22.614  0.894   3.217   1.00 34.31  ? 413  GLN A CA  1 
ATOM   3159 C C   . GLN A 1 413 ? 22.789  0.144   4.548   1.00 37.47  ? 413  GLN A C   1 
ATOM   3160 O O   . GLN A 1 413 ? 22.709  -1.081  4.583   1.00 31.05  ? 413  GLN A O   1 
ATOM   3161 C CB  . GLN A 1 413 ? 23.968  1.277   2.624   1.00 34.35  ? 413  GLN A CB  1 
ATOM   3162 C CG  . GLN A 1 413 ? 24.557  0.212   1.717   1.00 44.01  ? 413  GLN A CG  1 
ATOM   3163 C CD  . GLN A 1 413 ? 26.058  0.128   1.842   1.00 60.30  ? 413  GLN A CD  1 
ATOM   3164 O OE1 . GLN A 1 413 ? 26.718  1.116   2.165   1.00 64.12  ? 413  GLN A OE1 1 
ATOM   3165 N NE2 . GLN A 1 413 ? 26.611  -1.063  1.612   1.00 70.75  ? 413  GLN A NE2 1 
ATOM   3166 N N   . LEU A 1 414 ? 23.003  0.884   5.638   1.00 34.32  ? 414  LEU A N   1 
ATOM   3167 C CA  . LEU A 1 414 ? 23.091  0.279   6.965   1.00 33.49  ? 414  LEU A CA  1 
ATOM   3168 C C   . LEU A 1 414 ? 21.811  -0.482  7.378   1.00 36.16  ? 414  LEU A C   1 
ATOM   3169 O O   . LEU A 1 414 ? 21.875  -1.663  7.743   1.00 35.36  ? 414  LEU A O   1 
ATOM   3170 C CB  . LEU A 1 414 ? 23.443  1.331   8.019   1.00 26.55  ? 414  LEU A CB  1 
ATOM   3171 C CG  . LEU A 1 414 ? 23.716  0.826   9.446   1.00 31.40  ? 414  LEU A CG  1 
ATOM   3172 C CD1 . LEU A 1 414 ? 24.829  -0.223  9.465   1.00 28.05  ? 414  LEU A CD1 1 
ATOM   3173 C CD2 . LEU A 1 414 ? 24.094  1.988   10.336  1.00 30.94  ? 414  LEU A CD2 1 
ATOM   3174 N N   . ALA A 1 415 ? 20.658  0.183   7.319   1.00 30.32  ? 415  ALA A N   1 
ATOM   3175 C CA  . ALA A 1 415 ? 19.412  -0.455  7.744   1.00 31.96  ? 415  ALA A CA  1 
ATOM   3176 C C   . ALA A 1 415 ? 19.149  -1.724  6.937   1.00 35.87  ? 415  ALA A C   1 
ATOM   3177 O O   . ALA A 1 415 ? 18.813  -2.772  7.488   1.00 38.86  ? 415  ALA A O   1 
ATOM   3178 C CB  . ALA A 1 415 ? 18.249  0.510   7.622   1.00 29.58  ? 415  ALA A CB  1 
ATOM   3179 N N   . GLY A 1 416 ? 19.342  -1.631  5.628   1.00 35.25  ? 416  GLY A N   1 
ATOM   3180 C CA  . GLY A 1 416 ? 19.199  -2.786  4.767   1.00 39.15  ? 416  GLY A CA  1 
ATOM   3181 C C   . GLY A 1 416 ? 20.102  -3.953  5.120   1.00 40.17  ? 416  GLY A C   1 
ATOM   3182 O O   . GLY A 1 416 ? 19.639  -5.105  5.188   1.00 43.69  ? 416  GLY A O   1 
ATOM   3183 N N   . ARG A 1 417 ? 21.387  -3.676  5.344   1.00 39.30  ? 417  ARG A N   1 
ATOM   3184 C CA  . ARG A 1 417 ? 22.348  -4.756  5.610   1.00 44.26  ? 417  ARG A CA  1 
ATOM   3185 C C   . ARG A 1 417 ? 22.137  -5.371  6.994   1.00 43.03  ? 417  ARG A C   1 
ATOM   3186 O O   . ARG A 1 417 ? 22.165  -6.589  7.153   1.00 47.87  ? 417  ARG A O   1 
ATOM   3187 C CB  . ARG A 1 417 ? 23.798  -4.290  5.416   1.00 42.11  ? 417  ARG A CB  1 
ATOM   3188 C CG  . ARG A 1 417 ? 24.122  -3.839  3.996   1.00 45.55  ? 417  ARG A CG  1 
ATOM   3189 C CD  . ARG A 1 417 ? 24.620  -4.967  3.091   1.00 55.05  ? 417  ARG A CD  1 
ATOM   3190 N NE  . ARG A 1 417 ? 23.637  -6.026  2.875   1.00 72.14  ? 417  ARG A NE  1 
ATOM   3191 C CZ  . ARG A 1 417 ? 23.945  -7.292  2.591   1.00 83.55  ? 417  ARG A CZ  1 
ATOM   3192 N NH1 . ARG A 1 417 ? 25.217  -7.665  2.490   1.00 85.34  ? 417  ARG A NH1 1 
ATOM   3193 N NH2 . ARG A 1 417 ? 22.980  -8.190  2.420   1.00 86.22  ? 417  ARG A NH2 1 
ATOM   3194 N N   . LEU A 1 418 ? 21.893  -4.524  7.985   1.00 36.14  ? 418  LEU A N   1 
ATOM   3195 C CA  . LEU A 1 418 ? 21.626  -5.012  9.328   1.00 40.12  ? 418  LEU A CA  1 
ATOM   3196 C C   . LEU A 1 418 ? 20.379  -5.887  9.333   1.00 42.54  ? 418  LEU A C   1 
ATOM   3197 O O   . LEU A 1 418 ? 20.362  -6.949  9.943   1.00 43.37  ? 418  LEU A O   1 
ATOM   3198 C CB  . LEU A 1 418 ? 21.458  -3.848  10.305  1.00 38.78  ? 418  LEU A CB  1 
ATOM   3199 C CG  . LEU A 1 418 ? 22.700  -3.015  10.613  1.00 39.11  ? 418  LEU A CG  1 
ATOM   3200 C CD1 . LEU A 1 418 ? 22.344  -1.876  11.529  1.00 35.50  ? 418  LEU A CD1 1 
ATOM   3201 C CD2 . LEU A 1 418 ? 23.768  -3.877  11.240  1.00 47.98  ? 418  LEU A CD2 1 
ATOM   3202 N N   . ALA A 1 419 ? 19.338  -5.440  8.644   1.00 43.13  ? 419  ALA A N   1 
ATOM   3203 C CA  . ALA A 1 419 ? 18.090  -6.187  8.599   1.00 42.43  ? 419  ALA A CA  1 
ATOM   3204 C C   . ALA A 1 419 ? 18.250  -7.518  7.877   1.00 48.68  ? 419  ALA A C   1 
ATOM   3205 O O   . ALA A 1 419 ? 17.668  -8.522  8.279   1.00 51.53  ? 419  ALA A O   1 
ATOM   3206 C CB  . ALA A 1 419 ? 16.999  -5.357  7.939   1.00 45.98  ? 419  ALA A CB  1 
ATOM   3207 N N   . ALA A 1 420 ? 19.034  -7.533  6.807   1.00 52.64  ? 420  ALA A N   1 
ATOM   3208 C CA  . ALA A 1 420 ? 19.183  -8.760  6.023   1.00 53.49  ? 420  ALA A CA  1 
ATOM   3209 C C   . ALA A 1 420 ? 19.968  -9.785  6.820   1.00 57.62  ? 420  ALA A C   1 
ATOM   3210 O O   . ALA A 1 420 ? 19.884  -10.987 6.569   1.00 59.53  ? 420  ALA A O   1 
ATOM   3211 C CB  . ALA A 1 420 ? 19.869  -8.480  4.684   1.00 46.65  ? 420  ALA A CB  1 
ATOM   3212 N N   . GLN A 1 421 ? 20.717  -9.298  7.803   1.00 56.57  ? 421  GLN A N   1 
ATOM   3213 C CA  . GLN A 1 421 ? 21.601  -10.155 8.570   1.00 53.58  ? 421  GLN A CA  1 
ATOM   3214 C C   . GLN A 1 421 ? 21.181  -10.314 10.025  1.00 51.34  ? 421  GLN A C   1 
ATOM   3215 O O   . GLN A 1 421 ? 22.022  -10.503 10.906  1.00 55.26  ? 421  GLN A O   1 
ATOM   3216 C CB  . GLN A 1 421 ? 23.048  -9.673  8.444   1.00 58.22  ? 421  GLN A CB  1 
ATOM   3217 C CG  . GLN A 1 421 ? 23.681  -10.064 7.113   1.00 67.17  ? 421  GLN A CG  1 
ATOM   3218 C CD  . GLN A 1 421 ? 24.447  -8.928  6.479   1.00 72.22  ? 421  GLN A CD  1 
ATOM   3219 O OE1 . GLN A 1 421 ? 24.216  -8.573  5.322   1.00 76.58  ? 421  GLN A OE1 1 
ATOM   3220 N NE2 . GLN A 1 421 ? 25.366  -8.346  7.234   1.00 72.46  ? 421  GLN A NE2 1 
ATOM   3221 N N   . GLY A 1 422 ? 19.876  -10.238 10.268  1.00 49.75  ? 422  GLY A N   1 
ATOM   3222 C CA  . GLY A 1 422 ? 19.304  -10.685 11.529  1.00 48.26  ? 422  GLY A CA  1 
ATOM   3223 C C   . GLY A 1 422 ? 19.038  -9.678  12.634  1.00 47.59  ? 422  GLY A C   1 
ATOM   3224 O O   . GLY A 1 422 ? 18.516  -10.040 13.687  1.00 51.57  ? 422  GLY A O   1 
ATOM   3225 N N   . ALA A 1 423 ? 19.406  -8.422  12.423  1.00 49.91  ? 423  ALA A N   1 
ATOM   3226 C CA  . ALA A 1 423 ? 19.153  -7.400  13.427  1.00 40.13  ? 423  ALA A CA  1 
ATOM   3227 C C   . ALA A 1 423 ? 17.712  -6.944  13.322  1.00 44.39  ? 423  ALA A C   1 
ATOM   3228 O O   . ALA A 1 423 ? 17.141  -6.934  12.231  1.00 48.91  ? 423  ALA A O   1 
ATOM   3229 C CB  . ALA A 1 423 ? 20.080  -6.218  13.209  1.00 37.61  ? 423  ALA A CB  1 
ATOM   3230 N N   A ARG A 1 424 ? 17.136  -6.558  14.455  0.48 41.04  ? 424  ARG A N   1 
ATOM   3231 N N   B ARG A 1 424 ? 17.101  -6.590  14.447  0.52 40.99  ? 424  ARG A N   1 
ATOM   3232 C CA  A ARG A 1 424 ? 15.839  -5.899  14.483  0.48 43.66  ? 424  ARG A CA  1 
ATOM   3233 C CA  B ARG A 1 424 ? 15.804  -5.932  14.376  0.52 43.16  ? 424  ARG A CA  1 
ATOM   3234 C C   A ARG A 1 424 ? 16.051  -4.397  14.288  0.48 41.90  ? 424  ARG A C   1 
ATOM   3235 C C   B ARG A 1 424 ? 16.024  -4.428  14.278  0.52 41.75  ? 424  ARG A C   1 
ATOM   3236 O O   A ARG A 1 424 ? 16.673  -3.747  15.129  0.48 41.21  ? 424  ARG A O   1 
ATOM   3237 O O   B ARG A 1 424 ? 16.617  -3.815  15.167  0.52 41.18  ? 424  ARG A O   1 
ATOM   3238 C CB  A ARG A 1 424 ? 15.147  -6.179  15.819  0.48 46.85  ? 424  ARG A CB  1 
ATOM   3239 C CB  B ARG A 1 424 ? 14.900  -6.285  15.558  0.52 47.61  ? 424  ARG A CB  1 
ATOM   3240 C CG  A ARG A 1 424 ? 13.927  -5.318  16.112  0.48 49.16  ? 424  ARG A CG  1 
ATOM   3241 C CG  B ARG A 1 424 ? 13.478  -5.744  15.389  0.52 52.16  ? 424  ARG A CG  1 
ATOM   3242 C CD  A ARG A 1 424 ? 12.755  -6.172  16.581  0.48 57.11  ? 424  ARG A CD  1 
ATOM   3243 C CD  B ARG A 1 424 ? 12.499  -6.345  16.386  0.52 58.09  ? 424  ARG A CD  1 
ATOM   3244 N NE  A ARG A 1 424 ? 13.169  -7.221  17.512  0.48 59.77  ? 424  ARG A NE  1 
ATOM   3245 N NE  B ARG A 1 424 ? 11.473  -7.159  15.736  0.52 56.33  ? 424  ARG A NE  1 
ATOM   3246 C CZ  A ARG A 1 424 ? 13.131  -7.107  18.835  0.48 56.29  ? 424  ARG A CZ  1 
ATOM   3247 C CZ  B ARG A 1 424 ? 10.392  -7.626  16.352  0.52 57.49  ? 424  ARG A CZ  1 
ATOM   3248 N NH1 A ARG A 1 424 ? 12.693  -5.987  19.398  0.48 48.15  ? 424  ARG A NH1 1 
ATOM   3249 N NH1 B ARG A 1 424 ? 10.190  -7.354  17.636  0.52 60.07  ? 424  ARG A NH1 1 
ATOM   3250 N NH2 A ARG A 1 424 ? 13.531  -8.118  19.593  0.48 60.10  ? 424  ARG A NH2 1 
ATOM   3251 N NH2 B ARG A 1 424 ? 9.509   -8.357  15.686  0.52 57.98  ? 424  ARG A NH2 1 
ATOM   3252 N N   . VAL A 1 425 ? 15.549  -3.850  13.180  1.00 40.80  ? 425  VAL A N   1 
ATOM   3253 C CA  . VAL A 1 425 ? 15.797  -2.444  12.840  1.00 37.41  ? 425  VAL A CA  1 
ATOM   3254 C C   . VAL A 1 425 ? 14.526  -1.597  12.840  1.00 35.84  ? 425  VAL A C   1 
ATOM   3255 O O   . VAL A 1 425 ? 13.512  -2.010  12.303  1.00 39.92  ? 425  VAL A O   1 
ATOM   3256 C CB  . VAL A 1 425 ? 16.416  -2.315  11.418  1.00 56.22  ? 425  VAL A CB  1 
ATOM   3257 C CG1 . VAL A 1 425 ? 16.829  -0.864  11.128  1.00 31.43  ? 425  VAL A CG1 1 
ATOM   3258 C CG2 . VAL A 1 425 ? 17.586  -3.273  11.239  1.00 34.39  ? 425  VAL A CG2 1 
ATOM   3259 N N   . TYR A 1 426 ? 14.591  -0.404  13.422  1.00 33.40  ? 426  TYR A N   1 
ATOM   3260 C CA  . TYR A 1 426 ? 13.510  0.560   13.293  1.00 32.04  ? 426  TYR A CA  1 
ATOM   3261 C C   . TYR A 1 426 ? 14.064  1.823   12.657  1.00 38.47  ? 426  TYR A C   1 
ATOM   3262 O O   . TYR A 1 426 ? 15.123  2.303   13.054  1.00 39.96  ? 426  TYR A O   1 
ATOM   3263 C CB  . TYR A 1 426 ? 12.884  0.878   14.652  1.00 32.17  ? 426  TYR A CB  1 
ATOM   3264 C CG  . TYR A 1 426 ? 12.165  -0.300  15.280  1.00 34.61  ? 426  TYR A CG  1 
ATOM   3265 C CD1 . TYR A 1 426 ? 10.816  -0.572  15.002  1.00 37.23  ? 426  TYR A CD1 1 
ATOM   3266 C CD2 . TYR A 1 426 ? 12.827  -1.146  16.150  1.00 37.39  ? 426  TYR A CD2 1 
ATOM   3267 C CE1 . TYR A 1 426 ? 10.166  -1.661  15.584  1.00 38.36  ? 426  TYR A CE1 1 
ATOM   3268 C CE2 . TYR A 1 426 ? 12.187  -2.232  16.729  1.00 42.77  ? 426  TYR A CE2 1 
ATOM   3269 C CZ  . TYR A 1 426 ? 10.867  -2.489  16.450  1.00 47.01  ? 426  TYR A CZ  1 
ATOM   3270 O OH  . TYR A 1 426 ? 10.277  -3.584  17.057  1.00 50.35  ? 426  TYR A OH  1 
ATOM   3271 N N   . ALA A 1 427 ? 13.356  2.360   11.668  1.00 30.36  ? 427  ALA A N   1 
ATOM   3272 C CA  . ALA A 1 427 ? 13.828  3.547   10.962  1.00 32.69  ? 427  ALA A CA  1 
ATOM   3273 C C   . ALA A 1 427 ? 12.824  4.689   11.011  1.00 34.74  ? 427  ALA A C   1 
ATOM   3274 O O   . ALA A 1 427 ? 11.620  4.459   11.032  1.00 36.71  ? 427  ALA A O   1 
ATOM   3275 C CB  . ALA A 1 427 ? 14.203  3.212   9.505   1.00 29.05  ? 427  ALA A CB  1 
ATOM   3276 N N   . TYR A 1 428 ? 13.329  5.922   11.015  1.00 36.60  ? 428  TYR A N   1 
ATOM   3277 C CA  . TYR A 1 428 ? 12.475  7.103   11.078  1.00 37.71  ? 428  TYR A CA  1 
ATOM   3278 C C   . TYR A 1 428 ? 13.012  8.221   10.188  1.00 38.68  ? 428  TYR A C   1 
ATOM   3279 O O   . TYR A 1 428 ? 14.211  8.281   9.891   1.00 30.06  ? 428  TYR A O   1 
ATOM   3280 C CB  . TYR A 1 428 ? 12.391  7.638   12.519  1.00 37.65  ? 428  TYR A CB  1 
ATOM   3281 C CG  . TYR A 1 428 ? 13.705  8.228   13.028  1.00 36.23  ? 428  TYR A CG  1 
ATOM   3282 C CD1 . TYR A 1 428 ? 14.099  9.530   12.697  1.00 32.90  ? 428  TYR A CD1 1 
ATOM   3283 C CD2 . TYR A 1 428 ? 14.552  7.485   13.844  1.00 33.49  ? 428  TYR A CD2 1 
ATOM   3284 C CE1 . TYR A 1 428 ? 15.308  10.058  13.150  1.00 25.47  ? 428  TYR A CE1 1 
ATOM   3285 C CE2 . TYR A 1 428 ? 15.757  8.012   14.309  1.00 32.11  ? 428  TYR A CE2 1 
ATOM   3286 C CZ  . TYR A 1 428 ? 16.126  9.290   13.960  1.00 29.32  ? 428  TYR A CZ  1 
ATOM   3287 O OH  . TYR A 1 428 ? 17.316  9.794   14.428  1.00 34.10  ? 428  TYR A OH  1 
ATOM   3288 N N   . ILE A 1 429 ? 12.125  9.133   9.802   1.00 43.94  ? 429  ILE A N   1 
ATOM   3289 C CA  . ILE A 1 429 ? 12.559  10.439  9.319   1.00 37.85  ? 429  ILE A CA  1 
ATOM   3290 C C   . ILE A 1 429 ? 11.957  11.523  10.209  1.00 36.30  ? 429  ILE A C   1 
ATOM   3291 O O   . ILE A 1 429 ? 10.747  11.532  10.479  1.00 35.97  ? 429  ILE A O   1 
ATOM   3292 C CB  . ILE A 1 429 ? 12.211  10.671  7.841   1.00 33.41  ? 429  ILE A CB  1 
ATOM   3293 C CG1 . ILE A 1 429 ? 12.720  12.034  7.387   1.00 33.15  ? 429  ILE A CG1 1 
ATOM   3294 C CG2 . ILE A 1 429 ? 10.719  10.522  7.610   1.00 39.83  ? 429  ILE A CG2 1 
ATOM   3295 C CD1 . ILE A 1 429 ? 12.592  12.251  5.896   1.00 36.44  ? 429  ILE A CD1 1 
ATOM   3296 N N   . PHE A 1 430 ? 12.816  12.414  10.691  1.00 28.74  ? 430  PHE A N   1 
ATOM   3297 C CA  . PHE A 1 430 ? 12.394  13.494  11.564  1.00 29.21  ? 430  PHE A CA  1 
ATOM   3298 C C   . PHE A 1 430 ? 12.115  14.752  10.752  1.00 31.07  ? 430  PHE A C   1 
ATOM   3299 O O   . PHE A 1 430 ? 13.006  15.281  10.098  1.00 33.40  ? 430  PHE A O   1 
ATOM   3300 C CB  . PHE A 1 430 ? 13.492  13.763  12.574  1.00 25.66  ? 430  PHE A CB  1 
ATOM   3301 C CG  . PHE A 1 430 ? 13.121  14.748  13.621  1.00 27.55  ? 430  PHE A CG  1 
ATOM   3302 C CD1 . PHE A 1 430 ? 13.335  16.107  13.424  1.00 29.39  ? 430  PHE A CD1 1 
ATOM   3303 C CD2 . PHE A 1 430 ? 12.588  14.322  14.820  1.00 31.69  ? 430  PHE A CD2 1 
ATOM   3304 C CE1 . PHE A 1 430 ? 13.012  17.025  14.408  1.00 27.71  ? 430  PHE A CE1 1 
ATOM   3305 C CE2 . PHE A 1 430 ? 12.262  15.238  15.809  1.00 36.20  ? 430  PHE A CE2 1 
ATOM   3306 C CZ  . PHE A 1 430 ? 12.471  16.590  15.599  1.00 30.73  ? 430  PHE A CZ  1 
ATOM   3307 N N   . GLU A 1 431 ? 10.882  15.245  10.811  1.00 39.48  ? 431  GLU A N   1 
ATOM   3308 C CA  . GLU A 1 431 ? 10.437  16.274  9.873   1.00 40.11  ? 431  GLU A CA  1 
ATOM   3309 C C   . GLU A 1 431 ? 9.914   17.563  10.508  1.00 46.14  ? 431  GLU A C   1 
ATOM   3310 O O   . GLU A 1 431 ? 9.438   18.442  9.794   1.00 45.68  ? 431  GLU A O   1 
ATOM   3311 C CB  . GLU A 1 431 ? 9.334   15.718  8.978   1.00 39.75  ? 431  GLU A CB  1 
ATOM   3312 C CG  . GLU A 1 431 ? 9.730   14.560  8.097   1.00 43.57  ? 431  GLU A CG  1 
ATOM   3313 C CD  . GLU A 1 431 ? 8.679   14.281  7.019   1.00 46.78  ? 431  GLU A CD  1 
ATOM   3314 O OE1 . GLU A 1 431 ? 7.501   14.031  7.376   1.00 41.34  ? 431  GLU A OE1 1 
ATOM   3315 O OE2 . GLU A 1 431 ? 9.038   14.332  5.817   1.00 47.46  ? 431  GLU A OE2 1 
ATOM   3316 N N   . HIS A 1 432 ? 9.963   17.679  11.832  1.00 44.49  ? 432  HIS A N   1 
ATOM   3317 C CA  . HIS A 1 432 ? 9.480   18.903  12.472  1.00 37.73  ? 432  HIS A CA  1 
ATOM   3318 C C   . HIS A 1 432 ? 10.591  19.941  12.635  1.00 38.90  ? 432  HIS A C   1 
ATOM   3319 O O   . HIS A 1 432 ? 11.691  19.641  13.099  1.00 34.83  ? 432  HIS A O   1 
ATOM   3320 C CB  . HIS A 1 432 ? 8.824   18.625  13.823  1.00 29.58  ? 432  HIS A CB  1 
ATOM   3321 C CG  . HIS A 1 432 ? 8.500   19.868  14.601  1.00 39.82  ? 432  HIS A CG  1 
ATOM   3322 N ND1 . HIS A 1 432 ? 7.421   20.677  14.303  1.00 41.28  ? 432  HIS A ND1 1 
ATOM   3323 C CD2 . HIS A 1 432 ? 9.112   20.440  15.667  1.00 35.82  ? 432  HIS A CD2 1 
ATOM   3324 C CE1 . HIS A 1 432 ? 7.381   21.688  15.152  1.00 39.79  ? 432  HIS A CE1 1 
ATOM   3325 N NE2 . HIS A 1 432 ? 8.397   21.571  15.988  1.00 39.67  ? 432  HIS A NE2 1 
ATOM   3326 N N   A ARG A 1 433 ? 10.292  21.168  12.225  0.40 37.68  ? 433  ARG A N   1 
ATOM   3327 N N   B ARG A 1 433 ? 10.282  21.172  12.262  0.60 37.36  ? 433  ARG A N   1 
ATOM   3328 C CA  A ARG A 1 433 ? 11.211  22.284  12.389  0.40 37.60  ? 433  ARG A CA  1 
ATOM   3329 C CA  B ARG A 1 433 ? 11.229  22.263  12.382  0.60 37.59  ? 433  ARG A CA  1 
ATOM   3330 C C   A ARG A 1 433 ? 10.838  23.033  13.662  0.40 38.66  ? 433  ARG A C   1 
ATOM   3331 C C   B ARG A 1 433 ? 10.862  23.078  13.624  0.60 39.18  ? 433  ARG A C   1 
ATOM   3332 O O   A ARG A 1 433 ? 9.686   23.449  13.825  0.40 38.54  ? 433  ARG A O   1 
ATOM   3333 O O   B ARG A 1 433 ? 9.733   23.575  13.730  0.60 38.10  ? 433  ARG A O   1 
ATOM   3334 C CB  A ARG A 1 433 ? 11.121  23.222  11.183  0.40 38.10  ? 433  ARG A CB  1 
ATOM   3335 C CB  B ARG A 1 433 ? 11.163  23.120  11.119  0.60 37.62  ? 433  ARG A CB  1 
ATOM   3336 C CG  A ARG A 1 433 ? 11.849  24.545  11.350  0.40 38.97  ? 433  ARG A CG  1 
ATOM   3337 C CG  B ARG A 1 433 ? 12.201  24.199  11.029  0.60 38.26  ? 433  ARG A CG  1 
ATOM   3338 C CD  A ARG A 1 433 ? 11.417  25.549  10.286  0.40 38.78  ? 433  ARG A CD  1 
ATOM   3339 C CD  B ARG A 1 433 ? 12.049  24.999  9.744   0.60 36.34  ? 433  ARG A CD  1 
ATOM   3340 N NE  A ARG A 1 433 ? 12.180  26.797  10.341  0.40 42.15  ? 433  ARG A NE  1 
ATOM   3341 N NE  B ARG A 1 433 ? 12.503  26.371  9.936   0.60 37.53  ? 433  ARG A NE  1 
ATOM   3342 C CZ  A ARG A 1 433 ? 11.922  27.804  11.175  0.40 47.99  ? 433  ARG A CZ  1 
ATOM   3343 C CZ  B ARG A 1 433 ? 13.686  26.839  9.557   0.60 35.53  ? 433  ARG A CZ  1 
ATOM   3344 N NH1 A ARG A 1 433 ? 10.924  27.720  12.048  0.40 32.76  ? 433  ARG A NH1 1 
ATOM   3345 N NH1 B ARG A 1 433 ? 14.549  26.055  8.927   0.60 26.94  ? 433  ARG A NH1 1 
ATOM   3346 N NH2 A ARG A 1 433 ? 12.675  28.896  11.144  0.40 48.41  ? 433  ARG A NH2 1 
ATOM   3347 N NH2 B ARG A 1 433 ? 13.993  28.105  9.794   0.60 38.15  ? 433  ARG A NH2 1 
ATOM   3348 N N   . ALA A 1 434 ? 11.804  23.192  14.564  1.00 35.16  ? 434  ALA A N   1 
ATOM   3349 C CA  . ALA A 1 434 ? 11.558  23.895  15.824  1.00 33.13  ? 434  ALA A CA  1 
ATOM   3350 C C   . ALA A 1 434 ? 11.102  25.317  15.568  1.00 40.14  ? 434  ALA A C   1 
ATOM   3351 O O   . ALA A 1 434 ? 11.684  26.017  14.734  1.00 41.47  ? 434  ALA A O   1 
ATOM   3352 C CB  . ALA A 1 434 ? 12.788  23.903  16.686  1.00 32.18  ? 434  ALA A CB  1 
ATOM   3353 N N   . SER A 1 435 ? 10.061  25.739  16.284  1.00 32.84  ? 435  SER A N   1 
ATOM   3354 C CA  . SER A 1 435 ? 9.544   27.095  16.140  1.00 44.47  ? 435  SER A CA  1 
ATOM   3355 C C   . SER A 1 435 ? 10.574  28.100  16.633  1.00 45.59  ? 435  SER A C   1 
ATOM   3356 O O   . SER A 1 435 ? 10.488  29.284  16.337  1.00 46.63  ? 435  SER A O   1 
ATOM   3357 C CB  . SER A 1 435 ? 8.201   27.276  16.878  1.00 40.91  ? 435  SER A CB  1 
ATOM   3358 O OG  . SER A 1 435 ? 8.289   26.910  18.245  1.00 42.83  ? 435  SER A OG  1 
ATOM   3359 N N   . THR A 1 436 ? 11.557  27.608  17.375  1.00 49.59  ? 436  THR A N   1 
ATOM   3360 C CA  . THR A 1 436 ? 12.620  28.443  17.923  1.00 53.37  ? 436  THR A CA  1 
ATOM   3361 C C   . THR A 1 436 ? 13.887  28.474  17.050  1.00 48.15  ? 436  THR A C   1 
ATOM   3362 O O   . THR A 1 436 ? 14.887  29.066  17.436  1.00 48.12  ? 436  THR A O   1 
ATOM   3363 C CB  . THR A 1 436 ? 12.995  27.976  19.357  1.00 39.74  ? 436  THR A CB  1 
ATOM   3364 O OG1 . THR A 1 436 ? 13.526  26.645  19.311  1.00 37.00  ? 436  THR A OG1 1 
ATOM   3365 C CG2 . THR A 1 436 ? 11.765  27.979  20.254  1.00 41.59  ? 436  THR A CG2 1 
ATOM   3366 N N   . LEU A 1 437 ? 13.841  27.845  15.878  1.00 48.28  ? 437  LEU A N   1 
ATOM   3367 C CA  . LEU A 1 437 ? 15.016  27.732  14.998  1.00 44.19  ? 437  LEU A CA  1 
ATOM   3368 C C   . LEU A 1 437 ? 15.460  29.090  14.418  1.00 46.53  ? 437  LEU A C   1 
ATOM   3369 O O   . LEU A 1 437 ? 14.631  29.882  13.954  1.00 46.25  ? 437  LEU A O   1 
ATOM   3370 C CB  . LEU A 1 437 ? 14.719  26.748  13.865  1.00 44.30  ? 437  LEU A CB  1 
ATOM   3371 C CG  . LEU A 1 437 ? 15.886  25.987  13.237  1.00 51.10  ? 437  LEU A CG  1 
ATOM   3372 C CD1 . LEU A 1 437 ? 16.493  25.075  14.255  1.00 47.80  ? 437  LEU A CD1 1 
ATOM   3373 C CD2 . LEU A 1 437 ? 15.412  25.185  12.047  1.00 52.24  ? 437  LEU A CD2 1 
ATOM   3374 N N   . THR A 1 438 ? 16.766  29.353  14.441  1.00 48.46  ? 438  THR A N   1 
ATOM   3375 C CA  . THR A 1 438 ? 17.291  30.647  13.998  1.00 51.13  ? 438  THR A CA  1 
ATOM   3376 C C   . THR A 1 438 ? 17.826  30.603  12.564  1.00 55.08  ? 438  THR A C   1 
ATOM   3377 O O   . THR A 1 438 ? 18.174  31.637  11.997  1.00 58.94  ? 438  THR A O   1 
ATOM   3378 C CB  . THR A 1 438 ? 18.395  31.191  14.953  1.00 52.36  ? 438  THR A CB  1 
ATOM   3379 O OG1 . THR A 1 438 ? 19.456  30.233  15.066  1.00 59.75  ? 438  THR A OG1 1 
ATOM   3380 C CG2 . THR A 1 438 ? 17.834  31.458  16.340  1.00 48.27  ? 438  THR A CG2 1 
ATOM   3381 N N   . TRP A 1 439 ? 17.900  29.405  11.987  1.00 54.01  ? 439  TRP A N   1 
ATOM   3382 C CA  . TRP A 1 439 ? 18.300  29.252  10.588  1.00 49.39  ? 439  TRP A CA  1 
ATOM   3383 C C   . TRP A 1 439 ? 17.133  29.671  9.697   1.00 48.24  ? 439  TRP A C   1 
ATOM   3384 O O   . TRP A 1 439 ? 15.987  29.612  10.127  1.00 48.91  ? 439  TRP A O   1 
ATOM   3385 C CB  . TRP A 1 439 ? 18.713  27.803  10.290  1.00 41.72  ? 439  TRP A CB  1 
ATOM   3386 C CG  . TRP A 1 439 ? 19.906  27.334  11.055  1.00 35.47  ? 439  TRP A CG  1 
ATOM   3387 C CD1 . TRP A 1 439 ? 19.915  26.462  12.115  1.00 43.09  ? 439  TRP A CD1 1 
ATOM   3388 C CD2 . TRP A 1 439 ? 21.272  27.704  10.832  1.00 33.67  ? 439  TRP A CD2 1 
ATOM   3389 N NE1 . TRP A 1 439 ? 21.208  26.276  12.569  1.00 37.77  ? 439  TRP A NE1 1 
ATOM   3390 C CE2 . TRP A 1 439 ? 22.057  27.022  11.796  1.00 37.35  ? 439  TRP A CE2 1 
ATOM   3391 C CE3 . TRP A 1 439 ? 21.911  28.540  9.913   1.00 35.26  ? 439  TRP A CE3 1 
ATOM   3392 C CZ2 . TRP A 1 439 ? 23.445  27.158  11.863  1.00 37.01  ? 439  TRP A CZ2 1 
ATOM   3393 C CZ3 . TRP A 1 439 ? 23.293  28.669  9.976   1.00 35.30  ? 439  TRP A CZ3 1 
ATOM   3394 C CH2 . TRP A 1 439 ? 24.044  27.982  10.948  1.00 39.71  ? 439  TRP A CH2 1 
ATOM   3395 N N   . PRO A 1 440 ? 17.419  30.111  8.458   1.00 44.04  ? 440  PRO A N   1 
ATOM   3396 C CA  . PRO A 1 440 ? 16.356  30.524  7.524   1.00 33.95  ? 440  PRO A CA  1 
ATOM   3397 C C   . PRO A 1 440 ? 15.437  29.365  7.134   1.00 38.08  ? 440  PRO A C   1 
ATOM   3398 O O   . PRO A 1 440 ? 15.782  28.204  7.350   1.00 41.16  ? 440  PRO A O   1 
ATOM   3399 C CB  . PRO A 1 440 ? 17.137  31.001  6.295   1.00 39.03  ? 440  PRO A CB  1 
ATOM   3400 C CG  . PRO A 1 440 ? 18.452  30.272  6.371   1.00 42.31  ? 440  PRO A CG  1 
ATOM   3401 C CD  . PRO A 1 440 ? 18.758  30.210  7.848   1.00 44.04  ? 440  PRO A CD  1 
ATOM   3402 N N   . LEU A 1 441 ? 14.280  29.678  6.564   1.00 39.39  ? 441  LEU A N   1 
ATOM   3403 C CA  . LEU A 1 441 ? 13.297  28.655  6.240   1.00 40.69  ? 441  LEU A CA  1 
ATOM   3404 C C   . LEU A 1 441 ? 13.808  27.675  5.196   1.00 47.14  ? 441  LEU A C   1 
ATOM   3405 O O   . LEU A 1 441 ? 13.468  26.494  5.231   1.00 46.21  ? 441  LEU A O   1 
ATOM   3406 C CB  . LEU A 1 441 ? 11.994  29.293  5.749   1.00 47.08  ? 441  LEU A CB  1 
ATOM   3407 C CG  . LEU A 1 441 ? 10.795  29.261  6.703   1.00 62.92  ? 441  LEU A CG  1 
ATOM   3408 C CD1 . LEU A 1 441 ? 10.183  27.863  6.778   1.00 64.85  ? 441  LEU A CD1 1 
ATOM   3409 C CD2 . LEU A 1 441 ? 11.199  29.735  8.099   1.00 68.67  ? 441  LEU A CD2 1 
ATOM   3410 N N   . TRP A 1 442 ? 14.619  28.159  4.262   1.00 46.43  ? 442  TRP A N   1 
ATOM   3411 C CA  . TRP A 1 442 ? 15.015  27.322  3.139   1.00 38.24  ? 442  TRP A CA  1 
ATOM   3412 C C   . TRP A 1 442 ? 15.821  26.103  3.608   1.00 38.45  ? 442  TRP A C   1 
ATOM   3413 O O   . TRP A 1 442 ? 15.851  25.078  2.930   1.00 33.12  ? 442  TRP A O   1 
ATOM   3414 C CB  . TRP A 1 442 ? 15.745  28.122  2.039   1.00 34.21  ? 442  TRP A CB  1 
ATOM   3415 C CG  . TRP A 1 442 ? 17.159  28.561  2.351   1.00 35.31  ? 442  TRP A CG  1 
ATOM   3416 C CD1 . TRP A 1 442 ? 17.569  29.818  2.736   1.00 39.84  ? 442  TRP A CD1 1 
ATOM   3417 C CD2 . TRP A 1 442 ? 18.356  27.758  2.276   1.00 32.63  ? 442  TRP A CD2 1 
ATOM   3418 N NE1 . TRP A 1 442 ? 18.940  29.834  2.924   1.00 34.98  ? 442  TRP A NE1 1 
ATOM   3419 C CE2 . TRP A 1 442 ? 19.442  28.586  2.641   1.00 28.92  ? 442  TRP A CE2 1 
ATOM   3420 C CE3 . TRP A 1 442 ? 18.613  26.422  1.936   1.00 34.23  ? 442  TRP A CE3 1 
ATOM   3421 C CZ2 . TRP A 1 442 ? 20.751  28.117  2.688   1.00 29.90  ? 442  TRP A CZ2 1 
ATOM   3422 C CZ3 . TRP A 1 442 ? 19.928  25.957  1.982   1.00 28.65  ? 442  TRP A CZ3 1 
ATOM   3423 C CH2 . TRP A 1 442 ? 20.972  26.799  2.359   1.00 31.42  ? 442  TRP A CH2 1 
ATOM   3424 N N   . MET A 1 443 ? 16.447  26.202  4.777   1.00 33.06  ? 443  MET A N   1 
ATOM   3425 C CA  . MET A 1 443 ? 17.238  25.087  5.291   1.00 32.39  ? 443  MET A CA  1 
ATOM   3426 C C   . MET A 1 443 ? 16.386  23.939  5.850   1.00 32.99  ? 443  MET A C   1 
ATOM   3427 O O   . MET A 1 443 ? 16.916  22.884  6.177   1.00 30.11  ? 443  MET A O   1 
ATOM   3428 C CB  . MET A 1 443 ? 18.243  25.568  6.335   1.00 34.94  ? 443  MET A CB  1 
ATOM   3429 C CG  . MET A 1 443 ? 19.330  26.437  5.740   1.00 43.50  ? 443  MET A CG  1 
ATOM   3430 S SD  . MET A 1 443 ? 20.505  27.054  6.957   1.00 44.00  ? 443  MET A SD  1 
ATOM   3431 C CE  . MET A 1 443 ? 21.218  25.530  7.515   1.00 45.26  ? 443  MET A CE  1 
ATOM   3432 N N   . GLY A 1 444 ? 15.075  24.139  5.954   1.00 25.08  ? 444  GLY A N   1 
ATOM   3433 C CA  . GLY A 1 444 ? 14.188  23.087  6.427   1.00 31.34  ? 444  GLY A CA  1 
ATOM   3434 C C   . GLY A 1 444 ? 14.522  22.618  7.839   1.00 34.53  ? 444  GLY A C   1 
ATOM   3435 O O   . GLY A 1 444 ? 14.691  23.437  8.743   1.00 29.51  ? 444  GLY A O   1 
ATOM   3436 N N   . VAL A 1 445 ? 14.608  21.301  8.025   1.00 33.78  ? 445  VAL A N   1 
ATOM   3437 C CA  . VAL A 1 445 ? 14.988  20.705  9.309   1.00 33.39  ? 445  VAL A CA  1 
ATOM   3438 C C   . VAL A 1 445 ? 16.437  20.241  9.189   1.00 30.52  ? 445  VAL A C   1 
ATOM   3439 O O   . VAL A 1 445 ? 16.704  19.152  8.670   1.00 34.04  ? 445  VAL A O   1 
ATOM   3440 C CB  . VAL A 1 445 ? 14.097  19.482  9.659   1.00 26.50  ? 445  VAL A CB  1 
ATOM   3441 C CG1 . VAL A 1 445 ? 14.502  18.869  10.999  1.00 22.91  ? 445  VAL A CG1 1 
ATOM   3442 C CG2 . VAL A 1 445 ? 12.605  19.859  9.668   1.00 30.13  ? 445  VAL A CG2 1 
ATOM   3443 N N   . PRO A 1 446 ? 17.382  21.075  9.640   1.00 24.31  ? 446  PRO A N   1 
ATOM   3444 C CA  . PRO A 1 446 ? 18.799  20.802  9.374   1.00 21.49  ? 446  PRO A CA  1 
ATOM   3445 C C   . PRO A 1 446 ? 19.388  19.763  10.316  1.00 32.51  ? 446  PRO A C   1 
ATOM   3446 O O   . PRO A 1 446 ? 18.861  19.516  11.395  1.00 31.11  ? 446  PRO A O   1 
ATOM   3447 C CB  . PRO A 1 446 ? 19.476  22.157  9.618   1.00 20.68  ? 446  PRO A CB  1 
ATOM   3448 C CG  . PRO A 1 446 ? 18.330  23.175  9.749   1.00 21.92  ? 446  PRO A CG  1 
ATOM   3449 C CD  . PRO A 1 446 ? 17.188  22.383  10.288  1.00 30.00  ? 446  PRO A CD  1 
ATOM   3450 N N   . HIS A 1 447 ? 20.470  19.149  9.855   1.00 36.79  ? 447  HIS A N   1 
ATOM   3451 C CA  . HIS A 1 447 ? 21.319  18.245  10.616  1.00 34.30  ? 447  HIS A CA  1 
ATOM   3452 C C   . HIS A 1 447 ? 21.535  18.706  12.075  1.00 38.46  ? 447  HIS A C   1 
ATOM   3453 O O   . HIS A 1 447 ? 22.018  19.820  12.320  1.00 34.04  ? 447  HIS A O   1 
ATOM   3454 C CB  . HIS A 1 447 ? 22.661  18.189  9.886   1.00 29.99  ? 447  HIS A CB  1 
ATOM   3455 C CG  . HIS A 1 447 ? 23.571  17.092  10.334  1.00 34.46  ? 447  HIS A CG  1 
ATOM   3456 N ND1 . HIS A 1 447 ? 23.338  15.764  10.042  1.00 35.33  ? 447  HIS A ND1 1 
ATOM   3457 C CD2 . HIS A 1 447 ? 24.740  17.129  11.017  1.00 36.70  ? 447  HIS A CD2 1 
ATOM   3458 C CE1 . HIS A 1 447 ? 24.321  15.028  10.533  1.00 31.59  ? 447  HIS A CE1 1 
ATOM   3459 N NE2 . HIS A 1 447 ? 25.183  15.832  11.134  1.00 36.70  ? 447  HIS A NE2 1 
ATOM   3460 N N   . GLY A 1 448 ? 21.172  17.844  13.029  1.00 34.46  ? 448  GLY A N   1 
ATOM   3461 C CA  . GLY A 1 448 ? 21.402  18.102  14.442  1.00 32.00  ? 448  GLY A CA  1 
ATOM   3462 C C   . GLY A 1 448 ? 20.201  18.669  15.187  1.00 35.70  ? 448  GLY A C   1 
ATOM   3463 O O   . GLY A 1 448 ? 20.219  18.793  16.409  1.00 34.39  ? 448  GLY A O   1 
ATOM   3464 N N   . TYR A 1 449 ? 19.141  19.004  14.462  1.00 23.20  ? 449  TYR A N   1 
ATOM   3465 C CA  . TYR A 1 449 ? 18.042  19.719  15.094  1.00 28.28  ? 449  TYR A CA  1 
ATOM   3466 C C   . TYR A 1 449 ? 16.851  18.873  15.547  1.00 30.21  ? 449  TYR A C   1 
ATOM   3467 O O   . TYR A 1 449 ? 15.797  19.406  15.870  1.00 28.54  ? 449  TYR A O   1 
ATOM   3468 C CB  . TYR A 1 449 ? 17.640  20.949  14.273  1.00 25.95  ? 449  TYR A CB  1 
ATOM   3469 C CG  . TYR A 1 449 ? 18.698  22.017  14.419  1.00 27.76  ? 449  TYR A CG  1 
ATOM   3470 C CD1 . TYR A 1 449 ? 18.666  22.920  15.487  1.00 29.37  ? 449  TYR A CD1 1 
ATOM   3471 C CD2 . TYR A 1 449 ? 19.776  22.076  13.544  1.00 24.52  ? 449  TYR A CD2 1 
ATOM   3472 C CE1 . TYR A 1 449 ? 19.653  23.902  15.641  1.00 23.47  ? 449  TYR A CE1 1 
ATOM   3473 C CE2 . TYR A 1 449 ? 20.775  23.030  13.700  1.00 24.18  ? 449  TYR A CE2 1 
ATOM   3474 C CZ  . TYR A 1 449 ? 20.702  23.940  14.747  1.00 26.26  ? 449  TYR A CZ  1 
ATOM   3475 O OH  . TYR A 1 449 ? 21.694  24.874  14.884  1.00 31.59  ? 449  TYR A OH  1 
ATOM   3476 N N   . GLU A 1 450 ? 17.043  17.559  15.610  1.00 29.50  ? 450  GLU A N   1 
ATOM   3477 C CA  . GLU A 1 450 ? 16.096  16.693  16.300  1.00 29.64  ? 450  GLU A CA  1 
ATOM   3478 C C   . GLU A 1 450 ? 16.579  16.464  17.733  1.00 30.85  ? 450  GLU A C   1 
ATOM   3479 O O   . GLU A 1 450 ? 15.770  16.188  18.624  1.00 31.84  ? 450  GLU A O   1 
ATOM   3480 C CB  . GLU A 1 450 ? 15.938  15.356  15.564  1.00 21.51  ? 450  GLU A CB  1 
ATOM   3481 C CG  . GLU A 1 450 ? 16.978  14.289  15.907  1.00 20.79  ? 450  GLU A CG  1 
ATOM   3482 C CD  . GLU A 1 450 ? 18.370  14.571  15.360  1.00 29.18  ? 450  GLU A CD  1 
ATOM   3483 O OE1 . GLU A 1 450 ? 18.685  15.735  15.031  1.00 26.07  ? 450  GLU A OE1 1 
ATOM   3484 O OE2 . GLU A 1 450 ? 19.160  13.607  15.248  1.00 37.32  ? 450  GLU A OE2 1 
ATOM   3485 N N   . ILE A 1 451 ? 17.893  16.603  17.944  1.00 23.29  ? 451  ILE A N   1 
ATOM   3486 C CA  . ILE A 1 451 ? 18.538  16.265  19.222  1.00 28.51  ? 451  ILE A CA  1 
ATOM   3487 C C   . ILE A 1 451 ? 17.846  16.893  20.430  1.00 33.24  ? 451  ILE A C   1 
ATOM   3488 O O   . ILE A 1 451 ? 17.672  16.237  21.459  1.00 36.81  ? 451  ILE A O   1 
ATOM   3489 C CB  . ILE A 1 451 ? 20.050  16.679  19.262  1.00 25.08  ? 451  ILE A CB  1 
ATOM   3490 C CG1 . ILE A 1 451 ? 20.848  15.979  18.163  1.00 19.34  ? 451  ILE A CG1 1 
ATOM   3491 C CG2 . ILE A 1 451 ? 20.664  16.350  20.617  1.00 25.42  ? 451  ILE A CG2 1 
ATOM   3492 C CD1 . ILE A 1 451 ? 22.368  16.249  18.234  1.00 28.46  ? 451  ILE A CD1 1 
ATOM   3493 N N   . GLU A 1 452 ? 17.447  18.159  20.298  1.00 27.49  ? 452  GLU A N   1 
ATOM   3494 C CA  . GLU A 1 452 ? 16.851  18.889  21.414  1.00 25.51  ? 452  GLU A CA  1 
ATOM   3495 C C   . GLU A 1 452 ? 15.467  18.336  21.779  1.00 29.96  ? 452  GLU A C   1 
ATOM   3496 O O   . GLU A 1 452 ? 15.027  18.450  22.928  1.00 30.00  ? 452  GLU A O   1 
ATOM   3497 C CB  . GLU A 1 452 ? 16.777  20.399  21.123  1.00 31.75  ? 452  GLU A CB  1 
ATOM   3498 C CG  . GLU A 1 452 ? 15.916  20.771  19.895  1.00 34.88  ? 452  GLU A CG  1 
ATOM   3499 C CD  . GLU A 1 452 ? 16.316  22.101  19.267  1.00 34.93  ? 452  GLU A CD  1 
ATOM   3500 O OE1 . GLU A 1 452 ? 17.426  22.202  18.700  1.00 36.16  ? 452  GLU A OE1 1 
ATOM   3501 O OE2 . GLU A 1 452 ? 15.519  23.053  19.343  1.00 38.03  ? 452  GLU A OE2 1 
ATOM   3502 N N   . PHE A 1 453 ? 14.784  17.743  20.807  1.00 24.28  ? 453  PHE A N   1 
ATOM   3503 C CA  . PHE A 1 453 ? 13.492  17.124  21.089  1.00 27.43  ? 453  PHE A CA  1 
ATOM   3504 C C   . PHE A 1 453 ? 13.633  15.775  21.785  1.00 28.75  ? 453  PHE A C   1 
ATOM   3505 O O   . PHE A 1 453 ? 12.835  15.448  22.660  1.00 27.69  ? 453  PHE A O   1 
ATOM   3506 C CB  . PHE A 1 453 ? 12.665  16.995  19.814  1.00 31.68  ? 453  PHE A CB  1 
ATOM   3507 C CG  . PHE A 1 453 ? 12.182  18.311  19.298  1.00 35.47  ? 453  PHE A CG  1 
ATOM   3508 C CD1 . PHE A 1 453 ? 12.963  19.062  18.444  1.00 34.83  ? 453  PHE A CD1 1 
ATOM   3509 C CD2 . PHE A 1 453 ? 10.971  18.819  19.708  1.00 30.28  ? 453  PHE A CD2 1 
ATOM   3510 C CE1 . PHE A 1 453 ? 12.529  20.282  17.991  1.00 36.19  ? 453  PHE A CE1 1 
ATOM   3511 C CE2 . PHE A 1 453 ? 10.536  20.038  19.260  1.00 34.22  ? 453  PHE A CE2 1 
ATOM   3512 C CZ  . PHE A 1 453 ? 11.311  20.772  18.404  1.00 33.94  ? 453  PHE A CZ  1 
ATOM   3513 N N   . ILE A 1 454 ? 14.660  15.012  21.407  1.00 26.43  ? 454  ILE A N   1 
ATOM   3514 C CA  . ILE A 1 454 ? 14.896  13.704  21.990  1.00 24.00  ? 454  ILE A CA  1 
ATOM   3515 C C   . ILE A 1 454 ? 15.275  13.840  23.461  1.00 29.11  ? 454  ILE A C   1 
ATOM   3516 O O   . ILE A 1 454 ? 14.908  13.005  24.291  1.00 29.85  ? 454  ILE A O   1 
ATOM   3517 C CB  . ILE A 1 454 ? 16.028  12.967  21.265  1.00 38.57  ? 454  ILE A CB  1 
ATOM   3518 C CG1 . ILE A 1 454 ? 15.824  13.021  19.748  1.00 31.26  ? 454  ILE A CG1 1 
ATOM   3519 C CG2 . ILE A 1 454 ? 16.136  11.522  21.767  1.00 33.90  ? 454  ILE A CG2 1 
ATOM   3520 C CD1 . ILE A 1 454 ? 14.819  12.052  19.251  1.00 28.40  ? 454  ILE A CD1 1 
ATOM   3521 N N   . PHE A 1 455 ? 16.007  14.902  23.781  1.00 30.73  ? 455  PHE A N   1 
ATOM   3522 C CA  . PHE A 1 455 ? 16.466  15.121  25.146  1.00 31.33  ? 455  PHE A CA  1 
ATOM   3523 C C   . PHE A 1 455 ? 15.419  15.837  25.967  1.00 33.39  ? 455  PHE A C   1 
ATOM   3524 O O   . PHE A 1 455 ? 15.580  16.010  27.174  1.00 39.36  ? 455  PHE A O   1 
ATOM   3525 C CB  . PHE A 1 455 ? 17.788  15.890  25.176  1.00 23.56  ? 455  PHE A CB  1 
ATOM   3526 C CG  . PHE A 1 455 ? 19.003  15.011  25.027  1.00 30.45  ? 455  PHE A CG  1 
ATOM   3527 C CD1 . PHE A 1 455 ? 19.414  14.574  23.772  1.00 25.96  ? 455  PHE A CD1 1 
ATOM   3528 C CD2 . PHE A 1 455 ? 19.729  14.612  26.145  1.00 28.96  ? 455  PHE A CD2 1 
ATOM   3529 C CE1 . PHE A 1 455 ? 20.539  13.754  23.634  1.00 23.37  ? 455  PHE A CE1 1 
ATOM   3530 C CE2 . PHE A 1 455 ? 20.847  13.810  26.018  1.00 31.37  ? 455  PHE A CE2 1 
ATOM   3531 C CZ  . PHE A 1 455 ? 21.251  13.373  24.751  1.00 32.99  ? 455  PHE A CZ  1 
ATOM   3532 N N   . GLY A 1 456 ? 14.356  16.270  25.301  1.00 30.49  ? 456  GLY A N   1 
ATOM   3533 C CA  . GLY A 1 456 ? 13.203  16.815  25.989  1.00 30.40  ? 456  GLY A CA  1 
ATOM   3534 C C   . GLY A 1 456 ? 13.364  18.234  26.480  1.00 31.52  ? 456  GLY A C   1 
ATOM   3535 O O   . GLY A 1 456 ? 12.703  18.639  27.433  1.00 35.04  ? 456  GLY A O   1 
ATOM   3536 N N   . LEU A 1 457 ? 14.229  18.998  25.824  1.00 30.31  ? 457  LEU A N   1 
ATOM   3537 C CA  . LEU A 1 457 ? 14.320  20.440  26.096  1.00 36.48  ? 457  LEU A CA  1 
ATOM   3538 C C   . LEU A 1 457 ? 12.997  21.214  26.036  1.00 36.87  ? 457  LEU A C   1 
ATOM   3539 O O   . LEU A 1 457 ? 12.812  22.151  26.806  1.00 40.30  ? 457  LEU A O   1 
ATOM   3540 C CB  . LEU A 1 457 ? 15.363  21.121  25.199  1.00 36.46  ? 457  LEU A CB  1 
ATOM   3541 C CG  . LEU A 1 457 ? 16.784  21.142  25.786  1.00 36.80  ? 457  LEU A CG  1 
ATOM   3542 C CD1 . LEU A 1 457 ? 17.313  19.726  26.010  1.00 28.69  ? 457  LEU A CD1 1 
ATOM   3543 C CD2 . LEU A 1 457 ? 17.743  21.939  24.922  1.00 26.21  ? 457  LEU A CD2 1 
ATOM   3544 N N   . PRO A 1 458 ? 12.075  20.840  25.127  1.00 30.38  ? 458  PRO A N   1 
ATOM   3545 C CA  . PRO A 1 458 ? 10.856  21.661  25.115  1.00 39.82  ? 458  PRO A CA  1 
ATOM   3546 C C   . PRO A 1 458 ? 10.034  21.601  26.403  1.00 39.00  ? 458  PRO A C   1 
ATOM   3547 O O   . PRO A 1 458 ? 9.128   22.408  26.559  1.00 39.65  ? 458  PRO A O   1 
ATOM   3548 C CB  . PRO A 1 458 ? 10.065  21.095  23.930  1.00 37.72  ? 458  PRO A CB  1 
ATOM   3549 C CG  . PRO A 1 458 ? 11.129  20.612  23.005  1.00 41.86  ? 458  PRO A CG  1 
ATOM   3550 C CD  . PRO A 1 458 ? 12.153  19.988  23.925  1.00 29.16  ? 458  PRO A CD  1 
ATOM   3551 N N   . LEU A 1 459 ? 10.369  20.697  27.318  1.00 41.56  ? 459  LEU A N   1 
ATOM   3552 C CA  . LEU A 1 459 ? 9.661   20.591  28.599  1.00 37.96  ? 459  LEU A CA  1 
ATOM   3553 C C   . LEU A 1 459 ? 10.006  21.725  29.547  1.00 40.73  ? 459  LEU A C   1 
ATOM   3554 O O   . LEU A 1 459 ? 9.321   21.937  30.548  1.00 49.26  ? 459  LEU A O   1 
ATOM   3555 C CB  . LEU A 1 459 ? 9.963   19.262  29.280  1.00 35.84  ? 459  LEU A CB  1 
ATOM   3556 C CG  . LEU A 1 459 ? 9.206   18.024  28.810  1.00 39.60  ? 459  LEU A CG  1 
ATOM   3557 C CD1 . LEU A 1 459 ? 9.597   17.611  27.415  1.00 38.77  ? 459  LEU A CD1 1 
ATOM   3558 C CD2 . LEU A 1 459 ? 9.504   16.909  29.757  1.00 42.57  ? 459  LEU A CD2 1 
ATOM   3559 N N   . ASP A 1 460 ? 11.078  22.442  29.228  1.00 45.70  ? 460  ASP A N   1 
ATOM   3560 C CA  . ASP A 1 460 ? 11.524  23.569  30.028  1.00 48.48  ? 460  ASP A CA  1 
ATOM   3561 C C   . ASP A 1 460 ? 10.814  24.823  29.537  1.00 54.73  ? 460  ASP A C   1 
ATOM   3562 O O   . ASP A 1 460 ? 11.116  25.325  28.455  1.00 53.89  ? 460  ASP A O   1 
ATOM   3563 C CB  . ASP A 1 460 ? 13.037  23.730  29.891  1.00 48.83  ? 460  ASP A CB  1 
ATOM   3564 C CG  . ASP A 1 460 ? 13.598  24.811  30.796  1.00 58.52  ? 460  ASP A CG  1 
ATOM   3565 O OD1 . ASP A 1 460 ? 12.810  25.541  31.437  1.00 64.59  ? 460  ASP A OD1 1 
ATOM   3566 O OD2 . ASP A 1 460 ? 14.839  24.933  30.861  1.00 58.49  ? 460  ASP A OD2 1 
ATOM   3567 N N   . PRO A 1 461 ? 9.880   25.341  30.344  1.00 60.02  ? 461  PRO A N   1 
ATOM   3568 C CA  . PRO A 1 461 ? 9.017   26.472  29.974  1.00 62.35  ? 461  PRO A CA  1 
ATOM   3569 C C   . PRO A 1 461 ? 9.816   27.676  29.487  1.00 60.78  ? 461  PRO A C   1 
ATOM   3570 O O   . PRO A 1 461 ? 9.503   28.239  28.437  1.00 64.93  ? 461  PRO A O   1 
ATOM   3571 C CB  . PRO A 1 461 ? 8.297   26.805  31.283  1.00 59.13  ? 461  PRO A CB  1 
ATOM   3572 C CG  . PRO A 1 461 ? 9.149   26.199  32.359  1.00 59.82  ? 461  PRO A CG  1 
ATOM   3573 C CD  . PRO A 1 461 ? 9.716   24.961  31.756  1.00 60.17  ? 461  PRO A CD  1 
ATOM   3574 N N   . SER A 1 462 ? 10.857  28.033  30.229  1.00 51.60  ? 462  SER A N   1 
ATOM   3575 C CA  . SER A 1 462 ? 11.739  29.137  29.863  1.00 54.39  ? 462  SER A CA  1 
ATOM   3576 C C   . SER A 1 462 ? 12.393  29.082  28.459  1.00 53.11  ? 462  SER A C   1 
ATOM   3577 O O   . SER A 1 462 ? 12.968  30.076  28.012  1.00 57.80  ? 462  SER A O   1 
ATOM   3578 C CB  . SER A 1 462 ? 12.825  29.308  30.925  1.00 52.44  ? 462  SER A CB  1 
ATOM   3579 O OG  . SER A 1 462 ? 13.857  28.363  30.744  1.00 51.50  ? 462  SER A OG  1 
ATOM   3580 N N   . LEU A 1 463 ? 12.309  27.954  27.759  1.00 41.52  ? 463  LEU A N   1 
ATOM   3581 C CA  . LEU A 1 463 ? 12.859  27.897  26.403  1.00 40.79  ? 463  LEU A CA  1 
ATOM   3582 C C   . LEU A 1 463 ? 11.900  28.336  25.285  1.00 52.73  ? 463  LEU A C   1 
ATOM   3583 O O   . LEU A 1 463 ? 12.304  28.405  24.113  1.00 56.87  ? 463  LEU A O   1 
ATOM   3584 C CB  . LEU A 1 463 ? 13.435  26.515  26.083  1.00 40.37  ? 463  LEU A CB  1 
ATOM   3585 C CG  . LEU A 1 463 ? 14.630  26.105  26.946  1.00 46.25  ? 463  LEU A CG  1 
ATOM   3586 C CD1 . LEU A 1 463 ? 15.172  24.740  26.529  1.00 39.79  ? 463  LEU A CD1 1 
ATOM   3587 C CD2 . LEU A 1 463 ? 15.713  27.172  26.877  1.00 43.91  ? 463  LEU A CD2 1 
ATOM   3588 N N   . ASN A 1 464 ? 10.645  28.620  25.630  1.00 52.49  ? 464  ASN A N   1 
ATOM   3589 C CA  . ASN A 1 464 ? 9.703   29.204  24.664  1.00 58.83  ? 464  ASN A CA  1 
ATOM   3590 C C   . ASN A 1 464 ? 9.285   28.300  23.483  1.00 56.39  ? 464  ASN A C   1 
ATOM   3591 O O   . ASN A 1 464 ? 8.927   28.803  22.418  1.00 56.16  ? 464  ASN A O   1 
ATOM   3592 C CB  . ASN A 1 464 ? 10.224  30.558  24.125  1.00 60.02  ? 464  ASN A CB  1 
ATOM   3593 C CG  . ASN A 1 464 ? 10.338  31.627  25.208  1.00 70.96  ? 464  ASN A CG  1 
ATOM   3594 O OD1 . ASN A 1 464 ? 9.706   31.530  26.265  1.00 75.68  ? 464  ASN A OD1 1 
ATOM   3595 N ND2 . ASN A 1 464 ? 11.142  32.662  24.942  1.00 71.75  ? 464  ASN A ND2 1 
ATOM   3596 N N   . TYR A 1 465 ? 9.327   26.980  23.662  1.00 46.63  ? 465  TYR A N   1 
ATOM   3597 C CA  . TYR A 1 465 ? 8.720   26.079  22.684  1.00 40.85  ? 465  TYR A CA  1 
ATOM   3598 C C   . TYR A 1 465 ? 7.205   26.129  22.825  1.00 46.76  ? 465  TYR A C   1 
ATOM   3599 O O   . TYR A 1 465 ? 6.690   26.565  23.857  1.00 48.20  ? 465  TYR A O   1 
ATOM   3600 C CB  . TYR A 1 465 ? 9.169   24.637  22.904  1.00 37.78  ? 465  TYR A CB  1 
ATOM   3601 C CG  . TYR A 1 465 ? 10.608  24.358  22.572  1.00 33.37  ? 465  TYR A CG  1 
ATOM   3602 C CD1 . TYR A 1 465 ? 11.608  24.547  23.519  1.00 41.00  ? 465  TYR A CD1 1 
ATOM   3603 C CD2 . TYR A 1 465 ? 10.967  23.891  21.316  1.00 31.94  ? 465  TYR A CD2 1 
ATOM   3604 C CE1 . TYR A 1 465 ? 12.936  24.284  23.224  1.00 38.01  ? 465  TYR A CE1 1 
ATOM   3605 C CE2 . TYR A 1 465 ? 12.291  23.620  21.003  1.00 37.65  ? 465  TYR A CE2 1 
ATOM   3606 C CZ  . TYR A 1 465 ? 13.270  23.825  21.965  1.00 37.37  ? 465  TYR A CZ  1 
ATOM   3607 O OH  . TYR A 1 465 ? 14.577  23.564  21.669  1.00 32.69  ? 465  TYR A OH  1 
ATOM   3608 N N   . THR A 1 466 ? 6.497   25.651  21.804  1.00 48.44  ? 466  THR A N   1 
ATOM   3609 C CA  . THR A 1 466 ? 5.034   25.588  21.834  1.00 46.45  ? 466  THR A CA  1 
ATOM   3610 C C   . THR A 1 466 ? 4.549   24.416  22.679  1.00 49.52  ? 466  THR A C   1 
ATOM   3611 O O   . THR A 1 466 ? 5.303   23.470  22.949  1.00 40.44  ? 466  THR A O   1 
ATOM   3612 C CB  . THR A 1 466 ? 4.436   25.422  20.418  1.00 47.47  ? 466  THR A CB  1 
ATOM   3613 O OG1 . THR A 1 466 ? 4.775   24.129  19.892  1.00 50.05  ? 466  THR A OG1 1 
ATOM   3614 C CG2 . THR A 1 466 ? 4.960   26.494  19.487  1.00 43.63  ? 466  THR A CG2 1 
ATOM   3615 N N   . THR A 1 467 ? 3.283   24.479  23.088  1.00 51.41  ? 467  THR A N   1 
ATOM   3616 C CA  . THR A 1 467 ? 2.656   23.394  23.836  1.00 45.51  ? 467  THR A CA  1 
ATOM   3617 C C   . THR A 1 467 ? 2.685   22.080  23.045  1.00 49.90  ? 467  THR A C   1 
ATOM   3618 O O   . THR A 1 467 ? 2.982   21.017  23.601  1.00 45.59  ? 467  THR A O   1 
ATOM   3619 C CB  . THR A 1 467 ? 1.227   23.774  24.239  1.00 51.37  ? 467  THR A CB  1 
ATOM   3620 O OG1 . THR A 1 467 ? 1.289   24.779  25.261  1.00 53.21  ? 467  THR A OG1 1 
ATOM   3621 C CG2 . THR A 1 467 ? 0.453   22.559  24.760  1.00 49.66  ? 467  THR A CG2 1 
ATOM   3622 N N   . GLU A 1 468 ? 2.410   22.174  21.743  1.00 47.11  ? 468  GLU A N   1 
ATOM   3623 C CA  . GLU A 1 468 ? 2.460   21.029  20.832  1.00 45.83  ? 468  GLU A CA  1 
ATOM   3624 C C   . GLU A 1 468 ? 3.850   20.417  20.811  1.00 46.80  ? 468  GLU A C   1 
ATOM   3625 O O   . GLU A 1 468 ? 3.997   19.196  20.812  1.00 48.58  ? 468  GLU A O   1 
ATOM   3626 C CB  . GLU A 1 468 ? 2.085   21.438  19.399  1.00 44.98  ? 468  GLU A CB  1 
ATOM   3627 C CG  . GLU A 1 468 ? 0.688   22.004  19.237  1.00 66.24  ? 468  GLU A CG  1 
ATOM   3628 C CD  . GLU A 1 468 ? 0.608   23.493  19.552  1.00 76.76  ? 468  GLU A CD  1 
ATOM   3629 O OE1 . GLU A 1 468 ? 0.910   23.890  20.701  1.00 71.59  ? 468  GLU A OE1 1 
ATOM   3630 O OE2 . GLU A 1 468 ? 0.241   24.271  18.642  1.00 84.99  ? 468  GLU A OE2 1 
ATOM   3631 N N   . GLU A 1 469 ? 4.862   21.279  20.758  1.00 42.61  ? 469  GLU A N   1 
ATOM   3632 C CA  . GLU A 1 469 ? 6.253   20.843  20.788  1.00 37.07  ? 469  GLU A CA  1 
ATOM   3633 C C   . GLU A 1 469 ? 6.600   20.099  22.088  1.00 39.86  ? 469  GLU A C   1 
ATOM   3634 O O   . GLU A 1 469 ? 7.380   19.155  22.070  1.00 40.47  ? 469  GLU A O   1 
ATOM   3635 C CB  . GLU A 1 469 ? 7.193   22.028  20.542  1.00 37.38  ? 469  GLU A CB  1 
ATOM   3636 C CG  . GLU A 1 469 ? 7.378   22.339  19.052  1.00 41.67  ? 469  GLU A CG  1 
ATOM   3637 C CD  . GLU A 1 469 ? 8.203   23.591  18.784  1.00 43.87  ? 469  GLU A CD  1 
ATOM   3638 O OE1 . GLU A 1 469 ? 8.095   24.557  19.580  1.00 47.05  ? 469  GLU A OE1 1 
ATOM   3639 O OE2 . GLU A 1 469 ? 8.946   23.605  17.771  1.00 36.58  ? 469  GLU A OE2 1 
ATOM   3640 N N   A ARG A 1 470 ? 6.006   20.518  23.205  0.57 40.95  ? 470  ARG A N   1 
ATOM   3641 N N   B ARG A 1 470 ? 6.004   20.525  23.200  0.43 40.98  ? 470  ARG A N   1 
ATOM   3642 C CA  A ARG A 1 470 ? 6.219   19.839  24.475  0.57 40.50  ? 470  ARG A CA  1 
ATOM   3643 C CA  B ARG A 1 470 ? 6.209   19.856  24.478  0.43 40.59  ? 470  ARG A CA  1 
ATOM   3644 C C   A ARG A 1 470 ? 5.652   18.421  24.416  0.57 42.31  ? 470  ARG A C   1 
ATOM   3645 C C   B ARG A 1 470 ? 5.636   18.436  24.448  0.43 42.28  ? 470  ARG A C   1 
ATOM   3646 O O   A ARG A 1 470 ? 6.308   17.469  24.833  0.57 41.26  ? 470  ARG A O   1 
ATOM   3647 O O   B ARG A 1 470 ? 6.274   17.495  24.915  0.43 41.42  ? 470  ARG A O   1 
ATOM   3648 C CB  A ARG A 1 470 ? 5.590   20.624  25.633  0.57 42.30  ? 470  ARG A CB  1 
ATOM   3649 C CB  B ARG A 1 470 ? 5.600   20.671  25.628  0.43 42.26  ? 470  ARG A CB  1 
ATOM   3650 C CG  A ARG A 1 470 ? 6.302   20.463  26.973  0.57 39.20  ? 470  ARG A CG  1 
ATOM   3651 C CG  B ARG A 1 470 ? 6.143   22.095  25.752  0.43 43.17  ? 470  ARG A CG  1 
ATOM   3652 C CD  A ARG A 1 470 ? 5.372   19.940  28.084  0.57 46.32  ? 470  ARG A CD  1 
ATOM   3653 C CD  B ARG A 1 470 ? 5.546   22.843  26.945  0.43 46.39  ? 470  ARG A CD  1 
ATOM   3654 N NE  A ARG A 1 470 ? 4.147   20.723  28.221  0.57 49.96  ? 470  ARG A NE  1 
ATOM   3655 N NE  B ARG A 1 470 ? 6.259   24.087  27.232  0.43 41.88  ? 470  ARG A NE  1 
ATOM   3656 C CZ  A ARG A 1 470 ? 2.928   20.252  27.974  0.57 51.32  ? 470  ARG A CZ  1 
ATOM   3657 C CZ  B ARG A 1 470 ? 5.838   25.297  26.877  0.43 47.15  ? 470  ARG A CZ  1 
ATOM   3658 N NH1 A ARG A 1 470 ? 2.760   18.990  27.592  0.57 50.21  ? 470  ARG A NH1 1 
ATOM   3659 N NH1 B ARG A 1 470 ? 4.694   25.442  26.224  0.43 51.66  ? 470  ARG A NH1 1 
ATOM   3660 N NH2 A ARG A 1 470 ? 1.872   21.039  28.120  0.57 51.10  ? 470  ARG A NH2 1 
ATOM   3661 N NH2 B ARG A 1 470 ? 6.557   26.369  27.183  0.43 44.89  ? 470  ARG A NH2 1 
ATOM   3662 N N   . ILE A 1 471 ? 4.439   18.283  23.886  1.00 39.13  ? 471  ILE A N   1 
ATOM   3663 C CA  . ILE A 1 471 ? 3.801   16.973  23.787  1.00 39.73  ? 471  ILE A CA  1 
ATOM   3664 C C   . ILE A 1 471 ? 4.584   16.067  22.852  1.00 37.74  ? 471  ILE A C   1 
ATOM   3665 O O   . ILE A 1 471 ? 4.799   14.886  23.136  1.00 44.30  ? 471  ILE A O   1 
ATOM   3666 C CB  . ILE A 1 471 ? 2.324   17.089  23.327  1.00 46.04  ? 471  ILE A CB  1 
ATOM   3667 C CG1 . ILE A 1 471 ? 1.438   17.434  24.523  1.00 44.64  ? 471  ILE A CG1 1 
ATOM   3668 C CG2 . ILE A 1 471 ? 1.835   15.791  22.716  1.00 43.54  ? 471  ILE A CG2 1 
ATOM   3669 C CD1 . ILE A 1 471 ? 0.573   18.634  24.304  1.00 46.76  ? 471  ILE A CD1 1 
ATOM   3670 N N   . PHE A 1 472 ? 5.024   16.648  21.747  1.00 36.71  ? 472  PHE A N   1 
ATOM   3671 C CA  . PHE A 1 472 ? 5.845   15.966  20.764  1.00 39.70  ? 472  PHE A CA  1 
ATOM   3672 C C   . PHE A 1 472 ? 7.170   15.475  21.355  1.00 40.37  ? 472  PHE A C   1 
ATOM   3673 O O   . PHE A 1 472 ? 7.574   14.337  21.126  1.00 42.50  ? 472  PHE A O   1 
ATOM   3674 C CB  . PHE A 1 472 ? 6.098   16.915  19.594  1.00 42.55  ? 472  PHE A CB  1 
ATOM   3675 C CG  . PHE A 1 472 ? 7.012   16.366  18.536  1.00 44.73  ? 472  PHE A CG  1 
ATOM   3676 C CD1 . PHE A 1 472 ? 6.727   15.166  17.903  1.00 32.63  ? 472  PHE A CD1 1 
ATOM   3677 C CD2 . PHE A 1 472 ? 8.144   17.081  18.142  1.00 42.12  ? 472  PHE A CD2 1 
ATOM   3678 C CE1 . PHE A 1 472 ? 7.566   14.673  16.904  1.00 37.61  ? 472  PHE A CE1 1 
ATOM   3679 C CE2 . PHE A 1 472 ? 8.983   16.602  17.149  1.00 40.21  ? 472  PHE A CE2 1 
ATOM   3680 C CZ  . PHE A 1 472 ? 8.695   15.393  16.527  1.00 40.80  ? 472  PHE A CZ  1 
ATOM   3681 N N   . ALA A 1 473 ? 7.837   16.322  22.125  1.00 32.39  ? 473  ALA A N   1 
ATOM   3682 C CA  . ALA A 1 473 ? 9.096   15.923  22.750  1.00 40.18  ? 473  ALA A CA  1 
ATOM   3683 C C   . ALA A 1 473 ? 8.848   14.758  23.706  1.00 42.51  ? 473  ALA A C   1 
ATOM   3684 O O   . ALA A 1 473 ? 9.636   13.813  23.781  1.00 41.38  ? 473  ALA A O   1 
ATOM   3685 C CB  . ALA A 1 473 ? 9.741   17.104  23.482  1.00 34.93  ? 473  ALA A CB  1 
ATOM   3686 N N   . GLN A 1 474 ? 7.732   14.827  24.422  1.00 39.90  ? 474  GLN A N   1 
ATOM   3687 C CA  . GLN A 1 474 ? 7.355   13.764  25.338  1.00 38.59  ? 474  GLN A CA  1 
ATOM   3688 C C   . GLN A 1 474 ? 7.172   12.460  24.581  1.00 42.30  ? 474  GLN A C   1 
ATOM   3689 O O   . GLN A 1 474 ? 7.606   11.405  25.036  1.00 33.72  ? 474  GLN A O   1 
ATOM   3690 C CB  . GLN A 1 474 ? 6.088   14.139  26.108  1.00 38.46  ? 474  GLN A CB  1 
ATOM   3691 C CG  . GLN A 1 474 ? 6.329   15.172  27.182  1.00 44.91  ? 474  GLN A CG  1 
ATOM   3692 C CD  . GLN A 1 474 ? 5.051   15.685  27.809  1.00 56.56  ? 474  GLN A CD  1 
ATOM   3693 O OE1 . GLN A 1 474 ? 4.041   15.905  27.129  1.00 65.51  ? 474  GLN A OE1 1 
ATOM   3694 N NE2 . GLN A 1 474 ? 5.090   15.892  29.118  1.00 56.01  ? 474  GLN A NE2 1 
ATOM   3695 N N   . ARG A 1 475 ? 6.535   12.542  23.416  1.00 46.60  ? 475  ARG A N   1 
ATOM   3696 C CA  . ARG A 1 475 ? 6.378   11.383  22.551  1.00 45.37  ? 475  ARG A CA  1 
ATOM   3697 C C   . ARG A 1 475 ? 7.733   10.784  22.134  1.00 38.89  ? 475  ARG A C   1 
ATOM   3698 O O   . ARG A 1 475 ? 7.949   9.571   22.241  1.00 32.65  ? 475  ARG A O   1 
ATOM   3699 C CB  . ARG A 1 475 ? 5.562   11.759  21.317  1.00 43.14  ? 475  ARG A CB  1 
ATOM   3700 C CG  . ARG A 1 475 ? 4.274   11.010  21.208  1.00 46.36  ? 475  ARG A CG  1 
ATOM   3701 C CD  . ARG A 1 475 ? 3.450   11.513  20.025  1.00 52.10  ? 475  ARG A CD  1 
ATOM   3702 N NE  . ARG A 1 475 ? 3.910   10.918  18.781  1.00 48.69  ? 475  ARG A NE  1 
ATOM   3703 C CZ  . ARG A 1 475 ? 4.112   11.585  17.652  1.00 39.90  ? 475  ARG A CZ  1 
ATOM   3704 N NH1 . ARG A 1 475 ? 3.884   12.889  17.580  1.00 39.84  ? 475  ARG A NH1 1 
ATOM   3705 N NH2 . ARG A 1 475 ? 4.543   10.935  16.591  1.00 43.39  ? 475  ARG A NH2 1 
ATOM   3706 N N   . LEU A 1 476 ? 8.643   11.628  21.657  1.00 34.94  ? 476  LEU A N   1 
ATOM   3707 C CA  . LEU A 1 476 ? 9.956   11.135  21.229  1.00 31.34  ? 476  LEU A CA  1 
ATOM   3708 C C   . LEU A 1 476 ? 10.687  10.451  22.371  1.00 32.74  ? 476  LEU A C   1 
ATOM   3709 O O   . LEU A 1 476 ? 11.270  9.385   22.179  1.00 45.39  ? 476  LEU A O   1 
ATOM   3710 C CB  . LEU A 1 476 ? 10.802  12.249  20.609  1.00 34.91  ? 476  LEU A CB  1 
ATOM   3711 C CG  . LEU A 1 476 ? 10.092  12.899  19.421  1.00 35.43  ? 476  LEU A CG  1 
ATOM   3712 C CD1 . LEU A 1 476 ? 10.960  13.939  18.788  1.00 36.20  ? 476  LEU A CD1 1 
ATOM   3713 C CD2 . LEU A 1 476 ? 9.699   11.833  18.412  1.00 36.40  ? 476  LEU A CD2 1 
ATOM   3714 N N   . MET A 1 477 ? 10.621  11.043  23.561  1.00 32.08  ? 477  MET A N   1 
ATOM   3715 C CA  . MET A 1 477 ? 11.244  10.457  24.751  1.00 34.54  ? 477  MET A CA  1 
ATOM   3716 C C   . MET A 1 477 ? 10.729  9.063   25.087  1.00 34.64  ? 477  MET A C   1 
ATOM   3717 O O   . MET A 1 477 ? 11.523  8.200   25.451  1.00 37.77  ? 477  MET A O   1 
ATOM   3718 C CB  . MET A 1 477 ? 11.110  11.377  25.969  1.00 37.87  ? 477  MET A CB  1 
ATOM   3719 C CG  . MET A 1 477 ? 12.026  12.593  25.926  1.00 35.18  ? 477  MET A CG  1 
ATOM   3720 S SD  . MET A 1 477 ? 11.453  13.856  27.074  1.00 48.96  ? 477  MET A SD  1 
ATOM   3721 C CE  . MET A 1 477 ? 12.322  13.449  28.553  1.00 29.57  ? 477  MET A CE  1 
ATOM   3722 N N   . LYS A 1 478 ? 9.417   8.846   24.968  1.00 37.62  ? 478  LYS A N   1 
ATOM   3723 C CA  . LYS A 1 478 ? 8.833   7.511   25.157  1.00 46.17  ? 478  LYS A CA  1 
ATOM   3724 C C   . LYS A 1 478 ? 9.441   6.523   24.178  1.00 43.36  ? 478  LYS A C   1 
ATOM   3725 O O   . LYS A 1 478 ? 9.882   5.448   24.577  1.00 46.05  ? 478  LYS A O   1 
ATOM   3726 C CB  . LYS A 1 478 ? 7.305   7.497   24.950  1.00 47.59  ? 478  LYS A CB  1 
ATOM   3727 C CG  . LYS A 1 478 ? 6.483   8.127   26.035  1.00 43.96  ? 478  LYS A CG  1 
ATOM   3728 C CD  . LYS A 1 478 ? 6.542   7.332   27.317  1.00 53.46  ? 478  LYS A CD  1 
ATOM   3729 C CE  . LYS A 1 478 ? 5.846   8.084   28.445  1.00 52.65  ? 478  LYS A CE  1 
ATOM   3730 N NZ  . LYS A 1 478 ? 6.280   7.582   29.784  1.00 56.80  ? 478  LYS A NZ  1 
ATOM   3731 N N   . TYR A 1 479 ? 9.444   6.896   22.897  1.00 40.44  ? 479  TYR A N   1 
ATOM   3732 C CA  . TYR A 1 479 ? 9.956   6.033   21.833  1.00 37.61  ? 479  TYR A CA  1 
ATOM   3733 C C   . TYR A 1 479 ? 11.350  5.556   22.144  1.00 36.33  ? 479  TYR A C   1 
ATOM   3734 O O   . TYR A 1 479 ? 11.632  4.353   22.075  1.00 30.86  ? 479  TYR A O   1 
ATOM   3735 C CB  . TYR A 1 479 ? 10.006  6.772   20.504  1.00 34.96  ? 479  TYR A CB  1 
ATOM   3736 C CG  . TYR A 1 479 ? 8.659   7.016   19.861  1.00 38.56  ? 479  TYR A CG  1 
ATOM   3737 C CD1 . TYR A 1 479 ? 7.615   6.107   19.999  1.00 34.29  ? 479  TYR A CD1 1 
ATOM   3738 C CD2 . TYR A 1 479 ? 8.440   8.157   19.100  1.00 32.92  ? 479  TYR A CD2 1 
ATOM   3739 C CE1 . TYR A 1 479 ? 6.392   6.342   19.400  1.00 35.88  ? 479  TYR A CE1 1 
ATOM   3740 C CE2 . TYR A 1 479 ? 7.230   8.397   18.502  1.00 35.90  ? 479  TYR A CE2 1 
ATOM   3741 C CZ  . TYR A 1 479 ? 6.204   7.495   18.648  1.00 43.21  ? 479  TYR A CZ  1 
ATOM   3742 O OH  . TYR A 1 479 ? 4.993   7.766   18.037  1.00 42.93  ? 479  TYR A OH  1 
ATOM   3743 N N   . TRP A 1 480 ? 12.209  6.512   22.490  1.00 28.87  ? 480  TRP A N   1 
ATOM   3744 C CA  . TRP A 1 480 ? 13.620  6.255   22.748  1.00 27.70  ? 480  TRP A CA  1 
ATOM   3745 C C   . TRP A 1 480 ? 13.820  5.386   24.001  1.00 32.87  ? 480  TRP A C   1 
ATOM   3746 O O   . TRP A 1 480 ? 14.555  4.396   23.971  1.00 30.97  ? 480  TRP A O   1 
ATOM   3747 C CB  . TRP A 1 480 ? 14.392  7.585   22.865  1.00 27.71  ? 480  TRP A CB  1 
ATOM   3748 C CG  . TRP A 1 480 ? 15.210  7.976   21.633  1.00 30.09  ? 480  TRP A CG  1 
ATOM   3749 C CD1 . TRP A 1 480 ? 16.572  8.143   21.565  1.00 28.88  ? 480  TRP A CD1 1 
ATOM   3750 C CD2 . TRP A 1 480 ? 14.713  8.240   20.314  1.00 31.50  ? 480  TRP A CD2 1 
ATOM   3751 N NE1 . TRP A 1 480 ? 16.948  8.501   20.288  1.00 32.51  ? 480  TRP A NE1 1 
ATOM   3752 C CE2 . TRP A 1 480 ? 15.828  8.573   19.503  1.00 30.53  ? 480  TRP A CE2 1 
ATOM   3753 C CE3 . TRP A 1 480 ? 13.435  8.229   19.737  1.00 34.29  ? 480  TRP A CE3 1 
ATOM   3754 C CZ2 . TRP A 1 480 ? 15.701  8.886   18.146  1.00 27.91  ? 480  TRP A CZ2 1 
ATOM   3755 C CZ3 . TRP A 1 480 ? 13.311  8.547   18.388  1.00 29.63  ? 480  TRP A CZ3 1 
ATOM   3756 C CH2 . TRP A 1 480 ? 14.438  8.869   17.608  1.00 29.08  ? 480  TRP A CH2 1 
ATOM   3757 N N   . THR A 1 481 ? 13.145  5.736   25.090  1.00 29.27  ? 481  THR A N   1 
ATOM   3758 C CA  . THR A 1 481 ? 13.280  4.978   26.326  1.00 30.13  ? 481  THR A CA  1 
ATOM   3759 C C   . THR A 1 481 ? 12.565  3.624   26.251  1.00 36.22  ? 481  THR A C   1 
ATOM   3760 O O   . THR A 1 481 ? 13.065  2.641   26.792  1.00 37.49  ? 481  THR A O   1 
ATOM   3761 C CB  . THR A 1 481 ? 12.812  5.779   27.560  1.00 30.62  ? 481  THR A CB  1 
ATOM   3762 O OG1 . THR A 1 481 ? 11.471  6.246   27.355  1.00 40.76  ? 481  THR A OG1 1 
ATOM   3763 C CG2 . THR A 1 481 ? 13.721  6.977   27.790  1.00 29.22  ? 481  THR A CG2 1 
ATOM   3764 N N   . ASN A 1 482 ? 11.416  3.553   25.573  1.00 34.02  ? 482  ASN A N   1 
ATOM   3765 C CA  . ASN A 1 482 ? 10.798  2.244   25.310  1.00 37.38  ? 482  ASN A CA  1 
ATOM   3766 C C   . ASN A 1 482 ? 11.746  1.335   24.536  1.00 40.43  ? 482  ASN A C   1 
ATOM   3767 O O   . ASN A 1 482 ? 11.871  0.138   24.842  1.00 35.30  ? 482  ASN A O   1 
ATOM   3768 C CB  . ASN A 1 482 ? 9.475   2.361   24.542  1.00 35.79  ? 482  ASN A CB  1 
ATOM   3769 C CG  . ASN A 1 482 ? 8.351   2.847   25.401  1.00 37.12  ? 482  ASN A CG  1 
ATOM   3770 O OD1 . ASN A 1 482 ? 8.462   2.872   26.626  1.00 37.40  ? 482  ASN A OD1 1 
ATOM   3771 N ND2 . ASN A 1 482 ? 7.250   3.233   24.771  1.00 42.04  ? 482  ASN A ND2 1 
ATOM   3772 N N   . PHE A 1 483 ? 12.410  1.907   23.530  1.00 36.80  ? 483  PHE A N   1 
ATOM   3773 C CA  . PHE A 1 483 ? 13.388  1.154   22.756  1.00 38.28  ? 483  PHE A CA  1 
ATOM   3774 C C   . PHE A 1 483 ? 14.585  0.693   23.610  1.00 38.90  ? 483  PHE A C   1 
ATOM   3775 O O   . PHE A 1 483 ? 15.040  -0.450  23.496  1.00 35.88  ? 483  PHE A O   1 
ATOM   3776 C CB  . PHE A 1 483 ? 13.882  1.951   21.548  1.00 35.31  ? 483  PHE A CB  1 
ATOM   3777 C CG  . PHE A 1 483 ? 15.000  1.277   20.822  1.00 35.39  ? 483  PHE A CG  1 
ATOM   3778 C CD1 . PHE A 1 483 ? 14.747  0.182   20.002  1.00 31.45  ? 483  PHE A CD1 1 
ATOM   3779 C CD2 . PHE A 1 483 ? 16.306  1.697   20.991  1.00 28.77  ? 483  PHE A CD2 1 
ATOM   3780 C CE1 . PHE A 1 483 ? 15.780  -0.463  19.346  1.00 32.90  ? 483  PHE A CE1 1 
ATOM   3781 C CE2 . PHE A 1 483 ? 17.339  1.058   20.331  1.00 41.74  ? 483  PHE A CE2 1 
ATOM   3782 C CZ  . PHE A 1 483 ? 17.076  -0.020  19.504  1.00 29.89  ? 483  PHE A CZ  1 
ATOM   3783 N N   . ALA A 1 484 ? 15.092  1.584   24.458  1.00 39.78  ? 484  ALA A N   1 
ATOM   3784 C CA  . ALA A 1 484 ? 16.175  1.230   25.375  1.00 38.66  ? 484  ALA A CA  1 
ATOM   3785 C C   . ALA A 1 484 ? 15.708  0.143   26.323  1.00 38.86  ? 484  ALA A C   1 
ATOM   3786 O O   . ALA A 1 484 ? 16.446  -0.790  26.624  1.00 38.15  ? 484  ALA A O   1 
ATOM   3787 C CB  . ALA A 1 484 ? 16.618  2.435   26.163  1.00 29.36  ? 484  ALA A CB  1 
ATOM   3788 N N   . ARG A 1 485 ? 14.468  0.271   26.781  1.00 33.34  ? 485  ARG A N   1 
ATOM   3789 C CA  . ARG A 1 485 ? 13.906  -0.667  27.747  1.00 43.71  ? 485  ARG A CA  1 
ATOM   3790 C C   . ARG A 1 485 ? 13.755  -2.079  27.160  1.00 44.52  ? 485  ARG A C   1 
ATOM   3791 O O   . ARG A 1 485 ? 14.061  -3.060  27.836  1.00 41.84  ? 485  ARG A O   1 
ATOM   3792 C CB  . ARG A 1 485 ? 12.542  -0.160  28.239  1.00 53.52  ? 485  ARG A CB  1 
ATOM   3793 C CG  . ARG A 1 485 ? 12.294  -0.206  29.744  1.00 63.48  ? 485  ARG A CG  1 
ATOM   3794 C CD  . ARG A 1 485 ? 10.877  0.308   30.104  1.00 71.84  ? 485  ARG A CD  1 
ATOM   3795 N NE  . ARG A 1 485 ? 10.437  1.457   29.293  1.00 75.16  ? 485  ARG A NE  1 
ATOM   3796 C CZ  . ARG A 1 485 ? 10.737  2.739   29.541  1.00 69.83  ? 485  ARG A CZ  1 
ATOM   3797 N NH1 . ARG A 1 485 ? 11.494  3.066   30.590  1.00 63.83  ? 485  ARG A NH1 1 
ATOM   3798 N NH2 . ARG A 1 485 ? 10.282  3.701   28.732  1.00 59.14  ? 485  ARG A NH2 1 
ATOM   3799 N N   . THR A 1 486 ? 13.301  -2.173  25.903  1.00 36.93  ? 486  THR A N   1 
ATOM   3800 C CA  . THR A 1 486 ? 12.743  -3.431  25.367  1.00 38.97  ? 486  THR A CA  1 
ATOM   3801 C C   . THR A 1 486 ? 13.213  -3.809  23.956  1.00 42.14  ? 486  THR A C   1 
ATOM   3802 O O   . THR A 1 486 ? 12.952  -4.916  23.481  1.00 45.58  ? 486  THR A O   1 
ATOM   3803 C CB  . THR A 1 486 ? 11.194  -3.373  25.312  1.00 40.51  ? 486  THR A CB  1 
ATOM   3804 O OG1 . THR A 1 486 ? 10.789  -2.439  24.300  1.00 39.45  ? 486  THR A OG1 1 
ATOM   3805 C CG2 . THR A 1 486 ? 10.613  -2.947  26.649  1.00 41.00  ? 486  THR A CG2 1 
ATOM   3806 N N   . GLY A 1 487 ? 13.887  -2.891  23.275  1.00 47.14  ? 487  GLY A N   1 
ATOM   3807 C CA  . GLY A 1 487 ? 14.278  -3.130  21.899  1.00 45.88  ? 487  GLY A CA  1 
ATOM   3808 C C   . GLY A 1 487 ? 13.155  -2.823  20.927  1.00 49.84  ? 487  GLY A C   1 
ATOM   3809 O O   . GLY A 1 487 ? 13.234  -3.155  19.748  1.00 50.32  ? 487  GLY A O   1 
ATOM   3810 N N   . ASP A 1 488 ? 12.114  -2.174  21.437  1.00 53.41  ? 488  ASP A N   1 
ATOM   3811 C CA  . ASP A 1 488 ? 10.903  -1.876  20.682  1.00 50.04  ? 488  ASP A CA  1 
ATOM   3812 C C   . ASP A 1 488 ? 10.389  -0.488  21.102  1.00 47.07  ? 488  ASP A C   1 
ATOM   3813 O O   . ASP A 1 488 ? 10.051  -0.266  22.262  1.00 52.82  ? 488  ASP A O   1 
ATOM   3814 C CB  . ASP A 1 488 ? 9.861   -2.969  20.964  1.00 46.85  ? 488  ASP A CB  1 
ATOM   3815 C CG  . ASP A 1 488 ? 8.589   -2.831  20.124  1.00 47.69  ? 488  ASP A CG  1 
ATOM   3816 O OD1 . ASP A 1 488 ? 8.339   -1.755  19.541  1.00 50.69  ? 488  ASP A OD1 1 
ATOM   3817 O OD2 . ASP A 1 488 ? 7.817   -3.812  20.065  1.00 50.61  ? 488  ASP A OD2 1 
ATOM   3818 N N   . PRO A 1 489 ? 10.324  0.450   20.154  1.00 42.72  ? 489  PRO A N   1 
ATOM   3819 C CA  . PRO A 1 489 ? 9.907   1.813   20.498  1.00 42.78  ? 489  PRO A CA  1 
ATOM   3820 C C   . PRO A 1 489 ? 8.409   1.930   20.801  1.00 50.95  ? 489  PRO A C   1 
ATOM   3821 O O   . PRO A 1 489 ? 7.988   2.940   21.366  1.00 55.99  ? 489  PRO A O   1 
ATOM   3822 C CB  . PRO A 1 489 ? 10.263  2.613   19.242  1.00 37.44  ? 489  PRO A CB  1 
ATOM   3823 C CG  . PRO A 1 489 ? 10.170  1.606   18.130  1.00 42.67  ? 489  PRO A CG  1 
ATOM   3824 C CD  . PRO A 1 489 ? 10.648  0.308   18.722  1.00 41.65  ? 489  PRO A CD  1 
ATOM   3825 N N   . ASN A 1 490 ? 7.620   0.926   20.436  1.00 45.43  ? 490  ASN A N   1 
ATOM   3826 C CA  . ASN A 1 490 ? 6.171   0.982   20.660  1.00 50.14  ? 490  ASN A CA  1 
ATOM   3827 C C   . ASN A 1 490 ? 5.804   0.787   22.114  1.00 53.16  ? 490  ASN A C   1 
ATOM   3828 O O   . ASN A 1 490 ? 6.462   0.039   22.835  1.00 57.21  ? 490  ASN A O   1 
ATOM   3829 C CB  . ASN A 1 490 ? 5.434   -0.054  19.801  1.00 50.40  ? 490  ASN A CB  1 
ATOM   3830 C CG  . ASN A 1 490 ? 5.632   0.177   18.311  1.00 54.94  ? 490  ASN A CG  1 
ATOM   3831 O OD1 . ASN A 1 490 ? 4.995   1.053   17.716  1.00 49.93  ? 490  ASN A OD1 1 
ATOM   3832 N ND2 . ASN A 1 490 ? 6.520   -0.606  17.701  1.00 45.88  ? 490  ASN A ND2 1 
ATOM   3833 N N   . ASP A 1 491 ? 4.751   1.460   22.556  1.00 66.32  ? 491  ASP A N   1 
ATOM   3834 C CA  . ASP A 1 491 ? 4.274   1.248   23.918  1.00 78.42  ? 491  ASP A CA  1 
ATOM   3835 C C   . ASP A 1 491 ? 3.384   0.010   23.946  1.00 84.44  ? 491  ASP A C   1 
ATOM   3836 O O   . ASP A 1 491 ? 2.395   -0.061  23.218  1.00 85.97  ? 491  ASP A O   1 
ATOM   3837 C CB  . ASP A 1 491 ? 3.532   2.484   24.444  1.00 86.07  ? 491  ASP A CB  1 
ATOM   3838 C CG  . ASP A 1 491 ? 3.240   2.406   25.944  1.00 98.48  ? 491  ASP A CG  1 
ATOM   3839 O OD1 . ASP A 1 491 ? 3.702   1.452   26.611  1.00 98.89  ? 491  ASP A OD1 1 
ATOM   3840 O OD2 . ASP A 1 491 ? 2.540   3.304   26.460  1.00 103.71 ? 491  ASP A OD2 1 
ATOM   3841 N N   . PRO A 1 492 ? 3.760   -0.991  24.761  1.00 89.77  ? 492  PRO A N   1 
ATOM   3842 C CA  . PRO A 1 492 ? 2.925   -2.187  24.928  1.00 95.03  ? 492  PRO A CA  1 
ATOM   3843 C C   . PRO A 1 492 ? 1.557   -1.843  25.519  1.00 103.41 ? 492  PRO A C   1 
ATOM   3844 O O   . PRO A 1 492 ? 0.565   -2.494  25.191  1.00 103.90 ? 492  PRO A O   1 
ATOM   3845 C CB  . PRO A 1 492 ? 3.725   -3.038  25.921  1.00 93.16  ? 492  PRO A CB  1 
ATOM   3846 C CG  . PRO A 1 492 ? 5.130   -2.584  25.769  1.00 90.61  ? 492  PRO A CG  1 
ATOM   3847 C CD  . PRO A 1 492 ? 5.052   -1.116  25.462  1.00 87.27  ? 492  PRO A CD  1 
ATOM   3848 N N   . ARG A 1 493 ? 1.514   -0.821  26.373  1.00 111.20 ? 493  ARG A N   1 
ATOM   3849 C CA  . ARG A 1 493 ? 0.276   -0.404  27.036  1.00 118.88 ? 493  ARG A CA  1 
ATOM   3850 C C   . ARG A 1 493 ? -0.518  0.591   26.190  1.00 122.30 ? 493  ARG A C   1 
ATOM   3851 O O   . ARG A 1 493 ? -1.337  1.349   26.714  1.00 124.09 ? 493  ARG A O   1 
ATOM   3852 C CB  . ARG A 1 493 ? 0.582   0.209   28.409  1.00 117.94 ? 493  ARG A CB  1 
ATOM   3853 N N   . ASP A 1 494 ? -0.268  0.578   24.882  1.00 122.37 ? 494  ASP A N   1 
ATOM   3854 C CA  . ASP A 1 494 ? -0.921  1.491   23.947  1.00 123.91 ? 494  ASP A CA  1 
ATOM   3855 C C   . ASP A 1 494 ? -1.219  0.786   22.623  1.00 125.24 ? 494  ASP A C   1 
ATOM   3856 O O   . ASP A 1 494 ? -0.363  0.707   21.736  1.00 122.09 ? 494  ASP A O   1 
ATOM   3857 C CB  . ASP A 1 494 ? -0.037  2.716   23.702  1.00 119.23 ? 494  ASP A CB  1 
ATOM   3858 C CG  . ASP A 1 494 ? -0.766  3.833   22.979  1.00 118.28 ? 494  ASP A CG  1 
ATOM   3859 O OD1 . ASP A 1 494 ? -1.952  3.651   22.627  1.00 121.04 ? 494  ASP A OD1 1 
ATOM   3860 O OD2 . ASP A 1 494 ? -0.141  4.893   22.758  1.00 114.02 ? 494  ASP A OD2 1 
ATOM   3861 N N   . SER A 1 495 ? -2.442  0.282   22.495  1.00 129.37 ? 495  SER A N   1 
ATOM   3862 C CA  . SER A 1 495 ? -2.847  -0.449  21.300  1.00 126.01 ? 495  SER A CA  1 
ATOM   3863 C C   . SER A 1 495 ? -3.416  0.476   20.223  1.00 121.66 ? 495  SER A C   1 
ATOM   3864 O O   . SER A 1 495 ? -3.063  0.356   19.045  1.00 115.79 ? 495  SER A O   1 
ATOM   3865 C CB  . SER A 1 495 ? -3.859  -1.541  21.661  1.00 129.67 ? 495  SER A CB  1 
ATOM   3866 O OG  . SER A 1 495 ? -4.918  -1.019  22.443  1.00 133.46 ? 495  SER A OG  1 
ATOM   3867 N N   . LYS A 1 496 ? -4.288  1.395   20.640  1.00 122.17 ? 496  LYS A N   1 
ATOM   3868 C CA  . LYS A 1 496 ? -4.968  2.320   19.729  1.00 119.28 ? 496  LYS A CA  1 
ATOM   3869 C C   . LYS A 1 496 ? -4.007  3.118   18.835  1.00 111.89 ? 496  LYS A C   1 
ATOM   3870 O O   . LYS A 1 496 ? -4.167  3.159   17.611  1.00 107.18 ? 496  LYS A O   1 
ATOM   3871 C CB  . LYS A 1 496 ? -5.874  3.270   20.523  1.00 119.70 ? 496  LYS A CB  1 
ATOM   3872 N N   . SER A 1 497 ? -3.012  3.741   19.460  1.00 108.04 ? 497  SER A N   1 
ATOM   3873 C CA  . SER A 1 497 ? -2.008  4.547   18.766  1.00 98.15  ? 497  SER A CA  1 
ATOM   3874 C C   . SER A 1 497 ? -1.232  3.739   17.705  1.00 93.52  ? 497  SER A C   1 
ATOM   3875 O O   . SER A 1 497 ? -0.869  2.581   17.947  1.00 94.37  ? 497  SER A O   1 
ATOM   3876 C CB  . SER A 1 497 ? -1.051  5.147   19.801  1.00 91.92  ? 497  SER A CB  1 
ATOM   3877 O OG  . SER A 1 497 ? -0.220  6.145   19.240  1.00 87.45  ? 497  SER A OG  1 
ATOM   3878 N N   . PRO A 1 498 ? -0.974  4.356   16.530  1.00 83.96  ? 498  PRO A N   1 
ATOM   3879 C CA  . PRO A 1 498 ? -0.366  3.715   15.353  1.00 74.01  ? 498  PRO A CA  1 
ATOM   3880 C C   . PRO A 1 498 ? 0.986   3.084   15.658  1.00 62.62  ? 498  PRO A C   1 
ATOM   3881 O O   . PRO A 1 498 ? 1.786   3.690   16.358  1.00 56.11  ? 498  PRO A O   1 
ATOM   3882 C CB  . PRO A 1 498 ? -0.172  4.881   14.378  1.00 73.65  ? 498  PRO A CB  1 
ATOM   3883 C CG  . PRO A 1 498 ? -1.158  5.903   14.800  1.00 78.25  ? 498  PRO A CG  1 
ATOM   3884 C CD  . PRO A 1 498 ? -1.241  5.786   16.289  1.00 82.41  ? 498  PRO A CD  1 
ATOM   3885 N N   . GLN A 1 499 ? 1.232   1.890   15.124  1.00 63.66  ? 499  GLN A N   1 
ATOM   3886 C CA  . GLN A 1 499 ? 2.445   1.136   15.426  1.00 57.55  ? 499  GLN A CA  1 
ATOM   3887 C C   . GLN A 1 499 ? 3.627   1.496   14.527  1.00 54.65  ? 499  GLN A C   1 
ATOM   3888 O O   . GLN A 1 499 ? 3.466   1.838   13.358  1.00 52.58  ? 499  GLN A O   1 
ATOM   3889 C CB  . GLN A 1 499 ? 2.170   -0.370  15.361  1.00 62.21  ? 499  GLN A CB  1 
ATOM   3890 C CG  . GLN A 1 499 ? 1.192   -0.869  16.423  1.00 74.67  ? 499  GLN A CG  1 
ATOM   3891 C CD  . GLN A 1 499 ? 1.769   -0.809  17.834  1.00 77.41  ? 499  GLN A CD  1 
ATOM   3892 O OE1 . GLN A 1 499 ? 2.719   -1.528  18.160  1.00 74.86  ? 499  GLN A OE1 1 
ATOM   3893 N NE2 . GLN A 1 499 ? 1.194   0.050   18.676  1.00 78.62  ? 499  GLN A NE2 1 
ATOM   3894 N N   . TRP A 1 500 ? 4.821   1.428   15.098  1.00 53.64  ? 500  TRP A N   1 
ATOM   3895 C CA  . TRP A 1 500 ? 6.053   1.630   14.360  1.00 41.66  ? 500  TRP A CA  1 
ATOM   3896 C C   . TRP A 1 500 ? 6.550   0.238   13.983  1.00 46.89  ? 500  TRP A C   1 
ATOM   3897 O O   . TRP A 1 500 ? 6.997   -0.519  14.851  1.00 45.50  ? 500  TRP A O   1 
ATOM   3898 C CB  . TRP A 1 500 ? 7.059   2.366   15.261  1.00 41.61  ? 500  TRP A CB  1 
ATOM   3899 C CG  . TRP A 1 500 ? 8.341   2.792   14.625  1.00 38.70  ? 500  TRP A CG  1 
ATOM   3900 C CD1 . TRP A 1 500 ? 8.902   2.303   13.476  1.00 41.85  ? 500  TRP A CD1 1 
ATOM   3901 C CD2 . TRP A 1 500 ? 9.237   3.804   15.110  1.00 41.71  ? 500  TRP A CD2 1 
ATOM   3902 N NE1 . TRP A 1 500 ? 10.095  2.956   13.214  1.00 38.57  ? 500  TRP A NE1 1 
ATOM   3903 C CE2 . TRP A 1 500 ? 10.322  3.877   14.204  1.00 38.02  ? 500  TRP A CE2 1 
ATOM   3904 C CE3 . TRP A 1 500 ? 9.229   4.655   16.220  1.00 37.35  ? 500  TRP A CE3 1 
ATOM   3905 C CZ2 . TRP A 1 500 ? 11.375  4.769   14.373  1.00 38.34  ? 500  TRP A CZ2 1 
ATOM   3906 C CZ3 . TRP A 1 500 ? 10.281  5.542   16.383  1.00 32.32  ? 500  TRP A CZ3 1 
ATOM   3907 C CH2 . TRP A 1 500 ? 11.335  5.592   15.468  1.00 40.24  ? 500  TRP A CH2 1 
ATOM   3908 N N   . PRO A 1 501 ? 6.441   -0.127  12.694  1.00 42.46  ? 501  PRO A N   1 
ATOM   3909 C CA  . PRO A 1 501 ? 6.845   -1.478  12.288  1.00 43.52  ? 501  PRO A CA  1 
ATOM   3910 C C   . PRO A 1 501 ? 8.356   -1.530  12.091  1.00 44.34  ? 501  PRO A C   1 
ATOM   3911 O O   . PRO A 1 501 ? 8.961   -0.483  11.858  1.00 38.42  ? 501  PRO A O   1 
ATOM   3912 C CB  . PRO A 1 501 ? 6.137   -1.652  10.947  1.00 45.36  ? 501  PRO A CB  1 
ATOM   3913 C CG  . PRO A 1 501 ? 6.135   -0.264  10.370  1.00 43.49  ? 501  PRO A CG  1 
ATOM   3914 C CD  . PRO A 1 501 ? 6.005   0.686   11.543  1.00 42.27  ? 501  PRO A CD  1 
ATOM   3915 N N   . PRO A 1 502 ? 8.962   -2.721  12.209  1.00 44.17  ? 502  PRO A N   1 
ATOM   3916 C CA  . PRO A 1 502 ? 10.392  -2.870  11.906  1.00 42.97  ? 502  PRO A CA  1 
ATOM   3917 C C   . PRO A 1 502 ? 10.707  -2.573  10.436  1.00 44.47  ? 502  PRO A C   1 
ATOM   3918 O O   . PRO A 1 502 ? 9.869   -2.783  9.567   1.00 47.25  ? 502  PRO A O   1 
ATOM   3919 C CB  . PRO A 1 502 ? 10.662  -4.346  12.210  1.00 41.96  ? 502  PRO A CB  1 
ATOM   3920 C CG  . PRO A 1 502 ? 9.611   -4.717  13.211  1.00 44.02  ? 502  PRO A CG  1 
ATOM   3921 C CD  . PRO A 1 502 ? 8.393   -3.937  12.814  1.00 44.62  ? 502  PRO A CD  1 
ATOM   3922 N N   . TYR A 1 503 ? 11.902  -2.062  10.173  1.00 41.80  ? 503  TYR A N   1 
ATOM   3923 C CA  . TYR A 1 503 ? 12.376  -1.897  8.809   1.00 42.96  ? 503  TYR A CA  1 
ATOM   3924 C C   . TYR A 1 503 ? 12.834  -3.258  8.303   1.00 42.71  ? 503  TYR A C   1 
ATOM   3925 O O   . TYR A 1 503 ? 13.517  -3.978  9.021   1.00 42.41  ? 503  TYR A O   1 
ATOM   3926 C CB  . TYR A 1 503 ? 13.542  -0.910  8.790   1.00 39.01  ? 503  TYR A CB  1 
ATOM   3927 C CG  . TYR A 1 503 ? 14.101  -0.636  7.408   1.00 40.74  ? 503  TYR A CG  1 
ATOM   3928 C CD1 . TYR A 1 503 ? 15.122  -1.422  6.885   1.00 39.77  ? 503  TYR A CD1 1 
ATOM   3929 C CD2 . TYR A 1 503 ? 13.616  0.414   6.629   1.00 37.91  ? 503  TYR A CD2 1 
ATOM   3930 C CE1 . TYR A 1 503 ? 15.650  -1.170  5.629   1.00 40.31  ? 503  TYR A CE1 1 
ATOM   3931 C CE2 . TYR A 1 503 ? 14.137  0.665   5.357   1.00 39.67  ? 503  TYR A CE2 1 
ATOM   3932 C CZ  . TYR A 1 503 ? 15.155  -0.133  4.870   1.00 39.41  ? 503  TYR A CZ  1 
ATOM   3933 O OH  . TYR A 1 503 ? 15.680  0.091   3.623   1.00 48.62  ? 503  TYR A OH  1 
ATOM   3934 N N   . THR A 1 504 ? 12.447  -3.624  7.083   1.00 45.86  ? 504  THR A N   1 
ATOM   3935 C CA  . THR A 1 504 ? 12.907  -4.879  6.477   1.00 50.14  ? 504  THR A CA  1 
ATOM   3936 C C   . THR A 1 504 ? 13.334  -4.667  5.033   1.00 52.02  ? 504  THR A C   1 
ATOM   3937 O O   . THR A 1 504 ? 12.907  -3.714  4.395   1.00 48.82  ? 504  THR A O   1 
ATOM   3938 C CB  . THR A 1 504 ? 11.814  -5.942  6.460   1.00 51.78  ? 504  THR A CB  1 
ATOM   3939 O OG1 . THR A 1 504 ? 10.724  -5.474  5.657   1.00 54.93  ? 504  THR A OG1 1 
ATOM   3940 C CG2 . THR A 1 504 ? 11.329  -6.256  7.876   1.00 47.57  ? 504  THR A CG2 1 
ATOM   3941 N N   . THR A 1 505 ? 14.164  -5.564  4.515   1.00 48.80  ? 505  THR A N   1 
ATOM   3942 C CA  . THR A 1 505 ? 14.598  -5.459  3.130   1.00 51.08  ? 505  THR A CA  1 
ATOM   3943 C C   . THR A 1 505 ? 13.417  -5.504  2.154   1.00 55.95  ? 505  THR A C   1 
ATOM   3944 O O   . THR A 1 505 ? 13.414  -4.799  1.146   1.00 54.63  ? 505  THR A O   1 
ATOM   3945 C CB  . THR A 1 505 ? 15.638  -6.551  2.769   1.00 61.25  ? 505  THR A CB  1 
ATOM   3946 O OG1 . THR A 1 505 ? 15.104  -7.853  3.047   1.00 58.22  ? 505  THR A OG1 1 
ATOM   3947 C CG2 . THR A 1 505 ? 16.915  -6.356  3.573   1.00 59.25  ? 505  THR A CG2 1 
ATOM   3948 N N   . ALA A 1 506 ? 12.411  -6.318  2.470   1.00 55.43  ? 506  ALA A N   1 
ATOM   3949 C CA  . ALA A 1 506 ? 11.267  -6.525  1.582   1.00 58.76  ? 506  ALA A CA  1 
ATOM   3950 C C   . ALA A 1 506 ? 10.332  -5.326  1.542   1.00 67.86  ? 506  ALA A C   1 
ATOM   3951 O O   . ALA A 1 506 ? 9.989   -4.841  0.460   1.00 68.08  ? 506  ALA A O   1 
ATOM   3952 C CB  . ALA A 1 506 ? 10.499  -7.760  1.988   1.00 61.45  ? 506  ALA A CB  1 
ATOM   3953 N N   . ALA A 1 507 ? 9.923   -4.852  2.719   1.00 54.15  ? 507  ALA A N   1 
ATOM   3954 C CA  . ALA A 1 507 ? 8.939   -3.776  2.814   1.00 53.05  ? 507  ALA A CA  1 
ATOM   3955 C C   . ALA A 1 507 ? 9.557   -2.380  2.963   1.00 51.26  ? 507  ALA A C   1 
ATOM   3956 O O   . ALA A 1 507 ? 8.962   -1.393  2.542   1.00 55.83  ? 507  ALA A O   1 
ATOM   3957 C CB  . ALA A 1 507 ? 7.956   -4.051  3.947   1.00 52.95  ? 507  ALA A CB  1 
ATOM   3958 N N   . GLN A 1 508 ? 10.736  -2.303  3.570   1.00 46.88  ? 508  GLN A N   1 
ATOM   3959 C CA  . GLN A 1 508 ? 11.477  -1.036  3.696   1.00 49.70  ? 508  GLN A CA  1 
ATOM   3960 C C   . GLN A 1 508 ? 10.675  0.074   4.378   1.00 46.77  ? 508  GLN A C   1 
ATOM   3961 O O   . GLN A 1 508 ? 10.730  1.235   3.978   1.00 47.58  ? 508  GLN A O   1 
ATOM   3962 C CB  . GLN A 1 508 ? 12.008  -0.563  2.331   1.00 45.32  ? 508  GLN A CB  1 
ATOM   3963 C CG  . GLN A 1 508 ? 12.762  -1.635  1.540   1.00 48.23  ? 508  GLN A CG  1 
ATOM   3964 C CD  . GLN A 1 508 ? 13.244  -1.143  0.182   1.00 58.94  ? 508  GLN A CD  1 
ATOM   3965 O OE1 . GLN A 1 508 ? 13.878  -0.096  0.085   1.00 56.09  ? 508  GLN A OE1 1 
ATOM   3966 N NE2 . GLN A 1 508 ? 12.940  -1.898  -0.874  1.00 64.80  ? 508  GLN A NE2 1 
ATOM   3967 N N   . GLN A 1 509 ? 9.948   -0.292  5.426   1.00 47.58  ? 509  GLN A N   1 
ATOM   3968 C CA  . GLN A 1 509 ? 9.103   0.648   6.156   1.00 45.69  ? 509  GLN A CA  1 
ATOM   3969 C C   . GLN A 1 509 ? 9.832   1.497   7.195   1.00 43.91  ? 509  GLN A C   1 
ATOM   3970 O O   . GLN A 1 509 ? 10.639  0.999   7.967   1.00 36.20  ? 509  GLN A O   1 
ATOM   3971 C CB  . GLN A 1 509 ? 7.961   -0.099  6.843   1.00 45.46  ? 509  GLN A CB  1 
ATOM   3972 C CG  . GLN A 1 509 ? 6.822   -0.448  5.926   1.00 52.61  ? 509  GLN A CG  1 
ATOM   3973 C CD  . GLN A 1 509 ? 5.872   -1.437  6.551   1.00 54.61  ? 509  GLN A CD  1 
ATOM   3974 O OE1 . GLN A 1 509 ? 6.298   -2.413  7.171   1.00 52.14  ? 509  GLN A OE1 1 
ATOM   3975 N NE2 . GLN A 1 509 ? 4.576   -1.194  6.393   1.00 58.10  ? 509  GLN A NE2 1 
ATOM   3976 N N   . TYR A 1 510 ? 9.502   2.781   7.219   1.00 36.17  ? 510  TYR A N   1 
ATOM   3977 C CA  . TYR A 1 510 ? 9.954   3.691   8.257   1.00 41.12  ? 510  TYR A CA  1 
ATOM   3978 C C   . TYR A 1 510 ? 8.800   4.622   8.658   1.00 41.48  ? 510  TYR A C   1 
ATOM   3979 O O   . TYR A 1 510 ? 7.752   4.643   8.007   1.00 46.10  ? 510  TYR A O   1 
ATOM   3980 C CB  . TYR A 1 510 ? 11.158  4.498   7.764   1.00 35.47  ? 510  TYR A CB  1 
ATOM   3981 C CG  . TYR A 1 510 ? 10.867  5.366   6.555   1.00 36.31  ? 510  TYR A CG  1 
ATOM   3982 C CD1 . TYR A 1 510 ? 10.644  4.803   5.293   1.00 35.07  ? 510  TYR A CD1 1 
ATOM   3983 C CD2 . TYR A 1 510 ? 10.825  6.753   6.674   1.00 33.56  ? 510  TYR A CD2 1 
ATOM   3984 C CE1 . TYR A 1 510 ? 10.378  5.600   4.186   1.00 36.44  ? 510  TYR A CE1 1 
ATOM   3985 C CE2 . TYR A 1 510 ? 10.561  7.556   5.580   1.00 36.37  ? 510  TYR A CE2 1 
ATOM   3986 C CZ  . TYR A 1 510 ? 10.343  6.982   4.337   1.00 41.24  ? 510  TYR A CZ  1 
ATOM   3987 O OH  . TYR A 1 510 ? 10.082  7.805   3.259   1.00 47.04  ? 510  TYR A OH  1 
ATOM   3988 N N   . VAL A 1 511 ? 8.976   5.388   9.730   1.00 37.96  ? 511  VAL A N   1 
ATOM   3989 C CA  . VAL A 1 511 ? 7.925   6.312   10.145  1.00 35.13  ? 511  VAL A CA  1 
ATOM   3990 C C   . VAL A 1 511 ? 8.367   7.763   10.051  1.00 36.26  ? 511  VAL A C   1 
ATOM   3991 O O   . VAL A 1 511 ? 9.551   8.081   10.180  1.00 39.92  ? 511  VAL A O   1 
ATOM   3992 C CB  . VAL A 1 511 ? 7.448   6.059   11.589  1.00 39.10  ? 511  VAL A CB  1 
ATOM   3993 C CG1 . VAL A 1 511 ? 6.815   4.683   11.724  1.00 36.57  ? 511  VAL A CG1 1 
ATOM   3994 C CG2 . VAL A 1 511 ? 8.610   6.245   12.579  1.00 32.48  ? 511  VAL A CG2 1 
ATOM   3995 N N   . SER A 1 512 ? 7.400   8.639   9.814   1.00 33.43  ? 512  SER A N   1 
ATOM   3996 C CA  . SER A 1 512 ? 7.616   10.070  9.935   1.00 38.21  ? 512  SER A CA  1 
ATOM   3997 C C   . SER A 1 512 ? 7.474   10.506  11.400  1.00 37.41  ? 512  SER A C   1 
ATOM   3998 O O   . SER A 1 512 ? 6.497   10.170  12.075  1.00 44.43  ? 512  SER A O   1 
ATOM   3999 C CB  . SER A 1 512 ? 6.621   10.826  9.058   1.00 34.42  ? 512  SER A CB  1 
ATOM   4000 O OG  . SER A 1 512 ? 5.293   10.498  9.423   1.00 48.67  ? 512  SER A OG  1 
ATOM   4001 N N   . LEU A 1 513 ? 8.460   11.232  11.899  1.00 34.41  ? 513  LEU A N   1 
ATOM   4002 C CA  . LEU A 1 513 ? 8.334   11.836  13.215  1.00 37.59  ? 513  LEU A CA  1 
ATOM   4003 C C   . LEU A 1 513 ? 8.038   13.328  13.079  1.00 39.95  ? 513  LEU A C   1 
ATOM   4004 O O   . LEU A 1 513 ? 8.934   14.109  12.751  1.00 42.46  ? 513  LEU A O   1 
ATOM   4005 C CB  . LEU A 1 513 ? 9.606   11.636  14.035  1.00 33.79  ? 513  LEU A CB  1 
ATOM   4006 C CG  . LEU A 1 513 ? 10.020  10.206  14.378  1.00 35.51  ? 513  LEU A CG  1 
ATOM   4007 C CD1 . LEU A 1 513 ? 11.311  10.200  15.203  1.00 28.72  ? 513  LEU A CD1 1 
ATOM   4008 C CD2 . LEU A 1 513 ? 8.906   9.525   15.130  1.00 35.11  ? 513  LEU A CD2 1 
ATOM   4009 N N   . ASN A 1 514 ? 6.785   13.709  13.329  1.00 35.77  ? 514  ASN A N   1 
ATOM   4010 C CA  . ASN A 1 514 ? 6.372   15.112  13.364  1.00 40.02  ? 514  ASN A CA  1 
ATOM   4011 C C   . ASN A 1 514 ? 5.227   15.351  14.360  1.00 47.50  ? 514  ASN A C   1 
ATOM   4012 O O   . ASN A 1 514 ? 4.932   14.484  15.184  1.00 49.43  ? 514  ASN A O   1 
ATOM   4013 C CB  . ASN A 1 514 ? 5.978   15.597  11.966  1.00 41.40  ? 514  ASN A CB  1 
ATOM   4014 C CG  . ASN A 1 514 ? 5.034   14.630  11.250  1.00 49.37  ? 514  ASN A CG  1 
ATOM   4015 O OD1 . ASN A 1 514 ? 3.931   14.344  11.730  1.00 47.24  ? 514  ASN A OD1 1 
ATOM   4016 N ND2 . ASN A 1 514 ? 5.465   14.127  10.089  1.00 51.79  ? 514  ASN A ND2 1 
ATOM   4017 N N   . LEU A 1 515 ? 4.577   16.514  14.275  1.00 49.38  ? 515  LEU A N   1 
ATOM   4018 C CA  . LEU A 1 515 ? 3.514   16.876  15.218  1.00 43.35  ? 515  LEU A CA  1 
ATOM   4019 C C   . LEU A 1 515 ? 2.267   16.012  15.054  1.00 51.34  ? 515  LEU A C   1 
ATOM   4020 O O   . LEU A 1 515 ? 1.506   15.830  15.999  1.00 54.58  ? 515  LEU A O   1 
ATOM   4021 C CB  . LEU A 1 515 ? 3.139   18.349  15.077  1.00 44.96  ? 515  LEU A CB  1 
ATOM   4022 C CG  . LEU A 1 515 ? 4.250   19.352  15.359  1.00 58.26  ? 515  LEU A CG  1 
ATOM   4023 C CD1 . LEU A 1 515 ? 3.716   20.758  15.283  1.00 45.78  ? 515  LEU A CD1 1 
ATOM   4024 C CD2 . LEU A 1 515 ? 4.883   19.076  16.714  1.00 42.16  ? 515  LEU A CD2 1 
ATOM   4025 N N   . LYS A 1 516 ? 2.066   15.491  13.847  1.00 51.79  ? 516  LYS A N   1 
ATOM   4026 C CA  . LYS A 1 516 ? 0.962   14.583  13.546  1.00 50.68  ? 516  LYS A CA  1 
ATOM   4027 C C   . LYS A 1 516 ? 1.298   13.176  14.053  1.00 48.44  ? 516  LYS A C   1 
ATOM   4028 O O   . LYS A 1 516 ? 2.461   12.872  14.318  1.00 45.44  ? 516  LYS A O   1 
ATOM   4029 C CB  . LYS A 1 516 ? 0.713   14.563  12.038  1.00 49.69  ? 516  LYS A CB  1 
ATOM   4030 C CG  . LYS A 1 516 ? 0.483   15.940  11.434  1.00 76.38  ? 516  LYS A CG  1 
ATOM   4031 C CD  . LYS A 1 516 ? 0.801   15.975  9.936   1.00 75.92  ? 516  LYS A CD  1 
ATOM   4032 C CE  . LYS A 1 516 ? -0.240  15.251  9.096   1.00 83.58  ? 516  LYS A CE  1 
ATOM   4033 N NZ  . LYS A 1 516 ? 0.025   15.416  7.631   1.00 86.49  ? 516  LYS A NZ  1 
ATOM   4034 N N   . PRO A 1 517 ? 0.284   12.314  14.212  1.00 56.00  ? 517  PRO A N   1 
ATOM   4035 C CA  . PRO A 1 517 ? 0.580   10.949  14.663  1.00 51.77  ? 517  PRO A CA  1 
ATOM   4036 C C   . PRO A 1 517 ? 1.457   10.203  13.663  1.00 50.84  ? 517  PRO A C   1 
ATOM   4037 O O   . PRO A 1 517 ? 1.519   10.599  12.494  1.00 50.66  ? 517  PRO A O   1 
ATOM   4038 C CB  . PRO A 1 517 ? -0.807  10.305  14.742  1.00 56.61  ? 517  PRO A CB  1 
ATOM   4039 C CG  . PRO A 1 517 ? -1.713  11.440  15.003  1.00 58.79  ? 517  PRO A CG  1 
ATOM   4040 C CD  . PRO A 1 517 ? -1.163  12.583  14.203  1.00 56.07  ? 517  PRO A CD  1 
ATOM   4041 N N   . LEU A 1 518 ? 2.131   9.150   14.124  1.00 50.18  ? 518  LEU A N   1 
ATOM   4042 C CA  . LEU A 1 518 ? 3.017   8.356   13.272  1.00 46.49  ? 518  LEU A CA  1 
ATOM   4043 C C   . LEU A 1 518 ? 2.394   7.969   11.942  1.00 54.07  ? 518  LEU A C   1 
ATOM   4044 O O   . LEU A 1 518 ? 1.215   7.610   11.856  1.00 60.69  ? 518  LEU A O   1 
ATOM   4045 C CB  . LEU A 1 518 ? 3.460   7.075   13.972  1.00 47.02  ? 518  LEU A CB  1 
ATOM   4046 C CG  . LEU A 1 518 ? 4.584   7.132   14.990  1.00 44.61  ? 518  LEU A CG  1 
ATOM   4047 C CD1 . LEU A 1 518 ? 5.023   5.720   15.302  1.00 48.79  ? 518  LEU A CD1 1 
ATOM   4048 C CD2 . LEU A 1 518 ? 5.733   7.954   14.472  1.00 43.28  ? 518  LEU A CD2 1 
ATOM   4049 N N   . GLU A 1 519 ? 3.211   8.029   10.907  1.00 45.66  ? 519  GLU A N   1 
ATOM   4050 C CA  . GLU A 1 519 ? 2.780   7.653   9.584   1.00 50.91  ? 519  GLU A CA  1 
ATOM   4051 C C   . GLU A 1 519 ? 3.824   6.730   8.974   1.00 45.16  ? 519  GLU A C   1 
ATOM   4052 O O   . GLU A 1 519 ? 4.999   7.069   8.919   1.00 46.92  ? 519  GLU A O   1 
ATOM   4053 C CB  . GLU A 1 519 ? 2.588   8.911   8.746   1.00 56.54  ? 519  GLU A CB  1 
ATOM   4054 C CG  . GLU A 1 519 ? 2.638   8.691   7.253   1.00 66.22  ? 519  GLU A CG  1 
ATOM   4055 C CD  . GLU A 1 519 ? 2.249   9.938   6.489   1.00 75.04  ? 519  GLU A CD  1 
ATOM   4056 O OE1 . GLU A 1 519 ? 1.401   10.706  7.009   1.00 81.30  ? 519  GLU A OE1 1 
ATOM   4057 O OE2 . GLU A 1 519 ? 2.797   10.149  5.381   1.00 71.42  ? 519  GLU A OE2 1 
ATOM   4058 N N   . VAL A 1 520 ? 3.404   5.546   8.551   1.00 47.71  ? 520  VAL A N   1 
ATOM   4059 C CA  . VAL A 1 520 ? 4.320   4.591   7.939   1.00 47.55  ? 520  VAL A CA  1 
ATOM   4060 C C   . VAL A 1 520 ? 4.542   4.944   6.470   1.00 46.48  ? 520  VAL A C   1 
ATOM   4061 O O   . VAL A 1 520 ? 3.580   5.150   5.728   1.00 48.04  ? 520  VAL A O   1 
ATOM   4062 C CB  . VAL A 1 520 ? 3.762   3.154   8.039   1.00 52.12  ? 520  VAL A CB  1 
ATOM   4063 C CG1 . VAL A 1 520 ? 4.656   2.174   7.319   1.00 49.33  ? 520  VAL A CG1 1 
ATOM   4064 C CG2 . VAL A 1 520 ? 3.598   2.757   9.490   1.00 51.54  ? 520  VAL A CG2 1 
ATOM   4065 N N   . ARG A 1 521 ? 5.806   5.035   6.064   1.00 42.19  ? 521  ARG A N   1 
ATOM   4066 C CA  . ARG A 1 521 ? 6.165   5.247   4.662   1.00 47.28  ? 521  ARG A CA  1 
ATOM   4067 C C   . ARG A 1 521 ? 7.037   4.096   4.187   1.00 51.98  ? 521  ARG A C   1 
ATOM   4068 O O   . ARG A 1 521 ? 7.644   3.408   5.001   1.00 40.09  ? 521  ARG A O   1 
ATOM   4069 C CB  . ARG A 1 521 ? 6.910   6.574   4.478   1.00 43.93  ? 521  ARG A CB  1 
ATOM   4070 C CG  . ARG A 1 521 ? 6.063   7.774   4.817   1.00 47.48  ? 521  ARG A CG  1 
ATOM   4071 C CD  . ARG A 1 521 ? 6.774   9.095   4.607   1.00 40.75  ? 521  ARG A CD  1 
ATOM   4072 N NE  . ARG A 1 521 ? 5.996   10.186  5.198   1.00 41.95  ? 521  ARG A NE  1 
ATOM   4073 C CZ  . ARG A 1 521 ? 6.505   11.357  5.569   1.00 45.82  ? 521  ARG A CZ  1 
ATOM   4074 N NH1 . ARG A 1 521 ? 7.803   11.605  5.402   1.00 41.09  ? 521  ARG A NH1 1 
ATOM   4075 N NH2 . ARG A 1 521 ? 5.720   12.280  6.118   1.00 46.72  ? 521  ARG A NH2 1 
ATOM   4076 N N   . ARG A 1 522 ? 7.093   3.876   2.876   1.00 41.46  ? 522  ARG A N   1 
ATOM   4077 C CA  . ARG A 1 522 ? 7.936   2.819   2.336   1.00 48.05  ? 522  ARG A CA  1 
ATOM   4078 C C   . ARG A 1 522 ? 9.095   3.372   1.490   1.00 47.81  ? 522  ARG A C   1 
ATOM   4079 O O   . ARG A 1 522 ? 8.927   4.298   0.701   1.00 52.78  ? 522  ARG A O   1 
ATOM   4080 C CB  . ARG A 1 522 ? 7.101   1.807   1.543   1.00 49.45  ? 522  ARG A CB  1 
ATOM   4081 C CG  . ARG A 1 522 ? 6.018   1.111   2.365   1.00 66.00  ? 522  ARG A CG  1 
ATOM   4082 C CD  . ARG A 1 522 ? 5.307   0.023   1.557   1.00 80.60  ? 522  ARG A CD  1 
ATOM   4083 N NE  . ARG A 1 522 ? 6.257   -0.740  0.744   1.00 92.09  ? 522  ARG A NE  1 
ATOM   4084 C CZ  . ARG A 1 522 ? 5.947   -1.790  -0.017  1.00 98.77  ? 522  ARG A CZ  1 
ATOM   4085 N NH1 . ARG A 1 522 ? 4.696   -2.233  -0.078  1.00 103.07 ? 522  ARG A NH1 1 
ATOM   4086 N NH2 . ARG A 1 522 ? 6.896   -2.402  -0.718  1.00 97.05  ? 522  ARG A NH2 1 
ATOM   4087 N N   . GLY A 1 523 ? 10.279  2.811   1.679   1.00 43.90  ? 523  GLY A N   1 
ATOM   4088 C CA  . GLY A 1 523 ? 11.419  3.169   0.857   1.00 45.73  ? 523  GLY A CA  1 
ATOM   4089 C C   . GLY A 1 523 ? 12.112  4.446   1.277   1.00 45.78  ? 523  GLY A C   1 
ATOM   4090 O O   . GLY A 1 523 ? 11.554  5.535   1.192   1.00 52.67  ? 523  GLY A O   1 
ATOM   4091 N N   . LEU A 1 524 ? 13.343  4.301   1.740   1.00 44.21  ? 524  LEU A N   1 
ATOM   4092 C CA  . LEU A 1 524 ? 14.133  5.432   2.164   1.00 45.30  ? 524  LEU A CA  1 
ATOM   4093 C C   . LEU A 1 524 ? 14.866  5.980   0.952   1.00 40.57  ? 524  LEU A C   1 
ATOM   4094 O O   . LEU A 1 524 ? 15.988  5.564   0.670   1.00 38.33  ? 524  LEU A O   1 
ATOM   4095 C CB  . LEU A 1 524 ? 15.156  4.983   3.203   1.00 51.96  ? 524  LEU A CB  1 
ATOM   4096 C CG  . LEU A 1 524 ? 15.287  5.837   4.462   1.00 58.41  ? 524  LEU A CG  1 
ATOM   4097 C CD1 . LEU A 1 524 ? 14.721  7.251   4.240   1.00 56.19  ? 524  LEU A CD1 1 
ATOM   4098 C CD2 . LEU A 1 524 ? 14.607  5.124   5.633   1.00 57.52  ? 524  LEU A CD2 1 
ATOM   4099 N N   . ARG A 1 525 ? 14.230  6.910   0.246   1.00 39.01  ? 525  ARG A N   1 
ATOM   4100 C CA  . ARG A 1 525 ? 14.781  7.459   -0.992  1.00 42.21  ? 525  ARG A CA  1 
ATOM   4101 C C   . ARG A 1 525 ? 15.365  6.323   -1.849  1.00 38.43  ? 525  ARG A C   1 
ATOM   4102 O O   . ARG A 1 525 ? 16.532  6.362   -2.251  1.00 33.89  ? 525  ARG A O   1 
ATOM   4103 C CB  . ARG A 1 525 ? 15.820  8.558   -0.682  1.00 37.55  ? 525  ARG A CB  1 
ATOM   4104 C CG  . ARG A 1 525 ? 15.476  9.895   -1.327  1.00 46.73  ? 525  ARG A CG  1 
ATOM   4105 C CD  . ARG A 1 525 ? 16.139  11.083  -0.657  1.00 56.33  ? 525  ARG A CD  1 
ATOM   4106 N NE  . ARG A 1 525 ? 15.300  11.680  0.383   1.00 66.67  ? 525  ARG A NE  1 
ATOM   4107 C CZ  . ARG A 1 525 ? 15.529  12.868  0.946   1.00 70.50  ? 525  ARG A CZ  1 
ATOM   4108 N NH1 . ARG A 1 525 ? 16.569  13.599  0.565   1.00 66.40  ? 525  ARG A NH1 1 
ATOM   4109 N NH2 . ARG A 1 525 ? 14.714  13.329  1.893   1.00 74.36  ? 525  ARG A NH2 1 
ATOM   4110 N N   . ALA A 1 526 ? 14.551  5.296   -2.089  1.00 32.91  ? 526  ALA A N   1 
ATOM   4111 C CA  . ALA A 1 526 ? 15.053  4.048   -2.655  1.00 35.82  ? 526  ALA A CA  1 
ATOM   4112 C C   . ALA A 1 526 ? 15.681  4.236   -4.043  1.00 36.73  ? 526  ALA A C   1 
ATOM   4113 O O   . ALA A 1 526 ? 16.756  3.711   -4.316  1.00 34.65  ? 526  ALA A O   1 
ATOM   4114 C CB  . ALA A 1 526 ? 13.961  2.992   -2.684  1.00 38.69  ? 526  ALA A CB  1 
ATOM   4115 N N   . GLN A 1 527 ? 15.033  5.014   -4.899  1.00 32.71  ? 527  GLN A N   1 
ATOM   4116 C CA  . GLN A 1 527 ? 15.526  5.185   -6.259  1.00 44.36  ? 527  GLN A CA  1 
ATOM   4117 C C   . GLN A 1 527 ? 16.878  5.919   -6.316  1.00 40.78  ? 527  GLN A C   1 
ATOM   4118 O O   . GLN A 1 527 ? 17.844  5.420   -6.885  1.00 42.26  ? 527  GLN A O   1 
ATOM   4119 C CB  . GLN A 1 527 ? 14.459  5.882   -7.106  1.00 45.33  ? 527  GLN A CB  1 
ATOM   4120 C CG  . GLN A 1 527 ? 14.419  5.434   -8.536  1.00 52.45  ? 527  GLN A CG  1 
ATOM   4121 C CD  . GLN A 1 527 ? 14.109  3.953   -8.710  1.00 52.88  ? 527  GLN A CD  1 
ATOM   4122 O OE1 . GLN A 1 527 ? 13.503  3.317   -7.842  1.00 49.65  ? 527  GLN A OE1 1 
ATOM   4123 N NE2 . GLN A 1 527 ? 14.516  3.401   -9.854  1.00 52.49  ? 527  GLN A NE2 1 
ATOM   4124 N N   . THR A 1 528 ? 16.949  7.091   -5.703  1.00 31.37  ? 528  THR A N   1 
ATOM   4125 C CA  . THR A 1 528 ? 18.193  7.846   -5.629  1.00 32.83  ? 528  THR A CA  1 
ATOM   4126 C C   . THR A 1 528 ? 19.303  7.106   -4.870  1.00 36.79  ? 528  THR A C   1 
ATOM   4127 O O   . THR A 1 528 ? 20.478  7.140   -5.261  1.00 40.05  ? 528  THR A O   1 
ATOM   4128 C CB  . THR A 1 528 ? 17.948  9.219   -4.993  1.00 34.42  ? 528  THR A CB  1 
ATOM   4129 O OG1 . THR A 1 528 ? 17.222  10.028  -5.919  1.00 39.01  ? 528  THR A OG1 1 
ATOM   4130 C CG2 . THR A 1 528 ? 19.262  9.919   -4.663  1.00 39.62  ? 528  THR A CG2 1 
ATOM   4131 N N   . CYS A 1 529 ? 18.950  6.418   -3.794  1.00 27.86  ? 529  CYS A N   1 
ATOM   4132 C CA  . CYS A 1 529 ? 19.975  5.694   -3.055  1.00 31.65  ? 529  CYS A CA  1 
ATOM   4133 C C   . CYS A 1 529 ? 20.549  4.493   -3.839  1.00 33.29  ? 529  CYS A C   1 
ATOM   4134 O O   . CYS A 1 529 ? 21.658  4.039   -3.560  1.00 32.11  ? 529  CYS A O   1 
ATOM   4135 C CB  . CYS A 1 529 ? 19.495  5.323   -1.641  1.00 28.12  ? 529  CYS A CB  1 
ATOM   4136 S SG  . CYS A 1 529 ? 19.526  6.758   -0.495  1.00 33.42  ? 529  CYS A SG  1 
ATOM   4137 N N   . ALA A 1 530 ? 19.806  3.997   -4.824  1.00 29.19  ? 530  ALA A N   1 
ATOM   4138 C CA  . ALA A 1 530 ? 20.347  2.998   -5.741  1.00 34.15  ? 530  ALA A CA  1 
ATOM   4139 C C   . ALA A 1 530 ? 21.510  3.596   -6.526  1.00 38.74  ? 530  ALA A C   1 
ATOM   4140 O O   . ALA A 1 530 ? 22.522  2.928   -6.761  1.00 39.34  ? 530  ALA A O   1 
ATOM   4141 C CB  . ALA A 1 530 ? 19.279  2.510   -6.698  1.00 32.38  ? 530  ALA A CB  1 
ATOM   4142 N N   . PHE A 1 531 ? 21.354  4.851   -6.940  1.00 33.60  ? 531  PHE A N   1 
ATOM   4143 C CA  . PHE A 1 531 ? 22.430  5.566   -7.625  1.00 37.43  ? 531  PHE A CA  1 
ATOM   4144 C C   . PHE A 1 531 ? 23.712  5.624   -6.784  1.00 35.75  ? 531  PHE A C   1 
ATOM   4145 O O   . PHE A 1 531 ? 24.767  5.187   -7.231  1.00 38.28  ? 531  PHE A O   1 
ATOM   4146 C CB  . PHE A 1 531 ? 21.976  6.977   -8.031  1.00 32.43  ? 531  PHE A CB  1 
ATOM   4147 C CG  . PHE A 1 531 ? 23.092  7.869   -8.500  1.00 36.56  ? 531  PHE A CG  1 
ATOM   4148 C CD1 . PHE A 1 531 ? 23.510  7.843   -9.821  1.00 40.79  ? 531  PHE A CD1 1 
ATOM   4149 C CD2 . PHE A 1 531 ? 23.716  8.742   -7.620  1.00 40.61  ? 531  PHE A CD2 1 
ATOM   4150 C CE1 . PHE A 1 531 ? 24.528  8.660   -10.265 1.00 42.64  ? 531  PHE A CE1 1 
ATOM   4151 C CE2 . PHE A 1 531 ? 24.746  9.553   -8.049  1.00 43.59  ? 531  PHE A CE2 1 
ATOM   4152 C CZ  . PHE A 1 531 ? 25.149  9.517   -9.381  1.00 46.77  ? 531  PHE A CZ  1 
ATOM   4153 N N   . TRP A 1 532 ? 23.607  6.165   -5.575  1.00 32.43  ? 532  TRP A N   1 
ATOM   4154 C CA  . TRP A 1 532 ? 24.744  6.288   -4.663  1.00 38.11  ? 532  TRP A CA  1 
ATOM   4155 C C   . TRP A 1 532 ? 25.313  4.946   -4.212  1.00 40.58  ? 532  TRP A C   1 
ATOM   4156 O O   . TRP A 1 532 ? 26.534  4.758   -4.206  1.00 40.44  ? 532  TRP A O   1 
ATOM   4157 C CB  . TRP A 1 532 ? 24.373  7.120   -3.418  1.00 27.24  ? 532  TRP A CB  1 
ATOM   4158 C CG  . TRP A 1 532 ? 24.057  8.561   -3.729  1.00 31.62  ? 532  TRP A CG  1 
ATOM   4159 C CD1 . TRP A 1 532 ? 22.822  9.135   -3.806  1.00 27.90  ? 532  TRP A CD1 1 
ATOM   4160 C CD2 . TRP A 1 532 ? 24.999  9.596   -4.028  1.00 29.28  ? 532  TRP A CD2 1 
ATOM   4161 N NE1 . TRP A 1 532 ? 22.940  10.466  -4.128  1.00 29.79  ? 532  TRP A NE1 1 
ATOM   4162 C CE2 . TRP A 1 532 ? 24.267  10.771  -4.269  1.00 31.32  ? 532  TRP A CE2 1 
ATOM   4163 C CE3 . TRP A 1 532 ? 26.393  9.639   -4.117  1.00 30.36  ? 532  TRP A CE3 1 
ATOM   4164 C CZ2 . TRP A 1 532 ? 24.881  11.979  -4.596  1.00 33.78  ? 532  TRP A CZ2 1 
ATOM   4165 C CZ3 . TRP A 1 532 ? 26.995  10.832  -4.430  1.00 32.27  ? 532  TRP A CZ3 1 
ATOM   4166 C CH2 . TRP A 1 532 ? 26.240  11.987  -4.663  1.00 33.11  ? 532  TRP A CH2 1 
ATOM   4167 N N   . ASN A 1 533 ? 24.433  4.022   -3.833  1.00 32.59  ? 533  ASN A N   1 
ATOM   4168 C CA  . ASN A 1 533 ? 24.873  2.781   -3.182  1.00 34.95  ? 533  ASN A CA  1 
ATOM   4169 C C   . ASN A 1 533 ? 25.274  1.645   -4.124  1.00 40.99  ? 533  ASN A C   1 
ATOM   4170 O O   . ASN A 1 533 ? 26.084  0.798   -3.759  1.00 43.16  ? 533  ASN A O   1 
ATOM   4171 C CB  . ASN A 1 533 ? 23.810  2.281   -2.203  1.00 28.49  ? 533  ASN A CB  1 
ATOM   4172 C CG  . ASN A 1 533 ? 23.562  3.257   -1.062  1.00 29.91  ? 533  ASN A CG  1 
ATOM   4173 O OD1 . ASN A 1 533 ? 24.300  4.219   -0.894  1.00 33.22  ? 533  ASN A OD1 1 
ATOM   4174 N ND2 . ASN A 1 533 ? 22.535  2.995   -0.258  1.00 31.17  ? 533  ASN A ND2 1 
ATOM   4175 N N   . ARG A 1 534 ? 24.709  1.623   -5.327  1.00 33.34  ? 534  ARG A N   1 
ATOM   4176 C CA  . ARG A 1 534 ? 25.018  0.564   -6.281  1.00 41.30  ? 534  ARG A CA  1 
ATOM   4177 C C   . ARG A 1 534 ? 25.782  1.059   -7.503  1.00 45.78  ? 534  ARG A C   1 
ATOM   4178 O O   . ARG A 1 534 ? 26.829  0.507   -7.845  1.00 52.50  ? 534  ARG A O   1 
ATOM   4179 C CB  . ARG A 1 534 ? 23.749  -0.172  -6.721  1.00 35.90  ? 534  ARG A CB  1 
ATOM   4180 C CG  . ARG A 1 534 ? 23.032  -0.890  -5.593  1.00 36.72  ? 534  ARG A CG  1 
ATOM   4181 C CD  . ARG A 1 534 ? 21.564  -1.130  -5.934  1.00 44.96  ? 534  ARG A CD  1 
ATOM   4182 N NE  . ARG A 1 534 ? 20.796  -1.601  -4.783  1.00 51.84  ? 534  ARG A NE  1 
ATOM   4183 C CZ  . ARG A 1 534 ? 20.676  -2.881  -4.431  1.00 56.96  ? 534  ARG A CZ  1 
ATOM   4184 N NH1 . ARG A 1 534 ? 21.277  -3.837  -5.140  1.00 47.87  ? 534  ARG A NH1 1 
ATOM   4185 N NH2 . ARG A 1 534 ? 19.952  -3.205  -3.367  1.00 62.56  ? 534  ARG A NH2 1 
ATOM   4186 N N   . PHE A 1 535 ? 25.266  2.091   -8.163  1.00 38.30  ? 535  PHE A N   1 
ATOM   4187 C CA  . PHE A 1 535 ? 25.900  2.573   -9.388  1.00 39.89  ? 535  PHE A CA  1 
ATOM   4188 C C   . PHE A 1 535 ? 27.201  3.369   -9.191  1.00 43.01  ? 535  PHE A C   1 
ATOM   4189 O O   . PHE A 1 535 ? 28.209  3.048   -9.803  1.00 44.84  ? 535  PHE A O   1 
ATOM   4190 C CB  . PHE A 1 535 ? 24.932  3.379   -10.244 1.00 35.82  ? 535  PHE A CB  1 
ATOM   4191 C CG  . PHE A 1 535 ? 25.514  3.799   -11.548 1.00 38.02  ? 535  PHE A CG  1 
ATOM   4192 C CD1 . PHE A 1 535 ? 25.767  2.863   -12.534 1.00 39.83  ? 535  PHE A CD1 1 
ATOM   4193 C CD2 . PHE A 1 535 ? 25.833  5.119   -11.785 1.00 38.70  ? 535  PHE A CD2 1 
ATOM   4194 C CE1 . PHE A 1 535 ? 26.320  3.235   -13.737 1.00 42.73  ? 535  PHE A CE1 1 
ATOM   4195 C CE2 . PHE A 1 535 ? 26.379  5.502   -12.997 1.00 50.74  ? 535  PHE A CE2 1 
ATOM   4196 C CZ  . PHE A 1 535 ? 26.622  4.560   -13.973 1.00 45.73  ? 535  PHE A CZ  1 
ATOM   4197 N N   . LEU A 1 536 ? 27.168  4.409   -8.362  1.00 42.59  ? 536  LEU A N   1 
ATOM   4198 C CA  . LEU A 1 536 ? 28.339  5.271   -8.145  1.00 42.25  ? 536  LEU A CA  1 
ATOM   4199 C C   . LEU A 1 536 ? 29.657  4.509   -7.915  1.00 47.87  ? 536  LEU A C   1 
ATOM   4200 O O   . LEU A 1 536 ? 30.664  4.815   -8.561  1.00 52.01  ? 536  LEU A O   1 
ATOM   4201 C CB  . LEU A 1 536 ? 28.078  6.252   -6.997  1.00 44.77  ? 536  LEU A CB  1 
ATOM   4202 C CG  . LEU A 1 536 ? 28.774  7.623   -6.938  1.00 57.28  ? 536  LEU A CG  1 
ATOM   4203 C CD1 . LEU A 1 536 ? 30.224  7.535   -6.459  1.00 58.79  ? 536  LEU A CD1 1 
ATOM   4204 C CD2 . LEU A 1 536 ? 28.694  8.339   -8.274  1.00 61.24  ? 536  LEU A CD2 1 
ATOM   4205 N N   . PRO A 1 537 ? 29.659  3.510   -7.009  1.00 46.40  ? 537  PRO A N   1 
ATOM   4206 C CA  . PRO A 1 537 ? 30.945  2.829   -6.813  1.00 47.22  ? 537  PRO A CA  1 
ATOM   4207 C C   . PRO A 1 537 ? 31.444  2.081   -8.050  1.00 52.53  ? 537  PRO A C   1 
ATOM   4208 O O   . PRO A 1 537 ? 32.647  2.073   -8.285  1.00 65.64  ? 537  PRO A O   1 
ATOM   4209 C CB  . PRO A 1 537 ? 30.683  1.880   -5.633  1.00 40.49  ? 537  PRO A CB  1 
ATOM   4210 C CG  . PRO A 1 537 ? 29.228  1.776   -5.511  1.00 42.65  ? 537  PRO A CG  1 
ATOM   4211 C CD  . PRO A 1 537 ? 28.631  3.030   -6.068  1.00 41.03  ? 537  PRO A CD  1 
ATOM   4212 N N   . LYS A 1 538 ? 30.554  1.488   -8.837  1.00 47.16  ? 538  LYS A N   1 
ATOM   4213 C CA  . LYS A 1 538 ? 30.973  0.877   -10.099 1.00 48.28  ? 538  LYS A CA  1 
ATOM   4214 C C   . LYS A 1 538 ? 31.526  1.904   -11.088 1.00 50.27  ? 538  LYS A C   1 
ATOM   4215 O O   . LYS A 1 538 ? 32.429  1.615   -11.870 1.00 53.14  ? 538  LYS A O   1 
ATOM   4216 C CB  . LYS A 1 538 ? 29.824  0.099   -10.736 1.00 45.15  ? 538  LYS A CB  1 
ATOM   4217 C CG  . LYS A 1 538 ? 29.423  -1.117  -9.936  1.00 52.42  ? 538  LYS A CG  1 
ATOM   4218 C CD  . LYS A 1 538 ? 28.241  -1.846  -10.555 1.00 64.49  ? 538  LYS A CD  1 
ATOM   4219 C CE  . LYS A 1 538 ? 27.852  -3.043  -9.698  1.00 70.32  ? 538  LYS A CE  1 
ATOM   4220 N NZ  . LYS A 1 538 ? 29.038  -3.908  -9.398  1.00 71.52  ? 538  LYS A NZ  1 
ATOM   4221 N N   . LEU A 1 539 ? 30.978  3.109   -11.047 1.00 54.57  ? 539  LEU A N   1 
ATOM   4222 C CA  . LEU A 1 539 ? 31.385  4.169   -11.959 1.00 54.41  ? 539  LEU A CA  1 
ATOM   4223 C C   . LEU A 1 539 ? 32.748  4.736   -11.582 1.00 61.53  ? 539  LEU A C   1 
ATOM   4224 O O   . LEU A 1 539 ? 33.557  5.061   -12.453 1.00 63.34  ? 539  LEU A O   1 
ATOM   4225 C CB  . LEU A 1 539 ? 30.341  5.283   -11.969 1.00 45.84  ? 539  LEU A CB  1 
ATOM   4226 C CG  . LEU A 1 539 ? 30.681  6.448   -12.889 1.00 49.43  ? 539  LEU A CG  1 
ATOM   4227 C CD1 . LEU A 1 539 ? 30.993  5.902   -14.269 1.00 49.66  ? 539  LEU A CD1 1 
ATOM   4228 C CD2 . LEU A 1 539 ? 29.523  7.444   -12.934 1.00 47.07  ? 539  LEU A CD2 1 
ATOM   4229 N N   . LEU A 1 540 ? 32.993  4.863   -10.279 1.00 64.85  ? 540  LEU A N   1 
ATOM   4230 C CA  . LEU A 1 540 ? 34.292  5.316   -9.789  1.00 67.81  ? 540  LEU A CA  1 
ATOM   4231 C C   . LEU A 1 540 ? 35.389  4.309   -10.130 1.00 72.66  ? 540  LEU A C   1 
ATOM   4232 O O   . LEU A 1 540 ? 36.506  4.705   -10.476 1.00 78.93  ? 540  LEU A O   1 
ATOM   4233 C CB  . LEU A 1 540 ? 34.253  5.577   -8.279  1.00 63.23  ? 540  LEU A CB  1 
ATOM   4234 C CG  . LEU A 1 540 ? 33.646  6.913   -7.824  1.00 59.69  ? 540  LEU A CG  1 
ATOM   4235 C CD1 . LEU A 1 540 ? 33.614  7.010   -6.291  1.00 53.76  ? 540  LEU A CD1 1 
ATOM   4236 C CD2 . LEU A 1 540 ? 34.390  8.116   -8.449  1.00 52.84  ? 540  LEU A CD2 1 
ATOM   4237 N N   . SER A 1 541 ? 35.061  3.016   -10.031 1.00 69.29  ? 541  SER A N   1 
ATOM   4238 C CA  . SER A 1 541 ? 35.943  1.933   -10.482 1.00 68.26  ? 541  SER A CA  1 
ATOM   4239 C C   . SER A 1 541 ? 36.562  2.198   -11.858 1.00 77.67  ? 541  SER A C   1 
ATOM   4240 O O   . SER A 1 541 ? 37.730  1.888   -12.078 1.00 85.72  ? 541  SER A O   1 
ATOM   4241 C CB  . SER A 1 541 ? 35.196  0.597   -10.516 1.00 64.61  ? 541  SER A CB  1 
ATOM   4242 O OG  . SER A 1 541 ? 34.937  0.115   -9.214  1.00 62.91  ? 541  SER A OG  1 
ATOM   4243 N N   . ALA A 1 542 ? 35.789  2.766   -12.783 1.00 73.47  ? 542  ALA A N   1 
ATOM   4244 C CA  . ALA A 1 542 ? 36.347  3.180   -14.068 1.00 74.58  ? 542  ALA A CA  1 
ATOM   4245 C C   . ALA A 1 542 ? 36.976  4.586   -14.018 1.00 82.43  ? 542  ALA A C   1 
ATOM   4246 O O   . ALA A 1 542 ? 36.401  5.548   -14.530 1.00 83.35  ? 542  ALA A O   1 
ATOM   4247 C CB  . ALA A 1 542 ? 35.295  3.095   -15.154 1.00 70.35  ? 542  ALA A CB  1 
ATOM   4248 N N   . THR A 1 543 ? 38.147  4.683   -13.377 1.00 88.70  ? 543  THR A N   1 
ATOM   4249 C CA  . THR A 1 543 ? 39.005  5.883   -13.382 1.00 92.78  ? 543  THR A CA  1 
ATOM   4250 C C   . THR A 1 543 ? 40.336  5.604   -12.654 1.00 97.79  ? 543  THR A C   1 
ATOM   4251 O O   . THR A 1 543 ? 40.337  4.984   -11.585 1.00 93.42  ? 543  THR A O   1 
ATOM   4252 C CB  . THR A 1 543 ? 38.322  7.110   -12.742 1.00 88.98  ? 543  THR A CB  1 
ATOM   4253 N N   . ALA A 1 544 ? 41.455  6.067   -13.226 1.00 100.94 ? 544  ALA A N   1 
ATOM   4254 C CA  . ALA A 1 544 ? 42.796  5.771   -12.688 1.00 99.94  ? 544  ALA A CA  1 
ATOM   4255 C C   . ALA A 1 544 ? 43.605  6.962   -12.139 1.00 104.65 ? 544  ALA A C   1 
ATOM   4256 O O   . ALA A 1 544 ? 44.244  6.838   -11.092 1.00 105.03 ? 544  ALA A O   1 
ATOM   4257 C CB  . ALA A 1 544 ? 43.630  5.002   -13.714 1.00 100.24 ? 544  ALA A CB  1 
ATOM   4258 N N   . THR A 1 545 ? 43.596  8.099   -12.835 1.00 105.61 ? 545  THR A N   1 
ATOM   4259 C CA  . THR A 1 545 ? 44.459  9.224   -12.443 1.00 105.77 ? 545  THR A CA  1 
ATOM   4260 C C   . THR A 1 545 ? 43.791  10.611  -12.375 1.00 99.97  ? 545  THR A C   1 
ATOM   4261 O O   . THR A 1 545 ? 43.573  11.237  -13.412 1.00 97.43  ? 545  THR A O   1 
ATOM   4262 C CB  . THR A 1 545 ? 45.693  9.321   -13.368 1.00 111.20 ? 545  THR A CB  1 
ATOM   4263 N N   . GLU A 1 546 ? 43.487  11.109  -11.172 1.00 98.82  ? 546  GLU A N   1 
ATOM   4264 C CA  . GLU A 1 546 ? 43.723  10.413  -9.905  1.00 101.30 ? 546  GLU A CA  1 
ATOM   4265 C C   . GLU A 1 546 ? 42.744  10.859  -8.799  1.00 104.62 ? 546  GLU A C   1 
ATOM   4266 O O   . GLU A 1 546 ? 41.545  11.057  -9.052  1.00 104.22 ? 546  GLU A O   1 
ATOM   4267 C CB  . GLU A 1 546 ? 45.168  10.628  -9.427  1.00 107.01 ? 546  GLU A CB  1 
ATOM   4268 N N   . ALA A 1 547 ? 43.301  11.001  -7.590  1.00 106.87 ? 547  ALA A N   1 
ATOM   4269 C CA  . ALA A 1 547 ? 42.639  11.380  -6.323  1.00 98.89  ? 547  ALA A CA  1 
ATOM   4270 C C   . ALA A 1 547 ? 43.518  10.800  -5.207  1.00 101.31 ? 547  ALA A C   1 
ATOM   4271 O O   . ALA A 1 547 ? 44.746  10.911  -5.277  1.00 114.14 ? 547  ALA A O   1 
ATOM   4272 C CB  . ALA A 1 547 ? 41.201  10.861  -6.214  1.00 84.49  ? 547  ALA A CB  1 
ATOM   4273 N N   . PRO A 1 548 ? 42.902  10.159  -4.196  1.00 89.29  ? 548  PRO A N   1 
ATOM   4274 C CA  . PRO A 1 548 ? 43.580  9.447   -3.097  1.00 82.97  ? 548  PRO A CA  1 
ATOM   4275 C C   . PRO A 1 548 ? 44.614  10.295  -2.349  1.00 82.08  ? 548  PRO A C   1 
ATOM   4276 O O   . PRO A 1 548 ? 44.401  10.654  -1.186  1.00 74.26  ? 548  PRO A O   1 
ATOM   4277 C CB  . PRO A 1 548 ? 44.272  8.276   -3.810  1.00 78.13  ? 548  PRO A CB  1 
ATOM   4278 N N   . ASP B 1 5   ? -15.961 7.868   -67.845 1.00 68.28  ? 5    ASP B N   1 
ATOM   4279 C CA  . ASP B 1 5   ? -16.001 8.851   -66.753 1.00 68.31  ? 5    ASP B CA  1 
ATOM   4280 C C   . ASP B 1 5   ? -14.770 9.750   -66.776 1.00 70.44  ? 5    ASP B C   1 
ATOM   4281 O O   . ASP B 1 5   ? -13.676 9.321   -66.414 1.00 72.61  ? 5    ASP B O   1 
ATOM   4282 C CB  . ASP B 1 5   ? -16.115 8.166   -65.384 1.00 61.77  ? 5    ASP B CB  1 
ATOM   4283 C CG  . ASP B 1 5   ? -16.457 9.148   -64.250 1.00 66.31  ? 5    ASP B CG  1 
ATOM   4284 O OD1 . ASP B 1 5   ? -16.319 10.376  -64.447 1.00 66.84  ? 5    ASP B OD1 1 
ATOM   4285 O OD2 . ASP B 1 5   ? -16.873 8.686   -63.159 1.00 56.29  ? 5    ASP B OD2 1 
ATOM   4286 N N   . PRO B 1 6   ? -14.956 11.012  -67.187 1.00 68.05  ? 6    PRO B N   1 
ATOM   4287 C CA  . PRO B 1 6   ? -13.866 11.985  -67.329 1.00 63.03  ? 6    PRO B CA  1 
ATOM   4288 C C   . PRO B 1 6   ? -13.154 12.295  -66.013 1.00 64.16  ? 6    PRO B C   1 
ATOM   4289 O O   . PRO B 1 6   ? -11.989 12.698  -66.038 1.00 65.51  ? 6    PRO B O   1 
ATOM   4290 C CB  . PRO B 1 6   ? -14.577 13.235  -67.864 1.00 67.68  ? 6    PRO B CB  1 
ATOM   4291 C CG  . PRO B 1 6   ? -16.027 13.039  -67.537 1.00 66.41  ? 6    PRO B CG  1 
ATOM   4292 C CD  . PRO B 1 6   ? -16.262 11.568  -67.589 1.00 66.49  ? 6    PRO B CD  1 
ATOM   4293 N N   . GLN B 1 7   ? -13.834 12.105  -64.884 1.00 59.63  ? 7    GLN B N   1 
ATOM   4294 C CA  . GLN B 1 7   ? -13.204 12.313  -63.583 1.00 56.84  ? 7    GLN B CA  1 
ATOM   4295 C C   . GLN B 1 7   ? -12.128 11.282  -63.330 1.00 46.70  ? 7    GLN B C   1 
ATOM   4296 O O   . GLN B 1 7   ? -11.292 11.465  -62.455 1.00 44.46  ? 7    GLN B O   1 
ATOM   4297 C CB  . GLN B 1 7   ? -14.230 12.231  -62.451 1.00 59.57  ? 7    GLN B CB  1 
ATOM   4298 C CG  . GLN B 1 7   ? -15.149 13.430  -62.349 1.00 65.65  ? 7    GLN B CG  1 
ATOM   4299 C CD  . GLN B 1 7   ? -14.417 14.680  -61.918 1.00 68.47  ? 7    GLN B CD  1 
ATOM   4300 O OE1 . GLN B 1 7   ? -13.498 14.627  -61.094 1.00 68.26  ? 7    GLN B OE1 1 
ATOM   4301 N NE2 . GLN B 1 7   ? -14.815 15.817  -62.480 1.00 70.71  ? 7    GLN B NE2 1 
ATOM   4302 N N   . LEU B 1 8   ? -12.165 10.185  -64.075 1.00 46.80  ? 8    LEU B N   1 
ATOM   4303 C CA  . LEU B 1 8   ? -11.230 9.097   -63.839 1.00 46.56  ? 8    LEU B CA  1 
ATOM   4304 C C   . LEU B 1 8   ? -10.114 9.102   -64.865 1.00 48.60  ? 8    LEU B C   1 
ATOM   4305 O O   . LEU B 1 8   ? -9.201  8.286   -64.809 1.00 50.23  ? 8    LEU B O   1 
ATOM   4306 C CB  . LEU B 1 8   ? -11.964 7.760   -63.821 1.00 46.42  ? 8    LEU B CB  1 
ATOM   4307 C CG  . LEU B 1 8   ? -12.953 7.705   -62.650 1.00 51.51  ? 8    LEU B CG  1 
ATOM   4308 C CD1 . LEU B 1 8   ? -13.751 6.406   -62.620 1.00 50.37  ? 8    LEU B CD1 1 
ATOM   4309 C CD2 . LEU B 1 8   ? -12.197 7.912   -61.344 1.00 42.42  ? 8    LEU B CD2 1 
ATOM   4310 N N   . LEU B 1 9   ? -10.184 10.046  -65.793 1.00 51.32  ? 9    LEU B N   1 
ATOM   4311 C CA  . LEU B 1 9   ? -9.157  10.184  -66.819 1.00 48.39  ? 9    LEU B CA  1 
ATOM   4312 C C   . LEU B 1 9   ? -8.228  11.349  -66.504 1.00 44.27  ? 9    LEU B C   1 
ATOM   4313 O O   . LEU B 1 9   ? -8.679  12.486  -66.359 1.00 50.91  ? 9    LEU B O   1 
ATOM   4314 C CB  . LEU B 1 9   ? -9.803  10.378  -68.192 1.00 48.59  ? 9    LEU B CB  1 
ATOM   4315 C CG  . LEU B 1 9   ? -9.836  9.120   -69.046 1.00 63.24  ? 9    LEU B CG  1 
ATOM   4316 C CD1 . LEU B 1 9   ? -10.613 9.353   -70.342 1.00 63.83  ? 9    LEU B CD1 1 
ATOM   4317 C CD2 . LEU B 1 9   ? -8.397  8.698   -69.322 1.00 61.51  ? 9    LEU B CD2 1 
ATOM   4318 N N   . VAL B 1 10  ? -6.935  11.063  -66.389 1.00 43.22  ? 10   VAL B N   1 
ATOM   4319 C CA  . VAL B 1 10  ? -5.955  12.093  -66.070 1.00 47.56  ? 10   VAL B CA  1 
ATOM   4320 C C   . VAL B 1 10  ? -4.729  11.983  -66.963 1.00 51.35  ? 10   VAL B C   1 
ATOM   4321 O O   . VAL B 1 10  ? -4.273  10.882  -67.267 1.00 50.10  ? 10   VAL B O   1 
ATOM   4322 C CB  . VAL B 1 10  ? -5.540  12.035  -64.579 1.00 45.53  ? 10   VAL B CB  1 
ATOM   4323 C CG1 . VAL B 1 10  ? -4.366  12.958  -64.294 1.00 41.95  ? 10   VAL B CG1 1 
ATOM   4324 C CG2 . VAL B 1 10  ? -6.706  12.419  -63.705 1.00 53.04  ? 10   VAL B CG2 1 
ATOM   4325 N N   . ARG B 1 11  ? -4.211  13.132  -67.387 1.00 41.86  ? 11   ARG B N   1 
ATOM   4326 C CA  . ARG B 1 11  ? -2.974  13.199  -68.150 1.00 49.13  ? 11   ARG B CA  1 
ATOM   4327 C C   . ARG B 1 11  ? -1.803  13.714  -67.309 1.00 46.48  ? 11   ARG B C   1 
ATOM   4328 O O   . ARG B 1 11  ? -1.833  14.827  -66.795 1.00 45.06  ? 11   ARG B O   1 
ATOM   4329 C CB  . ARG B 1 11  ? -3.148  14.088  -69.383 1.00 46.53  ? 11   ARG B CB  1 
ATOM   4330 C CG  . ARG B 1 11  ? -1.845  14.391  -70.088 1.00 51.29  ? 11   ARG B CG  1 
ATOM   4331 C CD  . ARG B 1 11  ? -2.049  14.595  -71.574 1.00 63.10  ? 11   ARG B CD  1 
ATOM   4332 N NE  . ARG B 1 11  ? -1.264  13.627  -72.335 1.00 76.62  ? 11   ARG B NE  1 
ATOM   4333 C CZ  . ARG B 1 11  ? -1.742  12.875  -73.322 1.00 80.20  ? 11   ARG B CZ  1 
ATOM   4334 N NH1 . ARG B 1 11  ? -3.015  12.981  -73.686 1.00 79.20  ? 11   ARG B NH1 1 
ATOM   4335 N NH2 . ARG B 1 11  ? -0.941  12.020  -73.949 1.00 81.99  ? 11   ARG B NH2 1 
ATOM   4336 N N   . VAL B 1 12  ? -0.764  12.900  -67.189 1.00 44.11  ? 12   VAL B N   1 
ATOM   4337 C CA  . VAL B 1 12  ? 0.446   13.329  -66.505 1.00 41.40  ? 12   VAL B CA  1 
ATOM   4338 C C   . VAL B 1 12  ? 1.553   13.433  -67.537 1.00 41.56  ? 12   VAL B C   1 
ATOM   4339 O O   . VAL B 1 12  ? 1.332   13.125  -68.703 1.00 49.25  ? 12   VAL B O   1 
ATOM   4340 C CB  . VAL B 1 12  ? 0.829   12.365  -65.364 1.00 39.90  ? 12   VAL B CB  1 
ATOM   4341 C CG1 . VAL B 1 12  ? -0.188  12.460  -64.253 1.00 39.05  ? 12   VAL B CG1 1 
ATOM   4342 C CG2 . VAL B 1 12  ? 0.908   10.930  -65.864 1.00 41.23  ? 12   VAL B CG2 1 
ATOM   4343 N N   . ARG B 1 13  ? 2.738   13.859  -67.118 1.00 39.55  ? 13   ARG B N   1 
ATOM   4344 C CA  . ARG B 1 13  ? 3.841   14.053  -68.050 1.00 41.72  ? 13   ARG B CA  1 
ATOM   4345 C C   . ARG B 1 13  ? 4.180   12.806  -68.866 1.00 40.80  ? 13   ARG B C   1 
ATOM   4346 O O   . ARG B 1 13  ? 4.680   12.918  -69.968 1.00 44.03  ? 13   ARG B O   1 
ATOM   4347 C CB  . ARG B 1 13  ? 5.091   14.558  -67.329 1.00 46.12  ? 13   ARG B CB  1 
ATOM   4348 C CG  . ARG B 1 13  ? 5.012   16.010  -66.888 1.00 57.42  ? 13   ARG B CG  1 
ATOM   4349 C CD  . ARG B 1 13  ? 6.391   16.539  -66.510 1.00 74.38  ? 13   ARG B CD  1 
ATOM   4350 N NE  . ARG B 1 13  ? 6.316   17.863  -65.889 1.00 91.51  ? 13   ARG B NE  1 
ATOM   4351 C CZ  . ARG B 1 13  ? 7.363   18.530  -65.403 1.00 96.98  ? 13   ARG B CZ  1 
ATOM   4352 N NH1 . ARG B 1 13  ? 8.580   18.000  -65.466 1.00 101.21 ? 13   ARG B NH1 1 
ATOM   4353 N NH2 . ARG B 1 13  ? 7.197   19.727  -64.852 1.00 93.39  ? 13   ARG B NH2 1 
ATOM   4354 N N   . GLY B 1 14  ? 3.894   11.626  -68.328 1.00 35.85  ? 14   GLY B N   1 
ATOM   4355 C CA  . GLY B 1 14  ? 4.294   10.388  -68.965 1.00 35.11  ? 14   GLY B CA  1 
ATOM   4356 C C   . GLY B 1 14  ? 3.239   9.763   -69.858 1.00 38.88  ? 14   GLY B C   1 
ATOM   4357 O O   . GLY B 1 14  ? 3.507   8.789   -70.559 1.00 38.51  ? 14   GLY B O   1 
ATOM   4358 N N   . GLY B 1 15  ? 2.037   10.324  -69.837 1.00 39.22  ? 15   GLY B N   1 
ATOM   4359 C CA  . GLY B 1 15  ? 0.930   9.786   -70.597 1.00 38.33  ? 15   GLY B CA  1 
ATOM   4360 C C   . GLY B 1 15  ? -0.381  9.789   -69.831 1.00 41.41  ? 15   GLY B C   1 
ATOM   4361 O O   . GLY B 1 15  ? -0.526  10.462  -68.801 1.00 40.02  ? 15   GLY B O   1 
ATOM   4362 N N   . GLN B 1 16  ? -1.338  9.019   -70.335 1.00 42.68  ? 16   GLN B N   1 
ATOM   4363 C CA  . GLN B 1 16  ? -2.684  8.984   -69.775 1.00 43.18  ? 16   GLN B CA  1 
ATOM   4364 C C   . GLN B 1 16  ? -2.958  7.846   -68.792 1.00 41.57  ? 16   GLN B C   1 
ATOM   4365 O O   . GLN B 1 16  ? -2.451  6.738   -68.946 1.00 43.39  ? 16   GLN B O   1 
ATOM   4366 C CB  . GLN B 1 16  ? -3.699  8.934   -70.900 1.00 51.04  ? 16   GLN B CB  1 
ATOM   4367 C CG  . GLN B 1 16  ? -3.743  10.202  -71.691 1.00 60.62  ? 16   GLN B CG  1 
ATOM   4368 C CD  . GLN B 1 16  ? -5.146  10.536  -72.094 1.00 72.52  ? 16   GLN B CD  1 
ATOM   4369 O OE1 . GLN B 1 16  ? -5.796  11.377  -71.464 1.00 83.61  ? 16   GLN B OE1 1 
ATOM   4370 N NE2 . GLN B 1 16  ? -5.644  9.860   -73.133 1.00 66.63  ? 16   GLN B NE2 1 
ATOM   4371 N N   . LEU B 1 17  ? -3.793  8.137   -67.799 1.00 36.75  ? 17   LEU B N   1 
ATOM   4372 C CA  . LEU B 1 17  ? -4.080  7.222   -66.715 1.00 35.06  ? 17   LEU B CA  1 
ATOM   4373 C C   . LEU B 1 17  ? -5.571  7.098   -66.563 1.00 39.14  ? 17   LEU B C   1 
ATOM   4374 O O   . LEU B 1 17  ? -6.294  8.077   -66.721 1.00 46.67  ? 17   LEU B O   1 
ATOM   4375 C CB  . LEU B 1 17  ? -3.508  7.774   -65.393 1.00 32.91  ? 17   LEU B CB  1 
ATOM   4376 C CG  . LEU B 1 17  ? -1.989  7.916   -65.306 1.00 40.08  ? 17   LEU B CG  1 
ATOM   4377 C CD1 . LEU B 1 17  ? -1.569  8.560   -64.008 1.00 32.00  ? 17   LEU B CD1 1 
ATOM   4378 C CD2 . LEU B 1 17  ? -1.324  6.555   -65.448 1.00 45.62  ? 17   LEU B CD2 1 
ATOM   4379 N N   . ARG B 1 18  ? -6.036  5.899   -66.244 1.00 40.83  ? 18   ARG B N   1 
ATOM   4380 C CA  . ARG B 1 18  ? -7.430  5.702   -65.862 1.00 38.76  ? 18   ARG B CA  1 
ATOM   4381 C C   . ARG B 1 18  ? -7.464  5.230   -64.423 1.00 37.13  ? 18   ARG B C   1 
ATOM   4382 O O   . ARG B 1 18  ? -6.857  4.221   -64.081 1.00 41.37  ? 18   ARG B O   1 
ATOM   4383 C CB  . ARG B 1 18  ? -8.115  4.672   -66.758 1.00 44.71  ? 18   ARG B CB  1 
ATOM   4384 C CG  . ARG B 1 18  ? -9.561  4.352   -66.346 1.00 51.37  ? 18   ARG B CG  1 
ATOM   4385 C CD  . ARG B 1 18  ? -10.261 3.535   -67.406 1.00 63.74  ? 18   ARG B CD  1 
ATOM   4386 N NE  . ARG B 1 18  ? -9.289  2.757   -68.166 1.00 75.60  ? 18   ARG B NE  1 
ATOM   4387 C CZ  . ARG B 1 18  ? -9.088  2.889   -69.472 1.00 81.60  ? 18   ARG B CZ  1 
ATOM   4388 N NH1 . ARG B 1 18  ? -9.815  3.752   -70.171 1.00 79.43  ? 18   ARG B NH1 1 
ATOM   4389 N NH2 . ARG B 1 18  ? -8.165  2.151   -70.076 1.00 88.69  ? 18   ARG B NH2 1 
ATOM   4390 N N   . GLY B 1 19  ? -8.155  5.970   -63.570 1.00 36.76  ? 19   GLY B N   1 
ATOM   4391 C CA  . GLY B 1 19  ? -8.274  5.574   -62.187 1.00 35.53  ? 19   GLY B CA  1 
ATOM   4392 C C   . GLY B 1 19  ? -9.609  4.905   -61.961 1.00 41.19  ? 19   GLY B C   1 
ATOM   4393 O O   . GLY B 1 19  ? -10.286 4.499   -62.907 1.00 40.11  ? 19   GLY B O   1 
ATOM   4394 N N   . ILE B 1 20  ? -9.998  4.802   -60.700 1.00 37.37  ? 20   ILE B N   1 
ATOM   4395 C CA  . ILE B 1 20  ? -11.193 4.061   -60.341 1.00 41.94  ? 20   ILE B CA  1 
ATOM   4396 C C   . ILE B 1 20  ? -11.940 4.807   -59.248 1.00 44.06  ? 20   ILE B C   1 
ATOM   4397 O O   . ILE B 1 20  ? -11.335 5.365   -58.337 1.00 49.72  ? 20   ILE B O   1 
ATOM   4398 C CB  . ILE B 1 20  ? -10.850 2.613   -59.887 1.00 42.48  ? 20   ILE B CB  1 
ATOM   4399 C CG1 . ILE B 1 20  ? -12.109 1.864   -59.464 1.00 46.29  ? 20   ILE B CG1 1 
ATOM   4400 C CG2 . ILE B 1 20  ? -9.849  2.626   -58.731 1.00 40.57  ? 20   ILE B CG2 1 
ATOM   4401 C CD1 . ILE B 1 20  ? -11.888 0.389   -59.197 1.00 43.16  ? 20   ILE B CD1 1 
ATOM   4402 N N   . ARG B 1 21  ? -13.259 4.839   -59.367 1.00 43.03  ? 21   ARG B N   1 
ATOM   4403 C CA  . ARG B 1 21  ? -14.113 5.482   -58.388 1.00 46.25  ? 21   ARG B CA  1 
ATOM   4404 C C   . ARG B 1 21  ? -14.359 4.504   -57.242 1.00 49.78  ? 21   ARG B C   1 
ATOM   4405 O O   . ARG B 1 21  ? -14.821 3.383   -57.458 1.00 57.15  ? 21   ARG B O   1 
ATOM   4406 C CB  . ARG B 1 21  ? -15.419 5.905   -59.060 1.00 47.68  ? 21   ARG B CB  1 
ATOM   4407 C CG  . ARG B 1 21  ? -16.508 6.415   -58.140 1.00 61.37  ? 21   ARG B CG  1 
ATOM   4408 C CD  . ARG B 1 21  ? -17.788 6.621   -58.932 1.00 69.21  ? 21   ARG B CD  1 
ATOM   4409 N NE  . ARG B 1 21  ? -18.909 7.008   -58.086 1.00 81.20  ? 21   ARG B NE  1 
ATOM   4410 C CZ  . ARG B 1 21  ? -19.807 6.157   -57.601 1.00 87.26  ? 21   ARG B CZ  1 
ATOM   4411 N NH1 . ARG B 1 21  ? -19.712 4.864   -57.881 1.00 90.14  ? 21   ARG B NH1 1 
ATOM   4412 N NH2 . ARG B 1 21  ? -20.799 6.600   -56.835 1.00 86.15  ? 21   ARG B NH2 1 
ATOM   4413 N N   . LEU B 1 22  ? -14.017 4.926   -56.027 1.00 45.18  ? 22   LEU B N   1 
ATOM   4414 C CA  . LEU B 1 22  ? -14.197 4.098   -54.837 1.00 48.32  ? 22   LEU B CA  1 
ATOM   4415 C C   . LEU B 1 22  ? -15.263 4.691   -53.937 1.00 52.29  ? 22   LEU B C   1 
ATOM   4416 O O   . LEU B 1 22  ? -15.531 5.890   -53.994 1.00 54.81  ? 22   LEU B O   1 
ATOM   4417 C CB  . LEU B 1 22  ? -12.891 3.999   -54.057 1.00 51.20  ? 22   LEU B CB  1 
ATOM   4418 C CG  . LEU B 1 22  ? -11.752 3.250   -54.743 1.00 51.47  ? 22   LEU B CG  1 
ATOM   4419 C CD1 . LEU B 1 22  ? -10.592 3.120   -53.787 1.00 49.60  ? 22   LEU B CD1 1 
ATOM   4420 C CD2 . LEU B 1 22  ? -12.224 1.885   -55.235 1.00 55.56  ? 22   LEU B CD2 1 
ATOM   4421 N N   . LYS B 1 23  ? -15.880 3.855   -53.110 1.00 54.11  ? 23   LYS B N   1 
ATOM   4422 C CA  . LYS B 1 23  ? -16.813 4.370   -52.116 1.00 55.84  ? 23   LYS B CA  1 
ATOM   4423 C C   . LYS B 1 23  ? -16.130 4.535   -50.751 1.00 58.25  ? 23   LYS B C   1 
ATOM   4424 O O   . LYS B 1 23  ? -15.480 3.621   -50.231 1.00 46.73  ? 23   LYS B O   1 
ATOM   4425 C CB  . LYS B 1 23  ? -18.098 3.528   -52.017 1.00 58.35  ? 23   LYS B CB  1 
ATOM   4426 C CG  . LYS B 1 23  ? -17.874 2.073   -51.647 1.00 68.95  ? 23   LYS B CG  1 
ATOM   4427 C CD  . LYS B 1 23  ? -19.157 1.406   -51.149 1.00 81.22  ? 23   LYS B CD  1 
ATOM   4428 C CE  . LYS B 1 23  ? -18.948 -0.093  -50.904 1.00 82.73  ? 23   LYS B CE  1 
ATOM   4429 N NZ  . LYS B 1 23  ? -20.061 -0.716  -50.127 1.00 83.54  ? 23   LYS B NZ  1 
ATOM   4430 N N   . ALA B 1 24  ? -16.244 5.742   -50.214 1.00 54.67  ? 24   ALA B N   1 
ATOM   4431 C CA  . ALA B 1 24  ? -15.930 6.018   -48.829 1.00 53.19  ? 24   ALA B CA  1 
ATOM   4432 C C   . ALA B 1 24  ? -17.290 6.210   -48.175 1.00 59.72  ? 24   ALA B C   1 
ATOM   4433 O O   . ALA B 1 24  ? -18.248 6.566   -48.860 1.00 61.12  ? 24   ALA B O   1 
ATOM   4434 C CB  . ALA B 1 24  ? -15.090 7.270   -48.728 1.00 45.21  ? 24   ALA B CB  1 
ATOM   4435 N N   . PRO B 1 25  ? -17.392 5.967   -46.857 1.00 67.28  ? 25   PRO B N   1 
ATOM   4436 C CA  . PRO B 1 25  ? -18.704 5.994   -46.190 1.00 55.34  ? 25   PRO B CA  1 
ATOM   4437 C C   . PRO B 1 25  ? -19.525 7.252   -46.471 1.00 73.31  ? 25   PRO B C   1 
ATOM   4438 O O   . PRO B 1 25  ? -20.749 7.185   -46.502 1.00 60.30  ? 25   PRO B O   1 
ATOM   4439 C CB  . PRO B 1 25  ? -18.351 5.894   -44.702 1.00 55.68  ? 25   PRO B CB  1 
ATOM   4440 C CG  . PRO B 1 25  ? -16.866 6.156   -44.619 1.00 52.19  ? 25   PRO B CG  1 
ATOM   4441 C CD  . PRO B 1 25  ? -16.295 5.695   -45.912 1.00 49.93  ? 25   PRO B CD  1 
ATOM   4442 N N   . GLY B 1 26  ? -18.862 8.376   -46.709 1.00 73.89  ? 26   GLY B N   1 
ATOM   4443 C CA  . GLY B 1 26  ? -19.563 9.626   -46.940 1.00 57.08  ? 26   GLY B CA  1 
ATOM   4444 C C   . GLY B 1 26  ? -19.757 9.991   -48.400 1.00 58.06  ? 26   GLY B C   1 
ATOM   4445 O O   . GLY B 1 26  ? -20.353 11.020  -48.705 1.00 62.37  ? 26   GLY B O   1 
ATOM   4446 N N   . GLY B 1 27  ? -19.261 9.156   -49.309 1.00 56.08  ? 27   GLY B N   1 
ATOM   4447 C CA  . GLY B 1 27  ? -19.339 9.465   -50.726 1.00 55.27  ? 27   GLY B CA  1 
ATOM   4448 C C   . GLY B 1 27  ? -18.166 8.949   -51.534 1.00 54.13  ? 27   GLY B C   1 
ATOM   4449 O O   . GLY B 1 27  ? -17.260 8.326   -50.992 1.00 54.26  ? 27   GLY B O   1 
ATOM   4450 N N   . PRO B 1 28  ? -18.181 9.196   -52.848 1.00 55.44  ? 28   PRO B N   1 
ATOM   4451 C CA  . PRO B 1 28  ? -17.144 8.664   -53.742 1.00 49.50  ? 28   PRO B CA  1 
ATOM   4452 C C   . PRO B 1 28  ? -15.795 9.366   -53.632 1.00 50.49  ? 28   PRO B C   1 
ATOM   4453 O O   . PRO B 1 28  ? -15.723 10.516  -53.208 1.00 50.27  ? 28   PRO B O   1 
ATOM   4454 C CB  . PRO B 1 28  ? -17.743 8.893   -55.136 1.00 52.54  ? 28   PRO B CB  1 
ATOM   4455 C CG  . PRO B 1 28  ? -18.745 9.982   -54.951 1.00 54.62  ? 28   PRO B CG  1 
ATOM   4456 C CD  . PRO B 1 28  ? -19.298 9.809   -53.587 1.00 55.58  ? 28   PRO B CD  1 
ATOM   4457 N N   . VAL B 1 29  ? -14.733 8.660   -54.005 1.00 43.85  ? 29   VAL B N   1 
ATOM   4458 C CA  . VAL B 1 29  ? -13.414 9.265   -54.166 1.00 46.02  ? 29   VAL B CA  1 
ATOM   4459 C C   . VAL B 1 29  ? -12.792 8.740   -55.448 1.00 41.58  ? 29   VAL B C   1 
ATOM   4460 O O   . VAL B 1 29  ? -13.119 7.642   -55.885 1.00 42.85  ? 29   VAL B O   1 
ATOM   4461 C CB  . VAL B 1 29  ? -12.450 8.958   -52.975 1.00 48.86  ? 29   VAL B CB  1 
ATOM   4462 C CG1 . VAL B 1 29  ? -13.080 9.362   -51.655 1.00 50.54  ? 29   VAL B CG1 1 
ATOM   4463 C CG2 . VAL B 1 29  ? -12.063 7.494   -52.951 1.00 38.11  ? 29   VAL B CG2 1 
ATOM   4464 N N   . SER B 1 30  ? -11.910 9.527   -56.057 1.00 42.96  ? 30   SER B N   1 
ATOM   4465 C CA  . SER B 1 30  ? -11.155 9.067   -57.222 1.00 41.94  ? 30   SER B CA  1 
ATOM   4466 C C   . SER B 1 30  ? -9.837  8.437   -56.770 1.00 42.93  ? 30   SER B C   1 
ATOM   4467 O O   . SER B 1 30  ? -9.049  9.063   -56.065 1.00 48.73  ? 30   SER B O   1 
ATOM   4468 C CB  . SER B 1 30  ? -10.881 10.222  -58.201 1.00 43.40  ? 30   SER B CB  1 
ATOM   4469 O OG  . SER B 1 30  ? -12.077 10.851  -58.640 1.00 52.88  ? 30   SER B OG  1 
ATOM   4470 N N   . ALA B 1 31  ? -9.588  7.197   -57.167 1.00 38.42  ? 31   ALA B N   1 
ATOM   4471 C CA  . ALA B 1 31  ? -8.319  6.563   -56.827 1.00 32.81  ? 31   ALA B CA  1 
ATOM   4472 C C   . ALA B 1 31  ? -7.542  6.129   -58.074 1.00 38.25  ? 31   ALA B C   1 
ATOM   4473 O O   . ALA B 1 31  ? -8.092  5.505   -58.991 1.00 40.48  ? 31   ALA B O   1 
ATOM   4474 C CB  . ALA B 1 31  ? -8.546  5.386   -55.901 1.00 33.41  ? 31   ALA B CB  1 
ATOM   4475 N N   . PHE B 1 32  ? -6.265  6.492   -58.098 1.00 32.12  ? 32   PHE B N   1 
ATOM   4476 C CA  . PHE B 1 32  ? -5.360  6.187   -59.195 1.00 30.92  ? 32   PHE B CA  1 
ATOM   4477 C C   . PHE B 1 32  ? -4.212  5.414   -58.577 1.00 33.69  ? 32   PHE B C   1 
ATOM   4478 O O   . PHE B 1 32  ? -3.318  5.991   -57.954 1.00 33.19  ? 32   PHE B O   1 
ATOM   4479 C CB  . PHE B 1 32  ? -4.849  7.480   -59.843 1.00 34.04  ? 32   PHE B CB  1 
ATOM   4480 C CG  . PHE B 1 32  ? -5.950  8.380   -60.340 1.00 41.42  ? 32   PHE B CG  1 
ATOM   4481 C CD1 . PHE B 1 32  ? -6.573  9.274   -59.486 1.00 45.09  ? 32   PHE B CD1 1 
ATOM   4482 C CD2 . PHE B 1 32  ? -6.373  8.317   -61.660 1.00 44.78  ? 32   PHE B CD2 1 
ATOM   4483 C CE1 . PHE B 1 32  ? -7.598  10.090  -59.943 1.00 48.02  ? 32   PHE B CE1 1 
ATOM   4484 C CE2 . PHE B 1 32  ? -7.387  9.127   -62.122 1.00 48.49  ? 32   PHE B CE2 1 
ATOM   4485 C CZ  . PHE B 1 32  ? -8.002  10.018  -61.261 1.00 47.26  ? 32   PHE B CZ  1 
ATOM   4486 N N   . LEU B 1 33  ? -4.266  4.098   -58.718 1.00 33.60  ? 33   LEU B N   1 
ATOM   4487 C CA  . LEU B 1 33  ? -3.353  3.213   -58.021 1.00 35.22  ? 33   LEU B CA  1 
ATOM   4488 C C   . LEU B 1 33  ? -2.405  2.548   -58.996 1.00 35.14  ? 33   LEU B C   1 
ATOM   4489 O O   . LEU B 1 33  ? -2.809  2.194   -60.096 1.00 39.67  ? 33   LEU B O   1 
ATOM   4490 C CB  . LEU B 1 33  ? -4.154  2.128   -57.312 1.00 35.40  ? 33   LEU B CB  1 
ATOM   4491 C CG  . LEU B 1 33  ? -5.362  2.631   -56.527 1.00 36.44  ? 33   LEU B CG  1 
ATOM   4492 C CD1 . LEU B 1 33  ? -6.152  1.446   -55.944 1.00 31.15  ? 33   LEU B CD1 1 
ATOM   4493 C CD2 . LEU B 1 33  ? -4.912  3.598   -55.445 1.00 30.30  ? 33   LEU B CD2 1 
ATOM   4494 N N   . GLY B 1 34  ? -1.152  2.358   -58.589 1.00 31.72  ? 34   GLY B N   1 
ATOM   4495 C CA  . GLY B 1 34  ? -0.206  1.607   -59.401 1.00 32.89  ? 34   GLY B CA  1 
ATOM   4496 C C   . GLY B 1 34  ? 0.468   2.454   -60.466 1.00 35.27  ? 34   GLY B C   1 
ATOM   4497 O O   . GLY B 1 34  ? 0.889   1.947   -61.489 1.00 43.07  ? 34   GLY B O   1 
ATOM   4498 N N   . ILE B 1 35  ? 0.576   3.755   -60.231 1.00 32.03  ? 35   ILE B N   1 
ATOM   4499 C CA  . ILE B 1 35  ? 1.196   4.641   -61.207 1.00 30.14  ? 35   ILE B CA  1 
ATOM   4500 C C   . ILE B 1 35  ? 2.707   4.472   -61.140 1.00 27.48  ? 35   ILE B C   1 
ATOM   4501 O O   . ILE B 1 35  ? 3.296   4.626   -60.076 1.00 37.28  ? 35   ILE B O   1 
ATOM   4502 C CB  . ILE B 1 35  ? 0.826   6.120   -60.932 1.00 32.49  ? 35   ILE B CB  1 
ATOM   4503 C CG1 . ILE B 1 35  ? -0.700  6.301   -60.917 1.00 32.71  ? 35   ILE B CG1 1 
ATOM   4504 C CG2 . ILE B 1 35  ? 1.514   7.055   -61.941 1.00 25.80  ? 35   ILE B CG2 1 
ATOM   4505 C CD1 . ILE B 1 35  ? -1.186  7.612   -60.270 1.00 26.39  ? 35   ILE B CD1 1 
ATOM   4506 N N   . PRO B 1 36  ? 3.341   4.144   -62.273 1.00 31.36  ? 36   PRO B N   1 
ATOM   4507 C CA  . PRO B 1 36  ? 4.800   3.964   -62.300 1.00 25.07  ? 36   PRO B CA  1 
ATOM   4508 C C   . PRO B 1 36  ? 5.497   5.298   -62.244 1.00 27.29  ? 36   PRO B C   1 
ATOM   4509 O O   . PRO B 1 36  ? 5.116   6.196   -62.989 1.00 29.36  ? 36   PRO B O   1 
ATOM   4510 C CB  . PRO B 1 36  ? 5.050   3.319   -63.672 1.00 29.50  ? 36   PRO B CB  1 
ATOM   4511 C CG  . PRO B 1 36  ? 3.887   3.748   -64.522 1.00 30.11  ? 36   PRO B CG  1 
ATOM   4512 C CD  . PRO B 1 36  ? 2.712   3.882   -63.584 1.00 28.30  ? 36   PRO B CD  1 
ATOM   4513 N N   . PHE B 1 37  ? 6.486   5.443   -61.368 1.00 29.49  ? 37   PHE B N   1 
ATOM   4514 C CA  . PHE B 1 37  ? 7.242   6.696   -61.300 1.00 26.79  ? 37   PHE B CA  1 
ATOM   4515 C C   . PHE B 1 37  ? 8.719   6.480   -61.595 1.00 33.63  ? 37   PHE B C   1 
ATOM   4516 O O   . PHE B 1 37  ? 9.511   7.419   -61.552 1.00 27.45  ? 37   PHE B O   1 
ATOM   4517 C CB  . PHE B 1 37  ? 7.048   7.398   -59.955 1.00 26.68  ? 37   PHE B CB  1 
ATOM   4518 C CG  . PHE B 1 37  ? 7.622   6.652   -58.769 1.00 30.23  ? 37   PHE B CG  1 
ATOM   4519 C CD1 . PHE B 1 37  ? 8.948   6.828   -58.391 1.00 31.19  ? 37   PHE B CD1 1 
ATOM   4520 C CD2 . PHE B 1 37  ? 6.822   5.806   -58.010 1.00 29.04  ? 37   PHE B CD2 1 
ATOM   4521 C CE1 . PHE B 1 37  ? 9.476   6.153   -57.290 1.00 29.28  ? 37   PHE B CE1 1 
ATOM   4522 C CE2 . PHE B 1 37  ? 7.340   5.123   -56.908 1.00 28.01  ? 37   PHE B CE2 1 
ATOM   4523 C CZ  . PHE B 1 37  ? 8.671   5.303   -56.545 1.00 28.35  ? 37   PHE B CZ  1 
ATOM   4524 N N   . ALA B 1 38  ? 9.074   5.238   -61.914 1.00 34.60  ? 38   ALA B N   1 
ATOM   4525 C CA  . ALA B 1 38  ? 10.455  4.887   -62.245 1.00 36.81  ? 38   ALA B CA  1 
ATOM   4526 C C   . ALA B 1 38  ? 10.544  3.647   -63.126 1.00 37.37  ? 38   ALA B C   1 
ATOM   4527 O O   . ALA B 1 38  ? 9.683   2.760   -63.081 1.00 34.88  ? 38   ALA B O   1 
ATOM   4528 C CB  . ALA B 1 38  ? 11.273  4.663   -60.969 1.00 27.76  ? 38   ALA B CB  1 
ATOM   4529 N N   . GLU B 1 39  ? 11.608  3.585   -63.914 1.00 29.05  ? 39   GLU B N   1 
ATOM   4530 C CA  . GLU B 1 39  ? 11.985  2.342   -64.566 1.00 30.91  ? 39   GLU B CA  1 
ATOM   4531 C C   . GLU B 1 39  ? 12.154  1.270   -63.499 1.00 32.57  ? 39   GLU B C   1 
ATOM   4532 O O   . GLU B 1 39  ? 12.844  1.500   -62.498 1.00 31.46  ? 39   GLU B O   1 
ATOM   4533 C CB  . GLU B 1 39  ? 13.313  2.521   -65.293 1.00 32.47  ? 39   GLU B CB  1 
ATOM   4534 C CG  . GLU B 1 39  ? 13.250  3.499   -66.441 1.00 35.74  ? 39   GLU B CG  1 
ATOM   4535 C CD  . GLU B 1 39  ? 12.332  3.030   -67.551 1.00 32.36  ? 39   GLU B CD  1 
ATOM   4536 O OE1 . GLU B 1 39  ? 12.798  2.290   -68.437 1.00 37.56  ? 39   GLU B OE1 1 
ATOM   4537 O OE2 . GLU B 1 39  ? 11.150  3.407   -67.546 1.00 38.75  ? 39   GLU B OE2 1 
ATOM   4538 N N   . PRO B 1 40  ? 11.528  0.098   -63.704 1.00 33.15  ? 40   PRO B N   1 
ATOM   4539 C CA  . PRO B 1 40  ? 11.719  -1.056  -62.811 1.00 38.90  ? 40   PRO B CA  1 
ATOM   4540 C C   . PRO B 1 40  ? 13.204  -1.273  -62.475 1.00 37.23  ? 40   PRO B C   1 
ATOM   4541 O O   . PRO B 1 40  ? 14.011  -1.414  -63.385 1.00 35.90  ? 40   PRO B O   1 
ATOM   4542 C CB  . PRO B 1 40  ? 11.198  -2.227  -63.645 1.00 32.11  ? 40   PRO B CB  1 
ATOM   4543 C CG  . PRO B 1 40  ? 10.164  -1.600  -64.545 1.00 31.20  ? 40   PRO B CG  1 
ATOM   4544 C CD  . PRO B 1 40  ? 10.669  -0.221  -64.858 1.00 30.44  ? 40   PRO B CD  1 
ATOM   4545 N N   . PRO B 1 41  ? 13.555  -1.274  -61.179 1.00 37.70  ? 41   PRO B N   1 
ATOM   4546 C CA  . PRO B 1 41  ? 14.958  -1.390  -60.771 1.00 34.49  ? 41   PRO B CA  1 
ATOM   4547 C C   . PRO B 1 41  ? 15.430  -2.838  -60.808 1.00 43.15  ? 41   PRO B C   1 
ATOM   4548 O O   . PRO B 1 41  ? 15.814  -3.389  -59.773 1.00 40.78  ? 41   PRO B O   1 
ATOM   4549 C CB  . PRO B 1 41  ? 14.937  -0.881  -59.327 1.00 35.29  ? 41   PRO B CB  1 
ATOM   4550 C CG  . PRO B 1 41  ? 13.549  -1.228  -58.831 1.00 36.72  ? 41   PRO B CG  1 
ATOM   4551 C CD  . PRO B 1 41  ? 12.637  -1.131  -60.029 1.00 31.51  ? 41   PRO B CD  1 
ATOM   4552 N N   . VAL B 1 42  ? 15.405  -3.440  -61.992 1.00 37.48  ? 42   VAL B N   1 
ATOM   4553 C CA  . VAL B 1 42  ? 15.709  -4.859  -62.145 1.00 39.97  ? 42   VAL B CA  1 
ATOM   4554 C C   . VAL B 1 42  ? 16.991  -5.145  -62.948 1.00 48.31  ? 42   VAL B C   1 
ATOM   4555 O O   . VAL B 1 42  ? 17.524  -4.277  -63.655 1.00 41.89  ? 42   VAL B O   1 
ATOM   4556 C CB  . VAL B 1 42  ? 14.514  -5.601  -62.771 1.00 47.04  ? 42   VAL B CB  1 
ATOM   4557 C CG1 . VAL B 1 42  ? 13.238  -5.316  -61.954 1.00 37.87  ? 42   VAL B CG1 1 
ATOM   4558 C CG2 . VAL B 1 42  ? 14.319  -5.167  -64.213 1.00 42.61  ? 42   VAL B CG2 1 
ATOM   4559 N N   . GLY B 1 43  ? 17.488  -6.371  -62.815 1.00 45.71  ? 43   GLY B N   1 
ATOM   4560 C CA  . GLY B 1 43  ? 18.692  -6.789  -63.496 1.00 47.90  ? 43   GLY B CA  1 
ATOM   4561 C C   . GLY B 1 43  ? 19.899  -6.010  -63.033 1.00 71.41  ? 43   GLY B C   1 
ATOM   4562 O O   . GLY B 1 43  ? 20.328  -6.130  -61.885 1.00 49.59  ? 43   GLY B O   1 
ATOM   4563 N N   . SER B 1 44  ? 20.437  -5.204  -63.940 1.00 48.29  ? 44   SER B N   1 
ATOM   4564 C CA  . SER B 1 44  ? 21.630  -4.415  -63.686 1.00 57.16  ? 44   SER B CA  1 
ATOM   4565 C C   . SER B 1 44  ? 21.278  -3.148  -62.924 1.00 47.07  ? 44   SER B C   1 
ATOM   4566 O O   . SER B 1 44  ? 22.159  -2.453  -62.424 1.00 58.63  ? 44   SER B O   1 
ATOM   4567 C CB  . SER B 1 44  ? 22.304  -4.030  -64.999 1.00 50.56  ? 44   SER B CB  1 
ATOM   4568 O OG  . SER B 1 44  ? 21.604  -2.946  -65.597 1.00 51.02  ? 44   SER B OG  1 
ATOM   4569 N N   . ARG B 1 45  ? 19.990  -2.837  -62.855 1.00 44.15  ? 45   ARG B N   1 
ATOM   4570 C CA  . ARG B 1 45  ? 19.553  -1.693  -62.072 1.00 45.94  ? 45   ARG B CA  1 
ATOM   4571 C C   . ARG B 1 45  ? 19.392  -2.028  -60.585 1.00 49.34  ? 45   ARG B C   1 
ATOM   4572 O O   . ARG B 1 45  ? 19.106  -1.148  -59.781 1.00 43.32  ? 45   ARG B O   1 
ATOM   4573 C CB  . ARG B 1 45  ? 18.261  -1.109  -62.631 1.00 39.32  ? 45   ARG B CB  1 
ATOM   4574 C CG  . ARG B 1 45  ? 18.401  -0.526  -64.024 1.00 41.73  ? 45   ARG B CG  1 
ATOM   4575 C CD  . ARG B 1 45  ? 17.114  0.192   -64.435 1.00 56.69  ? 45   ARG B CD  1 
ATOM   4576 N NE  . ARG B 1 45  ? 16.980  0.320   -65.889 1.00 74.38  ? 45   ARG B NE  1 
ATOM   4577 C CZ  . ARG B 1 45  ? 16.046  -0.285  -66.623 1.00 76.30  ? 45   ARG B CZ  1 
ATOM   4578 N NH1 . ARG B 1 45  ? 15.127  -1.062  -66.050 1.00 69.37  ? 45   ARG B NH1 1 
ATOM   4579 N NH2 . ARG B 1 45  ? 16.024  -0.104  -67.938 1.00 80.93  ? 45   ARG B NH2 1 
ATOM   4580 N N   . ARG B 1 46  ? 19.575  -3.290  -60.210 1.00 45.58  ? 46   ARG B N   1 
ATOM   4581 C CA  . ARG B 1 46  ? 19.530  -3.637  -58.790 1.00 43.22  ? 46   ARG B CA  1 
ATOM   4582 C C   . ARG B 1 46  ? 20.624  -2.876  -58.028 1.00 39.60  ? 46   ARG B C   1 
ATOM   4583 O O   . ARG B 1 46  ? 21.755  -2.781  -58.507 1.00 44.73  ? 46   ARG B O   1 
ATOM   4584 C CB  . ARG B 1 46  ? 19.684  -5.147  -58.594 1.00 44.85  ? 46   ARG B CB  1 
ATOM   4585 C CG  . ARG B 1 46  ? 19.483  -5.612  -57.167 1.00 42.25  ? 46   ARG B CG  1 
ATOM   4586 C CD  . ARG B 1 46  ? 19.780  -7.091  -57.044 1.00 47.99  ? 46   ARG B CD  1 
ATOM   4587 N NE  . ARG B 1 46  ? 18.607  -7.935  -57.250 1.00 40.26  ? 46   ARG B NE  1 
ATOM   4588 C CZ  . ARG B 1 46  ? 18.638  -9.260  -57.188 1.00 47.06  ? 46   ARG B CZ  1 
ATOM   4589 N NH1 . ARG B 1 46  ? 19.787  -9.884  -56.943 1.00 43.98  ? 46   ARG B NH1 1 
ATOM   4590 N NH2 . ARG B 1 46  ? 17.531  -9.963  -57.373 1.00 42.08  ? 46   ARG B NH2 1 
ATOM   4591 N N   . PHE B 1 47  ? 20.259  -2.322  -56.869 1.00 37.42  ? 47   PHE B N   1 
ATOM   4592 C CA  . PHE B 1 47  ? 21.134  -1.502  -56.017 1.00 35.85  ? 47   PHE B CA  1 
ATOM   4593 C C   . PHE B 1 47  ? 21.473  -0.130  -56.606 1.00 46.18  ? 47   PHE B C   1 
ATOM   4594 O O   . PHE B 1 47  ? 22.226  0.621   -56.000 1.00 47.73  ? 47   PHE B O   1 
ATOM   4595 C CB  . PHE B 1 47  ? 22.456  -2.216  -55.655 1.00 37.92  ? 47   PHE B CB  1 
ATOM   4596 C CG  . PHE B 1 47  ? 22.302  -3.658  -55.250 1.00 38.84  ? 47   PHE B CG  1 
ATOM   4597 C CD1 . PHE B 1 47  ? 21.610  -4.007  -54.091 1.00 37.91  ? 47   PHE B CD1 1 
ATOM   4598 C CD2 . PHE B 1 47  ? 22.877  -4.668  -56.015 1.00 40.89  ? 47   PHE B CD2 1 
ATOM   4599 C CE1 . PHE B 1 47  ? 21.476  -5.339  -53.716 1.00 43.52  ? 47   PHE B CE1 1 
ATOM   4600 C CE2 . PHE B 1 47  ? 22.759  -6.008  -55.641 1.00 44.39  ? 47   PHE B CE2 1 
ATOM   4601 C CZ  . PHE B 1 47  ? 22.057  -6.347  -54.501 1.00 44.96  ? 47   PHE B CZ  1 
ATOM   4602 N N   . MET B 1 48  ? 20.959  0.184   -57.793 1.00 44.65  ? 48   MET B N   1 
ATOM   4603 C CA  . MET B 1 48  ? 21.257  1.462   -58.443 1.00 35.31  ? 48   MET B CA  1 
ATOM   4604 C C   . MET B 1 48  ? 20.188  2.503   -58.110 1.00 39.36  ? 48   MET B C   1 
ATOM   4605 O O   . MET B 1 48  ? 19.043  2.137   -57.817 1.00 32.15  ? 48   MET B O   1 
ATOM   4606 C CB  . MET B 1 48  ? 21.351  1.289   -59.963 1.00 42.02  ? 48   MET B CB  1 
ATOM   4607 C CG  . MET B 1 48  ? 22.554  0.464   -60.477 1.00 50.76  ? 48   MET B CG  1 
ATOM   4608 S SD  . MET B 1 48  ? 24.170  1.252   -60.249 1.00 80.73  ? 48   MET B SD  1 
ATOM   4609 C CE  . MET B 1 48  ? 24.072  2.615   -61.398 1.00 60.91  ? 48   MET B CE  1 
ATOM   4610 N N   . PRO B 1 49  ? 20.556  3.802   -58.152 1.00 39.97  ? 49   PRO B N   1 
ATOM   4611 C CA  . PRO B 1 49  ? 19.560  4.881   -58.025 1.00 35.80  ? 49   PRO B CA  1 
ATOM   4612 C C   . PRO B 1 49  ? 18.446  4.688   -59.048 1.00 41.04  ? 49   PRO B C   1 
ATOM   4613 O O   . PRO B 1 49  ? 18.697  4.164   -60.139 1.00 44.11  ? 49   PRO B O   1 
ATOM   4614 C CB  . PRO B 1 49  ? 20.345  6.147   -58.388 1.00 33.74  ? 49   PRO B CB  1 
ATOM   4615 C CG  . PRO B 1 49  ? 21.780  5.805   -58.202 1.00 34.33  ? 49   PRO B CG  1 
ATOM   4616 C CD  . PRO B 1 49  ? 21.927  4.314   -58.340 1.00 34.94  ? 49   PRO B CD  1 
ATOM   4617 N N   . PRO B 1 50  ? 17.223  5.112   -58.711 1.00 36.53  ? 50   PRO B N   1 
ATOM   4618 C CA  . PRO B 1 50  ? 16.113  4.941   -59.655 1.00 38.07  ? 50   PRO B CA  1 
ATOM   4619 C C   . PRO B 1 50  ? 16.252  5.879   -60.848 1.00 38.09  ? 50   PRO B C   1 
ATOM   4620 O O   . PRO B 1 50  ? 16.904  6.909   -60.745 1.00 34.36  ? 50   PRO B O   1 
ATOM   4621 C CB  . PRO B 1 50  ? 14.882  5.314   -58.827 1.00 28.07  ? 50   PRO B CB  1 
ATOM   4622 C CG  . PRO B 1 50  ? 15.417  6.247   -57.779 1.00 30.08  ? 50   PRO B CG  1 
ATOM   4623 C CD  . PRO B 1 50  ? 16.812  5.790   -57.470 1.00 31.28  ? 50   PRO B CD  1 
ATOM   4624 N N   . GLU B 1 51  ? 15.663  5.504   -61.975 1.00 42.61  ? 51   GLU B N   1 
ATOM   4625 C CA  . GLU B 1 51  ? 15.614  6.375   -63.136 1.00 38.80  ? 51   GLU B CA  1 
ATOM   4626 C C   . GLU B 1 51  ? 14.153  6.686   -63.416 1.00 37.10  ? 51   GLU B C   1 
ATOM   4627 O O   . GLU B 1 51  ? 13.279  5.869   -63.129 1.00 39.26  ? 51   GLU B O   1 
ATOM   4628 C CB  . GLU B 1 51  ? 16.263  5.691   -64.333 1.00 42.78  ? 51   GLU B CB  1 
ATOM   4629 C CG  . GLU B 1 51  ? 17.743  5.453   -64.161 1.00 56.08  ? 51   GLU B CG  1 
ATOM   4630 C CD  . GLU B 1 51  ? 18.333  4.623   -65.285 1.00 76.63  ? 51   GLU B CD  1 
ATOM   4631 O OE1 . GLU B 1 51  ? 17.594  3.807   -65.891 1.00 80.83  ? 51   GLU B OE1 1 
ATOM   4632 O OE2 . GLU B 1 51  ? 19.539  4.792   -65.565 1.00 84.26  ? 51   GLU B OE2 1 
ATOM   4633 N N   . PRO B 1 52  ? 13.879  7.872   -63.969 1.00 37.13  ? 52   PRO B N   1 
ATOM   4634 C CA  . PRO B 1 52  ? 12.502  8.287   -64.284 1.00 37.30  ? 52   PRO B CA  1 
ATOM   4635 C C   . PRO B 1 52  ? 11.790  7.336   -65.261 1.00 37.74  ? 52   PRO B C   1 
ATOM   4636 O O   . PRO B 1 52  ? 12.403  6.852   -66.231 1.00 32.21  ? 52   PRO B O   1 
ATOM   4637 C CB  . PRO B 1 52  ? 12.691  9.659   -64.949 1.00 40.97  ? 52   PRO B CB  1 
ATOM   4638 C CG  . PRO B 1 52  ? 14.069  10.124  -64.520 1.00 41.86  ? 52   PRO B CG  1 
ATOM   4639 C CD  . PRO B 1 52  ? 14.884  8.882   -64.356 1.00 37.68  ? 52   PRO B CD  1 
ATOM   4640 N N   . LYS B 1 53  ? 10.507  7.079   -65.009 1.00 30.89  ? 53   LYS B N   1 
ATOM   4641 C CA  . LYS B 1 53  ? 9.707   6.237   -65.904 1.00 35.13  ? 53   LYS B CA  1 
ATOM   4642 C C   . LYS B 1 53  ? 9.613   6.817   -67.321 1.00 37.17  ? 53   LYS B C   1 
ATOM   4643 O O   . LYS B 1 53  ? 9.287   7.990   -67.499 1.00 39.87  ? 53   LYS B O   1 
ATOM   4644 C CB  . LYS B 1 53  ? 8.301   6.022   -65.327 1.00 35.05  ? 53   LYS B CB  1 
ATOM   4645 C CG  . LYS B 1 53  ? 7.324   5.287   -66.256 1.00 36.51  ? 53   LYS B CG  1 
ATOM   4646 C CD  . LYS B 1 53  ? 7.703   3.821   -66.456 1.00 31.47  ? 53   LYS B CD  1 
ATOM   4647 C CE  . LYS B 1 53  ? 6.683   3.071   -67.314 1.00 32.45  ? 53   LYS B CE  1 
ATOM   4648 N NZ  . LYS B 1 53  ? 7.048   3.063   -68.754 1.00 33.91  ? 53   LYS B NZ  1 
ATOM   4649 N N   . ARG B 1 54  ? 9.925   5.996   -68.322 1.00 38.35  ? 54   ARG B N   1 
ATOM   4650 C CA  . ARG B 1 54  ? 9.736   6.382   -69.716 1.00 34.80  ? 54   ARG B CA  1 
ATOM   4651 C C   . ARG B 1 54  ? 8.242   6.591   -69.979 1.00 39.46  ? 54   ARG B C   1 
ATOM   4652 O O   . ARG B 1 54  ? 7.401   5.909   -69.398 1.00 43.98  ? 54   ARG B O   1 
ATOM   4653 C CB  . ARG B 1 54  ? 10.287  5.298   -70.659 1.00 36.13  ? 54   ARG B CB  1 
ATOM   4654 C CG  . ARG B 1 54  ? 11.795  5.069   -70.552 1.00 37.32  ? 54   ARG B CG  1 
ATOM   4655 C CD  . ARG B 1 54  ? 12.267  3.882   -71.406 1.00 38.08  ? 54   ARG B CD  1 
ATOM   4656 N NE  . ARG B 1 54  ? 11.584  2.651   -71.025 1.00 49.82  ? 54   ARG B NE  1 
ATOM   4657 C CZ  . ARG B 1 54  ? 10.832  1.914   -71.844 1.00 51.01  ? 54   ARG B CZ  1 
ATOM   4658 N NH1 . ARG B 1 54  ? 10.680  2.252   -73.129 1.00 47.58  ? 54   ARG B NH1 1 
ATOM   4659 N NH2 . ARG B 1 54  ? 10.244  0.818   -71.375 1.00 46.15  ? 54   ARG B NH2 1 
ATOM   4660 N N   . PRO B 1 55  ? 7.904   7.537   -70.853 1.00 41.61  ? 55   PRO B N   1 
ATOM   4661 C CA  . PRO B 1 55  ? 6.509   7.781   -71.254 1.00 47.94  ? 55   PRO B CA  1 
ATOM   4662 C C   . PRO B 1 55  ? 5.829   6.552   -71.867 1.00 36.79  ? 55   PRO B C   1 
ATOM   4663 O O   . PRO B 1 55  ? 6.480   5.769   -72.526 1.00 37.63  ? 55   PRO B O   1 
ATOM   4664 C CB  . PRO B 1 55  ? 6.645   8.864   -72.327 1.00 49.60  ? 55   PRO B CB  1 
ATOM   4665 C CG  . PRO B 1 55  ? 7.922   9.554   -71.998 1.00 48.91  ? 55   PRO B CG  1 
ATOM   4666 C CD  . PRO B 1 55  ? 8.835   8.495   -71.468 1.00 45.33  ? 55   PRO B CD  1 
ATOM   4667 N N   . TRP B 1 56  ? 4.529   6.402   -71.653 1.00 41.42  ? 56   TRP B N   1 
ATOM   4668 C CA  . TRP B 1 56  ? 3.781   5.287   -72.222 1.00 41.96  ? 56   TRP B CA  1 
ATOM   4669 C C   . TRP B 1 56  ? 2.755   5.750   -73.245 1.00 42.95  ? 56   TRP B C   1 
ATOM   4670 O O   . TRP B 1 56  ? 2.357   6.924   -73.264 1.00 42.40  ? 56   TRP B O   1 
ATOM   4671 C CB  . TRP B 1 56  ? 3.059   4.518   -71.121 1.00 36.54  ? 56   TRP B CB  1 
ATOM   4672 C CG  . TRP B 1 56  ? 2.185   5.384   -70.292 1.00 42.21  ? 56   TRP B CG  1 
ATOM   4673 C CD1 . TRP B 1 56  ? 0.869   5.660   -70.506 1.00 45.68  ? 56   TRP B CD1 1 
ATOM   4674 C CD2 . TRP B 1 56  ? 2.561   6.102   -69.109 1.00 41.03  ? 56   TRP B CD2 1 
ATOM   4675 N NE1 . TRP B 1 56  ? 0.398   6.511   -69.531 1.00 45.99  ? 56   TRP B NE1 1 
ATOM   4676 C CE2 . TRP B 1 56  ? 1.417   6.792   -68.658 1.00 44.90  ? 56   TRP B CE2 1 
ATOM   4677 C CE3 . TRP B 1 56  ? 3.751   6.227   -68.386 1.00 33.15  ? 56   TRP B CE3 1 
ATOM   4678 C CZ2 . TRP B 1 56  ? 1.430   7.591   -67.513 1.00 39.65  ? 56   TRP B CZ2 1 
ATOM   4679 C CZ3 . TRP B 1 56  ? 3.762   7.021   -67.253 1.00 35.04  ? 56   TRP B CZ3 1 
ATOM   4680 C CH2 . TRP B 1 56  ? 2.610   7.697   -66.830 1.00 37.21  ? 56   TRP B CH2 1 
ATOM   4681 N N   . SER B 1 57  ? 2.318   4.810   -74.079 1.00 41.89  ? 57   SER B N   1 
ATOM   4682 C CA  . SER B 1 57  ? 1.277   5.062   -75.070 1.00 41.96  ? 57   SER B CA  1 
ATOM   4683 C C   . SER B 1 57  ? -0.098  4.667   -74.533 1.00 41.94  ? 57   SER B C   1 
ATOM   4684 O O   . SER B 1 57  ? -0.194  3.891   -73.585 1.00 50.89  ? 57   SER B O   1 
ATOM   4685 C CB  . SER B 1 57  ? 1.572   4.272   -76.341 1.00 43.69  ? 57   SER B CB  1 
ATOM   4686 O OG  . SER B 1 57  ? 1.361   2.891   -76.112 1.00 48.21  ? 57   SER B OG  1 
ATOM   4687 N N   . GLY B 1 58  ? -1.157  5.200   -75.140 1.00 43.27  ? 58   GLY B N   1 
ATOM   4688 C CA  . GLY B 1 58  ? -2.512  4.886   -74.729 1.00 43.67  ? 58   GLY B CA  1 
ATOM   4689 C C   . GLY B 1 58  ? -2.895  5.297   -73.314 1.00 47.45  ? 58   GLY B C   1 
ATOM   4690 O O   . GLY B 1 58  ? -2.410  6.302   -72.761 1.00 43.01  ? 58   GLY B O   1 
ATOM   4691 N N   . VAL B 1 59  ? -3.790  4.512   -72.722 1.00 48.68  ? 59   VAL B N   1 
ATOM   4692 C CA  . VAL B 1 59  ? -4.273  4.786   -71.379 1.00 48.85  ? 59   VAL B CA  1 
ATOM   4693 C C   . VAL B 1 59  ? -3.833  3.679   -70.438 1.00 45.74  ? 59   VAL B C   1 
ATOM   4694 O O   . VAL B 1 59  ? -4.313  2.536   -70.524 1.00 42.48  ? 59   VAL B O   1 
ATOM   4695 C CB  . VAL B 1 59  ? -5.812  4.910   -71.343 1.00 55.27  ? 59   VAL B CB  1 
ATOM   4696 C CG1 . VAL B 1 59  ? -6.289  5.270   -69.933 1.00 41.24  ? 59   VAL B CG1 1 
ATOM   4697 C CG2 . VAL B 1 59  ? -6.288  5.940   -72.368 1.00 43.92  ? 59   VAL B CG2 1 
ATOM   4698 N N   . LEU B 1 60  ? -2.903  4.025   -69.554 1.00 45.11  ? 60   LEU B N   1 
ATOM   4699 C CA  . LEU B 1 60  ? -2.409  3.098   -68.534 1.00 46.14  ? 60   LEU B CA  1 
ATOM   4700 C C   . LEU B 1 60  ? -3.458  2.864   -67.443 1.00 44.07  ? 60   LEU B C   1 
ATOM   4701 O O   . LEU B 1 60  ? -3.985  3.798   -66.847 1.00 47.35  ? 60   LEU B O   1 
ATOM   4702 C CB  . LEU B 1 60  ? -1.088  3.602   -67.941 1.00 39.67  ? 60   LEU B CB  1 
ATOM   4703 C CG  . LEU B 1 60  ? -0.279  2.719   -66.978 1.00 47.41  ? 60   LEU B CG  1 
ATOM   4704 C CD1 . LEU B 1 60  ? 1.209   3.061   -67.029 1.00 42.07  ? 60   LEU B CD1 1 
ATOM   4705 C CD2 . LEU B 1 60  ? -0.769  2.856   -65.541 1.00 50.79  ? 60   LEU B CD2 1 
ATOM   4706 N N   . ASP B 1 61  ? -3.757  1.600   -67.198 1.00 44.60  ? 61   ASP B N   1 
ATOM   4707 C CA  . ASP B 1 61  ? -4.713  1.219   -66.181 1.00 48.00  ? 61   ASP B CA  1 
ATOM   4708 C C   . ASP B 1 61  ? -4.156  1.466   -64.771 1.00 48.82  ? 61   ASP B C   1 
ATOM   4709 O O   . ASP B 1 61  ? -3.233  0.780   -64.334 1.00 51.43  ? 61   ASP B O   1 
ATOM   4710 C CB  . ASP B 1 61  ? -5.075  -0.254  -66.354 1.00 50.78  ? 61   ASP B CB  1 
ATOM   4711 C CG  . ASP B 1 61  ? -6.113  -0.702  -65.369 1.00 62.34  ? 61   ASP B CG  1 
ATOM   4712 O OD1 . ASP B 1 61  ? -7.302  -0.407  -65.605 1.00 71.58  ? 61   ASP B OD1 1 
ATOM   4713 O OD2 . ASP B 1 61  ? -5.744  -1.326  -64.352 1.00 69.99  ? 61   ASP B OD2 1 
ATOM   4714 N N   . ALA B 1 62  ? -4.718  2.446   -64.067 1.00 40.03  ? 62   ALA B N   1 
ATOM   4715 C CA  . ALA B 1 62  ? -4.292  2.745   -62.703 1.00 40.67  ? 62   ALA B CA  1 
ATOM   4716 C C   . ALA B 1 62  ? -5.392  2.462   -61.684 1.00 40.16  ? 62   ALA B C   1 
ATOM   4717 O O   . ALA B 1 62  ? -5.646  3.283   -60.801 1.00 36.93  ? 62   ALA B O   1 
ATOM   4718 C CB  . ALA B 1 62  ? -3.831  4.209   -62.581 1.00 34.53  ? 62   ALA B CB  1 
ATOM   4719 N N   . THR B 1 63  ? -6.037  1.305   -61.797 1.00 37.67  ? 63   THR B N   1 
ATOM   4720 C CA  . THR B 1 63  ? -7.214  1.029   -60.983 1.00 44.12  ? 63   THR B CA  1 
ATOM   4721 C C   . THR B 1 63  ? -6.969  -0.014  -59.896 1.00 47.77  ? 63   THR B C   1 
ATOM   4722 O O   . THR B 1 63  ? -7.899  -0.428  -59.200 1.00 50.08  ? 63   THR B O   1 
ATOM   4723 C CB  . THR B 1 63  ? -8.415  0.599   -61.849 1.00 43.96  ? 63   THR B CB  1 
ATOM   4724 O OG1 . THR B 1 63  ? -8.190  -0.716  -62.377 1.00 45.95  ? 63   THR B OG1 1 
ATOM   4725 C CG2 . THR B 1 63  ? -8.624  1.584   -62.991 1.00 40.34  ? 63   THR B CG2 1 
ATOM   4726 N N   . THR B 1 64  ? -5.714  -0.414  -59.740 1.00 42.54  ? 64   THR B N   1 
ATOM   4727 C CA  . THR B 1 64  ? -5.367  -1.487  -58.823 1.00 45.37  ? 64   THR B CA  1 
ATOM   4728 C C   . THR B 1 64  ? -3.955  -1.298  -58.229 1.00 44.29  ? 64   THR B C   1 
ATOM   4729 O O   . THR B 1 64  ? -3.084  -0.689  -58.846 1.00 41.92  ? 64   THR B O   1 
ATOM   4730 C CB  . THR B 1 64  ? -5.488  -2.849  -59.531 1.00 50.90  ? 64   THR B CB  1 
ATOM   4731 O OG1 . THR B 1 64  ? -4.965  -3.874  -58.685 1.00 64.49  ? 64   THR B OG1 1 
ATOM   4732 C CG2 . THR B 1 64  ? -4.710  -2.835  -60.822 1.00 51.19  ? 64   THR B CG2 1 
ATOM   4733 N N   . PHE B 1 65  ? -3.740  -1.798  -57.018 1.00 36.74  ? 65   PHE B N   1 
ATOM   4734 C CA  . PHE B 1 65  ? -2.431  -1.692  -56.395 1.00 32.11  ? 65   PHE B CA  1 
ATOM   4735 C C   . PHE B 1 65  ? -1.417  -2.531  -57.148 1.00 35.27  ? 65   PHE B C   1 
ATOM   4736 O O   . PHE B 1 65  ? -1.724  -3.628  -57.618 1.00 33.46  ? 65   PHE B O   1 
ATOM   4737 C CB  . PHE B 1 65  ? -2.477  -2.131  -54.925 1.00 33.28  ? 65   PHE B CB  1 
ATOM   4738 C CG  . PHE B 1 65  ? -3.078  -1.103  -53.994 1.00 38.89  ? 65   PHE B CG  1 
ATOM   4739 C CD1 . PHE B 1 65  ? -2.499  0.153   -53.855 1.00 38.84  ? 65   PHE B CD1 1 
ATOM   4740 C CD2 . PHE B 1 65  ? -4.209  -1.397  -53.249 1.00 40.26  ? 65   PHE B CD2 1 
ATOM   4741 C CE1 . PHE B 1 65  ? -3.044  1.099   -52.998 1.00 41.72  ? 65   PHE B CE1 1 
ATOM   4742 C CE2 . PHE B 1 65  ? -4.758  -0.453  -52.389 1.00 37.02  ? 65   PHE B CE2 1 
ATOM   4743 C CZ  . PHE B 1 65  ? -4.179  0.795   -52.268 1.00 40.49  ? 65   PHE B CZ  1 
ATOM   4744 N N   . GLN B 1 66  ? -0.202  -2.014  -57.242 1.00 36.59  ? 66   GLN B N   1 
ATOM   4745 C CA  . GLN B 1 66  ? 0.882   -2.728  -57.887 1.00 37.42  ? 66   GLN B CA  1 
ATOM   4746 C C   . GLN B 1 66  ? 1.607   -3.619  -56.888 1.00 44.37  ? 66   GLN B C   1 
ATOM   4747 O O   . GLN B 1 66  ? 1.269   -3.629  -55.702 1.00 41.86  ? 66   GLN B O   1 
ATOM   4748 C CB  . GLN B 1 66  ? 1.859   -1.745  -58.526 1.00 37.29  ? 66   GLN B CB  1 
ATOM   4749 C CG  . GLN B 1 66  ? 1.614   -1.537  -60.017 1.00 33.34  ? 66   GLN B CG  1 
ATOM   4750 C CD  . GLN B 1 66  ? 2.088   -2.717  -60.840 1.00 38.64  ? 66   GLN B CD  1 
ATOM   4751 O OE1 . GLN B 1 66  ? 2.698   -3.653  -60.311 1.00 47.43  ? 66   GLN B OE1 1 
ATOM   4752 N NE2 . GLN B 1 66  ? 1.814   -2.685  -62.137 1.00 38.11  ? 66   GLN B NE2 1 
ATOM   4753 N N   . ASN B 1 67  ? 2.592   -4.370  -57.378 1.00 37.82  ? 67   ASN B N   1 
ATOM   4754 C CA  . ASN B 1 67  ? 3.354   -5.287  -56.540 1.00 35.54  ? 67   ASN B CA  1 
ATOM   4755 C C   . ASN B 1 67  ? 4.081   -4.618  -55.388 1.00 38.47  ? 67   ASN B C   1 
ATOM   4756 O O   . ASN B 1 67  ? 4.425   -3.436  -55.445 1.00 38.13  ? 67   ASN B O   1 
ATOM   4757 C CB  . ASN B 1 67  ? 4.377   -6.056  -57.373 1.00 34.27  ? 67   ASN B CB  1 
ATOM   4758 C CG  . ASN B 1 67  ? 3.730   -6.898  -58.459 1.00 42.09  ? 67   ASN B CG  1 
ATOM   4759 O OD1 . ASN B 1 67  ? 2.664   -7.478  -58.253 1.00 43.30  ? 67   ASN B OD1 1 
ATOM   4760 N ND2 . ASN B 1 67  ? 4.374   -6.964  -59.626 1.00 43.52  ? 67   ASN B ND2 1 
ATOM   4761 N N   . VAL B 1 68  ? 4.332   -5.410  -54.354 1.00 30.89  ? 68   VAL B N   1 
ATOM   4762 C CA  . VAL B 1 68  ? 5.101   -4.991  -53.202 1.00 29.99  ? 68   VAL B CA  1 
ATOM   4763 C C   . VAL B 1 68  ? 6.578   -5.275  -53.439 1.00 32.93  ? 68   VAL B C   1 
ATOM   4764 O O   . VAL B 1 68  ? 6.941   -6.346  -53.938 1.00 35.42  ? 68   VAL B O   1 
ATOM   4765 C CB  . VAL B 1 68  ? 4.603   -5.741  -51.945 1.00 41.55  ? 68   VAL B CB  1 
ATOM   4766 C CG1 . VAL B 1 68  ? 5.533   -5.527  -50.748 1.00 38.65  ? 68   VAL B CG1 1 
ATOM   4767 C CG2 . VAL B 1 68  ? 3.165   -5.328  -51.633 1.00 33.89  ? 68   VAL B CG2 1 
ATOM   4768 N N   . CYS B 1 69  ? 7.422   -4.310  -53.087 1.00 30.23  ? 69   CYS B N   1 
ATOM   4769 C CA  . CYS B 1 69  ? 8.865   -4.459  -53.173 1.00 29.38  ? 69   CYS B CA  1 
ATOM   4770 C C   . CYS B 1 69  ? 9.342   -5.690  -52.435 1.00 30.67  ? 69   CYS B C   1 
ATOM   4771 O O   . CYS B 1 69  ? 8.874   -5.996  -51.329 1.00 35.75  ? 69   CYS B O   1 
ATOM   4772 C CB  . CYS B 1 69  ? 9.551   -3.217  -52.614 1.00 28.13  ? 69   CYS B CB  1 
ATOM   4773 S SG  . CYS B 1 69  ? 9.384   -1.743  -53.634 1.00 35.08  ? 69   CYS B SG  1 
ATOM   4774 N N   . TYR B 1 70  ? 10.277  -6.404  -53.047 1.00 40.45  ? 70   TYR B N   1 
ATOM   4775 C CA  . TYR B 1 70  ? 10.682  -7.692  -52.516 1.00 33.49  ? 70   TYR B CA  1 
ATOM   4776 C C   . TYR B 1 70  ? 11.275  -7.547  -51.115 1.00 36.36  ? 70   TYR B C   1 
ATOM   4777 O O   . TYR B 1 70  ? 12.149  -6.721  -50.881 1.00 35.57  ? 70   TYR B O   1 
ATOM   4778 C CB  . TYR B 1 70  ? 11.644  -8.399  -53.465 1.00 34.95  ? 70   TYR B CB  1 
ATOM   4779 C CG  . TYR B 1 70  ? 11.541  -9.889  -53.337 1.00 40.10  ? 70   TYR B CG  1 
ATOM   4780 C CD1 . TYR B 1 70  ? 12.127  -10.545 -52.270 1.00 42.91  ? 70   TYR B CD1 1 
ATOM   4781 C CD2 . TYR B 1 70  ? 10.813  -10.640 -54.248 1.00 43.39  ? 70   TYR B CD2 1 
ATOM   4782 C CE1 . TYR B 1 70  ? 12.027  -11.913 -52.125 1.00 42.93  ? 70   TYR B CE1 1 
ATOM   4783 C CE2 . TYR B 1 70  ? 10.706  -12.023 -54.109 1.00 44.95  ? 70   TYR B CE2 1 
ATOM   4784 C CZ  . TYR B 1 70  ? 11.319  -12.649 -53.039 1.00 42.11  ? 70   TYR B CZ  1 
ATOM   4785 O OH  . TYR B 1 70  ? 11.228  -14.008 -52.866 1.00 43.62  ? 70   TYR B OH  1 
ATOM   4786 N N   . GLN B 1 71  ? 10.773  -8.355  -50.188 1.00 39.76  ? 71   GLN B N   1 
ATOM   4787 C CA  . GLN B 1 71  ? 11.092  -8.214  -48.774 1.00 35.91  ? 71   GLN B CA  1 
ATOM   4788 C C   . GLN B 1 71  ? 10.805  -9.490  -48.007 1.00 39.90  ? 71   GLN B C   1 
ATOM   4789 O O   . GLN B 1 71  ? 10.071  -10.369 -48.467 1.00 41.95  ? 71   GLN B O   1 
ATOM   4790 C CB  . GLN B 1 71  ? 10.238  -7.117  -48.157 1.00 32.26  ? 71   GLN B CB  1 
ATOM   4791 C CG  . GLN B 1 71  ? 8.746   -7.409  -48.201 1.00 32.37  ? 71   GLN B CG  1 
ATOM   4792 C CD  . GLN B 1 71  ? 7.909   -6.153  -47.962 1.00 45.33  ? 71   GLN B CD  1 
ATOM   4793 O OE1 . GLN B 1 71  ? 7.106   -6.093  -47.039 1.00 30.64  ? 71   GLN B OE1 1 
ATOM   4794 N NE2 . GLN B 1 71  ? 8.108   -5.142  -48.797 1.00 44.66  ? 71   GLN B NE2 1 
ATOM   4795 N N   . TYR B 1 72  ? 11.375  -9.559  -46.813 1.00 39.13  ? 72   TYR B N   1 
ATOM   4796 C CA  . TYR B 1 72  ? 11.074  -10.610 -45.860 1.00 42.19  ? 72   TYR B CA  1 
ATOM   4797 C C   . TYR B 1 72  ? 9.597   -10.592 -45.443 1.00 42.42  ? 72   TYR B C   1 
ATOM   4798 O O   . TYR B 1 72  ? 8.981   -9.530  -45.320 1.00 39.65  ? 72   TYR B O   1 
ATOM   4799 C CB  . TYR B 1 72  ? 11.986  -10.432 -44.643 1.00 45.49  ? 72   TYR B CB  1 
ATOM   4800 C CG  . TYR B 1 72  ? 11.702  -11.340 -43.475 1.00 53.72  ? 72   TYR B CG  1 
ATOM   4801 C CD1 . TYR B 1 72  ? 12.163  -12.657 -43.455 1.00 55.17  ? 72   TYR B CD1 1 
ATOM   4802 C CD2 . TYR B 1 72  ? 10.991  -10.872 -42.374 1.00 57.57  ? 72   TYR B CD2 1 
ATOM   4803 C CE1 . TYR B 1 72  ? 11.910  -13.483 -42.369 1.00 57.24  ? 72   TYR B CE1 1 
ATOM   4804 C CE2 . TYR B 1 72  ? 10.735  -11.687 -41.287 1.00 60.30  ? 72   TYR B CE2 1 
ATOM   4805 C CZ  . TYR B 1 72  ? 11.195  -12.986 -41.286 1.00 60.38  ? 72   TYR B CZ  1 
ATOM   4806 O OH  . TYR B 1 72  ? 10.924  -13.776 -40.196 1.00 66.17  ? 72   TYR B OH  1 
ATOM   4807 N N   . VAL B 1 73  ? 9.036   -11.775 -45.225 1.00 41.11  ? 73   VAL B N   1 
ATOM   4808 C CA  . VAL B 1 73  ? 7.653   -11.910 -44.780 1.00 44.96  ? 73   VAL B CA  1 
ATOM   4809 C C   . VAL B 1 73  ? 7.630   -12.578 -43.399 1.00 51.89  ? 73   VAL B C   1 
ATOM   4810 O O   . VAL B 1 73  ? 8.228   -13.635 -43.211 1.00 54.20  ? 73   VAL B O   1 
ATOM   4811 C CB  . VAL B 1 73  ? 6.816   -12.716 -45.812 1.00 50.01  ? 73   VAL B CB  1 
ATOM   4812 C CG1 . VAL B 1 73  ? 5.513   -13.201 -45.207 1.00 47.85  ? 73   VAL B CG1 1 
ATOM   4813 C CG2 . VAL B 1 73  ? 6.551   -11.871 -47.051 1.00 47.20  ? 73   VAL B CG2 1 
ATOM   4814 N N   . ASP B 1 74  ? 6.956   -11.958 -42.431 1.00 55.32  ? 74   ASP B N   1 
ATOM   4815 C CA  . ASP B 1 74  ? 6.982   -12.466 -41.059 1.00 59.23  ? 74   ASP B CA  1 
ATOM   4816 C C   . ASP B 1 74  ? 6.098   -13.688 -40.846 1.00 59.58  ? 74   ASP B C   1 
ATOM   4817 O O   . ASP B 1 74  ? 4.965   -13.732 -41.318 1.00 61.21  ? 74   ASP B O   1 
ATOM   4818 C CB  . ASP B 1 74  ? 6.608   -11.380 -40.052 1.00 69.49  ? 74   ASP B CB  1 
ATOM   4819 C CG  . ASP B 1 74  ? 6.903   -11.799 -38.628 1.00 83.07  ? 74   ASP B CG  1 
ATOM   4820 O OD1 . ASP B 1 74  ? 8.091   -11.742 -38.235 1.00 88.72  ? 74   ASP B OD1 1 
ATOM   4821 O OD2 . ASP B 1 74  ? 5.960   -12.212 -37.914 1.00 86.29  ? 74   ASP B OD2 1 
ATOM   4822 N N   . THR B 1 75  ? 6.620   -14.665 -40.106 1.00 61.29  ? 75   THR B N   1 
ATOM   4823 C CA  . THR B 1 75  ? 5.933   -15.938 -39.909 1.00 66.43  ? 75   THR B CA  1 
ATOM   4824 C C   . THR B 1 75  ? 5.854   -16.366 -38.442 1.00 66.23  ? 75   THR B C   1 
ATOM   4825 O O   . THR B 1 75  ? 5.482   -17.500 -38.144 1.00 69.76  ? 75   THR B O   1 
ATOM   4826 C CB  . THR B 1 75  ? 6.621   -17.062 -40.714 1.00 72.56  ? 75   THR B CB  1 
ATOM   4827 O OG1 . THR B 1 75  ? 8.039   -17.002 -40.500 1.00 74.36  ? 75   THR B OG1 1 
ATOM   4828 C CG2 . THR B 1 75  ? 6.325   -16.911 -42.205 1.00 66.77  ? 75   THR B CG2 1 
ATOM   4829 N N   . LEU B 1 76  ? 6.202   -15.461 -37.534 1.00 64.89  ? 76   LEU B N   1 
ATOM   4830 C CA  . LEU B 1 76  ? 6.206   -15.771 -36.109 1.00 67.67  ? 76   LEU B CA  1 
ATOM   4831 C C   . LEU B 1 76  ? 4.845   -16.279 -35.619 1.00 75.16  ? 76   LEU B C   1 
ATOM   4832 O O   . LEU B 1 76  ? 4.757   -17.336 -34.988 1.00 82.42  ? 76   LEU B O   1 
ATOM   4833 C CB  . LEU B 1 76  ? 6.657   -14.560 -35.292 1.00 63.72  ? 76   LEU B CB  1 
ATOM   4834 C CG  . LEU B 1 76  ? 6.734   -14.793 -33.780 1.00 69.30  ? 76   LEU B CG  1 
ATOM   4835 C CD1 . LEU B 1 76  ? 7.689   -15.934 -33.448 1.00 70.16  ? 76   LEU B CD1 1 
ATOM   4836 C CD2 . LEU B 1 76  ? 7.144   -13.517 -33.059 1.00 68.35  ? 76   LEU B CD2 1 
ATOM   4837 N N   . TYR B 1 77  ? 3.785   -15.538 -35.918 1.00 68.82  ? 77   TYR B N   1 
ATOM   4838 C CA  . TYR B 1 77  ? 2.442   -15.979 -35.564 1.00 64.86  ? 77   TYR B CA  1 
ATOM   4839 C C   . TYR B 1 77  ? 1.559   -16.094 -36.809 1.00 62.01  ? 77   TYR B C   1 
ATOM   4840 O O   . TYR B 1 77  ? 0.791   -15.184 -37.105 1.00 54.60  ? 77   TYR B O   1 
ATOM   4841 C CB  . TYR B 1 77  ? 1.809   -15.011 -34.572 1.00 63.95  ? 77   TYR B CB  1 
ATOM   4842 C CG  . TYR B 1 77  ? 2.537   -14.877 -33.250 1.00 65.98  ? 77   TYR B CG  1 
ATOM   4843 C CD1 . TYR B 1 77  ? 2.473   -15.878 -32.291 1.00 66.93  ? 77   TYR B CD1 1 
ATOM   4844 C CD2 . TYR B 1 77  ? 3.256   -13.725 -32.944 1.00 66.95  ? 77   TYR B CD2 1 
ATOM   4845 C CE1 . TYR B 1 77  ? 3.123   -15.747 -31.071 1.00 71.56  ? 77   TYR B CE1 1 
ATOM   4846 C CE2 . TYR B 1 77  ? 3.907   -13.582 -31.727 1.00 67.62  ? 77   TYR B CE2 1 
ATOM   4847 C CZ  . TYR B 1 77  ? 3.839   -14.594 -30.794 1.00 71.88  ? 77   TYR B CZ  1 
ATOM   4848 O OH  . TYR B 1 77  ? 4.483   -14.452 -29.582 1.00 72.57  ? 77   TYR B OH  1 
ATOM   4849 N N   . PRO B 1 78  ? 1.646   -17.233 -37.521 1.00 68.03  ? 78   PRO B N   1 
ATOM   4850 C CA  . PRO B 1 78  ? 1.042   -17.426 -38.851 1.00 68.92  ? 78   PRO B CA  1 
ATOM   4851 C C   . PRO B 1 78  ? -0.477  -17.221 -38.897 1.00 68.82  ? 78   PRO B C   1 
ATOM   4852 O O   . PRO B 1 78  ? -1.215  -17.956 -38.257 1.00 57.82  ? 78   PRO B O   1 
ATOM   4853 C CB  . PRO B 1 78  ? 1.390   -18.884 -39.188 1.00 68.89  ? 78   PRO B CB  1 
ATOM   4854 C CG  . PRO B 1 78  ? 2.548   -19.223 -38.310 1.00 71.17  ? 78   PRO B CG  1 
ATOM   4855 C CD  . PRO B 1 78  ? 2.309   -18.459 -37.043 1.00 71.17  ? 78   PRO B CD  1 
ATOM   4856 N N   . GLY B 1 79  ? -0.931  -16.223 -39.650 1.00 68.41  ? 79   GLY B N   1 
ATOM   4857 C CA  . GLY B 1 79  ? -2.356  -15.968 -39.790 1.00 70.13  ? 79   GLY B CA  1 
ATOM   4858 C C   . GLY B 1 79  ? -3.007  -15.286 -38.598 1.00 68.55  ? 79   GLY B C   1 
ATOM   4859 O O   . GLY B 1 79  ? -4.236  -15.284 -38.463 1.00 63.36  ? 79   GLY B O   1 
ATOM   4860 N N   . PHE B 1 80  ? -2.179  -14.721 -37.722 1.00 66.56  ? 80   PHE B N   1 
ATOM   4861 C CA  . PHE B 1 80  ? -2.655  -13.891 -36.627 1.00 61.57  ? 80   PHE B CA  1 
ATOM   4862 C C   . PHE B 1 80  ? -2.821  -12.481 -37.186 1.00 59.10  ? 80   PHE B C   1 
ATOM   4863 O O   . PHE B 1 80  ? -1.912  -11.959 -37.838 1.00 58.00  ? 80   PHE B O   1 
ATOM   4864 C CB  . PHE B 1 80  ? -1.649  -13.930 -35.466 1.00 59.80  ? 80   PHE B CB  1 
ATOM   4865 C CG  . PHE B 1 80  ? -1.879  -12.880 -34.410 1.00 58.56  ? 80   PHE B CG  1 
ATOM   4866 C CD1 . PHE B 1 80  ? -3.006  -12.916 -33.602 1.00 58.31  ? 80   PHE B CD1 1 
ATOM   4867 C CD2 . PHE B 1 80  ? -0.953  -11.866 -34.211 1.00 57.72  ? 80   PHE B CD2 1 
ATOM   4868 C CE1 . PHE B 1 80  ? -3.215  -11.948 -32.624 1.00 56.75  ? 80   PHE B CE1 1 
ATOM   4869 C CE2 . PHE B 1 80  ? -1.156  -10.899 -33.229 1.00 56.36  ? 80   PHE B CE2 1 
ATOM   4870 C CZ  . PHE B 1 80  ? -2.290  -10.942 -32.437 1.00 53.79  ? 80   PHE B CZ  1 
ATOM   4871 N N   . GLU B 1 81  ? -3.983  -11.875 -36.950 1.00 58.32  ? 81   GLU B N   1 
ATOM   4872 C CA  . GLU B 1 81  ? -4.302  -10.577 -37.554 1.00 59.53  ? 81   GLU B CA  1 
ATOM   4873 C C   . GLU B 1 81  ? -3.273  -9.484  -37.246 1.00 52.09  ? 81   GLU B C   1 
ATOM   4874 O O   . GLU B 1 81  ? -2.944  -8.679  -38.113 1.00 48.85  ? 81   GLU B O   1 
ATOM   4875 C CB  . GLU B 1 81  ? -5.711  -10.115 -37.159 1.00 70.42  ? 81   GLU B CB  1 
ATOM   4876 C CG  . GLU B 1 81  ? -6.217  -8.897  -37.934 1.00 80.38  ? 81   GLU B CG  1 
ATOM   4877 C CD  . GLU B 1 81  ? -6.367  -9.158  -39.436 1.00 94.08  ? 81   GLU B CD  1 
ATOM   4878 O OE1 . GLU B 1 81  ? -6.984  -10.184 -39.810 1.00 99.29  ? 81   GLU B OE1 1 
ATOM   4879 O OE2 . GLU B 1 81  ? -5.867  -8.335  -40.245 1.00 94.72  ? 81   GLU B OE2 1 
ATOM   4880 N N   . GLY B 1 82  ? -2.762  -9.470  -36.016 1.00 51.23  ? 82   GLY B N   1 
ATOM   4881 C CA  . GLY B 1 82  ? -1.822  -8.449  -35.575 1.00 44.35  ? 82   GLY B CA  1 
ATOM   4882 C C   . GLY B 1 82  ? -0.452  -8.449  -36.243 1.00 42.09  ? 82   GLY B C   1 
ATOM   4883 O O   . GLY B 1 82  ? 0.234   -7.428  -36.245 1.00 44.69  ? 82   GLY B O   1 
ATOM   4884 N N   . THR B 1 83  ? -0.039  -9.584  -36.802 1.00 45.27  ? 83   THR B N   1 
ATOM   4885 C CA  . THR B 1 83  ? 1.215   -9.640  -37.550 1.00 47.82  ? 83   THR B CA  1 
ATOM   4886 C C   . THR B 1 83  ? 0.955   -9.562  -39.054 1.00 50.57  ? 83   THR B C   1 
ATOM   4887 O O   . THR B 1 83  ? 1.718   -8.940  -39.801 1.00 44.38  ? 83   THR B O   1 
ATOM   4888 C CB  . THR B 1 83  ? 2.023   -10.918 -37.240 1.00 51.96  ? 83   THR B CB  1 
ATOM   4889 O OG1 . THR B 1 83  ? 1.179   -12.068 -37.371 1.00 63.91  ? 83   THR B OG1 1 
ATOM   4890 C CG2 . THR B 1 83  ? 2.589   -10.873 -35.834 1.00 52.68  ? 83   THR B CG2 1 
ATOM   4891 N N   . GLU B 1 84  ? -0.137  -10.185 -39.486 1.00 54.10  ? 84   GLU B N   1 
ATOM   4892 C CA  . GLU B 1 84  ? -0.459  -10.275 -40.905 1.00 52.13  ? 84   GLU B CA  1 
ATOM   4893 C C   . GLU B 1 84  ? -0.855  -8.932  -41.520 1.00 50.82  ? 84   GLU B C   1 
ATOM   4894 O O   . GLU B 1 84  ? -0.609  -8.694  -42.706 1.00 48.02  ? 84   GLU B O   1 
ATOM   4895 C CB  . GLU B 1 84  ? -1.554  -11.316 -41.137 1.00 51.74  ? 84   GLU B CB  1 
ATOM   4896 C CG  . GLU B 1 84  ? -1.165  -12.737 -40.740 1.00 61.89  ? 84   GLU B CG  1 
ATOM   4897 C CD  . GLU B 1 84  ? -0.254  -13.427 -41.748 1.00 66.98  ? 84   GLU B CD  1 
ATOM   4898 O OE1 . GLU B 1 84  ? 0.005   -12.848 -42.831 1.00 66.95  ? 84   GLU B OE1 1 
ATOM   4899 O OE2 . GLU B 1 84  ? 0.199   -14.558 -41.450 1.00 65.66  ? 84   GLU B OE2 1 
ATOM   4900 N N   . MET B 1 85  ? -1.447  -8.048  -40.718 1.00 50.42  ? 85   MET B N   1 
ATOM   4901 C CA  . MET B 1 85  ? -1.881  -6.735  -41.211 1.00 44.84  ? 85   MET B CA  1 
ATOM   4902 C C   . MET B 1 85  ? -0.710  -5.903  -41.748 1.00 44.77  ? 85   MET B C   1 
ATOM   4903 O O   . MET B 1 85  ? -0.921  -4.904  -42.446 1.00 43.98  ? 85   MET B O   1 
ATOM   4904 C CB  . MET B 1 85  ? -2.637  -5.956  -40.123 1.00 38.77  ? 85   MET B CB  1 
ATOM   4905 C CG  . MET B 1 85  ? -1.810  -5.661  -38.879 1.00 40.46  ? 85   MET B CG  1 
ATOM   4906 S SD  . MET B 1 85  ? -2.654  -4.672  -37.621 1.00 47.98  ? 85   MET B SD  1 
ATOM   4907 C CE  . MET B 1 85  ? -2.635  -3.054  -38.397 1.00 33.69  ? 85   MET B CE  1 
ATOM   4908 N N   . TRP B 1 86  ? 0.516   -6.320  -41.419 1.00 38.39  ? 86   TRP B N   1 
ATOM   4909 C CA  . TRP B 1 86  ? 1.727   -5.680  -41.940 1.00 36.59  ? 86   TRP B CA  1 
ATOM   4910 C C   . TRP B 1 86  ? 2.382   -6.458  -43.091 1.00 37.19  ? 86   TRP B C   1 
ATOM   4911 O O   . TRP B 1 86  ? 3.226   -5.920  -43.788 1.00 37.77  ? 86   TRP B O   1 
ATOM   4912 C CB  . TRP B 1 86  ? 2.743   -5.454  -40.814 1.00 34.22  ? 86   TRP B CB  1 
ATOM   4913 C CG  . TRP B 1 86  ? 2.121   -4.842  -39.607 1.00 40.33  ? 86   TRP B CG  1 
ATOM   4914 C CD1 . TRP B 1 86  ? 1.754   -5.484  -38.458 1.00 40.25  ? 86   TRP B CD1 1 
ATOM   4915 C CD2 . TRP B 1 86  ? 1.763   -3.468  -39.426 1.00 40.76  ? 86   TRP B CD2 1 
ATOM   4916 N NE1 . TRP B 1 86  ? 1.205   -4.593  -37.570 1.00 39.19  ? 86   TRP B NE1 1 
ATOM   4917 C CE2 . TRP B 1 86  ? 1.199   -3.348  -38.138 1.00 42.92  ? 86   TRP B CE2 1 
ATOM   4918 C CE3 . TRP B 1 86  ? 1.875   -2.326  -40.221 1.00 40.93  ? 86   TRP B CE3 1 
ATOM   4919 C CZ2 . TRP B 1 86  ? 0.744   -2.128  -37.628 1.00 41.83  ? 86   TRP B CZ2 1 
ATOM   4920 C CZ3 . TRP B 1 86  ? 1.422   -1.111  -39.715 1.00 39.24  ? 86   TRP B CZ3 1 
ATOM   4921 C CH2 . TRP B 1 86  ? 0.866   -1.022  -38.429 1.00 37.00  ? 86   TRP B CH2 1 
ATOM   4922 N N   . ASN B 1 87  ? 2.003   -7.720  -43.281 1.00 34.67  ? 87   ASN B N   1 
ATOM   4923 C CA  . ASN B 1 87  ? 2.578   -8.536  -44.349 1.00 47.02  ? 87   ASN B CA  1 
ATOM   4924 C C   . ASN B 1 87  ? 2.125   -8.063  -45.738 1.00 46.15  ? 87   ASN B C   1 
ATOM   4925 O O   . ASN B 1 87  ? 1.065   -7.453  -45.865 1.00 40.73  ? 87   ASN B O   1 
ATOM   4926 C CB  . ASN B 1 87  ? 2.216   -10.008 -44.139 1.00 53.51  ? 87   ASN B CB  1 
ATOM   4927 C CG  . ASN B 1 87  ? 3.177   -10.719 -43.202 1.00 53.02  ? 87   ASN B CG  1 
ATOM   4928 O OD1 . ASN B 1 87  ? 4.357   -10.369 -43.123 1.00 51.47  ? 87   ASN B OD1 1 
ATOM   4929 N ND2 . ASN B 1 87  ? 2.678   -11.731 -42.495 1.00 50.10  ? 87   ASN B ND2 1 
ATOM   4930 N N   . PRO B 1 88  ? 2.936   -8.331  -46.780 1.00 47.91  ? 88   PRO B N   1 
ATOM   4931 C CA  . PRO B 1 88  ? 2.569   -7.892  -48.134 1.00 45.45  ? 88   PRO B CA  1 
ATOM   4932 C C   . PRO B 1 88  ? 1.196   -8.401  -48.546 1.00 44.46  ? 88   PRO B C   1 
ATOM   4933 O O   . PRO B 1 88  ? 0.881   -9.578  -48.345 1.00 44.40  ? 88   PRO B O   1 
ATOM   4934 C CB  . PRO B 1 88  ? 3.649   -8.527  -49.016 1.00 34.37  ? 88   PRO B CB  1 
ATOM   4935 C CG  . PRO B 1 88  ? 4.819   -8.693  -48.112 1.00 34.33  ? 88   PRO B CG  1 
ATOM   4936 C CD  . PRO B 1 88  ? 4.231   -9.034  -46.768 1.00 44.99  ? 88   PRO B CD  1 
ATOM   4937 N N   . ASN B 1 89  ? 0.383   -7.513  -49.107 1.00 45.14  ? 89   ASN B N   1 
ATOM   4938 C CA  . ASN B 1 89  ? -0.966  -7.882  -49.508 1.00 45.30  ? 89   ASN B CA  1 
ATOM   4939 C C   . ASN B 1 89  ? -1.126  -7.888  -51.030 1.00 45.26  ? 89   ASN B C   1 
ATOM   4940 O O   . ASN B 1 89  ? -2.237  -8.021  -51.544 1.00 47.61  ? 89   ASN B O   1 
ATOM   4941 C CB  . ASN B 1 89  ? -2.010  -6.991  -48.813 1.00 43.01  ? 89   ASN B CB  1 
ATOM   4942 C CG  . ASN B 1 89  ? -1.980  -5.559  -49.306 1.00 41.16  ? 89   ASN B CG  1 
ATOM   4943 O OD1 . ASN B 1 89  ? -0.985  -5.104  -49.861 1.00 40.45  ? 89   ASN B OD1 1 
ATOM   4944 N ND2 . ASN B 1 89  ? -3.081  -4.842  -49.109 1.00 45.05  ? 89   ASN B ND2 1 
ATOM   4945 N N   . ARG B 1 90  ? -0.005  -7.728  -51.737 1.00 40.02  ? 90   ARG B N   1 
ATOM   4946 C CA  . ARG B 1 90  ? 0.067   -7.988  -53.180 1.00 41.80  ? 90   ARG B CA  1 
ATOM   4947 C C   . ARG B 1 90  ? 1.264   -8.893  -53.456 1.00 40.78  ? 90   ARG B C   1 
ATOM   4948 O O   . ARG B 1 90  ? 2.049   -9.154  -52.562 1.00 41.70  ? 90   ARG B O   1 
ATOM   4949 C CB  . ARG B 1 90  ? 0.201   -6.690  -53.979 1.00 39.80  ? 90   ARG B CB  1 
ATOM   4950 C CG  . ARG B 1 90  ? -1.058  -5.849  -54.031 1.00 44.13  ? 90   ARG B CG  1 
ATOM   4951 C CD  . ARG B 1 90  ? -2.212  -6.608  -54.688 1.00 47.44  ? 90   ARG B CD  1 
ATOM   4952 N NE  . ARG B 1 90  ? -3.414  -5.782  -54.750 1.00 54.61  ? 90   ARG B NE  1 
ATOM   4953 C CZ  . ARG B 1 90  ? -4.251  -5.603  -53.728 1.00 56.98  ? 90   ARG B CZ  1 
ATOM   4954 N NH1 . ARG B 1 90  ? -4.020  -6.201  -52.564 1.00 53.85  ? 90   ARG B NH1 1 
ATOM   4955 N NH2 . ARG B 1 90  ? -5.320  -4.824  -53.865 1.00 55.18  ? 90   ARG B NH2 1 
ATOM   4956 N N   . GLU B 1 91  ? 1.400   -9.379  -54.685 1.00 42.13  ? 91   GLU B N   1 
ATOM   4957 C CA  . GLU B 1 91  ? 2.576   -10.162 -55.064 1.00 44.79  ? 91   GLU B CA  1 
ATOM   4958 C C   . GLU B 1 91  ? 3.896   -9.424  -54.821 1.00 40.48  ? 91   GLU B C   1 
ATOM   4959 O O   . GLU B 1 91  ? 3.968   -8.206  -54.956 1.00 41.73  ? 91   GLU B O   1 
ATOM   4960 C CB  . GLU B 1 91  ? 2.491   -10.586 -56.533 1.00 49.89  ? 91   GLU B CB  1 
ATOM   4961 C CG  . GLU B 1 91  ? 1.499   -11.714 -56.817 1.00 63.29  ? 91   GLU B CG  1 
ATOM   4962 C CD  . GLU B 1 91  ? 2.013   -13.081 -56.395 1.00 72.75  ? 91   GLU B CD  1 
ATOM   4963 O OE1 . GLU B 1 91  ? 3.075   -13.155 -55.741 1.00 71.69  ? 91   GLU B OE1 1 
ATOM   4964 O OE2 . GLU B 1 91  ? 1.355   -14.089 -56.730 1.00 83.07  ? 91   GLU B OE2 1 
ATOM   4965 N N   . LEU B 1 92  ? 4.932   -10.178 -54.460 1.00 40.40  ? 92   LEU B N   1 
ATOM   4966 C CA  . LEU B 1 92  ? 6.282   -9.649  -54.284 1.00 36.09  ? 92   LEU B CA  1 
ATOM   4967 C C   . LEU B 1 92  ? 7.004   -9.508  -55.622 1.00 41.30  ? 92   LEU B C   1 
ATOM   4968 O O   . LEU B 1 92  ? 6.968   -10.414 -56.448 1.00 45.19  ? 92   LEU B O   1 
ATOM   4969 C CB  . LEU B 1 92  ? 7.105   -10.593 -53.411 1.00 37.30  ? 92   LEU B CB  1 
ATOM   4970 C CG  . LEU B 1 92  ? 6.715   -10.805 -51.953 1.00 45.94  ? 92   LEU B CG  1 
ATOM   4971 C CD1 . LEU B 1 92  ? 7.879   -11.434 -51.204 1.00 38.36  ? 92   LEU B CD1 1 
ATOM   4972 C CD2 . LEU B 1 92  ? 6.311   -9.504  -51.300 1.00 35.38  ? 92   LEU B CD2 1 
ATOM   4973 N N   . SER B 1 93  ? 7.698   -8.396  -55.816 1.00 40.28  ? 93   SER B N   1 
ATOM   4974 C CA  . SER B 1 93  ? 8.512   -8.221  -57.011 1.00 38.41  ? 93   SER B CA  1 
ATOM   4975 C C   . SER B 1 93  ? 9.533   -7.100  -56.842 1.00 39.28  ? 93   SER B C   1 
ATOM   4976 O O   . SER B 1 93  ? 9.277   -6.117  -56.138 1.00 36.62  ? 93   SER B O   1 
ATOM   4977 C CB  . SER B 1 93  ? 7.619   -7.914  -58.216 1.00 41.10  ? 93   SER B CB  1 
ATOM   4978 O OG  . SER B 1 93  ? 8.389   -7.670  -59.378 1.00 35.33  ? 93   SER B OG  1 
ATOM   4979 N N   . GLU B 1 94  ? 10.678  -7.231  -57.507 1.00 34.41  ? 94   GLU B N   1 
ATOM   4980 C CA  . GLU B 1 94  ? 11.640  -6.137  -57.549 1.00 33.46  ? 94   GLU B CA  1 
ATOM   4981 C C   . GLU B 1 94  ? 11.114  -5.019  -58.432 1.00 32.44  ? 94   GLU B C   1 
ATOM   4982 O O   . GLU B 1 94  ? 11.495  -3.873  -58.294 1.00 31.36  ? 94   GLU B O   1 
ATOM   4983 C CB  . GLU B 1 94  ? 12.996  -6.615  -58.045 1.00 34.85  ? 94   GLU B CB  1 
ATOM   4984 C CG  . GLU B 1 94  ? 13.798  -7.308  -56.978 1.00 35.66  ? 94   GLU B CG  1 
ATOM   4985 C CD  . GLU B 1 94  ? 15.170  -7.713  -57.468 1.00 44.77  ? 94   GLU B CD  1 
ATOM   4986 O OE1 . GLU B 1 94  ? 16.088  -6.863  -57.478 1.00 46.52  ? 94   GLU B OE1 1 
ATOM   4987 O OE2 . GLU B 1 94  ? 15.328  -8.886  -57.847 1.00 43.13  ? 94   GLU B OE2 1 
ATOM   4988 N N   . ASP B 1 95  ? 10.226  -5.379  -59.348 1.00 33.28  ? 95   ASP B N   1 
ATOM   4989 C CA  . ASP B 1 95  ? 9.516   -4.397  -60.138 1.00 32.25  ? 95   ASP B CA  1 
ATOM   4990 C C   . ASP B 1 95  ? 8.401   -3.847  -59.259 1.00 31.03  ? 95   ASP B C   1 
ATOM   4991 O O   . ASP B 1 95  ? 7.298   -4.369  -59.263 1.00 39.45  ? 95   ASP B O   1 
ATOM   4992 C CB  . ASP B 1 95  ? 8.949   -5.060  -61.393 1.00 33.55  ? 95   ASP B CB  1 
ATOM   4993 C CG  . ASP B 1 95  ? 8.203   -4.096  -62.279 1.00 34.85  ? 95   ASP B CG  1 
ATOM   4994 O OD1 . ASP B 1 95  ? 8.039   -2.914  -61.907 1.00 35.63  ? 95   ASP B OD1 1 
ATOM   4995 O OD2 . ASP B 1 95  ? 7.758   -4.527  -63.358 1.00 39.69  ? 95   ASP B OD2 1 
ATOM   4996 N N   . CYS B 1 96  ? 8.680   -2.783  -58.515 1.00 33.92  ? 96   CYS B N   1 
ATOM   4997 C CA  . CYS B 1 96  ? 7.727   -2.329  -57.505 1.00 30.13  ? 96   CYS B CA  1 
ATOM   4998 C C   . CYS B 1 96  ? 7.669   -0.827  -57.311 1.00 32.28  ? 96   CYS B C   1 
ATOM   4999 O O   . CYS B 1 96  ? 7.045   -0.359  -56.366 1.00 32.76  ? 96   CYS B O   1 
ATOM   5000 C CB  . CYS B 1 96  ? 8.078   -2.947  -56.166 1.00 28.73  ? 96   CYS B CB  1 
ATOM   5001 S SG  . CYS B 1 96  ? 9.689   -2.369  -55.537 1.00 33.39  ? 96   CYS B SG  1 
ATOM   5002 N N   . LEU B 1 97  ? 8.311   -0.068  -58.190 1.00 30.19  ? 97   LEU B N   1 
ATOM   5003 C CA  . LEU B 1 97  ? 8.368   1.372   -57.993 1.00 26.43  ? 97   LEU B CA  1 
ATOM   5004 C C   . LEU B 1 97  ? 7.122   2.054   -58.561 1.00 28.95  ? 97   LEU B C   1 
ATOM   5005 O O   . LEU B 1 97  ? 7.107   2.552   -59.687 1.00 28.13  ? 97   LEU B O   1 
ATOM   5006 C CB  . LEU B 1 97  ? 9.676   1.948   -58.540 1.00 26.67  ? 97   LEU B CB  1 
ATOM   5007 C CG  . LEU B 1 97  ? 10.902  1.485   -57.748 1.00 26.85  ? 97   LEU B CG  1 
ATOM   5008 C CD1 . LEU B 1 97  ? 12.165  2.185   -58.222 1.00 27.25  ? 97   LEU B CD1 1 
ATOM   5009 C CD2 . LEU B 1 97  ? 10.695  1.681   -56.216 1.00 26.81  ? 97   LEU B CD2 1 
ATOM   5010 N N   . TYR B 1 98  ? 6.063   2.058   -57.758 1.00 32.59  ? 98   TYR B N   1 
ATOM   5011 C CA  . TYR B 1 98  ? 4.805   2.656   -58.167 1.00 28.52  ? 98   TYR B CA  1 
ATOM   5012 C C   . TYR B 1 98  ? 4.255   3.459   -57.013 1.00 35.36  ? 98   TYR B C   1 
ATOM   5013 O O   . TYR B 1 98  ? 4.596   3.200   -55.854 1.00 38.02  ? 98   TYR B O   1 
ATOM   5014 C CB  . TYR B 1 98  ? 3.797   1.582   -58.592 1.00 26.89  ? 98   TYR B CB  1 
ATOM   5015 C CG  . TYR B 1 98  ? 4.279   0.714   -59.742 1.00 38.55  ? 98   TYR B CG  1 
ATOM   5016 C CD1 . TYR B 1 98  ? 5.131   -0.366  -59.514 1.00 36.03  ? 98   TYR B CD1 1 
ATOM   5017 C CD2 . TYR B 1 98  ? 3.881   0.973   -61.053 1.00 32.18  ? 98   TYR B CD2 1 
ATOM   5018 C CE1 . TYR B 1 98  ? 5.583   -1.163  -60.557 1.00 37.15  ? 98   TYR B CE1 1 
ATOM   5019 C CE2 . TYR B 1 98  ? 4.319   0.183   -62.106 1.00 33.75  ? 98   TYR B CE2 1 
ATOM   5020 C CZ  . TYR B 1 98  ? 5.173   -0.889  -61.850 1.00 40.56  ? 98   TYR B CZ  1 
ATOM   5021 O OH  . TYR B 1 98  ? 5.622   -1.679  -62.884 1.00 38.18  ? 98   TYR B OH  1 
ATOM   5022 N N   . LEU B 1 99  ? 3.404   4.432   -57.332 1.00 34.45  ? 99   LEU B N   1 
ATOM   5023 C CA  . LEU B 1 99  ? 2.750   5.228   -56.308 1.00 35.90  ? 99   LEU B CA  1 
ATOM   5024 C C   . LEU B 1 99  ? 1.239   5.230   -56.475 1.00 40.99  ? 99   LEU B C   1 
ATOM   5025 O O   . LEU B 1 99  ? 0.716   4.782   -57.493 1.00 42.31  ? 99   LEU B O   1 
ATOM   5026 C CB  . LEU B 1 99  ? 3.299   6.659   -56.268 1.00 35.49  ? 99   LEU B CB  1 
ATOM   5027 C CG  . LEU B 1 99  ? 3.344   7.532   -57.526 1.00 39.04  ? 99   LEU B CG  1 
ATOM   5028 C CD1 . LEU B 1 99  ? 2.004   8.188   -57.846 1.00 25.21  ? 99   LEU B CD1 1 
ATOM   5029 C CD2 . LEU B 1 99  ? 4.438   8.588   -57.381 1.00 31.33  ? 99   LEU B CD2 1 
ATOM   5030 N N   . ASN B 1 100 ? 0.558   5.745   -55.456 1.00 39.78  ? 100  ASN B N   1 
ATOM   5031 C CA  . ASN B 1 100 ? -0.889  5.770   -55.397 1.00 33.31  ? 100  ASN B CA  1 
ATOM   5032 C C   . ASN B 1 100 ? -1.399  7.177   -55.067 1.00 36.78  ? 100  ASN B C   1 
ATOM   5033 O O   . ASN B 1 100 ? -0.777  7.905   -54.293 1.00 38.32  ? 100  ASN B O   1 
ATOM   5034 C CB  . ASN B 1 100 ? -1.372  4.782   -54.339 1.00 34.86  ? 100  ASN B CB  1 
ATOM   5035 C CG  . ASN B 1 100 ? -0.757  3.392   -54.502 1.00 35.26  ? 100  ASN B CG  1 
ATOM   5036 O OD1 . ASN B 1 100 ? -0.997  2.700   -55.501 1.00 34.28  ? 100  ASN B OD1 1 
ATOM   5037 N ND2 . ASN B 1 100 ? 0.015   2.968   -53.504 1.00 31.06  ? 100  ASN B ND2 1 
ATOM   5038 N N   . VAL B 1 101 ? -2.524  7.565   -55.666 1.00 38.30  ? 101  VAL B N   1 
ATOM   5039 C CA  . VAL B 1 101 ? -3.102  8.887   -55.435 1.00 33.04  ? 101  VAL B CA  1 
ATOM   5040 C C   . VAL B 1 101 ? -4.603  8.776   -55.175 1.00 34.55  ? 101  VAL B C   1 
ATOM   5041 O O   . VAL B 1 101 ? -5.327  8.174   -55.970 1.00 38.44  ? 101  VAL B O   1 
ATOM   5042 C CB  . VAL B 1 101 ? -2.907  9.814   -56.656 1.00 34.75  ? 101  VAL B CB  1 
ATOM   5043 C CG1 . VAL B 1 101 ? -3.583  11.164  -56.414 1.00 28.17  ? 101  VAL B CG1 1 
ATOM   5044 C CG2 . VAL B 1 101 ? -1.426  9.994   -56.984 1.00 35.58  ? 101  VAL B CG2 1 
ATOM   5045 N N   . TRP B 1 102 ? -5.069  9.341   -54.065 1.00 30.32  ? 102  TRP B N   1 
ATOM   5046 C CA  . TRP B 1 102 ? -6.502  9.504   -53.845 1.00 32.93  ? 102  TRP B CA  1 
ATOM   5047 C C   . TRP B 1 102 ? -6.840  10.990  -53.891 1.00 40.88  ? 102  TRP B C   1 
ATOM   5048 O O   . TRP B 1 102 ? -6.125  11.810  -53.295 1.00 38.95  ? 102  TRP B O   1 
ATOM   5049 C CB  . TRP B 1 102 ? -6.918  8.978   -52.468 1.00 31.91  ? 102  TRP B CB  1 
ATOM   5050 C CG  . TRP B 1 102 ? -6.900  7.482   -52.270 1.00 34.39  ? 102  TRP B CG  1 
ATOM   5051 C CD1 . TRP B 1 102 ? -7.964  6.622   -52.379 1.00 36.17  ? 102  TRP B CD1 1 
ATOM   5052 C CD2 . TRP B 1 102 ? -5.777  6.679   -51.875 1.00 32.20  ? 102  TRP B CD2 1 
ATOM   5053 N NE1 . TRP B 1 102 ? -7.564  5.337   -52.091 1.00 44.85  ? 102  TRP B NE1 1 
ATOM   5054 C CE2 . TRP B 1 102 ? -6.226  5.346   -51.780 1.00 35.92  ? 102  TRP B CE2 1 
ATOM   5055 C CE3 . TRP B 1 102 ? -4.434  6.958   -51.597 1.00 34.76  ? 102  TRP B CE3 1 
ATOM   5056 C CZ2 . TRP B 1 102 ? -5.381  4.298   -51.421 1.00 33.03  ? 102  TRP B CZ2 1 
ATOM   5057 C CZ3 . TRP B 1 102 ? -3.594  5.909   -51.239 1.00 33.74  ? 102  TRP B CZ3 1 
ATOM   5058 C CH2 . TRP B 1 102 ? -4.071  4.601   -51.153 1.00 32.97  ? 102  TRP B CH2 1 
ATOM   5059 N N   . THR B 1 103 ? -7.933  11.336  -54.573 1.00 42.27  ? 103  THR B N   1 
ATOM   5060 C CA  . THR B 1 103 ? -8.444  12.707  -54.580 1.00 43.77  ? 103  THR B CA  1 
ATOM   5061 C C   . THR B 1 103 ? -9.935  12.685  -54.319 1.00 50.37  ? 103  THR B C   1 
ATOM   5062 O O   . THR B 1 103 ? -10.573 11.648  -54.487 1.00 53.13  ? 103  THR B O   1 
ATOM   5063 C CB  . THR B 1 103 ? -8.235  13.414  -55.941 1.00 45.28  ? 103  THR B CB  1 
ATOM   5064 O OG1 . THR B 1 103 ? -9.139  12.866  -56.905 1.00 51.67  ? 103  THR B OG1 1 
ATOM   5065 C CG2 . THR B 1 103 ? -6.823  13.242  -56.427 1.00 46.42  ? 103  THR B CG2 1 
ATOM   5066 N N   . PRO B 1 104 ? -10.504 13.832  -53.911 1.00 46.63  ? 104  PRO B N   1 
ATOM   5067 C CA  . PRO B 1 104 ? -11.962 13.922  -53.821 1.00 45.63  ? 104  PRO B CA  1 
ATOM   5068 C C   . PRO B 1 104 ? -12.611 13.667  -55.175 1.00 45.38  ? 104  PRO B C   1 
ATOM   5069 O O   . PRO B 1 104 ? -11.982 13.862  -56.216 1.00 49.47  ? 104  PRO B O   1 
ATOM   5070 C CB  . PRO B 1 104 ? -12.190 15.377  -53.411 1.00 38.73  ? 104  PRO B CB  1 
ATOM   5071 C CG  . PRO B 1 104 ? -10.968 15.749  -52.685 1.00 47.43  ? 104  PRO B CG  1 
ATOM   5072 C CD  . PRO B 1 104 ? -9.850  15.036  -53.375 1.00 42.93  ? 104  PRO B CD  1 
ATOM   5073 N N   . TYR B 1 105 ? -13.861 13.224  -55.144 1.00 41.75  ? 105  TYR B N   1 
ATOM   5074 C CA  . TYR B 1 105 ? -14.664 13.055  -56.339 1.00 43.15  ? 105  TYR B CA  1 
ATOM   5075 C C   . TYR B 1 105 ? -15.906 13.935  -56.188 1.00 52.02  ? 105  TYR B C   1 
ATOM   5076 O O   . TYR B 1 105 ? -16.754 13.670  -55.331 1.00 51.95  ? 105  TYR B O   1 
ATOM   5077 C CB  . TYR B 1 105 ? -15.065 11.591  -56.495 1.00 43.55  ? 105  TYR B CB  1 
ATOM   5078 C CG  . TYR B 1 105 ? -15.821 11.272  -57.760 1.00 45.51  ? 105  TYR B CG  1 
ATOM   5079 C CD1 . TYR B 1 105 ? -17.182 11.525  -57.865 1.00 50.83  ? 105  TYR B CD1 1 
ATOM   5080 C CD2 . TYR B 1 105 ? -15.175 10.701  -58.846 1.00 58.24  ? 105  TYR B CD2 1 
ATOM   5081 C CE1 . TYR B 1 105 ? -17.874 11.228  -59.018 1.00 52.98  ? 105  TYR B CE1 1 
ATOM   5082 C CE2 . TYR B 1 105 ? -15.853 10.396  -60.003 1.00 51.21  ? 105  TYR B CE2 1 
ATOM   5083 C CZ  . TYR B 1 105 ? -17.203 10.661  -60.088 1.00 55.81  ? 105  TYR B CZ  1 
ATOM   5084 O OH  . TYR B 1 105 ? -17.881 10.357  -61.249 1.00 56.19  ? 105  TYR B OH  1 
ATOM   5085 N N   . PRO B 1 106 ? -16.043 14.965  -57.040 1.00 52.47  ? 106  PRO B N   1 
ATOM   5086 C CA  . PRO B 1 106 ? -15.176 15.235  -58.194 1.00 57.01  ? 106  PRO B CA  1 
ATOM   5087 C C   . PRO B 1 106 ? -13.824 15.825  -57.812 1.00 59.23  ? 106  PRO B C   1 
ATOM   5088 O O   . PRO B 1 106 ? -13.614 16.192  -56.658 1.00 59.65  ? 106  PRO B O   1 
ATOM   5089 C CB  . PRO B 1 106 ? -15.985 16.247  -59.010 1.00 54.91  ? 106  PRO B CB  1 
ATOM   5090 C CG  . PRO B 1 106 ? -16.843 16.934  -58.003 1.00 57.01  ? 106  PRO B CG  1 
ATOM   5091 C CD  . PRO B 1 106 ? -17.175 15.906  -56.962 1.00 56.95  ? 106  PRO B CD  1 
ATOM   5092 N N   A ARG B 1 107 ? -12.908 15.874  -58.776 0.56 60.93  ? 107  ARG B N   1 
ATOM   5093 N N   B ARG B 1 107 ? -12.930 15.906  -58.792 0.44 60.83  ? 107  ARG B N   1 
ATOM   5094 C CA  A ARG B 1 107 ? -11.587 16.448  -58.557 0.56 58.98  ? 107  ARG B CA  1 
ATOM   5095 C CA  B ARG B 1 107 ? -11.614 16.504  -58.616 0.44 58.73  ? 107  ARG B CA  1 
ATOM   5096 C C   A ARG B 1 107 ? -11.724 17.862  -58.014 0.56 59.27  ? 107  ARG B C   1 
ATOM   5097 C C   B ARG B 1 107 ? -11.752 17.891  -58.005 0.44 59.18  ? 107  ARG B C   1 
ATOM   5098 O O   A ARG B 1 107 ? -12.534 18.640  -58.516 0.56 61.81  ? 107  ARG B O   1 
ATOM   5099 O O   B ARG B 1 107 ? -12.590 18.676  -58.445 0.44 61.85  ? 107  ARG B O   1 
ATOM   5100 C CB  A ARG B 1 107 ? -10.788 16.467  -59.861 0.56 56.98  ? 107  ARG B CB  1 
ATOM   5101 C CB  B ARG B 1 107 ? -10.916 16.608  -59.972 0.44 56.83  ? 107  ARG B CB  1 
ATOM   5102 C CG  A ARG B 1 107 ? -9.747  15.369  -59.974 0.56 56.16  ? 107  ARG B CG  1 
ATOM   5103 C CG  B ARG B 1 107 ? -9.428  16.854  -59.884 0.44 55.48  ? 107  ARG B CG  1 
ATOM   5104 C CD  A ARG B 1 107 ? -8.933  15.526  -61.255 0.56 57.31  ? 107  ARG B CD  1 
ATOM   5105 C CD  B ARG B 1 107 ? -8.714  16.596  -61.207 0.44 57.29  ? 107  ARG B CD  1 
ATOM   5106 N NE  A ARG B 1 107 ? -9.544  14.831  -62.386 0.56 54.81  ? 107  ARG B NE  1 
ATOM   5107 N NE  B ARG B 1 107 ? -9.333  15.555  -62.035 0.44 57.68  ? 107  ARG B NE  1 
ATOM   5108 C CZ  A ARG B 1 107 ? -9.118  14.920  -63.641 0.56 48.42  ? 107  ARG B CZ  1 
ATOM   5109 C CZ  B ARG B 1 107 ? -9.430  14.264  -61.715 0.44 54.40  ? 107  ARG B CZ  1 
ATOM   5110 N NH1 A ARG B 1 107 ? -8.076  15.683  -63.941 0.56 48.88  ? 107  ARG B NH1 1 
ATOM   5111 N NH1 B ARG B 1 107 ? -8.976  13.806  -60.551 0.44 46.50  ? 107  ARG B NH1 1 
ATOM   5112 N NH2 A ARG B 1 107 ? -9.732  14.243  -64.598 0.56 46.10  ? 107  ARG B NH2 1 
ATOM   5113 N NH2 B ARG B 1 107 ? -10.008 13.426  -62.564 0.44 56.15  ? 107  ARG B NH2 1 
ATOM   5114 N N   . PRO B 1 108 ? -10.942 18.190  -56.976 1.00 55.43  ? 108  PRO B N   1 
ATOM   5115 C CA  . PRO B 1 108 ? -10.985 19.504  -56.323 1.00 58.36  ? 108  PRO B CA  1 
ATOM   5116 C C   . PRO B 1 108 ? -10.898 20.681  -57.303 1.00 63.82  ? 108  PRO B C   1 
ATOM   5117 O O   . PRO B 1 108 ? -10.050 20.692  -58.202 1.00 60.25  ? 108  PRO B O   1 
ATOM   5118 C CB  . PRO B 1 108 ? -9.772  19.478  -55.383 1.00 50.69  ? 108  PRO B CB  1 
ATOM   5119 C CG  . PRO B 1 108 ? -9.000  18.222  -55.730 1.00 49.02  ? 108  PRO B CG  1 
ATOM   5120 C CD  . PRO B 1 108 ? -9.981  17.283  -56.327 1.00 51.00  ? 108  PRO B CD  1 
ATOM   5121 N N   . ALA B 1 109 ? -11.798 21.646  -57.132 1.00 65.45  ? 109  ALA B N   1 
ATOM   5122 C CA  . ALA B 1 109 ? -11.859 22.816  -58.006 1.00 69.65  ? 109  ALA B CA  1 
ATOM   5123 C C   . ALA B 1 109 ? -10.724 23.793  -57.724 1.00 69.66  ? 109  ALA B C   1 
ATOM   5124 O O   . ALA B 1 109 ? -10.287 24.528  -58.609 1.00 73.53  ? 109  ALA B O   1 
ATOM   5125 C CB  . ALA B 1 109 ? -13.195 23.516  -57.856 1.00 69.30  ? 109  ALA B CB  1 
ATOM   5126 N N   . SER B 1 110 ? -10.268 23.810  -56.478 1.00 61.24  ? 110  SER B N   1 
ATOM   5127 C CA  . SER B 1 110 ? -9.131  24.625  -56.096 1.00 55.41  ? 110  SER B CA  1 
ATOM   5128 C C   . SER B 1 110 ? -7.949  23.705  -55.803 1.00 53.68  ? 110  SER B C   1 
ATOM   5129 O O   . SER B 1 110 ? -8.128  22.549  -55.430 1.00 49.25  ? 110  SER B O   1 
ATOM   5130 C CB  . SER B 1 110 ? -9.467  25.447  -54.857 1.00 52.30  ? 110  SER B CB  1 
ATOM   5131 O OG  . SER B 1 110 ? -10.718 26.091  -55.007 1.00 63.50  ? 110  SER B OG  1 
ATOM   5132 N N   . PRO B 1 111 ? -6.730  24.212  -55.988 1.00 49.65  ? 111  PRO B N   1 
ATOM   5133 C CA  . PRO B 1 111 ? -5.565  23.421  -55.590 1.00 45.58  ? 111  PRO B CA  1 
ATOM   5134 C C   . PRO B 1 111 ? -5.614  23.084  -54.096 1.00 44.49  ? 111  PRO B C   1 
ATOM   5135 O O   . PRO B 1 111 ? -5.851  23.952  -53.255 1.00 44.24  ? 111  PRO B O   1 
ATOM   5136 C CB  . PRO B 1 111 ? -4.390  24.344  -55.918 1.00 48.92  ? 111  PRO B CB  1 
ATOM   5137 C CG  . PRO B 1 111 ? -4.902  25.229  -57.011 1.00 48.22  ? 111  PRO B CG  1 
ATOM   5138 C CD  . PRO B 1 111 ? -6.358  25.447  -56.700 1.00 52.35  ? 111  PRO B CD  1 
ATOM   5139 N N   . THR B 1 112 ? -5.391  21.810  -53.792 1.00 42.83  ? 112  THR B N   1 
ATOM   5140 C CA  . THR B 1 112 ? -5.651  21.244  -52.477 1.00 43.12  ? 112  THR B CA  1 
ATOM   5141 C C   . THR B 1 112 ? -4.360  20.741  -51.840 1.00 40.72  ? 112  THR B C   1 
ATOM   5142 O O   . THR B 1 112 ? -3.516  20.189  -52.530 1.00 44.81  ? 112  THR B O   1 
ATOM   5143 C CB  . THR B 1 112 ? -6.618  20.064  -52.622 1.00 42.02  ? 112  THR B CB  1 
ATOM   5144 O OG1 . THR B 1 112 ? -7.857  20.536  -53.162 1.00 53.28  ? 112  THR B OG1 1 
ATOM   5145 C CG2 . THR B 1 112 ? -6.879  19.435  -51.297 1.00 42.46  ? 112  THR B CG2 1 
ATOM   5146 N N   . PRO B 1 113 ? -4.196  20.945  -50.522 1.00 38.80  ? 113  PRO B N   1 
ATOM   5147 C CA  . PRO B 1 113 ? -3.007  20.440  -49.821 1.00 33.31  ? 113  PRO B CA  1 
ATOM   5148 C C   . PRO B 1 113 ? -2.771  18.959  -50.063 1.00 33.98  ? 113  PRO B C   1 
ATOM   5149 O O   . PRO B 1 113 ? -3.710  18.161  -50.068 1.00 38.48  ? 113  PRO B O   1 
ATOM   5150 C CB  . PRO B 1 113 ? -3.338  20.691  -48.356 1.00 30.33  ? 113  PRO B CB  1 
ATOM   5151 C CG  . PRO B 1 113 ? -4.190  21.923  -48.409 1.00 39.57  ? 113  PRO B CG  1 
ATOM   5152 C CD  . PRO B 1 113 ? -5.002  21.839  -49.670 1.00 36.56  ? 113  PRO B CD  1 
ATOM   5153 N N   . VAL B 1 114 ? -1.513  18.604  -50.285 1.00 30.21  ? 114  VAL B N   1 
ATOM   5154 C CA  . VAL B 1 114 ? -1.149  17.230  -50.561 1.00 26.60  ? 114  VAL B CA  1 
ATOM   5155 C C   . VAL B 1 114 ? -0.500  16.641  -49.339 1.00 30.62  ? 114  VAL B C   1 
ATOM   5156 O O   . VAL B 1 114 ? 0.411   17.242  -48.776 1.00 28.26  ? 114  VAL B O   1 
ATOM   5157 C CB  . VAL B 1 114 ? -0.113  17.140  -51.707 1.00 30.83  ? 114  VAL B CB  1 
ATOM   5158 C CG1 . VAL B 1 114 ? 0.214   15.675  -52.011 1.00 26.47  ? 114  VAL B CG1 1 
ATOM   5159 C CG2 . VAL B 1 114 ? -0.609  17.874  -52.958 1.00 27.50  ? 114  VAL B CG2 1 
ATOM   5160 N N   . LEU B 1 115 ? -0.963  15.466  -48.926 1.00 34.55  ? 115  LEU B N   1 
ATOM   5161 C CA  . LEU B 1 115 ? -0.237  14.678  -47.947 1.00 28.10  ? 115  LEU B CA  1 
ATOM   5162 C C   . LEU B 1 115 ? 0.424   13.498  -48.625 1.00 35.14  ? 115  LEU B C   1 
ATOM   5163 O O   . LEU B 1 115 ? -0.191  12.812  -49.448 1.00 41.31  ? 115  LEU B O   1 
ATOM   5164 C CB  . LEU B 1 115 ? -1.155  14.167  -46.849 1.00 26.48  ? 115  LEU B CB  1 
ATOM   5165 C CG  . LEU B 1 115 ? -1.593  15.196  -45.811 1.00 35.55  ? 115  LEU B CG  1 
ATOM   5166 C CD1 . LEU B 1 115 ? -3.072  15.463  -45.946 1.00 37.64  ? 115  LEU B CD1 1 
ATOM   5167 C CD2 . LEU B 1 115 ? -1.281  14.683  -44.440 1.00 35.99  ? 115  LEU B CD2 1 
ATOM   5168 N N   . ILE B 1 116 ? 1.679   13.256  -48.268 1.00 27.59  ? 116  ILE B N   1 
ATOM   5169 C CA  . ILE B 1 116 ? 2.420   12.138  -48.825 1.00 28.42  ? 116  ILE B CA  1 
ATOM   5170 C C   . ILE B 1 116 ? 2.888   11.186  -47.739 1.00 32.48  ? 116  ILE B C   1 
ATOM   5171 O O   . ILE B 1 116 ? 3.733   11.538  -46.905 1.00 26.36  ? 116  ILE B O   1 
ATOM   5172 C CB  . ILE B 1 116 ? 3.645   12.612  -49.595 1.00 30.67  ? 116  ILE B CB  1 
ATOM   5173 C CG1 . ILE B 1 116 ? 3.220   13.610  -50.671 1.00 36.35  ? 116  ILE B CG1 1 
ATOM   5174 C CG2 . ILE B 1 116 ? 4.353   11.422  -50.203 1.00 21.82  ? 116  ILE B CG2 1 
ATOM   5175 C CD1 . ILE B 1 116 ? 4.316   14.061  -51.569 1.00 22.94  ? 116  ILE B CD1 1 
ATOM   5176 N N   . TRP B 1 117 ? 2.340   9.978   -47.767 1.00 23.77  ? 117  TRP B N   1 
ATOM   5177 C CA  . TRP B 1 117 ? 2.631   8.965   -46.773 1.00 22.79  ? 117  TRP B CA  1 
ATOM   5178 C C   . TRP B 1 117 ? 3.843   8.126   -47.143 1.00 26.06  ? 117  TRP B C   1 
ATOM   5179 O O   . TRP B 1 117 ? 3.928   7.615   -48.258 1.00 28.73  ? 117  TRP B O   1 
ATOM   5180 C CB  . TRP B 1 117 ? 1.433   8.042   -46.630 1.00 22.29  ? 117  TRP B CB  1 
ATOM   5181 C CG  . TRP B 1 117 ? 1.696   6.912   -45.721 1.00 31.67  ? 117  TRP B CG  1 
ATOM   5182 C CD1 . TRP B 1 117 ? 1.890   5.603   -46.060 1.00 32.63  ? 117  TRP B CD1 1 
ATOM   5183 C CD2 . TRP B 1 117 ? 1.811   6.983   -44.301 1.00 34.08  ? 117  TRP B CD2 1 
ATOM   5184 N NE1 . TRP B 1 117 ? 2.108   4.849   -44.928 1.00 34.34  ? 117  TRP B NE1 1 
ATOM   5185 C CE2 . TRP B 1 117 ? 2.067   5.675   -43.835 1.00 32.29  ? 117  TRP B CE2 1 
ATOM   5186 C CE3 . TRP B 1 117 ? 1.709   8.026   -43.373 1.00 35.41  ? 117  TRP B CE3 1 
ATOM   5187 C CZ2 . TRP B 1 117 ? 2.218   5.383   -42.484 1.00 23.01  ? 117  TRP B CZ2 1 
ATOM   5188 C CZ3 . TRP B 1 117 ? 1.861   7.730   -42.026 1.00 30.47  ? 117  TRP B CZ3 1 
ATOM   5189 C CH2 . TRP B 1 117 ? 2.117   6.421   -41.598 1.00 22.89  ? 117  TRP B CH2 1 
ATOM   5190 N N   . ILE B 1 118 ? 4.767   7.974   -46.198 1.00 24.52  ? 118  ILE B N   1 
ATOM   5191 C CA  . ILE B 1 118 ? 5.889   7.039   -46.342 1.00 26.42  ? 118  ILE B CA  1 
ATOM   5192 C C   . ILE B 1 118 ? 5.803   5.932   -45.276 1.00 31.56  ? 118  ILE B C   1 
ATOM   5193 O O   . ILE B 1 118 ? 6.053   6.174   -44.091 1.00 34.45  ? 118  ILE B O   1 
ATOM   5194 C CB  . ILE B 1 118 ? 7.248   7.758   -46.209 1.00 27.17  ? 118  ILE B CB  1 
ATOM   5195 C CG1 . ILE B 1 118 ? 7.284   9.005   -47.098 1.00 27.98  ? 118  ILE B CG1 1 
ATOM   5196 C CG2 . ILE B 1 118 ? 8.385   6.809   -46.559 1.00 23.69  ? 118  ILE B CG2 1 
ATOM   5197 C CD1 . ILE B 1 118 ? 8.575   9.788   -47.003 1.00 21.70  ? 118  ILE B CD1 1 
ATOM   5198 N N   . TYR B 1 119 ? 5.441   4.722   -45.687 1.00 26.63  ? 119  TYR B N   1 
ATOM   5199 C CA  . TYR B 1 119 ? 5.332   3.611   -44.738 1.00 27.17  ? 119  TYR B CA  1 
ATOM   5200 C C   . TYR B 1 119 ? 6.626   3.292   -44.006 1.00 27.21  ? 119  TYR B C   1 
ATOM   5201 O O   . TYR B 1 119 ? 7.723   3.584   -44.485 1.00 26.72  ? 119  TYR B O   1 
ATOM   5202 C CB  . TYR B 1 119 ? 4.813   2.324   -45.415 1.00 27.03  ? 119  TYR B CB  1 
ATOM   5203 C CG  . TYR B 1 119 ? 5.652   1.783   -46.560 1.00 30.16  ? 119  TYR B CG  1 
ATOM   5204 C CD1 . TYR B 1 119 ? 6.854   1.102   -46.330 1.00 26.81  ? 119  TYR B CD1 1 
ATOM   5205 C CD2 . TYR B 1 119 ? 5.224   1.924   -47.876 1.00 28.62  ? 119  TYR B CD2 1 
ATOM   5206 C CE1 . TYR B 1 119 ? 7.607   0.587   -47.397 1.00 30.58  ? 119  TYR B CE1 1 
ATOM   5207 C CE2 . TYR B 1 119 ? 5.964   1.409   -48.942 1.00 27.10  ? 119  TYR B CE2 1 
ATOM   5208 C CZ  . TYR B 1 119 ? 7.152   0.749   -48.701 1.00 31.68  ? 119  TYR B CZ  1 
ATOM   5209 O OH  . TYR B 1 119 ? 7.870   0.261   -49.776 1.00 34.24  ? 119  TYR B OH  1 
ATOM   5210 N N   . GLY B 1 120 ? 6.477   2.666   -42.846 1.00 30.49  ? 120  GLY B N   1 
ATOM   5211 C CA  . GLY B 1 120 ? 7.606   2.096   -42.133 1.00 34.04  ? 120  GLY B CA  1 
ATOM   5212 C C   . GLY B 1 120 ? 7.661   0.592   -42.334 1.00 32.56  ? 120  GLY B C   1 
ATOM   5213 O O   . GLY B 1 120 ? 7.052   0.060   -43.275 1.00 31.00  ? 120  GLY B O   1 
ATOM   5214 N N   . GLY B 1 121 ? 8.385   -0.092  -41.451 1.00 32.21  ? 121  GLY B N   1 
ATOM   5215 C CA  . GLY B 1 121 ? 8.708   -1.501  -41.627 1.00 32.58  ? 121  GLY B CA  1 
ATOM   5216 C C   . GLY B 1 121 ? 10.198  -1.789  -41.469 1.00 34.65  ? 121  GLY B C   1 
ATOM   5217 O O   . GLY B 1 121 ? 10.721  -2.749  -42.045 1.00 34.59  ? 121  GLY B O   1 
ATOM   5218 N N   . GLY B 1 122 ? 10.881  -0.942  -40.695 1.00 37.67  ? 122  GLY B N   1 
ATOM   5219 C CA  . GLY B 1 122 ? 12.290  -1.124  -40.358 1.00 33.68  ? 122  GLY B CA  1 
ATOM   5220 C C   . GLY B 1 122 ? 13.262  -1.042  -41.525 1.00 34.66  ? 122  GLY B C   1 
ATOM   5221 O O   . GLY B 1 122 ? 14.392  -1.495  -41.409 1.00 34.24  ? 122  GLY B O   1 
ATOM   5222 N N   . PHE B 1 123 ? 12.822  -0.459  -42.641 1.00 32.37  ? 123  PHE B N   1 
ATOM   5223 C CA  . PHE B 1 123 ? 13.607  -0.426  -43.874 1.00 35.13  ? 123  PHE B CA  1 
ATOM   5224 C C   . PHE B 1 123 ? 13.811  -1.808  -44.488 1.00 34.36  ? 123  PHE B C   1 
ATOM   5225 O O   . PHE B 1 123 ? 14.586  -1.928  -45.423 1.00 37.25  ? 123  PHE B O   1 
ATOM   5226 C CB  . PHE B 1 123 ? 14.980  0.266   -43.695 1.00 32.39  ? 123  PHE B CB  1 
ATOM   5227 C CG  . PHE B 1 123 ? 14.889  1.732   -43.338 1.00 30.07  ? 123  PHE B CG  1 
ATOM   5228 C CD1 . PHE B 1 123 ? 14.420  2.660   -44.262 1.00 31.39  ? 123  PHE B CD1 1 
ATOM   5229 C CD2 . PHE B 1 123 ? 15.275  2.181   -42.078 1.00 26.34  ? 123  PHE B CD2 1 
ATOM   5230 C CE1 . PHE B 1 123 ? 14.303  4.005   -43.939 1.00 24.45  ? 123  PHE B CE1 1 
ATOM   5231 C CE2 . PHE B 1 123 ? 15.172  3.523   -41.747 1.00 25.59  ? 123  PHE B CE2 1 
ATOM   5232 C CZ  . PHE B 1 123 ? 14.684  4.438   -42.686 1.00 29.72  ? 123  PHE B CZ  1 
ATOM   5233 N N   . TYR B 1 124 ? 13.130  -2.842  -43.980 1.00 33.65  ? 124  TYR B N   1 
ATOM   5234 C CA  . TYR B 1 124 ? 13.241  -4.193  -44.567 1.00 34.83  ? 124  TYR B CA  1 
ATOM   5235 C C   . TYR B 1 124 ? 11.918  -4.743  -45.128 1.00 35.60  ? 124  TYR B C   1 
ATOM   5236 O O   . TYR B 1 124 ? 11.887  -5.830  -45.701 1.00 37.01  ? 124  TYR B O   1 
ATOM   5237 C CB  . TYR B 1 124 ? 13.843  -5.202  -43.580 1.00 36.03  ? 124  TYR B CB  1 
ATOM   5238 C CG  . TYR B 1 124 ? 12.921  -5.606  -42.441 1.00 40.68  ? 124  TYR B CG  1 
ATOM   5239 C CD1 . TYR B 1 124 ? 12.009  -6.646  -42.590 1.00 36.21  ? 124  TYR B CD1 1 
ATOM   5240 C CD2 . TYR B 1 124 ? 12.976  -4.956  -41.207 1.00 40.58  ? 124  TYR B CD2 1 
ATOM   5241 C CE1 . TYR B 1 124 ? 11.163  -7.019  -41.554 1.00 36.26  ? 124  TYR B CE1 1 
ATOM   5242 C CE2 . TYR B 1 124 ? 12.138  -5.327  -40.158 1.00 40.09  ? 124  TYR B CE2 1 
ATOM   5243 C CZ  . TYR B 1 124 ? 11.234  -6.359  -40.337 1.00 40.86  ? 124  TYR B CZ  1 
ATOM   5244 O OH  . TYR B 1 124 ? 10.400  -6.732  -39.302 1.00 41.24  ? 124  TYR B OH  1 
ATOM   5245 N N   . SER B 1 125 ? 10.840  -3.983  -44.966 1.00 33.88  ? 125  SER B N   1 
ATOM   5246 C CA  . SER B 1 125 ? 9.501   -4.460  -45.276 1.00 31.70  ? 125  SER B CA  1 
ATOM   5247 C C   . SER B 1 125 ? 8.562   -3.277  -45.387 1.00 33.45  ? 125  SER B C   1 
ATOM   5248 O O   . SER B 1 125 ? 8.954   -2.143  -45.121 1.00 29.54  ? 125  SER B O   1 
ATOM   5249 C CB  . SER B 1 125 ? 8.998   -5.382  -44.165 1.00 30.86  ? 125  SER B CB  1 
ATOM   5250 O OG  . SER B 1 125 ? 8.881   -4.672  -42.934 1.00 35.30  ? 125  SER B OG  1 
ATOM   5251 N N   . GLY B 1 126 ? 7.313   -3.547  -45.753 1.00 36.26  ? 126  GLY B N   1 
ATOM   5252 C CA  . GLY B 1 126 ? 6.323   -2.502  -45.892 1.00 26.80  ? 126  GLY B CA  1 
ATOM   5253 C C   . GLY B 1 126 ? 5.792   -2.385  -47.309 1.00 34.59  ? 126  GLY B C   1 
ATOM   5254 O O   . GLY B 1 126 ? 6.421   -2.873  -48.250 1.00 30.27  ? 126  GLY B O   1 
ATOM   5255 N N   . ALA B 1 127 ? 4.628   -1.741  -47.447 1.00 31.90  ? 127  ALA B N   1 
ATOM   5256 C CA  . ALA B 1 127 ? 3.971   -1.526  -48.736 1.00 32.51  ? 127  ALA B CA  1 
ATOM   5257 C C   . ALA B 1 127 ? 2.934   -0.422  -48.588 1.00 30.99  ? 127  ALA B C   1 
ATOM   5258 O O   . ALA B 1 127 ? 2.349   -0.265  -47.533 1.00 31.60  ? 127  ALA B O   1 
ATOM   5259 C CB  . ALA B 1 127 ? 3.306   -2.799  -49.226 1.00 27.61  ? 127  ALA B CB  1 
ATOM   5260 N N   . ALA B 1 128 ? 2.702   0.333   -49.655 1.00 34.57  ? 128  ALA B N   1 
ATOM   5261 C CA  . ALA B 1 128 ? 1.741   1.426   -49.612 1.00 32.75  ? 128  ALA B CA  1 
ATOM   5262 C C   . ALA B 1 128 ? 0.320   0.927   -49.830 1.00 32.46  ? 128  ALA B C   1 
ATOM   5263 O O   . ALA B 1 128 ? -0.612  1.713   -49.803 1.00 28.55  ? 128  ALA B O   1 
ATOM   5264 C CB  . ALA B 1 128 ? 2.098   2.508   -50.631 1.00 24.20  ? 128  ALA B CB  1 
ATOM   5265 N N   . SER B 1 129 ? 0.169   -0.384  -50.019 1.00 36.51  ? 129  SER B N   1 
ATOM   5266 C CA  . SER B 1 129 ? -1.126  -0.998  -50.322 1.00 31.71  ? 129  SER B CA  1 
ATOM   5267 C C   . SER B 1 129 ? -1.844  -1.608  -49.114 1.00 32.27  ? 129  SER B C   1 
ATOM   5268 O O   . SER B 1 129 ? -2.954  -2.125  -49.241 1.00 30.61  ? 129  SER B O   1 
ATOM   5269 C CB  . SER B 1 129 ? -0.955  -2.081  -51.399 1.00 33.90  ? 129  SER B CB  1 
ATOM   5270 O OG  . SER B 1 129 ? 0.136   -2.930  -51.096 1.00 31.76  ? 129  SER B OG  1 
ATOM   5271 N N   . LEU B 1 130 ? -1.215  -1.569  -47.946 1.00 30.33  ? 130  LEU B N   1 
ATOM   5272 C CA  . LEU B 1 130 ? -1.850  -2.129  -46.763 1.00 36.05  ? 130  LEU B CA  1 
ATOM   5273 C C   . LEU B 1 130 ? -3.155  -1.389  -46.466 1.00 40.67  ? 130  LEU B C   1 
ATOM   5274 O O   . LEU B 1 130 ? -3.283  -0.186  -46.764 1.00 35.04  ? 130  LEU B O   1 
ATOM   5275 C CB  . LEU B 1 130 ? -0.912  -2.044  -45.564 1.00 37.24  ? 130  LEU B CB  1 
ATOM   5276 C CG  . LEU B 1 130 ? 0.498   -2.606  -45.768 1.00 34.49  ? 130  LEU B CG  1 
ATOM   5277 C CD1 . LEU B 1 130 ? 1.279   -2.550  -44.458 1.00 28.51  ? 130  LEU B CD1 1 
ATOM   5278 C CD2 . LEU B 1 130 ? 0.424   -4.026  -46.284 1.00 33.14  ? 130  LEU B CD2 1 
ATOM   5279 N N   . ASP B 1 131 ? -4.123  -2.108  -45.895 1.00 39.38  ? 131  ASP B N   1 
ATOM   5280 C CA  . ASP B 1 131 ? -5.399  -1.501  -45.524 1.00 44.74  ? 131  ASP B CA  1 
ATOM   5281 C C   . ASP B 1 131 ? -5.253  -0.288  -44.573 1.00 44.80  ? 131  ASP B C   1 
ATOM   5282 O O   . ASP B 1 131 ? -5.993  0.685   -44.703 1.00 47.49  ? 131  ASP B O   1 
ATOM   5283 C CB  . ASP B 1 131 ? -6.367  -2.533  -44.923 1.00 46.62  ? 131  ASP B CB  1 
ATOM   5284 C CG  . ASP B 1 131 ? -6.678  -3.698  -45.876 1.00 53.62  ? 131  ASP B CG  1 
ATOM   5285 O OD1 . ASP B 1 131 ? -6.493  -3.563  -47.111 1.00 50.66  ? 131  ASP B OD1 1 
ATOM   5286 O OD2 . ASP B 1 131 ? -7.122  -4.760  -45.373 1.00 52.12  ? 131  ASP B OD2 1 
ATOM   5287 N N   . VAL B 1 132 ? -4.308  -0.325  -43.634 1.00 38.30  ? 132  VAL B N   1 
ATOM   5288 C CA  . VAL B 1 132 ? -4.169  0.798   -42.693 1.00 41.35  ? 132  VAL B CA  1 
ATOM   5289 C C   . VAL B 1 132 ? -3.615  2.077   -43.315 1.00 40.12  ? 132  VAL B C   1 
ATOM   5290 O O   . VAL B 1 132 ? -3.513  3.097   -42.636 1.00 43.64  ? 132  VAL B O   1 
ATOM   5291 C CB  . VAL B 1 132 ? -3.325  0.453   -41.448 1.00 34.47  ? 132  VAL B CB  1 
ATOM   5292 C CG1 . VAL B 1 132 ? -4.083  -0.489  -40.558 1.00 34.63  ? 132  VAL B CG1 1 
ATOM   5293 C CG2 . VAL B 1 132 ? -1.986  -0.139  -41.855 1.00 35.82  ? 132  VAL B CG2 1 
ATOM   5294 N N   . TYR B 1 133 ? -3.259  2.016   -44.598 1.00 33.85  ? 133  TYR B N   1 
ATOM   5295 C CA  . TYR B 1 133 ? -2.750  3.186   -45.318 1.00 28.56  ? 133  TYR B CA  1 
ATOM   5296 C C   . TYR B 1 133 ? -3.724  3.667   -46.390 1.00 32.96  ? 133  TYR B C   1 
ATOM   5297 O O   . TYR B 1 133 ? -3.361  4.457   -47.250 1.00 37.92  ? 133  TYR B O   1 
ATOM   5298 C CB  . TYR B 1 133 ? -1.423  2.858   -45.989 1.00 26.52  ? 133  TYR B CB  1 
ATOM   5299 C CG  . TYR B 1 133 ? -0.368  2.314   -45.055 1.00 25.46  ? 133  TYR B CG  1 
ATOM   5300 C CD1 . TYR B 1 133 ? -0.379  2.614   -43.692 1.00 26.06  ? 133  TYR B CD1 1 
ATOM   5301 C CD2 . TYR B 1 133 ? 0.638   1.492   -45.539 1.00 26.73  ? 133  TYR B CD2 1 
ATOM   5302 C CE1 . TYR B 1 133 ? 0.593   2.112   -42.845 1.00 29.23  ? 133  TYR B CE1 1 
ATOM   5303 C CE2 . TYR B 1 133 ? 1.608   0.989   -44.713 1.00 31.60  ? 133  TYR B CE2 1 
ATOM   5304 C CZ  . TYR B 1 133 ? 1.595   1.303   -43.373 1.00 33.01  ? 133  TYR B CZ  1 
ATOM   5305 O OH  . TYR B 1 133 ? 2.581   0.784   -42.580 1.00 28.16  ? 133  TYR B OH  1 
ATOM   5306 N N   . ASP B 1 134 ? -4.953  3.166   -46.337 1.00 32.11  ? 134  ASP B N   1 
ATOM   5307 C CA  . ASP B 1 134 ? -6.016  3.534   -47.264 1.00 35.54  ? 134  ASP B CA  1 
ATOM   5308 C C   . ASP B 1 134 ? -6.331  5.038   -47.189 1.00 39.72  ? 134  ASP B C   1 
ATOM   5309 O O   . ASP B 1 134 ? -6.803  5.544   -46.162 1.00 36.70  ? 134  ASP B O   1 
ATOM   5310 C CB  . ASP B 1 134 ? -7.255  2.692   -46.937 1.00 31.39  ? 134  ASP B CB  1 
ATOM   5311 C CG  . ASP B 1 134 ? -8.364  2.838   -47.955 1.00 39.46  ? 134  ASP B CG  1 
ATOM   5312 O OD1 . ASP B 1 134 ? -8.379  3.839   -48.696 1.00 40.74  ? 134  ASP B OD1 1 
ATOM   5313 O OD2 . ASP B 1 134 ? -9.241  1.945   -48.005 1.00 34.36  ? 134  ASP B OD2 1 
ATOM   5314 N N   . GLY B 1 135 ? -6.088  5.736   -48.296 1.00 34.81  ? 135  GLY B N   1 
ATOM   5315 C CA  . GLY B 1 135 ? -6.300  7.174   -48.370 1.00 32.08  ? 135  GLY B CA  1 
ATOM   5316 C C   . GLY B 1 135 ? -7.727  7.675   -48.589 1.00 36.29  ? 135  GLY B C   1 
ATOM   5317 O O   . GLY B 1 135 ? -7.965  8.876   -48.535 1.00 35.82  ? 135  GLY B O   1 
ATOM   5318 N N   . ARG B 1 136 ? -8.687  6.790   -48.823 1.00 31.57  ? 136  ARG B N   1 
ATOM   5319 C CA  . ARG B 1 136 ? -9.996  7.284   -49.222 1.00 41.20  ? 136  ARG B CA  1 
ATOM   5320 C C   . ARG B 1 136 ? -10.669 8.120   -48.122 1.00 47.03  ? 136  ARG B C   1 
ATOM   5321 O O   . ARG B 1 136 ? -11.457 9.014   -48.421 1.00 45.60  ? 136  ARG B O   1 
ATOM   5322 C CB  . ARG B 1 136 ? -10.912 6.161   -49.728 1.00 34.93  ? 136  ARG B CB  1 
ATOM   5323 C CG  . ARG B 1 136 ? -11.645 5.420   -48.647 1.00 46.12  ? 136  ARG B CG  1 
ATOM   5324 C CD  . ARG B 1 136 ? -11.409 3.944   -48.751 1.00 46.18  ? 136  ARG B CD  1 
ATOM   5325 N NE  . ARG B 1 136 ? -12.464 3.262   -49.475 1.00 53.86  ? 136  ARG B NE  1 
ATOM   5326 C CZ  . ARG B 1 136 ? -12.272 2.245   -50.311 1.00 54.68  ? 136  ARG B CZ  1 
ATOM   5327 N NH1 . ARG B 1 136 ? -11.053 1.777   -50.550 1.00 54.36  ? 136  ARG B NH1 1 
ATOM   5328 N NH2 . ARG B 1 136 ? -13.312 1.700   -50.916 1.00 54.39  ? 136  ARG B NH2 1 
ATOM   5329 N N   . PHE B 1 137 ? -10.340 7.864   -46.859 1.00 33.56  ? 137  PHE B N   1 
ATOM   5330 C CA  . PHE B 1 137 ? -11.027 8.570   -45.783 1.00 36.92  ? 137  PHE B CA  1 
ATOM   5331 C C   . PHE B 1 137 ? -10.592 10.029  -45.695 1.00 37.51  ? 137  PHE B C   1 
ATOM   5332 O O   . PHE B 1 137 ? -11.438 10.931  -45.624 1.00 39.05  ? 137  PHE B O   1 
ATOM   5333 C CB  . PHE B 1 137 ? -10.872 7.832   -44.445 1.00 37.11  ? 137  PHE B CB  1 
ATOM   5334 C CG  . PHE B 1 137 ? -11.327 6.414   -44.508 1.00 41.28  ? 137  PHE B CG  1 
ATOM   5335 C CD1 . PHE B 1 137 ? -12.683 6.117   -44.620 1.00 37.79  ? 137  PHE B CD1 1 
ATOM   5336 C CD2 . PHE B 1 137 ? -10.409 5.374   -44.516 1.00 34.52  ? 137  PHE B CD2 1 
ATOM   5337 C CE1 . PHE B 1 137 ? -13.114 4.805   -44.719 1.00 38.99  ? 137  PHE B CE1 1 
ATOM   5338 C CE2 . PHE B 1 137 ? -10.835 4.052   -44.614 1.00 35.72  ? 137  PHE B CE2 1 
ATOM   5339 C CZ  . PHE B 1 137 ? -12.187 3.768   -44.715 1.00 37.95  ? 137  PHE B CZ  1 
ATOM   5340 N N   . LEU B 1 138 ? -9.279  10.255  -45.724 1.00 34.81  ? 138  LEU B N   1 
ATOM   5341 C CA  . LEU B 1 138 ? -8.729  11.608  -45.692 1.00 33.36  ? 138  LEU B CA  1 
ATOM   5342 C C   . LEU B 1 138 ? -9.129  12.395  -46.933 1.00 38.75  ? 138  LEU B C   1 
ATOM   5343 O O   . LEU B 1 138 ? -9.389  13.586  -46.853 1.00 39.77  ? 138  LEU B O   1 
ATOM   5344 C CB  . LEU B 1 138 ? -7.210  11.568  -45.530 1.00 34.09  ? 138  LEU B CB  1 
ATOM   5345 C CG  . LEU B 1 138 ? -6.753  11.159  -44.129 1.00 28.91  ? 138  LEU B CG  1 
ATOM   5346 C CD1 . LEU B 1 138 ? -5.358  10.605  -44.175 1.00 30.52  ? 138  LEU B CD1 1 
ATOM   5347 C CD2 . LEU B 1 138 ? -6.824  12.351  -43.213 1.00 29.25  ? 138  LEU B CD2 1 
ATOM   5348 N N   . ALA B 1 139 ? -9.205  11.714  -48.072 1.00 32.01  ? 139  ALA B N   1 
ATOM   5349 C CA  . ALA B 1 139 ? -9.656  12.339  -49.309 1.00 37.13  ? 139  ALA B CA  1 
ATOM   5350 C C   . ALA B 1 139 ? -11.133 12.727  -49.241 1.00 40.94  ? 139  ALA B C   1 
ATOM   5351 O O   . ALA B 1 139 ? -11.516 13.831  -49.622 1.00 44.87  ? 139  ALA B O   1 
ATOM   5352 C CB  . ALA B 1 139 ? -9.400  11.418  -50.502 1.00 32.57  ? 139  ALA B CB  1 
ATOM   5353 N N   . GLN B 1 140 ? -11.967 11.820  -48.756 1.00 36.11  ? 140  GLN B N   1 
ATOM   5354 C CA  . GLN B 1 140 ? -13.399 12.074  -48.748 1.00 38.49  ? 140  GLN B CA  1 
ATOM   5355 C C   . GLN B 1 140 ? -13.822 13.096  -47.703 1.00 44.64  ? 140  GLN B C   1 
ATOM   5356 O O   . GLN B 1 140 ? -14.486 14.072  -48.022 1.00 48.65  ? 140  GLN B O   1 
ATOM   5357 C CB  . GLN B 1 140 ? -14.171 10.782  -48.542 1.00 39.63  ? 140  GLN B CB  1 
ATOM   5358 C CG  . GLN B 1 140 ? -15.573 10.827  -49.141 1.00 44.30  ? 140  GLN B CG  1 
ATOM   5359 C CD  . GLN B 1 140 ? -16.587 11.505  -48.242 1.00 46.89  ? 140  GLN B CD  1 
ATOM   5360 O OE1 . GLN B 1 140 ? -16.601 11.300  -47.022 1.00 49.24  ? 140  GLN B OE1 1 
ATOM   5361 N NE2 . GLN B 1 140 ? -17.449 12.314  -48.842 1.00 50.79  ? 140  GLN B NE2 1 
ATOM   5362 N N   . VAL B 1 141 ? -13.431 12.869  -46.456 1.00 46.80  ? 141  VAL B N   1 
ATOM   5363 C CA  . VAL B 1 141 ? -13.889 13.699  -45.347 1.00 43.91  ? 141  VAL B CA  1 
ATOM   5364 C C   . VAL B 1 141 ? -13.218 15.063  -45.314 1.00 41.08  ? 141  VAL B C   1 
ATOM   5365 O O   . VAL B 1 141 ? -13.875 16.079  -45.109 1.00 45.14  ? 141  VAL B O   1 
ATOM   5366 C CB  . VAL B 1 141 ? -13.673 12.983  -44.005 1.00 51.68  ? 141  VAL B CB  1 
ATOM   5367 C CG1 . VAL B 1 141 ? -14.041 13.897  -42.821 1.00 40.14  ? 141  VAL B CG1 1 
ATOM   5368 C CG2 . VAL B 1 141 ? -14.471 11.688  -43.993 1.00 40.33  ? 141  VAL B CG2 1 
ATOM   5369 N N   . GLU B 1 142 ? -11.912 15.081  -45.543 1.00 41.41  ? 142  GLU B N   1 
ATOM   5370 C CA  . GLU B 1 142 ? -11.136 16.308  -45.421 1.00 38.17  ? 142  GLU B CA  1 
ATOM   5371 C C   . GLU B 1 142 ? -10.788 16.960  -46.758 1.00 41.57  ? 142  GLU B C   1 
ATOM   5372 O O   . GLU B 1 142 ? -10.106 17.982  -46.793 1.00 43.45  ? 142  GLU B O   1 
ATOM   5373 C CB  . GLU B 1 142 ? -9.862  16.029  -44.627 1.00 38.25  ? 142  GLU B CB  1 
ATOM   5374 C CG  . GLU B 1 142 ? -10.148 15.715  -43.178 1.00 45.75  ? 142  GLU B CG  1 
ATOM   5375 C CD  . GLU B 1 142 ? -10.766 16.900  -42.461 1.00 55.21  ? 142  GLU B CD  1 
ATOM   5376 O OE1 . GLU B 1 142 ? -10.509 18.049  -42.892 1.00 56.35  ? 142  GLU B OE1 1 
ATOM   5377 O OE2 . GLU B 1 142 ? -11.510 16.685  -41.476 1.00 60.79  ? 142  GLU B OE2 1 
ATOM   5378 N N   . GLY B 1 143 ? -11.249 16.367  -47.854 1.00 36.46  ? 143  GLY B N   1 
ATOM   5379 C CA  . GLY B 1 143 ? -10.906 16.860  -49.170 1.00 36.41  ? 143  GLY B CA  1 
ATOM   5380 C C   . GLY B 1 143 ? -9.415  16.887  -49.502 1.00 44.08  ? 143  GLY B C   1 
ATOM   5381 O O   . GLY B 1 143 ? -9.008  17.643  -50.364 1.00 47.29  ? 143  GLY B O   1 
ATOM   5382 N N   . ALA B 1 144 ? -8.600  16.072  -48.837 1.00 39.32  ? 144  ALA B N   1 
ATOM   5383 C CA  . ALA B 1 144 ? -7.157  16.054  -49.108 1.00 40.48  ? 144  ALA B CA  1 
ATOM   5384 C C   . ALA B 1 144 ? -6.809  15.311  -50.387 1.00 34.69  ? 144  ALA B C   1 
ATOM   5385 O O   . ALA B 1 144 ? -7.507  14.388  -50.786 1.00 36.41  ? 144  ALA B O   1 
ATOM   5386 C CB  . ALA B 1 144 ? -6.389  15.422  -47.930 1.00 29.68  ? 144  ALA B CB  1 
ATOM   5387 N N   . VAL B 1 145 ? -5.722  15.706  -51.030 1.00 32.30  ? 145  VAL B N   1 
ATOM   5388 C CA  . VAL B 1 145 ? -5.107  14.815  -51.997 1.00 28.95  ? 145  VAL B CA  1 
ATOM   5389 C C   . VAL B 1 145 ? -4.041  14.005  -51.280 1.00 34.18  ? 145  VAL B C   1 
ATOM   5390 O O   . VAL B 1 145 ? -3.170  14.556  -50.603 1.00 38.48  ? 145  VAL B O   1 
ATOM   5391 C CB  . VAL B 1 145 ? -4.490  15.553  -53.164 1.00 29.29  ? 145  VAL B CB  1 
ATOM   5392 C CG1 . VAL B 1 145 ? -3.771  14.558  -54.084 1.00 28.36  ? 145  VAL B CG1 1 
ATOM   5393 C CG2 . VAL B 1 145 ? -5.572  16.303  -53.922 1.00 31.52  ? 145  VAL B CG2 1 
ATOM   5394 N N   . LEU B 1 146 ? -4.127  12.690  -51.411 1.00 33.58  ? 146  LEU B N   1 
ATOM   5395 C CA  . LEU B 1 146 ? -3.236  11.818  -50.672 1.00 32.61  ? 146  LEU B CA  1 
ATOM   5396 C C   . LEU B 1 146 ? -2.398  10.930  -51.590 1.00 38.07  ? 146  LEU B C   1 
ATOM   5397 O O   . LEU B 1 146 ? -2.924  10.300  -52.516 1.00 43.37  ? 146  LEU B O   1 
ATOM   5398 C CB  . LEU B 1 146 ? -4.024  10.975  -49.669 1.00 30.20  ? 146  LEU B CB  1 
ATOM   5399 C CG  . LEU B 1 146 ? -3.116  10.402  -48.579 1.00 41.17  ? 146  LEU B CG  1 
ATOM   5400 C CD1 . LEU B 1 146 ? -3.657  10.709  -47.225 1.00 33.43  ? 146  LEU B CD1 1 
ATOM   5401 C CD2 . LEU B 1 146 ? -2.925  8.906   -48.748 1.00 49.91  ? 146  LEU B CD2 1 
ATOM   5402 N N   . VAL B 1 147 ? -1.096  10.882  -51.311 1.00 34.76  ? 147  VAL B N   1 
ATOM   5403 C CA  . VAL B 1 147 ? -0.145  10.128  -52.123 1.00 31.34  ? 147  VAL B CA  1 
ATOM   5404 C C   . VAL B 1 147 ? 0.688   9.165   -51.264 1.00 30.16  ? 147  VAL B C   1 
ATOM   5405 O O   . VAL B 1 147 ? 1.103   9.508   -50.171 1.00 38.06  ? 147  VAL B O   1 
ATOM   5406 C CB  . VAL B 1 147 ? 0.795   11.086  -52.910 1.00 30.21  ? 147  VAL B CB  1 
ATOM   5407 C CG1 . VAL B 1 147 ? 1.783   10.305  -53.768 1.00 23.51  ? 147  VAL B CG1 1 
ATOM   5408 C CG2 . VAL B 1 147 ? -0.020  12.047  -53.784 1.00 34.59  ? 147  VAL B CG2 1 
ATOM   5409 N N   . SER B 1 148 ? 0.914   7.953   -51.752 1.00 29.67  ? 148  SER B N   1 
ATOM   5410 C CA  . SER B 1 148 ? 1.849   7.031   -51.103 1.00 27.87  ? 148  SER B CA  1 
ATOM   5411 C C   . SER B 1 148 ? 2.646   6.321   -52.179 1.00 29.75  ? 148  SER B C   1 
ATOM   5412 O O   . SER B 1 148 ? 2.099   5.977   -53.242 1.00 27.97  ? 148  SER B O   1 
ATOM   5413 C CB  . SER B 1 148 ? 1.116   5.998   -50.256 1.00 26.30  ? 148  SER B CB  1 
ATOM   5414 O OG  . SER B 1 148 ? 0.205   5.265   -51.060 1.00 33.03  ? 148  SER B OG  1 
ATOM   5415 N N   . MET B 1 149 ? 3.937   6.113   -51.922 1.00 27.96  ? 149  MET B N   1 
ATOM   5416 C CA  . MET B 1 149 ? 4.773   5.389   -52.879 1.00 25.87  ? 149  MET B CA  1 
ATOM   5417 C C   . MET B 1 149 ? 5.312   4.108   -52.267 1.00 33.82  ? 149  MET B C   1 
ATOM   5418 O O   . MET B 1 149 ? 5.478   4.008   -51.048 1.00 41.55  ? 149  MET B O   1 
ATOM   5419 C CB  . MET B 1 149 ? 5.941   6.255   -53.367 1.00 24.34  ? 149  MET B CB  1 
ATOM   5420 C CG  . MET B 1 149 ? 7.142   6.314   -52.407 1.00 26.36  ? 149  MET B CG  1 
ATOM   5421 S SD  . MET B 1 149 ? 6.762   7.015   -50.775 1.00 27.34  ? 149  MET B SD  1 
ATOM   5422 C CE  . MET B 1 149 ? 6.707   8.766   -51.189 1.00 21.60  ? 149  MET B CE  1 
ATOM   5423 N N   . ASN B 1 150 ? 5.566   3.119   -53.116 1.00 29.53  ? 150  ASN B N   1 
ATOM   5424 C CA  . ASN B 1 150 ? 6.400   2.007   -52.719 1.00 28.27  ? 150  ASN B CA  1 
ATOM   5425 C C   . ASN B 1 150 ? 7.847   2.457   -52.867 1.00 29.86  ? 150  ASN B C   1 
ATOM   5426 O O   . ASN B 1 150 ? 8.155   3.239   -53.768 1.00 25.01  ? 150  ASN B O   1 
ATOM   5427 C CB  . ASN B 1 150 ? 6.128   0.794   -53.601 1.00 29.60  ? 150  ASN B CB  1 
ATOM   5428 C CG  . ASN B 1 150 ? 4.916   0.025   -53.157 1.00 37.04  ? 150  ASN B CG  1 
ATOM   5429 O OD1 . ASN B 1 150 ? 4.251   0.403   -52.185 1.00 37.03  ? 150  ASN B OD1 1 
ATOM   5430 N ND2 . ASN B 1 150 ? 4.607   -1.055  -53.866 1.00 37.37  ? 150  ASN B ND2 1 
ATOM   5431 N N   . TYR B 1 151 ? 8.726   2.004   -51.976 1.00 23.88  ? 151  TYR B N   1 
ATOM   5432 C CA  . TYR B 1 151 ? 10.156  2.224   -52.175 1.00 27.86  ? 151  TYR B CA  1 
ATOM   5433 C C   . TYR B 1 151 ? 10.908  0.958   -51.807 1.00 26.42  ? 151  TYR B C   1 
ATOM   5434 O O   . TYR B 1 151 ? 10.423  0.152   -51.014 1.00 27.30  ? 151  TYR B O   1 
ATOM   5435 C CB  . TYR B 1 151 ? 10.667  3.425   -51.378 1.00 26.47  ? 151  TYR B CB  1 
ATOM   5436 C CG  . TYR B 1 151 ? 10.503  3.266   -49.890 1.00 30.26  ? 151  TYR B CG  1 
ATOM   5437 C CD1 . TYR B 1 151 ? 9.317   3.612   -49.258 1.00 29.11  ? 151  TYR B CD1 1 
ATOM   5438 C CD2 . TYR B 1 151 ? 11.524  2.744   -49.118 1.00 25.39  ? 151  TYR B CD2 1 
ATOM   5439 C CE1 . TYR B 1 151 ? 9.164   3.452   -47.897 1.00 26.89  ? 151  TYR B CE1 1 
ATOM   5440 C CE2 . TYR B 1 151 ? 11.379  2.578   -47.762 1.00 28.20  ? 151  TYR B CE2 1 
ATOM   5441 C CZ  . TYR B 1 151 ? 10.201  2.933   -47.155 1.00 29.50  ? 151  TYR B CZ  1 
ATOM   5442 O OH  . TYR B 1 151 ? 10.081  2.759   -45.795 1.00 29.83  ? 151  TYR B OH  1 
ATOM   5443 N N   . ARG B 1 152 ? 12.094  0.782   -52.375 1.00 26.99  ? 152  ARG B N   1 
ATOM   5444 C CA  . ARG B 1 152 ? 12.828  -0.459  -52.154 1.00 29.08  ? 152  ARG B CA  1 
ATOM   5445 C C   . ARG B 1 152 ? 13.262  -0.604  -50.703 1.00 30.50  ? 152  ARG B C   1 
ATOM   5446 O O   . ARG B 1 152 ? 13.647  0.366   -50.046 1.00 27.80  ? 152  ARG B O   1 
ATOM   5447 C CB  . ARG B 1 152 ? 14.019  -0.564  -53.090 1.00 30.91  ? 152  ARG B CB  1 
ATOM   5448 C CG  . ARG B 1 152 ? 13.667  -1.072  -54.486 1.00 28.39  ? 152  ARG B CG  1 
ATOM   5449 C CD  . ARG B 1 152 ? 14.878  -0.924  -55.409 1.00 33.97  ? 152  ARG B CD  1 
ATOM   5450 N NE  . ARG B 1 152 ? 15.101  0.480   -55.739 1.00 28.68  ? 152  ARG B NE  1 
ATOM   5451 C CZ  . ARG B 1 152 ? 16.163  0.942   -56.389 1.00 36.37  ? 152  ARG B CZ  1 
ATOM   5452 N NH1 . ARG B 1 152 ? 17.121  0.106   -56.779 1.00 33.45  ? 152  ARG B NH1 1 
ATOM   5453 N NH2 . ARG B 1 152 ? 16.264  2.241   -56.646 1.00 28.97  ? 152  ARG B NH2 1 
ATOM   5454 N N   . VAL B 1 153 ? 13.155  -1.822  -50.198 1.00 27.71  ? 153  VAL B N   1 
ATOM   5455 C CA  . VAL B 1 153 ? 13.526  -2.101  -48.829 1.00 28.02  ? 153  VAL B CA  1 
ATOM   5456 C C   . VAL B 1 153 ? 14.565  -3.202  -48.819 1.00 29.65  ? 153  VAL B C   1 
ATOM   5457 O O   . VAL B 1 153 ? 14.884  -3.776  -49.872 1.00 30.52  ? 153  VAL B O   1 
ATOM   5458 C CB  . VAL B 1 153 ? 12.308  -2.526  -48.000 1.00 37.52  ? 153  VAL B CB  1 
ATOM   5459 C CG1 . VAL B 1 153 ? 11.341  -1.355  -47.847 1.00 29.68  ? 153  VAL B CG1 1 
ATOM   5460 C CG2 . VAL B 1 153 ? 11.623  -3.750  -48.631 1.00 28.74  ? 153  VAL B CG2 1 
ATOM   5461 N N   . GLY B 1 154 ? 15.094  -3.486  -47.629 1.00 34.95  ? 154  GLY B N   1 
ATOM   5462 C CA  . GLY B 1 154 ? 16.115  -4.507  -47.444 1.00 32.04  ? 154  GLY B CA  1 
ATOM   5463 C C   . GLY B 1 154 ? 17.357  -4.238  -48.277 1.00 35.23  ? 154  GLY B C   1 
ATOM   5464 O O   . GLY B 1 154 ? 17.679  -3.089  -48.571 1.00 32.70  ? 154  GLY B O   1 
ATOM   5465 N N   . THR B 1 155 ? 18.057  -5.300  -48.664 1.00 37.35  ? 155  THR B N   1 
ATOM   5466 C CA  . THR B 1 155 ? 19.267  -5.151  -49.462 1.00 41.02  ? 155  THR B CA  1 
ATOM   5467 C C   . THR B 1 155 ? 18.991  -4.374  -50.749 1.00 43.53  ? 155  THR B C   1 
ATOM   5468 O O   . THR B 1 155 ? 19.796  -3.545  -51.169 1.00 42.98  ? 155  THR B O   1 
ATOM   5469 C CB  . THR B 1 155 ? 19.852  -6.504  -49.837 1.00 41.15  ? 155  THR B CB  1 
ATOM   5470 O OG1 . THR B 1 155 ? 18.926  -7.186  -50.680 1.00 37.81  ? 155  THR B OG1 1 
ATOM   5471 C CG2 . THR B 1 155 ? 20.107  -7.341  -48.596 1.00 39.07  ? 155  THR B CG2 1 
ATOM   5472 N N   . PHE B 1 156 ? 17.837  -4.623  -51.353 1.00 33.88  ? 156  PHE B N   1 
ATOM   5473 C CA  . PHE B 1 156 ? 17.503  -3.983  -52.622 1.00 36.95  ? 156  PHE B CA  1 
ATOM   5474 C C   . PHE B 1 156 ? 17.487  -2.462  -52.509 1.00 36.10  ? 156  PHE B C   1 
ATOM   5475 O O   . PHE B 1 156 ? 17.828  -1.766  -53.457 1.00 36.43  ? 156  PHE B O   1 
ATOM   5476 C CB  . PHE B 1 156 ? 16.165  -4.509  -53.168 1.00 34.94  ? 156  PHE B CB  1 
ATOM   5477 C CG  . PHE B 1 156 ? 16.064  -6.003  -53.138 1.00 40.05  ? 156  PHE B CG  1 
ATOM   5478 C CD1 . PHE B 1 156 ? 16.581  -6.767  -54.182 1.00 37.50  ? 156  PHE B CD1 1 
ATOM   5479 C CD2 . PHE B 1 156 ? 15.485  -6.653  -52.051 1.00 34.47  ? 156  PHE B CD2 1 
ATOM   5480 C CE1 . PHE B 1 156 ? 16.515  -8.155  -54.144 1.00 40.45  ? 156  PHE B CE1 1 
ATOM   5481 C CE2 . PHE B 1 156 ? 15.414  -8.035  -52.005 1.00 36.19  ? 156  PHE B CE2 1 
ATOM   5482 C CZ  . PHE B 1 156 ? 15.934  -8.792  -53.053 1.00 40.75  ? 156  PHE B CZ  1 
ATOM   5483 N N   . GLY B 1 157 ? 17.113  -1.946  -51.346 1.00 30.67  ? 157  GLY B N   1 
ATOM   5484 C CA  . GLY B 1 157 ? 17.015  -0.505  -51.178 1.00 36.41  ? 157  GLY B CA  1 
ATOM   5485 C C   . GLY B 1 157 ? 18.193  0.134   -50.456 1.00 29.85  ? 157  GLY B C   1 
ATOM   5486 O O   . GLY B 1 157 ? 18.415  1.333   -50.560 1.00 35.69  ? 157  GLY B O   1 
ATOM   5487 N N   . PHE B 1 158 ? 18.951  -0.660  -49.718 1.00 31.05  ? 158  PHE B N   1 
ATOM   5488 C CA  . PHE B 1 158 ? 19.912  -0.075  -48.797 1.00 41.37  ? 158  PHE B CA  1 
ATOM   5489 C C   . PHE B 1 158 ? 21.259  -0.778  -48.701 1.00 42.32  ? 158  PHE B C   1 
ATOM   5490 O O   . PHE B 1 158 ? 22.147  -0.291  -48.012 1.00 40.38  ? 158  PHE B O   1 
ATOM   5491 C CB  . PHE B 1 158 ? 19.280  0.127   -47.409 1.00 32.03  ? 158  PHE B CB  1 
ATOM   5492 C CG  . PHE B 1 158 ? 18.085  1.040   -47.431 1.00 28.82  ? 158  PHE B CG  1 
ATOM   5493 C CD1 . PHE B 1 158 ? 18.249  2.415   -47.465 1.00 28.75  ? 158  PHE B CD1 1 
ATOM   5494 C CD2 . PHE B 1 158 ? 16.799  0.525   -47.459 1.00 29.98  ? 158  PHE B CD2 1 
ATOM   5495 C CE1 . PHE B 1 158 ? 17.149  3.276   -47.516 1.00 26.74  ? 158  PHE B CE1 1 
ATOM   5496 C CE2 . PHE B 1 158 ? 15.671  1.382   -47.502 1.00 29.48  ? 158  PHE B CE2 1 
ATOM   5497 C CZ  . PHE B 1 158 ? 15.852  2.752   -47.541 1.00 33.55  ? 158  PHE B CZ  1 
ATOM   5498 N N   . LEU B 1 159 ? 21.428  -1.907  -49.383 1.00 36.62  ? 159  LEU B N   1 
ATOM   5499 C CA  . LEU B 1 159 ? 22.768  -2.492  -49.456 1.00 38.14  ? 159  LEU B CA  1 
ATOM   5500 C C   . LEU B 1 159 ? 23.695  -1.466  -50.091 1.00 39.89  ? 159  LEU B C   1 
ATOM   5501 O O   . LEU B 1 159 ? 23.403  -0.918  -51.163 1.00 45.38  ? 159  LEU B O   1 
ATOM   5502 C CB  . LEU B 1 159 ? 22.793  -3.792  -50.267 1.00 37.79  ? 159  LEU B CB  1 
ATOM   5503 C CG  . LEU B 1 159 ? 24.164  -4.486  -50.274 1.00 42.39  ? 159  LEU B CG  1 
ATOM   5504 C CD1 . LEU B 1 159 ? 24.049  -5.951  -49.866 1.00 38.54  ? 159  LEU B CD1 1 
ATOM   5505 C CD2 . LEU B 1 159 ? 24.859  -4.355  -51.630 1.00 42.78  ? 159  LEU B CD2 1 
ATOM   5506 N N   . ALA B 1 160 ? 24.807  -1.204  -49.422 1.00 40.28  ? 160  ALA B N   1 
ATOM   5507 C CA  . ALA B 1 160 ? 25.703  -0.137  -49.829 1.00 42.54  ? 160  ALA B CA  1 
ATOM   5508 C C   . ALA B 1 160 ? 27.137  -0.585  -49.755 1.00 43.61  ? 160  ALA B C   1 
ATOM   5509 O O   . ALA B 1 160 ? 27.575  -1.126  -48.749 1.00 48.11  ? 160  ALA B O   1 
ATOM   5510 C CB  . ALA B 1 160 ? 25.510  1.087   -48.939 1.00 36.75  ? 160  ALA B CB  1 
ATOM   5511 N N   . LEU B 1 161 ? 27.866  -0.358  -50.836 1.00 46.22  ? 161  LEU B N   1 
ATOM   5512 C CA  . LEU B 1 161 ? 29.311  -0.387  -50.786 1.00 45.05  ? 161  LEU B CA  1 
ATOM   5513 C C   . LEU B 1 161 ? 29.762  1.032   -51.006 1.00 49.83  ? 161  LEU B C   1 
ATOM   5514 O O   . LEU B 1 161 ? 29.987  1.444   -52.142 1.00 46.13  ? 161  LEU B O   1 
ATOM   5515 C CB  . LEU B 1 161 ? 29.885  -1.335  -51.833 1.00 47.40  ? 161  LEU B CB  1 
ATOM   5516 C CG  . LEU B 1 161 ? 29.719  -2.749  -51.279 1.00 50.80  ? 161  LEU B CG  1 
ATOM   5517 C CD1 . LEU B 1 161 ? 28.693  -3.546  -52.065 1.00 53.55  ? 161  LEU B CD1 1 
ATOM   5518 C CD2 . LEU B 1 161 ? 31.042  -3.462  -51.202 1.00 54.53  ? 161  LEU B CD2 1 
ATOM   5519 N N   . PRO B 1 162 ? 29.871  1.791   -49.904 1.00 50.18  ? 162  PRO B N   1 
ATOM   5520 C CA  . PRO B 1 162 ? 30.099  3.237   -49.904 1.00 46.94  ? 162  PRO B CA  1 
ATOM   5521 C C   . PRO B 1 162 ? 31.248  3.591   -50.820 1.00 51.43  ? 162  PRO B C   1 
ATOM   5522 O O   . PRO B 1 162 ? 32.324  3.023   -50.687 1.00 53.92  ? 162  PRO B O   1 
ATOM   5523 C CB  . PRO B 1 162 ? 30.468  3.530   -48.449 1.00 47.97  ? 162  PRO B CB  1 
ATOM   5524 C CG  . PRO B 1 162 ? 29.815  2.453   -47.673 1.00 44.68  ? 162  PRO B CG  1 
ATOM   5525 C CD  . PRO B 1 162 ? 29.872  1.235   -48.541 1.00 43.17  ? 162  PRO B CD  1 
ATOM   5526 N N   . GLY B 1 163 ? 31.004  4.492   -51.760 1.00 52.78  ? 163  GLY B N   1 
ATOM   5527 C CA  . GLY B 1 163 ? 32.028  4.897   -52.700 1.00 57.82  ? 163  GLY B CA  1 
ATOM   5528 C C   . GLY B 1 163 ? 31.954  4.185   -54.039 1.00 62.74  ? 163  GLY B C   1 
ATOM   5529 O O   . GLY B 1 163 ? 32.473  4.686   -55.039 1.00 62.23  ? 163  GLY B O   1 
ATOM   5530 N N   . SER B 1 164 ? 31.323  3.014   -54.065 1.00 58.04  ? 164  SER B N   1 
ATOM   5531 C CA  . SER B 1 164 ? 31.168  2.269   -55.310 1.00 54.96  ? 164  SER B CA  1 
ATOM   5532 C C   . SER B 1 164 ? 30.228  3.034   -56.221 1.00 54.34  ? 164  SER B C   1 
ATOM   5533 O O   . SER B 1 164 ? 29.415  3.825   -55.755 1.00 51.80  ? 164  SER B O   1 
ATOM   5534 C CB  . SER B 1 164 ? 30.605  0.875   -55.049 1.00 51.44  ? 164  SER B CB  1 
ATOM   5535 O OG  . SER B 1 164 ? 29.255  0.967   -54.608 1.00 46.94  ? 164  SER B OG  1 
ATOM   5536 N N   . ARG B 1 165 ? 30.350  2.799   -57.522 1.00 58.20  ? 165  ARG B N   1 
ATOM   5537 C CA  . ARG B 1 165 ? 29.500  3.453   -58.504 1.00 61.30  ? 165  ARG B CA  1 
ATOM   5538 C C   . ARG B 1 165 ? 28.183  2.690   -58.584 1.00 60.38  ? 165  ARG B C   1 
ATOM   5539 O O   . ARG B 1 165 ? 27.130  3.257   -58.875 1.00 62.90  ? 165  ARG B O   1 
ATOM   5540 C CB  . ARG B 1 165 ? 30.184  3.458   -59.873 1.00 77.23  ? 165  ARG B CB  1 
ATOM   5541 C CG  . ARG B 1 165 ? 29.574  4.429   -60.877 1.00 93.82  ? 165  ARG B CG  1 
ATOM   5542 C CD  . ARG B 1 165 ? 29.494  3.820   -62.279 1.00 106.93 ? 165  ARG B CD  1 
ATOM   5543 N NE  . ARG B 1 165 ? 28.324  2.954   -62.434 1.00 107.86 ? 165  ARG B NE  1 
ATOM   5544 C CZ  . ARG B 1 165 ? 28.286  1.864   -63.197 1.00 108.55 ? 165  ARG B CZ  1 
ATOM   5545 N NH1 . ARG B 1 165 ? 29.362  1.491   -63.881 1.00 112.62 ? 165  ARG B NH1 1 
ATOM   5546 N NH2 . ARG B 1 165 ? 27.173  1.143   -63.271 1.00 102.95 ? 165  ARG B NH2 1 
ATOM   5547 N N   . GLU B 1 166 ? 28.247  1.399   -58.282 1.00 60.20  ? 166  GLU B N   1 
ATOM   5548 C CA  . GLU B 1 166 ? 27.142  0.498   -58.573 1.00 62.38  ? 166  GLU B CA  1 
ATOM   5549 C C   . GLU B 1 166 ? 26.271  0.112   -57.372 1.00 54.58  ? 166  GLU B C   1 
ATOM   5550 O O   . GLU B 1 166 ? 25.247  -0.548  -57.541 1.00 50.85  ? 166  GLU B O   1 
ATOM   5551 C CB  . GLU B 1 166 ? 27.651  -0.746  -59.318 1.00 69.75  ? 166  GLU B CB  1 
ATOM   5552 C CG  . GLU B 1 166 ? 28.981  -1.258  -58.824 1.00 77.25  ? 166  GLU B CG  1 
ATOM   5553 C CD  . GLU B 1 166 ? 30.164  -0.598  -59.505 1.00 85.37  ? 166  GLU B CD  1 
ATOM   5554 O OE1 . GLU B 1 166 ? 30.198  -0.578  -60.752 1.00 85.55  ? 166  GLU B OE1 1 
ATOM   5555 O OE2 . GLU B 1 166 ? 31.058  -0.102  -58.786 1.00 89.48  ? 166  GLU B OE2 1 
ATOM   5556 N N   . ALA B 1 167 ? 26.684  0.516   -56.174 1.00 52.67  ? 167  ALA B N   1 
ATOM   5557 C CA  . ALA B 1 167 ? 25.854  0.376   -54.977 1.00 48.94  ? 167  ALA B CA  1 
ATOM   5558 C C   . ALA B 1 167 ? 26.189  1.468   -53.961 1.00 51.06  ? 167  ALA B C   1 
ATOM   5559 O O   . ALA B 1 167 ? 26.766  1.187   -52.907 1.00 44.10  ? 167  ALA B O   1 
ATOM   5560 C CB  . ALA B 1 167 ? 26.029  -0.993  -54.354 1.00 44.36  ? 167  ALA B CB  1 
ATOM   5561 N N   . PRO B 1 168 ? 25.807  2.718   -54.273 1.00 53.80  ? 168  PRO B N   1 
ATOM   5562 C CA  . PRO B 1 168 ? 26.202  3.908   -53.508 1.00 50.51  ? 168  PRO B CA  1 
ATOM   5563 C C   . PRO B 1 168 ? 25.431  4.065   -52.199 1.00 47.99  ? 168  PRO B C   1 
ATOM   5564 O O   . PRO B 1 168 ? 25.690  4.999   -51.432 1.00 38.76  ? 168  PRO B O   1 
ATOM   5565 C CB  . PRO B 1 168 ? 25.852  5.053   -54.458 1.00 47.04  ? 168  PRO B CB  1 
ATOM   5566 C CG  . PRO B 1 168 ? 24.693  4.534   -55.234 1.00 45.71  ? 168  PRO B CG  1 
ATOM   5567 C CD  . PRO B 1 168 ? 24.925  3.056   -55.406 1.00 39.01  ? 168  PRO B CD  1 
ATOM   5568 N N   . GLY B 1 169 ? 24.496  3.152   -51.958 1.00 34.91  ? 169  GLY B N   1 
ATOM   5569 C CA  . GLY B 1 169 ? 23.604  3.230   -50.814 1.00 32.96  ? 169  GLY B CA  1 
ATOM   5570 C C   . GLY B 1 169 ? 22.454  4.219   -50.949 1.00 31.94  ? 169  GLY B C   1 
ATOM   5571 O O   . GLY B 1 169 ? 22.397  5.022   -51.891 1.00 35.67  ? 169  GLY B O   1 
ATOM   5572 N N   . ASN B 1 170 ? 21.531  4.142   -49.998 1.00 34.99  ? 170  ASN B N   1 
ATOM   5573 C CA  . ASN B 1 170 ? 20.413  5.072   -49.894 1.00 34.35  ? 170  ASN B CA  1 
ATOM   5574 C C   . ASN B 1 170 ? 19.470  5.107   -51.105 1.00 36.49  ? 170  ASN B C   1 
ATOM   5575 O O   . ASN B 1 170 ? 18.708  6.063   -51.269 1.00 42.51  ? 170  ASN B O   1 
ATOM   5576 C CB  . ASN B 1 170 ? 20.916  6.490   -49.569 1.00 31.85  ? 170  ASN B CB  1 
ATOM   5577 C CG  . ASN B 1 170 ? 21.670  6.560   -48.242 1.00 39.77  ? 170  ASN B CG  1 
ATOM   5578 O OD1 . ASN B 1 170 ? 21.462  5.743   -47.340 1.00 34.64  ? 170  ASN B OD1 1 
ATOM   5579 N ND2 . ASN B 1 170 ? 22.559  7.543   -48.121 1.00 49.08  ? 170  ASN B ND2 1 
ATOM   5580 N N   . VAL B 1 171 ? 19.496  4.077   -51.945 1.00 34.71  ? 171  VAL B N   1 
ATOM   5581 C CA  . VAL B 1 171 ? 18.658  4.132   -53.138 1.00 32.22  ? 171  VAL B CA  1 
ATOM   5582 C C   . VAL B 1 171 ? 17.159  4.041   -52.804 1.00 33.89  ? 171  VAL B C   1 
ATOM   5583 O O   . VAL B 1 171 ? 16.323  4.591   -53.522 1.00 32.90  ? 171  VAL B O   1 
ATOM   5584 C CB  . VAL B 1 171 ? 19.068  3.116   -54.255 1.00 41.34  ? 171  VAL B CB  1 
ATOM   5585 C CG1 . VAL B 1 171 ? 20.571  3.170   -54.520 1.00 30.90  ? 171  VAL B CG1 1 
ATOM   5586 C CG2 . VAL B 1 171 ? 18.595  1.702   -53.933 1.00 34.43  ? 171  VAL B CG2 1 
ATOM   5587 N N   . GLY B 1 172 ? 16.820  3.376   -51.704 1.00 33.98  ? 172  GLY B N   1 
ATOM   5588 C CA  . GLY B 1 172 ? 15.442  3.392   -51.230 1.00 26.59  ? 172  GLY B CA  1 
ATOM   5589 C C   . GLY B 1 172 ? 14.932  4.796   -50.900 1.00 28.67  ? 172  GLY B C   1 
ATOM   5590 O O   . GLY B 1 172 ? 13.774  5.120   -51.174 1.00 31.78  ? 172  GLY B O   1 
ATOM   5591 N N   . LEU B 1 173 ? 15.783  5.641   -50.316 1.00 27.07  ? 173  LEU B N   1 
ATOM   5592 C CA  . LEU B 1 173 ? 15.390  7.029   -50.056 1.00 27.61  ? 173  LEU B CA  1 
ATOM   5593 C C   . LEU B 1 173 ? 15.373  7.806   -51.361 1.00 40.28  ? 173  LEU B C   1 
ATOM   5594 O O   . LEU B 1 173 ? 14.577  8.733   -51.526 1.00 38.54  ? 173  LEU B O   1 
ATOM   5595 C CB  . LEU B 1 173 ? 16.329  7.725   -49.060 1.00 29.08  ? 173  LEU B CB  1 
ATOM   5596 C CG  . LEU B 1 173 ? 16.427  7.210   -47.611 1.00 35.14  ? 173  LEU B CG  1 
ATOM   5597 C CD1 . LEU B 1 173 ? 17.601  7.841   -46.879 1.00 32.05  ? 173  LEU B CD1 1 
ATOM   5598 C CD2 . LEU B 1 173 ? 15.131  7.443   -46.849 1.00 34.04  ? 173  LEU B CD2 1 
ATOM   5599 N N   . LEU B 1 174 ? 16.262  7.438   -52.287 1.00 36.99  ? 174  LEU B N   1 
ATOM   5600 C CA  . LEU B 1 174 ? 16.225  8.035   -53.617 1.00 37.51  ? 174  LEU B CA  1 
ATOM   5601 C C   . LEU B 1 174 ? 14.919  7.683   -54.331 1.00 30.83  ? 174  LEU B C   1 
ATOM   5602 O O   . LEU B 1 174 ? 14.416  8.491   -55.100 1.00 29.99  ? 174  LEU B O   1 
ATOM   5603 C CB  . LEU B 1 174 ? 17.455  7.666   -54.461 1.00 28.85  ? 174  LEU B CB  1 
ATOM   5604 C CG  . LEU B 1 174 ? 18.755  8.339   -54.002 1.00 41.92  ? 174  LEU B CG  1 
ATOM   5605 C CD1 . LEU B 1 174 ? 19.944  7.931   -54.865 1.00 32.44  ? 174  LEU B CD1 1 
ATOM   5606 C CD2 . LEU B 1 174 ? 18.612  9.840   -53.991 1.00 31.65  ? 174  LEU B CD2 1 
ATOM   5607 N N   . ASP B 1 175 ? 14.361  6.500   -54.064 1.00 26.44  ? 175  ASP B N   1 
ATOM   5608 C CA  . ASP B 1 175 ? 13.059  6.150   -54.640 1.00 26.45  ? 175  ASP B CA  1 
ATOM   5609 C C   . ASP B 1 175 ? 11.998  7.140   -54.134 1.00 34.41  ? 175  ASP B C   1 
ATOM   5610 O O   . ASP B 1 175 ? 11.250  7.727   -54.921 1.00 36.50  ? 175  ASP B O   1 
ATOM   5611 C CB  . ASP B 1 175 ? 12.631  4.716   -54.294 1.00 26.84  ? 175  ASP B CB  1 
ATOM   5612 C CG  . ASP B 1 175 ? 13.520  3.654   -54.923 1.00 30.29  ? 175  ASP B CG  1 
ATOM   5613 O OD1 . ASP B 1 175 ? 14.237  3.957   -55.897 1.00 32.66  ? 175  ASP B OD1 1 
ATOM   5614 O OD2 . ASP B 1 175 ? 13.496  2.496   -54.442 1.00 32.09  ? 175  ASP B OD2 1 
ATOM   5615 N N   . GLN B 1 176 ? 11.942  7.315   -52.816 1.00 28.52  ? 176  GLN B N   1 
ATOM   5616 C CA  . GLN B 1 176 ? 11.065  8.304   -52.199 1.00 26.86  ? 176  GLN B CA  1 
ATOM   5617 C C   . GLN B 1 176 ? 11.248  9.683   -52.832 1.00 26.74  ? 176  GLN B C   1 
ATOM   5618 O O   . GLN B 1 176 ? 10.285  10.338  -53.206 1.00 26.94  ? 176  GLN B O   1 
ATOM   5619 C CB  . GLN B 1 176 ? 11.333  8.375   -50.695 1.00 27.73  ? 176  GLN B CB  1 
ATOM   5620 C CG  . GLN B 1 176 ? 11.347  7.008   -50.027 1.00 39.85  ? 176  GLN B CG  1 
ATOM   5621 C CD  . GLN B 1 176 ? 11.632  7.093   -48.545 1.00 40.69  ? 176  GLN B CD  1 
ATOM   5622 O OE1 . GLN B 1 176 ? 11.758  8.189   -48.011 1.00 30.34  ? 176  GLN B OE1 1 
ATOM   5623 N NE2 . GLN B 1 176 ? 11.734  5.939   -47.872 1.00 30.03  ? 176  GLN B NE2 1 
ATOM   5624 N N   . ARG B 1 177 ? 12.494  10.112  -52.974 1.00 31.39  ? 177  ARG B N   1 
ATOM   5625 C CA  . ARG B 1 177 ? 12.740  11.432  -53.517 1.00 36.34  ? 177  ARG B CA  1 
ATOM   5626 C C   . ARG B 1 177 ? 12.167  11.571  -54.938 1.00 37.14  ? 177  ARG B C   1 
ATOM   5627 O O   . ARG B 1 177 ? 11.571  12.600  -55.280 1.00 29.38  ? 177  ARG B O   1 
ATOM   5628 C CB  . ARG B 1 177 ? 14.228  11.766  -53.476 1.00 28.52  ? 177  ARG B CB  1 
ATOM   5629 C CG  . ARG B 1 177 ? 14.572  13.023  -54.229 1.00 36.09  ? 177  ARG B CG  1 
ATOM   5630 C CD  . ARG B 1 177 ? 16.034  13.348  -54.115 1.00 31.77  ? 177  ARG B CD  1 
ATOM   5631 N NE  . ARG B 1 177 ? 16.339  13.855  -52.788 1.00 40.91  ? 177  ARG B NE  1 
ATOM   5632 C CZ  . ARG B 1 177 ? 17.556  13.853  -52.250 1.00 44.50  ? 177  ARG B CZ  1 
ATOM   5633 N NH1 . ARG B 1 177 ? 18.590  13.356  -52.934 1.00 37.82  ? 177  ARG B NH1 1 
ATOM   5634 N NH2 . ARG B 1 177 ? 17.734  14.347  -51.029 1.00 36.86  ? 177  ARG B NH2 1 
ATOM   5635 N N   . LEU B 1 178 ? 12.324  10.526  -55.748 1.00 32.24  ? 178  LEU B N   1 
ATOM   5636 C CA  . LEU B 1 178 ? 11.824  10.557  -57.112 1.00 34.19  ? 178  LEU B CA  1 
ATOM   5637 C C   . LEU B 1 178 ? 10.301  10.682  -57.119 1.00 34.53  ? 178  LEU B C   1 
ATOM   5638 O O   . LEU B 1 178 ? 9.732   11.389  -57.942 1.00 30.16  ? 178  LEU B O   1 
ATOM   5639 C CB  . LEU B 1 178 ? 12.276  9.328   -57.902 1.00 27.61  ? 178  LEU B CB  1 
ATOM   5640 C CG  . LEU B 1 178 ? 11.874  9.332   -59.385 1.00 37.70  ? 178  LEU B CG  1 
ATOM   5641 C CD1 . LEU B 1 178 ? 12.480  10.506  -60.120 1.00 29.78  ? 178  LEU B CD1 1 
ATOM   5642 C CD2 . LEU B 1 178 ? 12.273  8.042   -60.059 1.00 30.02  ? 178  LEU B CD2 1 
ATOM   5643 N N   . ALA B 1 179 ? 9.650   10.001  -56.186 1.00 34.74  ? 179  ALA B N   1 
ATOM   5644 C CA  . ALA B 1 179 ? 8.199   10.059  -56.075 1.00 27.06  ? 179  ALA B CA  1 
ATOM   5645 C C   . ALA B 1 179 ? 7.754   11.463  -55.675 1.00 29.28  ? 179  ALA B C   1 
ATOM   5646 O O   . ALA B 1 179 ? 6.754   11.967  -56.176 1.00 30.60  ? 179  ALA B O   1 
ATOM   5647 C CB  . ALA B 1 179 ? 7.704   9.028   -55.082 1.00 27.69  ? 179  ALA B CB  1 
ATOM   5648 N N   . LEU B 1 180 ? 8.520   12.089  -54.785 1.00 30.10  ? 180  LEU B N   1 
ATOM   5649 C CA  . LEU B 1 180 ? 8.317   13.493  -54.397 1.00 34.80  ? 180  LEU B CA  1 
ATOM   5650 C C   . LEU B 1 180 ? 8.434   14.471  -55.585 1.00 37.57  ? 180  LEU B C   1 
ATOM   5651 O O   . LEU B 1 180 ? 7.639   15.401  -55.698 1.00 39.75  ? 180  LEU B O   1 
ATOM   5652 C CB  . LEU B 1 180 ? 9.272   13.887  -53.256 1.00 28.39  ? 180  LEU B CB  1 
ATOM   5653 C CG  . LEU B 1 180 ? 8.845   13.620  -51.801 1.00 35.60  ? 180  LEU B CG  1 
ATOM   5654 C CD1 . LEU B 1 180 ? 8.327   12.212  -51.547 1.00 32.11  ? 180  LEU B CD1 1 
ATOM   5655 C CD2 . LEU B 1 180 ? 9.974   13.932  -50.806 1.00 34.14  ? 180  LEU B CD2 1 
ATOM   5656 N N   . GLN B 1 181 ? 9.416   14.254  -56.464 1.00 42.15  ? 181  GLN B N   1 
ATOM   5657 C CA  . GLN B 1 181 ? 9.564   15.056  -57.687 1.00 39.54  ? 181  GLN B CA  1 
ATOM   5658 C C   . GLN B 1 181 ? 8.351   14.835  -58.586 1.00 36.85  ? 181  GLN B C   1 
ATOM   5659 O O   . GLN B 1 181 ? 7.828   15.770  -59.198 1.00 34.42  ? 181  GLN B O   1 
ATOM   5660 C CB  . GLN B 1 181 ? 10.834  14.671  -58.458 1.00 44.75  ? 181  GLN B CB  1 
ATOM   5661 C CG  . GLN B 1 181 ? 12.049  15.566  -58.223 1.00 59.24  ? 181  GLN B CG  1 
ATOM   5662 C CD  . GLN B 1 181 ? 13.344  14.769  -58.020 1.00 65.58  ? 181  GLN B CD  1 
ATOM   5663 O OE1 . GLN B 1 181 ? 13.424  13.582  -58.348 1.00 68.80  ? 181  GLN B OE1 1 
ATOM   5664 N NE2 . GLN B 1 181 ? 14.355  15.422  -57.460 1.00 64.96  ? 181  GLN B NE2 1 
ATOM   5665 N N   . TRP B 1 182 ? 7.912   13.582  -58.657 1.00 31.92  ? 182  TRP B N   1 
ATOM   5666 C CA  . TRP B 1 182 ? 6.759   13.221  -59.468 1.00 34.31  ? 182  TRP B CA  1 
ATOM   5667 C C   . TRP B 1 182 ? 5.528   13.999  -59.022 1.00 37.81  ? 182  TRP B C   1 
ATOM   5668 O O   . TRP B 1 182 ? 4.751   14.461  -59.863 1.00 34.92  ? 182  TRP B O   1 
ATOM   5669 C CB  . TRP B 1 182 ? 6.491   11.716  -59.400 1.00 30.67  ? 182  TRP B CB  1 
ATOM   5670 C CG  . TRP B 1 182 ? 5.430   11.269  -60.348 1.00 36.43  ? 182  TRP B CG  1 
ATOM   5671 C CD1 . TRP B 1 182 ? 5.615   10.751  -61.595 1.00 31.15  ? 182  TRP B CD1 1 
ATOM   5672 C CD2 . TRP B 1 182 ? 4.014   11.311  -60.138 1.00 38.32  ? 182  TRP B CD2 1 
ATOM   5673 N NE1 . TRP B 1 182 ? 4.410   10.465  -62.170 1.00 38.45  ? 182  TRP B NE1 1 
ATOM   5674 C CE2 . TRP B 1 182 ? 3.409   10.797  -61.297 1.00 37.86  ? 182  TRP B CE2 1 
ATOM   5675 C CE3 . TRP B 1 182 ? 3.201   11.721  -59.079 1.00 34.53  ? 182  TRP B CE3 1 
ATOM   5676 C CZ2 . TRP B 1 182 ? 2.033   10.686  -61.431 1.00 43.59  ? 182  TRP B CZ2 1 
ATOM   5677 C CZ3 . TRP B 1 182 ? 1.836   11.608  -59.214 1.00 32.76  ? 182  TRP B CZ3 1 
ATOM   5678 C CH2 . TRP B 1 182 ? 1.264   11.100  -60.379 1.00 47.13  ? 182  TRP B CH2 1 
ATOM   5679 N N   . VAL B 1 183 ? 5.357   14.135  -57.703 1.00 34.16  ? 183  VAL B N   1 
ATOM   5680 C CA  . VAL B 1 183 ? 4.250   14.914  -57.157 1.00 37.86  ? 183  VAL B CA  1 
ATOM   5681 C C   . VAL B 1 183 ? 4.370   16.391  -57.554 1.00 40.19  ? 183  VAL B C   1 
ATOM   5682 O O   . VAL B 1 183 ? 3.378   17.016  -57.942 1.00 37.39  ? 183  VAL B O   1 
ATOM   5683 C CB  . VAL B 1 183 ? 4.113   14.772  -55.618 1.00 36.18  ? 183  VAL B CB  1 
ATOM   5684 C CG1 . VAL B 1 183 ? 3.284   15.922  -55.040 1.00 30.74  ? 183  VAL B CG1 1 
ATOM   5685 C CG2 . VAL B 1 183 ? 3.500   13.432  -55.260 1.00 30.39  ? 183  VAL B CG2 1 
ATOM   5686 N N   . GLN B 1 184 ? 5.580   16.939  -57.470 1.00 33.87  ? 184  GLN B N   1 
ATOM   5687 C CA  . GLN B 1 184 ? 5.809   18.312  -57.906 1.00 34.55  ? 184  GLN B CA  1 
ATOM   5688 C C   . GLN B 1 184 ? 5.393   18.503  -59.360 1.00 39.62  ? 184  GLN B C   1 
ATOM   5689 O O   . GLN B 1 184 ? 4.752   19.500  -59.706 1.00 39.93  ? 184  GLN B O   1 
ATOM   5690 C CB  . GLN B 1 184 ? 7.281   18.707  -57.744 1.00 32.04  ? 184  GLN B CB  1 
ATOM   5691 C CG  . GLN B 1 184 ? 7.681   18.995  -56.332 1.00 40.96  ? 184  GLN B CG  1 
ATOM   5692 C CD  . GLN B 1 184 ? 6.820   20.089  -55.727 1.00 48.41  ? 184  GLN B CD  1 
ATOM   5693 O OE1 . GLN B 1 184 ? 6.790   21.215  -56.222 1.00 47.55  ? 184  GLN B OE1 1 
ATOM   5694 N NE2 . GLN B 1 184 ? 6.097   19.753  -54.666 1.00 47.27  ? 184  GLN B NE2 1 
ATOM   5695 N N   . GLU B 1 185 ? 5.760   17.547  -60.208 1.00 33.86  ? 185  GLU B N   1 
ATOM   5696 C CA  . GLU B 1 185 ? 5.547   17.697  -61.641 1.00 42.10  ? 185  GLU B CA  1 
ATOM   5697 C C   . GLU B 1 185 ? 4.109   17.413  -62.054 1.00 45.62  ? 185  GLU B C   1 
ATOM   5698 O O   . GLU B 1 185 ? 3.648   17.917  -63.077 1.00 54.78  ? 185  GLU B O   1 
ATOM   5699 C CB  . GLU B 1 185 ? 6.490   16.778  -62.434 1.00 44.46  ? 185  GLU B CB  1 
ATOM   5700 C CG  . GLU B 1 185 ? 7.975   17.069  -62.254 1.00 57.63  ? 185  GLU B CG  1 
ATOM   5701 C CD  . GLU B 1 185 ? 8.873   15.979  -62.842 1.00 67.24  ? 185  GLU B CD  1 
ATOM   5702 O OE1 . GLU B 1 185 ? 8.352   15.082  -63.544 1.00 75.20  ? 185  GLU B OE1 1 
ATOM   5703 O OE2 . GLU B 1 185 ? 10.101  16.019  -62.594 1.00 64.34  ? 185  GLU B OE2 1 
ATOM   5704 N N   . ASN B 1 186 ? 3.402   16.601  -61.270 1.00 41.02  ? 186  ASN B N   1 
ATOM   5705 C CA  . ASN B 1 186 ? 2.156   15.998  -61.755 1.00 36.36  ? 186  ASN B CA  1 
ATOM   5706 C C   . ASN B 1 186 ? 0.892   16.174  -60.908 1.00 32.84  ? 186  ASN B C   1 
ATOM   5707 O O   . ASN B 1 186 ? -0.210  16.026  -61.426 1.00 37.52  ? 186  ASN B O   1 
ATOM   5708 C CB  . ASN B 1 186 ? 2.366   14.506  -62.048 1.00 38.41  ? 186  ASN B CB  1 
ATOM   5709 C CG  . ASN B 1 186 ? 3.325   14.266  -63.204 1.00 43.51  ? 186  ASN B CG  1 
ATOM   5710 O OD1 . ASN B 1 186 ? 3.047   14.643  -64.337 1.00 50.94  ? 186  ASN B OD1 1 
ATOM   5711 N ND2 . ASN B 1 186 ? 4.451   13.630  -62.921 1.00 38.55  ? 186  ASN B ND2 1 
ATOM   5712 N N   . ILE B 1 187 ? 1.046   16.467  -59.618 1.00 32.99  ? 187  ILE B N   1 
ATOM   5713 C CA  . ILE B 1 187 ? -0.089  16.502  -58.701 1.00 32.51  ? 187  ILE B CA  1 
ATOM   5714 C C   . ILE B 1 187 ? -1.142  17.556  -59.087 1.00 37.59  ? 187  ILE B C   1 
ATOM   5715 O O   . ILE B 1 187 ? -2.335  17.361  -58.842 1.00 38.95  ? 187  ILE B O   1 
ATOM   5716 C CB  . ILE B 1 187 ? 0.371   16.691  -57.235 1.00 36.18  ? 187  ILE B CB  1 
ATOM   5717 C CG1 . ILE B 1 187 ? -0.518  15.884  -56.283 1.00 34.61  ? 187  ILE B CG1 1 
ATOM   5718 C CG2 . ILE B 1 187 ? 0.431   18.191  -56.864 1.00 32.57  ? 187  ILE B CG2 1 
ATOM   5719 C CD1 . ILE B 1 187 ? -0.647  14.408  -56.645 1.00 35.22  ? 187  ILE B CD1 1 
ATOM   5720 N N   . ALA B 1 188 ? -0.711  18.648  -59.715 1.00 32.50  ? 188  ALA B N   1 
ATOM   5721 C CA  . ALA B 1 188 ? -1.650  19.659  -60.175 1.00 40.39  ? 188  ALA B CA  1 
ATOM   5722 C C   . ALA B 1 188 ? -2.712  19.072  -61.114 1.00 39.96  ? 188  ALA B C   1 
ATOM   5723 O O   . ALA B 1 188 ? -3.845  19.539  -61.136 1.00 41.37  ? 188  ALA B O   1 
ATOM   5724 C CB  . ALA B 1 188 ? -0.921  20.824  -60.844 1.00 32.40  ? 188  ALA B CB  1 
ATOM   5725 N N   . ALA B 1 189 ? -2.350  18.043  -61.874 1.00 34.79  ? 189  ALA B N   1 
ATOM   5726 C CA  . ALA B 1 189 ? -3.298  17.409  -62.783 1.00 36.90  ? 189  ALA B CA  1 
ATOM   5727 C C   . ALA B 1 189 ? -4.429  16.710  -62.032 1.00 42.22  ? 189  ALA B C   1 
ATOM   5728 O O   . ALA B 1 189 ? -5.495  16.480  -62.593 1.00 41.94  ? 189  ALA B O   1 
ATOM   5729 C CB  . ALA B 1 189 ? -2.591  16.435  -63.715 1.00 37.06  ? 189  ALA B CB  1 
ATOM   5730 N N   . PHE B 1 190 ? -4.194  16.372  -60.766 1.00 42.35  ? 190  PHE B N   1 
ATOM   5731 C CA  . PHE B 1 190 ? -5.202  15.698  -59.958 1.00 42.16  ? 190  PHE B CA  1 
ATOM   5732 C C   . PHE B 1 190 ? -5.938  16.694  -59.057 1.00 43.41  ? 190  PHE B C   1 
ATOM   5733 O O   . PHE B 1 190 ? -6.755  16.303  -58.218 1.00 46.37  ? 190  PHE B O   1 
ATOM   5734 C CB  . PHE B 1 190 ? -4.566  14.623  -59.088 1.00 42.05  ? 190  PHE B CB  1 
ATOM   5735 C CG  . PHE B 1 190 ? -3.841  13.560  -59.850 1.00 41.39  ? 190  PHE B CG  1 
ATOM   5736 C CD1 . PHE B 1 190 ? -2.552  13.776  -60.317 1.00 38.37  ? 190  PHE B CD1 1 
ATOM   5737 C CD2 . PHE B 1 190 ? -4.427  12.317  -60.058 1.00 44.45  ? 190  PHE B CD2 1 
ATOM   5738 C CE1 . PHE B 1 190 ? -1.866  12.776  -61.002 1.00 38.29  ? 190  PHE B CE1 1 
ATOM   5739 C CE2 . PHE B 1 190 ? -3.754  11.315  -60.744 1.00 44.36  ? 190  PHE B CE2 1 
ATOM   5740 C CZ  . PHE B 1 190 ? -2.467  11.544  -61.215 1.00 41.21  ? 190  PHE B CZ  1 
ATOM   5741 N N   . GLY B 1 191 ? -5.631  17.976  -59.230 1.00 41.45  ? 191  GLY B N   1 
ATOM   5742 C CA  . GLY B 1 191 ? -6.178  19.025  -58.389 1.00 42.63  ? 191  GLY B CA  1 
ATOM   5743 C C   . GLY B 1 191 ? -5.358  19.282  -57.128 1.00 48.54  ? 191  GLY B C   1 
ATOM   5744 O O   . GLY B 1 191 ? -5.801  20.000  -56.240 1.00 46.55  ? 191  GLY B O   1 
ATOM   5745 N N   . GLY B 1 192 ? -4.167  18.693  -57.045 1.00 42.91  ? 192  GLY B N   1 
ATOM   5746 C CA  . GLY B 1 192 ? -3.292  18.883  -55.899 1.00 38.31  ? 192  GLY B CA  1 
ATOM   5747 C C   . GLY B 1 192 ? -2.459  20.152  -56.000 1.00 51.64  ? 192  GLY B C   1 
ATOM   5748 O O   . GLY B 1 192 ? -2.147  20.615  -57.092 1.00 59.53  ? 192  GLY B O   1 
ATOM   5749 N N   . ASP B 1 193 ? -2.111  20.724  -54.853 1.00 45.81  ? 193  ASP B N   1 
ATOM   5750 C CA  . ASP B 1 193 ? -1.297  21.933  -54.786 1.00 43.45  ? 193  ASP B CA  1 
ATOM   5751 C C   . ASP B 1 193 ? 0.161   21.552  -54.522 1.00 44.37  ? 193  ASP B C   1 
ATOM   5752 O O   . ASP B 1 193 ? 0.512   21.183  -53.403 1.00 45.14  ? 193  ASP B O   1 
ATOM   5753 C CB  . ASP B 1 193 ? -1.811  22.808  -53.641 1.00 49.64  ? 193  ASP B CB  1 
ATOM   5754 C CG  . ASP B 1 193 ? -1.169  24.194  -53.603 1.00 54.06  ? 193  ASP B CG  1 
ATOM   5755 O OD1 . ASP B 1 193 ? -0.132  24.405  -54.268 1.00 39.20  ? 193  ASP B OD1 1 
ATOM   5756 O OD2 . ASP B 1 193 ? -1.714  25.076  -52.890 1.00 49.69  ? 193  ASP B OD2 1 
ATOM   5757 N N   . PRO B 1 194 ? 1.026   21.659  -55.545 1.00 41.89  ? 194  PRO B N   1 
ATOM   5758 C CA  . PRO B 1 194 ? 2.427   21.272  -55.314 1.00 35.16  ? 194  PRO B CA  1 
ATOM   5759 C C   . PRO B 1 194 ? 3.163   22.265  -54.407 1.00 39.66  ? 194  PRO B C   1 
ATOM   5760 O O   . PRO B 1 194 ? 4.209   21.936  -53.835 1.00 36.64  ? 194  PRO B O   1 
ATOM   5761 C CB  . PRO B 1 194 ? 3.028   21.237  -56.721 1.00 37.18  ? 194  PRO B CB  1 
ATOM   5762 C CG  . PRO B 1 194 ? 2.142   22.162  -57.546 1.00 39.47  ? 194  PRO B CG  1 
ATOM   5763 C CD  . PRO B 1 194 ? 0.778   22.155  -56.912 1.00 39.32  ? 194  PRO B CD  1 
ATOM   5764 N N   . MET B 1 195 ? 2.605   23.458  -54.244 1.00 36.74  ? 195  MET B N   1 
ATOM   5765 C CA  . MET B 1 195 ? 3.162   24.409  -53.285 1.00 38.89  ? 195  MET B CA  1 
ATOM   5766 C C   . MET B 1 195 ? 2.679   24.196  -51.862 1.00 38.98  ? 195  MET B C   1 
ATOM   5767 O O   . MET B 1 195 ? 2.981   25.001  -50.989 1.00 47.21  ? 195  MET B O   1 
ATOM   5768 C CB  . MET B 1 195 ? 2.917   25.854  -53.712 1.00 39.01  ? 195  MET B CB  1 
ATOM   5769 C CG  . MET B 1 195 ? 3.656   26.219  -54.966 1.00 40.98  ? 195  MET B CG  1 
ATOM   5770 S SD  . MET B 1 195 ? 3.429   27.927  -55.383 1.00 63.22  ? 195  MET B SD  1 
ATOM   5771 C CE  . MET B 1 195 ? 1.678   28.131  -55.056 1.00 63.14  ? 195  MET B CE  1 
ATOM   5772 N N   . SER B 1 196 ? 1.958   23.110  -51.616 1.00 36.26  ? 196  SER B N   1 
ATOM   5773 C CA  . SER B 1 196 ? 1.605   22.746  -50.239 1.00 36.89  ? 196  SER B CA  1 
ATOM   5774 C C   . SER B 1 196 ? 1.650   21.239  -50.045 1.00 37.84  ? 196  SER B C   1 
ATOM   5775 O O   . SER B 1 196 ? 0.634   20.548  -50.170 1.00 34.11  ? 196  SER B O   1 
ATOM   5776 C CB  . SER B 1 196 ? 0.227   23.277  -49.854 1.00 34.52  ? 196  SER B CB  1 
ATOM   5777 O OG  . SER B 1 196 ? -0.094  22.847  -48.548 1.00 37.83  ? 196  SER B OG  1 
ATOM   5778 N N   . VAL B 1 197 ? 2.839   20.736  -49.741 1.00 28.68  ? 197  VAL B N   1 
ATOM   5779 C CA  . VAL B 1 197 ? 3.063   19.307  -49.664 1.00 27.22  ? 197  VAL B CA  1 
ATOM   5780 C C   . VAL B 1 197 ? 3.574   18.941  -48.292 1.00 27.29  ? 197  VAL B C   1 
ATOM   5781 O O   . VAL B 1 197 ? 4.579   19.478  -47.822 1.00 34.59  ? 197  VAL B O   1 
ATOM   5782 C CB  . VAL B 1 197 ? 4.063   18.850  -50.753 1.00 32.14  ? 197  VAL B CB  1 
ATOM   5783 C CG1 . VAL B 1 197 ? 4.509   17.413  -50.525 1.00 25.79  ? 197  VAL B CG1 1 
ATOM   5784 C CG2 . VAL B 1 197 ? 3.439   19.031  -52.153 1.00 29.08  ? 197  VAL B CG2 1 
ATOM   5785 N N   . THR B 1 198 ? 2.880   18.022  -47.642 1.00 26.42  ? 198  THR B N   1 
ATOM   5786 C CA  . THR B 1 198 ? 3.265   17.593  -46.306 1.00 23.96  ? 198  THR B CA  1 
ATOM   5787 C C   . THR B 1 198 ? 3.652   16.125  -46.324 1.00 30.87  ? 198  THR B C   1 
ATOM   5788 O O   . THR B 1 198 ? 2.852   15.274  -46.722 1.00 32.54  ? 198  THR B O   1 
ATOM   5789 C CB  . THR B 1 198 ? 2.101   17.783  -45.314 1.00 36.54  ? 198  THR B CB  1 
ATOM   5790 O OG1 . THR B 1 198 ? 1.686   19.155  -45.318 1.00 43.06  ? 198  THR B OG1 1 
ATOM   5791 C CG2 . THR B 1 198 ? 2.513   17.374  -43.904 1.00 23.52  ? 198  THR B CG2 1 
ATOM   5792 N N   . LEU B 1 199 ? 4.875   15.823  -45.908 1.00 22.17  ? 199  LEU B N   1 
ATOM   5793 C CA  . LEU B 1 199 ? 5.266   14.427  -45.731 1.00 28.66  ? 199  LEU B CA  1 
ATOM   5794 C C   . LEU B 1 199 ? 4.785   13.929  -44.375 1.00 28.51  ? 199  LEU B C   1 
ATOM   5795 O O   . LEU B 1 199 ? 4.898   14.641  -43.372 1.00 33.64  ? 199  LEU B O   1 
ATOM   5796 C CB  . LEU B 1 199 ? 6.788   14.262  -45.797 1.00 23.81  ? 199  LEU B CB  1 
ATOM   5797 C CG  . LEU B 1 199 ? 7.532   14.932  -46.952 1.00 27.96  ? 199  LEU B CG  1 
ATOM   5798 C CD1 . LEU B 1 199 ? 9.021   14.679  -46.782 1.00 25.73  ? 199  LEU B CD1 1 
ATOM   5799 C CD2 . LEU B 1 199 ? 7.026   14.446  -48.318 1.00 24.73  ? 199  LEU B CD2 1 
ATOM   5800 N N   . PHE B 1 200 ? 4.235   12.724  -44.340 1.00 24.84  ? 200  PHE B N   1 
ATOM   5801 C CA  . PHE B 1 200 ? 4.069   12.041  -43.064 1.00 26.21  ? 200  PHE B CA  1 
ATOM   5802 C C   . PHE B 1 200 ? 4.460   10.568  -43.147 1.00 29.95  ? 200  PHE B C   1 
ATOM   5803 O O   . PHE B 1 200 ? 4.356   9.951   -44.209 1.00 33.64  ? 200  PHE B O   1 
ATOM   5804 C CB  . PHE B 1 200 ? 2.684   12.285  -42.408 1.00 22.07  ? 200  PHE B CB  1 
ATOM   5805 C CG  . PHE B 1 200 ? 1.499   11.634  -43.107 1.00 28.98  ? 200  PHE B CG  1 
ATOM   5806 C CD1 . PHE B 1 200 ? 1.351   11.664  -44.490 1.00 30.48  ? 200  PHE B CD1 1 
ATOM   5807 C CD2 . PHE B 1 200 ? 0.488   11.048  -42.347 1.00 26.43  ? 200  PHE B CD2 1 
ATOM   5808 C CE1 . PHE B 1 200 ? 0.228   11.094  -45.098 1.00 33.48  ? 200  PHE B CE1 1 
ATOM   5809 C CE2 . PHE B 1 200 ? -0.631  10.478  -42.946 1.00 24.72  ? 200  PHE B CE2 1 
ATOM   5810 C CZ  . PHE B 1 200 ? -0.760  10.498  -44.326 1.00 33.85  ? 200  PHE B CZ  1 
ATOM   5811 N N   . GLY B 1 201 ? 4.941   10.024  -42.030 1.00 30.08  ? 201  GLY B N   1 
ATOM   5812 C CA  . GLY B 1 201 ? 5.391   8.645   -41.978 1.00 30.28  ? 201  GLY B CA  1 
ATOM   5813 C C   . GLY B 1 201 ? 5.496   8.124   -40.559 1.00 35.98  ? 201  GLY B C   1 
ATOM   5814 O O   . GLY B 1 201 ? 5.518   8.895   -39.603 1.00 39.61  ? 201  GLY B O   1 
ATOM   5815 N N   . GLU B 1 202 ? 5.557   6.805   -40.422 1.00 32.30  ? 202  GLU B N   1 
ATOM   5816 C CA  . GLU B 1 202 ? 5.624   6.188   -39.112 1.00 30.56  ? 202  GLU B CA  1 
ATOM   5817 C C   . GLU B 1 202 ? 6.816   5.239   -39.023 1.00 34.62  ? 202  GLU B C   1 
ATOM   5818 O O   . GLU B 1 202 ? 7.155   4.573   -40.006 1.00 30.16  ? 202  GLU B O   1 
ATOM   5819 C CB  . GLU B 1 202 ? 4.328   5.454   -38.797 1.00 23.80  ? 202  GLU B CB  1 
ATOM   5820 C CG  . GLU B 1 202 ? 4.246   4.877   -37.371 1.00 26.18  ? 202  GLU B CG  1 
ATOM   5821 C CD  . GLU B 1 202 ? 4.766   3.456   -37.280 1.00 33.56  ? 202  GLU B CD  1 
ATOM   5822 O OE1 . GLU B 1 202 ? 5.034   2.855   -38.336 1.00 32.12  ? 202  GLU B OE1 1 
ATOM   5823 O OE2 . GLU B 1 202 ? 4.910   2.937   -36.154 1.00 38.37  ? 202  GLU B OE2 1 
HETATM 5824 N N   . SGB B 1 203 ? 7.454   5.206   -37.850 1.00 33.29  ? 203  SGB B N   1 
HETATM 5825 C CA  . SGB B 1 203 ? 8.586   4.335   -37.602 1.00 28.42  ? 203  SGB B CA  1 
HETATM 5826 C C   . SGB B 1 203 ? 9.651   4.585   -38.642 1.00 28.34  ? 203  SGB B C   1 
HETATM 5827 O O   . SGB B 1 203 ? 10.065  5.715   -38.845 1.00 25.74  ? 203  SGB B O   1 
HETATM 5828 C CB  . SGB B 1 203 ? 8.134   2.881   -37.677 1.00 28.11  ? 203  SGB B CB  1 
HETATM 5829 O OG  . SGB B 1 203 ? 9.129   2.044   -37.092 1.00 35.51  ? 203  SGB B OG  1 
HETATM 5830 O O1  . SGB B 1 203 ? 9.979   1.050   -39.347 0.30 24.65  ? 203  SGB B O1  1 
HETATM 5831 P P1  . SGB B 1 203 ? 9.708   0.771   -37.901 0.30 33.29  ? 203  SGB B P1  1 
HETATM 5832 C C1  . SGB B 1 203 ? 11.139  0.268   -36.972 0.30 36.62  ? 203  SGB B C1  1 
HETATM 5833 O O2  . SGB B 1 203 ? 8.590   -0.365  -37.661 0.30 27.46  ? 203  SGB B O2  1 
HETATM 5834 C C2  . SGB B 1 203 ? 8.951   -1.633  -37.119 0.30 34.22  ? 203  SGB B C2  1 
HETATM 5835 C C4  . SGB B 1 203 ? 9.389   -2.561  -38.246 0.30 29.32  ? 203  SGB B C4  1 
HETATM 5836 C C3  . SGB B 1 203 ? 7.765   -2.217  -36.361 0.30 37.14  ? 203  SGB B C3  1 
ATOM   5837 N N   . ALA B 1 204 ? 10.091  3.585   -39.411 1.00 23.34  ? 204  ALA B N   1 
ATOM   5838 C CA  . ALA B 1 204 ? 11.095  3.896   -40.450 1.00 30.54  ? 204  ALA B CA  1 
ATOM   5839 C C   . ALA B 1 204 ? 10.627  4.913   -41.508 1.00 29.53  ? 204  ALA B C   1 
ATOM   5840 O O   . ALA B 1 204 ? 11.444  5.589   -42.134 1.00 26.02  ? 204  ALA B O   1 
ATOM   5841 C CB  . ALA B 1 204 ? 11.669  2.635   -41.126 1.00 31.46  ? 204  ALA B CB  1 
ATOM   5842 N N   . GLY B 1 205 ? 9.320   5.025   -41.697 1.00 32.98  ? 205  GLY B N   1 
ATOM   5843 C CA  . GLY B 1 205 ? 8.782   6.070   -42.554 1.00 33.84  ? 205  GLY B CA  1 
ATOM   5844 C C   . GLY B 1 205 ? 9.054   7.455   -41.977 1.00 27.75  ? 205  GLY B C   1 
ATOM   5845 O O   . GLY B 1 205 ? 9.417   8.382   -42.706 1.00 27.96  ? 205  GLY B O   1 
ATOM   5846 N N   . ALA B 1 206 ? 8.899   7.587   -40.661 1.00 26.70  ? 206  ALA B N   1 
ATOM   5847 C CA  . ALA B 1 206 ? 9.182   8.843   -39.963 1.00 25.43  ? 206  ALA B CA  1 
ATOM   5848 C C   . ALA B 1 206 ? 10.658  9.195   -40.081 1.00 27.02  ? 206  ALA B C   1 
ATOM   5849 O O   . ALA B 1 206 ? 11.017  10.338  -40.346 1.00 31.27  ? 206  ALA B O   1 
ATOM   5850 C CB  . ALA B 1 206 ? 8.761   8.748   -38.481 1.00 25.14  ? 206  ALA B CB  1 
ATOM   5851 N N   . ALA B 1 207 ? 11.516  8.201   -39.889 1.00 30.85  ? 207  ALA B N   1 
ATOM   5852 C CA  . ALA B 1 207 ? 12.941  8.400   -40.074 1.00 27.95  ? 207  ALA B CA  1 
ATOM   5853 C C   . ALA B 1 207 ? 13.232  8.862   -41.508 1.00 30.50  ? 207  ALA B C   1 
ATOM   5854 O O   . ALA B 1 207 ? 14.042  9.774   -41.724 1.00 25.09  ? 207  ALA B O   1 
ATOM   5855 C CB  . ALA B 1 207 ? 13.678  7.128   -39.756 1.00 30.88  ? 207  ALA B CB  1 
ATOM   5856 N N   . SER B 1 208 ? 12.556  8.257   -42.485 1.00 28.90  ? 208  SER B N   1 
ATOM   5857 C CA  . SER B 1 208 ? 12.752  8.647   -43.887 1.00 27.84  ? 208  SER B CA  1 
ATOM   5858 C C   . SER B 1 208 ? 12.402  10.113  -44.059 1.00 28.56  ? 208  SER B C   1 
ATOM   5859 O O   . SER B 1 208 ? 13.189  10.893  -44.593 1.00 28.51  ? 208  SER B O   1 
ATOM   5860 C CB  . SER B 1 208 ? 11.905  7.793   -44.835 1.00 27.26  ? 208  SER B CB  1 
ATOM   5861 O OG  . SER B 1 208 ? 12.257  6.429   -44.728 1.00 32.24  ? 208  SER B OG  1 
ATOM   5862 N N   . VAL B 1 209 ? 11.214  10.481  -43.596 1.00 25.09  ? 209  VAL B N   1 
ATOM   5863 C CA  . VAL B 1 209 ? 10.819  11.883  -43.550 1.00 25.01  ? 209  VAL B CA  1 
ATOM   5864 C C   . VAL B 1 209 ? 11.916  12.746  -42.915 1.00 26.16  ? 209  VAL B C   1 
ATOM   5865 O O   . VAL B 1 209 ? 12.290  13.785  -43.459 1.00 31.73  ? 209  VAL B O   1 
ATOM   5866 C CB  . VAL B 1 209 ? 9.498   12.045  -42.786 1.00 20.92  ? 209  VAL B CB  1 
ATOM   5867 C CG1 . VAL B 1 209 ? 9.217   13.506  -42.514 1.00 20.15  ? 209  VAL B CG1 1 
ATOM   5868 C CG2 . VAL B 1 209 ? 8.378   11.411  -43.586 1.00 21.40  ? 209  VAL B CG2 1 
ATOM   5869 N N   . GLY B 1 210 ? 12.452  12.287  -41.787 1.00 24.22  ? 210  GLY B N   1 
ATOM   5870 C CA  . GLY B 1 210 ? 13.610  12.921  -41.159 1.00 26.01  ? 210  GLY B CA  1 
ATOM   5871 C C   . GLY B 1 210 ? 14.809  13.117  -42.084 1.00 32.40  ? 210  GLY B C   1 
ATOM   5872 O O   . GLY B 1 210 ? 15.377  14.210  -42.129 1.00 31.02  ? 210  GLY B O   1 
ATOM   5873 N N   . MET B 1 211 ? 15.195  12.075  -42.828 1.00 29.92  ? 211  MET B N   1 
ATOM   5874 C CA  . MET B 1 211 ? 16.301  12.199  -43.773 1.00 30.68  ? 211  MET B CA  1 
ATOM   5875 C C   . MET B 1 211 ? 16.012  13.278  -44.826 1.00 36.75  ? 211  MET B C   1 
ATOM   5876 O O   . MET B 1 211 ? 16.914  14.041  -45.211 1.00 38.25  ? 211  MET B O   1 
ATOM   5877 C CB  . MET B 1 211 ? 16.556  10.889  -44.503 1.00 36.11  ? 211  MET B CB  1 
ATOM   5878 C CG  . MET B 1 211 ? 16.455  9.648   -43.653 1.00 38.97  ? 211  MET B CG  1 
ATOM   5879 S SD  . MET B 1 211 ? 17.933  9.319   -42.704 1.00 53.42  ? 211  MET B SD  1 
ATOM   5880 C CE  . MET B 1 211 ? 17.457  7.767   -41.946 1.00 42.57  ? 211  MET B CE  1 
ATOM   5881 N N   . HIS B 1 212 ? 14.767  13.329  -45.304 1.00 26.02  ? 212  HIS B N   1 
ATOM   5882 C CA  . HIS B 1 212 ? 14.394  14.332  -46.299 1.00 32.03  ? 212  HIS B CA  1 
ATOM   5883 C C   . HIS B 1 212 ? 14.532  15.760  -45.766 1.00 34.08  ? 212  HIS B C   1 
ATOM   5884 O O   . HIS B 1 212 ? 14.989  16.630  -46.488 1.00 38.66  ? 212  HIS B O   1 
ATOM   5885 C CB  . HIS B 1 212 ? 13.004  14.065  -46.894 1.00 27.60  ? 212  HIS B CB  1 
ATOM   5886 C CG  . HIS B 1 212 ? 12.953  12.832  -47.743 1.00 31.60  ? 212  HIS B CG  1 
ATOM   5887 N ND1 . HIS B 1 212 ? 13.696  12.693  -48.896 1.00 34.22  ? 212  HIS B ND1 1 
ATOM   5888 C CD2 . HIS B 1 212 ? 12.271  11.671  -47.593 1.00 27.87  ? 212  HIS B CD2 1 
ATOM   5889 C CE1 . HIS B 1 212 ? 13.474  11.500  -49.419 1.00 31.82  ? 212  HIS B CE1 1 
ATOM   5890 N NE2 . HIS B 1 212 ? 12.614  10.859  -48.647 1.00 27.01  ? 212  HIS B NE2 1 
ATOM   5891 N N   . ILE B 1 213 ? 14.155  15.986  -44.508 1.00 28.54  ? 213  ILE B N   1 
ATOM   5892 C CA  . ILE B 1 213 ? 14.424  17.256  -43.836 1.00 30.15  ? 213  ILE B CA  1 
ATOM   5893 C C   . ILE B 1 213 ? 15.921  17.582  -43.857 1.00 32.12  ? 213  ILE B C   1 
ATOM   5894 O O   . ILE B 1 213 ? 16.323  18.734  -44.073 1.00 35.01  ? 213  ILE B O   1 
ATOM   5895 C CB  . ILE B 1 213 ? 13.944  17.222  -42.368 1.00 27.82  ? 213  ILE B CB  1 
ATOM   5896 C CG1 . ILE B 1 213 ? 12.419  17.175  -42.316 1.00 26.87  ? 213  ILE B CG1 1 
ATOM   5897 C CG2 . ILE B 1 213 ? 14.459  18.433  -41.594 1.00 25.08  ? 213  ILE B CG2 1 
ATOM   5898 C CD1 . ILE B 1 213 ? 11.870  16.848  -40.950 1.00 22.47  ? 213  ILE B CD1 1 
ATOM   5899 N N   . LEU B 1 214 ? 16.738  16.551  -43.654 1.00 27.57  ? 214  LEU B N   1 
ATOM   5900 C CA  . LEU B 1 214 ? 18.181  16.711  -43.479 1.00 32.91  ? 214  LEU B CA  1 
ATOM   5901 C C   . LEU B 1 214 ? 18.990  16.609  -44.783 1.00 39.13  ? 214  LEU B C   1 
ATOM   5902 O O   . LEU B 1 214 ? 20.224  16.703  -44.765 1.00 39.74  ? 214  LEU B O   1 
ATOM   5903 C CB  . LEU B 1 214 ? 18.697  15.696  -42.446 1.00 33.51  ? 214  LEU B CB  1 
ATOM   5904 C CG  . LEU B 1 214 ? 18.140  15.843  -41.022 1.00 35.69  ? 214  LEU B CG  1 
ATOM   5905 C CD1 . LEU B 1 214 ? 18.608  14.717  -40.117 1.00 33.86  ? 214  LEU B CD1 1 
ATOM   5906 C CD2 . LEU B 1 214 ? 18.553  17.193  -40.433 1.00 30.71  ? 214  LEU B CD2 1 
ATOM   5907 N N   . SER B 1 215 ? 18.306  16.413  -45.909 1.00 35.57  ? 215  SER B N   1 
ATOM   5908 C CA  . SER B 1 215 ? 18.988  16.309  -47.204 1.00 31.84  ? 215  SER B CA  1 
ATOM   5909 C C   . SER B 1 215 ? 18.520  17.393  -48.186 1.00 33.48  ? 215  SER B C   1 
ATOM   5910 O O   . SER B 1 215 ? 17.379  17.372  -48.658 1.00 35.77  ? 215  SER B O   1 
ATOM   5911 C CB  . SER B 1 215 ? 18.807  14.909  -47.804 1.00 30.87  ? 215  SER B CB  1 
ATOM   5912 O OG  . SER B 1 215 ? 19.641  14.707  -48.939 1.00 30.90  ? 215  SER B OG  1 
ATOM   5913 N N   . LEU B 1 216 ? 19.411  18.338  -48.474 1.00 35.88  ? 216  LEU B N   1 
ATOM   5914 C CA  . LEU B 1 216 ? 19.078  19.532  -49.255 1.00 43.18  ? 216  LEU B CA  1 
ATOM   5915 C C   . LEU B 1 216 ? 18.271  19.314  -50.542 1.00 42.60  ? 216  LEU B C   1 
ATOM   5916 O O   . LEU B 1 216 ? 17.224  19.930  -50.716 1.00 45.26  ? 216  LEU B O   1 
ATOM   5917 C CB  . LEU B 1 216 ? 20.330  20.353  -49.555 1.00 52.17  ? 216  LEU B CB  1 
ATOM   5918 C CG  . LEU B 1 216 ? 20.237  21.778  -49.029 1.00 61.31  ? 216  LEU B CG  1 
ATOM   5919 C CD1 . LEU B 1 216 ? 20.143  21.771  -47.490 1.00 57.55  ? 216  LEU B CD1 1 
ATOM   5920 C CD2 . LEU B 1 216 ? 21.428  22.598  -49.533 1.00 65.30  ? 216  LEU B CD2 1 
ATOM   5921 N N   . PRO B 1 217 ? 18.743  18.442  -51.444 1.00 37.99  ? 217  PRO B N   1 
ATOM   5922 C CA  . PRO B 1 217 ? 17.959  18.248  -52.671 1.00 46.00  ? 217  PRO B CA  1 
ATOM   5923 C C   . PRO B 1 217 ? 16.487  17.859  -52.429 1.00 41.86  ? 217  PRO B C   1 
ATOM   5924 O O   . PRO B 1 217 ? 15.654  18.095  -53.301 1.00 45.71  ? 217  PRO B O   1 
ATOM   5925 C CB  . PRO B 1 217 ? 18.706  17.112  -53.385 1.00 40.23  ? 217  PRO B CB  1 
ATOM   5926 C CG  . PRO B 1 217 ? 20.090  17.187  -52.851 1.00 35.42  ? 217  PRO B CG  1 
ATOM   5927 C CD  . PRO B 1 217 ? 19.937  17.583  -51.421 1.00 36.12  ? 217  PRO B CD  1 
ATOM   5928 N N   . SER B 1 218 ? 16.173  17.301  -51.263 1.00 38.03  ? 218  SER B N   1 
ATOM   5929 C CA  . SER B 1 218 ? 14.782  16.980  -50.929 1.00 33.28  ? 218  SER B CA  1 
ATOM   5930 C C   . SER B 1 218 ? 13.947  18.178  -50.503 1.00 39.02  ? 218  SER B C   1 
ATOM   5931 O O   . SER B 1 218 ? 12.728  18.144  -50.631 1.00 39.22  ? 218  SER B O   1 
ATOM   5932 C CB  . SER B 1 218 ? 14.710  15.940  -49.824 1.00 27.15  ? 218  SER B CB  1 
ATOM   5933 O OG  . SER B 1 218 ? 14.906  14.634  -50.323 1.00 29.56  ? 218  SER B OG  1 
ATOM   5934 N N   . ARG B 1 219 ? 14.599  19.227  -50.001 1.00 43.37  ? 219  ARG B N   1 
ATOM   5935 C CA  . ARG B 1 219 ? 13.902  20.327  -49.329 1.00 40.99  ? 219  ARG B CA  1 
ATOM   5936 C C   . ARG B 1 219 ? 13.019  21.167  -50.244 1.00 39.75  ? 219  ARG B C   1 
ATOM   5937 O O   . ARG B 1 219 ? 12.030  21.741  -49.799 1.00 41.48  ? 219  ARG B O   1 
ATOM   5938 C CB  . ARG B 1 219 ? 14.879  21.209  -48.542 1.00 45.88  ? 219  ARG B CB  1 
ATOM   5939 C CG  . ARG B 1 219 ? 15.367  20.576  -47.223 1.00 52.18  ? 219  ARG B CG  1 
ATOM   5940 C CD  . ARG B 1 219 ? 14.226  20.323  -46.215 1.00 53.99  ? 219  ARG B CD  1 
ATOM   5941 N NE  . ARG B 1 219 ? 13.460  21.530  -45.893 1.00 64.15  ? 219  ARG B NE  1 
ATOM   5942 C CZ  . ARG B 1 219 ? 13.758  22.382  -44.910 1.00 68.37  ? 219  ARG B CZ  1 
ATOM   5943 N NH1 . ARG B 1 219 ? 14.817  22.172  -44.134 1.00 66.44  ? 219  ARG B NH1 1 
ATOM   5944 N NH2 . ARG B 1 219 ? 12.997  23.454  -44.708 1.00 68.60  ? 219  ARG B NH2 1 
ATOM   5945 N N   . SER B 1 220 ? 13.349  21.223  -51.524 1.00 39.22  ? 220  SER B N   1 
ATOM   5946 C CA  . SER B 1 220 ? 12.507  21.956  -52.452 1.00 43.23  ? 220  SER B CA  1 
ATOM   5947 C C   . SER B 1 220 ? 11.243  21.162  -52.838 1.00 38.67  ? 220  SER B C   1 
ATOM   5948 O O   . SER B 1 220 ? 10.435  21.613  -53.652 1.00 40.75  ? 220  SER B O   1 
ATOM   5949 C CB  . SER B 1 220 ? 13.305  22.359  -53.701 1.00 47.73  ? 220  SER B CB  1 
ATOM   5950 O OG  . SER B 1 220 ? 13.505  21.252  -54.565 1.00 57.54  ? 220  SER B OG  1 
ATOM   5951 N N   . LEU B 1 221 ? 11.066  19.985  -52.255 1.00 31.58  ? 221  LEU B N   1 
ATOM   5952 C CA  . LEU B 1 221 ? 9.978   19.109  -52.675 1.00 32.24  ? 221  LEU B CA  1 
ATOM   5953 C C   . LEU B 1 221 ? 8.856   18.954  -51.636 1.00 33.53  ? 221  LEU B C   1 
ATOM   5954 O O   . LEU B 1 221 ? 7.886   18.242  -51.867 1.00 39.71  ? 221  LEU B O   1 
ATOM   5955 C CB  . LEU B 1 221 ? 10.530  17.730  -53.061 1.00 30.71  ? 221  LEU B CB  1 
ATOM   5956 C CG  . LEU B 1 221 ? 11.707  17.666  -54.037 1.00 33.91  ? 221  LEU B CG  1 
ATOM   5957 C CD1 . LEU B 1 221 ? 12.207  16.225  -54.166 1.00 28.40  ? 221  LEU B CD1 1 
ATOM   5958 C CD2 . LEU B 1 221 ? 11.351  18.267  -55.408 1.00 31.43  ? 221  LEU B CD2 1 
ATOM   5959 N N   . PHE B 1 222 ? 8.994   19.600  -50.487 1.00 35.85  ? 222  PHE B N   1 
ATOM   5960 C CA  . PHE B 1 222 ? 7.937   19.583  -49.480 1.00 33.75  ? 222  PHE B CA  1 
ATOM   5961 C C   . PHE B 1 222 ? 8.075   20.784  -48.544 1.00 36.35  ? 222  PHE B C   1 
ATOM   5962 O O   . PHE B 1 222 ? 9.095   21.471  -48.550 1.00 32.47  ? 222  PHE B O   1 
ATOM   5963 C CB  . PHE B 1 222 ? 7.953   18.276  -48.692 1.00 28.83  ? 222  PHE B CB  1 
ATOM   5964 C CG  . PHE B 1 222 ? 9.149   18.126  -47.804 1.00 30.10  ? 222  PHE B CG  1 
ATOM   5965 C CD1 . PHE B 1 222 ? 10.393  17.802  -48.344 1.00 26.02  ? 222  PHE B CD1 1 
ATOM   5966 C CD2 . PHE B 1 222 ? 9.034   18.319  -46.429 1.00 28.13  ? 222  PHE B CD2 1 
ATOM   5967 C CE1 . PHE B 1 222 ? 11.502  17.673  -47.533 1.00 31.35  ? 222  PHE B CE1 1 
ATOM   5968 C CE2 . PHE B 1 222 ? 10.139  18.192  -45.601 1.00 35.00  ? 222  PHE B CE2 1 
ATOM   5969 C CZ  . PHE B 1 222 ? 11.381  17.866  -46.156 1.00 40.46  ? 222  PHE B CZ  1 
ATOM   5970 N N   . HIS B 1 223 ? 7.045   21.031  -47.738 1.00 41.15  ? 223  HIS B N   1 
ATOM   5971 C CA  . HIS B 1 223 ? 6.977   22.248  -46.933 1.00 34.32  ? 223  HIS B CA  1 
ATOM   5972 C C   . HIS B 1 223 ? 6.840   21.951  -45.454 1.00 33.62  ? 223  HIS B C   1 
ATOM   5973 O O   . HIS B 1 223 ? 7.374   22.683  -44.618 1.00 37.30  ? 223  HIS B O   1 
ATOM   5974 C CB  . HIS B 1 223 ? 5.811   23.108  -47.403 1.00 32.38  ? 223  HIS B CB  1 
ATOM   5975 C CG  . HIS B 1 223 ? 5.766   23.268  -48.886 1.00 42.31  ? 223  HIS B CG  1 
ATOM   5976 N ND1 . HIS B 1 223 ? 5.190   22.329  -49.715 1.00 42.89  ? 223  HIS B ND1 1 
ATOM   5977 C CD2 . HIS B 1 223 ? 6.272   24.228  -49.694 1.00 39.45  ? 223  HIS B CD2 1 
ATOM   5978 C CE1 . HIS B 1 223 ? 5.325   22.714  -50.970 1.00 39.50  ? 223  HIS B CE1 1 
ATOM   5979 N NE2 . HIS B 1 223 ? 5.979   23.862  -50.984 1.00 42.25  ? 223  HIS B NE2 1 
ATOM   5980 N N   . ARG B 1 224 ? 6.121   20.875  -45.141 1.00 32.12  ? 224  ARG B N   1 
ATOM   5981 C CA  . ARG B 1 224 ? 5.920   20.447  -43.764 1.00 32.17  ? 224  ARG B CA  1 
ATOM   5982 C C   . ARG B 1 224 ? 6.135   18.938  -43.606 1.00 33.48  ? 224  ARG B C   1 
ATOM   5983 O O   . ARG B 1 224 ? 6.074   18.190  -44.587 1.00 31.60  ? 224  ARG B O   1 
ATOM   5984 C CB  . ARG B 1 224 ? 4.519   20.832  -43.309 1.00 29.40  ? 224  ARG B CB  1 
ATOM   5985 C CG  . ARG B 1 224 ? 4.341   22.314  -43.222 1.00 39.68  ? 224  ARG B CG  1 
ATOM   5986 C CD  . ARG B 1 224 ? 2.895   22.720  -43.086 1.00 39.07  ? 224  ARG B CD  1 
ATOM   5987 N NE  . ARG B 1 224 ? 2.203   22.758  -44.363 1.00 45.16  ? 224  ARG B NE  1 
ATOM   5988 C CZ  . ARG B 1 224 ? 2.327   23.741  -45.246 1.00 49.69  ? 224  ARG B CZ  1 
ATOM   5989 N NH1 . ARG B 1 224 ? 3.135   24.767  -44.989 1.00 44.04  ? 224  ARG B NH1 1 
ATOM   5990 N NH2 . ARG B 1 224 ? 1.651   23.685  -46.390 1.00 54.32  ? 224  ARG B NH2 1 
ATOM   5991 N N   . ALA B 1 225 ? 6.360   18.504  -42.365 1.00 24.79  ? 225  ALA B N   1 
ATOM   5992 C CA  . ALA B 1 225 ? 6.679   17.118  -42.077 1.00 25.61  ? 225  ALA B CA  1 
ATOM   5993 C C   . ALA B 1 225 ? 6.018   16.629  -40.799 1.00 30.47  ? 225  ALA B C   1 
ATOM   5994 O O   . ALA B 1 225 ? 5.889   17.368  -39.820 1.00 35.02  ? 225  ALA B O   1 
ATOM   5995 C CB  . ALA B 1 225 ? 8.193   16.947  -41.978 1.00 29.57  ? 225  ALA B CB  1 
ATOM   5996 N N   . VAL B 1 226 ? 5.600   15.373  -40.820 1.00 30.51  ? 226  VAL B N   1 
ATOM   5997 C CA  . VAL B 1 226 ? 5.078   14.707  -39.637 1.00 34.79  ? 226  VAL B CA  1 
ATOM   5998 C C   . VAL B 1 226 ? 5.897   13.444  -39.424 1.00 32.06  ? 226  VAL B C   1 
ATOM   5999 O O   . VAL B 1 226 ? 6.053   12.648  -40.357 1.00 25.15  ? 226  VAL B O   1 
ATOM   6000 C CB  . VAL B 1 226 ? 3.589   14.304  -39.809 1.00 29.88  ? 226  VAL B CB  1 
ATOM   6001 C CG1 . VAL B 1 226 ? 3.045   13.618  -38.543 1.00 22.56  ? 226  VAL B CG1 1 
ATOM   6002 C CG2 . VAL B 1 226 ? 2.730   15.522  -40.205 1.00 26.63  ? 226  VAL B CG2 1 
ATOM   6003 N N   . LEU B 1 227 ? 6.429   13.274  -38.214 1.00 27.26  ? 227  LEU B N   1 
ATOM   6004 C CA  . LEU B 1 227 ? 7.198   12.081  -37.881 1.00 29.16  ? 227  LEU B CA  1 
ATOM   6005 C C   . LEU B 1 227 ? 6.514   11.338  -36.760 1.00 27.11  ? 227  LEU B C   1 
ATOM   6006 O O   . LEU B 1 227 ? 6.549   11.769  -35.614 1.00 28.97  ? 227  LEU B O   1 
ATOM   6007 C CB  . LEU B 1 227 ? 8.633   12.424  -37.465 1.00 27.96  ? 227  LEU B CB  1 
ATOM   6008 C CG  . LEU B 1 227 ? 9.594   12.940  -38.546 1.00 32.11  ? 227  LEU B CG  1 
ATOM   6009 C CD1 . LEU B 1 227 ? 9.338   14.417  -38.834 1.00 24.88  ? 227  LEU B CD1 1 
ATOM   6010 C CD2 . LEU B 1 227 ? 11.087  12.710  -38.167 1.00 21.29  ? 227  LEU B CD2 1 
ATOM   6011 N N   . GLN B 1 228 ? 5.881   10.222  -37.089 1.00 30.25  ? 228  GLN B N   1 
ATOM   6012 C CA  . GLN B 1 228 ? 5.219   9.394   -36.081 1.00 32.05  ? 228  GLN B CA  1 
ATOM   6013 C C   . GLN B 1 228 ? 6.125   8.240   -35.646 1.00 32.33  ? 228  GLN B C   1 
ATOM   6014 O O   . GLN B 1 228 ? 6.440   7.372   -36.442 1.00 35.74  ? 228  GLN B O   1 
ATOM   6015 C CB  . GLN B 1 228 ? 3.906   8.841   -36.645 1.00 29.64  ? 228  GLN B CB  1 
ATOM   6016 C CG  . GLN B 1 228 ? 3.025   9.913   -37.283 1.00 24.91  ? 228  GLN B CG  1 
ATOM   6017 C CD  . GLN B 1 228 ? 1.845   9.345   -38.078 1.00 30.53  ? 228  GLN B CD  1 
ATOM   6018 O OE1 . GLN B 1 228 ? 1.332   9.996   -38.991 1.00 27.78  ? 228  GLN B OE1 1 
ATOM   6019 N NE2 . GLN B 1 228 ? 1.404   8.138   -37.726 1.00 27.68  ? 228  GLN B NE2 1 
ATOM   6020 N N   . SER B 1 229 ? 6.565   8.252   -34.394 1.00 27.54  ? 229  SER B N   1 
ATOM   6021 C CA  . SER B 1 229 ? 7.280   7.119   -33.811 1.00 28.10  ? 229  SER B CA  1 
ATOM   6022 C C   . SER B 1 229 ? 8.551   6.739   -34.554 1.00 27.23  ? 229  SER B C   1 
ATOM   6023 O O   . SER B 1 229 ? 8.818   5.567   -34.741 1.00 32.50  ? 229  SER B O   1 
ATOM   6024 C CB  . SER B 1 229 ? 6.379   5.879   -33.731 1.00 29.28  ? 229  SER B CB  1 
ATOM   6025 O OG  . SER B 1 229 ? 5.206   6.137   -32.985 1.00 32.45  ? 229  SER B OG  1 
ATOM   6026 N N   . GLY B 1 230 ? 9.329   7.719   -34.979 1.00 25.97  ? 230  GLY B N   1 
ATOM   6027 C CA  . GLY B 1 230 ? 10.585  7.436   -35.653 1.00 26.21  ? 230  GLY B CA  1 
ATOM   6028 C C   . GLY B 1 230 ? 11.314  8.727   -35.974 1.00 26.74  ? 230  GLY B C   1 
ATOM   6029 O O   . GLY B 1 230 ? 10.684  9.757   -36.127 1.00 29.11  ? 230  GLY B O   1 
ATOM   6030 N N   . THR B 1 231 ? 12.639  8.674   -36.053 1.00 22.99  ? 231  THR B N   1 
ATOM   6031 C CA  . THR B 1 231 ? 13.464  9.865   -36.212 1.00 26.48  ? 231  THR B CA  1 
ATOM   6032 C C   . THR B 1 231 ? 14.674  9.455   -37.015 1.00 24.76  ? 231  THR B C   1 
ATOM   6033 O O   . THR B 1 231 ? 15.027  8.278   -37.026 1.00 29.65  ? 231  THR B O   1 
ATOM   6034 C CB  . THR B 1 231 ? 13.997  10.390  -34.854 1.00 28.92  ? 231  THR B CB  1 
ATOM   6035 O OG1 . THR B 1 231 ? 14.744  9.355   -34.210 1.00 29.66  ? 231  THR B OG1 1 
ATOM   6036 C CG2 . THR B 1 231 ? 12.868  10.837  -33.939 1.00 24.50  ? 231  THR B CG2 1 
ATOM   6037 N N   . PRO B 1 232 ? 15.318  10.418  -37.695 1.00 27.79  ? 232  PRO B N   1 
ATOM   6038 C CA  . PRO B 1 232 ? 16.542  10.086  -38.440 1.00 25.57  ? 232  PRO B CA  1 
ATOM   6039 C C   . PRO B 1 232 ? 17.706  9.913   -37.480 1.00 27.61  ? 232  PRO B C   1 
ATOM   6040 O O   . PRO B 1 232 ? 18.673  9.233   -37.797 1.00 32.30  ? 232  PRO B O   1 
ATOM   6041 C CB  . PRO B 1 232 ? 16.766  11.331  -39.320 1.00 26.12  ? 232  PRO B CB  1 
ATOM   6042 C CG  . PRO B 1 232 ? 16.126  12.466  -38.522 1.00 26.93  ? 232  PRO B CG  1 
ATOM   6043 C CD  . PRO B 1 232 ? 14.890  11.816  -37.923 1.00 27.66  ? 232  PRO B CD  1 
ATOM   6044 N N   . ASN B 1 233 ? 17.614  10.549  -36.318 1.00 32.05  ? 233  ASN B N   1 
ATOM   6045 C CA  . ASN B 1 233 ? 18.636  10.417  -35.294 1.00 34.48  ? 233  ASN B CA  1 
ATOM   6046 C C   . ASN B 1 233 ? 18.292  9.175   -34.503 1.00 38.41  ? 233  ASN B C   1 
ATOM   6047 O O   . ASN B 1 233 ? 17.232  8.600   -34.708 1.00 26.64  ? 233  ASN B O   1 
ATOM   6048 C CB  . ASN B 1 233 ? 18.667  11.657  -34.390 1.00 28.30  ? 233  ASN B CB  1 
ATOM   6049 C CG  . ASN B 1 233 ? 17.300  11.968  -33.757 1.00 32.10  ? 233  ASN B CG  1 
ATOM   6050 O OD1 . ASN B 1 233 ? 16.356  12.352  -34.446 1.00 30.57  ? 233  ASN B OD1 1 
ATOM   6051 N ND2 . ASN B 1 233 ? 17.203  11.814  -32.439 1.00 28.69  ? 233  ASN B ND2 1 
ATOM   6052 N N   . GLY B 1 234 ? 19.180  8.754   -33.609 1.00 41.83  ? 234  GLY B N   1 
ATOM   6053 C CA  . GLY B 1 234 ? 18.919  7.576   -32.804 1.00 41.41  ? 234  GLY B CA  1 
ATOM   6054 C C   . GLY B 1 234 ? 19.732  6.365   -33.223 1.00 42.07  ? 234  GLY B C   1 
ATOM   6055 O O   . GLY B 1 234 ? 20.513  6.434   -34.170 1.00 41.23  ? 234  GLY B O   1 
ATOM   6056 N N   . PRO B 1 235 ? 19.525  5.235   -32.536 1.00 36.32  ? 235  PRO B N   1 
ATOM   6057 C CA  . PRO B 1 235 ? 20.455  4.106   -32.635 1.00 37.46  ? 235  PRO B CA  1 
ATOM   6058 C C   . PRO B 1 235 ? 20.188  3.076   -33.756 1.00 40.37  ? 235  PRO B C   1 
ATOM   6059 O O   . PRO B 1 235 ? 21.067  2.238   -33.984 1.00 41.81  ? 235  PRO B O   1 
ATOM   6060 C CB  . PRO B 1 235 ? 20.343  3.456   -31.248 1.00 43.35  ? 235  PRO B CB  1 
ATOM   6061 C CG  . PRO B 1 235 ? 18.919  3.769   -30.792 1.00 39.76  ? 235  PRO B CG  1 
ATOM   6062 C CD  . PRO B 1 235 ? 18.458  5.007   -31.541 1.00 36.84  ? 235  PRO B CD  1 
ATOM   6063 N N   . TRP B 1 236 ? 19.046  3.140   -34.445 1.00 34.52  ? 236  TRP B N   1 
ATOM   6064 C CA  . TRP B 1 236 ? 18.694  2.115   -35.447 1.00 29.74  ? 236  TRP B CA  1 
ATOM   6065 C C   . TRP B 1 236 ? 18.562  2.614   -36.887 1.00 37.66  ? 236  TRP B C   1 
ATOM   6066 O O   . TRP B 1 236 ? 18.586  1.818   -37.824 1.00 42.40  ? 236  TRP B O   1 
ATOM   6067 C CB  . TRP B 1 236 ? 17.381  1.418   -35.070 1.00 29.63  ? 236  TRP B CB  1 
ATOM   6068 C CG  . TRP B 1 236 ? 16.211  2.373   -34.859 1.00 37.55  ? 236  TRP B CG  1 
ATOM   6069 C CD1 . TRP B 1 236 ? 15.829  2.951   -33.679 1.00 38.17  ? 236  TRP B CD1 1 
ATOM   6070 C CD2 . TRP B 1 236 ? 15.283  2.847   -35.852 1.00 33.03  ? 236  TRP B CD2 1 
ATOM   6071 N NE1 . TRP B 1 236 ? 14.727  3.757   -33.877 1.00 38.72  ? 236  TRP B NE1 1 
ATOM   6072 C CE2 . TRP B 1 236 ? 14.368  3.706   -35.196 1.00 34.59  ? 236  TRP B CE2 1 
ATOM   6073 C CE3 . TRP B 1 236 ? 15.130  2.623   -37.227 1.00 37.13  ? 236  TRP B CE3 1 
ATOM   6074 C CZ2 . TRP B 1 236 ? 13.318  4.343   -35.869 1.00 34.31  ? 236  TRP B CZ2 1 
ATOM   6075 C CZ3 . TRP B 1 236 ? 14.086  3.258   -37.899 1.00 33.53  ? 236  TRP B CZ3 1 
ATOM   6076 C CH2 . TRP B 1 236 ? 13.192  4.111   -37.214 1.00 32.32  ? 236  TRP B CH2 1 
ATOM   6077 N N   . ALA B 1 237 ? 18.405  3.921   -37.066 1.00 37.74  ? 237  ALA B N   1 
ATOM   6078 C CA  . ALA B 1 237 ? 17.965  4.462   -38.357 1.00 34.11  ? 237  ALA B CA  1 
ATOM   6079 C C   . ALA B 1 237 ? 19.069  4.622   -39.405 1.00 34.63  ? 237  ALA B C   1 
ATOM   6080 O O   . ALA B 1 237 ? 18.789  4.658   -40.605 1.00 37.83  ? 237  ALA B O   1 
ATOM   6081 C CB  . ALA B 1 237 ? 17.209  5.784   -38.163 1.00 25.43  ? 237  ALA B CB  1 
ATOM   6082 N N   . THR B 1 238 ? 20.317  4.729   -38.961 1.00 27.34  ? 238  THR B N   1 
ATOM   6083 C CA  . THR B 1 238 ? 21.428  4.856   -39.898 1.00 32.01  ? 238  THR B CA  1 
ATOM   6084 C C   . THR B 1 238 ? 22.606  3.967   -39.531 1.00 33.80  ? 238  THR B C   1 
ATOM   6085 O O   . THR B 1 238 ? 22.687  3.455   -38.418 1.00 33.12  ? 238  THR B O   1 
ATOM   6086 C CB  . THR B 1 238 ? 21.949  6.303   -39.991 1.00 28.34  ? 238  THR B CB  1 
ATOM   6087 O OG1 . THR B 1 238 ? 22.425  6.718   -38.705 1.00 29.52  ? 238  THR B OG1 1 
ATOM   6088 C CG2 . THR B 1 238 ? 20.852  7.240   -40.467 1.00 26.77  ? 238  THR B CG2 1 
ATOM   6089 N N   . VAL B 1 239 ? 23.524  3.793   -40.473 1.00 32.72  ? 239  VAL B N   1 
ATOM   6090 C CA  . VAL B 1 239 ? 24.815  3.196   -40.160 1.00 37.19  ? 239  VAL B CA  1 
ATOM   6091 C C   . VAL B 1 239 ? 25.946  4.004   -40.780 1.00 34.06  ? 239  VAL B C   1 
ATOM   6092 O O   . VAL B 1 239 ? 25.751  4.722   -41.761 1.00 38.24  ? 239  VAL B O   1 
ATOM   6093 C CB  . VAL B 1 239 ? 24.900  1.733   -40.624 1.00 40.23  ? 239  VAL B CB  1 
ATOM   6094 C CG1 . VAL B 1 239 ? 23.987  0.864   -39.771 1.00 43.09  ? 239  VAL B CG1 1 
ATOM   6095 C CG2 . VAL B 1 239 ? 24.550  1.617   -42.119 1.00 35.42  ? 239  VAL B CG2 1 
ATOM   6096 N N   . SER B 1 240 ? 27.118  3.901   -40.175 1.00 36.30  ? 240  SER B N   1 
ATOM   6097 C CA  . SER B 1 240 ? 28.339  4.462   -40.739 1.00 49.03  ? 240  SER B CA  1 
ATOM   6098 C C   . SER B 1 240 ? 28.647  3.784   -42.065 1.00 47.38  ? 240  SER B C   1 
ATOM   6099 O O   . SER B 1 240 ? 28.112  2.712   -42.371 1.00 37.47  ? 240  SER B O   1 
ATOM   6100 C CB  . SER B 1 240 ? 29.510  4.222   -39.796 1.00 40.85  ? 240  SER B CB  1 
ATOM   6101 O OG  . SER B 1 240 ? 29.778  2.838   -39.696 1.00 59.51  ? 240  SER B OG  1 
ATOM   6102 N N   . ALA B 1 241 ? 29.524  4.404   -42.844 1.00 44.05  ? 241  ALA B N   1 
ATOM   6103 C CA  . ALA B 1 241 ? 29.907  3.840   -44.126 1.00 44.65  ? 241  ALA B CA  1 
ATOM   6104 C C   . ALA B 1 241 ? 30.633  2.520   -43.899 1.00 52.18  ? 241  ALA B C   1 
ATOM   6105 O O   . ALA B 1 241 ? 30.402  1.536   -44.620 1.00 48.86  ? 241  ALA B O   1 
ATOM   6106 C CB  . ALA B 1 241 ? 30.760  4.804   -44.881 1.00 41.97  ? 241  ALA B CB  1 
ATOM   6107 N N   . GLY B 1 242 ? 31.479  2.498   -42.867 1.00 50.88  ? 242  GLY B N   1 
ATOM   6108 C CA  . GLY B 1 242 ? 32.275  1.331   -42.538 1.00 49.85  ? 242  GLY B CA  1 
ATOM   6109 C C   . GLY B 1 242 ? 31.442  0.122   -42.162 1.00 51.95  ? 242  GLY B C   1 
ATOM   6110 O O   . GLY B 1 242 ? 31.729  -0.998  -42.586 1.00 57.15  ? 242  GLY B O   1 
ATOM   6111 N N   . GLU B 1 243 ? 30.401  0.345   -41.368 1.00 46.53  ? 243  GLU B N   1 
ATOM   6112 C CA  . GLU B 1 243 ? 29.542  -0.752  -40.932 1.00 50.04  ? 243  GLU B CA  1 
ATOM   6113 C C   . GLU B 1 243 ? 28.656  -1.286  -42.068 1.00 50.71  ? 243  GLU B C   1 
ATOM   6114 O O   . GLU B 1 243 ? 28.367  -2.480  -42.124 1.00 55.00  ? 243  GLU B O   1 
ATOM   6115 C CB  . GLU B 1 243 ? 28.703  -0.334  -39.714 1.00 45.57  ? 243  GLU B CB  1 
ATOM   6116 C CG  . GLU B 1 243 ? 27.585  -1.308  -39.325 1.00 42.40  ? 243  GLU B CG  1 
ATOM   6117 C CD  . GLU B 1 243 ? 28.075  -2.606  -38.691 1.00 48.14  ? 243  GLU B CD  1 
ATOM   6118 O OE1 . GLU B 1 243 ? 29.310  -2.803  -38.540 1.00 48.76  ? 243  GLU B OE1 1 
ATOM   6119 O OE2 . GLU B 1 243 ? 27.205  -3.438  -38.341 1.00 46.81  ? 243  GLU B OE2 1 
ATOM   6120 N N   . ALA B 1 244 ? 28.237  -0.402  -42.969 1.00 44.36  ? 244  ALA B N   1 
ATOM   6121 C CA  . ALA B 1 244 ? 27.461  -0.807  -44.144 1.00 38.14  ? 244  ALA B CA  1 
ATOM   6122 C C   . ALA B 1 244 ? 28.327  -1.651  -45.081 1.00 39.17  ? 244  ALA B C   1 
ATOM   6123 O O   . ALA B 1 244 ? 27.889  -2.684  -45.581 1.00 38.92  ? 244  ALA B O   1 
ATOM   6124 C CB  . ALA B 1 244 ? 26.914  0.409   -44.873 1.00 35.68  ? 244  ALA B CB  1 
ATOM   6125 N N   . ARG B 1 245 ? 29.567  -1.212  -45.294 1.00 41.00  ? 245  ARG B N   1 
ATOM   6126 C CA  . ARG B 1 245 ? 30.510  -1.979  -46.101 1.00 49.22  ? 245  ARG B CA  1 
ATOM   6127 C C   . ARG B 1 245 ? 30.744  -3.368  -45.502 1.00 54.91  ? 245  ARG B C   1 
ATOM   6128 O O   . ARG B 1 245 ? 30.835  -4.358  -46.237 1.00 54.78  ? 245  ARG B O   1 
ATOM   6129 C CB  . ARG B 1 245 ? 31.844  -1.238  -46.262 1.00 46.64  ? 245  ARG B CB  1 
ATOM   6130 C CG  . ARG B 1 245 ? 32.960  -2.108  -46.855 1.00 48.19  ? 245  ARG B CG  1 
ATOM   6131 C CD  . ARG B 1 245 ? 34.057  -1.261  -47.430 1.00 50.30  ? 245  ARG B CD  1 
ATOM   6132 N NE  . ARG B 1 245 ? 33.547  -0.382  -48.471 1.00 52.86  ? 245  ARG B NE  1 
ATOM   6133 C CZ  . ARG B 1 245 ? 33.595  -0.663  -49.770 1.00 53.50  ? 245  ARG B CZ  1 
ATOM   6134 N NH1 . ARG B 1 245 ? 34.140  -1.801  -50.181 1.00 51.15  ? 245  ARG B NH1 1 
ATOM   6135 N NH2 . ARG B 1 245 ? 33.100  0.193   -50.660 1.00 50.48  ? 245  ARG B NH2 1 
ATOM   6136 N N   . ARG B 1 246 ? 30.831  -3.442  -44.173 1.00 45.01  ? 246  ARG B N   1 
ATOM   6137 C CA  . ARG B 1 246 ? 31.035  -4.727  -43.509 1.00 51.04  ? 246  ARG B CA  1 
ATOM   6138 C C   . ARG B 1 246 ? 29.827  -5.635  -43.738 1.00 52.35  ? 246  ARG B C   1 
ATOM   6139 O O   . ARG B 1 246 ? 29.977  -6.801  -44.107 1.00 49.88  ? 246  ARG B O   1 
ATOM   6140 C CB  . ARG B 1 246 ? 31.305  -4.555  -42.005 1.00 47.66  ? 246  ARG B CB  1 
ATOM   6141 C CG  . ARG B 1 246 ? 31.553  -5.865  -41.270 1.00 49.75  ? 246  ARG B CG  1 
ATOM   6142 C CD  . ARG B 1 246 ? 31.438  -5.735  -39.756 1.00 50.39  ? 246  ARG B CD  1 
ATOM   6143 N NE  . ARG B 1 246 ? 30.056  -5.537  -39.341 1.00 63.93  ? 246  ARG B NE  1 
ATOM   6144 C CZ  . ARG B 1 246 ? 29.180  -6.515  -39.137 1.00 58.95  ? 246  ARG B CZ  1 
ATOM   6145 N NH1 . ARG B 1 246 ? 29.538  -7.783  -39.297 1.00 54.58  ? 246  ARG B NH1 1 
ATOM   6146 N NH2 . ARG B 1 246 ? 27.940  -6.221  -38.764 1.00 45.48  ? 246  ARG B NH2 1 
ATOM   6147 N N   . ARG B 1 247 ? 28.631  -5.091  -43.536 1.00 51.75  ? 247  ARG B N   1 
ATOM   6148 C CA  . ARG B 1 247 ? 27.405  -5.877  -43.681 1.00 47.61  ? 247  ARG B CA  1 
ATOM   6149 C C   . ARG B 1 247 ? 27.166  -6.364  -45.107 1.00 47.08  ? 247  ARG B C   1 
ATOM   6150 O O   . ARG B 1 247 ? 26.746  -7.500  -45.309 1.00 47.35  ? 247  ARG B O   1 
ATOM   6151 C CB  . ARG B 1 247 ? 26.192  -5.104  -43.177 1.00 46.29  ? 247  ARG B CB  1 
ATOM   6152 C CG  . ARG B 1 247 ? 26.221  -4.812  -41.681 1.00 48.81  ? 247  ARG B CG  1 
ATOM   6153 C CD  . ARG B 1 247 ? 24.913  -4.177  -41.239 1.00 42.33  ? 247  ARG B CD  1 
ATOM   6154 N NE  . ARG B 1 247 ? 24.993  -3.645  -39.889 1.00 44.17  ? 247  ARG B NE  1 
ATOM   6155 C CZ  . ARG B 1 247 ? 23.964  -3.112  -39.237 1.00 51.91  ? 247  ARG B CZ  1 
ATOM   6156 N NH1 . ARG B 1 247 ? 22.764  -3.056  -39.828 1.00 34.40  ? 247  ARG B NH1 1 
ATOM   6157 N NH2 . ARG B 1 247 ? 24.136  -2.632  -38.000 1.00 36.96  ? 247  ARG B NH2 1 
ATOM   6158 N N   . ALA B 1 248 ? 27.434  -5.509  -46.091 1.00 48.49  ? 248  ALA B N   1 
ATOM   6159 C CA  . ALA B 1 248 ? 27.292  -5.889  -47.499 1.00 49.54  ? 248  ALA B CA  1 
ATOM   6160 C C   . ALA B 1 248 ? 28.329  -6.947  -47.892 1.00 54.39  ? 248  ALA B C   1 
ATOM   6161 O O   . ALA B 1 248 ? 28.026  -7.900  -48.617 1.00 53.66  ? 248  ALA B O   1 
ATOM   6162 C CB  . ALA B 1 248 ? 27.412  -4.667  -48.390 1.00 39.56  ? 248  ALA B CB  1 
ATOM   6163 N N   . THR B 1 249 ? 29.554  -6.776  -47.401 1.00 54.10  ? 249  THR B N   1 
ATOM   6164 C CA  . THR B 1 249 ? 30.626  -7.729  -47.664 1.00 53.23  ? 249  THR B CA  1 
ATOM   6165 C C   . THR B 1 249 ? 30.317  -9.081  -47.039 1.00 54.09  ? 249  THR B C   1 
ATOM   6166 O O   . THR B 1 249 ? 30.589  -10.121 -47.628 1.00 57.67  ? 249  THR B O   1 
ATOM   6167 C CB  . THR B 1 249 ? 31.953  -7.218  -47.105 1.00 55.57  ? 249  THR B CB  1 
ATOM   6168 O OG1 . THR B 1 249 ? 32.214  -5.910  -47.631 1.00 56.64  ? 249  THR B OG1 1 
ATOM   6169 C CG2 . THR B 1 249 ? 33.088  -8.156  -47.475 1.00 53.03  ? 249  THR B CG2 1 
ATOM   6170 N N   . LEU B 1 250 ? 29.739  -9.062  -45.842 1.00 56.55  ? 250  LEU B N   1 
ATOM   6171 C CA  . LEU B 1 250 ? 29.377  -10.301 -45.162 1.00 58.83  ? 250  LEU B CA  1 
ATOM   6172 C C   . LEU B 1 250 ? 28.251  -11.019 -45.896 1.00 55.22  ? 250  LEU B C   1 
ATOM   6173 O O   . LEU B 1 250 ? 28.272  -12.243 -46.061 1.00 56.35  ? 250  LEU B O   1 
ATOM   6174 C CB  . LEU B 1 250 ? 28.984  -10.045 -43.702 1.00 48.81  ? 250  LEU B CB  1 
ATOM   6175 C CG  . LEU B 1 250 ? 28.703  -11.313 -42.881 1.00 50.61  ? 250  LEU B CG  1 
ATOM   6176 C CD1 . LEU B 1 250 ? 29.819  -12.323 -43.087 1.00 53.82  ? 250  LEU B CD1 1 
ATOM   6177 C CD2 . LEU B 1 250 ? 28.508  -11.007 -41.401 1.00 50.76  ? 250  LEU B CD2 1 
ATOM   6178 N N   . LEU B 1 251 ? 27.263  -10.252 -46.331 1.00 47.19  ? 251  LEU B N   1 
ATOM   6179 C CA  . LEU B 1 251 ? 26.133  -10.829 -47.037 1.00 47.76  ? 251  LEU B CA  1 
ATOM   6180 C C   . LEU B 1 251 ? 26.592  -11.461 -48.345 1.00 48.56  ? 251  LEU B C   1 
ATOM   6181 O O   . LEU B 1 251 ? 26.193  -12.579 -48.682 1.00 49.92  ? 251  LEU B O   1 
ATOM   6182 C CB  . LEU B 1 251 ? 25.077  -9.775  -47.309 1.00 42.47  ? 251  LEU B CB  1 
ATOM   6183 C CG  . LEU B 1 251 ? 23.935  -10.404 -48.073 1.00 42.90  ? 251  LEU B CG  1 
ATOM   6184 C CD1 . LEU B 1 251 ? 22.731  -10.537 -47.169 1.00 47.61  ? 251  LEU B CD1 1 
ATOM   6185 C CD2 . LEU B 1 251 ? 23.652  -9.568  -49.296 1.00 40.01  ? 251  LEU B CD2 1 
ATOM   6186 N N   . ALA B 1 252 ? 27.452  -10.747 -49.064 1.00 51.34  ? 252  ALA B N   1 
ATOM   6187 C CA  . ALA B 1 252 ? 28.059  -11.280 -50.277 1.00 52.78  ? 252  ALA B CA  1 
ATOM   6188 C C   . ALA B 1 252 ? 28.765  -12.604 -49.999 1.00 51.57  ? 252  ALA B C   1 
ATOM   6189 O O   . ALA B 1 252 ? 28.669  -13.541 -50.785 1.00 60.09  ? 252  ALA B O   1 
ATOM   6190 C CB  . ALA B 1 252 ? 29.029  -10.278 -50.864 1.00 55.96  ? 252  ALA B CB  1 
ATOM   6191 N N   . ARG B 1 253 ? 29.467  -12.679 -48.876 1.00 52.71  ? 253  ARG B N   1 
ATOM   6192 C CA  . ARG B 1 253 ? 30.135  -13.917 -48.486 1.00 63.00  ? 253  ARG B CA  1 
ATOM   6193 C C   . ARG B 1 253 ? 29.119  -15.038 -48.266 1.00 63.88  ? 253  ARG B C   1 
ATOM   6194 O O   . ARG B 1 253 ? 29.320  -16.170 -48.713 1.00 59.99  ? 253  ARG B O   1 
ATOM   6195 C CB  . ARG B 1 253 ? 30.971  -13.706 -47.222 1.00 62.06  ? 253  ARG B CB  1 
ATOM   6196 C CG  . ARG B 1 253 ? 31.636  -14.967 -46.689 1.00 70.76  ? 253  ARG B CG  1 
ATOM   6197 C CD  . ARG B 1 253 ? 32.235  -14.728 -45.311 1.00 79.83  ? 253  ARG B CD  1 
ATOM   6198 N NE  . ARG B 1 253 ? 32.916  -15.910 -44.788 1.00 95.32  ? 253  ARG B NE  1 
ATOM   6199 C CZ  . ARG B 1 253 ? 32.446  -16.678 -43.808 1.00 99.25  ? 253  ARG B CZ  1 
ATOM   6200 N NH1 . ARG B 1 253 ? 31.283  -16.390 -43.230 1.00 93.64  ? 253  ARG B NH1 1 
ATOM   6201 N NH2 . ARG B 1 253 ? 33.149  -17.732 -43.401 1.00 100.92 ? 253  ARG B NH2 1 
ATOM   6202 N N   . LEU B 1 254 ? 28.019  -14.708 -47.596 1.00 61.46  ? 254  LEU B N   1 
ATOM   6203 C CA  . LEU B 1 254 ? 26.992  -15.691 -47.253 1.00 61.01  ? 254  LEU B CA  1 
ATOM   6204 C C   . LEU B 1 254 ? 26.310  -16.334 -48.464 1.00 63.63  ? 254  LEU B C   1 
ATOM   6205 O O   . LEU B 1 254 ? 25.800  -17.453 -48.366 1.00 55.53  ? 254  LEU B O   1 
ATOM   6206 C CB  . LEU B 1 254 ? 25.938  -15.062 -46.335 1.00 57.76  ? 254  LEU B CB  1 
ATOM   6207 C CG  . LEU B 1 254 ? 26.361  -14.743 -44.900 1.00 58.23  ? 254  LEU B CG  1 
ATOM   6208 C CD1 . LEU B 1 254 ? 25.202  -14.127 -44.107 1.00 52.95  ? 254  LEU B CD1 1 
ATOM   6209 C CD2 . LEU B 1 254 ? 26.881  -16.002 -44.230 1.00 55.42  ? 254  LEU B CD2 1 
ATOM   6210 N N   . VAL B 1 255 ? 26.295  -15.627 -49.595 1.00 58.59  ? 255  VAL B N   1 
ATOM   6211 C CA  . VAL B 1 255 ? 25.626  -16.129 -50.796 1.00 57.62  ? 255  VAL B CA  1 
ATOM   6212 C C   . VAL B 1 255 ? 26.564  -16.506 -51.951 1.00 60.55  ? 255  VAL B C   1 
ATOM   6213 O O   . VAL B 1 255 ? 26.098  -16.733 -53.068 1.00 64.11  ? 255  VAL B O   1 
ATOM   6214 C CB  . VAL B 1 255 ? 24.547  -15.137 -51.319 1.00 50.69  ? 255  VAL B CB  1 
ATOM   6215 C CG1 . VAL B 1 255 ? 23.511  -14.864 -50.243 1.00 48.17  ? 255  VAL B CG1 1 
ATOM   6216 C CG2 . VAL B 1 255 ? 25.182  -13.837 -51.797 1.00 48.27  ? 255  VAL B CG2 1 
ATOM   6217 N N   . GLY B 1 256 ? 27.872  -16.555 -51.690 1.00 60.85  ? 256  GLY B N   1 
ATOM   6218 C CA  . GLY B 1 256 ? 28.835  -17.063 -52.661 1.00 65.31  ? 256  GLY B CA  1 
ATOM   6219 C C   . GLY B 1 256 ? 29.700  -16.069 -53.435 1.00 64.77  ? 256  GLY B C   1 
ATOM   6220 O O   . GLY B 1 256 ? 30.501  -16.469 -54.289 1.00 61.44  ? 256  GLY B O   1 
ATOM   6221 N N   . CYS B 1 257 ? 29.569  -14.782 -53.124 1.00 65.16  ? 257  CYS B N   1 
ATOM   6222 C CA  . CYS B 1 257 ? 30.228  -13.731 -53.897 1.00 66.93  ? 257  CYS B CA  1 
ATOM   6223 C C   . CYS B 1 257 ? 31.522  -13.204 -53.272 1.00 70.04  ? 257  CYS B C   1 
ATOM   6224 O O   . CYS B 1 257 ? 32.606  -13.365 -53.845 1.00 78.13  ? 257  CYS B O   1 
ATOM   6225 C CB  . CYS B 1 257 ? 29.245  -12.584 -54.132 1.00 66.35  ? 257  CYS B CB  1 
ATOM   6226 S SG  . CYS B 1 257 ? 27.740  -13.085 -55.005 1.00 57.35  ? 257  CYS B SG  1 
ATOM   6227 N N   . ASN B 1 265 ? 37.729  -6.233  -55.679 1.00 72.92  ? 265  ASN B N   1 
ATOM   6228 C CA  . ASN B 1 265 ? 37.165  -4.893  -55.845 1.00 76.46  ? 265  ASN B CA  1 
ATOM   6229 C C   . ASN B 1 265 ? 35.630  -4.875  -55.812 1.00 73.36  ? 265  ASN B C   1 
ATOM   6230 O O   . ASN B 1 265 ? 34.995  -5.915  -55.990 1.00 72.42  ? 265  ASN B O   1 
ATOM   6231 C CB  . ASN B 1 265 ? 37.717  -4.205  -57.111 1.00 80.96  ? 265  ASN B CB  1 
ATOM   6232 C CG  . ASN B 1 265 ? 37.243  -4.859  -58.416 1.00 84.90  ? 265  ASN B CG  1 
ATOM   6233 O OD1 . ASN B 1 265 ? 36.120  -5.356  -58.510 1.00 78.52  ? 265  ASN B OD1 1 
ATOM   6234 N ND2 . ASN B 1 265 ? 38.108  -4.842  -59.437 1.00 93.40  ? 265  ASN B ND2 1 
ATOM   6235 N N   . ASP B 1 266 ? 35.042  -3.699  -55.605 1.00 56.74  ? 266  ASP B N   1 
ATOM   6236 C CA  . ASP B 1 266 ? 33.577  -3.583  -55.472 1.00 56.85  ? 266  ASP B CA  1 
ATOM   6237 C C   . ASP B 1 266 ? 32.768  -4.086  -56.675 1.00 60.48  ? 266  ASP B C   1 
ATOM   6238 O O   . ASP B 1 266 ? 31.788  -4.807  -56.507 1.00 56.86  ? 266  ASP B O   1 
ATOM   6239 C CB  . ASP B 1 266 ? 33.167  -2.147  -55.143 1.00 51.58  ? 266  ASP B CB  1 
ATOM   6240 C CG  . ASP B 1 266 ? 33.469  -1.770  -53.698 1.00 66.83  ? 266  ASP B CG  1 
ATOM   6241 O OD1 . ASP B 1 266 ? 33.793  -2.687  -52.911 1.00 65.36  ? 266  ASP B OD1 1 
ATOM   6242 O OD2 . ASP B 1 266 ? 33.370  -0.567  -53.345 1.00 61.00  ? 266  ASP B OD2 1 
ATOM   6243 N N   . THR B 1 267 ? 33.187  -3.709  -57.880 1.00 66.32  ? 267  THR B N   1 
ATOM   6244 C CA  . THR B 1 267 ? 32.442  -4.030  -59.096 1.00 63.58  ? 267  THR B CA  1 
ATOM   6245 C C   . THR B 1 267 ? 32.167  -5.523  -59.262 1.00 62.73  ? 267  THR B C   1 
ATOM   6246 O O   . THR B 1 267 ? 31.045  -5.931  -59.576 1.00 56.15  ? 267  THR B O   1 
ATOM   6247 C CB  . THR B 1 267 ? 33.163  -3.496  -60.348 1.00 65.88  ? 267  THR B CB  1 
ATOM   6248 O OG1 . THR B 1 267 ? 32.979  -2.078  -60.428 1.00 63.86  ? 267  THR B OG1 1 
ATOM   6249 C CG2 . THR B 1 267 ? 32.601  -4.137  -61.605 1.00 57.47  ? 267  THR B CG2 1 
ATOM   6250 N N   . GLU B 1 268 ? 33.191  -6.336  -59.040 1.00 67.93  ? 268  GLU B N   1 
ATOM   6251 C CA  . GLU B 1 268 ? 33.034  -7.779  -59.149 1.00 69.64  ? 268  GLU B CA  1 
ATOM   6252 C C   . GLU B 1 268 ? 32.061  -8.300  -58.091 1.00 63.39  ? 268  GLU B C   1 
ATOM   6253 O O   . GLU B 1 268 ? 31.251  -9.186  -58.356 1.00 64.07  ? 268  GLU B O   1 
ATOM   6254 C CB  . GLU B 1 268 ? 34.390  -8.485  -59.043 1.00 78.76  ? 268  GLU B CB  1 
ATOM   6255 C CG  . GLU B 1 268 ? 35.032  -8.855  -60.387 1.00 94.62  ? 268  GLU B CG  1 
ATOM   6256 C CD  . GLU B 1 268 ? 35.691  -7.678  -61.108 1.00 107.25 ? 268  GLU B CD  1 
ATOM   6257 O OE1 . GLU B 1 268 ? 34.985  -6.976  -61.867 1.00 106.67 ? 268  GLU B OE1 1 
ATOM   6258 O OE2 . GLU B 1 268 ? 36.919  -7.470  -60.934 1.00 114.36 ? 268  GLU B OE2 1 
ATOM   6259 N N   . LEU B 1 269 ? 32.125  -7.729  -56.896 1.00 53.88  ? 269  LEU B N   1 
ATOM   6260 C CA  . LEU B 1 269 ? 31.291  -8.198  -55.798 1.00 53.09  ? 269  LEU B CA  1 
ATOM   6261 C C   . LEU B 1 269 ? 29.814  -7.894  -56.049 1.00 53.97  ? 269  LEU B C   1 
ATOM   6262 O O   . LEU B 1 269 ? 28.944  -8.743  -55.838 1.00 52.53  ? 269  LEU B O   1 
ATOM   6263 C CB  . LEU B 1 269 ? 31.752  -7.591  -54.472 1.00 51.45  ? 269  LEU B CB  1 
ATOM   6264 C CG  . LEU B 1 269 ? 31.057  -8.132  -53.220 1.00 56.92  ? 269  LEU B CG  1 
ATOM   6265 C CD1 . LEU B 1 269 ? 32.036  -8.285  -52.079 1.00 63.27  ? 269  LEU B CD1 1 
ATOM   6266 C CD2 . LEU B 1 269 ? 29.925  -7.217  -52.804 1.00 49.69  ? 269  LEU B CD2 1 
ATOM   6267 N N   . ILE B 1 270 ? 29.538  -6.678  -56.497 1.00 48.00  ? 270  ILE B N   1 
ATOM   6268 C CA  . ILE B 1 270 ? 28.176  -6.270  -56.762 1.00 45.65  ? 270  ILE B CA  1 
ATOM   6269 C C   . ILE B 1 270 ? 27.635  -6.999  -57.985 1.00 49.71  ? 270  ILE B C   1 
ATOM   6270 O O   . ILE B 1 270 ? 26.456  -7.348  -58.031 1.00 50.10  ? 270  ILE B O   1 
ATOM   6271 C CB  . ILE B 1 270 ? 28.094  -4.757  -56.927 1.00 54.32  ? 270  ILE B CB  1 
ATOM   6272 C CG1 . ILE B 1 270 ? 28.438  -4.097  -55.592 1.00 50.80  ? 270  ILE B CG1 1 
ATOM   6273 C CG2 . ILE B 1 270 ? 26.708  -4.334  -57.387 1.00 42.60  ? 270  ILE B CG2 1 
ATOM   6274 C CD1 . ILE B 1 270 ? 29.322  -2.882  -55.718 1.00 53.25  ? 270  ILE B CD1 1 
ATOM   6275 N N   . ALA B 1 271 ? 28.503  -7.253  -58.961 1.00 49.06  ? 271  ALA B N   1 
ATOM   6276 C CA  . ALA B 1 271 ? 28.106  -8.015  -60.136 1.00 50.07  ? 271  ALA B CA  1 
ATOM   6277 C C   . ALA B 1 271 ? 27.568  -9.393  -59.749 1.00 54.98  ? 271  ALA B C   1 
ATOM   6278 O O   . ALA B 1 271 ? 26.516  -9.815  -60.238 1.00 51.71  ? 271  ALA B O   1 
ATOM   6279 C CB  . ALA B 1 271 ? 29.248  -8.139  -61.097 1.00 53.04  ? 271  ALA B CB  1 
ATOM   6280 N N   . CYS B 1 272 ? 28.270  -10.081 -58.851 1.00 54.00  ? 272  CYS B N   1 
ATOM   6281 C CA  . CYS B 1 272 ? 27.837  -11.409 -58.421 1.00 57.49  ? 272  CYS B CA  1 
ATOM   6282 C C   . CYS B 1 272 ? 26.528  -11.322 -57.636 1.00 56.74  ? 272  CYS B C   1 
ATOM   6283 O O   . CYS B 1 272 ? 25.616  -12.135 -57.832 1.00 59.22  ? 272  CYS B O   1 
ATOM   6284 C CB  . CYS B 1 272 ? 28.928  -12.122 -57.612 1.00 53.42  ? 272  CYS B CB  1 
ATOM   6285 S SG  . CYS B 1 272 ? 28.421  -13.703 -56.845 1.00 57.16  ? 272  CYS B SG  1 
ATOM   6286 N N   . LEU B 1 273 ? 26.441  -10.326 -56.759 1.00 47.10  ? 273  LEU B N   1 
ATOM   6287 C CA  . LEU B 1 273 ? 25.206  -10.057 -56.027 1.00 51.72  ? 273  LEU B CA  1 
ATOM   6288 C C   . LEU B 1 273 ? 24.012  -9.864  -56.960 1.00 49.21  ? 273  LEU B C   1 
ATOM   6289 O O   . LEU B 1 273 ? 22.910  -10.306 -56.660 1.00 51.69  ? 273  LEU B O   1 
ATOM   6290 C CB  . LEU B 1 273 ? 25.359  -8.825  -55.130 1.00 42.96  ? 273  LEU B CB  1 
ATOM   6291 C CG  . LEU B 1 273 ? 26.063  -9.029  -53.791 1.00 44.99  ? 273  LEU B CG  1 
ATOM   6292 C CD1 . LEU B 1 273 ? 26.069  -7.739  -53.017 1.00 41.63  ? 273  LEU B CD1 1 
ATOM   6293 C CD2 . LEU B 1 273 ? 25.412  -10.134 -52.980 1.00 46.81  ? 273  LEU B CD2 1 
ATOM   6294 N N   . ARG B 1 274 ? 24.238  -9.208  -58.093 1.00 47.69  ? 274  ARG B N   1 
ATOM   6295 C CA  . ARG B 1 274 ? 23.155  -8.940  -59.033 1.00 47.52  ? 274  ARG B CA  1 
ATOM   6296 C C   . ARG B 1 274 ? 22.650  -10.189 -59.744 1.00 45.27  ? 274  ARG B C   1 
ATOM   6297 O O   . ARG B 1 274 ? 21.557  -10.190 -60.283 1.00 51.29  ? 274  ARG B O   1 
ATOM   6298 C CB  . ARG B 1 274 ? 23.559  -7.877  -60.052 1.00 45.48  ? 274  ARG B CB  1 
ATOM   6299 C CG  . ARG B 1 274 ? 23.426  -6.463  -59.523 1.00 45.38  ? 274  ARG B CG  1 
ATOM   6300 C CD  . ARG B 1 274 ? 23.356  -5.498  -60.668 1.00 42.48  ? 274  ARG B CD  1 
ATOM   6301 N NE  . ARG B 1 274 ? 24.411  -5.781  -61.626 1.00 52.64  ? 274  ARG B NE  1 
ATOM   6302 C CZ  . ARG B 1 274 ? 25.613  -5.222  -61.583 1.00 58.33  ? 274  ARG B CZ  1 
ATOM   6303 N NH1 . ARG B 1 274 ? 25.898  -4.338  -60.629 1.00 53.79  ? 274  ARG B NH1 1 
ATOM   6304 N NH2 . ARG B 1 274 ? 26.526  -5.543  -62.492 1.00 58.91  ? 274  ARG B NH2 1 
ATOM   6305 N N   . THR B 1 275 ? 23.443  -11.251 -59.735 1.00 53.23  ? 275  THR B N   1 
ATOM   6306 C CA  . THR B 1 275 ? 23.025  -12.502 -60.358 1.00 49.17  ? 275  THR B CA  1 
ATOM   6307 C C   . THR B 1 275 ? 22.125  -13.282 -59.414 1.00 48.64  ? 275  THR B C   1 
ATOM   6308 O O   . THR B 1 275 ? 21.437  -14.209 -59.827 1.00 57.21  ? 275  THR B O   1 
ATOM   6309 C CB  . THR B 1 275 ? 24.226  -13.407 -60.731 1.00 51.94  ? 275  THR B CB  1 
ATOM   6310 O OG1 . THR B 1 275 ? 24.830  -13.920 -59.537 1.00 52.18  ? 275  THR B OG1 1 
ATOM   6311 C CG2 . THR B 1 275 ? 25.258  -12.639 -61.533 1.00 52.82  ? 275  THR B CG2 1 
ATOM   6312 N N   . ARG B 1 276 ? 22.131  -12.912 -58.141 1.00 47.03  ? 276  ARG B N   1 
ATOM   6313 C CA  . ARG B 1 276 ? 21.426  -13.708 -57.149 1.00 49.93  ? 276  ARG B CA  1 
ATOM   6314 C C   . ARG B 1 276 ? 19.910  -13.481 -57.155 1.00 53.28  ? 276  ARG B C   1 
ATOM   6315 O O   . ARG B 1 276 ? 19.443  -12.331 -57.161 1.00 43.65  ? 276  ARG B O   1 
ATOM   6316 C CB  . ARG B 1 276 ? 22.025  -13.471 -55.757 1.00 49.25  ? 276  ARG B CB  1 
ATOM   6317 C CG  . ARG B 1 276 ? 23.432  -14.056 -55.576 1.00 51.31  ? 276  ARG B CG  1 
ATOM   6318 C CD  . ARG B 1 276 ? 23.417  -15.578 -55.640 1.00 50.80  ? 276  ARG B CD  1 
ATOM   6319 N NE  . ARG B 1 276 ? 24.733  -16.143 -55.368 1.00 55.45  ? 276  ARG B NE  1 
ATOM   6320 C CZ  . ARG B 1 276 ? 25.617  -16.464 -56.311 1.00 56.46  ? 276  ARG B CZ  1 
ATOM   6321 N NH1 . ARG B 1 276 ? 25.317  -16.274 -57.586 1.00 56.30  ? 276  ARG B NH1 1 
ATOM   6322 N NH2 . ARG B 1 276 ? 26.800  -16.965 -55.983 1.00 56.92  ? 276  ARG B NH2 1 
ATOM   6323 N N   . PRO B 1 277 ? 19.138  -14.582 -57.171 1.00 47.14  ? 277  PRO B N   1 
ATOM   6324 C CA  . PRO B 1 277 ? 17.680  -14.516 -57.031 1.00 46.39  ? 277  PRO B CA  1 
ATOM   6325 C C   . PRO B 1 277 ? 17.298  -13.774 -55.753 1.00 47.67  ? 277  PRO B C   1 
ATOM   6326 O O   . PRO B 1 277 ? 18.010  -13.868 -54.747 1.00 45.22  ? 277  PRO B O   1 
ATOM   6327 C CB  . PRO B 1 277 ? 17.264  -15.985 -56.931 1.00 48.89  ? 277  PRO B CB  1 
ATOM   6328 C CG  . PRO B 1 277 ? 18.345  -16.736 -57.636 1.00 51.06  ? 277  PRO B CG  1 
ATOM   6329 C CD  . PRO B 1 277 ? 19.613  -15.965 -57.350 1.00 49.92  ? 277  PRO B CD  1 
ATOM   6330 N N   . ALA B 1 278 ? 16.184  -13.050 -55.799 1.00 43.90  ? 278  ALA B N   1 
ATOM   6331 C CA  . ALA B 1 278 ? 15.780  -12.176 -54.704 1.00 46.80  ? 278  ALA B CA  1 
ATOM   6332 C C   . ALA B 1 278 ? 15.679  -12.893 -53.354 1.00 46.67  ? 278  ALA B C   1 
ATOM   6333 O O   . ALA B 1 278 ? 16.193  -12.402 -52.352 1.00 44.56  ? 278  ALA B O   1 
ATOM   6334 C CB  . ALA B 1 278 ? 14.470  -11.467 -55.040 1.00 39.58  ? 278  ALA B CB  1 
ATOM   6335 N N   . GLN B 1 279 ? 15.037  -14.057 -53.337 1.00 49.01  ? 279  GLN B N   1 
ATOM   6336 C CA  . GLN B 1 279 ? 14.827  -14.773 -52.088 1.00 49.55  ? 279  GLN B CA  1 
ATOM   6337 C C   . GLN B 1 279 ? 16.141  -15.207 -51.434 1.00 51.82  ? 279  GLN B C   1 
ATOM   6338 O O   . GLN B 1 279 ? 16.194  -15.362 -50.216 1.00 53.18  ? 279  GLN B O   1 
ATOM   6339 C CB  . GLN B 1 279 ? 13.881  -15.966 -52.277 1.00 51.62  ? 279  GLN B CB  1 
ATOM   6340 C CG  . GLN B 1 279 ? 13.340  -16.541 -50.964 1.00 47.85  ? 279  GLN B CG  1 
ATOM   6341 C CD  . GLN B 1 279 ? 12.753  -15.478 -50.032 1.00 48.31  ? 279  GLN B CD  1 
ATOM   6342 O OE1 . GLN B 1 279 ? 12.115  -14.523 -50.477 1.00 44.89  ? 279  GLN B OE1 1 
ATOM   6343 N NE2 . GLN B 1 279 ? 12.978  -15.641 -48.732 1.00 46.01  ? 279  GLN B NE2 1 
ATOM   6344 N N   . ASP B 1 280 ? 17.195  -15.389 -52.234 1.00 48.17  ? 280  ASP B N   1 
ATOM   6345 C CA  . ASP B 1 280 ? 18.510  -15.728 -51.683 1.00 49.27  ? 280  ASP B CA  1 
ATOM   6346 C C   . ASP B 1 280 ? 19.048  -14.589 -50.818 1.00 48.41  ? 280  ASP B C   1 
ATOM   6347 O O   . ASP B 1 280 ? 19.601  -14.832 -49.748 1.00 57.16  ? 280  ASP B O   1 
ATOM   6348 C CB  . ASP B 1 280 ? 19.522  -16.099 -52.781 1.00 51.19  ? 280  ASP B CB  1 
ATOM   6349 C CG  . ASP B 1 280 ? 19.195  -17.418 -53.462 1.00 62.77  ? 280  ASP B CG  1 
ATOM   6350 O OD1 . ASP B 1 280 ? 18.100  -17.967 -53.203 1.00 69.72  ? 280  ASP B OD1 1 
ATOM   6351 O OD2 . ASP B 1 280 ? 20.025  -17.903 -54.266 1.00 64.36  ? 280  ASP B OD2 1 
ATOM   6352 N N   . LEU B 1 281 ? 18.882  -13.348 -51.270 1.00 44.83  ? 281  LEU B N   1 
ATOM   6353 C CA  . LEU B 1 281 ? 19.320  -12.189 -50.482 1.00 44.30  ? 281  LEU B CA  1 
ATOM   6354 C C   . LEU B 1 281 ? 18.494  -12.040 -49.197 1.00 45.88  ? 281  LEU B C   1 
ATOM   6355 O O   . LEU B 1 281 ? 19.052  -11.875 -48.112 1.00 39.88  ? 281  LEU B O   1 
ATOM   6356 C CB  . LEU B 1 281 ? 19.287  -10.893 -51.310 1.00 38.67  ? 281  LEU B CB  1 
ATOM   6357 C CG  . LEU B 1 281 ? 20.082  -10.914 -52.620 1.00 44.01  ? 281  LEU B CG  1 
ATOM   6358 C CD1 . LEU B 1 281 ? 20.092  -9.550  -53.282 1.00 41.41  ? 281  LEU B CD1 1 
ATOM   6359 C CD2 . LEU B 1 281 ? 21.496  -11.401 -52.394 1.00 41.18  ? 281  LEU B CD2 1 
ATOM   6360 N N   . VAL B 1 282 ? 17.170  -12.108 -49.326 1.00 44.34  ? 282  VAL B N   1 
ATOM   6361 C CA  . VAL B 1 282 ? 16.276  -12.061 -48.172 1.00 39.17  ? 282  VAL B CA  1 
ATOM   6362 C C   . VAL B 1 282 ? 16.584  -13.175 -47.139 1.00 52.90  ? 282  VAL B C   1 
ATOM   6363 O O   . VAL B 1 282 ? 16.502  -12.954 -45.930 1.00 45.53  ? 282  VAL B O   1 
ATOM   6364 C CB  . VAL B 1 282 ? 14.794  -12.103 -48.628 1.00 42.12  ? 282  VAL B CB  1 
ATOM   6365 C CG1 . VAL B 1 282 ? 13.852  -12.391 -47.464 1.00 43.96  ? 282  VAL B CG1 1 
ATOM   6366 C CG2 . VAL B 1 282 ? 14.416  -10.790 -49.285 1.00 38.59  ? 282  VAL B CG2 1 
ATOM   6367 N N   . ASP B 1 283 ? 16.966  -14.356 -47.620 1.00 43.63  ? 283  ASP B N   1 
ATOM   6368 C CA  . ASP B 1 283 ? 17.284  -15.488 -46.749 1.00 49.35  ? 283  ASP B CA  1 
ATOM   6369 C C   . ASP B 1 283 ? 18.428  -15.187 -45.776 1.00 52.65  ? 283  ASP B C   1 
ATOM   6370 O O   . ASP B 1 283 ? 18.524  -15.791 -44.702 1.00 52.69  ? 283  ASP B O   1 
ATOM   6371 C CB  . ASP B 1 283 ? 17.662  -16.729 -47.574 1.00 48.67  ? 283  ASP B CB  1 
ATOM   6372 C CG  . ASP B 1 283 ? 16.455  -17.468 -48.117 1.00 54.61  ? 283  ASP B CG  1 
ATOM   6373 O OD1 . ASP B 1 283 ? 15.322  -17.069 -47.780 1.00 51.94  ? 283  ASP B OD1 1 
ATOM   6374 O OD2 . ASP B 1 283 ? 16.641  -18.459 -48.875 1.00 52.07  ? 283  ASP B OD2 1 
ATOM   6375 N N   . HIS B 1 284 ? 19.307  -14.274 -46.160 1.00 44.69  ? 284  HIS B N   1 
ATOM   6376 C CA  . HIS B 1 284 ? 20.527  -14.079 -45.396 1.00 48.59  ? 284  HIS B CA  1 
ATOM   6377 C C   . HIS B 1 284 ? 20.661  -12.684 -44.811 1.00 48.50  ? 284  HIS B C   1 
ATOM   6378 O O   . HIS B 1 284 ? 21.557  -12.440 -44.013 1.00 43.59  ? 284  HIS B O   1 
ATOM   6379 C CB  . HIS B 1 284 ? 21.746  -14.389 -46.257 1.00 53.07  ? 284  HIS B CB  1 
ATOM   6380 C CG  . HIS B 1 284 ? 22.051  -15.848 -46.370 1.00 57.00  ? 284  HIS B CG  1 
ATOM   6381 N ND1 . HIS B 1 284 ? 22.553  -16.585 -45.318 1.00 62.78  ? 284  HIS B ND1 1 
ATOM   6382 C CD2 . HIS B 1 284 ? 21.935  -16.707 -47.411 1.00 50.74  ? 284  HIS B CD2 1 
ATOM   6383 C CE1 . HIS B 1 284 ? 22.731  -17.836 -45.706 1.00 63.57  ? 284  HIS B CE1 1 
ATOM   6384 N NE2 . HIS B 1 284 ? 22.367  -17.936 -46.972 1.00 60.65  ? 284  HIS B NE2 1 
ATOM   6385 N N   . GLU B 1 285 ? 19.771  -11.775 -45.199 1.00 40.74  ? 285  GLU B N   1 
ATOM   6386 C CA  . GLU B 1 285 ? 19.929  -10.382 -44.816 1.00 38.69  ? 285  GLU B CA  1 
ATOM   6387 C C   . GLU B 1 285 ? 19.968  -10.209 -43.294 1.00 47.84  ? 285  GLU B C   1 
ATOM   6388 O O   . GLU B 1 285 ? 20.736  -9.403  -42.776 1.00 43.35  ? 285  GLU B O   1 
ATOM   6389 C CB  . GLU B 1 285 ? 18.847  -9.505  -45.450 1.00 37.93  ? 285  GLU B CB  1 
ATOM   6390 C CG  . GLU B 1 285 ? 17.434  -9.712  -44.908 1.00 42.84  ? 285  GLU B CG  1 
ATOM   6391 C CD  . GLU B 1 285 ? 16.482  -8.636  -45.398 1.00 47.88  ? 285  GLU B CD  1 
ATOM   6392 O OE1 . GLU B 1 285 ? 16.964  -7.673  -46.031 1.00 53.37  ? 285  GLU B OE1 1 
ATOM   6393 O OE2 . GLU B 1 285 ? 15.262  -8.745  -45.149 1.00 48.03  ? 285  GLU B OE2 1 
ATOM   6394 N N   . TRP B 1 286 ? 19.181  -11.011 -42.588 1.00 49.16  ? 286  TRP B N   1 
ATOM   6395 C CA  . TRP B 1 286 ? 19.018  -10.857 -41.153 1.00 56.67  ? 286  TRP B CA  1 
ATOM   6396 C C   . TRP B 1 286 ? 20.137  -11.568 -40.375 1.00 64.41  ? 286  TRP B C   1 
ATOM   6397 O O   . TRP B 1 286 ? 20.117  -11.626 -39.148 1.00 72.66  ? 286  TRP B O   1 
ATOM   6398 C CB  . TRP B 1 286 ? 17.633  -11.363 -40.749 1.00 66.93  ? 286  TRP B CB  1 
ATOM   6399 C CG  . TRP B 1 286 ? 17.144  -10.864 -39.434 1.00 84.07  ? 286  TRP B CG  1 
ATOM   6400 C CD1 . TRP B 1 286 ? 17.697  -9.879  -38.665 1.00 87.06  ? 286  TRP B CD1 1 
ATOM   6401 C CD2 . TRP B 1 286 ? 15.998  -11.336 -38.719 1.00 93.38  ? 286  TRP B CD2 1 
ATOM   6402 N NE1 . TRP B 1 286 ? 16.967  -9.713  -37.513 1.00 88.23  ? 286  TRP B NE1 1 
ATOM   6403 C CE2 . TRP B 1 286 ? 15.918  -10.595 -37.523 1.00 94.53  ? 286  TRP B CE2 1 
ATOM   6404 C CE3 . TRP B 1 286 ? 15.032  -12.316 -38.972 1.00 95.52  ? 286  TRP B CE3 1 
ATOM   6405 C CZ2 . TRP B 1 286 ? 14.918  -10.811 -36.580 1.00 99.12  ? 286  TRP B CZ2 1 
ATOM   6406 C CZ3 . TRP B 1 286 ? 14.034  -12.521 -38.039 1.00 98.63  ? 286  TRP B CZ3 1 
ATOM   6407 C CH2 . TRP B 1 286 ? 13.984  -11.772 -36.858 1.00 100.71 ? 286  TRP B CH2 1 
ATOM   6408 N N   . HIS B 1 287 ? 21.129  -12.087 -41.092 1.00 59.15  ? 287  HIS B N   1 
ATOM   6409 C CA  . HIS B 1 287 ? 22.246  -12.769 -40.447 1.00 58.50  ? 287  HIS B CA  1 
ATOM   6410 C C   . HIS B 1 287 ? 23.494  -11.902 -40.312 1.00 57.51  ? 287  HIS B C   1 
ATOM   6411 O O   . HIS B 1 287 ? 24.538  -12.391 -39.883 1.00 60.38  ? 287  HIS B O   1 
ATOM   6412 C CB  . HIS B 1 287 ? 22.606  -14.054 -41.201 1.00 60.16  ? 287  HIS B CB  1 
ATOM   6413 C CG  . HIS B 1 287 ? 21.535  -15.096 -41.166 1.00 67.40  ? 287  HIS B CG  1 
ATOM   6414 N ND1 . HIS B 1 287 ? 21.490  -16.146 -42.058 1.00 76.87  ? 287  HIS B ND1 1 
ATOM   6415 C CD2 . HIS B 1 287 ? 20.471  -15.252 -40.344 1.00 71.42  ? 287  HIS B CD2 1 
ATOM   6416 C CE1 . HIS B 1 287 ? 20.444  -16.906 -41.785 1.00 81.83  ? 287  HIS B CE1 1 
ATOM   6417 N NE2 . HIS B 1 287 ? 19.808  -16.383 -40.750 1.00 79.18  ? 287  HIS B NE2 1 
ATOM   6418 N N   . VAL B 1 288 ? 23.397  -10.625 -40.673 1.00 54.03  ? 288  VAL B N   1 
ATOM   6419 C CA  . VAL B 1 288 ? 24.579  -9.755  -40.672 1.00 54.83  ? 288  VAL B CA  1 
ATOM   6420 C C   . VAL B 1 288 ? 24.636  -8.738  -39.532 1.00 54.99  ? 288  VAL B C   1 
ATOM   6421 O O   . VAL B 1 288 ? 25.566  -7.935  -39.477 1.00 55.14  ? 288  VAL B O   1 
ATOM   6422 C CB  . VAL B 1 288 ? 24.739  -8.974  -41.997 1.00 52.48  ? 288  VAL B CB  1 
ATOM   6423 C CG1 . VAL B 1 288 ? 24.806  -9.923  -43.171 1.00 54.85  ? 288  VAL B CG1 1 
ATOM   6424 C CG2 . VAL B 1 288 ? 23.614  -7.975  -42.162 1.00 39.57  ? 288  VAL B CG2 1 
ATOM   6425 N N   . LEU B 1 289 ? 23.649  -8.748  -38.643 1.00 52.91  ? 289  LEU B N   1 
ATOM   6426 C CA  . LEU B 1 289 ? 23.703  -7.868  -37.483 1.00 52.43  ? 289  LEU B CA  1 
ATOM   6427 C C   . LEU B 1 289 ? 24.839  -8.340  -36.576 1.00 54.42  ? 289  LEU B C   1 
ATOM   6428 O O   . LEU B 1 289 ? 25.023  -9.543  -36.378 1.00 60.35  ? 289  LEU B O   1 
ATOM   6429 C CB  . LEU B 1 289 ? 22.364  -7.836  -36.733 1.00 42.34  ? 289  LEU B CB  1 
ATOM   6430 C CG  . LEU B 1 289 ? 21.166  -7.235  -37.482 1.00 43.27  ? 289  LEU B CG  1 
ATOM   6431 C CD1 . LEU B 1 289 ? 19.857  -7.518  -36.766 1.00 39.72  ? 289  LEU B CD1 1 
ATOM   6432 C CD2 . LEU B 1 289 ? 21.340  -5.735  -37.689 1.00 40.22  ? 289  LEU B CD2 1 
ATOM   6433 N N   . PRO B 1 290 ? 25.622  -7.390  -36.040 1.00 54.60  ? 290  PRO B N   1 
ATOM   6434 C CA  . PRO B 1 290 ? 26.779  -7.695  -35.183 1.00 55.82  ? 290  PRO B CA  1 
ATOM   6435 C C   . PRO B 1 290 ? 26.399  -8.329  -33.836 1.00 51.18  ? 290  PRO B C   1 
ATOM   6436 O O   . PRO B 1 290 ? 27.162  -9.121  -33.296 1.00 58.61  ? 290  PRO B O   1 
ATOM   6437 C CB  . PRO B 1 290 ? 27.410  -6.318  -34.959 1.00 53.31  ? 290  PRO B CB  1 
ATOM   6438 C CG  . PRO B 1 290 ? 26.243  -5.353  -35.096 1.00 45.47  ? 290  PRO B CG  1 
ATOM   6439 C CD  . PRO B 1 290 ? 25.420  -5.937  -36.202 1.00 43.85  ? 290  PRO B CD  1 
ATOM   6440 N N   . GLN B 1 291 ? 25.231  -7.993  -33.302 1.00 55.02  ? 291  GLN B N   1 
ATOM   6441 C CA  . GLN B 1 291 ? 24.814  -8.542  -32.015 1.00 57.23  ? 291  GLN B CA  1 
ATOM   6442 C C   . GLN B 1 291 ? 23.397  -9.119  -32.088 1.00 53.97  ? 291  GLN B C   1 
ATOM   6443 O O   . GLN B 1 291 ? 22.609  -8.753  -32.966 1.00 49.86  ? 291  GLN B O   1 
ATOM   6444 C CB  . GLN B 1 291 ? 24.887  -7.468  -30.909 1.00 62.54  ? 291  GLN B CB  1 
ATOM   6445 C CG  . GLN B 1 291 ? 26.276  -6.838  -30.670 1.00 70.93  ? 291  GLN B CG  1 
ATOM   6446 C CD  . GLN B 1 291 ? 26.447  -5.459  -31.324 1.00 73.15  ? 291  GLN B CD  1 
ATOM   6447 O OE1 . GLN B 1 291 ? 25.512  -4.910  -31.913 1.00 79.72  ? 291  GLN B OE1 1 
ATOM   6448 N NE2 . GLN B 1 291 ? 27.647  -4.899  -31.218 1.00 71.27  ? 291  GLN B NE2 1 
ATOM   6449 N N   . GLU B 1 292 ? 23.075  -10.024 -31.167 1.00 58.71  ? 292  GLU B N   1 
ATOM   6450 C CA  . GLU B 1 292 ? 21.698  -10.476 -31.022 1.00 60.11  ? 292  GLU B CA  1 
ATOM   6451 C C   . GLU B 1 292 ? 20.885  -9.293  -30.507 1.00 55.66  ? 292  GLU B C   1 
ATOM   6452 O O   . GLU B 1 292 ? 21.145  -8.779  -29.422 1.00 62.37  ? 292  GLU B O   1 
ATOM   6453 C CB  . GLU B 1 292 ? 21.592  -11.651 -30.047 1.00 66.62  ? 292  GLU B CB  1 
ATOM   6454 C CG  . GLU B 1 292 ? 20.222  -12.329 -30.063 1.00 74.47  ? 292  GLU B CG  1 
ATOM   6455 C CD  . GLU B 1 292 ? 19.903  -13.080 -28.775 1.00 88.39  ? 292  GLU B CD  1 
ATOM   6456 O OE1 . GLU B 1 292 ? 20.815  -13.270 -27.933 1.00 91.43  ? 292  GLU B OE1 1 
ATOM   6457 O OE2 . GLU B 1 292 ? 18.728  -13.479 -28.606 1.00 92.92  ? 292  GLU B OE2 1 
ATOM   6458 N N   . SER B 1 293 ? 19.910  -8.850  -31.284 1.00 48.85  ? 293  SER B N   1 
ATOM   6459 C CA  . SER B 1 293 ? 19.177  -7.661  -30.906 1.00 52.73  ? 293  SER B CA  1 
ATOM   6460 C C   . SER B 1 293 ? 17.691  -7.686  -31.235 1.00 51.62  ? 293  SER B C   1 
ATOM   6461 O O   . SER B 1 293 ? 17.166  -8.635  -31.813 1.00 52.76  ? 293  SER B O   1 
ATOM   6462 C CB  . SER B 1 293 ? 19.826  -6.411  -31.525 1.00 50.47  ? 293  SER B CB  1 
ATOM   6463 O OG  . SER B 1 293 ? 20.393  -6.669  -32.799 1.00 48.11  ? 293  SER B OG  1 
ATOM   6464 N N   . ILE B 1 294 ? 17.023  -6.622  -30.813 1.00 52.60  ? 294  ILE B N   1 
ATOM   6465 C CA  . ILE B 1 294 ? 15.713  -6.275  -31.310 1.00 50.31  ? 294  ILE B CA  1 
ATOM   6466 C C   . ILE B 1 294 ? 15.824  -4.805  -31.628 1.00 45.56  ? 294  ILE B C   1 
ATOM   6467 O O   . ILE B 1 294 ? 16.748  -4.146  -31.166 1.00 46.65  ? 294  ILE B O   1 
ATOM   6468 C CB  . ILE B 1 294 ? 14.610  -6.498  -30.272 1.00 51.69  ? 294  ILE B CB  1 
ATOM   6469 C CG1 . ILE B 1 294 ? 14.906  -5.693  -29.008 1.00 48.94  ? 294  ILE B CG1 1 
ATOM   6470 C CG2 . ILE B 1 294 ? 14.460  -7.990  -29.963 1.00 51.51  ? 294  ILE B CG2 1 
ATOM   6471 C CD1 . ILE B 1 294 ? 13.881  -5.877  -27.923 1.00 48.27  ? 294  ILE B CD1 1 
ATOM   6472 N N   . PHE B 1 295 ? 14.892  -4.314  -32.435 1.00 42.39  ? 295  PHE B N   1 
ATOM   6473 C CA  . PHE B 1 295 ? 14.860  -2.938  -32.900 1.00 42.57  ? 295  PHE B CA  1 
ATOM   6474 C C   . PHE B 1 295 ? 16.157  -2.533  -33.573 1.00 45.52  ? 295  PHE B C   1 
ATOM   6475 O O   . PHE B 1 295 ? 16.622  -1.404  -33.429 1.00 54.94  ? 295  PHE B O   1 
ATOM   6476 C CB  . PHE B 1 295 ? 14.481  -1.964  -31.776 1.00 39.92  ? 295  PHE B CB  1 
ATOM   6477 C CG  . PHE B 1 295 ? 13.564  -0.853  -32.230 1.00 33.27  ? 295  PHE B CG  1 
ATOM   6478 C CD1 . PHE B 1 295 ? 13.802  -0.186  -33.423 1.00 31.17  ? 295  PHE B CD1 1 
ATOM   6479 C CD2 . PHE B 1 295 ? 12.443  -0.510  -31.489 1.00 33.66  ? 295  PHE B CD2 1 
ATOM   6480 C CE1 . PHE B 1 295 ? 12.962  0.820   -33.850 1.00 29.52  ? 295  PHE B CE1 1 
ATOM   6481 C CE2 . PHE B 1 295 ? 11.597  0.505   -31.905 1.00 33.21  ? 295  PHE B CE2 1 
ATOM   6482 C CZ  . PHE B 1 295 ? 11.854  1.170   -33.084 1.00 30.25  ? 295  PHE B CZ  1 
ATOM   6483 N N   . ARG B 1 296 ? 16.735  -3.473  -34.305 1.00 39.17  ? 296  ARG B N   1 
ATOM   6484 C CA  . ARG B 1 296 ? 17.918  -3.214  -35.101 1.00 40.47  ? 296  ARG B CA  1 
ATOM   6485 C C   . ARG B 1 296 ? 17.701  -3.889  -36.464 1.00 45.02  ? 296  ARG B C   1 
ATOM   6486 O O   . ARG B 1 296 ? 17.103  -4.965  -36.553 1.00 49.27  ? 296  ARG B O   1 
ATOM   6487 C CB  . ARG B 1 296 ? 19.169  -3.727  -34.383 1.00 50.35  ? 296  ARG B CB  1 
ATOM   6488 C CG  . ARG B 1 296 ? 20.376  -2.767  -34.415 1.00 53.34  ? 296  ARG B CG  1 
ATOM   6489 C CD  . ARG B 1 296 ? 20.651  -2.071  -33.077 1.00 45.82  ? 296  ARG B CD  1 
ATOM   6490 N NE  . ARG B 1 296 ? 19.508  -1.265  -32.685 1.00 45.70  ? 296  ARG B NE  1 
ATOM   6491 C CZ  . ARG B 1 296 ? 19.410  -0.530  -31.577 1.00 46.87  ? 296  ARG B CZ  1 
ATOM   6492 N NH1 . ARG B 1 296 ? 20.399  -0.450  -30.692 1.00 38.85  ? 296  ARG B NH1 1 
ATOM   6493 N NH2 . ARG B 1 296 ? 18.290  0.139   -31.364 1.00 48.42  ? 296  ARG B NH2 1 
ATOM   6494 N N   . PHE B 1 297 ? 18.152  -3.242  -37.529 1.00 42.77  ? 297  PHE B N   1 
ATOM   6495 C CA  . PHE B 1 297 ? 17.833  -3.700  -38.884 1.00 43.37  ? 297  PHE B CA  1 
ATOM   6496 C C   . PHE B 1 297 ? 19.076  -3.727  -39.756 1.00 43.20  ? 297  PHE B C   1 
ATOM   6497 O O   . PHE B 1 297 ? 19.912  -2.827  -39.677 1.00 39.77  ? 297  PHE B O   1 
ATOM   6498 C CB  . PHE B 1 297 ? 16.754  -2.805  -39.487 1.00 29.55  ? 297  PHE B CB  1 
ATOM   6499 C CG  . PHE B 1 297 ? 15.637  -2.516  -38.532 1.00 35.31  ? 297  PHE B CG  1 
ATOM   6500 C CD1 . PHE B 1 297 ? 14.760  -3.528  -38.150 1.00 38.93  ? 297  PHE B CD1 1 
ATOM   6501 C CD2 . PHE B 1 297 ? 15.492  -1.258  -37.968 1.00 34.18  ? 297  PHE B CD2 1 
ATOM   6502 C CE1 . PHE B 1 297 ? 13.735  -3.281  -37.248 1.00 39.17  ? 297  PHE B CE1 1 
ATOM   6503 C CE2 . PHE B 1 297 ? 14.469  -1.001  -37.064 1.00 36.87  ? 297  PHE B CE2 1 
ATOM   6504 C CZ  . PHE B 1 297 ? 13.586  -2.018  -36.710 1.00 36.47  ? 297  PHE B CZ  1 
ATOM   6505 N N   . SER B 1 298 ? 19.191  -4.763  -40.582 1.00 42.95  ? 298  SER B N   1 
ATOM   6506 C CA  . SER B 1 298 ? 20.431  -5.032  -41.311 1.00 48.50  ? 298  SER B CA  1 
ATOM   6507 C C   . SER B 1 298 ? 20.802  -3.984  -42.345 1.00 40.81  ? 298  SER B C   1 
ATOM   6508 O O   . SER B 1 298 ? 21.961  -3.581  -42.434 1.00 41.67  ? 298  SER B O   1 
ATOM   6509 C CB  . SER B 1 298 ? 20.369  -6.399  -41.986 1.00 50.76  ? 298  SER B CB  1 
ATOM   6510 O OG  . SER B 1 298 ? 20.339  -7.414  -41.009 1.00 53.51  ? 298  SER B OG  1 
ATOM   6511 N N   . PHE B 1 299 ? 19.822  -3.545  -43.125 1.00 36.41  ? 299  PHE B N   1 
ATOM   6512 C CA  . PHE B 1 299 ? 20.099  -2.630  -44.226 1.00 34.02  ? 299  PHE B CA  1 
ATOM   6513 C C   . PHE B 1 299 ? 19.220  -1.401  -44.131 1.00 35.78  ? 299  PHE B C   1 
ATOM   6514 O O   . PHE B 1 299 ? 18.003  -1.462  -44.311 1.00 36.67  ? 299  PHE B O   1 
ATOM   6515 C CB  . PHE B 1 299 ? 19.992  -3.354  -45.580 1.00 33.87  ? 299  PHE B CB  1 
ATOM   6516 C CG  . PHE B 1 299 ? 21.071  -4.393  -45.771 1.00 36.33  ? 299  PHE B CG  1 
ATOM   6517 C CD1 . PHE B 1 299 ? 22.350  -4.015  -46.138 1.00 36.68  ? 299  PHE B CD1 1 
ATOM   6518 C CD2 . PHE B 1 299 ? 20.820  -5.738  -45.514 1.00 38.67  ? 299  PHE B CD2 1 
ATOM   6519 C CE1 . PHE B 1 299 ? 23.374  -4.970  -46.274 1.00 39.67  ? 299  PHE B CE1 1 
ATOM   6520 C CE2 . PHE B 1 299 ? 21.819  -6.692  -45.639 1.00 41.30  ? 299  PHE B CE2 1 
ATOM   6521 C CZ  . PHE B 1 299 ? 23.101  -6.311  -46.024 1.00 41.49  ? 299  PHE B CZ  1 
ATOM   6522 N N   . VAL B 1 300 ? 19.857  -0.285  -43.805 1.00 29.57  ? 300  VAL B N   1 
ATOM   6523 C CA  . VAL B 1 300 ? 19.164  0.952   -43.497 1.00 30.75  ? 300  VAL B CA  1 
ATOM   6524 C C   . VAL B 1 300 ? 19.964  2.074   -44.155 1.00 33.91  ? 300  VAL B C   1 
ATOM   6525 O O   . VAL B 1 300 ? 21.026  1.803   -44.719 1.00 32.61  ? 300  VAL B O   1 
ATOM   6526 C CB  . VAL B 1 300 ? 19.090  1.162   -41.955 1.00 27.66  ? 300  VAL B CB  1 
ATOM   6527 C CG1 . VAL B 1 300 ? 18.348  0.012   -41.273 1.00 34.02  ? 300  VAL B CG1 1 
ATOM   6528 C CG2 . VAL B 1 300 ? 20.474  1.333   -41.381 1.00 28.78  ? 300  VAL B CG2 1 
ATOM   6529 N N   . PRO B 1 301 ? 19.462  3.329   -44.106 1.00 33.22  ? 301  PRO B N   1 
ATOM   6530 C CA  . PRO B 1 301 ? 20.227  4.439   -44.684 1.00 31.33  ? 301  PRO B CA  1 
ATOM   6531 C C   . PRO B 1 301 ? 21.671  4.527   -44.141 1.00 38.04  ? 301  PRO B C   1 
ATOM   6532 O O   . PRO B 1 301 ? 21.911  4.220   -42.971 1.00 41.03  ? 301  PRO B O   1 
ATOM   6533 C CB  . PRO B 1 301 ? 19.412  5.661   -44.261 1.00 25.17  ? 301  PRO B CB  1 
ATOM   6534 C CG  . PRO B 1 301 ? 18.004  5.162   -44.221 1.00 30.80  ? 301  PRO B CG  1 
ATOM   6535 C CD  . PRO B 1 301 ? 18.105  3.760   -43.697 1.00 34.48  ? 301  PRO B CD  1 
ATOM   6536 N N   . VAL B 1 302 ? 22.620  4.910   -44.995 1.00 32.49  ? 302  VAL B N   1 
ATOM   6537 C CA  . VAL B 1 302 ? 24.032  4.955   -44.598 1.00 32.55  ? 302  VAL B CA  1 
ATOM   6538 C C   . VAL B 1 302 ? 24.549  6.385   -44.651 1.00 34.15  ? 302  VAL B C   1 
ATOM   6539 O O   . VAL B 1 302 ? 24.185  7.144   -45.543 1.00 43.62  ? 302  VAL B O   1 
ATOM   6540 C CB  . VAL B 1 302 ? 24.920  4.034   -45.485 1.00 31.76  ? 302  VAL B CB  1 
ATOM   6541 C CG1 . VAL B 1 302 ? 24.707  4.334   -46.954 1.00 32.72  ? 302  VAL B CG1 1 
ATOM   6542 C CG2 . VAL B 1 302 ? 26.390  4.171   -45.125 1.00 33.79  ? 302  VAL B CG2 1 
ATOM   6543 N N   . VAL B 1 303 ? 25.371  6.770   -43.681 1.00 36.61  ? 303  VAL B N   1 
ATOM   6544 C CA  . VAL B 1 303 ? 25.979  8.092   -43.732 1.00 33.31  ? 303  VAL B CA  1 
ATOM   6545 C C   . VAL B 1 303 ? 27.011  8.069   -44.846 1.00 37.62  ? 303  VAL B C   1 
ATOM   6546 O O   . VAL B 1 303 ? 28.162  7.681   -44.643 1.00 42.04  ? 303  VAL B O   1 
ATOM   6547 C CB  . VAL B 1 303 ? 26.576  8.508   -42.378 1.00 34.49  ? 303  VAL B CB  1 
ATOM   6548 C CG1 . VAL B 1 303 ? 27.042  9.953   -42.426 1.00 36.04  ? 303  VAL B CG1 1 
ATOM   6549 C CG2 . VAL B 1 303 ? 25.526  8.350   -41.289 1.00 32.84  ? 303  VAL B CG2 1 
ATOM   6550 N N   . ASP B 1 304 ? 26.566  8.453   -46.040 1.00 36.11  ? 304  ASP B N   1 
ATOM   6551 C CA  . ASP B 1 304 ? 27.371  8.326   -47.256 1.00 38.11  ? 304  ASP B CA  1 
ATOM   6552 C C   . ASP B 1 304 ? 28.240  9.546   -47.541 1.00 38.86  ? 304  ASP B C   1 
ATOM   6553 O O   . ASP B 1 304 ? 29.119  9.502   -48.401 1.00 40.81  ? 304  ASP B O   1 
ATOM   6554 C CB  . ASP B 1 304 ? 26.463  8.065   -48.456 1.00 35.41  ? 304  ASP B CB  1 
ATOM   6555 C CG  . ASP B 1 304 ? 25.379  9.108   -48.597 1.00 46.83  ? 304  ASP B CG  1 
ATOM   6556 O OD1 . ASP B 1 304 ? 25.290  9.989   -47.713 1.00 41.49  ? 304  ASP B OD1 1 
ATOM   6557 O OD2 . ASP B 1 304 ? 24.608  9.043   -49.583 1.00 42.24  ? 304  ASP B OD2 1 
ATOM   6558 N N   . GLY B 1 305 ? 27.978  10.635  -46.829 1.00 47.67  ? 305  GLY B N   1 
ATOM   6559 C CA  . GLY B 1 305 ? 28.595  11.908  -47.140 1.00 43.54  ? 305  GLY B CA  1 
ATOM   6560 C C   . GLY B 1 305 ? 27.928  12.521  -48.354 1.00 41.78  ? 305  GLY B C   1 
ATOM   6561 O O   . GLY B 1 305 ? 28.392  13.523  -48.888 1.00 44.37  ? 305  GLY B O   1 
ATOM   6562 N N   . ASP B 1 306 ? 26.824  11.918  -48.790 1.00 40.01  ? 306  ASP B N   1 
ATOM   6563 C CA  . ASP B 1 306 ? 26.137  12.355  -50.003 1.00 41.89  ? 306  ASP B CA  1 
ATOM   6564 C C   . ASP B 1 306 ? 24.674  12.731  -49.727 1.00 39.40  ? 306  ASP B C   1 
ATOM   6565 O O   . ASP B 1 306 ? 24.372  13.906  -49.549 1.00 44.68  ? 306  ASP B O   1 
ATOM   6566 C CB  . ASP B 1 306 ? 26.257  11.295  -51.105 1.00 39.71  ? 306  ASP B CB  1 
ATOM   6567 C CG  . ASP B 1 306 ? 25.781  11.790  -52.451 1.00 54.49  ? 306  ASP B CG  1 
ATOM   6568 O OD1 . ASP B 1 306 ? 25.510  13.003  -52.581 1.00 47.38  ? 306  ASP B OD1 1 
ATOM   6569 O OD2 . ASP B 1 306 ? 25.693  10.962  -53.385 1.00 62.83  ? 306  ASP B OD2 1 
ATOM   6570 N N   . PHE B 1 307 ? 23.771  11.751  -49.718 1.00 40.34  ? 307  PHE B N   1 
ATOM   6571 C CA  . PHE B 1 307 ? 22.390  12.009  -49.303 1.00 37.63  ? 307  PHE B CA  1 
ATOM   6572 C C   . PHE B 1 307 ? 22.429  12.619  -47.906 1.00 36.86  ? 307  PHE B C   1 
ATOM   6573 O O   . PHE B 1 307 ? 21.772  13.612  -47.642 1.00 33.48  ? 307  PHE B O   1 
ATOM   6574 C CB  . PHE B 1 307 ? 21.556  10.718  -49.280 1.00 32.55  ? 307  PHE B CB  1 
ATOM   6575 C CG  . PHE B 1 307 ? 20.063  10.958  -49.250 1.00 33.18  ? 307  PHE B CG  1 
ATOM   6576 C CD1 . PHE B 1 307 ? 19.420  11.293  -48.072 1.00 33.19  ? 307  PHE B CD1 1 
ATOM   6577 C CD2 . PHE B 1 307 ? 19.308  10.849  -50.401 1.00 32.71  ? 307  PHE B CD2 1 
ATOM   6578 C CE1 . PHE B 1 307 ? 18.046  11.514  -48.041 1.00 27.99  ? 307  PHE B CE1 1 
ATOM   6579 C CE2 . PHE B 1 307 ? 17.936  11.072  -50.377 1.00 36.77  ? 307  PHE B CE2 1 
ATOM   6580 C CZ  . PHE B 1 307 ? 17.308  11.405  -49.190 1.00 34.94  ? 307  PHE B CZ  1 
ATOM   6581 N N   . LEU B 1 308 ? 23.223  12.005  -47.032 1.00 34.09  ? 308  LEU B N   1 
ATOM   6582 C CA  . LEU B 1 308 ? 23.486  12.508  -45.692 1.00 38.28  ? 308  LEU B CA  1 
ATOM   6583 C C   . LEU B 1 308 ? 24.926  12.996  -45.638 1.00 45.65  ? 308  LEU B C   1 
ATOM   6584 O O   . LEU B 1 308 ? 25.871  12.196  -45.611 1.00 45.29  ? 308  LEU B O   1 
ATOM   6585 C CB  . LEU B 1 308 ? 23.274  11.398  -44.658 1.00 31.41  ? 308  LEU B CB  1 
ATOM   6586 C CG  . LEU B 1 308 ? 21.859  10.813  -44.615 1.00 34.29  ? 308  LEU B CG  1 
ATOM   6587 C CD1 . LEU B 1 308 ? 21.742  9.697   -43.592 1.00 28.00  ? 308  LEU B CD1 1 
ATOM   6588 C CD2 . LEU B 1 308 ? 20.842  11.902  -44.330 1.00 28.65  ? 308  LEU B CD2 1 
ATOM   6589 N N   . SER B 1 309 ? 25.091  14.313  -45.621 1.00 47.97  ? 309  SER B N   1 
ATOM   6590 C CA  . SER B 1 309 ? 26.419  14.926  -45.624 1.00 52.99  ? 309  SER B CA  1 
ATOM   6591 C C   . SER B 1 309 ? 27.206  14.672  -44.328 1.00 50.63  ? 309  SER B C   1 
ATOM   6592 O O   . SER B 1 309 ? 28.430  14.748  -44.313 1.00 55.56  ? 309  SER B O   1 
ATOM   6593 C CB  . SER B 1 309 ? 26.296  16.424  -45.895 1.00 43.36  ? 309  SER B CB  1 
ATOM   6594 O OG  . SER B 1 309 ? 25.532  17.049  -44.883 1.00 55.13  ? 309  SER B OG  1 
ATOM   6595 N N   . ASP B 1 310 ? 26.498  14.368  -43.247 1.00 48.92  ? 310  ASP B N   1 
ATOM   6596 C CA  . ASP B 1 310 ? 27.113  14.036  -41.962 1.00 46.23  ? 310  ASP B CA  1 
ATOM   6597 C C   . ASP B 1 310 ? 26.089  13.175  -41.205 1.00 42.39  ? 310  ASP B C   1 
ATOM   6598 O O   . ASP B 1 310 ? 25.022  12.874  -41.746 1.00 36.03  ? 310  ASP B O   1 
ATOM   6599 C CB  . ASP B 1 310 ? 27.436  15.320  -41.197 1.00 47.07  ? 310  ASP B CB  1 
ATOM   6600 C CG  . ASP B 1 310 ? 28.530  15.140  -40.166 1.00 53.87  ? 310  ASP B CG  1 
ATOM   6601 O OD1 . ASP B 1 310 ? 28.693  14.009  -39.667 1.00 55.38  ? 310  ASP B OD1 1 
ATOM   6602 O OD2 . ASP B 1 310 ? 29.219  16.139  -39.849 1.00 47.67  ? 310  ASP B OD2 1 
ATOM   6603 N N   . THR B 1 311 ? 26.393  12.763  -39.979 1.00 37.43  ? 311  THR B N   1 
ATOM   6604 C CA  . THR B 1 311 ? 25.424  11.988  -39.202 1.00 39.65  ? 311  THR B CA  1 
ATOM   6605 C C   . THR B 1 311 ? 24.186  12.826  -38.953 1.00 40.89  ? 311  THR B C   1 
ATOM   6606 O O   . THR B 1 311 ? 24.259  14.056  -38.933 1.00 46.81  ? 311  THR B O   1 
ATOM   6607 C CB  . THR B 1 311 ? 25.968  11.604  -37.830 1.00 39.10  ? 311  THR B CB  1 
ATOM   6608 O OG1 . THR B 1 311 ? 26.383  12.791  -37.146 1.00 38.45  ? 311  THR B OG1 1 
ATOM   6609 C CG2 . THR B 1 311 ? 27.142  10.653  -37.974 1.00 37.94  ? 311  THR B CG2 1 
ATOM   6610 N N   . PRO B 1 312 ? 23.037  12.166  -38.769 1.00 35.28  ? 312  PRO B N   1 
ATOM   6611 C CA  . PRO B 1 312 ? 21.825  12.908  -38.416 1.00 35.80  ? 312  PRO B CA  1 
ATOM   6612 C C   . PRO B 1 312 ? 22.014  13.736  -37.141 1.00 42.55  ? 312  PRO B C   1 
ATOM   6613 O O   . PRO B 1 312 ? 21.473  14.847  -37.044 1.00 46.40  ? 312  PRO B O   1 
ATOM   6614 C CB  . PRO B 1 312 ? 20.792  11.805  -38.217 1.00 31.06  ? 312  PRO B CB  1 
ATOM   6615 C CG  . PRO B 1 312 ? 21.255  10.716  -39.151 1.00 32.03  ? 312  PRO B CG  1 
ATOM   6616 C CD  . PRO B 1 312 ? 22.755  10.751  -39.069 1.00 35.57  ? 312  PRO B CD  1 
ATOM   6617 N N   A GLU B 1 313 ? 22.773  13.220  -36.174 0.41 42.49  ? 313  GLU B N   1 
ATOM   6618 N N   B GLU B 1 313 ? 22.776  13.205  -36.190 0.19 42.86  ? 313  GLU B N   1 
ATOM   6619 N N   C GLU B 1 313 ? 22.769  13.199  -36.191 0.40 42.49  ? 313  GLU B N   1 
ATOM   6620 C CA  A GLU B 1 313 ? 23.011  13.984  -34.950 0.41 45.08  ? 313  GLU B CA  1 
ATOM   6621 C CA  B GLU B 1 313 ? 23.059  13.908  -34.944 0.19 45.43  ? 313  GLU B CA  1 
ATOM   6622 C CA  C GLU B 1 313 ? 23.054  13.905  -34.951 0.40 45.59  ? 313  GLU B CA  1 
ATOM   6623 C C   A GLU B 1 313 ? 23.724  15.281  -35.276 0.41 46.02  ? 313  GLU B C   1 
ATOM   6624 C C   B GLU B 1 313 ? 23.758  15.234  -35.226 0.19 46.57  ? 313  GLU B C   1 
ATOM   6625 C C   C GLU B 1 313 ? 23.757  15.231  -35.228 0.40 46.46  ? 313  GLU B C   1 
ATOM   6626 O O   A GLU B 1 313 ? 23.311  16.350  -34.828 0.41 47.79  ? 313  GLU B O   1 
ATOM   6627 O O   B GLU B 1 313 ? 23.364  16.275  -34.703 0.19 47.69  ? 313  GLU B O   1 
ATOM   6628 O O   C GLU B 1 313 ? 23.359  16.271  -34.710 0.40 47.89  ? 313  GLU B O   1 
ATOM   6629 C CB  A GLU B 1 313 ? 23.817  13.208  -33.896 0.41 48.20  ? 313  GLU B CB  1 
ATOM   6630 C CB  B GLU B 1 313 ? 23.926  13.044  -34.024 0.19 48.17  ? 313  GLU B CB  1 
ATOM   6631 C CB  C GLU B 1 313 ? 23.887  13.026  -34.010 0.40 48.60  ? 313  GLU B CB  1 
ATOM   6632 C CG  A GLU B 1 313 ? 23.894  13.973  -32.570 0.41 50.01  ? 313  GLU B CG  1 
ATOM   6633 C CG  B GLU B 1 313 ? 23.450  11.600  -33.879 0.19 47.31  ? 313  GLU B CG  1 
ATOM   6634 C CG  C GLU B 1 313 ? 23.066  11.994  -33.223 0.40 48.13  ? 313  GLU B CG  1 
ATOM   6635 C CD  A GLU B 1 313 ? 24.690  13.275  -31.480 0.41 54.07  ? 313  GLU B CD  1 
ATOM   6636 C CD  B GLU B 1 313 ? 22.199  11.459  -33.027 0.19 43.42  ? 313  GLU B CD  1 
ATOM   6637 C CD  C GLU B 1 313 ? 22.600  10.799  -34.056 0.40 45.44  ? 313  GLU B CD  1 
ATOM   6638 O OE1 A GLU B 1 313 ? 25.649  12.543  -31.795 0.41 41.02  ? 313  GLU B OE1 1 
ATOM   6639 O OE1 B GLU B 1 313 ? 21.868  12.403  -32.279 0.19 36.91  ? 313  GLU B OE1 1 
ATOM   6640 O OE1 C GLU B 1 313 ? 23.061  10.625  -35.214 0.40 32.33  ? 313  GLU B OE1 1 
ATOM   6641 O OE2 A GLU B 1 313 ? 24.359  13.485  -30.294 0.41 56.65  ? 313  GLU B OE2 1 
ATOM   6642 O OE2 B GLU B 1 313 ? 21.551  10.394  -33.105 0.19 42.84  ? 313  GLU B OE2 1 
ATOM   6643 O OE2 C GLU B 1 313 ? 21.770  10.024  -33.533 0.40 31.46  ? 313  GLU B OE2 1 
ATOM   6644 N N   . ALA B 1 314 ? 24.791  15.186  -36.062 1.00 44.84  ? 314  ALA B N   1 
ATOM   6645 C CA  . ALA B 1 314 ? 25.540  16.383  -36.440 1.00 51.97  ? 314  ALA B CA  1 
ATOM   6646 C C   . ALA B 1 314 ? 24.646  17.378  -37.183 1.00 48.07  ? 314  ALA B C   1 
ATOM   6647 O O   . ALA B 1 314 ? 24.682  18.584  -36.916 1.00 45.17  ? 314  ALA B O   1 
ATOM   6648 C CB  . ALA B 1 314 ? 26.768  16.021  -37.288 1.00 42.90  ? 314  ALA B CB  1 
ATOM   6649 N N   . LEU B 1 315 ? 23.831  16.857  -38.095 1.00 38.26  ? 315  LEU B N   1 
ATOM   6650 C CA  . LEU B 1 315 ? 22.978  17.693  -38.928 1.00 50.12  ? 315  LEU B CA  1 
ATOM   6651 C C   . LEU B 1 315 ? 21.831  18.362  -38.165 1.00 53.20  ? 315  LEU B C   1 
ATOM   6652 O O   . LEU B 1 315 ? 21.514  19.521  -38.439 1.00 38.91  ? 315  LEU B O   1 
ATOM   6653 C CB  . LEU B 1 315 ? 22.444  16.903  -40.122 1.00 42.56  ? 315  LEU B CB  1 
ATOM   6654 C CG  . LEU B 1 315 ? 23.498  16.409  -41.108 1.00 42.50  ? 315  LEU B CG  1 
ATOM   6655 C CD1 . LEU B 1 315 ? 22.837  15.587  -42.203 1.00 34.85  ? 315  LEU B CD1 1 
ATOM   6656 C CD2 . LEU B 1 315 ? 24.270  17.577  -41.690 1.00 40.24  ? 315  LEU B CD2 1 
ATOM   6657 N N   . ILE B 1 316 ? 21.209  17.658  -37.216 1.00 49.51  ? 316  ILE B N   1 
ATOM   6658 C CA  . ILE B 1 316 ? 20.185  18.316  -36.391 1.00 52.72  ? 316  ILE B CA  1 
ATOM   6659 C C   . ILE B 1 316 ? 20.795  19.318  -35.404 1.00 55.34  ? 316  ILE B C   1 
ATOM   6660 O O   . ILE B 1 316 ? 20.162  20.317  -35.072 1.00 55.87  ? 316  ILE B O   1 
ATOM   6661 C CB  . ILE B 1 316 ? 19.221  17.337  -35.638 1.00 38.96  ? 316  ILE B CB  1 
ATOM   6662 C CG1 . ILE B 1 316 ? 19.930  16.617  -34.486 1.00 47.69  ? 316  ILE B CG1 1 
ATOM   6663 C CG2 . ILE B 1 316 ? 18.548  16.345  -36.605 1.00 29.93  ? 316  ILE B CG2 1 
ATOM   6664 C CD1 . ILE B 1 316 ? 19.048  15.569  -33.769 1.00 46.23  ? 316  ILE B CD1 1 
ATOM   6665 N N   . ASN B 1 317 ? 22.023  19.060  -34.949 1.00 53.62  ? 317  ASN B N   1 
ATOM   6666 C CA  . ASN B 1 317 ? 22.682  19.943  -33.978 1.00 54.85  ? 317  ASN B CA  1 
ATOM   6667 C C   . ASN B 1 317 ? 23.113  21.277  -34.583 1.00 53.02  ? 317  ASN B C   1 
ATOM   6668 O O   . ASN B 1 317 ? 23.370  22.231  -33.856 1.00 56.76  ? 317  ASN B O   1 
ATOM   6669 C CB  . ASN B 1 317 ? 23.921  19.274  -33.346 1.00 62.01  ? 317  ASN B CB  1 
ATOM   6670 C CG  . ASN B 1 317 ? 23.573  18.187  -32.324 1.00 60.65  ? 317  ASN B CG  1 
ATOM   6671 O OD1 . ASN B 1 317 ? 22.408  17.827  -32.138 1.00 67.16  ? 317  ASN B OD1 1 
ATOM   6672 N ND2 . ASN B 1 317 ? 24.601  17.644  -31.674 1.00 50.66  ? 317  ASN B ND2 1 
ATOM   6673 N N   . THR B 1 318 ? 23.215  21.337  -35.910 1.00 54.77  ? 318  THR B N   1 
ATOM   6674 C CA  . THR B 1 318 ? 23.804  22.503  -36.572 1.00 61.00  ? 318  THR B CA  1 
ATOM   6675 C C   . THR B 1 318 ? 22.954  23.095  -37.689 1.00 60.52  ? 318  THR B C   1 
ATOM   6676 O O   . THR B 1 318 ? 23.287  24.158  -38.213 1.00 57.77  ? 318  THR B O   1 
ATOM   6677 C CB  . THR B 1 318 ? 25.142  22.154  -37.212 1.00 63.83  ? 318  THR B CB  1 
ATOM   6678 O OG1 . THR B 1 318 ? 24.917  21.236  -38.293 1.00 57.41  ? 318  THR B OG1 1 
ATOM   6679 C CG2 . THR B 1 318 ? 26.076  21.531  -36.191 1.00 68.03  ? 318  THR B CG2 1 
ATOM   6680 N N   . GLY B 1 319 ? 21.878  22.405  -38.064 1.00 45.65  ? 319  GLY B N   1 
ATOM   6681 C CA  . GLY B 1 319 ? 21.023  22.857  -39.150 1.00 54.08  ? 319  GLY B CA  1 
ATOM   6682 C C   . GLY B 1 319 ? 20.268  24.156  -38.902 1.00 60.01  ? 319  GLY B C   1 
ATOM   6683 O O   . GLY B 1 319 ? 20.141  24.616  -37.766 1.00 54.46  ? 319  GLY B O   1 
ATOM   6684 N N   . ASP B 1 320 ? 19.779  24.757  -39.985 1.00 67.82  ? 320  ASP B N   1 
ATOM   6685 C CA  . ASP B 1 320 ? 18.867  25.892  -39.901 1.00 66.96  ? 320  ASP B CA  1 
ATOM   6686 C C   . ASP B 1 320 ? 17.475  25.455  -40.349 1.00 62.95  ? 320  ASP B C   1 
ATOM   6687 O O   . ASP B 1 320 ? 17.255  25.111  -41.514 1.00 60.63  ? 320  ASP B O   1 
ATOM   6688 C CB  . ASP B 1 320 ? 19.353  27.055  -40.757 1.00 71.03  ? 320  ASP B CB  1 
ATOM   6689 C CG  . ASP B 1 320 ? 18.678  28.363  -40.392 1.00 77.71  ? 320  ASP B CG  1 
ATOM   6690 O OD1 . ASP B 1 320 ? 17.606  28.320  -39.749 1.00 75.76  ? 320  ASP B OD1 1 
ATOM   6691 O OD2 . ASP B 1 320 ? 19.223  29.434  -40.743 1.00 83.19  ? 320  ASP B OD2 1 
ATOM   6692 N N   . PHE B 1 321 ? 16.536  25.472  -39.413 1.00 58.92  ? 321  PHE B N   1 
ATOM   6693 C CA  . PHE B 1 321 ? 15.213  24.929  -39.673 1.00 50.85  ? 321  PHE B CA  1 
ATOM   6694 C C   . PHE B 1 321 ? 14.137  25.986  -39.542 1.00 49.63  ? 321  PHE B C   1 
ATOM   6695 O O   . PHE B 1 321 ? 12.980  25.672  -39.265 1.00 50.24  ? 321  PHE B O   1 
ATOM   6696 C CB  . PHE B 1 321 ? 14.924  23.767  -38.726 1.00 43.72  ? 321  PHE B CB  1 
ATOM   6697 C CG  . PHE B 1 321 ? 15.901  22.636  -38.849 1.00 42.53  ? 321  PHE B CG  1 
ATOM   6698 C CD1 . PHE B 1 321 ? 15.963  21.880  -40.006 1.00 41.26  ? 321  PHE B CD1 1 
ATOM   6699 C CD2 . PHE B 1 321 ? 16.761  22.328  -37.811 1.00 45.62  ? 321  PHE B CD2 1 
ATOM   6700 C CE1 . PHE B 1 321 ? 16.864  20.840  -40.123 1.00 37.84  ? 321  PHE B CE1 1 
ATOM   6701 C CE2 . PHE B 1 321 ? 17.662  21.280  -37.927 1.00 46.59  ? 321  PHE B CE2 1 
ATOM   6702 C CZ  . PHE B 1 321 ? 17.709  20.537  -39.085 1.00 37.74  ? 321  PHE B CZ  1 
ATOM   6703 N N   . GLN B 1 322 ? 14.522  27.234  -39.774 1.00 54.88  ? 322  GLN B N   1 
ATOM   6704 C CA  . GLN B 1 322 ? 13.635  28.364  -39.538 1.00 61.00  ? 322  GLN B CA  1 
ATOM   6705 C C   . GLN B 1 322 ? 12.331  28.350  -40.343 1.00 65.45  ? 322  GLN B C   1 
ATOM   6706 O O   . GLN B 1 322 ? 11.312  28.865  -39.876 1.00 70.16  ? 322  GLN B O   1 
ATOM   6707 C CB  . GLN B 1 322 ? 14.381  29.688  -39.731 1.00 66.97  ? 322  GLN B CB  1 
ATOM   6708 C CG  . GLN B 1 322 ? 14.898  30.286  -38.429 1.00 75.71  ? 322  GLN B CG  1 
ATOM   6709 C CD  . GLN B 1 322 ? 15.652  31.588  -38.630 1.00 87.20  ? 322  GLN B CD  1 
ATOM   6710 O OE1 . GLN B 1 322 ? 16.502  31.699  -39.519 1.00 90.61  ? 322  GLN B OE1 1 
ATOM   6711 N NE2 . GLN B 1 322 ? 15.343  32.584  -37.803 1.00 88.08  ? 322  GLN B NE2 1 
ATOM   6712 N N   . ASP B 1 323 ? 12.343  27.753  -41.530 1.00 62.50  ? 323  ASP B N   1 
ATOM   6713 C CA  . ASP B 1 323 ? 11.148  27.788  -42.376 1.00 72.71  ? 323  ASP B CA  1 
ATOM   6714 C C   . ASP B 1 323 ? 10.259  26.561  -42.206 1.00 64.64  ? 323  ASP B C   1 
ATOM   6715 O O   . ASP B 1 323 ? 9.296   26.380  -42.947 1.00 63.58  ? 323  ASP B O   1 
ATOM   6716 C CB  . ASP B 1 323 ? 11.533  27.942  -43.849 1.00 90.12  ? 323  ASP B CB  1 
ATOM   6717 C CG  . ASP B 1 323 ? 10.700  28.993  -44.562 1.00 103.72 ? 323  ASP B CG  1 
ATOM   6718 O OD1 . ASP B 1 323 ? 10.401  30.040  -43.943 1.00 108.98 ? 323  ASP B OD1 1 
ATOM   6719 O OD2 . ASP B 1 323 ? 10.347  28.771  -45.742 1.00 107.40 ? 323  ASP B OD2 1 
ATOM   6720 N N   . LEU B 1 324 ? 10.569  25.740  -41.210 1.00 59.42  ? 324  LEU B N   1 
ATOM   6721 C CA  . LEU B 1 324 ? 10.001  24.403  -41.111 1.00 49.82  ? 324  LEU B CA  1 
ATOM   6722 C C   . LEU B 1 324 ? 8.890   24.250  -40.067 1.00 51.57  ? 324  LEU B C   1 
ATOM   6723 O O   . LEU B 1 324 ? 8.941   24.847  -38.993 1.00 50.12  ? 324  LEU B O   1 
ATOM   6724 C CB  . LEU B 1 324 ? 11.123  23.424  -40.800 1.00 43.24  ? 324  LEU B CB  1 
ATOM   6725 C CG  . LEU B 1 324 ? 10.775  21.967  -41.036 1.00 43.46  ? 324  LEU B CG  1 
ATOM   6726 C CD1 . LEU B 1 324 ? 10.201  21.808  -42.429 1.00 44.40  ? 324  LEU B CD1 1 
ATOM   6727 C CD2 . LEU B 1 324 ? 12.028  21.147  -40.875 1.00 48.77  ? 324  LEU B CD2 1 
ATOM   6728 N N   . GLN B 1 325 ? 7.885   23.448  -40.395 1.00 35.84  ? 325  GLN B N   1 
ATOM   6729 C CA  . GLN B 1 325 ? 6.887   23.057  -39.420 1.00 34.16  ? 325  GLN B CA  1 
ATOM   6730 C C   . GLN B 1 325 ? 6.865   21.554  -39.333 1.00 33.05  ? 325  GLN B C   1 
ATOM   6731 O O   . GLN B 1 325 ? 6.802   20.863  -40.349 1.00 31.23  ? 325  GLN B O   1 
ATOM   6732 C CB  . GLN B 1 325 ? 5.494   23.590  -39.760 1.00 35.79  ? 325  GLN B CB  1 
ATOM   6733 C CG  . GLN B 1 325 ? 5.375   25.105  -39.700 1.00 39.01  ? 325  GLN B CG  1 
ATOM   6734 C CD  . GLN B 1 325 ? 5.224   25.711  -41.073 1.00 54.51  ? 325  GLN B CD  1 
ATOM   6735 O OE1 . GLN B 1 325 ? 4.921   25.011  -42.028 1.00 40.97  ? 325  GLN B OE1 1 
ATOM   6736 N NE2 . GLN B 1 325 ? 5.438   27.014  -41.182 1.00 60.91  ? 325  GLN B NE2 1 
ATOM   6737 N N   . VAL B 1 326 ? 6.936   21.052  -38.103 1.00 34.03  ? 326  VAL B N   1 
ATOM   6738 C CA  . VAL B 1 326 ? 7.061   19.634  -37.851 1.00 36.85  ? 326  VAL B CA  1 
ATOM   6739 C C   . VAL B 1 326 ? 6.112   19.216  -36.747 1.00 35.66  ? 326  VAL B C   1 
ATOM   6740 O O   . VAL B 1 326 ? 5.976   19.904  -35.744 1.00 42.08  ? 326  VAL B O   1 
ATOM   6741 C CB  . VAL B 1 326 ? 8.498   19.258  -37.418 1.00 36.37  ? 326  VAL B CB  1 
ATOM   6742 C CG1 . VAL B 1 326 ? 8.678   17.771  -37.491 1.00 35.70  ? 326  VAL B CG1 1 
ATOM   6743 C CG2 . VAL B 1 326 ? 9.521   19.930  -38.300 1.00 39.07  ? 326  VAL B CG2 1 
ATOM   6744 N N   . LEU B 1 327 ? 5.460   18.080  -36.947 1.00 32.60  ? 327  LEU B N   1 
ATOM   6745 C CA  . LEU B 1 327 ? 4.595   17.478  -35.949 1.00 31.17  ? 327  LEU B CA  1 
ATOM   6746 C C   . LEU B 1 327 ? 5.184   16.101  -35.631 1.00 30.47  ? 327  LEU B C   1 
ATOM   6747 O O   . LEU B 1 327 ? 5.420   15.299  -36.538 1.00 28.36  ? 327  LEU B O   1 
ATOM   6748 C CB  . LEU B 1 327 ? 3.167   17.362  -36.497 1.00 29.84  ? 327  LEU B CB  1 
ATOM   6749 C CG  . LEU B 1 327 ? 2.227   16.365  -35.818 1.00 34.40  ? 327  LEU B CG  1 
ATOM   6750 C CD1 . LEU B 1 327 ? 1.959   16.787  -34.396 1.00 38.38  ? 327  LEU B CD1 1 
ATOM   6751 C CD2 . LEU B 1 327 ? 0.925   16.242  -36.592 1.00 29.37  ? 327  LEU B CD2 1 
ATOM   6752 N N   . VAL B 1 328 ? 5.460   15.840  -34.357 1.00 24.39  ? 328  VAL B N   1 
ATOM   6753 C CA  . VAL B 1 328 ? 6.111   14.593  -33.969 1.00 28.27  ? 328  VAL B CA  1 
ATOM   6754 C C   . VAL B 1 328 ? 5.428   14.022  -32.746 1.00 33.22  ? 328  VAL B C   1 
ATOM   6755 O O   . VAL B 1 328 ? 4.808   14.750  -31.958 1.00 33.45  ? 328  VAL B O   1 
ATOM   6756 C CB  . VAL B 1 328 ? 7.618   14.780  -33.631 1.00 23.36  ? 328  VAL B CB  1 
ATOM   6757 C CG1 . VAL B 1 328 ? 8.351   15.347  -34.805 1.00 24.81  ? 328  VAL B CG1 1 
ATOM   6758 C CG2 . VAL B 1 328 ? 7.787   15.710  -32.434 1.00 23.73  ? 328  VAL B CG2 1 
ATOM   6759 N N   . GLY B 1 329 ? 5.560   12.717  -32.566 1.00 28.31  ? 329  GLY B N   1 
ATOM   6760 C CA  . GLY B 1 329 ? 4.873   12.083  -31.469 1.00 32.30  ? 329  GLY B CA  1 
ATOM   6761 C C   . GLY B 1 329 ? 5.164   10.615  -31.332 1.00 33.37  ? 329  GLY B C   1 
ATOM   6762 O O   . GLY B 1 329 ? 5.828   10.019  -32.173 1.00 31.02  ? 329  GLY B O   1 
ATOM   6763 N N   . VAL B 1 330 ? 4.658   10.038  -30.248 1.00 33.50  ? 330  VAL B N   1 
ATOM   6764 C CA  . VAL B 1 330 ? 4.901   8.645   -29.929 1.00 33.54  ? 330  VAL B CA  1 
ATOM   6765 C C   . VAL B 1 330 ? 3.596   8.024   -29.471 1.00 38.17  ? 330  VAL B C   1 
ATOM   6766 O O   . VAL B 1 330 ? 2.621   8.740   -29.208 1.00 39.68  ? 330  VAL B O   1 
ATOM   6767 C CB  . VAL B 1 330 ? 5.934   8.504   -28.788 1.00 30.00  ? 330  VAL B CB  1 
ATOM   6768 C CG1 . VAL B 1 330 ? 7.271   9.063   -29.209 1.00 33.57  ? 330  VAL B CG1 1 
ATOM   6769 C CG2 . VAL B 1 330 ? 5.448   9.208   -27.538 1.00 31.70  ? 330  VAL B CG2 1 
ATOM   6770 N N   . VAL B 1 331 ? 3.574   6.695   -29.390 1.00 31.57  ? 331  VAL B N   1 
ATOM   6771 C CA  . VAL B 1 331 ? 2.484   5.998   -28.727 1.00 33.23  ? 331  VAL B CA  1 
ATOM   6772 C C   . VAL B 1 331 ? 2.918   5.634   -27.309 1.00 37.87  ? 331  VAL B C   1 
ATOM   6773 O O   . VAL B 1 331 ? 4.111   5.640   -26.994 1.00 36.60  ? 331  VAL B O   1 
ATOM   6774 C CB  . VAL B 1 331 ? 2.041   4.742   -29.496 1.00 36.72  ? 331  VAL B CB  1 
ATOM   6775 C CG1 . VAL B 1 331 ? 1.491   5.135   -30.889 1.00 27.83  ? 331  VAL B CG1 1 
ATOM   6776 C CG2 . VAL B 1 331 ? 3.190   3.724   -29.595 1.00 29.79  ? 331  VAL B CG2 1 
ATOM   6777 N N   . LYS B 1 332 ? 1.941   5.317   -26.467 1.00 38.64  ? 332  LYS B N   1 
ATOM   6778 C CA  . LYS B 1 332 ? 2.173   5.069   -25.050 1.00 39.72  ? 332  LYS B CA  1 
ATOM   6779 C C   . LYS B 1 332 ? 3.197   3.960   -24.785 1.00 42.37  ? 332  LYS B C   1 
ATOM   6780 O O   . LYS B 1 332 ? 4.050   4.105   -23.916 1.00 40.94  ? 332  LYS B O   1 
ATOM   6781 C CB  . LYS B 1 332 ? 0.835   4.784   -24.351 1.00 41.50  ? 332  LYS B CB  1 
ATOM   6782 C CG  . LYS B 1 332 ? 0.877   4.531   -22.830 1.00 40.51  ? 332  LYS B CG  1 
ATOM   6783 C CD  . LYS B 1 332 ? -0.569  4.421   -22.284 1.00 48.00  ? 332  LYS B CD  1 
ATOM   6784 C CE  . LYS B 1 332 ? -0.707  3.425   -21.128 1.00 56.28  ? 332  LYS B CE  1 
ATOM   6785 N NZ  . LYS B 1 332 ? -0.737  1.973   -21.549 1.00 55.61  ? 332  LYS B NZ  1 
ATOM   6786 N N   . ASP B 1 333 ? 3.133   2.875   -25.551 1.00 40.78  ? 333  ASP B N   1 
ATOM   6787 C CA  . ASP B 1 333 ? 3.988   1.715   -25.298 1.00 34.00  ? 333  ASP B CA  1 
ATOM   6788 C C   . ASP B 1 333 ? 4.794   1.316   -26.521 1.00 34.24  ? 333  ASP B C   1 
ATOM   6789 O O   . ASP B 1 333 ? 4.557   0.269   -27.116 1.00 38.61  ? 333  ASP B O   1 
ATOM   6790 C CB  . ASP B 1 333 ? 3.134   0.533   -24.844 1.00 35.35  ? 333  ASP B CB  1 
ATOM   6791 C CG  . ASP B 1 333 ? 2.284   0.864   -23.630 1.00 42.46  ? 333  ASP B CG  1 
ATOM   6792 O OD1 . ASP B 1 333 ? 2.790   0.728   -22.496 1.00 45.79  ? 333  ASP B OD1 1 
ATOM   6793 O OD2 . ASP B 1 333 ? 1.115   1.274   -23.808 1.00 38.09  ? 333  ASP B OD2 1 
ATOM   6794 N N   . GLU B 1 334 ? 5.762   2.146   -26.887 1.00 34.36  ? 334  GLU B N   1 
ATOM   6795 C CA  . GLU B 1 334 ? 6.522   1.937   -28.117 1.00 32.66  ? 334  GLU B CA  1 
ATOM   6796 C C   . GLU B 1 334 ? 7.274   0.618   -28.162 1.00 36.02  ? 334  GLU B C   1 
ATOM   6797 O O   . GLU B 1 334 ? 7.510   0.084   -29.247 1.00 42.12  ? 334  GLU B O   1 
ATOM   6798 C CB  . GLU B 1 334 ? 7.492   3.085   -28.343 1.00 31.95  ? 334  GLU B CB  1 
ATOM   6799 C CG  . GLU B 1 334 ? 6.796   4.390   -28.680 1.00 37.11  ? 334  GLU B CG  1 
ATOM   6800 C CD  . GLU B 1 334 ? 6.541   4.572   -30.168 1.00 36.27  ? 334  GLU B CD  1 
ATOM   6801 O OE1 . GLU B 1 334 ? 6.983   3.722   -30.965 1.00 35.91  ? 334  GLU B OE1 1 
ATOM   6802 O OE2 . GLU B 1 334 ? 5.904   5.575   -30.544 1.00 36.64  ? 334  GLU B OE2 1 
ATOM   6803 N N   . GLY B 1 335 ? 7.625   0.082   -26.995 1.00 31.30  ? 335  GLY B N   1 
ATOM   6804 C CA  . GLY B 1 335 ? 8.547   -1.038  -26.927 1.00 31.91  ? 335  GLY B CA  1 
ATOM   6805 C C   . GLY B 1 335 ? 7.943   -2.427  -26.944 1.00 39.39  ? 335  GLY B C   1 
ATOM   6806 O O   . GLY B 1 335 ? 8.628   -3.398  -27.271 1.00 48.30  ? 335  GLY B O   1 
ATOM   6807 N N   . SER B 1 336 ? 6.663   -2.529  -26.608 1.00 36.69  ? 336  SER B N   1 
ATOM   6808 C CA  . SER B 1 336 ? 6.068   -3.826  -26.298 1.00 37.34  ? 336  SER B CA  1 
ATOM   6809 C C   . SER B 1 336 ? 6.080   -4.796  -27.489 1.00 40.63  ? 336  SER B C   1 
ATOM   6810 O O   . SER B 1 336 ? 6.423   -5.966  -27.345 1.00 43.39  ? 336  SER B O   1 
ATOM   6811 C CB  . SER B 1 336 ? 4.643   -3.633  -25.786 1.00 38.10  ? 336  SER B CB  1 
ATOM   6812 O OG  . SER B 1 336 ? 3.833   -3.057  -26.801 1.00 36.72  ? 336  SER B OG  1 
ATOM   6813 N N   . TYR B 1 337 ? 5.703   -4.291  -28.656 1.00 37.52  ? 337  TYR B N   1 
ATOM   6814 C CA  . TYR B 1 337 ? 5.661   -5.062  -29.891 1.00 39.90  ? 337  TYR B CA  1 
ATOM   6815 C C   . TYR B 1 337 ? 6.948   -5.848  -30.157 1.00 47.46  ? 337  TYR B C   1 
ATOM   6816 O O   . TYR B 1 337 ? 6.896   -7.004  -30.567 1.00 42.65  ? 337  TYR B O   1 
ATOM   6817 C CB  . TYR B 1 337 ? 5.375   -4.110  -31.049 1.00 40.71  ? 337  TYR B CB  1 
ATOM   6818 C CG  . TYR B 1 337 ? 5.027   -4.747  -32.354 1.00 43.93  ? 337  TYR B CG  1 
ATOM   6819 C CD1 . TYR B 1 337 ? 3.719   -5.071  -32.647 1.00 64.29  ? 337  TYR B CD1 1 
ATOM   6820 C CD2 . TYR B 1 337 ? 5.996   -4.990  -33.311 1.00 59.95  ? 337  TYR B CD2 1 
ATOM   6821 C CE1 . TYR B 1 337 ? 3.375   -5.647  -33.854 1.00 68.08  ? 337  TYR B CE1 1 
ATOM   6822 C CE2 . TYR B 1 337 ? 5.665   -5.573  -34.523 1.00 66.02  ? 337  TYR B CE2 1 
ATOM   6823 C CZ  . TYR B 1 337 ? 4.345   -5.902  -34.791 1.00 68.31  ? 337  TYR B CZ  1 
ATOM   6824 O OH  . TYR B 1 337 ? 3.974   -6.481  -35.987 1.00 71.07  ? 337  TYR B OH  1 
ATOM   6825 N N   . PHE B 1 338 ? 8.092   -5.221  -29.898 1.00 38.42  ? 338  PHE B N   1 
ATOM   6826 C CA  . PHE B 1 338 ? 9.391   -5.777  -30.267 1.00 48.64  ? 338  PHE B CA  1 
ATOM   6827 C C   . PHE B 1 338 ? 9.870   -6.855  -29.301 1.00 51.45  ? 338  PHE B C   1 
ATOM   6828 O O   . PHE B 1 338 ? 10.747  -7.660  -29.645 1.00 52.83  ? 338  PHE B O   1 
ATOM   6829 C CB  . PHE B 1 338 ? 10.443  -4.667  -30.358 1.00 37.39  ? 338  PHE B CB  1 
ATOM   6830 C CG  . PHE B 1 338 ? 10.115  -3.614  -31.365 1.00 44.81  ? 338  PHE B CG  1 
ATOM   6831 C CD1 . PHE B 1 338 ? 9.340   -2.512  -31.014 1.00 39.65  ? 338  PHE B CD1 1 
ATOM   6832 C CD2 . PHE B 1 338 ? 10.557  -3.729  -32.679 1.00 50.77  ? 338  PHE B CD2 1 
ATOM   6833 C CE1 . PHE B 1 338 ? 9.021   -1.544  -31.953 1.00 37.15  ? 338  PHE B CE1 1 
ATOM   6834 C CE2 . PHE B 1 338 ? 10.244  -2.756  -33.621 1.00 40.87  ? 338  PHE B CE2 1 
ATOM   6835 C CZ  . PHE B 1 338 ? 9.475   -1.669  -33.257 1.00 62.88  ? 338  PHE B CZ  1 
ATOM   6836 N N   . LEU B 1 339 ? 9.297   -6.870  -28.098 1.00 44.66  ? 339  LEU B N   1 
ATOM   6837 C CA  . LEU B 1 339 ? 9.723   -7.818  -27.072 1.00 45.34  ? 339  LEU B CA  1 
ATOM   6838 C C   . LEU B 1 339 ? 9.383   -9.266  -27.443 1.00 48.61  ? 339  LEU B C   1 
ATOM   6839 O O   . LEU B 1 339 ? 10.178  -10.177 -27.195 1.00 46.74  ? 339  LEU B O   1 
ATOM   6840 C CB  . LEU B 1 339 ? 9.153   -7.445  -25.691 1.00 42.59  ? 339  LEU B CB  1 
ATOM   6841 C CG  . LEU B 1 339 ? 9.609   -6.097  -25.127 1.00 41.96  ? 339  LEU B CG  1 
ATOM   6842 C CD1 . LEU B 1 339 ? 9.116   -5.889  -23.691 1.00 40.53  ? 339  LEU B CD1 1 
ATOM   6843 C CD2 . LEU B 1 339 ? 11.120  -5.970  -25.205 1.00 42.73  ? 339  LEU B CD2 1 
ATOM   6844 N N   . VAL B 1 340 ? 8.215   -9.469  -28.050 1.00 50.48  ? 340  VAL B N   1 
ATOM   6845 C CA  . VAL B 1 340 ? 7.764   -10.810 -28.423 1.00 56.66  ? 340  VAL B CA  1 
ATOM   6846 C C   . VAL B 1 340 ? 8.561   -11.450 -29.576 1.00 60.57  ? 340  VAL B C   1 
ATOM   6847 O O   . VAL B 1 340 ? 8.338   -12.613 -29.919 1.00 62.26  ? 340  VAL B O   1 
ATOM   6848 C CB  . VAL B 1 340 ? 6.258   -10.823 -28.775 1.00 55.76  ? 340  VAL B CB  1 
ATOM   6849 C CG1 . VAL B 1 340 ? 5.446   -10.118 -27.683 1.00 50.17  ? 340  VAL B CG1 1 
ATOM   6850 C CG2 . VAL B 1 340 ? 6.025   -10.167 -30.119 1.00 52.06  ? 340  VAL B CG2 1 
ATOM   6851 N N   . TYR B 1 341 ? 9.498   -10.701 -30.153 1.00 63.65  ? 341  TYR B N   1 
ATOM   6852 C CA  . TYR B 1 341 ? 10.235  -11.170 -31.328 1.00 72.35  ? 341  TYR B CA  1 
ATOM   6853 C C   . TYR B 1 341 ? 11.656  -11.643 -31.044 1.00 74.94  ? 341  TYR B C   1 
ATOM   6854 O O   . TYR B 1 341 ? 12.209  -12.436 -31.805 1.00 84.55  ? 341  TYR B O   1 
ATOM   6855 C CB  . TYR B 1 341 ? 10.283  -10.084 -32.404 1.00 74.21  ? 341  TYR B CB  1 
ATOM   6856 C CG  . TYR B 1 341 ? 9.058   -10.041 -33.278 1.00 73.09  ? 341  TYR B CG  1 
ATOM   6857 C CD1 . TYR B 1 341 ? 8.957   -10.858 -34.393 1.00 73.84  ? 341  TYR B CD1 1 
ATOM   6858 C CD2 . TYR B 1 341 ? 8.000   -9.185  -32.988 1.00 69.74  ? 341  TYR B CD2 1 
ATOM   6859 C CE1 . TYR B 1 341 ? 7.841   -10.825 -35.199 1.00 74.89  ? 341  TYR B CE1 1 
ATOM   6860 C CE2 . TYR B 1 341 ? 6.876   -9.148  -33.789 1.00 70.68  ? 341  TYR B CE2 1 
ATOM   6861 C CZ  . TYR B 1 341 ? 6.802   -9.976  -34.892 1.00 72.55  ? 341  TYR B CZ  1 
ATOM   6862 O OH  . TYR B 1 341 ? 5.696   -9.948  -35.704 1.00 77.12  ? 341  TYR B OH  1 
ATOM   6863 N N   . GLY B 1 342 ? 12.251  -11.154 -29.963 1.00 67.29  ? 342  GLY B N   1 
ATOM   6864 C CA  . GLY B 1 342 ? 13.638  -11.469 -29.674 1.00 70.41  ? 342  GLY B CA  1 
ATOM   6865 C C   . GLY B 1 342 ? 13.956  -11.777 -28.221 1.00 73.62  ? 342  GLY B C   1 
ATOM   6866 O O   . GLY B 1 342 ? 14.906  -12.510 -27.934 1.00 82.36  ? 342  GLY B O   1 
ATOM   6867 N N   . VAL B 1 343 ? 13.164  -11.231 -27.302 1.00 65.95  ? 343  VAL B N   1 
ATOM   6868 C CA  . VAL B 1 343 ? 13.454  -11.357 -25.873 1.00 58.17  ? 343  VAL B CA  1 
ATOM   6869 C C   . VAL B 1 343 ? 12.736  -12.533 -25.189 1.00 56.38  ? 343  VAL B C   1 
ATOM   6870 O O   . VAL B 1 343 ? 11.508  -12.606 -25.186 1.00 57.72  ? 343  VAL B O   1 
ATOM   6871 C CB  . VAL B 1 343 ? 13.129  -10.052 -25.126 1.00 50.16  ? 343  VAL B CB  1 
ATOM   6872 C CG1 . VAL B 1 343 ? 13.645  -10.125 -23.706 1.00 46.07  ? 343  VAL B CG1 1 
ATOM   6873 C CG2 . VAL B 1 343 ? 13.740  -8.857  -25.854 1.00 46.32  ? 343  VAL B CG2 1 
ATOM   6874 N N   . PRO B 1 344 ? 13.510  -13.456 -24.600 1.00 59.72  ? 344  PRO B N   1 
ATOM   6875 C CA  . PRO B 1 344 ? 12.944  -14.650 -23.952 1.00 67.99  ? 344  PRO B CA  1 
ATOM   6876 C C   . PRO B 1 344 ? 12.029  -14.303 -22.776 1.00 63.14  ? 344  PRO B C   1 
ATOM   6877 O O   . PRO B 1 344 ? 12.346  -13.406 -21.986 1.00 53.81  ? 344  PRO B O   1 
ATOM   6878 C CB  . PRO B 1 344 ? 14.184  -15.403 -23.455 1.00 55.70  ? 344  PRO B CB  1 
ATOM   6879 C CG  . PRO B 1 344 ? 15.284  -14.937 -24.335 1.00 62.18  ? 344  PRO B CG  1 
ATOM   6880 C CD  . PRO B 1 344 ? 14.981  -13.488 -24.626 1.00 50.92  ? 344  PRO B CD  1 
ATOM   6881 N N   . GLY B 1 345 ? 10.907  -15.010 -22.666 1.00 60.97  ? 345  GLY B N   1 
ATOM   6882 C CA  . GLY B 1 345 ? 9.963   -14.767 -21.592 1.00 57.17  ? 345  GLY B CA  1 
ATOM   6883 C C   . GLY B 1 345 ? 8.785   -13.931 -22.048 1.00 59.69  ? 345  GLY B C   1 
ATOM   6884 O O   . GLY B 1 345 ? 7.782   -13.814 -21.342 1.00 65.55  ? 345  GLY B O   1 
ATOM   6885 N N   . PHE B 1 346 ? 8.901   -13.346 -23.236 1.00 51.73  ? 346  PHE B N   1 
ATOM   6886 C CA  . PHE B 1 346 ? 7.813   -12.557 -23.793 1.00 49.08  ? 346  PHE B CA  1 
ATOM   6887 C C   . PHE B 1 346 ? 7.045   -13.309 -24.878 1.00 58.91  ? 346  PHE B C   1 
ATOM   6888 O O   . PHE B 1 346 ? 7.620   -14.079 -25.653 1.00 59.44  ? 346  PHE B O   1 
ATOM   6889 C CB  . PHE B 1 346 ? 8.324   -11.214 -24.297 1.00 44.34  ? 346  PHE B CB  1 
ATOM   6890 C CG  . PHE B 1 346 ? 8.824   -10.325 -23.201 1.00 52.27  ? 346  PHE B CG  1 
ATOM   6891 C CD1 . PHE B 1 346 ? 10.118  -10.454 -22.722 1.00 42.05  ? 346  PHE B CD1 1 
ATOM   6892 C CD2 . PHE B 1 346 ? 7.994   -9.370  -22.634 1.00 51.51  ? 346  PHE B CD2 1 
ATOM   6893 C CE1 . PHE B 1 346 ? 10.583  -9.641  -21.700 1.00 41.58  ? 346  PHE B CE1 1 
ATOM   6894 C CE2 . PHE B 1 346 ? 8.449   -8.545  -21.610 1.00 39.03  ? 346  PHE B CE2 1 
ATOM   6895 C CZ  . PHE B 1 346 ? 9.746   -8.682  -21.143 1.00 43.98  ? 346  PHE B CZ  1 
ATOM   6896 N N   . SER B 1 347 ? 5.734   -13.083 -24.895 1.00 59.83  ? 347  SER B N   1 
ATOM   6897 C CA  . SER B 1 347 ? 4.816   -13.750 -25.802 1.00 54.82  ? 347  SER B CA  1 
ATOM   6898 C C   . SER B 1 347 ? 3.476   -13.032 -25.773 1.00 59.90  ? 347  SER B C   1 
ATOM   6899 O O   . SER B 1 347 ? 3.087   -12.478 -24.745 1.00 63.46  ? 347  SER B O   1 
ATOM   6900 C CB  . SER B 1 347 ? 4.614   -15.205 -25.393 1.00 56.61  ? 347  SER B CB  1 
ATOM   6901 O OG  . SER B 1 347 ? 3.592   -15.803 -26.176 1.00 62.78  ? 347  SER B OG  1 
ATOM   6902 N N   . LYS B 1 348 ? 2.776   -13.041 -26.902 1.00 58.29  ? 348  LYS B N   1 
ATOM   6903 C CA  . LYS B 1 348 ? 1.457   -12.434 -26.988 1.00 55.29  ? 348  LYS B CA  1 
ATOM   6904 C C   . LYS B 1 348 ? 0.398   -13.339 -26.352 1.00 66.06  ? 348  LYS B C   1 
ATOM   6905 O O   . LYS B 1 348 ? -0.747  -12.933 -26.144 1.00 69.98  ? 348  LYS B O   1 
ATOM   6906 C CB  . LYS B 1 348 ? 1.092   -12.188 -28.450 1.00 55.03  ? 348  LYS B CB  1 
ATOM   6907 C CG  . LYS B 1 348 ? 0.595   -13.433 -29.178 1.00 59.37  ? 348  LYS B CG  1 
ATOM   6908 C CD  . LYS B 1 348 ? 0.064   -13.104 -30.564 1.00 61.22  ? 348  LYS B CD  1 
ATOM   6909 C CE  . LYS B 1 348 ? -0.515  -14.329 -31.241 1.00 66.08  ? 348  LYS B CE  1 
ATOM   6910 N NZ  . LYS B 1 348 ? -1.699  -14.874 -30.520 1.00 75.27  ? 348  LYS B NZ  1 
ATOM   6911 N N   . ASP B 1 349 ? 0.786   -14.572 -26.050 1.00 58.91  ? 349  ASP B N   1 
ATOM   6912 C CA  . ASP B 1 349 ? -0.167  -15.573 -25.583 1.00 65.71  ? 349  ASP B CA  1 
ATOM   6913 C C   . ASP B 1 349 ? -0.164  -15.798 -24.067 1.00 67.26  ? 349  ASP B C   1 
ATOM   6914 O O   . ASP B 1 349 ? -0.929  -16.623 -23.560 1.00 65.47  ? 349  ASP B O   1 
ATOM   6915 C CB  . ASP B 1 349 ? 0.061   -16.895 -26.318 1.00 66.27  ? 349  ASP B CB  1 
ATOM   6916 C CG  . ASP B 1 349 ? -0.246  -16.795 -27.797 1.00 80.76  ? 349  ASP B CG  1 
ATOM   6917 O OD1 . ASP B 1 349 ? -1.174  -16.037 -28.165 1.00 67.16  ? 349  ASP B OD1 1 
ATOM   6918 O OD2 . ASP B 1 349 ? 0.441   -17.476 -28.588 1.00 79.90  ? 349  ASP B OD2 1 
ATOM   6919 N N   . ASN B 1 350 ? 0.703   -15.080 -23.354 1.00 59.24  ? 350  ASN B N   1 
ATOM   6920 C CA  . ASN B 1 350 ? 0.689   -15.067 -21.890 1.00 59.25  ? 350  ASN B CA  1 
ATOM   6921 C C   . ASN B 1 350 ? 0.969   -13.657 -21.346 1.00 56.21  ? 350  ASN B C   1 
ATOM   6922 O O   . ASN B 1 350 ? 1.063   -12.698 -22.118 1.00 55.29  ? 350  ASN B O   1 
ATOM   6923 C CB  . ASN B 1 350 ? 1.606   -16.159 -21.278 1.00 61.24  ? 350  ASN B CB  1 
ATOM   6924 C CG  . ASN B 1 350 ? 3.092   -15.992 -21.633 1.00 81.52  ? 350  ASN B CG  1 
ATOM   6925 O OD1 . ASN B 1 350 ? 3.608   -14.880 -21.713 1.00 55.83  ? 350  ASN B OD1 1 
ATOM   6926 N ND2 . ASN B 1 350 ? 3.788   -17.114 -21.812 1.00 61.90  ? 350  ASN B ND2 1 
ATOM   6927 N N   . GLU B 1 351 ? 1.086   -13.525 -20.030 1.00 58.01  ? 351  GLU B N   1 
ATOM   6928 C CA  . GLU B 1 351 ? 1.275   -12.214 -19.412 1.00 60.42  ? 351  GLU B CA  1 
ATOM   6929 C C   . GLU B 1 351 ? 2.726   -11.738 -19.449 1.00 54.34  ? 351  GLU B C   1 
ATOM   6930 O O   . GLU B 1 351 ? 3.016   -10.612 -19.047 1.00 52.85  ? 351  GLU B O   1 
ATOM   6931 C CB  . GLU B 1 351 ? 0.783   -12.222 -17.963 1.00 71.93  ? 351  GLU B CB  1 
ATOM   6932 C CG  . GLU B 1 351 ? -0.655  -12.676 -17.783 1.00 83.11  ? 351  GLU B CG  1 
ATOM   6933 C CD  . GLU B 1 351 ? -1.645  -11.534 -17.865 1.00 86.78  ? 351  GLU B CD  1 
ATOM   6934 O OE1 . GLU B 1 351 ? -1.320  -10.504 -18.503 1.00 85.17  ? 351  GLU B OE1 1 
ATOM   6935 O OE2 . GLU B 1 351 ? -2.750  -11.674 -17.290 1.00 90.27  ? 351  GLU B OE2 1 
ATOM   6936 N N   . SER B 1 352 ? 3.631   -12.598 -19.911 1.00 54.59  ? 352  SER B N   1 
ATOM   6937 C CA  . SER B 1 352 ? 5.041   -12.237 -20.067 1.00 48.96  ? 352  SER B CA  1 
ATOM   6938 C C   . SER B 1 352 ? 5.635   -11.673 -18.771 1.00 52.49  ? 352  SER B C   1 
ATOM   6939 O O   . SER B 1 352 ? 6.336   -10.649 -18.775 1.00 48.49  ? 352  SER B O   1 
ATOM   6940 C CB  . SER B 1 352 ? 5.211   -11.240 -21.221 1.00 53.02  ? 352  SER B CB  1 
ATOM   6941 O OG  . SER B 1 352 ? 4.510   -11.677 -22.373 1.00 52.52  ? 352  SER B OG  1 
ATOM   6942 N N   . LEU B 1 353 ? 5.329   -12.339 -17.664 1.00 50.91  ? 353  LEU B N   1 
ATOM   6943 C CA  . LEU B 1 353 ? 5.860   -11.963 -16.365 1.00 52.63  ? 353  LEU B CA  1 
ATOM   6944 C C   . LEU B 1 353 ? 7.252   -12.546 -16.240 1.00 53.13  ? 353  LEU B C   1 
ATOM   6945 O O   . LEU B 1 353 ? 7.416   -13.757 -16.131 1.00 57.09  ? 353  LEU B O   1 
ATOM   6946 C CB  . LEU B 1 353 ? 4.960   -12.500 -15.253 1.00 56.11  ? 353  LEU B CB  1 
ATOM   6947 C CG  . LEU B 1 353 ? 3.513   -12.003 -15.301 1.00 57.88  ? 353  LEU B CG  1 
ATOM   6948 C CD1 . LEU B 1 353 ? 2.664   -12.726 -14.277 1.00 58.85  ? 353  LEU B CD1 1 
ATOM   6949 C CD2 . LEU B 1 353 ? 3.454   -10.483 -15.093 1.00 52.29  ? 353  LEU B CD2 1 
ATOM   6950 N N   . ILE B 1 354 ? 8.258   -11.686 -16.253 1.00 49.56  ? 354  ILE B N   1 
ATOM   6951 C CA  . ILE B 1 354 ? 9.634   -12.154 -16.299 1.00 58.06  ? 354  ILE B CA  1 
ATOM   6952 C C   . ILE B 1 354 ? 10.376  -12.055 -14.966 1.00 58.20  ? 354  ILE B C   1 
ATOM   6953 O O   . ILE B 1 354 ? 9.971   -11.335 -14.055 1.00 54.56  ? 354  ILE B O   1 
ATOM   6954 C CB  . ILE B 1 354 ? 10.413  -11.401 -17.368 1.00 47.07  ? 354  ILE B CB  1 
ATOM   6955 C CG1 . ILE B 1 354 ? 10.273  -9.896  -17.137 1.00 44.24  ? 354  ILE B CG1 1 
ATOM   6956 C CG2 . ILE B 1 354 ? 9.873   -11.773 -18.735 1.00 46.66  ? 354  ILE B CG2 1 
ATOM   6957 C CD1 . ILE B 1 354 ? 11.216  -9.061  -17.946 1.00 41.66  ? 354  ILE B CD1 1 
ATOM   6958 N N   . SER B 1 355 ? 11.467  -12.805 -14.870 1.00 59.99  ? 355  SER B N   1 
ATOM   6959 C CA  . SER B 1 355 ? 12.323  -12.771 -13.702 1.00 55.61  ? 355  SER B CA  1 
ATOM   6960 C C   . SER B 1 355 ? 13.321  -11.634 -13.847 1.00 57.11  ? 355  SER B C   1 
ATOM   6961 O O   . SER B 1 355 ? 13.470  -11.048 -14.920 1.00 49.81  ? 355  SER B O   1 
ATOM   6962 C CB  . SER B 1 355 ? 13.094  -14.074 -13.589 1.00 59.29  ? 355  SER B CB  1 
ATOM   6963 O OG  . SER B 1 355 ? 14.018  -14.183 -14.656 1.00 72.08  ? 355  SER B OG  1 
ATOM   6964 N N   . ARG B 1 356 ? 14.017  -11.340 -12.761 1.00 54.50  ? 356  ARG B N   1 
ATOM   6965 C CA  . ARG B 1 356 ? 15.058  -10.329 -12.785 1.00 65.31  ? 356  ARG B CA  1 
ATOM   6966 C C   . ARG B 1 356 ? 16.161  -10.731 -13.765 1.00 61.86  ? 356  ARG B C   1 
ATOM   6967 O O   . ARG B 1 356 ? 16.658  -9.901  -14.538 1.00 57.50  ? 356  ARG B O   1 
ATOM   6968 C CB  . ARG B 1 356 ? 15.620  -10.130 -11.375 1.00 55.55  ? 356  ARG B CB  1 
ATOM   6969 C CG  . ARG B 1 356 ? 16.670  -9.066  -11.296 1.00 59.24  ? 356  ARG B CG  1 
ATOM   6970 C CD  . ARG B 1 356 ? 16.481  -8.177  -10.084 1.00 60.08  ? 356  ARG B CD  1 
ATOM   6971 N NE  . ARG B 1 356 ? 17.463  -7.101  -10.115 1.00 65.75  ? 356  ARG B NE  1 
ATOM   6972 C CZ  . ARG B 1 356 ? 17.256  -5.900  -10.650 1.00 61.28  ? 356  ARG B CZ  1 
ATOM   6973 N NH1 . ARG B 1 356 ? 16.086  -5.592  -11.182 1.00 48.52  ? 356  ARG B NH1 1 
ATOM   6974 N NH2 . ARG B 1 356 ? 18.222  -4.996  -10.632 1.00 63.05  ? 356  ARG B NH2 1 
ATOM   6975 N N   . ALA B 1 357 ? 16.513  -12.017 -13.742 1.00 59.99  ? 357  ALA B N   1 
ATOM   6976 C CA  . ALA B 1 357 ? 17.556  -12.554 -14.608 1.00 56.09  ? 357  ALA B CA  1 
ATOM   6977 C C   . ALA B 1 357 ? 17.211  -12.312 -16.070 1.00 53.07  ? 357  ALA B C   1 
ATOM   6978 O O   . ALA B 1 357 ? 18.054  -11.869 -16.849 1.00 52.81  ? 357  ALA B O   1 
ATOM   6979 C CB  . ALA B 1 357 ? 17.759  -14.037 -14.341 1.00 60.68  ? 357  ALA B CB  1 
ATOM   6980 N N   . GLN B 1 358 ? 15.956  -12.590 -16.417 1.00 52.45  ? 358  GLN B N   1 
ATOM   6981 C CA  . GLN B 1 358 ? 15.450  -12.396 -17.764 1.00 50.16  ? 358  GLN B CA  1 
ATOM   6982 C C   . GLN B 1 358 ? 15.384  -10.929 -18.121 1.00 48.45  ? 358  GLN B C   1 
ATOM   6983 O O   . GLN B 1 358 ? 15.369  -10.565 -19.302 1.00 44.75  ? 358  GLN B O   1 
ATOM   6984 C CB  . GLN B 1 358 ? 14.062  -13.008 -17.888 1.00 50.92  ? 358  GLN B CB  1 
ATOM   6985 C CG  . GLN B 1 358 ? 14.070  -14.522 -17.886 1.00 57.82  ? 358  GLN B CG  1 
ATOM   6986 C CD  . GLN B 1 358 ? 12.696  -15.094 -18.111 1.00 64.14  ? 358  GLN B CD  1 
ATOM   6987 O OE1 . GLN B 1 358 ? 11.705  -14.545 -17.626 1.00 64.95  ? 358  GLN B OE1 1 
ATOM   6988 N NE2 . GLN B 1 358 ? 12.620  -16.196 -18.857 1.00 58.58  ? 358  GLN B NE2 1 
ATOM   6989 N N   . PHE B 1 359 ? 15.329  -10.079 -17.102 1.00 47.62  ? 359  PHE B N   1 
ATOM   6990 C CA  . PHE B 1 359 ? 15.292  -8.649  -17.351 1.00 50.41  ? 359  PHE B CA  1 
ATOM   6991 C C   . PHE B 1 359 ? 16.688  -8.160  -17.738 1.00 48.93  ? 359  PHE B C   1 
ATOM   6992 O O   . PHE B 1 359 ? 16.836  -7.383  -18.689 1.00 40.53  ? 359  PHE B O   1 
ATOM   6993 C CB  . PHE B 1 359 ? 14.734  -7.886  -16.146 1.00 51.96  ? 359  PHE B CB  1 
ATOM   6994 C CG  . PHE B 1 359 ? 14.853  -6.402  -16.270 1.00 48.26  ? 359  PHE B CG  1 
ATOM   6995 C CD1 . PHE B 1 359 ? 14.239  -5.731  -17.317 1.00 50.37  ? 359  PHE B CD1 1 
ATOM   6996 C CD2 . PHE B 1 359 ? 15.598  -5.676  -15.363 1.00 47.87  ? 359  PHE B CD2 1 
ATOM   6997 C CE1 . PHE B 1 359 ? 14.358  -4.359  -17.452 1.00 46.95  ? 359  PHE B CE1 1 
ATOM   6998 C CE2 . PHE B 1 359 ? 15.712  -4.304  -15.487 1.00 47.76  ? 359  PHE B CE2 1 
ATOM   6999 C CZ  . PHE B 1 359 ? 15.094  -3.645  -16.534 1.00 45.25  ? 359  PHE B CZ  1 
ATOM   7000 N N   . LEU B 1 360 ? 17.706  -8.635  -17.022 1.00 43.96  ? 360  LEU B N   1 
ATOM   7001 C CA  . LEU B 1 360 ? 19.083  -8.283  -17.345 1.00 53.47  ? 360  LEU B CA  1 
ATOM   7002 C C   . LEU B 1 360 ? 19.444  -8.805  -18.731 1.00 54.45  ? 360  LEU B C   1 
ATOM   7003 O O   . LEU B 1 360 ? 20.121  -8.126  -19.506 1.00 50.16  ? 360  LEU B O   1 
ATOM   7004 C CB  . LEU B 1 360 ? 20.053  -8.847  -16.307 1.00 60.01  ? 360  LEU B CB  1 
ATOM   7005 C CG  . LEU B 1 360 ? 20.332  -7.998  -15.060 1.00 62.53  ? 360  LEU B CG  1 
ATOM   7006 C CD1 . LEU B 1 360 ? 19.077  -7.734  -14.239 1.00 65.27  ? 360  LEU B CD1 1 
ATOM   7007 C CD2 . LEU B 1 360 ? 21.384  -8.664  -14.198 1.00 60.23  ? 360  LEU B CD2 1 
ATOM   7008 N N   . ALA B 1 361 ? 18.981  -10.014 -19.037 1.00 53.47  ? 361  ALA B N   1 
ATOM   7009 C CA  . ALA B 1 361 ? 19.227  -10.621 -20.339 1.00 55.07  ? 361  ALA B CA  1 
ATOM   7010 C C   . ALA B 1 361 ? 18.539  -9.806  -21.428 1.00 52.83  ? 361  ALA B C   1 
ATOM   7011 O O   . ALA B 1 361 ? 19.100  -9.561  -22.497 1.00 54.39  ? 361  ALA B O   1 
ATOM   7012 C CB  . ALA B 1 361 ? 18.736  -12.062 -20.355 1.00 50.01  ? 361  ALA B CB  1 
ATOM   7013 N N   . GLY B 1 362 ? 17.322  -9.367  -21.140 1.00 49.44  ? 362  GLY B N   1 
ATOM   7014 C CA  . GLY B 1 362 ? 16.563  -8.585  -22.095 1.00 43.91  ? 362  GLY B CA  1 
ATOM   7015 C C   . GLY B 1 362 ? 17.181  -7.234  -22.381 1.00 43.60  ? 362  GLY B C   1 
ATOM   7016 O O   . GLY B 1 362 ? 17.023  -6.697  -23.480 1.00 39.72  ? 362  GLY B O   1 
ATOM   7017 N N   . VAL B 1 363 ? 17.882  -6.678  -21.396 1.00 44.21  ? 363  VAL B N   1 
ATOM   7018 C CA  . VAL B 1 363 ? 18.530  -5.379  -21.577 1.00 39.56  ? 363  VAL B CA  1 
ATOM   7019 C C   . VAL B 1 363 ? 19.739  -5.454  -22.519 1.00 38.07  ? 363  VAL B C   1 
ATOM   7020 O O   . VAL B 1 363 ? 19.944  -4.556  -23.319 1.00 43.04  ? 363  VAL B O   1 
ATOM   7021 C CB  . VAL B 1 363 ? 18.877  -4.702  -20.219 1.00 42.07  ? 363  VAL B CB  1 
ATOM   7022 C CG1 . VAL B 1 363 ? 19.815  -3.534  -20.409 1.00 34.40  ? 363  VAL B CG1 1 
ATOM   7023 C CG2 . VAL B 1 363 ? 17.605  -4.247  -19.525 1.00 34.31  ? 363  VAL B CG2 1 
ATOM   7024 N N   . ARG B 1 364 ? 20.520  -6.530  -22.451 1.00 43.24  ? 364  ARG B N   1 
ATOM   7025 C CA  . ARG B 1 364 ? 21.655  -6.693  -23.361 1.00 43.14  ? 364  ARG B CA  1 
ATOM   7026 C C   . ARG B 1 364 ? 21.184  -6.779  -24.809 1.00 47.95  ? 364  ARG B C   1 
ATOM   7027 O O   . ARG B 1 364 ? 21.881  -6.349  -25.726 1.00 47.37  ? 364  ARG B O   1 
ATOM   7028 C CB  . ARG B 1 364 ? 22.456  -7.950  -23.032 1.00 46.43  ? 364  ARG B CB  1 
ATOM   7029 C CG  . ARG B 1 364 ? 22.951  -8.027  -21.605 1.00 56.86  ? 364  ARG B CG  1 
ATOM   7030 C CD  . ARG B 1 364 ? 23.573  -6.713  -21.148 1.00 59.80  ? 364  ARG B CD  1 
ATOM   7031 N NE  . ARG B 1 364 ? 24.680  -6.270  -21.994 1.00 63.21  ? 364  ARG B NE  1 
ATOM   7032 C CZ  . ARG B 1 364 ? 25.961  -6.338  -21.642 1.00 68.04  ? 364  ARG B CZ  1 
ATOM   7033 N NH1 . ARG B 1 364 ? 26.303  -6.838  -20.456 1.00 64.71  ? 364  ARG B NH1 1 
ATOM   7034 N NH2 . ARG B 1 364 ? 26.901  -5.904  -22.475 1.00 69.87  ? 364  ARG B NH2 1 
ATOM   7035 N N   . ILE B 1 365 ? 20.000  -7.350  -25.001 1.00 47.57  ? 365  ILE B N   1 
ATOM   7036 C CA  . ILE B 1 365 ? 19.439  -7.545  -26.332 1.00 51.02  ? 365  ILE B CA  1 
ATOM   7037 C C   . ILE B 1 365 ? 18.808  -6.258  -26.851 1.00 51.58  ? 365  ILE B C   1 
ATOM   7038 O O   . ILE B 1 365 ? 18.918  -5.935  -28.040 1.00 48.36  ? 365  ILE B O   1 
ATOM   7039 C CB  . ILE B 1 365 ? 18.387  -8.673  -26.334 1.00 50.39  ? 365  ILE B CB  1 
ATOM   7040 C CG1 . ILE B 1 365 ? 19.061  -10.032 -26.104 1.00 45.97  ? 365  ILE B CG1 1 
ATOM   7041 C CG2 . ILE B 1 365 ? 17.596  -8.677  -27.636 1.00 42.89  ? 365  ILE B CG2 1 
ATOM   7042 C CD1 . ILE B 1 365 ? 18.086  -11.204 -26.053 1.00 47.91  ? 365  ILE B CD1 1 
ATOM   7043 N N   . GLY B 1 366 ? 18.163  -5.524  -25.947 1.00 46.83  ? 366  GLY B N   1 
ATOM   7044 C CA  . GLY B 1 366 ? 17.494  -4.276  -26.284 1.00 47.59  ? 366  GLY B CA  1 
ATOM   7045 C C   . GLY B 1 366 ? 18.439  -3.097  -26.414 1.00 48.01  ? 366  GLY B C   1 
ATOM   7046 O O   . GLY B 1 366 ? 18.128  -2.103  -27.058 1.00 52.26  ? 366  GLY B O   1 
ATOM   7047 N N   . VAL B 1 367 ? 19.603  -3.197  -25.791 1.00 42.44  ? 367  VAL B N   1 
ATOM   7048 C CA  . VAL B 1 367 ? 20.620  -2.175  -25.954 1.00 42.78  ? 367  VAL B CA  1 
ATOM   7049 C C   . VAL B 1 367 ? 21.897  -2.861  -26.405 1.00 40.99  ? 367  VAL B C   1 
ATOM   7050 O O   . VAL B 1 367 ? 22.916  -2.801  -25.729 1.00 39.95  ? 367  VAL B O   1 
ATOM   7051 C CB  . VAL B 1 367 ? 20.864  -1.409  -24.649 1.00 43.62  ? 367  VAL B CB  1 
ATOM   7052 C CG1 . VAL B 1 367 ? 21.677  -0.165  -24.915 1.00 31.95  ? 367  VAL B CG1 1 
ATOM   7053 C CG2 . VAL B 1 367 ? 19.537  -1.045  -24.001 1.00 38.03  ? 367  VAL B CG2 1 
ATOM   7054 N N   . PRO B 1 368 ? 21.847  -3.500  -27.578 1.00 42.46  ? 368  PRO B N   1 
ATOM   7055 C CA  . PRO B 1 368 ? 22.908  -4.414  -28.020 1.00 44.44  ? 368  PRO B CA  1 
ATOM   7056 C C   . PRO B 1 368 ? 24.288  -3.765  -28.144 1.00 45.75  ? 368  PRO B C   1 
ATOM   7057 O O   . PRO B 1 368 ? 25.290  -4.481  -28.237 1.00 50.12  ? 368  PRO B O   1 
ATOM   7058 C CB  . PRO B 1 368 ? 22.416  -4.872  -29.392 1.00 42.42  ? 368  PRO B CB  1 
ATOM   7059 C CG  . PRO B 1 368 ? 21.547  -3.750  -29.870 1.00 43.95  ? 368  PRO B CG  1 
ATOM   7060 C CD  . PRO B 1 368 ? 20.856  -3.248  -28.641 1.00 41.32  ? 368  PRO B CD  1 
ATOM   7061 N N   . GLN B 1 369 ? 24.341  -2.437  -28.136 1.00 41.46  ? 369  GLN B N   1 
ATOM   7062 C CA  . GLN B 1 369 ? 25.609  -1.733  -28.321 1.00 47.11  ? 369  GLN B CA  1 
ATOM   7063 C C   . GLN B 1 369 ? 26.274  -1.402  -26.988 1.00 48.45  ? 369  GLN B C   1 
ATOM   7064 O O   . GLN B 1 369 ? 27.415  -0.931  -26.955 1.00 47.13  ? 369  GLN B O   1 
ATOM   7065 C CB  . GLN B 1 369 ? 25.395  -0.445  -29.114 1.00 45.61  ? 369  GLN B CB  1 
ATOM   7066 C CG  . GLN B 1 369 ? 24.766  0.691   -28.307 1.00 52.91  ? 369  GLN B CG  1 
ATOM   7067 C CD  . GLN B 1 369 ? 23.247  0.588   -28.179 1.00 55.52  ? 369  GLN B CD  1 
ATOM   7068 O OE1 . GLN B 1 369 ? 22.652  -0.467  -28.410 1.00 55.40  ? 369  GLN B OE1 1 
ATOM   7069 N NE2 . GLN B 1 369 ? 22.616  1.696   -27.806 1.00 52.97  ? 369  GLN B NE2 1 
ATOM   7070 N N   . ALA B 1 370 ? 25.562  -1.665  -25.895 1.00 38.88  ? 370  ALA B N   1 
ATOM   7071 C CA  . ALA B 1 370 ? 26.019  -1.268  -24.566 1.00 38.57  ? 370  ALA B CA  1 
ATOM   7072 C C   . ALA B 1 370 ? 27.187  -2.089  -24.040 1.00 45.97  ? 370  ALA B C   1 
ATOM   7073 O O   . ALA B 1 370 ? 27.227  -3.314  -24.196 1.00 49.08  ? 370  ALA B O   1 
ATOM   7074 C CB  . ALA B 1 370 ? 24.867  -1.315  -23.571 1.00 36.72  ? 370  ALA B CB  1 
ATOM   7075 N N   . SER B 1 371 ? 28.130  -1.397  -23.404 1.00 44.18  ? 371  SER B N   1 
ATOM   7076 C CA  . SER B 1 371 ? 29.161  -2.040  -22.594 1.00 46.43  ? 371  SER B CA  1 
ATOM   7077 C C   . SER B 1 371 ? 28.491  -2.654  -21.370 1.00 50.94  ? 371  SER B C   1 
ATOM   7078 O O   . SER B 1 371 ? 27.323  -2.372  -21.091 1.00 49.25  ? 371  SER B O   1 
ATOM   7079 C CB  . SER B 1 371 ? 30.173  -1.002  -22.127 1.00 47.63  ? 371  SER B CB  1 
ATOM   7080 O OG  . SER B 1 371 ? 29.512  0.025   -21.401 1.00 50.94  ? 371  SER B OG  1 
ATOM   7081 N N   . ASP B 1 372 ? 29.222  -3.478  -20.629 1.00 55.72  ? 372  ASP B N   1 
ATOM   7082 C CA  . ASP B 1 372 ? 28.663  -4.065  -19.416 1.00 58.34  ? 372  ASP B CA  1 
ATOM   7083 C C   . ASP B 1 372 ? 28.166  -2.981  -18.467 1.00 55.47  ? 372  ASP B C   1 
ATOM   7084 O O   . ASP B 1 372 ? 27.074  -3.089  -17.908 1.00 54.03  ? 372  ASP B O   1 
ATOM   7085 C CB  . ASP B 1 372 ? 29.692  -4.945  -18.710 1.00 62.82  ? 372  ASP B CB  1 
ATOM   7086 C CG  . ASP B 1 372 ? 30.041  -6.178  -19.509 1.00 69.09  ? 372  ASP B CG  1 
ATOM   7087 O OD1 . ASP B 1 372 ? 29.247  -6.536  -20.403 1.00 66.68  ? 372  ASP B OD1 1 
ATOM   7088 O OD2 . ASP B 1 372 ? 31.101  -6.787  -19.246 1.00 75.69  ? 372  ASP B OD2 1 
ATOM   7089 N N   . LEU B 1 373 ? 28.965  -1.929  -18.313 1.00 50.39  ? 373  LEU B N   1 
ATOM   7090 C CA  . LEU B 1 373 ? 28.671  -0.880  -17.349 1.00 51.32  ? 373  LEU B CA  1 
ATOM   7091 C C   . LEU B 1 373 ? 27.445  -0.072  -17.753 1.00 52.01  ? 373  LEU B C   1 
ATOM   7092 O O   . LEU B 1 373 ? 26.608  0.257   -16.907 1.00 48.76  ? 373  LEU B O   1 
ATOM   7093 C CB  . LEU B 1 373 ? 29.881  0.030   -17.160 1.00 47.63  ? 373  LEU B CB  1 
ATOM   7094 C CG  . LEU B 1 373 ? 29.715  1.227   -16.223 1.00 64.06  ? 373  LEU B CG  1 
ATOM   7095 C CD1 . LEU B 1 373 ? 29.326  0.796   -14.820 1.00 49.33  ? 373  LEU B CD1 1 
ATOM   7096 C CD2 . LEU B 1 373 ? 31.002  2.026   -16.194 1.00 49.58  ? 373  LEU B CD2 1 
ATOM   7097 N N   . ALA B 1 374 ? 27.339  0.236   -19.045 1.00 48.80  ? 374  ALA B N   1 
ATOM   7098 C CA  . ALA B 1 374 ? 26.182  0.960   -19.568 1.00 41.67  ? 374  ALA B CA  1 
ATOM   7099 C C   . ALA B 1 374 ? 24.916  0.141   -19.372 1.00 39.18  ? 374  ALA B C   1 
ATOM   7100 O O   . ALA B 1 374 ? 23.869  0.680   -19.022 1.00 36.83  ? 374  ALA B O   1 
ATOM   7101 C CB  . ALA B 1 374 ? 26.378  1.295   -21.032 1.00 38.51  ? 374  ALA B CB  1 
ATOM   7102 N N   . ALA B 1 375 ? 25.032  -1.163  -19.587 1.00 38.14  ? 375  ALA B N   1 
ATOM   7103 C CA  . ALA B 1 375 ? 23.924  -2.083  -19.402 1.00 43.32  ? 375  ALA B CA  1 
ATOM   7104 C C   . ALA B 1 375 ? 23.486  -2.114  -17.938 1.00 44.65  ? 375  ALA B C   1 
ATOM   7105 O O   . ALA B 1 375 ? 22.293  -2.124  -17.645 1.00 45.28  ? 375  ALA B O   1 
ATOM   7106 C CB  . ALA B 1 375 ? 24.309  -3.483  -19.890 1.00 39.72  ? 375  ALA B CB  1 
ATOM   7107 N N   . GLU B 1 376 ? 24.444  -2.120  -17.017 1.00 44.50  ? 376  GLU B N   1 
ATOM   7108 C CA  . GLU B 1 376 ? 24.111  -2.042  -15.594 1.00 48.47  ? 376  GLU B CA  1 
ATOM   7109 C C   . GLU B 1 376 ? 23.403  -0.718  -15.259 1.00 50.97  ? 376  GLU B C   1 
ATOM   7110 O O   . GLU B 1 376 ? 22.407  -0.707  -14.530 1.00 49.67  ? 376  GLU B O   1 
ATOM   7111 C CB  . GLU B 1 376 ? 25.353  -2.213  -14.716 1.00 45.72  ? 376  GLU B CB  1 
ATOM   7112 C CG  . GLU B 1 376 ? 25.827  -3.642  -14.588 1.00 82.31  ? 376  GLU B CG  1 
ATOM   7113 C CD  . GLU B 1 376 ? 27.142  -3.755  -13.839 1.00 89.63  ? 376  GLU B CD  1 
ATOM   7114 O OE1 . GLU B 1 376 ? 28.171  -3.304  -14.386 1.00 90.06  ? 376  GLU B OE1 1 
ATOM   7115 O OE2 . GLU B 1 376 ? 27.151  -4.295  -12.708 1.00 94.99  ? 376  GLU B OE2 1 
ATOM   7116 N N   . ALA B 1 377 ? 23.918  0.387   -15.798 1.00 43.31  ? 377  ALA B N   1 
ATOM   7117 C CA  . ALA B 1 377 ? 23.297  1.691   -15.605 1.00 44.01  ? 377  ALA B CA  1 
ATOM   7118 C C   . ALA B 1 377 ? 21.827  1.666   -16.019 1.00 45.51  ? 377  ALA B C   1 
ATOM   7119 O O   . ALA B 1 377 ? 20.982  2.226   -15.322 1.00 40.76  ? 377  ALA B O   1 
ATOM   7120 C CB  . ALA B 1 377 ? 24.043  2.762   -16.377 1.00 37.72  ? 377  ALA B CB  1 
ATOM   7121 N N   . VAL B 1 378 ? 21.533  1.010   -17.144 1.00 44.87  ? 378  VAL B N   1 
ATOM   7122 C CA  . VAL B 1 378 ? 20.162  0.874   -17.624 1.00 33.18  ? 378  VAL B CA  1 
ATOM   7123 C C   . VAL B 1 378 ? 19.323  0.084   -16.629 1.00 38.09  ? 378  VAL B C   1 
ATOM   7124 O O   . VAL B 1 378 ? 18.243  0.523   -16.226 1.00 35.80  ? 378  VAL B O   1 
ATOM   7125 C CB  . VAL B 1 378 ? 20.106  0.162   -18.980 1.00 39.69  ? 378  VAL B CB  1 
ATOM   7126 C CG1 . VAL B 1 378 ? 18.660  -0.110  -19.376 1.00 41.85  ? 378  VAL B CG1 1 
ATOM   7127 C CG2 . VAL B 1 378 ? 20.806  0.991   -20.035 1.00 32.34  ? 378  VAL B CG2 1 
ATOM   7128 N N   . VAL B 1 379 ? 19.829  -1.076  -16.224 1.00 36.08  ? 379  VAL B N   1 
ATOM   7129 C CA  . VAL B 1 379 ? 19.144  -1.914  -15.241 1.00 42.40  ? 379  VAL B CA  1 
ATOM   7130 C C   . VAL B 1 379 ? 18.884  -1.153  -13.947 1.00 41.64  ? 379  VAL B C   1 
ATOM   7131 O O   . VAL B 1 379 ? 17.782  -1.189  -13.408 1.00 42.22  ? 379  VAL B O   1 
ATOM   7132 C CB  . VAL B 1 379 ? 19.940  -3.207  -14.940 1.00 48.28  ? 379  VAL B CB  1 
ATOM   7133 C CG1 . VAL B 1 379 ? 19.316  -3.995  -13.769 1.00 42.76  ? 379  VAL B CG1 1 
ATOM   7134 C CG2 . VAL B 1 379 ? 20.032  -4.064  -16.198 1.00 39.41  ? 379  VAL B CG2 1 
ATOM   7135 N N   . LEU B 1 380 ? 19.894  -0.447  -13.463 1.00 42.53  ? 380  LEU B N   1 
ATOM   7136 C CA  . LEU B 1 380 ? 19.747  0.303   -12.227 1.00 47.29  ? 380  LEU B CA  1 
ATOM   7137 C C   . LEU B 1 380 ? 18.742  1.452   -12.360 1.00 46.36  ? 380  LEU B C   1 
ATOM   7138 O O   . LEU B 1 380 ? 18.003  1.746   -11.421 1.00 49.30  ? 380  LEU B O   1 
ATOM   7139 C CB  . LEU B 1 380 ? 21.106  0.800   -11.721 1.00 49.63  ? 380  LEU B CB  1 
ATOM   7140 C CG  . LEU B 1 380 ? 22.105  -0.325  -11.404 1.00 59.00  ? 380  LEU B CG  1 
ATOM   7141 C CD1 . LEU B 1 380 ? 23.301  0.194   -10.629 1.00 64.81  ? 380  LEU B CD1 1 
ATOM   7142 C CD2 . LEU B 1 380 ? 21.463  -1.491  -10.655 1.00 62.71  ? 380  LEU B CD2 1 
ATOM   7143 N N   . HIS B 1 381 ? 18.698  2.081   -13.529 1.00 42.21  ? 381  HIS B N   1 
ATOM   7144 C CA  . HIS B 1 381 ? 17.760  3.181   -13.767 1.00 38.88  ? 381  HIS B CA  1 
ATOM   7145 C C   . HIS B 1 381 ? 16.292  2.732   -13.810 1.00 37.05  ? 381  HIS B C   1 
ATOM   7146 O O   . HIS B 1 381 ? 15.418  3.394   -13.248 1.00 38.16  ? 381  HIS B O   1 
ATOM   7147 C CB  . HIS B 1 381 ? 18.102  3.914   -15.067 1.00 37.27  ? 381  HIS B CB  1 
ATOM   7148 C CG  . HIS B 1 381 ? 17.264  5.131   -15.302 1.00 40.68  ? 381  HIS B CG  1 
ATOM   7149 N ND1 . HIS B 1 381 ? 17.495  6.327   -14.659 1.00 51.71  ? 381  HIS B ND1 1 
ATOM   7150 C CD2 . HIS B 1 381 ? 16.174  5.327   -16.080 1.00 40.57  ? 381  HIS B CD2 1 
ATOM   7151 C CE1 . HIS B 1 381 ? 16.594  7.213   -15.043 1.00 49.43  ? 381  HIS B CE1 1 
ATOM   7152 N NE2 . HIS B 1 381 ? 15.779  6.631   -15.904 1.00 46.54  ? 381  HIS B NE2 1 
ATOM   7153 N N   . TYR B 1 382 ? 16.039  1.600   -14.465 1.00 35.88  ? 382  TYR B N   1 
ATOM   7154 C CA  . TYR B 1 382 ? 14.678  1.137   -14.735 1.00 43.33  ? 382  TYR B CA  1 
ATOM   7155 C C   . TYR B 1 382 ? 14.106  0.187   -13.686 1.00 42.86  ? 382  TYR B C   1 
ATOM   7156 O O   . TYR B 1 382 ? 12.899  -0.046  -13.655 1.00 48.32  ? 382  TYR B O   1 
ATOM   7157 C CB  . TYR B 1 382 ? 14.587  0.492   -16.133 1.00 39.41  ? 382  TYR B CB  1 
ATOM   7158 C CG  . TYR B 1 382 ? 14.478  1.496   -17.260 1.00 38.46  ? 382  TYR B CG  1 
ATOM   7159 C CD1 . TYR B 1 382 ? 15.618  2.064   -17.816 1.00 38.29  ? 382  TYR B CD1 1 
ATOM   7160 C CD2 . TYR B 1 382 ? 13.236  1.885   -17.766 1.00 38.27  ? 382  TYR B CD2 1 
ATOM   7161 C CE1 . TYR B 1 382 ? 15.537  2.977   -18.858 1.00 38.18  ? 382  TYR B CE1 1 
ATOM   7162 C CE2 . TYR B 1 382 ? 13.140  2.806   -18.814 1.00 38.45  ? 382  TYR B CE2 1 
ATOM   7163 C CZ  . TYR B 1 382 ? 14.302  3.348   -19.356 1.00 39.36  ? 382  TYR B CZ  1 
ATOM   7164 O OH  . TYR B 1 382 ? 14.247  4.268   -20.382 1.00 34.88  ? 382  TYR B OH  1 
ATOM   7165 N N   . THR B 1 383 ? 14.970  -0.370  -12.842 1.00 45.48  ? 383  THR B N   1 
ATOM   7166 C CA  . THR B 1 383 ? 14.524  -1.186  -11.724 1.00 46.46  ? 383  THR B CA  1 
ATOM   7167 C C   . THR B 1 383 ? 13.724  -0.310  -10.778 1.00 47.31  ? 383  THR B C   1 
ATOM   7168 O O   . THR B 1 383 ? 14.149  0.805   -10.476 1.00 44.02  ? 383  THR B O   1 
ATOM   7169 C CB  . THR B 1 383 ? 15.725  -1.765  -10.952 1.00 44.20  ? 383  THR B CB  1 
ATOM   7170 O OG1 . THR B 1 383 ? 16.363  -2.761  -11.754 1.00 44.42  ? 383  THR B OG1 1 
ATOM   7171 C CG2 . THR B 1 383 ? 15.291  -2.380  -9.621  1.00 46.47  ? 383  THR B CG2 1 
ATOM   7172 N N   . ASP B 1 384 ? 12.563  -0.798  -10.336 1.00 48.38  ? 384  ASP B N   1 
ATOM   7173 C CA  . ASP B 1 384 ? 11.849  -0.172  -9.222  1.00 47.20  ? 384  ASP B CA  1 
ATOM   7174 C C   . ASP B 1 384 ? 12.396  -0.735  -7.912  1.00 52.47  ? 384  ASP B C   1 
ATOM   7175 O O   . ASP B 1 384 ? 12.072  -1.858  -7.520  1.00 48.75  ? 384  ASP B O   1 
ATOM   7176 C CB  . ASP B 1 384 ? 10.336  -0.401  -9.324  1.00 47.77  ? 384  ASP B CB  1 
ATOM   7177 C CG  . ASP B 1 384 ? 9.540   0.390   -8.274  1.00 56.30  ? 384  ASP B CG  1 
ATOM   7178 O OD1 . ASP B 1 384 ? 10.011  0.533   -7.127  1.00 58.77  ? 384  ASP B OD1 1 
ATOM   7179 O OD2 . ASP B 1 384 ? 8.431   0.870   -8.598  1.00 58.43  ? 384  ASP B OD2 1 
ATOM   7180 N N   . TRP B 1 385 ? 13.213  0.053   -7.220  1.00 50.77  ? 385  TRP B N   1 
ATOM   7181 C CA  . TRP B 1 385 ? 13.866  -0.439  -6.002  1.00 50.29  ? 385  TRP B CA  1 
ATOM   7182 C C   . TRP B 1 385 ? 12.934  -0.664  -4.825  1.00 52.53  ? 385  TRP B C   1 
ATOM   7183 O O   . TRP B 1 385 ? 13.336  -1.219  -3.810  1.00 54.89  ? 385  TRP B O   1 
ATOM   7184 C CB  . TRP B 1 385 ? 15.081  0.420   -5.645  1.00 50.57  ? 385  TRP B CB  1 
ATOM   7185 C CG  . TRP B 1 385 ? 16.078  0.288   -6.723  1.00 56.96  ? 385  TRP B CG  1 
ATOM   7186 C CD1 . TRP B 1 385 ? 16.270  1.135   -7.777  1.00 55.35  ? 385  TRP B CD1 1 
ATOM   7187 C CD2 . TRP B 1 385 ? 16.964  -0.811  -6.924  1.00 54.88  ? 385  TRP B CD2 1 
ATOM   7188 N NE1 . TRP B 1 385 ? 17.247  0.646   -8.602  1.00 46.40  ? 385  TRP B NE1 1 
ATOM   7189 C CE2 . TRP B 1 385 ? 17.694  -0.547  -8.099  1.00 48.23  ? 385  TRP B CE2 1 
ATOM   7190 C CE3 . TRP B 1 385 ? 17.221  -1.988  -6.218  1.00 52.15  ? 385  TRP B CE3 1 
ATOM   7191 C CZ2 . TRP B 1 385 ? 18.666  -1.417  -8.581  1.00 54.69  ? 385  TRP B CZ2 1 
ATOM   7192 C CZ3 . TRP B 1 385 ? 18.187  -2.848  -6.698  1.00 52.66  ? 385  TRP B CZ3 1 
ATOM   7193 C CH2 . TRP B 1 385 ? 18.896  -2.562  -7.866  1.00 57.03  ? 385  TRP B CH2 1 
ATOM   7194 N N   . LEU B 1 386 ? 11.679  -0.266  -4.971  1.00 66.35  ? 386  LEU B N   1 
ATOM   7195 C CA  . LEU B 1 386 ? 10.678  -0.653  -3.988  1.00 72.68  ? 386  LEU B CA  1 
ATOM   7196 C C   . LEU B 1 386 ? 10.248  -2.096  -4.241  1.00 67.88  ? 386  LEU B C   1 
ATOM   7197 O O   . LEU B 1 386 ? 9.954   -2.843  -3.307  1.00 64.26  ? 386  LEU B O   1 
ATOM   7198 C CB  . LEU B 1 386 ? 9.483   0.297   -4.028  1.00 71.29  ? 386  LEU B CB  1 
ATOM   7199 C CG  . LEU B 1 386 ? 9.720   1.590   -3.250  1.00 71.12  ? 386  LEU B CG  1 
ATOM   7200 C CD1 . LEU B 1 386 ? 8.944   2.769   -3.850  1.00 65.58  ? 386  LEU B CD1 1 
ATOM   7201 C CD2 . LEU B 1 386 ? 9.367   1.365   -1.783  1.00 75.91  ? 386  LEU B CD2 1 
ATOM   7202 N N   . HIS B 1 387 ? 10.238  -2.478  -5.516  1.00 67.08  ? 387  HIS B N   1 
ATOM   7203 C CA  . HIS B 1 387 ? 9.816   -3.811  -5.936  1.00 69.81  ? 387  HIS B CA  1 
ATOM   7204 C C   . HIS B 1 387 ? 10.781  -4.364  -6.980  1.00 59.85  ? 387  HIS B C   1 
ATOM   7205 O O   . HIS B 1 387 ? 10.404  -4.527  -8.137  1.00 53.15  ? 387  HIS B O   1 
ATOM   7206 C CB  . HIS B 1 387 ? 8.410   -3.753  -6.548  1.00 73.57  ? 387  HIS B CB  1 
ATOM   7207 C CG  . HIS B 1 387 ? 7.454   -2.876  -5.798  1.00 77.17  ? 387  HIS B CG  1 
ATOM   7208 N ND1 . HIS B 1 387 ? 7.217   -1.561  -6.146  1.00 76.86  ? 387  HIS B ND1 1 
ATOM   7209 C CD2 . HIS B 1 387 ? 6.677   -3.125  -4.717  1.00 76.08  ? 387  HIS B CD2 1 
ATOM   7210 C CE1 . HIS B 1 387 ? 6.336   -1.039  -5.312  1.00 73.84  ? 387  HIS B CE1 1 
ATOM   7211 N NE2 . HIS B 1 387 ? 5.993   -1.967  -4.435  1.00 76.98  ? 387  HIS B NE2 1 
ATOM   7212 N N   . PRO B 1 388 ? 12.031  -4.648  -6.576  1.00 57.41  ? 388  PRO B N   1 
ATOM   7213 C CA  . PRO B 1 388 ? 13.105  -4.976  -7.526  1.00 53.42  ? 388  PRO B CA  1 
ATOM   7214 C C   . PRO B 1 388 ? 12.921  -6.301  -8.266  1.00 52.63  ? 388  PRO B C   1 
ATOM   7215 O O   . PRO B 1 388 ? 13.514  -6.485  -9.336  1.00 51.34  ? 388  PRO B O   1 
ATOM   7216 C CB  . PRO B 1 388 ? 14.354  -5.041  -6.635  1.00 54.36  ? 388  PRO B CB  1 
ATOM   7217 C CG  . PRO B 1 388 ? 13.836  -5.334  -5.270  1.00 56.38  ? 388  PRO B CG  1 
ATOM   7218 C CD  . PRO B 1 388 ? 12.502  -4.661  -5.178  1.00 60.03  ? 388  PRO B CD  1 
ATOM   7219 N N   . GLU B 1 389 ? 12.114  -7.199  -7.709  1.00 55.29  ? 389  GLU B N   1 
ATOM   7220 C CA  . GLU B 1 389 ? 11.977  -8.554  -8.242  1.00 57.16  ? 389  GLU B CA  1 
ATOM   7221 C C   . GLU B 1 389 ? 10.588  -8.826  -8.791  1.00 59.95  ? 389  GLU B C   1 
ATOM   7222 O O   . GLU B 1 389 ? 10.298  -9.946  -9.232  1.00 60.01  ? 389  GLU B O   1 
ATOM   7223 C CB  . GLU B 1 389 ? 12.299  -9.587  -7.162  1.00 59.43  ? 389  GLU B CB  1 
ATOM   7224 C CG  . GLU B 1 389 ? 13.670  -9.407  -6.546  1.00 77.35  ? 389  GLU B CG  1 
ATOM   7225 C CD  . GLU B 1 389 ? 14.520  -10.655 -6.640  1.00 79.70  ? 389  GLU B CD  1 
ATOM   7226 O OE1 . GLU B 1 389 ? 14.896  -11.044 -7.768  1.00 75.82  ? 389  GLU B OE1 1 
ATOM   7227 O OE2 . GLU B 1 389 ? 14.807  -11.254 -5.580  1.00 87.73  ? 389  GLU B OE2 1 
ATOM   7228 N N   . ASP B 1 390 ? 9.734   -7.805  -8.758  1.00 54.42  ? 390  ASP B N   1 
ATOM   7229 C CA  . ASP B 1 390 ? 8.350   -7.959  -9.193  1.00 56.40  ? 390  ASP B CA  1 
ATOM   7230 C C   . ASP B 1 390 ? 8.244   -8.120  -10.706 1.00 52.47  ? 390  ASP B C   1 
ATOM   7231 O O   . ASP B 1 390 ? 8.601   -7.219  -11.454 1.00 52.42  ? 390  ASP B O   1 
ATOM   7232 C CB  . ASP B 1 390 ? 7.491   -6.787  -8.720  1.00 57.07  ? 390  ASP B CB  1 
ATOM   7233 C CG  . ASP B 1 390 ? 6.054   -6.880  -9.213  1.00 62.07  ? 390  ASP B CG  1 
ATOM   7234 O OD1 . ASP B 1 390 ? 5.344   -7.819  -8.794  1.00 69.25  ? 390  ASP B OD1 1 
ATOM   7235 O OD2 . ASP B 1 390 ? 5.628   -6.013  -10.012 1.00 51.64  ? 390  ASP B OD2 1 
ATOM   7236 N N   . PRO B 1 391 ? 7.757   -9.285  -11.152 1.00 57.35  ? 391  PRO B N   1 
ATOM   7237 C CA  . PRO B 1 391 ? 7.611   -9.616  -12.574 1.00 52.73  ? 391  PRO B CA  1 
ATOM   7238 C C   . PRO B 1 391 ? 6.806   -8.596  -13.394 1.00 51.12  ? 391  PRO B C   1 
ATOM   7239 O O   . PRO B 1 391 ? 7.229   -8.284  -14.499 1.00 49.60  ? 391  PRO B O   1 
ATOM   7240 C CB  . PRO B 1 391 ? 6.917   -10.979 -12.538 1.00 55.64  ? 391  PRO B CB  1 
ATOM   7241 C CG  . PRO B 1 391 ? 7.390   -11.576 -11.249 1.00 58.32  ? 391  PRO B CG  1 
ATOM   7242 C CD  . PRO B 1 391 ? 7.435   -10.434 -10.285 1.00 57.46  ? 391  PRO B CD  1 
ATOM   7243 N N   . THR B 1 392 ? 5.691   -8.086  -12.876 1.00 51.45  ? 392  THR B N   1 
ATOM   7244 C CA  . THR B 1 392 ? 4.903   -7.075  -13.597 1.00 49.98  ? 392  THR B CA  1 
ATOM   7245 C C   . THR B 1 392 ? 5.694   -5.787  -13.871 1.00 49.79  ? 392  THR B C   1 
ATOM   7246 O O   . THR B 1 392 ? 5.590   -5.205  -14.958 1.00 45.54  ? 392  THR B O   1 
ATOM   7247 C CB  . THR B 1 392 ? 3.571   -6.750  -12.860 1.00 49.95  ? 392  THR B CB  1 
ATOM   7248 O OG1 . THR B 1 392 ? 2.667   -7.852  -13.011 1.00 52.25  ? 392  THR B OG1 1 
ATOM   7249 C CG2 . THR B 1 392 ? 2.910   -5.509  -13.420 1.00 47.86  ? 392  THR B CG2 1 
ATOM   7250 N N   . HIS B 1 393 ? 6.483   -5.347  -12.890 1.00 50.97  ? 393  HIS B N   1 
ATOM   7251 C CA  . HIS B 1 393 ? 7.307   -4.153  -13.065 1.00 51.72  ? 393  HIS B CA  1 
ATOM   7252 C C   . HIS B 1 393 ? 8.413   -4.414  -14.059 1.00 46.89  ? 393  HIS B C   1 
ATOM   7253 O O   . HIS B 1 393 ? 8.646   -3.613  -14.953 1.00 48.36  ? 393  HIS B O   1 
ATOM   7254 C CB  . HIS B 1 393 ? 7.933   -3.698  -11.750 1.00 56.83  ? 393  HIS B CB  1 
ATOM   7255 C CG  . HIS B 1 393 ? 7.005   -2.921  -10.877 1.00 67.48  ? 393  HIS B CG  1 
ATOM   7256 N ND1 . HIS B 1 393 ? 6.122   -3.525  -10.006 1.00 72.84  ? 393  HIS B ND1 1 
ATOM   7257 C CD2 . HIS B 1 393 ? 6.822   -1.587  -10.735 1.00 69.02  ? 393  HIS B CD2 1 
ATOM   7258 C CE1 . HIS B 1 393 ? 5.436   -2.596  -9.365  1.00 71.78  ? 393  HIS B CE1 1 
ATOM   7259 N NE2 . HIS B 1 393 ? 5.842   -1.412  -9.787  1.00 70.46  ? 393  HIS B NE2 1 
ATOM   7260 N N   . LEU B 1 394 ? 9.098   -5.537  -13.880 1.00 45.88  ? 394  LEU B N   1 
ATOM   7261 C CA  . LEU B 1 394 ? 10.209  -5.897  -14.740 1.00 47.76  ? 394  LEU B CA  1 
ATOM   7262 C C   . LEU B 1 394 ? 9.773   -5.984  -16.211 1.00 50.05  ? 394  LEU B C   1 
ATOM   7263 O O   . LEU B 1 394 ? 10.479  -5.511  -17.104 1.00 45.40  ? 394  LEU B O   1 
ATOM   7264 C CB  . LEU B 1 394 ? 10.845  -7.203  -14.260 1.00 49.49  ? 394  LEU B CB  1 
ATOM   7265 C CG  . LEU B 1 394 ? 11.560  -7.099  -12.909 1.00 52.28  ? 394  LEU B CG  1 
ATOM   7266 C CD1 . LEU B 1 394 ? 11.887  -8.480  -12.342 1.00 51.31  ? 394  LEU B CD1 1 
ATOM   7267 C CD2 . LEU B 1 394 ? 12.818  -6.241  -13.022 1.00 46.02  ? 394  LEU B CD2 1 
ATOM   7268 N N   . ARG B 1 395 ? 8.593   -6.550  -16.447 1.00 42.81  ? 395  ARG B N   1 
ATOM   7269 C CA  . ARG B 1 395 ? 8.047   -6.659  -17.792 1.00 41.78  ? 395  ARG B CA  1 
ATOM   7270 C C   . ARG B 1 395 ? 7.785   -5.276  -18.395 1.00 44.11  ? 395  ARG B C   1 
ATOM   7271 O O   . ARG B 1 395 ? 8.261   -4.960  -19.493 1.00 40.02  ? 395  ARG B O   1 
ATOM   7272 C CB  . ARG B 1 395 ? 6.764   -7.492  -17.776 1.00 44.82  ? 395  ARG B CB  1 
ATOM   7273 C CG  . ARG B 1 395 ? 6.022   -7.520  -19.103 1.00 44.41  ? 395  ARG B CG  1 
ATOM   7274 C CD  . ARG B 1 395 ? 4.711   -6.782  -18.996 1.00 44.79  ? 395  ARG B CD  1 
ATOM   7275 N NE  . ARG B 1 395 ? 3.644   -7.646  -18.527 1.00 50.66  ? 395  ARG B NE  1 
ATOM   7276 C CZ  . ARG B 1 395 ? 2.588   -7.229  -17.833 1.00 56.97  ? 395  ARG B CZ  1 
ATOM   7277 N NH1 . ARG B 1 395 ? 2.451   -5.940  -17.523 1.00 43.79  ? 395  ARG B NH1 1 
ATOM   7278 N NH2 . ARG B 1 395 ? 1.666   -8.114  -17.447 1.00 54.37  ? 395  ARG B NH2 1 
ATOM   7279 N N   . ASP B 1 396 ? 7.037   -4.450  -17.668 1.00 43.40  ? 396  ASP B N   1 
ATOM   7280 C CA  . ASP B 1 396 ? 6.726   -3.098  -18.129 1.00 40.38  ? 396  ASP B CA  1 
ATOM   7281 C C   . ASP B 1 396 ? 7.990   -2.257  -18.285 1.00 42.91  ? 396  ASP B C   1 
ATOM   7282 O O   . ASP B 1 396 ? 8.068   -1.418  -19.179 1.00 50.10  ? 396  ASP B O   1 
ATOM   7283 C CB  . ASP B 1 396 ? 5.743   -2.406  -17.183 1.00 37.45  ? 396  ASP B CB  1 
ATOM   7284 C CG  . ASP B 1 396 ? 4.386   -3.091  -17.142 1.00 53.13  ? 396  ASP B CG  1 
ATOM   7285 O OD1 . ASP B 1 396 ? 4.032   -3.795  -18.114 1.00 49.59  ? 396  ASP B OD1 1 
ATOM   7286 O OD2 . ASP B 1 396 ? 3.672   -2.926  -16.132 1.00 56.45  ? 396  ASP B OD2 1 
ATOM   7287 N N   . ALA B 1 397 ? 8.980   -2.485  -17.422 1.00 38.87  ? 397  ALA B N   1 
ATOM   7288 C CA  . ALA B 1 397 ? 10.243  -1.757  -17.509 1.00 38.64  ? 397  ALA B CA  1 
ATOM   7289 C C   . ALA B 1 397 ? 10.982  -2.131  -18.794 1.00 41.74  ? 397  ALA B C   1 
ATOM   7290 O O   . ALA B 1 397 ? 11.482  -1.254  -19.513 1.00 37.42  ? 397  ALA B O   1 
ATOM   7291 C CB  . ALA B 1 397 ? 11.118  -2.033  -16.296 1.00 36.98  ? 397  ALA B CB  1 
ATOM   7292 N N   . MET B 1 398 ? 11.039  -3.433  -19.075 1.00 35.98  ? 398  MET B N   1 
ATOM   7293 C CA  . MET B 1 398 ? 11.701  -3.942  -20.274 1.00 35.81  ? 398  MET B CA  1 
ATOM   7294 C C   . MET B 1 398 ? 11.174  -3.252  -21.536 1.00 40.15  ? 398  MET B C   1 
ATOM   7295 O O   . MET B 1 398 ? 11.943  -2.901  -22.429 1.00 39.83  ? 398  MET B O   1 
ATOM   7296 C CB  . MET B 1 398 ? 11.510  -5.455  -20.395 1.00 37.76  ? 398  MET B CB  1 
ATOM   7297 C CG  . MET B 1 398 ? 12.291  -6.083  -21.542 1.00 41.25  ? 398  MET B CG  1 
ATOM   7298 S SD  . MET B 1 398 ? 14.079  -6.027  -21.277 1.00 44.75  ? 398  MET B SD  1 
ATOM   7299 C CE  . MET B 1 398 ? 14.615  -4.921  -22.574 1.00 36.85  ? 398  MET B CE  1 
ATOM   7300 N N   . SER B 1 399 ? 9.860   -3.059  -21.588 1.00 33.56  ? 399  SER B N   1 
ATOM   7301 C CA  . SER B 1 399 ? 9.208   -2.392  -22.701 1.00 42.08  ? 399  SER B CA  1 
ATOM   7302 C C   . SER B 1 399 ? 9.614   -0.911  -22.775 1.00 42.22  ? 399  SER B C   1 
ATOM   7303 O O   . SER B 1 399 ? 9.950   -0.398  -23.849 1.00 42.02  ? 399  SER B O   1 
ATOM   7304 C CB  . SER B 1 399 ? 7.693   -2.544  -22.555 1.00 43.04  ? 399  SER B CB  1 
ATOM   7305 O OG  . SER B 1 399 ? 6.989   -1.630  -23.363 1.00 43.50  ? 399  SER B OG  1 
ATOM   7306 N N   . ALA B 1 400 ? 9.595   -0.237  -21.626 1.00 38.15  ? 400  ALA B N   1 
ATOM   7307 C CA  . ALA B 1 400 ? 10.051  1.150   -21.537 1.00 38.23  ? 400  ALA B CA  1 
ATOM   7308 C C   . ALA B 1 400 ? 11.498  1.314   -22.017 1.00 36.52  ? 400  ALA B C   1 
ATOM   7309 O O   . ALA B 1 400 ? 11.802  2.269   -22.716 1.00 33.31  ? 400  ALA B O   1 
ATOM   7310 C CB  . ALA B 1 400 ? 9.899   1.686   -20.104 1.00 30.06  ? 400  ALA B CB  1 
ATOM   7311 N N   . VAL B 1 401 ? 12.383  0.387   -21.648 1.00 33.99  ? 401  VAL B N   1 
ATOM   7312 C CA  . VAL B 1 401 ? 13.771  0.478   -22.087 1.00 33.34  ? 401  VAL B CA  1 
ATOM   7313 C C   . VAL B 1 401 ? 13.838  0.517   -23.607 1.00 32.10  ? 401  VAL B C   1 
ATOM   7314 O O   . VAL B 1 401 ? 14.480  1.386   -24.189 1.00 31.62  ? 401  VAL B O   1 
ATOM   7315 C CB  . VAL B 1 401 ? 14.636  -0.695  -21.566 1.00 36.58  ? 401  VAL B CB  1 
ATOM   7316 C CG1 . VAL B 1 401 ? 15.935  -0.790  -22.357 1.00 32.88  ? 401  VAL B CG1 1 
ATOM   7317 C CG2 . VAL B 1 401 ? 14.923  -0.526  -20.084 1.00 34.01  ? 401  VAL B CG2 1 
ATOM   7318 N N   . VAL B 1 402 ? 13.147  -0.421  -24.239 1.00 33.46  ? 402  VAL B N   1 
ATOM   7319 C CA  . VAL B 1 402 ? 13.171  -0.544  -25.685 1.00 35.11  ? 402  VAL B CA  1 
ATOM   7320 C C   . VAL B 1 402 ? 12.541  0.682   -26.347 1.00 38.72  ? 402  VAL B C   1 
ATOM   7321 O O   . VAL B 1 402 ? 13.132  1.273   -27.250 1.00 38.72  ? 402  VAL B O   1 
ATOM   7322 C CB  . VAL B 1 402 ? 12.478  -1.852  -26.137 1.00 35.16  ? 402  VAL B CB  1 
ATOM   7323 C CG1 . VAL B 1 402 ? 12.260  -1.864  -27.641 1.00 31.27  ? 402  VAL B CG1 1 
ATOM   7324 C CG2 . VAL B 1 402 ? 13.304  -3.046  -25.701 1.00 32.53  ? 402  VAL B CG2 1 
ATOM   7325 N N   . GLY B 1 403 ? 11.359  1.075   -25.873 1.00 33.35  ? 403  GLY B N   1 
ATOM   7326 C CA  . GLY B 1 403 ? 10.666  2.232   -26.409 1.00 27.44  ? 403  GLY B CA  1 
ATOM   7327 C C   . GLY B 1 403 ? 11.391  3.559   -26.220 1.00 33.99  ? 403  GLY B C   1 
ATOM   7328 O O   . GLY B 1 403 ? 11.455  4.386   -27.143 1.00 30.65  ? 403  GLY B O   1 
ATOM   7329 N N   . ASP B 1 404 ? 11.926  3.778   -25.019 1.00 26.04  ? 404  ASP B N   1 
ATOM   7330 C CA  . ASP B 1 404 ? 12.614  5.018   -24.723 1.00 27.49  ? 404  ASP B CA  1 
ATOM   7331 C C   . ASP B 1 404 ? 13.896  5.139   -25.541 1.00 34.17  ? 404  ASP B C   1 
ATOM   7332 O O   . ASP B 1 404 ? 14.165  6.171   -26.159 1.00 37.67  ? 404  ASP B O   1 
ATOM   7333 C CB  . ASP B 1 404 ? 12.941  5.113   -23.229 1.00 33.72  ? 404  ASP B CB  1 
ATOM   7334 C CG  . ASP B 1 404 ? 11.701  5.127   -22.363 1.00 33.50  ? 404  ASP B CG  1 
ATOM   7335 O OD1 . ASP B 1 404 ? 10.607  5.259   -22.951 1.00 34.91  ? 404  ASP B OD1 1 
ATOM   7336 O OD2 . ASP B 1 404 ? 11.811  5.007   -21.110 1.00 28.50  ? 404  ASP B OD2 1 
ATOM   7337 N N   . HIS B 1 405 ? 14.690  4.078   -25.523 1.00 27.12  ? 405  HIS B N   1 
ATOM   7338 C CA  . HIS B 1 405 ? 15.980  4.070   -26.185 1.00 34.59  ? 405  HIS B CA  1 
ATOM   7339 C C   . HIS B 1 405 ? 15.822  4.241   -27.705 1.00 38.77  ? 405  HIS B C   1 
ATOM   7340 O O   . HIS B 1 405 ? 16.653  4.880   -28.355 1.00 36.33  ? 405  HIS B O   1 
ATOM   7341 C CB  . HIS B 1 405 ? 16.691  2.758   -25.866 1.00 33.25  ? 405  HIS B CB  1 
ATOM   7342 C CG  . HIS B 1 405 ? 17.963  2.553   -26.622 1.00 36.67  ? 405  HIS B CG  1 
ATOM   7343 N ND1 . HIS B 1 405 ? 18.889  3.556   -26.806 1.00 33.19  ? 405  HIS B ND1 1 
ATOM   7344 C CD2 . HIS B 1 405 ? 18.473  1.453   -27.226 1.00 40.60  ? 405  HIS B CD2 1 
ATOM   7345 C CE1 . HIS B 1 405 ? 19.915  3.082   -27.491 1.00 33.45  ? 405  HIS B CE1 1 
ATOM   7346 N NE2 . HIS B 1 405 ? 19.686  1.810   -27.762 1.00 35.44  ? 405  HIS B NE2 1 
ATOM   7347 N N   . ASN B 1 406 ? 14.749  3.688   -28.262 1.00 26.68  ? 406  ASN B N   1 
ATOM   7348 C CA  . ASN B 1 406 ? 14.600  3.655   -29.714 1.00 30.54  ? 406  ASN B CA  1 
ATOM   7349 C C   . ASN B 1 406 ? 13.691  4.717   -30.296 1.00 32.17  ? 406  ASN B C   1 
ATOM   7350 O O   . ASN B 1 406 ? 13.914  5.160   -31.410 1.00 38.40  ? 406  ASN B O   1 
ATOM   7351 C CB  . ASN B 1 406 ? 14.150  2.274   -30.200 1.00 27.74  ? 406  ASN B CB  1 
ATOM   7352 C CG  . ASN B 1 406 ? 15.206  1.215   -29.982 1.00 34.24  ? 406  ASN B CG  1 
ATOM   7353 O OD1 . ASN B 1 406 ? 16.300  1.301   -30.529 1.00 29.59  ? 406  ASN B OD1 1 
ATOM   7354 N ND2 . ASN B 1 406 ? 14.887  0.213   -29.167 1.00 36.16  ? 406  ASN B ND2 1 
ATOM   7355 N N   . VAL B 1 407 ? 12.660  5.114   -29.562 1.00 25.82  ? 407  VAL B N   1 
ATOM   7356 C CA  . VAL B 1 407 ? 11.717  6.082   -30.103 1.00 30.71  ? 407  VAL B CA  1 
ATOM   7357 C C   . VAL B 1 407 ? 11.560  7.352   -29.247 1.00 31.20  ? 407  VAL B C   1 
ATOM   7358 O O   . VAL B 1 407 ? 11.836  8.449   -29.710 1.00 34.37  ? 407  VAL B O   1 
ATOM   7359 C CB  . VAL B 1 407 ? 10.338  5.437   -30.344 1.00 33.24  ? 407  VAL B CB  1 
ATOM   7360 C CG1 . VAL B 1 407 ? 9.359   6.460   -30.923 1.00 30.65  ? 407  VAL B CG1 1 
ATOM   7361 C CG2 . VAL B 1 407 ? 10.469  4.227   -31.254 1.00 25.38  ? 407  VAL B CG2 1 
ATOM   7362 N N   . VAL B 1 408 ? 11.138  7.202   -27.998 1.00 23.30  ? 408  VAL B N   1 
ATOM   7363 C CA  . VAL B 1 408 ? 10.727  8.362   -27.203 1.00 29.87  ? 408  VAL B CA  1 
ATOM   7364 C C   . VAL B 1 408 ? 11.833  9.386   -27.004 1.00 30.12  ? 408  VAL B C   1 
ATOM   7365 O O   . VAL B 1 408 ? 11.647  10.578  -27.225 1.00 34.11  ? 408  VAL B O   1 
ATOM   7366 C CB  . VAL B 1 408 ? 10.185  7.959   -25.818 1.00 30.99  ? 408  VAL B CB  1 
ATOM   7367 C CG1 . VAL B 1 408 ? 9.717   9.202   -25.066 1.00 23.89  ? 408  VAL B CG1 1 
ATOM   7368 C CG2 . VAL B 1 408 ? 9.059   6.939   -25.960 1.00 25.29  ? 408  VAL B CG2 1 
ATOM   7369 N N   . CYS B 1 409 ? 12.993  8.915   -26.585 1.00 32.58  ? 409  CYS B N   1 
ATOM   7370 C CA  . CYS B 1 409 ? 14.099  9.819   -26.325 1.00 29.25  ? 409  CYS B CA  1 
ATOM   7371 C C   . CYS B 1 409 ? 14.718  10.400  -27.599 1.00 30.20  ? 409  CYS B C   1 
ATOM   7372 O O   . CYS B 1 409 ? 15.058  11.588  -27.622 1.00 33.93  ? 409  CYS B O   1 
ATOM   7373 C CB  . CYS B 1 409 ? 15.138  9.156   -25.416 1.00 26.24  ? 409  CYS B CB  1 
ATOM   7374 S SG  . CYS B 1 409 ? 14.474  8.799   -23.782 1.00 35.56  ? 409  CYS B SG  1 
ATOM   7375 N N   . PRO B 1 410 ? 14.873  9.576   -28.657 1.00 26.70  ? 410  PRO B N   1 
ATOM   7376 C CA  . PRO B 1 410 ? 15.285  10.178  -29.932 1.00 30.57  ? 410  PRO B CA  1 
ATOM   7377 C C   . PRO B 1 410 ? 14.300  11.239  -30.417 1.00 30.43  ? 410  PRO B C   1 
ATOM   7378 O O   . PRO B 1 410 ? 14.731  12.265  -30.958 1.00 31.18  ? 410  PRO B O   1 
ATOM   7379 C CB  . PRO B 1 410 ? 15.296  8.985   -30.889 1.00 28.47  ? 410  PRO B CB  1 
ATOM   7380 C CG  . PRO B 1 410 ? 15.665  7.850   -30.017 1.00 32.77  ? 410  PRO B CG  1 
ATOM   7381 C CD  . PRO B 1 410 ? 14.952  8.104   -28.714 1.00 31.56  ? 410  PRO B CD  1 
ATOM   7382 N N   . VAL B 1 411 ? 13.006  11.004  -30.207 1.00 29.26  ? 411  VAL B N   1 
ATOM   7383 C CA  . VAL B 1 411 ? 11.980  11.977  -30.581 1.00 32.16  ? 411  VAL B CA  1 
ATOM   7384 C C   . VAL B 1 411 ? 12.106  13.262  -29.738 1.00 31.08  ? 411  VAL B C   1 
ATOM   7385 O O   . VAL B 1 411 ? 12.000  14.379  -30.263 1.00 29.60  ? 411  VAL B O   1 
ATOM   7386 C CB  . VAL B 1 411 ? 10.544  11.379  -30.493 1.00 22.34  ? 411  VAL B CB  1 
ATOM   7387 C CG1 . VAL B 1 411 ? 9.516   12.476  -30.508 1.00 22.19  ? 411  VAL B CG1 1 
ATOM   7388 C CG2 . VAL B 1 411 ? 10.282  10.412  -31.630 1.00 22.00  ? 411  VAL B CG2 1 
ATOM   7389 N N   . ALA B 1 412 ? 12.373  13.103  -28.443 1.00 25.85  ? 412  ALA B N   1 
ATOM   7390 C CA  . ALA B 1 412 ? 12.550  14.265  -27.567 1.00 30.16  ? 412  ALA B CA  1 
ATOM   7391 C C   . ALA B 1 412 ? 13.789  15.048  -27.965 1.00 32.56  ? 412  ALA B C   1 
ATOM   7392 O O   . ALA B 1 412 ? 13.766  16.290  -28.002 1.00 32.30  ? 412  ALA B O   1 
ATOM   7393 C CB  . ALA B 1 412 ? 12.621  13.853  -26.094 1.00 25.53  ? 412  ALA B CB  1 
ATOM   7394 N N   . GLN B 1 413 ? 14.861  14.324  -28.290 1.00 28.31  ? 413  GLN B N   1 
ATOM   7395 C CA  . GLN B 1 413 ? 16.060  14.975  -28.819 1.00 30.14  ? 413  GLN B CA  1 
ATOM   7396 C C   . GLN B 1 413 ? 15.768  15.769  -30.097 1.00 29.80  ? 413  GLN B C   1 
ATOM   7397 O O   . GLN B 1 413 ? 16.168  16.925  -30.213 1.00 28.90  ? 413  GLN B O   1 
ATOM   7398 C CB  . GLN B 1 413 ? 17.195  13.977  -29.067 1.00 33.13  ? 413  GLN B CB  1 
ATOM   7399 C CG  . GLN B 1 413 ? 18.526  14.662  -29.357 1.00 45.84  ? 413  GLN B CG  1 
ATOM   7400 C CD  . GLN B 1 413 ? 19.700  13.701  -29.377 1.00 61.51  ? 413  GLN B CD  1 
ATOM   7401 O OE1 . GLN B 1 413 ? 19.843  12.895  -30.299 1.00 70.32  ? 413  GLN B OE1 1 
ATOM   7402 N NE2 . GLN B 1 413 ? 20.549  13.781  -28.356 1.00 63.28  ? 413  GLN B NE2 1 
ATOM   7403 N N   . LEU B 1 414 ? 15.064  15.150  -31.046 1.00 32.55  ? 414  LEU B N   1 
ATOM   7404 C CA  . LEU B 1 414 ? 14.732  15.830  -32.297 1.00 34.21  ? 414  LEU B CA  1 
ATOM   7405 C C   . LEU B 1 414 ? 13.874  17.074  -32.062 1.00 33.34  ? 414  LEU B C   1 
ATOM   7406 O O   . LEU B 1 414 ? 14.208  18.158  -32.530 1.00 33.89  ? 414  LEU B O   1 
ATOM   7407 C CB  . LEU B 1 414 ? 14.018  14.891  -33.272 1.00 29.31  ? 414  LEU B CB  1 
ATOM   7408 C CG  . LEU B 1 414 ? 13.749  15.491  -34.660 1.00 25.79  ? 414  LEU B CG  1 
ATOM   7409 C CD1 . LEU B 1 414 ? 15.024  15.860  -35.399 1.00 27.31  ? 414  LEU B CD1 1 
ATOM   7410 C CD2 . LEU B 1 414 ? 12.964  14.522  -35.493 1.00 29.17  ? 414  LEU B CD2 1 
ATOM   7411 N N   . ALA B 1 415 ? 12.774  16.903  -31.335 1.00 30.02  ? 415  ALA B N   1 
ATOM   7412 C CA  . ALA B 1 415 ? 11.855  18.000  -31.057 1.00 34.25  ? 415  ALA B CA  1 
ATOM   7413 C C   . ALA B 1 415 ? 12.591  19.193  -30.468 1.00 37.03  ? 415  ALA B C   1 
ATOM   7414 O O   . ALA B 1 415 ? 12.448  20.328  -30.935 1.00 36.97  ? 415  ALA B O   1 
ATOM   7415 C CB  . ALA B 1 415 ? 10.762  17.544  -30.112 1.00 29.40  ? 415  ALA B CB  1 
ATOM   7416 N N   . GLY B 1 416 ? 13.395  18.924  -29.449 1.00 28.42  ? 416  GLY B N   1 
ATOM   7417 C CA  . GLY B 1 416 ? 14.157  19.967  -28.805 1.00 30.26  ? 416  GLY B CA  1 
ATOM   7418 C C   . GLY B 1 416 ? 15.165  20.623  -29.727 1.00 35.18  ? 416  GLY B C   1 
ATOM   7419 O O   . GLY B 1 416 ? 15.275  21.847  -29.745 1.00 38.90  ? 416  GLY B O   1 
ATOM   7420 N N   . ARG B 1 417 ? 15.903  19.829  -30.498 1.00 31.26  ? 417  ARG B N   1 
ATOM   7421 C CA  . ARG B 1 417 ? 16.875  20.414  -31.420 1.00 35.16  ? 417  ARG B CA  1 
ATOM   7422 C C   . ARG B 1 417 ? 16.216  21.235  -32.524 1.00 35.36  ? 417  ARG B C   1 
ATOM   7423 O O   . ARG B 1 417 ? 16.656  22.352  -32.815 1.00 39.15  ? 417  ARG B O   1 
ATOM   7424 C CB  . ARG B 1 417 ? 17.827  19.367  -31.998 1.00 39.62  ? 417  ARG B CB  1 
ATOM   7425 C CG  . ARG B 1 417 ? 18.729  18.714  -30.958 1.00 50.78  ? 417  ARG B CG  1 
ATOM   7426 C CD  . ARG B 1 417 ? 19.378  19.739  -30.035 1.00 58.08  ? 417  ARG B CD  1 
ATOM   7427 N NE  . ARG B 1 417 ? 20.557  20.347  -30.635 1.00 69.50  ? 417  ARG B NE  1 
ATOM   7428 C CZ  . ARG B 1 417 ? 21.029  21.550  -30.315 1.00 77.17  ? 417  ARG B CZ  1 
ATOM   7429 N NH1 . ARG B 1 417 ? 20.406  22.289  -29.401 1.00 77.40  ? 417  ARG B NH1 1 
ATOM   7430 N NH2 . ARG B 1 417 ? 22.120  22.017  -30.916 1.00 74.98  ? 417  ARG B NH2 1 
ATOM   7431 N N   . LEU B 1 418 ? 15.149  20.707  -33.119 1.00 32.93  ? 418  LEU B N   1 
ATOM   7432 C CA  . LEU B 1 418 ? 14.423  21.463  -34.139 1.00 39.33  ? 418  LEU B CA  1 
ATOM   7433 C C   . LEU B 1 418 ? 13.860  22.781  -33.571 1.00 42.58  ? 418  LEU B C   1 
ATOM   7434 O O   . LEU B 1 418 ? 14.030  23.842  -34.171 1.00 42.93  ? 418  LEU B O   1 
ATOM   7435 C CB  . LEU B 1 418 ? 13.302  20.624  -34.764 1.00 37.45  ? 418  LEU B CB  1 
ATOM   7436 C CG  . LEU B 1 418 ? 13.672  19.408  -35.619 1.00 36.36  ? 418  LEU B CG  1 
ATOM   7437 C CD1 . LEU B 1 418 ? 12.420  18.689  -36.069 1.00 30.83  ? 418  LEU B CD1 1 
ATOM   7438 C CD2 . LEU B 1 418 ? 14.509  19.796  -36.823 1.00 31.22  ? 418  LEU B CD2 1 
ATOM   7439 N N   . ALA B 1 419 ? 13.203  22.711  -32.413 1.00 38.42  ? 419  ALA B N   1 
ATOM   7440 C CA  . ALA B 1 419 ? 12.627  23.906  -31.802 1.00 33.36  ? 419  ALA B CA  1 
ATOM   7441 C C   . ALA B 1 419 ? 13.680  24.968  -31.530 1.00 43.51  ? 419  ALA B C   1 
ATOM   7442 O O   . ALA B 1 419 ? 13.467  26.155  -31.798 1.00 49.31  ? 419  ALA B O   1 
ATOM   7443 C CB  . ALA B 1 419 ? 11.879  23.554  -30.525 1.00 34.47  ? 419  ALA B CB  1 
ATOM   7444 N N   . ALA B 1 420 ? 14.830  24.542  -31.017 1.00 40.61  ? 420  ALA B N   1 
ATOM   7445 C CA  . ALA B 1 420 ? 15.898  25.482  -30.697 1.00 42.99  ? 420  ALA B CA  1 
ATOM   7446 C C   . ALA B 1 420 ? 16.453  26.158  -31.950 1.00 42.25  ? 420  ALA B C   1 
ATOM   7447 O O   . ALA B 1 420 ? 17.028  27.233  -31.875 1.00 43.83  ? 420  ALA B O   1 
ATOM   7448 C CB  . ALA B 1 420 ? 17.027  24.783  -29.915 1.00 39.16  ? 420  ALA B CB  1 
ATOM   7449 N N   . GLN B 1 421 ? 16.277  25.533  -33.105 1.00 43.02  ? 421  GLN B N   1 
ATOM   7450 C CA  . GLN B 1 421 ? 16.886  26.058  -34.315 1.00 44.31  ? 421  GLN B CA  1 
ATOM   7451 C C   . GLN B 1 421 ? 15.892  26.606  -35.345 1.00 49.31  ? 421  GLN B C   1 
ATOM   7452 O O   . GLN B 1 421 ? 16.163  26.619  -36.551 1.00 46.03  ? 421  GLN B O   1 
ATOM   7453 C CB  . GLN B 1 421 ? 17.856  25.034  -34.900 1.00 47.72  ? 421  GLN B CB  1 
ATOM   7454 C CG  . GLN B 1 421 ? 19.218  25.123  -34.209 1.00 65.15  ? 421  GLN B CG  1 
ATOM   7455 C CD  . GLN B 1 421 ? 19.852  23.778  -33.952 1.00 74.71  ? 421  GLN B CD  1 
ATOM   7456 O OE1 . GLN B 1 421 ? 19.960  23.334  -32.804 1.00 75.66  ? 421  GLN B OE1 1 
ATOM   7457 N NE2 . GLN B 1 421 ? 20.289  23.121  -35.018 1.00 79.19  ? 421  GLN B NE2 1 
ATOM   7458 N N   . GLY B 1 422 ? 14.750  27.079  -34.848 1.00 49.79  ? 422  GLY B N   1 
ATOM   7459 C CA  . GLY B 1 422 ? 13.844  27.891  -35.637 1.00 40.71  ? 422  GLY B CA  1 
ATOM   7460 C C   . GLY B 1 422 ? 12.599  27.188  -36.130 1.00 45.24  ? 422  GLY B C   1 
ATOM   7461 O O   . GLY B 1 422 ? 11.686  27.828  -36.642 1.00 49.25  ? 422  GLY B O   1 
ATOM   7462 N N   . ALA B 1 423 ? 12.559  25.868  -35.983 1.00 36.14  ? 423  ALA B N   1 
ATOM   7463 C CA  . ALA B 1 423 ? 11.411  25.100  -36.429 1.00 38.42  ? 423  ALA B CA  1 
ATOM   7464 C C   . ALA B 1 423 ? 10.191  25.313  -35.544 1.00 43.57  ? 423  ALA B C   1 
ATOM   7465 O O   . ALA B 1 423 ? 10.295  25.413  -34.324 1.00 43.04  ? 423  ALA B O   1 
ATOM   7466 C CB  . ALA B 1 423 ? 11.751  23.621  -36.496 1.00 38.23  ? 423  ALA B CB  1 
ATOM   7467 N N   . ARG B 1 424 ? 9.032   25.378  -36.181 1.00 33.11  ? 424  ARG B N   1 
ATOM   7468 C CA  . ARG B 1 424 ? 7.764   25.303  -35.484 1.00 35.59  ? 424  ARG B CA  1 
ATOM   7469 C C   . ARG B 1 424 ? 7.428   23.842  -35.226 1.00 39.60  ? 424  ARG B C   1 
ATOM   7470 O O   . ARG B 1 424 ? 7.197   23.083  -36.169 1.00 29.22  ? 424  ARG B O   1 
ATOM   7471 C CB  . ARG B 1 424 ? 6.681   25.863  -36.371 1.00 39.91  ? 424  ARG B CB  1 
ATOM   7472 C CG  . ARG B 1 424 ? 5.486   26.299  -35.635 1.00 48.20  ? 424  ARG B CG  1 
ATOM   7473 C CD  . ARG B 1 424 ? 5.556   27.790  -35.476 1.00 59.22  ? 424  ARG B CD  1 
ATOM   7474 N NE  . ARG B 1 424 ? 4.211   28.286  -35.304 1.00 64.04  ? 424  ARG B NE  1 
ATOM   7475 C CZ  . ARG B 1 424 ? 3.711   28.633  -34.137 1.00 61.68  ? 424  ARG B CZ  1 
ATOM   7476 N NH1 . ARG B 1 424 ? 4.474   28.569  -33.056 1.00 68.26  ? 424  ARG B NH1 1 
ATOM   7477 N NH2 . ARG B 1 424 ? 2.462   29.052  -34.066 1.00 58.55  ? 424  ARG B NH2 1 
ATOM   7478 N N   . VAL B 1 425 ? 7.367   23.460  -33.955 1.00 29.85  ? 425  VAL B N   1 
ATOM   7479 C CA  . VAL B 1 425 ? 7.229   22.059  -33.578 1.00 34.13  ? 425  VAL B CA  1 
ATOM   7480 C C   . VAL B 1 425 ? 5.991   21.826  -32.720 1.00 31.79  ? 425  VAL B C   1 
ATOM   7481 O O   . VAL B 1 425 ? 5.715   22.597  -31.802 1.00 31.12  ? 425  VAL B O   1 
ATOM   7482 C CB  . VAL B 1 425 ? 8.473   21.597  -32.789 1.00 33.36  ? 425  VAL B CB  1 
ATOM   7483 C CG1 . VAL B 1 425 ? 8.402   20.118  -32.457 1.00 26.41  ? 425  VAL B CG1 1 
ATOM   7484 C CG2 . VAL B 1 425 ? 9.734   21.929  -33.566 1.00 28.79  ? 425  VAL B CG2 1 
ATOM   7485 N N   . TYR B 1 426 ? 5.261   20.756  -33.028 1.00 28.92  ? 426  TYR B N   1 
ATOM   7486 C CA  . TYR B 1 426 ? 4.122   20.301  -32.236 1.00 26.30  ? 426  TYR B CA  1 
ATOM   7487 C C   . TYR B 1 426 ? 4.312   18.840  -31.910 1.00 30.50  ? 426  TYR B C   1 
ATOM   7488 O O   . TYR B 1 426 ? 4.577   18.025  -32.808 1.00 31.35  ? 426  TYR B O   1 
ATOM   7489 C CB  . TYR B 1 426 ? 2.811   20.440  -33.016 1.00 28.01  ? 426  TYR B CB  1 
ATOM   7490 C CG  . TYR B 1 426 ? 2.411   21.854  -33.298 1.00 29.66  ? 426  TYR B CG  1 
ATOM   7491 C CD1 . TYR B 1 426 ? 1.620   22.564  -32.397 1.00 29.40  ? 426  TYR B CD1 1 
ATOM   7492 C CD2 . TYR B 1 426 ? 2.831   22.493  -34.458 1.00 28.93  ? 426  TYR B CD2 1 
ATOM   7493 C CE1 . TYR B 1 426 ? 1.250   23.871  -32.657 1.00 44.03  ? 426  TYR B CE1 1 
ATOM   7494 C CE2 . TYR B 1 426 ? 2.470   23.802  -34.721 1.00 32.44  ? 426  TYR B CE2 1 
ATOM   7495 C CZ  . TYR B 1 426 ? 1.675   24.482  -33.824 1.00 31.47  ? 426  TYR B CZ  1 
ATOM   7496 O OH  . TYR B 1 426 ? 1.313   25.774  -34.080 1.00 37.80  ? 426  TYR B OH  1 
ATOM   7497 N N   . ALA B 1 427 ? 4.144   18.496  -30.638 1.00 28.83  ? 427  ALA B N   1 
ATOM   7498 C CA  . ALA B 1 427 ? 4.417   17.140  -30.191 1.00 24.21  ? 427  ALA B CA  1 
ATOM   7499 C C   . ALA B 1 427 ? 3.216   16.516  -29.514 1.00 31.30  ? 427  ALA B C   1 
ATOM   7500 O O   . ALA B 1 427 ? 2.417   17.211  -28.886 1.00 27.50  ? 427  ALA B O   1 
ATOM   7501 C CB  . ALA B 1 427 ? 5.620   17.125  -29.258 1.00 24.44  ? 427  ALA B CB  1 
ATOM   7502 N N   . TYR B 1 428 ? 3.103   15.196  -29.633 1.00 23.56  ? 428  TYR B N   1 
ATOM   7503 C CA  . TYR B 1 428 ? 2.005   14.471  -29.010 1.00 23.93  ? 428  TYR B CA  1 
ATOM   7504 C C   . TYR B 1 428 ? 2.457   13.138  -28.421 1.00 32.84  ? 428  TYR B C   1 
ATOM   7505 O O   . TYR B 1 428 ? 3.541   12.635  -28.727 1.00 23.90  ? 428  TYR B O   1 
ATOM   7506 C CB  . TYR B 1 428 ? 0.891   14.173  -30.036 1.00 26.84  ? 428  TYR B CB  1 
ATOM   7507 C CG  . TYR B 1 428 ? 1.298   13.168  -31.101 1.00 23.18  ? 428  TYR B CG  1 
ATOM   7508 C CD1 . TYR B 1 428 ? 1.225   11.789  -30.874 1.00 28.13  ? 428  TYR B CD1 1 
ATOM   7509 C CD2 . TYR B 1 428 ? 1.752   13.596  -32.336 1.00 25.65  ? 428  TYR B CD2 1 
ATOM   7510 C CE1 . TYR B 1 428 ? 1.611   10.873  -31.860 1.00 26.82  ? 428  TYR B CE1 1 
ATOM   7511 C CE2 . TYR B 1 428 ? 2.132   12.694  -33.319 1.00 22.37  ? 428  TYR B CE2 1 
ATOM   7512 C CZ  . TYR B 1 428 ? 2.070   11.343  -33.078 1.00 24.87  ? 428  TYR B CZ  1 
ATOM   7513 O OH  . TYR B 1 428 ? 2.468   10.477  -34.069 1.00 27.87  ? 428  TYR B OH  1 
ATOM   7514 N N   . ILE B 1 429 ? 1.585   12.561  -27.601 1.00 33.47  ? 429  ILE B N   1 
ATOM   7515 C CA  . ILE B 1 429 ? 1.653   11.156  -27.248 1.00 31.22  ? 429  ILE B CA  1 
ATOM   7516 C C   . ILE B 1 429 ? 0.252   10.552  -27.392 1.00 28.67  ? 429  ILE B C   1 
ATOM   7517 O O   . ILE B 1 429 ? -0.737  11.114  -26.938 1.00 36.62  ? 429  ILE B O   1 
ATOM   7518 C CB  . ILE B 1 429 ? 2.198   10.937  -25.830 1.00 35.67  ? 429  ILE B CB  1 
ATOM   7519 C CG1 . ILE B 1 429 ? 2.273   9.439   -25.528 1.00 37.50  ? 429  ILE B CG1 1 
ATOM   7520 C CG2 . ILE B 1 429 ? 1.333   11.664  -24.795 1.00 38.55  ? 429  ILE B CG2 1 
ATOM   7521 C CD1 . ILE B 1 429 ? 3.008   9.132   -24.223 1.00 44.28  ? 429  ILE B CD1 1 
ATOM   7522 N N   . PHE B 1 430 ? 0.186   9.409   -28.055 1.00 27.02  ? 430  PHE B N   1 
ATOM   7523 C CA  . PHE B 1 430 ? -1.064  8.799   -28.440 1.00 25.35  ? 430  PHE B CA  1 
ATOM   7524 C C   . PHE B 1 430 ? -1.360  7.652   -27.466 1.00 34.30  ? 430  PHE B C   1 
ATOM   7525 O O   . PHE B 1 430 ? -0.572  6.707   -27.363 1.00 34.04  ? 430  PHE B O   1 
ATOM   7526 C CB  . PHE B 1 430 ? -0.913  8.282   -29.875 1.00 24.64  ? 430  PHE B CB  1 
ATOM   7527 C CG  . PHE B 1 430 ? -2.152  7.652   -30.431 1.00 31.01  ? 430  PHE B CG  1 
ATOM   7528 C CD1 . PHE B 1 430 ? -2.413  6.300   -30.225 1.00 34.10  ? 430  PHE B CD1 1 
ATOM   7529 C CD2 . PHE B 1 430 ? -3.046  8.403   -31.187 1.00 29.23  ? 430  PHE B CD2 1 
ATOM   7530 C CE1 . PHE B 1 430 ? -3.572  5.702   -30.749 1.00 38.21  ? 430  PHE B CE1 1 
ATOM   7531 C CE2 . PHE B 1 430 ? -4.201  7.820   -31.713 1.00 33.69  ? 430  PHE B CE2 1 
ATOM   7532 C CZ  . PHE B 1 430 ? -4.462  6.464   -31.494 1.00 34.57  ? 430  PHE B CZ  1 
ATOM   7533 N N   . GLU B 1 431 ? -2.496  7.727   -26.771 1.00 31.90  ? 431  GLU B N   1 
ATOM   7534 C CA  . GLU B 1 431 ? -2.744  6.853   -25.625 1.00 36.64  ? 431  GLU B CA  1 
ATOM   7535 C C   . GLU B 1 431 ? -4.006  6.029   -25.734 1.00 42.32  ? 431  GLU B C   1 
ATOM   7536 O O   . GLU B 1 431 ? -4.403  5.378   -24.776 1.00 51.39  ? 431  GLU B O   1 
ATOM   7537 C CB  . GLU B 1 431 ? -2.817  7.665   -24.326 1.00 36.53  ? 431  GLU B CB  1 
ATOM   7538 C CG  . GLU B 1 431 ? -1.532  8.368   -23.951 1.00 39.15  ? 431  GLU B CG  1 
ATOM   7539 C CD  . GLU B 1 431 ? -1.629  9.097   -22.629 1.00 41.71  ? 431  GLU B CD  1 
ATOM   7540 O OE1 . GLU B 1 431 ? -2.659  9.759   -22.383 1.00 48.38  ? 431  GLU B OE1 1 
ATOM   7541 O OE2 . GLU B 1 431 ? -0.677  8.999   -21.828 1.00 47.32  ? 431  GLU B OE2 1 
ATOM   7542 N N   . HIS B 1 432 ? -4.666  6.062   -26.878 1.00 43.01  ? 432  HIS B N   1 
ATOM   7543 C CA  . HIS B 1 432 ? -5.855  5.240   -27.012 1.00 41.14  ? 432  HIS B CA  1 
ATOM   7544 C C   . HIS B 1 432 ? -5.543  3.857   -27.581 1.00 40.94  ? 432  HIS B C   1 
ATOM   7545 O O   . HIS B 1 432 ? -4.928  3.736   -28.639 1.00 40.60  ? 432  HIS B O   1 
ATOM   7546 C CB  . HIS B 1 432 ? -6.899  5.906   -27.886 1.00 39.32  ? 432  HIS B CB  1 
ATOM   7547 C CG  . HIS B 1 432 ? -8.079  5.029   -28.145 1.00 44.07  ? 432  HIS B CG  1 
ATOM   7548 N ND1 . HIS B 1 432 ? -9.016  4.743   -27.173 1.00 49.20  ? 432  HIS B ND1 1 
ATOM   7549 C CD2 . HIS B 1 432 ? -8.454  4.336   -29.246 1.00 40.78  ? 432  HIS B CD2 1 
ATOM   7550 C CE1 . HIS B 1 432 ? -9.933  3.933   -27.675 1.00 45.60  ? 432  HIS B CE1 1 
ATOM   7551 N NE2 . HIS B 1 432 ? -9.616  3.672   -28.931 1.00 44.61  ? 432  HIS B NE2 1 
ATOM   7552 N N   . ARG B 1 433 ? -5.982  2.819   -26.876 1.00 40.21  ? 433  ARG B N   1 
ATOM   7553 C CA  . ARG B 1 433 ? -5.841  1.448   -27.352 1.00 42.21  ? 433  ARG B CA  1 
ATOM   7554 C C   . ARG B 1 433 ? -7.112  1.032   -28.093 1.00 47.16  ? 433  ARG B C   1 
ATOM   7555 O O   . ARG B 1 433 ? -8.208  1.082   -27.536 1.00 38.83  ? 433  ARG B O   1 
ATOM   7556 C CB  . ARG B 1 433 ? -5.582  0.501   -26.179 1.00 44.76  ? 433  ARG B CB  1 
ATOM   7557 C CG  . ARG B 1 433 ? -5.518  -0.965  -26.567 1.00 51.27  ? 433  ARG B CG  1 
ATOM   7558 C CD  . ARG B 1 433 ? -5.257  -1.855  -25.359 1.00 53.34  ? 433  ARG B CD  1 
ATOM   7559 N NE  . ARG B 1 433 ? -5.644  -3.247  -25.603 1.00 52.87  ? 433  ARG B NE  1 
ATOM   7560 C CZ  . ARG B 1 433 ? -4.791  -4.230  -25.872 1.00 49.09  ? 433  ARG B CZ  1 
ATOM   7561 N NH1 . ARG B 1 433 ? -3.487  -3.980  -25.925 1.00 41.99  ? 433  ARG B NH1 1 
ATOM   7562 N NH2 . ARG B 1 433 ? -5.243  -5.464  -26.082 1.00 48.08  ? 433  ARG B NH2 1 
ATOM   7563 N N   . ALA B 1 434 ? -6.953  0.639   -29.353 1.00 45.06  ? 434  ALA B N   1 
ATOM   7564 C CA  . ALA B 1 434 ? -8.077  0.235   -30.191 1.00 44.90  ? 434  ALA B CA  1 
ATOM   7565 C C   . ALA B 1 434 ? -8.866  -0.892  -29.536 1.00 47.28  ? 434  ALA B C   1 
ATOM   7566 O O   . ALA B 1 434 ? -8.288  -1.845  -29.022 1.00 46.27  ? 434  ALA B O   1 
ATOM   7567 C CB  . ALA B 1 434 ? -7.581  -0.199  -31.570 1.00 37.27  ? 434  ALA B CB  1 
ATOM   7568 N N   . SER B 1 435 ? -10.187 -0.768  -29.546 1.00 42.97  ? 435  SER B N   1 
ATOM   7569 C CA  . SER B 1 435 ? -11.045 -1.810  -29.012 1.00 46.13  ? 435  SER B CA  1 
ATOM   7570 C C   . SER B 1 435 ? -10.897 -3.113  -29.803 1.00 56.43  ? 435  SER B C   1 
ATOM   7571 O O   . SER B 1 435 ? -11.117 -4.200  -29.270 1.00 62.28  ? 435  SER B O   1 
ATOM   7572 C CB  . SER B 1 435 ? -12.504 -1.345  -29.016 1.00 48.32  ? 435  SER B CB  1 
ATOM   7573 O OG  . SER B 1 435 ? -12.941 -1.010  -30.322 1.00 49.34  ? 435  SER B OG  1 
ATOM   7574 N N   . THR B 1 436 ? -10.513 -2.990  -31.073 1.00 53.73  ? 436  THR B N   1 
ATOM   7575 C CA  . THR B 1 436 ? -10.379 -4.134  -31.977 1.00 53.82  ? 436  THR B CA  1 
ATOM   7576 C C   . THR B 1 436 ? -8.989  -4.784  -31.963 1.00 54.62  ? 436  THR B C   1 
ATOM   7577 O O   . THR B 1 436 ? -8.748  -5.752  -32.685 1.00 59.06  ? 436  THR B O   1 
ATOM   7578 C CB  . THR B 1 436 ? -10.710 -3.734  -33.433 1.00 53.53  ? 436  THR B CB  1 
ATOM   7579 O OG1 . THR B 1 436 ? -9.899  -2.611  -33.822 1.00 50.90  ? 436  THR B OG1 1 
ATOM   7580 C CG2 . THR B 1 436 ? -12.193 -3.377  -33.574 1.00 48.66  ? 436  THR B CG2 1 
ATOM   7581 N N   . LEU B 1 437 ? -8.084  -4.257  -31.142 1.00 52.77  ? 437  LEU B N   1 
ATOM   7582 C CA  . LEU B 1 437 ? -6.704  -4.739  -31.095 1.00 52.43  ? 437  LEU B CA  1 
ATOM   7583 C C   . LEU B 1 437 ? -6.615  -6.202  -30.674 1.00 55.49  ? 437  LEU B C   1 
ATOM   7584 O O   . LEU B 1 437 ? -7.272  -6.624  -29.722 1.00 57.54  ? 437  LEU B O   1 
ATOM   7585 C CB  . LEU B 1 437 ? -5.885  -3.888  -30.133 1.00 54.33  ? 437  LEU B CB  1 
ATOM   7586 C CG  . LEU B 1 437 ? -4.410  -3.735  -30.480 1.00 59.48  ? 437  LEU B CG  1 
ATOM   7587 C CD1 . LEU B 1 437 ? -4.182  -2.365  -31.091 1.00 58.81  ? 437  LEU B CD1 1 
ATOM   7588 C CD2 . LEU B 1 437 ? -3.548  -3.928  -29.241 1.00 62.68  ? 437  LEU B CD2 1 
ATOM   7589 N N   . THR B 1 438 ? -5.787  -6.967  -31.378 1.00 57.23  ? 438  THR B N   1 
ATOM   7590 C CA  . THR B 1 438 ? -5.682  -8.406  -31.135 1.00 63.90  ? 438  THR B CA  1 
ATOM   7591 C C   . THR B 1 438 ? -4.531  -8.804  -30.201 1.00 65.82  ? 438  THR B C   1 
ATOM   7592 O O   . THR B 1 438 ? -4.505  -9.927  -29.698 1.00 71.66  ? 438  THR B O   1 
ATOM   7593 C CB  . THR B 1 438 ? -5.575  -9.192  -32.461 1.00 66.81  ? 438  THR B CB  1 
ATOM   7594 O OG1 . THR B 1 438 ? -4.501  -8.661  -33.254 1.00 65.02  ? 438  THR B OG1 1 
ATOM   7595 C CG2 . THR B 1 438 ? -6.877  -9.085  -33.244 1.00 62.56  ? 438  THR B CG2 1 
ATOM   7596 N N   . TRP B 1 439 ? -3.584  -7.891  -29.980 1.00 61.46  ? 439  TRP B N   1 
ATOM   7597 C CA  . TRP B 1 439 ? -2.493  -8.113  -29.023 1.00 55.98  ? 439  TRP B CA  1 
ATOM   7598 C C   . TRP B 1 439 ? -3.032  -8.063  -27.592 1.00 54.53  ? 439  TRP B C   1 
ATOM   7599 O O   . TRP B 1 439 ? -4.025  -7.376  -27.338 1.00 53.92  ? 439  TRP B O   1 
ATOM   7600 C CB  . TRP B 1 439 ? -1.384  -7.061  -29.197 1.00 51.19  ? 439  TRP B CB  1 
ATOM   7601 C CG  . TRP B 1 439 ? -0.737  -7.071  -30.536 1.00 49.85  ? 439  TRP B CG  1 
ATOM   7602 C CD1 . TRP B 1 439 ? -1.016  -6.239  -31.583 1.00 51.41  ? 439  TRP B CD1 1 
ATOM   7603 C CD2 . TRP B 1 439 ? 0.294   -7.960  -30.992 1.00 51.76  ? 439  TRP B CD2 1 
ATOM   7604 N NE1 . TRP B 1 439 ? -0.227  -6.560  -32.662 1.00 52.77  ? 439  TRP B NE1 1 
ATOM   7605 C CE2 . TRP B 1 439 ? 0.587   -7.609  -32.325 1.00 51.62  ? 439  TRP B CE2 1 
ATOM   7606 C CE3 . TRP B 1 439 ? 0.997   -9.016  -30.403 1.00 59.54  ? 439  TRP B CE3 1 
ATOM   7607 C CZ2 . TRP B 1 439 ? 1.553   -8.277  -33.080 1.00 56.81  ? 439  TRP B CZ2 1 
ATOM   7608 C CZ3 . TRP B 1 439 ? 1.962   -9.673  -31.151 1.00 62.11  ? 439  TRP B CZ3 1 
ATOM   7609 C CH2 . TRP B 1 439 ? 2.232   -9.300  -32.476 1.00 62.30  ? 439  TRP B CH2 1 
ATOM   7610 N N   . PRO B 1 440 ? -2.375  -8.776  -26.650 1.00 54.13  ? 440  PRO B N   1 
ATOM   7611 C CA  . PRO B 1 440 ? -2.835  -8.806  -25.251 1.00 53.62  ? 440  PRO B CA  1 
ATOM   7612 C C   . PRO B 1 440 ? -2.730  -7.455  -24.545 1.00 52.38  ? 440  PRO B C   1 
ATOM   7613 O O   . PRO B 1 440 ? -2.040  -6.545  -25.023 1.00 48.52  ? 440  PRO B O   1 
ATOM   7614 C CB  . PRO B 1 440 ? -1.890  -9.816  -24.592 1.00 53.47  ? 440  PRO B CB  1 
ATOM   7615 C CG  . PRO B 1 440 ? -0.664  -9.781  -25.424 1.00 53.78  ? 440  PRO B CG  1 
ATOM   7616 C CD  . PRO B 1 440 ? -1.146  -9.570  -26.836 1.00 51.59  ? 440  PRO B CD  1 
ATOM   7617 N N   . LEU B 1 441 ? -3.403  -7.343  -23.405 1.00 53.88  ? 441  LEU B N   1 
ATOM   7618 C CA  . LEU B 1 441 ? -3.459  -6.089  -22.660 1.00 53.36  ? 441  LEU B CA  1 
ATOM   7619 C C   . LEU B 1 441 ? -2.099  -5.530  -22.269 1.00 50.33  ? 441  LEU B C   1 
ATOM   7620 O O   . LEU B 1 441 ? -1.894  -4.316  -22.277 1.00 52.67  ? 441  LEU B O   1 
ATOM   7621 C CB  . LEU B 1 441 ? -4.307  -6.241  -21.393 1.00 58.19  ? 441  LEU B CB  1 
ATOM   7622 C CG  . LEU B 1 441 ? -5.815  -6.052  -21.535 1.00 67.22  ? 441  LEU B CG  1 
ATOM   7623 C CD1 . LEU B 1 441 ? -6.108  -5.049  -22.648 1.00 65.95  ? 441  LEU B CD1 1 
ATOM   7624 C CD2 . LEU B 1 441 ? -6.527  -7.387  -21.767 1.00 70.88  ? 441  LEU B CD2 1 
ATOM   7625 N N   . TRP B 1 442 ? -1.169  -6.404  -21.913 1.00 48.75  ? 442  TRP B N   1 
ATOM   7626 C CA  . TRP B 1 442 ? 0.064   -5.928  -21.294 1.00 50.56  ? 442  TRP B CA  1 
ATOM   7627 C C   . TRP B 1 442 ? 0.906   -5.114  -22.270 1.00 47.71  ? 442  TRP B C   1 
ATOM   7628 O O   . TRP B 1 442 ? 1.802   -4.372  -21.864 1.00 49.81  ? 442  TRP B O   1 
ATOM   7629 C CB  . TRP B 1 442 ? 0.871   -7.082  -20.678 1.00 49.18  ? 442  TRP B CB  1 
ATOM   7630 C CG  . TRP B 1 442 ? 1.499   -7.997  -21.675 1.00 53.87  ? 442  TRP B CG  1 
ATOM   7631 C CD1 . TRP B 1 442 ? 1.030   -9.215  -22.079 1.00 59.44  ? 442  TRP B CD1 1 
ATOM   7632 C CD2 . TRP B 1 442 ? 2.719   -7.774  -22.399 1.00 53.28  ? 442  TRP B CD2 1 
ATOM   7633 N NE1 . TRP B 1 442 ? 1.883   -9.762  -23.009 1.00 60.64  ? 442  TRP B NE1 1 
ATOM   7634 C CE2 . TRP B 1 442 ? 2.926   -8.897  -23.223 1.00 53.02  ? 442  TRP B CE2 1 
ATOM   7635 C CE3 . TRP B 1 442 ? 3.662   -6.737  -22.424 1.00 47.88  ? 442  TRP B CE3 1 
ATOM   7636 C CZ2 . TRP B 1 442 ? 4.030   -9.010  -24.064 1.00 47.59  ? 442  TRP B CZ2 1 
ATOM   7637 C CZ3 . TRP B 1 442 ? 4.751   -6.848  -23.264 1.00 43.35  ? 442  TRP B CZ3 1 
ATOM   7638 C CH2 . TRP B 1 442 ? 4.926   -7.977  -24.077 1.00 40.82  ? 442  TRP B CH2 1 
ATOM   7639 N N   . MET B 1 443 ? 0.611   -5.255  -23.558 1.00 45.02  ? 443  MET B N   1 
ATOM   7640 C CA  . MET B 1 443 ? 1.351   -4.534  -24.584 1.00 44.54  ? 443  MET B CA  1 
ATOM   7641 C C   . MET B 1 443 ? 0.868   -3.093  -24.722 1.00 43.63  ? 443  MET B C   1 
ATOM   7642 O O   . MET B 1 443 ? 1.532   -2.271  -25.362 1.00 37.53  ? 443  MET B O   1 
ATOM   7643 C CB  . MET B 1 443 ? 1.274   -5.270  -25.920 1.00 43.62  ? 443  MET B CB  1 
ATOM   7644 C CG  . MET B 1 443 ? 1.961   -6.617  -25.883 1.00 48.54  ? 443  MET B CG  1 
ATOM   7645 S SD  . MET B 1 443 ? 1.824   -7.487  -27.450 1.00 54.11  ? 443  MET B SD  1 
ATOM   7646 C CE  . MET B 1 443 ? 3.332   -7.015  -28.253 1.00 43.61  ? 443  MET B CE  1 
ATOM   7647 N N   . GLY B 1 444 ? -0.284  -2.798  -24.114 1.00 41.38  ? 444  GLY B N   1 
ATOM   7648 C CA  . GLY B 1 444 ? -0.838  -1.453  -24.105 1.00 39.05  ? 444  GLY B CA  1 
ATOM   7649 C C   . GLY B 1 444 ? -1.199  -0.922  -25.484 1.00 41.13  ? 444  GLY B C   1 
ATOM   7650 O O   . GLY B 1 444 ? -1.975  -1.537  -26.215 1.00 36.40  ? 444  GLY B O   1 
ATOM   7651 N N   . VAL B 1 445 ? -0.648  0.239   -25.829 1.00 38.52  ? 445  VAL B N   1 
ATOM   7652 C CA  . VAL B 1 445 ? -0.816  0.819   -27.158 1.00 34.63  ? 445  VAL B CA  1 
ATOM   7653 C C   . VAL B 1 445 ? 0.494   0.672   -27.907 1.00 34.60  ? 445  VAL B C   1 
ATOM   7654 O O   . VAL B 1 445 ? 1.400   1.482   -27.739 1.00 33.79  ? 445  VAL B O   1 
ATOM   7655 C CB  . VAL B 1 445 ? -1.140  2.313   -27.067 1.00 33.83  ? 445  VAL B CB  1 
ATOM   7656 C CG1 . VAL B 1 445 ? -1.455  2.871   -28.449 1.00 28.43  ? 445  VAL B CG1 1 
ATOM   7657 C CG2 . VAL B 1 445 ? -2.283  2.550   -26.090 1.00 32.06  ? 445  VAL B CG2 1 
ATOM   7658 N N   . PRO B 1 446 ? 0.614   -0.374  -28.726 1.00 35.36  ? 446  PRO B N   1 
ATOM   7659 C CA  . PRO B 1 446 ? 1.922   -0.679  -29.321 1.00 35.13  ? 446  PRO B CA  1 
ATOM   7660 C C   . PRO B 1 446 ? 2.282   0.184   -30.527 1.00 33.46  ? 446  PRO B C   1 
ATOM   7661 O O   . PRO B 1 446 ? 1.420   0.810   -31.137 1.00 32.07  ? 446  PRO B O   1 
ATOM   7662 C CB  . PRO B 1 446 ? 1.778   -2.141  -29.767 1.00 30.79  ? 446  PRO B CB  1 
ATOM   7663 C CG  . PRO B 1 446 ? 0.488   -2.636  -29.132 1.00 35.56  ? 446  PRO B CG  1 
ATOM   7664 C CD  . PRO B 1 446 ? -0.372  -1.430  -28.990 1.00 36.91  ? 446  PRO B CD  1 
ATOM   7665 N N   . HIS B 1 447 ? 3.575   0.207   -30.831 1.00 36.82  ? 447  HIS B N   1 
ATOM   7666 C CA  . HIS B 1 447 ? 4.137   0.753   -32.060 1.00 32.58  ? 447  HIS B CA  1 
ATOM   7667 C C   . HIS B 1 447 ? 3.255   0.451   -33.274 1.00 37.92  ? 447  HIS B C   1 
ATOM   7668 O O   . HIS B 1 447 ? 2.998   -0.711  -33.595 1.00 42.78  ? 447  HIS B O   1 
ATOM   7669 C CB  . HIS B 1 447 ? 5.502   0.103   -32.252 1.00 36.33  ? 447  HIS B CB  1 
ATOM   7670 C CG  . HIS B 1 447 ? 6.339   0.728   -33.320 1.00 45.78  ? 447  HIS B CG  1 
ATOM   7671 N ND1 . HIS B 1 447 ? 6.901   1.981   -33.192 1.00 42.76  ? 447  HIS B ND1 1 
ATOM   7672 C CD2 . HIS B 1 447 ? 6.737   0.258   -34.526 1.00 49.20  ? 447  HIS B CD2 1 
ATOM   7673 C CE1 . HIS B 1 447 ? 7.604   2.259   -34.276 1.00 44.39  ? 447  HIS B CE1 1 
ATOM   7674 N NE2 . HIS B 1 447 ? 7.523   1.228   -35.100 1.00 50.23  ? 447  HIS B NE2 1 
ATOM   7675 N N   . GLY B 1 448 ? 2.777   1.496   -33.939 1.00 35.13  ? 448  GLY B N   1 
ATOM   7676 C CA  . GLY B 1 448 ? 2.036   1.313   -35.177 1.00 31.87  ? 448  GLY B CA  1 
ATOM   7677 C C   . GLY B 1 448 ? 0.523   1.440   -35.085 1.00 34.69  ? 448  GLY B C   1 
ATOM   7678 O O   . GLY B 1 448 ? -0.156  1.564   -36.111 1.00 31.64  ? 448  GLY B O   1 
ATOM   7679 N N   . TYR B 1 449 ? -0.023  1.432   -33.870 1.00 32.09  ? 449  TYR B N   1 
ATOM   7680 C CA  . TYR B 1 449 ? -1.479  1.369   -33.734 1.00 33.12  ? 449  TYR B CA  1 
ATOM   7681 C C   . TYR B 1 449 ? -2.221  2.703   -33.568 1.00 34.39  ? 449  TYR B C   1 
ATOM   7682 O O   . TYR B 1 449 ? -3.395  2.735   -33.206 1.00 34.94  ? 449  TYR B O   1 
ATOM   7683 C CB  . TYR B 1 449 ? -1.884  0.293   -32.719 1.00 38.16  ? 449  TYR B CB  1 
ATOM   7684 C CG  . TYR B 1 449 ? -1.566  -1.069  -33.274 1.00 35.34  ? 449  TYR B CG  1 
ATOM   7685 C CD1 . TYR B 1 449 ? -2.484  -1.738  -34.077 1.00 37.73  ? 449  TYR B CD1 1 
ATOM   7686 C CD2 . TYR B 1 449 ? -0.325  -1.645  -33.079 1.00 31.01  ? 449  TYR B CD2 1 
ATOM   7687 C CE1 . TYR B 1 449 ? -2.200  -2.980  -34.617 1.00 36.21  ? 449  TYR B CE1 1 
ATOM   7688 C CE2 . TYR B 1 449 ? -0.018  -2.887  -33.627 1.00 32.48  ? 449  TYR B CE2 1 
ATOM   7689 C CZ  . TYR B 1 449 ? -0.959  -3.550  -34.390 1.00 37.79  ? 449  TYR B CZ  1 
ATOM   7690 O OH  . TYR B 1 449 ? -0.662  -4.778  -34.944 1.00 39.76  ? 449  TYR B OH  1 
ATOM   7691 N N   . GLU B 1 450 ? -1.538  3.797   -33.890 1.00 32.24  ? 450  GLU B N   1 
ATOM   7692 C CA  . GLU B 1 450 ? -2.207  5.077   -34.061 1.00 33.26  ? 450  GLU B CA  1 
ATOM   7693 C C   . GLU B 1 450 ? -2.618  5.278   -35.530 1.00 34.31  ? 450  GLU B C   1 
ATOM   7694 O O   . GLU B 1 450 ? -3.540  6.048   -35.835 1.00 30.20  ? 450  GLU B O   1 
ATOM   7695 C CB  . GLU B 1 450 ? -1.298  6.221   -33.607 1.00 30.22  ? 450  GLU B CB  1 
ATOM   7696 C CG  . GLU B 1 450 ? -0.304  6.712   -34.673 1.00 29.17  ? 450  GLU B CG  1 
ATOM   7697 C CD  . GLU B 1 450 ? 0.926   5.818   -34.852 1.00 35.27  ? 450  GLU B CD  1 
ATOM   7698 O OE1 . GLU B 1 450 ? 0.852   4.584   -34.597 1.00 33.63  ? 450  GLU B OE1 1 
ATOM   7699 O OE2 . GLU B 1 450 ? 1.978   6.370   -35.256 1.00 32.77  ? 450  GLU B OE2 1 
ATOM   7700 N N   . ILE B 1 451 ? -1.935  4.575   -36.432 1.00 26.06  ? 451  ILE B N   1 
ATOM   7701 C CA  . ILE B 1 451 ? -2.080  4.816   -37.867 1.00 28.93  ? 451  ILE B CA  1 
ATOM   7702 C C   . ILE B 1 451 ? -3.501  4.649   -38.390 1.00 33.75  ? 451  ILE B C   1 
ATOM   7703 O O   . ILE B 1 451 ? -4.010  5.505   -39.124 1.00 38.13  ? 451  ILE B O   1 
ATOM   7704 C CB  . ILE B 1 451 ? -1.141  3.939   -38.684 1.00 34.20  ? 451  ILE B CB  1 
ATOM   7705 C CG1 . ILE B 1 451 ? 0.319   4.214   -38.291 1.00 38.77  ? 451  ILE B CG1 1 
ATOM   7706 C CG2 . ILE B 1 451 ? -1.336  4.216   -40.163 1.00 26.81  ? 451  ILE B CG2 1 
ATOM   7707 C CD1 . ILE B 1 451 ? 1.302   3.220   -38.895 1.00 36.40  ? 451  ILE B CD1 1 
ATOM   7708 N N   . GLU B 1 452 ? -4.142  3.551   -38.010 1.00 31.54  ? 452  GLU B N   1 
ATOM   7709 C CA  . GLU B 1 452 ? -5.510  3.294   -38.437 1.00 33.45  ? 452  GLU B CA  1 
ATOM   7710 C C   . GLU B 1 452 ? -6.469  4.427   -38.043 1.00 31.34  ? 452  GLU B C   1 
ATOM   7711 O O   . GLU B 1 452 ? -7.454  4.666   -38.734 1.00 35.94  ? 452  GLU B O   1 
ATOM   7712 C CB  . GLU B 1 452 ? -5.993  1.961   -37.878 1.00 39.92  ? 452  GLU B CB  1 
ATOM   7713 C CG  . GLU B 1 452 ? -5.956  1.893   -36.365 1.00 43.07  ? 452  GLU B CG  1 
ATOM   7714 C CD  . GLU B 1 452 ? -5.988  0.472   -35.868 1.00 46.62  ? 452  GLU B CD  1 
ATOM   7715 O OE1 . GLU B 1 452 ? -4.969  -0.222  -36.028 1.00 44.24  ? 452  GLU B OE1 1 
ATOM   7716 O OE2 . GLU B 1 452 ? -7.029  0.042   -35.332 1.00 53.27  ? 452  GLU B OE2 1 
ATOM   7717 N N   . PHE B 1 453 ? -6.164  5.127   -36.950 1.00 29.71  ? 453  PHE B N   1 
ATOM   7718 C CA  . PHE B 1 453 ? -6.959  6.273   -36.516 1.00 29.95  ? 453  PHE B CA  1 
ATOM   7719 C C   . PHE B 1 453 ? -6.692  7.524   -37.328 1.00 33.10  ? 453  PHE B C   1 
ATOM   7720 O O   . PHE B 1 453 ? -7.634  8.183   -37.770 1.00 35.07  ? 453  PHE B O   1 
ATOM   7721 C CB  . PHE B 1 453 ? -6.773  6.545   -35.018 1.00 29.70  ? 453  PHE B CB  1 
ATOM   7722 C CG  . PHE B 1 453 ? -7.360  5.481   -34.162 1.00 36.92  ? 453  PHE B CG  1 
ATOM   7723 C CD1 . PHE B 1 453 ? -8.733  5.443   -33.931 1.00 40.13  ? 453  PHE B CD1 1 
ATOM   7724 C CD2 . PHE B 1 453 ? -6.566  4.475   -33.649 1.00 30.95  ? 453  PHE B CD2 1 
ATOM   7725 C CE1 . PHE B 1 453 ? -9.296  4.437   -33.168 1.00 40.06  ? 453  PHE B CE1 1 
ATOM   7726 C CE2 . PHE B 1 453 ? -7.122  3.463   -32.880 1.00 32.62  ? 453  PHE B CE2 1 
ATOM   7727 C CZ  . PHE B 1 453 ? -8.489  3.446   -32.639 1.00 39.10  ? 453  PHE B CZ  1 
ATOM   7728 N N   . ILE B 1 454 ? -5.415  7.843   -37.528 1.00 29.14  ? 454  ILE B N   1 
ATOM   7729 C CA  . ILE B 1 454 ? -5.022  8.961   -38.385 1.00 31.86  ? 454  ILE B CA  1 
ATOM   7730 C C   . ILE B 1 454 ? -5.599  8.819   -39.796 1.00 30.69  ? 454  ILE B C   1 
ATOM   7731 O O   . ILE B 1 454 ? -6.147  9.776   -40.341 1.00 30.49  ? 454  ILE B O   1 
ATOM   7732 C CB  . ILE B 1 454 ? -3.500  9.099   -38.495 1.00 35.77  ? 454  ILE B CB  1 
ATOM   7733 C CG1 . ILE B 1 454 ? -2.869  9.247   -37.106 1.00 35.45  ? 454  ILE B CG1 1 
ATOM   7734 C CG2 . ILE B 1 454 ? -3.142  10.278  -39.393 1.00 33.60  ? 454  ILE B CG2 1 
ATOM   7735 C CD1 . ILE B 1 454 ? -3.378  10.428  -36.346 1.00 39.47  ? 454  ILE B CD1 1 
ATOM   7736 N N   . PHE B 1 455 ? -5.509  7.624   -40.374 1.00 28.52  ? 455  PHE B N   1 
ATOM   7737 C CA  . PHE B 1 455 ? -6.067  7.403   -41.716 1.00 32.21  ? 455  PHE B CA  1 
ATOM   7738 C C   . PHE B 1 455 ? -7.588  7.312   -41.739 1.00 33.72  ? 455  PHE B C   1 
ATOM   7739 O O   . PHE B 1 455 ? -8.189  7.254   -42.809 1.00 32.06  ? 455  PHE B O   1 
ATOM   7740 C CB  . PHE B 1 455 ? -5.461  6.174   -42.392 1.00 32.90  ? 455  PHE B CB  1 
ATOM   7741 C CG  . PHE B 1 455 ? -4.148  6.446   -43.055 1.00 38.20  ? 455  PHE B CG  1 
ATOM   7742 C CD1 . PHE B 1 455 ? -2.992  6.606   -42.299 1.00 32.30  ? 455  PHE B CD1 1 
ATOM   7743 C CD2 . PHE B 1 455 ? -4.063  6.555   -44.432 1.00 39.76  ? 455  PHE B CD2 1 
ATOM   7744 C CE1 . PHE B 1 455 ? -1.781  6.863   -42.907 1.00 37.00  ? 455  PHE B CE1 1 
ATOM   7745 C CE2 . PHE B 1 455 ? -2.842  6.810   -45.049 1.00 33.58  ? 455  PHE B CE2 1 
ATOM   7746 C CZ  . PHE B 1 455 ? -1.701  6.961   -44.287 1.00 34.71  ? 455  PHE B CZ  1 
ATOM   7747 N N   . GLY B 1 456 ? -8.201  7.277   -40.560 1.00 32.14  ? 456  GLY B N   1 
ATOM   7748 C CA  . GLY B 1 456 ? -9.652  7.347   -40.468 1.00 36.69  ? 456  GLY B CA  1 
ATOM   7749 C C   . GLY B 1 456 ? -10.437 6.070   -40.682 1.00 36.07  ? 456  GLY B C   1 
ATOM   7750 O O   . GLY B 1 456 ? -11.640 6.119   -40.956 1.00 38.27  ? 456  GLY B O   1 
ATOM   7751 N N   . LEU B 1 457 ? -9.766  4.927   -40.547 1.00 37.96  ? 457  LEU B N   1 
ATOM   7752 C CA  . LEU B 1 457 ? -10.419 3.615   -40.678 1.00 40.78  ? 457  LEU B CA  1 
ATOM   7753 C C   . LEU B 1 457 ? -11.693 3.403   -39.829 1.00 44.36  ? 457  LEU B C   1 
ATOM   7754 O O   . LEU B 1 457 ? -12.631 2.774   -40.301 1.00 47.77  ? 457  LEU B O   1 
ATOM   7755 C CB  . LEU B 1 457 ? -9.415  2.473   -40.448 1.00 43.28  ? 457  LEU B CB  1 
ATOM   7756 C CG  . LEU B 1 457 ? -8.719  1.911   -41.699 1.00 46.11  ? 457  LEU B CG  1 
ATOM   7757 C CD1 . LEU B 1 457 ? -7.805  2.932   -42.358 1.00 34.71  ? 457  LEU B CD1 1 
ATOM   7758 C CD2 . LEU B 1 457 ? -7.938  0.659   -41.363 1.00 46.44  ? 457  LEU B CD2 1 
ATOM   7759 N N   . PRO B 1 458 ? -11.731 3.914   -38.578 1.00 38.56  ? 458  PRO B N   1 
ATOM   7760 C CA  . PRO B 1 458 ? -12.962 3.763   -37.797 1.00 40.83  ? 458  PRO B CA  1 
ATOM   7761 C C   . PRO B 1 458 ? -14.232 4.307   -38.463 1.00 50.49  ? 458  PRO B C   1 
ATOM   7762 O O   . PRO B 1 458 ? -15.329 3.882   -38.093 1.00 52.73  ? 458  PRO B O   1 
ATOM   7763 C CB  . PRO B 1 458 ? -12.651 4.545   -36.524 1.00 44.55  ? 458  PRO B CB  1 
ATOM   7764 C CG  . PRO B 1 458 ? -11.181 4.357   -36.351 1.00 38.51  ? 458  PRO B CG  1 
ATOM   7765 C CD  . PRO B 1 458 ? -10.616 4.398   -37.734 1.00 36.33  ? 458  PRO B CD  1 
ATOM   7766 N N   . LEU B 1 459 ? -14.097 5.204   -39.435 1.00 45.83  ? 459  LEU B N   1 
ATOM   7767 C CA  . LEU B 1 459 ? -15.271 5.737   -40.123 1.00 43.67  ? 459  LEU B CA  1 
ATOM   7768 C C   . LEU B 1 459 ? -15.960 4.698   -41.009 1.00 53.42  ? 459  LEU B C   1 
ATOM   7769 O O   . LEU B 1 459 ? -17.054 4.932   -41.522 1.00 57.04  ? 459  LEU B O   1 
ATOM   7770 C CB  . LEU B 1 459 ? -14.917 6.970   -40.949 1.00 52.50  ? 459  LEU B CB  1 
ATOM   7771 C CG  . LEU B 1 459 ? -14.912 8.302   -40.208 1.00 52.48  ? 459  LEU B CG  1 
ATOM   7772 C CD1 . LEU B 1 459 ? -13.643 8.464   -39.369 1.00 43.02  ? 459  LEU B CD1 1 
ATOM   7773 C CD2 . LEU B 1 459 ? -15.053 9.433   -41.202 1.00 54.22  ? 459  LEU B CD2 1 
ATOM   7774 N N   . ASP B 1 460 ? -15.311 3.556   -41.192 1.00 56.90  ? 460  ASP B N   1 
ATOM   7775 C CA  . ASP B 1 460 ? -15.902 2.443   -41.917 1.00 61.49  ? 460  ASP B CA  1 
ATOM   7776 C C   . ASP B 1 460 ? -16.667 1.588   -40.921 1.00 62.09  ? 460  ASP B C   1 
ATOM   7777 O O   . ASP B 1 460 ? -16.061 0.916   -40.083 1.00 57.34  ? 460  ASP B O   1 
ATOM   7778 C CB  . ASP B 1 460 ? -14.812 1.613   -42.598 1.00 63.25  ? 460  ASP B CB  1 
ATOM   7779 C CG  . ASP B 1 460 ? -15.377 0.496   -43.478 1.00 69.76  ? 460  ASP B CG  1 
ATOM   7780 O OD1 . ASP B 1 460 ? -16.560 0.109   -43.318 1.00 70.74  ? 460  ASP B OD1 1 
ATOM   7781 O OD2 . ASP B 1 460 ? -14.619 0.000   -44.337 1.00 69.16  ? 460  ASP B OD2 1 
ATOM   7782 N N   . PRO B 1 461 ? -18.004 1.602   -41.019 1.00 68.17  ? 461  PRO B N   1 
ATOM   7783 C CA  . PRO B 1 461 ? -18.892 0.886   -40.091 1.00 72.05  ? 461  PRO B CA  1 
ATOM   7784 C C   . PRO B 1 461 ? -18.600 -0.613  -40.018 1.00 76.20  ? 461  PRO B C   1 
ATOM   7785 O O   . PRO B 1 461 ? -18.689 -1.205  -38.939 1.00 82.01  ? 461  PRO B O   1 
ATOM   7786 C CB  . PRO B 1 461 ? -20.291 1.143   -40.667 1.00 71.07  ? 461  PRO B CB  1 
ATOM   7787 C CG  . PRO B 1 461 ? -20.062 1.552   -42.090 1.00 71.87  ? 461  PRO B CG  1 
ATOM   7788 C CD  . PRO B 1 461 ? -18.755 2.289   -42.082 1.00 69.31  ? 461  PRO B CD  1 
ATOM   7789 N N   . SER B 1 462 ? -18.231 -1.208  -41.149 1.00 73.08  ? 462  SER B N   1 
ATOM   7790 C CA  . SER B 1 462 ? -17.961 -2.642  -41.214 1.00 72.64  ? 462  SER B CA  1 
ATOM   7791 C C   . SER B 1 462 ? -16.738 -3.087  -40.402 1.00 67.58  ? 462  SER B C   1 
ATOM   7792 O O   . SER B 1 462 ? -16.503 -4.287  -40.249 1.00 67.66  ? 462  SER B O   1 
ATOM   7793 C CB  . SER B 1 462 ? -17.791 -3.079  -42.669 1.00 72.89  ? 462  SER B CB  1 
ATOM   7794 O OG  . SER B 1 462 ? -16.566 -2.603  -43.195 1.00 68.56  ? 462  SER B OG  1 
ATOM   7795 N N   . LEU B 1 463 ? -15.963 -2.134  -39.885 1.00 57.55  ? 463  LEU B N   1 
ATOM   7796 C CA  . LEU B 1 463 ? -14.741 -2.473  -39.166 1.00 56.64  ? 463  LEU B CA  1 
ATOM   7797 C C   . LEU B 1 463 ? -14.929 -2.636  -37.659 1.00 60.24  ? 463  LEU B C   1 
ATOM   7798 O O   . LEU B 1 463 ? -13.978 -2.949  -36.943 1.00 69.37  ? 463  LEU B O   1 
ATOM   7799 C CB  . LEU B 1 463 ? -13.627 -1.468  -39.463 1.00 59.61  ? 463  LEU B CB  1 
ATOM   7800 C CG  . LEU B 1 463 ? -13.079 -1.483  -40.894 1.00 56.50  ? 463  LEU B CG  1 
ATOM   7801 C CD1 . LEU B 1 463 ? -11.873 -0.565  -41.006 1.00 50.23  ? 463  LEU B CD1 1 
ATOM   7802 C CD2 . LEU B 1 463 ? -12.726 -2.892  -41.328 1.00 51.82  ? 463  LEU B CD2 1 
ATOM   7803 N N   . ASN B 1 464 ? -16.151 -2.425  -37.184 1.00 61.18  ? 464  ASN B N   1 
ATOM   7804 C CA  . ASN B 1 464 ? -16.514 -2.747  -35.800 1.00 70.93  ? 464  ASN B CA  1 
ATOM   7805 C C   . ASN B 1 464 ? -15.846 -1.876  -34.723 1.00 67.14  ? 464  ASN B C   1 
ATOM   7806 O O   . ASN B 1 464 ? -15.771 -2.273  -33.559 1.00 70.56  ? 464  ASN B O   1 
ATOM   7807 C CB  . ASN B 1 464 ? -16.292 -4.247  -35.492 1.00 76.83  ? 464  ASN B CB  1 
ATOM   7808 C CG  . ASN B 1 464 ? -17.019 -5.172  -36.470 1.00 80.67  ? 464  ASN B CG  1 
ATOM   7809 O OD1 . ASN B 1 464 ? -18.097 -4.849  -36.976 1.00 82.92  ? 464  ASN B OD1 1 
ATOM   7810 N ND2 . ASN B 1 464 ? -16.420 -6.331  -36.740 1.00 81.58  ? 464  ASN B ND2 1 
ATOM   7811 N N   . TYR B 1 465 ? -15.363 -0.697  -35.108 1.00 62.38  ? 465  TYR B N   1 
ATOM   7812 C CA  . TYR B 1 465 ? -14.866 0.273   -34.135 1.00 55.63  ? 465  TYR B CA  1 
ATOM   7813 C C   . TYR B 1 465 ? -16.040 0.876   -33.376 1.00 50.89  ? 465  TYR B C   1 
ATOM   7814 O O   . TYR B 1 465 ? -17.156 0.919   -33.888 1.00 56.66  ? 465  TYR B O   1 
ATOM   7815 C CB  . TYR B 1 465 ? -14.108 1.402   -34.828 1.00 52.43  ? 465  TYR B CB  1 
ATOM   7816 C CG  . TYR B 1 465 ? -12.744 1.035   -35.337 1.00 49.87  ? 465  TYR B CG  1 
ATOM   7817 C CD1 . TYR B 1 465 ? -11.625 1.160   -34.519 1.00 50.93  ? 465  TYR B CD1 1 
ATOM   7818 C CD2 . TYR B 1 465 ? -12.564 0.580   -36.637 1.00 43.44  ? 465  TYR B CD2 1 
ATOM   7819 C CE1 . TYR B 1 465 ? -10.367 0.832   -34.981 1.00 48.89  ? 465  TYR B CE1 1 
ATOM   7820 C CE2 . TYR B 1 465 ? -11.311 0.259   -37.110 1.00 41.62  ? 465  TYR B CE2 1 
ATOM   7821 C CZ  . TYR B 1 465 ? -10.215 0.386   -36.278 1.00 45.22  ? 465  TYR B CZ  1 
ATOM   7822 O OH  . TYR B 1 465 ? -8.962  0.067   -36.729 1.00 44.48  ? 465  TYR B OH  1 
ATOM   7823 N N   . THR B 1 466 ? -15.791 1.352   -32.163 1.00 50.34  ? 466  THR B N   1 
ATOM   7824 C CA  . THR B 1 466 ? -16.848 1.967   -31.367 1.00 56.38  ? 466  THR B CA  1 
ATOM   7825 C C   . THR B 1 466 ? -17.141 3.351   -31.909 1.00 58.59  ? 466  THR B C   1 
ATOM   7826 O O   . THR B 1 466 ? -16.346 3.922   -32.655 1.00 57.62  ? 466  THR B O   1 
ATOM   7827 C CB  . THR B 1 466 ? -16.460 2.096   -29.875 1.00 59.50  ? 466  THR B CB  1 
ATOM   7828 O OG1 . THR B 1 466 ? -15.525 3.175   -29.697 1.00 49.44  ? 466  THR B OG1 1 
ATOM   7829 C CG2 . THR B 1 466 ? -15.857 0.801   -29.367 1.00 52.72  ? 466  THR B CG2 1 
ATOM   7830 N N   . THR B 1 467 ? -18.277 3.900   -31.514 1.00 54.14  ? 467  THR B N   1 
ATOM   7831 C CA  . THR B 1 467 ? -18.695 5.198   -32.016 1.00 62.34  ? 467  THR B CA  1 
ATOM   7832 C C   . THR B 1 467 ? -17.815 6.347   -31.510 1.00 55.91  ? 467  THR B C   1 
ATOM   7833 O O   . THR B 1 467 ? -17.576 7.311   -32.236 1.00 56.10  ? 467  THR B O   1 
ATOM   7834 C CB  . THR B 1 467 ? -20.181 5.462   -31.707 1.00 65.53  ? 467  THR B CB  1 
ATOM   7835 O OG1 . THR B 1 467 ? -20.504 6.810   -32.053 1.00 66.75  ? 467  THR B OG1 1 
ATOM   7836 C CG2 . THR B 1 467 ? -20.455 5.245   -30.242 1.00 68.56  ? 467  THR B CG2 1 
ATOM   7837 N N   . GLU B 1 468 ? -17.324 6.243   -30.276 1.00 52.78  ? 468  GLU B N   1 
ATOM   7838 C CA  . GLU B 1 468 ? -16.423 7.262   -29.740 1.00 53.39  ? 468  GLU B CA  1 
ATOM   7839 C C   . GLU B 1 468 ? -15.102 7.214   -30.499 1.00 50.29  ? 468  GLU B C   1 
ATOM   7840 O O   . GLU B 1 468 ? -14.419 8.228   -30.642 1.00 49.67  ? 468  GLU B O   1 
ATOM   7841 C CB  . GLU B 1 468 ? -16.159 7.073   -28.239 1.00 58.06  ? 468  GLU B CB  1 
ATOM   7842 C CG  . GLU B 1 468 ? -17.380 6.763   -27.399 1.00 74.62  ? 468  GLU B CG  1 
ATOM   7843 C CD  . GLU B 1 468 ? -17.594 5.263   -27.206 1.00 84.25  ? 468  GLU B CD  1 
ATOM   7844 O OE1 . GLU B 1 468 ? -16.620 4.575   -26.808 1.00 85.23  ? 468  GLU B OE1 1 
ATOM   7845 O OE2 . GLU B 1 468 ? -18.730 4.779   -27.455 1.00 80.70  ? 468  GLU B OE2 1 
ATOM   7846 N N   . GLU B 1 469 ? -14.742 6.026   -30.975 1.00 48.21  ? 469  GLU B N   1 
ATOM   7847 C CA  . GLU B 1 469 ? -13.540 5.868   -31.784 1.00 52.37  ? 469  GLU B CA  1 
ATOM   7848 C C   . GLU B 1 469 ? -13.708 6.514   -33.155 1.00 56.69  ? 469  GLU B C   1 
ATOM   7849 O O   . GLU B 1 469 ? -12.748 7.067   -33.701 1.00 39.04  ? 469  GLU B O   1 
ATOM   7850 C CB  . GLU B 1 469 ? -13.170 4.397   -31.936 1.00 48.34  ? 469  GLU B CB  1 
ATOM   7851 C CG  . GLU B 1 469 ? -12.258 3.884   -30.852 1.00 46.68  ? 469  GLU B CG  1 
ATOM   7852 C CD  . GLU B 1 469 ? -12.165 2.377   -30.857 1.00 50.93  ? 469  GLU B CD  1 
ATOM   7853 O OE1 . GLU B 1 469 ? -13.145 1.731   -31.290 1.00 51.73  ? 469  GLU B OE1 1 
ATOM   7854 O OE2 . GLU B 1 469 ? -11.117 1.839   -30.433 1.00 50.50  ? 469  GLU B OE2 1 
ATOM   7855 N N   . ARG B 1 470 ? -14.920 6.449   -33.707 1.00 43.63  ? 470  ARG B N   1 
ATOM   7856 C CA  . ARG B 1 470 ? -15.187 7.141   -34.957 1.00 45.30  ? 470  ARG B CA  1 
ATOM   7857 C C   . ARG B 1 470 ? -14.970 8.636   -34.748 1.00 42.34  ? 470  ARG B C   1 
ATOM   7858 O O   . ARG B 1 470 ? -14.238 9.273   -35.500 1.00 40.43  ? 470  ARG B O   1 
ATOM   7859 C CB  . ARG B 1 470 ? -16.601 6.873   -35.476 1.00 48.05  ? 470  ARG B CB  1 
ATOM   7860 C CG  . ARG B 1 470 ? -16.957 7.724   -36.697 1.00 55.24  ? 470  ARG B CG  1 
ATOM   7861 C CD  . ARG B 1 470 ? -18.384 7.490   -37.204 1.00 68.08  ? 470  ARG B CD  1 
ATOM   7862 N NE  . ARG B 1 470 ? -19.407 7.758   -36.190 1.00 79.83  ? 470  ARG B NE  1 
ATOM   7863 C CZ  . ARG B 1 470 ? -19.815 8.973   -35.819 1.00 82.12  ? 470  ARG B CZ  1 
ATOM   7864 N NH1 . ARG B 1 470 ? -19.285 10.060  -36.367 1.00 79.92  ? 470  ARG B NH1 1 
ATOM   7865 N NH2 . ARG B 1 470 ? -20.752 9.103   -34.886 1.00 83.32  ? 470  ARG B NH2 1 
ATOM   7866 N N   . ILE B 1 471 ? -15.601 9.175   -33.707 1.00 46.53  ? 471  ILE B N   1 
ATOM   7867 C CA  . ILE B 1 471 ? -15.471 10.584  -33.316 1.00 47.23  ? 471  ILE B CA  1 
ATOM   7868 C C   . ILE B 1 471 ? -14.013 11.013  -33.045 1.00 46.70  ? 471  ILE B C   1 
ATOM   7869 O O   . ILE B 1 471 ? -13.594 12.108  -33.431 1.00 48.00  ? 471  ILE B O   1 
ATOM   7870 C CB  . ILE B 1 471 ? -16.356 10.873  -32.076 1.00 56.73  ? 471  ILE B CB  1 
ATOM   7871 C CG1 . ILE B 1 471 ? -17.829 10.641  -32.427 1.00 53.04  ? 471  ILE B CG1 1 
ATOM   7872 C CG2 . ILE B 1 471 ? -16.137 12.280  -31.556 1.00 45.96  ? 471  ILE B CG2 1 
ATOM   7873 C CD1 . ILE B 1 471 ? -18.746 10.580  -31.228 1.00 52.35  ? 471  ILE B CD1 1 
ATOM   7874 N N   . PHE B 1 472 ? -13.251 10.132  -32.400 1.00 39.60  ? 472  PHE B N   1 
ATOM   7875 C CA  . PHE B 1 472 ? -11.835 10.343  -32.127 1.00 37.10  ? 472  PHE B CA  1 
ATOM   7876 C C   . PHE B 1 472 ? -11.052 10.357  -33.434 1.00 40.63  ? 472  PHE B C   1 
ATOM   7877 O O   . PHE B 1 472 ? -10.161 11.192  -33.615 1.00 37.67  ? 472  PHE B O   1 
ATOM   7878 C CB  . PHE B 1 472 ? -11.341 9.237   -31.196 1.00 36.91  ? 472  PHE B CB  1 
ATOM   7879 C CG  . PHE B 1 472 ? -9.854  9.261   -30.901 1.00 38.80  ? 472  PHE B CG  1 
ATOM   7880 C CD1 . PHE B 1 472 ? -9.251  10.366  -30.329 1.00 33.78  ? 472  PHE B CD1 1 
ATOM   7881 C CD2 . PHE B 1 472 ? -9.078  8.135   -31.136 1.00 33.50  ? 472  PHE B CD2 1 
ATOM   7882 C CE1 . PHE B 1 472 ? -7.880  10.366  -30.036 1.00 31.90  ? 472  PHE B CE1 1 
ATOM   7883 C CE2 . PHE B 1 472 ? -7.726  8.124   -30.848 1.00 31.65  ? 472  PHE B CE2 1 
ATOM   7884 C CZ  . PHE B 1 472 ? -7.125  9.248   -30.285 1.00 32.03  ? 472  PHE B CZ  1 
ATOM   7885 N N   . ALA B 1 473 ? -11.392 9.452   -34.354 1.00 37.71  ? 473  ALA B N   1 
ATOM   7886 C CA  . ALA B 1 473 ? -10.678 9.378   -35.631 1.00 37.94  ? 473  ALA B CA  1 
ATOM   7887 C C   . ALA B 1 473 ? -10.836 10.680  -36.423 1.00 41.95  ? 473  ALA B C   1 
ATOM   7888 O O   . ALA B 1 473 ? -9.865  11.194  -36.998 1.00 40.33  ? 473  ALA B O   1 
ATOM   7889 C CB  . ALA B 1 473 ? -11.123 8.178   -36.450 1.00 35.00  ? 473  ALA B CB  1 
ATOM   7890 N N   . GLN B 1 474 ? -12.046 11.231  -36.409 1.00 35.83  ? 474  GLN B N   1 
ATOM   7891 C CA  . GLN B 1 474 ? -12.308 12.493  -37.096 1.00 46.31  ? 474  GLN B CA  1 
ATOM   7892 C C   . GLN B 1 474 ? -11.495 13.654  -36.508 1.00 43.73  ? 474  GLN B C   1 
ATOM   7893 O O   . GLN B 1 474 ? -11.064 14.544  -37.243 1.00 45.14  ? 474  GLN B O   1 
ATOM   7894 C CB  . GLN B 1 474 ? -13.812 12.826  -37.104 1.00 43.16  ? 474  GLN B CB  1 
ATOM   7895 C CG  . GLN B 1 474 ? -14.718 11.658  -37.510 1.00 45.02  ? 474  GLN B CG  1 
ATOM   7896 C CD  . GLN B 1 474 ? -16.160 12.082  -37.834 1.00 57.81  ? 474  GLN B CD  1 
ATOM   7897 O OE1 . GLN B 1 474 ? -17.127 11.531  -37.286 1.00 54.47  ? 474  GLN B OE1 1 
ATOM   7898 N NE2 . GLN B 1 474 ? -16.305 13.046  -38.746 1.00 59.68  ? 474  GLN B NE2 1 
ATOM   7899 N N   . ARG B 1 475 ? -11.281 13.640  -35.192 1.00 40.41  ? 475  ARG B N   1 
ATOM   7900 C CA  . ARG B 1 475 ? -10.465 14.667  -34.550 1.00 35.30  ? 475  ARG B CA  1 
ATOM   7901 C C   . ARG B 1 475 ? -9.039  14.608  -35.074 1.00 37.07  ? 475  ARG B C   1 
ATOM   7902 O O   . ARG B 1 475 ? -8.461  15.630  -35.437 1.00 39.05  ? 475  ARG B O   1 
ATOM   7903 C CB  . ARG B 1 475 ? -10.475 14.535  -33.017 1.00 39.11  ? 475  ARG B CB  1 
ATOM   7904 C CG  . ARG B 1 475 ? -11.689 15.156  -32.323 1.00 47.62  ? 475  ARG B CG  1 
ATOM   7905 C CD  . ARG B 1 475 ? -11.640 14.998  -30.788 1.00 48.37  ? 475  ARG B CD  1 
ATOM   7906 N NE  . ARG B 1 475 ? -10.334 15.394  -30.281 1.00 54.44  ? 475  ARG B NE  1 
ATOM   7907 C CZ  . ARG B 1 475 ? -9.649  14.756  -29.333 1.00 47.47  ? 475  ARG B CZ  1 
ATOM   7908 N NH1 . ARG B 1 475 ? -10.144 13.674  -28.742 1.00 40.99  ? 475  ARG B NH1 1 
ATOM   7909 N NH2 . ARG B 1 475 ? -8.458  15.217  -28.981 1.00 34.38  ? 475  ARG B NH2 1 
ATOM   7910 N N   . LEU B 1 476 ? -8.482  13.405  -35.131 1.00 30.79  ? 476  LEU B N   1 
ATOM   7911 C CA  . LEU B 1 476 ? -7.111  13.215  -35.592 1.00 28.88  ? 476  LEU B CA  1 
ATOM   7912 C C   . LEU B 1 476 ? -6.904  13.614  -37.055 1.00 37.10  ? 476  LEU B C   1 
ATOM   7913 O O   . LEU B 1 476 ? -5.905  14.251  -37.391 1.00 36.50  ? 476  LEU B O   1 
ATOM   7914 C CB  . LEU B 1 476 ? -6.676  11.767  -35.358 1.00 30.38  ? 476  LEU B CB  1 
ATOM   7915 C CG  . LEU B 1 476 ? -6.703  11.384  -33.876 1.00 40.16  ? 476  LEU B CG  1 
ATOM   7916 C CD1 . LEU B 1 476 ? -6.211  9.978   -33.693 1.00 51.44  ? 476  LEU B CD1 1 
ATOM   7917 C CD2 . LEU B 1 476 ? -5.854  12.356  -33.065 1.00 39.46  ? 476  LEU B CD2 1 
ATOM   7918 N N   . MET B 1 477 ? -7.851  13.247  -37.918 1.00 29.54  ? 477  MET B N   1 
ATOM   7919 C CA  . MET B 1 477 ? -7.761  13.588  -39.329 1.00 31.86  ? 477  MET B CA  1 
ATOM   7920 C C   . MET B 1 477 ? -7.794  15.102  -39.471 1.00 36.29  ? 477  MET B C   1 
ATOM   7921 O O   . MET B 1 477 ? -7.168  15.680  -40.368 1.00 40.05  ? 477  MET B O   1 
ATOM   7922 C CB  . MET B 1 477 ? -8.918  12.967  -40.108 1.00 37.87  ? 477  MET B CB  1 
ATOM   7923 C CG  . MET B 1 477 ? -8.907  11.445  -40.156 1.00 46.35  ? 477  MET B CG  1 
ATOM   7924 S SD  . MET B 1 477 ? -10.427 10.758  -40.856 1.00 54.88  ? 477  MET B SD  1 
ATOM   7925 C CE  . MET B 1 477 ? -10.285 11.304  -42.535 1.00 46.85  ? 477  MET B CE  1 
ATOM   7926 N N   . LYS B 1 478 ? -8.525  15.734  -38.562 1.00 33.09  ? 478  LYS B N   1 
ATOM   7927 C CA  . LYS B 1 478 ? -8.660  17.180  -38.546 1.00 38.85  ? 478  LYS B CA  1 
ATOM   7928 C C   . LYS B 1 478 ? -7.340  17.817  -38.129 1.00 37.82  ? 478  LYS B C   1 
ATOM   7929 O O   . LYS B 1 478 ? -6.911  18.792  -38.730 1.00 38.94  ? 478  LYS B O   1 
ATOM   7930 C CB  . LYS B 1 478 ? -9.783  17.610  -37.596 1.00 37.41  ? 478  LYS B CB  1 
ATOM   7931 C CG  . LYS B 1 478 ? -10.974 18.236  -38.277 1.00 54.78  ? 478  LYS B CG  1 
ATOM   7932 C CD  . LYS B 1 478 ? -10.725 19.693  -38.643 1.00 62.72  ? 478  LYS B CD  1 
ATOM   7933 C CE  . LYS B 1 478 ? -11.865 20.237  -39.505 1.00 69.85  ? 478  LYS B CE  1 
ATOM   7934 N NZ  . LYS B 1 478 ? -12.029 19.493  -40.803 1.00 67.26  ? 478  LYS B NZ  1 
ATOM   7935 N N   . TYR B 1 479 ? -6.701  17.263  -37.102 1.00 32.34  ? 479  TYR B N   1 
ATOM   7936 C CA  . TYR B 1 479 ? -5.430  17.794  -36.631 1.00 33.62  ? 479  TYR B CA  1 
ATOM   7937 C C   . TYR B 1 479 ? -4.379  17.666  -37.729 1.00 29.88  ? 479  TYR B C   1 
ATOM   7938 O O   . TYR B 1 479 ? -3.677  18.629  -38.048 1.00 32.44  ? 479  TYR B O   1 
ATOM   7939 C CB  . TYR B 1 479 ? -4.940  17.033  -35.402 1.00 34.45  ? 479  TYR B CB  1 
ATOM   7940 C CG  . TYR B 1 479 ? -5.671  17.319  -34.121 1.00 29.91  ? 479  TYR B CG  1 
ATOM   7941 C CD1 . TYR B 1 479 ? -6.113  18.598  -33.813 1.00 31.12  ? 479  TYR B CD1 1 
ATOM   7942 C CD2 . TYR B 1 479 ? -5.906  16.304  -33.203 1.00 31.42  ? 479  TYR B CD2 1 
ATOM   7943 C CE1 . TYR B 1 479 ? -6.786  18.853  -32.625 1.00 32.17  ? 479  TYR B CE1 1 
ATOM   7944 C CE2 . TYR B 1 479 ? -6.574  16.550  -32.015 1.00 31.42  ? 479  TYR B CE2 1 
ATOM   7945 C CZ  . TYR B 1 479 ? -7.008  17.821  -31.728 1.00 38.46  ? 479  TYR B CZ  1 
ATOM   7946 O OH  . TYR B 1 479 ? -7.672  18.052  -30.540 1.00 47.08  ? 479  TYR B OH  1 
ATOM   7947 N N   . TRP B 1 480 ? -4.273  16.468  -38.293 1.00 26.79  ? 480  TRP B N   1 
ATOM   7948 C CA  . TRP B 1 480 ? -3.264  16.191  -39.312 1.00 36.31  ? 480  TRP B CA  1 
ATOM   7949 C C   . TRP B 1 480 ? -3.472  17.065  -40.553 1.00 36.50  ? 480  TRP B C   1 
ATOM   7950 O O   . TRP B 1 480 ? -2.518  17.674  -41.047 1.00 30.86  ? 480  TRP B O   1 
ATOM   7951 C CB  . TRP B 1 480 ? -3.264  14.708  -39.694 1.00 25.44  ? 480  TRP B CB  1 
ATOM   7952 C CG  . TRP B 1 480 ? -2.194  13.876  -39.029 1.00 32.50  ? 480  TRP B CG  1 
ATOM   7953 C CD1 . TRP B 1 480 ? -1.195  13.158  -39.650 1.00 23.76  ? 480  TRP B CD1 1 
ATOM   7954 C CD2 . TRP B 1 480 ? -2.024  13.657  -37.626 1.00 27.71  ? 480  TRP B CD2 1 
ATOM   7955 N NE1 . TRP B 1 480 ? -0.424  12.518  -38.719 1.00 30.25  ? 480  TRP B NE1 1 
ATOM   7956 C CE2 . TRP B 1 480 ? -0.905  12.812  -37.468 1.00 28.63  ? 480  TRP B CE2 1 
ATOM   7957 C CE3 . TRP B 1 480 ? -2.702  14.100  -36.487 1.00 29.57  ? 480  TRP B CE3 1 
ATOM   7958 C CZ2 . TRP B 1 480 ? -0.445  12.409  -36.216 1.00 22.82  ? 480  TRP B CZ2 1 
ATOM   7959 C CZ3 . TRP B 1 480 ? -2.248  13.689  -35.242 1.00 26.47  ? 480  TRP B CZ3 1 
ATOM   7960 C CH2 . TRP B 1 480 ? -1.134  12.846  -35.120 1.00 24.07  ? 480  TRP B CH2 1 
ATOM   7961 N N   . THR B 1 481 ? -4.714  17.156  -41.036 1.00 31.20  ? 481  THR B N   1 
ATOM   7962 C CA  . THR B 1 481 ? -4.970  17.938  -42.243 1.00 28.81  ? 481  THR B CA  1 
ATOM   7963 C C   . THR B 1 481 ? -4.926  19.450  -41.958 1.00 29.71  ? 481  THR B C   1 
ATOM   7964 O O   . THR B 1 481 ? -4.573  20.243  -42.829 1.00 32.77  ? 481  THR B O   1 
ATOM   7965 C CB  . THR B 1 481 ? -6.286  17.536  -42.969 1.00 30.63  ? 481  THR B CB  1 
ATOM   7966 O OG1 . THR B 1 481 ? -7.407  17.710  -42.095 1.00 37.31  ? 481  THR B OG1 1 
ATOM   7967 C CG2 . THR B 1 481 ? -6.236  16.082  -43.446 1.00 29.45  ? 481  THR B CG2 1 
ATOM   7968 N N   . ASN B 1 482 ? -5.271  19.855  -40.741 1.00 32.69  ? 482  ASN B N   1 
ATOM   7969 C CA  . ASN B 1 482 ? -5.113  21.263  -40.378 1.00 36.35  ? 482  ASN B CA  1 
ATOM   7970 C C   . ASN B 1 482 ? -3.640  21.580  -40.390 1.00 34.72  ? 482  ASN B C   1 
ATOM   7971 O O   . ASN B 1 482 ? -3.214  22.644  -40.850 1.00 31.16  ? 482  ASN B O   1 
ATOM   7972 C CB  . ASN B 1 482 ? -5.686  21.577  -39.004 1.00 31.88  ? 482  ASN B CB  1 
ATOM   7973 C CG  . ASN B 1 482 ? -7.186  21.805  -39.031 1.00 34.63  ? 482  ASN B CG  1 
ATOM   7974 O OD1 . ASN B 1 482 ? -7.772  22.072  -40.076 1.00 35.45  ? 482  ASN B OD1 1 
ATOM   7975 N ND2 . ASN B 1 482 ? -7.810  21.720  -37.867 1.00 39.96  ? 482  ASN B ND2 1 
ATOM   7976 N N   . PHE B 1 483 ? -2.856  20.638  -39.888 1.00 31.27  ? 483  PHE B N   1 
ATOM   7977 C CA  . PHE B 1 483 ? -1.424  20.806  -39.928 1.00 33.95  ? 483  PHE B CA  1 
ATOM   7978 C C   . PHE B 1 483 ? -0.948  20.899  -41.388 1.00 35.16  ? 483  PHE B C   1 
ATOM   7979 O O   . PHE B 1 483 ? -0.143  21.766  -41.726 1.00 35.78  ? 483  PHE B O   1 
ATOM   7980 C CB  . PHE B 1 483 ? -0.709  19.695  -39.172 1.00 31.77  ? 483  PHE B CB  1 
ATOM   7981 C CG  . PHE B 1 483 ? 0.787   19.810  -39.222 1.00 34.83  ? 483  PHE B CG  1 
ATOM   7982 C CD1 . PHE B 1 483 ? 1.448   20.752  -38.442 1.00 26.73  ? 483  PHE B CD1 1 
ATOM   7983 C CD2 . PHE B 1 483 ? 1.532   18.996  -40.067 1.00 29.23  ? 483  PHE B CD2 1 
ATOM   7984 C CE1 . PHE B 1 483 ? 2.821   20.863  -38.493 1.00 36.41  ? 483  PHE B CE1 1 
ATOM   7985 C CE2 . PHE B 1 483 ? 2.914   19.106  -40.127 1.00 28.37  ? 483  PHE B CE2 1 
ATOM   7986 C CZ  . PHE B 1 483 ? 3.560   20.036  -39.337 1.00 34.16  ? 483  PHE B CZ  1 
ATOM   7987 N N   . ALA B 1 484 ? -1.468  20.040  -42.257 1.00 32.91  ? 484  ALA B N   1 
ATOM   7988 C CA  . ALA B 1 484 ? -1.039  20.039  -43.657 1.00 29.04  ? 484  ALA B CA  1 
ATOM   7989 C C   . ALA B 1 484 ? -1.373  21.375  -44.332 1.00 40.53  ? 484  ALA B C   1 
ATOM   7990 O O   . ALA B 1 484 ? -0.539  21.950  -45.054 1.00 30.64  ? 484  ALA B O   1 
ATOM   7991 C CB  . ALA B 1 484 ? -1.666  18.864  -44.415 1.00 28.15  ? 484  ALA B CB  1 
ATOM   7992 N N   . ARG B 1 485 ? -2.580  21.875  -44.067 1.00 30.94  ? 485  ARG B N   1 
ATOM   7993 C CA  . ARG B 1 485 ? -3.037  23.134  -44.653 1.00 36.38  ? 485  ARG B CA  1 
ATOM   7994 C C   . ARG B 1 485 ? -2.217  24.338  -44.203 1.00 39.49  ? 485  ARG B C   1 
ATOM   7995 O O   . ARG B 1 485 ? -1.950  25.233  -45.002 1.00 38.50  ? 485  ARG B O   1 
ATOM   7996 C CB  . ARG B 1 485 ? -4.527  23.394  -44.349 1.00 33.87  ? 485  ARG B CB  1 
ATOM   7997 C CG  . ARG B 1 485 ? -5.503  22.672  -45.286 1.00 58.64  ? 485  ARG B CG  1 
ATOM   7998 C CD  . ARG B 1 485 ? -6.985  22.958  -44.961 1.00 62.02  ? 485  ARG B CD  1 
ATOM   7999 N NE  . ARG B 1 485 ? -7.429  22.293  -43.732 1.00 62.84  ? 485  ARG B NE  1 
ATOM   8000 C CZ  . ARG B 1 485 ? -7.980  21.079  -43.673 1.00 61.03  ? 485  ARG B CZ  1 
ATOM   8001 N NH1 . ARG B 1 485 ? -8.181  20.367  -44.779 1.00 57.89  ? 485  ARG B NH1 1 
ATOM   8002 N NH2 . ARG B 1 485 ? -8.334  20.573  -42.496 1.00 57.60  ? 485  ARG B NH2 1 
ATOM   8003 N N   . THR B 1 486 ? -1.821  24.356  -42.929 1.00 35.52  ? 486  THR B N   1 
ATOM   8004 C CA  . THR B 1 486 ? -1.380  25.595  -42.290 1.00 34.71  ? 486  THR B CA  1 
ATOM   8005 C C   . THR B 1 486 ? -0.126  25.497  -41.421 1.00 35.91  ? 486  THR B C   1 
ATOM   8006 O O   . THR B 1 486 ? 0.388   26.515  -40.974 1.00 36.93  ? 486  THR B O   1 
ATOM   8007 C CB  . THR B 1 486 ? -2.495  26.194  -41.393 1.00 37.34  ? 486  THR B CB  1 
ATOM   8008 O OG1 . THR B 1 486 ? -2.744  25.311  -40.288 1.00 38.97  ? 486  THR B OG1 1 
ATOM   8009 C CG2 . THR B 1 486 ? -3.780  26.405  -42.171 1.00 36.62  ? 486  THR B CG2 1 
ATOM   8010 N N   . GLY B 1 487 ? 0.348   24.289  -41.142 1.00 42.40  ? 487  GLY B N   1 
ATOM   8011 C CA  . GLY B 1 487 ? 1.493   24.142  -40.258 1.00 38.17  ? 487  GLY B CA  1 
ATOM   8012 C C   . GLY B 1 487 ? 1.141   24.231  -38.783 1.00 43.53  ? 487  GLY B C   1 
ATOM   8013 O O   . GLY B 1 487 ? 2.028   24.211  -37.924 1.00 39.02  ? 487  GLY B O   1 
ATOM   8014 N N   . ASP B 1 488 ? -0.158  24.317  -38.498 1.00 44.21  ? 488  ASP B N   1 
ATOM   8015 C CA  . ASP B 1 488 ? -0.689  24.410  -37.137 1.00 34.84  ? 488  ASP B CA  1 
ATOM   8016 C C   . ASP B 1 488 ? -1.868  23.438  -37.059 1.00 35.08  ? 488  ASP B C   1 
ATOM   8017 O O   . ASP B 1 488 ? -2.828  23.569  -37.816 1.00 38.36  ? 488  ASP B O   1 
ATOM   8018 C CB  . ASP B 1 488 ? -1.142  25.853  -36.881 1.00 36.69  ? 488  ASP B CB  1 
ATOM   8019 C CG  . ASP B 1 488 ? -1.641  26.093  -35.457 1.00 37.23  ? 488  ASP B CG  1 
ATOM   8020 O OD1 . ASP B 1 488 ? -1.978  25.114  -34.764 1.00 35.68  ? 488  ASP B OD1 1 
ATOM   8021 O OD2 . ASP B 1 488 ? -1.717  27.279  -35.041 1.00 38.23  ? 488  ASP B OD2 1 
ATOM   8022 N N   . PRO B 1 489 ? -1.798  22.449  -36.152 1.00 33.03  ? 489  PRO B N   1 
ATOM   8023 C CA  . PRO B 1 489 ? -2.860  21.426  -36.076 1.00 33.45  ? 489  PRO B CA  1 
ATOM   8024 C C   . PRO B 1 489 ? -4.172  21.955  -35.476 1.00 42.48  ? 489  PRO B C   1 
ATOM   8025 O O   . PRO B 1 489 ? -5.204  21.275  -35.553 1.00 43.46  ? 489  PRO B O   1 
ATOM   8026 C CB  . PRO B 1 489 ? -2.259  20.365  -35.155 1.00 31.00  ? 489  PRO B CB  1 
ATOM   8027 C CG  . PRO B 1 489 ? -1.337  21.170  -34.231 1.00 29.74  ? 489  PRO B CG  1 
ATOM   8028 C CD  . PRO B 1 489 ? -0.750  22.248  -35.128 1.00 30.70  ? 489  PRO B CD  1 
ATOM   8029 N N   . ASN B 1 490 ? -4.140  23.154  -34.899 1.00 35.97  ? 490  ASN B N   1 
ATOM   8030 C CA  . ASN B 1 490 ? -5.327  23.706  -34.263 1.00 39.92  ? 490  ASN B CA  1 
ATOM   8031 C C   . ASN B 1 490 ? -6.399  24.150  -35.257 1.00 42.72  ? 490  ASN B C   1 
ATOM   8032 O O   . ASN B 1 490 ? -6.093  24.796  -36.264 1.00 42.69  ? 490  ASN B O   1 
ATOM   8033 C CB  . ASN B 1 490 ? -4.954  24.863  -33.325 1.00 38.89  ? 490  ASN B CB  1 
ATOM   8034 C CG  . ASN B 1 490 ? -4.263  24.383  -32.062 1.00 39.88  ? 490  ASN B CG  1 
ATOM   8035 O OD1 . ASN B 1 490 ? -4.887  23.745  -31.209 1.00 39.40  ? 490  ASN B OD1 1 
ATOM   8036 N ND2 . ASN B 1 490 ? -2.970  24.680  -31.936 1.00 34.97  ? 490  ASN B ND2 1 
ATOM   8037 N N   . ASP B 1 491 ? -7.650  23.800  -34.966 1.00 48.72  ? 491  ASP B N   1 
ATOM   8038 C CA  . ASP B 1 491 ? -8.795  24.266  -35.755 1.00 61.70  ? 491  ASP B CA  1 
ATOM   8039 C C   . ASP B 1 491 ? -8.812  25.788  -35.763 1.00 68.62  ? 491  ASP B C   1 
ATOM   8040 O O   . ASP B 1 491 ? -8.853  26.413  -34.705 1.00 73.23  ? 491  ASP B O   1 
ATOM   8041 C CB  . ASP B 1 491 ? -10.105 23.720  -35.179 1.00 70.86  ? 491  ASP B CB  1 
ATOM   8042 C CG  . ASP B 1 491 ? -10.972 23.035  -36.227 1.00 78.56  ? 491  ASP B CG  1 
ATOM   8043 O OD1 . ASP B 1 491 ? -11.158 23.605  -37.325 1.00 83.91  ? 491  ASP B OD1 1 
ATOM   8044 O OD2 . ASP B 1 491 ? -11.470 21.923  -35.950 1.00 76.59  ? 491  ASP B OD2 1 
ATOM   8045 N N   . PRO B 1 492 ? -8.780  26.390  -36.962 1.00 74.58  ? 492  PRO B N   1 
ATOM   8046 C CA  . PRO B 1 492 ? -8.502  27.822  -37.109 1.00 75.16  ? 492  PRO B CA  1 
ATOM   8047 C C   . PRO B 1 492 ? -9.714  28.715  -36.867 1.00 78.14  ? 492  PRO B C   1 
ATOM   8048 O O   . PRO B 1 492 ? -9.577  29.937  -36.967 1.00 74.54  ? 492  PRO B O   1 
ATOM   8049 C CB  . PRO B 1 492 ? -8.057  27.931  -38.566 1.00 74.95  ? 492  PRO B CB  1 
ATOM   8050 C CG  . PRO B 1 492 ? -8.868  26.876  -39.257 1.00 77.49  ? 492  PRO B CG  1 
ATOM   8051 C CD  . PRO B 1 492 ? -9.062  25.751  -38.261 1.00 75.86  ? 492  PRO B CD  1 
ATOM   8052 N N   . ARG B 1 493 ? -10.867 28.121  -36.559 1.00 84.81  ? 493  ARG B N   1 
ATOM   8053 C CA  . ARG B 1 493 ? -12.068 28.899  -36.244 1.00 92.10  ? 493  ARG B CA  1 
ATOM   8054 C C   . ARG B 1 493 ? -12.951 28.233  -35.177 1.00 97.12  ? 493  ARG B C   1 
ATOM   8055 O O   . ARG B 1 493 ? -13.930 28.825  -34.716 1.00 102.25 ? 493  ARG B O   1 
ATOM   8056 C CB  . ARG B 1 493 ? -12.866 29.225  -37.512 1.00 93.40  ? 493  ARG B CB  1 
ATOM   8057 N N   . ASP B 1 494 ? -12.608 27.007  -34.788 1.00 98.83  ? 494  ASP B N   1 
ATOM   8058 C CA  . ASP B 1 494 ? -13.174 26.421  -33.573 1.00 107.92 ? 494  ASP B CA  1 
ATOM   8059 C C   . ASP B 1 494 ? -12.514 27.053  -32.350 1.00 112.85 ? 494  ASP B C   1 
ATOM   8060 O O   . ASP B 1 494 ? -11.316 26.870  -32.103 1.00 111.86 ? 494  ASP B O   1 
ATOM   8061 C CB  . ASP B 1 494 ? -13.000 24.893  -33.536 1.00 107.37 ? 494  ASP B CB  1 
ATOM   8062 C CG  . ASP B 1 494 ? -13.016 24.321  -32.105 1.00 107.18 ? 494  ASP B CG  1 
ATOM   8063 O OD1 . ASP B 1 494 ? -14.114 24.078  -31.559 1.00 108.26 ? 494  ASP B OD1 1 
ATOM   8064 O OD2 . ASP B 1 494 ? -11.925 24.106  -31.526 1.00 104.77 ? 494  ASP B OD2 1 
ATOM   8065 N N   . SER B 1 495 ? -13.299 27.808  -31.591 1.00 117.32 ? 495  SER B N   1 
ATOM   8066 C CA  . SER B 1 495 ? -12.824 28.355  -30.331 1.00 117.07 ? 495  SER B CA  1 
ATOM   8067 C C   . SER B 1 495 ? -12.786 27.265  -29.264 1.00 124.85 ? 495  SER B C   1 
ATOM   8068 O O   . SER B 1 495 ? -12.596 26.083  -29.572 1.00 122.09 ? 495  SER B O   1 
ATOM   8069 C CB  . SER B 1 495 ? -13.725 29.497  -29.873 1.00 115.19 ? 495  SER B CB  1 
ATOM   8070 O OG  . SER B 1 495 ? -13.421 29.865  -28.539 1.00 112.82 ? 495  SER B OG  1 
ATOM   8071 N N   . LYS B 1 496 ? -12.973 27.680  -28.014 1.00 133.18 ? 496  LYS B N   1 
ATOM   8072 C CA  . LYS B 1 496 ? -13.022 26.772  -26.870 1.00 135.99 ? 496  LYS B CA  1 
ATOM   8073 C C   . LYS B 1 496 ? -11.728 25.984  -26.645 1.00 134.53 ? 496  LYS B C   1 
ATOM   8074 O O   . LYS B 1 496 ? -11.270 25.231  -27.513 1.00 131.71 ? 496  LYS B O   1 
ATOM   8075 C CB  . LYS B 1 496 ? -14.236 25.831  -26.961 1.00 133.86 ? 496  LYS B CB  1 
ATOM   8076 C CG  . LYS B 1 496 ? -14.356 24.831  -25.818 1.00 130.53 ? 496  LYS B CG  1 
ATOM   8077 C CD  . LYS B 1 496 ? -14.286 25.513  -24.459 1.00 131.90 ? 496  LYS B CD  1 
ATOM   8078 C CE  . LYS B 1 496 ? -15.399 26.527  -24.284 1.00 138.08 ? 496  LYS B CE  1 
ATOM   8079 N NZ  . LYS B 1 496 ? -15.254 27.267  -23.005 1.00 140.79 ? 496  LYS B NZ  1 
ATOM   8080 N N   . SER B 1 497 ? -11.150 26.178  -25.462 1.00 133.78 ? 497  SER B N   1 
ATOM   8081 C CA  . SER B 1 497 ? -10.038 25.367  -24.979 1.00 124.62 ? 497  SER B CA  1 
ATOM   8082 C C   . SER B 1 497 ? -10.308 23.870  -25.217 1.00 116.31 ? 497  SER B C   1 
ATOM   8083 O O   . SER B 1 497 ? -11.467 23.449  -25.316 1.00 129.13 ? 497  SER B O   1 
ATOM   8084 C CB  . SER B 1 497 ? -9.819  25.648  -23.485 1.00 124.36 ? 497  SER B CB  1 
ATOM   8085 O OG  . SER B 1 497 ? -8.730  26.531  -23.283 1.00 120.47 ? 497  SER B OG  1 
ATOM   8086 N N   . PRO B 1 498 ? -9.245  23.054  -25.293 1.00 86.58  ? 498  PRO B N   1 
ATOM   8087 C CA  . PRO B 1 498 ? -7.845  23.446  -25.127 1.00 77.86  ? 498  PRO B CA  1 
ATOM   8088 C C   . PRO B 1 498 ? -7.091  23.477  -26.452 1.00 63.08  ? 498  PRO B C   1 
ATOM   8089 O O   . PRO B 1 498 ? -7.337  22.658  -27.328 1.00 55.49  ? 498  PRO B O   1 
ATOM   8090 C CB  . PRO B 1 498 ? -7.291  22.348  -24.198 1.00 77.11  ? 498  PRO B CB  1 
ATOM   8091 C CG  . PRO B 1 498 ? -8.432  21.290  -24.072 1.00 61.14  ? 498  PRO B CG  1 
ATOM   8092 C CD  . PRO B 1 498 ? -9.393  21.598  -25.177 1.00 69.59  ? 498  PRO B CD  1 
ATOM   8093 N N   . GLN B 1 499 ? -6.185  24.436  -26.597 1.00 59.43  ? 499  GLN B N   1 
ATOM   8094 C CA  . GLN B 1 499 ? -5.377  24.527  -27.800 1.00 50.23  ? 499  GLN B CA  1 
ATOM   8095 C C   . GLN B 1 499 ? -4.123  23.675  -27.638 1.00 45.96  ? 499  GLN B C   1 
ATOM   8096 O O   . GLN B 1 499 ? -3.652  23.441  -26.533 1.00 37.91  ? 499  GLN B O   1 
ATOM   8097 C CB  . GLN B 1 499 ? -5.009  25.982  -28.092 1.00 43.01  ? 499  GLN B CB  1 
ATOM   8098 C CG  . GLN B 1 499 ? -6.213  26.924  -28.171 1.00 65.25  ? 499  GLN B CG  1 
ATOM   8099 C CD  . GLN B 1 499 ? -7.056  26.734  -29.429 1.00 64.76  ? 499  GLN B CD  1 
ATOM   8100 O OE1 . GLN B 1 499 ? -6.586  26.957  -30.548 1.00 46.42  ? 499  GLN B OE1 1 
ATOM   8101 N NE2 . GLN B 1 499 ? -8.318  26.341  -29.244 1.00 68.03  ? 499  GLN B NE2 1 
ATOM   8102 N N   . TRP B 1 500 ? -3.604  23.200  -28.759 1.00 35.25  ? 500  TRP B N   1 
ATOM   8103 C CA  . TRP B 1 500 ? -2.377  22.431  -28.792 1.00 32.21  ? 500  TRP B CA  1 
ATOM   8104 C C   . TRP B 1 500 ? -1.218  23.416  -28.938 1.00 31.68  ? 500  TRP B C   1 
ATOM   8105 O O   . TRP B 1 500 ? -1.028  23.989  -30.006 1.00 31.62  ? 500  TRP B O   1 
ATOM   8106 C CB  . TRP B 1 500 ? -2.441  21.495  -29.999 1.00 30.67  ? 500  TRP B CB  1 
ATOM   8107 C CG  . TRP B 1 500 ? -1.327  20.516  -30.136 1.00 32.42  ? 500  TRP B CG  1 
ATOM   8108 C CD1 . TRP B 1 500 ? -0.089  20.573  -29.554 1.00 27.51  ? 500  TRP B CD1 1 
ATOM   8109 C CD2 . TRP B 1 500 ? -1.344  19.323  -30.925 1.00 30.01  ? 500  TRP B CD2 1 
ATOM   8110 N NE1 . TRP B 1 500 ? 0.659   19.485  -29.931 1.00 25.45  ? 500  TRP B NE1 1 
ATOM   8111 C CE2 . TRP B 1 500 ? -0.087  18.702  -30.772 1.00 31.63  ? 500  TRP B CE2 1 
ATOM   8112 C CE3 . TRP B 1 500 ? -2.300  18.720  -31.748 1.00 33.21  ? 500  TRP B CE3 1 
ATOM   8113 C CZ2 . TRP B 1 500 ? 0.236   17.506  -31.406 1.00 30.81  ? 500  TRP B CZ2 1 
ATOM   8114 C CZ3 . TRP B 1 500 ? -1.979  17.536  -32.380 1.00 32.51  ? 500  TRP B CZ3 1 
ATOM   8115 C CH2 . TRP B 1 500 ? -0.720  16.941  -32.206 1.00 33.33  ? 500  TRP B CH2 1 
ATOM   8116 N N   . PRO B 1 501 ? -0.441  23.629  -27.862 1.00 36.04  ? 501  PRO B N   1 
ATOM   8117 C CA  . PRO B 1 501 ? 0.636   24.617  -27.981 1.00 31.76  ? 501  PRO B CA  1 
ATOM   8118 C C   . PRO B 1 501 ? 1.874   24.032  -28.656 1.00 29.32  ? 501  PRO B C   1 
ATOM   8119 O O   . PRO B 1 501 ? 2.062   22.812  -28.653 1.00 32.38  ? 501  PRO B O   1 
ATOM   8120 C CB  . PRO B 1 501 ? 0.935   24.980  -26.525 1.00 33.45  ? 501  PRO B CB  1 
ATOM   8121 C CG  . PRO B 1 501 ? 0.609   23.762  -25.773 1.00 34.53  ? 501  PRO B CG  1 
ATOM   8122 C CD  . PRO B 1 501 ? -0.540  23.087  -26.496 1.00 34.66  ? 501  PRO B CD  1 
ATOM   8123 N N   . PRO B 1 502 ? 2.710   24.898  -29.247 1.00 30.66  ? 502  PRO B N   1 
ATOM   8124 C CA  . PRO B 1 502 ? 3.980   24.467  -29.840 1.00 29.21  ? 502  PRO B CA  1 
ATOM   8125 C C   . PRO B 1 502 ? 4.944   23.921  -28.782 1.00 32.66  ? 502  PRO B C   1 
ATOM   8126 O O   . PRO B 1 502 ? 5.053   24.483  -27.696 1.00 34.35  ? 502  PRO B O   1 
ATOM   8127 C CB  . PRO B 1 502 ? 4.544   25.758  -30.429 1.00 29.37  ? 502  PRO B CB  1 
ATOM   8128 C CG  . PRO B 1 502 ? 3.359   26.633  -30.643 1.00 31.05  ? 502  PRO B CG  1 
ATOM   8129 C CD  . PRO B 1 502 ? 2.423   26.314  -29.523 1.00 31.59  ? 502  PRO B CD  1 
ATOM   8130 N N   . TYR B 1 503 ? 5.618   22.824  -29.103 1.00 32.15  ? 503  TYR B N   1 
ATOM   8131 C CA  . TYR B 1 503 ? 6.720   22.326  -28.287 1.00 35.76  ? 503  TYR B CA  1 
ATOM   8132 C C   . TYR B 1 503 ? 7.888   23.308  -28.338 1.00 34.51  ? 503  TYR B C   1 
ATOM   8133 O O   . TYR B 1 503 ? 8.283   23.755  -29.416 1.00 32.61  ? 503  TYR B O   1 
ATOM   8134 C CB  . TYR B 1 503 ? 7.190   20.957  -28.801 1.00 31.86  ? 503  TYR B CB  1 
ATOM   8135 C CG  . TYR B 1 503 ? 8.276   20.316  -27.954 1.00 35.21  ? 503  TYR B CG  1 
ATOM   8136 C CD1 . TYR B 1 503 ? 9.626   20.562  -28.205 1.00 36.13  ? 503  TYR B CD1 1 
ATOM   8137 C CD2 . TYR B 1 503 ? 7.951   19.455  -26.905 1.00 32.13  ? 503  TYR B CD2 1 
ATOM   8138 C CE1 . TYR B 1 503 ? 10.617  19.976  -27.428 1.00 35.23  ? 503  TYR B CE1 1 
ATOM   8139 C CE2 . TYR B 1 503 ? 8.936   18.864  -26.124 1.00 29.06  ? 503  TYR B CE2 1 
ATOM   8140 C CZ  . TYR B 1 503 ? 10.262  19.129  -26.386 1.00 33.35  ? 503  TYR B CZ  1 
ATOM   8141 O OH  . TYR B 1 503 ? 11.231  18.543  -25.615 1.00 35.74  ? 503  TYR B OH  1 
ATOM   8142 N N   . THR B 1 504 ? 8.444   23.634  -27.176 1.00 28.53  ? 504  THR B N   1 
ATOM   8143 C CA  . THR B 1 504 ? 9.610   24.506  -27.109 1.00 35.29  ? 504  THR B CA  1 
ATOM   8144 C C   . THR B 1 504 ? 10.625  23.908  -26.141 1.00 38.87  ? 504  THR B C   1 
ATOM   8145 O O   . THR B 1 504 ? 10.295  23.031  -25.357 1.00 35.66  ? 504  THR B O   1 
ATOM   8146 C CB  . THR B 1 504 ? 9.239   25.914  -26.631 1.00 34.10  ? 504  THR B CB  1 
ATOM   8147 O OG1 . THR B 1 504 ? 8.620   25.828  -25.342 1.00 34.61  ? 504  THR B OG1 1 
ATOM   8148 C CG2 . THR B 1 504 ? 8.278   26.579  -27.606 1.00 34.75  ? 504  THR B CG2 1 
ATOM   8149 N N   . THR B 1 505 ? 11.866  24.368  -26.194 1.00 41.53  ? 505  THR B N   1 
ATOM   8150 C CA  . THR B 1 505 ? 12.870  23.813  -25.300 1.00 44.07  ? 505  THR B CA  1 
ATOM   8151 C C   . THR B 1 505 ? 12.583  24.267  -23.867 1.00 47.45  ? 505  THR B C   1 
ATOM   8152 O O   . THR B 1 505 ? 12.761  23.503  -22.930 1.00 47.65  ? 505  THR B O   1 
ATOM   8153 C CB  . THR B 1 505 ? 14.305  24.192  -25.736 1.00 47.02  ? 505  THR B CB  1 
ATOM   8154 O OG1 . THR B 1 505 ? 14.372  25.594  -26.041 1.00 47.50  ? 505  THR B OG1 1 
ATOM   8155 C CG2 . THR B 1 505 ? 14.701  23.412  -26.973 1.00 44.16  ? 505  THR B CG2 1 
ATOM   8156 N N   . ALA B 1 506 ? 12.099  25.500  -23.721 1.00 44.76  ? 506  ALA B N   1 
ATOM   8157 C CA  . ALA B 1 506 ? 11.815  26.084  -22.412 1.00 50.60  ? 506  ALA B CA  1 
ATOM   8158 C C   . ALA B 1 506 ? 10.715  25.356  -21.639 1.00 56.17  ? 506  ALA B C   1 
ATOM   8159 O O   . ALA B 1 506 ? 10.920  24.956  -20.490 1.00 60.80  ? 506  ALA B O   1 
ATOM   8160 C CB  . ALA B 1 506 ? 11.453  27.551  -22.563 1.00 41.42  ? 506  ALA B CB  1 
ATOM   8161 N N   . ALA B 1 507 ? 9.553   25.186  -22.270 1.00 47.96  ? 507  ALA B N   1 
ATOM   8162 C CA  . ALA B 1 507 ? 8.390   24.660  -21.571 1.00 40.94  ? 507  ALA B CA  1 
ATOM   8163 C C   . ALA B 1 507 ? 8.072   23.199  -21.920 1.00 38.69  ? 507  ALA B C   1 
ATOM   8164 O O   . ALA B 1 507 ? 7.402   22.502  -21.158 1.00 37.29  ? 507  ALA B O   1 
ATOM   8165 C CB  . ALA B 1 507 ? 7.188   25.553  -21.814 1.00 38.47  ? 507  ALA B CB  1 
ATOM   8166 N N   . GLN B 1 508 ? 8.545   22.743  -23.073 1.00 32.51  ? 508  GLN B N   1 
ATOM   8167 C CA  . GLN B 1 508 ? 8.414   21.337  -23.470 1.00 38.21  ? 508  GLN B CA  1 
ATOM   8168 C C   . GLN B 1 508 ? 6.980   20.785  -23.458 1.00 39.75  ? 508  GLN B C   1 
ATOM   8169 O O   . GLN B 1 508 ? 6.741   19.644  -23.056 1.00 35.13  ? 508  GLN B O   1 
ATOM   8170 C CB  . GLN B 1 508 ? 9.342   20.468  -22.620 1.00 31.45  ? 508  GLN B CB  1 
ATOM   8171 C CG  . GLN B 1 508 ? 10.755  21.057  -22.477 1.00 36.94  ? 508  GLN B CG  1 
ATOM   8172 C CD  . GLN B 1 508 ? 11.636  20.224  -21.576 1.00 39.07  ? 508  GLN B CD  1 
ATOM   8173 O OE1 . GLN B 1 508 ? 11.511  19.004  -21.541 1.00 42.28  ? 508  GLN B OE1 1 
ATOM   8174 N NE2 . GLN B 1 508 ? 12.511  20.878  -20.823 1.00 46.01  ? 508  GLN B NE2 1 
ATOM   8175 N N   . GLN B 1 509 ? 6.032   21.592  -23.926 1.00 40.44  ? 509  GLN B N   1 
ATOM   8176 C CA  . GLN B 1 509 ? 4.625   21.189  -23.938 1.00 34.21  ? 509  GLN B CA  1 
ATOM   8177 C C   . GLN B 1 509 ? 4.273   20.231  -25.062 1.00 31.68  ? 509  GLN B C   1 
ATOM   8178 O O   . GLN B 1 509 ? 4.667   20.430  -26.210 1.00 29.08  ? 509  GLN B O   1 
ATOM   8179 C CB  . GLN B 1 509 ? 3.729   22.412  -24.015 1.00 31.17  ? 509  GLN B CB  1 
ATOM   8180 C CG  . GLN B 1 509 ? 3.745   23.236  -22.755 1.00 34.40  ? 509  GLN B CG  1 
ATOM   8181 C CD  . GLN B 1 509 ? 3.165   24.611  -22.970 1.00 42.27  ? 509  GLN B CD  1 
ATOM   8182 O OE1 . GLN B 1 509 ? 3.671   25.382  -23.782 1.00 39.96  ? 509  GLN B OE1 1 
ATOM   8183 N NE2 . GLN B 1 509 ? 2.092   24.929  -22.247 1.00 41.97  ? 509  GLN B NE2 1 
ATOM   8184 N N   . TYR B 1 510 ? 3.530   19.189  -24.714 1.00 31.85  ? 510  TYR B N   1 
ATOM   8185 C CA  . TYR B 1 510 ? 2.974   18.252  -25.689 1.00 32.97  ? 510  TYR B CA  1 
ATOM   8186 C C   . TYR B 1 510 ? 1.571   17.839  -25.232 1.00 26.81  ? 510  TYR B C   1 
ATOM   8187 O O   . TYR B 1 510 ? 1.144   18.171  -24.126 1.00 28.81  ? 510  TYR B O   1 
ATOM   8188 C CB  . TYR B 1 510 ? 3.879   17.030  -25.856 1.00 24.61  ? 510  TYR B CB  1 
ATOM   8189 C CG  . TYR B 1 510 ? 3.963   16.175  -24.619 1.00 25.55  ? 510  TYR B CG  1 
ATOM   8190 C CD1 . TYR B 1 510 ? 4.714   16.582  -23.520 1.00 29.21  ? 510  TYR B CD1 1 
ATOM   8191 C CD2 . TYR B 1 510 ? 3.291   14.954  -24.542 1.00 28.26  ? 510  TYR B CD2 1 
ATOM   8192 C CE1 . TYR B 1 510 ? 4.786   15.809  -22.369 1.00 31.97  ? 510  TYR B CE1 1 
ATOM   8193 C CE2 . TYR B 1 510 ? 3.360   14.164  -23.392 1.00 26.83  ? 510  TYR B CE2 1 
ATOM   8194 C CZ  . TYR B 1 510 ? 4.113   14.598  -22.320 1.00 32.00  ? 510  TYR B CZ  1 
ATOM   8195 O OH  . TYR B 1 510 ? 4.184   13.833  -21.189 1.00 34.66  ? 510  TYR B OH  1 
ATOM   8196 N N   . VAL B 1 511 ? 0.839   17.131  -26.078 1.00 26.10  ? 511  VAL B N   1 
ATOM   8197 C CA  . VAL B 1 511 ? -0.535  16.810  -25.745 1.00 27.58  ? 511  VAL B CA  1 
ATOM   8198 C C   . VAL B 1 511 ? -0.784  15.320  -25.832 1.00 32.31  ? 511  VAL B C   1 
ATOM   8199 O O   . VAL B 1 511 ? -0.124  14.598  -26.577 1.00 28.91  ? 511  VAL B O   1 
ATOM   8200 C CB  . VAL B 1 511 ? -1.547  17.548  -26.660 1.00 28.28  ? 511  VAL B CB  1 
ATOM   8201 C CG1 . VAL B 1 511 ? -1.286  19.037  -26.669 1.00 29.00  ? 511  VAL B CG1 1 
ATOM   8202 C CG2 . VAL B 1 511 ? -1.476  17.004  -28.073 1.00 31.60  ? 511  VAL B CG2 1 
ATOM   8203 N N   . SER B 1 512 ? -1.755  14.865  -25.064 1.00 31.57  ? 512  SER B N   1 
ATOM   8204 C CA  . SER B 1 512 ? -2.193  13.493  -25.154 1.00 33.54  ? 512  SER B CA  1 
ATOM   8205 C C   . SER B 1 512 ? -3.336  13.357  -26.165 1.00 38.70  ? 512  SER B C   1 
ATOM   8206 O O   . SER B 1 512 ? -4.326  14.085  -26.114 1.00 31.33  ? 512  SER B O   1 
ATOM   8207 C CB  . SER B 1 512 ? -2.628  13.003  -23.777 1.00 31.29  ? 512  SER B CB  1 
ATOM   8208 O OG  . SER B 1 512 ? -3.496  13.945  -23.188 1.00 38.17  ? 512  SER B OG  1 
ATOM   8209 N N   . LEU B 1 513 ? -3.182  12.430  -27.100 1.00 37.32  ? 513  LEU B N   1 
ATOM   8210 C CA  . LEU B 1 513 ? -4.268  12.076  -28.003 1.00 34.50  ? 513  LEU B CA  1 
ATOM   8211 C C   . LEU B 1 513 ? -4.973  10.830  -27.472 1.00 37.88  ? 513  LEU B C   1 
ATOM   8212 O O   . LEU B 1 513 ? -4.411  9.725   -27.492 1.00 32.77  ? 513  LEU B O   1 
ATOM   8213 C CB  . LEU B 1 513 ? -3.724  11.827  -29.405 1.00 33.26  ? 513  LEU B CB  1 
ATOM   8214 C CG  . LEU B 1 513 ? -3.008  13.046  -29.985 1.00 36.25  ? 513  LEU B CG  1 
ATOM   8215 C CD1 . LEU B 1 513 ? -2.416  12.770  -31.369 1.00 33.37  ? 513  LEU B CD1 1 
ATOM   8216 C CD2 . LEU B 1 513 ? -3.975  14.220  -30.035 1.00 28.76  ? 513  LEU B CD2 1 
ATOM   8217 N N   . ASN B 1 514 ? -6.180  11.021  -26.948 1.00 29.94  ? 514  ASN B N   1 
ATOM   8218 C CA  . ASN B 1 514 ? -7.016  9.902   -26.505 1.00 40.20  ? 514  ASN B CA  1 
ATOM   8219 C C   . ASN B 1 514 ? -8.483  10.284  -26.613 1.00 37.45  ? 514  ASN B C   1 
ATOM   8220 O O   . ASN B 1 514 ? -8.812  11.284  -27.255 1.00 35.24  ? 514  ASN B O   1 
ATOM   8221 C CB  . ASN B 1 514 ? -6.655  9.434   -25.085 1.00 46.61  ? 514  ASN B CB  1 
ATOM   8222 C CG  . ASN B 1 514 ? -6.640  10.572  -24.065 1.00 48.90  ? 514  ASN B CG  1 
ATOM   8223 O OD1 . ASN B 1 514 ? -7.539  11.418  -24.037 1.00 52.00  ? 514  ASN B OD1 1 
ATOM   8224 N ND2 . ASN B 1 514 ? -5.605  10.595  -23.223 1.00 42.41  ? 514  ASN B ND2 1 
ATOM   8225 N N   . LEU B 1 515 ? -9.363  9.520   -25.984 1.00 37.04  ? 515  LEU B N   1 
ATOM   8226 C CA  . LEU B 1 515 ? -10.790 9.794   -26.128 1.00 38.94  ? 515  LEU B CA  1 
ATOM   8227 C C   . LEU B 1 515 ? -11.245 11.063  -25.407 1.00 45.66  ? 515  LEU B C   1 
ATOM   8228 O O   . LEU B 1 515 ? -12.285 11.620  -25.743 1.00 49.44  ? 515  LEU B O   1 
ATOM   8229 C CB  . LEU B 1 515 ? -11.614 8.599   -25.671 1.00 42.76  ? 515  LEU B CB  1 
ATOM   8230 C CG  . LEU B 1 515 ? -11.310 7.341   -26.481 1.00 54.62  ? 515  LEU B CG  1 
ATOM   8231 C CD1 . LEU B 1 515 ? -11.978 6.134   -25.865 1.00 47.71  ? 515  LEU B CD1 1 
ATOM   8232 C CD2 . LEU B 1 515 ? -11.738 7.528   -27.931 1.00 42.05  ? 515  LEU B CD2 1 
ATOM   8233 N N   . LYS B 1 516 ? -10.465 11.518  -24.426 1.00 42.56  ? 516  LYS B N   1 
ATOM   8234 C CA  . LYS B 1 516 ? -10.779 12.737  -23.676 1.00 43.32  ? 516  LYS B CA  1 
ATOM   8235 C C   . LYS B 1 516 ? -10.226 13.931  -24.440 1.00 43.54  ? 516  LYS B C   1 
ATOM   8236 O O   . LYS B 1 516 ? -9.398  13.761  -25.327 1.00 44.31  ? 516  LYS B O   1 
ATOM   8237 C CB  . LYS B 1 516 ? -10.156 12.671  -22.281 1.00 41.80  ? 516  LYS B CB  1 
ATOM   8238 C CG  . LYS B 1 516 ? -10.579 11.464  -21.474 1.00 52.07  ? 516  LYS B CG  1 
ATOM   8239 C CD  . LYS B 1 516 ? -9.538  11.131  -20.423 1.00 65.15  ? 516  LYS B CD  1 
ATOM   8240 C CE  . LYS B 1 516 ? -9.935  9.905   -19.616 1.00 82.10  ? 516  LYS B CE  1 
ATOM   8241 N NZ  . LYS B 1 516 ? -8.807  9.412   -18.774 1.00 88.63  ? 516  LYS B NZ  1 
ATOM   8242 N N   . PRO B 1 517 ? -10.681 15.147  -24.112 1.00 44.88  ? 517  PRO B N   1 
ATOM   8243 C CA  . PRO B 1 517 ? -10.121 16.331  -24.786 1.00 47.05  ? 517  PRO B CA  1 
ATOM   8244 C C   . PRO B 1 517 ? -8.613  16.490  -24.574 1.00 43.31  ? 517  PRO B C   1 
ATOM   8245 O O   . PRO B 1 517 ? -8.063  15.929  -23.625 1.00 44.92  ? 517  PRO B O   1 
ATOM   8246 C CB  . PRO B 1 517 ? -10.868 17.491  -24.126 1.00 51.44  ? 517  PRO B CB  1 
ATOM   8247 C CG  . PRO B 1 517 ? -12.167 16.887  -23.667 1.00 41.94  ? 517  PRO B CG  1 
ATOM   8248 C CD  . PRO B 1 517 ? -11.824 15.488  -23.248 1.00 44.46  ? 517  PRO B CD  1 
ATOM   8249 N N   . LEU B 1 518 ? -7.959  17.237  -25.461 1.00 42.21  ? 518  LEU B N   1 
ATOM   8250 C CA  . LEU B 1 518 ? -6.522  17.467  -25.362 1.00 37.42  ? 518  LEU B CA  1 
ATOM   8251 C C   . LEU B 1 518 ? -6.104  17.889  -23.965 1.00 37.82  ? 518  LEU B C   1 
ATOM   8252 O O   . LEU B 1 518 ? -6.689  18.783  -23.360 1.00 35.85  ? 518  LEU B O   1 
ATOM   8253 C CB  . LEU B 1 518 ? -6.065  18.560  -26.326 1.00 31.72  ? 518  LEU B CB  1 
ATOM   8254 C CG  . LEU B 1 518 ? -5.983  18.339  -27.822 1.00 33.78  ? 518  LEU B CG  1 
ATOM   8255 C CD1 . LEU B 1 518 ? -5.340  19.561  -28.459 1.00 35.39  ? 518  LEU B CD1 1 
ATOM   8256 C CD2 . LEU B 1 518 ? -5.194  17.087  -28.136 1.00 36.92  ? 518  LEU B CD2 1 
ATOM   8257 N N   . GLU B 1 519 ? -5.066  17.254  -23.460 1.00 38.75  ? 519  GLU B N   1 
ATOM   8258 C CA  . GLU B 1 519 ? -4.490  17.668  -22.201 1.00 38.55  ? 519  GLU B CA  1 
ATOM   8259 C C   . GLU B 1 519 ? -3.047  18.075  -22.507 1.00 39.44  ? 519  GLU B C   1 
ATOM   8260 O O   . GLU B 1 519 ? -2.344  17.377  -23.245 1.00 32.74  ? 519  GLU B O   1 
ATOM   8261 C CB  . GLU B 1 519 ? -4.573  16.500  -21.224 1.00 37.22  ? 519  GLU B CB  1 
ATOM   8262 C CG  . GLU B 1 519 ? -3.880  16.681  -19.905 1.00 48.79  ? 519  GLU B CG  1 
ATOM   8263 C CD  . GLU B 1 519 ? -4.008  15.434  -19.044 1.00 57.74  ? 519  GLU B CD  1 
ATOM   8264 O OE1 . GLU B 1 519 ? -5.159  15.052  -18.719 1.00 64.85  ? 519  GLU B OE1 1 
ATOM   8265 O OE2 . GLU B 1 519 ? -2.963  14.831  -18.709 1.00 52.04  ? 519  GLU B OE2 1 
ATOM   8266 N N   . VAL B 1 520 ? -2.622  19.219  -21.980 1.00 35.95  ? 520  VAL B N   1 
ATOM   8267 C CA  . VAL B 1 520 ? -1.274  19.713  -22.216 1.00 30.60  ? 520  VAL B CA  1 
ATOM   8268 C C   . VAL B 1 520 ? -0.333  19.200  -21.132 1.00 30.64  ? 520  VAL B C   1 
ATOM   8269 O O   . VAL B 1 520 ? -0.524  19.468  -19.957 1.00 32.86  ? 520  VAL B O   1 
ATOM   8270 C CB  . VAL B 1 520 ? -1.244  21.273  -22.243 1.00 39.91  ? 520  VAL B CB  1 
ATOM   8271 C CG1 . VAL B 1 520 ? 0.180   21.792  -22.385 1.00 32.14  ? 520  VAL B CG1 1 
ATOM   8272 C CG2 . VAL B 1 520 ? -2.126  21.805  -23.378 1.00 32.78  ? 520  VAL B CG2 1 
ATOM   8273 N N   . ARG B 1 521 ? 0.694   18.460  -21.521 1.00 32.13  ? 521  ARG B N   1 
ATOM   8274 C CA  . ARG B 1 521 ? 1.680   17.991  -20.547 1.00 31.04  ? 521  ARG B CA  1 
ATOM   8275 C C   . ARG B 1 521 ? 3.033   18.634  -20.808 1.00 30.79  ? 521  ARG B C   1 
ATOM   8276 O O   . ARG B 1 521 ? 3.294   19.130  -21.907 1.00 30.31  ? 521  ARG B O   1 
ATOM   8277 C CB  . ARG B 1 521 ? 1.794   16.469  -20.585 1.00 29.75  ? 521  ARG B CB  1 
ATOM   8278 C CG  . ARG B 1 521 ? 0.587   15.772  -20.006 1.00 35.84  ? 521  ARG B CG  1 
ATOM   8279 C CD  . ARG B 1 521 ? 0.610   14.274  -20.275 1.00 39.77  ? 521  ARG B CD  1 
ATOM   8280 N NE  . ARG B 1 521 ? -0.731  13.701  -20.176 1.00 41.02  ? 521  ARG B NE  1 
ATOM   8281 C CZ  . ARG B 1 521 ? -1.033  12.454  -20.523 1.00 43.12  ? 521  ARG B CZ  1 
ATOM   8282 N NH1 . ARG B 1 521 ? -0.084  11.652  -20.990 1.00 29.00  ? 521  ARG B NH1 1 
ATOM   8283 N NH2 . ARG B 1 521 ? -2.280  12.012  -20.414 1.00 32.14  ? 521  ARG B NH2 1 
ATOM   8284 N N   . ARG B 1 522 ? 3.888   18.648  -19.795 1.00 34.94  ? 522  ARG B N   1 
ATOM   8285 C CA  . ARG B 1 522 ? 5.199   19.272  -19.938 1.00 38.03  ? 522  ARG B CA  1 
ATOM   8286 C C   . ARG B 1 522 ? 6.291   18.246  -19.681 1.00 35.76  ? 522  ARG B C   1 
ATOM   8287 O O   . ARG B 1 522 ? 6.314   17.618  -18.633 1.00 38.86  ? 522  ARG B O   1 
ATOM   8288 C CB  . ARG B 1 522 ? 5.331   20.488  -19.008 1.00 31.40  ? 522  ARG B CB  1 
ATOM   8289 C CG  . ARG B 1 522 ? 4.459   21.661  -19.462 1.00 38.97  ? 522  ARG B CG  1 
ATOM   8290 C CD  . ARG B 1 522 ? 4.499   22.868  -18.538 1.00 36.52  ? 522  ARG B CD  1 
ATOM   8291 N NE  . ARG B 1 522 ? 5.843   23.400  -18.366 1.00 45.71  ? 522  ARG B NE  1 
ATOM   8292 C CZ  . ARG B 1 522 ? 6.119   24.565  -17.783 1.00 52.12  ? 522  ARG B CZ  1 
ATOM   8293 N NH1 . ARG B 1 522 ? 5.138   25.341  -17.330 1.00 43.67  ? 522  ARG B NH1 1 
ATOM   8294 N NH2 . ARG B 1 522 ? 7.380   24.960  -17.669 1.00 41.38  ? 522  ARG B NH2 1 
ATOM   8295 N N   . GLY B 1 523 ? 7.167   18.050  -20.663 1.00 30.87  ? 523  GLY B N   1 
ATOM   8296 C CA  . GLY B 1 523 ? 8.297   17.158  -20.500 1.00 34.59  ? 523  GLY B CA  1 
ATOM   8297 C C   . GLY B 1 523 ? 8.042   15.754  -20.997 1.00 41.38  ? 523  GLY B C   1 
ATOM   8298 O O   . GLY B 1 523 ? 7.263   15.000  -20.417 1.00 43.15  ? 523  GLY B O   1 
ATOM   8299 N N   . LEU B 1 524 ? 8.718   15.392  -22.077 1.00 45.62  ? 524  LEU B N   1 
ATOM   8300 C CA  . LEU B 1 524 ? 8.550   14.069  -22.657 1.00 45.87  ? 524  LEU B CA  1 
ATOM   8301 C C   . LEU B 1 524 ? 9.585   13.131  -22.046 1.00 38.66  ? 524  LEU B C   1 
ATOM   8302 O O   . LEU B 1 524 ? 10.704  13.031  -22.551 1.00 39.55  ? 524  LEU B O   1 
ATOM   8303 C CB  . LEU B 1 524 ? 8.724   14.152  -24.170 1.00 46.44  ? 524  LEU B CB  1 
ATOM   8304 C CG  . LEU B 1 524 ? 8.043   13.067  -24.992 1.00 48.38  ? 524  LEU B CG  1 
ATOM   8305 C CD1 . LEU B 1 524 ? 6.573   13.033  -24.671 1.00 50.70  ? 524  LEU B CD1 1 
ATOM   8306 C CD2 . LEU B 1 524 ? 8.262   13.335  -26.468 1.00 47.77  ? 524  LEU B CD2 1 
ATOM   8307 N N   . ARG B 1 525 ? 9.192   12.450  -20.968 1.00 33.06  ? 525  ARG B N   1 
ATOM   8308 C CA  . ARG B 1 525 ? 10.094  11.648  -20.130 1.00 37.04  ? 525  ARG B CA  1 
ATOM   8309 C C   . ARG B 1 525 ? 11.446  12.348  -19.926 1.00 38.61  ? 525  ARG B C   1 
ATOM   8310 O O   . ARG B 1 525 ? 12.501  11.820  -20.281 1.00 39.46  ? 525  ARG B O   1 
ATOM   8311 C CB  . ARG B 1 525 ? 10.276  10.254  -20.725 1.00 39.21  ? 525  ARG B CB  1 
ATOM   8312 C CG  . ARG B 1 525 ? 9.053   9.771   -21.469 1.00 50.65  ? 525  ARG B CG  1 
ATOM   8313 C CD  . ARG B 1 525 ? 8.267   8.734   -20.689 1.00 57.82  ? 525  ARG B CD  1 
ATOM   8314 N NE  . ARG B 1 525 ? 8.517   7.377   -21.171 1.00 60.11  ? 525  ARG B NE  1 
ATOM   8315 C CZ  . ARG B 1 525 ? 7.606   6.604   -21.756 1.00 61.29  ? 525  ARG B CZ  1 
ATOM   8316 N NH1 . ARG B 1 525 ? 6.365   7.041   -21.938 1.00 64.26  ? 525  ARG B NH1 1 
ATOM   8317 N NH2 . ARG B 1 525 ? 7.933   5.382   -22.148 1.00 62.43  ? 525  ARG B NH2 1 
ATOM   8318 N N   . ALA B 1 526 ? 11.404  13.547  -19.358 1.00 36.85  ? 526  ALA B N   1 
ATOM   8319 C CA  . ALA B 1 526 ? 12.578  14.412  -19.370 1.00 34.66  ? 526  ALA B CA  1 
ATOM   8320 C C   . ALA B 1 526 ? 13.739  13.819  -18.592 1.00 30.82  ? 526  ALA B C   1 
ATOM   8321 O O   . ALA B 1 526 ? 14.873  13.829  -19.076 1.00 34.71  ? 526  ALA B O   1 
ATOM   8322 C CB  . ALA B 1 526 ? 12.236  15.798  -18.847 1.00 40.52  ? 526  ALA B CB  1 
ATOM   8323 N N   . GLN B 1 527 ? 13.456  13.311  -17.396 1.00 26.91  ? 527  GLN B N   1 
ATOM   8324 C CA  . GLN B 1 527 ? 14.502  12.764  -16.537 1.00 33.77  ? 527  GLN B CA  1 
ATOM   8325 C C   . GLN B 1 527 ? 15.135  11.557  -17.199 1.00 33.83  ? 527  GLN B C   1 
ATOM   8326 O O   . GLN B 1 527 ? 16.351  11.503  -17.376 1.00 36.78  ? 527  GLN B O   1 
ATOM   8327 C CB  . GLN B 1 527 ? 13.963  12.383  -15.148 1.00 31.95  ? 527  GLN B CB  1 
ATOM   8328 C CG  . GLN B 1 527 ? 13.549  13.556  -14.309 1.00 38.58  ? 527  GLN B CG  1 
ATOM   8329 C CD  . GLN B 1 527 ? 14.656  14.601  -14.183 1.00 45.24  ? 527  GLN B CD  1 
ATOM   8330 O OE1 . GLN B 1 527 ? 14.560  15.691  -14.761 1.00 43.91  ? 527  GLN B OE1 1 
ATOM   8331 N NE2 . GLN B 1 527 ? 15.712  14.273  -13.420 1.00 40.53  ? 527  GLN B NE2 1 
ATOM   8332 N N   . THR B 1 528 ? 14.293  10.598  -17.575 1.00 27.68  ? 528  THR B N   1 
ATOM   8333 C CA  . THR B 1 528 ? 14.752  9.383   -18.232 1.00 28.22  ? 528  THR B CA  1 
ATOM   8334 C C   . THR B 1 528 ? 15.458  9.655   -19.573 1.00 34.55  ? 528  THR B C   1 
ATOM   8335 O O   . THR B 1 528 ? 16.490  9.046   -19.864 1.00 37.52  ? 528  THR B O   1 
ATOM   8336 C CB  . THR B 1 528 ? 13.593  8.357   -18.364 1.00 35.69  ? 528  THR B CB  1 
ATOM   8337 O OG1 . THR B 1 528 ? 13.360  7.758   -17.084 1.00 35.84  ? 528  THR B OG1 1 
ATOM   8338 C CG2 . THR B 1 528 ? 13.913  7.257   -19.382 1.00 36.25  ? 528  THR B CG2 1 
ATOM   8339 N N   . CYS B 1 529 ? 14.950  10.578  -20.380 1.00 26.59  ? 529  CYS B N   1 
ATOM   8340 C CA  . CYS B 1 529 ? 15.634  10.851  -21.644 1.00 26.77  ? 529  CYS B CA  1 
ATOM   8341 C C   . CYS B 1 529 ? 16.950  11.599  -21.455 1.00 31.98  ? 529  CYS B C   1 
ATOM   8342 O O   . CYS B 1 529 ? 17.829  11.527  -22.314 1.00 29.57  ? 529  CYS B O   1 
ATOM   8343 C CB  . CYS B 1 529 ? 14.716  11.555  -22.649 1.00 35.31  ? 529  CYS B CB  1 
ATOM   8344 S SG  . CYS B 1 529 ? 13.411  10.460  -23.289 1.00 35.30  ? 529  CYS B SG  1 
ATOM   8345 N N   . ALA B 1 530 ? 17.098  12.305  -20.332 1.00 27.38  ? 530  ALA B N   1 
ATOM   8346 C CA  . ALA B 1 530 ? 18.387  12.912  -20.019 1.00 35.13  ? 530  ALA B CA  1 
ATOM   8347 C C   . ALA B 1 530 ? 19.432  11.812  -19.832 1.00 36.70  ? 530  ALA B C   1 
ATOM   8348 O O   . ALA B 1 530 ? 20.579  11.945  -20.261 1.00 36.16  ? 530  ALA B O   1 
ATOM   8349 C CB  . ALA B 1 530 ? 18.305  13.799  -18.765 1.00 29.61  ? 530  ALA B CB  1 
ATOM   8350 N N   . PHE B 1 531 ? 19.028  10.724  -19.190 1.00 29.57  ? 531  PHE B N   1 
ATOM   8351 C CA  . PHE B 1 531 ? 19.905  9.580   -19.033 1.00 31.05  ? 531  PHE B CA  1 
ATOM   8352 C C   . PHE B 1 531 ? 20.339  9.046   -20.401 1.00 32.60  ? 531  PHE B C   1 
ATOM   8353 O O   . PHE B 1 531 ? 21.536  8.918   -20.678 1.00 40.54  ? 531  PHE B O   1 
ATOM   8354 C CB  . PHE B 1 531 ? 19.227  8.497   -18.191 1.00 31.48  ? 531  PHE B CB  1 
ATOM   8355 C CG  . PHE B 1 531 ? 19.910  7.158   -18.254 1.00 36.42  ? 531  PHE B CG  1 
ATOM   8356 C CD1 . PHE B 1 531 ? 21.033  6.897   -17.480 1.00 39.46  ? 531  PHE B CD1 1 
ATOM   8357 C CD2 . PHE B 1 531 ? 19.426  6.152   -19.086 1.00 35.23  ? 531  PHE B CD2 1 
ATOM   8358 C CE1 . PHE B 1 531 ? 21.659  5.656   -17.529 1.00 43.79  ? 531  PHE B CE1 1 
ATOM   8359 C CE2 . PHE B 1 531 ? 20.049  4.913   -19.148 1.00 39.20  ? 531  PHE B CE2 1 
ATOM   8360 C CZ  . PHE B 1 531 ? 21.166  4.661   -18.364 1.00 44.44  ? 531  PHE B CZ  1 
ATOM   8361 N N   . TRP B 1 532 ? 19.372  8.764   -21.265 1.00 31.49  ? 532  TRP B N   1 
ATOM   8362 C CA  . TRP B 1 532 ? 19.687  8.292   -22.609 1.00 36.49  ? 532  TRP B CA  1 
ATOM   8363 C C   . TRP B 1 532 ? 20.431  9.321   -23.462 1.00 34.29  ? 532  TRP B C   1 
ATOM   8364 O O   . TRP B 1 532 ? 21.425  8.983   -24.103 1.00 37.47  ? 532  TRP B O   1 
ATOM   8365 C CB  . TRP B 1 532 ? 18.428  7.826   -23.351 1.00 32.42  ? 532  TRP B CB  1 
ATOM   8366 C CG  . TRP B 1 532 ? 17.818  6.561   -22.811 1.00 38.07  ? 532  TRP B CG  1 
ATOM   8367 C CD1 . TRP B 1 532 ? 16.688  6.456   -22.056 1.00 33.74  ? 532  TRP B CD1 1 
ATOM   8368 C CD2 . TRP B 1 532 ? 18.302  5.218   -22.995 1.00 35.83  ? 532  TRP B CD2 1 
ATOM   8369 N NE1 . TRP B 1 532 ? 16.434  5.135   -21.765 1.00 42.60  ? 532  TRP B NE1 1 
ATOM   8370 C CE2 . TRP B 1 532 ? 17.414  4.358   -22.323 1.00 36.27  ? 532  TRP B CE2 1 
ATOM   8371 C CE3 . TRP B 1 532 ? 19.395  4.665   -23.662 1.00 38.45  ? 532  TRP B CE3 1 
ATOM   8372 C CZ2 . TRP B 1 532 ? 17.587  2.979   -22.298 1.00 39.28  ? 532  TRP B CZ2 1 
ATOM   8373 C CZ3 . TRP B 1 532 ? 19.565  3.292   -23.637 1.00 41.36  ? 532  TRP B CZ3 1 
ATOM   8374 C CH2 . TRP B 1 532 ? 18.666  2.466   -22.960 1.00 41.77  ? 532  TRP B CH2 1 
ATOM   8375 N N   . ASN B 1 533 ? 19.965  10.571  -23.479 1.00 33.00  ? 533  ASN B N   1 
ATOM   8376 C CA  . ASN B 1 533 ? 20.501  11.537  -24.450 1.00 36.58  ? 533  ASN B CA  1 
ATOM   8377 C C   . ASN B 1 533 ? 21.789  12.217  -24.021 1.00 41.32  ? 533  ASN B C   1 
ATOM   8378 O O   . ASN B 1 533 ? 22.613  12.602  -24.857 1.00 36.96  ? 533  ASN B O   1 
ATOM   8379 C CB  . ASN B 1 533 ? 19.471  12.606  -24.799 1.00 40.86  ? 533  ASN B CB  1 
ATOM   8380 C CG  . ASN B 1 533 ? 18.227  12.029  -25.438 1.00 37.69  ? 533  ASN B CG  1 
ATOM   8381 O OD1 . ASN B 1 533 ? 18.232  10.905  -25.926 1.00 41.40  ? 533  ASN B OD1 1 
ATOM   8382 N ND2 . ASN B 1 533 ? 17.156  12.801  -25.436 1.00 30.54  ? 533  ASN B ND2 1 
ATOM   8383 N N   . ARG B 1 534 ? 21.960  12.351  -22.712 1.00 37.87  ? 534  ARG B N   1 
ATOM   8384 C CA  . ARG B 1 534 ? 23.071  13.109  -22.169 1.00 41.89  ? 534  ARG B CA  1 
ATOM   8385 C C   . ARG B 1 534 ? 24.104  12.244  -21.454 1.00 41.93  ? 534  ARG B C   1 
ATOM   8386 O O   . ARG B 1 534 ? 25.299  12.403  -21.671 1.00 44.00  ? 534  ARG B O   1 
ATOM   8387 C CB  . ARG B 1 534 ? 22.556  14.192  -21.217 1.00 42.12  ? 534  ARG B CB  1 
ATOM   8388 C CG  . ARG B 1 534 ? 21.792  15.307  -21.889 1.00 41.54  ? 534  ARG B CG  1 
ATOM   8389 C CD  . ARG B 1 534 ? 21.215  16.238  -20.855 1.00 43.75  ? 534  ARG B CD  1 
ATOM   8390 N NE  . ARG B 1 534 ? 20.224  17.123  -21.451 1.00 48.77  ? 534  ARG B NE  1 
ATOM   8391 C CZ  . ARG B 1 534 ? 20.458  18.383  -21.803 1.00 47.69  ? 534  ARG B CZ  1 
ATOM   8392 N NH1 . ARG B 1 534 ? 21.658  18.931  -21.600 1.00 43.24  ? 534  ARG B NH1 1 
ATOM   8393 N NH2 . ARG B 1 534 ? 19.475  19.098  -22.338 1.00 45.39  ? 534  ARG B NH2 1 
ATOM   8394 N N   . PHE B 1 535 ? 23.654  11.341  -20.593 1.00 37.73  ? 535  PHE B N   1 
ATOM   8395 C CA  . PHE B 1 535 ? 24.603  10.591  -19.796 1.00 38.25  ? 535  PHE B CA  1 
ATOM   8396 C C   . PHE B 1 535 ? 25.192  9.398   -20.529 1.00 41.61  ? 535  PHE B C   1 
ATOM   8397 O O   . PHE B 1 535 ? 26.403  9.228   -20.577 1.00 44.65  ? 535  PHE B O   1 
ATOM   8398 C CB  . PHE B 1 535 ? 24.000  10.116  -18.487 1.00 35.36  ? 535  PHE B CB  1 
ATOM   8399 C CG  . PHE B 1 535 ? 24.978  9.380   -17.642 1.00 36.97  ? 535  PHE B CG  1 
ATOM   8400 C CD1 . PHE B 1 535 ? 26.046  10.052  -17.076 1.00 38.04  ? 535  PHE B CD1 1 
ATOM   8401 C CD2 . PHE B 1 535 ? 24.866  8.016   -17.452 1.00 37.89  ? 535  PHE B CD2 1 
ATOM   8402 C CE1 . PHE B 1 535 ? 26.971  9.384   -16.314 1.00 39.68  ? 535  PHE B CE1 1 
ATOM   8403 C CE2 . PHE B 1 535 ? 25.784  7.344   -16.687 1.00 53.79  ? 535  PHE B CE2 1 
ATOM   8404 C CZ  . PHE B 1 535 ? 26.840  8.030   -16.118 1.00 40.50  ? 535  PHE B CZ  1 
ATOM   8405 N N   . LEU B 1 536 ? 24.336  8.560   -21.083 1.00 40.83  ? 536  LEU B N   1 
ATOM   8406 C CA  . LEU B 1 536 ? 24.824  7.355   -21.735 1.00 46.49  ? 536  LEU B CA  1 
ATOM   8407 C C   . LEU B 1 536 ? 25.956  7.562   -22.764 1.00 47.61  ? 536  LEU B C   1 
ATOM   8408 O O   . LEU B 1 536 ? 26.926  6.805   -22.752 1.00 49.54  ? 536  LEU B O   1 
ATOM   8409 C CB  . LEU B 1 536 ? 23.674  6.553   -22.338 1.00 48.30  ? 536  LEU B CB  1 
ATOM   8410 C CG  . LEU B 1 536 ? 23.965  5.066   -22.205 1.00 63.83  ? 536  LEU B CG  1 
ATOM   8411 C CD1 . LEU B 1 536 ? 23.695  4.619   -20.768 1.00 63.69  ? 536  LEU B CD1 1 
ATOM   8412 C CD2 . LEU B 1 536 ? 23.181  4.250   -23.228 1.00 70.61  ? 536  LEU B CD2 1 
ATOM   8413 N N   . PRO B 1 537 ? 25.840  8.574   -23.653 1.00 44.10  ? 537  PRO B N   1 
ATOM   8414 C CA  . PRO B 1 537 ? 26.953  8.821   -24.578 1.00 48.72  ? 537  PRO B CA  1 
ATOM   8415 C C   . PRO B 1 537 ? 28.277  9.102   -23.863 1.00 56.71  ? 537  PRO B C   1 
ATOM   8416 O O   . PRO B 1 537 ? 29.303  8.590   -24.300 1.00 67.62  ? 537  PRO B O   1 
ATOM   8417 C CB  . PRO B 1 537 ? 26.501  10.069  -25.341 1.00 45.95  ? 537  PRO B CB  1 
ATOM   8418 C CG  . PRO B 1 537 ? 25.040  10.005  -25.324 1.00 42.90  ? 537  PRO B CG  1 
ATOM   8419 C CD  . PRO B 1 537 ? 24.672  9.411   -23.989 1.00 40.75  ? 537  PRO B CD  1 
ATOM   8420 N N   . LYS B 1 538 ? 28.255  9.890   -22.788 1.00 50.59  ? 538  LYS B N   1 
ATOM   8421 C CA  . LYS B 1 538 ? 29.475  10.177  -22.039 1.00 51.22  ? 538  LYS B CA  1 
ATOM   8422 C C   . LYS B 1 538 ? 30.026  8.895   -21.433 1.00 55.31  ? 538  LYS B C   1 
ATOM   8423 O O   . LYS B 1 538 ? 31.241  8.717   -21.297 1.00 57.76  ? 538  LYS B O   1 
ATOM   8424 C CB  . LYS B 1 538 ? 29.217  11.201  -20.936 1.00 49.67  ? 538  LYS B CB  1 
ATOM   8425 C CG  . LYS B 1 538 ? 28.837  12.590  -21.427 1.00 57.72  ? 538  LYS B CG  1 
ATOM   8426 C CD  . LYS B 1 538 ? 28.561  13.511  -20.244 1.00 67.98  ? 538  LYS B CD  1 
ATOM   8427 C CE  . LYS B 1 538 ? 28.248  14.932  -20.687 1.00 74.01  ? 538  LYS B CE  1 
ATOM   8428 N NZ  . LYS B 1 538 ? 27.957  15.791  -19.501 1.00 79.01  ? 538  LYS B NZ  1 
ATOM   8429 N N   . LEU B 1 539 ? 29.117  8.000   -21.079 1.00 47.21  ? 539  LEU B N   1 
ATOM   8430 C CA  . LEU B 1 539 ? 29.493  6.757   -20.445 1.00 55.71  ? 539  LEU B CA  1 
ATOM   8431 C C   . LEU B 1 539 ? 30.153  5.825   -21.437 1.00 61.56  ? 539  LEU B C   1 
ATOM   8432 O O   . LEU B 1 539 ? 31.333  5.512   -21.289 1.00 61.80  ? 539  LEU B O   1 
ATOM   8433 C CB  . LEU B 1 539 ? 28.278  6.081   -19.837 1.00 52.87  ? 539  LEU B CB  1 
ATOM   8434 C CG  . LEU B 1 539 ? 28.601  4.741   -19.201 1.00 53.10  ? 539  LEU B CG  1 
ATOM   8435 C CD1 . LEU B 1 539 ? 29.686  4.952   -18.166 1.00 55.70  ? 539  LEU B CD1 1 
ATOM   8436 C CD2 . LEU B 1 539 ? 27.345  4.168   -18.573 1.00 51.22  ? 539  LEU B CD2 1 
ATOM   8437 N N   . LEU B 1 540 ? 29.388  5.386   -22.440 1.00 63.89  ? 540  LEU B N   1 
ATOM   8438 C CA  . LEU B 1 540 ? 29.889  4.480   -23.478 1.00 66.19  ? 540  LEU B CA  1 
ATOM   8439 C C   . LEU B 1 540 ? 31.196  4.996   -24.065 1.00 73.52  ? 540  LEU B C   1 
ATOM   8440 O O   . LEU B 1 540 ? 32.099  4.219   -24.379 1.00 74.99  ? 540  LEU B O   1 
ATOM   8441 C CB  . LEU B 1 540 ? 28.856  4.304   -24.594 1.00 66.63  ? 540  LEU B CB  1 
ATOM   8442 C CG  . LEU B 1 540 ? 27.763  3.244   -24.414 1.00 68.19  ? 540  LEU B CG  1 
ATOM   8443 C CD1 . LEU B 1 540 ? 26.567  3.542   -25.319 1.00 57.87  ? 540  LEU B CD1 1 
ATOM   8444 C CD2 . LEU B 1 540 ? 28.307  1.830   -24.672 1.00 71.98  ? 540  LEU B CD2 1 
ATOM   8445 N N   . SER B 1 541 ? 31.284  6.317   -24.203 1.00 76.35  ? 541  SER B N   1 
ATOM   8446 C CA  . SER B 1 541 ? 32.506  6.976   -24.638 1.00 78.33  ? 541  SER B CA  1 
ATOM   8447 C C   . SER B 1 541 ? 33.674  6.628   -23.717 1.00 87.80  ? 541  SER B C   1 
ATOM   8448 O O   . SER B 1 541 ? 34.696  6.113   -24.169 1.00 97.10  ? 541  SER B O   1 
ATOM   8449 C CB  . SER B 1 541 ? 32.294  8.491   -24.688 1.00 72.81  ? 541  SER B CB  1 
ATOM   8450 O OG  . SER B 1 541 ? 33.526  9.185   -24.714 1.00 76.88  ? 541  SER B OG  1 
ATOM   8451 N N   . ALA B 1 542 ? 33.512  6.894   -22.424 1.00 86.49  ? 542  ALA B N   1 
ATOM   8452 C CA  . ALA B 1 542 ? 34.570  6.636   -21.448 1.00 81.89  ? 542  ALA B CA  1 
ATOM   8453 C C   . ALA B 1 542 ? 34.854  5.142   -21.254 1.00 85.51  ? 542  ALA B C   1 
ATOM   8454 O O   . ALA B 1 542 ? 36.005  4.741   -21.086 1.00 93.93  ? 542  ALA B O   1 
ATOM   8455 C CB  . ALA B 1 542 ? 34.236  7.296   -20.123 1.00 74.19  ? 542  ALA B CB  1 
ATOM   8456 N N   . THR B 1 543 ? 33.809  4.319   -21.286 1.00 84.19  ? 543  THR B N   1 
ATOM   8457 C CA  . THR B 1 543 ? 33.970  2.875   -21.115 1.00 90.17  ? 543  THR B CA  1 
ATOM   8458 C C   . THR B 1 543 ? 34.190  2.117   -22.439 1.00 96.74  ? 543  THR B C   1 
ATOM   8459 O O   . THR B 1 543 ? 33.854  0.936   -22.550 1.00 100.02 ? 543  THR B O   1 
ATOM   8460 C CB  . THR B 1 543 ? 32.785  2.249   -20.320 1.00 104.77 ? 543  THR B CB  1 
ATOM   8461 O OG1 . THR B 1 543 ? 33.010  0.846   -20.132 1.00 109.39 ? 543  THR B OG1 1 
ATOM   8462 C CG2 . THR B 1 543 ? 31.473  2.442   -21.051 1.00 101.56 ? 543  THR B CG2 1 
ATOM   8463 N N   . ALA B 1 544 ? 34.764  2.789   -23.434 1.00 96.33  ? 544  ALA B N   1 
ATOM   8464 C CA  . ALA B 1 544 ? 35.085  2.135   -24.702 1.00 98.26  ? 544  ALA B CA  1 
ATOM   8465 C C   . ALA B 1 544 ? 36.447  1.442   -24.632 1.00 96.98  ? 544  ALA B C   1 
ATOM   8466 O O   . ALA B 1 544 ? 37.329  1.693   -25.451 1.00 99.61  ? 544  ALA B O   1 
ATOM   8467 C CB  . ALA B 1 544 ? 35.038  3.134   -25.860 1.00 95.35  ? 544  ALA B CB  1 
HETATM 8468 C C1  . NAG C 2 .   ? 23.930  35.495  -0.223  1.00 69.00  ? 601  NAG A C1  1 
HETATM 8469 C C2  . NAG C 2 .   ? 24.221  35.714  -1.712  1.00 83.34  ? 601  NAG A C2  1 
HETATM 8470 C C3  . NAG C 2 .   ? 25.542  35.039  -2.093  1.00 86.47  ? 601  NAG A C3  1 
HETATM 8471 C C4  . NAG C 2 .   ? 26.677  35.573  -1.227  1.00 87.75  ? 601  NAG A C4  1 
HETATM 8472 C C5  . NAG C 2 .   ? 26.353  35.425  0.263   1.00 83.26  ? 601  NAG A C5  1 
HETATM 8473 C C6  . NAG C 2 .   ? 27.366  36.120  1.152   1.00 81.76  ? 601  NAG A C6  1 
HETATM 8474 C C7  . NAG C 2 .   ? 22.233  36.069  -3.112  1.00 90.97  ? 601  NAG A C7  1 
HETATM 8475 C C8  . NAG C 2 .   ? 21.173  35.419  -3.954  1.00 90.42  ? 601  NAG A C8  1 
HETATM 8476 N N2  . NAG C 2 .   ? 23.130  35.245  -2.554  1.00 88.78  ? 601  NAG A N2  1 
HETATM 8477 O O3  . NAG C 2 .   ? 25.838  35.279  -3.466  1.00 85.67  ? 601  NAG A O3  1 
HETATM 8478 O O4  . NAG C 2 .   ? 27.890  34.885  -1.523  1.00 87.97  ? 601  NAG A O4  1 
HETATM 8479 O O5  . NAG C 2 .   ? 25.065  35.991  0.577   1.00 78.33  ? 601  NAG A O5  1 
HETATM 8480 O O6  . NAG C 2 .   ? 26.978  37.446  1.488   1.00 80.35  ? 601  NAG A O6  1 
HETATM 8481 O O7  . NAG C 2 .   ? 22.276  37.286  -2.945  1.00 91.65  ? 601  NAG A O7  1 
HETATM 8482 C C   . CO3 D 3 .   ? 39.604  25.184  5.077   1.00 70.57  ? 1549 CO3 A C   1 
HETATM 8483 O O1  . CO3 D 3 .   ? 38.307  25.040  4.542   1.00 65.98  ? 1549 CO3 A O1  1 
HETATM 8484 O O2  . CO3 D 3 .   ? 40.604  24.259  4.699   1.00 74.40  ? 1549 CO3 A O2  1 
HETATM 8485 O O3  . CO3 D 3 .   ? 39.818  26.010  5.956   1.00 64.42  ? 1549 CO3 A O3  1 
HETATM 8486 O O1  . P6G E 4 .   ? 16.507  10.992  -12.367 1.00 78.23  ? 1550 P6G A O1  1 
HETATM 8487 C C2  . P6G E 4 .   ? 17.524  10.346  -12.944 1.00 82.15  ? 1550 P6G A C2  1 
HETATM 8488 C C3  . P6G E 4 .   ? 18.292  10.930  -13.871 1.00 83.85  ? 1550 P6G A C3  1 
HETATM 8489 O O4  . P6G E 4 .   ? 19.399  10.187  -14.464 1.00 85.00  ? 1550 P6G A O4  1 
HETATM 8490 C C5  . P6G E 4 .   ? 20.522  10.836  -15.147 1.00 78.53  ? 1550 P6G A C5  1 
HETATM 8491 C C6  . P6G E 4 .   ? 21.759  10.333  -15.034 1.00 70.23  ? 1550 P6G A C6  1 
HETATM 8492 O O7  . P6G E 4 .   ? 22.022  9.142   -14.213 1.00 63.23  ? 1550 P6G A O7  1 
HETATM 8493 C C8  . P6G E 4 .   ? 23.187  8.305   -14.472 1.00 50.23  ? 1550 P6G A C8  1 
HETATM 8494 C C9  . P6G E 4 .   ? 23.322  7.050   -14.039 1.00 40.78  ? 1550 P6G A C9  1 
HETATM 8495 O O10 . P6G E 4 .   ? 22.332  6.376   -13.214 1.00 42.80  ? 1550 P6G A O10 1 
HETATM 8496 C C11 . P6G E 4 .   ? 22.234  4.955   -13.285 1.00 45.28  ? 1550 P6G A C11 1 
HETATM 8497 C C12 . P6G E 4 .   ? 21.780  4.352   -11.958 1.00 52.44  ? 1550 P6G A C12 1 
HETATM 8498 O O13 . P6G E 4 .   ? 20.484  4.834   -11.622 1.00 60.76  ? 1550 P6G A O13 1 
HETATM 8499 C C14 . P6G E 4 .   ? 19.834  4.437   -10.380 1.00 62.44  ? 1550 P6G A C14 1 
HETATM 8500 C C15 . P6G E 4 .   ? 18.738  5.076   -9.959  1.00 63.29  ? 1550 P6G A C15 1 
HETATM 8501 O O16 . P6G E 4 .   ? 18.176  6.182   -10.723 1.00 63.46  ? 1550 P6G A O16 1 
HETATM 8502 C C17 . P6G E 4 .   ? 16.921  6.011   -11.443 1.00 70.36  ? 1550 P6G A C17 1 
HETATM 8503 C C18 . P6G E 4 .   ? 15.908  6.853   -11.256 1.00 75.30  ? 1550 P6G A C18 1 
HETATM 8504 O O19 . P6G E 4 .   ? 14.764  6.682   -11.918 1.00 76.79  ? 1550 P6G A O19 1 
HETATM 8505 C C1  . AE3 F 5 .   ? 13.284  16.411  -10.462 1.00 57.19  ? 1551 AE3 A C1  1 
HETATM 8506 C C2  . AE3 F 5 .   ? 14.667  16.387  -9.902  1.00 64.86  ? 1551 AE3 A C2  1 
HETATM 8507 O O2  . AE3 F 5 .   ? 15.196  15.153  -9.581  1.00 72.73  ? 1551 AE3 A O2  1 
HETATM 8508 C C3  . AE3 F 5 .   ? 15.835  14.967  -8.373  1.00 77.14  ? 1551 AE3 A C3  1 
HETATM 8509 C C4  . AE3 F 5 .   ? 15.444  13.773  -7.565  1.00 81.21  ? 1551 AE3 A C4  1 
HETATM 8510 O O3  . AE3 F 5 .   ? 16.049  13.625  -6.333  1.00 83.86  ? 1551 AE3 A O3  1 
HETATM 8511 C C5  . AE3 F 5 .   ? 15.370  13.080  -5.262  1.00 79.34  ? 1551 AE3 A C5  1 
HETATM 8512 C C6  . AE3 F 5 .   ? 15.727  13.586  -3.899  1.00 74.56  ? 1551 AE3 A C6  1 
HETATM 8513 O O4  . AE3 F 5 .   ? 16.765  12.990  -3.209  1.00 67.05  ? 1551 AE3 A O4  1 
HETATM 8514 O O3  A HI6 G 6 .   ? 37.703  18.545  9.696   0.50 45.94  ? 1552 HI6 A O3  1 
HETATM 8515 O O3  B HI6 G 6 .   ? 37.979  18.546  9.571   0.50 45.79  ? 1552 HI6 A O3  1 
HETATM 8516 C C14 A HI6 G 6 .   ? 37.877  19.672  10.002  0.50 44.80  ? 1552 HI6 A C14 1 
HETATM 8517 C C14 B HI6 G 6 .   ? 38.060  19.645  9.996   0.50 44.64  ? 1552 HI6 A C14 1 
HETATM 8518 N N4  A HI6 G 6 .   ? 39.121  20.056  10.545  0.50 44.11  ? 1552 HI6 A N4  1 
HETATM 8519 N N4  B HI6 G 6 .   ? 39.232  20.036  10.679  0.50 43.28  ? 1552 HI6 A N4  1 
HETATM 8520 C C11 A HI6 G 6 .   ? 36.737  20.701  9.801   0.50 43.77  ? 1552 HI6 A C11 1 
HETATM 8521 C C11 B HI6 G 6 .   ? 36.882  20.628  9.796   0.50 43.86  ? 1552 HI6 A C11 1 
HETATM 8522 C C10 A HI6 G 6 .   ? 35.723  20.442  8.874   0.50 44.03  ? 1552 HI6 A C10 1 
HETATM 8523 C C10 B HI6 G 6 .   ? 35.928  20.377  8.805   0.50 43.88  ? 1552 HI6 A C10 1 
HETATM 8524 C C9  A HI6 G 6 .   ? 34.738  21.358  8.718   0.50 48.65  ? 1552 HI6 A C9  1 
HETATM 8525 C C9  B HI6 G 6 .   ? 34.907  21.254  8.651   0.50 48.15  ? 1552 HI6 A C9  1 
HETATM 8526 N N3  A HI6 G 6 .   ? 34.727  22.543  9.464   0.50 53.31  ? 1552 HI6 A N3  1 
HETATM 8527 N N3  B HI6 G 6 .   ? 34.801  22.391  9.463   0.50 52.17  ? 1552 HI6 A N3  1 
HETATM 8528 C C13 A HI6 G 6 .   ? 35.696  22.798  10.353  0.50 48.07  ? 1552 HI6 A C13 1 
HETATM 8529 C C13 B HI6 G 6 .   ? 35.711  22.637  10.414  0.50 48.14  ? 1552 HI6 A C13 1 
HETATM 8530 C C12 A HI6 G 6 .   ? 36.707  21.914  10.550  0.50 43.60  ? 1552 HI6 A C12 1 
HETATM 8531 C C12 B HI6 G 6 .   ? 36.755  21.791  10.612  0.50 43.53  ? 1552 HI6 A C12 1 
HETATM 8532 C C8  A HI6 G 6 .   ? 33.638  23.519  9.267   0.50 62.63  ? 1552 HI6 A C8  1 
HETATM 8533 C C8  B HI6 G 6 .   ? 33.674  23.324  9.266   0.50 61.07  ? 1552 HI6 A C8  1 
HETATM 8534 O O2  A HI6 G 6 .   ? 32.494  23.091  8.552   0.50 66.79  ? 1552 HI6 A O2  1 
HETATM 8535 O O2  B HI6 G 6 .   ? 32.509  22.825  8.638   0.50 67.08  ? 1552 HI6 A O2  1 
HETATM 8536 C C7  A HI6 G 6 .   ? 31.667  22.191  9.101   0.50 68.47  ? 1552 HI6 A C7  1 
HETATM 8537 C C7  B HI6 G 6 .   ? 31.783  21.875  9.243   0.50 68.64  ? 1552 HI6 A C7  1 
HETATM 8538 N N2  A HI6 G 6 .   ? 30.925  22.598  10.312  0.50 69.71  ? 1552 HI6 A N2  1 
HETATM 8539 N N2  B HI6 G 6 .   ? 30.918  22.292  10.366  0.50 70.49  ? 1552 HI6 A N2  1 
HETATM 8540 C C2  A HI6 G 6 .   ? 30.302  21.649  11.147  0.50 73.00  ? 1552 HI6 A C2  1 
HETATM 8541 C C2  B HI6 G 6 .   ? 30.339  21.349  11.239  0.50 73.93  ? 1552 HI6 A C2  1 
HETATM 8542 C C1  A HI6 G 6 .   ? 30.357  20.224  10.857  0.50 74.73  ? 1552 HI6 A C1  1 
HETATM 8543 C C1  B HI6 G 6 .   ? 30.565  19.920  11.077  0.50 75.08  ? 1552 HI6 A C1  1 
HETATM 8544 N N1  A HI6 G 6 .   ? 29.743  19.394  11.613  0.50 75.13  ? 1552 HI6 A N1  1 
HETATM 8545 N N1  B HI6 G 6 .   ? 29.643  19.089  11.389  0.50 75.06  ? 1552 HI6 A N1  1 
HETATM 8546 O O1  A HI6 G 6 .   ? 29.687  18.178  11.294  0.50 75.68  ? 1552 HI6 A O1  1 
HETATM 8547 O O1  B HI6 G 6 .   ? 28.518  19.514  11.762  0.50 75.49  ? 1552 HI6 A O1  1 
HETATM 8548 C C3  A HI6 G 6 .   ? 29.614  22.058  12.276  0.50 73.51  ? 1552 HI6 A C3  1 
HETATM 8549 C C3  B HI6 G 6 .   ? 29.533  21.767  12.284  0.50 73.85  ? 1552 HI6 A C3  1 
HETATM 8550 C C4  A HI6 G 6 .   ? 29.520  23.424  12.617  0.50 72.81  ? 1552 HI6 A C4  1 
HETATM 8551 C C4  B HI6 G 6 .   ? 29.273  23.137  12.499  0.50 73.11  ? 1552 HI6 A C4  1 
HETATM 8552 C C5  A HI6 G 6 .   ? 30.158  24.360  11.758  0.50 71.90  ? 1552 HI6 A C5  1 
HETATM 8553 C C5  B HI6 G 6 .   ? 29.869  24.068  11.604  0.50 71.98  ? 1552 HI6 A C5  1 
HETATM 8554 C C6  A HI6 G 6 .   ? 30.851  23.913  10.616  0.50 70.04  ? 1552 HI6 A C6  1 
HETATM 8555 C C6  B HI6 G 6 .   ? 30.685  23.611  10.550  0.50 70.00  ? 1552 HI6 A C6  1 
HETATM 8556 O O3  A HI6 H 6 .   ? 13.004  -7.873  -34.541 0.50 53.39  ? 1545 HI6 B O3  1 
HETATM 8557 O O3  B HI6 H 6 .   ? 16.923  -6.420  -40.460 0.50 25.14  ? 1545 HI6 B O3  1 
HETATM 8558 C C14 A HI6 H 6 .   ? 12.497  -6.818  -34.662 0.50 39.79  ? 1545 HI6 B C14 1 
HETATM 8559 C C14 B HI6 H 6 .   ? 16.206  -7.307  -40.761 0.50 20.44  ? 1545 HI6 B C14 1 
HETATM 8560 N N4  A HI6 H 6 .   ? 13.151  -5.702  -34.132 0.50 12.96  ? 1545 HI6 B N4  1 
HETATM 8561 N N4  B HI6 H 6 .   ? 16.328  -7.892  -42.033 0.50 26.02  ? 1545 HI6 B N4  1 
HETATM 8562 C C11 A HI6 H 6 .   ? 11.140  -6.687  -35.392 0.50 49.82  ? 1545 HI6 B C11 1 
HETATM 8563 C C11 B HI6 H 6 .   ? 15.143  -7.769  -39.750 0.50 14.93  ? 1545 HI6 B C11 1 
HETATM 8564 C C10 A HI6 H 6 .   ? 10.304  -7.801  -35.497 0.50 53.87  ? 1545 HI6 B C10 1 
HETATM 8565 C C10 B HI6 H 6 .   ? 15.201  -7.239  -38.460 0.50 12.65  ? 1545 HI6 B C10 1 
HETATM 8566 C C9  A HI6 H 6 .   ? 9.117   -7.665  -36.136 0.50 58.79  ? 1545 HI6 B C9  1 
HETATM 8567 C C9  B HI6 H 6 .   ? 14.264  -7.627  -37.572 0.50 16.20  ? 1545 HI6 B C9  1 
HETATM 8568 N N3  A HI6 H 6 .   ? 8.722   -6.437  -36.684 0.50 61.76  ? 1545 HI6 B N3  1 
HETATM 8569 N N3  B HI6 H 6 .   ? 13.254  -8.530  -37.929 0.50 21.07  ? 1545 HI6 B N3  1 
HETATM 8570 C C13 A HI6 H 6 .   ? 9.527   -5.371  -36.580 0.50 59.42  ? 1545 HI6 B C13 1 
HETATM 8571 C C13 B HI6 H 6 .   ? 13.193  -9.054  -39.161 0.50 13.55  ? 1545 HI6 B C13 1 
HETATM 8572 C C12 A HI6 H 6 .   ? 10.729  -5.445  -35.955 0.50 53.39  ? 1545 HI6 B C12 1 
HETATM 8573 C C12 B HI6 H 6 .   ? 14.116  -8.699  -40.096 0.50 13.47  ? 1545 HI6 B C12 1 
HETATM 8574 C C8  A HI6 H 6 .   ? 7.415   -6.329  -37.384 0.50 60.65  ? 1545 HI6 B C8  1 
HETATM 8575 C C8  B HI6 H 6 .   ? 12.279  -8.911  -36.898 0.50 30.71  ? 1545 HI6 B C8  1 
HETATM 8576 O O2  A HI6 H 6 .   ? 6.929   -5.047  -37.761 0.50 55.73  ? 1545 HI6 B O2  1 
HETATM 8577 O O2  B HI6 H 6 .   ? 10.914  -8.819  -37.187 0.50 45.06  ? 1545 HI6 B O2  1 
HETATM 8578 C C7  A HI6 H 6 .   ? 5.649   -4.852  -38.127 0.50 40.44  ? 1545 HI6 B C7  1 
HETATM 8579 C C7  B HI6 H 6 .   ? 10.134  -8.303  -36.233 0.50 55.33  ? 1545 HI6 B C7  1 
HETATM 8580 N N2  A HI6 H 6 .   ? 5.241   -3.438  -38.106 0.50 30.76  ? 1545 HI6 B N2  1 
HETATM 8581 N N2  B HI6 H 6 .   ? 8.986   -7.507  -36.697 0.50 60.93  ? 1545 HI6 B N2  1 
HETATM 8582 C C2  A HI6 H 6 .   ? 4.564   -2.878  -37.001 0.50 30.95  ? 1545 HI6 B C2  1 
HETATM 8583 C C2  B HI6 H 6 .   ? 9.001   -6.102  -36.647 0.50 62.13  ? 1545 HI6 B C2  1 
HETATM 8584 C C3  A HI6 H 6 .   ? 4.232   -1.534  -37.016 0.50 33.19  ? 1545 HI6 B C3  1 
HETATM 8585 C C3  B HI6 H 6 .   ? 7.898   -5.402  -37.102 0.50 60.92  ? 1545 HI6 B C3  1 
HETATM 8586 C C4  A HI6 H 6 .   ? 4.560   -0.704  -38.117 0.50 31.27  ? 1545 HI6 B C4  1 
HETATM 8587 C C4  B HI6 H 6 .   ? 6.754   -6.048  -37.619 0.50 60.30  ? 1545 HI6 B C4  1 
HETATM 8588 C C5  A HI6 H 6 .   ? 5.242   -1.300  -39.215 0.50 32.37  ? 1545 HI6 B C5  1 
HETATM 8589 C C5  B HI6 H 6 .   ? 6.770   -7.468  -37.655 0.50 59.97  ? 1545 HI6 B C5  1 
HETATM 8590 C C6  A HI6 H 6 .   ? 5.570   -2.671  -39.166 0.50 29.52  ? 1545 HI6 B C6  1 
HETATM 8591 C C6  B HI6 H 6 .   ? 7.906   -8.155  -37.187 0.50 60.16  ? 1545 HI6 B C6  1 
HETATM 8592 C C1  . AE3 I 5 .   ? 9.258   5.265   -9.882  1.00 47.64  ? 1546 AE3 B C1  1 
HETATM 8593 C C2  . AE3 I 5 .   ? 9.977   3.987   -10.197 1.00 54.16  ? 1546 AE3 B C2  1 
HETATM 8594 O O2  . AE3 I 5 .   ? 11.108  4.057   -10.996 1.00 57.80  ? 1546 AE3 B O2  1 
HETATM 8595 C C3  . AE3 I 5 .   ? 11.365  3.101   -11.959 1.00 61.31  ? 1546 AE3 B C3  1 
HETATM 8596 C C4  . AE3 I 5 .   ? 11.482  3.549   -13.381 1.00 69.89  ? 1546 AE3 B C4  1 
HETATM 8597 O O3  . AE3 I 5 .   ? 10.711  2.876   -14.317 1.00 76.11  ? 1546 AE3 B O3  1 
HETATM 8598 C C5  . AE3 I 5 .   ? 10.485  3.434   -15.563 1.00 74.56  ? 1546 AE3 B C5  1 
HETATM 8599 C C6  . AE3 I 5 .   ? 9.148   3.231   -16.207 1.00 67.41  ? 1546 AE3 B C6  1 
HETATM 8600 O O4  . AE3 I 5 .   ? 8.542   1.992   -16.118 1.00 54.81  ? 1546 AE3 B O4  1 
HETATM 8601 C C   . CO3 J 3 .   ? 17.689  -13.749 -36.473 1.00 91.71  ? 1547 CO3 B C   1 
HETATM 8602 O O1  . CO3 J 3 .   ? 16.414  -14.324 -36.629 1.00 89.53  ? 1547 CO3 B O1  1 
HETATM 8603 O O2  . CO3 J 3 .   ? 17.923  -12.797 -35.459 1.00 90.16  ? 1547 CO3 B O2  1 
HETATM 8604 O O3  . CO3 J 3 .   ? 18.570  -14.027 -37.265 1.00 92.91  ? 1547 CO3 B O3  1 
HETATM 8605 O O   . HOH K 7 .   ? 29.722  17.723  55.932  1.00 50.61  ? 2001 HOH A O   1 
HETATM 8606 O O   . HOH K 7 .   ? 28.203  8.486   51.958  1.00 56.65  ? 2002 HOH A O   1 
HETATM 8607 O O   . HOH K 7 .   ? 25.939  10.472  54.733  1.00 45.69  ? 2003 HOH A O   1 
HETATM 8608 O O   . HOH K 7 .   ? 20.894  18.998  52.652  1.00 45.12  ? 2004 HOH A O   1 
HETATM 8609 O O   . HOH K 7 .   ? 31.276  0.339   46.589  1.00 33.32  ? 2005 HOH A O   1 
HETATM 8610 O O   . HOH K 7 .   ? 35.449  -0.155  47.803  1.00 43.43  ? 2006 HOH A O   1 
HETATM 8611 O O   . HOH K 7 .   ? 24.766  13.012  55.395  1.00 43.36  ? 2007 HOH A O   1 
HETATM 8612 O O   . HOH K 7 .   ? 38.078  3.184   38.274  1.00 48.55  ? 2008 HOH A O   1 
HETATM 8613 O O   . HOH K 7 .   ? 23.755  19.519  50.496  1.00 52.64  ? 2009 HOH A O   1 
HETATM 8614 O O   . HOH K 7 .   ? 18.826  18.019  51.998  1.00 34.37  ? 2010 HOH A O   1 
HETATM 8615 O O   . HOH K 7 .   ? 23.579  8.540   48.326  1.00 27.44  ? 2011 HOH A O   1 
HETATM 8616 O O   . HOH K 7 .   ? 24.849  9.417   52.712  1.00 40.85  ? 2012 HOH A O   1 
HETATM 8617 O O   . HOH K 7 .   ? 8.088   17.453  32.996  1.00 44.53  ? 2013 HOH A O   1 
HETATM 8618 O O   . HOH K 7 .   ? 27.702  4.013   46.960  1.00 28.47  ? 2014 HOH A O   1 
HETATM 8619 O O   . HOH K 7 .   ? 29.092  2.131   45.875  1.00 29.58  ? 2015 HOH A O   1 
HETATM 8620 O O   . HOH K 7 .   ? 36.232  2.721   45.805  1.00 35.93  ? 2016 HOH A O   1 
HETATM 8621 O O   . HOH K 7 .   ? 38.924  4.422   49.008  1.00 41.54  ? 2017 HOH A O   1 
HETATM 8622 O O   . HOH K 7 .   ? 39.626  14.858  38.920  1.00 43.78  ? 2018 HOH A O   1 
HETATM 8623 O O   . HOH K 7 .   ? 32.676  0.723   44.182  1.00 32.10  ? 2019 HOH A O   1 
HETATM 8624 O O   . HOH K 7 .   ? 38.844  3.175   45.101  1.00 35.93  ? 2020 HOH A O   1 
HETATM 8625 O O   . HOH K 7 .   ? 41.978  0.446   44.715  1.00 23.37  ? 2021 HOH A O   1 
HETATM 8626 O O   . HOH K 7 .   ? 35.997  5.008   38.824  1.00 37.67  ? 2022 HOH A O   1 
HETATM 8627 O O   . HOH K 7 .   ? 39.667  5.350   46.404  1.00 37.22  ? 2023 HOH A O   1 
HETATM 8628 O O   . HOH K 7 .   ? 37.765  8.381   47.616  1.00 37.54  ? 2024 HOH A O   1 
HETATM 8629 O O   . HOH K 7 .   ? 30.544  10.376  48.888  1.00 50.36  ? 2025 HOH A O   1 
HETATM 8630 O O   . HOH K 7 .   ? 25.742  19.197  46.456  1.00 54.63  ? 2026 HOH A O   1 
HETATM 8631 O O   . HOH K 7 .   ? 22.669  19.632  45.964  1.00 41.24  ? 2027 HOH A O   1 
HETATM 8632 O O   . HOH K 7 .   ? 18.994  23.382  38.587  1.00 30.69  ? 2028 HOH A O   1 
HETATM 8633 O O   . HOH K 7 .   ? 10.702  17.396  34.313  1.00 40.15  ? 2029 HOH A O   1 
HETATM 8634 O O   . HOH K 7 .   ? 13.360  23.614  35.246  1.00 47.29  ? 2030 HOH A O   1 
HETATM 8635 O O   . HOH K 7 .   ? 20.895  24.884  23.388  1.00 46.55  ? 2031 HOH A O   1 
HETATM 8636 O O   . HOH K 7 .   ? 33.317  18.155  38.660  1.00 55.65  ? 2032 HOH A O   1 
HETATM 8637 O O   . HOH K 7 .   ? 32.071  16.862  32.540  1.00 26.24  ? 2033 HOH A O   1 
HETATM 8638 O O   . HOH K 7 .   ? 36.720  16.227  38.436  1.00 43.15  ? 2034 HOH A O   1 
HETATM 8639 O O   . HOH K 7 .   ? 38.374  3.973   34.690  1.00 51.50  ? 2035 HOH A O   1 
HETATM 8640 O O   . HOH K 7 .   ? 40.289  12.348  33.513  1.00 31.07  ? 2036 HOH A O   1 
HETATM 8641 O O   . HOH K 7 .   ? 45.169  8.013   29.595  1.00 27.52  ? 2037 HOH A O   1 
HETATM 8642 O O   . HOH K 7 .   ? 48.227  11.568  32.870  1.00 43.66  ? 2038 HOH A O   1 
HETATM 8643 O O   . HOH K 7 .   ? 45.964  14.859  24.304  1.00 31.22  ? 2039 HOH A O   1 
HETATM 8644 O O   . HOH K 7 .   ? 50.508  17.304  25.830  1.00 38.52  ? 2040 HOH A O   1 
HETATM 8645 O O   . HOH K 7 .   ? 52.073  16.244  24.361  1.00 29.82  ? 2041 HOH A O   1 
HETATM 8646 O O   . HOH K 7 .   ? 56.142  14.305  25.686  1.00 42.04  ? 2042 HOH A O   1 
HETATM 8647 O O   . HOH K 7 .   ? 46.690  8.387   27.116  1.00 42.39  ? 2043 HOH A O   1 
HETATM 8648 O O   . HOH K 7 .   ? 49.408  6.242   27.968  1.00 50.77  ? 2044 HOH A O   1 
HETATM 8649 O O   . HOH K 7 .   ? 52.549  9.341   21.659  1.00 28.22  ? 2045 HOH A O   1 
HETATM 8650 O O   . HOH K 7 .   ? 45.777  12.481  22.521  1.00 31.68  ? 2046 HOH A O   1 
HETATM 8651 O O   . HOH K 7 .   ? 46.963  7.598   17.889  1.00 26.48  ? 2047 HOH A O   1 
HETATM 8652 O O   . HOH K 7 .   ? 42.597  1.712   25.712  1.00 49.41  ? 2048 HOH A O   1 
HETATM 8653 O O   . HOH K 7 .   ? 5.533   12.244  29.324  1.00 41.81  ? 2049 HOH A O   1 
HETATM 8654 O O   . HOH K 7 .   ? 41.566  13.093  35.948  1.00 45.05  ? 2050 HOH A O   1 
HETATM 8655 O O   . HOH K 7 .   ? 42.404  13.634  40.219  1.00 59.64  ? 2051 HOH A O   1 
HETATM 8656 O O   . HOH K 7 .   ? 39.389  14.732  45.971  1.00 44.42  ? 2052 HOH A O   1 
HETATM 8657 O O   . HOH K 7 .   ? 37.256  17.277  43.821  1.00 50.65  ? 2053 HOH A O   1 
HETATM 8658 O O   . HOH K 7 .   ? 25.694  22.719  38.168  1.00 49.41  ? 2054 HOH A O   1 
HETATM 8659 O O   . HOH K 7 .   ? 29.039  22.994  35.185  1.00 40.69  ? 2055 HOH A O   1 
HETATM 8660 O O   . HOH K 7 .   ? 32.547  18.974  29.062  1.00 27.92  ? 2056 HOH A O   1 
HETATM 8661 O O   . HOH K 7 .   ? 37.218  22.569  36.294  1.00 54.76  ? 2057 HOH A O   1 
HETATM 8662 O O   . HOH K 7 .   ? 42.403  19.993  34.704  1.00 54.01  ? 2058 HOH A O   1 
HETATM 8663 O O   . HOH K 7 .   ? 26.582  -7.299  35.329  1.00 41.65  ? 2059 HOH A O   1 
HETATM 8664 O O   . HOH K 7 .   ? 34.834  17.275  24.523  1.00 22.32  ? 2060 HOH A O   1 
HETATM 8665 O O   . HOH K 7 .   ? 40.791  16.884  21.631  1.00 24.78  ? 2061 HOH A O   1 
HETATM 8666 O O   . HOH K 7 .   ? 42.005  17.203  23.770  1.00 28.71  ? 2062 HOH A O   1 
HETATM 8667 O O   . HOH K 7 .   ? 41.220  19.117  18.057  1.00 23.76  ? 2063 HOH A O   1 
HETATM 8668 O O   . HOH K 7 .   ? 24.348  -7.113  37.233  1.00 39.30  ? 2064 HOH A O   1 
HETATM 8669 O O   . HOH K 7 .   ? 40.461  26.409  19.362  1.00 44.23  ? 2065 HOH A O   1 
HETATM 8670 O O   . HOH K 7 .   ? 34.079  23.320  18.731  1.00 26.79  ? 2066 HOH A O   1 
HETATM 8671 O O   . HOH K 7 .   ? 31.734  21.896  21.578  1.00 30.27  ? 2067 HOH A O   1 
HETATM 8672 O O   . HOH K 7 .   ? 39.294  20.216  16.485  1.00 20.20  ? 2068 HOH A O   1 
HETATM 8673 O O   . HOH K 7 .   ? 40.068  27.564  17.028  1.00 34.93  ? 2069 HOH A O   1 
HETATM 8674 O O   . HOH K 7 .   ? 31.380  23.876  16.656  1.00 41.43  ? 2070 HOH A O   1 
HETATM 8675 O O   . HOH K 7 .   ? 20.952  34.038  17.692  1.00 55.48  ? 2071 HOH A O   1 
HETATM 8676 O O   . HOH K 7 .   ? 27.333  25.806  23.788  1.00 51.71  ? 2072 HOH A O   1 
HETATM 8677 O O   . HOH K 7 .   ? 39.081  8.735   2.440   1.00 32.33  ? 2073 HOH A O   1 
HETATM 8678 O O   . HOH K 7 .   ? 23.650  23.625  23.489  1.00 40.79  ? 2074 HOH A O   1 
HETATM 8679 O O   . HOH K 7 .   ? 29.246  20.416  19.129  1.00 25.15  ? 2075 HOH A O   1 
HETATM 8680 O O   . HOH K 7 .   ? 26.433  20.858  14.889  1.00 48.51  ? 2076 HOH A O   1 
HETATM 8681 O O   . HOH K 7 .   ? 53.175  11.423  2.544   1.00 38.82  ? 2077 HOH A O   1 
HETATM 8682 O O   . HOH K 7 .   ? 35.709  27.180  25.919  1.00 33.50  ? 2078 HOH A O   1 
HETATM 8683 O O   . HOH K 7 .   ? 35.906  25.583  32.988  1.00 44.10  ? 2079 HOH A O   1 
HETATM 8684 O O   . HOH K 7 .   ? 45.677  21.218  27.835  1.00 39.67  ? 2080 HOH A O   1 
HETATM 8685 O O   . HOH K 7 .   ? 43.125  15.275  25.035  1.00 27.20  ? 2081 HOH A O   1 
HETATM 8686 O O   . HOH K 7 .   ? 47.910  20.838  26.367  1.00 48.63  ? 2082 HOH A O   1 
HETATM 8687 O O   . HOH K 7 .   ? 41.609  13.846  31.424  1.00 30.41  ? 2083 HOH A O   1 
HETATM 8688 O O   . HOH K 7 .   ? 46.529  17.219  33.795  1.00 44.38  ? 2084 HOH A O   1 
HETATM 8689 O O   . HOH K 7 .   ? 31.405  16.784  29.733  1.00 23.73  ? 2085 HOH A O   1 
HETATM 8690 O O   . HOH K 7 .   ? 36.398  22.260  -6.235  1.00 46.78  ? 2086 HOH A O   1 
HETATM 8691 O O   . HOH K 7 .   ? 11.636  13.207  44.203  1.00 43.51  ? 2087 HOH A O   1 
HETATM 8692 O O   . HOH K 7 .   ? 12.727  8.422   42.297  1.00 48.17  ? 2088 HOH A O   1 
HETATM 8693 O O   . HOH K 7 .   ? 25.106  3.874   46.100  1.00 34.79  ? 2089 HOH A O   1 
HETATM 8694 O O   . HOH K 7 .   ? 16.646  -2.674  33.919  1.00 37.67  ? 2090 HOH A O   1 
HETATM 8695 O O   . HOH K 7 .   ? 13.557  4.530   36.984  1.00 39.19  ? 2091 HOH A O   1 
HETATM 8696 O O   . HOH K 7 .   ? 18.987  0.442   27.847  1.00 32.07  ? 2092 HOH A O   1 
HETATM 8697 O O   . HOH K 7 .   ? 28.982  12.173  24.699  1.00 21.35  ? 2093 HOH A O   1 
HETATM 8698 O O   . HOH K 7 .   ? 25.824  15.366  18.418  1.00 17.84  ? 2094 HOH A O   1 
HETATM 8699 O O   . HOH K 7 .   ? 28.497  17.783  19.944  1.00 22.38  ? 2095 HOH A O   1 
HETATM 8700 O O   . HOH K 7 .   ? 32.836  14.551  17.116  1.00 25.07  ? 2096 HOH A O   1 
HETATM 8701 O O   . HOH K 7 .   ? 37.963  15.378  12.459  1.00 25.28  ? 2097 HOH A O   1 
HETATM 8702 O O   . HOH K 7 .   ? 30.929  28.969  -7.082  1.00 43.37  ? 2098 HOH A O   1 
HETATM 8703 O O   . HOH K 7 .   ? 30.782  20.971  16.634  1.00 33.11  ? 2099 HOH A O   1 
HETATM 8704 O O   . HOH K 7 .   ? 25.364  14.854  27.906  1.00 28.37  ? 2100 HOH A O   1 
HETATM 8705 O O   . HOH K 7 .   ? 24.680  18.333  28.829  1.00 32.62  ? 2101 HOH A O   1 
HETATM 8706 O O   . HOH K 7 .   ? 24.924  22.396  30.030  1.00 32.20  ? 2102 HOH A O   1 
HETATM 8707 O O   . HOH K 7 .   ? 29.832  25.725  -15.215 1.00 41.33  ? 2103 HOH A O   1 
HETATM 8708 O O   . HOH K 7 .   ? 19.250  22.474  28.740  1.00 53.77  ? 2104 HOH A O   1 
HETATM 8709 O O   . HOH K 7 .   ? 34.485  23.859  -10.110 1.00 51.90  ? 2105 HOH A O   1 
HETATM 8710 O O   . HOH K 7 .   ? 17.213  14.800  28.987  1.00 25.18  ? 2106 HOH A O   1 
HETATM 8711 O O   . HOH K 7 .   ? 23.534  20.313  30.926  1.00 42.90  ? 2107 HOH A O   1 
HETATM 8712 O O   . HOH K 7 .   ? 18.119  25.044  34.267  1.00 62.17  ? 2108 HOH A O   1 
HETATM 8713 O O   . HOH K 7 .   ? 21.178  23.659  36.542  1.00 42.95  ? 2109 HOH A O   1 
HETATM 8714 O O   . HOH K 7 .   ? 12.062  9.661   37.868  1.00 42.86  ? 2110 HOH A O   1 
HETATM 8715 O O   . HOH K 7 .   ? 9.270   6.974   35.970  1.00 49.26  ? 2111 HOH A O   1 
HETATM 8716 O O   . HOH K 7 .   ? 13.260  3.628   32.764  1.00 51.07  ? 2112 HOH A O   1 
HETATM 8717 O O   . HOH K 7 .   ? 7.756   11.399  27.721  1.00 36.16  ? 2113 HOH A O   1 
HETATM 8718 O O   . HOH K 7 .   ? 9.181   3.820   33.467  1.00 59.85  ? 2114 HOH A O   1 
HETATM 8719 O O   . HOH K 7 .   ? 43.708  18.700  16.401  1.00 27.56  ? 2115 HOH A O   1 
HETATM 8720 O O   . HOH K 7 .   ? 42.345  7.587   13.925  1.00 22.77  ? 2116 HOH A O   1 
HETATM 8721 O O   . HOH K 7 .   ? 42.697  9.703   11.212  1.00 32.67  ? 2117 HOH A O   1 
HETATM 8722 O O   . HOH K 7 .   ? 46.242  10.640  10.782  1.00 26.31  ? 2118 HOH A O   1 
HETATM 8723 O O   . HOH K 7 .   ? 47.422  -0.192  11.493  1.00 39.70  ? 2119 HOH A O   1 
HETATM 8724 O O   . HOH K 7 .   ? 56.400  -0.874  13.836  1.00 49.27  ? 2120 HOH A O   1 
HETATM 8725 O O   . HOH K 7 .   ? 49.315  0.080   16.203  1.00 48.11  ? 2121 HOH A O   1 
HETATM 8726 O O   . HOH K 7 .   ? 56.705  3.052   15.958  1.00 43.35  ? 2122 HOH A O   1 
HETATM 8727 O O   . HOH K 7 .   ? 44.776  1.171   15.975  1.00 48.33  ? 2123 HOH A O   1 
HETATM 8728 O O   . HOH K 7 .   ? 43.790  1.636   18.456  1.00 41.98  ? 2124 HOH A O   1 
HETATM 8729 O O   . HOH K 7 .   ? 39.738  1.651   25.935  1.00 47.28  ? 2125 HOH A O   1 
HETATM 8730 O O   . HOH K 7 .   ? 39.990  -1.982  23.532  1.00 33.28  ? 2126 HOH A O   1 
HETATM 8731 O O   . HOH K 7 .   ? 28.355  -0.371  29.449  1.00 27.18  ? 2127 HOH A O   1 
HETATM 8732 O O   . HOH K 7 .   ? 36.562  1.415   34.168  1.00 36.64  ? 2128 HOH A O   1 
HETATM 8733 O O   . HOH K 7 .   ? 27.430  -1.375  37.367  1.00 28.23  ? 2129 HOH A O   1 
HETATM 8734 O O   . HOH K 7 .   ? 26.327  -6.624  31.931  1.00 53.98  ? 2130 HOH A O   1 
HETATM 8735 O O   . HOH K 7 .   ? 31.686  0.249   41.412  1.00 36.99  ? 2131 HOH A O   1 
HETATM 8736 O O   . HOH K 7 .   ? 36.186  -2.054  34.514  1.00 55.14  ? 2132 HOH A O   1 
HETATM 8737 O O   . HOH K 7 .   ? 36.213  1.678   37.004  1.00 35.13  ? 2133 HOH A O   1 
HETATM 8738 O O   . HOH K 7 .   ? 33.607  -1.693  41.683  1.00 36.00  ? 2134 HOH A O   1 
HETATM 8739 O O   . HOH K 7 .   ? 21.945  -6.207  36.697  1.00 48.08  ? 2135 HOH A O   1 
HETATM 8740 O O   . HOH K 7 .   ? 18.980  -5.746  28.219  1.00 31.92  ? 2136 HOH A O   1 
HETATM 8741 O O   . HOH K 7 .   ? 16.000  -3.564  29.653  1.00 35.59  ? 2137 HOH A O   1 
HETATM 8742 O O   . HOH K 7 .   ? 20.816  15.091  13.179  1.00 26.82  ? 2138 HOH A O   1 
HETATM 8743 O O   . HOH K 7 .   ? 32.194  -7.253  13.356  1.00 47.53  ? 2139 HOH A O   1 
HETATM 8744 O O   . HOH K 7 .   ? 36.234  -4.836  13.899  1.00 37.14  ? 2140 HOH A O   1 
HETATM 8745 O O   . HOH K 7 .   ? 36.672  -6.434  16.009  1.00 35.48  ? 2141 HOH A O   1 
HETATM 8746 O O   . HOH K 7 .   ? 26.082  -7.978  25.347  1.00 54.10  ? 2142 HOH A O   1 
HETATM 8747 O O   . HOH K 7 .   ? 18.245  12.126  13.196  1.00 25.03  ? 2143 HOH A O   1 
HETATM 8748 O O   . HOH K 7 .   ? 26.349  8.772   7.719   1.00 34.30  ? 2144 HOH A O   1 
HETATM 8749 O O   . HOH K 7 .   ? 33.457  4.775   6.381   1.00 24.54  ? 2145 HOH A O   1 
HETATM 8750 O O   . HOH K 7 .   ? 30.420  8.234   6.502   1.00 27.97  ? 2146 HOH A O   1 
HETATM 8751 O O   . HOH K 7 .   ? 27.649  3.480   2.186   1.00 32.41  ? 2147 HOH A O   1 
HETATM 8752 O O   . HOH K 7 .   ? 31.116  6.066   0.560   1.00 34.39  ? 2148 HOH A O   1 
HETATM 8753 O O   . HOH K 7 .   ? 35.397  9.614   0.707   1.00 53.96  ? 2149 HOH A O   1 
HETATM 8754 O O   . HOH K 7 .   ? 36.840  9.557   4.263   1.00 25.70  ? 2150 HOH A O   1 
HETATM 8755 O O   . HOH K 7 .   ? 35.892  12.747  6.679   1.00 26.50  ? 2151 HOH A O   1 
HETATM 8756 O O   . HOH K 7 .   ? 40.735  6.902   2.846   1.00 35.24  ? 2152 HOH A O   1 
HETATM 8757 O O   . HOH K 7 .   ? 42.639  5.897   0.325   1.00 36.43  ? 2153 HOH A O   1 
HETATM 8758 O O   . HOH K 7 .   ? 45.681  1.984   3.043   1.00 46.20  ? 2154 HOH A O   1 
HETATM 8759 O O   . HOH K 7 .   ? 43.162  0.625   5.896   1.00 31.64  ? 2155 HOH A O   1 
HETATM 8760 O O   . HOH K 7 .   ? 48.469  1.817   3.654   1.00 54.55  ? 2156 HOH A O   1 
HETATM 8761 O O   . HOH K 7 .   ? 50.437  7.353   2.850   1.00 41.44  ? 2157 HOH A O   1 
HETATM 8762 O O   . HOH K 7 .   ? 51.345  4.704   2.986   1.00 50.04  ? 2158 HOH A O   1 
HETATM 8763 O O   . HOH K 7 .   ? 52.285  8.895   3.655   1.00 47.96  ? 2159 HOH A O   1 
HETATM 8764 O O   . HOH K 7 .   ? 51.923  13.741  3.546   1.00 39.99  ? 2160 HOH A O   1 
HETATM 8765 O O   . HOH K 7 .   ? 50.437  14.939  1.299   1.00 33.60  ? 2161 HOH A O   1 
HETATM 8766 O O   . HOH K 7 .   ? 37.949  12.070  4.592   1.00 30.30  ? 2162 HOH A O   1 
HETATM 8767 O O   . HOH K 7 .   ? 37.956  13.485  1.981   1.00 29.93  ? 2163 HOH A O   1 
HETATM 8768 O O   . HOH K 7 .   ? 40.145  11.335  1.226   1.00 36.58  ? 2164 HOH A O   1 
HETATM 8769 O O   . HOH K 7 .   ? 58.349  21.284  8.107   1.00 36.17  ? 2165 HOH A O   1 
HETATM 8770 O O   . HOH K 7 .   ? 52.930  25.876  8.672   1.00 33.21  ? 2166 HOH A O   1 
HETATM 8771 O O   . HOH K 7 .   ? 54.552  25.270  14.736  1.00 61.20  ? 2167 HOH A O   1 
HETATM 8772 O O   . HOH K 7 .   ? 63.322  4.338   15.719  1.00 61.60  ? 2168 HOH A O   1 
HETATM 8773 O O   . HOH K 7 .   ? 58.960  3.693   11.568  1.00 55.78  ? 2169 HOH A O   1 
HETATM 8774 O O   . HOH K 7 .   ? 56.013  2.208   13.071  1.00 40.69  ? 2170 HOH A O   1 
HETATM 8775 O O   . HOH K 7 .   ? 57.469  8.834   20.065  1.00 44.57  ? 2171 HOH A O   1 
HETATM 8776 O O   . HOH K 7 .   ? 56.328  25.211  17.941  1.00 50.35  ? 2172 HOH A O   1 
HETATM 8777 O O   . HOH K 7 .   ? 49.413  22.741  24.998  1.00 25.78  ? 2173 HOH A O   1 
HETATM 8778 O O   . HOH K 7 .   ? 49.215  28.105  15.630  1.00 43.79  ? 2174 HOH A O   1 
HETATM 8779 O O   . HOH K 7 .   ? 53.755  28.708  15.941  1.00 51.06  ? 2175 HOH A O   1 
HETATM 8780 O O   . HOH K 7 .   ? 42.252  23.963  11.449  1.00 53.35  ? 2176 HOH A O   1 
HETATM 8781 O O   . HOH K 7 .   ? 40.098  17.049  12.517  1.00 37.22  ? 2177 HOH A O   1 
HETATM 8782 O O   . HOH K 7 .   ? 39.663  22.616  12.273  1.00 45.96  ? 2178 HOH A O   1 
HETATM 8783 O O   . HOH K 7 .   ? 46.420  18.246  1.289   1.00 46.61  ? 2179 HOH A O   1 
HETATM 8784 O O   . HOH K 7 .   ? 38.305  15.806  0.908   1.00 22.37  ? 2180 HOH A O   1 
HETATM 8785 O O   . HOH K 7 .   ? 40.264  20.502  -4.457  1.00 49.08  ? 2181 HOH A O   1 
HETATM 8786 O O   . HOH K 7 .   ? 36.504  19.475  -4.739  1.00 38.51  ? 2182 HOH A O   1 
HETATM 8787 O O   . HOH K 7 .   ? 37.838  21.827  2.383   1.00 37.94  ? 2183 HOH A O   1 
HETATM 8788 O O   . HOH K 7 .   ? 29.908  16.125  1.004   1.00 27.37  ? 2184 HOH A O   1 
HETATM 8789 O O   . HOH K 7 .   ? 32.040  20.465  6.448   1.00 16.11  ? 2185 HOH A O   1 
HETATM 8790 O O   . HOH K 7 .   ? 36.044  12.158  -0.315  1.00 37.77  ? 2186 HOH A O   1 
HETATM 8791 O O   . HOH K 7 .   ? 43.844  11.363  9.329   1.00 28.82  ? 2187 HOH A O   1 
HETATM 8792 O O   . HOH K 7 .   ? 39.104  -5.339  17.422  1.00 55.55  ? 2188 HOH A O   1 
HETATM 8793 O O   . HOH K 7 .   ? 42.298  -0.594  19.004  1.00 43.31  ? 2189 HOH A O   1 
HETATM 8794 O O   . HOH K 7 .   ? 32.303  1.106   -1.756  1.00 63.60  ? 2190 HOH A O   1 
HETATM 8795 O O   . HOH K 7 .   ? 32.118  -9.791  10.056  1.00 54.57  ? 2191 HOH A O   1 
HETATM 8796 O O   . HOH K 7 .   ? 17.902  14.850  4.238   1.00 32.38  ? 2192 HOH A O   1 
HETATM 8797 O O   . HOH K 7 .   ? 16.553  16.625  1.047   1.00 50.77  ? 2193 HOH A O   1 
HETATM 8798 O O   . HOH K 7 .   ? 10.904  22.421  6.829   1.00 35.47  ? 2194 HOH A O   1 
HETATM 8799 O O   . HOH K 7 .   ? 21.643  20.140  7.337   1.00 27.25  ? 2195 HOH A O   1 
HETATM 8800 O O   . HOH K 7 .   ? 19.409  17.895  2.657   1.00 28.27  ? 2196 HOH A O   1 
HETATM 8801 O O   . HOH K 7 .   ? 31.538  30.884  3.684   1.00 67.02  ? 2197 HOH A O   1 
HETATM 8802 O O   . HOH K 7 .   ? 30.230  29.341  1.825   1.00 49.02  ? 2198 HOH A O   1 
HETATM 8803 O O   . HOH K 7 .   ? 29.081  27.465  -5.902  1.00 36.02  ? 2199 HOH A O   1 
HETATM 8804 O O   . HOH K 7 .   ? 23.178  32.998  -4.125  1.00 45.92  ? 2200 HOH A O   1 
HETATM 8805 O O   . HOH K 7 .   ? 19.925  32.837  10.374  1.00 46.24  ? 2201 HOH A O   1 
HETATM 8806 O O   . HOH K 7 .   ? 18.382  34.936  -2.703  1.00 51.23  ? 2202 HOH A O   1 
HETATM 8807 O O   . HOH K 7 .   ? 27.146  32.173  -11.136 1.00 49.77  ? 2203 HOH A O   1 
HETATM 8808 O O   . HOH K 7 .   ? 21.105  29.601  -13.370 1.00 55.74  ? 2204 HOH A O   1 
HETATM 8809 O O   . HOH K 7 .   ? 25.142  29.328  -14.548 1.00 40.02  ? 2205 HOH A O   1 
HETATM 8810 O O   . HOH K 7 .   ? 30.868  25.675  -12.461 1.00 38.29  ? 2206 HOH A O   1 
HETATM 8811 O O   . HOH K 7 .   ? 25.614  33.842  -5.553  1.00 56.29  ? 2207 HOH A O   1 
HETATM 8812 O O   . HOH K 7 .   ? 29.883  31.899  -6.823  1.00 42.43  ? 2208 HOH A O   1 
HETATM 8813 O O   . HOH K 7 .   ? 30.411  19.481  -11.377 1.00 36.21  ? 2209 HOH A O   1 
HETATM 8814 O O   . HOH K 7 .   ? 32.295  23.725  -11.576 1.00 35.75  ? 2210 HOH A O   1 
HETATM 8815 O O   . HOH K 7 .   ? 34.067  23.822  -7.161  1.00 43.97  ? 2211 HOH A O   1 
HETATM 8816 O O   . HOH K 7 .   ? 35.929  10.763  -15.112 1.00 41.81  ? 2212 HOH A O   1 
HETATM 8817 O O   . HOH K 7 .   ? 38.454  12.830  -13.499 1.00 45.23  ? 2213 HOH A O   1 
HETATM 8818 O O   . HOH K 7 .   ? 19.959  7.473   -12.885 1.00 51.12  ? 2214 HOH A O   1 
HETATM 8819 O O   . HOH K 7 .   ? 17.529  21.887  -12.129 1.00 47.74  ? 2215 HOH A O   1 
HETATM 8820 O O   . HOH K 7 .   ? 12.105  16.947  -14.603 1.00 47.89  ? 2216 HOH A O   1 
HETATM 8821 O O   . HOH K 7 .   ? 16.325  20.277  -20.449 1.00 41.01  ? 2217 HOH A O   1 
HETATM 8822 O O   . HOH K 7 .   ? 16.570  19.360  -0.523  1.00 39.17  ? 2218 HOH A O   1 
HETATM 8823 O O   . HOH K 7 .   ? 16.656  23.381  0.793   1.00 46.53  ? 2219 HOH A O   1 
HETATM 8824 O O   . HOH K 7 .   ? 19.260  14.958  1.895   1.00 35.53  ? 2220 HOH A O   1 
HETATM 8825 O O   . HOH K 7 .   ? 26.825  8.008   -0.493  1.00 33.42  ? 2221 HOH A O   1 
HETATM 8826 O O   . HOH K 7 .   ? 26.121  5.537   0.750   1.00 44.03  ? 2222 HOH A O   1 
HETATM 8827 O O   . HOH K 7 .   ? 15.034  -7.849  6.124   1.00 49.03  ? 2223 HOH A O   1 
HETATM 8828 O O   . HOH K 7 .   ? 16.212  -8.711  10.525  1.00 53.36  ? 2224 HOH A O   1 
HETATM 8829 O O   . HOH K 7 .   ? 14.160  -5.489  11.235  1.00 45.88  ? 2225 HOH A O   1 
HETATM 8830 O O   . HOH K 7 .   ? 7.735   -3.731  16.578  1.00 48.10  ? 2226 HOH A O   1 
HETATM 8831 O O   . HOH K 7 .   ? 11.177  1.091   10.765  1.00 30.54  ? 2227 HOH A O   1 
HETATM 8832 O O   . HOH K 7 .   ? 8.769   21.008  8.231   1.00 49.30  ? 2228 HOH A O   1 
HETATM 8833 O O   . HOH K 7 .   ? 13.658  21.089  14.265  1.00 40.17  ? 2229 HOH A O   1 
HETATM 8834 O O   . HOH K 7 .   ? 7.874   21.768  10.713  1.00 39.01  ? 2230 HOH A O   1 
HETATM 8835 O O   . HOH K 7 .   ? 8.246   29.003  19.992  1.00 49.66  ? 2231 HOH A O   1 
HETATM 8836 O O   . HOH K 7 .   ? 15.682  25.360  17.679  1.00 40.31  ? 2232 HOH A O   1 
HETATM 8837 O O   . HOH K 7 .   ? 12.622  23.644  2.355   1.00 45.49  ? 2233 HOH A O   1 
HETATM 8838 O O   . HOH K 7 .   ? 24.659  20.226  13.439  1.00 44.55  ? 2234 HOH A O   1 
HETATM 8839 O O   . HOH K 7 .   ? 18.773  19.988  18.601  1.00 33.43  ? 2235 HOH A O   1 
HETATM 8840 O O   . HOH K 7 .   ? 9.504   25.246  26.070  1.00 51.82  ? 2236 HOH A O   1 
HETATM 8841 O O   . HOH K 7 .   ? 15.848  23.465  33.523  1.00 68.09  ? 2237 HOH A O   1 
HETATM 8842 O O   . HOH K 7 .   ? 11.531  35.409  26.255  1.00 64.57  ? 2238 HOH A O   1 
HETATM 8843 O O   . HOH K 7 .   ? 13.737  33.094  25.247  1.00 63.99  ? 2239 HOH A O   1 
HETATM 8844 O O   . HOH K 7 .   ? 2.986   12.850  24.598  1.00 53.46  ? 2240 HOH A O   1 
HETATM 8845 O O   . HOH K 7 .   ? 2.498   15.567  18.754  1.00 49.39  ? 2241 HOH A O   1 
HETATM 8846 O O   . HOH K 7 .   ? 4.812   11.468  14.178  1.00 45.38  ? 2242 HOH A O   1 
HETATM 8847 O O   . HOH K 7 .   ? 6.957   6.793   32.591  1.00 58.03  ? 2243 HOH A O   1 
HETATM 8848 O O   . HOH K 7 .   ? 2.756   6.664   18.146  1.00 41.65  ? 2244 HOH A O   1 
HETATM 8849 O O   . HOH K 7 .   ? 3.617   -3.032  21.586  1.00 46.50  ? 2245 HOH A O   1 
HETATM 8850 O O   . HOH K 7 .   ? 9.493   -2.930  6.548   1.00 37.21  ? 2246 HOH A O   1 
HETATM 8851 O O   . HOH K 7 .   ? 14.922  1.928   1.637   1.00 40.90  ? 2247 HOH A O   1 
HETATM 8852 O O   . HOH K 7 .   ? 13.453  -5.488  -1.682  1.00 41.29  ? 2248 HOH A O   1 
HETATM 8853 O O   . HOH K 7 .   ? 12.870  -9.044  4.533   1.00 54.91  ? 2249 HOH A O   1 
HETATM 8854 O O   . HOH K 7 .   ? 3.384   0.078   4.832   1.00 43.85  ? 2250 HOH A O   1 
HETATM 8855 O O   . HOH K 7 .   ? 9.513   10.583  3.245   1.00 38.34  ? 2251 HOH A O   1 
HETATM 8856 O O   . HOH K 7 .   ? 11.892  8.884   0.355   1.00 53.80  ? 2252 HOH A O   1 
HETATM 8857 O O   . HOH K 7 .   ? 4.949   18.604  11.854  1.00 57.89  ? 2253 HOH A O   1 
HETATM 8858 O O   . HOH K 7 .   ? 1.512   8.544   16.967  1.00 41.24  ? 2254 HOH A O   1 
HETATM 8859 O O   . HOH K 7 .   ? 5.516   5.749   1.105   1.00 38.65  ? 2255 HOH A O   1 
HETATM 8860 O O   . HOH K 7 .   ? 16.799  2.996   0.120   1.00 37.17  ? 2256 HOH A O   1 
HETATM 8861 O O   . HOH K 7 .   ? 14.437  8.201   -4.524  1.00 30.89  ? 2257 HOH A O   1 
HETATM 8862 O O   . HOH K 7 .   ? 11.958  11.731  1.837   1.00 43.80  ? 2258 HOH A O   1 
HETATM 8863 O O   . HOH K 7 .   ? 17.914  1.832   -2.569  1.00 44.61  ? 2259 HOH A O   1 
HETATM 8864 O O   . HOH K 7 .   ? 14.670  9.651   -8.318  1.00 56.00  ? 2260 HOH A O   1 
HETATM 8865 O O   . HOH K 7 .   ? 20.754  0.416   -0.244  1.00 51.02  ? 2261 HOH A O   1 
HETATM 8866 O O   . HOH K 7 .   ? 20.025  0.457   -3.087  1.00 43.56  ? 2262 HOH A O   1 
HETATM 8867 O O   . HOH K 7 .   ? 13.455  8.620   -13.114 1.00 52.01  ? 2263 HOH A O   1 
HETATM 8868 O O   . HOH L 7 .   ? 0.452   16.933  -67.702 1.00 54.47  ? 2001 HOH B O   1 
HETATM 8869 O O   . HOH L 7 .   ? 1.603   13.031  -71.962 1.00 60.65  ? 2002 HOH B O   1 
HETATM 8870 O O   . HOH L 7 .   ? 4.577   11.159  -65.479 1.00 38.93  ? 2003 HOH B O   1 
HETATM 8871 O O   . HOH L 7 .   ? 3.038   9.757   -73.527 1.00 49.97  ? 2004 HOH B O   1 
HETATM 8872 O O   . HOH L 7 .   ? -0.210  7.704   -73.013 1.00 32.11  ? 2005 HOH B O   1 
HETATM 8873 O O   . HOH L 7 .   ? 14.666  5.213   -74.722 1.00 45.54  ? 2006 HOH B O   1 
HETATM 8874 O O   . HOH L 7 .   ? -12.624 3.110   -63.620 1.00 44.26  ? 2007 HOH B O   1 
HETATM 8875 O O   . HOH L 7 .   ? -14.790 3.381   -61.667 1.00 48.57  ? 2008 HOH B O   1 
HETATM 8876 O O   . HOH L 7 .   ? -15.212 0.731   -53.189 1.00 40.93  ? 2009 HOH B O   1 
HETATM 8877 O O   . HOH L 7 .   ? -2.852  -0.326  -61.662 1.00 42.46  ? 2010 HOH B O   1 
HETATM 8878 O O   . HOH L 7 .   ? 0.488   0.528   -56.209 1.00 35.18  ? 2011 HOH B O   1 
HETATM 8879 O O   . HOH L 7 .   ? 5.121   8.697   -64.526 1.00 27.32  ? 2012 HOH B O   1 
HETATM 8880 O O   . HOH L 7 .   ? 8.951   9.732   -62.847 1.00 39.26  ? 2013 HOH B O   1 
HETATM 8881 O O   . HOH L 7 .   ? 7.847   1.227   -62.127 1.00 26.06  ? 2014 HOH B O   1 
HETATM 8882 O O   . HOH L 7 .   ? 15.241  2.697   -62.092 1.00 25.61  ? 2015 HOH B O   1 
HETATM 8883 O O   . HOH L 7 .   ? 9.322   1.596   -68.651 1.00 26.25  ? 2016 HOH B O   1 
HETATM 8884 O O   . HOH L 7 .   ? 12.429  -0.611  -68.487 1.00 40.04  ? 2017 HOH B O   1 
HETATM 8885 O O   . HOH L 7 .   ? 15.127  2.566   -68.977 1.00 44.46  ? 2018 HOH B O   1 
HETATM 8886 O O   . HOH L 7 .   ? 15.798  -4.377  -57.020 1.00 40.63  ? 2019 HOH B O   1 
HETATM 8887 O O   . HOH L 7 .   ? 17.101  -3.595  -66.363 1.00 41.15  ? 2020 HOH B O   1 
HETATM 8888 O O   . HOH L 7 .   ? 16.946  -7.659  -60.205 1.00 44.50  ? 2021 HOH B O   1 
HETATM 8889 O O   . HOH L 7 .   ? 24.381  -2.698  -59.654 1.00 46.74  ? 2022 HOH B O   1 
HETATM 8890 O O   . HOH L 7 .   ? 17.269  1.386   -60.535 1.00 57.07  ? 2023 HOH B O   1 
HETATM 8891 O O   . HOH L 7 .   ? 17.800  -2.617  -56.136 1.00 33.23  ? 2024 HOH B O   1 
HETATM 8892 O O   . HOH L 7 .   ? 23.166  0.951   -53.363 1.00 42.25  ? 2025 HOH B O   1 
HETATM 8893 O O   . HOH L 7 .   ? 20.442  3.840   -62.305 1.00 53.51  ? 2026 HOH B O   1 
HETATM 8894 O O   . HOH L 7 .   ? 7.331   9.736   -65.380 1.00 39.01  ? 2027 HOH B O   1 
HETATM 8895 O O   . HOH L 7 .   ? 4.717   1.632   -69.504 1.00 25.32  ? 2028 HOH B O   1 
HETATM 8896 O O   . HOH L 7 .   ? 7.506   3.342   -71.769 1.00 36.72  ? 2029 HOH B O   1 
HETATM 8897 O O   . HOH L 7 .   ? 11.820  4.158   -75.032 1.00 39.28  ? 2030 HOH B O   1 
HETATM 8898 O O   . HOH L 7 .   ? -4.718  2.051   -73.837 1.00 46.84  ? 2031 HOH B O   1 
HETATM 8899 O O   . HOH L 7 .   ? -1.349  -1.361  -65.059 1.00 46.70  ? 2032 HOH B O   1 
HETATM 8900 O O   . HOH L 7 .   ? -6.196  -3.072  -56.008 1.00 41.83  ? 2033 HOH B O   1 
HETATM 8901 O O   . HOH L 7 .   ? 1.750   -2.470  -53.178 1.00 26.19  ? 2034 HOH B O   1 
HETATM 8902 O O   . HOH L 7 .   ? 6.707   -2.260  -50.843 1.00 34.13  ? 2035 HOH B O   1 
HETATM 8903 O O   . HOH L 7 .   ? 12.679  -4.151  -51.758 1.00 43.61  ? 2036 HOH B O   1 
HETATM 8904 O O   . HOH L 7 .   ? 14.290  -7.151  -48.966 1.00 29.41  ? 2037 HOH B O   1 
HETATM 8905 O O   . HOH L 7 .   ? 4.362   -5.184  -46.425 1.00 37.28  ? 2038 HOH B O   1 
HETATM 8906 O O   . HOH L 7 .   ? 6.474   -8.140  -44.793 1.00 35.17  ? 2039 HOH B O   1 
HETATM 8907 O O   . HOH L 7 .   ? 13.504  -7.769  -46.564 1.00 34.00  ? 2040 HOH B O   1 
HETATM 8908 O O   . HOH L 7 .   ? 8.413   -8.696  -39.993 1.00 42.50  ? 2041 HOH B O   1 
HETATM 8909 O O   . HOH L 7 .   ? 3.557   -13.674 -37.849 1.00 63.24  ? 2042 HOH B O   1 
HETATM 8910 O O   . HOH L 7 .   ? 4.543   -8.274  -39.705 1.00 54.42  ? 2043 HOH B O   1 
HETATM 8911 O O   . HOH L 7 .   ? -1.851  -7.102  -45.174 1.00 41.88  ? 2044 HOH B O   1 
HETATM 8912 O O   . HOH L 7 .   ? -1.195  -11.103 -45.751 1.00 56.30  ? 2045 HOH B O   1 
HETATM 8913 O O   . HOH L 7 .   ? -3.202  -3.268  -42.973 1.00 49.83  ? 2046 HOH B O   1 
HETATM 8914 O O   . HOH L 7 .   ? 4.461   -3.572  -42.936 1.00 39.89  ? 2047 HOH B O   1 
HETATM 8915 O O   . HOH L 7 .   ? 6.132   -7.895  -41.967 1.00 37.76  ? 2048 HOH B O   1 
HETATM 8916 O O   . HOH L 7 .   ? 32.440  -2.143  -33.753 1.00 52.74  ? 2049 HOH B O   1 
HETATM 8917 O O   . HOH L 7 .   ? -3.573  -5.160  -45.503 1.00 40.87  ? 2050 HOH B O   1 
HETATM 8918 O O   . HOH L 7 .   ? -5.330  -6.395  -47.528 1.00 46.18  ? 2051 HOH B O   1 
HETATM 8919 O O   . HOH L 7 .   ? -5.263  -2.223  -49.203 1.00 39.55  ? 2052 HOH B O   1 
HETATM 8920 O O   . HOH L 7 .   ? 4.759   -13.176 -53.823 1.00 36.33  ? 2053 HOH B O   1 
HETATM 8921 O O   . HOH L 7 .   ? 13.241  -3.888  -55.870 1.00 37.33  ? 2054 HOH B O   1 
HETATM 8922 O O   . HOH L 7 .   ? 9.045   -0.687  -60.918 1.00 29.51  ? 2055 HOH B O   1 
HETATM 8923 O O   . HOH L 7 .   ? 10.457  -5.754  -64.565 1.00 34.67  ? 2056 HOH B O   1 
HETATM 8924 O O   . HOH L 7 .   ? 6.944   0.113   -64.856 1.00 43.02  ? 2057 HOH B O   1 
HETATM 8925 O O   . HOH L 7 .   ? 1.554   0.327   -53.322 1.00 27.29  ? 2058 HOH B O   1 
HETATM 8926 O O   . HOH L 7 .   ? 22.249  9.985   -28.243 1.00 48.65  ? 2059 HOH B O   1 
HETATM 8927 O O   . HOH L 7 .   ? -3.738  24.478  -51.317 1.00 39.20  ? 2060 HOH B O   1 
HETATM 8928 O O   . HOH L 7 .   ? 0.197   20.059  -47.443 1.00 30.78  ? 2061 HOH B O   1 
HETATM 8929 O O   . HOH L 7 .   ? 4.421   4.922   -48.488 1.00 20.53  ? 2062 HOH B O   1 
HETATM 8930 O O   . HOH L 7 .   ? 4.142   2.530   -41.007 1.00 45.51  ? 2063 HOH B O   1 
HETATM 8931 O O   . HOH L 7 .   ? 4.395   -0.667  -43.699 1.00 38.37  ? 2064 HOH B O   1 
HETATM 8932 O O   . HOH L 7 .   ? 10.278  0.142   -44.181 1.00 27.02  ? 2065 HOH B O   1 
HETATM 8933 O O   . HOH L 7 .   ? 16.493  -3.223  -43.042 1.00 22.39  ? 2066 HOH B O   1 
HETATM 8934 O O   . HOH L 7 .   ? 16.509  -15.200 -20.987 1.00 51.37  ? 2067 HOH B O   1 
HETATM 8935 O O   . HOH L 7 .   ? -4.570  -11.995 -26.356 1.00 59.04  ? 2068 HOH B O   1 
HETATM 8936 O O   . HOH L 7 .   ? -3.423  1.374   -48.670 1.00 31.53  ? 2069 HOH B O   1 
HETATM 8937 O O   . HOH L 7 .   ? -1.269  4.252   -48.944 1.00 31.79  ? 2070 HOH B O   1 
HETATM 8938 O O   . HOH L 7 .   ? -9.223  -0.130  -45.286 1.00 49.47  ? 2071 HOH B O   1 
HETATM 8939 O O   . HOH L 7 .   ? -7.910  7.962   -45.403 1.00 34.47  ? 2072 HOH B O   1 
HETATM 8940 O O   . HOH L 7 .   ? 16.709  -7.988  -48.816 1.00 46.29  ? 2073 HOH B O   1 
HETATM 8941 O O   . HOH L 7 .   ? 22.808  -0.167  -45.162 1.00 40.98  ? 2074 HOH B O   1 
HETATM 8942 O O   . HOH L 7 .   ? 21.944  2.510   -47.697 1.00 45.15  ? 2075 HOH B O   1 
HETATM 8943 O O   . HOH L 7 .   ? 25.114  -2.331  -46.810 1.00 32.10  ? 2076 HOH B O   1 
HETATM 8944 O O   . HOH L 7 .   ? 33.579  2.631   -47.456 1.00 42.25  ? 2077 HOH B O   1 
HETATM 8945 O O   . HOH L 7 .   ? 28.321  5.668   -51.613 1.00 38.04  ? 2078 HOH B O   1 
HETATM 8946 O O   . HOH L 7 .   ? 33.318  1.589   -57.799 1.00 48.63  ? 2079 HOH B O   1 
HETATM 8947 O O   . HOH L 7 .   ? 22.951  7.531   -52.948 1.00 54.54  ? 2080 HOH B O   1 
HETATM 8948 O O   . HOH L 7 .   ? 15.966  10.185  -56.655 1.00 37.35  ? 2081 HOH B O   1 
HETATM 8949 O O   . HOH L 7 .   ? 18.848  12.967  -55.587 1.00 53.62  ? 2082 HOH B O   1 
HETATM 8950 O O   . HOH L 7 .   ? 6.247   17.069  -53.725 1.00 28.78  ? 2083 HOH B O   1 
HETATM 8951 O O   . HOH L 7 .   ? 16.526  16.956  -56.358 1.00 45.23  ? 2084 HOH B O   1 
HETATM 8952 O O   . HOH L 7 .   ? 1.859   19.528  -60.157 1.00 30.32  ? 2085 HOH B O   1 
HETATM 8953 O O   . HOH L 7 .   ? 9.838   21.631  -57.417 1.00 53.48  ? 2086 HOH B O   1 
HETATM 8954 O O   . HOH L 7 .   ? 1.226   17.956  -65.438 1.00 42.26  ? 2087 HOH B O   1 
HETATM 8955 O O   . HOH L 7 .   ? 6.898   12.868  -64.626 1.00 49.74  ? 2088 HOH B O   1 
HETATM 8956 O O   . HOH L 7 .   ? 9.236   12.518  -62.077 1.00 63.87  ? 2089 HOH B O   1 
HETATM 8957 O O   . HOH L 7 .   ? 7.944   9.315   -17.441 1.00 55.78  ? 2090 HOH B O   1 
HETATM 8958 O O   . HOH L 7 .   ? -11.329 7.918   -21.745 1.00 51.64  ? 2091 HOH B O   1 
HETATM 8959 O O   . HOH L 7 .   ? -1.546  25.240  -47.666 1.00 31.81  ? 2092 HOH B O   1 
HETATM 8960 O O   . HOH L 7 .   ? 3.506   4.253   -34.126 1.00 24.27  ? 2093 HOH B O   1 
HETATM 8961 O O   . HOH L 7 .   ? 22.742  15.926  -45.882 1.00 34.40  ? 2094 HOH B O   1 
HETATM 8962 O O   . HOH L 7 .   ? 22.309  15.736  -50.185 1.00 53.40  ? 2095 HOH B O   1 
HETATM 8963 O O   . HOH L 7 .   ? 22.114  17.794  -47.901 1.00 41.03  ? 2096 HOH B O   1 
HETATM 8964 O O   . HOH L 7 .   ? 13.847  26.098  -42.904 1.00 56.67  ? 2097 HOH B O   1 
HETATM 8965 O O   . HOH L 7 .   ? 3.082   7.895   -33.367 1.00 29.08  ? 2098 HOH B O   1 
HETATM 8966 O O   . HOH L 7 .   ? 13.091  6.847   -33.515 1.00 30.71  ? 2099 HOH B O   1 
HETATM 8967 O O   . HOH L 7 .   ? 20.535  7.272   -36.900 1.00 40.79  ? 2100 HOH B O   1 
HETATM 8968 O O   . HOH L 7 .   ? 17.134  5.847   -34.953 1.00 31.15  ? 2101 HOH B O   1 
HETATM 8969 O O   . HOH L 7 .   ? 19.180  10.350  -30.506 1.00 35.53  ? 2102 HOH B O   1 
HETATM 8970 O O   . HOH L 7 .   ? 21.760  6.489   -30.467 1.00 46.26  ? 2103 HOH B O   1 
HETATM 8971 O O   . HOH L 7 .   ? 22.467  1.617   -36.332 1.00 25.54  ? 2104 HOH B O   1 
HETATM 8972 O O   . HOH L 7 .   ? 22.990  0.308   -32.256 1.00 53.35  ? 2105 HOH B O   1 
HETATM 8973 O O   . HOH L 7 .   ? 18.990  -1.035  -37.395 1.00 46.39  ? 2106 HOH B O   1 
HETATM 8974 O O   . HOH L 7 .   ? 27.381  2.081   -37.716 1.00 38.66  ? 2107 HOH B O   1 
HETATM 8975 O O   . HOH L 7 .   ? 30.444  1.436   -36.472 1.00 39.76  ? 2108 HOH B O   1 
HETATM 8976 O O   . HOH L 7 .   ? 30.303  -4.085  -35.872 1.00 54.83  ? 2109 HOH B O   1 
HETATM 8977 O O   . HOH L 7 .   ? 31.897  -2.456  -36.730 1.00 58.97  ? 2110 HOH B O   1 
HETATM 8978 O O   . HOH L 7 .   ? 25.885  -1.754  -35.645 1.00 35.38  ? 2111 HOH B O   1 
HETATM 8979 O O   . HOH L 7 .   ? 22.152  -0.949  -36.967 1.00 33.31  ? 2112 HOH B O   1 
HETATM 8980 O O   . HOH L 7 .   ? 23.482  -2.482  -34.642 1.00 32.21  ? 2113 HOH B O   1 
HETATM 8981 O O   . HOH L 7 .   ? 37.140  -8.332  -54.028 1.00 63.25  ? 2114 HOH B O   1 
HETATM 8982 O O   . HOH L 7 .   ? 36.879  -1.469  -55.275 1.00 50.44  ? 2115 HOH B O   1 
HETATM 8983 O O   . HOH L 7 .   ? 18.442  -19.855 -55.422 1.00 55.63  ? 2116 HOH B O   1 
HETATM 8984 O O   . HOH L 7 .   ? 17.298  -5.811  -43.775 1.00 48.44  ? 2117 HOH B O   1 
HETATM 8985 O O   . HOH L 7 .   ? 23.622  -12.760 -36.539 1.00 59.79  ? 2118 HOH B O   1 
HETATM 8986 O O   . HOH L 7 .   ? 24.373  -12.086 -34.028 1.00 54.60  ? 2119 HOH B O   1 
HETATM 8987 O O   . HOH L 7 .   ? 23.077  -4.941  -33.607 1.00 25.07  ? 2120 HOH B O   1 
HETATM 8988 O O   . HOH L 7 .   ? 24.084  -1.884  -31.550 1.00 41.52  ? 2121 HOH B O   1 
HETATM 8989 O O   . HOH L 7 .   ? 23.255  -8.272  -27.395 1.00 46.32  ? 2122 HOH B O   1 
HETATM 8990 O O   . HOH L 7 .   ? 18.910  -10.695 -33.817 1.00 50.01  ? 2123 HOH B O   1 
HETATM 8991 O O   . HOH L 7 .   ? 16.456  -1.830  -28.982 1.00 42.22  ? 2124 HOH B O   1 
HETATM 8992 O O   . HOH L 7 .   ? 24.149  -2.075  -44.263 1.00 34.02  ? 2125 HOH B O   1 
HETATM 8993 O O   . HOH L 7 .   ? 22.394  10.238  -53.091 1.00 45.53  ? 2126 HOH B O   1 
HETATM 8994 O O   . HOH L 7 .   ? 25.485  10.605  -29.488 1.00 53.38  ? 2127 HOH B O   1 
HETATM 8995 O O   . HOH L 7 .   ? 8.011   28.015  -39.427 1.00 47.37  ? 2128 HOH B O   1 
HETATM 8996 O O   . HOH L 7 .   ? 6.386   4.452   -25.056 1.00 31.15  ? 2129 HOH B O   1 
HETATM 8997 O O   . HOH L 7 .   ? -3.181  0.811   -22.551 1.00 44.74  ? 2130 HOH B O   1 
HETATM 8998 O O   . HOH L 7 .   ? 5.249   -1.625  -29.385 1.00 38.83  ? 2131 HOH B O   1 
HETATM 8999 O O   . HOH L 7 .   ? 4.660   -1.053  -22.170 1.00 42.18  ? 2132 HOH B O   1 
HETATM 9000 O O   . HOH L 7 .   ? 7.155   1.197   -24.381 1.00 42.92  ? 2133 HOH B O   1 
HETATM 9001 O O   . HOH L 7 .   ? 15.088  -12.522 -21.333 1.00 47.95  ? 2134 HOH B O   1 
HETATM 9002 O O   . HOH L 7 .   ? -2.554  -12.022 -29.001 1.00 50.24  ? 2135 HOH B O   1 
HETATM 9003 O O   . HOH L 7 .   ? 14.150  -16.827 -14.939 1.00 44.07  ? 2136 HOH B O   1 
HETATM 9004 O O   . HOH L 7 .   ? 13.492  -12.279 -10.213 1.00 56.94  ? 2137 HOH B O   1 
HETATM 9005 O O   . HOH L 7 .   ? 20.745  -5.616  -10.819 1.00 52.66  ? 2138 HOH B O   1 
HETATM 9006 O O   . HOH L 7 .   ? 17.510  -14.795 -18.242 1.00 48.80  ? 2139 HOH B O   1 
HETATM 9007 O O   . HOH L 7 .   ? 21.433  -11.689 -18.142 1.00 49.52  ? 2140 HOH B O   1 
HETATM 9008 O O   . HOH L 7 .   ? 24.623  -5.296  -24.570 1.00 42.89  ? 2141 HOH B O   1 
HETATM 9009 O O   . HOH L 7 .   ? 31.657  -4.701  -21.745 1.00 54.61  ? 2142 HOH B O   1 
HETATM 9010 O O   . HOH L 7 .   ? 31.717  -1.970  -19.013 1.00 49.05  ? 2143 HOH B O   1 
HETATM 9011 O O   . HOH L 7 .   ? 11.747  -3.583  -10.665 1.00 47.46  ? 2144 HOH B O   1 
HETATM 9012 O O   . HOH L 7 .   ? 10.007  -7.015  -5.250  1.00 42.67  ? 2145 HOH B O   1 
HETATM 9013 O O   . HOH L 7 .   ? 6.150   0.162   -19.883 1.00 41.27  ? 2146 HOH B O   1 
HETATM 9014 O O   . HOH L 7 .   ? 8.629   3.575   -24.295 1.00 31.52  ? 2147 HOH B O   1 
HETATM 9015 O O   . HOH L 7 .   ? 10.180  5.370   -18.990 1.00 44.09  ? 2148 HOH B O   1 
HETATM 9016 O O   . HOH L 7 .   ? 18.451  6.666   -27.150 1.00 35.39  ? 2149 HOH B O   1 
HETATM 9017 O O   . HOH L 7 .   ? 18.311  9.109   -27.842 1.00 33.72  ? 2150 HOH B O   1 
HETATM 9018 O O   . HOH L 7 .   ? 11.205  27.640  -32.811 1.00 49.37  ? 2151 HOH B O   1 
HETATM 9019 O O   . HOH L 7 .   ? 7.900   25.053  -31.908 1.00 28.50  ? 2152 HOH B O   1 
HETATM 9020 O O   . HOH L 7 .   ? 7.084   28.386  -31.341 1.00 48.20  ? 2153 HOH B O   1 
HETATM 9021 O O   . HOH L 7 .   ? -0.317  27.145  -32.454 1.00 32.06  ? 2154 HOH B O   1 
HETATM 9022 O O   . HOH L 7 .   ? 3.339   20.380  -28.574 1.00 20.94  ? 2155 HOH B O   1 
HETATM 9023 O O   . HOH L 7 .   ? 1.534   7.672   -20.994 1.00 58.43  ? 2156 HOH B O   1 
HETATM 9024 O O   . HOH L 7 .   ? -4.697  1.652   -30.824 1.00 50.64  ? 2157 HOH B O   1 
HETATM 9025 O O   . HOH L 7 .   ? -8.475  5.463   -24.592 1.00 44.73  ? 2158 HOH B O   1 
HETATM 9026 O O   . HOH L 7 .   ? -4.823  -5.727  -34.461 1.00 59.63  ? 2159 HOH B O   1 
HETATM 9027 O O   . HOH L 7 .   ? -4.980  -10.108 -22.919 1.00 49.71  ? 2160 HOH B O   1 
HETATM 9028 O O   . HOH L 7 .   ? -2.843  1.254   -37.121 1.00 29.86  ? 2161 HOH B O   1 
HETATM 9029 O O   . HOH L 7 .   ? -14.250 -6.936  -39.160 1.00 51.99  ? 2162 HOH B O   1 
HETATM 9030 O O   . HOH L 7 .   ? -18.361 -7.680  -37.828 1.00 59.60  ? 2163 HOH B O   1 
HETATM 9031 O O   . HOH L 7 .   ? -20.346 2.120   -30.406 1.00 51.42  ? 2164 HOH B O   1 
HETATM 9032 O O   . HOH L 7 .   ? -7.247  13.877  -26.797 1.00 24.68  ? 2165 HOH B O   1 
HETATM 9033 O O   . HOH L 7 .   ? -5.227  25.372  -38.454 1.00 44.36  ? 2166 HOH B O   1 
HETATM 9034 O O   . HOH L 7 .   ? -1.555  26.802  -29.888 1.00 34.21  ? 2167 HOH B O   1 
HETATM 9035 O O   . HOH L 7 .   ? -4.009  27.746  -30.908 1.00 43.39  ? 2168 HOH B O   1 
HETATM 9036 O O   . HOH L 7 .   ? -13.617 31.318  -25.703 1.00 32.48  ? 2169 HOH B O   1 
HETATM 9037 O O   . HOH L 7 .   ? 4.402   27.250  -27.037 1.00 45.30  ? 2170 HOH B O   1 
HETATM 9038 O O   . HOH L 7 .   ? 6.152   24.262  -25.080 1.00 25.23  ? 2171 HOH B O   1 
HETATM 9039 O O   . HOH L 7 .   ? 10.891  17.160  -23.183 1.00 24.58  ? 2172 HOH B O   1 
HETATM 9040 O O   . HOH L 7 .   ? 12.224  26.576  -28.265 1.00 36.81  ? 2173 HOH B O   1 
HETATM 9041 O O   . HOH L 7 .   ? 12.243  27.863  -25.581 1.00 39.63  ? 2174 HOH B O   1 
HETATM 9042 O O   . HOH L 7 .   ? 13.278  26.182  -18.620 1.00 60.42  ? 2175 HOH B O   1 
HETATM 9043 O O   . HOH L 7 .   ? 1.330   23.771  -19.762 1.00 37.96  ? 2176 HOH B O   1 
HETATM 9044 O O   . HOH L 7 .   ? 2.726   11.552  -20.792 1.00 36.37  ? 2177 HOH B O   1 
HETATM 9045 O O   . HOH L 7 .   ? 5.391   14.893  -18.760 1.00 39.17  ? 2178 HOH B O   1 
HETATM 9046 O O   . HOH L 7 .   ? 6.663   12.030  -19.435 1.00 50.46  ? 2179 HOH B O   1 
HETATM 9047 O O   . HOH L 7 .   ? -5.756  12.829  -20.916 1.00 41.13  ? 2180 HOH B O   1 
HETATM 9048 O O   . HOH L 7 .   ? -8.925  7.617   -23.724 1.00 53.89  ? 2181 HOH B O   1 
HETATM 9049 O O   . HOH L 7 .   ? -10.097 18.286  -27.509 1.00 35.83  ? 2182 HOH B O   1 
HETATM 9050 O O   . HOH L 7 .   ? -4.242  21.157  -20.581 1.00 32.41  ? 2183 HOH B O   1 
HETATM 9051 O O   . HOH L 7 .   ? 1.093   21.464  -18.714 1.00 30.43  ? 2184 HOH B O   1 
HETATM 9052 O O   . HOH L 7 .   ? 3.062   17.157  -17.190 1.00 43.49  ? 2185 HOH B O   1 
HETATM 9053 O O   . HOH L 7 .   ? 8.593   14.249  -17.839 1.00 39.63  ? 2186 HOH B O   1 
HETATM 9054 O O   . HOH L 7 .   ? 12.483  15.126  -22.866 1.00 20.70  ? 2187 HOH B O   1 
HETATM 9055 O O   . HOH L 7 .   ? 4.596   9.142   -20.640 1.00 35.45  ? 2188 HOH B O   1 
HETATM 9056 O O   . HOH L 7 .   ? 10.796  12.950  -16.296 1.00 42.92  ? 2189 HOH B O   1 
HETATM 9057 O O   . HOH L 7 .   ? 15.338  15.641  -21.166 1.00 37.06  ? 2190 HOH B O   1 
HETATM 9058 O O   . HOH L 7 .   ? 11.334  10.704  -16.996 1.00 33.09  ? 2191 HOH B O   1 
HETATM 9059 O O   . HOH L 7 .   ? 17.372  15.809  -25.133 1.00 38.77  ? 2192 HOH B O   1 
HETATM 9060 O O   . HOH L 7 .   ? 17.717  15.589  -22.153 1.00 43.01  ? 2193 HOH B O   1 
HETATM 9061 O O   . HOH L 7 .   ? 13.733  -9.786  -34.002 1.00 53.86  ? 2194 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLU A 1   ? 1.3273 1.1717 0.7999 0.0234  -0.0371 -0.0332 1   GLU A N   
2    C CA  . GLU A 1   ? 1.2822 1.1230 0.7563 0.0297  -0.0176 -0.0244 1   GLU A CA  
3    C C   . GLU A 1   ? 1.2745 1.1050 0.7076 0.0316  -0.0064 -0.0297 1   GLU A C   
4    O O   . GLU A 1   ? 1.3096 1.1396 0.7093 0.0301  -0.0157 -0.0298 1   GLU A O   
5    C CB  . GLU A 1   ? 1.2481 1.0979 0.7330 0.0330  -0.0198 -0.0047 1   GLU A CB  
6    C CG  . GLU A 1   ? 1.1750 1.0217 0.6607 0.0362  -0.0002 0.0051  1   GLU A CG  
7    C CD  . GLU A 1   ? 1.0809 0.9311 0.5795 0.0377  -0.0018 0.0233  1   GLU A CD  
8    O OE1 . GLU A 1   ? 1.0539 0.9098 0.5670 0.0385  -0.0171 0.0277  1   GLU A OE1 
9    O OE2 . GLU A 1   ? 1.0353 0.8819 0.5291 0.0378  0.0129  0.0329  1   GLU A OE2 
10   N N   . GLY A 2   ? 1.2339 1.0584 0.6697 0.0354  0.0137  -0.0339 2   GLY A N   
11   C CA  . GLY A 2   ? 1.2047 1.0204 0.6028 0.0382  0.0274  -0.0396 2   GLY A CA  
12   C C   . GLY A 2   ? 1.1519 0.9635 0.5599 0.0440  0.0488  -0.0476 2   GLY A C   
13   O O   . GLY A 2   ? 1.0400 0.8565 0.4412 0.0480  0.0665  -0.0411 2   GLY A O   
14   N N   . ARG A 3   ? 1.2142 1.0173 0.6381 0.0448  0.0477  -0.0610 3   ARG A N   
15   C CA  . ARG A 3   ? 1.1683 0.9662 0.6004 0.0532  0.0674  -0.0694 3   ARG A CA  
16   C C   . ARG A 3   ? 1.1117 0.9193 0.5912 0.0562  0.0703  -0.0641 3   ARG A C   
17   O O   . ARG A 3   ? 1.1781 0.9843 0.6693 0.0648  0.0853  -0.0696 3   ARG A O   
18   C CB  . ARG A 3   ? 1.1683 0.9421 0.5728 0.0543  0.0680  -0.0903 3   ARG A CB  
19   C CG  . ARG A 3   ? 1.2394 1.0058 0.6300 0.0659  0.0920  -0.0988 3   ARG A CG  
20   C CD  . ARG A 3   ? 1.2493 1.0184 0.6007 0.0670  0.1019  -0.0968 3   ARG A CD  
21   N NE  . ARG A 3   ? 1.2735 1.0260 0.5814 0.0593  0.0882  -0.1073 3   ARG A NE  
22   C CZ  . ARG A 3   ? 1.3020 1.0563 0.5815 0.0584  0.0936  -0.1105 3   ARG A CZ  
23   N NH1 . ARG A 3   ? 1.2156 0.9816 0.4942 0.0659  0.1147  -0.1051 3   ARG A NH1 
24   N NH2 . ARG A 3   ? 1.3880 1.1359 0.6423 0.0492  0.0777  -0.1189 3   ARG A NH2 
25   N N   . GLU A 4   ? 1.0122 0.8304 0.5179 0.0503  0.0564  -0.0533 4   GLU A N   
26   C CA  . GLU A 4   ? 0.9915 0.8203 0.5402 0.0523  0.0586  -0.0473 4   GLU A CA  
27   C C   . GLU A 4   ? 0.9261 0.7734 0.4911 0.0553  0.0737  -0.0343 4   GLU A C   
28   O O   . GLU A 4   ? 0.9747 0.8260 0.5183 0.0546  0.0815  -0.0283 4   GLU A O   
29   C CB  . GLU A 4   ? 1.0723 0.9054 0.6423 0.0450  0.0396  -0.0414 4   GLU A CB  
30   C CG  . GLU A 4   ? 1.2239 1.0586 0.7739 0.0389  0.0245  -0.0360 4   GLU A CG  
31   C CD  . GLU A 4   ? 1.3180 1.1568 0.8883 0.0331  0.0059  -0.0349 4   GLU A CD  
32   O OE1 . GLU A 4   ? 1.2845 1.1197 0.8766 0.0323  0.0047  -0.0414 4   GLU A OE1 
33   O OE2 . GLU A 4   ? 1.3844 1.2304 0.9487 0.0302  -0.0070 -0.0269 4   GLU A OE2 
34   N N   . ASP A 5   ? 0.8008 0.6597 0.4027 0.0577  0.0777  -0.0300 5   ASP A N   
35   C CA  . ASP A 5   ? 0.6991 0.5790 0.3215 0.0584  0.0911  -0.0185 5   ASP A CA  
36   C C   . ASP A 5   ? 0.7261 0.6117 0.3506 0.0491  0.0832  -0.0041 5   ASP A C   
37   O O   . ASP A 5   ? 0.7152 0.5996 0.3563 0.0448  0.0693  -0.0001 5   ASP A O   
38   C CB  . ASP A 5   ? 0.6349 0.5260 0.2958 0.0630  0.0939  -0.0184 5   ASP A CB  
39   C CG  . ASP A 5   ? 0.6953 0.6126 0.3810 0.0617  0.1059  -0.0067 5   ASP A CG  
40   O OD1 . ASP A 5   ? 0.7353 0.6602 0.4106 0.0552  0.1115  0.0022  5   ASP A OD1 
41   O OD2 . ASP A 5   ? 0.6905 0.6211 0.4063 0.0665  0.1094  -0.0062 5   ASP A OD2 
42   N N   . PRO A 6   ? 0.8035 0.6938 0.4098 0.0462  0.0933  0.0040  6   PRO A N   
43   C CA  . PRO A 6   ? 0.7595 0.6488 0.3611 0.0381  0.0872  0.0181  6   PRO A CA  
44   C C   . PRO A 6   ? 0.7121 0.6132 0.3491 0.0327  0.0867  0.0275  6   PRO A C   
45   O O   . PRO A 6   ? 0.6947 0.5902 0.3311 0.0268  0.0793  0.0378  6   PRO A O   
46   C CB  . PRO A 6   ? 0.8414 0.7329 0.4161 0.0365  0.1026  0.0238  6   PRO A CB  
47   C CG  . PRO A 6   ? 0.7771 0.6818 0.3600 0.0429  0.1199  0.0155  6   PRO A CG  
48   C CD  . PRO A 6   ? 0.7900 0.6849 0.3766 0.0508  0.1118  0.0006  6   PRO A CD  
49   N N   . GLN A 7   ? 0.6964 0.6127 0.3624 0.0355  0.0941  0.0239  7   GLN A N   
50   C CA  . GLN A 7   ? 0.6947 0.6245 0.3933 0.0295  0.0939  0.0318  7   GLN A CA  
51   C C   . GLN A 7   ? 0.6654 0.5893 0.3838 0.0300  0.0776  0.0293  7   GLN A C   
52   O O   . GLN A 7   ? 0.6865 0.6184 0.4291 0.0249  0.0749  0.0353  7   GLN A O   
53   C CB  . GLN A 7   ? 0.8818 0.8360 0.6027 0.0323  0.1095  0.0308  7   GLN A CB  
54   C CG  . GLN A 7   ? 0.9831 0.9565 0.7380 0.0249  0.1100  0.0384  7   GLN A CG  
55   C CD  . GLN A 7   ? 0.9625 0.9337 0.7114 0.0108  0.1112  0.0505  7   GLN A CD  
56   O OE1 . GLN A 7   ? 0.8840 0.8533 0.6483 0.0036  0.1030  0.0555  7   GLN A OE1 
57   N NE2 . GLN A 7   ? 0.9872 0.9568 0.7121 0.0067  0.1223  0.0553  7   GLN A NE2 
58   N N   . LEU A 8   ? 0.6661 0.5760 0.3729 0.0349  0.0668  0.0205  8   LEU A N   
59   C CA  . LEU A 8   ? 0.6346 0.5406 0.3601 0.0348  0.0525  0.0176  8   LEU A CA  
60   C C   . LEU A 8   ? 0.6745 0.5692 0.3871 0.0318  0.0371  0.0204  8   LEU A C   
61   O O   . LEU A 8   ? 0.6650 0.5574 0.3896 0.0316  0.0251  0.0170  8   LEU A O   
62   C CB  . LEU A 8   ? 0.6147 0.5157 0.3436 0.0416  0.0518  0.0050  8   LEU A CB  
63   C CG  . LEU A 8   ? 0.6370 0.5506 0.3834 0.0481  0.0659  0.0029  8   LEU A CG  
64   C CD1 . LEU A 8   ? 0.5349 0.4357 0.2768 0.0564  0.0663  -0.0097 8   LEU A CD1 
65   C CD2 . LEU A 8   ? 0.5532 0.4832 0.3334 0.0448  0.0648  0.0109  8   LEU A CD2 
66   N N   . LEU A 9   ? 0.6331 0.5219 0.3212 0.0300  0.0377  0.0272  9   LEU A N   
67   C CA  . LEU A 9   ? 0.5753 0.4558 0.2499 0.0297  0.0234  0.0312  9   LEU A CA  
68   C C   . LEU A 9   ? 0.6050 0.4832 0.2848 0.0264  0.0235  0.0447  9   LEU A C   
69   O O   . LEU A 9   ? 0.6645 0.5404 0.3339 0.0231  0.0346  0.0524  9   LEU A O   
70   C CB  . LEU A 9   ? 0.5908 0.4632 0.2287 0.0319  0.0220  0.0290  9   LEU A CB  
71   C CG  . LEU A 9   ? 0.7461 0.6160 0.3721 0.0344  0.0242  0.0142  9   LEU A CG  
72   C CD1 . LEU A 9   ? 0.7692 0.6312 0.3545 0.0356  0.0249  0.0122  9   LEU A CD1 
73   C CD2 . LEU A 9   ? 0.6909 0.5599 0.3304 0.0338  0.0106  0.0045  9   LEU A CD2 
74   N N   . VAL A 10  ? 0.5434 0.4213 0.2386 0.0269  0.0119  0.0472  10  VAL A N   
75   C CA  . VAL A 10  ? 0.5360 0.4079 0.2366 0.0248  0.0117  0.0585  10  VAL A CA  
76   C C   . VAL A 10  ? 0.6170 0.4850 0.3147 0.0304  -0.0035 0.0616  10  VAL A C   
77   O O   . VAL A 10  ? 0.6584 0.5347 0.3649 0.0328  -0.0141 0.0540  10  VAL A O   
78   C CB  . VAL A 10  ? 0.6023 0.4823 0.3341 0.0198  0.0163  0.0579  10  VAL A CB  
79   C CG1 . VAL A 10  ? 0.6416 0.5119 0.3769 0.0169  0.0154  0.0675  10  VAL A CG1 
80   C CG2 . VAL A 10  ? 0.5827 0.4724 0.3205 0.0152  0.0311  0.0560  10  VAL A CG2 
81   N N   . ARG A 11  ? 0.5939 0.4494 0.2788 0.0325  -0.0043 0.0729  11  ARG A N   
82   C CA  . ARG A 11  ? 0.5411 0.3950 0.2255 0.0403  -0.0176 0.0773  11  ARG A CA  
83   C C   . ARG A 11  ? 0.6261 0.4748 0.3301 0.0398  -0.0166 0.0817  11  ARG A C   
84   O O   . ARG A 11  ? 0.6508 0.4864 0.3517 0.0344  -0.0063 0.0877  11  ARG A O   
85   C CB  . ARG A 11  ? 0.5770 0.4181 0.2287 0.0469  -0.0204 0.0877  11  ARG A CB  
86   C CG  . ARG A 11  ? 0.5819 0.4208 0.2333 0.0577  -0.0324 0.0951  11  ARG A CG  
87   C CD  . ARG A 11  ? 0.6199 0.4483 0.2378 0.0662  -0.0368 0.1058  11  ARG A CD  
88   N NE  . ARG A 11  ? 0.7123 0.5553 0.3155 0.0675  -0.0456 0.0997  11  ARG A NE  
89   C CZ  . ARG A 11  ? 0.7063 0.5677 0.3137 0.0741  -0.0616 0.0969  11  ARG A CZ  
90   N NH1 . ARG A 11  ? 0.7081 0.5777 0.3361 0.0814  -0.0697 0.1000  11  ARG A NH1 
91   N NH2 . ARG A 11  ? 0.7084 0.5813 0.2993 0.0728  -0.0694 0.0905  11  ARG A NH2 
92   N N   . VAL A 12  ? 0.5723 0.4316 0.2955 0.0443  -0.0268 0.0783  12  VAL A N   
93   C CA  . VAL A 12  ? 0.5375 0.3906 0.2746 0.0464  -0.0271 0.0828  12  VAL A CA  
94   C C   . VAL A 12  ? 0.5661 0.4180 0.2958 0.0592  -0.0376 0.0894  12  VAL A C   
95   O O   . VAL A 12  ? 0.6451 0.5036 0.3600 0.0653  -0.0457 0.0908  12  VAL A O   
96   C CB  . VAL A 12  ? 0.4899 0.3575 0.2578 0.0416  -0.0281 0.0743  12  VAL A CB  
97   C CG1 . VAL A 12  ? 0.4631 0.3317 0.2393 0.0312  -0.0171 0.0704  12  VAL A CG1 
98   C CG2 . VAL A 12  ? 0.5516 0.4386 0.3297 0.0435  -0.0386 0.0662  12  VAL A CG2 
99   N N   . ARG A 13  ? 0.5702 0.4150 0.3098 0.0638  -0.0375 0.0932  13  ARG A N   
100  C CA  . ARG A 13  ? 0.5960 0.4386 0.3291 0.0788  -0.0456 0.1009  13  ARG A CA  
101  C C   . ARG A 13  ? 0.5619 0.4336 0.3045 0.0851  -0.0597 0.0969  13  ARG A C   
102  O O   . ARG A 13  ? 0.5895 0.4649 0.3193 0.0972  -0.0680 0.1039  13  ARG A O   
103  C CB  . ARG A 13  ? 0.5382 0.3718 0.2849 0.0825  -0.0424 0.1025  13  ARG A CB  
104  C CG  . ARG A 13  ? 0.5437 0.3770 0.2864 0.1010  -0.0497 0.1102  13  ARG A CG  
105  C CD  . ARG A 13  ? 0.5677 0.3763 0.2778 0.1108  -0.0485 0.1225  13  ARG A CD  
106  N NE  . ARG A 13  ? 0.6529 0.4602 0.3583 0.1314  -0.0550 0.1313  13  ARG A NE  
107  C CZ  . ARG A 13  ? 0.6731 0.5093 0.3840 0.1435  -0.0682 0.1331  13  ARG A CZ  
108  N NH1 . ARG A 13  ? 0.6169 0.4826 0.3367 0.1351  -0.0766 0.1255  13  ARG A NH1 
109  N NH2 . ARG A 13  ? 0.6841 0.5252 0.4006 0.1591  -0.0714 0.1387  13  ARG A NH2 
110  N N   . GLY A 14  ? 0.5039 0.3962 0.2686 0.0764  -0.0625 0.0859  14  GLY A N   
111  C CA  . GLY A 14  ? 0.5180 0.4377 0.2927 0.0783  -0.0755 0.0808  14  GLY A CA  
112  C C   . GLY A 14  ? 0.5999 0.5261 0.3585 0.0731  -0.0804 0.0758  14  GLY A C   
113  O O   . GLY A 14  ? 0.6544 0.6027 0.4176 0.0729  -0.0921 0.0713  14  GLY A O   
114  N N   . GLY A 15  ? 0.5978 0.5061 0.3373 0.0678  -0.0711 0.0758  15  GLY A N   
115  C CA  . GLY A 15  ? 0.6333 0.5451 0.3537 0.0635  -0.0742 0.0705  15  GLY A CA  
116  C C   . GLY A 15  ? 0.5812 0.4816 0.2955 0.0539  -0.0619 0.0641  15  GLY A C   
117  O O   . GLY A 15  ? 0.6016 0.4906 0.3232 0.0506  -0.0503 0.0663  15  GLY A O   
118  N N   . GLN A 16  ? 0.5958 0.5003 0.2962 0.0497  -0.0644 0.0558  16  GLN A N   
119  C CA  . GLN A 16  ? 0.6054 0.5007 0.2983 0.0430  -0.0522 0.0490  16  GLN A CA  
120  C C   . GLN A 16  ? 0.5375 0.4381 0.2542 0.0363  -0.0493 0.0377  16  GLN A C   
121  O O   . GLN A 16  ? 0.6088 0.5200 0.3375 0.0338  -0.0591 0.0307  16  GLN A O   
122  C CB  . GLN A 16  ? 0.5891 0.4824 0.2508 0.0427  -0.0545 0.0450  16  GLN A CB  
123  C CG  . GLN A 16  ? 0.6248 0.5077 0.2578 0.0485  -0.0523 0.0571  16  GLN A CG  
124  C CD  . GLN A 16  ? 0.7185 0.6020 0.3192 0.0487  -0.0573 0.0534  16  GLN A CD  
125  O OE1 . GLN A 16  ? 0.8393 0.7352 0.4337 0.0510  -0.0727 0.0516  16  GLN A OE1 
126  N NE2 . GLN A 16  ? 0.6930 0.5652 0.2724 0.0461  -0.0444 0.0520  16  GLN A NE2 
127  N N   . LEU A 17  ? 0.5315 0.4254 0.2545 0.0334  -0.0357 0.0365  17  LEU A N   
128  C CA  . LEU A 17  ? 0.4934 0.3903 0.2363 0.0292  -0.0315 0.0272  17  LEU A CA  
129  C C   . LEU A 17  ? 0.5552 0.4460 0.2843 0.0285  -0.0209 0.0200  17  LEU A C   
130  O O   . LEU A 17  ? 0.6351 0.5214 0.3478 0.0297  -0.0116 0.0246  17  LEU A O   
131  C CB  . LEU A 17  ? 0.4548 0.3536 0.2221 0.0280  -0.0247 0.0323  17  LEU A CB  
132  C CG  . LEU A 17  ? 0.5534 0.4556 0.3347 0.0295  -0.0315 0.0394  17  LEU A CG  
133  C CD1 . LEU A 17  ? 0.5051 0.4054 0.3017 0.0269  -0.0225 0.0443  17  LEU A CD1 
134  C CD2 . LEU A 17  ? 0.5316 0.4441 0.3294 0.0284  -0.0422 0.0334  17  LEU A CD2 
135  N N   . ARG A 18  ? 0.5533 0.4428 0.2883 0.0268  -0.0214 0.0089  18  ARG A N   
136  C CA  . ARG A 18  ? 0.5397 0.4228 0.2671 0.0285  -0.0090 0.0019  18  ARG A CA  
137  C C   . ARG A 18  ? 0.6038 0.4901 0.3589 0.0292  -0.0029 0.0005  18  ARG A C   
138  O O   . ARG A 18  ? 0.6387 0.5241 0.4081 0.0270  -0.0101 -0.0037 18  ARG A O   
139  C CB  . ARG A 18  ? 0.5339 0.4071 0.2388 0.0275  -0.0129 -0.0106 18  ARG A CB  
140  C CG  . ARG A 18  ? 0.6456 0.5092 0.3406 0.0317  0.0010  -0.0193 18  ARG A CG  
141  C CD  . ARG A 18  ? 0.7873 0.6362 0.4547 0.0297  -0.0030 -0.0331 18  ARG A CD  
142  N NE  . ARG A 18  ? 0.9024 0.7510 0.5738 0.0220  -0.0193 -0.0375 18  ARG A NE  
143  C CZ  . ARG A 18  ? 0.8967 0.7490 0.5500 0.0170  -0.0323 -0.0387 18  ARG A CZ  
144  N NH1 . ARG A 18  ? 0.7887 0.6418 0.4154 0.0195  -0.0311 -0.0357 18  ARG A NH1 
145  N NH2 . ARG A 18  ? 0.9977 0.8549 0.6597 0.0091  -0.0467 -0.0423 18  ARG A NH2 
146  N N   . GLY A 19  ? 0.4778 0.3695 0.2403 0.0319  0.0100  0.0049  19  GLY A N   
147  C CA  . GLY A 19  ? 0.4640 0.3622 0.2521 0.0338  0.0157  0.0049  19  GLY A CA  
148  C C   . GLY A 19  ? 0.5554 0.4485 0.3387 0.0405  0.0256  -0.0037 19  GLY A C   
149  O O   . GLY A 19  ? 0.5151 0.3968 0.2739 0.0427  0.0277  -0.0116 19  GLY A O   
150  N N   . ILE A 20  ? 0.4808 0.3822 0.2865 0.0446  0.0320  -0.0022 20  ILE A N   
151  C CA  . ILE A 20  ? 0.5277 0.4241 0.3312 0.0541  0.0420  -0.0094 20  ILE A CA  
152  C C   . ILE A 20  ? 0.5021 0.4200 0.3223 0.0598  0.0552  -0.0031 20  ILE A C   
153  O O   . ILE A 20  ? 0.5270 0.4626 0.3674 0.0549  0.0542  0.0060  20  ILE A O   
154  C CB  . ILE A 20  ? 0.5721 0.4546 0.3844 0.0561  0.0360  -0.0151 20  ILE A CB  
155  C CG1 . ILE A 20  ? 0.6095 0.4806 0.4159 0.0682  0.0468  -0.0228 20  ILE A CG1 
156  C CG2 . ILE A 20  ? 0.4404 0.3362 0.2816 0.0533  0.0309  -0.0066 20  ILE A CG2 
157  C CD1 . ILE A 20  ? 0.4993 0.3515 0.3112 0.0700  0.0420  -0.0275 20  ILE A CD1 
158  N N   . ARG A 21  ? 0.4872 0.4049 0.2980 0.0696  0.0679  -0.0084 21  ARG A N   
159  C CA  . ARG A 21  ? 0.4813 0.4241 0.3096 0.0762  0.0811  -0.0030 21  ARG A CA  
160  C C   . ARG A 21  ? 0.4844 0.4298 0.3337 0.0870  0.0823  -0.0039 21  ARG A C   
161  O O   . ARG A 21  ? 0.5627 0.4890 0.4011 0.0978  0.0859  -0.0125 21  ARG A O   
162  C CB  . ARG A 21  ? 0.5108 0.4544 0.3183 0.0832  0.0955  -0.0078 21  ARG A CB  
163  C CG  . ARG A 21  ? 0.5078 0.4825 0.3335 0.0903  0.1109  -0.0024 21  ARG A CG  
164  C CD  . ARG A 21  ? 0.5675 0.5404 0.3709 0.1001  0.1266  -0.0092 21  ARG A CD  
165  N NE  . ARG A 21  ? 0.7280 0.7180 0.5481 0.1170  0.1399  -0.0105 21  ARG A NE  
166  C CZ  . ARG A 21  ? 0.8461 0.8660 0.6739 0.1227  0.1562  -0.0069 21  ARG A CZ  
167  N NH1 . ARG A 21  ? 0.9279 0.9611 0.7460 0.1111  0.1620  -0.0018 21  ARG A NH1 
168  N NH2 . ARG A 21  ? 0.8294 0.8666 0.6746 0.1407  0.1674  -0.0078 21  ARG A NH2 
169  N N   . LEU A 22  ? 0.4669 0.4338 0.3440 0.0842  0.0792  0.0051  22  LEU A N   
170  C CA  . LEU A 22  ? 0.4630 0.4336 0.3597 0.0947  0.0790  0.0062  22  LEU A CA  
171  C C   . LEU A 22  ? 0.4731 0.4740 0.3875 0.1067  0.0922  0.0105  22  LEU A C   
172  O O   . LEU A 22  ? 0.5022 0.5296 0.4230 0.1014  0.0992  0.0156  22  LEU A O   
173  C CB  . LEU A 22  ? 0.4426 0.4194 0.3586 0.0854  0.0667  0.0133  22  LEU A CB  
174  C CG  . LEU A 22  ? 0.4504 0.4012 0.3548 0.0761  0.0536  0.0097  22  LEU A CG  
175  C CD1 . LEU A 22  ? 0.3965 0.3557 0.3211 0.0698  0.0441  0.0166  22  LEU A CD1 
176  C CD2 . LEU A 22  ? 0.4593 0.3796 0.3465 0.0833  0.0532  -0.0002 22  LEU A CD2 
177  N N   . LYS A 23  ? 0.5244 0.5216 0.4469 0.1228  0.0957  0.0090  23  LYS A N   
178  C CA  . LYS A 23  ? 0.5785 0.6077 0.5210 0.1375  0.1074  0.0138  23  LYS A CA  
179  C C   . LYS A 23  ? 0.5778 0.6365 0.5517 0.1350  0.1003  0.0247  23  LYS A C   
180  O O   . LYS A 23  ? 0.5434 0.5870 0.5218 0.1360  0.0905  0.0262  23  LYS A O   
181  C CB  . LYS A 23  ? 0.6592 0.6664 0.5908 0.1595  0.1161  0.0066  23  LYS A CB  
182  C CG  . LYS A 23  ? 0.7939 0.8340 0.7465 0.1795  0.1289  0.0115  23  LYS A CG  
183  C CD  . LYS A 23  ? 0.8947 0.9720 0.8532 0.1762  0.1409  0.0140  23  LYS A CD  
184  C CE  . LYS A 23  ? 0.8696 0.9902 0.8555 0.1950  0.1527  0.0206  23  LYS A CE  
185  N NZ  . LYS A 23  ? 0.8377 1.0046 0.8385 0.1834  0.1603  0.0266  23  LYS A NZ  
186  N N   . ALA A 24  ? 0.4955 0.5965 0.4896 0.1298  0.1051  0.0322  24  ALA A N   
187  C CA  . ALA A 24  ? 0.5099 0.6449 0.5339 0.1288  0.0997  0.0420  24  ALA A CA  
188  C C   . ALA A 24  ? 0.5655 0.7395 0.6096 0.1464  0.1124  0.0460  24  ALA A C   
189  O O   . ALA A 24  ? 0.5838 0.7631 0.6194 0.1538  0.1259  0.0419  24  ALA A O   
190  C CB  . ALA A 24  ? 0.3622 0.5162 0.3945 0.1051  0.0931  0.0476  24  ALA A CB  
191  N N   . PRO A 25  ? 0.5528 0.7561 0.6232 0.1540  0.1081  0.0543  25  PRO A N   
192  C CA  . PRO A 25  ? 0.4624 0.7065 0.5545 0.1741  0.1194  0.0590  25  PRO A CA  
193  C C   . PRO A 25  ? 0.4160 0.6986 0.5160 0.1683  0.1327  0.0597  25  PRO A C   
194  O O   . PRO A 25  ? 0.4821 0.7786 0.5843 0.1879  0.1472  0.0579  25  PRO A O   
195  C CB  . PRO A 25  ? 0.4405 0.7184 0.5609 0.1728  0.1085  0.0696  25  PRO A CB  
196  C CG  . PRO A 25  ? 0.4879 0.7239 0.5941 0.1648  0.0941  0.0682  25  PRO A CG  
197  C CD  . PRO A 25  ? 0.4875 0.6886 0.5681 0.1461  0.0928  0.0599  25  PRO A CD  
198  N N   . GLY A 26  ? 0.3745 0.6718 0.4768 0.1421  0.1290  0.0623  26  GLY A N   
199  C CA  . GLY A 26  ? 0.3769 0.7111 0.4866 0.1327  0.1415  0.0643  26  GLY A CA  
200  C C   . GLY A 26  ? 0.5770 0.8816 0.6561 0.1234  0.1495  0.0574  26  GLY A C   
201  O O   . GLY A 26  ? 0.3995 0.7315 0.4812 0.1161  0.1618  0.0592  26  GLY A O   
202  N N   . GLY A 27  ? 0.5454 0.7963 0.5953 0.1230  0.1427  0.0499  27  GLY A N   
203  C CA  . GLY A 27  ? 0.4187 0.6400 0.4370 0.1162  0.1486  0.0433  27  GLY A CA  
204  C C   . GLY A 27  ? 0.5728 0.7437 0.5655 0.1076  0.1352  0.0379  27  GLY A C   
205  O O   . GLY A 27  ? 0.4949 0.6522 0.4942 0.1068  0.1220  0.0388  27  GLY A O   
206  N N   . PRO A 28  ? 0.6151 0.7602 0.5782 0.1010  0.1384  0.0326  28  PRO A N   
207  C CA  . PRO A 28  ? 0.4360 0.5375 0.3747 0.0933  0.1258  0.0275  28  PRO A CA  
208  C C   . PRO A 28  ? 0.5283 0.6289 0.4723 0.0730  0.1133  0.0340  28  PRO A C   
209  O O   . PRO A 28  ? 0.4612 0.5884 0.4175 0.0606  0.1169  0.0413  28  PRO A O   
210  C CB  . PRO A 28  ? 0.4768 0.5607 0.3839 0.0925  0.1344  0.0218  28  PRO A CB  
211  C CG  . PRO A 28  ? 0.5451 0.6666 0.4619 0.0899  0.1500  0.0275  28  PRO A CG  
212  C CD  . PRO A 28  ? 0.4558 0.6139 0.4067 0.1017  0.1547  0.0315  28  PRO A CD  
213  N N   . VAL A 29  ? 0.4063 0.4768 0.3411 0.0695  0.0995  0.0312  29  VAL A N   
214  C CA  . VAL A 29  ? 0.4660 0.5281 0.3986 0.0523  0.0887  0.0357  29  VAL A CA  
215  C C   . VAL A 29  ? 0.4641 0.4902 0.3698 0.0501  0.0806  0.0302  29  VAL A C   
216  O O   . VAL A 29  ? 0.4160 0.4227 0.3087 0.0600  0.0797  0.0223  29  VAL A O   
217  C CB  . VAL A 29  ? 0.4826 0.5522 0.4377 0.0489  0.0778  0.0397  29  VAL A CB  
218  C CG1 . VAL A 29  ? 0.3563 0.4644 0.3389 0.0512  0.0833  0.0454  29  VAL A CG1 
219  C CG2 . VAL A 29  ? 0.3664 0.4124 0.3186 0.0589  0.0695  0.0343  29  VAL A CG2 
220  N N   . SER A 30  ? 0.4352 0.4523 0.3320 0.0371  0.0743  0.0343  30  SER A N   
221  C CA  . SER A 30  ? 0.5040 0.4925 0.3788 0.0356  0.0649  0.0304  30  SER A CA  
222  C C   . SER A 30  ? 0.4478 0.4277 0.3342 0.0333  0.0515  0.0305  30  SER A C   
223  O O   . SER A 30  ? 0.4639 0.4543 0.3663 0.0263  0.0483  0.0362  30  SER A O   
224  C CB  . SER A 30  ? 0.5143 0.4955 0.3700 0.0257  0.0658  0.0356  30  SER A CB  
225  O OG  . SER A 30  ? 0.6397 0.6314 0.4855 0.0258  0.0795  0.0371  30  SER A OG  
226  N N   . ALA A 31  ? 0.4366 0.3979 0.3142 0.0382  0.0441  0.0237  31  ALA A N   
227  C CA  . ALA A 31  ? 0.4286 0.3822 0.3153 0.0350  0.0320  0.0239  31  ALA A CA  
228  C C   . ALA A 31  ? 0.4521 0.3880 0.3204 0.0318  0.0228  0.0208  31  ALA A C   
229  O O   . ALA A 31  ? 0.5577 0.4820 0.4069 0.0350  0.0231  0.0144  31  ALA A O   
230  C CB  . ALA A 31  ? 0.3789 0.3299 0.2773 0.0424  0.0309  0.0197  31  ALA A CB  
231  N N   . PHE A 32  ? 0.4122 0.3474 0.2860 0.0258  0.0144  0.0254  32  PHE A N   
232  C CA  . PHE A 32  ? 0.3759 0.3000 0.2376 0.0240  0.0042  0.0236  32  PHE A CA  
233  C C   . PHE A 32  ? 0.4172 0.3423 0.2958 0.0222  -0.0042 0.0232  32  PHE A C   
234  O O   . PHE A 32  ? 0.4501 0.3812 0.3411 0.0190  -0.0060 0.0288  32  PHE A O   
235  C CB  . PHE A 32  ? 0.3817 0.3036 0.2315 0.0207  0.0033  0.0306  32  PHE A CB  
236  C CG  . PHE A 32  ? 0.4076 0.3275 0.2385 0.0213  0.0122  0.0320  32  PHE A CG  
237  C CD1 . PHE A 32  ? 0.4140 0.3437 0.2512 0.0189  0.0235  0.0360  32  PHE A CD1 
238  C CD2 . PHE A 32  ? 0.4505 0.3612 0.2572 0.0236  0.0094  0.0295  32  PHE A CD2 
239  C CE1 . PHE A 32  ? 0.4701 0.3999 0.2901 0.0186  0.0332  0.0377  32  PHE A CE1 
240  C CE2 . PHE A 32  ? 0.4660 0.3747 0.2532 0.0240  0.0185  0.0311  32  PHE A CE2 
241  C CZ  . PHE A 32  ? 0.4988 0.4167 0.2927 0.0215  0.0310  0.0354  32  PHE A CZ  
242  N N   . LEU A 33  ? 0.3953 0.3131 0.2724 0.0234  -0.0087 0.0163  33  LEU A N   
243  C CA  . LEU A 33  ? 0.3978 0.3161 0.2902 0.0210  -0.0148 0.0157  33  LEU A CA  
244  C C   . LEU A 33  ? 0.4376 0.3535 0.3257 0.0166  -0.0256 0.0130  33  LEU A C   
245  O O   . LEU A 33  ? 0.4436 0.3538 0.3150 0.0160  -0.0291 0.0080  33  LEU A O   
246  C CB  . LEU A 33  ? 0.4257 0.3364 0.3213 0.0247  -0.0106 0.0106  33  LEU A CB  
247  C CG  . LEU A 33  ? 0.4340 0.3511 0.3346 0.0315  0.0003  0.0128  33  LEU A CG  
248  C CD1 . LEU A 33  ? 0.3900 0.2959 0.2911 0.0382  0.0042  0.0078  33  LEU A CD1 
249  C CD2 . LEU A 33  ? 0.3897 0.3240 0.3090 0.0297  0.0018  0.0213  33  LEU A CD2 
250  N N   . GLY A 34  ? 0.3542 0.2770 0.2573 0.0135  -0.0309 0.0165  34  GLY A N   
251  C CA  . GLY A 34  ? 0.3526 0.2791 0.2562 0.0094  -0.0406 0.0147  34  GLY A CA  
252  C C   . GLY A 34  ? 0.4356 0.3678 0.3292 0.0114  -0.0455 0.0178  34  GLY A C   
253  O O   . GLY A 34  ? 0.3801 0.3157 0.2662 0.0095  -0.0534 0.0145  34  GLY A O   
254  N N   . ILE A 35  ? 0.4835 0.4164 0.3758 0.0151  -0.0410 0.0246  35  ILE A N   
255  C CA  . ILE A 35  ? 0.4442 0.3791 0.3265 0.0189  -0.0451 0.0295  35  ILE A CA  
256  C C   . ILE A 35  ? 0.4521 0.3970 0.3482 0.0199  -0.0511 0.0328  35  ILE A C   
257  O O   . ILE A 35  ? 0.4357 0.3809 0.3435 0.0197  -0.0472 0.0360  35  ILE A O   
258  C CB  . ILE A 35  ? 0.4228 0.3502 0.2970 0.0213  -0.0372 0.0360  35  ILE A CB  
259  C CG1 . ILE A 35  ? 0.4083 0.3299 0.2727 0.0202  -0.0287 0.0338  35  ILE A CG1 
260  C CG2 . ILE A 35  ? 0.4163 0.3405 0.2764 0.0265  -0.0410 0.0420  35  ILE A CG2 
261  C CD1 . ILE A 35  ? 0.4063 0.3236 0.2665 0.0192  -0.0199 0.0403  35  ILE A CD1 
262  N N   . PRO A 36  ? 0.4651 0.4203 0.3598 0.0212  -0.0604 0.0319  36  PRO A N   
263  C CA  . PRO A 36  ? 0.3835 0.3523 0.2925 0.0239  -0.0652 0.0354  36  PRO A CA  
264  C C   . PRO A 36  ? 0.5018 0.4640 0.4062 0.0324  -0.0613 0.0433  36  PRO A C   
265  O O   . PRO A 36  ? 0.4938 0.4460 0.3804 0.0371  -0.0602 0.0471  36  PRO A O   
266  C CB  . PRO A 36  ? 0.3946 0.3786 0.3000 0.0244  -0.0762 0.0334  36  PRO A CB  
267  C CG  . PRO A 36  ? 0.3602 0.3336 0.2422 0.0251  -0.0766 0.0317  36  PRO A CG  
268  C CD  . PRO A 36  ? 0.3958 0.3524 0.2742 0.0208  -0.0667 0.0281  36  PRO A CD  
269  N N   . PHE A 37  ? 0.4837 0.4486 0.4014 0.0338  -0.0587 0.0457  37  PHE A N   
270  C CA  . PHE A 37  ? 0.4597 0.4144 0.3708 0.0420  -0.0548 0.0522  37  PHE A CA  
271  C C   . PHE A 37  ? 0.4909 0.4595 0.4125 0.0502  -0.0589 0.0548  37  PHE A C   
272  O O   . PHE A 37  ? 0.5262 0.4851 0.4409 0.0596  -0.0561 0.0600  37  PHE A O   
273  C CB  . PHE A 37  ? 0.4582 0.3980 0.3694 0.0370  -0.0455 0.0527  37  PHE A CB  
274  C CG  . PHE A 37  ? 0.4220 0.3705 0.3513 0.0313  -0.0440 0.0495  37  PHE A CG  
275  C CD1 . PHE A 37  ? 0.3613 0.3120 0.2974 0.0352  -0.0427 0.0510  37  PHE A CD1 
276  C CD2 . PHE A 37  ? 0.4441 0.3968 0.3814 0.0232  -0.0432 0.0452  37  PHE A CD2 
277  C CE1 . PHE A 37  ? 0.3940 0.3528 0.3444 0.0297  -0.0411 0.0486  37  PHE A CE1 
278  C CE2 . PHE A 37  ? 0.4374 0.3967 0.3890 0.0186  -0.0420 0.0436  37  PHE A CE2 
279  C CZ  . PHE A 37  ? 0.3805 0.3436 0.3385 0.0212  -0.0411 0.0454  37  PHE A CZ  
280  N N   . ALA A 38  ? 0.4081 0.3991 0.3459 0.0466  -0.0649 0.0510  38  ALA A N   
281  C CA  . ALA A 38  ? 0.3466 0.3583 0.2979 0.0538  -0.0688 0.0532  38  ALA A CA  
282  C C   . ALA A 38  ? 0.3592 0.3968 0.3182 0.0508  -0.0792 0.0507  38  ALA A C   
283  O O   . ALA A 38  ? 0.4088 0.4462 0.3657 0.0399  -0.0823 0.0452  38  ALA A O   
284  C CB  . ALA A 38  ? 0.2950 0.3119 0.2626 0.0491  -0.0635 0.0512  38  ALA A CB  
285  N N   . GLU A 39  ? 0.3414 0.4019 0.3094 0.0606  -0.0845 0.0545  39  GLU A N   
286  C CA  . GLU A 39  ? 0.3296 0.4227 0.3124 0.0545  -0.0940 0.0515  39  GLU A CA  
287  C C   . GLU A 39  ? 0.3320 0.4318 0.3321 0.0402  -0.0906 0.0462  39  GLU A C   
288  O O   . GLU A 39  ? 0.3030 0.3961 0.3099 0.0419  -0.0823 0.0475  39  GLU A O   
289  C CB  . GLU A 39  ? 0.3233 0.4446 0.3167 0.0692  -0.0990 0.0576  39  GLU A CB  
290  C CG  . GLU A 39  ? 0.4751 0.5957 0.4514 0.0827  -0.1058 0.0635  39  GLU A CG  
291  C CD  . GLU A 39  ? 0.5244 0.6552 0.4927 0.0723  -0.1167 0.0592  39  GLU A CD  
292  O OE1 . GLU A 39  ? 0.6938 0.8582 0.6778 0.0646  -0.1256 0.0559  39  GLU A OE1 
293  O OE2 . GLU A 39  ? 0.5214 0.6274 0.4670 0.0709  -0.1160 0.0587  39  GLU A OE2 
294  N N   . PRO A 40  ? 0.3342 0.4451 0.3390 0.0256  -0.0968 0.0402  40  PRO A N   
295  C CA  . PRO A 40  ? 0.3006 0.4139 0.3189 0.0111  -0.0934 0.0360  40  PRO A CA  
296  C C   . PRO A 40  ? 0.3316 0.4699 0.3710 0.0143  -0.0905 0.0395  40  PRO A C   
297  O O   . PRO A 40  ? 0.3646 0.5349 0.4161 0.0185  -0.0967 0.0417  40  PRO A O   
298  C CB  . PRO A 40  ? 0.3221 0.4467 0.3402 -0.0036 -0.1026 0.0296  40  PRO A CB  
299  C CG  . PRO A 40  ? 0.3371 0.4533 0.3353 0.0021  -0.1085 0.0289  40  PRO A CG  
300  C CD  . PRO A 40  ? 0.3085 0.4304 0.3050 0.0214  -0.1077 0.0372  40  PRO A CD  
301  N N   . PRO A 41  ? 0.3032 0.4291 0.3468 0.0126  -0.0811 0.0403  41  PRO A N   
302  C CA  . PRO A 41  ? 0.3260 0.4733 0.3864 0.0174  -0.0765 0.0436  41  PRO A CA  
303  C C   . PRO A 41  ? 0.3259 0.5000 0.4049 0.0022  -0.0789 0.0415  41  PRO A C   
304  O O   . PRO A 41  ? 0.2780 0.4510 0.3643 -0.0044 -0.0719 0.0420  41  PRO A O   
305  C CB  . PRO A 41  ? 0.3037 0.4247 0.3572 0.0189  -0.0661 0.0445  41  PRO A CB  
306  C CG  . PRO A 41  ? 0.3719 0.4686 0.4152 0.0069  -0.0663 0.0407  41  PRO A CG  
307  C CD  . PRO A 41  ? 0.3465 0.4407 0.3794 0.0070  -0.0744 0.0384  41  PRO A CD  
308  N N   . VAL A 42  ? 0.2580 0.4562 0.3433 -0.0043 -0.0888 0.0395  42  VAL A N   
309  C CA  . VAL A 42  ? 0.3245 0.5460 0.4254 -0.0230 -0.0918 0.0367  42  VAL A CA  
310  C C   . VAL A 42  ? 0.2828 0.5538 0.4062 -0.0187 -0.0961 0.0399  42  VAL A C   
311  O O   . VAL A 42  ? 0.2712 0.5561 0.3956 0.0001  -0.0985 0.0441  42  VAL A O   
312  C CB  . VAL A 42  ? 0.3590 0.5695 0.4490 -0.0393 -0.1002 0.0298  42  VAL A CB  
313  C CG1 . VAL A 42  ? 0.2973 0.4618 0.3646 -0.0388 -0.0960 0.0270  42  VAL A CG1 
314  C CG2 . VAL A 42  ? 0.2807 0.5156 0.3698 -0.0348 -0.1122 0.0291  42  VAL A CG2 
315  N N   . GLY A 43  ? 0.2743 0.5717 0.4155 -0.0358 -0.0965 0.0386  43  GLY A N   
316  C CA  . GLY A 43  ? 0.2550 0.6056 0.4212 -0.0337 -0.0999 0.0418  43  GLY A CA  
317  C C   . GLY A 43  ? 0.3802 0.7441 0.5555 -0.0107 -0.0911 0.0482  43  GLY A C   
318  O O   . GLY A 43  ? 0.3461 0.6885 0.5173 -0.0079 -0.0795 0.0494  43  GLY A O   
319  N N   . SER A 44  ? 0.3544 0.7522 0.5401 0.0067  -0.0966 0.0523  44  SER A N   
320  C CA  . SER A 44  ? 0.3088 0.7196 0.5020 0.0317  -0.0883 0.0582  44  SER A CA  
321  C C   . SER A 44  ? 0.3463 0.7066 0.5153 0.0474  -0.0793 0.0591  44  SER A C   
322  O O   . SER A 44  ? 0.3195 0.6795 0.4897 0.0660  -0.0699 0.0625  44  SER A O   
323  C CB  . SER A 44  ? 0.2628 0.7132 0.4671 0.0499  -0.0975 0.0630  44  SER A CB  
324  O OG  . SER A 44  ? 0.3696 0.7917 0.5508 0.0595  -0.1052 0.0635  44  SER A OG  
325  N N   . ARG A 45  ? 0.2663 0.5847 0.4130 0.0396  -0.0819 0.0556  45  ARG A N   
326  C CA  . ARG A 45  ? 0.2704 0.5429 0.3946 0.0506  -0.0741 0.0561  45  ARG A CA  
327  C C   . ARG A 45  ? 0.3096 0.5554 0.4284 0.0382  -0.0645 0.0533  45  ARG A C   
328  O O   . ARG A 45  ? 0.3006 0.5114 0.4023 0.0449  -0.0579 0.0533  45  ARG A O   
329  C CB  . ARG A 45  ? 0.2699 0.5139 0.3726 0.0516  -0.0813 0.0550  45  ARG A CB  
330  C CG  . ARG A 45  ? 0.2728 0.5352 0.3738 0.0661  -0.0909 0.0590  45  ARG A CG  
331  C CD  . ARG A 45  ? 1.0057 1.2322 1.0810 0.0657  -0.0947 0.0578  45  ARG A CD  
332  N NE  . ARG A 45  ? 0.9946 1.2373 1.0647 0.0717  -0.1068 0.0601  45  ARG A NE  
333  C CZ  . ARG A 45  ? 0.9738 1.2096 1.0314 0.0924  -0.1083 0.0668  45  ARG A CZ  
334  N NH1 . ARG A 45  ? 0.9532 1.1643 1.0023 0.1081  -0.0978 0.0709  45  ARG A NH1 
335  N NH2 . ARG A 45  ? 0.9718 1.2236 1.0234 0.0970  -0.1202 0.0694  45  ARG A NH2 
336  N N   . ARG A 46  ? 0.2973 0.5585 0.4292 0.0194  -0.0640 0.0513  46  ARG A N   
337  C CA  . ARG A 46  ? 0.2889 0.5273 0.4156 0.0094  -0.0549 0.0503  46  ARG A CA  
338  C C   . ARG A 46  ? 0.3431 0.5811 0.4697 0.0242  -0.0439 0.0528  46  ARG A C   
339  O O   . ARG A 46  ? 0.2361 0.5060 0.3772 0.0354  -0.0415 0.0553  46  ARG A O   
340  C CB  . ARG A 46  ? 0.2724 0.5279 0.4126 -0.0126 -0.0552 0.0491  46  ARG A CB  
341  C CG  . ARG A 46  ? 0.2754 0.5077 0.4089 -0.0221 -0.0461 0.0497  46  ARG A CG  
342  C CD  . ARG A 46  ? 0.2326 0.4829 0.3792 -0.0427 -0.0447 0.0502  46  ARG A CD  
343  N NE  . ARG A 46  ? 0.2401 0.4798 0.3829 -0.0604 -0.0527 0.0467  46  ARG A NE  
344  C CZ  . ARG A 46  ? 0.3110 0.5636 0.4632 -0.0810 -0.0531 0.0464  46  ARG A CZ  
345  N NH1 . ARG A 46  ? 0.2466 0.5264 0.4142 -0.0863 -0.0459 0.0502  46  ARG A NH1 
346  N NH2 . ARG A 46  ? 0.2662 0.5038 0.4114 -0.0971 -0.0601 0.0420  46  ARG A NH2 
347  N N   . PHE A 47  ? 0.2339 0.4367 0.3436 0.0247  -0.0374 0.0520  47  PHE A N   
348  C CA  . PHE A 47  ? 0.2381 0.4313 0.3410 0.0362  -0.0268 0.0527  47  PHE A CA  
349  C C   . PHE A 47  ? 0.3292 0.5093 0.4205 0.0571  -0.0257 0.0534  47  PHE A C   
350  O O   . PHE A 47  ? 0.3230 0.4888 0.4044 0.0671  -0.0168 0.0529  47  PHE A O   
351  C CB  . PHE A 47  ? 0.2376 0.4636 0.3577 0.0363  -0.0194 0.0543  47  PHE A CB  
352  C CG  . PHE A 47  ? 0.2619 0.5003 0.3924 0.0153  -0.0191 0.0548  47  PHE A CG  
353  C CD1 . PHE A 47  ? 0.2790 0.4880 0.3964 0.0023  -0.0177 0.0542  47  PHE A CD1 
354  C CD2 . PHE A 47  ? 0.2297 0.5093 0.3827 0.0081  -0.0202 0.0564  47  PHE A CD2 
355  C CE1 . PHE A 47  ? 0.2840 0.4999 0.4083 -0.0164 -0.0168 0.0558  47  PHE A CE1 
356  C CE2 . PHE A 47  ? 0.2649 0.5522 0.4253 -0.0132 -0.0192 0.0572  47  PHE A CE2 
357  C CZ  . PHE A 47  ? 0.2294 0.4820 0.3741 -0.0250 -0.0173 0.0571  47  PHE A CZ  
358  N N   . MET A 48  ? 0.3283 0.5114 0.4187 0.0633  -0.0343 0.0545  48  MET A N   
359  C CA  . MET A 48  ? 0.3037 0.4744 0.3823 0.0840  -0.0337 0.0568  48  MET A CA  
360  C C   . MET A 48  ? 0.3757 0.5024 0.4297 0.0831  -0.0336 0.0556  48  MET A C   
361  O O   . MET A 48  ? 0.2723 0.3855 0.3215 0.0680  -0.0371 0.0534  48  MET A O   
362  C CB  . MET A 48  ? 0.3431 0.5416 0.4320 0.0921  -0.0436 0.0601  48  MET A CB  
363  C CG  . MET A 48  ? 0.4361 0.6851 0.5522 0.0926  -0.0450 0.0617  48  MET A CG  
364  S SD  . MET A 48  ? 0.7367 1.0062 0.8584 0.1235  -0.0409 0.0671  48  MET A SD  
365  C CE  . MET A 48  ? 0.2877 0.5316 0.3990 0.1288  -0.0240 0.0643  48  MET A CE  
366  N N   . PRO A 49  ? 0.3708 0.4746 0.4087 0.0994  -0.0286 0.0571  49  PRO A N   
367  C CA  . PRO A 49  ? 0.3507 0.4153 0.3652 0.0986  -0.0287 0.0569  49  PRO A CA  
368  C C   . PRO A 49  ? 0.2978 0.3665 0.3116 0.0941  -0.0390 0.0586  49  PRO A C   
369  O O   . PRO A 49  ? 0.3266 0.4224 0.3516 0.1003  -0.0460 0.0613  49  PRO A O   
370  C CB  . PRO A 49  ? 0.3338 0.3799 0.3336 0.1196  -0.0230 0.0598  49  PRO A CB  
371  C CG  . PRO A 49  ? 0.3295 0.3988 0.3428 0.1302  -0.0163 0.0594  49  PRO A CG  
372  C CD  . PRO A 49  ? 0.3956 0.5089 0.4359 0.1197  -0.0220 0.0593  49  PRO A CD  
373  N N   . PRO A 50  ? 0.2956 0.3396 0.2963 0.0831  -0.0400 0.0569  50  PRO A N   
374  C CA  . PRO A 50  ? 0.3868 0.4318 0.3834 0.0792  -0.0485 0.0578  50  PRO A CA  
375  C C   . PRO A 50  ? 0.4534 0.4916 0.4372 0.0957  -0.0513 0.0632  50  PRO A C   
376  O O   . PRO A 50  ? 0.5013 0.5150 0.4701 0.1067  -0.0449 0.0659  50  PRO A O   
377  C CB  . PRO A 50  ? 0.3388 0.3563 0.3225 0.0671  -0.0455 0.0552  50  PRO A CB  
378  C CG  . PRO A 50  ? 0.4107 0.4054 0.3840 0.0703  -0.0364 0.0551  50  PRO A CG  
379  C CD  . PRO A 50  ? 0.2980 0.3114 0.2846 0.0762  -0.0328 0.0545  50  PRO A CD  
380  N N   . GLU A 51  ? 0.4412 0.4997 0.4292 0.0969  -0.0610 0.0649  51  GLU A N   
381  C CA  . GLU A 51  ? 0.4998 0.5523 0.4733 0.1113  -0.0656 0.0710  51  GLU A CA  
382  C C   . GLU A 51  ? 0.5120 0.5433 0.4676 0.1017  -0.0682 0.0701  51  GLU A C   
383  O O   . GLU A 51  ? 0.5453 0.5841 0.5065 0.0864  -0.0717 0.0648  51  GLU A O   
384  C CB  . GLU A 51  ? 0.6473 0.7409 0.6369 0.1192  -0.0757 0.0737  51  GLU A CB  
385  C CG  . GLU A 51  ? 1.0076 1.1013 0.9825 0.1316  -0.0838 0.0802  51  GLU A CG  
386  C CD  . GLU A 51  ? 1.2134 1.3539 1.2064 0.1396  -0.0949 0.0833  51  GLU A CD  
387  O OE1 . GLU A 51  ? 1.3076 1.4777 1.3239 0.1418  -0.0933 0.0823  51  GLU A OE1 
388  O OE2 . GLU A 51  ? 1.2007 1.3503 1.1845 0.1431  -0.1052 0.0867  51  GLU A OE2 
389  N N   . PRO A 52  ? 0.5674 0.5700 0.5000 0.1105  -0.0653 0.0753  52  PRO A N   
390  C CA  . PRO A 52  ? 0.5205 0.5028 0.4346 0.1021  -0.0658 0.0752  52  PRO A CA  
391  C C   . PRO A 52  ? 0.4440 0.4482 0.3593 0.0979  -0.0768 0.0738  52  PRO A C   
392  O O   . PRO A 52  ? 0.4182 0.4469 0.3393 0.1078  -0.0853 0.0772  52  PRO A O   
393  C CB  . PRO A 52  ? 0.5092 0.4621 0.3992 0.1156  -0.0616 0.0833  52  PRO A CB  
394  C CG  . PRO A 52  ? 0.5075 0.4530 0.4017 0.1262  -0.0548 0.0846  52  PRO A CG  
395  C CD  . PRO A 52  ? 0.5030 0.4878 0.4239 0.1289  -0.0600 0.0819  52  PRO A CD  
396  N N   . LYS A 53  ? 0.3845 0.3809 0.2940 0.0837  -0.0765 0.0687  53  LYS A N   
397  C CA  . LYS A 53  ? 0.3978 0.4101 0.3048 0.0777  -0.0860 0.0653  53  LYS A CA  
398  C C   . LYS A 53  ? 0.4951 0.5069 0.3828 0.0894  -0.0925 0.0722  53  LYS A C   
399  O O   . LYS A 53  ? 0.5764 0.5615 0.4427 0.0944  -0.0869 0.0777  53  LYS A O   
400  C CB  . LYS A 53  ? 0.4033 0.4003 0.3031 0.0633  -0.0817 0.0587  53  LYS A CB  
401  C CG  . LYS A 53  ? 0.4185 0.4246 0.3093 0.0570  -0.0899 0.0540  53  LYS A CG  
402  C CD  . LYS A 53  ? 0.4167 0.4486 0.3264 0.0478  -0.0976 0.0472  53  LYS A CD  
403  C CE  . LYS A 53  ? 0.4436 0.4818 0.3414 0.0398  -0.1061 0.0409  53  LYS A CE  
404  N NZ  . LYS A 53  ? 0.4878 0.5550 0.4028 0.0313  -0.1159 0.0359  53  LYS A NZ  
405  N N   . ARG A 54  ? 0.4490 0.4914 0.3441 0.0928  -0.1043 0.0725  54  ARG A N   
406  C CA  . ARG A 54  ? 0.4657 0.5132 0.3427 0.1038  -0.1129 0.0793  54  ARG A CA  
407  C C   . ARG A 54  ? 0.5470 0.5810 0.4025 0.0932  -0.1143 0.0750  54  ARG A C   
408  O O   . ARG A 54  ? 0.6217 0.6599 0.4832 0.0776  -0.1148 0.0650  54  ARG A O   
409  C CB  . ARG A 54  ? 0.5326 0.6233 0.4264 0.1086  -0.1264 0.0801  54  ARG A CB  
410  C CG  . ARG A 54  ? 0.6431 0.7514 0.5576 0.1228  -0.1248 0.0855  54  ARG A CG  
411  C CD  . ARG A 54  ? 0.7932 0.9452 0.7192 0.1332  -0.1387 0.0901  54  ARG A CD  
412  N NE  . ARG A 54  ? 0.9312 1.1171 0.8737 0.1148  -0.1485 0.0810  54  ARG A NE  
413  C CZ  . ARG A 54  ? 1.0208 1.2354 0.9921 0.1067  -0.1487 0.0762  54  ARG A CZ  
414  N NH1 . ARG A 54  ? 1.0089 1.2245 0.9960 0.1167  -0.1394 0.0796  54  ARG A NH1 
415  N NH2 . ARG A 54  ? 1.0438 1.2848 1.0265 0.0876  -0.1576 0.0679  54  ARG A NH2 
416  N N   . PRO A 55  ? 0.5949 0.6102 0.4232 0.1021  -0.1138 0.0827  55  PRO A N   
417  C CA  . PRO A 55  ? 0.5975 0.5976 0.4010 0.0941  -0.1130 0.0799  55  PRO A CA  
418  C C   . PRO A 55  ? 0.6241 0.6469 0.4290 0.0823  -0.1236 0.0700  55  PRO A C   
419  O O   . PRO A 55  ? 0.4705 0.5245 0.2868 0.0844  -0.1362 0.0696  55  PRO A O   
420  C CB  . PRO A 55  ? 0.5520 0.5414 0.3291 0.1096  -0.1158 0.0926  55  PRO A CB  
421  C CG  . PRO A 55  ? 0.5450 0.5233 0.3290 0.1235  -0.1100 0.1015  55  PRO A CG  
422  C CD  . PRO A 55  ? 0.4762 0.4809 0.2940 0.1216  -0.1125 0.0955  55  PRO A CD  
423  N N   . TRP A 56  ? 0.4724 0.4797 0.2651 0.0700  -0.1184 0.0617  56  TRP A N   
424  C CA  . TRP A 56  ? 0.4794 0.5004 0.2667 0.0583  -0.1273 0.0512  56  TRP A CA  
425  C C   . TRP A 56  ? 0.5456 0.5570 0.2989 0.0600  -0.1301 0.0525  56  TRP A C   
426  O O   . TRP A 56  ? 0.5400 0.5309 0.2739 0.0685  -0.1227 0.0614  56  TRP A O   
427  C CB  . TRP A 56  ? 0.4824 0.4927 0.2796 0.0437  -0.1196 0.0393  56  TRP A CB  
428  C CG  . TRP A 56  ? 0.6086 0.5899 0.3950 0.0436  -0.1046 0.0401  56  TRP A CG  
429  C CD1 . TRP A 56  ? 0.6064 0.5710 0.3685 0.0404  -0.0990 0.0364  56  TRP A CD1 
430  C CD2 . TRP A 56  ? 0.5883 0.5565 0.3878 0.0464  -0.0931 0.0449  56  TRP A CD2 
431  N NE1 . TRP A 56  ? 0.6616 0.6067 0.4236 0.0410  -0.0847 0.0391  56  TRP A NE1 
432  C CE2 . TRP A 56  ? 0.6359 0.5827 0.4203 0.0438  -0.0814 0.0442  56  TRP A CE2 
433  C CE3 . TRP A 56  ? 0.5378 0.5113 0.3593 0.0503  -0.0914 0.0494  56  TRP A CE3 
434  C CZ2 . TRP A 56  ? 0.6260 0.5588 0.4181 0.0437  -0.0694 0.0479  56  TRP A CZ2 
435  C CZ3 . TRP A 56  ? 0.5962 0.5522 0.4226 0.0504  -0.0793 0.0523  56  TRP A CZ3 
436  C CH2 . TRP A 56  ? 0.6118 0.5488 0.4242 0.0464  -0.0690 0.0516  56  TRP A CH2 
437  N N   . SER A 57  ? 0.6007 0.6260 0.3448 0.0509  -0.1405 0.0434  57  SER A N   
438  C CA  . SER A 57  ? 0.7219 0.7382 0.4312 0.0509  -0.1431 0.0428  57  SER A CA  
439  C C   . SER A 57  ? 0.6936 0.6909 0.3911 0.0375  -0.1348 0.0289  57  SER A C   
440  O O   . SER A 57  ? 0.6842 0.6829 0.3995 0.0265  -0.1336 0.0183  57  SER A O   
441  C CB  . SER A 57  ? 0.7800 0.8261 0.4809 0.0518  -0.1621 0.0431  57  SER A CB  
442  O OG  . SER A 57  ? 0.7870 0.8510 0.5008 0.0358  -0.1706 0.0293  57  SER A OG  
443  N N   . GLY A 58  ? 0.6579 0.6364 0.3243 0.0394  -0.1284 0.0297  58  GLY A N   
444  C CA  . GLY A 58  ? 0.6352 0.5952 0.2872 0.0298  -0.1192 0.0171  58  GLY A CA  
445  C C   . GLY A 58  ? 0.6695 0.6113 0.3373 0.0299  -0.1018 0.0173  58  GLY A C   
446  O O   . GLY A 58  ? 0.6530 0.5934 0.3367 0.0366  -0.0966 0.0277  58  GLY A O   
447  N N   . VAL A 59  ? 0.6694 0.5972 0.3320 0.0226  -0.0931 0.0054  59  VAL A N   
448  C CA  . VAL A 59  ? 0.6189 0.5326 0.2951 0.0235  -0.0768 0.0056  59  VAL A CA  
449  C C   . VAL A 59  ? 0.5983 0.5150 0.3035 0.0173  -0.0774 -0.0013 59  VAL A C   
450  O O   . VAL A 59  ? 0.6913 0.6039 0.3932 0.0096  -0.0802 -0.0136 59  VAL A O   
451  C CB  . VAL A 59  ? 0.6469 0.5435 0.2987 0.0228  -0.0642 -0.0013 59  VAL A CB  
452  C CG1 . VAL A 59  ? 0.6195 0.5078 0.2874 0.0250  -0.0476 0.0010  59  VAL A CG1 
453  C CG2 . VAL A 59  ? 0.6113 0.5051 0.2300 0.0274  -0.0644 0.0052  59  VAL A CG2 
454  N N   . LEU A 60  ? 0.5049 0.4269 0.2362 0.0204  -0.0747 0.0067  60  LEU A N   
455  C CA  . LEU A 60  ? 0.5578 0.4823 0.3161 0.0153  -0.0740 0.0022  60  LEU A CA  
456  C C   . LEU A 60  ? 0.6216 0.5299 0.3812 0.0141  -0.0604 -0.0040 60  LEU A C   
457  O O   . LEU A 60  ? 0.5982 0.5006 0.3565 0.0190  -0.0489 0.0013  60  LEU A O   
458  C CB  . LEU A 60  ? 0.4705 0.4048 0.2531 0.0197  -0.0743 0.0126  60  LEU A CB  
459  C CG  . LEU A 60  ? 0.4951 0.4342 0.3058 0.0149  -0.0739 0.0100  60  LEU A CG  
460  C CD1 . LEU A 60  ? 0.4675 0.4238 0.2955 0.0179  -0.0814 0.0171  60  LEU A CD1 
461  C CD2 . LEU A 60  ? 0.5005 0.4289 0.3218 0.0163  -0.0610 0.0119  60  LEU A CD2 
462  N N   . ASP A 61  ? 0.5451 0.4464 0.3065 0.0076  -0.0615 -0.0149 61  ASP A N   
463  C CA  . ASP A 61  ? 0.5854 0.4713 0.3487 0.0091  -0.0490 -0.0202 61  ASP A CA  
464  C C   . ASP A 61  ? 0.5636 0.4547 0.3558 0.0113  -0.0439 -0.0132 61  ASP A C   
465  O O   . ASP A 61  ? 0.6156 0.5138 0.4261 0.0068  -0.0506 -0.0121 61  ASP A O   
466  C CB  . ASP A 61  ? 0.6505 0.5218 0.4043 0.0022  -0.0513 -0.0337 61  ASP A CB  
467  C CG  . ASP A 61  ? 0.7230 0.5755 0.4739 0.0074  -0.0373 -0.0392 61  ASP A CG  
468  O OD1 . ASP A 61  ? 0.6283 0.4796 0.4009 0.0093  -0.0326 -0.0362 61  ASP A OD1 
469  O OD2 . ASP A 61  ? 0.7792 0.6191 0.5056 0.0108  -0.0306 -0.0461 61  ASP A OD2 
470  N N   . ALA A 62  ? 0.4829 0.3723 0.2783 0.0174  -0.0320 -0.0083 62  ALA A N   
471  C CA  . ALA A 62  ? 0.4416 0.3376 0.2616 0.0190  -0.0272 -0.0014 62  ALA A CA  
472  C C   . ALA A 62  ? 0.5131 0.4025 0.3376 0.0234  -0.0157 -0.0046 62  ALA A C   
473  O O   . ALA A 62  ? 0.4958 0.3929 0.3307 0.0268  -0.0073 0.0016  62  ALA A O   
474  C CB  . ALA A 62  ? 0.4506 0.3547 0.2723 0.0213  -0.0245 0.0090  62  ALA A CB  
475  N N   . THR A 63  ? 0.4537 0.3290 0.2701 0.0231  -0.0154 -0.0143 63  THR A N   
476  C CA  . THR A 63  ? 0.4687 0.3352 0.2861 0.0303  -0.0041 -0.0180 63  THR A CA  
477  C C   . THR A 63  ? 0.5327 0.3929 0.3674 0.0304  -0.0048 -0.0184 63  THR A C   
478  O O   . THR A 63  ? 0.5558 0.4092 0.3936 0.0385  0.0042  -0.0198 63  THR A O   
479  C CB  . THR A 63  ? 0.5435 0.3918 0.3332 0.0328  0.0002  -0.0293 63  THR A CB  
480  O OG1 . THR A 63  ? 0.5510 0.3830 0.3318 0.0254  -0.0084 -0.0383 63  THR A OG1 
481  C CG2 . THR A 63  ? 0.4997 0.3531 0.2679 0.0321  0.0003  -0.0287 63  THR A CG2 
482  N N   . THR A 64  ? 0.5184 0.3813 0.3638 0.0223  -0.0150 -0.0167 64  THR A N   
483  C CA  . THR A 64  ? 0.4722 0.3284 0.3322 0.0210  -0.0159 -0.0160 64  THR A CA  
484  C C   . THR A 64  ? 0.4991 0.3721 0.3798 0.0157  -0.0226 -0.0076 64  THR A C   
485  O O   . THR A 64  ? 0.5131 0.3985 0.3944 0.0112  -0.0292 -0.0051 64  THR A O   
486  C CB  . THR A 64  ? 0.4829 0.3175 0.3301 0.0137  -0.0207 -0.0257 64  THR A CB  
487  O OG1 . THR A 64  ? 0.5629 0.4070 0.4086 0.0024  -0.0324 -0.0270 64  THR A OG1 
488  C CG2 . THR A 64  ? 0.4926 0.3059 0.3144 0.0183  -0.0143 -0.0361 64  THR A CG2 
489  N N   . PHE A 65  ? 0.5091 0.3821 0.4055 0.0174  -0.0204 -0.0032 65  PHE A N   
490  C CA  . PHE A 65  ? 0.4305 0.3174 0.3445 0.0123  -0.0257 0.0038  65  PHE A CA  
491  C C   . PHE A 65  ? 0.4163 0.3027 0.3295 0.0018  -0.0350 0.0006  65  PHE A C   
492  O O   . PHE A 65  ? 0.4816 0.3524 0.3842 -0.0035 -0.0372 -0.0068 65  PHE A O   
493  C CB  . PHE A 65  ? 0.4545 0.3394 0.3817 0.0160  -0.0218 0.0088  65  PHE A CB  
494  C CG  . PHE A 65  ? 0.4539 0.3504 0.3888 0.0249  -0.0146 0.0144  65  PHE A CG  
495  C CD1 . PHE A 65  ? 0.3448 0.2602 0.2875 0.0233  -0.0150 0.0200  65  PHE A CD1 
496  C CD2 . PHE A 65  ? 0.3940 0.2832 0.3284 0.0346  -0.0072 0.0141  65  PHE A CD2 
497  C CE1 . PHE A 65  ? 0.3798 0.3083 0.3302 0.0285  -0.0087 0.0248  65  PHE A CE1 
498  C CE2 . PHE A 65  ? 0.4422 0.3484 0.3866 0.0422  -0.0011 0.0197  65  PHE A CE2 
499  C CZ  . PHE A 65  ? 0.3984 0.3255 0.3512 0.0378  -0.0021 0.0248  65  PHE A CZ  
500  N N   . GLN A 66  ? 0.3705 0.2746 0.2946 -0.0013 -0.0401 0.0058  66  GLN A N   
501  C CA  . GLN A 66  ? 0.3415 0.2531 0.2698 -0.0103 -0.0485 0.0043  66  GLN A CA  
502  C C   . GLN A 66  ? 0.4399 0.3523 0.3825 -0.0159 -0.0489 0.0075  66  GLN A C   
503  O O   . GLN A 66  ? 0.3870 0.2931 0.3354 -0.0119 -0.0432 0.0115  66  GLN A O   
504  C CB  . GLN A 66  ? 0.3891 0.3198 0.3210 -0.0086 -0.0533 0.0086  66  GLN A CB  
505  C CG  . GLN A 66  ? 0.4257 0.3583 0.3422 -0.0093 -0.0589 0.0040  66  GLN A CG  
506  C CD  . GLN A 66  ? 0.5237 0.4588 0.4381 -0.0200 -0.0674 -0.0026 66  GLN A CD  
507  O OE1 . GLN A 66  ? 0.5750 0.5073 0.4986 -0.0278 -0.0679 -0.0040 66  GLN A OE1 
508  N NE2 . GLN A 66  ? 0.4900 0.4313 0.3915 -0.0213 -0.0743 -0.0062 66  GLN A NE2 
509  N N   . ASN A 67  ? 0.3927 0.3149 0.3407 -0.0254 -0.0557 0.0061  67  ASN A N   
510  C CA  . ASN A 67  ? 0.3766 0.3017 0.3373 -0.0325 -0.0558 0.0094  67  ASN A CA  
511  C C   . ASN A 67  ? 0.3636 0.2974 0.3368 -0.0263 -0.0513 0.0178  67  ASN A C   
512  O O   . ASN A 67  ? 0.3304 0.2758 0.3064 -0.0194 -0.0507 0.0212  67  ASN A O   
513  C CB  . ASN A 67  ? 0.4116 0.3560 0.3800 -0.0426 -0.0634 0.0081  67  ASN A CB  
514  C CG  . ASN A 67  ? 0.3769 0.3149 0.3332 -0.0523 -0.0694 -0.0008 67  ASN A CG  
515  O OD1 . ASN A 67  ? 0.3895 0.3017 0.3320 -0.0558 -0.0668 -0.0067 67  ASN A OD1 
516  N ND2 . ASN A 67  ? 0.4179 0.3794 0.3782 -0.0563 -0.0775 -0.0021 67  ASN A ND2 
517  N N   . VAL A 68  ? 0.3214 0.2472 0.2996 -0.0296 -0.0482 0.0210  68  VAL A N   
518  C CA  . VAL A 68  ? 0.3530 0.2878 0.3417 -0.0263 -0.0451 0.0286  68  VAL A CA  
519  C C   . VAL A 68  ? 0.3408 0.2943 0.3408 -0.0336 -0.0479 0.0308  68  VAL A C   
520  O O   . VAL A 68  ? 0.3502 0.3054 0.3518 -0.0438 -0.0511 0.0280  68  VAL A O   
521  C CB  . VAL A 68  ? 0.4523 0.3694 0.4389 -0.0253 -0.0406 0.0319  68  VAL A CB  
522  C CG1 . VAL A 68  ? 0.4046 0.3316 0.4006 -0.0249 -0.0385 0.0398  68  VAL A CG1 
523  C CG2 . VAL A 68  ? 0.3107 0.2150 0.2890 -0.0149 -0.0366 0.0305  68  VAL A CG2 
524  N N   . CYS A 69  ? 0.2920 0.2600 0.2992 -0.0287 -0.0463 0.0354  69  CYS A N   
525  C CA  . CYS A 69  ? 0.3106 0.2979 0.3285 -0.0329 -0.0473 0.0376  69  CYS A CA  
526  C C   . CYS A 69  ? 0.3518 0.3372 0.3746 -0.0427 -0.0453 0.0405  69  CYS A C   
527  O O   . CYS A 69  ? 0.2975 0.2681 0.3163 -0.0424 -0.0418 0.0441  69  CYS A O   
528  C CB  . CYS A 69  ? 0.2465 0.2438 0.2672 -0.0249 -0.0446 0.0411  69  CYS A CB  
529  S SG  . CYS A 69  ? 0.3549 0.3552 0.3695 -0.0156 -0.0470 0.0387  69  CYS A SG  
530  N N   . TYR A 70  ? 0.3152 0.3170 0.3466 -0.0513 -0.0476 0.0395  70  TYR A N   
531  C CA  . TYR A 70  ? 0.3866 0.3868 0.4218 -0.0632 -0.0453 0.0424  70  TYR A CA  
532  C C   . TYR A 70  ? 0.4145 0.4123 0.4502 -0.0601 -0.0393 0.0495  70  TYR A C   
533  O O   . TYR A 70  ? 0.3279 0.3417 0.3687 -0.0539 -0.0371 0.0517  70  TYR A O   
534  C CB  . TYR A 70  ? 0.3640 0.3908 0.4119 -0.0727 -0.0478 0.0412  70  TYR A CB  
535  C CG  . TYR A 70  ? 0.4007 0.4182 0.4470 -0.0898 -0.0492 0.0391  70  TYR A CG  
536  C CD1 . TYR A 70  ? 0.4397 0.4452 0.4844 -0.0989 -0.0438 0.0444  70  TYR A CD1 
537  C CD2 . TYR A 70  ? 0.4090 0.4260 0.4521 -0.0976 -0.0558 0.0319  70  TYR A CD2 
538  C CE1 . TYR A 70  ? 0.5072 0.4988 0.5476 -0.1160 -0.0442 0.0427  70  TYR A CE1 
539  C CE2 . TYR A 70  ? 0.5064 0.5109 0.5453 -0.1157 -0.0569 0.0289  70  TYR A CE2 
540  C CZ  . TYR A 70  ? 0.5509 0.5413 0.5884 -0.1251 -0.0508 0.0344  70  TYR A CZ  
541  O OH  . TYR A 70  ? 0.7711 0.7444 0.8019 -0.1445 -0.0512 0.0316  70  TYR A OH  
542  N N   . GLN A 71  ? 0.3814 0.3575 0.4095 -0.0637 -0.0366 0.0531  71  GLN A N   
543  C CA  . GLN A 71  ? 0.3721 0.3450 0.3979 -0.0597 -0.0321 0.0604  71  GLN A CA  
544  C C   . GLN A 71  ? 0.3936 0.3474 0.4130 -0.0676 -0.0291 0.0661  71  GLN A C   
545  O O   . GLN A 71  ? 0.3874 0.3206 0.4003 -0.0737 -0.0300 0.0639  71  GLN A O   
546  C CB  . GLN A 71  ? 0.3756 0.3412 0.3957 -0.0468 -0.0323 0.0609  71  GLN A CB  
547  C CG  . GLN A 71  ? 0.3141 0.2561 0.3255 -0.0429 -0.0330 0.0599  71  GLN A CG  
548  C CD  . GLN A 71  ? 0.3381 0.2815 0.3476 -0.0311 -0.0334 0.0588  71  GLN A CD  
549  O OE1 . GLN A 71  ? 0.3302 0.2659 0.3362 -0.0245 -0.0318 0.0634  71  GLN A OE1 
550  N NE2 . GLN A 71  ? 0.2862 0.2408 0.2980 -0.0285 -0.0354 0.0536  71  GLN A NE2 
551  N N   . TYR A 72  ? 0.4482 0.4066 0.4669 -0.0674 -0.0253 0.0736  72  TYR A N   
552  C CA  . TYR A 72  ? 0.5215 0.4599 0.5311 -0.0721 -0.0220 0.0816  72  TYR A CA  
553  C C   . TYR A 72  ? 0.4947 0.4081 0.4941 -0.0617 -0.0231 0.0834  72  TYR A C   
554  O O   . TYR A 72  ? 0.4233 0.3427 0.4238 -0.0499 -0.0251 0.0816  72  TYR A O   
555  C CB  . TYR A 72  ? 0.5665 0.5177 0.5755 -0.0714 -0.0181 0.0892  72  TYR A CB  
556  C CG  . TYR A 72  ? 0.5973 0.5283 0.5947 -0.0743 -0.0149 0.0994  72  TYR A CG  
557  C CD1 . TYR A 72  ? 0.6119 0.5369 0.6072 -0.0889 -0.0107 0.1037  72  TYR A CD1 
558  C CD2 . TYR A 72  ? 0.5618 0.4806 0.5500 -0.0627 -0.0161 0.1057  72  TYR A CD2 
559  C CE1 . TYR A 72  ? 0.6427 0.5456 0.6246 -0.0917 -0.0073 0.1144  72  TYR A CE1 
560  C CE2 . TYR A 72  ? 0.6048 0.5043 0.5808 -0.0636 -0.0135 0.1166  72  TYR A CE2 
561  C CZ  . TYR A 72  ? 0.6980 0.5873 0.6696 -0.0779 -0.0089 0.1212  72  TYR A CZ  
562  O OH  . TYR A 72  ? 0.7740 0.6406 0.7308 -0.0789 -0.0058 0.1332  72  TYR A OH  
563  N N   . VAL A 73  ? 0.5254 0.4108 0.5147 -0.0659 -0.0213 0.0871  73  VAL A N   
564  C CA  . VAL A 73  ? 0.6071 0.4675 0.5864 -0.0538 -0.0214 0.0890  73  VAL A CA  
565  C C   . VAL A 73  ? 0.6656 0.5094 0.6348 -0.0497 -0.0184 0.1014  73  VAL A C   
566  O O   . VAL A 73  ? 0.6353 0.4618 0.5968 -0.0605 -0.0152 0.1066  73  VAL A O   
567  C CB  . VAL A 73  ? 0.6085 0.4427 0.5802 -0.0585 -0.0216 0.0814  73  VAL A CB  
568  C CG1 . VAL A 73  ? 0.5907 0.3934 0.5494 -0.0457 -0.0194 0.0847  73  VAL A CG1 
569  C CG2 . VAL A 73  ? 0.5433 0.3946 0.5228 -0.0583 -0.0255 0.0701  73  VAL A CG2 
570  N N   . ASP A 74  ? 0.8297 0.6797 0.7984 -0.0347 -0.0197 0.1068  74  ASP A N   
571  C CA  . ASP A 74  ? 0.9265 0.7663 0.8858 -0.0284 -0.0183 0.1199  74  ASP A CA  
572  C C   . ASP A 74  ? 0.9472 0.7477 0.8925 -0.0228 -0.0156 0.1248  74  ASP A C   
573  O O   . ASP A 74  ? 0.9536 0.7408 0.8975 -0.0130 -0.0157 0.1195  74  ASP A O   
574  C CB  . ASP A 74  ? 1.0052 0.8690 0.9695 -0.0151 -0.0218 0.1238  74  ASP A CB  
575  C CG  . ASP A 74  ? 1.0551 0.9501 1.0266 -0.0219 -0.0231 0.1217  74  ASP A CG  
576  O OD1 . ASP A 74  ? 1.0996 0.9978 1.0657 -0.0289 -0.0212 0.1284  74  ASP A OD1 
577  O OD2 . ASP A 74  ? 1.0000 0.9144 0.9808 -0.0200 -0.0254 0.1134  74  ASP A OD2 
578  N N   . THR A 75  ? 1.0284 0.8086 0.9616 -0.0288 -0.0123 0.1350  75  THR A N   
579  C CA  . THR A 75  ? 1.2042 0.9394 1.1203 -0.0261 -0.0085 0.1399  75  THR A CA  
580  C C   . THR A 75  ? 1.2340 0.9542 1.1369 -0.0155 -0.0071 0.1567  75  THR A C   
581  O O   . THR A 75  ? 1.2576 0.9368 1.1429 -0.0161 -0.0028 0.1636  75  THR A O   
582  C CB  . THR A 75  ? 1.1095 0.8220 1.0185 -0.0485 -0.0046 0.1360  75  THR A CB  
583  O OG1 . THR A 75  ? 1.0277 0.7633 0.9421 -0.0635 -0.0035 0.1402  75  THR A OG1 
584  C CG2 . THR A 75  ? 1.0925 0.8078 1.0089 -0.0564 -0.0064 0.1197  75  THR A CG2 
585  N N   . LEU A 76  ? 1.1642 0.9160 1.0738 -0.0061 -0.0111 0.1633  76  LEU A N   
586  C CA  . LEU A 76  ? 1.1357 0.8801 1.0327 0.0033  -0.0113 0.1801  76  LEU A CA  
587  C C   . LEU A 76  ? 1.1602 0.8749 1.0466 0.0245  -0.0106 0.1881  76  LEU A C   
588  O O   . LEU A 76  ? 1.2499 0.9344 1.1183 0.0286  -0.0077 0.2017  76  LEU A O   
589  C CB  . LEU A 76  ? 1.1451 0.9324 1.0510 0.0078  -0.0168 0.1837  76  LEU A CB  
590  C CG  . LEU A 76  ? 1.2649 1.0497 1.1559 0.0103  -0.0171 0.2007  76  LEU A CG  
591  C CD1 . LEU A 76  ? 1.2795 1.0552 1.1615 -0.0105 -0.0114 0.2033  76  LEU A CD1 
592  C CD2 . LEU A 76  ? 1.2791 1.1042 1.1765 0.0186  -0.0242 0.2040  76  LEU A CD2 
593  N N   . TYR A 77  ? 1.0791 0.8019 0.9757 0.0387  -0.0124 0.1802  77  TYR A N   
594  C CA  . TYR A 77  ? 1.0398 0.7356 0.9275 0.0610  -0.0104 0.1865  77  TYR A CA  
595  C C   . TYR A 77  ? 1.0997 0.7709 0.9864 0.0626  -0.0062 0.1727  77  TYR A C   
596  O O   . TYR A 77  ? 1.0643 0.7566 0.9640 0.0739  -0.0077 0.1650  77  TYR A O   
597  C CB  . TYR A 77  ? 0.9530 0.6848 0.8524 0.0823  -0.0161 0.1935  77  TYR A CB  
598  C CG  . TYR A 77  ? 0.9702 0.7240 0.8666 0.0834  -0.0212 0.2081  77  TYR A CG  
599  C CD1 . TYR A 77  ? 0.9542 0.6831 0.8328 0.0920  -0.0209 0.2226  77  TYR A CD1 
600  C CD2 . TYR A 77  ? 1.0080 0.8076 0.9177 0.0745  -0.0271 0.2047  77  TYR A CD2 
601  C CE1 . TYR A 77  ? 0.9825 0.7335 0.8564 0.0916  -0.0266 0.2332  77  TYR A CE1 
602  C CE2 . TYR A 77  ? 1.0355 0.8548 0.9397 0.0748  -0.0319 0.2169  77  TYR A CE2 
603  C CZ  . TYR A 77  ? 1.0512 0.8464 0.9371 0.0842  -0.0315 0.2326  77  TYR A CZ  
604  O OH  . TYR A 77  ? 1.1135 0.9295 0.9916 0.0830  -0.0370 0.2414  77  TYR A OH  
605  N N   . PRO A 78  ? 1.2434 0.8698 1.1135 0.0499  -0.0006 0.1695  78  PRO A N   
606  C CA  . PRO A 78  ? 1.2411 0.8374 1.1047 0.0467  0.0036  0.1553  78  PRO A CA  
607  C C   . PRO A 78  ? 1.1601 0.7409 1.0200 0.0729  0.0066  0.1538  78  PRO A C   
608  O O   . PRO A 78  ? 1.1356 0.6913 0.9849 0.0871  0.0094  0.1617  78  PRO A O   
609  C CB  . PRO A 78  ? 1.3374 0.8824 1.1780 0.0309  0.0091  0.1586  78  PRO A CB  
610  C CG  . PRO A 78  ? 1.3482 0.9130 1.1918 0.0157  0.0071  0.1685  78  PRO A CG  
611  C CD  . PRO A 78  ? 1.3100 0.9128 1.1648 0.0345  0.0020  0.1795  78  PRO A CD  
612  N N   . GLY A 79  ? 1.1119 0.7176 0.9858 0.0771  0.0053  0.1410  79  GLY A N   
613  C CA  . GLY A 79  ? 1.1018 0.6949 0.9727 0.1003  0.0098  0.1372  79  GLY A CA  
614  C C   . GLY A 79  ? 1.0084 0.6429 0.8967 0.1235  0.0068  0.1461  79  GLY A C   
615  O O   . GLY A 79  ? 0.9270 0.5639 0.8185 0.1438  0.0104  0.1432  79  GLY A O   
616  N N   . PHE A 80  ? 0.9637 0.6325 0.8630 0.1195  0.0003  0.1566  80  PHE A N   
617  C CA  . PHE A 80  ? 0.8575 0.5714 0.7740 0.1368  -0.0044 0.1655  80  PHE A CA  
618  C C   . PHE A 80  ? 0.8528 0.6119 0.7906 0.1314  -0.0075 0.1537  80  PHE A C   
619  O O   . PHE A 80  ? 0.8165 0.5914 0.7602 0.1103  -0.0107 0.1459  80  PHE A O   
620  C CB  . PHE A 80  ? 0.8170 0.5480 0.7335 0.1304  -0.0105 0.1793  80  PHE A CB  
621  C CG  . PHE A 80  ? 0.8236 0.6049 0.7571 0.1430  -0.0174 0.1876  80  PHE A CG  
622  C CD1 . PHE A 80  ? 0.8257 0.6166 0.7636 0.1667  -0.0179 0.1939  80  PHE A CD1 
623  C CD2 . PHE A 80  ? 0.7768 0.5994 0.7228 0.1275  -0.0241 0.1854  80  PHE A CD2 
624  C CE1 . PHE A 80  ? 0.7766 0.6181 0.7313 0.1750  -0.0252 0.2000  80  PHE A CE1 
625  C CE2 . PHE A 80  ? 0.7533 0.6216 0.7133 0.1362  -0.0310 0.1923  80  PHE A CE2 
626  C CZ  . PHE A 80  ? 0.7775 0.6563 0.7423 0.1608  -0.0317 0.2013  80  PHE A CZ  
627  N N   . GLU A 81  ? 0.8245 0.6043 0.7735 0.1509  -0.0058 0.1531  81  GLU A N   
628  C CA  . GLU A 81  ? 0.8127 0.6303 0.7794 0.1462  -0.0069 0.1420  81  GLU A CA  
629  C C   . GLU A 81  ? 0.6700 0.5314 0.6514 0.1310  -0.0150 0.1433  81  GLU A C   
630  O O   . GLU A 81  ? 0.5142 0.3949 0.5041 0.1176  -0.0162 0.1327  81  GLU A O   
631  C CB  . GLU A 81  ? 0.9414 0.7785 0.9189 0.1705  -0.0031 0.1436  81  GLU A CB  
632  C CG  . GLU A 81  ? 1.0830 0.9543 1.0761 0.1655  -0.0022 0.1322  81  GLU A CG  
633  C CD  . GLU A 81  ? 1.2571 1.0987 1.2386 0.1563  0.0036  0.1167  81  GLU A CD  
634  O OE1 . GLU A 81  ? 1.3590 1.1579 1.3233 0.1658  0.0103  0.1140  81  GLU A OE1 
635  O OE2 . GLU A 81  ? 1.2316 1.0914 1.2195 0.1399  0.0014  0.1073  81  GLU A OE2 
636  N N   . GLY A 82  ? 0.6082 0.4826 0.5899 0.1336  -0.0204 0.1565  82  GLY A N   
637  C CA  . GLY A 82  ? 0.6254 0.5383 0.6173 0.1201  -0.0278 0.1579  82  GLY A CA  
638  C C   . GLY A 82  ? 0.6195 0.5242 0.6069 0.0962  -0.0283 0.1487  82  GLY A C   
639  O O   . GLY A 82  ? 0.6435 0.5770 0.6405 0.0845  -0.0318 0.1428  82  GLY A O   
640  N N   . THR A 83  ? 0.5884 0.4541 0.5610 0.0888  -0.0246 0.1476  83  THR A N   
641  C CA  . THR A 83  ? 0.6250 0.4852 0.5954 0.0672  -0.0244 0.1385  83  THR A CA  
642  C C   . THR A 83  ? 0.6548 0.5032 0.6263 0.0620  -0.0208 0.1240  83  THR A C   
643  O O   . THR A 83  ? 0.6496 0.5127 0.6272 0.0486  -0.0225 0.1152  83  THR A O   
644  C CB  . THR A 83  ? 0.6403 0.4715 0.5958 0.0570  -0.0227 0.1447  83  THR A CB  
645  O OG1 . THR A 83  ? 0.7832 0.5715 0.7253 0.0616  -0.0172 0.1441  83  THR A OG1 
646  C CG2 . THR A 83  ? 0.6395 0.4798 0.5903 0.0627  -0.0260 0.1600  83  THR A CG2 
647  N N   . GLU A 84  ? 0.6966 0.5183 0.6607 0.0737  -0.0160 0.1217  84  GLU A N   
648  C CA  . GLU A 84  ? 0.7394 0.5452 0.6998 0.0682  -0.0127 0.1079  84  GLU A CA  
649  C C   . GLU A 84  ? 0.7114 0.5489 0.6850 0.0677  -0.0139 0.0992  84  GLU A C   
650  O O   . GLU A 84  ? 0.7616 0.5973 0.7342 0.0561  -0.0141 0.0886  84  GLU A O   
651  C CB  . GLU A 84  ? 0.9081 0.6756 0.8545 0.0820  -0.0063 0.1067  84  GLU A CB  
652  C CG  . GLU A 84  ? 1.0533 0.7789 0.9818 0.0814  -0.0036 0.1145  84  GLU A CG  
653  C CD  . GLU A 84  ? 1.0970 0.8015 1.0162 0.0573  -0.0042 0.1089  84  GLU A CD  
654  O OE1 . GLU A 84  ? 1.1221 0.8440 1.0486 0.0426  -0.0068 0.0983  84  GLU A OE1 
655  O OE2 . GLU A 84  ? 1.1159 0.7870 1.0202 0.0533  -0.0017 0.1159  84  GLU A OE2 
656  N N   . MET A 85  ? 0.6099 0.4769 0.5954 0.0798  -0.0149 0.1042  85  MET A N   
657  C CA  . MET A 85  ? 0.5324 0.4289 0.5295 0.0784  -0.0153 0.0972  85  MET A CA  
658  C C   . MET A 85  ? 0.4929 0.4046 0.4940 0.0600  -0.0195 0.0918  85  MET A C   
659  O O   . MET A 85  ? 0.5040 0.4278 0.5091 0.0560  -0.0189 0.0841  85  MET A O   
660  C CB  . MET A 85  ? 0.5469 0.4773 0.5578 0.0911  -0.0164 0.1048  85  MET A CB  
661  C CG  . MET A 85  ? 0.5653 0.5170 0.5815 0.0877  -0.0229 0.1151  85  MET A CG  
662  S SD  . MET A 85  ? 0.5723 0.5684 0.6055 0.1017  -0.0255 0.1239  85  MET A SD  
663  C CE  . MET A 85  ? 0.3155 0.3404 0.3594 0.0879  -0.0256 0.1133  85  MET A CE  
664  N N   . TRP A 86  ? 0.3838 0.2936 0.3825 0.0499  -0.0229 0.0962  86  TRP A N   
665  C CA  . TRP A 86  ? 0.3956 0.3194 0.3976 0.0349  -0.0259 0.0916  86  TRP A CA  
666  C C   . TRP A 86  ? 0.3829 0.2872 0.3782 0.0233  -0.0252 0.0843  86  TRP A C   
667  O O   . TRP A 86  ? 0.3555 0.2714 0.3542 0.0136  -0.0270 0.0790  86  TRP A O   
668  C CB  . TRP A 86  ? 0.4257 0.3646 0.4294 0.0304  -0.0295 0.0996  86  TRP A CB  
669  C CG  . TRP A 86  ? 0.3290 0.2908 0.3392 0.0399  -0.0318 0.1068  86  TRP A CG  
670  C CD1 . TRP A 86  ? 0.4025 0.3639 0.4107 0.0497  -0.0332 0.1178  86  TRP A CD1 
671  C CD2 . TRP A 86  ? 0.3539 0.3438 0.3737 0.0398  -0.0335 0.1040  86  TRP A CD2 
672  N NE1 . TRP A 86  ? 0.4735 0.4654 0.4913 0.0562  -0.0365 0.1219  86  TRP A NE1 
673  C CE2 . TRP A 86  ? 0.3990 0.4084 0.4241 0.0490  -0.0364 0.1132  86  TRP A CE2 
674  C CE3 . TRP A 86  ? 0.4150 0.4151 0.4386 0.0325  -0.0328 0.0953  86  TRP A CE3 
675  C CZ2 . TRP A 86  ? 0.3747 0.4159 0.4103 0.0488  -0.0388 0.1130  86  TRP A CZ2 
676  C CZ3 . TRP A 86  ? 0.3199 0.3468 0.3518 0.0325  -0.0342 0.0954  86  TRP A CZ3 
677  C CH2 . TRP A 86  ? 0.3194 0.3677 0.3579 0.0394  -0.0372 0.1038  86  TRP A CH2 
678  N N   . ASN A 87  ? 0.3517 0.2269 0.3373 0.0244  -0.0227 0.0842  87  ASN A N   
679  C CA  . ASN A 87  ? 0.5297 0.3874 0.5089 0.0113  -0.0226 0.0775  87  ASN A CA  
680  C C   . ASN A 87  ? 0.5417 0.4003 0.5203 0.0087  -0.0229 0.0660  87  ASN A C   
681  O O   . ASN A 87  ? 0.4751 0.3353 0.4533 0.0191  -0.0209 0.0630  87  ASN A O   
682  C CB  . ASN A 87  ? 0.4591 0.2812 0.4252 0.0115  -0.0195 0.0805  87  ASN A CB  
683  C CG  . ASN A 87  ? 0.5347 0.3529 0.4985 0.0064  -0.0196 0.0911  87  ASN A CG  
684  O OD1 . ASN A 87  ? 0.6318 0.4729 0.6030 -0.0014 -0.0220 0.0937  87  ASN A OD1 
685  N ND2 . ASN A 87  ? 0.5341 0.3209 0.4853 0.0111  -0.0163 0.0975  87  ASN A ND2 
686  N N   . PRO A 88  ? 0.5212 0.3809 0.4996 -0.0049 -0.0254 0.0601  88  PRO A N   
687  C CA  . PRO A 88  ? 0.4705 0.3313 0.4463 -0.0082 -0.0270 0.0498  88  PRO A CA  
688  C C   . PRO A 88  ? 0.4771 0.3112 0.4397 -0.0026 -0.0239 0.0439  88  PRO A C   
689  O O   . PRO A 88  ? 0.4638 0.2704 0.4166 -0.0042 -0.0216 0.0448  88  PRO A O   
690  C CB  . PRO A 88  ? 0.3709 0.2341 0.3480 -0.0240 -0.0304 0.0466  88  PRO A CB  
691  C CG  . PRO A 88  ? 0.4755 0.3516 0.4607 -0.0277 -0.0302 0.0552  88  PRO A CG  
692  C CD  . PRO A 88  ? 0.4657 0.3302 0.4473 -0.0175 -0.0270 0.0636  88  PRO A CD  
693  N N   . ASN A 89  ? 0.4231 0.2632 0.3837 0.0039  -0.0231 0.0380  89  ASN A N   
694  C CA  . ASN A 89  ? 0.4793 0.2953 0.4258 0.0108  -0.0189 0.0313  89  ASN A CA  
695  C C   . ASN A 89  ? 0.5028 0.3155 0.4399 0.0020  -0.0220 0.0202  89  ASN A C   
696  O O   . ASN A 89  ? 0.5502 0.3473 0.4740 0.0074  -0.0187 0.0129  89  ASN A O   
697  C CB  . ASN A 89  ? 0.4071 0.2330 0.3574 0.0277  -0.0138 0.0342  89  ASN A CB  
698  C CG  . ASN A 89  ? 0.4489 0.3039 0.4076 0.0276  -0.0154 0.0332  89  ASN A CG  
699  O OD1 . ASN A 89  ? 0.4182 0.2878 0.3822 0.0175  -0.0205 0.0328  89  ASN A OD1 
700  N ND2 . ASN A 89  ? 0.4399 0.3032 0.3995 0.0392  -0.0102 0.0330  89  ASN A ND2 
701  N N   . ARG A 90  ? 0.4184 0.2475 0.3619 -0.0108 -0.0283 0.0192  90  ARG A N   
702  C CA  . ARG A 90  ? 0.4436 0.2734 0.3794 -0.0207 -0.0333 0.0099  90  ARG A CA  
703  C C   . ARG A 90  ? 0.4842 0.3199 0.4262 -0.0366 -0.0387 0.0106  90  ARG A C   
704  O O   . ARG A 90  ? 0.4941 0.3355 0.4464 -0.0387 -0.0377 0.0184  90  ARG A O   
705  C CB  . ARG A 90  ? 0.4349 0.2898 0.3752 -0.0167 -0.0359 0.0092  90  ARG A CB  
706  C CG  . ARG A 90  ? 0.4850 0.3377 0.4192 -0.0035 -0.0302 0.0083  90  ARG A CG  
707  C CD  . ARG A 90  ? 0.5219 0.3468 0.4371 -0.0010 -0.0264 -0.0003 90  ARG A CD  
708  N NE  . ARG A 90  ? 0.7240 0.5511 0.6264 -0.0023 -0.0284 -0.0081 90  ARG A NE  
709  C CZ  . ARG A 90  ? 0.9352 0.7390 0.8174 -0.0040 -0.0271 -0.0182 90  ARG A CZ  
710  N NH1 . ARG A 90  ? 0.9927 0.7667 0.8653 -0.0044 -0.0233 -0.0216 90  ARG A NH1 
711  N NH2 . ARG A 90  ? 0.8813 0.6894 0.7504 -0.0053 -0.0295 -0.0247 90  ARG A NH2 
712  N N   . GLU A 91  ? 0.4415 0.2785 0.3774 -0.0482 -0.0443 0.0025  91  GLU A N   
713  C CA  . GLU A 91  ? 0.4504 0.2984 0.3941 -0.0648 -0.0496 0.0026  91  GLU A CA  
714  C C   . GLU A 91  ? 0.4654 0.3480 0.4293 -0.0637 -0.0517 0.0104  91  GLU A C   
715  O O   . GLU A 91  ? 0.4565 0.3580 0.4257 -0.0539 -0.0527 0.0121  91  GLU A O   
716  C CB  . GLU A 91  ? 0.4587 0.3089 0.3932 -0.0764 -0.0566 -0.0077 91  GLU A CB  
717  C CG  . GLU A 91  ? 0.5391 0.4095 0.4846 -0.0942 -0.0630 -0.0080 91  GLU A CG  
718  C CD  . GLU A 91  ? 0.6177 0.4966 0.5552 -0.1055 -0.0718 -0.0179 91  GLU A CD  
719  O OE1 . GLU A 91  ? 0.5528 0.4105 0.4705 -0.1022 -0.0717 -0.0260 91  GLU A OE1 
720  O OE2 . GLU A 91  ? 0.6734 0.5820 0.6239 -0.1172 -0.0787 -0.0176 91  GLU A OE2 
721  N N   . LEU A 92  ? 0.3706 0.2590 0.3440 -0.0738 -0.0514 0.0151  92  LEU A N   
722  C CA  . LEU A 92  ? 0.4124 0.3323 0.4034 -0.0737 -0.0524 0.0214  92  LEU A CA  
723  C C   . LEU A 92  ? 0.3783 0.3260 0.3773 -0.0814 -0.0596 0.0172  92  LEU A C   
724  O O   . LEU A 92  ? 0.3633 0.3099 0.3598 -0.0960 -0.0637 0.0118  92  LEU A O   
725  C CB  . LEU A 92  ? 0.3811 0.2982 0.3781 -0.0816 -0.0483 0.0284  92  LEU A CB  
726  C CG  . LEU A 92  ? 0.4229 0.3164 0.4131 -0.0737 -0.0419 0.0350  92  LEU A CG  
727  C CD1 . LEU A 92  ? 0.3589 0.2544 0.3546 -0.0824 -0.0386 0.0428  92  LEU A CD1 
728  C CD2 . LEU A 92  ? 0.3846 0.2879 0.3780 -0.0569 -0.0403 0.0385  92  LEU A CD2 
729  N N   . SER A 93  ? 0.3482 0.3209 0.3564 -0.0716 -0.0612 0.0199  93  SER A N   
730  C CA  . SER A 93  ? 0.3430 0.3450 0.3600 -0.0749 -0.0681 0.0176  93  SER A CA  
731  C C   . SER A 93  ? 0.4104 0.4357 0.4389 -0.0626 -0.0666 0.0235  93  SER A C   
732  O O   . SER A 93  ? 0.3789 0.3942 0.4034 -0.0510 -0.0618 0.0269  93  SER A O   
733  C CB  . SER A 93  ? 0.3446 0.3417 0.3485 -0.0733 -0.0743 0.0104  93  SER A CB  
734  O OG  . SER A 93  ? 0.3193 0.3473 0.3315 -0.0753 -0.0823 0.0092  93  SER A OG  
735  N N   . GLU A 94  ? 0.3095 0.3660 0.3518 -0.0651 -0.0705 0.0245  94  GLU A N   
736  C CA  . GLU A 94  ? 0.2849 0.3612 0.3351 -0.0511 -0.0692 0.0290  94  GLU A CA  
737  C C   . GLU A 94  ? 0.3242 0.3963 0.3634 -0.0396 -0.0734 0.0273  94  GLU A C   
738  O O   . GLU A 94  ? 0.3344 0.4060 0.3716 -0.0262 -0.0704 0.0310  94  GLU A O   
739  C CB  . GLU A 94  ? 0.3351 0.4480 0.4039 -0.0545 -0.0715 0.0310  94  GLU A CB  
740  C CG  . GLU A 94  ? 0.3711 0.4898 0.4504 -0.0639 -0.0649 0.0345  94  GLU A CG  
741  C CD  . GLU A 94  ? 0.3295 0.4887 0.4289 -0.0664 -0.0656 0.0367  94  GLU A CD  
742  O OE1 . GLU A 94  ? 0.3420 0.5169 0.4483 -0.0524 -0.0618 0.0404  94  GLU A OE1 
743  O OE2 . GLU A 94  ? 0.3759 0.5513 0.4842 -0.0827 -0.0694 0.0346  94  GLU A OE2 
744  N N   . ASP A 95  ? 0.3154 0.3819 0.3450 -0.0456 -0.0798 0.0217  95  ASP A N   
745  C CA  . ASP A 95  ? 0.3946 0.4535 0.4099 -0.0358 -0.0831 0.0201  95  ASP A CA  
746  C C   . ASP A 95  ? 0.3574 0.3854 0.3591 -0.0310 -0.0761 0.0199  95  ASP A C   
747  O O   . ASP A 95  ? 0.3131 0.3218 0.3030 -0.0365 -0.0761 0.0146  95  ASP A O   
748  C CB  . ASP A 95  ? 0.3478 0.4113 0.3550 -0.0450 -0.0923 0.0134  95  ASP A CB  
749  C CG  . ASP A 95  ? 0.3776 0.4351 0.3679 -0.0351 -0.0960 0.0124  95  ASP A CG  
750  O OD1 . ASP A 95  ? 0.3664 0.4128 0.3504 -0.0223 -0.0907 0.0168  95  ASP A OD1 
751  O OD2 . ASP A 95  ? 0.5475 0.6113 0.5294 -0.0415 -0.1043 0.0070  95  ASP A OD2 
752  N N   . CYS A 96  ? 0.2749 0.2990 0.2779 -0.0207 -0.0701 0.0252  96  CYS A N   
753  C CA  . CYS A 96  ? 0.2976 0.2990 0.2929 -0.0179 -0.0632 0.0259  96  CYS A CA  
754  C C   . CYS A 96  ? 0.3374 0.3344 0.3271 -0.0070 -0.0592 0.0299  96  CYS A C   
755  O O   . CYS A 96  ? 0.3187 0.3031 0.3053 -0.0051 -0.0534 0.0314  96  CYS A O   
756  C CB  . CYS A 96  ? 0.3411 0.3394 0.3456 -0.0229 -0.0584 0.0285  96  CYS A CB  
757  S SG  . CYS A 96  ? 0.3183 0.3350 0.3359 -0.0185 -0.0552 0.0344  96  CYS A SG  
758  N N   . LEU A 97  ? 0.2680 0.2755 0.2563 0.0000  -0.0622 0.0320  97  LEU A N   
759  C CA  . LEU A 97  ? 0.4051 0.4041 0.3856 0.0090  -0.0579 0.0360  97  LEU A CA  
760  C C   . LEU A 97  ? 0.3774 0.3626 0.3414 0.0116  -0.0573 0.0350  97  LEU A C   
761  O O   . LEU A 97  ? 0.4010 0.3877 0.3555 0.0172  -0.0608 0.0364  97  LEU A O   
762  C CB  . LEU A 97  ? 0.2864 0.2982 0.2710 0.0175  -0.0595 0.0398  97  LEU A CB  
763  C CG  . LEU A 97  ? 0.3606 0.3837 0.3598 0.0159  -0.0565 0.0411  97  LEU A CG  
764  C CD1 . LEU A 97  ? 0.3458 0.3807 0.3487 0.0269  -0.0562 0.0446  97  LEU A CD1 
765  C CD2 . LEU A 97  ? 0.3102 0.3193 0.3085 0.0123  -0.0494 0.0416  97  LEU A CD2 
766  N N   . TYR A 98  ? 0.3391 0.3121 0.2998 0.0082  -0.0525 0.0332  98  TYR A N   
767  C CA  . TYR A 98  ? 0.3916 0.3531 0.3379 0.0099  -0.0500 0.0318  98  TYR A CA  
768  C C   . TYR A 98  ? 0.3743 0.3282 0.3207 0.0103  -0.0420 0.0346  98  TYR A C   
769  O O   . TYR A 98  ? 0.3630 0.3194 0.3202 0.0080  -0.0397 0.0360  98  TYR A O   
770  C CB  . TYR A 98  ? 0.4262 0.3829 0.3681 0.0052  -0.0519 0.0254  98  TYR A CB  
771  C CG  . TYR A 98  ? 0.3912 0.3573 0.3326 0.0015  -0.0607 0.0218  98  TYR A CG  
772  C CD1 . TYR A 98  ? 0.3655 0.3413 0.3206 -0.0051 -0.0643 0.0206  98  TYR A CD1 
773  C CD2 . TYR A 98  ? 0.3612 0.3286 0.2882 0.0037  -0.0656 0.0201  98  TYR A CD2 
774  C CE1 . TYR A 98  ? 0.3867 0.3757 0.3432 -0.0105 -0.0727 0.0173  98  TYR A CE1 
775  C CE2 . TYR A 98  ? 0.4489 0.4294 0.3761 -0.0006 -0.0751 0.0168  98  TYR A CE2 
776  C CZ  . TYR A 98  ? 0.4703 0.4627 0.4134 -0.0083 -0.0786 0.0152  98  TYR A CZ  
777  O OH  . TYR A 98  ? 0.4434 0.4530 0.3887 -0.0146 -0.0883 0.0119  98  TYR A OH  
778  N N   . LEU A 99  ? 0.3766 0.3232 0.3108 0.0125  -0.0381 0.0356  99  LEU A N   
779  C CA  . LEU A 99  ? 0.3677 0.3113 0.3032 0.0111  -0.0306 0.0381  99  LEU A CA  
780  C C   . LEU A 99  ? 0.3942 0.3342 0.3215 0.0119  -0.0258 0.0359  99  LEU A C   
781  O O   . LEU A 99  ? 0.4419 0.3779 0.3579 0.0137  -0.0278 0.0325  99  LEU A O   
782  C CB  . LEU A 99  ? 0.3185 0.2575 0.2484 0.0115  -0.0280 0.0430  99  LEU A CB  
783  C CG  . LEU A 99  ? 0.3777 0.3077 0.2902 0.0154  -0.0283 0.0458  99  LEU A CG  
784  C CD1 . LEU A 99  ? 0.3203 0.2450 0.2206 0.0138  -0.0223 0.0464  99  LEU A CD1 
785  C CD2 . LEU A 99  ? 0.3921 0.3133 0.2999 0.0169  -0.0268 0.0505  99  LEU A CD2 
786  N N   . ASN A 100 ? 0.4000 0.3434 0.3326 0.0104  -0.0192 0.0377  100 ASN A N   
787  C CA  . ASN A 100 ? 0.3907 0.3349 0.3191 0.0125  -0.0129 0.0359  100 ASN A CA  
788  C C   . ASN A 100 ? 0.4061 0.3546 0.3320 0.0095  -0.0058 0.0403  100 ASN A C   
789  O O   . ASN A 100 ? 0.4229 0.3752 0.3554 0.0046  -0.0053 0.0441  100 ASN A O   
790  C CB  . ASN A 100 ? 0.2952 0.2444 0.2366 0.0146  -0.0113 0.0342  100 ASN A CB  
791  C CG  . ASN A 100 ? 0.4616 0.4051 0.4070 0.0146  -0.0178 0.0310  100 ASN A CG  
792  O OD1 . ASN A 100 ? 0.4491 0.3838 0.3850 0.0152  -0.0208 0.0259  100 ASN A OD1 
793  N ND2 . ASN A 100 ? 0.4088 0.3574 0.3671 0.0125  -0.0199 0.0339  100 ASN A ND2 
794  N N   . VAL A 101 ? 0.4190 0.3667 0.3340 0.0112  0.0002  0.0395  101 VAL A N   
795  C CA  . VAL A 101 ? 0.4122 0.3656 0.3245 0.0066  0.0082  0.0439  101 VAL A CA  
796  C C   . VAL A 101 ? 0.4382 0.4030 0.3535 0.0102  0.0167  0.0421  101 VAL A C   
797  O O   . VAL A 101 ? 0.4759 0.4346 0.3808 0.0164  0.0181  0.0375  101 VAL A O   
798  C CB  . VAL A 101 ? 0.4220 0.3624 0.3133 0.0049  0.0091  0.0468  101 VAL A CB  
799  C CG1 . VAL A 101 ? 0.3651 0.3103 0.2517 -0.0017 0.0192  0.0514  101 VAL A CG1 
800  C CG2 . VAL A 101 ? 0.3396 0.2688 0.2274 0.0039  0.0020  0.0494  101 VAL A CG2 
801  N N   . TRP A 102 ? 0.3926 0.3749 0.3217 0.0064  0.0224  0.0455  102 TRP A N   
802  C CA  . TRP A 102 ? 0.3578 0.3562 0.2916 0.0105  0.0320  0.0451  102 TRP A CA  
803  C C   . TRP A 102 ? 0.4192 0.4272 0.3496 0.0006  0.0399  0.0503  102 TRP A C   
804  O O   . TRP A 102 ? 0.4255 0.4359 0.3605 -0.0100 0.0379  0.0543  102 TRP A O   
805  C CB  . TRP A 102 ? 0.3691 0.3871 0.3255 0.0150  0.0324  0.0458  102 TRP A CB  
806  C CG  . TRP A 102 ? 0.3911 0.4001 0.3514 0.0251  0.0273  0.0417  102 TRP A CG  
807  C CD1 . TRP A 102 ? 0.4173 0.4244 0.3767 0.0370  0.0320  0.0376  102 TRP A CD1 
808  C CD2 . TRP A 102 ? 0.3814 0.3812 0.3469 0.0237  0.0177  0.0416  102 TRP A CD2 
809  N NE1 . TRP A 102 ? 0.4099 0.4042 0.3722 0.0421  0.0256  0.0352  102 TRP A NE1 
810  C CE2 . TRP A 102 ? 0.4060 0.3974 0.3728 0.0336  0.0169  0.0379  102 TRP A CE2 
811  C CE3 . TRP A 102 ? 0.3559 0.3525 0.3236 0.0152  0.0108  0.0441  102 TRP A CE3 
812  C CZ2 . TRP A 102 ? 0.4181 0.3994 0.3889 0.0335  0.0092  0.0374  102 TRP A CZ2 
813  C CZ3 . TRP A 102 ? 0.4018 0.3910 0.3745 0.0165  0.0035  0.0432  102 TRP A CZ3 
814  C CH2 . TRP A 102 ? 0.4589 0.4412 0.4334 0.0248  0.0027  0.0403  102 TRP A CH2 
815  N N   . THR A 103 ? 0.3832 0.3956 0.3039 0.0032  0.0493  0.0498  103 THR A N   
816  C CA  . THR A 103 ? 0.3666 0.3891 0.2832 -0.0074 0.0586  0.0552  103 THR A CA  
817  C C   . THR A 103 ? 0.4251 0.4707 0.3483 -0.0012 0.0705  0.0542  103 THR A C   
818  O O   . THR A 103 ? 0.3936 0.4374 0.3157 0.0125  0.0717  0.0486  103 THR A O   
819  C CB  . THR A 103 ? 0.4287 0.4270 0.3172 -0.0116 0.0596  0.0573  103 THR A CB  
820  O OG1 . THR A 103 ? 0.4454 0.4375 0.3183 -0.0015 0.0634  0.0530  103 THR A OG1 
821  C CG2 . THR A 103 ? 0.4756 0.4498 0.3552 -0.0124 0.0481  0.0577  103 THR A CG2 
822  N N   . PRO A 104 ? 0.4000 0.4671 0.3295 -0.0116 0.0799  0.0594  104 PRO A N   
823  C CA  . PRO A 104 ? 0.4641 0.5549 0.3971 -0.0066 0.0936  0.0594  104 PRO A CA  
824  C C   . PRO A 104 ? 0.5040 0.5745 0.4106 0.0030  0.0986  0.0550  104 PRO A C   
825  O O   . PRO A 104 ? 0.5801 0.6216 0.4636 0.0003  0.0927  0.0547  104 PRO A O   
826  C CB  . PRO A 104 ? 0.3933 0.4993 0.3275 -0.0253 0.1015  0.0667  104 PRO A CB  
827  C CG  . PRO A 104 ? 0.4671 0.5723 0.4133 -0.0373 0.0915  0.0692  104 PRO A CG  
828  C CD  . PRO A 104 ? 0.4237 0.4965 0.3595 -0.0294 0.0785  0.0652  104 PRO A CD  
829  N N   . TYR A 105 ? 0.4602 0.5466 0.3697 0.0151  0.1091  0.0513  105 TYR A N   
830  C CA  . TYR A 105 ? 0.4688 0.5385 0.3510 0.0229  0.1159  0.0465  105 TYR A CA  
831  C C   . TYR A 105 ? 0.5195 0.6154 0.4023 0.0206  0.1332  0.0499  105 TYR A C   
832  O O   . TYR A 105 ? 0.4862 0.6147 0.3925 0.0274  0.1416  0.0501  105 TYR A O   
833  C CB  . TYR A 105 ? 0.4658 0.5246 0.3459 0.0410  0.1139  0.0370  105 TYR A CB  
834  C CG  . TYR A 105 ? 0.4732 0.5117 0.3222 0.0489  0.1196  0.0297  105 TYR A CG  
835  C CD1 . TYR A 105 ? 0.4939 0.5479 0.3365 0.0557  0.1363  0.0281  105 TYR A CD1 
836  C CD2 . TYR A 105 ? 0.5873 0.5932 0.4136 0.0497  0.1082  0.0240  105 TYR A CD2 
837  C CE1 . TYR A 105 ? 0.5238 0.5578 0.3348 0.0629  0.1417  0.0205  105 TYR A CE1 
838  C CE2 . TYR A 105 ? 0.5105 0.4983 0.3065 0.0558  0.1122  0.0165  105 TYR A CE2 
839  C CZ  . TYR A 105 ? 0.5417 0.5418 0.3287 0.0624  0.1290  0.0145  105 TYR A CZ  
840  O OH  . TYR A 105 ? 0.5644 0.5450 0.3183 0.0681  0.1329  0.0062  105 TYR A OH  
841  N N   . PRO A 106 ? 0.5812 0.6648 0.4382 0.0116  0.1390  0.0534  106 PRO A N   
842  C CA  . PRO A 106 ? 0.5452 0.5931 0.3745 0.0047  0.1292  0.0551  106 PRO A CA  
843  C C   . PRO A 106 ? 0.5709 0.6136 0.4101 -0.0101 0.1200  0.0622  106 PRO A C   
844  O O   . PRO A 106 ? 0.5557 0.6239 0.4198 -0.0184 0.1231  0.0660  106 PRO A O   
845  C CB  . PRO A 106 ? 0.5940 0.6392 0.3968 -0.0010 0.1421  0.0593  106 PRO A CB  
846  C CG  . PRO A 106 ? 0.5841 0.6681 0.4081 -0.0060 0.1578  0.0633  106 PRO A CG  
847  C CD  . PRO A 106 ? 0.5700 0.6772 0.4235 0.0082  0.1572  0.0569  106 PRO A CD  
848  N N   . ARG A 107 ? 0.6062 0.6174 0.4260 -0.0128 0.1089  0.0636  107 ARG A N   
849  C CA  . ARG A 107 ? 0.5411 0.5419 0.3671 -0.0244 0.1002  0.0691  107 ARG A CA  
850  C C   . ARG A 107 ? 0.5119 0.5235 0.3398 -0.0422 0.1104  0.0775  107 ARG A C   
851  O O   . ARG A 107 ? 0.6343 0.6536 0.4505 -0.0461 0.1231  0.0809  107 ARG A O   
852  C CB  . ARG A 107 ? 0.5365 0.5029 0.3383 -0.0219 0.0889  0.0701  107 ARG A CB  
853  C CG  . ARG A 107 ? 0.7068 0.6653 0.5112 -0.0083 0.0770  0.0616  107 ARG A CG  
854  C CD  . ARG A 107 ? 0.7549 0.6870 0.5421 -0.0067 0.0647  0.0636  107 ARG A CD  
855  N NE  . ARG A 107 ? 0.6836 0.5989 0.4394 -0.0081 0.0682  0.0693  107 ARG A NE  
856  C CZ  . ARG A 107 ? 0.6551 0.5649 0.3896 -0.0004 0.0681  0.0656  107 ARG A CZ  
857  N NH1 . ARG A 107 ? 0.5593 0.4766 0.3007 0.0083  0.0652  0.0553  107 ARG A NH1 
858  N NH2 . ARG A 107 ? 0.7511 0.6460 0.4555 -0.0017 0.0710  0.0720  107 ARG A NH2 
859  N N   . PRO A 108 ? 0.5898 0.6028 0.4324 -0.0539 0.1053  0.0806  108 PRO A N   
860  C CA  . PRO A 108 ? 0.6175 0.6429 0.4645 -0.0739 0.1145  0.0875  108 PRO A CA  
861  C C   . PRO A 108 ? 0.7004 0.6972 0.5147 -0.0845 0.1210  0.0953  108 PRO A C   
862  O O   . PRO A 108 ? 0.6720 0.6340 0.4621 -0.0783 0.1138  0.0967  108 PRO A O   
863  C CB  . PRO A 108 ? 0.5533 0.5755 0.4157 -0.0828 0.1044  0.0872  108 PRO A CB  
864  C CG  . PRO A 108 ? 0.5170 0.5406 0.3930 -0.0661 0.0929  0.0801  108 PRO A CG  
865  C CD  . PRO A 108 ? 0.5509 0.5566 0.4074 -0.0502 0.0913  0.0770  108 PRO A CD  
866  N N   . ALA A 109 ? 0.7884 0.8017 0.6029 -0.1005 0.1346  0.1010  109 ALA A N   
867  C CA  . ALA A 109 ? 0.9437 0.9302 0.7267 -0.1132 0.1429  0.1100  109 ALA A CA  
868  C C   . ALA A 109 ? 0.9810 0.9317 0.7512 -0.1260 0.1361  0.1146  109 ALA A C   
869  O O   . ALA A 109 ? 1.0186 0.9291 0.7581 -0.1225 0.1331  0.1195  109 ALA A O   
870  C CB  . ALA A 109 ? 0.9985 1.0160 0.7885 -0.1294 0.1600  0.1148  109 ALA A CB  
871  N N   . SER A 110 ? 0.9054 0.8711 0.6983 -0.1402 0.1339  0.1130  110 SER A N   
872  C CA  . SER A 110 ? 0.7988 0.7315 0.5802 -0.1543 0.1291  0.1158  110 SER A CA  
873  C C   . SER A 110 ? 0.7421 0.6678 0.5368 -0.1423 0.1136  0.1086  110 SER A C   
874  O O   . SER A 110 ? 0.6858 0.6394 0.5044 -0.1285 0.1077  0.1020  110 SER A O   
875  C CB  . SER A 110 ? 0.7700 0.7245 0.5652 -0.1815 0.1374  0.1181  110 SER A CB  
876  O OG  . SER A 110 ? 0.8129 0.8228 0.6438 -0.1798 0.1395  0.1135  110 SER A OG  
877  N N   . PRO A 111 ? 0.7069 0.5936 0.4848 -0.1471 0.1078  0.1102  111 PRO A N   
878  C CA  . PRO A 111 ? 0.6301 0.5103 0.4193 -0.1360 0.0944  0.1036  111 PRO A CA  
879  C C   . PRO A 111 ? 0.6296 0.5473 0.4522 -0.1438 0.0907  0.0973  111 PRO A C   
880  O O   . PRO A 111 ? 0.6734 0.6021 0.5025 -0.1653 0.0954  0.0982  111 PRO A O   
881  C CB  . PRO A 111 ? 0.6812 0.5123 0.4432 -0.1429 0.0929  0.1073  111 PRO A CB  
882  C CG  . PRO A 111 ? 0.6877 0.4926 0.4188 -0.1478 0.1029  0.1168  111 PRO A CG  
883  C CD  . PRO A 111 ? 0.6804 0.5231 0.4245 -0.1599 0.1140  0.1184  111 PRO A CD  
884  N N   . THR A 112 ? 0.5636 0.4999 0.4059 -0.1265 0.0818  0.0913  112 THR A N   
885  C CA  . THR A 112 ? 0.5025 0.4780 0.3767 -0.1283 0.0779  0.0865  112 THR A CA  
886  C C   . THR A 112 ? 0.4363 0.3998 0.3157 -0.1246 0.0663  0.0818  112 THR A C   
887  O O   . THR A 112 ? 0.4455 0.3857 0.3151 -0.1093 0.0596  0.0801  112 THR A O   
888  C CB  . THR A 112 ? 0.5269 0.5317 0.4181 -0.1096 0.0780  0.0837  112 THR A CB  
889  O OG1 . THR A 112 ? 0.6348 0.6509 0.5195 -0.1115 0.0899  0.0875  112 THR A OG1 
890  C CG2 . THR A 112 ? 0.4241 0.4690 0.3476 -0.1085 0.0740  0.0802  112 THR A CG2 
891  N N   . PRO A 113 ? 0.4482 0.4304 0.3432 -0.1389 0.0638  0.0795  113 PRO A N   
892  C CA  . PRO A 113 ? 0.4339 0.4088 0.3341 -0.1363 0.0535  0.0747  113 PRO A CA  
893  C C   . PRO A 113 ? 0.4897 0.4736 0.4027 -0.1135 0.0458  0.0716  113 PRO A C   
894  O O   . PRO A 113 ? 0.4655 0.4785 0.3957 -0.1040 0.0471  0.0715  113 PRO A O   
895  C CB  . PRO A 113 ? 0.4436 0.4529 0.3639 -0.1540 0.0528  0.0733  113 PRO A CB  
896  C CG  . PRO A 113 ? 0.4503 0.4667 0.3650 -0.1736 0.0636  0.0778  113 PRO A CG  
897  C CD  . PRO A 113 ? 0.4985 0.5098 0.4048 -0.1605 0.0710  0.0817  113 PRO A CD  
898  N N   . VAL A 114 ? 0.4786 0.4362 0.3822 -0.1051 0.0387  0.0690  114 VAL A N   
899  C CA  . VAL A 114 ? 0.4053 0.3651 0.3169 -0.0856 0.0317  0.0663  114 VAL A CA  
900  C C   . VAL A 114 ? 0.3949 0.3683 0.3223 -0.0852 0.0240  0.0627  114 VAL A C   
901  O O   . VAL A 114 ? 0.3836 0.3464 0.3052 -0.0962 0.0222  0.0612  114 VAL A O   
902  C CB  . VAL A 114 ? 0.4550 0.3788 0.3454 -0.0753 0.0290  0.0667  114 VAL A CB  
903  C CG1 . VAL A 114 ? 0.3561 0.2847 0.2559 -0.0578 0.0213  0.0635  114 VAL A CG1 
904  C CG2 . VAL A 114 ? 0.4003 0.3077 0.2710 -0.0752 0.0359  0.0714  114 VAL A CG2 
905  N N   . LEU A 115 ? 0.3750 0.3693 0.3200 -0.0727 0.0199  0.0614  115 LEU A N   
906  C CA  . LEU A 115 ? 0.3076 0.3120 0.2651 -0.0699 0.0124  0.0591  115 LEU A CA  
907  C C   . LEU A 115 ? 0.3564 0.3459 0.3113 -0.0547 0.0073  0.0571  115 LEU A C   
908  O O   . LEU A 115 ? 0.3378 0.3273 0.2932 -0.0437 0.0081  0.0570  115 LEU A O   
909  C CB  . LEU A 115 ? 0.4110 0.4524 0.3914 -0.0680 0.0117  0.0604  115 LEU A CB  
910  C CG  . LEU A 115 ? 0.5083 0.5761 0.4982 -0.0839 0.0146  0.0623  115 LEU A CG  
911  C CD1 . LEU A 115 ? 0.4722 0.5785 0.4860 -0.0761 0.0139  0.0647  115 LEU A CD1 
912  C CD2 . LEU A 115 ? 0.5876 0.6486 0.5720 -0.0977 0.0096  0.0602  115 LEU A CD2 
913  N N   . ILE A 116 ? 0.3364 0.3137 0.2876 -0.0548 0.0023  0.0551  116 ILE A N   
914  C CA  . ILE A 116 ? 0.3579 0.3254 0.3089 -0.0422 -0.0024 0.0535  116 ILE A CA  
915  C C   . ILE A 116 ? 0.4381 0.4201 0.4027 -0.0404 -0.0076 0.0527  116 ILE A C   
916  O O   . ILE A 116 ? 0.3464 0.3284 0.3094 -0.0482 -0.0092 0.0518  116 ILE A O   
917  C CB  . ILE A 116 ? 0.3501 0.2909 0.2847 -0.0408 -0.0029 0.0525  116 ILE A CB  
918  C CG1 . ILE A 116 ? 0.3685 0.2908 0.2859 -0.0422 0.0021  0.0548  116 ILE A CG1 
919  C CG2 . ILE A 116 ? 0.3481 0.2864 0.2862 -0.0285 -0.0078 0.0512  116 ILE A CG2 
920  C CD1 . ILE A 116 ? 0.3579 0.2526 0.2581 -0.0382 0.0019  0.0551  116 ILE A CD1 
921  N N   . TRP A 117 ? 0.2611 0.2530 0.2364 -0.0306 -0.0098 0.0530  117 TRP A N   
922  C CA  . TRP A 117 ? 0.2782 0.2819 0.2649 -0.0279 -0.0142 0.0537  117 TRP A CA  
923  C C   . TRP A 117 ? 0.3606 0.3514 0.3437 -0.0234 -0.0178 0.0521  117 TRP A C   
924  O O   . TRP A 117 ? 0.2893 0.2690 0.2678 -0.0174 -0.0181 0.0506  117 TRP A O   
925  C CB  . TRP A 117 ? 0.2488 0.2657 0.2469 -0.0193 -0.0138 0.0553  117 TRP A CB  
926  C CG  . TRP A 117 ? 0.3239 0.3487 0.3316 -0.0147 -0.0181 0.0575  117 TRP A CG  
927  C CD1 . TRP A 117 ? 0.3519 0.3674 0.3604 -0.0070 -0.0202 0.0571  117 TRP A CD1 
928  C CD2 . TRP A 117 ? 0.3070 0.3499 0.3228 -0.0183 -0.0208 0.0609  117 TRP A CD2 
929  N NE1 . TRP A 117 ? 0.4014 0.4255 0.4172 -0.0051 -0.0232 0.0608  117 TRP A NE1 
930  C CE2 . TRP A 117 ? 0.3735 0.4156 0.3939 -0.0110 -0.0241 0.0634  117 TRP A CE2 
931  C CE3 . TRP A 117 ? 0.2933 0.3536 0.3122 -0.0280 -0.0211 0.0622  117 TRP A CE3 
932  C CZ2 . TRP A 117 ? 0.3278 0.3856 0.3548 -0.0113 -0.0278 0.0681  117 TRP A CZ2 
933  C CZ3 . TRP A 117 ? 0.2462 0.3253 0.2731 -0.0292 -0.0258 0.0660  117 TRP A CZ3 
934  C CH2 . TRP A 117 ? 0.2696 0.3470 0.3000 -0.0199 -0.0291 0.0693  117 TRP A CH2 
935  N N   . ILE A 118 ? 0.3231 0.3182 0.3085 -0.0267 -0.0205 0.0524  118 ILE A N   
936  C CA  . ILE A 118 ? 0.3087 0.2967 0.2934 -0.0224 -0.0230 0.0516  118 ILE A CA  
937  C C   . ILE A 118 ? 0.3201 0.3202 0.3144 -0.0207 -0.0260 0.0546  118 ILE A C   
938  O O   . ILE A 118 ? 0.3408 0.3505 0.3360 -0.0259 -0.0275 0.0561  118 ILE A O   
939  C CB  . ILE A 118 ? 0.2877 0.2650 0.2618 -0.0268 -0.0222 0.0492  118 ILE A CB  
940  C CG1 . ILE A 118 ? 0.2678 0.2295 0.2295 -0.0288 -0.0187 0.0475  118 ILE A CG1 
941  C CG2 . ILE A 118 ? 0.2925 0.2656 0.2674 -0.0209 -0.0234 0.0484  118 ILE A CG2 
942  C CD1 . ILE A 118 ? 0.2808 0.2261 0.2289 -0.0310 -0.0167 0.0447  118 ILE A CD1 
943  N N   . TYR A 119 ? 0.2300 0.2283 0.2296 -0.0140 -0.0270 0.0555  119 TYR A N   
944  C CA  . TYR A 119 ? 0.2584 0.2634 0.2649 -0.0114 -0.0292 0.0595  119 TYR A CA  
945  C C   . TYR A 119 ? 0.3064 0.3124 0.3107 -0.0150 -0.0308 0.0610  119 TYR A C   
946  O O   . TYR A 119 ? 0.2362 0.2357 0.2350 -0.0172 -0.0299 0.0580  119 TYR A O   
947  C CB  . TYR A 119 ? 0.2298 0.2267 0.2390 -0.0050 -0.0291 0.0595  119 TYR A CB  
948  C CG  . TYR A 119 ? 0.4019 0.3883 0.4077 -0.0058 -0.0298 0.0560  119 TYR A CG  
949  C CD1 . TYR A 119 ? 0.3245 0.3105 0.3313 -0.0086 -0.0310 0.0572  119 TYR A CD1 
950  C CD2 . TYR A 119 ? 0.2329 0.2125 0.2348 -0.0039 -0.0293 0.0519  119 TYR A CD2 
951  C CE1 . TYR A 119 ? 0.3332 0.3155 0.3397 -0.0096 -0.0317 0.0543  119 TYR A CE1 
952  C CE2 . TYR A 119 ? 0.2875 0.2625 0.2876 -0.0045 -0.0312 0.0492  119 TYR A CE2 
953  C CZ  . TYR A 119 ? 0.3579 0.3358 0.3617 -0.0074 -0.0324 0.0503  119 TYR A CZ  
954  O OH  . TYR A 119 ? 0.3248 0.3036 0.3295 -0.0083 -0.0344 0.0478  119 TYR A OH  
955  N N   . GLY A 120 ? 0.2493 0.2638 0.2572 -0.0142 -0.0329 0.0661  120 GLY A N   
956  C CA  . GLY A 120 ? 0.2794 0.2948 0.2840 -0.0168 -0.0341 0.0688  120 GLY A CA  
957  C C   . GLY A 120 ? 0.3085 0.3158 0.3155 -0.0133 -0.0339 0.0721  120 GLY A C   
958  O O   . GLY A 120 ? 0.3257 0.3240 0.3355 -0.0098 -0.0330 0.0705  120 GLY A O   
959  N N   . GLY A 121 ? 0.2931 0.3024 0.2969 -0.0155 -0.0345 0.0766  121 GLY A N   
960  C CA  . GLY A 121 ? 0.3632 0.3632 0.3671 -0.0154 -0.0333 0.0799  121 GLY A CA  
961  C C   . GLY A 121 ? 0.3840 0.3858 0.3838 -0.0212 -0.0311 0.0794  121 GLY A C   
962  O O   . GLY A 121 ? 0.3603 0.3567 0.3624 -0.0236 -0.0291 0.0789  121 GLY A O   
963  N N   . GLY A 122 ? 0.2981 0.3082 0.2916 -0.0241 -0.0310 0.0788  122 GLY A N   
964  C CA  . GLY A 122 ? 0.3440 0.3568 0.3314 -0.0284 -0.0278 0.0788  122 GLY A CA  
965  C C   . GLY A 122 ? 0.3907 0.4028 0.3813 -0.0287 -0.0238 0.0728  122 GLY A C   
966  O O   . GLY A 122 ? 0.3740 0.3900 0.3633 -0.0313 -0.0199 0.0737  122 GLY A O   
967  N N   . PHE A 123 ? 0.2885 0.2972 0.2833 -0.0257 -0.0246 0.0675  123 PHE A N   
968  C CA  . PHE A 123 ? 0.2754 0.2852 0.2745 -0.0237 -0.0221 0.0627  123 PHE A CA  
969  C C   . PHE A 123 ? 0.2696 0.2827 0.2777 -0.0262 -0.0217 0.0649  123 PHE A C   
970  O O   . PHE A 123 ? 0.3340 0.3542 0.3477 -0.0254 -0.0200 0.0620  123 PHE A O   
971  C CB  . PHE A 123 ? 0.2888 0.3018 0.2807 -0.0228 -0.0176 0.0592  123 PHE A CB  
972  C CG  . PHE A 123 ? 0.2599 0.2655 0.2409 -0.0223 -0.0177 0.0552  123 PHE A CG  
973  C CD1 . PHE A 123 ? 0.2579 0.2558 0.2381 -0.0187 -0.0183 0.0512  123 PHE A CD1 
974  C CD2 . PHE A 123 ? 0.2571 0.2629 0.2270 -0.0267 -0.0173 0.0554  123 PHE A CD2 
975  C CE1 . PHE A 123 ? 0.3274 0.3159 0.2962 -0.0205 -0.0177 0.0477  123 PHE A CE1 
976  C CE2 . PHE A 123 ? 0.3988 0.3972 0.3577 -0.0292 -0.0176 0.0509  123 PHE A CE2 
977  C CZ  . PHE A 123 ? 0.4206 0.4093 0.3790 -0.0266 -0.0174 0.0471  123 PHE A CZ  
978  N N   . TYR A 124 ? 0.2678 0.2755 0.2767 -0.0293 -0.0232 0.0701  124 TYR A N   
979  C CA  . TYR A 124 ? 0.3985 0.4047 0.4136 -0.0343 -0.0228 0.0716  124 TYR A CA  
980  C C   . TYR A 124 ? 0.3391 0.3312 0.3548 -0.0336 -0.0262 0.0716  124 TYR A C   
981  O O   . TYR A 124 ? 0.3391 0.3246 0.3569 -0.0392 -0.0263 0.0723  124 TYR A O   
982  C CB  . TYR A 124 ? 0.4263 0.4338 0.4383 -0.0404 -0.0194 0.0784  124 TYR A CB  
983  C CG  . TYR A 124 ? 0.4121 0.4071 0.4166 -0.0394 -0.0211 0.0854  124 TYR A CG  
984  C CD1 . TYR A 124 ? 0.3807 0.3600 0.3849 -0.0412 -0.0221 0.0889  124 TYR A CD1 
985  C CD2 . TYR A 124 ? 0.4073 0.4059 0.4040 -0.0361 -0.0219 0.0886  124 TYR A CD2 
986  C CE1 . TYR A 124 ? 0.4169 0.3839 0.4138 -0.0373 -0.0233 0.0963  124 TYR A CE1 
987  C CE2 . TYR A 124 ? 0.4125 0.4036 0.4034 -0.0333 -0.0243 0.0963  124 TYR A CE2 
988  C CZ  . TYR A 124 ? 0.4468 0.4220 0.4382 -0.0326 -0.0247 0.1006  124 TYR A CZ  
989  O OH  . TYR A 124 ? 0.4290 0.3957 0.4142 -0.0270 -0.0267 0.1091  124 TYR A OH  
990  N N   . SER A 125 ? 0.3087 0.2956 0.3217 -0.0274 -0.0284 0.0705  125 SER A N   
991  C CA  . SER A 125 ? 0.2992 0.2726 0.3115 -0.0248 -0.0302 0.0701  125 SER A CA  
992  C C   . SER A 125 ? 0.3205 0.2950 0.3320 -0.0180 -0.0314 0.0670  125 SER A C   
993  O O   . SER A 125 ? 0.2825 0.2664 0.2933 -0.0168 -0.0312 0.0659  125 SER A O   
994  C CB  . SER A 125 ? 0.2804 0.2424 0.2883 -0.0240 -0.0295 0.0776  125 SER A CB  
995  O OG  . SER A 125 ? 0.3530 0.3232 0.3585 -0.0197 -0.0300 0.0824  125 SER A OG  
996  N N   . GLY A 126 ? 0.2994 0.2631 0.3096 -0.0141 -0.0319 0.0656  126 GLY A N   
997  C CA  . GLY A 126 ? 0.3769 0.3430 0.3867 -0.0080 -0.0319 0.0630  126 GLY A CA  
998  C C   . GLY A 126 ? 0.3860 0.3465 0.3938 -0.0076 -0.0324 0.0563  126 GLY A C   
999  O O   . GLY A 126 ? 0.3603 0.3190 0.3680 -0.0124 -0.0339 0.0530  126 GLY A O   
1000 N N   . ALA A 127 ? 0.3370 0.2971 0.3429 -0.0020 -0.0312 0.0547  127 ALA A N   
1001 C CA  . ALA A 127 ? 0.3511 0.3047 0.3519 -0.0004 -0.0311 0.0488  127 ALA A CA  
1002 C C   . ALA A 127 ? 0.3340 0.2929 0.3339 0.0051  -0.0282 0.0488  127 ALA A C   
1003 O O   . ALA A 127 ? 0.3166 0.2811 0.3207 0.0093  -0.0262 0.0529  127 ALA A O   
1004 C CB  . ALA A 127 ? 0.3751 0.3120 0.3712 0.0000  -0.0309 0.0463  127 ALA A CB  
1005 N N   . ALA A 128 ? 0.2762 0.2350 0.2706 0.0051  -0.0279 0.0448  128 ALA A N   
1006 C CA  . ALA A 128 ? 0.3273 0.2919 0.3202 0.0083  -0.0241 0.0452  128 ALA A CA  
1007 C C   . ALA A 128 ? 0.3873 0.3451 0.3768 0.0150  -0.0205 0.0429  128 ALA A C   
1008 O O   . ALA A 128 ? 0.3751 0.3402 0.3650 0.0189  -0.0160 0.0435  128 ALA A O   
1009 C CB  . ALA A 128 ? 0.2756 0.2401 0.2611 0.0058  -0.0243 0.0431  128 ALA A CB  
1010 N N   . SER A 129 ? 0.3400 0.2835 0.3257 0.0160  -0.0218 0.0401  129 SER A N   
1011 C CA  . SER A 129 ? 0.3991 0.3300 0.3773 0.0227  -0.0178 0.0361  129 SER A CA  
1012 C C   . SER A 129 ? 0.4217 0.3495 0.4047 0.0313  -0.0143 0.0401  129 SER A C   
1013 O O   . SER A 129 ? 0.3964 0.3113 0.3724 0.0391  -0.0098 0.0368  129 SER A O   
1014 C CB  . SER A 129 ? 0.3426 0.2555 0.3098 0.0181  -0.0210 0.0293  129 SER A CB  
1015 O OG  . SER A 129 ? 0.3521 0.2592 0.3234 0.0123  -0.0247 0.0312  129 SER A OG  
1016 N N   . LEU A 130 ? 0.3486 0.2871 0.3419 0.0308  -0.0161 0.0472  130 LEU A N   
1017 C CA  . LEU A 130 ? 0.3285 0.2655 0.3263 0.0403  -0.0138 0.0529  130 LEU A CA  
1018 C C   . LEU A 130 ? 0.4083 0.3598 0.4111 0.0511  -0.0081 0.0542  130 LEU A C   
1019 O O   . LEU A 130 ? 0.3828 0.3525 0.3895 0.0479  -0.0069 0.0534  130 LEU A O   
1020 C CB  . LEU A 130 ? 0.3322 0.2815 0.3387 0.0371  -0.0177 0.0608  130 LEU A CB  
1021 C CG  . LEU A 130 ? 0.3865 0.3289 0.3908 0.0263  -0.0222 0.0610  130 LEU A CG  
1022 C CD1 . LEU A 130 ? 0.3507 0.3061 0.3614 0.0250  -0.0248 0.0691  130 LEU A CD1 
1023 C CD2 . LEU A 130 ? 0.4261 0.3419 0.4214 0.0250  -0.0218 0.0583  130 LEU A CD2 
1024 N N   . ASP A 131 ? 0.3486 0.2923 0.3513 0.0641  -0.0042 0.0568  131 ASP A N   
1025 C CA  . ASP A 131 ? 0.3974 0.3576 0.4066 0.0768  0.0022  0.0585  131 ASP A CA  
1026 C C   . ASP A 131 ? 0.4368 0.4338 0.4627 0.0746  0.0004  0.0653  131 ASP A C   
1027 O O   . ASP A 131 ? 0.5167 0.5346 0.5488 0.0770  0.0051  0.0647  131 ASP A O   
1028 C CB  . ASP A 131 ? 0.4345 0.3791 0.4410 0.0936  0.0066  0.0615  131 ASP A CB  
1029 C CG  . ASP A 131 ? 0.5234 0.4309 0.5109 0.0968  0.0109  0.0526  131 ASP A CG  
1030 O OD1 . ASP A 131 ? 0.4607 0.3610 0.4387 0.0874  0.0109  0.0439  131 ASP A OD1 
1031 O OD2 . ASP A 131 ? 0.6931 0.5772 0.6735 0.1088  0.0144  0.0542  131 ASP A OD2 
1032 N N   . VAL A 132 ? 0.3699 0.3754 0.4017 0.0686  -0.0062 0.0715  132 VAL A N   
1033 C CA  . VAL A 132 ? 0.4292 0.4692 0.4749 0.0648  -0.0089 0.0773  132 VAL A CA  
1034 C C   . VAL A 132 ? 0.3809 0.4315 0.4262 0.0501  -0.0094 0.0728  132 VAL A C   
1035 O O   . VAL A 132 ? 0.2841 0.3615 0.3388 0.0442  -0.0108 0.0759  132 VAL A O   
1036 C CB  . VAL A 132 ? 0.3889 0.4355 0.4384 0.0621  -0.0159 0.0848  132 VAL A CB  
1037 C CG1 . VAL A 132 ? 0.5103 0.5587 0.5643 0.0788  -0.0152 0.0928  132 VAL A CG1 
1038 C CG2 . VAL A 132 ? 0.3282 0.3498 0.3665 0.0522  -0.0195 0.0820  132 VAL A CG2 
1039 N N   . TYR A 133 ? 0.2635 0.2928 0.2969 0.0439  -0.0087 0.0659  133 TYR A N   
1040 C CA  . TYR A 133 ? 0.2705 0.3048 0.3004 0.0320  -0.0086 0.0625  133 TYR A CA  
1041 C C   . TYR A 133 ? 0.2679 0.2994 0.2918 0.0349  -0.0019 0.0578  133 TYR A C   
1042 O O   . TYR A 133 ? 0.3230 0.3499 0.3391 0.0267  -0.0014 0.0547  133 TYR A O   
1043 C CB  . TYR A 133 ? 0.2665 0.2826 0.2872 0.0231  -0.0134 0.0593  133 TYR A CB  
1044 C CG  . TYR A 133 ? 0.3161 0.3326 0.3400 0.0200  -0.0188 0.0633  133 TYR A CG  
1045 C CD1 . TYR A 133 ? 0.3235 0.3602 0.3563 0.0195  -0.0210 0.0692  133 TYR A CD1 
1046 C CD2 . TYR A 133 ? 0.2566 0.2553 0.2742 0.0171  -0.0218 0.0614  133 TYR A CD2 
1047 C CE1 . TYR A 133 ? 0.3074 0.3439 0.3402 0.0167  -0.0257 0.0730  133 TYR A CE1 
1048 C CE2 . TYR A 133 ? 0.2506 0.2500 0.2698 0.0140  -0.0255 0.0653  133 TYR A CE2 
1049 C CZ  . TYR A 133 ? 0.3048 0.3217 0.3304 0.0140  -0.0273 0.0711  133 TYR A CZ  
1050 O OH  . TYR A 133 ? 0.2611 0.2785 0.2858 0.0109  -0.0307 0.0752  133 TYR A OH  
1051 N N   . ASP A 134 ? 0.3561 0.3891 0.3821 0.0475  0.0037  0.0576  134 ASP A N   
1052 C CA  . ASP A 134 ? 0.3273 0.3583 0.3461 0.0516  0.0114  0.0530  134 ASP A CA  
1053 C C   . ASP A 134 ? 0.3328 0.3883 0.3573 0.0435  0.0153  0.0550  134 ASP A C   
1054 O O   . ASP A 134 ? 0.3014 0.3852 0.3411 0.0447  0.0172  0.0601  134 ASP A O   
1055 C CB  . ASP A 134 ? 0.3718 0.4024 0.3932 0.0687  0.0178  0.0530  134 ASP A CB  
1056 C CG  . ASP A 134 ? 0.4674 0.4892 0.4766 0.0747  0.0266  0.0465  134 ASP A CG  
1057 O OD1 . ASP A 134 ? 0.4471 0.4734 0.4500 0.0660  0.0290  0.0442  134 ASP A OD1 
1058 O OD2 . ASP A 134 ? 0.4803 0.4888 0.4845 0.0888  0.0318  0.0438  134 ASP A OD2 
1059 N N   . GLY A 135 ? 0.4045 0.4496 0.4163 0.0348  0.0165  0.0515  135 GLY A N   
1060 C CA  . GLY A 135 ? 0.2762 0.3385 0.2898 0.0249  0.0207  0.0538  135 GLY A CA  
1061 C C   . GLY A 135 ? 0.3825 0.4606 0.3976 0.0302  0.0313  0.0537  135 GLY A C   
1062 O O   . GLY A 135 ? 0.2872 0.3804 0.3035 0.0204  0.0359  0.0560  135 GLY A O   
1063 N N   . ARG A 136 ? 0.3329 0.4071 0.3470 0.0453  0.0361  0.0509  136 ARG A N   
1064 C CA  . ARG A 136 ? 0.3890 0.4755 0.4013 0.0520  0.0477  0.0496  136 ARG A CA  
1065 C C   . ARG A 136 ? 0.4542 0.5825 0.4881 0.0504  0.0534  0.0559  136 ARG A C   
1066 O O   . ARG A 136 ? 0.3511 0.4947 0.3838 0.0454  0.0622  0.0566  136 ARG A O   
1067 C CB  . ARG A 136 ? 0.3636 0.4330 0.3675 0.0697  0.0526  0.0440  136 ARG A CB  
1068 C CG  . ARG A 136 ? 0.3520 0.4339 0.3722 0.0854  0.0538  0.0473  136 ARG A CG  
1069 C CD  . ARG A 136 ? 0.3932 0.4490 0.3994 0.1025  0.0596  0.0406  136 ARG A CD  
1070 N NE  . ARG A 136 ? 0.4635 0.4803 0.4514 0.0982  0.0518  0.0347  136 ARG A NE  
1071 C CZ  . ARG A 136 ? 0.5197 0.5053 0.4880 0.1061  0.0550  0.0264  136 ARG A CZ  
1072 N NH1 . ARG A 136 ? 0.4459 0.4308 0.4077 0.1208  0.0668  0.0223  136 ARG A NH1 
1073 N NH2 . ARG A 136 ? 0.4967 0.4520 0.4510 0.0988  0.0468  0.0216  136 ARG A NH2 
1074 N N   . PHE A 137 ? 0.4318 0.5800 0.4848 0.0534  0.0481  0.0609  137 PHE A N   
1075 C CA  . PHE A 137 ? 0.4107 0.6041 0.4868 0.0525  0.0520  0.0672  137 PHE A CA  
1076 C C   . PHE A 137 ? 0.3624 0.5726 0.4413 0.0297  0.0510  0.0697  137 PHE A C   
1077 O O   . PHE A 137 ? 0.3218 0.5628 0.4106 0.0244  0.0593  0.0723  137 PHE A O   
1078 C CB  . PHE A 137 ? 0.2806 0.4912 0.3747 0.0626  0.0452  0.0726  137 PHE A CB  
1079 C CG  . PHE A 137 ? 0.3380 0.5239 0.4256 0.0835  0.0458  0.0705  137 PHE A CG  
1080 C CD1 . PHE A 137 ? 0.3419 0.5366 0.4335 0.1034  0.0561  0.0700  137 PHE A CD1 
1081 C CD2 . PHE A 137 ? 0.2912 0.4430 0.3671 0.0829  0.0370  0.0687  137 PHE A CD2 
1082 C CE1 . PHE A 137 ? 0.4185 0.5840 0.5005 0.1222  0.0575  0.0674  137 PHE A CE1 
1083 C CE2 . PHE A 137 ? 0.3065 0.4317 0.3741 0.0996  0.0380  0.0666  137 PHE A CE2 
1084 C CZ  . PHE A 137 ? 0.4259 0.5552 0.4952 0.1191  0.0481  0.0657  137 PHE A CZ  
1085 N N   . LEU A 138 ? 0.2731 0.4626 0.3428 0.0162  0.0418  0.0690  138 LEU A N   
1086 C CA  . LEU A 138 ? 0.3772 0.5710 0.4433 -0.0058 0.0409  0.0702  138 LEU A CA  
1087 C C   . LEU A 138 ? 0.4064 0.5874 0.4561 -0.0121 0.0502  0.0684  138 LEU A C   
1088 O O   . LEU A 138 ? 0.3792 0.5803 0.4326 -0.0259 0.0564  0.0712  138 LEU A O   
1089 C CB  . LEU A 138 ? 0.2661 0.4334 0.3217 -0.0151 0.0304  0.0687  138 LEU A CB  
1090 C CG  . LEU A 138 ? 0.2742 0.4609 0.3452 -0.0161 0.0215  0.0719  138 LEU A CG  
1091 C CD1 . LEU A 138 ? 0.2505 0.4085 0.3097 -0.0202 0.0126  0.0697  138 LEU A CD1 
1092 C CD2 . LEU A 138 ? 0.2548 0.4772 0.3392 -0.0323 0.0220  0.0754  138 LEU A CD2 
1093 N N   . ALA A 139 ? 0.2934 0.4419 0.3242 -0.0028 0.0511  0.0639  139 ALA A N   
1094 C CA  . ALA A 139 ? 0.3629 0.4975 0.3749 -0.0061 0.0595  0.0625  139 ALA A CA  
1095 C C   . ALA A 139 ? 0.3722 0.5376 0.3936 -0.0021 0.0724  0.0642  139 ALA A C   
1096 O O   . ALA A 139 ? 0.4261 0.5994 0.4420 -0.0145 0.0802  0.0669  139 ALA A O   
1097 C CB  . ALA A 139 ? 0.3653 0.4649 0.3569 0.0048  0.0570  0.0569  139 ALA A CB  
1098 N N   . GLN A 140 ? 0.3896 0.5719 0.4247 0.0157  0.0755  0.0632  140 GLN A N   
1099 C CA  . GLN A 140 ? 0.4043 0.6160 0.4481 0.0235  0.0890  0.0643  140 GLN A CA  
1100 C C   . GLN A 140 ? 0.4380 0.6977 0.5071 0.0121  0.0925  0.0709  140 GLN A C   
1101 O O   . GLN A 140 ? 0.4046 0.6841 0.4742 0.0029  0.1033  0.0732  140 GLN A O   
1102 C CB  . GLN A 140 ? 0.3319 0.5435 0.3805 0.0485  0.0922  0.0609  140 GLN A CB  
1103 C CG  . GLN A 140 ? 0.3512 0.5735 0.3947 0.0601  0.1078  0.0584  140 GLN A CG  
1104 C CD  . GLN A 140 ? 0.4732 0.7502 0.5436 0.0600  0.1179  0.0646  140 GLN A CD  
1105 O OE1 . GLN A 140 ? 0.3545 0.6631 0.4509 0.0616  0.1127  0.0698  140 GLN A OE1 
1106 N NE2 . GLN A 140 ? 0.3645 0.6551 0.4285 0.0576  0.1322  0.0644  140 GLN A NE2 
1107 N N   . VAL A 141 ? 0.3681 0.6482 0.4577 0.0118  0.0834  0.0742  141 VAL A N   
1108 C CA  . VAL A 141 ? 0.3510 0.6833 0.4674 0.0031  0.0859  0.0802  141 VAL A CA  
1109 C C   . VAL A 141 ? 0.3643 0.6996 0.4769 -0.0264 0.0836  0.0823  141 VAL A C   
1110 O O   . VAL A 141 ? 0.3232 0.6943 0.4481 -0.0395 0.0914  0.0860  141 VAL A O   
1111 C CB  . VAL A 141 ? 0.4198 0.7774 0.5595 0.0152  0.0768  0.0837  141 VAL A CB  
1112 C CG1 . VAL A 141 ? 0.2805 0.6981 0.4494 0.0063  0.0784  0.0902  141 VAL A CG1 
1113 C CG2 . VAL A 141 ? 0.2915 0.6409 0.4320 0.0448  0.0808  0.0819  141 VAL A CG2 
1114 N N   . GLU A 142 ? 0.3620 0.6590 0.4569 -0.0370 0.0736  0.0799  142 GLU A N   
1115 C CA  . GLU A 142 ? 0.3379 0.6289 0.4250 -0.0641 0.0711  0.0812  142 GLU A CA  
1116 C C   . GLU A 142 ? 0.3966 0.6474 0.4541 -0.0738 0.0769  0.0797  142 GLU A C   
1117 O O   . GLU A 142 ? 0.4044 0.6432 0.4510 -0.0957 0.0767  0.0809  142 GLU A O   
1118 C CB  . GLU A 142 ? 0.2914 0.5683 0.3778 -0.0702 0.0569  0.0799  142 GLU A CB  
1119 C CG  . GLU A 142 ? 0.2988 0.6186 0.4122 -0.0680 0.0501  0.0831  142 GLU A CG  
1120 C CD  . GLU A 142 ? 0.4654 0.8349 0.5985 -0.0858 0.0549  0.0872  142 GLU A CD  
1121 O OE1 . GLU A 142 ? 0.4583 0.8206 0.5802 -0.1081 0.0604  0.0870  142 GLU A OE1 
1122 O OE2 . GLU A 142 ? 0.4981 0.9149 0.6580 -0.0775 0.0530  0.0911  142 GLU A OE2 
1123 N N   . GLY A 143 ? 0.4164 0.6444 0.4590 -0.0576 0.0818  0.0770  143 GLY A N   
1124 C CA  . GLY A 143 ? 0.3748 0.5654 0.3881 -0.0638 0.0861  0.0764  143 GLY A CA  
1125 C C   . GLY A 143 ? 0.4074 0.5556 0.4019 -0.0679 0.0753  0.0744  143 GLY A C   
1126 O O   . GLY A 143 ? 0.5466 0.6642 0.5172 -0.0756 0.0774  0.0755  143 GLY A O   
1127 N N   . ALA A 144 ? 0.3832 0.5296 0.3878 -0.0617 0.0643  0.0721  144 ALA A N   
1128 C CA  . ALA A 144 ? 0.3749 0.4861 0.3646 -0.0658 0.0547  0.0702  144 ALA A CA  
1129 C C   . ALA A 144 ? 0.4465 0.5222 0.4153 -0.0533 0.0526  0.0674  144 ALA A C   
1130 O O   . ALA A 144 ? 0.4789 0.5561 0.4477 -0.0383 0.0547  0.0649  144 ALA A O   
1131 C CB  . ALA A 144 ? 0.3069 0.4287 0.3129 -0.0625 0.0445  0.0689  144 ALA A CB  
1132 N N   . VAL A 145 ? 0.4379 0.4819 0.3881 -0.0595 0.0483  0.0676  145 VAL A N   
1133 C CA  . VAL A 145 ? 0.3400 0.3558 0.2757 -0.0471 0.0424  0.0648  145 VAL A CA  
1134 C C   . VAL A 145 ? 0.4493 0.4619 0.3949 -0.0433 0.0321  0.0621  145 VAL A C   
1135 O O   . VAL A 145 ? 0.4421 0.4497 0.3880 -0.0534 0.0288  0.0629  145 VAL A O   
1136 C CB  . VAL A 145 ? 0.3619 0.3463 0.2714 -0.0521 0.0438  0.0675  145 VAL A CB  
1137 C CG1 . VAL A 145 ? 0.3603 0.3214 0.2585 -0.0396 0.0355  0.0650  145 VAL A CG1 
1138 C CG2 . VAL A 145 ? 0.3812 0.3679 0.2782 -0.0547 0.0545  0.0707  145 VAL A CG2 
1139 N N   . LEU A 146 ? 0.4359 0.4503 0.3883 -0.0296 0.0277  0.0588  146 LEU A N   
1140 C CA  . LEU A 146 ? 0.4186 0.4317 0.3805 -0.0259 0.0190  0.0570  146 LEU A CA  
1141 C C   . LEU A 146 ? 0.4386 0.4288 0.3897 -0.0175 0.0128  0.0541  146 LEU A C   
1142 O O   . LEU A 146 ? 0.4364 0.4200 0.3801 -0.0093 0.0135  0.0517  146 LEU A O   
1143 C CB  . LEU A 146 ? 0.4033 0.4406 0.3853 -0.0187 0.0186  0.0567  146 LEU A CB  
1144 C CG  . LEU A 146 ? 0.5073 0.5509 0.5010 -0.0203 0.0112  0.0574  146 LEU A CG  
1145 C CD1 . LEU A 146 ? 0.4871 0.5609 0.5003 -0.0174 0.0123  0.0600  146 LEU A CD1 
1146 C CD2 . LEU A 146 ? 0.5298 0.5561 0.5205 -0.0113 0.0048  0.0546  146 LEU A CD2 
1147 N N   . VAL A 147 ? 0.3055 0.2853 0.2555 -0.0203 0.0069  0.0539  147 VAL A N   
1148 C CA  . VAL A 147 ? 0.3433 0.3070 0.2862 -0.0134 0.0008  0.0518  147 VAL A CA  
1149 C C   . VAL A 147 ? 0.3945 0.3639 0.3503 -0.0118 -0.0049 0.0505  147 VAL A C   
1150 O O   . VAL A 147 ? 0.3676 0.3438 0.3300 -0.0181 -0.0055 0.0518  147 VAL A O   
1151 C CB  . VAL A 147 ? 0.4154 0.3592 0.3421 -0.0163 0.0003  0.0537  147 VAL A CB  
1152 C CG1 . VAL A 147 ? 0.3289 0.2631 0.2518 -0.0080 -0.0062 0.0520  147 VAL A CG1 
1153 C CG2 . VAL A 147 ? 0.4358 0.3711 0.3467 -0.0188 0.0065  0.0565  147 VAL A CG2 
1154 N N   . SER A 148 ? 0.3259 0.2925 0.2840 -0.0045 -0.0091 0.0480  148 SER A N   
1155 C CA  . SER A 148 ? 0.3528 0.3217 0.3202 -0.0037 -0.0142 0.0475  148 SER A CA  
1156 C C   . SER A 148 ? 0.3409 0.3003 0.3035 0.0004  -0.0191 0.0452  148 SER A C   
1157 O O   . SER A 148 ? 0.3196 0.2738 0.2748 0.0041  -0.0198 0.0430  148 SER A O   
1158 C CB  . SER A 148 ? 0.3556 0.3351 0.3349 -0.0003 -0.0141 0.0476  148 SER A CB  
1159 O OG  . SER A 148 ? 0.4234 0.3968 0.3991 0.0061  -0.0137 0.0445  148 SER A OG  
1160 N N   . MET A 149 ? 0.2824 0.2418 0.2492 -0.0006 -0.0225 0.0455  149 MET A N   
1161 C CA  . MET A 149 ? 0.2773 0.2334 0.2424 0.0028  -0.0271 0.0439  149 MET A CA  
1162 C C   . MET A 149 ? 0.2835 0.2459 0.2596 0.0017  -0.0302 0.0433  149 MET A C   
1163 O O   . MET A 149 ? 0.3048 0.2715 0.2871 -0.0011 -0.0290 0.0452  149 MET A O   
1164 C CB  . MET A 149 ? 0.3016 0.2513 0.2591 0.0042  -0.0271 0.0455  149 MET A CB  
1165 C CG  . MET A 149 ? 0.3283 0.2801 0.2909 0.0025  -0.0269 0.0461  149 MET A CG  
1166 S SD  . MET A 149 ? 0.4108 0.3640 0.3748 -0.0054 -0.0229 0.0471  149 MET A SD  
1167 C CE  . MET A 149 ? 0.2744 0.2109 0.2218 -0.0080 -0.0185 0.0480  149 MET A CE  
1168 N N   . ASN A 150 ? 0.3088 0.2719 0.2862 0.0028  -0.0342 0.0410  150 ASN A N   
1169 C CA  . ASN A 150 ? 0.3092 0.2783 0.2960 0.0001  -0.0367 0.0410  150 ASN A CA  
1170 C C   . ASN A 150 ? 0.2974 0.2721 0.2858 0.0017  -0.0372 0.0424  150 ASN A C   
1171 O O   . ASN A 150 ? 0.3015 0.2746 0.2834 0.0061  -0.0380 0.0425  150 ASN A O   
1172 C CB  . ASN A 150 ? 0.2511 0.2200 0.2384 -0.0019 -0.0409 0.0375  150 ASN A CB  
1173 C CG  . ASN A 150 ? 0.3688 0.3281 0.3541 -0.0030 -0.0393 0.0355  150 ASN A CG  
1174 O OD1 . ASN A 150 ? 0.3982 0.3546 0.3835 -0.0005 -0.0352 0.0375  150 ASN A OD1 
1175 N ND2 . ASN A 150 ? 0.3800 0.3345 0.3631 -0.0067 -0.0425 0.0315  150 ASN A ND2 
1176 N N   . TYR A 151 ? 0.2938 0.2741 0.2892 -0.0008 -0.0360 0.0440  151 TYR A N   
1177 C CA  . TYR A 151 ? 0.2610 0.2482 0.2587 0.0018  -0.0356 0.0446  151 TYR A CA  
1178 C C   . TYR A 151 ? 0.3155 0.3140 0.3239 -0.0026 -0.0364 0.0451  151 TYR A C   
1179 O O   . TYR A 151 ? 0.3183 0.3145 0.3296 -0.0080 -0.0362 0.0461  151 TYR A O   
1180 C CB  . TYR A 151 ? 0.3411 0.3221 0.3325 0.0028  -0.0311 0.0456  151 TYR A CB  
1181 C CG  . TYR A 151 ? 0.3535 0.3351 0.3468 -0.0031 -0.0292 0.0470  151 TYR A CG  
1182 C CD1 . TYR A 151 ? 0.3360 0.3136 0.3270 -0.0059 -0.0289 0.0478  151 TYR A CD1 
1183 C CD2 . TYR A 151 ? 0.2497 0.2381 0.2470 -0.0053 -0.0278 0.0480  151 TYR A CD2 
1184 C CE1 . TYR A 151 ? 0.3064 0.2882 0.2997 -0.0100 -0.0283 0.0500  151 TYR A CE1 
1185 C CE2 . TYR A 151 ? 0.2312 0.2207 0.2283 -0.0101 -0.0270 0.0501  151 TYR A CE2 
1186 C CZ  . TYR A 151 ? 0.2787 0.2655 0.2742 -0.0121 -0.0278 0.0513  151 TYR A CZ  
1187 O OH  . TYR A 151 ? 0.2462 0.2377 0.2423 -0.0156 -0.0281 0.0543  151 TYR A OH  
1188 N N   . ARG A 152 ? 0.2325 0.2434 0.2465 0.0001  -0.0370 0.0451  152 ARG A N   
1189 C CA  . ARG A 152 ? 0.3003 0.3246 0.3250 -0.0055 -0.0368 0.0459  152 ARG A CA  
1190 C C   . ARG A 152 ? 0.3359 0.3580 0.3602 -0.0091 -0.0320 0.0484  152 ARG A C   
1191 O O   . ARG A 152 ? 0.3087 0.3261 0.3264 -0.0053 -0.0283 0.0486  152 ARG A O   
1192 C CB  . ARG A 152 ? 0.2837 0.3273 0.3166 -0.0008 -0.0376 0.0458  152 ARG A CB  
1193 C CG  . ARG A 152 ? 0.2460 0.2990 0.2826 -0.0011 -0.0444 0.0439  152 ARG A CG  
1194 C CD  . ARG A 152 ? 0.2762 0.3522 0.3217 0.0067  -0.0456 0.0449  152 ARG A CD  
1195 N NE  . ARG A 152 ? 0.2639 0.3304 0.2995 0.0203  -0.0434 0.0462  152 ARG A NE  
1196 C CZ  . ARG A 152 ? 0.3236 0.4041 0.3631 0.0321  -0.0428 0.0479  152 ARG A CZ  
1197 N NH1 . ARG A 152 ? 0.2429 0.3534 0.2991 0.0319  -0.0445 0.0487  152 ARG A NH1 
1198 N NH2 . ARG A 152 ? 0.2967 0.3609 0.3233 0.0443  -0.0400 0.0493  152 ARG A NH2 
1199 N N   . VAL A 153 ? 0.2285 0.2517 0.2575 -0.0171 -0.0321 0.0503  153 VAL A N   
1200 C CA  . VAL A 153 ? 0.3103 0.3327 0.3376 -0.0205 -0.0281 0.0539  153 VAL A CA  
1201 C C   . VAL A 153 ? 0.3545 0.3914 0.3902 -0.0263 -0.0255 0.0559  153 VAL A C   
1202 O O   . VAL A 153 ? 0.3090 0.3584 0.3539 -0.0288 -0.0275 0.0544  153 VAL A O   
1203 C CB  . VAL A 153 ? 0.2881 0.2969 0.3108 -0.0235 -0.0291 0.0566  153 VAL A CB  
1204 C CG1 . VAL A 153 ? 0.2443 0.2443 0.2604 -0.0182 -0.0302 0.0550  153 VAL A CG1 
1205 C CG2 . VAL A 153 ? 0.2938 0.2966 0.3196 -0.0290 -0.0317 0.0564  153 VAL A CG2 
1206 N N   . GLY A 154 ? 0.3625 0.3999 0.3949 -0.0291 -0.0212 0.0596  154 GLY A N   
1207 C CA  . GLY A 154 ? 0.2387 0.2892 0.2775 -0.0359 -0.0173 0.0626  154 GLY A CA  
1208 C C   . GLY A 154 ? 0.3613 0.4332 0.4089 -0.0315 -0.0143 0.0601  154 GLY A C   
1209 O O   . GLY A 154 ? 0.3359 0.4078 0.3795 -0.0214 -0.0131 0.0570  154 GLY A O   
1210 N N   . THR A 155 ? 0.2384 0.3284 0.2977 -0.0389 -0.0127 0.0617  155 THR A N   
1211 C CA  . THR A 155 ? 0.3446 0.4612 0.4159 -0.0339 -0.0098 0.0600  155 THR A CA  
1212 C C   . THR A 155 ? 0.3846 0.5048 0.4593 -0.0238 -0.0154 0.0559  155 THR A C   
1213 O O   . THR A 155 ? 0.3852 0.5149 0.4609 -0.0114 -0.0126 0.0544  155 THR A O   
1214 C CB  . THR A 155 ? 0.3087 0.4487 0.3952 -0.0463 -0.0083 0.0625  155 THR A CB  
1215 O OG1 . THR A 155 ? 0.2719 0.4057 0.3617 -0.0563 -0.0158 0.0613  155 THR A OG1 
1216 C CG2 . THR A 155 ? 0.3298 0.4675 0.4115 -0.0556 -0.0011 0.0678  155 THR A CG2 
1217 N N   . PHE A 156 ? 0.2813 0.3917 0.3554 -0.0283 -0.0229 0.0543  156 PHE A N   
1218 C CA  . PHE A 156 ? 0.3129 0.4281 0.3891 -0.0204 -0.0291 0.0512  156 PHE A CA  
1219 C C   . PHE A 156 ? 0.2784 0.3786 0.3425 -0.0063 -0.0274 0.0501  156 PHE A C   
1220 O O   . PHE A 156 ? 0.3079 0.4152 0.3730 0.0046  -0.0293 0.0491  156 PHE A O   
1221 C CB  . PHE A 156 ? 0.2305 0.3329 0.3034 -0.0285 -0.0365 0.0490  156 PHE A CB  
1222 C CG  . PHE A 156 ? 0.2842 0.3911 0.3637 -0.0448 -0.0374 0.0496  156 PHE A CG  
1223 C CD1 . PHE A 156 ? 0.2392 0.3729 0.3328 -0.0524 -0.0409 0.0485  156 PHE A CD1 
1224 C CD2 . PHE A 156 ? 0.2423 0.3270 0.3135 -0.0527 -0.0347 0.0519  156 PHE A CD2 
1225 C CE1 . PHE A 156 ? 0.2488 0.3844 0.3471 -0.0703 -0.0412 0.0488  156 PHE A CE1 
1226 C CE2 . PHE A 156 ? 0.2841 0.3672 0.3583 -0.0682 -0.0347 0.0530  156 PHE A CE2 
1227 C CZ  . PHE A 156 ? 0.3422 0.4498 0.4296 -0.0782 -0.0377 0.0511  156 PHE A CZ  
1228 N N   . GLY A 157 ? 0.3072 0.3867 0.3593 -0.0071 -0.0240 0.0506  157 GLY A N   
1229 C CA  . GLY A 157 ? 0.3454 0.4082 0.3844 0.0025  -0.0222 0.0491  157 GLY A CA  
1230 C C   . GLY A 157 ? 0.3149 0.3780 0.3483 0.0084  -0.0145 0.0488  157 GLY A C   
1231 O O   . GLY A 157 ? 0.3611 0.4115 0.3837 0.0174  -0.0123 0.0468  157 GLY A O   
1232 N N   . PHE A 158 ? 0.2384 0.3132 0.2766 0.0029  -0.0099 0.0505  158 PHE A N   
1233 C CA  . PHE A 158 ? 0.2473 0.3177 0.2752 0.0067  -0.0022 0.0494  158 PHE A CA  
1234 C C   . PHE A 158 ? 0.2956 0.3883 0.3319 0.0080  0.0051  0.0504  158 PHE A C   
1235 O O   . PHE A 158 ? 0.3208 0.4095 0.3466 0.0126  0.0124  0.0486  158 PHE A O   
1236 C CB  . PHE A 158 ? 0.2488 0.3016 0.2638 -0.0014 -0.0025 0.0502  158 PHE A CB  
1237 C CG  . PHE A 158 ? 0.2532 0.2866 0.2594 -0.0008 -0.0074 0.0486  158 PHE A CG  
1238 C CD1 . PHE A 158 ? 0.2577 0.2759 0.2505 0.0056  -0.0051 0.0449  158 PHE A CD1 
1239 C CD2 . PHE A 158 ? 0.3736 0.4030 0.3841 -0.0065 -0.0135 0.0507  158 PHE A CD2 
1240 C CE1 . PHE A 158 ? 0.3401 0.3423 0.3254 0.0044  -0.0088 0.0439  158 PHE A CE1 
1241 C CE2 . PHE A 158 ? 0.3786 0.3936 0.3821 -0.0057 -0.0169 0.0494  158 PHE A CE2 
1242 C CZ  . PHE A 158 ? 0.2690 0.2719 0.2607 -0.0011 -0.0146 0.0463  158 PHE A CZ  
1243 N N   . LEU A 159 ? 0.3234 0.4401 0.3776 0.0032  0.0035  0.0530  159 LEU A N   
1244 C CA  . LEU A 159 ? 0.3006 0.4442 0.3656 0.0048  0.0112  0.0542  159 LEU A CA  
1245 C C   . LEU A 159 ? 0.2916 0.4415 0.3560 0.0230  0.0158  0.0512  159 LEU A C   
1246 O O   . LEU A 159 ? 0.3466 0.4958 0.4140 0.0320  0.0104  0.0502  159 LEU A O   
1247 C CB  . LEU A 159 ? 0.2508 0.4216 0.3365 -0.0055 0.0080  0.0572  159 LEU A CB  
1248 C CG  . LEU A 159 ? 0.3149 0.5191 0.4148 -0.0064 0.0166  0.0593  159 LEU A CG  
1249 C CD1 . LEU A 159 ? 0.3064 0.5243 0.4177 -0.0260 0.0155  0.0635  159 LEU A CD1 
1250 C CD2 . LEU A 159 ? 0.2455 0.4782 0.3609 0.0081  0.0168  0.0579  159 LEU A CD2 
1251 N N   . ALA A 160 ? 0.3290 0.4837 0.3877 0.0292  0.0262  0.0499  160 ALA A N   
1252 C CA  . ALA A 160 ? 0.3068 0.4603 0.3601 0.0487  0.0325  0.0465  160 ALA A CA  
1253 C C   . ALA A 160 ? 0.3523 0.5347 0.4150 0.0556  0.0439  0.0468  160 ALA A C   
1254 O O   . ALA A 160 ? 0.3748 0.5628 0.4344 0.0462  0.0505  0.0477  160 ALA A O   
1255 C CB  . ALA A 160 ? 0.3165 0.4314 0.3425 0.0525  0.0351  0.0418  160 ALA A CB  
1256 N N   . LEU A 161 ? 0.3708 0.5735 0.4453 0.0729  0.0465  0.0468  161 LEU A N   
1257 C CA  . LEU A 161 ? 0.3678 0.5920 0.4463 0.0858  0.0597  0.0457  161 LEU A CA  
1258 C C   . LEU A 161 ? 0.3461 0.5416 0.4048 0.1076  0.0644  0.0410  161 LEU A C   
1259 O O   . LEU A 161 ? 0.3670 0.5718 0.4343 0.1248  0.0624  0.0424  161 LEU A O   
1260 C CB  . LEU A 161 ? 0.2993 0.5751 0.4100 0.0891  0.0593  0.0503  161 LEU A CB  
1261 C CG  . LEU A 161 ? 0.4792 0.7779 0.6054 0.0644  0.0564  0.0544  161 LEU A CG  
1262 C CD1 . LEU A 161 ? 0.5258 0.8719 0.6834 0.0625  0.0516  0.0584  161 LEU A CD1 
1263 C CD2 . LEU A 161 ? 0.2930 0.5988 0.4135 0.0582  0.0697  0.0546  161 LEU A CD2 
1264 N N   . PRO A 162 ? 0.3832 0.5412 0.4133 0.1059  0.0701  0.0356  162 PRO A N   
1265 C CA  . PRO A 162 ? 0.4654 0.5840 0.4702 0.1215  0.0736  0.0302  162 PRO A CA  
1266 C C   . PRO A 162 ? 0.5169 0.6492 0.5271 0.1482  0.0828  0.0298  162 PRO A C   
1267 O O   . PRO A 162 ? 0.4244 0.5877 0.4462 0.1544  0.0930  0.0300  162 PRO A O   
1268 C CB  . PRO A 162 ? 0.3894 0.4801 0.3667 0.1128  0.0810  0.0240  162 PRO A CB  
1269 C CG  . PRO A 162 ? 0.3964 0.5011 0.3825 0.0893  0.0748  0.0279  162 PRO A CG  
1270 C CD  . PRO A 162 ? 0.3464 0.4973 0.3650 0.0882  0.0735  0.0345  162 PRO A CD  
1271 N N   . GLY A 163 ? 0.5174 0.6287 0.5201 0.1641  0.0794  0.0302  163 GLY A N   
1272 C CA  . GLY A 163 ? 0.4625 0.5839 0.4694 0.1929  0.0871  0.0312  163 GLY A CA  
1273 C C   . GLY A 163 ? 0.4917 0.6591 0.5313 0.2019  0.0789  0.0393  163 GLY A C   
1274 O O   . GLY A 163 ? 0.6071 0.7798 0.6497 0.2272  0.0812  0.0420  163 GLY A O   
1275 N N   . SER A 164 ? 0.4506 0.6510 0.5138 0.1813  0.0691  0.0432  164 SER A N   
1276 C CA  . SER A 164 ? 0.3854 0.6321 0.4797 0.1849  0.0597  0.0501  164 SER A CA  
1277 C C   . SER A 164 ? 0.4313 0.6574 0.5188 0.1893  0.0469  0.0531  164 SER A C   
1278 O O   . SER A 164 ? 0.4581 0.6362 0.5196 0.1841  0.0445  0.0503  164 SER A O   
1279 C CB  . SER A 164 ? 0.3679 0.6492 0.4850 0.1582  0.0534  0.0523  164 SER A CB  
1280 O OG  . SER A 164 ? 0.3969 0.6482 0.5021 0.1372  0.0429  0.0514  164 SER A OG  
1281 N N   . ARG A 165 ? 0.4781 0.7435 0.5893 0.1972  0.0383  0.0591  165 ARG A N   
1282 C CA  . ARG A 165 ? 0.5116 0.7630 0.6169 0.2018  0.0257  0.0628  165 ARG A CA  
1283 C C   . ARG A 165 ? 0.5054 0.7661 0.6203 0.1743  0.0125  0.0631  165 ARG A C   
1284 O O   . ARG A 165 ? 0.5550 0.7850 0.6543 0.1678  0.0042  0.0632  165 ARG A O   
1285 C CB  . ARG A 165 ? 0.5621 0.8526 0.6862 0.2268  0.0225  0.0695  165 ARG A CB  
1286 C CG  . ARG A 165 ? 0.7543 1.0160 0.8606 0.2443  0.0155  0.0740  165 ARG A CG  
1287 C CD  . ARG A 165 ? 0.8863 1.1985 1.0175 0.2553  0.0036  0.0817  165 ARG A CD  
1288 N NE  . ARG A 165 ? 0.9664 1.2975 1.1097 0.2285  -0.0108 0.0815  165 ARG A NE  
1289 C CZ  . ARG A 165 ? 0.9339 1.3204 1.1053 0.2244  -0.0218 0.0853  165 ARG A CZ  
1290 N NH1 . ARG A 165 ? 0.9379 1.3688 1.1298 0.2438  -0.0203 0.0899  165 ARG A NH1 
1291 N NH2 . ARG A 165 ? 0.8168 1.2107 0.9932 0.1985  -0.0340 0.0834  165 ARG A NH2 
1292 N N   . GLU A 166 ? 0.3819 0.6832 0.5210 0.1579  0.0118  0.0632  166 GLU A N   
1293 C CA  . GLU A 166 ? 0.3457 0.6594 0.4955 0.1332  -0.0004 0.0634  166 GLU A CA  
1294 C C   . GLU A 166 ? 0.3594 0.6381 0.4938 0.1097  0.0000  0.0594  166 GLU A C   
1295 O O   . GLU A 166 ? 0.3798 0.6577 0.5173 0.0912  -0.0096 0.0591  166 GLU A O   
1296 C CB  . GLU A 166 ? 0.3576 0.7315 0.5406 0.1249  -0.0028 0.0660  166 GLU A CB  
1297 C CG  . GLU A 166 ? 0.4003 0.8184 0.6030 0.1490  -0.0034 0.0708  166 GLU A CG  
1298 C CD  . GLU A 166 ? 0.5314 0.9642 0.7393 0.1679  0.0128  0.0710  166 GLU A CD  
1299 O OE1 . GLU A 166 ? 0.6176 1.0103 0.8029 0.1709  0.0241  0.0669  166 GLU A OE1 
1300 O OE2 . GLU A 166 ? 0.5547 1.0409 0.7891 0.1798  0.0144  0.0748  166 GLU A OE2 
1301 N N   . ALA A 167 ? 0.3016 0.5516 0.4186 0.1113  0.0109  0.0562  167 ALA A N   
1302 C CA  . ALA A 167 ? 0.3003 0.5206 0.4030 0.0913  0.0113  0.0533  167 ALA A CA  
1303 C C   . ALA A 167 ? 0.3085 0.4892 0.3849 0.0985  0.0205  0.0495  167 ALA A C   
1304 O O   . ALA A 167 ? 0.3098 0.4892 0.3814 0.0936  0.0296  0.0474  167 ALA A O   
1305 C CB  . ALA A 167 ? 0.3036 0.5509 0.4220 0.0737  0.0147  0.0542  167 ALA A CB  
1306 N N   . PRO A 168 ? 0.3041 0.4521 0.3619 0.1091  0.0184  0.0485  168 PRO A N   
1307 C CA  . PRO A 168 ? 0.3266 0.4374 0.3585 0.1177  0.0277  0.0442  168 PRO A CA  
1308 C C   . PRO A 168 ? 0.4782 0.5601 0.4931 0.0992  0.0276  0.0407  168 PRO A C   
1309 O O   . PRO A 168 ? 0.4719 0.5244 0.4646 0.1019  0.0348  0.0361  168 PRO A O   
1310 C CB  . PRO A 168 ? 0.3632 0.4494 0.3818 0.1329  0.0243  0.0456  168 PRO A CB  
1311 C CG  . PRO A 168 ? 0.3521 0.4493 0.3819 0.1226  0.0111  0.0493  168 PRO A CG  
1312 C CD  . PRO A 168 ? 0.3023 0.4456 0.3602 0.1133  0.0078  0.0513  168 PRO A CD  
1313 N N   . GLY A 169 ? 0.3697 0.4597 0.3941 0.0811  0.0194  0.0426  169 GLY A N   
1314 C CA  . GLY A 169 ? 0.3640 0.4317 0.3753 0.0649  0.0181  0.0407  169 GLY A CA  
1315 C C   . GLY A 169 ? 0.3911 0.4275 0.3868 0.0625  0.0126  0.0397  169 GLY A C   
1316 O O   . GLY A 169 ? 0.3839 0.4088 0.3736 0.0743  0.0114  0.0401  169 GLY A O   
1317 N N   . ASN A 170 ? 0.3713 0.3954 0.3606 0.0476  0.0093  0.0391  170 ASN A N   
1318 C CA  . ASN A 170 ? 0.3720 0.3698 0.3475 0.0433  0.0052  0.0382  170 ASN A CA  
1319 C C   . ASN A 170 ? 0.4089 0.4078 0.3907 0.0456  -0.0024 0.0410  170 ASN A C   
1320 O O   . ASN A 170 ? 0.4348 0.4119 0.4041 0.0442  -0.0042 0.0406  170 ASN A O   
1321 C CB  . ASN A 170 ? 0.3709 0.3396 0.3236 0.0503  0.0117  0.0340  170 ASN A CB  
1322 C CG  . ASN A 170 ? 0.5224 0.4850 0.4633 0.0453  0.0184  0.0297  170 ASN A CG  
1323 O OD1 . ASN A 170 ? 0.4789 0.4499 0.4228 0.0325  0.0161  0.0304  170 ASN A OD1 
1324 N ND2 . ASN A 170 ? 0.3587 0.3050 0.2839 0.0561  0.0269  0.0253  170 ASN A ND2 
1325 N N   . VAL A 171 ? 0.3271 0.3514 0.3271 0.0477  -0.0067 0.0437  171 VAL A N   
1326 C CA  . VAL A 171 ? 0.3249 0.3506 0.3281 0.0504  -0.0140 0.0458  171 VAL A CA  
1327 C C   . VAL A 171 ? 0.3466 0.3604 0.3460 0.0382  -0.0190 0.0456  171 VAL A C   
1328 O O   . VAL A 171 ? 0.3415 0.3447 0.3342 0.0401  -0.0228 0.0464  171 VAL A O   
1329 C CB  . VAL A 171 ? 0.3538 0.4114 0.3764 0.0540  -0.0187 0.0480  171 VAL A CB  
1330 C CG1 . VAL A 171 ? 0.4101 0.4835 0.4384 0.0683  -0.0129 0.0487  171 VAL A CG1 
1331 C CG2 . VAL A 171 ? 0.4001 0.4756 0.4371 0.0389  -0.0216 0.0480  171 VAL A CG2 
1332 N N   . GLY A 172 ? 0.3097 0.3246 0.3117 0.0267  -0.0182 0.0451  172 GLY A N   
1333 C CA  . GLY A 172 ? 0.2573 0.2610 0.2554 0.0175  -0.0215 0.0452  172 GLY A CA  
1334 C C   . GLY A 172 ? 0.2703 0.2515 0.2522 0.0182  -0.0195 0.0441  172 GLY A C   
1335 O O   . GLY A 172 ? 0.2859 0.2592 0.2641 0.0158  -0.0223 0.0445  172 GLY A O   
1336 N N   . LEU A 173 ? 0.2871 0.2573 0.2582 0.0205  -0.0140 0.0422  173 LEU A N   
1337 C CA  . LEU A 173 ? 0.3019 0.2483 0.2556 0.0194  -0.0114 0.0406  173 LEU A CA  
1338 C C   . LEU A 173 ? 0.3871 0.3221 0.3337 0.0289  -0.0120 0.0421  173 LEU A C   
1339 O O   . LEU A 173 ? 0.4715 0.3902 0.4073 0.0255  -0.0120 0.0427  173 LEU A O   
1340 C CB  . LEU A 173 ? 0.3370 0.2714 0.2778 0.0195  -0.0051 0.0371  173 LEU A CB  
1341 C CG  . LEU A 173 ? 0.3703 0.3127 0.3126 0.0088  -0.0049 0.0359  173 LEU A CG  
1342 C CD1 . LEU A 173 ? 0.3557 0.2881 0.2840 0.0102  0.0017  0.0315  173 LEU A CD1 
1343 C CD2 . LEU A 173 ? 0.4280 0.3652 0.3665 -0.0027 -0.0082 0.0362  173 LEU A CD2 
1344 N N   . LEU A 174 ? 0.3963 0.3416 0.3490 0.0409  -0.0124 0.0435  174 LEU A N   
1345 C CA  . LEU A 174 ? 0.4126 0.3495 0.3584 0.0519  -0.0139 0.0464  174 LEU A CA  
1346 C C   . LEU A 174 ? 0.3782 0.3217 0.3286 0.0474  -0.0207 0.0485  174 LEU A C   
1347 O O   . LEU A 174 ? 0.3633 0.2923 0.3016 0.0515  -0.0215 0.0509  174 LEU A O   
1348 C CB  . LEU A 174 ? 0.3197 0.2716 0.2730 0.0674  -0.0133 0.0480  174 LEU A CB  
1349 C CG  . LEU A 174 ? 0.4518 0.3897 0.3944 0.0764  -0.0046 0.0457  174 LEU A CG  
1350 C CD1 . LEU A 174 ? 0.3440 0.3028 0.2976 0.0933  -0.0034 0.0478  174 LEU A CD1 
1351 C CD2 . LEU A 174 ? 0.4111 0.3099 0.3279 0.0795  0.0001  0.0454  174 LEU A CD2 
1352 N N   . ASP A 175 ? 0.3953 0.3579 0.3605 0.0390  -0.0248 0.0476  175 ASP A N   
1353 C CA  . ASP A 175 ? 0.4087 0.3743 0.3757 0.0340  -0.0301 0.0481  175 ASP A CA  
1354 C C   . ASP A 175 ? 0.3928 0.3389 0.3471 0.0275  -0.0271 0.0480  175 ASP A C   
1355 O O   . ASP A 175 ? 0.4059 0.3436 0.3514 0.0285  -0.0283 0.0495  175 ASP A O   
1356 C CB  . ASP A 175 ? 0.2600 0.2432 0.2422 0.0255  -0.0336 0.0465  175 ASP A CB  
1357 C CG  . ASP A 175 ? 0.3547 0.3605 0.3510 0.0285  -0.0365 0.0466  175 ASP A CG  
1358 O OD1 . ASP A 175 ? 0.3137 0.3270 0.3103 0.0388  -0.0379 0.0482  175 ASP A OD1 
1359 O OD2 . ASP A 175 ? 0.3351 0.3524 0.3424 0.0204  -0.0375 0.0457  175 ASP A OD2 
1360 N N   . GLN A 176 ? 0.3777 0.3184 0.3307 0.0204  -0.0232 0.0465  176 GLN A N   
1361 C CA  . GLN A 176 ? 0.4213 0.3492 0.3652 0.0123  -0.0205 0.0464  176 GLN A CA  
1362 C C   . GLN A 176 ? 0.4734 0.3786 0.3989 0.0157  -0.0169 0.0478  176 GLN A C   
1363 O O   . GLN A 176 ? 0.5141 0.4105 0.4316 0.0115  -0.0158 0.0493  176 GLN A O   
1364 C CB  . GLN A 176 ? 0.3771 0.3073 0.3232 0.0036  -0.0183 0.0446  176 GLN A CB  
1365 C CG  . GLN A 176 ? 0.3401 0.2893 0.3017 0.0008  -0.0214 0.0447  176 GLN A CG  
1366 C CD  . GLN A 176 ? 0.4012 0.3532 0.3627 -0.0063 -0.0198 0.0439  176 GLN A CD  
1367 O OE1 . GLN A 176 ? 0.3858 0.3264 0.3357 -0.0106 -0.0168 0.0421  176 GLN A OE1 
1368 N NE2 . GLN A 176 ? 0.3769 0.3425 0.3492 -0.0083 -0.0219 0.0453  176 GLN A NE2 
1369 N N   . ARG A 177 ? 0.4286 0.3232 0.3466 0.0237  -0.0141 0.0475  177 ARG A N   
1370 C CA  . ARG A 177 ? 0.4770 0.3443 0.3746 0.0283  -0.0099 0.0494  177 ARG A CA  
1371 C C   . ARG A 177 ? 0.4708 0.3363 0.3637 0.0359  -0.0131 0.0541  177 ARG A C   
1372 O O   . ARG A 177 ? 0.4554 0.3008 0.3322 0.0330  -0.0102 0.0567  177 ARG A O   
1373 C CB  . ARG A 177 ? 0.5053 0.3609 0.3954 0.0388  -0.0058 0.0481  177 ARG A CB  
1374 C CG  . ARG A 177 ? 0.5581 0.3803 0.4245 0.0465  -0.0009 0.0506  177 ARG A CG  
1375 C CD  . ARG A 177 ? 0.5561 0.3657 0.4147 0.0590  0.0043  0.0487  177 ARG A CD  
1376 N NE  . ARG A 177 ? 0.6150 0.4111 0.4649 0.0478  0.0096  0.0423  177 ARG A NE  
1377 C CZ  . ARG A 177 ? 0.6092 0.3977 0.4533 0.0551  0.0150  0.0382  177 ARG A CZ  
1378 N NH1 . ARG A 177 ? 0.5494 0.3454 0.3984 0.0749  0.0163  0.0403  177 ARG A NH1 
1379 N NH2 . ARG A 177 ? 0.5216 0.2971 0.3549 0.0428  0.0192  0.0317  177 ARG A NH2 
1380 N N   . LEU A 178 ? 0.4446 0.3319 0.3506 0.0441  -0.0190 0.0551  178 LEU A N   
1381 C CA  . LEU A 178 ? 0.4153 0.3048 0.3166 0.0514  -0.0236 0.0592  178 LEU A CA  
1382 C C   . LEU A 178 ? 0.4774 0.3653 0.3749 0.0413  -0.0240 0.0592  178 LEU A C   
1383 O O   . LEU A 178 ? 0.5090 0.3838 0.3913 0.0439  -0.0234 0.0631  178 LEU A O   
1384 C CB  . LEU A 178 ? 0.3572 0.2751 0.2753 0.0583  -0.0309 0.0589  178 LEU A CB  
1385 C CG  . LEU A 178 ? 0.3754 0.3009 0.2892 0.0659  -0.0377 0.0625  178 LEU A CG  
1386 C CD1 . LEU A 178 ? 0.3703 0.2766 0.2658 0.0797  -0.0360 0.0687  178 LEU A CD1 
1387 C CD2 . LEU A 178 ? 0.4030 0.3603 0.3360 0.0689  -0.0452 0.0609  178 LEU A CD2 
1388 N N   . ALA A 179 ? 0.4183 0.3192 0.3287 0.0308  -0.0243 0.0553  179 ALA A N   
1389 C CA  . ALA A 179 ? 0.3993 0.3000 0.3075 0.0221  -0.0228 0.0550  179 ALA A CA  
1390 C C   . ALA A 179 ? 0.4304 0.3106 0.3234 0.0154  -0.0159 0.0571  179 ALA A C   
1391 O O   . ALA A 179 ? 0.5374 0.4119 0.4210 0.0123  -0.0136 0.0593  179 ALA A O   
1392 C CB  . ALA A 179 ? 0.3001 0.2181 0.2254 0.0146  -0.0239 0.0512  179 ALA A CB  
1393 N N   . LEU A 180 ? 0.4112 0.2795 0.3002 0.0123  -0.0122 0.0561  180 LEU A N   
1394 C CA  . LEU A 180 ? 0.4532 0.2998 0.3260 0.0033  -0.0057 0.0575  180 LEU A CA  
1395 C C   . LEU A 180 ? 0.5309 0.3534 0.3825 0.0107  -0.0035 0.0629  180 LEU A C   
1396 O O   . LEU A 180 ? 0.4921 0.3012 0.3304 0.0031  0.0011  0.0658  180 LEU A O   
1397 C CB  . LEU A 180 ? 0.4185 0.2542 0.2877 -0.0032 -0.0024 0.0541  180 LEU A CB  
1398 C CG  . LEU A 180 ? 0.4779 0.3348 0.3643 -0.0103 -0.0045 0.0497  180 LEU A CG  
1399 C CD1 . LEU A 180 ? 0.4563 0.2991 0.3327 -0.0211 -0.0006 0.0463  180 LEU A CD1 
1400 C CD2 . LEU A 180 ? 0.4633 0.3445 0.3656 -0.0167 -0.0069 0.0499  180 LEU A CD2 
1401 N N   . GLN A 181 ? 0.5268 0.3454 0.3754 0.0259  -0.0066 0.0648  181 GLN A N   
1402 C CA  . GLN A 181 ? 0.5355 0.3324 0.3635 0.0363  -0.0057 0.0714  181 GLN A CA  
1403 C C   . GLN A 181 ? 0.6171 0.4230 0.4421 0.0360  -0.0085 0.0748  181 GLN A C   
1404 O O   . GLN A 181 ? 0.6438 0.4291 0.4486 0.0345  -0.0044 0.0802  181 GLN A O   
1405 C CB  . GLN A 181 ? 0.5139 0.3125 0.3432 0.0548  -0.0094 0.0733  181 GLN A CB  
1406 C CG  . GLN A 181 ? 0.6977 0.4742 0.5185 0.0586  -0.0036 0.0715  181 GLN A CG  
1407 C CD  . GLN A 181 ? 0.7305 0.5223 0.5630 0.0753  -0.0068 0.0709  181 GLN A CD  
1408 O OE1 . GLN A 181 ? 0.8044 0.6278 0.6553 0.0806  -0.0141 0.0710  181 GLN A OE1 
1409 N NE2 . GLN A 181 ? 0.6726 0.4423 0.4940 0.0829  -0.0007 0.0698  181 GLN A NE2 
1410 N N   . TRP A 182 ? 0.5904 0.4253 0.4337 0.0366  -0.0148 0.0713  182 TRP A N   
1411 C CA  . TRP A 182 ? 0.5328 0.3774 0.3733 0.0354  -0.0172 0.0723  182 TRP A CA  
1412 C C   . TRP A 182 ? 0.5091 0.3454 0.3417 0.0224  -0.0096 0.0730  182 TRP A C   
1413 O O   . TRP A 182 ? 0.5049 0.3350 0.3229 0.0223  -0.0077 0.0768  182 TRP A O   
1414 C CB  . TRP A 182 ? 0.4180 0.2907 0.2791 0.0345  -0.0236 0.0665  182 TRP A CB  
1415 C CG  . TRP A 182 ? 0.4264 0.3070 0.2820 0.0344  -0.0263 0.0660  182 TRP A CG  
1416 C CD1 . TRP A 182 ? 0.4007 0.2894 0.2516 0.0426  -0.0340 0.0668  182 TRP A CD1 
1417 C CD2 . TRP A 182 ? 0.4381 0.3205 0.2917 0.0258  -0.0213 0.0639  182 TRP A CD2 
1418 N NE1 . TRP A 182 ? 0.4462 0.3385 0.2897 0.0389  -0.0340 0.0646  182 TRP A NE1 
1419 C CE2 . TRP A 182 ? 0.5118 0.4002 0.3571 0.0296  -0.0256 0.0629  182 TRP A CE2 
1420 C CE3 . TRP A 182 ? 0.4183 0.3004 0.2767 0.0155  -0.0137 0.0628  182 TRP A CE3 
1421 C CZ2 . TRP A 182 ? 0.5813 0.4723 0.4215 0.0246  -0.0211 0.0603  182 TRP A CZ2 
1422 C CZ3 . TRP A 182 ? 0.4475 0.3362 0.3039 0.0113  -0.0096 0.0611  182 TRP A CZ3 
1423 C CH2 . TRP A 182 ? 0.5707 0.4622 0.4173 0.0164  -0.0126 0.0598  182 TRP A CH2 
1424 N N   . VAL A 183 ? 0.4178 0.2567 0.2602 0.0111  -0.0053 0.0695  183 VAL A N   
1425 C CA  . VAL A 183 ? 0.4448 0.2820 0.2832 -0.0020 0.0019  0.0703  183 VAL A CA  
1426 C C   . VAL A 183 ? 0.5213 0.3282 0.3345 -0.0055 0.0084  0.0765  183 VAL A C   
1427 O O   . VAL A 183 ? 0.4865 0.2892 0.2880 -0.0106 0.0133  0.0803  183 VAL A O   
1428 C CB  . VAL A 183 ? 0.4443 0.2956 0.3000 -0.0134 0.0037  0.0657  183 VAL A CB  
1429 C CG1 . VAL A 183 ? 0.4249 0.2750 0.2758 -0.0281 0.0115  0.0674  183 VAL A CG1 
1430 C CG2 . VAL A 183 ? 0.3798 0.2585 0.2571 -0.0102 -0.0013 0.0611  183 VAL A CG2 
1431 N N   . GLN A 184 ? 0.5358 0.3198 0.3388 -0.0022 0.0091  0.0777  184 GLN A N   
1432 C CA  . GLN A 184 ? 0.6814 0.4296 0.4569 -0.0042 0.0156  0.0841  184 GLN A CA  
1433 C C   . GLN A 184 ? 0.6404 0.3795 0.3981 0.0059  0.0148  0.0917  184 GLN A C   
1434 O O   . GLN A 184 ? 0.6562 0.3769 0.3944 -0.0018 0.0216  0.0974  184 GLN A O   
1435 C CB  . GLN A 184 ? 0.5120 0.2342 0.2774 0.0030  0.0162  0.0839  184 GLN A CB  
1436 C CG  . GLN A 184 ? 0.5473 0.2690 0.3204 -0.0106 0.0191  0.0771  184 GLN A CG  
1437 C CD  . GLN A 184 ? 0.6117 0.3189 0.3729 -0.0316 0.0270  0.0779  184 GLN A CD  
1438 O OE1 . GLN A 184 ? 0.6510 0.3225 0.3861 -0.0347 0.0332  0.0830  184 GLN A OE1 
1439 N NE2 . GLN A 184 ? 0.5278 0.2633 0.3082 -0.0464 0.0268  0.0733  184 GLN A NE2 
1440 N N   . GLU A 185 ? 0.5266 0.2800 0.2903 0.0219  0.0063  0.0921  185 GLU A N   
1441 C CA  . GLU A 185 ? 0.5858 0.3316 0.3308 0.0325  0.0039  0.0995  185 GLU A CA  
1442 C C   . GLU A 185 ? 0.5764 0.3384 0.3209 0.0251  0.0053  0.0991  185 GLU A C   
1443 O O   . GLU A 185 ? 0.6525 0.3990 0.3739 0.0252  0.0091  0.1062  185 GLU A O   
1444 C CB  . GLU A 185 ? 0.5974 0.3565 0.3485 0.0514  -0.0065 0.1002  185 GLU A CB  
1445 C CG  . GLU A 185 ? 0.7562 0.5122 0.4880 0.0618  -0.0107 0.1079  185 GLU A CG  
1446 C CD  . GLU A 185 ? 0.8824 0.6328 0.6068 0.0822  -0.0175 0.1142  185 GLU A CD  
1447 O OE1 . GLU A 185 ? 0.9404 0.7065 0.6845 0.0894  -0.0223 0.1099  185 GLU A OE1 
1448 O OE2 . GLU A 185 ? 0.8650 0.5972 0.5643 0.0916  -0.0179 0.1241  185 GLU A OE2 
1449 N N   . ASN A 186 ? 0.5532 0.3441 0.3211 0.0191  0.0033  0.0910  186 ASN A N   
1450 C CA  . ASN A 186 ? 0.4755 0.2846 0.2443 0.0178  0.0027  0.0888  186 ASN A CA  
1451 C C   . ASN A 186 ? 0.5278 0.3482 0.3043 0.0039  0.0113  0.0858  186 ASN A C   
1452 O O   . ASN A 186 ? 0.5717 0.4011 0.3424 0.0033  0.0138  0.0853  186 ASN A O   
1453 C CB  . ASN A 186 ? 0.4508 0.2840 0.2371 0.0259  -0.0076 0.0822  186 ASN A CB  
1454 C CG  . ASN A 186 ? 0.5734 0.4038 0.3528 0.0402  -0.0168 0.0858  186 ASN A CG  
1455 O OD1 . ASN A 186 ? 0.5528 0.3753 0.3117 0.0470  -0.0189 0.0916  186 ASN A OD1 
1456 N ND2 . ASN A 186 ? 0.5042 0.3430 0.3006 0.0454  -0.0221 0.0830  186 ASN A ND2 
1457 N N   . ILE A 187 ? 0.4569 0.2787 0.2461 -0.0068 0.0158  0.0836  187 ILE A N   
1458 C CA  . ILE A 187 ? 0.4436 0.2853 0.2466 -0.0183 0.0223  0.0803  187 ILE A CA  
1459 C C   . ILE A 187 ? 0.5326 0.3685 0.3186 -0.0268 0.0325  0.0857  187 ILE A C   
1460 O O   . ILE A 187 ? 0.5486 0.4053 0.3433 -0.0310 0.0378  0.0834  187 ILE A O   
1461 C CB  . ILE A 187 ? 0.4430 0.2927 0.2646 -0.0284 0.0233  0.0768  187 ILE A CB  
1462 C CG1 . ILE A 187 ? 0.4165 0.2977 0.2613 -0.0323 0.0248  0.0719  187 ILE A CG1 
1463 C CG2 . ILE A 187 ? 0.4935 0.3222 0.3012 -0.0421 0.0306  0.0812  187 ILE A CG2 
1464 C CD1 . ILE A 187 ? 0.3820 0.2778 0.2391 -0.0201 0.0176  0.0666  187 ILE A CD1 
1465 N N   . ALA A 188 ? 0.4993 0.3064 0.2601 -0.0284 0.0360  0.0934  188 ALA A N   
1466 C CA  . ALA A 188 ? 0.5394 0.3384 0.2815 -0.0378 0.0465  0.0997  188 ALA A CA  
1467 C C   . ALA A 188 ? 0.5865 0.3985 0.3211 -0.0300 0.0471  0.0995  188 ALA A C   
1468 O O   . ALA A 188 ? 0.6253 0.4439 0.3528 -0.0380 0.0570  0.1020  188 ALA A O   
1469 C CB  . ALA A 188 ? 0.5652 0.3250 0.2781 -0.0399 0.0499  0.1090  188 ALA A CB  
1470 N N   . ALA A 189 ? 0.6159 0.4332 0.3523 -0.0153 0.0368  0.0957  189 ALA A N   
1471 C CA  . ALA A 189 ? 0.5207 0.3488 0.2479 -0.0081 0.0360  0.0936  189 ALA A CA  
1472 C C   . ALA A 189 ? 0.5430 0.3985 0.2901 -0.0120 0.0413  0.0857  189 ALA A C   
1473 O O   . ALA A 189 ? 0.6041 0.4675 0.3419 -0.0090 0.0451  0.0834  189 ALA A O   
1474 C CB  . ALA A 189 ? 0.5152 0.3436 0.2405 0.0061  0.0226  0.0907  189 ALA A CB  
1475 N N   . PHE A 190 ? 0.5605 0.4301 0.3337 -0.0176 0.0416  0.0816  190 PHE A N   
1476 C CA  . PHE A 190 ? 0.5009 0.3972 0.2950 -0.0191 0.0464  0.0752  190 PHE A CA  
1477 C C   . PHE A 190 ? 0.5010 0.4091 0.3024 -0.0330 0.0582  0.0789  190 PHE A C   
1478 O O   . PHE A 190 ? 0.5837 0.5173 0.4036 -0.0342 0.0636  0.0753  190 PHE A O   
1479 C CB  . PHE A 190 ? 0.4254 0.3336 0.2448 -0.0146 0.0378  0.0686  190 PHE A CB  
1480 C CG  . PHE A 190 ? 0.4501 0.3509 0.2658 -0.0035 0.0263  0.0646  190 PHE A CG  
1481 C CD1 . PHE A 190 ? 0.4236 0.3090 0.2332 -0.0006 0.0182  0.0677  190 PHE A CD1 
1482 C CD2 . PHE A 190 ? 0.4970 0.4068 0.3154 0.0037  0.0239  0.0574  190 PHE A CD2 
1483 C CE1 . PHE A 190 ? 0.5360 0.4208 0.3452 0.0086  0.0075  0.0642  190 PHE A CE1 
1484 C CE2 . PHE A 190 ? 0.5019 0.4069 0.3173 0.0109  0.0130  0.0532  190 PHE A CE2 
1485 C CZ  . PHE A 190 ? 0.4131 0.3083 0.2254 0.0130  0.0046  0.0569  190 PHE A CZ  
1486 N N   . GLY A 191 ? 0.4804 0.3700 0.2671 -0.0436 0.0624  0.0864  191 GLY A N   
1487 C CA  . GLY A 191 ? 0.4862 0.3870 0.2801 -0.0605 0.0728  0.0898  191 GLY A CA  
1488 C C   . GLY A 191 ? 0.5449 0.4484 0.3566 -0.0700 0.0688  0.0883  191 GLY A C   
1489 O O   . GLY A 191 ? 0.4952 0.4121 0.3162 -0.0859 0.0756  0.0900  191 GLY A O   
1490 N N   . GLY A 192 ? 0.5467 0.4394 0.3629 -0.0613 0.0577  0.0848  192 GLY A N   
1491 C CA  . GLY A 192 ? 0.5418 0.4343 0.3711 -0.0694 0.0537  0.0828  192 GLY A CA  
1492 C C   . GLY A 192 ? 0.5706 0.4296 0.3784 -0.0804 0.0564  0.0878  192 GLY A C   
1493 O O   . GLY A 192 ? 0.5630 0.3929 0.3457 -0.0746 0.0569  0.0929  192 GLY A O   
1494 N N   . ASP A 193 ? 0.5365 0.3985 0.3525 -0.0960 0.0579  0.0865  193 ASP A N   
1495 C CA  . ASP A 193 ? 0.5796 0.4061 0.3743 -0.1082 0.0607  0.0896  193 ASP A CA  
1496 C C   . ASP A 193 ? 0.5789 0.3868 0.3728 -0.0993 0.0520  0.0855  193 ASP A C   
1497 O O   . ASP A 193 ? 0.4925 0.3171 0.3046 -0.1038 0.0476  0.0797  193 ASP A O   
1498 C CB  . ASP A 193 ? 0.5950 0.4354 0.3973 -0.1331 0.0674  0.0893  193 ASP A CB  
1499 C CG  . ASP A 193 ? 0.6467 0.4456 0.4226 -0.1494 0.0722  0.0922  193 ASP A CG  
1500 O OD1 . ASP A 193 ? 0.7600 0.5190 0.5139 -0.1389 0.0696  0.0938  193 ASP A OD1 
1501 O OD2 . ASP A 193 ? 0.5972 0.4031 0.3739 -0.1729 0.0788  0.0929  193 ASP A OD2 
1502 N N   . PRO A 194 ? 0.6352 0.4094 0.4073 -0.0864 0.0498  0.0889  194 PRO A N   
1503 C CA  . PRO A 194 ? 0.5204 0.2775 0.2911 -0.0764 0.0431  0.0854  194 PRO A CA  
1504 C C   . PRO A 194 ? 0.6734 0.4084 0.4351 -0.0925 0.0464  0.0828  194 PRO A C   
1505 O O   . PRO A 194 ? 0.5760 0.3038 0.3408 -0.0868 0.0417  0.0779  194 PRO A O   
1506 C CB  . PRO A 194 ? 0.6623 0.3895 0.4095 -0.0595 0.0418  0.0918  194 PRO A CB  
1507 C CG  . PRO A 194 ? 0.5733 0.2866 0.2998 -0.0678 0.0504  0.0996  194 PRO A CG  
1508 C CD  . PRO A 194 ? 0.5879 0.3393 0.3347 -0.0799 0.0540  0.0970  194 PRO A CD  
1509 N N   . MET A 195 ? 0.5673 0.2920 0.3172 -0.1131 0.0549  0.0857  195 MET A N   
1510 C CA  . MET A 195 ? 0.5932 0.2948 0.3316 -0.1324 0.0584  0.0824  195 MET A CA  
1511 C C   . MET A 195 ? 0.6602 0.4008 0.4244 -0.1494 0.0561  0.0757  195 MET A C   
1512 O O   . MET A 195 ? 0.6868 0.4154 0.4442 -0.1678 0.0576  0.0714  195 MET A O   
1513 C CB  . MET A 195 ? 0.6416 0.3066 0.3503 -0.1487 0.0689  0.0891  195 MET A CB  
1514 C CG  . MET A 195 ? 0.6757 0.2951 0.3547 -0.1316 0.0707  0.0958  195 MET A CG  
1515 S SD  . MET A 195 ? 0.9361 0.5219 0.5910 -0.1453 0.0796  0.0980  195 MET A SD  
1516 C CE  . MET A 195 ? 0.9478 0.5726 0.6169 -0.1645 0.0862  0.1023  195 MET A CE  
1517 N N   . SER A 196 ? 0.5704 0.3568 0.3628 -0.1428 0.0524  0.0749  196 SER A N   
1518 C CA  . SER A 196 ? 0.5673 0.3938 0.3864 -0.1530 0.0482  0.0695  196 SER A CA  
1519 C C   . SER A 196 ? 0.5611 0.4161 0.4039 -0.1330 0.0396  0.0664  196 SER A C   
1520 O O   . SER A 196 ? 0.5616 0.4484 0.4229 -0.1257 0.0392  0.0679  196 SER A O   
1521 C CB  . SER A 196 ? 0.5181 0.3777 0.3503 -0.1698 0.0543  0.0724  196 SER A CB  
1522 O OG  . SER A 196 ? 0.4755 0.3769 0.3344 -0.1775 0.0493  0.0681  196 SER A OG  
1523 N N   . VAL A 197 ? 0.5425 0.3836 0.3829 -0.1246 0.0335  0.0621  197 VAL A N   
1524 C CA  . VAL A 197 ? 0.4935 0.3561 0.3532 -0.1073 0.0257  0.0594  197 VAL A CA  
1525 C C   . VAL A 197 ? 0.5248 0.4049 0.3974 -0.1146 0.0203  0.0541  197 VAL A C   
1526 O O   . VAL A 197 ? 0.5369 0.3945 0.3952 -0.1223 0.0201  0.0503  197 VAL A O   
1527 C CB  . VAL A 197 ? 0.5445 0.3812 0.3924 -0.0878 0.0228  0.0598  197 VAL A CB  
1528 C CG1 . VAL A 197 ? 0.4489 0.3073 0.3164 -0.0743 0.0151  0.0565  197 VAL A CG1 
1529 C CG2 . VAL A 197 ? 0.5162 0.3422 0.3532 -0.0780 0.0259  0.0655  197 VAL A CG2 
1530 N N   . THR A 198 ? 0.5037 0.4223 0.4011 -0.1115 0.0163  0.0540  198 THR A N   
1531 C CA  . THR A 198 ? 0.4589 0.3991 0.3698 -0.1162 0.0102  0.0506  198 THR A CA  
1532 C C   . THR A 198 ? 0.4292 0.3799 0.3531 -0.0975 0.0041  0.0501  198 THR A C   
1533 O O   . THR A 198 ? 0.3962 0.3643 0.3337 -0.0863 0.0036  0.0526  198 THR A O   
1534 C CB  . THR A 198 ? 0.3588 0.3382 0.2885 -0.1284 0.0103  0.0523  198 THR A CB  
1535 O OG1 . THR A 198 ? 0.4787 0.4501 0.3967 -0.1496 0.0158  0.0523  198 THR A OG1 
1536 C CG2 . THR A 198 ? 0.3759 0.3819 0.3206 -0.1305 0.0026  0.0502  198 THR A CG2 
1537 N N   . LEU A 199 ? 0.3429 0.2812 0.2610 -0.0946 0.0003  0.0466  199 LEU A N   
1538 C CA  . LEU A 199 ? 0.3589 0.3090 0.2896 -0.0803 -0.0050 0.0464  199 LEU A CA  
1539 C C   . LEU A 199 ? 0.4432 0.4261 0.3915 -0.0845 -0.0098 0.0472  199 LEU A C   
1540 O O   . LEU A 199 ? 0.4575 0.4497 0.4044 -0.0992 -0.0109 0.0457  199 LEU A O   
1541 C CB  . LEU A 199 ? 0.3284 0.2560 0.2468 -0.0749 -0.0061 0.0430  199 LEU A CB  
1542 C CG  . LEU A 199 ? 0.5327 0.4265 0.4316 -0.0694 -0.0017 0.0425  199 LEU A CG  
1543 C CD1 . LEU A 199 ? 0.4214 0.2994 0.3120 -0.0615 -0.0023 0.0391  199 LEU A CD1 
1544 C CD2 . LEU A 199 ? 0.5367 0.4307 0.4392 -0.0575 -0.0011 0.0465  199 LEU A CD2 
1545 N N   . PHE A 200 ? 0.3734 0.3730 0.3371 -0.0718 -0.0129 0.0498  200 PHE A N   
1546 C CA  . PHE A 200 ? 0.3672 0.3932 0.3452 -0.0717 -0.0181 0.0517  200 PHE A CA  
1547 C C   . PHE A 200 ? 0.3725 0.3986 0.3575 -0.0572 -0.0211 0.0533  200 PHE A C   
1548 O O   . PHE A 200 ? 0.3046 0.3192 0.2891 -0.0472 -0.0193 0.0532  200 PHE A O   
1549 C CB  . PHE A 200 ? 0.3231 0.3809 0.3165 -0.0765 -0.0179 0.0553  200 PHE A CB  
1550 C CG  . PHE A 200 ? 0.3379 0.4055 0.3429 -0.0639 -0.0148 0.0584  200 PHE A CG  
1551 C CD1 . PHE A 200 ? 0.3586 0.4057 0.3549 -0.0580 -0.0100 0.0572  200 PHE A CD1 
1552 C CD2 . PHE A 200 ? 0.2859 0.3836 0.3091 -0.0576 -0.0164 0.0627  200 PHE A CD2 
1553 C CE1 . PHE A 200 ? 0.3085 0.3633 0.3124 -0.0473 -0.0067 0.0589  200 PHE A CE1 
1554 C CE2 . PHE A 200 ? 0.3236 0.4278 0.3550 -0.0452 -0.0122 0.0646  200 PHE A CE2 
1555 C CZ  . PHE A 200 ? 0.3041 0.3858 0.3250 -0.0407 -0.0072 0.0621  200 PHE A CZ  
1556 N N   . GLY A 201 ? 0.3331 0.3716 0.3228 -0.0575 -0.0259 0.0546  201 GLY A N   
1557 C CA  . GLY A 201 ? 0.2884 0.3249 0.2825 -0.0466 -0.0284 0.0566  201 GLY A CA  
1558 C C   . GLY A 201 ? 0.3247 0.3802 0.3242 -0.0485 -0.0336 0.0602  201 GLY A C   
1559 O O   . GLY A 201 ? 0.3209 0.3891 0.3182 -0.0592 -0.0360 0.0596  201 GLY A O   
1560 N N   . GLU A 202 ? 0.2369 0.2941 0.2422 -0.0387 -0.0355 0.0642  202 GLU A N   
1561 C CA  . GLU A 202 ? 0.2513 0.3243 0.2596 -0.0385 -0.0405 0.0692  202 GLU A CA  
1562 C C   . GLU A 202 ? 0.2696 0.3292 0.2704 -0.0359 -0.0409 0.0696  202 GLU A C   
1563 O O   . GLU A 202 ? 0.2662 0.3099 0.2665 -0.0303 -0.0379 0.0681  202 GLU A O   
1564 C CB  . GLU A 202 ? 0.2336 0.3245 0.2564 -0.0285 -0.0420 0.0760  202 GLU A CB  
1565 C CG  . GLU A 202 ? 0.2764 0.3854 0.3025 -0.0259 -0.0479 0.0833  202 GLU A CG  
1566 C CD  . GLU A 202 ? 0.3051 0.3991 0.3279 -0.0170 -0.0480 0.0876  202 GLU A CD  
1567 O OE1 . GLU A 202 ? 0.2785 0.3517 0.2997 -0.0127 -0.0438 0.0848  202 GLU A OE1 
1568 O OE2 . GLU A 202 ? 0.2574 0.3607 0.2783 -0.0152 -0.0524 0.0941  202 GLU A OE2 
1569 N N   . SGB A 203 ? 0.3409 0.4087 0.3353 -0.0411 -0.0445 0.0713  203 SGB A N   
1570 C CA  . SGB A 203 ? 0.3100 0.3693 0.2969 -0.0394 -0.0443 0.0729  203 SGB A CA  
1571 C C   . SGB A 203 ? 0.4152 0.4548 0.3932 -0.0413 -0.0391 0.0658  203 SGB A C   
1572 O O   . SGB A 203 ? 0.3116 0.3449 0.2804 -0.0483 -0.0374 0.0595  203 SGB A O   
1573 C CB  . SGB A 203 ? 0.3565 0.4131 0.3516 -0.0288 -0.0443 0.0798  203 SGB A CB  
1574 O OG  . SGB A 203 ? 0.3685 0.4237 0.3565 -0.0289 -0.0452 0.0843  203 SGB A OG  
1575 O O1  . SGB A 203 ? 0.2477 0.2746 0.2379 -0.0247 -0.0370 0.0794  203 SGB A O1  
1576 P P1  . SGB A 203 ? 0.6292 0.6686 0.6173 -0.0244 -0.0414 0.0866  203 SGB A P1  
1577 C C1  . SGB A 203 ? 0.6047 0.6462 0.5797 -0.0292 -0.0414 0.0906  203 SGB A C1  
1578 O O2  . SGB A 203 ? 0.2651 0.3038 0.2610 -0.0151 -0.0433 0.0951  203 SGB A O2  
1579 C C2  . SGB A 203 ? 0.3474 0.3819 0.3524 -0.0089 -0.0421 0.0931  203 SGB A C2  
1580 C C4  . SGB A 203 ? 0.2984 0.3508 0.3103 -0.0035 -0.0456 0.0974  203 SGB A C4  
1581 C C3  . SGB A 203 ? 0.4401 0.4562 0.4457 -0.0035 -0.0397 0.0961  203 SGB A C3  
1582 N N   . ALA A 204 ? 0.2477 0.2771 0.2286 -0.0350 -0.0363 0.0666  204 ALA A N   
1583 C CA  . ALA A 204 ? 0.3217 0.3372 0.2970 -0.0346 -0.0316 0.0606  204 ALA A CA  
1584 C C   . ALA A 204 ? 0.4089 0.4160 0.3840 -0.0345 -0.0298 0.0557  204 ALA A C   
1585 O O   . ALA A 204 ? 0.3843 0.3795 0.3506 -0.0350 -0.0264 0.0506  204 ALA A O   
1586 C CB  . ALA A 204 ? 0.3007 0.3122 0.2819 -0.0292 -0.0296 0.0627  204 ALA A CB  
1587 N N   . GLY A 205 ? 0.4132 0.4257 0.3968 -0.0327 -0.0315 0.0578  205 GLY A N   
1588 C CA  . GLY A 205 ? 0.3146 0.3203 0.2964 -0.0337 -0.0294 0.0544  205 GLY A CA  
1589 C C   . GLY A 205 ? 0.3706 0.3743 0.3417 -0.0438 -0.0287 0.0508  205 GLY A C   
1590 O O   . GLY A 205 ? 0.3803 0.3681 0.3414 -0.0457 -0.0253 0.0466  205 GLY A O   
1591 N N   . ALA A 206 ? 0.2819 0.3007 0.2536 -0.0504 -0.0323 0.0528  206 ALA A N   
1592 C CA  . ALA A 206 ? 0.3978 0.4159 0.3579 -0.0629 -0.0326 0.0486  206 ALA A CA  
1593 C C   . ALA A 206 ? 0.4215 0.4187 0.3640 -0.0650 -0.0291 0.0426  206 ALA A C   
1594 O O   . ALA A 206 ? 0.3860 0.3655 0.3151 -0.0712 -0.0257 0.0372  206 ALA A O   
1595 C CB  . ALA A 206 ? 0.3243 0.3675 0.2889 -0.0693 -0.0388 0.0523  206 ALA A CB  
1596 N N   . ALA A 207 ? 0.3332 0.3310 0.2745 -0.0595 -0.0291 0.0438  207 ALA A N   
1597 C CA  . ALA A 207 ? 0.3475 0.3278 0.2736 -0.0585 -0.0243 0.0382  207 ALA A CA  
1598 C C   . ALA A 207 ? 0.4605 0.4206 0.3831 -0.0518 -0.0190 0.0350  207 ALA A C   
1599 O O   . ALA A 207 ? 0.4426 0.3821 0.3484 -0.0539 -0.0146 0.0290  207 ALA A O   
1600 C CB  . ALA A 207 ? 0.2922 0.2796 0.2217 -0.0521 -0.0238 0.0414  207 ALA A CB  
1601 N N   . SER A 208 ? 0.3505 0.3150 0.2873 -0.0433 -0.0196 0.0389  208 SER A N   
1602 C CA  . SER A 208 ? 0.3908 0.3400 0.3254 -0.0362 -0.0163 0.0374  208 SER A CA  
1603 C C   . SER A 208 ? 0.4137 0.3466 0.3355 -0.0434 -0.0142 0.0345  208 SER A C   
1604 O O   . SER A 208 ? 0.4051 0.3159 0.3129 -0.0402 -0.0096 0.0312  208 SER A O   
1605 C CB  . SER A 208 ? 0.3136 0.2722 0.2637 -0.0290 -0.0187 0.0416  208 SER A CB  
1606 O OG  . SER A 208 ? 0.3951 0.3636 0.3547 -0.0235 -0.0196 0.0438  208 SER A OG  
1607 N N   . VAL A 209 ? 0.3483 0.2924 0.2748 -0.0528 -0.0170 0.0362  209 VAL A N   
1608 C CA  . VAL A 209 ? 0.3189 0.2501 0.2341 -0.0629 -0.0147 0.0339  209 VAL A CA  
1609 C C   . VAL A 209 ? 0.4790 0.3893 0.3728 -0.0709 -0.0116 0.0275  209 VAL A C   
1610 O O   . VAL A 209 ? 0.4976 0.3807 0.3748 -0.0727 -0.0067 0.0245  209 VAL A O   
1611 C CB  . VAL A 209 ? 0.3296 0.2837 0.2558 -0.0731 -0.0182 0.0368  209 VAL A CB  
1612 C CG1 . VAL A 209 ? 0.3329 0.2761 0.2457 -0.0891 -0.0157 0.0335  209 VAL A CG1 
1613 C CG2 . VAL A 209 ? 0.2925 0.2593 0.2348 -0.0646 -0.0188 0.0418  209 VAL A CG2 
1614 N N   . GLY A 210 ? 0.4551 0.3756 0.3472 -0.0750 -0.0141 0.0255  210 GLY A N   
1615 C CA  . GLY A 210 ? 0.4710 0.3721 0.3406 -0.0833 -0.0113 0.0182  210 GLY A CA  
1616 C C   . GLY A 210 ? 0.5188 0.3915 0.3741 -0.0713 -0.0042 0.0145  210 GLY A C   
1617 O O   . GLY A 210 ? 0.5968 0.4400 0.4291 -0.0761 0.0009  0.0082  210 GLY A O   
1618 N N   . MET A 211 ? 0.3718 0.2532 0.2406 -0.0555 -0.0036 0.0184  211 MET A N   
1619 C CA  . MET A 211 ? 0.4939 0.3556 0.3538 -0.0414 0.0027  0.0163  211 MET A CA  
1620 C C   . MET A 211 ? 0.4894 0.3259 0.3399 -0.0363 0.0063  0.0169  211 MET A C   
1621 O O   . MET A 211 ? 0.5120 0.3211 0.3445 -0.0290 0.0127  0.0132  211 MET A O   
1622 C CB  . MET A 211 ? 0.4544 0.3376 0.3329 -0.0282 0.0018  0.0205  211 MET A CB  
1623 C CG  . MET A 211 ? 0.5422 0.4347 0.4172 -0.0298 0.0032  0.0180  211 MET A CG  
1624 S SD  . MET A 211 ? 0.6653 0.5896 0.5644 -0.0238 -0.0002 0.0247  211 MET A SD  
1625 C CE  . MET A 211 ? 0.6015 0.5379 0.4941 -0.0362 -0.0030 0.0243  211 MET A CE  
1626 N N   . HIS A 212 ? 0.3874 0.2319 0.2484 -0.0394 0.0028  0.0218  212 HIS A N   
1627 C CA  . HIS A 212 ? 0.4593 0.2791 0.3083 -0.0375 0.0062  0.0232  212 HIS A CA  
1628 C C   . HIS A 212 ? 0.5419 0.3311 0.3656 -0.0516 0.0107  0.0179  212 HIS A C   
1629 O O   . HIS A 212 ? 0.6154 0.3707 0.4192 -0.0466 0.0165  0.0170  212 HIS A O   
1630 C CB  . HIS A 212 ? 0.3855 0.2220 0.2497 -0.0389 0.0023  0.0292  212 HIS A CB  
1631 C CG  . HIS A 212 ? 0.3955 0.2533 0.2790 -0.0253 -0.0014 0.0333  212 HIS A CG  
1632 N ND1 . HIS A 212 ? 0.4211 0.2714 0.3031 -0.0095 0.0000  0.0349  212 HIS A ND1 
1633 C CD2 . HIS A 212 ? 0.3315 0.2173 0.2353 -0.0254 -0.0065 0.0361  212 HIS A CD2 
1634 C CE1 . HIS A 212 ? 0.3974 0.2718 0.2984 -0.0029 -0.0046 0.0378  212 HIS A CE1 
1635 N NE2 . HIS A 212 ? 0.4881 0.3813 0.4012 -0.0124 -0.0081 0.0384  212 HIS A NE2 
1636 N N   . ILE A 213 ? 0.5124 0.3130 0.3358 -0.0692 0.0079  0.0145  213 ILE A N   
1637 C CA  . ILE A 213 ? 0.5538 0.3273 0.3524 -0.0861 0.0113  0.0080  213 ILE A CA  
1638 C C   . ILE A 213 ? 0.6567 0.3973 0.4314 -0.0781 0.0180  0.0010  213 ILE A C   
1639 O O   . ILE A 213 ? 0.7010 0.4012 0.4493 -0.0819 0.0244  -0.0031 213 ILE A O   
1640 C CB  . ILE A 213 ? 0.5856 0.3852 0.3906 -0.1058 0.0053  0.0054  213 ILE A CB  
1641 C CG1 . ILE A 213 ? 0.5250 0.3566 0.3532 -0.1118 0.0002  0.0124  213 ILE A CG1 
1642 C CG2 . ILE A 213 ? 0.5102 0.2821 0.2873 -0.1259 0.0082  -0.0031 213 ILE A CG2 
1643 C CD1 . ILE A 213 ? 0.4336 0.2959 0.2711 -0.1288 -0.0062 0.0116  213 ILE A CD1 
1644 N N   . LEU A 214 ? 0.6291 0.3859 0.4123 -0.0665 0.0173  0.0000  214 LEU A N   
1645 C CA  . LEU A 214 ? 0.6108 0.3421 0.3728 -0.0583 0.0243  -0.0071 214 LEU A CA  
1646 C C   . LEU A 214 ? 0.5833 0.2953 0.3417 -0.0347 0.0308  -0.0046 214 LEU A C   
1647 O O   . LEU A 214 ? 0.6227 0.3104 0.3624 -0.0249 0.0383  -0.0102 214 LEU A O   
1648 C CB  . LEU A 214 ? 0.5841 0.3431 0.3552 -0.0575 0.0218  -0.0093 214 LEU A CB  
1649 C CG  . LEU A 214 ? 0.6268 0.4031 0.3969 -0.0794 0.0152  -0.0121 214 LEU A CG  
1650 C CD1 . LEU A 214 ? 0.5647 0.3671 0.3415 -0.0774 0.0126  -0.0126 214 LEU A CD1 
1651 C CD2 . LEU A 214 ? 0.6410 0.3822 0.3794 -0.0967 0.0186  -0.0216 214 LEU A CD2 
1652 N N   . SER A 215 ? 0.5344 0.2585 0.3102 -0.0249 0.0279  0.0038  215 SER A N   
1653 C CA  . SER A 215 ? 0.5841 0.2978 0.3598 -0.0015 0.0321  0.0076  215 SER A CA  
1654 C C   . SER A 215 ? 0.6855 0.3668 0.4456 0.0016  0.0349  0.0116  215 SER A C   
1655 O O   . SER A 215 ? 0.6381 0.3318 0.4099 -0.0020 0.0301  0.0181  215 SER A O   
1656 C CB  . SER A 215 ? 0.5631 0.3179 0.3699 0.0101  0.0264  0.0142  215 SER A CB  
1657 O OG  . SER A 215 ? 0.5741 0.3254 0.3823 0.0326  0.0299  0.0171  215 SER A OG  
1658 N N   . LEU A 216 ? 0.7611 0.3991 0.4929 0.0092  0.0434  0.0079  216 LEU A N   
1659 C CA  . LEU A 216 ? 0.8712 0.4684 0.5805 0.0108  0.0477  0.0116  216 LEU A CA  
1660 C C   . LEU A 216 ? 0.7980 0.4088 0.5213 0.0199  0.0430  0.0225  216 LEU A C   
1661 O O   . LEU A 216 ? 0.7200 0.3197 0.4366 0.0063  0.0421  0.0260  216 LEU A O   
1662 C CB  . LEU A 216 ? 1.0364 0.5879 0.7167 0.0280  0.0580  0.0080  216 LEU A CB  
1663 C CG  . LEU A 216 ? 1.1743 0.6906 0.8255 0.0120  0.0645  -0.0038 216 LEU A CG  
1664 C CD1 . LEU A 216 ? 1.2304 0.7145 0.8598 0.0335  0.0748  -0.0093 216 LEU A CD1 
1665 C CD2 . LEU A 216 ? 1.2177 0.6946 0.8440 -0.0091 0.0666  -0.0041 216 LEU A CD2 
1666 N N   . PRO A 217 ? 0.7678 0.4046 0.5105 0.0415  0.0400  0.0277  217 PRO A N   
1667 C CA  . PRO A 217 ? 0.6764 0.3235 0.4281 0.0495  0.0350  0.0374  217 PRO A CA  
1668 C C   . PRO A 217 ? 0.6613 0.3373 0.4312 0.0316  0.0279  0.0397  217 PRO A C   
1669 O O   . PRO A 217 ? 0.7531 0.4311 0.5242 0.0345  0.0251  0.0468  217 PRO A O   
1670 C CB  . PRO A 217 ? 0.5530 0.2305 0.3253 0.0727  0.0319  0.0408  217 PRO A CB  
1671 C CG  . PRO A 217 ? 0.6209 0.2879 0.3853 0.0821  0.0390  0.0342  217 PRO A CG  
1672 C CD  . PRO A 217 ? 0.6095 0.2675 0.3652 0.0589  0.0410  0.0255  217 PRO A CD  
1673 N N   . SER A 218 ? 0.6426 0.3408 0.4252 0.0150  0.0252  0.0343  218 SER A N   
1674 C CA  . SER A 218 ? 0.5852 0.3100 0.3844 0.0001  0.0194  0.0366  218 SER A CA  
1675 C C   . SER A 218 ? 0.6652 0.3680 0.4477 -0.0195 0.0227  0.0360  218 SER A C   
1676 O O   . SER A 218 ? 0.6455 0.3632 0.4368 -0.0289 0.0202  0.0398  218 SER A O   
1677 C CB  . SER A 218 ? 0.5319 0.2921 0.3529 -0.0077 0.0147  0.0328  218 SER A CB  
1678 O OG  . SER A 218 ? 0.5560 0.3440 0.3976 0.0065  0.0104  0.0352  218 SER A OG  
1679 N N   . ARG A 219 ? 0.7147 0.3818 0.4724 -0.0262 0.0290  0.0309  219 ARG A N   
1680 C CA  . ARG A 219 ? 0.7831 0.4340 0.5265 -0.0505 0.0317  0.0280  219 ARG A CA  
1681 C C   . ARG A 219 ? 0.7508 0.3842 0.4834 -0.0559 0.0345  0.0350  219 ARG A C   
1682 O O   . ARG A 219 ? 0.8006 0.4402 0.5338 -0.0770 0.0348  0.0349  219 ARG A O   
1683 C CB  . ARG A 219 ? 0.9390 0.5520 0.6551 -0.0576 0.0379  0.0195  219 ARG A CB  
1684 C CG  . ARG A 219 ? 0.9531 0.5888 0.6786 -0.0631 0.0347  0.0115  219 ARG A CG  
1685 C CD  . ARG A 219 ? 0.9235 0.5993 0.6701 -0.0832 0.0275  0.0113  219 ARG A CD  
1686 N NE  . ARG A 219 ? 0.9878 0.6499 0.7219 -0.1068 0.0294  0.0107  219 ARG A NE  
1687 C CZ  . ARG A 219 ? 0.9965 0.6439 0.7132 -0.1283 0.0307  0.0028  219 ARG A CZ  
1688 N NH1 . ARG A 219 ? 0.9670 0.6101 0.6750 -0.1281 0.0304  -0.0055 219 ARG A NH1 
1689 N NH2 . ARG A 219 ? 1.0163 0.6542 0.7236 -0.1512 0.0324  0.0029  219 ARG A NH2 
1690 N N   . SER A 220 ? 0.7503 0.3650 0.4738 -0.0366 0.0365  0.0416  220 SER A N   
1691 C CA  . SER A 220 ? 0.8027 0.4007 0.5140 -0.0394 0.0392  0.0497  220 SER A CA  
1692 C C   . SER A 220 ? 0.6952 0.3347 0.4314 -0.0383 0.0332  0.0551  220 SER A C   
1693 O O   . SER A 220 ? 0.7416 0.3728 0.4695 -0.0384 0.0351  0.0622  220 SER A O   
1694 C CB  . SER A 220 ? 0.9171 0.4769 0.6056 -0.0176 0.0434  0.0558  220 SER A CB  
1695 O OG  . SER A 220 ? 0.9131 0.4984 0.6196 0.0066  0.0377  0.0584  220 SER A OG  
1696 N N   . LEU A 221 ? 0.5830 0.2647 0.3475 -0.0373 0.0266  0.0517  221 LEU A N   
1697 C CA  . LEU A 221 ? 0.5447 0.2614 0.3304 -0.0340 0.0215  0.0558  221 LEU A CA  
1698 C C   . LEU A 221 ? 0.6191 0.3640 0.4208 -0.0530 0.0204  0.0537  221 LEU A C   
1699 O O   . LEU A 221 ? 0.5751 0.3486 0.3941 -0.0511 0.0172  0.0561  221 LEU A O   
1700 C CB  . LEU A 221 ? 0.5349 0.2778 0.3406 -0.0162 0.0148  0.0552  221 LEU A CB  
1701 C CG  . LEU A 221 ? 0.5984 0.3229 0.3940 0.0040  0.0153  0.0567  221 LEU A CG  
1702 C CD1 . LEU A 221 ? 0.5611 0.3185 0.3804 0.0167  0.0088  0.0550  221 LEU A CD1 
1703 C CD2 . LEU A 221 ? 0.5173 0.2197 0.2949 0.0146  0.0168  0.0649  221 LEU A CD2 
1704 N N   . PHE A 222 ? 0.4910 0.2285 0.2864 -0.0710 0.0230  0.0489  222 PHE A N   
1705 C CA  . PHE A 222 ? 0.5770 0.3463 0.3895 -0.0885 0.0213  0.0473  222 PHE A CA  
1706 C C   . PHE A 222 ? 0.5663 0.3189 0.3637 -0.1118 0.0254  0.0432  222 PHE A C   
1707 O O   . PHE A 222 ? 0.6151 0.3299 0.3887 -0.1135 0.0292  0.0400  222 PHE A O   
1708 C CB  . PHE A 222 ? 0.4471 0.2536 0.2856 -0.0825 0.0141  0.0443  222 PHE A CB  
1709 C CG  . PHE A 222 ? 0.4829 0.2831 0.3172 -0.0841 0.0124  0.0380  222 PHE A CG  
1710 C CD1 . PHE A 222 ? 0.4991 0.2841 0.3273 -0.0676 0.0123  0.0365  222 PHE A CD1 
1711 C CD2 . PHE A 222 ? 0.5191 0.3319 0.3559 -0.1019 0.0108  0.0336  222 PHE A CD2 
1712 C CE1 . PHE A 222 ? 0.5271 0.3068 0.3500 -0.0686 0.0121  0.0304  222 PHE A CE1 
1713 C CE2 . PHE A 222 ? 0.5424 0.3490 0.3724 -0.1038 0.0093  0.0274  222 PHE A CE2 
1714 C CZ  . PHE A 222 ? 0.5202 0.3091 0.3426 -0.0869 0.0106  0.0256  222 PHE A CZ  
1715 N N   . HIS A 223 ? 0.5646 0.3453 0.3751 -0.1298 0.0248  0.0432  223 HIS A N   
1716 C CA  . HIS A 223 ? 0.6314 0.3988 0.4274 -0.1555 0.0285  0.0396  223 HIS A CA  
1717 C C   . HIS A 223 ? 0.6347 0.4371 0.4474 -0.1704 0.0226  0.0344  223 HIS A C   
1718 O O   . HIS A 223 ? 0.7490 0.5378 0.5473 -0.1902 0.0235  0.0288  223 HIS A O   
1719 C CB  . HIS A 223 ? 0.6054 0.3698 0.3959 -0.1688 0.0351  0.0455  223 HIS A CB  
1720 C CG  . HIS A 223 ? 0.7105 0.4460 0.4856 -0.1530 0.0399  0.0522  223 HIS A CG  
1721 N ND1 . HIS A 223 ? 0.6657 0.4232 0.4563 -0.1346 0.0375  0.0572  223 HIS A ND1 
1722 C CD2 . HIS A 223 ? 0.5934 0.2788 0.3374 -0.1518 0.0463  0.0548  223 HIS A CD2 
1723 C CE1 . HIS A 223 ? 0.7157 0.4413 0.4861 -0.1235 0.0415  0.0628  223 HIS A CE1 
1724 N NE2 . HIS A 223 ? 0.8164 0.4979 0.5587 -0.1327 0.0470  0.0621  223 HIS A NE2 
1725 N N   . ARG A 224 ? 0.5825 0.4286 0.4238 -0.1609 0.0164  0.0364  224 ARG A N   
1726 C CA  . ARG A 224 ? 0.4858 0.3705 0.3452 -0.1718 0.0099  0.0337  224 ARG A CA  
1727 C C   . ARG A 224 ? 0.4911 0.3999 0.3703 -0.1515 0.0035  0.0349  224 ARG A C   
1728 O O   . ARG A 224 ? 0.4858 0.3914 0.3704 -0.1328 0.0043  0.0385  224 ARG A O   
1729 C CB  . ARG A 224 ? 0.5158 0.4370 0.3931 -0.1856 0.0110  0.0379  224 ARG A CB  
1730 C CG  . ARG A 224 ? 0.6280 0.5379 0.4903 -0.2137 0.0153  0.0356  224 ARG A CG  
1731 C CD  . ARG A 224 ? 0.5653 0.5065 0.4434 -0.2242 0.0195  0.0413  224 ARG A CD  
1732 N NE  . ARG A 224 ? 0.6499 0.5706 0.5205 -0.2122 0.0270  0.0470  224 ARG A NE  
1733 C CZ  . ARG A 224 ? 0.7394 0.6187 0.5835 -0.2214 0.0350  0.0483  224 ARG A CZ  
1734 N NH1 . ARG A 224 ? 0.7893 0.6400 0.6114 -0.2436 0.0373  0.0437  224 ARG A NH1 
1735 N NH2 . ARG A 224 ? 0.7980 0.6624 0.6355 -0.2087 0.0409  0.0544  224 ARG A NH2 
1736 N N   . ALA A 225 ? 0.4825 0.4154 0.3714 -0.1562 -0.0031 0.0323  225 ALA A N   
1737 C CA  . ALA A 225 ? 0.4320 0.3829 0.3360 -0.1384 -0.0086 0.0338  225 ALA A CA  
1738 C C   . ALA A 225 ? 0.4737 0.4674 0.3975 -0.1436 -0.0159 0.0356  225 ALA A C   
1739 O O   . ALA A 225 ? 0.3702 0.3756 0.2907 -0.1623 -0.0186 0.0327  225 ALA A O   
1740 C CB  . ALA A 225 ? 0.4975 0.4199 0.3846 -0.1311 -0.0085 0.0289  225 ALA A CB  
1741 N N   . VAL A 226 ? 0.3294 0.3455 0.2727 -0.1271 -0.0191 0.0405  226 VAL A N   
1742 C CA  . VAL A 226 ? 0.4951 0.5492 0.4565 -0.1264 -0.0262 0.0439  226 VAL A CA  
1743 C C   . VAL A 226 ? 0.4363 0.4875 0.3990 -0.1119 -0.0301 0.0448  226 VAL A C   
1744 O O   . VAL A 226 ? 0.4382 0.4759 0.4028 -0.0966 -0.0277 0.0462  226 VAL A O   
1745 C CB  . VAL A 226 ? 0.4804 0.5658 0.4648 -0.1193 -0.0256 0.0503  226 VAL A CB  
1746 C CG1 . VAL A 226 ? 0.4130 0.5390 0.4154 -0.1185 -0.0331 0.0547  226 VAL A CG1 
1747 C CG2 . VAL A 226 ? 0.3078 0.3954 0.2912 -0.1323 -0.0196 0.0502  226 VAL A CG2 
1748 N N   . LEU A 227 ? 0.3761 0.4408 0.3368 -0.1179 -0.0361 0.0440  227 LEU A N   
1749 C CA  . LEU A 227 ? 0.3754 0.4379 0.3353 -0.1062 -0.0392 0.0455  227 LEU A CA  
1750 C C   . LEU A 227 ? 0.3088 0.4069 0.2854 -0.1019 -0.0463 0.0526  227 LEU A C   
1751 O O   . LEU A 227 ? 0.2933 0.4123 0.2690 -0.1135 -0.0521 0.0525  227 LEU A O   
1752 C CB  . LEU A 227 ? 0.3172 0.3583 0.2546 -0.1145 -0.0391 0.0384  227 LEU A CB  
1753 C CG  . LEU A 227 ? 0.4293 0.4309 0.3483 -0.1126 -0.0315 0.0322  227 LEU A CG  
1754 C CD1 . LEU A 227 ? 0.4227 0.4088 0.3298 -0.1278 -0.0277 0.0277  227 LEU A CD1 
1755 C CD2 . LEU A 227 ? 0.3453 0.3288 0.2467 -0.1109 -0.0303 0.0271  227 LEU A CD2 
1756 N N   . GLN A 228 ? 0.3124 0.4165 0.3030 -0.0852 -0.0461 0.0588  228 GLN A N   
1757 C CA  . GLN A 228 ? 0.3349 0.4690 0.3405 -0.0775 -0.0520 0.0669  228 GLN A CA  
1758 C C   . GLN A 228 ? 0.3506 0.4780 0.3503 -0.0696 -0.0550 0.0702  228 GLN A C   
1759 O O   . GLN A 228 ? 0.2991 0.4066 0.2977 -0.0590 -0.0513 0.0707  228 GLN A O   
1760 C CB  . GLN A 228 ? 0.2478 0.3917 0.2710 -0.0640 -0.0491 0.0721  228 GLN A CB  
1761 C CG  . GLN A 228 ? 0.2486 0.3978 0.2767 -0.0713 -0.0443 0.0693  228 GLN A CG  
1762 C CD  . GLN A 228 ? 0.2878 0.4415 0.3293 -0.0569 -0.0396 0.0728  228 GLN A CD  
1763 O OE1 . GLN A 228 ? 0.3462 0.4933 0.3871 -0.0595 -0.0336 0.0701  228 GLN A OE1 
1764 N NE2 . GLN A 228 ? 0.3136 0.4761 0.3648 -0.0415 -0.0418 0.0790  228 GLN A NE2 
1765 N N   . SER A 229 ? 0.3990 0.3629 0.3211 -0.0378 -0.0098 0.0003  229 SER A N   
1766 C CA  . SER A 229 ? 0.3947 0.3565 0.3265 -0.0322 -0.0168 0.0097  229 SER A CA  
1767 C C   . SER A 229 ? 0.3143 0.2533 0.2288 -0.0276 -0.0131 0.0121  229 SER A C   
1768 O O   . SER A 229 ? 0.4048 0.3430 0.3342 -0.0190 -0.0173 0.0171  229 SER A O   
1769 C CB  . SER A 229 ? 0.2980 0.2746 0.2698 -0.0208 -0.0245 0.0108  229 SER A CB  
1770 O OG  . SER A 229 ? 0.3427 0.3435 0.3368 -0.0229 -0.0282 0.0081  229 SER A OG  
1771 N N   . GLY A 230 ? 0.3953 0.3161 0.2822 -0.0334 -0.0057 0.0086  230 GLY A N   
1772 C CA  . GLY A 230 ? 0.3799 0.2813 0.2538 -0.0279 -0.0015 0.0094  230 GLY A CA  
1773 C C   . GLY A 230 ? 0.4168 0.2964 0.2677 -0.0339 0.0064  0.0041  230 GLY A C   
1774 O O   . GLY A 230 ? 0.4373 0.3131 0.2825 -0.0414 0.0089  0.0016  230 GLY A O   
1775 N N   . THR A 231 ? 0.3792 0.2454 0.2205 -0.0308 0.0103  0.0024  231 THR A N   
1776 C CA  . THR A 231 ? 0.4917 0.3346 0.3182 -0.0354 0.0176  -0.0052 231 THR A CA  
1777 C C   . THR A 231 ? 0.4774 0.3060 0.3039 -0.0239 0.0222  -0.0064 231 THR A C   
1778 O O   . THR A 231 ? 0.4579 0.2994 0.2903 -0.0168 0.0201  -0.0028 231 THR A O   
1779 C CB  . THR A 231 ? 0.5261 0.3754 0.3415 -0.0490 0.0192  -0.0147 231 THR A CB  
1780 O OG1 . THR A 231 ? 0.5367 0.4052 0.3521 -0.0474 0.0174  -0.0137 231 THR A OG1 
1781 C CG2 . THR A 231 ? 0.4613 0.3280 0.2774 -0.0617 0.0143  -0.0133 231 THR A CG2 
1782 N N   . PRO A 232 ? 0.4985 0.3009 0.3217 -0.0221 0.0278  -0.0105 232 PRO A N   
1783 C CA  . PRO A 232 ? 0.4622 0.2547 0.2905 -0.0092 0.0320  -0.0120 232 PRO A CA  
1784 C C   . PRO A 232 ? 0.5063 0.3059 0.3297 -0.0116 0.0376  -0.0265 232 PRO A C   
1785 O O   . PRO A 232 ? 0.5217 0.3298 0.3497 -0.0024 0.0401  -0.0277 232 PRO A O   
1786 C CB  . PRO A 232 ? 0.4366 0.1987 0.2689 -0.0065 0.0347  -0.0095 232 PRO A CB  
1787 C CG  . PRO A 232 ? 0.4708 0.2230 0.2957 -0.0226 0.0352  -0.0148 232 PRO A CG  
1788 C CD  . PRO A 232 ? 0.4572 0.2385 0.2768 -0.0308 0.0298  -0.0113 232 PRO A CD  
1789 N N   . ASN A 233 ? 0.5351 0.3361 0.3488 -0.0256 0.0398  -0.0384 233 ASN A N   
1790 C CA  . ASN A 233 ? 0.5797 0.3992 0.3853 -0.0325 0.0447  -0.0537 233 ASN A CA  
1791 C C   . ASN A 233 ? 0.5121 0.3696 0.3147 -0.0372 0.0374  -0.0419 233 ASN A C   
1792 O O   . ASN A 233 ? 0.5530 0.4168 0.3631 -0.0344 0.0290  -0.0254 233 ASN A O   
1793 C CB  . ASN A 233 ? 0.4773 0.2896 0.2735 -0.0487 0.0487  -0.0715 233 ASN A CB  
1794 C CG  . ASN A 233 ? 0.5731 0.3927 0.3643 -0.0616 0.0410  -0.0619 233 ASN A CG  
1795 O OD1 . ASN A 233 ? 0.5578 0.3633 0.3554 -0.0578 0.0370  -0.0490 233 ASN A OD1 
1796 N ND2 . ASN A 233 ? 0.5373 0.3848 0.3178 -0.0774 0.0387  -0.0678 233 ASN A ND2 
1797 N N   . GLY A 234 ? 0.4995 0.3843 0.2936 -0.0449 0.0404  -0.0502 234 GLY A N   
1798 C CA  . GLY A 234 ? 0.4703 0.3924 0.2638 -0.0516 0.0318  -0.0341 234 GLY A CA  
1799 C C   . GLY A 234 ? 0.5114 0.4494 0.3114 -0.0431 0.0323  -0.0259 234 GLY A C   
1800 O O   . GLY A 234 ? 0.5999 0.5224 0.4047 -0.0310 0.0400  -0.0344 234 GLY A O   
1801 N N   . PRO A 235 ? 0.5318 0.5018 0.3353 -0.0499 0.0230  -0.0070 235 PRO A N   
1802 C CA  . PRO A 235 ? 0.4361 0.4302 0.2430 -0.0482 0.0238  0.0008  235 PRO A CA  
1803 C C   . PRO A 235 ? 0.4374 0.4168 0.2635 -0.0331 0.0198  0.0146  235 PRO A C   
1804 O O   . PRO A 235 ? 0.4486 0.4451 0.2780 -0.0311 0.0222  0.0186  235 PRO A O   
1805 C CB  . PRO A 235 ? 0.3956 0.4315 0.1995 -0.0655 0.0136  0.0194  235 PRO A CB  
1806 C CG  . PRO A 235 ? 0.5011 0.5265 0.3133 -0.0679 0.0030  0.0295  235 PRO A CG  
1807 C CD  . PRO A 235 ? 0.5258 0.5159 0.3311 -0.0621 0.0113  0.0080  235 PRO A CD  
1808 N N   . TRP A 236 ? 0.4381 0.3908 0.2764 -0.0242 0.0145  0.0198  236 TRP A N   
1809 C CA  . TRP A 236 ? 0.4088 0.3539 0.2657 -0.0131 0.0096  0.0313  236 TRP A CA  
1810 C C   . TRP A 236 ? 0.4283 0.3447 0.2883 0.0008  0.0147  0.0225  236 TRP A C   
1811 O O   . TRP A 236 ? 0.4068 0.3217 0.2779 0.0095  0.0136  0.0273  236 TRP A O   
1812 C CB  . TRP A 236 ? 0.3825 0.3319 0.2585 -0.0156 -0.0035 0.0478  236 TRP A CB  
1813 C CG  . TRP A 236 ? 0.4312 0.3678 0.3075 -0.0167 -0.0058 0.0427  236 TRP A CG  
1814 C CD1 . TRP A 236 ? 0.4174 0.3663 0.2872 -0.0279 -0.0090 0.0439  236 TRP A CD1 
1815 C CD2 . TRP A 236 ? 0.3896 0.3049 0.2725 -0.0080 -0.0049 0.0359  236 TRP A CD2 
1816 N NE1 . TRP A 236 ? 0.4744 0.4095 0.3478 -0.0259 -0.0098 0.0379  236 TRP A NE1 
1817 C CE2 . TRP A 236 ? 0.4436 0.3591 0.3243 -0.0143 -0.0069 0.0329  236 TRP A CE2 
1818 C CE3 . TRP A 236 ? 0.3986 0.3001 0.2883 0.0028  -0.0027 0.0325  236 TRP A CE3 
1819 C CZ2 . TRP A 236 ? 0.4096 0.3134 0.2948 -0.0105 -0.0060 0.0264  236 TRP A CZ2 
1820 C CZ3 . TRP A 236 ? 0.4062 0.2972 0.2986 0.0059  -0.0024 0.0265  236 TRP A CZ3 
1821 C CH2 . TRP A 236 ? 0.3697 0.2624 0.2598 -0.0009 -0.0036 0.0233  236 TRP A CH2 
1822 N N   . ALA A 237 ? 0.3984 0.2943 0.2493 0.0014  0.0192  0.0117  237 ALA A N   
1823 C CA  . ALA A 237 ? 0.4566 0.3292 0.3120 0.0119  0.0209  0.0101  237 ALA A CA  
1824 C C   . ALA A 237 ? 0.4680 0.3328 0.3258 0.0232  0.0278  0.0057  237 ALA A C   
1825 O O   . ALA A 237 ? 0.4717 0.3271 0.3369 0.0321  0.0263  0.0106  237 ALA A O   
1826 C CB  . ALA A 237 ? 0.3607 0.2151 0.2080 0.0071  0.0223  0.0044  237 ALA A CB  
1827 N N   . THR A 238 ? 0.3719 0.2450 0.2249 0.0224  0.0353  -0.0043 238 THR A N   
1828 C CA  . THR A 238 ? 0.3939 0.2629 0.2549 0.0349  0.0426  -0.0105 238 THR A CA  
1829 C C   . THR A 238 ? 0.4672 0.3668 0.3290 0.0333  0.0474  -0.0147 238 THR A C   
1830 O O   . THR A 238 ? 0.5218 0.4450 0.3743 0.0203  0.0459  -0.0136 238 THR A O   
1831 C CB  . THR A 238 ? 0.4070 0.2503 0.2678 0.0387  0.0508  -0.0259 238 THR A CB  
1832 O OG1 . THR A 238 ? 0.4265 0.2776 0.2751 0.0265  0.0564  -0.0421 238 THR A OG1 
1833 C CG2 . THR A 238 ? 0.4101 0.2252 0.2715 0.0392  0.0462  -0.0184 238 THR A CG2 
1834 N N   . VAL A 239 ? 0.4321 0.3358 0.3060 0.0458  0.0525  -0.0175 239 VAL A N   
1835 C CA  . VAL A 239 ? 0.3896 0.3260 0.2653 0.0447  0.0598  -0.0250 239 VAL A CA  
1836 C C   . VAL A 239 ? 0.5024 0.4296 0.3914 0.0594  0.0709  -0.0428 239 VAL A C   
1837 O O   . VAL A 239 ? 0.5800 0.4780 0.4812 0.0722  0.0692  -0.0396 239 VAL A O   
1838 C CB  . VAL A 239 ? 0.3751 0.3368 0.2599 0.0447  0.0536  -0.0076 239 VAL A CB  
1839 C CG1 . VAL A 239 ? 0.3566 0.3315 0.2353 0.0294  0.0430  0.0090  239 VAL A CG1 
1840 C CG2 . VAL A 239 ? 0.3605 0.3054 0.2603 0.0588  0.0488  0.0017  239 VAL A CG2 
1841 N N   . SER A 240 ? 0.4231 0.3779 0.3120 0.0574  0.0819  -0.0611 240 SER A N   
1842 C CA  . SER A 240 ? 0.4442 0.3945 0.3526 0.0730  0.0938  -0.0821 240 SER A CA  
1843 C C   . SER A 240 ? 0.4440 0.3996 0.3744 0.0895  0.0911  -0.0687 240 SER A C   
1844 O O   . SER A 240 ? 0.4175 0.3880 0.3450 0.0856  0.0820  -0.0473 240 SER A O   
1845 C CB  . SER A 240 ? 0.4606 0.4518 0.3640 0.0650  0.1072  -0.1072 240 SER A CB  
1846 O OG  . SER A 240 ? 0.4727 0.5098 0.3723 0.0579  0.1057  -0.0941 240 SER A OG  
1847 N N   . ALA A 241 ? 0.4863 0.4310 0.4421 0.1079  0.0986  -0.0821 241 ALA A N   
1848 C CA  . ALA A 241 ? 0.4975 0.4538 0.4771 0.1240  0.0963  -0.0701 241 ALA A CA  
1849 C C   . ALA A 241 ? 0.4476 0.4568 0.4252 0.1177  0.1005  -0.0702 241 ALA A C   
1850 O O   . ALA A 241 ? 0.4102 0.4352 0.3919 0.1182  0.0924  -0.0496 241 ALA A O   
1851 C CB  . ALA A 241 ? 0.4693 0.4065 0.4827 0.1460  0.1037  -0.0850 241 ALA A CB  
1852 N N   . GLY A 242 ? 0.4697 0.5090 0.4402 0.1093  0.1131  -0.0936 242 GLY A N   
1853 C CA  . GLY A 242 ? 0.4368 0.5329 0.4048 0.1004  0.1184  -0.0939 242 GLY A CA  
1854 C C   . GLY A 242 ? 0.4706 0.5814 0.4186 0.0814  0.1054  -0.0648 242 GLY A C   
1855 O O   . GLY A 242 ? 0.4661 0.6070 0.4214 0.0789  0.1018  -0.0495 242 GLY A O   
1856 N N   . GLU A 243 ? 0.4081 0.4967 0.3347 0.0681  0.0976  -0.0571 243 GLU A N   
1857 C CA  . GLU A 243 ? 0.3882 0.4854 0.3023 0.0517  0.0844  -0.0303 243 GLU A CA  
1858 C C   . GLU A 243 ? 0.4284 0.5027 0.3557 0.0605  0.0721  -0.0094 243 GLU A C   
1859 O O   . GLU A 243 ? 0.3676 0.4615 0.2995 0.0525  0.0644  0.0089  243 GLU A O   
1860 C CB  . GLU A 243 ? 0.4640 0.5456 0.3566 0.0370  0.0793  -0.0289 243 GLU A CB  
1861 C CG  . GLU A 243 ? 0.3732 0.4580 0.2599 0.0222  0.0643  -0.0011 243 GLU A CG  
1862 C CD  . GLU A 243 ? 0.4426 0.5769 0.3284 0.0060  0.0625  0.0136  243 GLU A CD  
1863 O OE1 . GLU A 243 ? 0.3843 0.5587 0.2681 0.0029  0.0744  0.0006  243 GLU A OE1 
1864 O OE2 . GLU A 243 ? 0.4492 0.5835 0.3388 -0.0045 0.0490  0.0386  243 GLU A OE2 
1865 N N   . ALA A 244 ? 0.3704 0.4059 0.3049 0.0752  0.0702  -0.0122 244 ALA A N   
1866 C CA  . ALA A 244 ? 0.3551 0.3755 0.3000 0.0820  0.0593  0.0050  244 ALA A CA  
1867 C C   . ALA A 244 ? 0.4481 0.4995 0.4119 0.0891  0.0605  0.0100  244 ALA A C   
1868 O O   . ALA A 244 ? 0.4285 0.4899 0.3974 0.0836  0.0512  0.0257  244 ALA A O   
1869 C CB  . ALA A 244 ? 0.3627 0.3445 0.3116 0.0948  0.0576  0.0030  244 ALA A CB  
1870 N N   A ARG A 245 ? 0.3643 0.4321 0.3414 0.1010  0.0723  -0.0055 245 ARG A N   
1871 N N   B ARG A 245 ? 0.4372 0.5054 0.4139 0.1006  0.0725  -0.0057 245 ARG A N   
1872 C CA  A ARG A 245 ? 0.4170 0.5214 0.4146 0.1081  0.0752  -0.0029 245 ARG A CA  
1873 C CA  B ARG A 245 ? 0.4230 0.5270 0.4206 0.1084  0.0757  -0.0038 245 ARG A CA  
1874 C C   A ARG A 245 ? 0.4082 0.5521 0.3988 0.0888  0.0731  0.0077  245 ARG A C   
1875 C C   B ARG A 245 ? 0.4139 0.5594 0.4055 0.0898  0.0741  0.0064  245 ARG A C   
1876 O O   A ARG A 245 ? 0.4096 0.5701 0.4107 0.0859  0.0656  0.0230  245 ARG A O   
1877 O O   B ARG A 245 ? 0.4110 0.5761 0.4147 0.0882  0.0678  0.0204  245 ARG A O   
1878 C CB  A ARG A 245 ? 0.3817 0.5013 0.3981 0.1240  0.0905  -0.0263 245 ARG A CB  
1879 C CB  B ARG A 245 ? 0.3833 0.4996 0.3989 0.1244  0.0910  -0.0278 245 ARG A CB  
1880 C CG  A ARG A 245 ? 0.3791 0.5465 0.4186 0.1307  0.0955  -0.0260 245 ARG A CG  
1881 C CG  B ARG A 245 ? 0.5124 0.6638 0.5570 0.1381  0.0947  -0.0273 245 ARG A CG  
1882 C CD  A ARG A 245 ? 0.4004 0.5757 0.4705 0.1539  0.1086  -0.0487 245 ARG A CD  
1883 C CD  B ARG A 245 ? 0.5141 0.6682 0.5858 0.1593  0.1090  -0.0531 245 ARG A CD  
1884 N NE  A ARG A 245 ? 0.4073 0.5412 0.4971 0.1740  0.1017  -0.0419 245 ARG A NE  
1885 N NE  B ARG A 245 ? 0.5039 0.6052 0.5847 0.1739  0.1061  -0.0560 245 ARG A NE  
1886 C CZ  A ARG A 245 ? 0.3981 0.5367 0.5070 0.1845  0.0917  -0.0220 245 ARG A CZ  
1887 C CZ  B ARG A 245 ? 0.4442 0.5198 0.5221 0.1755  0.1149  -0.0788 245 ARG A CZ  
1888 N NH1 A ARG A 245 ? 0.3815 0.5619 0.4934 0.1772  0.0883  -0.0103 245 ARG A NH1 
1889 N NH1 B ARG A 245 ? 0.4539 0.5555 0.5183 0.1638  0.1279  -0.1034 245 ARG A NH1 
1890 N NH2 A ARG A 245 ? 0.4075 0.5117 0.5328 0.2002  0.0843  -0.0123 245 ARG A NH2 
1891 N NH2 B ARG A 245 ? 0.4590 0.4855 0.5480 0.1871  0.1104  -0.0768 245 ARG A NH2 
1892 N N   . ARG A 246 ? 0.3574 0.5181 0.3310 0.0740  0.0788  0.0009  246 ARG A N   
1893 C CA  . ARG A 246 ? 0.4070 0.6089 0.3753 0.0535  0.0763  0.0149  246 ARG A CA  
1894 C C   . ARG A 246 ? 0.4491 0.6337 0.4176 0.0422  0.0592  0.0405  246 ARG A C   
1895 O O   . ARG A 246 ? 0.3279 0.5383 0.3073 0.0327  0.0537  0.0559  246 ARG A O   
1896 C CB  . ARG A 246 ? 0.3651 0.5886 0.3127 0.0373  0.0832  0.0064  246 ARG A CB  
1897 C CG  . ARG A 246 ? 0.4225 0.6927 0.3646 0.0134  0.0792  0.0260  246 ARG A CG  
1898 C CD  . ARG A 246 ? 0.4616 0.7479 0.3801 -0.0060 0.0802  0.0260  246 ARG A CD  
1899 N NE  . ARG A 246 ? 0.5358 0.7817 0.4458 -0.0122 0.0658  0.0421  246 ARG A NE  
1900 C CZ  . ARG A 246 ? 0.4998 0.7414 0.4160 -0.0254 0.0500  0.0718  246 ARG A CZ  
1901 N NH1 . ARG A 246 ? 0.4572 0.7293 0.3868 -0.0354 0.0456  0.0906  246 ARG A NH1 
1902 N NH2 . ARG A 246 ? 0.3521 0.5589 0.2649 -0.0285 0.0384  0.0821  246 ARG A NH2 
1903 N N   . ARG A 247 ? 0.3972 0.5391 0.3568 0.0429  0.0511  0.0432  247 ARG A N   
1904 C CA  . ARG A 247 ? 0.4538 0.5772 0.4182 0.0343  0.0360  0.0616  247 ARG A CA  
1905 C C   . ARG A 247 ? 0.3983 0.5177 0.3801 0.0431  0.0302  0.0661  247 ARG A C   
1906 O O   . ARG A 247 ? 0.3951 0.5231 0.3886 0.0325  0.0210  0.0794  247 ARG A O   
1907 C CB  . ARG A 247 ? 0.4058 0.4900 0.3587 0.0340  0.0304  0.0601  247 ARG A CB  
1908 C CG  . ARG A 247 ? 0.3795 0.4696 0.3151 0.0232  0.0340  0.0572  247 ARG A CG  
1909 C CD  . ARG A 247 ? 0.3922 0.4473 0.3201 0.0220  0.0270  0.0578  247 ARG A CD  
1910 N NE  . ARG A 247 ? 0.3787 0.4441 0.2906 0.0099  0.0288  0.0568  247 ARG A NE  
1911 C CZ  . ARG A 247 ? 0.4324 0.4764 0.3369 0.0060  0.0234  0.0578  247 ARG A CZ  
1912 N NH1 . ARG A 247 ? 0.4329 0.4444 0.3446 0.0134  0.0167  0.0585  247 ARG A NH1 
1913 N NH2 . ARG A 247 ? 0.4052 0.4660 0.2951 -0.0066 0.0248  0.0575  247 ARG A NH2 
1914 N N   . ALA A 248 ? 0.4396 0.5467 0.4251 0.0611  0.0347  0.0558  248 ALA A N   
1915 C CA  . ALA A 248 ? 0.4109 0.5226 0.4122 0.0688  0.0289  0.0611  248 ALA A CA  
1916 C C   . ALA A 248 ? 0.4138 0.5684 0.4303 0.0633  0.0303  0.0673  248 ALA A C   
1917 O O   . ALA A 248 ? 0.3932 0.5576 0.4213 0.0561  0.0213  0.0770  248 ALA A O   
1918 C CB  . ALA A 248 ? 0.3145 0.4126 0.3204 0.0889  0.0331  0.0535  248 ALA A CB  
1919 N N   . THR A 249 ? 0.3091 0.4923 0.3261 0.0650  0.0421  0.0599  249 THR A N   
1920 C CA  . THR A 249 ? 0.3624 0.5930 0.3946 0.0602  0.0454  0.0646  249 THR A CA  
1921 C C   . THR A 249 ? 0.3232 0.5691 0.3551 0.0357  0.0368  0.0823  249 THR A C   
1922 O O   . THR A 249 ? 0.3166 0.5851 0.3644 0.0284  0.0311  0.0927  249 THR A O   
1923 C CB  . THR A 249 ? 0.3842 0.6483 0.4181 0.0670  0.0620  0.0486  249 THR A CB  
1924 O OG1 . THR A 249 ? 0.3756 0.6181 0.4162 0.0906  0.0691  0.0320  249 THR A OG1 
1925 C CG2 . THR A 249 ? 0.3211 0.6391 0.3734 0.0633  0.0661  0.0528  249 THR A CG2 
1926 N N   . LEU A 250 ? 0.3077 0.5415 0.3242 0.0224  0.0348  0.0871  250 LEU A N   
1927 C CA  . LEU A 250 ? 0.3891 0.6335 0.4100 -0.0010 0.0245  0.1081  250 LEU A CA  
1928 C C   . LEU A 250 ? 0.3989 0.6146 0.4350 -0.0041 0.0098  0.1167  250 LEU A C   
1929 O O   . LEU A 250 ? 0.4136 0.6453 0.4669 -0.0186 0.0020  0.1308  250 LEU A O   
1930 C CB  . LEU A 250 ? 0.3147 0.5516 0.3187 -0.0134 0.0232  0.1141  250 LEU A CB  
1931 C CG  . LEU A 250 ? 0.3191 0.5642 0.3322 -0.0377 0.0101  0.1412  250 LEU A CG  
1932 C CD1 . LEU A 250 ? 0.3239 0.6182 0.3495 -0.0530 0.0110  0.1560  250 LEU A CD1 
1933 C CD2 . LEU A 250 ? 0.3277 0.5736 0.3244 -0.0495 0.0085  0.1496  250 LEU A CD2 
1934 N N   . LEU A 251 ? 0.3426 0.5183 0.3734 0.0081  0.0066  0.1066  251 LEU A N   
1935 C CA  . LEU A 251 ? 0.3533 0.5055 0.3977 0.0044  -0.0058 0.1091  251 LEU A CA  
1936 C C   . LEU A 251 ? 0.3083 0.4836 0.3685 0.0064  -0.0076 0.1085  251 LEU A C   
1937 O O   . LEU A 251 ? 0.3272 0.5058 0.4056 -0.0069 -0.0173 0.1154  251 LEU A O   
1938 C CB  . LEU A 251 ? 0.3716 0.4855 0.4054 0.0161  -0.0074 0.0969  251 LEU A CB  
1939 C CG  . LEU A 251 ? 0.3913 0.4921 0.4408 0.0120  -0.0182 0.0943  251 LEU A CG  
1940 C CD1 . LEU A 251 ? 0.3956 0.4708 0.4552 0.0010  -0.0274 0.0974  251 LEU A CD1 
1941 C CD2 . LEU A 251 ? 0.4463 0.5378 0.4875 0.0263  -0.0166 0.0820  251 LEU A CD2 
1942 N N   . ALA A 252 ? 0.2867 0.4784 0.3432 0.0226  0.0012  0.1001  252 ALA A N   
1943 C CA  . ALA A 252 ? 0.3057 0.5296 0.3786 0.0253  0.0004  0.1016  252 ALA A CA  
1944 C C   . ALA A 252 ? 0.3818 0.6394 0.4700 0.0056  -0.0024 0.1146  252 ALA A C   
1945 O O   . ALA A 252 ? 0.2818 0.5462 0.3863 -0.0051 -0.0119 0.1191  252 ALA A O   
1946 C CB  . ALA A 252 ? 0.2834 0.5259 0.3560 0.0458  0.0117  0.0937  252 ALA A CB  
1947 N N   . ARG A 253 ? 0.2892 0.5693 0.3718 -0.0014 0.0054  0.1203  253 ARG A N   
1948 C CA  . ARG A 253 ? 0.2946 0.6109 0.3901 -0.0232 0.0028  0.1368  253 ARG A CA  
1949 C C   . ARG A 253 ? 0.3146 0.6072 0.4241 -0.0437 -0.0128 0.1511  253 ARG A C   
1950 O O   . ARG A 253 ? 0.3382 0.6486 0.4684 -0.0579 -0.0200 0.1602  253 ARG A O   
1951 C CB  . ARG A 253 ? 0.3033 0.6484 0.3860 -0.0307 0.0130  0.1415  253 ARG A CB  
1952 C CG  . ARG A 253 ? 0.4859 0.8723 0.5662 -0.0164 0.0295  0.1270  253 ARG A CG  
1953 C CD  . ARG A 253 ? 0.5839 1.0168 0.6554 -0.0325 0.0388  0.1330  253 ARG A CD  
1954 N NE  . ARG A 253 ? 0.7499 1.2118 0.8153 -0.0157 0.0573  0.1098  253 ARG A NE  
1955 C CZ  . ARG A 253 ? 0.8336 1.2754 0.8811 -0.0047 0.0658  0.0922  253 ARG A CZ  
1956 N NH1 . ARG A 253 ? 0.7687 1.1640 0.8000 -0.0087 0.0574  0.0972  253 ARG A NH1 
1957 N NH2 . ARG A 253 ? 0.8644 1.3336 0.9131 0.0104  0.0830  0.0677  253 ARG A NH2 
1958 N N   . LEU A 254 ? 0.3247 0.5768 0.4266 -0.0448 -0.0182 0.1518  254 LEU A N   
1959 C CA  . LEU A 254 ? 0.3603 0.5851 0.4817 -0.0615 -0.0331 0.1634  254 LEU A CA  
1960 C C   . LEU A 254 ? 0.4142 0.6245 0.5556 -0.0621 -0.0419 0.1532  254 LEU A C   
1961 O O   . LEU A 254 ? 0.3630 0.5585 0.5294 -0.0782 -0.0538 0.1610  254 LEU A O   
1962 C CB  . LEU A 254 ? 0.3071 0.4926 0.4190 -0.0579 -0.0364 0.1625  254 LEU A CB  
1963 C CG  . LEU A 254 ? 0.3923 0.5937 0.4872 -0.0640 -0.0312 0.1757  254 LEU A CG  
1964 C CD1 . LEU A 254 ? 0.3106 0.4755 0.3939 -0.0568 -0.0334 0.1707  254 LEU A CD1 
1965 C CD2 . LEU A 254 ? 0.3257 0.5509 0.4383 -0.0896 -0.0399 0.2052  254 LEU A CD2 
1966 N N   . VAL A 255 ? 0.4350 0.6504 0.5674 -0.0454 -0.0367 0.1358  255 VAL A N   
1967 C CA  . VAL A 255 ? 0.3900 0.6014 0.5376 -0.0475 -0.0445 0.1243  255 VAL A CA  
1968 C C   . VAL A 255 ? 0.4569 0.7127 0.6127 -0.0484 -0.0425 0.1254  255 VAL A C   
1969 O O   . VAL A 255 ? 0.5302 0.7919 0.6956 -0.0499 -0.0484 0.1152  255 VAL A O   
1970 C CB  . VAL A 255 ? 0.4196 0.6039 0.5533 -0.0316 -0.0442 0.1051  255 VAL A CB  
1971 C CG1 . VAL A 255 ? 0.2884 0.4314 0.4215 -0.0333 -0.0481 0.1020  255 VAL A CG1 
1972 C CG2 . VAL A 255 ? 0.2786 0.4737 0.3893 -0.0102 -0.0333 0.1011  255 VAL A CG2 
1973 N N   . GLY A 256 ? 0.4321 0.7240 0.5852 -0.0483 -0.0341 0.1364  256 GLY A N   
1974 C CA  . GLY A 256 ? 0.4134 0.7529 0.5794 -0.0506 -0.0324 0.1392  256 GLY A CA  
1975 C C   . GLY A 256 ? 0.4368 0.7968 0.5944 -0.0262 -0.0240 0.1293  256 GLY A C   
1976 O O   . GLY A 256 ? 0.6081 0.9960 0.7780 -0.0246 -0.0273 0.1273  256 GLY A O   
1977 N N   . CYS A 257 ? 0.4153 0.7620 0.5548 -0.0080 -0.0139 0.1240  257 CYS A N   
1978 C CA  . CYS A 257 ? 0.3705 0.7291 0.5068 0.0169  -0.0061 0.1158  257 CYS A CA  
1979 C C   . CYS A 257 ? 0.4434 0.8203 0.5744 0.0272  0.0090  0.1130  257 CYS A C   
1980 O O   . CYS A 257 ? 0.5811 1.0022 0.7265 0.0348  0.0167  0.1121  257 CYS A O   
1981 C CB  . CYS A 257 ? 0.4163 0.7319 0.5376 0.0306  -0.0093 0.1072  257 CYS A CB  
1982 S SG  . CYS A 257 ? 0.3430 0.6460 0.4679 0.0218  -0.0246 0.1032  257 CYS A SG  
1983 N N   . ASN A 265 ? 0.6257 1.0500 0.8761 0.2088  0.0812  0.0299  265 ASN A N   
1984 C CA  . ASN A 265 ? 0.6010 0.9938 0.8663 0.2263  0.0681  0.0454  265 ASN A CA  
1985 C C   . ASN A 265 ? 0.5350 0.8830 0.7644 0.2097  0.0537  0.0613  265 ASN A C   
1986 O O   . ASN A 265 ? 0.5062 0.8665 0.7175 0.1886  0.0443  0.0732  265 ASN A O   
1987 C CB  . ASN A 265 ? 0.5747 1.0141 0.8748 0.2365  0.0601  0.0612  265 ASN A CB  
1988 C CG  . ASN A 265 ? 0.5906 1.0068 0.9028 0.2494  0.0433  0.0840  265 ASN A CG  
1989 O OD1 . ASN A 265 ? 0.4956 0.9053 0.7851 0.2328  0.0286  0.1019  265 ASN A OD1 
1990 N ND2 . ASN A 265 ? 0.6262 1.0300 0.9749 0.2762  0.0447  0.0825  265 ASN A ND2 
1991 N N   . ASP A 266 ? 0.5207 0.8177 0.7426 0.2188  0.0521  0.0599  266 ASP A N   
1992 C CA  . ASP A 266 ? 0.5106 0.7671 0.6976 0.2028  0.0413  0.0704  266 ASP A CA  
1993 C C   . ASP A 266 ? 0.4791 0.7450 0.6652 0.1971  0.0239  0.0936  266 ASP A C   
1994 O O   . ASP A 266 ? 0.3277 0.5840 0.4867 0.1768  0.0160  0.0985  266 ASP A O   
1995 C CB  . ASP A 266 ? 0.5299 0.7336 0.7109 0.2128  0.0440  0.0643  266 ASP A CB  
1996 C CG  . ASP A 266 ? 0.5150 0.7058 0.6846 0.2098  0.0598  0.0388  266 ASP A CG  
1997 O OD1 . ASP A 266 ? 0.5218 0.7410 0.6780 0.1946  0.0664  0.0302  266 ASP A OD1 
1998 O OD2 . ASP A 266 ? 0.4960 0.6499 0.6701 0.2209  0.0648  0.0285  266 ASP A OD2 
1999 N N   . THR A 267 ? 0.4734 0.7612 0.6916 0.2148  0.0178  0.1068  267 THR A N   
2000 C CA  . THR A 267 ? 0.4390 0.7457 0.6577 0.2089  0.0008  0.1293  267 THR A CA  
2001 C C   . THR A 267 ? 0.3949 0.7366 0.6002 0.1854  -0.0040 0.1296  267 THR A C   
2002 O O   . THR A 267 ? 0.3175 0.6540 0.5012 0.1682  -0.0148 0.1360  267 THR A O   
2003 C CB  . THR A 267 ? 0.4302 0.7659 0.6917 0.2321  -0.0053 0.1458  267 THR A CB  
2004 O OG1 . THR A 267 ? 0.4400 0.7369 0.7195 0.2528  -0.0020 0.1456  267 THR A OG1 
2005 C CG2 . THR A 267 ? 0.3559 0.7135 0.6128 0.2222  -0.0241 0.1700  267 THR A CG2 
2006 N N   . GLU A 268 ? 0.3515 0.7303 0.5720 0.1841  0.0043  0.1213  268 GLU A N   
2007 C CA  . GLU A 268 ? 0.3941 0.8072 0.6081 0.1610  -0.0003 0.1227  268 GLU A CA  
2008 C C   . GLU A 268 ? 0.3698 0.7520 0.5506 0.1370  -0.0001 0.1148  268 GLU A C   
2009 O O   . GLU A 268 ? 0.3698 0.7557 0.5399 0.1174  -0.0104 0.1186  268 GLU A O   
2010 C CB  . GLU A 268 ? 0.4321 0.8932 0.6705 0.1639  0.0100  0.1165  268 GLU A CB  
2011 C CG  . GLU A 268 ? 0.6405 1.1414 0.9194 0.1874  0.0090  0.1242  268 GLU A CG  
2012 C CD  . GLU A 268 ? 0.7935 1.3490 1.0973 0.1888  0.0203  0.1159  268 GLU A CD  
2013 O OE1 . GLU A 268 ? 0.8141 1.3800 1.1009 0.1673  0.0269  0.1080  268 GLU A OE1 
2014 O OE2 . GLU A 268 ? 0.8252 1.4115 1.1653 0.2094  0.0220  0.1177  268 GLU A OE2 
2015 N N   . LEU A 269 ? 0.3161 0.6699 0.4841 0.1387  0.0114  0.1027  269 LEU A N   
2016 C CA  . LEU A 269 ? 0.3592 0.6808 0.4990 0.1194  0.0112  0.0974  269 LEU A CA  
2017 C C   . LEU A 269 ? 0.4274 0.7141 0.5488 0.1131  -0.0001 0.1013  269 LEU A C   
2018 O O   . LEU A 269 ? 0.4295 0.7113 0.5407 0.0935  -0.0074 0.1012  269 LEU A O   
2019 C CB  . LEU A 269 ? 0.3654 0.6652 0.4953 0.1254  0.0249  0.0846  269 LEU A CB  
2020 C CG  . LEU A 269 ? 0.4440 0.7222 0.5496 0.1058  0.0266  0.0805  269 LEU A CG  
2021 C CD1 . LEU A 269 ? 0.4222 0.7093 0.5249 0.1089  0.0417  0.0680  269 LEU A CD1 
2022 C CD2 . LEU A 269 ? 0.4932 0.7226 0.5780 0.1037  0.0202  0.0803  269 LEU A CD2 
2023 N N   . ILE A 270 ? 0.4254 0.6894 0.5453 0.1291  -0.0013 0.1042  270 ILE A N   
2024 C CA  . ILE A 270 ? 0.4388 0.6745 0.5393 0.1223  -0.0102 0.1072  270 ILE A CA  
2025 C C   . ILE A 270 ? 0.5146 0.7805 0.6190 0.1110  -0.0229 0.1147  270 ILE A C   
2026 O O   . ILE A 270 ? 0.2894 0.5458 0.3788 0.0943  -0.0292 0.1094  270 ILE A O   
2027 C CB  . ILE A 270 ? 0.4249 0.6347 0.5254 0.1398  -0.0098 0.1130  270 ILE A CB  
2028 C CG1 . ILE A 270 ? 0.4565 0.6350 0.5528 0.1484  0.0030  0.1009  270 ILE A CG1 
2029 C CG2 . ILE A 270 ? 0.3125 0.5016 0.3919 0.1301  -0.0187 0.1171  270 ILE A CG2 
2030 C CD1 . ILE A 270 ? 0.5571 0.7157 0.6674 0.1692  0.0053  0.1054  270 ILE A CD1 
2031 N N   . ALA A 271 ? 0.2974 0.6029 0.4245 0.1201  -0.0264 0.1249  271 ALA A N   
2032 C CA  . ALA A 271 ? 0.2955 0.6380 0.4273 0.1086  -0.0389 0.1321  271 ALA A CA  
2033 C C   . ALA A 271 ? 0.3448 0.6954 0.4720 0.0846  -0.0407 0.1207  271 ALA A C   
2034 O O   . ALA A 271 ? 0.4116 0.7679 0.5304 0.0680  -0.0496 0.1158  271 ALA A O   
2035 C CB  . ALA A 271 ? 0.3004 0.6887 0.4615 0.1225  -0.0420 0.1459  271 ALA A CB  
2036 N N   . CYS A 272 ? 0.2812 0.6328 0.4153 0.0816  -0.0322 0.1158  272 CYS A N   
2037 C CA  . CYS A 272 ? 0.3462 0.7011 0.4804 0.0580  -0.0349 0.1091  272 CYS A CA  
2038 C C   . CYS A 272 ? 0.3209 0.6312 0.4358 0.0469  -0.0369 0.0989  272 CYS A C   
2039 O O   . CYS A 272 ? 0.3402 0.6508 0.4563 0.0291  -0.0450 0.0914  272 CYS A O   
2040 C CB  . CYS A 272 ? 0.2739 0.6442 0.4192 0.0552  -0.0258 0.1106  272 CYS A CB  
2041 S SG  . CYS A 272 ? 0.3472 0.7114 0.4950 0.0248  -0.0300 0.1083  272 CYS A SG  
2042 N N   . LEU A 273 ? 0.3123 0.5861 0.4124 0.0572  -0.0296 0.0967  273 LEU A N   
2043 C CA  . LEU A 273 ? 0.3170 0.5511 0.4006 0.0492  -0.0315 0.0876  273 LEU A CA  
2044 C C   . LEU A 273 ? 0.3419 0.5786 0.4191 0.0435  -0.0405 0.0817  273 LEU A C   
2045 O O   . LEU A 273 ? 0.3416 0.5651 0.4175 0.0290  -0.0450 0.0697  273 LEU A O   
2046 C CB  . LEU A 273 ? 0.3582 0.5587 0.4266 0.0625  -0.0229 0.0870  273 LEU A CB  
2047 C CG  . LEU A 273 ? 0.4054 0.5992 0.4738 0.0611  -0.0141 0.0871  273 LEU A CG  
2048 C CD1 . LEU A 273 ? 0.3514 0.5160 0.4048 0.0736  -0.0057 0.0835  273 LEU A CD1 
2049 C CD2 . LEU A 273 ? 0.3926 0.5757 0.4633 0.0411  -0.0189 0.0856  273 LEU A CD2 
2050 N N   . ARG A 274 ? 0.2940 0.5514 0.3699 0.0542  -0.0435 0.0902  274 ARG A N   
2051 C CA  . ARG A 274 ? 0.3354 0.6067 0.4028 0.0466  -0.0522 0.0867  274 ARG A CA  
2052 C C   . ARG A 274 ? 0.3839 0.6852 0.4622 0.0267  -0.0600 0.0759  274 ARG A C   
2053 O O   . ARG A 274 ? 0.3767 0.6859 0.4477 0.0144  -0.0656 0.0633  274 ARG A O   
2054 C CB  . ARG A 274 ? 0.2948 0.5881 0.3616 0.0607  -0.0560 0.1045  274 ARG A CB  
2055 C CG  . ARG A 274 ? 0.3381 0.5967 0.3955 0.0776  -0.0498 0.1127  274 ARG A CG  
2056 C CD  . ARG A 274 ? 0.3983 0.6741 0.4546 0.0859  -0.0571 0.1316  274 ARG A CD  
2057 N NE  . ARG A 274 ? 0.5179 0.8357 0.5965 0.0936  -0.0628 0.1467  274 ARG A NE  
2058 C CZ  . ARG A 274 ? 0.4797 0.7966 0.5797 0.1144  -0.0587 0.1589  274 ARG A CZ  
2059 N NH1 . ARG A 274 ? 0.3243 0.5991 0.4236 0.1280  -0.0487 0.1558  274 ARG A NH1 
2060 N NH2 . ARG A 274 ? 0.3837 0.7441 0.5080 0.1214  -0.0645 0.1721  274 ARG A NH2 
2061 N N   . THR A 275 ? 0.2839 0.6038 0.3806 0.0217  -0.0599 0.0787  275 THR A N   
2062 C CA  . THR A 275 ? 0.2871 0.6310 0.3969 0.0003  -0.0676 0.0668  275 THR A CA  
2063 C C   . THR A 275 ? 0.3280 0.6380 0.4442 -0.0152 -0.0674 0.0502  275 THR A C   
2064 O O   . THR A 275 ? 0.3726 0.6947 0.5032 -0.0338 -0.0738 0.0366  275 THR A O   
2065 C CB  . THR A 275 ? 0.3287 0.7135 0.4592 -0.0028 -0.0697 0.0772  275 THR A CB  
2066 O OG1 . THR A 275 ? 0.3537 0.7219 0.4938 -0.0032 -0.0627 0.0820  275 THR A OG1 
2067 C CG2 . THR A 275 ? 0.2862 0.7044 0.4185 0.0156  -0.0702 0.0953  275 THR A CG2 
2068 N N   . ARG A 276 ? 0.2841 0.5525 0.3930 -0.0081 -0.0608 0.0514  276 ARG A N   
2069 C CA  . ARG A 276 ? 0.2869 0.5236 0.4078 -0.0214 -0.0622 0.0405  276 ARG A CA  
2070 C C   . ARG A 276 ? 0.3562 0.5734 0.4724 -0.0265 -0.0647 0.0188  276 ARG A C   
2071 O O   . ARG A 276 ? 0.3640 0.5771 0.4595 -0.0163 -0.0618 0.0169  276 ARG A O   
2072 C CB  . ARG A 276 ? 0.3460 0.5539 0.4639 -0.0143 -0.0554 0.0532  276 ARG A CB  
2073 C CG  . ARG A 276 ? 0.2801 0.5110 0.4077 -0.0151 -0.0522 0.0700  276 ARG A CG  
2074 C CD  . ARG A 276 ? 0.5564 0.7991 0.7100 -0.0366 -0.0595 0.0701  276 ARG A CD  
2075 N NE  . ARG A 276 ? 0.6295 0.9061 0.7919 -0.0390 -0.0564 0.0862  276 ARG A NE  
2076 C CZ  . ARG A 276 ? 0.6926 1.0121 0.8622 -0.0388 -0.0578 0.0887  276 ARG A CZ  
2077 N NH1 . ARG A 276 ? 0.7226 1.0569 0.8897 -0.0375 -0.0633 0.0779  276 ARG A NH1 
2078 N NH2 . ARG A 276 ? 0.6603 1.0133 0.8400 -0.0409 -0.0537 0.1023  276 ARG A NH2 
2079 N N   . PRO A 277 ? 0.3659 0.5728 0.5048 -0.0430 -0.0701 0.0017  277 PRO A N   
2080 C CA  . PRO A 277 ? 0.3077 0.4956 0.4496 -0.0476 -0.0712 -0.0236 277 PRO A CA  
2081 C C   . PRO A 277 ? 0.3920 0.5431 0.5210 -0.0346 -0.0653 -0.0185 277 PRO A C   
2082 O O   . PRO A 277 ? 0.3315 0.4624 0.4622 -0.0295 -0.0629 -0.0001 277 PRO A O   
2083 C CB  . PRO A 277 ? 0.5277 0.7006 0.7067 -0.0649 -0.0776 -0.0369 277 PRO A CB  
2084 C CG  . PRO A 277 ? 0.3215 0.5219 0.5120 -0.0744 -0.0816 -0.0229 277 PRO A CG  
2085 C CD  . PRO A 277 ? 0.3920 0.6064 0.5590 -0.0588 -0.0756 0.0046  277 PRO A CD  
2086 N N   . ALA A 278 ? 0.3025 0.4501 0.4183 -0.0311 -0.0629 -0.0346 278 ALA A N   
2087 C CA  . ALA A 278 ? 0.4158 0.5317 0.5202 -0.0202 -0.0577 -0.0311 278 ALA A CA  
2088 C C   . ALA A 278 ? 0.2988 0.3794 0.4286 -0.0231 -0.0597 -0.0282 278 ALA A C   
2089 O O   . ALA A 278 ? 0.3135 0.3736 0.4345 -0.0148 -0.0564 -0.0108 278 ALA A O   
2090 C CB  . ALA A 278 ? 0.3015 0.4235 0.3955 -0.0209 -0.0556 -0.0535 278 ALA A CB  
2091 N N   . GLN A 279 ? 0.3131 0.3885 0.4765 -0.0358 -0.0660 -0.0445 279 GLN A N   
2092 C CA  . GLN A 279 ? 0.3165 0.3580 0.5116 -0.0396 -0.0707 -0.0391 279 GLN A CA  
2093 C C   . GLN A 279 ? 0.4318 0.4695 0.6277 -0.0411 -0.0722 -0.0065 279 GLN A C   
2094 O O   . GLN A 279 ? 0.3131 0.3272 0.5173 -0.0393 -0.0737 0.0085  279 GLN A O   
2095 C CB  . GLN A 279 ? 0.3344 0.3684 0.5726 -0.0531 -0.0779 -0.0643 279 GLN A CB  
2096 C CG  . GLN A 279 ? 0.3899 0.3847 0.6661 -0.0534 -0.0833 -0.0627 279 GLN A CG  
2097 C CD  . GLN A 279 ? 0.4567 0.4374 0.7246 -0.0408 -0.0783 -0.0743 279 GLN A CD  
2098 O OE1 . GLN A 279 ? 0.5478 0.5425 0.8094 -0.0390 -0.0736 -0.1045 279 GLN A OE1 
2099 N NE2 . GLN A 279 ? 0.3845 0.3429 0.6520 -0.0338 -0.0793 -0.0502 279 GLN A NE2 
2100 N N   . ASP A 280 ? 0.3100 0.3759 0.4979 -0.0451 -0.0719 0.0044  280 ASP A N   
2101 C CA  . ASP A 280 ? 0.3070 0.3788 0.4934 -0.0472 -0.0713 0.0331  280 ASP A CA  
2102 C C   . ASP A 280 ? 0.3211 0.3847 0.4786 -0.0330 -0.0633 0.0475  280 ASP A C   
2103 O O   . ASP A 280 ? 0.3634 0.4169 0.5251 -0.0359 -0.0640 0.0660  280 ASP A O   
2104 C CB  . ASP A 280 ? 0.5807 0.6911 0.7616 -0.0509 -0.0703 0.0396  280 ASP A CB  
2105 C CG  . ASP A 280 ? 0.6775 0.7969 0.8920 -0.0705 -0.0792 0.0356  280 ASP A CG  
2106 O OD1 . ASP A 280 ? 0.6938 0.7893 0.9366 -0.0800 -0.0860 0.0201  280 ASP A OD1 
2107 O OD2 . ASP A 280 ? 0.8080 0.9594 1.0235 -0.0765 -0.0793 0.0469  280 ASP A OD2 
2108 N N   . LEU A 281 ? 0.3085 0.3783 0.4378 -0.0195 -0.0565 0.0394  281 LEU A N   
2109 C CA  . LEU A 281 ? 0.3147 0.3745 0.4180 -0.0066 -0.0487 0.0489  281 LEU A CA  
2110 C C   . LEU A 281 ? 0.3843 0.4135 0.4933 -0.0072 -0.0505 0.0486  281 LEU A C   
2111 O O   . LEU A 281 ? 0.3889 0.4115 0.4905 -0.0061 -0.0480 0.0638  281 LEU A O   
2112 C CB  . LEU A 281 ? 0.3036 0.3716 0.3818 0.0061  -0.0432 0.0410  281 LEU A CB  
2113 C CG  . LEU A 281 ? 0.3303 0.4313 0.4041 0.0094  -0.0424 0.0447  281 LEU A CG  
2114 C CD1 . LEU A 281 ? 0.2809 0.3865 0.3320 0.0228  -0.0382 0.0443  281 LEU A CD1 
2115 C CD2 . LEU A 281 ? 0.2745 0.3928 0.3527 0.0101  -0.0390 0.0610  281 LEU A CD2 
2116 N N   . VAL A 282 ? 0.4052 0.4202 0.5290 -0.0095 -0.0547 0.0301  282 VAL A N   
2117 C CA  . VAL A 282 ? 0.4106 0.3991 0.5445 -0.0081 -0.0569 0.0280  282 VAL A CA  
2118 C C   . VAL A 282 ? 0.4426 0.4193 0.6044 -0.0178 -0.0647 0.0472  282 VAL A C   
2119 O O   . VAL A 282 ? 0.4311 0.3953 0.5911 -0.0162 -0.0656 0.0605  282 VAL A O   
2120 C CB  . VAL A 282 ? 0.3716 0.3530 0.5222 -0.0086 -0.0591 0.0000  282 VAL A CB  
2121 C CG1 . VAL A 282 ? 0.3003 0.2560 0.4780 -0.0086 -0.0640 -0.0022 282 VAL A CG1 
2122 C CG2 . VAL A 282 ? 0.3683 0.3622 0.4867 -0.0001 -0.0515 -0.0125 282 VAL A CG2 
2123 N N   . ASP A 283 ? 0.3277 0.3113 0.5153 -0.0295 -0.0713 0.0507  283 ASP A N   
2124 C CA  . ASP A 283 ? 0.3663 0.3397 0.5858 -0.0418 -0.0810 0.0723  283 ASP A CA  
2125 C C   . ASP A 283 ? 0.3870 0.3755 0.5855 -0.0444 -0.0780 0.1022  283 ASP A C   
2126 O O   . ASP A 283 ? 0.3535 0.3366 0.5715 -0.0543 -0.0859 0.1255  283 ASP A O   
2127 C CB  . ASP A 283 ? 0.3300 0.3092 0.5817 -0.0562 -0.0885 0.0696  283 ASP A CB  
2128 C CG  . ASP A 283 ? 0.4306 0.3898 0.7186 -0.0585 -0.0944 0.0404  283 ASP A CG  
2129 O OD1 . ASP A 283 ? 0.5134 0.4548 0.8056 -0.0490 -0.0931 0.0242  283 ASP A OD1 
2130 O OD2 . ASP A 283 ? 0.4521 0.4153 0.7671 -0.0708 -0.1000 0.0315  283 ASP A OD2 
2131 N N   . HIS A 284 ? 0.4014 0.4113 0.5625 -0.0359 -0.0669 0.1013  284 HIS A N   
2132 C CA  . HIS A 284 ? 0.4301 0.4609 0.5723 -0.0390 -0.0620 0.1231  284 HIS A CA  
2133 C C   . HIS A 284 ? 0.4129 0.4416 0.5218 -0.0271 -0.0526 0.1202  284 HIS A C   
2134 O O   . HIS A 284 ? 0.4032 0.4497 0.4971 -0.0309 -0.0483 0.1346  284 HIS A O   
2135 C CB  . HIS A 284 ? 0.3758 0.4401 0.5109 -0.0417 -0.0567 0.1265  284 HIS A CB  
2136 C CG  . HIS A 284 ? 0.3788 0.4519 0.5459 -0.0590 -0.0662 0.1373  284 HIS A CG  
2137 N ND1 . HIS A 284 ? 0.4259 0.4987 0.6105 -0.0615 -0.0702 0.1216  284 HIS A ND1 
2138 C CD2 . HIS A 284 ? 0.3873 0.4708 0.5734 -0.0768 -0.0733 0.1631  284 HIS A CD2 
2139 C CE1 . HIS A 284 ? 0.4806 0.5602 0.6949 -0.0798 -0.0790 0.1356  284 HIS A CE1 
2140 N NE2 . HIS A 284 ? 0.4121 0.4976 0.6286 -0.0894 -0.0814 0.1627  284 HIS A NE2 
2141 N N   . GLU A 285 ? 0.4123 0.4222 0.5104 -0.0149 -0.0494 0.1010  285 GLU A N   
2142 C CA  . GLU A 285 ? 0.4237 0.4308 0.4905 -0.0040 -0.0400 0.0960  285 GLU A CA  
2143 C C   . GLU A 285 ? 0.3773 0.3827 0.4392 -0.0100 -0.0415 0.1109  285 GLU A C   
2144 O O   . GLU A 285 ? 0.2909 0.3099 0.3287 -0.0083 -0.0331 0.1136  285 GLU A O   
2145 C CB  . GLU A 285 ? 0.3962 0.3850 0.4551 0.0066  -0.0379 0.0760  285 GLU A CB  
2146 C CG  . GLU A 285 ? 0.4557 0.4231 0.5357 0.0040  -0.0457 0.0697  285 GLU A CG  
2147 C CD  . GLU A 285 ? 0.4890 0.4462 0.5563 0.0131  -0.0415 0.0502  285 GLU A CD  
2148 O OE1 . GLU A 285 ? 0.4098 0.3746 0.4529 0.0203  -0.0342 0.0447  285 GLU A OE1 
2149 O OE2 . GLU A 285 ? 0.5564 0.5001 0.6406 0.0126  -0.0458 0.0415  285 GLU A OE2 
2150 N N   . TRP A 286 ? 0.3297 0.3217 0.4178 -0.0181 -0.0527 0.1207  286 TRP A N   
2151 C CA  . TRP A 286 ? 0.4376 0.4298 0.5246 -0.0243 -0.0569 0.1373  286 TRP A CA  
2152 C C   . TRP A 286 ? 0.5105 0.5343 0.5902 -0.0379 -0.0568 0.1611  286 TRP A C   
2153 O O   . TRP A 286 ? 0.5324 0.5692 0.5985 -0.0441 -0.0568 0.1734  286 TRP A O   
2154 C CB  . TRP A 286 ? 0.4646 0.4347 0.5906 -0.0279 -0.0707 0.1433  286 TRP A CB  
2155 C CG  . TRP A 286 ? 0.5552 0.5200 0.6829 -0.0288 -0.0757 0.1539  286 TRP A CG  
2156 C CD1 . TRP A 286 ? 0.6015 0.5809 0.6969 -0.0297 -0.0696 0.1588  286 TRP A CD1 
2157 C CD2 . TRP A 286 ? 0.6369 0.5823 0.8042 -0.0293 -0.0886 0.1603  286 TRP A CD2 
2158 N NE1 . TRP A 286 ? 0.5912 0.5644 0.7011 -0.0319 -0.0786 0.1701  286 TRP A NE1 
2159 C CE2 . TRP A 286 ? 0.5938 0.5459 0.7494 -0.0304 -0.0905 0.1721  286 TRP A CE2 
2160 C CE3 . TRP A 286 ? 0.6430 0.5670 0.8582 -0.0287 -0.0988 0.1556  286 TRP A CE3 
2161 C CZ2 . TRP A 286 ? 0.5651 0.5049 0.7562 -0.0297 -0.1028 0.1823  286 TRP A CZ2 
2162 C CZ3 . TRP A 286 ? 0.6440 0.5525 0.8972 -0.0269 -0.1103 0.1631  286 TRP A CZ3 
2163 C CH2 . TRP A 286 ? 0.6211 0.5395 0.8615 -0