data_5FPQ
# 
_entry.id   5FPQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5FPQ         
PDBE  EBI-65684    
WWPDB D_1290065684 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 5FOQ unspecified 'ACETYLCHOLINESTERASE IN COMPLEX WITH C7653'                                             
PDB 5FPP unspecified 'STRUCTURE OF A PRE-REACTION TERNAY COMPLEX BETWEEN SARIN-ACETYLCHOLINESTERASE AND HI-6' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        5FPQ 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2015-12-02 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Allgardsson, A.' 1 
'Berg, L.'        2 
'Akfur, C.'       3 
'Hornberg, A.'    4 
'Worek, F.'       5 
'Linusson, A.'    6 
'Ekstrom, F.'     7 
# 
_citation.id                        primary 
_citation.title                     
;Structure of a Prereaction Complex between the Nerve Agent Sarin, its Biological Target Acetylcholinesterase, and the Antidote Hi-6.
;
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            113 
_citation.page_first                5514 
_citation.page_last                 ? 
_citation.year                      2016 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   27140636 
_citation.pdbx_database_id_DOI      10.1073/PNAS.1523362113 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Allgardsson, A.' 1 
primary 'Berg, L.'        2 
primary 'Akfur, C.'       3 
primary 'Hornberg, A.'    4 
primary 'Worek, F.'       5 
primary 'Linusson, A.'    6 
primary 'Ekstrom, F.J.'   7 
# 
_cell.entry_id           5FPQ 
_cell.length_a           104.869 
_cell.length_b           104.869 
_cell.length_c           323.250 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5FPQ 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE   59567.191 2   3.1.1.7 ? 'CATALYTIC DOMAIN, UNP RESIDUES 33-574' ? 
2 non-polymer syn 'PENTAETHYLENE GLYCOL' 238.278   1   ?       ? ?                                       ? 
3 water       nat water                  18.015    113 ?       ? ?                                       ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGE(SGB)AGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWA
TVGMGEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALIN
AGDFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREA
LSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLM
RYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ARG n 
1 3   GLU n 
1 4   ASP n 
1 5   ALA n 
1 6   GLU n 
1 7   LEU n 
1 8   LEU n 
1 9   VAL n 
1 10  THR n 
1 11  VAL n 
1 12  ARG n 
1 13  GLY n 
1 14  GLY n 
1 15  ARG n 
1 16  LEU n 
1 17  ARG n 
1 18  GLY n 
1 19  ILE n 
1 20  ARG n 
1 21  LEU n 
1 22  LYS n 
1 23  THR n 
1 24  PRO n 
1 25  GLY n 
1 26  GLY n 
1 27  PRO n 
1 28  VAL n 
1 29  SER n 
1 30  ALA n 
1 31  PHE n 
1 32  LEU n 
1 33  GLY n 
1 34  ILE n 
1 35  PRO n 
1 36  PHE n 
1 37  ALA n 
1 38  GLU n 
1 39  PRO n 
1 40  PRO n 
1 41  MET n 
1 42  GLY n 
1 43  PRO n 
1 44  ARG n 
1 45  ARG n 
1 46  PHE n 
1 47  LEU n 
1 48  PRO n 
1 49  PRO n 
1 50  GLU n 
1 51  PRO n 
1 52  LYS n 
1 53  GLN n 
1 54  PRO n 
1 55  TRP n 
1 56  SER n 
1 57  GLY n 
1 58  VAL n 
1 59  VAL n 
1 60  ASP n 
1 61  ALA n 
1 62  THR n 
1 63  THR n 
1 64  PHE n 
1 65  GLN n 
1 66  SER n 
1 67  VAL n 
1 68  CYS n 
1 69  TYR n 
1 70  GLN n 
1 71  TYR n 
1 72  VAL n 
1 73  ASP n 
1 74  THR n 
1 75  LEU n 
1 76  TYR n 
1 77  PRO n 
1 78  GLY n 
1 79  PHE n 
1 80  GLU n 
1 81  GLY n 
1 82  THR n 
1 83  GLU n 
1 84  MET n 
1 85  TRP n 
1 86  ASN n 
1 87  PRO n 
1 88  ASN n 
1 89  ARG n 
1 90  GLU n 
1 91  LEU n 
1 92  SER n 
1 93  GLU n 
1 94  ASP n 
1 95  CYS n 
1 96  LEU n 
1 97  TYR n 
1 98  LEU n 
1 99  ASN n 
1 100 VAL n 
1 101 TRP n 
1 102 THR n 
1 103 PRO n 
1 104 TYR n 
1 105 PRO n 
1 106 ARG n 
1 107 PRO n 
1 108 THR n 
1 109 SER n 
1 110 PRO n 
1 111 THR n 
1 112 PRO n 
1 113 VAL n 
1 114 LEU n 
1 115 VAL n 
1 116 TRP n 
1 117 ILE n 
1 118 TYR n 
1 119 GLY n 
1 120 GLY n 
1 121 GLY n 
1 122 PHE n 
1 123 TYR n 
1 124 SER n 
1 125 GLY n 
1 126 ALA n 
1 127 SER n 
1 128 SER n 
1 129 LEU n 
1 130 ASP n 
1 131 VAL n 
1 132 TYR n 
1 133 ASP n 
1 134 GLY n 
1 135 ARG n 
1 136 PHE n 
1 137 LEU n 
1 138 VAL n 
1 139 GLN n 
1 140 ALA n 
1 141 GLU n 
1 142 ARG n 
1 143 THR n 
1 144 VAL n 
1 145 LEU n 
1 146 VAL n 
1 147 SER n 
1 148 MET n 
1 149 ASN n 
1 150 TYR n 
1 151 ARG n 
1 152 VAL n 
1 153 GLY n 
1 154 ALA n 
1 155 PHE n 
1 156 GLY n 
1 157 PHE n 
1 158 LEU n 
1 159 ALA n 
1 160 LEU n 
1 161 PRO n 
1 162 GLY n 
1 163 SER n 
1 164 ARG n 
1 165 GLU n 
1 166 ALA n 
1 167 PRO n 
1 168 GLY n 
1 169 ASN n 
1 170 VAL n 
1 171 GLY n 
1 172 LEU n 
1 173 LEU n 
1 174 ASP n 
1 175 GLN n 
1 176 ARG n 
1 177 LEU n 
1 178 ALA n 
1 179 LEU n 
1 180 GLN n 
1 181 TRP n 
1 182 VAL n 
1 183 GLN n 
1 184 GLU n 
1 185 ASN n 
1 186 VAL n 
1 187 ALA n 
1 188 ALA n 
1 189 PHE n 
1 190 GLY n 
1 191 GLY n 
1 192 ASP n 
1 193 PRO n 
1 194 THR n 
1 195 SER n 
1 196 VAL n 
1 197 THR n 
1 198 LEU n 
1 199 PHE n 
1 200 GLY n 
1 201 GLU n 
1 202 SGB n 
1 203 ALA n 
1 204 GLY n 
1 205 ALA n 
1 206 ALA n 
1 207 SER n 
1 208 VAL n 
1 209 GLY n 
1 210 MET n 
1 211 HIS n 
1 212 LEU n 
1 213 LEU n 
1 214 SER n 
1 215 PRO n 
1 216 PRO n 
1 217 SER n 
1 218 ARG n 
1 219 GLY n 
1 220 LEU n 
1 221 PHE n 
1 222 HIS n 
1 223 ARG n 
1 224 ALA n 
1 225 VAL n 
1 226 LEU n 
1 227 GLN n 
1 228 SER n 
1 229 GLY n 
1 230 ALA n 
1 231 PRO n 
1 232 ASN n 
1 233 GLY n 
1 234 PRO n 
1 235 TRP n 
1 236 ALA n 
1 237 THR n 
1 238 VAL n 
1 239 GLY n 
1 240 MET n 
1 241 GLY n 
1 242 GLU n 
1 243 ALA n 
1 244 ARG n 
1 245 ARG n 
1 246 ARG n 
1 247 ALA n 
1 248 THR n 
1 249 GLN n 
1 250 LEU n 
1 251 ALA n 
1 252 HIS n 
1 253 LEU n 
1 254 VAL n 
1 255 GLY n 
1 256 CYS n 
1 257 PRO n 
1 258 PRO n 
1 259 GLY n 
1 260 GLY n 
1 261 THR n 
1 262 GLY n 
1 263 GLY n 
1 264 ASN n 
1 265 ASP n 
1 266 THR n 
1 267 GLU n 
1 268 LEU n 
1 269 VAL n 
1 270 ALA n 
1 271 CYS n 
1 272 LEU n 
1 273 ARG n 
1 274 THR n 
1 275 ARG n 
1 276 PRO n 
1 277 ALA n 
1 278 GLN n 
1 279 VAL n 
1 280 LEU n 
1 281 VAL n 
1 282 ASN n 
1 283 HIS n 
1 284 GLU n 
1 285 TRP n 
1 286 HIS n 
1 287 VAL n 
1 288 LEU n 
1 289 PRO n 
1 290 GLN n 
1 291 GLU n 
1 292 SER n 
1 293 VAL n 
1 294 PHE n 
1 295 ARG n 
1 296 PHE n 
1 297 SER n 
1 298 PHE n 
1 299 VAL n 
1 300 PRO n 
1 301 VAL n 
1 302 VAL n 
1 303 ASP n 
1 304 GLY n 
1 305 ASP n 
1 306 PHE n 
1 307 LEU n 
1 308 SER n 
1 309 ASP n 
1 310 THR n 
1 311 PRO n 
1 312 GLU n 
1 313 ALA n 
1 314 LEU n 
1 315 ILE n 
1 316 ASN n 
1 317 ALA n 
1 318 GLY n 
1 319 ASP n 
1 320 PHE n 
1 321 HIS n 
1 322 GLY n 
1 323 LEU n 
1 324 GLN n 
1 325 VAL n 
1 326 LEU n 
1 327 VAL n 
1 328 GLY n 
1 329 VAL n 
1 330 VAL n 
1 331 LYS n 
1 332 ASP n 
1 333 GLU n 
1 334 GLY n 
1 335 SER n 
1 336 TYR n 
1 337 PHE n 
1 338 LEU n 
1 339 VAL n 
1 340 TYR n 
1 341 GLY n 
1 342 ALA n 
1 343 PRO n 
1 344 GLY n 
1 345 PHE n 
1 346 SER n 
1 347 LYS n 
1 348 ASP n 
1 349 ASN n 
1 350 GLU n 
1 351 SER n 
1 352 LEU n 
1 353 ILE n 
1 354 SER n 
1 355 ARG n 
1 356 ALA n 
1 357 GLU n 
1 358 PHE n 
1 359 LEU n 
1 360 ALA n 
1 361 GLY n 
1 362 VAL n 
1 363 ARG n 
1 364 VAL n 
1 365 GLY n 
1 366 VAL n 
1 367 PRO n 
1 368 GLN n 
1 369 VAL n 
1 370 SER n 
1 371 ASP n 
1 372 LEU n 
1 373 ALA n 
1 374 ALA n 
1 375 GLU n 
1 376 ALA n 
1 377 VAL n 
1 378 VAL n 
1 379 LEU n 
1 380 HIS n 
1 381 TYR n 
1 382 THR n 
1 383 ASP n 
1 384 TRP n 
1 385 LEU n 
1 386 HIS n 
1 387 PRO n 
1 388 GLU n 
1 389 ASP n 
1 390 PRO n 
1 391 ALA n 
1 392 ARG n 
1 393 LEU n 
1 394 ARG n 
1 395 GLU n 
1 396 ALA n 
1 397 LEU n 
1 398 SER n 
1 399 ASP n 
1 400 VAL n 
1 401 VAL n 
1 402 GLY n 
1 403 ASP n 
1 404 HIS n 
1 405 ASN n 
1 406 VAL n 
1 407 VAL n 
1 408 CYS n 
1 409 PRO n 
1 410 VAL n 
1 411 ALA n 
1 412 GLN n 
1 413 LEU n 
1 414 ALA n 
1 415 GLY n 
1 416 ARG n 
1 417 LEU n 
1 418 ALA n 
1 419 ALA n 
1 420 GLN n 
1 421 GLY n 
1 422 ALA n 
1 423 ARG n 
1 424 VAL n 
1 425 TYR n 
1 426 ALA n 
1 427 TYR n 
1 428 VAL n 
1 429 PHE n 
1 430 GLU n 
1 431 HIS n 
1 432 ARG n 
1 433 ALA n 
1 434 SER n 
1 435 THR n 
1 436 LEU n 
1 437 SER n 
1 438 TRP n 
1 439 PRO n 
1 440 LEU n 
1 441 TRP n 
1 442 MET n 
1 443 GLY n 
1 444 VAL n 
1 445 PRO n 
1 446 HIS n 
1 447 GLY n 
1 448 TYR n 
1 449 GLU n 
1 450 ILE n 
1 451 GLU n 
1 452 PHE n 
1 453 ILE n 
1 454 PHE n 
1 455 GLY n 
1 456 ILE n 
1 457 PRO n 
1 458 LEU n 
1 459 ASP n 
1 460 PRO n 
1 461 SER n 
1 462 ARG n 
1 463 ASN n 
1 464 TYR n 
1 465 THR n 
1 466 ALA n 
1 467 GLU n 
1 468 GLU n 
1 469 LYS n 
1 470 ILE n 
1 471 PHE n 
1 472 ALA n 
1 473 GLN n 
1 474 ARG n 
1 475 LEU n 
1 476 MET n 
1 477 ARG n 
1 478 TYR n 
1 479 TRP n 
1 480 ALA n 
1 481 ASN n 
1 482 PHE n 
1 483 ALA n 
1 484 ARG n 
1 485 THR n 
1 486 GLY n 
1 487 ASP n 
1 488 PRO n 
1 489 ASN n 
1 490 GLU n 
1 491 PRO n 
1 492 ARG n 
1 493 ASP n 
1 494 PRO n 
1 495 LYS n 
1 496 ALA n 
1 497 PRO n 
1 498 GLN n 
1 499 TRP n 
1 500 PRO n 
1 501 PRO n 
1 502 TYR n 
1 503 THR n 
1 504 ALA n 
1 505 GLY n 
1 506 ALA n 
1 507 GLN n 
1 508 GLN n 
1 509 TYR n 
1 510 VAL n 
1 511 SER n 
1 512 LEU n 
1 513 ASP n 
1 514 LEU n 
1 515 ARG n 
1 516 PRO n 
1 517 LEU n 
1 518 GLU n 
1 519 VAL n 
1 520 ARG n 
1 521 ARG n 
1 522 GLY n 
1 523 LEU n 
1 524 ARG n 
1 525 ALA n 
1 526 GLN n 
1 527 ALA n 
1 528 CYS n 
1 529 ALA n 
1 530 PHE n 
1 531 TRP n 
1 532 ASN n 
1 533 ARG n 
1 534 PHE n 
1 535 LEU n 
1 536 PRO n 
1 537 LYS n 
1 538 LEU n 
1 539 LEU n 
1 540 SER n 
1 541 ALA n 
1 542 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               HUMAN 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293F 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P22303 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5FPQ A 1 ? 542 ? P22303 33 ? 574 ? 2 543 
2 1 5FPQ B 1 ? 542 ? P22303 33 ? 574 ? 2 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1PE non-polymer         . 'PENTAETHYLENE GLYCOL'                              PEG400 'C10 H22 O6'     238.278 
ALA 'L-peptide linking' y ALANINE                                             ?      'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                            ?      'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                          ?      'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                     ?      'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                            ?      'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                           ?      'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                     ?      'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                             ?      'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                           ?      'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                               ?      'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                          ?      'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                             ?      'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                              ?      'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                          ?      'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                       ?      'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                             ?      'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                              ?      'C3 H7 N O3'     105.093 
SGB 'L-peptide linking' n 'O-[(S)-METHYL(1-METHYLETHOXY)PHOSPHORYL]-L-SERINE' ?      'C7 H16 N O5 P'  225.179 
THR 'L-peptide linking' y THREONINE                                           ?      'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                          ?      'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                            ?      'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                              ?      'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          5FPQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.31 
_exptl_crystal.density_percent_sol   71.44 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'PH 7' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.919 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I911-3' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I911-3 
_diffrn_source.pdbx_wavelength             0.919 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5FPQ 
_reflns.observed_criterion_sigma_I   3.9 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             47.20 
_reflns.d_resolution_high            2.40 
_reflns.number_obs                   81717 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.10 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.20 
_reflns.B_iso_Wilson_estimate        32.71 
_reflns.pdbx_redundancy              5 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              ? 
_reflns_shell.percent_possible_all   99.4 
_reflns_shell.Rmerge_I_obs           0.46 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.90 
_reflns_shell.pdbx_redundancy        5.1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5FPQ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     81198 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.410 
_refine.ls_d_res_high                            2.400 
_refine.ls_percent_reflns_obs                    99.36 
_refine.ls_R_factor_obs                          0.1784 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1767 
_refine.ls_R_factor_R_free                       0.2103 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  4144 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4EY4' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.25 
_refine.pdbx_overall_phase_error                 19.30 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8282 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         16 
_refine_hist.number_atoms_solvent             113 
_refine_hist.number_atoms_total               8411 
_refine_hist.d_res_high                       2.400 
_refine_hist.d_res_low                        45.410 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.008  ? ? 8687  'X-RAY DIFFRACTION' ? 
f_angle_d          1.081  ? ? 11874 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 14.655 ? ? 3143  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.079  ? ? 1256  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 1578  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.4000 2.4273  2555 0.2179 99.00  0.2771 . . 132 . . 
'X-RAY DIFFRACTION' . 2.4273 2.4558  2548 0.2081 99.00  0.2579 . . 132 . . 
'X-RAY DIFFRACTION' . 2.4558 2.4858  2504 0.2077 99.00  0.2526 . . 136 . . 
'X-RAY DIFFRACTION' . 2.4858 2.5173  2533 0.1909 99.00  0.2465 . . 127 . . 
'X-RAY DIFFRACTION' . 2.5173 2.5504  2504 0.2001 99.00  0.2592 . . 161 . . 
'X-RAY DIFFRACTION' . 2.5504 2.5853  2523 0.1908 99.00  0.2626 . . 120 . . 
'X-RAY DIFFRACTION' . 2.5853 2.6222  2579 0.1916 99.00  0.2047 . . 138 . . 
'X-RAY DIFFRACTION' . 2.6222 2.6614  2490 0.1861 99.00  0.2370 . . 133 . . 
'X-RAY DIFFRACTION' . 2.6614 2.7030  2562 0.1862 99.00  0.2159 . . 140 . . 
'X-RAY DIFFRACTION' . 2.7030 2.7473  2560 0.1909 99.00  0.2445 . . 137 . . 
'X-RAY DIFFRACTION' . 2.7473 2.7946  2485 0.1947 99.00  0.2216 . . 146 . . 
'X-RAY DIFFRACTION' . 2.7946 2.8454  2546 0.2008 99.00  0.2423 . . 135 . . 
'X-RAY DIFFRACTION' . 2.8454 2.9002  2529 0.2106 99.00  0.2403 . . 148 . . 
'X-RAY DIFFRACTION' . 2.9002 2.9594  2544 0.2058 100.00 0.2730 . . 135 . . 
'X-RAY DIFFRACTION' . 2.9594 3.0237  2565 0.1987 99.00  0.2412 . . 144 . . 
'X-RAY DIFFRACTION' . 3.0237 3.0940  2567 0.2084 100.00 0.2666 . . 119 . . 
'X-RAY DIFFRACTION' . 3.0940 3.1714  2556 0.2071 99.00  0.2543 . . 133 . . 
'X-RAY DIFFRACTION' . 3.1714 3.2571  2561 0.2072 100.00 0.2334 . . 129 . . 
'X-RAY DIFFRACTION' . 3.2571 3.3529  2549 0.1992 99.00  0.2289 . . 143 . . 
'X-RAY DIFFRACTION' . 3.3529 3.4611  2562 0.1982 99.00  0.2162 . . 143 . . 
'X-RAY DIFFRACTION' . 3.4611 3.5847  2560 0.1935 99.00  0.2379 . . 146 . . 
'X-RAY DIFFRACTION' . 3.5847 3.7282  2585 0.1735 99.00  0.2095 . . 132 . . 
'X-RAY DIFFRACTION' . 3.7282 3.8978  2580 0.1573 100.00 0.1795 . . 145 . . 
'X-RAY DIFFRACTION' . 3.8978 4.1032  2556 0.1444 100.00 0.1816 . . 150 . . 
'X-RAY DIFFRACTION' . 4.1032 4.3601  2637 0.1363 100.00 0.1462 . . 130 . . 
'X-RAY DIFFRACTION' . 4.3601 4.6964  2594 0.1273 100.00 0.1452 . . 135 . . 
'X-RAY DIFFRACTION' . 4.6964 5.1684  2617 0.1344 99.00  0.1657 . . 147 . . 
'X-RAY DIFFRACTION' . 5.1684 5.9149  2641 0.1557 99.00  0.2036 . . 131 . . 
'X-RAY DIFFRACTION' . 5.9149 7.4468  2676 0.1737 100.00 0.2029 . . 143 . . 
'X-RAY DIFFRACTION' . 7.4468 45.4177 2786 0.1788 98.00  0.1843 . . 154 . . 
# 
_struct.entry_id                  5FPQ 
_struct.title                     'Structure of Homo sapiens acetylcholinesterase phosphonylated by sarin.' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        5FPQ 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'HYDROLASE, SIGNALING PROTEIN, ACETYLCHOLINESTERASE, SARIN, HI-6, QM, DENSITY FUNCTIONAL THEORY CALCULATIONS, MICHAELIS COMPLEX.' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 4   ? GLU A 6   ? ASP A 5   GLU A 7   5 ? 3  
HELX_P HELX_P2  2  MET A 41  ? ARG A 45  ? MET A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 79  ? MET A 84  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 129 ? ASP A 133 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 134 ? ARG A 142 ? GLY A 135 ARG A 143 1 ? 9  
HELX_P HELX_P6  6  VAL A 152 ? LEU A 158 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 169 ? VAL A 186 ? ASN A 170 VAL A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 187 ? PHE A 189 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  ALA A 203 ? LEU A 213 ? ALA A 204 LEU A 214 1 ? 11 
HELX_P HELX_P10 10 SER A 214 ? GLY A 219 ? SER A 215 GLY A 220 1 ? 6  
HELX_P HELX_P11 11 GLY A 239 ? VAL A 254 ? GLY A 240 VAL A 255 1 ? 16 
HELX_P HELX_P12 12 ASN A 264 ? THR A 274 ? ASN A 265 THR A 275 1 ? 11 
HELX_P HELX_P13 13 PRO A 276 ? GLU A 284 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 14 TRP A 285 ? LEU A 288 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P15 15 THR A 310 ? GLY A 318 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 16 GLY A 334 ? VAL A 339 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P17 17 SER A 354 ? VAL A 366 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 370 ? THR A 382 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 389 ? VAL A 406 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 406 ? GLN A 420 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 21 PRO A 439 ? GLY A 443 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 449 ? PHE A 454 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 455 ? ASP A 459 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 24 THR A 465 ? GLY A 486 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 25 ARG A 524 ? ARG A 533 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 26 PHE A 534 ? SER A 540 ? PHE A 535 SER A 541 1 ? 7  
HELX_P HELX_P27 27 ASP B 4   ? GLU B 6   ? ASP B 5   GLU B 7   5 ? 3  
HELX_P HELX_P28 28 MET B 41  ? ARG B 45  ? MET B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 29 PHE B 79  ? MET B 84  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 30 LEU B 129 ? ASP B 133 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 31 GLY B 134 ? ARG B 142 ? GLY B 135 ARG B 143 1 ? 9  
HELX_P HELX_P32 32 VAL B 152 ? LEU B 158 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P33 33 ASN B 169 ? VAL B 186 ? ASN B 170 VAL B 187 1 ? 18 
HELX_P HELX_P34 34 ALA B 187 ? PHE B 189 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 35 ALA B 203 ? LEU B 213 ? ALA B 204 LEU B 214 1 ? 11 
HELX_P HELX_P36 36 SER B 214 ? GLY B 219 ? SER B 215 GLY B 220 1 ? 6  
HELX_P HELX_P37 37 MET B 240 ? VAL B 254 ? MET B 241 VAL B 255 1 ? 15 
HELX_P HELX_P38 38 ASN B 264 ? THR B 274 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P39 39 PRO B 276 ? ASN B 282 ? PRO B 277 ASN B 283 1 ? 7  
HELX_P HELX_P40 40 HIS B 283 ? LEU B 288 ? HIS B 284 LEU B 289 5 ? 6  
HELX_P HELX_P41 41 THR B 310 ? GLY B 318 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P42 42 GLY B 334 ? VAL B 339 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P43 43 SER B 354 ? VAL B 366 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 44 SER B 370 ? THR B 382 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P45 45 ASP B 389 ? VAL B 406 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 46 VAL B 406 ? GLN B 420 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 47 PRO B 439 ? GLY B 443 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 48 GLU B 449 ? PHE B 454 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 49 GLY B 455 ? ASP B 459 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P50 50 THR B 465 ? GLY B 486 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P51 51 ARG B 524 ? ARG B 533 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P52 52 ARG B 533 ? ALA B 541 ? ARG B 534 ALA B 542 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 68  SG ? ? ? 1_555 A CYS 95  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.069 ? 
disulf2 disulf ? ? A CYS 256 SG ? ? ? 1_555 A CYS 271 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf3 disulf ? ? A CYS 408 SG ? ? ? 1_555 A CYS 528 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.062 ? 
disulf4 disulf ? ? B CYS 68  SG ? ? ? 1_555 B CYS 95  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.081 ? 
disulf5 disulf ? ? B CYS 256 SG ? ? ? 1_555 B CYS 271 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.064 ? 
disulf6 disulf ? ? B CYS 408 SG ? ? ? 1_555 B CYS 528 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.058 ? 
covale1 covale ? ? A GLU 201 C  ? ? ? 1_555 A SGB 202 N  ? ? A GLU 202 A SGB 203 1_555 ? ? ? ? ? ? ? 1.342 ? 
covale2 covale ? ? A SGB 202 C  ? ? ? 1_555 A ALA 203 N  ? ? A SGB 203 A ALA 204 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale3 covale ? ? B GLU 201 C  ? ? ? 1_555 B SGB 202 N  ? ? B GLU 202 B SGB 203 1_555 ? ? ? ? ? ? ? 1.345 ? 
covale4 covale ? ? B SGB 202 C  ? ? ? 1_555 B ALA 203 N  ? ? B SGB 203 B ALA 204 1_555 ? ? ? ? ? ? ? 1.336 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 104 A . ? TYR 105 A PRO 105 A ? PRO 106 A 1 2.77 
2 TYR 104 B . ? TYR 105 B PRO 105 B ? PRO 106 B 1 1.48 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
BA ? 3  ? 
BB ? 11 ? 
BC ? 2  ? 
BD ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
BA 1  2  ? anti-parallel 
BA 2  3  ? parallel      
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? parallel      
BB 5  6  ? parallel      
BB 6  7  ? parallel      
BB 7  8  ? parallel      
BB 8  9  ? parallel      
BB 9  10 ? parallel      
BB 10 11 ? anti-parallel 
BC 1  2  ? parallel      
BD 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 8   ? VAL A 11  ? LEU A 9   VAL A 12  
AA 2  GLY A 14  ? ARG A 17  ? GLY A 15  ARG A 18  
AA 3  VAL A 58  ? ASP A 60  ? VAL A 59  ASP A 61  
AB 1  ILE A 19  ? LEU A 21  ? ILE A 20  LEU A 22  
AB 2  VAL A 28  ? PRO A 35  ? VAL A 29  PRO A 36  
AB 3  TYR A 97  ? PRO A 103 ? TYR A 98  PRO A 104 
AB 4  VAL A 144 ? MET A 148 ? VAL A 145 MET A 149 
AB 5  THR A 111 ? ILE A 117 ? THR A 112 ILE A 118 
AB 6  GLY A 191 ? GLY A 200 ? GLY A 192 GLY A 201 
AB 7  ARG A 223 ? GLN A 227 ? ARG A 224 GLN A 228 
AB 8  GLN A 324 ? VAL A 330 ? GLN A 325 VAL A 331 
AB 9  ARG A 423 ? PHE A 429 ? ARG A 424 PHE A 430 
AB 10 GLN A 508 ? LEU A 512 ? GLN A 509 LEU A 513 
AB 11 GLU A 518 ? ARG A 521 ? GLU A 519 ARG A 522 
AC 1  VAL A 67  ? CYS A 68  ? VAL A 68  CYS A 69  
AC 2  LEU A 91  ? SER A 92  ? LEU A 92  SER A 93  
BA 1  LEU B 8   ? VAL B 11  ? LEU B 9   VAL B 12  
BA 2  GLY B 14  ? ARG B 17  ? GLY B 15  ARG B 18  
BA 3  VAL B 58  ? ASP B 60  ? VAL B 59  ASP B 61  
BB 1  ILE B 19  ? LEU B 21  ? ILE B 20  LEU B 22  
BB 2  VAL B 28  ? PRO B 35  ? VAL B 29  PRO B 36  
BB 3  TYR B 97  ? PRO B 103 ? TYR B 98  PRO B 104 
BB 4  VAL B 144 ? MET B 148 ? VAL B 145 MET B 149 
BB 5  THR B 111 ? ILE B 117 ? THR B 112 ILE B 118 
BB 6  GLY B 191 ? GLY B 200 ? GLY B 192 GLY B 201 
BB 7  ARG B 223 ? GLN B 227 ? ARG B 224 GLN B 228 
BB 8  GLN B 324 ? VAL B 330 ? GLN B 325 VAL B 331 
BB 9  ARG B 423 ? PHE B 429 ? ARG B 424 PHE B 430 
BB 10 GLN B 508 ? LEU B 512 ? GLN B 509 LEU B 513 
BB 11 GLU B 518 ? ARG B 521 ? GLU B 519 ARG B 522 
BC 1  VAL B 67  ? CYS B 68  ? VAL B 68  CYS B 69  
BC 2  LEU B 91  ? SER B 92  ? LEU B 92  SER B 93  
BD 1  VAL B 238 ? GLY B 239 ? VAL B 239 GLY B 240 
BD 2  VAL B 301 ? VAL B 302 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N VAL A 11  ? N VAL A 12  O GLY A 14  ? O GLY A 15  
AA 2  3  N ARG A 17  ? N ARG A 18  O VAL A 59  ? O VAL A 60  
AB 1  2  N LEU A 21  ? N LEU A 22  O VAL A 28  ? O VAL A 29  
AB 2  3  N ILE A 34  ? N ILE A 35  O LEU A 98  ? O LEU A 99  
AB 3  4  N TRP A 101 ? N TRP A 102 O LEU A 145 ? O LEU A 146 
AB 4  5  N VAL A 144 ? N VAL A 145 O PRO A 112 ? O PRO A 113 
AB 5  6  O THR A 111 ? O THR A 112 N ASP A 192 ? N ASP A 193 
AB 6  7  N LEU A 198 ? N LEU A 199 O ARG A 223 ? O ARG A 224 
AB 7  8  N ALA A 224 ? N ALA A 225 O GLN A 324 ? O GLN A 325 
AB 8  9  N VAL A 325 ? N VAL A 326 O ARG A 423 ? O ARG A 424 
AB 9  10 N VAL A 428 ? N VAL A 429 O VAL A 510 ? O VAL A 511 
AB 10 11 N SER A 511 ? N SER A 512 O GLU A 518 ? O GLU A 519 
AC 1  2  O VAL A 67  ? O VAL A 68  N SER A 92  ? N SER A 93  
BA 1  2  N VAL B 11  ? N VAL B 12  O GLY B 14  ? O GLY B 15  
BA 2  3  N ARG B 17  ? N ARG B 18  O VAL B 59  ? O VAL B 60  
BB 1  2  N LEU B 21  ? N LEU B 22  O VAL B 28  ? O VAL B 29  
BB 2  3  N ILE B 34  ? N ILE B 35  O LEU B 98  ? O LEU B 99  
BB 3  4  N TRP B 101 ? N TRP B 102 O LEU B 145 ? O LEU B 146 
BB 4  5  N VAL B 144 ? N VAL B 145 O PRO B 112 ? O PRO B 113 
BB 5  6  O THR B 111 ? O THR B 112 N ASP B 192 ? N ASP B 193 
BB 6  7  N LEU B 198 ? N LEU B 199 O ARG B 223 ? O ARG B 224 
BB 7  8  N ALA B 224 ? N ALA B 225 O GLN B 324 ? O GLN B 325 
BB 8  9  N VAL B 325 ? N VAL B 326 O ARG B 423 ? O ARG B 424 
BB 9  10 N VAL B 428 ? N VAL B 429 O VAL B 510 ? O VAL B 511 
BB 10 11 N SER B 511 ? N SER B 512 O GLU B 518 ? O GLU B 519 
BC 1  2  O VAL B 67  ? O VAL B 68  N SER B 92  ? N SER B 93  
BD 1  2  O VAL B 238 ? O VAL B 239 N VAL B 302 ? N VAL B 303 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'BINDING SITE FOR RESIDUE 1PE A 1543' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 MET A 240 ? MET A 241  . ? 1_555 ? 
2 AC1 6 ASP A 303 ? ASP A 304  . ? 1_555 ? 
3 AC1 6 GLY A 304 ? GLY A 305  . ? 1_555 ? 
4 AC1 6 ASP A 305 ? ASP A 306  . ? 1_555 ? 
5 AC1 6 HOH D .   ? HOH A 2041 . ? 1_555 ? 
6 AC1 6 ASN B 282 ? ASN B 283  . ? 1_455 ? 
# 
_database_PDB_matrix.entry_id          5FPQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5FPQ 
_atom_sites.fract_transf_matrix[1][1]   0.009536 
_atom_sites.fract_transf_matrix[1][2]   0.005505 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011011 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003094 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . GLU A 1 3   ? 79.011  41.001 54.287  1.00 78.70  ? 4    GLU A N    1 
ATOM   2    C CA   . GLU A 1 3   ? 77.721  41.098 53.609  1.00 80.84  ? 4    GLU A CA   1 
ATOM   3    C C    . GLU A 1 3   ? 77.791  42.105 52.445  1.00 81.78  ? 4    GLU A C    1 
ATOM   4    O O    . GLU A 1 3   ? 77.896  43.313 52.663  1.00 84.02  ? 4    GLU A O    1 
ATOM   5    C CB   . GLU A 1 3   ? 76.621  41.469 54.617  1.00 82.92  ? 4    GLU A CB   1 
ATOM   6    C CG   . GLU A 1 3   ? 75.175  41.160 54.176  1.00 89.17  ? 4    GLU A CG   1 
ATOM   7    C CD   . GLU A 1 3   ? 74.755  39.689 54.355  1.00 89.98  ? 4    GLU A CD   1 
ATOM   8    O OE1  . GLU A 1 3   ? 75.632  38.819 54.559  1.00 95.92  ? 4    GLU A OE1  1 
ATOM   9    O OE2  . GLU A 1 3   ? 73.535  39.405 54.285  1.00 78.79  ? 4    GLU A OE2  1 
ATOM   10   N N    . ASP A 1 4   ? 77.735  41.586 51.215  1.00 77.05  ? 5    ASP A N    1 
ATOM   11   C CA   . ASP A 1 4   ? 77.887  42.365 49.977  1.00 69.78  ? 5    ASP A CA   1 
ATOM   12   C C    . ASP A 1 4   ? 76.641  43.200 49.654  1.00 69.71  ? 5    ASP A C    1 
ATOM   13   O O    . ASP A 1 4   ? 75.551  42.659 49.454  1.00 70.43  ? 5    ASP A O    1 
ATOM   14   C CB   . ASP A 1 4   ? 78.187  41.402 48.818  1.00 69.43  ? 5    ASP A CB   1 
ATOM   15   C CG   . ASP A 1 4   ? 78.549  42.111 47.515  1.00 71.03  ? 5    ASP A CG   1 
ATOM   16   O OD1  . ASP A 1 4   ? 78.230  43.310 47.345  1.00 72.69  ? 5    ASP A OD1  1 
ATOM   17   O OD2  . ASP A 1 4   ? 79.157  41.447 46.645  1.00 69.92  ? 5    ASP A OD2  1 
ATOM   18   N N    . ALA A 1 5   ? 76.815  44.517 49.568  1.00 65.93  ? 6    ALA A N    1 
ATOM   19   C CA   . ALA A 1 5   ? 75.693  45.435 49.357  1.00 59.16  ? 6    ALA A CA   1 
ATOM   20   C C    . ALA A 1 5   ? 74.982  45.262 48.015  1.00 54.04  ? 6    ALA A C    1 
ATOM   21   O O    . ALA A 1 5   ? 73.786  45.542 47.909  1.00 49.76  ? 6    ALA A O    1 
ATOM   22   C CB   . ALA A 1 5   ? 76.142  46.874 49.534  1.00 60.37  ? 6    ALA A CB   1 
ATOM   23   N N    . GLU A 1 6   ? 75.715  44.816 46.996  1.00 51.66  ? 7    GLU A N    1 
ATOM   24   C CA   . GLU A 1 6   ? 75.127  44.599 45.675  1.00 51.17  ? 7    GLU A CA   1 
ATOM   25   C C    . GLU A 1 6   ? 74.158  43.413 45.665  1.00 44.64  ? 7    GLU A C    1 
ATOM   26   O O    . GLU A 1 6   ? 73.349  43.260 44.746  1.00 36.70  ? 7    GLU A O    1 
ATOM   27   C CB   . GLU A 1 6   ? 76.224  44.385 44.628  1.00 58.61  ? 7    GLU A CB   1 
ATOM   28   C CG   . GLU A 1 6   ? 77.021  45.639 44.262  1.00 68.80  ? 7    GLU A CG   1 
ATOM   29   C CD   . GLU A 1 6   ? 76.256  46.589 43.347  1.00 74.94  ? 7    GLU A CD   1 
ATOM   30   O OE1  . GLU A 1 6   ? 75.264  46.155 42.722  1.00 77.19  ? 7    GLU A OE1  1 
ATOM   31   O OE2  . GLU A 1 6   ? 76.651  47.771 43.249  1.00 75.85  ? 7    GLU A OE2  1 
ATOM   32   N N    . LEU A 1 7   ? 74.248  42.564 46.683  1.00 38.87  ? 8    LEU A N    1 
ATOM   33   C CA   . LEU A 1 7   ? 73.428  41.361 46.722  1.00 37.63  ? 8    LEU A CA   1 
ATOM   34   C C    . LEU A 1 7   ? 72.253  41.511 47.692  1.00 38.83  ? 8    LEU A C    1 
ATOM   35   O O    . LEU A 1 7   ? 71.504  40.564 47.935  1.00 39.11  ? 8    LEU A O    1 
ATOM   36   C CB   . LEU A 1 7   ? 74.291  40.141 47.047  1.00 31.44  ? 8    LEU A CB   1 
ATOM   37   C CG   . LEU A 1 7   ? 75.473  39.959 46.089  1.00 35.51  ? 8    LEU A CG   1 
ATOM   38   C CD1  . LEU A 1 7   ? 76.341  38.790 46.524  1.00 34.84  ? 8    LEU A CD1  1 
ATOM   39   C CD2  . LEU A 1 7   ? 74.991  39.748 44.663  1.00 34.03  ? 8    LEU A CD2  1 
ATOM   40   N N    . LEU A 1 8   ? 72.095  42.721 48.222  1.00 39.07  ? 9    LEU A N    1 
ATOM   41   C CA   . LEU A 1 8   ? 71.009  43.040 49.140  1.00 32.28  ? 9    LEU A CA   1 
ATOM   42   C C    . LEU A 1 8   ? 70.104  44.070 48.497  1.00 32.52  ? 9    LEU A C    1 
ATOM   43   O O    . LEU A 1 8   ? 70.566  45.092 48.004  1.00 48.29  ? 9    LEU A O    1 
ATOM   44   C CB   . LEU A 1 8   ? 71.564  43.586 50.454  1.00 30.71  ? 9    LEU A CB   1 
ATOM   45   C CG   . LEU A 1 8   ? 72.267  42.518 51.286  1.00 34.23  ? 9    LEU A CG   1 
ATOM   46   C CD1  . LEU A 1 8   ? 72.941  43.127 52.499  1.00 36.55  ? 9    LEU A CD1  1 
ATOM   47   C CD2  . LEU A 1 8   ? 71.256  41.470 51.706  1.00 29.01  ? 9    LEU A CD2  1 
ATOM   48   N N    . VAL A 1 9   ? 68.810  43.792 48.500  1.00 27.43  ? 10   VAL A N    1 
ATOM   49   C CA   . VAL A 1 9   ? 67.833  44.676 47.890  1.00 34.45  ? 10   VAL A CA   1 
ATOM   50   C C    . VAL A 1 9   ? 66.583  44.682 48.742  1.00 31.10  ? 10   VAL A C    1 
ATOM   51   O O    . VAL A 1 9   ? 66.215  43.660 49.320  1.00 26.56  ? 10   VAL A O    1 
ATOM   52   C CB   . VAL A 1 9   ? 67.457  44.197 46.475  1.00 37.68  ? 10   VAL A CB   1 
ATOM   53   C CG1  . VAL A 1 9   ? 66.327  45.030 45.919  1.00 38.92  ? 10   VAL A CG1  1 
ATOM   54   C CG2  . VAL A 1 9   ? 68.658  44.281 45.563  1.00 47.00  ? 10   VAL A CG2  1 
ATOM   55   N N    . THR A 1 10  ? 65.932  45.832 48.827  1.00 33.49  ? 11   THR A N    1 
ATOM   56   C CA   . THR A 1 10  ? 64.657  45.910 49.519  1.00 32.27  ? 11   THR A CA   1 
ATOM   57   C C    . THR A 1 10  ? 63.536  46.119 48.509  1.00 30.65  ? 11   THR A C    1 
ATOM   58   O O    . THR A 1 10  ? 63.539  47.091 47.748  1.00 33.44  ? 11   THR A O    1 
ATOM   59   C CB   . THR A 1 10  ? 64.644  47.038 50.563  1.00 35.32  ? 11   THR A CB   1 
ATOM   60   O OG1  . THR A 1 10  ? 65.562  46.723 51.619  1.00 41.27  ? 11   THR A OG1  1 
ATOM   61   C CG2  . THR A 1 10  ? 63.266  47.183 51.152  1.00 35.84  ? 11   THR A CG2  1 
ATOM   62   N N    . VAL A 1 11  ? 62.586  45.192 48.490  1.00 33.77  ? 12   VAL A N    1 
ATOM   63   C CA   . VAL A 1 11  ? 61.388  45.343 47.662  1.00 35.02  ? 12   VAL A CA   1 
ATOM   64   C C    . VAL A 1 11  ? 60.220  45.599 48.595  1.00 34.22  ? 12   VAL A C    1 
ATOM   65   O O    . VAL A 1 11  ? 60.407  45.604 49.808  1.00 34.94  ? 12   VAL A O    1 
ATOM   66   C CB   . VAL A 1 11  ? 61.130  44.098 46.832  1.00 26.16  ? 12   VAL A CB   1 
ATOM   67   C CG1  . VAL A 1 11  ? 62.193  43.967 45.774  1.00 22.96  ? 12   VAL A CG1  1 
ATOM   68   C CG2  . VAL A 1 11  ? 61.123  42.873 47.738  1.00 23.92  ? 12   VAL A CG2  1 
ATOM   69   N N    . ARG A 1 12  ? 59.021  45.797 48.056  1.00 34.56  ? 13   ARG A N    1 
ATOM   70   C CA   . ARG A 1 12  ? 57.913  46.211 48.918  1.00 43.15  ? 13   ARG A CA   1 
ATOM   71   C C    . ARG A 1 12  ? 57.575  45.201 50.002  1.00 42.32  ? 13   ARG A C    1 
ATOM   72   O O    . ARG A 1 12  ? 57.199  45.581 51.103  1.00 44.56  ? 13   ARG A O    1 
ATOM   73   C CB   . ARG A 1 12  ? 56.675  46.599 48.111  1.00 49.06  ? 13   ARG A CB   1 
ATOM   74   C CG   . ARG A 1 12  ? 56.831  47.962 47.470  1.00 63.96  ? 13   ARG A CG   1 
ATOM   75   C CD   . ARG A 1 12  ? 55.562  48.452 46.809  1.00 76.49  ? 13   ARG A CD   1 
ATOM   76   N NE   . ARG A 1 12  ? 55.859  49.565 45.910  1.00 84.32  ? 13   ARG A NE   1 
ATOM   77   C CZ   . ARG A 1 12  ? 54.950  50.215 45.193  1.00 85.65  ? 13   ARG A CZ   1 
ATOM   78   N NH1  . ARG A 1 12  ? 53.674  49.870 45.272  1.00 87.64  ? 13   ARG A NH1  1 
ATOM   79   N NH2  . ARG A 1 12  ? 55.320  51.212 44.398  1.00 82.84  ? 13   ARG A NH2  1 
ATOM   80   N N    . GLY A 1 13  ? 57.738  43.920 49.694  1.00 41.54  ? 14   GLY A N    1 
ATOM   81   C CA   . GLY A 1 13  ? 57.419  42.866 50.636  1.00 41.77  ? 14   GLY A CA   1 
ATOM   82   C C    . GLY A 1 13  ? 58.411  42.735 51.775  1.00 43.92  ? 14   GLY A C    1 
ATOM   83   O O    . GLY A 1 13  ? 58.060  42.241 52.853  1.00 40.53  ? 14   GLY A O    1 
ATOM   84   N N    . GLY A 1 14  ? 59.650  43.167 51.540  1.00 42.55  ? 15   GLY A N    1 
ATOM   85   C CA   . GLY A 1 14  ? 60.701  43.017 52.530  1.00 25.75  ? 15   GLY A CA   1 
ATOM   86   C C    . GLY A 1 14  ? 62.093  42.945 51.927  1.00 27.35  ? 15   GLY A C    1 
ATOM   87   O O    . GLY A 1 14  ? 62.306  43.332 50.778  1.00 32.40  ? 15   GLY A O    1 
ATOM   88   N N    . ARG A 1 15  ? 63.045  42.437 52.701  1.00 25.55  ? 16   ARG A N    1 
ATOM   89   C CA   . ARG A 1 15  ? 64.440  42.375 52.268  1.00 32.11  ? 16   ARG A CA   1 
ATOM   90   C C    . ARG A 1 15  ? 64.796  41.083 51.523  1.00 31.66  ? 16   ARG A C    1 
ATOM   91   O O    . ARG A 1 15  ? 64.320  39.989 51.866  1.00 29.26  ? 16   ARG A O    1 
ATOM   92   C CB   . ARG A 1 15  ? 65.380  42.559 53.470  1.00 32.08  ? 16   ARG A CB   1 
ATOM   93   C CG   . ARG A 1 15  ? 65.408  43.976 54.013  1.00 40.53  ? 16   ARG A CG   1 
ATOM   94   C CD   . ARG A 1 15  ? 66.435  44.118 55.128  1.00 46.55  ? 16   ARG A CD   1 
ATOM   95   N NE   . ARG A 1 15  ? 65.996  43.461 56.353  1.00 51.81  ? 16   ARG A NE   1 
ATOM   96   C CZ   . ARG A 1 15  ? 66.818  43.031 57.307  1.00 56.98  ? 16   ARG A CZ   1 
ATOM   97   N NH1  . ARG A 1 15  ? 68.131  43.181 57.175  1.00 53.68  ? 16   ARG A NH1  1 
ATOM   98   N NH2  . ARG A 1 15  ? 66.325  42.441 58.390  1.00 59.18  ? 16   ARG A NH2  1 
ATOM   99   N N    . LEU A 1 16  ? 65.657  41.231 50.519  1.00 34.32  ? 17   LEU A N    1 
ATOM   100  C CA   . LEU A 1 16  ? 66.108  40.126 49.679  1.00 33.94  ? 17   LEU A CA   1 
ATOM   101  C C    . LEU A 1 16  ? 67.624  40.033 49.663  1.00 32.01  ? 17   LEU A C    1 
ATOM   102  O O    . LEU A 1 16  ? 68.322  41.053 49.609  1.00 35.48  ? 17   LEU A O    1 
ATOM   103  C CB   . LEU A 1 16  ? 65.645  40.327 48.229  1.00 29.31  ? 17   LEU A CB   1 
ATOM   104  C CG   . LEU A 1 16  ? 64.158  40.196 47.942  1.00 28.50  ? 17   LEU A CG   1 
ATOM   105  C CD1  . LEU A 1 16  ? 63.851  40.540 46.474  1.00 27.39  ? 17   LEU A CD1  1 
ATOM   106  C CD2  . LEU A 1 16  ? 63.720  38.783 48.276  1.00 25.34  ? 17   LEU A CD2  1 
ATOM   107  N N    A ARG A 1 17  ? 68.131  38.806 49.692  0.09 31.04  ? 18   ARG A N    1 
ATOM   108  N N    B ARG A 1 17  ? 68.126  38.802 49.707  0.91 29.70  ? 18   ARG A N    1 
ATOM   109  C CA   A ARG A 1 17  ? 69.554  38.562 49.521  0.09 32.21  ? 18   ARG A CA   1 
ATOM   110  C CA   B ARG A 1 17  ? 69.546  38.525 49.524  0.91 32.41  ? 18   ARG A CA   1 
ATOM   111  C C    A ARG A 1 17  ? 69.752  37.704 48.273  0.09 32.64  ? 18   ARG A C    1 
ATOM   112  C C    B ARG A 1 17  ? 69.701  37.725 48.232  0.91 34.08  ? 18   ARG A C    1 
ATOM   113  O O    A ARG A 1 17  ? 69.133  36.649 48.126  0.09 32.50  ? 18   ARG A O    1 
ATOM   114  O O    B ARG A 1 17  ? 69.002  36.728 48.009  0.91 31.98  ? 18   ARG A O    1 
ATOM   115  C CB   A ARG A 1 17  ? 70.134  37.886 50.764  0.09 32.49  ? 18   ARG A CB   1 
ATOM   116  C CB   B ARG A 1 17  ? 70.101  37.726 50.705  0.91 31.32  ? 18   ARG A CB   1 
ATOM   117  C CG   A ARG A 1 17  ? 71.520  37.300 50.581  0.09 33.70  ? 18   ARG A CG   1 
ATOM   118  C CG   B ARG A 1 17  ? 71.578  37.394 50.607  0.91 32.96  ? 18   ARG A CG   1 
ATOM   119  C CD   A ARG A 1 17  ? 72.335  37.355 51.872  0.09 37.11  ? 18   ARG A CD   1 
ATOM   120  C CD   B ARG A 1 17  ? 72.050  36.573 51.815  0.91 36.26  ? 18   ARG A CD   1 
ATOM   121  N NE   A ARG A 1 17  ? 71.507  37.464 53.072  0.09 40.52  ? 18   ARG A NE   1 
ATOM   122  N NE   B ARG A 1 17  ? 72.032  37.328 53.070  0.91 39.77  ? 18   ARG A NE   1 
ATOM   123  C CZ   A ARG A 1 17  ? 70.865  36.443 53.628  0.09 41.69  ? 18   ARG A CZ   1 
ATOM   124  C CZ   B ARG A 1 17  ? 71.161  37.141 54.064  0.91 42.53  ? 18   ARG A CZ   1 
ATOM   125  N NH1  A ARG A 1 17  ? 70.941  35.244 53.078  0.09 41.56  ? 18   ARG A NH1  1 
ATOM   126  N NH1  B ARG A 1 17  ? 70.223  36.206 53.981  0.91 41.87  ? 18   ARG A NH1  1 
ATOM   127  N NH2  A ARG A 1 17  ? 70.136  36.621 54.722  0.09 42.21  ? 18   ARG A NH2  1 
ATOM   128  N NH2  B ARG A 1 17  ? 71.237  37.887 55.158  0.91 42.82  ? 18   ARG A NH2  1 
ATOM   129  N N    . GLY A 1 18  ? 70.601  38.174 47.364  1.00 31.53  ? 19   GLY A N    1 
ATOM   130  C CA   . GLY A 1 18  ? 70.806  37.506 46.090  1.00 25.18  ? 19   GLY A CA   1 
ATOM   131  C C    . GLY A 1 18  ? 72.157  36.823 46.034  1.00 29.92  ? 19   GLY A C    1 
ATOM   132  O O    . GLY A 1 18  ? 72.828  36.642 47.054  1.00 30.96  ? 19   GLY A O    1 
ATOM   133  N N    . ILE A 1 19  ? 72.564  36.469 44.823  1.00 26.77  ? 20   ILE A N    1 
ATOM   134  C CA   . ILE A 1 19  ? 73.763  35.673 44.611  1.00 23.27  ? 20   ILE A CA   1 
ATOM   135  C C    . ILE A 1 19  ? 74.554  36.293 43.440  1.00 32.46  ? 20   ILE A C    1 
ATOM   136  O O    . ILE A 1 19  ? 73.962  36.879 42.525  1.00 28.97  ? 20   ILE A O    1 
ATOM   137  C CB   . ILE A 1 19  ? 73.351  34.193 44.351  1.00 38.81  ? 20   ILE A CB   1 
ATOM   138  C CG1  . ILE A 1 19  ? 74.494  33.226 44.621  1.00 43.83  ? 20   ILE A CG1  1 
ATOM   139  C CG2  . ILE A 1 19  ? 72.784  33.995 42.935  1.00 35.86  ? 20   ILE A CG2  1 
ATOM   140  C CD1  . ILE A 1 19  ? 74.150  31.797 44.231  1.00 45.24  ? 20   ILE A CD1  1 
ATOM   141  N N    . ARG A 1 20  ? 75.880  36.208 43.484  1.00 36.95  ? 21   ARG A N    1 
ATOM   142  C CA   . ARG A 1 20  ? 76.697  36.709 42.383  1.00 36.02  ? 21   ARG A CA   1 
ATOM   143  C C    . ARG A 1 20  ? 77.089  35.606 41.402  1.00 37.83  ? 21   ARG A C    1 
ATOM   144  O O    . ARG A 1 20  ? 77.844  34.699 41.751  1.00 39.05  ? 21   ARG A O    1 
ATOM   145  C CB   . ARG A 1 20  ? 77.966  37.371 42.905  1.00 41.21  ? 21   ARG A CB   1 
ATOM   146  C CG   . ARG A 1 20  ? 78.910  37.817 41.802  1.00 51.31  ? 21   ARG A CG   1 
ATOM   147  C CD   . ARG A 1 20  ? 80.166  38.421 42.384  1.00 68.81  ? 21   ARG A CD   1 
ATOM   148  N NE   . ARG A 1 20  ? 81.213  37.420 42.603  1.00 84.96  ? 21   ARG A NE   1 
ATOM   149  C CZ   . ARG A 1 20  ? 81.432  36.787 43.758  1.00 93.55  ? 21   ARG A CZ   1 
ATOM   150  N NH1  . ARG A 1 20  ? 80.674  37.043 44.820  1.00 97.36  ? 21   ARG A NH1  1 
ATOM   151  N NH2  . ARG A 1 20  ? 82.414  35.897 43.856  1.00 91.75  ? 21   ARG A NH2  1 
ATOM   152  N N    . LEU A 1 21  ? 76.592  35.706 40.171  1.00 36.31  ? 22   LEU A N    1 
ATOM   153  C CA   . LEU A 1 21  ? 76.878  34.727 39.120  1.00 36.84  ? 22   LEU A CA   1 
ATOM   154  C C    . LEU A 1 21  ? 78.108  35.068 38.286  1.00 42.10  ? 22   LEU A C    1 
ATOM   155  O O    . LEU A 1 21  ? 78.280  36.207 37.845  1.00 41.81  ? 22   LEU A O    1 
ATOM   156  C CB   . LEU A 1 21  ? 75.703  34.640 38.160  1.00 34.30  ? 22   LEU A CB   1 
ATOM   157  C CG   . LEU A 1 21  ? 74.353  34.235 38.713  1.00 30.11  ? 22   LEU A CG   1 
ATOM   158  C CD1  . LEU A 1 21  ? 73.476  33.857 37.544  1.00 26.33  ? 22   LEU A CD1  1 
ATOM   159  C CD2  . LEU A 1 21  ? 74.543  33.072 39.653  1.00 26.66  ? 22   LEU A CD2  1 
ATOM   160  N N    . LYS A 1 22  ? 78.950  34.070 38.043  1.00 48.00  ? 23   LYS A N    1 
ATOM   161  C CA   . LYS A 1 22  ? 80.038  34.230 37.091  1.00 44.09  ? 23   LYS A CA   1 
ATOM   162  C C    . LYS A 1 22  ? 79.499  34.044 35.672  1.00 43.22  ? 23   LYS A C    1 
ATOM   163  O O    . LYS A 1 22  ? 78.626  33.206 35.441  1.00 43.92  ? 23   LYS A O    1 
ATOM   164  C CB   . LYS A 1 22  ? 81.154  33.226 37.380  1.00 49.76  ? 23   LYS A CB   1 
ATOM   165  C CG   . LYS A 1 22  ? 81.871  33.465 38.699  1.00 60.39  ? 23   LYS A CG   1 
ATOM   166  C CD   . LYS A 1 22  ? 83.090  32.566 38.872  1.00 72.24  ? 23   LYS A CD   1 
ATOM   167  C CE   . LYS A 1 22  ? 82.705  31.094 38.844  1.00 78.97  ? 23   LYS A CE   1 
ATOM   168  N NZ   . LYS A 1 22  ? 83.903  30.200 38.830  1.00 82.86  ? 23   LYS A NZ   1 
ATOM   169  N N    . THR A 1 23  ? 79.984  34.857 34.736  1.00 45.29  ? 24   THR A N    1 
ATOM   170  C CA   . THR A 1 23  ? 79.698  34.653 33.312  1.00 53.13  ? 24   THR A CA   1 
ATOM   171  C C    . THR A 1 23  ? 80.958  34.905 32.487  1.00 59.06  ? 24   THR A C    1 
ATOM   172  O O    . THR A 1 23  ? 81.813  35.701 32.873  1.00 58.48  ? 24   THR A O    1 
ATOM   173  C CB   . THR A 1 23  ? 78.543  35.548 32.771  1.00 53.77  ? 24   THR A CB   1 
ATOM   174  O OG1  . THR A 1 23  ? 79.073  36.777 32.255  1.00 55.34  ? 24   THR A OG1  1 
ATOM   175  C CG2  . THR A 1 23  ? 77.512  35.838 33.855  1.00 52.02  ? 24   THR A CG2  1 
ATOM   176  N N    . PRO A 1 24  ? 81.077  34.226 31.340  1.00 64.61  ? 25   PRO A N    1 
ATOM   177  C CA   . PRO A 1 24  ? 82.235  34.397 30.458  1.00 68.97  ? 25   PRO A CA   1 
ATOM   178  C C    . PRO A 1 24  ? 82.310  35.792 29.859  1.00 66.22  ? 25   PRO A C    1 
ATOM   179  O O    . PRO A 1 24  ? 82.805  35.951 28.751  1.00 76.98  ? 25   PRO A O    1 
ATOM   180  C CB   . PRO A 1 24  ? 81.987  33.364 29.357  1.00 69.51  ? 25   PRO A CB   1 
ATOM   181  C CG   . PRO A 1 24  ? 81.136  32.331 30.005  1.00 67.72  ? 25   PRO A CG   1 
ATOM   182  C CD   . PRO A 1 24  ? 80.223  33.110 30.907  1.00 66.15  ? 25   PRO A CD   1 
ATOM   183  N N    . GLY A 1 25  ? 81.816  36.786 30.585  1.00 60.84  ? 26   GLY A N    1 
ATOM   184  C CA   . GLY A 1 25  ? 81.978  38.170 30.197  1.00 57.58  ? 26   GLY A CA   1 
ATOM   185  C C    . GLY A 1 25  ? 82.253  39.003 31.431  1.00 60.77  ? 26   GLY A C    1 
ATOM   186  O O    . GLY A 1 25  ? 82.904  40.044 31.354  1.00 75.84  ? 26   GLY A O    1 
ATOM   187  N N    . GLY A 1 26  ? 81.765  38.531 32.574  1.00 49.05  ? 27   GLY A N    1 
ATOM   188  C CA   . GLY A 1 26  ? 81.878  39.255 33.831  1.00 50.29  ? 27   GLY A CA   1 
ATOM   189  C C    . GLY A 1 26  ? 80.738  38.921 34.785  1.00 52.26  ? 27   GLY A C    1 
ATOM   190  O O    . GLY A 1 26  ? 79.829  38.155 34.447  1.00 47.46  ? 27   GLY A O    1 
ATOM   191  N N    . PRO A 1 27  ? 80.772  39.505 35.990  1.00 49.81  ? 28   PRO A N    1 
ATOM   192  C CA   . PRO A 1 27  ? 79.811  39.199 37.060  1.00 43.40  ? 28   PRO A CA   1 
ATOM   193  C C    . PRO A 1 27  ? 78.401  39.743 36.806  1.00 40.86  ? 28   PRO A C    1 
ATOM   194  O O    . PRO A 1 27  ? 78.225  40.821 36.238  1.00 42.19  ? 28   PRO A O    1 
ATOM   195  C CB   . PRO A 1 27  ? 80.424  39.899 38.278  1.00 41.76  ? 28   PRO A CB   1 
ATOM   196  C CG   . PRO A 1 27  ? 81.195  41.043 37.684  1.00 42.79  ? 28   PRO A CG   1 
ATOM   197  C CD   . PRO A 1 27  ? 81.760  40.518 36.401  1.00 43.93  ? 28   PRO A CD   1 
ATOM   198  N N    . VAL A 1 28  ? 77.407  38.982 37.246  1.00 37.42  ? 29   VAL A N    1 
ATOM   199  C CA   . VAL A 1 28  ? 76.013  39.373 37.160  1.00 26.87  ? 29   VAL A CA   1 
ATOM   200  C C    . VAL A 1 28  ? 75.376  39.114 38.522  1.00 29.16  ? 29   VAL A C    1 
ATOM   201  O O    . VAL A 1 28  ? 75.770  38.188 39.223  1.00 31.85  ? 29   VAL A O    1 
ATOM   202  C CB   . VAL A 1 28  ? 75.298  38.566 36.052  1.00 32.01  ? 29   VAL A CB   1 
ATOM   203  C CG1  . VAL A 1 28  ? 73.797  38.528 36.271  1.00 24.17  ? 29   VAL A CG1  1 
ATOM   204  C CG2  . VAL A 1 28  ? 75.636  39.142 34.673  1.00 29.29  ? 29   VAL A CG2  1 
ATOM   205  N N    . SER A 1 29  ? 74.421  39.947 38.920  1.00 31.87  ? 30   SER A N    1 
ATOM   206  C CA   . SER A 1 29  ? 73.719  39.718 40.177  1.00 34.10  ? 30   SER A CA   1 
ATOM   207  C C    . SER A 1 29  ? 72.427  38.983 39.878  1.00 34.55  ? 30   SER A C    1 
ATOM   208  O O    . SER A 1 29  ? 71.689  39.364 38.969  1.00 33.82  ? 30   SER A O    1 
ATOM   209  C CB   . SER A 1 29  ? 73.418  41.030 40.908  1.00 37.84  ? 30   SER A CB   1 
ATOM   210  O OG   . SER A 1 29  ? 74.605  41.666 41.353  1.00 42.94  ? 30   SER A OG   1 
ATOM   211  N N    . ALA A 1 30  ? 72.164  37.920 40.632  1.00 26.41  ? 31   ALA A N    1 
ATOM   212  C CA   . ALA A 1 30  ? 70.946  37.161 40.442  1.00 24.11  ? 31   ALA A CA   1 
ATOM   213  C C    . ALA A 1 30  ? 70.170  37.040 41.740  1.00 27.22  ? 31   ALA A C    1 
ATOM   214  O O    . ALA A 1 30  ? 70.730  36.732 42.799  1.00 30.45  ? 31   ALA A O    1 
ATOM   215  C CB   . ALA A 1 30  ? 71.248  35.788 39.865  1.00 20.19  ? 31   ALA A CB   1 
ATOM   216  N N    . PHE A 1 31  ? 68.874  37.297 41.636  1.00 23.24  ? 32   PHE A N    1 
ATOM   217  C CA   . PHE A 1 31  ? 67.943  37.101 42.723  1.00 24.28  ? 32   PHE A CA   1 
ATOM   218  C C    . PHE A 1 31  ? 66.938  36.071 42.224  1.00 26.85  ? 32   PHE A C    1 
ATOM   219  O O    . PHE A 1 31  ? 66.022  36.403 41.470  1.00 25.78  ? 32   PHE A O    1 
ATOM   220  C CB   . PHE A 1 31  ? 67.268  38.429 43.054  1.00 22.98  ? 32   PHE A CB   1 
ATOM   221  C CG   . PHE A 1 31  ? 68.241  39.502 43.478  1.00 25.26  ? 32   PHE A CG   1 
ATOM   222  C CD1  . PHE A 1 31  ? 68.891  40.284 42.531  1.00 25.59  ? 32   PHE A CD1  1 
ATOM   223  C CD2  . PHE A 1 31  ? 68.523  39.709 44.822  1.00 29.05  ? 32   PHE A CD2  1 
ATOM   224  C CE1  . PHE A 1 31  ? 69.802  41.264 42.915  1.00 31.96  ? 32   PHE A CE1  1 
ATOM   225  C CE2  . PHE A 1 31  ? 69.428  40.689 45.222  1.00 35.44  ? 32   PHE A CE2  1 
ATOM   226  C CZ   . PHE A 1 31  ? 70.071  41.468 44.267  1.00 35.17  ? 32   PHE A CZ   1 
ATOM   227  N N    . LEU A 1 32  ? 67.149  34.818 42.619  1.00 22.27  ? 33   LEU A N    1 
ATOM   228  C CA   . LEU A 1 32  ? 66.395  33.683 42.088  1.00 22.65  ? 33   LEU A CA   1 
ATOM   229  C C    . LEU A 1 32  ? 65.434  33.182 43.137  1.00 22.82  ? 33   LEU A C    1 
ATOM   230  O O    . LEU A 1 32  ? 65.799  33.061 44.303  1.00 26.40  ? 33   LEU A O    1 
ATOM   231  C CB   . LEU A 1 32  ? 67.358  32.559 41.709  1.00 21.75  ? 33   LEU A CB   1 
ATOM   232  C CG   . LEU A 1 32  ? 68.495  33.039 40.805  1.00 26.48  ? 33   LEU A CG   1 
ATOM   233  C CD1  . LEU A 1 32  ? 69.448  31.908 40.490  1.00 27.05  ? 33   LEU A CD1  1 
ATOM   234  C CD2  . LEU A 1 32  ? 67.916  33.640 39.517  1.00 17.75  ? 33   LEU A CD2  1 
ATOM   235  N N    . GLY A 1 33  ? 64.200  32.899 42.741  1.00 25.30  ? 34   GLY A N    1 
ATOM   236  C CA   . GLY A 1 33  ? 63.234  32.387 43.694  1.00 23.22  ? 34   GLY A CA   1 
ATOM   237  C C    . GLY A 1 33  ? 62.644  33.449 44.617  1.00 28.27  ? 34   GLY A C    1 
ATOM   238  O O    . GLY A 1 33  ? 62.551  33.241 45.824  1.00 25.44  ? 34   GLY A O    1 
ATOM   239  N N    . ILE A 1 34  ? 62.238  34.586 44.056  1.00 28.84  ? 35   ILE A N    1 
ATOM   240  C CA   . ILE A 1 34  ? 61.537  35.600 44.841  1.00 23.29  ? 35   ILE A CA   1 
ATOM   241  C C    . ILE A 1 34  ? 60.031  35.305 44.894  1.00 24.46  ? 35   ILE A C    1 
ATOM   242  O O    . ILE A 1 34  ? 59.362  35.237 43.858  1.00 27.25  ? 35   ILE A O    1 
ATOM   243  C CB   . ILE A 1 34  ? 61.727  36.992 44.248  1.00 22.58  ? 35   ILE A CB   1 
ATOM   244  C CG1  . ILE A 1 34  ? 63.214  37.309 44.080  1.00 23.36  ? 35   ILE A CG1  1 
ATOM   245  C CG2  . ILE A 1 34  ? 61.017  38.040 45.110  1.00 21.09  ? 35   ILE A CG2  1 
ATOM   246  C CD1  . ILE A 1 34  ? 63.484  38.618 43.321  1.00 18.77  ? 35   ILE A CD1  1 
ATOM   247  N N    . PRO A 1 35  ? 59.481  35.143 46.106  1.00 25.10  ? 36   PRO A N    1 
ATOM   248  C CA   . PRO A 1 35  ? 58.043  34.848 46.198  1.00 25.08  ? 36   PRO A CA   1 
ATOM   249  C C    . PRO A 1 35  ? 57.229  36.061 45.754  1.00 30.73  ? 36   PRO A C    1 
ATOM   250  O O    . PRO A 1 35  ? 57.504  37.175 46.221  1.00 29.87  ? 36   PRO A O    1 
ATOM   251  C CB   . PRO A 1 35  ? 57.833  34.593 47.698  1.00 21.33  ? 36   PRO A CB   1 
ATOM   252  C CG   . PRO A 1 35  ? 58.915  35.400 48.373  1.00 22.76  ? 36   PRO A CG   1 
ATOM   253  C CD   . PRO A 1 35  ? 60.101  35.348 47.430  1.00 21.37  ? 36   PRO A CD   1 
ATOM   254  N N    . PHE A 1 36  ? 56.255  35.874 44.865  1.00 26.26  ? 37   PHE A N    1 
ATOM   255  C CA   . PHE A 1 36  ? 55.423  37.016 44.474  1.00 24.87  ? 37   PHE A CA   1 
ATOM   256  C C    . PHE A 1 36  ? 53.935  36.816 44.774  1.00 26.81  ? 37   PHE A C    1 
ATOM   257  O O    . PHE A 1 36  ? 53.146  37.755 44.710  1.00 30.19  ? 37   PHE A O    1 
ATOM   258  C CB   . PHE A 1 36  ? 55.665  37.419 43.016  1.00 24.26  ? 37   PHE A CB   1 
ATOM   259  C CG   . PHE A 1 36  ? 55.166  36.425 42.006  1.00 26.26  ? 37   PHE A CG   1 
ATOM   260  C CD1  . PHE A 1 36  ? 55.998  35.412 41.544  1.00 20.59  ? 37   PHE A CD1  1 
ATOM   261  C CD2  . PHE A 1 36  ? 53.873  36.519 41.493  1.00 25.46  ? 37   PHE A CD2  1 
ATOM   262  C CE1  . PHE A 1 36  ? 55.550  34.495 40.590  1.00 24.05  ? 37   PHE A CE1  1 
ATOM   263  C CE2  . PHE A 1 36  ? 53.409  35.610 40.537  1.00 25.36  ? 37   PHE A CE2  1 
ATOM   264  C CZ   . PHE A 1 36  ? 54.250  34.596 40.077  1.00 25.65  ? 37   PHE A CZ   1 
ATOM   265  N N    . ALA A 1 37  ? 53.563  35.589 45.126  1.00 25.24  ? 38   ALA A N    1 
ATOM   266  C CA   . ALA A 1 37  ? 52.206  35.304 45.577  1.00 22.62  ? 38   ALA A CA   1 
ATOM   267  C C    . ALA A 1 37  ? 52.233  34.406 46.813  1.00 28.97  ? 38   ALA A C    1 
ATOM   268  O O    . ALA A 1 37  ? 53.256  33.779 47.115  1.00 31.59  ? 38   ALA A O    1 
ATOM   269  C CB   . ALA A 1 37  ? 51.406  34.647 44.470  1.00 19.64  ? 38   ALA A CB   1 
ATOM   270  N N    . GLU A 1 38  ? 51.117  34.355 47.534  1.00 27.28  ? 39   GLU A N    1 
ATOM   271  C CA   . GLU A 1 38  ? 50.939  33.312 48.527  1.00 34.06  ? 39   GLU A CA   1 
ATOM   272  C C    . GLU A 1 38  ? 50.882  31.980 47.792  1.00 35.83  ? 39   GLU A C    1 
ATOM   273  O O    . GLU A 1 38  ? 50.393  31.924 46.669  1.00 34.63  ? 39   GLU A O    1 
ATOM   274  C CB   . GLU A 1 38  ? 49.665  33.544 49.333  1.00 33.91  ? 39   GLU A CB   1 
ATOM   275  C CG   . GLU A 1 38  ? 49.764  34.736 50.292  1.00 44.65  ? 39   GLU A CG   1 
ATOM   276  C CD   . GLU A 1 38  ? 50.897  34.602 51.313  1.00 52.51  ? 39   GLU A CD   1 
ATOM   277  O OE1  . GLU A 1 38  ? 51.082  33.491 51.857  1.00 59.68  ? 39   GLU A OE1  1 
ATOM   278  O OE2  . GLU A 1 38  ? 51.602  35.608 51.577  1.00 51.63  ? 39   GLU A OE2  1 
ATOM   279  N N    . PRO A 1 39  ? 51.430  30.911 48.396  1.00 42.19  ? 40   PRO A N    1 
ATOM   280  C CA   . PRO A 1 39  ? 51.362  29.594 47.743  1.00 34.21  ? 40   PRO A CA   1 
ATOM   281  C C    . PRO A 1 39  ? 49.922  29.176 47.466  1.00 33.35  ? 40   PRO A C    1 
ATOM   282  O O    . PRO A 1 39  ? 49.116  29.123 48.389  1.00 34.27  ? 40   PRO A O    1 
ATOM   283  C CB   . PRO A 1 39  ? 51.996  28.658 48.772  1.00 30.14  ? 40   PRO A CB   1 
ATOM   284  C CG   . PRO A 1 39  ? 52.955  29.540 49.524  1.00 34.81  ? 40   PRO A CG   1 
ATOM   285  C CD   . PRO A 1 39  ? 52.284  30.897 49.600  1.00 35.81  ? 40   PRO A CD   1 
ATOM   286  N N    . PRO A 1 40  ? 49.600  28.892 46.191  1.00 34.81  ? 41   PRO A N    1 
ATOM   287  C CA   . PRO A 1 40  ? 48.245  28.533 45.749  1.00 33.31  ? 41   PRO A CA   1 
ATOM   288  C C    . PRO A 1 40  ? 47.935  27.064 46.036  1.00 36.75  ? 41   PRO A C    1 
ATOM   289  O O    . PRO A 1 40  ? 47.575  26.318 45.118  1.00 38.93  ? 41   PRO A O    1 
ATOM   290  C CB   . PRO A 1 40  ? 48.308  28.766 44.240  1.00 30.69  ? 41   PRO A CB   1 
ATOM   291  C CG   . PRO A 1 40  ? 49.722  28.402 43.884  1.00 34.76  ? 41   PRO A CG   1 
ATOM   292  C CD   . PRO A 1 40  ? 50.580  28.795 45.095  1.00 28.80  ? 41   PRO A CD   1 
ATOM   293  N N    . MET A 1 41  ? 48.078  26.663 47.299  1.00 34.09  ? 42   MET A N    1 
ATOM   294  C CA   . MET A 1 41  ? 47.916  25.271 47.697  1.00 36.08  ? 42   MET A CA   1 
ATOM   295  C C    . MET A 1 41  ? 46.637  25.126 48.481  1.00 37.92  ? 42   MET A C    1 
ATOM   296  O O    . MET A 1 41  ? 46.050  26.125 48.892  1.00 40.16  ? 42   MET A O    1 
ATOM   297  C CB   . MET A 1 41  ? 49.070  24.831 48.601  1.00 38.31  ? 42   MET A CB   1 
ATOM   298  C CG   . MET A 1 41  ? 50.454  25.211 48.118  1.00 37.70  ? 42   MET A CG   1 
ATOM   299  S SD   . MET A 1 41  ? 51.694  24.181 48.902  1.00 94.41  ? 42   MET A SD   1 
ATOM   300  C CE   . MET A 1 41  ? 51.159  22.552 48.379  1.00 59.10  ? 42   MET A CE   1 
ATOM   301  N N    . GLY A 1 42  ? 46.228  23.879 48.708  1.00 33.21  ? 43   GLY A N    1 
ATOM   302  C CA   . GLY A 1 42  ? 45.066  23.581 49.526  1.00 30.72  ? 43   GLY A CA   1 
ATOM   303  C C    . GLY A 1 42  ? 43.807  24.265 49.034  1.00 35.59  ? 43   GLY A C    1 
ATOM   304  O O    . GLY A 1 42  ? 43.368  24.027 47.906  1.00 33.00  ? 43   GLY A O    1 
ATOM   305  N N    . PRO A 1 43  ? 43.219  25.116 49.890  1.00 39.14  ? 44   PRO A N    1 
ATOM   306  C CA   . PRO A 1 43  ? 42.019  25.915 49.599  1.00 36.00  ? 44   PRO A CA   1 
ATOM   307  C C    . PRO A 1 43  ? 42.276  26.941 48.499  1.00 40.17  ? 44   PRO A C    1 
ATOM   308  O O    . PRO A 1 43  ? 41.317  27.423 47.886  1.00 43.39  ? 44   PRO A O    1 
ATOM   309  C CB   . PRO A 1 43  ? 41.727  26.625 50.937  1.00 31.33  ? 44   PRO A CB   1 
ATOM   310  C CG   . PRO A 1 43  ? 43.015  26.563 51.710  1.00 33.09  ? 44   PRO A CG   1 
ATOM   311  C CD   . PRO A 1 43  ? 43.690  25.291 51.278  1.00 36.38  ? 44   PRO A CD   1 
ATOM   312  N N    . ARG A 1 44  ? 43.546  27.262 48.250  1.00 33.21  ? 45   ARG A N    1 
ATOM   313  C CA   . ARG A 1 44  ? 43.894  28.240 47.219  1.00 33.79  ? 45   ARG A CA   1 
ATOM   314  C C    . ARG A 1 44  ? 44.149  27.656 45.821  1.00 36.45  ? 45   ARG A C    1 
ATOM   315  O O    . ARG A 1 44  ? 44.445  28.398 44.874  1.00 30.51  ? 45   ARG A O    1 
ATOM   316  C CB   . ARG A 1 44  ? 45.070  29.102 47.667  1.00 29.28  ? 45   ARG A CB   1 
ATOM   317  C CG   . ARG A 1 44  ? 44.716  30.072 48.779  1.00 36.14  ? 45   ARG A CG   1 
ATOM   318  C CD   . ARG A 1 44  ? 45.817  31.091 48.944  1.00 47.58  ? 45   ARG A CD   1 
ATOM   319  N NE   . ARG A 1 44  ? 46.042  31.453 50.343  1.00 59.54  ? 45   ARG A NE   1 
ATOM   320  C CZ   . ARG A 1 44  ? 45.833  32.667 50.841  1.00 65.89  ? 45   ARG A CZ   1 
ATOM   321  N NH1  . ARG A 1 44  ? 45.398  33.644 50.048  1.00 67.93  ? 45   ARG A NH1  1 
ATOM   322  N NH2  . ARG A 1 44  ? 46.065  32.906 52.125  1.00 64.25  ? 45   ARG A NH2  1 
ATOM   323  N N    . ARG A 1 45  ? 44.013  26.339 45.684  1.00 37.13  ? 46   ARG A N    1 
ATOM   324  C CA   . ARG A 1 45  ? 44.127  25.715 44.368  1.00 34.34  ? 46   ARG A CA   1 
ATOM   325  C C    . ARG A 1 45  ? 42.951  26.177 43.474  1.00 30.69  ? 46   ARG A C    1 
ATOM   326  O O    . ARG A 1 45  ? 41.811  26.233 43.924  1.00 27.69  ? 46   ARG A O    1 
ATOM   327  C CB   . ARG A 1 45  ? 44.174  24.185 44.509  1.00 29.43  ? 46   ARG A CB   1 
ATOM   328  C CG   . ARG A 1 45  ? 44.266  23.413 43.192  1.00 31.30  ? 46   ARG A CG   1 
ATOM   329  C CD   . ARG A 1 45  ? 44.015  21.930 43.397  1.00 32.77  ? 46   ARG A CD   1 
ATOM   330  N NE   . ARG A 1 45  ? 45.183  21.200 43.886  1.00 23.33  ? 46   ARG A NE   1 
ATOM   331  C CZ   . ARG A 1 45  ? 45.169  19.904 44.188  1.00 34.84  ? 46   ARG A CZ   1 
ATOM   332  N NH1  . ARG A 1 45  ? 44.045  19.213 44.046  1.00 27.61  ? 46   ARG A NH1  1 
ATOM   333  N NH2  . ARG A 1 45  ? 46.271  19.298 44.625  1.00 24.09  ? 46   ARG A NH2  1 
ATOM   334  N N    . PHE A 1 46  ? 43.259  26.529 42.227  1.00 24.53  ? 47   PHE A N    1 
ATOM   335  C CA   . PHE A 1 46  ? 42.294  27.029 41.233  1.00 22.29  ? 47   PHE A CA   1 
ATOM   336  C C    . PHE A 1 46  ? 41.902  28.494 41.417  1.00 34.27  ? 47   PHE A C    1 
ATOM   337  O O    . PHE A 1 46  ? 41.166  29.045 40.597  1.00 32.04  ? 47   PHE A O    1 
ATOM   338  C CB   . PHE A 1 46  ? 41.029  26.159 41.159  1.00 24.48  ? 47   PHE A CB   1 
ATOM   339  C CG   . PHE A 1 46  ? 41.302  24.693 40.985  1.00 27.02  ? 47   PHE A CG   1 
ATOM   340  C CD1  . PHE A 1 46  ? 42.134  24.236 39.967  1.00 25.33  ? 47   PHE A CD1  1 
ATOM   341  C CD2  . PHE A 1 46  ? 40.733  23.765 41.851  1.00 25.67  ? 47   PHE A CD2  1 
ATOM   342  C CE1  . PHE A 1 46  ? 42.383  22.869 39.814  1.00 29.99  ? 47   PHE A CE1  1 
ATOM   343  C CE2  . PHE A 1 46  ? 40.977  22.398 41.704  1.00 25.01  ? 47   PHE A CE2  1 
ATOM   344  C CZ   . PHE A 1 46  ? 41.801  21.951 40.689  1.00 27.48  ? 47   PHE A CZ   1 
ATOM   345  N N    . LEU A 1 47  ? 42.381  29.126 42.483  1.00 32.88  ? 48   LEU A N    1 
ATOM   346  C CA   . LEU A 1 47  ? 41.990  30.508 42.764  1.00 30.50  ? 48   LEU A CA   1 
ATOM   347  C C    . LEU A 1 47  ? 43.006  31.483 42.198  1.00 29.29  ? 48   LEU A C    1 
ATOM   348  O O    . LEU A 1 47  ? 44.172  31.129 42.005  1.00 27.90  ? 48   LEU A O    1 
ATOM   349  C CB   . LEU A 1 47  ? 41.818  30.748 44.267  1.00 23.88  ? 48   LEU A CB   1 
ATOM   350  C CG   . LEU A 1 47  ? 40.651  30.005 44.924  1.00 41.30  ? 48   LEU A CG   1 
ATOM   351  C CD1  . LEU A 1 47  ? 40.467  30.454 46.362  1.00 26.25  ? 48   LEU A CD1  1 
ATOM   352  C CD2  . LEU A 1 47  ? 39.369  30.220 44.131  1.00 31.32  ? 48   LEU A CD2  1 
ATOM   353  N N    . PRO A 1 48  ? 42.564  32.718 41.922  1.00 25.23  ? 49   PRO A N    1 
ATOM   354  C CA   . PRO A 1 48  ? 43.488  33.749 41.446  1.00 22.73  ? 49   PRO A CA   1 
ATOM   355  C C    . PRO A 1 48  ? 44.589  33.946 42.491  1.00 31.64  ? 49   PRO A C    1 
ATOM   356  O O    . PRO A 1 48  ? 44.349  33.747 43.683  1.00 36.07  ? 49   PRO A O    1 
ATOM   357  C CB   . PRO A 1 48  ? 42.605  34.999 41.351  1.00 23.97  ? 49   PRO A CB   1 
ATOM   358  C CG   . PRO A 1 48  ? 41.187  34.463 41.200  1.00 27.61  ? 49   PRO A CG   1 
ATOM   359  C CD   . PRO A 1 48  ? 41.179  33.209 42.047  1.00 25.69  ? 49   PRO A CD   1 
ATOM   360  N N    . PRO A 1 49  ? 45.792  34.318 42.050  1.00 27.39  ? 50   PRO A N    1 
ATOM   361  C CA   . PRO A 1 49  ? 46.904  34.443 43.002  1.00 25.95  ? 50   PRO A CA   1 
ATOM   362  C C    . PRO A 1 49  ? 46.666  35.597 43.984  1.00 30.54  ? 50   PRO A C    1 
ATOM   363  O O    . PRO A 1 49  ? 46.135  36.632 43.582  1.00 34.24  ? 50   PRO A O    1 
ATOM   364  C CB   . PRO A 1 49  ? 48.105  34.762 42.094  1.00 20.73  ? 50   PRO A CB   1 
ATOM   365  C CG   . PRO A 1 49  ? 47.473  35.515 40.896  1.00 19.80  ? 50   PRO A CG   1 
ATOM   366  C CD   . PRO A 1 49  ? 46.124  34.823 40.700  1.00 24.30  ? 50   PRO A CD   1 
ATOM   367  N N    . GLU A 1 50  ? 47.028  35.407 45.248  1.00 34.30  ? 51   GLU A N    1 
ATOM   368  C CA   . GLU A 1 50  ? 47.021  36.486 46.236  1.00 36.88  ? 51   GLU A CA   1 
ATOM   369  C C    . GLU A 1 50  ? 48.433  37.037 46.322  1.00 34.02  ? 51   GLU A C    1 
ATOM   370  O O    . GLU A 1 50  ? 49.396  36.264 46.350  1.00 31.85  ? 51   GLU A O    1 
ATOM   371  C CB   . GLU A 1 50  ? 46.612  35.970 47.622  1.00 42.96  ? 51   GLU A CB   1 
ATOM   372  C CG   . GLU A 1 50  ? 45.145  35.602 47.759  1.00 63.37  ? 51   GLU A CG   1 
ATOM   373  C CD   . GLU A 1 50  ? 44.222  36.814 47.672  1.00 80.69  ? 51   GLU A CD   1 
ATOM   374  O OE1  . GLU A 1 50  ? 44.381  37.742 48.496  1.00 86.78  ? 51   GLU A OE1  1 
ATOM   375  O OE2  . GLU A 1 50  ? 43.341  36.838 46.780  1.00 83.64  ? 51   GLU A OE2  1 
ATOM   376  N N    . PRO A 1 51  ? 48.566  38.372 46.366  1.00 33.99  ? 52   PRO A N    1 
ATOM   377  C CA   . PRO A 1 51  ? 49.878  39.022 46.516  1.00 32.02  ? 52   PRO A CA   1 
ATOM   378  C C    . PRO A 1 51  ? 50.615  38.521 47.768  1.00 35.31  ? 52   PRO A C    1 
ATOM   379  O O    . PRO A 1 51  ? 49.992  38.300 48.815  1.00 33.57  ? 52   PRO A O    1 
ATOM   380  C CB   . PRO A 1 51  ? 49.515  40.502 46.668  1.00 33.09  ? 52   PRO A CB   1 
ATOM   381  C CG   . PRO A 1 51  ? 48.187  40.645 45.969  1.00 34.71  ? 52   PRO A CG   1 
ATOM   382  C CD   . PRO A 1 51  ? 47.468  39.342 46.184  1.00 32.51  ? 52   PRO A CD   1 
ATOM   383  N N    . LYS A 1 52  ? 51.926  38.326 47.653  1.00 35.03  ? 53   LYS A N    1 
ATOM   384  C CA   . LYS A 1 52  ? 52.721  37.838 48.773  1.00 35.85  ? 53   LYS A CA   1 
ATOM   385  C C    . LYS A 1 52  ? 52.732  38.851 49.935  1.00 33.14  ? 53   LYS A C    1 
ATOM   386  O O    . LYS A 1 52  ? 53.043  40.018 49.741  1.00 31.49  ? 53   LYS A O    1 
ATOM   387  C CB   . LYS A 1 52  ? 54.145  37.535 48.288  1.00 31.82  ? 53   LYS A CB   1 
ATOM   388  C CG   . LYS A 1 52  ? 55.150  37.214 49.388  1.00 33.28  ? 53   LYS A CG   1 
ATOM   389  C CD   . LYS A 1 52  ? 54.806  35.913 50.101  1.00 32.40  ? 53   LYS A CD   1 
ATOM   390  C CE   . LYS A 1 52  ? 55.970  35.414 50.955  1.00 26.75  ? 53   LYS A CE   1 
ATOM   391  N NZ   . LYS A 1 52  ? 55.701  34.037 51.477  1.00 31.37  ? 53   LYS A NZ   1 
ATOM   392  N N    A GLN A 1 53  ? 52.388  38.387 51.132  0.47 34.01  ? 54   GLN A N    1 
ATOM   393  N N    B GLN A 1 53  ? 52.376  38.397 51.130  0.53 33.88  ? 54   GLN A N    1 
ATOM   394  C CA   A GLN A 1 53  ? 52.393  39.234 52.327  0.47 37.71  ? 54   GLN A CA   1 
ATOM   395  C CA   B GLN A 1 53  ? 52.382  39.273 52.302  0.53 37.26  ? 54   GLN A CA   1 
ATOM   396  C C    A GLN A 1 53  ? 53.811  39.602 52.754  0.47 35.55  ? 54   GLN A C    1 
ATOM   397  C C    B GLN A 1 53  ? 53.795  39.603 52.765  0.53 35.49  ? 54   GLN A C    1 
ATOM   398  O O    A GLN A 1 53  ? 54.720  38.779 52.664  0.47 33.61  ? 54   GLN A O    1 
ATOM   399  O O    B GLN A 1 53  ? 54.685  38.755 52.712  0.53 33.72  ? 54   GLN A O    1 
ATOM   400  C CB   A GLN A 1 53  ? 51.669  38.527 53.479  0.47 41.54  ? 54   GLN A CB   1 
ATOM   401  C CB   B GLN A 1 53  ? 51.576  38.658 53.450  0.53 42.28  ? 54   GLN A CB   1 
ATOM   402  C CG   A GLN A 1 53  ? 50.223  38.166 53.150  0.47 44.62  ? 54   GLN A CG   1 
ATOM   403  C CG   B GLN A 1 53  ? 50.072  38.645 53.192  0.53 47.43  ? 54   GLN A CG   1 
ATOM   404  C CD   A GLN A 1 53  ? 49.653  37.082 54.051  0.47 42.62  ? 54   GLN A CD   1 
ATOM   405  C CD   B GLN A 1 53  ? 49.513  40.033 52.910  0.53 49.53  ? 54   GLN A CD   1 
ATOM   406  O OE1  A GLN A 1 53  ? 50.228  36.745 55.084  0.47 38.25  ? 54   GLN A OE1  1 
ATOM   407  O OE1  B GLN A 1 53  ? 49.493  40.899 53.787  0.53 53.79  ? 54   GLN A OE1  1 
ATOM   408  N NE2  A GLN A 1 53  ? 48.510  36.529 53.654  0.47 44.69  ? 54   GLN A NE2  1 
ATOM   409  N NE2  B GLN A 1 53  ? 49.064  40.251 51.678  0.53 47.83  ? 54   GLN A NE2  1 
ATOM   410  N N    . PRO A 1 54  ? 54.002  40.846 53.221  1.00 39.56  ? 55   PRO A N    1 
ATOM   411  C CA   . PRO A 1 54  ? 55.324  41.316 53.655  1.00 40.15  ? 55   PRO A CA   1 
ATOM   412  C C    . PRO A 1 54  ? 55.906  40.383 54.707  1.00 38.80  ? 55   PRO A C    1 
ATOM   413  O O    . PRO A 1 54  ? 55.148  39.754 55.454  1.00 32.80  ? 55   PRO A O    1 
ATOM   414  C CB   . PRO A 1 54  ? 55.026  42.685 54.278  1.00 43.17  ? 55   PRO A CB   1 
ATOM   415  C CG   . PRO A 1 54  ? 53.766  43.141 53.611  1.00 44.05  ? 55   PRO A CG   1 
ATOM   416  C CD   . PRO A 1 54  ? 52.963  41.885 53.366  1.00 40.50  ? 55   PRO A CD   1 
ATOM   417  N N    . TRP A 1 55  ? 57.230  40.276 54.732  1.00 36.10  ? 56   TRP A N    1 
ATOM   418  C CA   . TRP A 1 55  ? 57.927  39.409 55.670  1.00 31.60  ? 56   TRP A CA   1 
ATOM   419  C C    . TRP A 1 55  ? 58.949  40.239 56.434  1.00 30.58  ? 56   TRP A C    1 
ATOM   420  O O    . TRP A 1 55  ? 59.413  41.273 55.950  1.00 30.05  ? 56   TRP A O    1 
ATOM   421  C CB   . TRP A 1 55  ? 58.637  38.258 54.932  1.00 27.13  ? 56   TRP A CB   1 
ATOM   422  C CG   . TRP A 1 55  ? 59.663  38.735 53.928  1.00 33.78  ? 56   TRP A CG   1 
ATOM   423  C CD1  . TRP A 1 55  ? 60.983  39.013 54.168  1.00 28.98  ? 56   TRP A CD1  1 
ATOM   424  C CD2  . TRP A 1 55  ? 59.443  39.007 52.537  1.00 29.42  ? 56   TRP A CD2  1 
ATOM   425  N NE1  . TRP A 1 55  ? 61.591  39.435 53.013  1.00 33.77  ? 56   TRP A NE1  1 
ATOM   426  C CE2  . TRP A 1 55  ? 60.669  39.440 51.998  1.00 30.53  ? 56   TRP A CE2  1 
ATOM   427  C CE3  . TRP A 1 55  ? 58.327  38.928 51.699  1.00 34.68  ? 56   TRP A CE3  1 
ATOM   428  C CZ2  . TRP A 1 55  ? 60.812  39.790 50.651  1.00 31.31  ? 56   TRP A CZ2  1 
ATOM   429  C CZ3  . TRP A 1 55  ? 58.468  39.276 50.355  1.00 32.91  ? 56   TRP A CZ3  1 
ATOM   430  C CH2  . TRP A 1 55  ? 59.699  39.698 49.846  1.00 29.97  ? 56   TRP A CH2  1 
ATOM   431  N N    . SER A 1 56  ? 59.295  39.794 57.631  1.00 34.00  ? 57   SER A N    1 
ATOM   432  C CA   . SER A 1 56  ? 60.370  40.426 58.370  1.00 37.18  ? 57   SER A CA   1 
ATOM   433  C C    . SER A 1 56  ? 61.648  39.674 58.024  1.00 34.70  ? 57   SER A C    1 
ATOM   434  O O    . SER A 1 56  ? 61.595  38.581 57.458  1.00 43.21  ? 57   SER A O    1 
ATOM   435  C CB   . SER A 1 56  ? 60.092  40.362 59.866  1.00 36.70  ? 57   SER A CB   1 
ATOM   436  O OG   . SER A 1 56  ? 60.089  39.019 60.293  1.00 41.98  ? 57   SER A OG   1 
ATOM   437  N N    . GLY A 1 57  ? 62.799  40.253 58.340  1.00 37.95  ? 58   GLY A N    1 
ATOM   438  C CA   . GLY A 1 57  ? 64.058  39.592 58.032  1.00 39.62  ? 58   GLY A CA   1 
ATOM   439  C C    . GLY A 1 57  ? 64.347  39.513 56.539  1.00 35.61  ? 58   GLY A C    1 
ATOM   440  O O    . GLY A 1 57  ? 63.711  40.210 55.739  1.00 40.05  ? 58   GLY A O    1 
ATOM   441  N N    . VAL A 1 58  ? 65.304  38.661 56.169  1.00 29.90  ? 59   VAL A N    1 
ATOM   442  C CA   . VAL A 1 58  ? 65.776  38.568 54.790  1.00 34.15  ? 59   VAL A CA   1 
ATOM   443  C C    . VAL A 1 58  ? 65.446  37.236 54.125  1.00 33.88  ? 59   VAL A C    1 
ATOM   444  O O    . VAL A 1 58  ? 65.782  36.171 54.654  1.00 27.78  ? 59   VAL A O    1 
ATOM   445  C CB   . VAL A 1 58  ? 67.292  38.740 54.705  1.00 32.29  ? 59   VAL A CB   1 
ATOM   446  C CG1  . VAL A 1 58  ? 67.682  39.038 53.259  1.00 33.38  ? 59   VAL A CG1  1 
ATOM   447  C CG2  . VAL A 1 58  ? 67.759  39.855 55.640  1.00 26.91  ? 59   VAL A CG2  1 
ATOM   448  N N    . VAL A 1 59  ? 64.796  37.307 52.963  1.00 29.49  ? 60   VAL A N    1 
ATOM   449  C CA   . VAL A 1 59  ? 64.570  36.137 52.121  1.00 30.64  ? 60   VAL A CA   1 
ATOM   450  C C    . VAL A 1 59  ? 65.790  35.866 51.227  1.00 33.99  ? 60   VAL A C    1 
ATOM   451  O O    . VAL A 1 59  ? 66.236  36.751 50.485  1.00 37.63  ? 60   VAL A O    1 
ATOM   452  C CB   . VAL A 1 59  ? 63.323  36.326 51.232  1.00 28.57  ? 60   VAL A CB   1 
ATOM   453  C CG1  . VAL A 1 59  ? 63.312  35.306 50.078  1.00 23.19  ? 60   VAL A CG1  1 
ATOM   454  C CG2  . VAL A 1 59  ? 62.069  36.220 52.065  1.00 27.98  ? 60   VAL A CG2  1 
ATOM   455  N N    . ASP A 1 60  ? 66.324  34.648 51.305  1.00 30.24  ? 61   ASP A N    1 
ATOM   456  C CA   . ASP A 1 60  ? 67.404  34.209 50.417  1.00 28.79  ? 61   ASP A CA   1 
ATOM   457  C C    . ASP A 1 60  ? 66.855  33.881 49.032  1.00 29.96  ? 61   ASP A C    1 
ATOM   458  O O    . ASP A 1 60  ? 66.210  32.843 48.844  1.00 26.31  ? 61   ASP A O    1 
ATOM   459  C CB   . ASP A 1 60  ? 68.078  32.955 50.977  1.00 43.69  ? 61   ASP A CB   1 
ATOM   460  C CG   . ASP A 1 60  ? 69.251  33.270 51.880  1.00 63.08  ? 61   ASP A CG   1 
ATOM   461  O OD1  . ASP A 1 60  ? 69.021  33.765 53.003  1.00 66.79  ? 61   ASP A OD1  1 
ATOM   462  O OD2  . ASP A 1 60  ? 70.408  33.022 51.469  1.00 75.56  ? 61   ASP A OD2  1 
ATOM   463  N N    . ALA A 1 61  ? 67.100  34.766 48.072  1.00 25.87  ? 62   ALA A N    1 
ATOM   464  C CA   . ALA A 1 61  ? 66.734  34.507 46.685  1.00 23.92  ? 62   ALA A CA   1 
ATOM   465  C C    . ALA A 1 61  ? 67.984  34.045 45.950  1.00 25.66  ? 62   ALA A C    1 
ATOM   466  O O    . ALA A 1 61  ? 68.508  34.750 45.081  1.00 24.70  ? 62   ALA A O    1 
ATOM   467  C CB   . ALA A 1 61  ? 66.153  35.756 46.027  1.00 27.54  ? 62   ALA A CB   1 
ATOM   468  N N    . THR A 1 62  ? 68.439  32.843 46.292  1.00 24.54  ? 63   THR A N    1 
ATOM   469  C CA   . THR A 1 62  ? 69.736  32.360 45.856  1.00 22.18  ? 63   THR A CA   1 
ATOM   470  C C    . THR A 1 62  ? 69.696  31.137 44.943  1.00 24.60  ? 63   THR A C    1 
ATOM   471  O O    . THR A 1 62  ? 70.745  30.604 44.592  1.00 27.35  ? 63   THR A O    1 
ATOM   472  C CB   . THR A 1 62  ? 70.572  31.978 47.069  1.00 26.69  ? 63   THR A CB   1 
ATOM   473  O OG1  . THR A 1 62  ? 69.862  30.990 47.817  1.00 32.30  ? 63   THR A OG1  1 
ATOM   474  C CG2  . THR A 1 62  ? 70.826  33.196 47.944  1.00 22.29  ? 63   THR A CG2  1 
ATOM   475  N N    . THR A 1 63  ? 68.500  30.677 44.582  1.00 24.51  ? 64   THR A N    1 
ATOM   476  C CA   . THR A 1 63  ? 68.378  29.486 43.745  1.00 23.60  ? 64   THR A CA   1 
ATOM   477  C C    . THR A 1 63  ? 66.954  29.407 43.202  1.00 21.39  ? 64   THR A C    1 
ATOM   478  O O    . THR A 1 63  ? 66.036  29.951 43.812  1.00 25.70  ? 64   THR A O    1 
ATOM   479  C CB   . THR A 1 63  ? 68.732  28.186 44.533  1.00 29.81  ? 64   THR A CB   1 
ATOM   480  O OG1  . THR A 1 63  ? 69.075  27.137 43.620  1.00 31.13  ? 64   THR A OG1  1 
ATOM   481  C CG2  . THR A 1 63  ? 67.543  27.722 45.390  1.00 29.32  ? 64   THR A CG2  1 
ATOM   482  N N    . PHE A 1 64  ? 66.772  28.759 42.052  1.00 18.81  ? 65   PHE A N    1 
ATOM   483  C CA   . PHE A 1 64  ? 65.435  28.596 41.483  1.00 27.02  ? 65   PHE A CA   1 
ATOM   484  C C    . PHE A 1 64  ? 64.543  27.791 42.412  1.00 28.17  ? 65   PHE A C    1 
ATOM   485  O O    . PHE A 1 64  ? 64.972  26.788 42.990  1.00 33.26  ? 65   PHE A O    1 
ATOM   486  C CB   . PHE A 1 64  ? 65.485  27.882 40.134  1.00 32.03  ? 65   PHE A CB   1 
ATOM   487  C CG   . PHE A 1 64  ? 66.073  28.700 39.034  1.00 26.33  ? 65   PHE A CG   1 
ATOM   488  C CD1  . PHE A 1 64  ? 65.379  29.781 38.507  1.00 19.53  ? 65   PHE A CD1  1 
ATOM   489  C CD2  . PHE A 1 64  ? 67.308  28.365 38.494  1.00 22.42  ? 65   PHE A CD2  1 
ATOM   490  C CE1  . PHE A 1 64  ? 65.922  30.527 37.472  1.00 22.27  ? 65   PHE A CE1  1 
ATOM   491  C CE2  . PHE A 1 64  ? 67.858  29.111 37.464  1.00 18.79  ? 65   PHE A CE2  1 
ATOM   492  C CZ   . PHE A 1 64  ? 67.171  30.195 36.959  1.00 21.37  ? 65   PHE A CZ   1 
ATOM   493  N N    . GLN A 1 65  ? 63.297  28.234 42.534  1.00 28.57  ? 66   GLN A N    1 
ATOM   494  C CA   . GLN A 1 65  ? 62.298  27.552 43.348  1.00 27.76  ? 66   GLN A CA   1 
ATOM   495  C C    . GLN A 1 65  ? 61.617  26.408 42.573  1.00 24.24  ? 66   GLN A C    1 
ATOM   496  O O    . GLN A 1 65  ? 61.964  26.136 41.422  1.00 21.55  ? 66   GLN A O    1 
ATOM   497  C CB   . GLN A 1 65  ? 61.280  28.571 43.855  1.00 28.10  ? 66   GLN A CB   1 
ATOM   498  C CG   . GLN A 1 65  ? 61.458  28.895 45.329  1.00 31.04  ? 66   GLN A CG   1 
ATOM   499  C CD   . GLN A 1 65  ? 61.004  27.742 46.191  1.00 30.62  ? 66   GLN A CD   1 
ATOM   500  O OE1  . GLN A 1 65  ? 60.677  26.669 45.679  1.00 35.32  ? 66   GLN A OE1  1 
ATOM   501  N NE2  . GLN A 1 65  ? 60.962  27.953 47.496  1.00 21.88  ? 66   GLN A NE2  1 
ATOM   502  N N    . SER A 1 66  ? 60.654  25.738 43.191  1.00 24.90  ? 67   SER A N    1 
ATOM   503  C CA   . SER A 1 66  ? 60.063  24.555 42.568  1.00 27.57  ? 67   SER A CA   1 
ATOM   504  C C    . SER A 1 66  ? 59.374  24.832 41.227  1.00 24.61  ? 67   SER A C    1 
ATOM   505  O O    . SER A 1 66  ? 58.944  25.946 40.947  1.00 26.10  ? 67   SER A O    1 
ATOM   506  C CB   . SER A 1 66  ? 59.093  23.860 43.522  1.00 26.32  ? 67   SER A CB   1 
ATOM   507  O OG   . SER A 1 66  ? 59.756  23.446 44.698  1.00 32.13  ? 67   SER A OG   1 
ATOM   508  N N    . VAL A 1 67  ? 59.294  23.796 40.404  1.00 25.62  ? 68   VAL A N    1 
ATOM   509  C CA   . VAL A 1 67  ? 58.573  23.836 39.147  1.00 26.37  ? 68   VAL A CA   1 
ATOM   510  C C    . VAL A 1 67  ? 57.092  23.602 39.450  1.00 28.05  ? 68   VAL A C    1 
ATOM   511  O O    . VAL A 1 67  ? 56.753  22.772 40.302  1.00 28.95  ? 68   VAL A O    1 
ATOM   512  C CB   . VAL A 1 67  ? 59.102  22.742 38.213  1.00 29.05  ? 68   VAL A CB   1 
ATOM   513  C CG1  . VAL A 1 67  ? 58.178  22.541 37.015  1.00 27.28  ? 68   VAL A CG1  1 
ATOM   514  C CG2  . VAL A 1 67  ? 60.531  23.078 37.767  1.00 28.29  ? 68   VAL A CG2  1 
ATOM   515  N N    . CYS A 1 68  ? 56.210  24.342 38.781  1.00 18.60  ? 69   CYS A N    1 
ATOM   516  C CA   . CYS A 1 68  ? 54.775  24.151 38.985  1.00 19.41  ? 69   CYS A CA   1 
ATOM   517  C C    . CYS A 1 68  ? 54.365  22.732 38.566  1.00 23.23  ? 69   CYS A C    1 
ATOM   518  O O    . CYS A 1 68  ? 54.849  22.207 37.557  1.00 26.46  ? 69   CYS A O    1 
ATOM   519  C CB   . CYS A 1 68  ? 53.972  25.216 38.227  1.00 26.54  ? 69   CYS A CB   1 
ATOM   520  S SG   . CYS A 1 68  ? 54.147  26.912 38.932  1.00 38.31  ? 69   CYS A SG   1 
ATOM   521  N N    . TYR A 1 69  ? 53.513  22.100 39.370  1.00 19.28  ? 70   TYR A N    1 
ATOM   522  C CA   . TYR A 1 69  ? 53.104  20.725 39.117  1.00 25.16  ? 70   TYR A CA   1 
ATOM   523  C C    . TYR A 1 69  ? 52.623  20.561 37.686  1.00 25.70  ? 70   TYR A C    1 
ATOM   524  O O    . TYR A 1 69  ? 51.875  21.391 37.174  1.00 23.61  ? 70   TYR A O    1 
ATOM   525  C CB   . TYR A 1 69  ? 51.998  20.303 40.075  1.00 30.05  ? 70   TYR A CB   1 
ATOM   526  C CG   . TYR A 1 69  ? 52.360  19.058 40.817  1.00 33.61  ? 70   TYR A CG   1 
ATOM   527  C CD1  . TYR A 1 69  ? 52.300  17.824 40.192  1.00 34.58  ? 70   TYR A CD1  1 
ATOM   528  C CD2  . TYR A 1 69  ? 52.795  19.114 42.133  1.00 35.04  ? 70   TYR A CD2  1 
ATOM   529  C CE1  . TYR A 1 69  ? 52.655  16.672 40.860  1.00 42.08  ? 70   TYR A CE1  1 
ATOM   530  C CE2  . TYR A 1 69  ? 53.147  17.968 42.811  1.00 36.37  ? 70   TYR A CE2  1 
ATOM   531  C CZ   . TYR A 1 69  ? 53.076  16.751 42.167  1.00 47.94  ? 70   TYR A CZ   1 
ATOM   532  O OH   . TYR A 1 69  ? 53.419  15.598 42.835  1.00 65.52  ? 70   TYR A OH   1 
ATOM   533  N N    . GLN A 1 70  ? 53.062  19.495 37.032  1.00 18.65  ? 71   GLN A N    1 
ATOM   534  C CA   . GLN A 1 70  ? 52.850  19.391 35.607  1.00 19.46  ? 71   GLN A CA   1 
ATOM   535  C C    . GLN A 1 70  ? 53.205  18.005 35.111  1.00 29.40  ? 71   GLN A C    1 
ATOM   536  O O    . GLN A 1 70  ? 54.028  17.300 35.716  1.00 25.12  ? 71   GLN A O    1 
ATOM   537  C CB   . GLN A 1 70  ? 53.698  20.446 34.875  1.00 19.26  ? 71   GLN A CB   1 
ATOM   538  C CG   . GLN A 1 70  ? 55.236  20.256 34.977  1.00 20.24  ? 71   GLN A CG   1 
ATOM   539  C CD   . GLN A 1 70  ? 56.010  21.375 34.268  1.00 25.10  ? 71   GLN A CD   1 
ATOM   540  O OE1  . GLN A 1 70  ? 56.671  21.150 33.249  1.00 24.62  ? 71   GLN A OE1  1 
ATOM   541  N NE2  . GLN A 1 70  ? 55.907  22.591 34.800  1.00 19.06  ? 71   GLN A NE2  1 
ATOM   542  N N    . TYR A 1 71  ? 52.578  17.626 34.002  1.00 28.13  ? 72   TYR A N    1 
ATOM   543  C CA   . TYR A 1 71  ? 52.910  16.396 33.299  1.00 29.93  ? 72   TYR A CA   1 
ATOM   544  C C    . TYR A 1 71  ? 54.387  16.410 32.899  1.00 32.95  ? 72   TYR A C    1 
ATOM   545  O O    . TYR A 1 71  ? 54.920  17.446 32.488  1.00 36.90  ? 72   TYR A O    1 
ATOM   546  C CB   . TYR A 1 71  ? 52.031  16.285 32.049  1.00 32.31  ? 72   TYR A CB   1 
ATOM   547  C CG   . TYR A 1 71  ? 52.355  15.103 31.170  1.00 33.21  ? 72   TYR A CG   1 
ATOM   548  C CD1  . TYR A 1 71  ? 51.892  13.830 31.491  1.00 33.81  ? 72   TYR A CD1  1 
ATOM   549  C CD2  . TYR A 1 71  ? 53.109  15.257 30.009  1.00 36.88  ? 72   TYR A CD2  1 
ATOM   550  C CE1  . TYR A 1 71  ? 52.172  12.736 30.687  1.00 35.22  ? 72   TYR A CE1  1 
ATOM   551  C CE2  . TYR A 1 71  ? 53.405  14.161 29.200  1.00 43.70  ? 72   TYR A CE2  1 
ATOM   552  C CZ   . TYR A 1 71  ? 52.926  12.903 29.550  1.00 42.10  ? 72   TYR A CZ   1 
ATOM   553  O OH   . TYR A 1 71  ? 53.206  11.808 28.774  1.00 50.29  ? 72   TYR A OH   1 
ATOM   554  N N    . VAL A 1 72  ? 55.047  15.264 33.025  1.00 31.60  ? 73   VAL A N    1 
ATOM   555  C CA   . VAL A 1 72  ? 56.444  15.127 32.621  1.00 28.08  ? 73   VAL A CA   1 
ATOM   556  C C    . VAL A 1 72  ? 56.541  14.232 31.385  1.00 36.04  ? 73   VAL A C    1 
ATOM   557  O O    . VAL A 1 72  ? 56.088  13.079 31.413  1.00 42.78  ? 73   VAL A O    1 
ATOM   558  C CB   . VAL A 1 72  ? 57.288  14.529 33.760  1.00 33.10  ? 73   VAL A CB   1 
ATOM   559  C CG1  . VAL A 1 72  ? 58.709  14.238 33.282  1.00 35.97  ? 73   VAL A CG1  1 
ATOM   560  C CG2  . VAL A 1 72  ? 57.309  15.477 34.947  1.00 31.55  ? 73   VAL A CG2  1 
ATOM   561  N N    . ASP A 1 73  ? 57.123  14.757 30.304  1.00 37.01  ? 74   ASP A N    1 
ATOM   562  C CA   . ASP A 1 73  ? 57.194  14.009 29.043  1.00 35.25  ? 74   ASP A CA   1 
ATOM   563  C C    . ASP A 1 73  ? 58.037  12.749 29.180  1.00 39.77  ? 74   ASP A C    1 
ATOM   564  O O    . ASP A 1 73  ? 59.109  12.768 29.788  1.00 46.95  ? 74   ASP A O    1 
ATOM   565  C CB   . ASP A 1 73  ? 57.729  14.871 27.895  1.00 42.65  ? 74   ASP A CB   1 
ATOM   566  C CG   . ASP A 1 73  ? 57.515  14.221 26.523  1.00 56.78  ? 74   ASP A CG   1 
ATOM   567  O OD1  . ASP A 1 73  ? 56.368  14.240 26.026  1.00 67.78  ? 74   ASP A OD1  1 
ATOM   568  O OD2  . ASP A 1 73  ? 58.484  13.685 25.942  1.00 58.02  ? 74   ASP A OD2  1 
ATOM   569  N N    . THR A 1 74  ? 57.534  11.657 28.612  1.00 45.71  ? 75   THR A N    1 
ATOM   570  C CA   . THR A 1 74  ? 58.193  10.358 28.689  1.00 52.58  ? 75   THR A CA   1 
ATOM   571  C C    . THR A 1 74  ? 58.224  9.672  27.326  1.00 51.60  ? 75   THR A C    1 
ATOM   572  O O    . THR A 1 74  ? 58.551  8.489  27.236  1.00 56.46  ? 75   THR A O    1 
ATOM   573  C CB   . THR A 1 74  ? 57.483  9.429  29.699  1.00 55.88  ? 75   THR A CB   1 
ATOM   574  O OG1  . THR A 1 74  ? 56.094  9.318  29.354  1.00 60.26  ? 75   THR A OG1  1 
ATOM   575  C CG2  . THR A 1 74  ? 57.616  9.972  31.116  1.00 48.37  ? 75   THR A CG2  1 
ATOM   576  N N    . LEU A 1 75  ? 57.879  10.416 26.275  1.00 44.86  ? 76   LEU A N    1 
ATOM   577  C CA   . LEU A 1 75  ? 57.875  9.879  24.912  1.00 48.76  ? 76   LEU A CA   1 
ATOM   578  C C    . LEU A 1 75  ? 59.211  9.225  24.538  1.00 48.84  ? 76   LEU A C    1 
ATOM   579  O O    . LEU A 1 75  ? 59.238  8.121  23.984  1.00 49.47  ? 76   LEU A O    1 
ATOM   580  C CB   . LEU A 1 75  ? 57.524  10.977 23.901  1.00 47.41  ? 76   LEU A CB   1 
ATOM   581  C CG   . LEU A 1 75  ? 57.448  10.562 22.423  1.00 52.40  ? 76   LEU A CG   1 
ATOM   582  C CD1  . LEU A 1 75  ? 56.373  9.498  22.203  1.00 47.63  ? 76   LEU A CD1  1 
ATOM   583  C CD2  . LEU A 1 75  ? 57.214  11.768 21.506  1.00 53.66  ? 76   LEU A CD2  1 
ATOM   584  N N    . TYR A 1 76  ? 60.309  9.915  24.844  1.00 45.07  ? 77   TYR A N    1 
ATOM   585  C CA   . TYR A 1 76  ? 61.658  9.402  24.597  1.00 45.20  ? 77   TYR A CA   1 
ATOM   586  C C    . TYR A 1 76  ? 62.544  9.581  25.834  1.00 48.03  ? 77   TYR A C    1 
ATOM   587  O O    . TYR A 1 76  ? 63.318  10.539 25.914  1.00 45.20  ? 77   TYR A O    1 
ATOM   588  C CB   . TYR A 1 76  ? 62.308  10.130 23.420  1.00 42.08  ? 77   TYR A CB   1 
ATOM   589  C CG   . TYR A 1 76  ? 61.657  9.906  22.076  1.00 44.36  ? 77   TYR A CG   1 
ATOM   590  C CD1  . TYR A 1 76  ? 61.707  8.667  21.458  1.00 44.67  ? 77   TYR A CD1  1 
ATOM   591  C CD2  . TYR A 1 76  ? 61.019  10.947 21.409  1.00 46.33  ? 77   TYR A CD2  1 
ATOM   592  C CE1  . TYR A 1 76  ? 61.122  8.461  20.215  1.00 48.47  ? 77   TYR A CE1  1 
ATOM   593  C CE2  . TYR A 1 76  ? 60.434  10.752 20.163  1.00 47.82  ? 77   TYR A CE2  1 
ATOM   594  C CZ   . TYR A 1 76  ? 60.491  9.510  19.569  1.00 48.75  ? 77   TYR A CZ   1 
ATOM   595  O OH   . TYR A 1 76  ? 59.914  9.312  18.330  1.00 48.37  ? 77   TYR A OH   1 
ATOM   596  N N    . PRO A 1 77  ? 62.437  8.656  26.802  1.00 51.24  ? 78   PRO A N    1 
ATOM   597  C CA   . PRO A 1 77  ? 63.186  8.791  28.063  1.00 50.42  ? 78   PRO A CA   1 
ATOM   598  C C    . PRO A 1 77  ? 64.702  8.844  27.855  1.00 45.87  ? 78   PRO A C    1 
ATOM   599  O O    . PRO A 1 77  ? 65.247  8.006  27.135  1.00 43.00  ? 78   PRO A O    1 
ATOM   600  C CB   . PRO A 1 77  ? 62.795  7.522  28.841  1.00 48.09  ? 78   PRO A CB   1 
ATOM   601  C CG   . PRO A 1 77  ? 61.481  7.098  28.243  1.00 48.11  ? 78   PRO A CG   1 
ATOM   602  C CD   . PRO A 1 77  ? 61.576  7.457  26.787  1.00 46.49  ? 78   PRO A CD   1 
ATOM   603  N N    . GLY A 1 78  ? 65.367  9.815  28.480  1.00 48.89  ? 79   GLY A N    1 
ATOM   604  C CA   . GLY A 1 78  ? 66.818  9.925  28.400  1.00 48.91  ? 79   GLY A CA   1 
ATOM   605  C C    . GLY A 1 78  ? 67.331  10.723 27.213  1.00 47.98  ? 79   GLY A C    1 
ATOM   606  O O    . GLY A 1 78  ? 68.524  11.011 27.116  1.00 50.28  ? 79   GLY A O    1 
ATOM   607  N N    . PHE A 1 79  ? 66.427  11.078 26.306  1.00 43.62  ? 80   PHE A N    1 
ATOM   608  C CA   . PHE A 1 79  ? 66.785  11.806 25.098  1.00 38.07  ? 80   PHE A CA   1 
ATOM   609  C C    . PHE A 1 79  ? 66.907  13.304 25.407  1.00 38.72  ? 80   PHE A C    1 
ATOM   610  O O    . PHE A 1 79  ? 65.971  13.917 25.919  1.00 42.69  ? 80   PHE A O    1 
ATOM   611  C CB   . PHE A 1 79  ? 65.725  11.543 24.030  1.00 36.70  ? 80   PHE A CB   1 
ATOM   612  C CG   . PHE A 1 79  ? 65.947  12.285 22.754  1.00 36.78  ? 80   PHE A CG   1 
ATOM   613  C CD1  . PHE A 1 79  ? 67.136  12.140 22.050  1.00 31.54  ? 80   PHE A CD1  1 
ATOM   614  C CD2  . PHE A 1 79  ? 64.956  13.118 22.242  1.00 34.70  ? 80   PHE A CD2  1 
ATOM   615  C CE1  . PHE A 1 79  ? 67.339  12.825 20.860  1.00 37.28  ? 80   PHE A CE1  1 
ATOM   616  C CE2  . PHE A 1 79  ? 65.151  13.808 21.057  1.00 37.78  ? 80   PHE A CE2  1 
ATOM   617  C CZ   . PHE A 1 79  ? 66.340  13.663 20.363  1.00 38.30  ? 80   PHE A CZ   1 
ATOM   618  N N    . GLU A 1 80  ? 68.065  13.882 25.110  1.00 35.24  ? 81   GLU A N    1 
ATOM   619  C CA   . GLU A 1 80  ? 68.318  15.303 25.363  1.00 36.62  ? 81   GLU A CA   1 
ATOM   620  C C    . GLU A 1 80  ? 67.260  16.235 24.770  1.00 37.57  ? 81   GLU A C    1 
ATOM   621  O O    . GLU A 1 80  ? 66.849  17.206 25.411  1.00 42.46  ? 81   GLU A O    1 
ATOM   622  C CB   . GLU A 1 80  ? 69.700  15.694 24.828  1.00 46.89  ? 81   GLU A CB   1 
ATOM   623  C CG   . GLU A 1 80  ? 70.605  16.348 25.857  1.00 64.17  ? 81   GLU A CG   1 
ATOM   624  C CD   . GLU A 1 80  ? 70.083  17.688 26.339  1.00 80.59  ? 81   GLU A CD   1 
ATOM   625  O OE1  . GLU A 1 80  ? 69.929  18.604 25.500  1.00 86.74  ? 81   GLU A OE1  1 
ATOM   626  O OE2  . GLU A 1 80  ? 69.828  17.829 27.558  1.00 85.20  ? 81   GLU A OE2  1 
ATOM   627  N N    . GLY A 1 81  ? 66.821  15.939 23.551  1.00 36.12  ? 82   GLY A N    1 
ATOM   628  C CA   . GLY A 1 81  ? 65.860  16.778 22.862  1.00 36.72  ? 82   GLY A CA   1 
ATOM   629  C C    . GLY A 1 81  ? 64.532  16.952 23.576  1.00 38.85  ? 82   GLY A C    1 
ATOM   630  O O    . GLY A 1 81  ? 63.825  17.932 23.340  1.00 35.16  ? 82   GLY A O    1 
ATOM   631  N N    . THR A 1 82  ? 64.190  16.005 24.446  1.00 35.70  ? 83   THR A N    1 
ATOM   632  C CA   . THR A 1 82  ? 62.963  16.106 25.225  1.00 36.24  ? 83   THR A CA   1 
ATOM   633  C C    . THR A 1 82  ? 63.248  16.449 26.682  1.00 33.83  ? 83   THR A C    1 
ATOM   634  O O    . THR A 1 82  ? 62.493  17.188 27.310  1.00 35.97  ? 83   THR A O    1 
ATOM   635  C CB   . THR A 1 82  ? 62.143  14.814 25.150  1.00 39.00  ? 83   THR A CB   1 
ATOM   636  O OG1  . THR A 1 82  ? 62.978  13.700 25.494  1.00 39.62  ? 83   THR A OG1  1 
ATOM   637  C CG2  . THR A 1 82  ? 61.599  14.620 23.752  1.00 38.34  ? 83   THR A CG2  1 
ATOM   638  N N    . GLU A 1 83  ? 64.339  15.909 27.215  1.00 34.44  ? 84   GLU A N    1 
ATOM   639  C CA   . GLU A 1 83  ? 64.686  16.118 28.617  1.00 41.14  ? 84   GLU A CA   1 
ATOM   640  C C    . GLU A 1 83  ? 64.970  17.586 28.946  1.00 39.65  ? 84   GLU A C    1 
ATOM   641  O O    . GLU A 1 83  ? 64.690  18.041 30.059  1.00 37.49  ? 84   GLU A O    1 
ATOM   642  C CB   . GLU A 1 83  ? 65.876  15.238 29.024  1.00 47.92  ? 84   GLU A CB   1 
ATOM   643  C CG   . GLU A 1 83  ? 65.625  13.723 28.922  1.00 58.05  ? 84   GLU A CG   1 
ATOM   644  C CD   . GLU A 1 83  ? 64.484  13.223 29.811  1.00 62.37  ? 84   GLU A CD   1 
ATOM   645  O OE1  . GLU A 1 83  ? 63.850  14.045 30.513  1.00 61.88  ? 84   GLU A OE1  1 
ATOM   646  O OE2  . GLU A 1 83  ? 64.224  11.998 29.804  1.00 64.44  ? 84   GLU A OE2  1 
ATOM   647  N N    . MET A 1 84  ? 65.508  18.321 27.973  1.00 34.71  ? 85   MET A N    1 
ATOM   648  C CA   . MET A 1 84  ? 65.837  19.740 28.159  1.00 30.41  ? 85   MET A CA   1 
ATOM   649  C C    . MET A 1 84  ? 64.614  20.607 28.477  1.00 29.16  ? 85   MET A C    1 
ATOM   650  O O    . MET A 1 84  ? 64.759  21.701 29.006  1.00 32.91  ? 85   MET A O    1 
ATOM   651  C CB   . MET A 1 84  ? 66.545  20.290 26.919  1.00 29.07  ? 85   MET A CB   1 
ATOM   652  C CG   . MET A 1 84  ? 65.684  20.296 25.656  1.00 32.28  ? 85   MET A CG   1 
ATOM   653  S SD   . MET A 1 84  ? 66.630  20.843 24.213  1.00 53.40  ? 85   MET A SD   1 
ATOM   654  C CE   . MET A 1 84  ? 66.688  22.608 24.532  1.00 36.90  ? 85   MET A CE   1 
ATOM   655  N N    . TRP A 1 85  ? 63.419  20.110 28.156  1.00 26.59  ? 86   TRP A N    1 
ATOM   656  C CA   . TRP A 1 85  ? 62.170  20.822 28.424  1.00 27.15  ? 86   TRP A CA   1 
ATOM   657  C C    . TRP A 1 85  ? 61.468  20.353 29.701  1.00 28.12  ? 86   TRP A C    1 
ATOM   658  O O    . TRP A 1 85  ? 60.429  20.895 30.086  1.00 23.74  ? 86   TRP A O    1 
ATOM   659  C CB   . TRP A 1 85  ? 61.219  20.629 27.247  1.00 19.61  ? 86   TRP A CB   1 
ATOM   660  C CG   . TRP A 1 85  ? 61.850  20.995 25.943  1.00 29.56  ? 86   TRP A CG   1 
ATOM   661  C CD1  . TRP A 1 85  ? 62.213  20.147 24.940  1.00 30.00  ? 86   TRP A CD1  1 
ATOM   662  C CD2  . TRP A 1 85  ? 62.217  22.314 25.510  1.00 35.50  ? 86   TRP A CD2  1 
ATOM   663  N NE1  . TRP A 1 85  ? 62.770  20.857 23.902  1.00 39.28  ? 86   TRP A NE1  1 
ATOM   664  C CE2  . TRP A 1 85  ? 62.787  22.187 24.228  1.00 35.02  ? 86   TRP A CE2  1 
ATOM   665  C CE3  . TRP A 1 85  ? 62.109  23.586 26.080  1.00 31.75  ? 86   TRP A CE3  1 
ATOM   666  C CZ2  . TRP A 1 85  ? 63.239  23.282 23.503  1.00 32.53  ? 86   TRP A CZ2  1 
ATOM   667  C CZ3  . TRP A 1 85  ? 62.568  24.669 25.366  1.00 32.37  ? 86   TRP A CZ3  1 
ATOM   668  C CH2  . TRP A 1 85  ? 63.124  24.515 24.088  1.00 28.27  ? 86   TRP A CH2  1 
ATOM   669  N N    . ASN A 1 86  ? 62.012  19.319 30.329  1.00 23.82  ? 87   ASN A N    1 
ATOM   670  C CA   . ASN A 1 86  ? 61.394  18.746 31.522  1.00 30.04  ? 87   ASN A CA   1 
ATOM   671  C C    . ASN A 1 86  ? 61.824  19.477 32.784  1.00 29.97  ? 87   ASN A C    1 
ATOM   672  O O    . ASN A 1 86  ? 62.871  20.109 32.810  1.00 29.23  ? 87   ASN A O    1 
ATOM   673  C CB   . ASN A 1 86  ? 61.731  17.253 31.647  1.00 32.46  ? 87   ASN A CB   1 
ATOM   674  C CG   . ASN A 1 86  ? 60.909  16.386 30.709  1.00 35.87  ? 87   ASN A CG   1 
ATOM   675  O OD1  . ASN A 1 86  ? 59.835  16.784 30.257  1.00 38.75  ? 87   ASN A OD1  1 
ATOM   676  N ND2  . ASN A 1 86  ? 61.404  15.187 30.426  1.00 34.52  ? 87   ASN A ND2  1 
ATOM   677  N N    . PRO A 1 87  ? 61.010  19.384 33.840  1.00 34.00  ? 88   PRO A N    1 
ATOM   678  C CA   . PRO A 1 87  ? 61.303  20.081 35.099  1.00 33.61  ? 88   PRO A CA   1 
ATOM   679  C C    . PRO A 1 87  ? 62.662  19.671 35.653  1.00 33.60  ? 88   PRO A C    1 
ATOM   680  O O    . PRO A 1 87  ? 62.949  18.483 35.721  1.00 32.18  ? 88   PRO A O    1 
ATOM   681  C CB   . PRO A 1 87  ? 60.190  19.599 36.029  1.00 31.03  ? 88   PRO A CB   1 
ATOM   682  C CG   . PRO A 1 87  ? 59.066  19.188 35.092  1.00 32.90  ? 88   PRO A CG   1 
ATOM   683  C CD   . PRO A 1 87  ? 59.755  18.611 33.898  1.00 30.90  ? 88   PRO A CD   1 
ATOM   684  N N    . ASN A 1 88  ? 63.476  20.649 36.036  1.00 29.93  ? 89   ASN A N    1 
ATOM   685  C CA   . ASN A 1 88  ? 64.811  20.403 36.563  1.00 30.24  ? 89   ASN A CA   1 
ATOM   686  C C    . ASN A 1 88  ? 64.894  20.823 38.038  1.00 32.89  ? 89   ASN A C    1 
ATOM   687  O O    . ASN A 1 88  ? 65.980  20.982 38.599  1.00 36.71  ? 89   ASN A O    1 
ATOM   688  C CB   . ASN A 1 88  ? 65.848  21.177 35.740  1.00 33.47  ? 89   ASN A CB   1 
ATOM   689  C CG   . ASN A 1 88  ? 65.663  22.688 35.843  1.00 39.70  ? 89   ASN A CG   1 
ATOM   690  O OD1  . ASN A 1 88  ? 64.541  23.190 36.060  1.00 29.63  ? 89   ASN A OD1  1 
ATOM   691  N ND2  . ASN A 1 88  ? 66.762  23.422 35.692  1.00 40.56  ? 89   ASN A ND2  1 
ATOM   692  N N    . ARG A 1 89  ? 63.726  21.030 38.641  1.00 28.41  ? 90   ARG A N    1 
ATOM   693  C CA   . ARG A 1 89  ? 63.576  21.231 40.078  1.00 24.61  ? 90   ARG A CA   1 
ATOM   694  C C    . ARG A 1 89  ? 62.379  20.382 40.462  1.00 32.93  ? 90   ARG A C    1 
ATOM   695  O O    . ARG A 1 89  ? 61.617  19.966 39.580  1.00 27.26  ? 90   ARG A O    1 
ATOM   696  C CB   . ARG A 1 89  ? 63.258  22.687 40.385  1.00 27.09  ? 90   ARG A CB   1 
ATOM   697  C CG   . ARG A 1 89  ? 64.411  23.637 40.191  1.00 35.23  ? 90   ARG A CG   1 
ATOM   698  C CD   . ARG A 1 89  ? 65.615  23.096 40.924  1.00 45.62  ? 90   ARG A CD   1 
ATOM   699  N NE   . ARG A 1 89  ? 66.600  24.122 41.241  1.00 49.94  ? 90   ARG A NE   1 
ATOM   700  C CZ   . ARG A 1 89  ? 67.632  24.433 40.468  1.00 45.85  ? 90   ARG A CZ   1 
ATOM   701  N NH1  . ARG A 1 89  ? 67.817  23.807 39.312  1.00 37.18  ? 90   ARG A NH1  1 
ATOM   702  N NH2  . ARG A 1 89  ? 68.474  25.379 40.857  1.00 51.88  ? 90   ARG A NH2  1 
ATOM   703  N N    . GLU A 1 90  ? 62.185  20.140 41.755  1.00 31.26  ? 91   GLU A N    1 
ATOM   704  C CA   . GLU A 1 90  ? 61.057  19.322 42.189  1.00 36.75  ? 91   GLU A CA   1 
ATOM   705  C C    . GLU A 1 90  ? 59.703  19.991 41.894  1.00 33.41  ? 91   GLU A C    1 
ATOM   706  O O    . GLU A 1 90  ? 59.586  21.229 41.879  1.00 27.31  ? 91   GLU A O    1 
ATOM   707  C CB   . GLU A 1 90  ? 61.170  18.988 43.672  1.00 44.60  ? 91   GLU A CB   1 
ATOM   708  C CG   . GLU A 1 90  ? 60.825  20.141 44.591  1.00 57.20  ? 91   GLU A CG   1 
ATOM   709  C CD   . GLU A 1 90  ? 60.748  19.704 46.044  1.00 75.48  ? 91   GLU A CD   1 
ATOM   710  O OE1  . GLU A 1 90  ? 61.335  18.649 46.379  1.00 79.89  ? 91   GLU A OE1  1 
ATOM   711  O OE2  . GLU A 1 90  ? 60.097  20.409 46.849  1.00 80.79  ? 91   GLU A OE2  1 
ATOM   712  N N    . LEU A 1 91  ? 58.689  19.164 41.646  1.00 27.89  ? 92   LEU A N    1 
ATOM   713  C CA   . LEU A 1 91  ? 57.346  19.650 41.335  1.00 25.54  ? 92   LEU A CA   1 
ATOM   714  C C    . LEU A 1 91  ? 56.639  20.081 42.612  1.00 32.20  ? 92   LEU A C    1 
ATOM   715  O O    . LEU A 1 91  ? 56.722  19.407 43.640  1.00 35.54  ? 92   LEU A O    1 
ATOM   716  C CB   . LEU A 1 91  ? 56.519  18.547 40.681  1.00 23.18  ? 92   LEU A CB   1 
ATOM   717  C CG   . LEU A 1 91  ? 57.031  17.929 39.391  1.00 27.20  ? 92   LEU A CG   1 
ATOM   718  C CD1  . LEU A 1 91  ? 56.021  16.917 38.871  1.00 25.06  ? 92   LEU A CD1  1 
ATOM   719  C CD2  . LEU A 1 91  ? 57.263  19.026 38.363  1.00 29.68  ? 92   LEU A CD2  1 
ATOM   720  N N    . SER A 1 92  ? 55.927  21.196 42.554  1.00 28.85  ? 93   SER A N    1 
ATOM   721  C CA   . SER A 1 92  ? 55.179  21.638 43.720  1.00 24.21  ? 93   SER A CA   1 
ATOM   722  C C    . SER A 1 92  ? 54.053  22.569 43.324  1.00 24.18  ? 93   SER A C    1 
ATOM   723  O O    . SER A 1 92  ? 54.147  23.261 42.312  1.00 27.29  ? 93   SER A O    1 
ATOM   724  C CB   . SER A 1 92  ? 56.108  22.338 44.713  1.00 18.72  ? 93   SER A CB   1 
ATOM   725  O OG   . SER A 1 92  ? 55.356  22.856 45.790  1.00 24.15  ? 93   SER A OG   1 
ATOM   726  N N    . GLU A 1 93  ? 52.988  22.587 44.118  1.00 26.58  ? 94   GLU A N    1 
ATOM   727  C CA   . GLU A 1 93  ? 51.940  23.573 43.913  1.00 28.94  ? 94   GLU A CA   1 
ATOM   728  C C    . GLU A 1 93  ? 52.391  24.927 44.458  1.00 30.74  ? 94   GLU A C    1 
ATOM   729  O O    . GLU A 1 93  ? 51.882  25.968 44.047  1.00 36.36  ? 94   GLU A O    1 
ATOM   730  C CB   . GLU A 1 93  ? 50.627  23.128 44.549  1.00 26.32  ? 94   GLU A CB   1 
ATOM   731  C CG   . GLU A 1 93  ? 49.861  22.110 43.721  1.00 31.60  ? 94   GLU A CG   1 
ATOM   732  C CD   . GLU A 1 93  ? 48.517  21.746 44.343  1.00 41.21  ? 94   GLU A CD   1 
ATOM   733  O OE1  . GLU A 1 93  ? 47.518  22.437 44.037  1.00 32.86  ? 94   GLU A OE1  1 
ATOM   734  O OE2  . GLU A 1 93  ? 48.469  20.779 45.142  1.00 45.00  ? 94   GLU A OE2  1 
ATOM   735  N N    . ASP A 1 94  ? 53.361  24.895 45.372  1.00 25.05  ? 95   ASP A N    1 
ATOM   736  C CA   . ASP A 1 94  ? 54.027  26.107 45.879  1.00 26.88  ? 95   ASP A CA   1 
ATOM   737  C C    . ASP A 1 94  ? 55.149  26.481 44.904  1.00 28.41  ? 95   ASP A C    1 
ATOM   738  O O    . ASP A 1 94  ? 56.305  26.078 45.080  1.00 23.87  ? 95   ASP A O    1 
ATOM   739  C CB   . ASP A 1 94  ? 54.577  25.836 47.293  1.00 18.94  ? 95   ASP A CB   1 
ATOM   740  C CG   . ASP A 1 94  ? 55.387  26.990 47.862  1.00 31.45  ? 95   ASP A CG   1 
ATOM   741  O OD1  . ASP A 1 94  ? 55.455  28.075 47.252  1.00 33.05  ? 95   ASP A OD1  1 
ATOM   742  O OD2  . ASP A 1 94  ? 55.969  26.804 48.953  1.00 33.91  ? 95   ASP A OD2  1 
ATOM   743  N N    . CYS A 1 95  ? 54.800  27.245 43.869  1.00 24.39  ? 96   CYS A N    1 
ATOM   744  C CA   . CYS A 1 95  ? 55.717  27.492 42.757  1.00 21.47  ? 96   CYS A CA   1 
ATOM   745  C C    . CYS A 1 95  ? 55.690  28.918 42.254  1.00 22.02  ? 96   CYS A C    1 
ATOM   746  O O    . CYS A 1 95  ? 56.277  29.212 41.215  1.00 22.68  ? 96   CYS A O    1 
ATOM   747  C CB   . CYS A 1 95  ? 55.373  26.575 41.588  1.00 21.54  ? 96   CYS A CB   1 
ATOM   748  S SG   . CYS A 1 95  ? 53.656  26.809 40.939  1.00 28.99  ? 96   CYS A SG   1 
ATOM   749  N N    . LEU A 1 96  ? 54.998  29.805 42.964  1.00 20.36  ? 97   LEU A N    1 
ATOM   750  C CA   . LEU A 1 96  ? 54.836  31.170 42.456  1.00 19.67  ? 97   LEU A CA   1 
ATOM   751  C C    . LEU A 1 96  ? 56.004  32.099 42.860  1.00 20.92  ? 97   LEU A C    1 
ATOM   752  O O    . LEU A 1 96  ? 55.899  32.945 43.765  1.00 21.20  ? 97   LEU A O    1 
ATOM   753  C CB   . LEU A 1 96  ? 53.450  31.740 42.792  1.00 17.99  ? 97   LEU A CB   1 
ATOM   754  C CG   . LEU A 1 96  ? 52.298  31.038 42.049  1.00 24.85  ? 97   LEU A CG   1 
ATOM   755  C CD1  . LEU A 1 96  ? 50.948  31.671 42.350  1.00 19.87  ? 97   LEU A CD1  1 
ATOM   756  C CD2  . LEU A 1 96  ? 52.537  31.029 40.537  1.00 24.46  ? 97   LEU A CD2  1 
ATOM   757  N N    . TYR A 1 97  ? 57.119  31.922 42.159  1.00 20.66  ? 98   TYR A N    1 
ATOM   758  C CA   . TYR A 1 97  ? 58.318  32.709 42.390  1.00 24.79  ? 98   TYR A CA   1 
ATOM   759  C C    . TYR A 1 97  ? 58.828  33.270 41.070  1.00 21.32  ? 98   TYR A C    1 
ATOM   760  O O    . TYR A 1 97  ? 58.594  32.702 40.005  1.00 23.74  ? 98   TYR A O    1 
ATOM   761  C CB   . TYR A 1 97  ? 59.403  31.839 43.040  1.00 21.12  ? 98   TYR A CB   1 
ATOM   762  C CG   . TYR A 1 97  ? 58.953  31.198 44.323  1.00 24.36  ? 98   TYR A CG   1 
ATOM   763  C CD1  . TYR A 1 97  ? 58.151  30.062 44.307  1.00 20.36  ? 98   TYR A CD1  1 
ATOM   764  C CD2  . TYR A 1 97  ? 59.332  31.727 45.558  1.00 29.87  ? 98   TYR A CD2  1 
ATOM   765  C CE1  . TYR A 1 97  ? 57.741  29.463 45.487  1.00 22.80  ? 98   TYR A CE1  1 
ATOM   766  C CE2  . TYR A 1 97  ? 58.931  31.138 46.743  1.00 24.95  ? 98   TYR A CE2  1 
ATOM   767  C CZ   . TYR A 1 97  ? 58.133  30.009 46.697  1.00 29.97  ? 98   TYR A CZ   1 
ATOM   768  O OH   . TYR A 1 97  ? 57.720  29.422 47.860  1.00 31.08  ? 98   TYR A OH   1 
ATOM   769  N N    . LEU A 1 98  ? 59.533  34.388 41.149  1.00 21.86  ? 99   LEU A N    1 
ATOM   770  C CA   . LEU A 1 98  ? 60.122  34.978 39.967  1.00 24.53  ? 99   LEU A CA   1 
ATOM   771  C C    . LEU A 1 98  ? 61.617  35.247 40.184  1.00 21.97  ? 99   LEU A C    1 
ATOM   772  O O    . LEU A 1 98  ? 62.126  35.134 41.307  1.00 22.14  ? 99   LEU A O    1 
ATOM   773  C CB   . LEU A 1 98  ? 59.340  36.229 39.544  1.00 17.30  ? 99   LEU A CB   1 
ATOM   774  C CG   . LEU A 1 98  ? 59.165  37.350 40.573  1.00 22.39  ? 99   LEU A CG   1 
ATOM   775  C CD1  . LEU A 1 98  ? 60.491  38.061 40.860  1.00 17.35  ? 99   LEU A CD1  1 
ATOM   776  C CD2  . LEU A 1 98  ? 58.100  38.353 40.110  1.00 17.22  ? 99   LEU A CD2  1 
ATOM   777  N N    . ASN A 1 99  ? 62.307  35.597 39.101  1.00 20.09  ? 100  ASN A N    1 
ATOM   778  C CA   . ASN A 1 99  ? 63.756  35.668 39.098  1.00 21.29  ? 100  ASN A CA   1 
ATOM   779  C C    . ASN A 1 99  ? 64.178  36.976 38.479  1.00 21.35  ? 100  ASN A C    1 
ATOM   780  O O    . ASN A 1 99  ? 63.601  37.388 37.483  1.00 21.66  ? 100  ASN A O    1 
ATOM   781  C CB   . ASN A 1 99  ? 64.336  34.512 38.280  1.00 16.37  ? 100  ASN A CB   1 
ATOM   782  C CG   . ASN A 1 99  ? 63.702  33.167 38.632  1.00 26.43  ? 100  ASN A CG   1 
ATOM   783  O OD1  . ASN A 1 99  ? 63.936  32.620 39.712  1.00 25.28  ? 100  ASN A OD1  1 
ATOM   784  N ND2  . ASN A 1 99  ? 62.907  32.624 37.709  1.00 20.01  ? 100  ASN A ND2  1 
ATOM   785  N N    . VAL A 1 100 ? 65.168  37.640 39.071  1.00 18.79  ? 101  VAL A N    1 
ATOM   786  C CA   . VAL A 1 100 ? 65.689  38.879 38.496  1.00 18.99  ? 101  VAL A CA   1 
ATOM   787  C C    . VAL A 1 100 ? 67.205  38.774 38.294  1.00 24.19  ? 101  VAL A C    1 
ATOM   788  O O    . VAL A 1 100 ? 67.927  38.356 39.197  1.00 27.96  ? 101  VAL A O    1 
ATOM   789  C CB   . VAL A 1 100 ? 65.358  40.096 39.384  1.00 22.04  ? 101  VAL A CB   1 
ATOM   790  C CG1  . VAL A 1 100 ? 65.896  41.385 38.760  1.00 20.29  ? 101  VAL A CG1  1 
ATOM   791  C CG2  . VAL A 1 100 ? 63.866  40.187 39.628  1.00 19.82  ? 101  VAL A CG2  1 
ATOM   792  N N    . TRP A 1 101 ? 67.672  39.120 37.099  1.00 25.02  ? 102  TRP A N    1 
ATOM   793  C CA   . TRP A 1 101 ? 69.098  39.219 36.830  1.00 20.11  ? 102  TRP A CA   1 
ATOM   794  C C    . TRP A 1 101 ? 69.410  40.669 36.540  1.00 27.42  ? 102  TRP A C    1 
ATOM   795  O O    . TRP A 1 101 ? 68.738  41.304 35.727  1.00 25.75  ? 102  TRP A O    1 
ATOM   796  C CB   . TRP A 1 101 ? 69.490  38.418 35.598  1.00 22.91  ? 102  TRP A CB   1 
ATOM   797  C CG   . TRP A 1 101 ? 69.490  36.937 35.776  1.00 25.42  ? 102  TRP A CG   1 
ATOM   798  C CD1  . TRP A 1 101 ? 70.552  36.151 36.124  1.00 22.76  ? 102  TRP A CD1  1 
ATOM   799  C CD2  . TRP A 1 101 ? 68.371  36.054 35.586  1.00 20.44  ? 102  TRP A CD2  1 
ATOM   800  N NE1  . TRP A 1 101 ? 70.158  34.834 36.168  1.00 23.30  ? 102  TRP A NE1  1 
ATOM   801  C CE2  . TRP A 1 101 ? 68.837  34.751 35.843  1.00 21.52  ? 102  TRP A CE2  1 
ATOM   802  C CE3  . TRP A 1 101 ? 67.033  36.249 35.234  1.00 20.12  ? 102  TRP A CE3  1 
ATOM   803  C CZ2  . TRP A 1 101 ? 67.991  33.636 35.747  1.00 18.23  ? 102  TRP A CZ2  1 
ATOM   804  C CZ3  . TRP A 1 101 ? 66.202  35.144 35.138  1.00 18.04  ? 102  TRP A CZ3  1 
ATOM   805  C CH2  . TRP A 1 101 ? 66.686  33.853 35.390  1.00 18.58  ? 102  TRP A CH2  1 
ATOM   806  N N    . THR A 1 102 ? 70.437  41.198 37.190  1.00 24.79  ? 103  THR A N    1 
ATOM   807  C CA   . THR A 1 102 ? 70.828  42.578 36.941  1.00 26.31  ? 103  THR A CA   1 
ATOM   808  C C    . THR A 1 102 ? 72.349  42.677 36.824  1.00 28.49  ? 103  THR A C    1 
ATOM   809  O O    . THR A 1 102 ? 73.080  41.838 37.365  1.00 31.54  ? 103  THR A O    1 
ATOM   810  C CB   . THR A 1 102 ? 70.311  43.494 38.054  1.00 32.80  ? 103  THR A CB   1 
ATOM   811  O OG1  . THR A 1 102 ? 70.418  44.860 37.640  1.00 42.45  ? 103  THR A OG1  1 
ATOM   812  C CG2  . THR A 1 102 ? 71.122  43.279 39.332  1.00 24.09  ? 103  THR A CG2  1 
ATOM   813  N N    . PRO A 1 103 ? 72.836  43.684 36.091  1.00 29.65  ? 104  PRO A N    1 
ATOM   814  C CA   . PRO A 1 103 ? 74.294  43.830 35.967  1.00 35.77  ? 104  PRO A CA   1 
ATOM   815  C C    . PRO A 1 103 ? 74.969  44.072 37.311  1.00 40.93  ? 104  PRO A C    1 
ATOM   816  O O    . PRO A 1 103 ? 74.353  44.630 38.220  1.00 44.41  ? 104  PRO A O    1 
ATOM   817  C CB   . PRO A 1 103 ? 74.441  45.053 35.063  1.00 36.37  ? 104  PRO A CB   1 
ATOM   818  C CG   . PRO A 1 103 ? 73.190  45.019 34.215  1.00 34.96  ? 104  PRO A CG   1 
ATOM   819  C CD   . PRO A 1 103 ? 72.104  44.547 35.147  1.00 30.58  ? 104  PRO A CD   1 
ATOM   820  N N    . TYR A 1 104 ? 76.213  43.624 37.436  1.00 50.23  ? 105  TYR A N    1 
ATOM   821  C CA   . TYR A 1 104 ? 77.029  43.863 38.623  1.00 54.70  ? 105  TYR A CA   1 
ATOM   822  C C    . TYR A 1 104 ? 78.164  44.793 38.205  1.00 56.93  ? 105  TYR A C    1 
ATOM   823  O O    . TYR A 1 104 ? 78.983  44.435 37.366  1.00 58.78  ? 105  TYR A O    1 
ATOM   824  C CB   . TYR A 1 104 ? 77.600  42.535 39.120  1.00 59.25  ? 105  TYR A CB   1 
ATOM   825  C CG   . TYR A 1 104 ? 78.253  42.542 40.491  1.00 62.12  ? 105  TYR A CG   1 
ATOM   826  C CD1  . TYR A 1 104 ? 79.469  43.191 40.717  1.00 61.64  ? 105  TYR A CD1  1 
ATOM   827  C CD2  . TYR A 1 104 ? 77.679  41.843 41.549  1.00 62.57  ? 105  TYR A CD2  1 
ATOM   828  C CE1  . TYR A 1 104 ? 80.073  43.166 41.976  1.00 57.47  ? 105  TYR A CE1  1 
ATOM   829  C CE2  . TYR A 1 104 ? 78.272  41.812 42.805  1.00 60.93  ? 105  TYR A CE2  1 
ATOM   830  C CZ   . TYR A 1 104 ? 79.465  42.472 43.014  1.00 64.24  ? 105  TYR A CZ   1 
ATOM   831  O OH   . TYR A 1 104 ? 80.036  42.434 44.269  1.00 67.28  ? 105  TYR A OH   1 
ATOM   832  N N    . PRO A 1 105 ? 78.218  45.997 38.784  1.00 58.18  ? 106  PRO A N    1 
ATOM   833  C CA   . PRO A 1 105 ? 77.310  46.473 39.828  1.00 54.25  ? 106  PRO A CA   1 
ATOM   834  C C    . PRO A 1 105 ? 75.993  46.981 39.251  1.00 51.82  ? 106  PRO A C    1 
ATOM   835  O O    . PRO A 1 105 ? 75.892  47.275 38.051  1.00 50.45  ? 106  PRO A O    1 
ATOM   836  C CB   . PRO A 1 105 ? 78.087  47.638 40.438  1.00 49.63  ? 106  PRO A CB   1 
ATOM   837  C CG   . PRO A 1 105 ? 78.821  48.202 39.281  1.00 48.89  ? 106  PRO A CG   1 
ATOM   838  C CD   . PRO A 1 105 ? 79.201  47.028 38.408  1.00 55.73  ? 106  PRO A CD   1 
ATOM   839  N N    . ARG A 1 106 ? 74.999  47.074 40.130  1.00 50.88  ? 107  ARG A N    1 
ATOM   840  C CA   . ARG A 1 106 ? 73.659  47.545 39.802  1.00 50.23  ? 107  ARG A CA   1 
ATOM   841  C C    . ARG A 1 106 ? 73.724  48.849 39.005  1.00 54.99  ? 107  ARG A C    1 
ATOM   842  O O    . ARG A 1 106 ? 74.492  49.750 39.340  1.00 61.66  ? 107  ARG A O    1 
ATOM   843  C CB   . ARG A 1 106 ? 72.893  47.750 41.111  1.00 48.66  ? 107  ARG A CB   1 
ATOM   844  C CG   . ARG A 1 106 ? 71.387  47.823 41.014  1.00 52.88  ? 107  ARG A CG   1 
ATOM   845  C CD   . ARG A 1 106 ? 70.787  47.791 42.418  1.00 61.32  ? 107  ARG A CD   1 
ATOM   846  N NE   . ARG A 1 106 ? 71.259  46.635 43.183  1.00 65.75  ? 107  ARG A NE   1 
ATOM   847  C CZ   . ARG A 1 106 ? 71.035  46.446 44.482  1.00 70.37  ? 107  ARG A CZ   1 
ATOM   848  N NH1  . ARG A 1 106 ? 70.342  47.336 45.179  1.00 73.30  ? 107  ARG A NH1  1 
ATOM   849  N NH2  . ARG A 1 106 ? 71.508  45.364 45.091  1.00 68.21  ? 107  ARG A NH2  1 
ATOM   850  N N    . PRO A 1 107 ? 72.927  48.947 37.932  1.00 56.10  ? 108  PRO A N    1 
ATOM   851  C CA   . PRO A 1 107 ? 72.927  50.147 37.083  1.00 55.94  ? 108  PRO A CA   1 
ATOM   852  C C    . PRO A 1 107 ? 72.645  51.411 37.894  1.00 63.18  ? 108  PRO A C    1 
ATOM   853  O O    . PRO A 1 107 ? 71.994  51.346 38.941  1.00 63.49  ? 108  PRO A O    1 
ATOM   854  C CB   . PRO A 1 107 ? 71.784  49.877 36.094  1.00 48.45  ? 108  PRO A CB   1 
ATOM   855  C CG   . PRO A 1 107 ? 71.689  48.372 36.039  1.00 47.78  ? 108  PRO A CG   1 
ATOM   856  C CD   . PRO A 1 107 ? 71.983  47.923 37.450  1.00 47.83  ? 108  PRO A CD   1 
ATOM   857  N N    . THR A 1 108 ? 73.143  52.547 37.422  1.00 67.39  ? 109  THR A N    1 
ATOM   858  C CA   . THR A 1 108 ? 72.967  53.797 38.147  1.00 72.44  ? 109  THR A CA   1 
ATOM   859  C C    . THR A 1 108 ? 71.903  54.661 37.485  1.00 74.24  ? 109  THR A C    1 
ATOM   860  O O    . THR A 1 108 ? 71.369  55.585 38.100  1.00 78.90  ? 109  THR A O    1 
ATOM   861  C CB   . THR A 1 108 ? 74.287  54.567 38.264  1.00 74.65  ? 109  THR A CB   1 
ATOM   862  O OG1  . THR A 1 108 ? 75.020  54.440 37.038  1.00 74.06  ? 109  THR A OG1  1 
ATOM   863  C CG2  . THR A 1 108 ? 75.119  54.002 39.403  1.00 73.33  ? 109  THR A CG2  1 
ATOM   864  N N    . SER A 1 109 ? 71.604  54.356 36.226  1.00 66.86  ? 110  SER A N    1 
ATOM   865  C CA   . SER A 1 109 ? 70.475  54.974 35.547  1.00 64.18  ? 110  SER A CA   1 
ATOM   866  C C    . SER A 1 109 ? 69.484  53.887 35.135  1.00 66.07  ? 110  SER A C    1 
ATOM   867  O O    . SER A 1 109 ? 69.885  52.751 34.873  1.00 65.53  ? 110  SER A O    1 
ATOM   868  C CB   . SER A 1 109 ? 70.936  55.811 34.347  1.00 64.92  ? 110  SER A CB   1 
ATOM   869  O OG   . SER A 1 109 ? 71.700  55.054 33.429  1.00 64.65  ? 110  SER A OG   1 
ATOM   870  N N    . PRO A 1 110 ? 68.184  54.226 35.107  1.00 65.10  ? 111  PRO A N    1 
ATOM   871  C CA   . PRO A 1 110 ? 67.104  53.287 34.762  1.00 60.73  ? 111  PRO A CA   1 
ATOM   872  C C    . PRO A 1 110 ? 67.399  52.484 33.488  1.00 56.52  ? 111  PRO A C    1 
ATOM   873  O O    . PRO A 1 110 ? 67.640  53.053 32.422  1.00 54.06  ? 111  PRO A O    1 
ATOM   874  C CB   . PRO A 1 110 ? 65.904  54.207 34.548  1.00 62.45  ? 111  PRO A CB   1 
ATOM   875  C CG   . PRO A 1 110 ? 66.182  55.388 35.440  1.00 63.88  ? 111  PRO A CG   1 
ATOM   876  C CD   . PRO A 1 110 ? 67.674  55.574 35.424  1.00 63.37  ? 111  PRO A CD   1 
ATOM   877  N N    . THR A 1 111 ? 67.377  51.162 33.620  1.00 54.92  ? 112  THR A N    1 
ATOM   878  C CA   . THR A 1 111 ? 67.744  50.262 32.537  1.00 49.94  ? 112  THR A CA   1 
ATOM   879  C C    . THR A 1 111 ? 66.525  49.503 32.017  1.00 42.94  ? 112  THR A C    1 
ATOM   880  O O    . THR A 1 111 ? 65.674  49.083 32.803  1.00 41.28  ? 112  THR A O    1 
ATOM   881  C CB   . THR A 1 111 ? 68.780  49.245 33.028  1.00 48.87  ? 112  THR A CB   1 
ATOM   882  O OG1  . THR A 1 111 ? 69.935  49.942 33.509  1.00 56.09  ? 112  THR A OG1  1 
ATOM   883  C CG2  . THR A 1 111 ? 69.186  48.309 31.912  1.00 46.26  ? 112  THR A CG2  1 
ATOM   884  N N    . PRO A 1 112 ? 66.447  49.316 30.689  1.00 40.99  ? 113  PRO A N    1 
ATOM   885  C CA   . PRO A 1 112 ? 65.381  48.514 30.061  1.00 42.52  ? 113  PRO A CA   1 
ATOM   886  C C    . PRO A 1 112 ? 65.242  47.136 30.699  1.00 39.43  ? 113  PRO A C    1 
ATOM   887  O O    . PRO A 1 112 ? 66.238  46.491 31.070  1.00 33.20  ? 113  PRO A O    1 
ATOM   888  C CB   . PRO A 1 112 ? 65.848  48.366 28.605  1.00 43.53  ? 113  PRO A CB   1 
ATOM   889  C CG   . PRO A 1 112 ? 67.306  48.803 28.602  1.00 46.40  ? 113  PRO A CG   1 
ATOM   890  C CD   . PRO A 1 112 ? 67.402  49.831 29.693  1.00 40.64  ? 113  PRO A CD   1 
ATOM   891  N N    . VAL A 1 113 ? 63.996  46.699 30.836  1.00 23.73  ? 114  VAL A N    1 
ATOM   892  C CA   . VAL A 1 113 ? 63.696  45.409 31.427  1.00 26.10  ? 114  VAL A CA   1 
ATOM   893  C C    . VAL A 1 113 ? 63.100  44.448 30.404  1.00 29.54  ? 114  VAL A C    1 
ATOM   894  O O    . VAL A 1 113 ? 62.174  44.797 29.664  1.00 28.66  ? 114  VAL A O    1 
ATOM   895  C CB   . VAL A 1 113 ? 62.709  45.561 32.583  1.00 24.16  ? 114  VAL A CB   1 
ATOM   896  C CG1  . VAL A 1 113 ? 62.448  44.208 33.234  1.00 21.13  ? 114  VAL A CG1  1 
ATOM   897  C CG2  . VAL A 1 113 ? 63.256  46.543 33.595  1.00 26.08  ? 114  VAL A CG2  1 
ATOM   898  N N    . LEU A 1 114 ? 63.653  43.242 30.366  1.00 26.29  ? 115  LEU A N    1 
ATOM   899  C CA   . LEU A 1 114 ? 63.107  42.158 29.573  1.00 22.66  ? 115  LEU A CA   1 
ATOM   900  C C    . LEU A 1 114 ? 62.418  41.169 30.513  1.00 29.50  ? 115  LEU A C    1 
ATOM   901  O O    . LEU A 1 114 ? 63.025  40.689 31.477  1.00 27.98  ? 115  LEU A O    1 
ATOM   902  C CB   . LEU A 1 114 ? 64.221  41.463 28.791  1.00 26.55  ? 115  LEU A CB   1 
ATOM   903  C CG   . LEU A 1 114 ? 64.557  42.117 27.451  1.00 34.10  ? 115  LEU A CG   1 
ATOM   904  C CD1  . LEU A 1 114 ? 65.994  41.863 27.050  1.00 38.32  ? 115  LEU A CD1  1 
ATOM   905  C CD2  . LEU A 1 114 ? 63.620  41.573 26.400  1.00 29.09  ? 115  LEU A CD2  1 
ATOM   906  N N    . VAL A 1 115 ? 61.146  40.890 30.248  1.00 22.92  ? 116  VAL A N    1 
ATOM   907  C CA   . VAL A 1 115 ? 60.401  39.928 31.040  1.00 17.58  ? 116  VAL A CA   1 
ATOM   908  C C    . VAL A 1 115 ? 60.040  38.710 30.198  1.00 25.18  ? 116  VAL A C    1 
ATOM   909  O O    . VAL A 1 115 ? 59.276  38.816 29.229  1.00 24.78  ? 116  VAL A O    1 
ATOM   910  C CB   . VAL A 1 115 ? 59.108  40.538 31.624  1.00 19.13  ? 116  VAL A CB   1 
ATOM   911  C CG1  . VAL A 1 115 ? 58.334  39.483 32.415  1.00 19.06  ? 116  VAL A CG1  1 
ATOM   912  C CG2  . VAL A 1 115 ? 59.435  41.734 32.520  1.00 18.48  ? 116  VAL A CG2  1 
ATOM   913  N N    . TRP A 1 116 ? 60.591  37.558 30.585  1.00 17.71  ? 117  TRP A N    1 
ATOM   914  C CA   . TRP A 1 116 ? 60.431  36.305 29.852  1.00 21.36  ? 117  TRP A CA   1 
ATOM   915  C C    . TRP A 1 116 ? 59.255  35.498 30.355  1.00 21.24  ? 117  TRP A C    1 
ATOM   916  O O    . TRP A 1 116 ? 59.129  35.272 31.566  1.00 21.62  ? 117  TRP A O    1 
ATOM   917  C CB   . TRP A 1 116 ? 61.685  35.446 30.013  1.00 21.77  ? 117  TRP A CB   1 
ATOM   918  C CG   . TRP A 1 116 ? 61.553  34.078 29.393  1.00 22.52  ? 117  TRP A CG   1 
ATOM   919  C CD1  . TRP A 1 116 ? 61.527  32.871 30.047  1.00 19.38  ? 117  TRP A CD1  1 
ATOM   920  C CD2  . TRP A 1 116 ? 61.451  33.781 27.992  1.00 20.59  ? 117  TRP A CD2  1 
ATOM   921  N NE1  . TRP A 1 116 ? 61.416  31.847 29.135  1.00 20.74  ? 117  TRP A NE1  1 
ATOM   922  C CE2  . TRP A 1 116 ? 61.364  32.374 27.878  1.00 23.59  ? 117  TRP A CE2  1 
ATOM   923  C CE3  . TRP A 1 116 ? 61.420  34.568 26.837  1.00 20.54  ? 117  TRP A CE3  1 
ATOM   924  C CZ2  . TRP A 1 116 ? 61.245  31.741 26.630  1.00 20.05  ? 117  TRP A CZ2  1 
ATOM   925  C CZ3  . TRP A 1 116 ? 61.307  33.941 25.605  1.00 19.49  ? 117  TRP A CZ3  1 
ATOM   926  C CH2  . TRP A 1 116 ? 61.219  32.535 25.510  1.00 21.89  ? 117  TRP A CH2  1 
ATOM   927  N N    . ILE A 1 117 ? 58.405  35.054 29.433  1.00 22.41  ? 118  ILE A N    1 
ATOM   928  C CA   . ILE A 1 117 ? 57.320  34.134 29.771  1.00 22.58  ? 118  ILE A CA   1 
ATOM   929  C C    . ILE A 1 117 ? 57.527  32.827 29.019  1.00 23.60  ? 118  ILE A C    1 
ATOM   930  O O    . ILE A 1 117 ? 57.354  32.782 27.792  1.00 19.66  ? 118  ILE A O    1 
ATOM   931  C CB   . ILE A 1 117 ? 55.948  34.715 29.397  1.00 21.87  ? 118  ILE A CB   1 
ATOM   932  C CG1  . ILE A 1 117 ? 55.722  36.057 30.098  1.00 16.07  ? 118  ILE A CG1  1 
ATOM   933  C CG2  . ILE A 1 117 ? 54.844  33.722 29.726  1.00 15.09  ? 118  ILE A CG2  1 
ATOM   934  C CD1  . ILE A 1 117 ? 54.441  36.743 29.705  1.00 19.77  ? 118  ILE A CD1  1 
ATOM   935  N N    . TYR A 1 118 ? 57.899  31.765 29.736  1.00 22.72  ? 119  TYR A N    1 
ATOM   936  C CA   . TYR A 1 118 ? 58.149  30.476 29.081  1.00 19.24  ? 119  TYR A CA   1 
ATOM   937  C C    . TYR A 1 118 ? 56.911  29.889 28.430  1.00 18.02  ? 119  TYR A C    1 
ATOM   938  O O    . TYR A 1 118 ? 55.777  30.205 28.817  1.00 17.31  ? 119  TYR A O    1 
ATOM   939  C CB   . TYR A 1 118 ? 58.758  29.445 30.038  1.00 17.77  ? 119  TYR A CB   1 
ATOM   940  C CG   . TYR A 1 118 ? 57.913  29.126 31.255  1.00 18.44  ? 119  TYR A CG   1 
ATOM   941  C CD1  . TYR A 1 118 ? 56.749  28.373 31.144  1.00 18.80  ? 119  TYR A CD1  1 
ATOM   942  C CD2  . TYR A 1 118 ? 58.303  29.548 32.521  1.00 16.57  ? 119  TYR A CD2  1 
ATOM   943  C CE1  . TYR A 1 118 ? 55.984  28.068 32.265  1.00 22.58  ? 119  TYR A CE1  1 
ATOM   944  C CE2  . TYR A 1 118 ? 57.554  29.241 33.649  1.00 18.94  ? 119  TYR A CE2  1 
ATOM   945  C CZ   . TYR A 1 118 ? 56.399  28.506 33.511  1.00 21.44  ? 119  TYR A CZ   1 
ATOM   946  O OH   . TYR A 1 118 ? 55.650  28.225 34.619  1.00 23.91  ? 119  TYR A OH   1 
ATOM   947  N N    . GLY A 1 119 ? 57.149  29.019 27.446  1.00 18.65  ? 120  GLY A N    1 
ATOM   948  C CA   . GLY A 1 119 ? 56.105  28.239 26.803  1.00 16.30  ? 120  GLY A CA   1 
ATOM   949  C C    . GLY A 1 119 ? 56.023  26.824 27.367  1.00 20.11  ? 120  GLY A C    1 
ATOM   950  O O    . GLY A 1 119 ? 56.578  26.548 28.437  1.00 22.57  ? 120  GLY A O    1 
ATOM   951  N N    . GLY A 1 120 ? 55.325  25.932 26.657  1.00 18.06  ? 121  GLY A N    1 
ATOM   952  C CA   . GLY A 1 120 ? 55.053  24.595 27.151  1.00 18.78  ? 121  GLY A CA   1 
ATOM   953  C C    . GLY A 1 120 ? 53.572  24.247 27.050  1.00 21.37  ? 121  GLY A C    1 
ATOM   954  O O    . GLY A 1 120 ? 53.052  23.443 27.836  1.00 24.05  ? 121  GLY A O    1 
ATOM   955  N N    . GLY A 1 121 ? 52.890  24.863 26.088  1.00 17.60  ? 122  GLY A N    1 
ATOM   956  C CA   . GLY A 1 121 ? 51.521  24.510 25.738  1.00 21.65  ? 122  GLY A CA   1 
ATOM   957  C C    . GLY A 1 121 ? 50.481  24.744 26.830  1.00 19.06  ? 122  GLY A C    1 
ATOM   958  O O    . GLY A 1 121 ? 49.390  24.189 26.775  1.00 20.27  ? 122  GLY A O    1 
ATOM   959  N N    . PHE A 1 122 ? 50.830  25.577 27.805  1.00 16.33  ? 123  PHE A N    1 
ATOM   960  C CA   . PHE A 1 122 ? 50.006  25.849 28.982  1.00 16.35  ? 123  PHE A CA   1 
ATOM   961  C C    . PHE A 1 122 ? 49.872  24.635 29.906  1.00 25.74  ? 123  PHE A C    1 
ATOM   962  O O    . PHE A 1 122 ? 49.086  24.656 30.853  1.00 23.58  ? 123  PHE A O    1 
ATOM   963  C CB   . PHE A 1 122 ? 48.632  26.400 28.580  1.00 16.74  ? 123  PHE A CB   1 
ATOM   964  C CG   . PHE A 1 122 ? 48.687  27.785 27.954  1.00 18.64  ? 123  PHE A CG   1 
ATOM   965  C CD1  . PHE A 1 122 ? 49.033  28.892 28.714  1.00 16.20  ? 123  PHE A CD1  1 
ATOM   966  C CD2  . PHE A 1 122 ? 48.380  27.971 26.613  1.00 16.81  ? 123  PHE A CD2  1 
ATOM   967  C CE1  . PHE A 1 122 ? 49.075  30.160 28.152  1.00 20.23  ? 123  PHE A CE1  1 
ATOM   968  C CE2  . PHE A 1 122 ? 48.417  29.234 26.041  1.00 17.20  ? 123  PHE A CE2  1 
ATOM   969  C CZ   . PHE A 1 122 ? 48.773  30.337 26.812  1.00 16.75  ? 123  PHE A CZ   1 
ATOM   970  N N    . TYR A 1 123 ? 50.653  23.588 29.643  1.00 19.29  ? 124  TYR A N    1 
ATOM   971  C CA   . TYR A 1 123 ? 50.588  22.390 30.476  1.00 22.44  ? 124  TYR A CA   1 
ATOM   972  C C    . TYR A 1 123 ? 51.928  22.054 31.136  1.00 21.48  ? 124  TYR A C    1 
ATOM   973  O O    . TYR A 1 123 ? 52.005  21.157 31.967  1.00 23.81  ? 124  TYR A O    1 
ATOM   974  C CB   . TYR A 1 123 ? 50.075  21.182 29.681  1.00 18.14  ? 124  TYR A CB   1 
ATOM   975  C CG   . TYR A 1 123 ? 51.069  20.630 28.675  1.00 25.03  ? 124  TYR A CG   1 
ATOM   976  C CD1  . TYR A 1 123 ? 52.106  19.797 29.079  1.00 19.85  ? 124  TYR A CD1  1 
ATOM   977  C CD2  . TYR A 1 123 ? 50.964  20.935 27.327  1.00 24.12  ? 124  TYR A CD2  1 
ATOM   978  C CE1  . TYR A 1 123 ? 53.009  19.296 28.176  1.00 22.84  ? 124  TYR A CE1  1 
ATOM   979  C CE2  . TYR A 1 123 ? 51.867  20.432 26.414  1.00 26.64  ? 124  TYR A CE2  1 
ATOM   980  C CZ   . TYR A 1 123 ? 52.887  19.615 26.853  1.00 27.31  ? 124  TYR A CZ   1 
ATOM   981  O OH   . TYR A 1 123 ? 53.786  19.106 25.962  1.00 33.57  ? 124  TYR A OH   1 
ATOM   982  N N    . SER A 1 124 ? 52.975  22.777 30.755  1.00 19.23  ? 125  SER A N    1 
ATOM   983  C CA   . SER A 1 124 ? 54.318  22.526 31.265  1.00 20.42  ? 125  SER A CA   1 
ATOM   984  C C    . SER A 1 124 ? 55.194  23.756 31.099  1.00 24.28  ? 125  SER A C    1 
ATOM   985  O O    . SER A 1 124 ? 54.775  24.784 30.550  1.00 20.51  ? 125  SER A O    1 
ATOM   986  C CB   . SER A 1 124 ? 54.972  21.372 30.504  1.00 21.55  ? 125  SER A CB   1 
ATOM   987  O OG   . SER A 1 124 ? 55.103  21.700 29.131  1.00 20.34  ? 125  SER A OG   1 
ATOM   988  N N    . GLY A 1 125 ? 56.432  23.630 31.553  1.00 15.83  ? 126  GLY A N    1 
ATOM   989  C CA   . GLY A 1 125 ? 57.384  24.718 31.458  1.00 15.45  ? 126  GLY A CA   1 
ATOM   990  C C    . GLY A 1 125 ? 57.854  25.119 32.839  1.00 20.39  ? 126  GLY A C    1 
ATOM   991  O O    . GLY A 1 125 ? 57.240  24.770 33.864  1.00 16.79  ? 126  GLY A O    1 
ATOM   992  N N    . ALA A 1 126 ? 58.962  25.849 32.867  1.00 15.52  ? 127  ALA A N    1 
ATOM   993  C CA   . ALA A 1 126 ? 59.510  26.360 34.112  1.00 18.60  ? 127  ALA A CA   1 
ATOM   994  C C    . ALA A 1 126 ? 60.522  27.446 33.794  1.00 24.02  ? 127  ALA A C    1 
ATOM   995  O O    . ALA A 1 126 ? 61.204  27.392 32.764  1.00 25.86  ? 127  ALA A O    1 
ATOM   996  C CB   . ALA A 1 126 ? 60.164  25.242 34.891  1.00 16.93  ? 127  ALA A CB   1 
ATOM   997  N N    . SER A 1 127 ? 60.630  28.430 34.678  1.00 16.11  ? 128  SER A N    1 
ATOM   998  C CA   . SER A 1 127 ? 61.591  29.489 34.459  1.00 22.34  ? 128  SER A CA   1 
ATOM   999  C C    . SER A 1 127 ? 63.006  29.000 34.799  1.00 25.44  ? 128  SER A C    1 
ATOM   1000 O O    . SER A 1 127 ? 63.973  29.676 34.509  1.00 22.80  ? 128  SER A O    1 
ATOM   1001 C CB   . SER A 1 127 ? 61.219  30.736 35.263  1.00 21.79  ? 128  SER A CB   1 
ATOM   1002 O OG   . SER A 1 127 ? 61.343  30.510 36.654  1.00 23.15  ? 128  SER A OG   1 
ATOM   1003 N N    . SER A 1 128 ? 63.121  27.810 35.385  1.00 22.29  ? 129  SER A N    1 
ATOM   1004 C CA   . SER A 1 128 ? 64.418  27.331 35.881  1.00 23.30  ? 129  SER A CA   1 
ATOM   1005 C C    . SER A 1 128 ? 65.222  26.541 34.850  1.00 22.91  ? 129  SER A C    1 
ATOM   1006 O O    . SER A 1 128 ? 66.361  26.199 35.094  1.00 25.43  ? 129  SER A O    1 
ATOM   1007 C CB   . SER A 1 128 ? 64.230  26.487 37.140  1.00 18.91  ? 129  SER A CB   1 
ATOM   1008 O OG   . SER A 1 128 ? 63.293  25.450 36.902  1.00 24.20  ? 129  SER A OG   1 
ATOM   1009 N N    . LEU A 1 129 ? 64.626  26.263 33.697  1.00 20.66  ? 130  LEU A N    1 
ATOM   1010 C CA   . LEU A 1 129 ? 65.307  25.522 32.639  1.00 25.47  ? 130  LEU A CA   1 
ATOM   1011 C C    . LEU A 1 129 ? 66.621  26.190 32.225  1.00 27.51  ? 130  LEU A C    1 
ATOM   1012 O O    . LEU A 1 129 ? 66.694  27.422 32.107  1.00 29.87  ? 130  LEU A O    1 
ATOM   1013 C CB   . LEU A 1 129 ? 64.395  25.367 31.416  1.00 17.60  ? 130  LEU A CB   1 
ATOM   1014 C CG   . LEU A 1 129 ? 63.058  24.682 31.691  1.00 28.49  ? 130  LEU A CG   1 
ATOM   1015 C CD1  . LEU A 1 129 ? 62.278  24.467 30.391  1.00 28.11  ? 130  LEU A CD1  1 
ATOM   1016 C CD2  . LEU A 1 129 ? 63.268  23.363 32.448  1.00 23.49  ? 130  LEU A CD2  1 
ATOM   1017 N N    . ASP A 1 130 ? 67.643  25.365 31.998  1.00 24.62  ? 131  ASP A N    1 
ATOM   1018 C CA   . ASP A 1 130 ? 68.975  25.845 31.608  1.00 28.80  ? 131  ASP A CA   1 
ATOM   1019 C C    . ASP A 1 130 ? 68.910  26.778 30.413  1.00 26.18  ? 131  ASP A C    1 
ATOM   1020 O O    . ASP A 1 130 ? 69.581  27.806 30.375  1.00 29.24  ? 131  ASP A O    1 
ATOM   1021 C CB   . ASP A 1 130 ? 69.903  24.669 31.288  1.00 27.86  ? 131  ASP A CB   1 
ATOM   1022 C CG   . ASP A 1 130 ? 70.218  23.822 32.515  1.00 41.48  ? 131  ASP A CG   1 
ATOM   1023 O OD1  . ASP A 1 130 ? 69.968  24.296 33.644  1.00 45.41  ? 131  ASP A OD1  1 
ATOM   1024 O OD2  . ASP A 1 130 ? 70.721  22.686 32.348  1.00 50.34  ? 131  ASP A OD2  1 
ATOM   1025 N N    . VAL A 1 131 ? 68.065  26.428 29.454  1.00 24.53  ? 132  VAL A N    1 
ATOM   1026 C CA   . VAL A 1 131 ? 67.942  27.209 28.231  1.00 23.71  ? 132  VAL A CA   1 
ATOM   1027 C C    . VAL A 1 131 ? 67.347  28.623 28.453  1.00 27.14  ? 132  VAL A C    1 
ATOM   1028 O O    . VAL A 1 131 ? 67.393  29.453 27.554  1.00 27.15  ? 132  VAL A O    1 
ATOM   1029 C CB   . VAL A 1 131 ? 67.164  26.405 27.154  1.00 39.74  ? 132  VAL A CB   1 
ATOM   1030 C CG1  . VAL A 1 131 ? 65.707  26.158 27.591  1.00 38.16  ? 132  VAL A CG1  1 
ATOM   1031 C CG2  . VAL A 1 131 ? 67.233  27.097 25.825  1.00 40.64  ? 132  VAL A CG2  1 
ATOM   1032 N N    . TYR A 1 132 ? 66.812  28.897 29.650  1.00 24.29  ? 133  TYR A N    1 
ATOM   1033 C CA   . TYR A 1 132 ? 66.255  30.218 29.964  1.00 25.34  ? 133  TYR A CA   1 
ATOM   1034 C C    . TYR A 1 132 ? 67.147  31.039 30.893  1.00 32.31  ? 133  TYR A C    1 
ATOM   1035 O O    . TYR A 1 132 ? 66.727  32.092 31.393  1.00 29.06  ? 133  TYR A O    1 
ATOM   1036 C CB   . TYR A 1 132 ? 64.866  30.105 30.608  1.00 22.59  ? 133  TYR A CB   1 
ATOM   1037 C CG   . TYR A 1 132 ? 63.838  29.362 29.784  1.00 24.81  ? 133  TYR A CG   1 
ATOM   1038 C CD1  . TYR A 1 132 ? 63.881  29.363 28.396  1.00 22.00  ? 133  TYR A CD1  1 
ATOM   1039 C CD2  . TYR A 1 132 ? 62.824  28.644 30.408  1.00 17.70  ? 133  TYR A CD2  1 
ATOM   1040 C CE1  . TYR A 1 132 ? 62.922  28.665 27.651  1.00 25.20  ? 133  TYR A CE1  1 
ATOM   1041 C CE2  . TYR A 1 132 ? 61.889  27.947 29.685  1.00 17.19  ? 133  TYR A CE2  1 
ATOM   1042 C CZ   . TYR A 1 132 ? 61.931  27.959 28.315  1.00 24.42  ? 133  TYR A CZ   1 
ATOM   1043 O OH   . TYR A 1 132 ? 60.969  27.255 27.622  1.00 24.63  ? 133  TYR A OH   1 
ATOM   1044 N N    . ASP A 1 133 ? 68.358  30.541 31.140  1.00 28.70  ? 134  ASP A N    1 
ATOM   1045 C CA   . ASP A 1 133 ? 69.334  31.212 31.995  1.00 32.24  ? 134  ASP A CA   1 
ATOM   1046 C C    . ASP A 1 133 ? 69.589  32.648 31.514  1.00 34.41  ? 134  ASP A C    1 
ATOM   1047 O O    . ASP A 1 133 ? 70.141  32.863 30.430  1.00 31.61  ? 134  ASP A O    1 
ATOM   1048 C CB   . ASP A 1 133 ? 70.643  30.411 31.985  1.00 32.12  ? 134  ASP A CB   1 
ATOM   1049 C CG   . ASP A 1 133 ? 71.643  30.895 33.020  1.00 34.93  ? 134  ASP A CG   1 
ATOM   1050 O OD1  . ASP A 1 133 ? 71.471  32.009 33.569  1.00 34.98  ? 134  ASP A OD1  1 
ATOM   1051 O OD2  . ASP A 1 133 ? 72.620  30.155 33.275  1.00 40.25  ? 134  ASP A OD2  1 
ATOM   1052 N N    . GLY A 1 134 ? 69.200  33.628 32.324  1.00 29.08  ? 135  GLY A N    1 
ATOM   1053 C CA   . GLY A 1 134 ? 69.290  35.018 31.919  1.00 24.68  ? 135  GLY A CA   1 
ATOM   1054 C C    . GLY A 1 134 ? 70.649  35.694 32.074  1.00 30.15  ? 135  GLY A C    1 
ATOM   1055 O O    . GLY A 1 134 ? 70.812  36.865 31.711  1.00 31.58  ? 135  GLY A O    1 
ATOM   1056 N N    . ARG A 1 135 ? 71.633  34.972 32.598  1.00 28.81  ? 136  ARG A N    1 
ATOM   1057 C CA   . ARG A 1 135 ? 72.921  35.586 32.913  1.00 29.33  ? 136  ARG A CA   1 
ATOM   1058 C C    . ARG A 1 135 ? 73.642  36.182 31.681  1.00 27.34  ? 136  ARG A C    1 
ATOM   1059 O O    . ARG A 1 135 ? 74.207  37.267 31.754  1.00 33.58  ? 136  ARG A O    1 
ATOM   1060 C CB   . ARG A 1 135 ? 73.821  34.602 33.673  1.00 26.91  ? 136  ARG A CB   1 
ATOM   1061 C CG   . ARG A 1 135 ? 74.514  33.571 32.780  1.00 34.32  ? 136  ARG A CG   1 
ATOM   1062 C CD   . ARG A 1 135 ? 75.403  32.649 33.578  1.00 32.05  ? 136  ARG A CD   1 
ATOM   1063 N NE   . ARG A 1 135 ? 74.621  31.801 34.463  1.00 36.35  ? 136  ARG A NE   1 
ATOM   1064 C CZ   . ARG A 1 135 ? 75.115  31.159 35.518  1.00 44.66  ? 136  ARG A CZ   1 
ATOM   1065 N NH1  . ARG A 1 135 ? 76.407  31.257 35.827  1.00 45.98  ? 136  ARG A NH1  1 
ATOM   1066 N NH2  . ARG A 1 135 ? 74.312  30.415 36.266  1.00 39.36  ? 136  ARG A NH2  1 
ATOM   1067 N N    . PHE A 1 136 ? 73.596  35.489 30.551  1.00 24.50  ? 137  PHE A N    1 
ATOM   1068 C CA   . PHE A 1 136 ? 74.304  35.942 29.344  1.00 24.69  ? 137  PHE A CA   1 
ATOM   1069 C C    . PHE A 1 136 ? 73.707  37.199 28.695  1.00 25.32  ? 137  PHE A C    1 
ATOM   1070 O O    . PHE A 1 136 ? 74.449  38.087 28.260  1.00 32.59  ? 137  PHE A O    1 
ATOM   1071 C CB   . PHE A 1 136 ? 74.377  34.812 28.328  1.00 23.42  ? 137  PHE A CB   1 
ATOM   1072 C CG   . PHE A 1 136 ? 74.817  33.516 28.920  1.00 35.07  ? 137  PHE A CG   1 
ATOM   1073 C CD1  . PHE A 1 136 ? 76.162  33.300 29.228  1.00 33.83  ? 137  PHE A CD1  1 
ATOM   1074 C CD2  . PHE A 1 136 ? 73.890  32.516 29.197  1.00 30.18  ? 137  PHE A CD2  1 
ATOM   1075 C CE1  . PHE A 1 136 ? 76.582  32.097 29.791  1.00 36.40  ? 137  PHE A CE1  1 
ATOM   1076 C CE2  . PHE A 1 136 ? 74.299  31.304 29.759  1.00 35.25  ? 137  PHE A CE2  1 
ATOM   1077 C CZ   . PHE A 1 136 ? 75.654  31.097 30.057  1.00 38.35  ? 137  PHE A CZ   1 
ATOM   1078 N N    . LEU A 1 137 ? 72.378  37.273 28.631  1.00 24.77  ? 138  LEU A N    1 
ATOM   1079 C CA   . LEU A 1 137 ? 71.694  38.458 28.107  1.00 32.11  ? 138  LEU A CA   1 
ATOM   1080 C C    . LEU A 1 137 ? 72.030  39.702 28.919  1.00 32.90  ? 138  LEU A C    1 
ATOM   1081 O O    . LEU A 1 137 ? 72.292  40.781 28.371  1.00 33.23  ? 138  LEU A O    1 
ATOM   1082 C CB   . LEU A 1 137 ? 70.182  38.260 28.154  1.00 27.44  ? 138  LEU A CB   1 
ATOM   1083 C CG   . LEU A 1 137 ? 69.484  38.048 26.828  1.00 27.39  ? 138  LEU A CG   1 
ATOM   1084 C CD1  . LEU A 1 137 ? 67.985  37.850 27.050  1.00 26.45  ? 138  LEU A CD1  1 
ATOM   1085 C CD2  . LEU A 1 137 ? 69.767  39.220 25.911  1.00 26.49  ? 138  LEU A CD2  1 
ATOM   1086 N N    . VAL A 1 138 ? 71.999  39.541 30.236  1.00 31.39  ? 139  VAL A N    1 
ATOM   1087 C CA   . VAL A 1 138 ? 72.221  40.660 31.136  1.00 29.28  ? 139  VAL A CA   1 
ATOM   1088 C C    . VAL A 1 138 ? 73.629  41.168 30.973  1.00 30.01  ? 139  VAL A C    1 
ATOM   1089 O O    . VAL A 1 138 ? 73.847  42.369 30.801  1.00 35.18  ? 139  VAL A O    1 
ATOM   1090 C CB   . VAL A 1 138 ? 71.931  40.275 32.584  1.00 27.50  ? 139  VAL A CB   1 
ATOM   1091 C CG1  . VAL A 1 138 ? 72.304  41.414 33.518  1.00 28.39  ? 139  VAL A CG1  1 
ATOM   1092 C CG2  . VAL A 1 138 ? 70.455  39.934 32.720  1.00 21.50  ? 139  VAL A CG2  1 
ATOM   1093 N N    . GLN A 1 139 ? 74.581  40.247 30.974  1.00 33.76  ? 140  GLN A N    1 
ATOM   1094 C CA   . GLN A 1 139 ? 75.983  40.608 30.789  1.00 40.99  ? 140  GLN A CA   1 
ATOM   1095 C C    . GLN A 1 139 ? 76.269  41.243 29.416  1.00 40.49  ? 140  GLN A C    1 
ATOM   1096 O O    . GLN A 1 139 ? 76.858  42.318 29.340  1.00 40.79  ? 140  GLN A O    1 
ATOM   1097 C CB   . GLN A 1 139 ? 76.866  39.383 31.024  1.00 46.71  ? 140  GLN A CB   1 
ATOM   1098 C CG   . GLN A 1 139 ? 78.255  39.720 31.536  1.00 55.81  ? 140  GLN A CG   1 
ATOM   1099 C CD   . GLN A 1 139 ? 79.215  40.085 30.420  1.00 61.43  ? 140  GLN A CD   1 
ATOM   1100 O OE1  . GLN A 1 139 ? 79.117  39.558 29.313  1.00 59.33  ? 140  GLN A OE1  1 
ATOM   1101 N NE2  . GLN A 1 139 ? 80.148  40.992 30.706  1.00 64.70  ? 140  GLN A NE2  1 
ATOM   1102 N N    . ALA A 1 140 ? 75.837  40.585 28.339  1.00 37.62  ? 141  ALA A N    1 
ATOM   1103 C CA   . ALA A 1 140 ? 76.085  41.083 26.981  1.00 38.54  ? 141  ALA A CA   1 
ATOM   1104 C C    . ALA A 1 140 ? 75.404  42.414 26.667  1.00 43.39  ? 141  ALA A C    1 
ATOM   1105 O O    . ALA A 1 140 ? 75.981  43.257 25.983  1.00 44.25  ? 141  ALA A O    1 
ATOM   1106 C CB   . ALA A 1 140 ? 75.670  40.038 25.932  1.00 31.13  ? 141  ALA A CB   1 
ATOM   1107 N N    . GLU A 1 141 ? 74.167  42.594 27.123  1.00 42.17  ? 142  GLU A N    1 
ATOM   1108 C CA   . GLU A 1 141 ? 73.387  43.730 26.639  1.00 39.87  ? 142  GLU A CA   1 
ATOM   1109 C C    . GLU A 1 141 ? 73.019  44.726 27.724  1.00 42.38  ? 142  GLU A C    1 
ATOM   1110 O O    . GLU A 1 141 ? 72.304  45.693 27.453  1.00 46.11  ? 142  GLU A O    1 
ATOM   1111 C CB   . GLU A 1 141 ? 72.136  43.256 25.881  1.00 33.57  ? 142  GLU A CB   1 
ATOM   1112 C CG   . GLU A 1 141 ? 72.432  42.573 24.536  1.00 38.42  ? 142  GLU A CG   1 
ATOM   1113 C CD   . GLU A 1 141 ? 73.209  43.467 23.563  1.00 46.95  ? 142  GLU A CD   1 
ATOM   1114 O OE1  . GLU A 1 141 ? 73.037  44.709 23.610  1.00 41.18  ? 142  GLU A OE1  1 
ATOM   1115 O OE2  . GLU A 1 141 ? 73.992  42.922 22.744  1.00 52.93  ? 142  GLU A OE2  1 
ATOM   1116 N N    . ARG A 1 142 ? 73.520  44.490 28.936  1.00 42.56  ? 143  ARG A N    1 
ATOM   1117 C CA   . ARG A 1 142 ? 73.254  45.363 30.086  1.00 43.78  ? 143  ARG A CA   1 
ATOM   1118 C C    . ARG A 1 142 ? 71.786  45.742 30.246  1.00 39.73  ? 143  ARG A C    1 
ATOM   1119 O O    . ARG A 1 142 ? 71.443  46.912 30.271  1.00 46.46  ? 143  ARG A O    1 
ATOM   1120 C CB   . ARG A 1 142 ? 74.108  46.636 30.027  1.00 47.86  ? 143  ARG A CB   1 
ATOM   1121 C CG   . ARG A 1 142 ? 75.566  46.422 30.429  1.00 61.21  ? 143  ARG A CG   1 
ATOM   1122 C CD   . ARG A 1 142 ? 76.269  47.745 30.755  1.00 70.68  ? 143  ARG A CD   1 
ATOM   1123 N NE   . ARG A 1 142 ? 75.725  48.390 31.951  1.00 73.76  ? 143  ARG A NE   1 
ATOM   1124 C CZ   . ARG A 1 142 ? 75.987  47.999 33.195  1.00 74.38  ? 143  ARG A CZ   1 
ATOM   1125 N NH1  . ARG A 1 142 ? 76.781  46.956 33.410  1.00 76.09  ? 143  ARG A NH1  1 
ATOM   1126 N NH2  . ARG A 1 142 ? 75.450  48.644 34.225  1.00 71.25  ? 143  ARG A NH2  1 
ATOM   1127 N N    . THR A 1 143 ? 70.923  44.745 30.339  1.00 40.34  ? 144  THR A N    1 
ATOM   1128 C CA   . THR A 1 143 ? 69.515  44.969 30.620  1.00 33.64  ? 144  THR A CA   1 
ATOM   1129 C C    . THR A 1 143 ? 69.201  44.269 31.925  1.00 31.20  ? 144  THR A C    1 
ATOM   1130 O O    . THR A 1 143 ? 70.002  43.479 32.428  1.00 29.98  ? 144  THR A O    1 
ATOM   1131 C CB   . THR A 1 143 ? 68.621  44.357 29.525  1.00 44.98  ? 144  THR A CB   1 
ATOM   1132 O OG1  . THR A 1 143 ? 69.011  42.994 29.307  1.00 48.13  ? 144  THR A OG1  1 
ATOM   1133 C CG2  . THR A 1 143 ? 68.761  45.124 28.213  1.00 49.11  ? 144  THR A CG2  1 
ATOM   1134 N N    . VAL A 1 144 ? 68.037  44.554 32.483  1.00 31.08  ? 145  VAL A N    1 
ATOM   1135 C CA   . VAL A 1 144 ? 67.546  43.742 33.575  1.00 28.45  ? 145  VAL A CA   1 
ATOM   1136 C C    . VAL A 1 144 ? 66.668  42.659 32.957  1.00 30.16  ? 145  VAL A C    1 
ATOM   1137 O O    . VAL A 1 144 ? 65.900  42.927 32.022  1.00 29.96  ? 145  VAL A O    1 
ATOM   1138 C CB   . VAL A 1 144 ? 66.762  44.583 34.588  1.00 28.22  ? 145  VAL A CB   1 
ATOM   1139 C CG1  . VAL A 1 144 ? 66.187  43.702 35.685  1.00 28.87  ? 145  VAL A CG1  1 
ATOM   1140 C CG2  . VAL A 1 144 ? 67.664  45.634 35.180  1.00 25.38  ? 145  VAL A CG2  1 
ATOM   1141 N N    . LEU A 1 145 ? 66.810  41.432 33.448  1.00 19.98  ? 146  LEU A N    1 
ATOM   1142 C CA   . LEU A 1 145 ? 65.992  40.328 32.964  1.00 20.36  ? 146  LEU A CA   1 
ATOM   1143 C C    . LEU A 1 145 ? 65.163  39.750 34.112  1.00 24.67  ? 146  LEU A C    1 
ATOM   1144 O O    . LEU A 1 145 ? 65.655  39.582 35.228  1.00 29.38  ? 146  LEU A O    1 
ATOM   1145 C CB   . LEU A 1 145 ? 66.874  39.262 32.323  1.00 27.62  ? 146  LEU A CB   1 
ATOM   1146 C CG   . LEU A 1 145 ? 66.191  38.012 31.768  1.00 37.79  ? 146  LEU A CG   1 
ATOM   1147 C CD1  . LEU A 1 145 ? 65.017  38.388 30.913  1.00 41.87  ? 146  LEU A CD1  1 
ATOM   1148 C CD2  . LEU A 1 145 ? 67.181  37.213 30.945  1.00 42.51  ? 146  LEU A CD2  1 
ATOM   1149 N N    . VAL A 1 146 ? 63.895  39.481 33.833  1.00 24.86  ? 147  VAL A N    1 
ATOM   1150 C CA   . VAL A 1 146 ? 62.981  38.916 34.814  1.00 24.72  ? 147  VAL A CA   1 
ATOM   1151 C C    . VAL A 1 146 ? 62.227  37.737 34.201  1.00 27.06  ? 147  VAL A C    1 
ATOM   1152 O O    . VAL A 1 146 ? 61.727  37.840 33.083  1.00 29.93  ? 147  VAL A O    1 
ATOM   1153 C CB   . VAL A 1 146 ? 61.942  39.954 35.264  1.00 24.26  ? 147  VAL A CB   1 
ATOM   1154 C CG1  . VAL A 1 146 ? 61.012  39.353 36.308  1.00 16.96  ? 147  VAL A CG1  1 
ATOM   1155 C CG2  . VAL A 1 146 ? 62.633  41.184 35.809  1.00 19.35  ? 147  VAL A CG2  1 
ATOM   1156 N N    . SER A 1 147 ? 62.153  36.618 34.920  1.00 25.69  ? 148  SER A N    1 
ATOM   1157 C CA   . SER A 1 147 ? 61.270  35.520 34.518  1.00 26.49  ? 148  SER A CA   1 
ATOM   1158 C C    . SER A 1 147 ? 60.405  35.120 35.704  1.00 25.42  ? 148  SER A C    1 
ATOM   1159 O O    . SER A 1 147 ? 60.814  35.278 36.859  1.00 26.68  ? 148  SER A O    1 
ATOM   1160 C CB   . SER A 1 147 ? 62.045  34.312 33.974  1.00 28.32  ? 148  SER A CB   1 
ATOM   1161 O OG   . SER A 1 147 ? 62.844  33.699 34.971  1.00 28.10  ? 148  SER A OG   1 
ATOM   1162 N N    . MET A 1 148 ? 59.198  34.633 35.431  1.00 23.04  ? 149  MET A N    1 
ATOM   1163 C CA   . MET A 1 148 ? 58.352  34.125 36.503  1.00 22.61  ? 149  MET A CA   1 
ATOM   1164 C C    . MET A 1 148 ? 57.878  32.708 36.201  1.00 23.53  ? 149  MET A C    1 
ATOM   1165 O O    . MET A 1 148 ? 57.832  32.304 35.037  1.00 25.32  ? 149  MET A O    1 
ATOM   1166 C CB   . MET A 1 148 ? 57.150  35.054 36.723  1.00 18.56  ? 149  MET A CB   1 
ATOM   1167 C CG   . MET A 1 148 ? 55.945  34.758 35.835  1.00 25.84  ? 149  MET A CG   1 
ATOM   1168 S SD   . MET A 1 148 ? 56.261  35.048 34.072  1.00 27.81  ? 149  MET A SD   1 
ATOM   1169 C CE   . MET A 1 148 ? 56.308  36.839 34.037  1.00 24.78  ? 149  MET A CE   1 
ATOM   1170 N N    . ASN A 1 149 ? 57.547  31.953 37.249  1.00 18.80  ? 150  ASN A N    1 
ATOM   1171 C CA   . ASN A 1 149 ? 56.747  30.734 37.097  1.00 16.75  ? 150  ASN A CA   1 
ATOM   1172 C C    . ASN A 1 149 ? 55.268  31.097 37.151  1.00 21.29  ? 150  ASN A C    1 
ATOM   1173 O O    . ASN A 1 149 ? 54.866  31.991 37.901  1.00 19.15  ? 150  ASN A O    1 
ATOM   1174 C CB   . ASN A 1 149 ? 57.040  29.727 38.210  1.00 16.61  ? 150  ASN A CB   1 
ATOM   1175 C CG   . ASN A 1 149 ? 58.281  28.922 37.945  1.00 26.36  ? 150  ASN A CG   1 
ATOM   1176 O OD1  . ASN A 1 149 ? 58.968  29.131 36.943  1.00 26.88  ? 150  ASN A OD1  1 
ATOM   1177 N ND2  . ASN A 1 149 ? 58.584  27.991 38.843  1.00 27.23  ? 150  ASN A ND2  1 
ATOM   1178 N N    . TYR A 1 150 ? 54.457  30.416 36.353  1.00 19.24  ? 151  TYR A N    1 
ATOM   1179 C CA   . TYR A 1 150 ? 53.011  30.572 36.452  1.00 16.19  ? 151  TYR A CA   1 
ATOM   1180 C C    . TYR A 1 150 ? 52.408  29.178 36.432  1.00 15.68  ? 151  TYR A C    1 
ATOM   1181 O O    . TYR A 1 150 ? 52.991  28.258 35.844  1.00 21.49  ? 151  TYR A O    1 
ATOM   1182 C CB   . TYR A 1 150 ? 52.470  31.444 35.307  1.00 16.34  ? 151  TYR A CB   1 
ATOM   1183 C CG   . TYR A 1 150 ? 52.756  30.907 33.919  1.00 15.32  ? 151  TYR A CG   1 
ATOM   1184 C CD1  . TYR A 1 150 ? 53.912  31.248 33.250  1.00 15.22  ? 151  TYR A CD1  1 
ATOM   1185 C CD2  . TYR A 1 150 ? 51.867  30.053 33.290  1.00 15.88  ? 151  TYR A CD2  1 
ATOM   1186 C CE1  . TYR A 1 150 ? 54.182  30.748 31.984  1.00 20.15  ? 151  TYR A CE1  1 
ATOM   1187 C CE2  . TYR A 1 150 ? 52.118  29.556 32.022  1.00 18.09  ? 151  TYR A CE2  1 
ATOM   1188 C CZ   . TYR A 1 150 ? 53.277  29.903 31.377  1.00 19.77  ? 151  TYR A CZ   1 
ATOM   1189 O OH   . TYR A 1 150 ? 53.526  29.407 30.114  1.00 21.40  ? 151  TYR A OH   1 
ATOM   1190 N N    . ARG A 1 151 ? 51.261  29.007 37.077  1.00 16.07  ? 152  ARG A N    1 
ATOM   1191 C CA   . ARG A 1 151 ? 50.630  27.690 37.124  1.00 23.22  ? 152  ARG A CA   1 
ATOM   1192 C C    . ARG A 1 151 ? 50.226  27.205 35.731  1.00 26.45  ? 152  ARG A C    1 
ATOM   1193 O O    . ARG A 1 151 ? 49.800  27.996 34.883  1.00 29.10  ? 152  ARG A O    1 
ATOM   1194 C CB   . ARG A 1 151 ? 49.431  27.699 38.065  1.00 23.78  ? 152  ARG A CB   1 
ATOM   1195 C CG   . ARG A 1 151 ? 49.798  27.790 39.546  1.00 17.49  ? 152  ARG A CG   1 
ATOM   1196 C CD   . ARG A 1 151 ? 48.531  27.991 40.367  1.00 18.33  ? 152  ARG A CD   1 
ATOM   1197 N NE   . ARG A 1 151 ? 48.128  29.398 40.388  1.00 26.16  ? 152  ARG A NE   1 
ATOM   1198 C CZ   . ARG A 1 151 ? 47.021  29.854 40.965  1.00 25.38  ? 152  ARG A CZ   1 
ATOM   1199 N NH1  . ARG A 1 151 ? 46.188  29.007 41.568  1.00 22.91  ? 152  ARG A NH1  1 
ATOM   1200 N NH2  . ARG A 1 151 ? 46.746  31.151 40.933  1.00 23.17  ? 152  ARG A NH2  1 
ATOM   1201 N N    . VAL A 1 152 ? 50.387  25.906 35.494  1.00 16.59  ? 153  VAL A N    1 
ATOM   1202 C CA   . VAL A 1 152 ? 50.029  25.307 34.216  1.00 25.86  ? 153  VAL A CA   1 
ATOM   1203 C C    . VAL A 1 152 ? 49.082  24.128 34.408  1.00 22.63  ? 153  VAL A C    1 
ATOM   1204 O O    . VAL A 1 152 ? 48.756  23.763 35.536  1.00 22.43  ? 153  VAL A O    1 
ATOM   1205 C CB   . VAL A 1 152 ? 51.271  24.821 33.476  1.00 29.35  ? 153  VAL A CB   1 
ATOM   1206 C CG1  . VAL A 1 152 ? 52.128  26.018 33.028  1.00 18.90  ? 153  VAL A CG1  1 
ATOM   1207 C CG2  . VAL A 1 152 ? 52.057  23.840 34.361  1.00 24.65  ? 153  VAL A CG2  1 
ATOM   1208 N N    . GLY A 1 153 ? 48.640  23.535 33.306  1.00 26.17  ? 154  GLY A N    1 
ATOM   1209 C CA   . GLY A 1 153 ? 47.691  22.438 33.373  1.00 18.45  ? 154  GLY A CA   1 
ATOM   1210 C C    . GLY A 1 153 ? 46.417  22.851 34.098  1.00 21.81  ? 154  GLY A C    1 
ATOM   1211 O O    . GLY A 1 153 ? 46.039  24.030 34.107  1.00 24.40  ? 154  GLY A O    1 
ATOM   1212 N N    . ALA A 1 154 ? 45.758  21.879 34.715  1.00 22.44  ? 155  ALA A N    1 
ATOM   1213 C CA   . ALA A 1 154 ? 44.537  22.135 35.473  1.00 25.80  ? 155  ALA A CA   1 
ATOM   1214 C C    . ALA A 1 154 ? 44.756  23.216 36.541  1.00 28.10  ? 155  ALA A C    1 
ATOM   1215 O O    . ALA A 1 154 ? 43.889  24.054 36.773  1.00 30.51  ? 155  ALA A O    1 
ATOM   1216 C CB   . ALA A 1 154 ? 44.019  20.832 36.109  1.00 21.05  ? 155  ALA A CB   1 
ATOM   1217 N N    . PHE A 1 155 ? 45.915  23.201 37.185  1.00 23.08  ? 156  PHE A N    1 
ATOM   1218 C CA   . PHE A 1 155 ? 46.131  24.114 38.295  1.00 24.94  ? 156  PHE A CA   1 
ATOM   1219 C C    . PHE A 1 155 ? 46.087  25.550 37.823  1.00 28.80  ? 156  PHE A C    1 
ATOM   1220 O O    . PHE A 1 155 ? 45.693  26.446 38.568  1.00 19.10  ? 156  PHE A O    1 
ATOM   1221 C CB   . PHE A 1 155 ? 47.459  23.795 38.993  1.00 21.28  ? 156  PHE A CB   1 
ATOM   1222 C CG   . PHE A 1 155 ? 47.592  22.348 39.360  1.00 28.40  ? 156  PHE A CG   1 
ATOM   1223 C CD1  . PHE A 1 155 ? 47.022  21.858 40.532  1.00 29.80  ? 156  PHE A CD1  1 
ATOM   1224 C CD2  . PHE A 1 155 ? 48.244  21.465 38.513  1.00 25.74  ? 156  PHE A CD2  1 
ATOM   1225 C CE1  . PHE A 1 155 ? 47.123  20.507 40.873  1.00 31.80  ? 156  PHE A CE1  1 
ATOM   1226 C CE2  . PHE A 1 155 ? 48.353  20.118 38.848  1.00 26.42  ? 156  PHE A CE2  1 
ATOM   1227 C CZ   . PHE A 1 155 ? 47.788  19.641 40.035  1.00 32.16  ? 156  PHE A CZ   1 
ATOM   1228 N N    . GLY A 1 156 ? 46.485  25.772 36.577  1.00 24.08  ? 157  GLY A N    1 
ATOM   1229 C CA   . GLY A 1 156 ? 46.477  27.115 36.042  1.00 20.87  ? 157  GLY A CA   1 
ATOM   1230 C C    . GLY A 1 156 ? 45.288  27.433 35.156  1.00 24.90  ? 157  GLY A C    1 
ATOM   1231 O O    . GLY A 1 156 ? 44.932  28.609 35.000  1.00 23.33  ? 157  GLY A O    1 
ATOM   1232 N N    . PHE A 1 157 ? 44.663  26.414 34.568  1.00 18.67  ? 158  PHE A N    1 
ATOM   1233 C CA   . PHE A 1 157 ? 43.674  26.716 33.533  1.00 24.21  ? 158  PHE A CA   1 
ATOM   1234 C C    . PHE A 1 157 ? 42.374  25.940 33.549  1.00 25.97  ? 158  PHE A C    1 
ATOM   1235 O O    . PHE A 1 157 ? 41.525  26.146 32.676  1.00 29.43  ? 158  PHE A O    1 
ATOM   1236 C CB   . PHE A 1 157 ? 44.333  26.693 32.148  1.00 19.78  ? 158  PHE A CB   1 
ATOM   1237 C CG   . PHE A 1 157 ? 45.420  27.719 32.017  1.00 21.24  ? 158  PHE A CG   1 
ATOM   1238 C CD1  . PHE A 1 157 ? 45.114  29.047 31.759  1.00 19.79  ? 158  PHE A CD1  1 
ATOM   1239 C CD2  . PHE A 1 157 ? 46.741  27.371 32.226  1.00 18.01  ? 158  PHE A CD2  1 
ATOM   1240 C CE1  . PHE A 1 157 ? 46.121  30.002 31.674  1.00 17.78  ? 158  PHE A CE1  1 
ATOM   1241 C CE2  . PHE A 1 157 ? 47.752  28.319 32.135  1.00 20.21  ? 158  PHE A CE2  1 
ATOM   1242 C CZ   . PHE A 1 157 ? 47.441  29.631 31.865  1.00 19.54  ? 158  PHE A CZ   1 
ATOM   1243 N N    . LEU A 1 158 ? 42.204  25.060 34.531  1.00 22.41  ? 159  LEU A N    1 
ATOM   1244 C CA   . LEU A 1 158 ? 40.914  24.406 34.693  1.00 27.51  ? 159  LEU A CA   1 
ATOM   1245 C C    . LEU A 1 158 ? 39.919  25.520 34.963  1.00 26.28  ? 159  LEU A C    1 
ATOM   1246 O O    . LEU A 1 158 ? 40.192  26.443 35.731  1.00 25.89  ? 159  LEU A O    1 
ATOM   1247 C CB   . LEU A 1 158 ? 40.927  23.369 35.824  1.00 31.39  ? 159  LEU A CB   1 
ATOM   1248 C CG   . LEU A 1 158 ? 39.629  22.568 35.995  1.00 31.55  ? 159  LEU A CG   1 
ATOM   1249 C CD1  . LEU A 1 158 ? 39.892  21.137 36.460  1.00 23.75  ? 159  LEU A CD1  1 
ATOM   1250 C CD2  . LEU A 1 158 ? 38.723  23.279 36.972  1.00 24.24  ? 159  LEU A CD2  1 
ATOM   1251 N N    . ALA A 1 159 ? 38.785  25.476 34.281  1.00 25.64  ? 160  ALA A N    1 
ATOM   1252 C CA   . ALA A 1 159 ? 37.829  26.570 34.395  1.00 32.49  ? 160  ALA A CA   1 
ATOM   1253 C C    . ALA A 1 159 ? 36.401  26.047 34.430  1.00 29.64  ? 160  ALA A C    1 
ATOM   1254 O O    . ALA A 1 159 ? 36.004  25.249 33.589  1.00 26.51  ? 160  ALA A O    1 
ATOM   1255 C CB   . ALA A 1 159 ? 38.017  27.569 33.248  1.00 23.79  ? 160  ALA A CB   1 
ATOM   1256 N N    . LEU A 1 160 ? 35.650  26.473 35.434  1.00 28.66  ? 161  LEU A N    1 
ATOM   1257 C CA   . LEU A 1 160 ? 34.213  26.287 35.442  1.00 34.03  ? 161  LEU A CA   1 
ATOM   1258 C C    . LEU A 1 160 ? 33.662  27.706 35.375  1.00 37.21  ? 161  LEU A C    1 
ATOM   1259 O O    . LEU A 1 160 ? 33.364  28.316 36.406  1.00 35.59  ? 161  LEU A O    1 
ATOM   1260 C CB   . LEU A 1 160 ? 33.752  25.555 36.705  1.00 29.27  ? 161  LEU A CB   1 
ATOM   1261 C CG   . LEU A 1 160 ? 34.220  24.111 36.868  1.00 35.23  ? 161  LEU A CG   1 
ATOM   1262 C CD1  . LEU A 1 160 ? 34.021  23.618 38.300  1.00 32.89  ? 161  LEU A CD1  1 
ATOM   1263 C CD2  . LEU A 1 160 ? 33.481  23.195 35.894  1.00 29.51  ? 161  LEU A CD2  1 
ATOM   1264 N N    . PRO A 1 161 ? 33.560  28.249 34.150  1.00 37.45  ? 162  PRO A N    1 
ATOM   1265 C CA   . PRO A 1 161 ? 33.226  29.662 33.932  1.00 34.89  ? 162  PRO A CA   1 
ATOM   1266 C C    . PRO A 1 161 ? 31.984  30.062 34.706  1.00 37.72  ? 162  PRO A C    1 
ATOM   1267 O O    . PRO A 1 161 ? 31.029  29.270 34.766  1.00 38.81  ? 162  PRO A O    1 
ATOM   1268 C CB   . PRO A 1 161 ? 32.977  29.735 32.423  1.00 35.39  ? 162  PRO A CB   1 
ATOM   1269 C CG   . PRO A 1 161 ? 33.827  28.619 31.854  1.00 36.18  ? 162  PRO A CG   1 
ATOM   1270 C CD   . PRO A 1 161 ? 33.744  27.516 32.880  1.00 35.32  ? 162  PRO A CD   1 
ATOM   1271 N N    . GLY A 1 162 ? 32.015  31.251 35.312  1.00 39.91  ? 163  GLY A N    1 
ATOM   1272 C CA   . GLY A 1 162 ? 30.927  31.722 36.152  1.00 40.13  ? 163  GLY A CA   1 
ATOM   1273 C C    . GLY A 1 162 ? 31.141  31.444 37.639  1.00 41.96  ? 163  GLY A C    1 
ATOM   1274 O O    . GLY A 1 162 ? 30.679  32.208 38.496  1.00 38.41  ? 163  GLY A O    1 
ATOM   1275 N N    . SER A 1 163 ? 31.831  30.350 37.953  1.00 37.41  ? 164  SER A N    1 
ATOM   1276 C CA   . SER A 1 163 ? 32.065  29.977 39.350  1.00 43.42  ? 164  SER A CA   1 
ATOM   1277 C C    . SER A 1 163 ? 33.192  30.820 39.931  1.00 43.19  ? 164  SER A C    1 
ATOM   1278 O O    . SER A 1 163 ? 34.103  31.231 39.200  1.00 45.37  ? 164  SER A O    1 
ATOM   1279 C CB   . SER A 1 163 ? 32.475  28.513 39.451  1.00 37.62  ? 164  SER A CB   1 
ATOM   1280 O OG   . SER A 1 163 ? 33.879  28.401 39.272  1.00 41.58  ? 164  SER A OG   1 
ATOM   1281 N N    . ARG A 1 164 ? 33.156  31.068 41.238  1.00 40.24  ? 165  ARG A N    1 
ATOM   1282 C CA   . ARG A 1 164 ? 34.275  31.765 41.863  1.00 43.84  ? 165  ARG A CA   1 
ATOM   1283 C C    . ARG A 1 164 ? 35.340  30.822 42.415  1.00 37.19  ? 165  ARG A C    1 
ATOM   1284 O O    . ARG A 1 164 ? 36.473  31.242 42.659  1.00 37.91  ? 165  ARG A O    1 
ATOM   1285 C CB   . ARG A 1 164 ? 33.812  32.794 42.895  1.00 57.55  ? 165  ARG A CB   1 
ATOM   1286 C CG   . ARG A 1 164 ? 33.540  34.161 42.261  1.00 72.23  ? 165  ARG A CG   1 
ATOM   1287 C CD   . ARG A 1 164 ? 33.795  35.310 43.219  1.00 83.77  ? 165  ARG A CD   1 
ATOM   1288 N NE   . ARG A 1 164 ? 32.850  35.304 44.331  1.00 95.56  ? 165  ARG A NE   1 
ATOM   1289 C CZ   . ARG A 1 164 ? 32.770  36.257 45.254  1.00 100.63 ? 165  ARG A CZ   1 
ATOM   1290 N NH1  . ARG A 1 164 ? 33.584  37.305 45.199  1.00 100.53 ? 165  ARG A NH1  1 
ATOM   1291 N NH2  . ARG A 1 164 ? 31.875  36.162 46.230  1.00 103.25 ? 165  ARG A NH2  1 
ATOM   1292 N N    . GLU A 1 165 ? 34.992  29.547 42.565  1.00 36.97  ? 166  GLU A N    1 
ATOM   1293 C CA   . GLU A 1 165 ? 35.956  28.549 43.046  1.00 41.06  ? 166  GLU A CA   1 
ATOM   1294 C C    . GLU A 1 165 ? 36.967  28.099 41.985  1.00 37.88  ? 166  GLU A C    1 
ATOM   1295 O O    . GLU A 1 165 ? 38.068  27.676 42.330  1.00 42.86  ? 166  GLU A O    1 
ATOM   1296 C CB   . GLU A 1 165 ? 35.253  27.334 43.661  1.00 52.72  ? 166  GLU A CB   1 
ATOM   1297 C CG   . GLU A 1 165 ? 34.268  27.670 44.775  1.00 69.89  ? 166  GLU A CG   1 
ATOM   1298 C CD   . GLU A 1 165 ? 32.875  28.015 44.245  1.00 91.78  ? 166  GLU A CD   1 
ATOM   1299 O OE1  . GLU A 1 165 ? 32.663  27.960 43.009  1.00 97.28  ? 166  GLU A OE1  1 
ATOM   1300 O OE2  . GLU A 1 165 ? 31.988  28.338 45.069  1.00 98.81  ? 166  GLU A OE2  1 
ATOM   1301 N N    . ALA A 1 166 ? 36.606  28.189 40.705  1.00 31.86  ? 167  ALA A N    1 
ATOM   1302 C CA   . ALA A 1 166 ? 37.576  27.945 39.625  1.00 31.81  ? 167  ALA A CA   1 
ATOM   1303 C C    . ALA A 1 166 ? 37.248  28.743 38.375  1.00 28.85  ? 167  ALA A C    1 
ATOM   1304 O O    . ALA A 1 166 ? 36.752  28.190 37.389  1.00 27.24  ? 167  ALA A O    1 
ATOM   1305 C CB   . ALA A 1 166 ? 37.681  26.457 39.293  1.00 25.86  ? 167  ALA A CB   1 
ATOM   1306 N N    . PRO A 1 167 ? 37.552  30.047 38.409  1.00 30.24  ? 168  PRO A N    1 
ATOM   1307 C CA   . PRO A 1 167 ? 37.156  31.025 37.379  1.00 34.80  ? 168  PRO A CA   1 
ATOM   1308 C C    . PRO A 1 167 ? 37.919  30.843 36.067  1.00 32.12  ? 168  PRO A C    1 
ATOM   1309 O O    . PRO A 1 167 ? 37.445  31.265 35.015  1.00 38.69  ? 168  PRO A O    1 
ATOM   1310 C CB   . PRO A 1 167 ? 37.514  32.372 38.023  1.00 32.95  ? 168  PRO A CB   1 
ATOM   1311 C CG   . PRO A 1 167 ? 38.693  32.036 38.931  1.00 29.23  ? 168  PRO A CG   1 
ATOM   1312 C CD   . PRO A 1 167 ? 38.367  30.656 39.480  1.00 26.48  ? 168  PRO A CD   1 
ATOM   1313 N N    . GLY A 1 168 ? 39.086  30.222 36.126  1.00 29.03  ? 169  GLY A N    1 
ATOM   1314 C CA   . GLY A 1 168 ? 39.874  30.006 34.925  1.00 30.47  ? 169  GLY A CA   1 
ATOM   1315 C C    . GLY A 1 168 ? 40.895  31.109 34.724  1.00 29.25  ? 169  GLY A C    1 
ATOM   1316 O O    . GLY A 1 168 ? 40.801  32.179 35.345  1.00 27.42  ? 169  GLY A O    1 
ATOM   1317 N N    . ASN A 1 169 ? 41.874  30.842 33.866  1.00 27.73  ? 170  ASN A N    1 
ATOM   1318 C CA   . ASN A 1 169 ? 42.875  31.831 33.522  1.00 24.85  ? 170  ASN A CA   1 
ATOM   1319 C C    . ASN A 1 169 ? 43.764  32.260 34.688  1.00 26.79  ? 170  ASN A C    1 
ATOM   1320 O O    . ASN A 1 169 ? 44.503  33.241 34.557  1.00 27.25  ? 170  ASN A O    1 
ATOM   1321 C CB   . ASN A 1 169 ? 42.207  33.062 32.901  1.00 22.85  ? 170  ASN A CB   1 
ATOM   1322 C CG   . ASN A 1 169 ? 41.576  32.763 31.551  1.00 29.17  ? 170  ASN A CG   1 
ATOM   1323 O OD1  . ASN A 1 169 ? 41.944  31.794 30.878  1.00 27.35  ? 170  ASN A OD1  1 
ATOM   1324 N ND2  . ASN A 1 169 ? 40.620  33.597 31.147  1.00 23.84  ? 170  ASN A ND2  1 
ATOM   1325 N N    . VAL A 1 170 ? 43.714  31.537 35.812  1.00 23.47  ? 171  VAL A N    1 
ATOM   1326 C CA   . VAL A 1 170 ? 44.538  31.933 36.964  1.00 25.59  ? 171  VAL A CA   1 
ATOM   1327 C C    . VAL A 1 170 ? 46.035  31.963 36.620  1.00 26.04  ? 171  VAL A C    1 
ATOM   1328 O O    . VAL A 1 170 ? 46.778  32.813 37.107  1.00 28.24  ? 171  VAL A O    1 
ATOM   1329 C CB   . VAL A 1 170 ? 44.252  31.106 38.269  1.00 25.05  ? 171  VAL A CB   1 
ATOM   1330 C CG1  . VAL A 1 170 ? 42.785  31.206 38.672  1.00 21.15  ? 171  VAL A CG1  1 
ATOM   1331 C CG2  . VAL A 1 170 ? 44.676  29.646 38.107  1.00 24.33  ? 171  VAL A CG2  1 
ATOM   1332 N N    . GLY A 1 171 ? 46.470  31.044 35.767  1.00 26.05  ? 172  GLY A N    1 
ATOM   1333 C CA   . GLY A 1 171 ? 47.831  31.067 35.260  1.00 16.94  ? 172  GLY A CA   1 
ATOM   1334 C C    . GLY A 1 171 ? 48.190  32.377 34.565  1.00 25.23  ? 172  GLY A C    1 
ATOM   1335 O O    . GLY A 1 171 ? 49.329  32.859 34.680  1.00 21.20  ? 172  GLY A O    1 
ATOM   1336 N N    . LEU A 1 172 ? 47.234  32.972 33.850  1.00 19.59  ? 173  LEU A N    1 
ATOM   1337 C CA   . LEU A 1 172 ? 47.502  34.263 33.222  1.00 20.29  ? 173  LEU A CA   1 
ATOM   1338 C C    . LEU A 1 172 ? 47.537  35.344 34.305  1.00 29.32  ? 173  LEU A C    1 
ATOM   1339 O O    . LEU A 1 172 ? 48.285  36.321 34.197  1.00 25.84  ? 173  LEU A O    1 
ATOM   1340 C CB   . LEU A 1 172 ? 46.462  34.598 32.150  1.00 21.61  ? 173  LEU A CB   1 
ATOM   1341 C CG   . LEU A 1 172 ? 46.559  33.831 30.830  1.00 24.13  ? 173  LEU A CG   1 
ATOM   1342 C CD1  . LEU A 1 172 ? 45.334  34.082 29.945  1.00 23.01  ? 173  LEU A CD1  1 
ATOM   1343 C CD2  . LEU A 1 172 ? 47.830  34.204 30.086  1.00 24.65  ? 173  LEU A CD2  1 
ATOM   1344 N N    . LEU A 1 173 ? 46.735  35.158 35.352  1.00 18.46  ? 174  LEU A N    1 
ATOM   1345 C CA   . LEU A 1 173 ? 46.715  36.102 36.473  1.00 26.64  ? 174  LEU A CA   1 
ATOM   1346 C C    . LEU A 1 173 ? 48.013  36.011 37.287  1.00 24.32  ? 174  LEU A C    1 
ATOM   1347 O O    . LEU A 1 173 ? 48.483  37.016 37.815  1.00 27.61  ? 174  LEU A O    1 
ATOM   1348 C CB   . LEU A 1 173 ? 45.474  35.903 37.358  1.00 20.02  ? 174  LEU A CB   1 
ATOM   1349 C CG   . LEU A 1 173 ? 44.129  36.305 36.730  1.00 36.56  ? 174  LEU A CG   1 
ATOM   1350 C CD1  . LEU A 1 173 ? 42.941  36.040 37.675  1.00 22.23  ? 174  LEU A CD1  1 
ATOM   1351 C CD2  . LEU A 1 173 ? 44.125  37.769 36.263  1.00 21.73  ? 174  LEU A CD2  1 
ATOM   1352 N N    . ASP A 1 174 ? 48.601  34.815 37.365  1.00 23.97  ? 175  ASP A N    1 
ATOM   1353 C CA   . ASP A 1 174 ? 49.942  34.664 37.940  1.00 23.54  ? 175  ASP A CA   1 
ATOM   1354 C C    . ASP A 1 174 ? 50.939  35.549 37.180  1.00 23.46  ? 175  ASP A C    1 
ATOM   1355 O O    . ASP A 1 174 ? 51.719  36.282 37.783  1.00 20.91  ? 175  ASP A O    1 
ATOM   1356 C CB   . ASP A 1 174 ? 50.412  33.198 37.884  1.00 24.23  ? 175  ASP A CB   1 
ATOM   1357 C CG   . ASP A 1 174 ? 49.569  32.261 38.746  1.00 32.31  ? 175  ASP A CG   1 
ATOM   1358 O OD1  . ASP A 1 174 ? 48.791  32.754 39.603  1.00 27.81  ? 175  ASP A OD1  1 
ATOM   1359 O OD2  . ASP A 1 174 ? 49.705  31.019 38.569  1.00 34.04  ? 175  ASP A OD2  1 
ATOM   1360 N N    . GLN A 1 175 ? 50.890  35.484 35.849  1.00 22.65  ? 176  GLN A N    1 
ATOM   1361 C CA   . GLN A 1 175 ? 51.732  36.328 35.015  1.00 19.45  ? 176  GLN A CA   1 
ATOM   1362 C C    . GLN A 1 175 ? 51.485  37.808 35.267  1.00 22.02  ? 176  GLN A C    1 
ATOM   1363 O O    . GLN A 1 175 ? 52.431  38.581 35.469  1.00 23.40  ? 176  GLN A O    1 
ATOM   1364 C CB   . GLN A 1 175 ? 51.531  36.001 33.533  1.00 18.72  ? 176  GLN A CB   1 
ATOM   1365 C CG   . GLN A 1 175 ? 51.862  34.559 33.165  1.00 17.00  ? 176  GLN A CG   1 
ATOM   1366 C CD   . GLN A 1 175 ? 51.529  34.263 31.715  1.00 22.83  ? 176  GLN A CD   1 
ATOM   1367 O OE1  . GLN A 1 175 ? 51.188  35.171 30.944  1.00 24.05  ? 176  GLN A OE1  1 
ATOM   1368 N NE2  . GLN A 1 175 ? 51.627  32.993 31.329  1.00 16.02  ? 176  GLN A NE2  1 
ATOM   1369 N N    . ARG A 1 176 ? 50.217  38.204 35.269  1.00 24.13  ? 177  ARG A N    1 
ATOM   1370 C CA   . ARG A 1 176 ? 49.869  39.602 35.517  1.00 24.10  ? 177  ARG A CA   1 
ATOM   1371 C C    . ARG A 1 176 ? 50.407  40.073 36.872  1.00 28.36  ? 177  ARG A C    1 
ATOM   1372 O O    . ARG A 1 176 ? 50.967  41.177 36.981  1.00 23.51  ? 177  ARG A O    1 
ATOM   1373 C CB   . ARG A 1 176 ? 48.355  39.826 35.451  1.00 22.98  ? 177  ARG A CB   1 
ATOM   1374 C CG   . ARG A 1 176 ? 47.948  41.262 35.744  1.00 27.86  ? 177  ARG A CG   1 
ATOM   1375 C CD   . ARG A 1 176 ? 46.456  41.467 35.614  1.00 31.68  ? 177  ARG A CD   1 
ATOM   1376 N NE   . ARG A 1 176 ? 46.017  41.508 34.224  1.00 33.10  ? 177  ARG A NE   1 
ATOM   1377 C CZ   . ARG A 1 176 ? 44.754  41.325 33.847  1.00 41.88  ? 177  ARG A CZ   1 
ATOM   1378 N NH1  . ARG A 1 176 ? 43.823  41.070 34.761  1.00 42.16  ? 177  ARG A NH1  1 
ATOM   1379 N NH2  . ARG A 1 176 ? 44.427  41.382 32.561  1.00 40.93  ? 177  ARG A NH2  1 
ATOM   1380 N N    . LEU A 1 177 ? 50.256  39.232 37.896  1.00 23.54  ? 178  LEU A N    1 
ATOM   1381 C CA   . LEU A 1 177 ? 50.715  39.604 39.229  1.00 20.86  ? 178  LEU A CA   1 
ATOM   1382 C C    . LEU A 1 177 ? 52.227  39.845 39.190  1.00 26.21  ? 178  LEU A C    1 
ATOM   1383 O O    . LEU A 1 177 ? 52.714  40.831 39.747  1.00 25.22  ? 178  LEU A O    1 
ATOM   1384 C CB   . LEU A 1 177 ? 50.332  38.537 40.260  1.00 20.22  ? 178  LEU A CB   1 
ATOM   1385 C CG   . LEU A 1 177 ? 50.664  38.837 41.728  1.00 27.51  ? 178  LEU A CG   1 
ATOM   1386 C CD1  . LEU A 1 177 ? 49.938  40.092 42.218  1.00 23.09  ? 178  LEU A CD1  1 
ATOM   1387 C CD2  . LEU A 1 177 ? 50.336  37.660 42.642  1.00 23.22  ? 178  LEU A CD2  1 
ATOM   1388 N N    . ALA A 1 178 ? 52.963  38.969 38.501  1.00 22.85  ? 179  ALA A N    1 
ATOM   1389 C CA   . ALA A 1 178 ? 54.413  39.141 38.372  1.00 23.76  ? 179  ALA A CA   1 
ATOM   1390 C C    . ALA A 1 178 ? 54.746  40.457 37.653  1.00 28.08  ? 179  ALA A C    1 
ATOM   1391 O O    . ALA A 1 178 ? 55.648  41.184 38.076  1.00 29.75  ? 179  ALA A O    1 
ATOM   1392 C CB   . ALA A 1 178 ? 55.043  37.953 37.654  1.00 18.57  ? 179  ALA A CB   1 
ATOM   1393 N N    . LEU A 1 179 ? 54.015  40.753 36.574  1.00 20.93  ? 180  LEU A N    1 
ATOM   1394 C CA   . LEU A 1 179 ? 54.168  42.026 35.860  1.00 25.43  ? 180  LEU A CA   1 
ATOM   1395 C C    . LEU A 1 179 ? 53.930  43.236 36.776  1.00 22.16  ? 180  LEU A C    1 
ATOM   1396 O O    . LEU A 1 179 ? 54.663  44.218 36.707  1.00 26.69  ? 180  LEU A O    1 
ATOM   1397 C CB   . LEU A 1 179 ? 53.264  42.087 34.615  1.00 22.80  ? 180  LEU A CB   1 
ATOM   1398 C CG   . LEU A 1 179 ? 53.643  41.123 33.479  1.00 27.08  ? 180  LEU A CG   1 
ATOM   1399 C CD1  . LEU A 1 179 ? 52.730  41.250 32.250  1.00 20.98  ? 180  LEU A CD1  1 
ATOM   1400 C CD2  . LEU A 1 179 ? 55.103  41.323 33.071  1.00 27.59  ? 180  LEU A CD2  1 
ATOM   1401 N N    . GLN A 1 180 ? 52.919  43.160 37.638  1.00 21.42  ? 181  GLN A N    1 
ATOM   1402 C CA   . GLN A 1 180 ? 52.679  44.213 38.629  1.00 25.61  ? 181  GLN A CA   1 
ATOM   1403 C C    . GLN A 1 180 ? 53.838  44.316 39.619  1.00 28.09  ? 181  GLN A C    1 
ATOM   1404 O O    . GLN A 1 180 ? 54.191  45.404 40.074  1.00 31.06  ? 181  GLN A O    1 
ATOM   1405 C CB   . GLN A 1 180 ? 51.357  43.966 39.369  1.00 28.58  ? 181  GLN A CB   1 
ATOM   1406 C CG   . GLN A 1 180 ? 50.115  44.090 38.477  1.00 40.69  ? 181  GLN A CG   1 
ATOM   1407 C CD   . GLN A 1 180 ? 48.851  43.546 39.138  1.00 48.19  ? 181  GLN A CD   1 
ATOM   1408 O OE1  . GLN A 1 180 ? 48.921  42.754 40.080  1.00 53.14  ? 181  GLN A OE1  1 
ATOM   1409 N NE2  . GLN A 1 180 ? 47.689  43.965 38.638  1.00 42.05  ? 181  GLN A NE2  1 
ATOM   1410 N N    . TRP A 1 181 ? 54.441  43.179 39.942  1.00 21.41  ? 182  TRP A N    1 
ATOM   1411 C CA   . TRP A 1 181 ? 55.579  43.163 40.853  1.00 24.29  ? 182  TRP A CA   1 
ATOM   1412 C C    . TRP A 1 181 ? 56.761  43.919 40.231  1.00 24.54  ? 182  TRP A C    1 
ATOM   1413 O O    . TRP A 1 181 ? 57.477  44.668 40.910  1.00 25.99  ? 182  TRP A O    1 
ATOM   1414 C CB   . TRP A 1 181 ? 55.955  41.714 41.168  1.00 25.22  ? 182  TRP A CB   1 
ATOM   1415 C CG   . TRP A 1 181 ? 56.988  41.568 42.220  1.00 27.17  ? 182  TRP A CG   1 
ATOM   1416 C CD1  . TRP A 1 181 ? 56.783  41.306 43.549  1.00 24.99  ? 182  TRP A CD1  1 
ATOM   1417 C CD2  . TRP A 1 181 ? 58.408  41.644 42.034  1.00 21.51  ? 182  TRP A CD2  1 
ATOM   1418 N NE1  . TRP A 1 181 ? 57.994  41.230 44.201  1.00 21.86  ? 182  TRP A NE1  1 
ATOM   1419 C CE2  . TRP A 1 181 ? 58.999  41.437 43.299  1.00 21.43  ? 182  TRP A CE2  1 
ATOM   1420 C CE3  . TRP A 1 181 ? 59.226  41.865 40.925  1.00 22.79  ? 182  TRP A CE3  1 
ATOM   1421 C CZ2  . TRP A 1 181 ? 60.391  41.452 43.477  1.00 21.29  ? 182  TRP A CZ2  1 
ATOM   1422 C CZ3  . TRP A 1 181 ? 60.602  41.884 41.107  1.00 22.51  ? 182  TRP A CZ3  1 
ATOM   1423 C CH2  . TRP A 1 181 ? 61.170  41.677 42.372  1.00 20.53  ? 182  TRP A CH2  1 
ATOM   1424 N N    . VAL A 1 182 ? 56.958  43.710 38.933  1.00 23.28  ? 183  VAL A N    1 
ATOM   1425 C CA   . VAL A 1 182 ? 57.986  44.405 38.168  1.00 24.28  ? 183  VAL A CA   1 
ATOM   1426 C C    . VAL A 1 182 ? 57.767  45.923 38.216  1.00 29.26  ? 183  VAL A C    1 
ATOM   1427 O O    . VAL A 1 182 ? 58.686  46.686 38.534  1.00 29.48  ? 183  VAL A O    1 
ATOM   1428 C CB   . VAL A 1 182 ? 57.975  43.919 36.716  1.00 22.57  ? 183  VAL A CB   1 
ATOM   1429 C CG1  . VAL A 1 182 ? 58.918  44.739 35.874  1.00 24.08  ? 183  VAL A CG1  1 
ATOM   1430 C CG2  . VAL A 1 182 ? 58.358  42.453 36.663  1.00 24.85  ? 183  VAL A CG2  1 
ATOM   1431 N N    . GLN A 1 183 ? 56.547  46.358 37.920  1.00 24.62  ? 184  GLN A N    1 
ATOM   1432 C CA   . GLN A 1 183 ? 56.207  47.774 38.045  1.00 33.18  ? 184  GLN A CA   1 
ATOM   1433 C C    . GLN A 1 183 ? 56.542  48.335 39.426  1.00 33.69  ? 184  GLN A C    1 
ATOM   1434 O O    . GLN A 1 183 ? 57.145  49.396 39.535  1.00 36.80  ? 184  GLN A O    1 
ATOM   1435 C CB   . GLN A 1 183 ? 54.737  48.017 37.698  1.00 34.14  ? 184  GLN A CB   1 
ATOM   1436 C CG   . GLN A 1 183 ? 54.451  47.912 36.195  1.00 33.61  ? 184  GLN A CG   1 
ATOM   1437 C CD   . GLN A 1 183 ? 55.278  48.898 35.380  1.00 36.09  ? 184  GLN A CD   1 
ATOM   1438 O OE1  . GLN A 1 183 ? 55.187  50.115 35.571  1.00 36.15  ? 184  GLN A OE1  1 
ATOM   1439 N NE2  . GLN A 1 183 ? 56.103  48.375 34.480  1.00 33.85  ? 184  GLN A NE2  1 
ATOM   1440 N N    . GLU A 1 184 ? 56.180  47.612 40.480  1.00 33.08  ? 185  GLU A N    1 
ATOM   1441 C CA   . GLU A 1 184 ? 56.401  48.099 41.843  1.00 34.86  ? 185  GLU A CA   1 
ATOM   1442 C C    . GLU A 1 184 ? 57.847  48.022 42.323  1.00 36.37  ? 185  GLU A C    1 
ATOM   1443 O O    . GLU A 1 184 ? 58.278  48.868 43.097  1.00 33.69  ? 185  GLU A O    1 
ATOM   1444 C CB   . GLU A 1 184 ? 55.503  47.355 42.830  1.00 39.56  ? 185  GLU A CB   1 
ATOM   1445 C CG   . GLU A 1 184 ? 54.022  47.582 42.592  1.00 52.85  ? 185  GLU A CG   1 
ATOM   1446 C CD   . GLU A 1 184 ? 53.162  47.034 43.716  1.00 66.40  ? 185  GLU A CD   1 
ATOM   1447 O OE1  . GLU A 1 184 ? 53.727  46.625 44.756  1.00 72.09  ? 185  GLU A OE1  1 
ATOM   1448 O OE2  . GLU A 1 184 ? 51.920  47.017 43.557  1.00 70.36  ? 185  GLU A OE2  1 
ATOM   1449 N N    . ASN A 1 185 ? 58.598  47.019 41.869  1.00 33.57  ? 186  ASN A N    1 
ATOM   1450 C CA   . ASN A 1 185 ? 59.897  46.732 42.476  1.00 28.66  ? 186  ASN A CA   1 
ATOM   1451 C C    . ASN A 1 185 ? 61.122  46.766 41.561  1.00 32.42  ? 186  ASN A C    1 
ATOM   1452 O O    . ASN A 1 185 ? 62.256  46.771 42.050  1.00 37.35  ? 186  ASN A O    1 
ATOM   1453 C CB   . ASN A 1 185 ? 59.854  45.378 43.196  1.00 29.69  ? 186  ASN A CB   1 
ATOM   1454 C CG   . ASN A 1 185 ? 58.769  45.308 44.244  1.00 31.13  ? 186  ASN A CG   1 
ATOM   1455 O OD1  . ASN A 1 185 ? 58.855  45.957 45.286  1.00 32.93  ? 186  ASN A OD1  1 
ATOM   1456 N ND2  . ASN A 1 185 ? 57.742  44.501 43.981  1.00 22.68  ? 186  ASN A ND2  1 
ATOM   1457 N N    . VAL A 1 186 ? 60.917  46.768 40.246  1.00 31.80  ? 187  VAL A N    1 
ATOM   1458 C CA   . VAL A 1 186 ? 62.047  46.578 39.344  1.00 30.33  ? 187  VAL A CA   1 
ATOM   1459 C C    . VAL A 1 186 ? 63.091  47.692 39.484  1.00 30.59  ? 187  VAL A C    1 
ATOM   1460 O O    . VAL A 1 186 ? 64.284  47.456 39.270  1.00 28.68  ? 187  VAL A O    1 
ATOM   1461 C CB   . VAL A 1 186 ? 61.611  46.397 37.872  1.00 33.44  ? 187  VAL A CB   1 
ATOM   1462 C CG1  . VAL A 1 186 ? 61.287  47.740 37.228  1.00 35.16  ? 187  VAL A CG1  1 
ATOM   1463 C CG2  . VAL A 1 186 ? 62.693  45.676 37.089  1.00 30.69  ? 187  VAL A CG2  1 
ATOM   1464 N N    . ALA A 1 187 ? 62.636  48.882 39.883  1.00 27.17  ? 188  ALA A N    1 
ATOM   1465 C CA   . ALA A 1 187 ? 63.517  50.045 40.019  1.00 32.79  ? 188  ALA A CA   1 
ATOM   1466 C C    . ALA A 1 187 ? 64.550  49.861 41.123  1.00 32.88  ? 188  ALA A C    1 
ATOM   1467 O O    . ALA A 1 187 ? 65.621  50.452 41.074  1.00 37.09  ? 188  ALA A O    1 
ATOM   1468 C CB   . ALA A 1 187 ? 62.706  51.334 40.235  1.00 27.42  ? 188  ALA A CB   1 
ATOM   1469 N N    . ALA A 1 188 ? 64.233  49.034 42.112  1.00 35.33  ? 189  ALA A N    1 
ATOM   1470 C CA   . ALA A 1 188 ? 65.194  48.729 43.174  1.00 36.81  ? 189  ALA A CA   1 
ATOM   1471 C C    . ALA A 1 188 ? 66.361  47.879 42.670  1.00 36.16  ? 189  ALA A C    1 
ATOM   1472 O O    . ALA A 1 188 ? 67.398  47.794 43.321  1.00 40.27  ? 189  ALA A O    1 
ATOM   1473 C CB   . ALA A 1 188 ? 64.511  48.051 44.333  1.00 25.65  ? 189  ALA A CB   1 
ATOM   1474 N N    . PHE A 1 189 ? 66.192  47.242 41.518  1.00 36.35  ? 190  PHE A N    1 
ATOM   1475 C CA   . PHE A 1 189 ? 67.291  46.501 40.907  1.00 33.80  ? 190  PHE A CA   1 
ATOM   1476 C C    . PHE A 1 189 ? 67.919  47.335 39.790  1.00 36.29  ? 190  PHE A C    1 
ATOM   1477 O O    . PHE A 1 189 ? 68.793  46.853 39.065  1.00 40.19  ? 190  PHE A O    1 
ATOM   1478 C CB   . PHE A 1 189 ? 66.820  45.150 40.346  1.00 33.90  ? 190  PHE A CB   1 
ATOM   1479 C CG   . PHE A 1 189 ? 66.155  44.255 41.362  1.00 32.61  ? 190  PHE A CG   1 
ATOM   1480 C CD1  . PHE A 1 189 ? 64.828  44.442 41.710  1.00 32.38  ? 190  PHE A CD1  1 
ATOM   1481 C CD2  . PHE A 1 189 ? 66.851  43.208 41.943  1.00 34.03  ? 190  PHE A CD2  1 
ATOM   1482 C CE1  . PHE A 1 189 ? 64.212  43.613 42.637  1.00 32.90  ? 190  PHE A CE1  1 
ATOM   1483 C CE2  . PHE A 1 189 ? 66.241  42.370 42.869  1.00 29.32  ? 190  PHE A CE2  1 
ATOM   1484 C CZ   . PHE A 1 189 ? 64.921  42.576 43.217  1.00 29.62  ? 190  PHE A CZ   1 
ATOM   1485 N N    . GLY A 1 190 ? 67.469  48.581 39.648  1.00 34.89  ? 191  GLY A N    1 
ATOM   1486 C CA   . GLY A 1 190 ? 68.040  49.481 38.657  1.00 36.51  ? 191  GLY A CA   1 
ATOM   1487 C C    . GLY A 1 190 ? 67.289  49.466 37.337  1.00 41.39  ? 191  GLY A C    1 
ATOM   1488 O O    . GLY A 1 190 ? 67.717  50.077 36.346  1.00 39.04  ? 191  GLY A O    1 
ATOM   1489 N N    . GLY A 1 191 ? 66.158  48.768 37.321  1.00 36.74  ? 192  GLY A N    1 
ATOM   1490 C CA   . GLY A 1 191 ? 65.337  48.698 36.130  1.00 36.92  ? 192  GLY A CA   1 
ATOM   1491 C C    . GLY A 1 191 ? 64.378  49.868 35.978  1.00 41.06  ? 192  GLY A C    1 
ATOM   1492 O O    . GLY A 1 191 ? 63.952  50.483 36.963  1.00 47.28  ? 192  GLY A O    1 
ATOM   1493 N N    . ASP A 1 192 ? 64.042  50.159 34.725  1.00 40.71  ? 193  ASP A N    1 
ATOM   1494 C CA   . ASP A 1 192 ? 63.101  51.204 34.349  1.00 36.85  ? 193  ASP A CA   1 
ATOM   1495 C C    . ASP A 1 192 ? 61.714  50.594 34.102  1.00 38.25  ? 193  ASP A C    1 
ATOM   1496 O O    . ASP A 1 192 ? 61.498  49.926 33.088  1.00 41.35  ? 193  ASP A O    1 
ATOM   1497 C CB   . ASP A 1 192 ? 63.606  51.855 33.061  1.00 39.48  ? 193  ASP A CB   1 
ATOM   1498 C CG   . ASP A 1 192 ? 62.842  53.109 32.691  1.00 44.03  ? 193  ASP A CG   1 
ATOM   1499 O OD1  . ASP A 1 192 ? 61.829  53.429 33.353  1.00 48.54  ? 193  ASP A OD1  1 
ATOM   1500 O OD2  . ASP A 1 192 ? 63.258  53.770 31.718  1.00 48.48  ? 193  ASP A OD2  1 
ATOM   1501 N N    . PRO A 1 193 ? 60.761  50.828 35.019  1.00 42.18  ? 194  PRO A N    1 
ATOM   1502 C CA   . PRO A 1 193 ? 59.415  50.262 34.843  1.00 38.17  ? 194  PRO A CA   1 
ATOM   1503 C C    . PRO A 1 193 ? 58.641  50.877 33.673  1.00 40.24  ? 194  PRO A C    1 
ATOM   1504 O O    . PRO A 1 193 ? 57.627  50.309 33.259  1.00 38.97  ? 194  PRO A O    1 
ATOM   1505 C CB   . PRO A 1 193 ? 58.720  50.572 36.177  1.00 37.45  ? 194  PRO A CB   1 
ATOM   1506 C CG   . PRO A 1 193 ? 59.451  51.764 36.721  1.00 37.48  ? 194  PRO A CG   1 
ATOM   1507 C CD   . PRO A 1 193 ? 60.884  51.598 36.272  1.00 43.93  ? 194  PRO A CD   1 
ATOM   1508 N N    . THR A 1 194 ? 59.103  52.008 33.145  1.00 40.66  ? 195  THR A N    1 
ATOM   1509 C CA   . THR A 1 194 ? 58.469  52.595 31.963  1.00 41.86  ? 195  THR A CA   1 
ATOM   1510 C C    . THR A 1 194 ? 58.921  51.892 30.679  1.00 48.16  ? 195  THR A C    1 
ATOM   1511 O O    . THR A 1 194 ? 58.265  51.997 29.639  1.00 51.45  ? 195  THR A O    1 
ATOM   1512 C CB   . THR A 1 194 ? 58.720  54.125 31.847  1.00 44.59  ? 195  THR A CB   1 
ATOM   1513 O OG1  . THR A 1 194 ? 60.128  54.392 31.836  1.00 46.79  ? 195  THR A OG1  1 
ATOM   1514 C CG2  . THR A 1 194 ? 58.073  54.874 33.007  1.00 36.23  ? 195  THR A CG2  1 
ATOM   1515 N N    . SER A 1 195 ? 60.039  51.173 30.761  1.00 46.99  ? 196  SER A N    1 
ATOM   1516 C CA   . SER A 1 195 ? 60.573  50.463 29.598  1.00 45.28  ? 196  SER A CA   1 
ATOM   1517 C C    . SER A 1 195 ? 60.612  48.942 29.787  1.00 38.30  ? 196  SER A C    1 
ATOM   1518 O O    . SER A 1 195 ? 61.686  48.336 29.814  1.00 38.09  ? 196  SER A O    1 
ATOM   1519 C CB   . SER A 1 195 ? 61.975  50.969 29.248  1.00 47.87  ? 196  SER A CB   1 
ATOM   1520 O OG   . SER A 1 195 ? 62.467  50.296 28.098  1.00 52.49  ? 196  SER A OG   1 
ATOM   1521 N N    . VAL A 1 196 ? 59.443  48.323 29.907  1.00 30.83  ? 197  VAL A N    1 
ATOM   1522 C CA   . VAL A 1 196 ? 59.383  46.877 30.041  1.00 26.23  ? 197  VAL A CA   1 
ATOM   1523 C C    . VAL A 1 196 ? 58.990  46.243 28.721  1.00 27.26  ? 197  VAL A C    1 
ATOM   1524 O O    . VAL A 1 196 ? 58.005  46.648 28.102  1.00 31.95  ? 197  VAL A O    1 
ATOM   1525 C CB   . VAL A 1 196 ? 58.398  46.437 31.137  1.00 24.93  ? 197  VAL A CB   1 
ATOM   1526 C CG1  . VAL A 1 196 ? 58.318  44.917 31.192  1.00 21.15  ? 197  VAL A CG1  1 
ATOM   1527 C CG2  . VAL A 1 196 ? 58.824  47.008 32.491  1.00 23.02  ? 197  VAL A CG2  1 
ATOM   1528 N N    . THR A 1 197 ? 59.779  45.257 28.290  1.00 25.30  ? 198  THR A N    1 
ATOM   1529 C CA   . THR A 1 197 ? 59.497  44.510 27.074  1.00 29.64  ? 198  THR A CA   1 
ATOM   1530 C C    . THR A 1 197 ? 59.184  43.063 27.423  1.00 26.34  ? 198  THR A C    1 
ATOM   1531 O O    . THR A 1 197 ? 60.026  42.354 27.985  1.00 30.29  ? 198  THR A O    1 
ATOM   1532 C CB   . THR A 1 197 ? 60.693  44.511 26.127  1.00 30.34  ? 198  THR A CB   1 
ATOM   1533 O OG1  . THR A 1 197 ? 60.965  45.848 25.702  1.00 36.03  ? 198  THR A OG1  1 
ATOM   1534 C CG2  . THR A 1 197 ? 60.401  43.642 24.903  1.00 23.44  ? 198  THR A CG2  1 
ATOM   1535 N N    . LEU A 1 198 ? 57.975  42.628 27.101  1.00 21.74  ? 199  LEU A N    1 
ATOM   1536 C CA   . LEU A 1 198 ? 57.593  41.242 27.339  1.00 24.33  ? 199  LEU A CA   1 
ATOM   1537 C C    . LEU A 1 198 ? 58.086  40.409 26.196  1.00 24.88  ? 199  LEU A C    1 
ATOM   1538 O O    . LEU A 1 198 ? 57.886  40.767 25.042  1.00 26.50  ? 199  LEU A O    1 
ATOM   1539 C CB   . LEU A 1 198 ? 56.081  41.100 27.371  1.00 28.52  ? 199  LEU A CB   1 
ATOM   1540 C CG   . LEU A 1 198 ? 55.343  41.499 28.634  1.00 34.81  ? 199  LEU A CG   1 
ATOM   1541 C CD1  . LEU A 1 198 ? 53.887  41.032 28.537  1.00 28.83  ? 199  LEU A CD1  1 
ATOM   1542 C CD2  . LEU A 1 198 ? 56.026  40.851 29.805  1.00 41.31  ? 199  LEU A CD2  1 
ATOM   1543 N N    . PHE A 1 199 ? 58.724  39.289 26.492  1.00 22.27  ? 200  PHE A N    1 
ATOM   1544 C CA   . PHE A 1 199 ? 58.940  38.320 25.433  1.00 24.31  ? 200  PHE A CA   1 
ATOM   1545 C C    . PHE A 1 199 ? 58.632  36.899 25.885  1.00 21.49  ? 200  PHE A C    1 
ATOM   1546 O O    . PHE A 1 199 ? 58.739  36.565 27.069  1.00 24.19  ? 200  PHE A O    1 
ATOM   1547 C CB   . PHE A 1 199 ? 60.312  38.479 24.739  1.00 27.64  ? 200  PHE A CB   1 
ATOM   1548 C CG   . PHE A 1 199 ? 61.494  38.090 25.575  1.00 26.61  ? 200  PHE A CG   1 
ATOM   1549 C CD1  . PHE A 1 199 ? 61.638  38.548 26.883  1.00 31.10  ? 200  PHE A CD1  1 
ATOM   1550 C CD2  . PHE A 1 199 ? 62.495  37.283 25.032  1.00 27.85  ? 200  PHE A CD2  1 
ATOM   1551 C CE1  . PHE A 1 199 ? 62.767  38.190 27.653  1.00 32.30  ? 200  PHE A CE1  1 
ATOM   1552 C CE2  . PHE A 1 199 ? 63.624  36.914 25.792  1.00 34.52  ? 200  PHE A CE2  1 
ATOM   1553 C CZ   . PHE A 1 199 ? 63.759  37.367 27.105  1.00 29.81  ? 200  PHE A CZ   1 
ATOM   1554 N N    . GLY A 1 200 ? 58.208  36.076 24.937  1.00 21.86  ? 201  GLY A N    1 
ATOM   1555 C CA   . GLY A 1 200 ? 57.878  34.697 25.231  1.00 20.98  ? 201  GLY A CA   1 
ATOM   1556 C C    . GLY A 1 200 ? 57.830  33.869 23.970  1.00 19.90  ? 201  GLY A C    1 
ATOM   1557 O O    . GLY A 1 200 ? 57.772  34.392 22.846  1.00 20.78  ? 201  GLY A O    1 
ATOM   1558 N N    . GLU A 1 201 ? 57.840  32.557 24.147  1.00 20.68  ? 202  GLU A N    1 
ATOM   1559 C CA   . GLU A 1 201 ? 57.887  31.657 23.001  1.00 20.01  ? 202  GLU A CA   1 
ATOM   1560 C C    . GLU A 1 201 ? 56.753  30.621 23.132  1.00 23.96  ? 202  GLU A C    1 
ATOM   1561 O O    . GLU A 1 201 ? 56.437  30.191 24.254  1.00 20.89  ? 202  GLU A O    1 
ATOM   1562 C CB   . GLU A 1 201 ? 59.283  31.025 22.957  1.00 19.02  ? 202  GLU A CB   1 
ATOM   1563 C CG   . GLU A 1 201 ? 59.593  30.175 21.743  1.00 27.34  ? 202  GLU A CG   1 
ATOM   1564 C CD   . GLU A 1 201 ? 59.073  28.755 21.907  1.00 41.86  ? 202  GLU A CD   1 
ATOM   1565 O OE1  . GLU A 1 201 ? 58.708  28.383 23.057  1.00 36.96  ? 202  GLU A OE1  1 
ATOM   1566 O OE2  . GLU A 1 201 ? 59.024  28.024 20.881  1.00 45.05  ? 202  GLU A OE2  1 
HETATM 1567 N N    . SGB A 1 202 ? 56.122  30.257 22.005  1.00 31.45  ? 203  SGB A N    1 
HETATM 1568 C CA   . SGB A 1 202 ? 54.982  29.308 21.978  1.00 35.41  ? 203  SGB A CA   1 
HETATM 1569 C C    . SGB A 1 202 ? 53.776  29.776 22.819  1.00 27.08  ? 203  SGB A C    1 
HETATM 1570 O O    . SGB A 1 202 ? 53.282  30.872 22.608  1.00 25.91  ? 203  SGB A O    1 
HETATM 1571 C CB   . SGB A 1 202 ? 55.507  27.935 22.413  1.00 44.23  ? 203  SGB A CB   1 
HETATM 1572 O OG   . SGB A 1 202 ? 54.728  26.881 21.852  1.00 53.05  ? 203  SGB A OG   1 
HETATM 1573 O O1   . SGB A 1 202 ? 54.034  26.081 24.192  1.00 21.98  ? 203  SGB A O1   1 
HETATM 1574 P P1   . SGB A 1 202 ? 54.267  25.632 22.773  1.00 29.00  ? 203  SGB A P1   1 
HETATM 1575 C C1   . SGB A 1 202 ? 52.787  25.108 21.925  1.00 27.27  ? 203  SGB A C1   1 
HETATM 1576 O O2   . SGB A 1 202 ? 55.402  24.530 22.566  1.00 44.55  ? 203  SGB A O2   1 
HETATM 1577 C C2   . SGB A 1 202 ? 55.505  23.459 23.499  1.00 45.45  ? 203  SGB A C2   1 
HETATM 1578 C C4   . SGB A 1 202 ? 56.792  22.697 23.213  1.00 39.92  ? 203  SGB A C4   1 
HETATM 1579 C C3   . SGB A 1 202 ? 54.304  22.542 23.350  1.00 43.22  ? 203  SGB A C3   1 
ATOM   1580 N N    . ALA A 1 203 ? 53.310  28.958 23.770  1.00 19.66  ? 204  ALA A N    1 
ATOM   1581 C CA   . ALA A 1 203 ? 52.338  29.419 24.775  1.00 15.91  ? 204  ALA A CA   1 
ATOM   1582 C C    . ALA A 1 203 ? 52.803  30.678 25.523  1.00 23.37  ? 204  ALA A C    1 
ATOM   1583 O O    . ALA A 1 203 ? 51.974  31.470 25.999  1.00 19.61  ? 204  ALA A O    1 
ATOM   1584 C CB   . ALA A 1 203 ? 52.015  28.320 25.774  1.00 18.29  ? 204  ALA A CB   1 
ATOM   1585 N N    . GLY A 1 204 ? 54.116  30.856 25.652  1.00 21.68  ? 205  GLY A N    1 
ATOM   1586 C CA   . GLY A 1 204 ? 54.645  32.091 26.215  1.00 20.90  ? 205  GLY A CA   1 
ATOM   1587 C C    . GLY A 1 204 ? 54.350  33.272 25.297  1.00 26.41  ? 205  GLY A C    1 
ATOM   1588 O O    . GLY A 1 204 ? 53.990  34.365 25.759  1.00 21.99  ? 205  GLY A O    1 
ATOM   1589 N N    . ALA A 1 205 ? 54.489  33.049 23.988  1.00 18.97  ? 206  ALA A N    1 
ATOM   1590 C CA   . ALA A 1 205 ? 54.162  34.086 23.011  1.00 18.27  ? 206  ALA A CA   1 
ATOM   1591 C C    . ALA A 1 205 ? 52.653  34.369 22.986  1.00 23.72  ? 206  ALA A C    1 
ATOM   1592 O O    . ALA A 1 205 ? 52.229  35.530 22.928  1.00 22.55  ? 206  ALA A O    1 
ATOM   1593 C CB   . ALA A 1 205 ? 54.660  33.706 21.638  1.00 16.91  ? 206  ALA A CB   1 
ATOM   1594 N N    . ALA A 1 206 ? 51.845  33.313 23.028  1.00 20.18  ? 207  ALA A N    1 
ATOM   1595 C CA   . ALA A 1 206 ? 50.398  33.485 23.141  1.00 23.65  ? 207  ALA A CA   1 
ATOM   1596 C C    . ALA A 1 206 ? 50.018  34.271 24.410  1.00 23.69  ? 207  ALA A C    1 
ATOM   1597 O O    . ALA A 1 206 ? 49.122  35.113 24.367  1.00 28.75  ? 207  ALA A O    1 
ATOM   1598 C CB   . ALA A 1 206 ? 49.695  32.135 23.109  1.00 16.87  ? 207  ALA A CB   1 
ATOM   1599 N N    . SER A 1 207 ? 50.699  34.000 25.526  1.00 20.73  ? 208  SER A N    1 
ATOM   1600 C CA   . SER A 1 207 ? 50.448  34.723 26.776  1.00 20.64  ? 208  SER A CA   1 
ATOM   1601 C C    . SER A 1 207 ? 50.741  36.207 26.571  1.00 24.91  ? 208  SER A C    1 
ATOM   1602 O O    . SER A 1 207 ? 49.966  37.076 27.000  1.00 19.97  ? 208  SER A O    1 
ATOM   1603 C CB   . SER A 1 207 ? 51.336  34.196 27.910  1.00 18.22  ? 208  SER A CB   1 
ATOM   1604 O OG   . SER A 1 207 ? 51.040  32.858 28.245  1.00 23.45  ? 208  SER A OG   1 
ATOM   1605 N N    . VAL A 1 208 ? 51.880  36.490 25.935  1.00 21.96  ? 209  VAL A N    1 
ATOM   1606 C CA   . VAL A 1 208 ? 52.276  37.867 25.684  1.00 19.92  ? 209  VAL A CA   1 
ATOM   1607 C C    . VAL A 1 208 ? 51.166  38.559 24.911  1.00 25.53  ? 209  VAL A C    1 
ATOM   1608 O O    . VAL A 1 208 ? 50.758  39.666 25.264  1.00 32.02  ? 209  VAL A O    1 
ATOM   1609 C CB   . VAL A 1 208 ? 53.595  37.954 24.888  1.00 20.50  ? 209  VAL A CB   1 
ATOM   1610 C CG1  . VAL A 1 208 ? 53.862  39.399 24.428  1.00 19.97  ? 209  VAL A CG1  1 
ATOM   1611 C CG2  . VAL A 1 208 ? 54.731  37.444 25.716  1.00 18.81  ? 209  VAL A CG2  1 
ATOM   1612 N N    . GLY A 1 209 ? 50.670  37.893 23.870  1.00 21.09  ? 210  GLY A N    1 
ATOM   1613 C CA   . GLY A 1 209 ? 49.615  38.456 23.037  1.00 23.74  ? 210  GLY A CA   1 
ATOM   1614 C C    . GLY A 1 209 ? 48.372  38.752 23.854  1.00 24.97  ? 210  GLY A C    1 
ATOM   1615 O O    . GLY A 1 209 ? 47.708  39.776 23.664  1.00 29.66  ? 210  GLY A O    1 
ATOM   1616 N N    . MET A 1 210 ? 48.063  37.857 24.784  1.00 23.14  ? 211  MET A N    1 
ATOM   1617 C CA   . MET A 1 210 ? 46.879  38.027 25.610  1.00 30.17  ? 211  MET A CA   1 
ATOM   1618 C C    . MET A 1 210 ? 46.997  39.208 26.559  1.00 30.36  ? 211  MET A C    1 
ATOM   1619 O O    . MET A 1 210 ? 46.005  39.882 26.809  1.00 31.73  ? 211  MET A O    1 
ATOM   1620 C CB   . MET A 1 210 ? 46.553  36.730 26.351  1.00 29.09  ? 211  MET A CB   1 
ATOM   1621 C CG   . MET A 1 210 ? 46.113  35.652 25.399  1.00 30.91  ? 211  MET A CG   1 
ATOM   1622 S SD   . MET A 1 210 ? 45.784  34.076 26.173  1.00 41.77  ? 211  MET A SD   1 
ATOM   1623 C CE   . MET A 1 210 ? 45.848  33.009 24.722  1.00 27.27  ? 211  MET A CE   1 
ATOM   1624 N N    . HIS A 1 211 ? 48.200  39.456 27.086  1.00 19.91  ? 212  HIS A N    1 
ATOM   1625 C CA   . HIS A 1 211 ? 48.425  40.661 27.887  1.00 21.38  ? 212  HIS A CA   1 
ATOM   1626 C C    . HIS A 1 211 ? 48.283  41.921 27.023  1.00 28.74  ? 212  HIS A C    1 
ATOM   1627 O O    . HIS A 1 211 ? 47.880  42.971 27.518  1.00 23.02  ? 212  HIS A O    1 
ATOM   1628 C CB   . HIS A 1 211 ? 49.781  40.629 28.601  1.00 19.16  ? 212  HIS A CB   1 
ATOM   1629 C CG   . HIS A 1 211 ? 49.867  39.574 29.661  1.00 28.23  ? 212  HIS A CG   1 
ATOM   1630 N ND1  . HIS A 1 211 ? 49.208  39.678 30.868  1.00 27.85  ? 212  HIS A ND1  1 
ATOM   1631 C CD2  . HIS A 1 211 ? 50.517  38.384 29.684  1.00 20.61  ? 212  HIS A CD2  1 
ATOM   1632 C CE1  . HIS A 1 211 ? 49.453  38.598 31.591  1.00 29.82  ? 212  HIS A CE1  1 
ATOM   1633 N NE2  . HIS A 1 211 ? 50.245  37.800 30.899  1.00 21.83  ? 212  HIS A NE2  1 
ATOM   1634 N N    . LEU A 1 212 ? 48.614  41.805 25.738  1.00 20.26  ? 213  LEU A N    1 
ATOM   1635 C CA   . LEU A 1 212 ? 48.418  42.892 24.789  1.00 30.20  ? 213  LEU A CA   1 
ATOM   1636 C C    . LEU A 1 212 ? 46.947  43.239 24.634  1.00 31.76  ? 213  LEU A C    1 
ATOM   1637 O O    . LEU A 1 212 ? 46.610  44.378 24.377  1.00 35.16  ? 213  LEU A O    1 
ATOM   1638 C CB   . LEU A 1 212 ? 48.976  42.520 23.417  1.00 32.92  ? 213  LEU A CB   1 
ATOM   1639 C CG   . LEU A 1 212 ? 50.412  42.959 23.171  1.00 44.18  ? 213  LEU A CG   1 
ATOM   1640 C CD1  . LEU A 1 212 ? 50.863  42.545 21.786  1.00 42.34  ? 213  LEU A CD1  1 
ATOM   1641 C CD2  . LEU A 1 212 ? 50.523  44.462 23.339  1.00 47.53  ? 213  LEU A CD2  1 
ATOM   1642 N N    . LEU A 1 213 ? 46.075  42.250 24.803  1.00 32.67  ? 214  LEU A N    1 
ATOM   1643 C CA   . LEU A 1 213 ? 44.668  42.398 24.438  1.00 26.16  ? 214  LEU A CA   1 
ATOM   1644 C C    . LEU A 1 213 ? 43.787  42.490 25.674  1.00 31.52  ? 214  LEU A C    1 
ATOM   1645 O O    . LEU A 1 213 ? 42.562  42.520 25.581  1.00 40.57  ? 214  LEU A O    1 
ATOM   1646 C CB   . LEU A 1 213 ? 44.236  41.221 23.563  1.00 21.82  ? 214  LEU A CB   1 
ATOM   1647 C CG   . LEU A 1 213 ? 45.075  41.017 22.300  1.00 24.75  ? 214  LEU A CG   1 
ATOM   1648 C CD1  . LEU A 1 213 ? 44.716  39.718 21.609  1.00 23.56  ? 214  LEU A CD1  1 
ATOM   1649 C CD2  . LEU A 1 213 ? 44.888  42.192 21.342  1.00 28.37  ? 214  LEU A CD2  1 
ATOM   1650 N N    . SER A 1 214 ? 44.424  42.521 26.838  1.00 31.42  ? 215  SER A N    1 
ATOM   1651 C CA   . SER A 1 214 ? 43.709  42.675 28.096  1.00 31.35  ? 215  SER A CA   1 
ATOM   1652 C C    . SER A 1 214 ? 44.164  43.974 28.730  1.00 34.40  ? 215  SER A C    1 
ATOM   1653 O O    . SER A 1 214 ? 45.323  44.090 29.140  1.00 36.79  ? 215  SER A O    1 
ATOM   1654 C CB   . SER A 1 214 ? 44.009  41.506 29.029  1.00 27.14  ? 215  SER A CB   1 
ATOM   1655 O OG   . SER A 1 214 ? 43.325  41.659 30.256  1.00 33.10  ? 215  SER A OG   1 
ATOM   1656 N N    . PRO A 1 215 ? 43.265  44.968 28.782  1.00 32.06  ? 216  PRO A N    1 
ATOM   1657 C CA   . PRO A 1 215 ? 43.573  46.315 29.282  1.00 39.92  ? 216  PRO A CA   1 
ATOM   1658 C C    . PRO A 1 215 ? 44.317  46.386 30.627  1.00 40.72  ? 216  PRO A C    1 
ATOM   1659 O O    . PRO A 1 215 ? 45.302  47.126 30.719  1.00 38.67  ? 216  PRO A O    1 
ATOM   1660 C CB   . PRO A 1 215 ? 42.190  46.980 29.346  1.00 37.95  ? 216  PRO A CB   1 
ATOM   1661 C CG   . PRO A 1 215 ? 41.488  46.391 28.136  1.00 36.42  ? 216  PRO A CG   1 
ATOM   1662 C CD   . PRO A 1 215 ? 41.956  44.927 28.099  1.00 38.64  ? 216  PRO A CD   1 
ATOM   1663 N N    . PRO A 1 216 ? 43.876  45.624 31.641  1.00 35.29  ? 217  PRO A N    1 
ATOM   1664 C CA   . PRO A 1 216 ? 44.582  45.638 32.928  1.00 39.13  ? 217  PRO A CA   1 
ATOM   1665 C C    . PRO A 1 216 ? 46.052  45.236 32.784  1.00 37.86  ? 217  PRO A C    1 
ATOM   1666 O O    . PRO A 1 216 ? 46.887  45.762 33.508  1.00 47.03  ? 217  PRO A O    1 
ATOM   1667 C CB   . PRO A 1 216 ? 43.824  44.597 33.752  1.00 36.78  ? 217  PRO A CB   1 
ATOM   1668 C CG   . PRO A 1 216 ? 42.473  44.530 33.115  1.00 34.44  ? 217  PRO A CG   1 
ATOM   1669 C CD   . PRO A 1 216 ? 42.730  44.704 31.657  1.00 30.02  ? 217  PRO A CD   1 
ATOM   1670 N N    . SER A 1 217 ? 46.366  44.334 31.859  1.00 34.40  ? 218  SER A N    1 
ATOM   1671 C CA   . SER A 1 217 ? 47.762  43.942 31.623  1.00 35.51  ? 218  SER A CA   1 
ATOM   1672 C C    . SER A 1 217 ? 48.513  44.992 30.809  1.00 37.31  ? 218  SER A C    1 
ATOM   1673 O O    . SER A 1 217 ? 49.713  45.215 31.005  1.00 35.68  ? 218  SER A O    1 
ATOM   1674 C CB   . SER A 1 217 ? 47.847  42.592 30.898  1.00 29.78  ? 218  SER A CB   1 
ATOM   1675 O OG   . SER A 1 217 ? 47.424  41.516 31.716  1.00 29.38  ? 218  SER A OG   1 
ATOM   1676 N N    . ARG A 1 218 ? 47.784  45.643 29.908  1.00 44.96  ? 219  ARG A N    1 
ATOM   1677 C CA   . ARG A 1 218 ? 48.386  46.477 28.870  1.00 44.78  ? 219  ARG A CA   1 
ATOM   1678 C C    . ARG A 1 218 ? 49.147  47.678 29.439  1.00 38.52  ? 219  ARG A C    1 
ATOM   1679 O O    . ARG A 1 218 ? 50.119  48.148 28.837  1.00 41.60  ? 219  ARG A O    1 
ATOM   1680 C CB   . ARG A 1 218 ? 47.332  46.893 27.826  1.00 43.14  ? 219  ARG A CB   1 
ATOM   1681 C CG   . ARG A 1 218 ? 47.865  47.744 26.670  1.00 44.30  ? 219  ARG A CG   1 
ATOM   1682 C CD   . ARG A 1 218 ? 48.929  47.010 25.867  1.00 45.70  ? 219  ARG A CD   1 
ATOM   1683 N NE   . ARG A 1 218 ? 49.667  47.887 24.952  1.00 55.94  ? 219  ARG A NE   1 
ATOM   1684 C CZ   . ARG A 1 218 ? 50.857  48.430 25.217  1.00 50.22  ? 219  ARG A CZ   1 
ATOM   1685 N NH1  . ARG A 1 218 ? 51.454  48.200 26.376  1.00 48.74  ? 219  ARG A NH1  1 
ATOM   1686 N NH2  . ARG A 1 218 ? 51.454  49.205 24.321  1.00 45.88  ? 219  ARG A NH2  1 
ATOM   1687 N N    . GLY A 1 219 ? 48.734  48.149 30.611  1.00 28.57  ? 220  GLY A N    1 
ATOM   1688 C CA   . GLY A 1 219 ? 49.454  49.220 31.285  1.00 27.85  ? 220  GLY A CA   1 
ATOM   1689 C C    . GLY A 1 219 ? 50.717  48.800 32.032  1.00 34.28  ? 220  GLY A C    1 
ATOM   1690 O O    . GLY A 1 219 ? 51.427  49.656 32.568  1.00 37.53  ? 220  GLY A O    1 
ATOM   1691 N N    . LEU A 1 220 ? 51.013  47.497 32.064  1.00 29.99  ? 221  LEU A N    1 
ATOM   1692 C CA   . LEU A 1 220 ? 52.155  46.999 32.834  1.00 28.67  ? 221  LEU A CA   1 
ATOM   1693 C C    . LEU A 1 220 ? 53.406  46.768 31.982  1.00 34.07  ? 221  LEU A C    1 
ATOM   1694 O O    . LEU A 1 220 ? 54.433  46.343 32.495  1.00 35.35  ? 221  LEU A O    1 
ATOM   1695 C CB   . LEU A 1 220 ? 51.796  45.706 33.573  1.00 25.22  ? 221  LEU A CB   1 
ATOM   1696 C CG   . LEU A 1 220 ? 50.488  45.683 34.370  1.00 29.96  ? 221  LEU A CG   1 
ATOM   1697 C CD1  . LEU A 1 220 ? 50.216  44.299 34.915  1.00 22.40  ? 221  LEU A CD1  1 
ATOM   1698 C CD2  . LEU A 1 220 ? 50.519  46.689 35.496  1.00 24.49  ? 221  LEU A CD2  1 
ATOM   1699 N N    . PHE A 1 221 ? 53.321  47.032 30.680  1.00 33.84  ? 222  PHE A N    1 
ATOM   1700 C CA   . PHE A 1 221 ? 54.492  46.890 29.827  1.00 32.35  ? 222  PHE A CA   1 
ATOM   1701 C C    . PHE A 1 221 ? 54.417  47.791 28.616  1.00 29.94  ? 222  PHE A C    1 
ATOM   1702 O O    . PHE A 1 221 ? 53.371  48.345 28.304  1.00 33.01  ? 222  PHE A O    1 
ATOM   1703 C CB   . PHE A 1 221 ? 54.691  45.433 29.389  1.00 27.59  ? 222  PHE A CB   1 
ATOM   1704 C CG   . PHE A 1 221 ? 53.602  44.908 28.506  1.00 27.61  ? 222  PHE A CG   1 
ATOM   1705 C CD1  . PHE A 1 221 ? 52.391  44.496 29.050  1.00 28.10  ? 222  PHE A CD1  1 
ATOM   1706 C CD2  . PHE A 1 221 ? 53.788  44.809 27.131  1.00 31.67  ? 222  PHE A CD2  1 
ATOM   1707 C CE1  . PHE A 1 221 ? 51.370  43.999 28.232  1.00 30.54  ? 222  PHE A CE1  1 
ATOM   1708 C CE2  . PHE A 1 221 ? 52.778  44.313 26.310  1.00 32.32  ? 222  PHE A CE2  1 
ATOM   1709 C CZ   . PHE A 1 221 ? 51.565  43.906 26.868  1.00 29.41  ? 222  PHE A CZ   1 
ATOM   1710 N N    . HIS A 1 222 ? 55.534  47.908 27.914  1.00 31.06  ? 223  HIS A N    1 
ATOM   1711 C CA   . HIS A 1 222 ? 55.633  48.871 26.834  1.00 34.39  ? 223  HIS A CA   1 
ATOM   1712 C C    . HIS A 1 222 ? 55.777  48.248 25.434  1.00 33.16  ? 223  HIS A C    1 
ATOM   1713 O O    . HIS A 1 222 ? 55.187  48.741 24.470  1.00 33.82  ? 223  HIS A O    1 
ATOM   1714 C CB   . HIS A 1 222 ? 56.774  49.861 27.125  1.00 40.33  ? 223  HIS A CB   1 
ATOM   1715 C CG   . HIS A 1 222 ? 56.843  50.989 26.148  1.00 48.26  ? 223  HIS A CG   1 
ATOM   1716 N ND1  . HIS A 1 222 ? 57.956  51.237 25.375  1.00 53.15  ? 223  HIS A ND1  1 
ATOM   1717 C CD2  . HIS A 1 222 ? 55.923  51.919 25.797  1.00 53.73  ? 223  HIS A CD2  1 
ATOM   1718 C CE1  . HIS A 1 222 ? 57.724  52.279 24.596  1.00 57.83  ? 223  HIS A CE1  1 
ATOM   1719 N NE2  . HIS A 1 222 ? 56.499  52.710 24.831  1.00 59.84  ? 223  HIS A NE2  1 
ATOM   1720 N N    . ARG A 1 223 ? 56.561  47.175 25.325  1.00 32.99  ? 224  ARG A N    1 
ATOM   1721 C CA   . ARG A 1 223 ? 56.828  46.526 24.032  1.00 28.64  ? 224  ARG A CA   1 
ATOM   1722 C C    . ARG A 1 223 ? 56.668  45.017 24.125  1.00 26.58  ? 224  ARG A C    1 
ATOM   1723 O O    . ARG A 1 223 ? 56.699  44.450 25.220  1.00 29.61  ? 224  ARG A O    1 
ATOM   1724 C CB   . ARG A 1 223 ? 58.254  46.825 23.566  1.00 22.86  ? 224  ARG A CB   1 
ATOM   1725 C CG   . ARG A 1 223 ? 58.439  48.205 23.082  1.00 24.38  ? 224  ARG A CG   1 
ATOM   1726 C CD   . ARG A 1 223 ? 59.891  48.594 22.989  1.00 28.88  ? 224  ARG A CD   1 
ATOM   1727 N NE   . ARG A 1 223 ? 59.927  49.996 22.597  1.00 39.26  ? 224  ARG A NE   1 
ATOM   1728 C CZ   . ARG A 1 223 ? 60.792  50.895 23.037  1.00 42.34  ? 224  ARG A CZ   1 
ATOM   1729 N NH1  . ARG A 1 223 ? 61.750  50.556 23.885  1.00 34.36  ? 224  ARG A NH1  1 
ATOM   1730 N NH2  . ARG A 1 223 ? 60.694  52.143 22.602  1.00 55.00  ? 224  ARG A NH2  1 
ATOM   1731 N N    . ALA A 1 224 ? 56.556  44.364 22.973  1.00 25.45  ? 225  ALA A N    1 
ATOM   1732 C CA   . ALA A 1 224 ? 56.254  42.946 22.955  1.00 20.04  ? 225  ALA A CA   1 
ATOM   1733 C C    . ALA A 1 224 ? 57.064  42.194 21.914  1.00 26.33  ? 225  ALA A C    1 
ATOM   1734 O O    . ALA A 1 224 ? 57.269  42.685 20.796  1.00 32.41  ? 225  ALA A O    1 
ATOM   1735 C CB   . ALA A 1 224 ? 54.765  42.736 22.719  1.00 21.05  ? 225  ALA A CB   1 
ATOM   1736 N N    . VAL A 1 225 ? 57.515  40.999 22.295  1.00 23.79  ? 226  VAL A N    1 
ATOM   1737 C CA   . VAL A 1 225 ? 58.174  40.057 21.389  1.00 20.86  ? 226  VAL A CA   1 
ATOM   1738 C C    . VAL A 1 225 ? 57.451  38.715 21.454  1.00 24.13  ? 226  VAL A C    1 
ATOM   1739 O O    . VAL A 1 225 ? 57.325  38.127 22.530  1.00 26.02  ? 226  VAL A O    1 
ATOM   1740 C CB   . VAL A 1 225 ? 59.627  39.831 21.794  1.00 22.62  ? 226  VAL A CB   1 
ATOM   1741 C CG1  . VAL A 1 225 ? 60.296  38.829 20.859  1.00 18.86  ? 226  VAL A CG1  1 
ATOM   1742 C CG2  . VAL A 1 225 ? 60.377  41.159 21.803  1.00 19.60  ? 226  VAL A CG2  1 
ATOM   1743 N N    . LEU A 1 226 ? 56.968  38.244 20.306  1.00 23.47  ? 227  LEU A N    1 
ATOM   1744 C CA   . LEU A 1 226 ? 56.250  36.982 20.227  1.00 21.39  ? 227  LEU A CA   1 
ATOM   1745 C C    . LEU A 1 226 ? 57.006  36.022 19.323  1.00 21.98  ? 227  LEU A C    1 
ATOM   1746 O O    . LEU A 1 226 ? 57.088  36.215 18.102  1.00 23.57  ? 227  LEU A O    1 
ATOM   1747 C CB   . LEU A 1 226 ? 54.838  37.181 19.679  1.00 22.11  ? 227  LEU A CB   1 
ATOM   1748 C CG   . LEU A 1 226 ? 53.847  37.904 20.573  1.00 27.24  ? 227  LEU A CG   1 
ATOM   1749 C CD1  . LEU A 1 226 ? 53.953  39.390 20.350  1.00 27.04  ? 227  LEU A CD1  1 
ATOM   1750 C CD2  . LEU A 1 226 ? 52.439  37.416 20.280  1.00 26.82  ? 227  LEU A CD2  1 
ATOM   1751 N N    . GLN A 1 227 ? 57.565  34.985 19.925  1.00 22.41  ? 228  GLN A N    1 
ATOM   1752 C CA   . GLN A 1 227 ? 58.362  34.022 19.184  1.00 22.42  ? 228  GLN A CA   1 
ATOM   1753 C C    . GLN A 1 227 ? 57.545  32.757 18.952  1.00 22.35  ? 228  GLN A C    1 
ATOM   1754 O O    . GLN A 1 227 ? 57.201  32.070 19.910  1.00 25.52  ? 228  GLN A O    1 
ATOM   1755 C CB   . GLN A 1 227 ? 59.639  33.705 19.983  1.00 19.99  ? 228  GLN A CB   1 
ATOM   1756 C CG   . GLN A 1 227 ? 60.514  34.944 20.229  1.00 33.63  ? 228  GLN A CG   1 
ATOM   1757 C CD   . GLN A 1 227 ? 61.639  34.726 21.241  1.00 41.20  ? 228  GLN A CD   1 
ATOM   1758 O OE1  . GLN A 1 227 ? 62.120  35.683 21.858  1.00 38.07  ? 228  GLN A OE1  1 
ATOM   1759 N NE2  . GLN A 1 227 ? 62.070  33.473 21.407  1.00 42.63  ? 228  GLN A NE2  1 
ATOM   1760 N N    . SER A 1 228 ? 57.226  32.451 17.695  1.00 22.62  ? 229  SER A N    1 
ATOM   1761 C CA   . SER A 1 228 ? 56.592  31.159 17.357  1.00 26.16  ? 229  SER A CA   1 
ATOM   1762 C C    . SER A 1 228 ? 55.293  30.890 18.108  1.00 24.18  ? 229  SER A C    1 
ATOM   1763 O O    . SER A 1 228 ? 55.057  29.762 18.567  1.00 26.83  ? 229  SER A O    1 
ATOM   1764 C CB   . SER A 1 228 ? 57.538  29.984 17.640  1.00 20.32  ? 229  SER A CB   1 
ATOM   1765 O OG   . SER A 1 228 ? 58.764  30.126 16.953  1.00 28.11  ? 229  SER A OG   1 
ATOM   1766 N N    . GLY A 1 229 ? 54.455  31.911 18.236  1.00 20.08  ? 230  GLY A N    1 
ATOM   1767 C CA   . GLY A 1 229 ? 53.177  31.744 18.912  1.00 18.18  ? 230  GLY A CA   1 
ATOM   1768 C C    . GLY A 1 229 ? 52.373  33.028 18.830  1.00 22.89  ? 230  GLY A C    1 
ATOM   1769 O O    . GLY A 1 229 ? 52.932  34.090 18.556  1.00 25.24  ? 230  GLY A O    1 
ATOM   1770 N N    . ALA A 1 230 ? 51.069  32.925 19.069  1.00 17.97  ? 231  ALA A N    1 
ATOM   1771 C CA   . ALA A 1 230 ? 50.144  34.039 18.947  1.00 18.34  ? 231  ALA A CA   1 
ATOM   1772 C C    . ALA A 1 230 ? 48.898  33.659 19.716  1.00 27.22  ? 231  ALA A C    1 
ATOM   1773 O O    . ALA A 1 230 ? 48.544  32.478 19.769  1.00 23.70  ? 231  ALA A O    1 
ATOM   1774 C CB   . ALA A 1 230 ? 49.793  34.294 17.481  1.00 19.03  ? 231  ALA A CB   1 
ATOM   1775 N N    . PRO A 1 231 ? 48.216  34.655 20.302  1.00 28.84  ? 232  PRO A N    1 
ATOM   1776 C CA   . PRO A 1 231 ? 47.002  34.423 21.096  1.00 27.63  ? 232  PRO A CA   1 
ATOM   1777 C C    . PRO A 1 231 ? 45.859  33.899 20.227  1.00 32.77  ? 232  PRO A C    1 
ATOM   1778 O O    . PRO A 1 231 ? 44.976  33.204 20.740  1.00 37.17  ? 232  PRO A O    1 
ATOM   1779 C CB   . PRO A 1 231 ? 46.666  35.821 21.640  1.00 29.35  ? 232  PRO A CB   1 
ATOM   1780 C CG   . PRO A 1 231 ? 47.270  36.772 20.636  1.00 25.80  ? 232  PRO A CG   1 
ATOM   1781 C CD   . PRO A 1 231 ? 48.537  36.091 20.172  1.00 25.72  ? 232  PRO A CD   1 
ATOM   1782 N N    . ASN A 1 232 ? 45.888  34.220 18.933  1.00 24.92  ? 233  ASN A N    1 
ATOM   1783 C CA   . ASN A 1 232 ? 44.869  33.753 17.987  1.00 29.08  ? 233  ASN A CA   1 
ATOM   1784 C C    . ASN A 1 232 ? 45.038  32.310 17.440  1.00 28.72  ? 233  ASN A C    1 
ATOM   1785 O O    . ASN A 1 232 ? 44.163  31.814 16.724  1.00 30.50  ? 233  ASN A O    1 
ATOM   1786 C CB   . ASN A 1 232 ? 44.701  34.753 16.825  1.00 20.91  ? 233  ASN A CB   1 
ATOM   1787 C CG   . ASN A 1 232 ? 46.034  35.249 16.280  1.00 25.53  ? 233  ASN A CG   1 
ATOM   1788 O OD1  . ASN A 1 232 ? 46.937  35.598 17.042  1.00 32.55  ? 233  ASN A OD1  1 
ATOM   1789 N ND2  . ASN A 1 232 ? 46.164  35.280 14.960  1.00 22.91  ? 233  ASN A ND2  1 
ATOM   1790 N N    . GLY A 1 233 ? 46.130  31.624 17.771  1.00 37.08  ? 234  GLY A N    1 
ATOM   1791 C CA   . GLY A 1 233 ? 46.236  30.202 17.430  1.00 54.21  ? 234  GLY A CA   1 
ATOM   1792 C C    . GLY A 1 233 ? 45.031  29.346 17.858  1.00 56.44  ? 234  GLY A C    1 
ATOM   1793 O O    . GLY A 1 233 ? 44.453  29.585 18.923  1.00 62.85  ? 234  GLY A O    1 
ATOM   1794 N N    . PRO A 1 234 ? 44.653  28.335 17.043  1.00 38.62  ? 235  PRO A N    1 
ATOM   1795 C CA   . PRO A 1 234 ? 43.489  27.476 17.341  1.00 27.42  ? 235  PRO A CA   1 
ATOM   1796 C C    . PRO A 1 234 ? 43.637  26.622 18.621  1.00 24.77  ? 235  PRO A C    1 
ATOM   1797 O O    . PRO A 1 234 ? 42.713  25.893 18.986  1.00 28.16  ? 235  PRO A O    1 
ATOM   1798 C CB   . PRO A 1 234 ? 43.397  26.567 16.109  1.00 25.38  ? 235  PRO A CB   1 
ATOM   1799 C CG   . PRO A 1 234 ? 44.782  26.553 15.531  1.00 26.25  ? 235  PRO A CG   1 
ATOM   1800 C CD   . PRO A 1 234 ? 45.370  27.903 15.826  1.00 24.50  ? 235  PRO A CD   1 
ATOM   1801 N N    . TRP A 1 235 ? 44.772  26.739 19.303  1.00 22.12  ? 236  TRP A N    1 
ATOM   1802 C CA   . TRP A 1 235 ? 45.092  25.883 20.449  1.00 24.07  ? 236  TRP A CA   1 
ATOM   1803 C C    . TRP A 1 235 ? 45.248  26.670 21.744  1.00 20.96  ? 236  TRP A C    1 
ATOM   1804 O O    . TRP A 1 235 ? 45.225  26.098 22.838  1.00 22.17  ? 236  TRP A O    1 
ATOM   1805 C CB   . TRP A 1 235 ? 46.399  25.147 20.175  1.00 18.89  ? 236  TRP A CB   1 
ATOM   1806 C CG   . TRP A 1 235 ? 47.483  26.107 19.789  1.00 26.32  ? 236  TRP A CG   1 
ATOM   1807 C CD1  . TRP A 1 235 ? 47.806  26.508 18.528  1.00 25.72  ? 236  TRP A CD1  1 
ATOM   1808 C CD2  . TRP A 1 235 ? 48.372  26.806 20.674  1.00 21.29  ? 236  TRP A CD2  1 
ATOM   1809 N NE1  . TRP A 1 235 ? 48.842  27.406 18.568  1.00 25.04  ? 236  TRP A NE1  1 
ATOM   1810 C CE2  . TRP A 1 235 ? 49.209  27.605 19.869  1.00 25.28  ? 236  TRP A CE2  1 
ATOM   1811 C CE3  . TRP A 1 235 ? 48.542  26.823 22.064  1.00 26.12  ? 236  TRP A CE3  1 
ATOM   1812 C CZ2  . TRP A 1 235 ? 50.207  28.423 20.412  1.00 24.16  ? 236  TRP A CZ2  1 
ATOM   1813 C CZ3  . TRP A 1 235 ? 49.531  27.626 22.600  1.00 22.45  ? 236  TRP A CZ3  1 
ATOM   1814 C CH2  . TRP A 1 235 ? 50.355  28.417 21.774  1.00 29.20  ? 236  TRP A CH2  1 
ATOM   1815 N N    . ALA A 1 236 ? 45.426  27.983 21.613  1.00 24.08  ? 237  ALA A N    1 
ATOM   1816 C CA   . ALA A 1 236 ? 45.787  28.842 22.745  1.00 22.26  ? 237  ALA A CA   1 
ATOM   1817 C C    . ALA A 1 236 ? 44.585  29.276 23.593  1.00 29.98  ? 237  ALA A C    1 
ATOM   1818 O O    . ALA A 1 236 ? 44.736  29.692 24.750  1.00 27.62  ? 237  ALA A O    1 
ATOM   1819 C CB   . ALA A 1 236 ? 46.559  30.053 22.266  1.00 20.87  ? 237  ALA A CB   1 
ATOM   1820 N N    . THR A 1 237 ? 43.391  29.178 23.029  1.00 18.66  ? 238  THR A N    1 
ATOM   1821 C CA   . THR A 1 237 ? 42.204  29.522 23.794  1.00 25.65  ? 238  THR A CA   1 
ATOM   1822 C C    . THR A 1 237 ? 41.145  28.484 23.565  1.00 26.03  ? 238  THR A C    1 
ATOM   1823 O O    . THR A 1 237 ? 41.163  27.786 22.557  1.00 24.74  ? 238  THR A O    1 
ATOM   1824 C CB   . THR A 1 237 ? 41.618  30.886 23.381  1.00 25.98  ? 238  THR A CB   1 
ATOM   1825 O OG1  . THR A 1 237 ? 41.291  30.853 21.987  1.00 25.10  ? 238  THR A OG1  1 
ATOM   1826 C CG2  . THR A 1 237 ? 42.615  32.015 23.635  1.00 27.80  ? 238  THR A CG2  1 
ATOM   1827 N N    . VAL A 1 238 ? 40.208  28.409 24.503  1.00 30.42  ? 239  VAL A N    1 
ATOM   1828 C CA   . VAL A 1 238 ? 39.060  27.518 24.398  1.00 20.53  ? 239  VAL A CA   1 
ATOM   1829 C C    . VAL A 1 238 ? 37.810  28.344 24.790  1.00 28.33  ? 239  VAL A C    1 
ATOM   1830 O O    . VAL A 1 238 ? 37.929  29.360 25.489  1.00 25.82  ? 239  VAL A O    1 
ATOM   1831 C CB   . VAL A 1 238 ? 39.286  26.268 25.291  1.00 29.26  ? 239  VAL A CB   1 
ATOM   1832 C CG1  . VAL A 1 238 ? 39.075  26.605 26.785  1.00 26.86  ? 239  VAL A CG1  1 
ATOM   1833 C CG2  . VAL A 1 238 ? 38.410  25.127 24.871  1.00 30.67  ? 239  VAL A CG2  1 
ATOM   1834 N N    . GLY A 1 239 ? 36.631  27.953 24.302  1.00 32.30  ? 240  GLY A N    1 
ATOM   1835 C CA   . GLY A 1 239 ? 35.390  28.641 24.642  1.00 22.92  ? 240  GLY A CA   1 
ATOM   1836 C C    . GLY A 1 239 ? 34.830  28.213 26.002  1.00 33.86  ? 240  GLY A C    1 
ATOM   1837 O O    . GLY A 1 239 ? 35.338  27.267 26.609  1.00 31.63  ? 240  GLY A O    1 
ATOM   1838 N N    . MET A 1 240 ? 33.785  28.887 26.484  1.00 28.67  ? 241  MET A N    1 
ATOM   1839 C CA   . MET A 1 240 ? 33.306  28.644 27.847  1.00 29.88  ? 241  MET A CA   1 
ATOM   1840 C C    . MET A 1 240 ? 32.727  27.244 28.067  1.00 29.48  ? 241  MET A C    1 
ATOM   1841 O O    . MET A 1 240 ? 32.953  26.641 29.117  1.00 25.82  ? 241  MET A O    1 
ATOM   1842 C CB   . MET A 1 240 ? 32.293  29.709 28.278  1.00 29.39  ? 241  MET A CB   1 
ATOM   1843 C CG   . MET A 1 240 ? 32.911  31.009 28.796  1.00 37.46  ? 241  MET A CG   1 
ATOM   1844 S SD   . MET A 1 240 ? 31.696  32.351 28.929  1.00 49.82  ? 241  MET A SD   1 
ATOM   1845 C CE   . MET A 1 240 ? 30.663  31.721 30.248  1.00 59.45  ? 241  MET A CE   1 
ATOM   1846 N N    . GLY A 1 241 ? 31.985  26.744 27.080  1.00 25.19  ? 242  GLY A N    1 
ATOM   1847 C CA   . GLY A 1 241 ? 31.350  25.442 27.150  1.00 25.76  ? 242  GLY A CA   1 
ATOM   1848 C C    . GLY A 1 241 ? 32.380  24.337 27.079  1.00 28.28  ? 242  GLY A C    1 
ATOM   1849 O O    . GLY A 1 241 ? 32.363  23.404 27.887  1.00 28.75  ? 242  GLY A O    1 
ATOM   1850 N N    . GLU A 1 242 ? 33.294  24.441 26.118  1.00 28.32  ? 243  GLU A N    1 
ATOM   1851 C CA   . GLU A 1 242 ? 34.355  23.449 26.003  1.00 35.33  ? 243  GLU A CA   1 
ATOM   1852 C C    . GLU A 1 242 ? 35.222  23.390 27.271  1.00 30.40  ? 243  GLU A C    1 
ATOM   1853 O O    . GLU A 1 242 ? 35.609  22.309 27.707  1.00 29.31  ? 243  GLU A O    1 
ATOM   1854 C CB   . GLU A 1 242 ? 35.205  23.698 24.752  1.00 38.51  ? 243  GLU A CB   1 
ATOM   1855 C CG   . GLU A 1 242 ? 36.302  22.660 24.514  1.00 42.08  ? 243  GLU A CG   1 
ATOM   1856 C CD   . GLU A 1 242 ? 35.766  21.241 24.355  1.00 41.61  ? 243  GLU A CD   1 
ATOM   1857 O OE1  . GLU A 1 242 ? 34.539  21.085 24.182  1.00 47.15  ? 243  GLU A OE1  1 
ATOM   1858 O OE2  . GLU A 1 242 ? 36.574  20.279 24.396  1.00 36.08  ? 243  GLU A OE2  1 
ATOM   1859 N N    . ALA A 1 243 ? 35.518  24.535 27.877  1.00 25.01  ? 244  ALA A N    1 
ATOM   1860 C CA   . ALA A 1 243 ? 36.313  24.496 29.106  1.00 29.09  ? 244  ALA A CA   1 
ATOM   1861 C C    . ALA A 1 243 ? 35.520  23.786 30.202  1.00 27.32  ? 244  ALA A C    1 
ATOM   1862 O O    . ALA A 1 243 ? 36.058  22.960 30.914  1.00 22.07  ? 244  ALA A O    1 
ATOM   1863 C CB   . ALA A 1 243 ? 36.733  25.890 29.551  1.00 24.81  ? 244  ALA A CB   1 
ATOM   1864 N N    . ARG A 1 244 ? 34.230  24.091 30.305  1.00 28.28  ? 245  ARG A N    1 
ATOM   1865 C CA   . ARG A 1 244 ? 33.377  23.445 31.292  1.00 26.91  ? 245  ARG A CA   1 
ATOM   1866 C C    . ARG A 1 244 ? 33.311  21.929 31.087  1.00 26.35  ? 245  ARG A C    1 
ATOM   1867 O O    . ARG A 1 244 ? 33.386  21.160 32.050  1.00 31.73  ? 245  ARG A O    1 
ATOM   1868 C CB   . ARG A 1 244 ? 31.973  24.060 31.273  1.00 25.07  ? 245  ARG A CB   1 
ATOM   1869 C CG   . ARG A 1 244 ? 31.011  23.423 32.272  1.00 25.99  ? 245  ARG A CG   1 
ATOM   1870 C CD   . ARG A 1 244 ? 29.820  24.350 32.584  1.00 32.41  ? 245  ARG A CD   1 
ATOM   1871 N NE   . ARG A 1 244 ? 30.175  25.455 33.478  1.00 32.12  ? 245  ARG A NE   1 
ATOM   1872 C CZ   . ARG A 1 244 ? 30.220  25.370 34.813  1.00 37.32  ? 245  ARG A CZ   1 
ATOM   1873 N NH1  . ARG A 1 244 ? 29.931  24.233 35.431  1.00 27.22  ? 245  ARG A NH1  1 
ATOM   1874 N NH2  . ARG A 1 244 ? 30.551  26.434 35.534  1.00 37.64  ? 245  ARG A NH2  1 
ATOM   1875 N N    . ARG A 1 245 ? 33.174  21.507 29.835  1.00 27.15  ? 246  ARG A N    1 
ATOM   1876 C CA   . ARG A 1 245 ? 33.123  20.084 29.504  1.00 32.25  ? 246  ARG A CA   1 
ATOM   1877 C C    . ARG A 1 245 ? 34.394  19.370 29.962  1.00 30.96  ? 246  ARG A C    1 
ATOM   1878 O O    . ARG A 1 245 ? 34.331  18.306 30.578  1.00 27.43  ? 246  ARG A O    1 
ATOM   1879 C CB   . ARG A 1 245 ? 32.943  19.877 27.994  1.00 31.53  ? 246  ARG A CB   1 
ATOM   1880 C CG   . ARG A 1 245 ? 32.623  18.425 27.623  1.00 36.85  ? 246  ARG A CG   1 
ATOM   1881 C CD   . ARG A 1 245 ? 32.755  18.155 26.124  1.00 42.54  ? 246  ARG A CD   1 
ATOM   1882 N NE   . ARG A 1 245 ? 34.129  18.310 25.652  1.00 45.41  ? 246  ARG A NE   1 
ATOM   1883 C CZ   . ARG A 1 245 ? 35.141  17.494 25.972  1.00 49.70  ? 246  ARG A CZ   1 
ATOM   1884 N NH1  . ARG A 1 245 ? 34.946  16.456 26.790  1.00 47.40  ? 246  ARG A NH1  1 
ATOM   1885 N NH2  . ARG A 1 245 ? 36.360  17.722 25.476  1.00 37.98  ? 246  ARG A NH2  1 
ATOM   1886 N N    . ARG A 1 246 ? 35.544  19.964 29.655  1.00 28.24  ? 247  ARG A N    1 
ATOM   1887 C CA   . ARG A 1 246 ? 36.829  19.393 30.035  1.00 25.96  ? 247  ARG A CA   1 
ATOM   1888 C C    . ARG A 1 246 ? 37.014  19.314 31.551  1.00 28.58  ? 247  ARG A C    1 
ATOM   1889 O O    . ARG A 1 246 ? 37.465  18.292 32.073  1.00 26.78  ? 247  ARG A O    1 
ATOM   1890 C CB   . ARG A 1 246 ? 37.969  20.198 29.401  1.00 26.02  ? 247  ARG A CB   1 
ATOM   1891 C CG   . ARG A 1 246 ? 37.941  20.146 27.882  1.00 30.86  ? 247  ARG A CG   1 
ATOM   1892 C CD   . ARG A 1 246 ? 39.130  20.841 27.259  1.00 21.01  ? 247  ARG A CD   1 
ATOM   1893 N NE   . ARG A 1 246 ? 39.001  20.884 25.800  1.00 26.47  ? 247  ARG A NE   1 
ATOM   1894 C CZ   . ARG A 1 246 ? 39.896  21.423 24.979  1.00 28.24  ? 247  ARG A CZ   1 
ATOM   1895 N NH1  . ARG A 1 246 ? 41.011  21.971 25.456  1.00 26.93  ? 247  ARG A NH1  1 
ATOM   1896 N NH2  . ARG A 1 246 ? 39.674  21.409 23.677  1.00 23.88  ? 247  ARG A NH2  1 
ATOM   1897 N N    . ALA A 1 247 ? 36.683  20.396 32.251  1.00 26.35  ? 248  ALA A N    1 
ATOM   1898 C CA   . ALA A 1 247 ? 36.829  20.432 33.700  1.00 22.10  ? 248  ALA A CA   1 
ATOM   1899 C C    . ALA A 1 247 ? 35.944  19.348 34.278  1.00 29.07  ? 248  ALA A C    1 
ATOM   1900 O O    . ALA A 1 247 ? 36.374  18.543 35.106  1.00 25.97  ? 248  ALA A O    1 
ATOM   1901 C CB   . ALA A 1 247 ? 36.424  21.797 34.238  1.00 23.67  ? 248  ALA A CB   1 
ATOM   1902 N N    . THR A 1 248 ? 34.699  19.318 33.815  1.00 29.99  ? 249  THR A N    1 
ATOM   1903 C CA   . THR A 1 248 ? 33.735  18.344 34.310  1.00 36.38  ? 249  THR A CA   1 
ATOM   1904 C C    . THR A 1 248 ? 34.196  16.905 34.075  1.00 35.86  ? 249  THR A C    1 
ATOM   1905 O O    . THR A 1 248 ? 34.013  16.047 34.937  1.00 35.61  ? 249  THR A O    1 
ATOM   1906 C CB   . THR A 1 248 ? 32.354  18.564 33.680  1.00 36.61  ? 249  THR A CB   1 
ATOM   1907 O OG1  . THR A 1 248 ? 31.900  19.889 33.994  1.00 37.02  ? 249  THR A OG1  1 
ATOM   1908 C CG2  . THR A 1 248 ? 31.365  17.548 34.206  1.00 27.09  ? 249  THR A CG2  1 
ATOM   1909 N N    A GLN A 1 249 ? 34.801  16.637 32.919  0.49 32.00  ? 250  GLN A N    1 
ATOM   1910 N N    B GLN A 1 249 ? 34.808  16.661 32.919  0.51 31.92  ? 250  GLN A N    1 
ATOM   1911 C CA   A GLN A 1 249 ? 35.254  15.277 32.628  0.49 33.94  ? 250  GLN A CA   1 
ATOM   1912 C CA   B GLN A 1 249 ? 35.282  15.325 32.569  0.51 34.29  ? 250  GLN A CA   1 
ATOM   1913 C C    A GLN A 1 249 ? 36.469  14.888 33.474  0.49 32.23  ? 250  GLN A C    1 
ATOM   1914 C C    B GLN A 1 249 ? 36.470  14.899 33.437  0.51 32.50  ? 250  GLN A C    1 
ATOM   1915 O O    A GLN A 1 249 ? 36.571  13.752 33.929  0.49 31.18  ? 250  GLN A O    1 
ATOM   1916 O O    B GLN A 1 249 ? 36.549  13.753 33.873  0.51 31.26  ? 250  GLN A O    1 
ATOM   1917 C CB   A GLN A 1 249 ? 35.546  15.072 31.135  0.49 36.49  ? 250  GLN A CB   1 
ATOM   1918 C CB   B GLN A 1 249 ? 35.645  15.256 31.081  0.51 35.82  ? 250  GLN A CB   1 
ATOM   1919 C CG   A GLN A 1 249 ? 35.728  13.593 30.765  0.49 39.76  ? 250  GLN A CG   1 
ATOM   1920 C CG   B GLN A 1 249 ? 36.052  13.864 30.607  0.51 39.09  ? 250  GLN A CG   1 
ATOM   1921 C CD   A GLN A 1 249 ? 36.297  13.383 29.370  0.49 39.62  ? 250  GLN A CD   1 
ATOM   1922 C CD   B GLN A 1 249 ? 34.969  12.815 30.835  0.51 41.37  ? 250  GLN A CD   1 
ATOM   1923 O OE1  A GLN A 1 249 ? 36.205  14.259 28.510  0.49 39.59  ? 250  GLN A OE1  1 
ATOM   1924 O OE1  B GLN A 1 249 ? 33.820  13.141 31.141  0.51 44.83  ? 250  GLN A OE1  1 
ATOM   1925 N NE2  A GLN A 1 249 ? 36.893  12.214 29.143  0.49 36.44  ? 250  GLN A NE2  1 
ATOM   1926 N NE2  B GLN A 1 249 ? 35.337  11.547 30.687  0.51 41.29  ? 250  GLN A NE2  1 
ATOM   1927 N N    . LEU A 1 250 ? 37.386  15.830 33.683  1.00 31.32  ? 251  LEU A N    1 
ATOM   1928 C CA   . LEU A 1 250 ? 38.529  15.578 34.559  1.00 37.09  ? 251  LEU A CA   1 
ATOM   1929 C C    . LEU A 1 250 ? 38.023  15.205 35.949  1.00 35.44  ? 251  LEU A C    1 
ATOM   1930 O O    . LEU A 1 250 ? 38.459  14.220 36.528  1.00 30.92  ? 251  LEU A O    1 
ATOM   1931 C CB   . LEU A 1 250 ? 39.441  16.805 34.671  1.00 32.88  ? 251  LEU A CB   1 
ATOM   1932 C CG   . LEU A 1 250 ? 40.632  16.600 35.619  1.00 35.81  ? 251  LEU A CG   1 
ATOM   1933 C CD1  . LEU A 1 250 ? 41.498  15.462 35.118  1.00 37.61  ? 251  LEU A CD1  1 
ATOM   1934 C CD2  . LEU A 1 250 ? 41.481  17.858 35.789  1.00 32.97  ? 251  LEU A CD2  1 
ATOM   1935 N N    . ALA A 1 251 ? 37.091  16.004 36.459  1.00 34.13  ? 252  ALA A N    1 
ATOM   1936 C CA   . ALA A 1 251 ? 36.508  15.784 37.771  1.00 35.37  ? 252  ALA A CA   1 
ATOM   1937 C C    . ALA A 1 251 ? 35.925  14.385 37.830  1.00 35.28  ? 252  ALA A C    1 
ATOM   1938 O O    . ALA A 1 251 ? 36.124  13.654 38.794  1.00 35.05  ? 252  ALA A O    1 
ATOM   1939 C CB   . ALA A 1 251 ? 35.430  16.824 38.052  1.00 36.59  ? 252  ALA A CB   1 
ATOM   1940 N N    . HIS A 1 252 ? 35.214  14.015 36.775  1.00 35.70  ? 253  HIS A N    1 
ATOM   1941 C CA   . HIS A 1 252 ? 34.597  12.701 36.697  1.00 42.52  ? 253  HIS A CA   1 
ATOM   1942 C C    . HIS A 1 252 ? 35.650  11.579 36.735  1.00 41.82  ? 253  HIS A C    1 
ATOM   1943 O O    . HIS A 1 252 ? 35.468  10.567 37.415  1.00 44.73  ? 253  HIS A O    1 
ATOM   1944 C CB   . HIS A 1 252 ? 33.741  12.626 35.431  1.00 47.60  ? 253  HIS A CB   1 
ATOM   1945 C CG   . HIS A 1 252 ? 33.065  11.307 35.229  1.00 57.01  ? 253  HIS A CG   1 
ATOM   1946 N ND1  . HIS A 1 252 ? 33.514  10.375 34.316  1.00 61.59  ? 253  HIS A ND1  1 
ATOM   1947 C CD2  . HIS A 1 252 ? 31.960  10.773 35.805  1.00 56.70  ? 253  HIS A CD2  1 
ATOM   1948 C CE1  . HIS A 1 252 ? 32.721  9.317  34.346  1.00 61.26  ? 253  HIS A CE1  1 
ATOM   1949 N NE2  . HIS A 1 252 ? 31.770  9.534  35.238  1.00 58.79  ? 253  HIS A NE2  1 
ATOM   1950 N N    . LEU A 1 253 ? 36.751  11.773 36.012  1.00 37.51  ? 254  LEU A N    1 
ATOM   1951 C CA   . LEU A 1 253 ? 37.819  10.774 35.926  1.00 40.33  ? 254  LEU A CA   1 
ATOM   1952 C C    . LEU A 1 253 ? 38.512  10.484 37.260  1.00 40.23  ? 254  LEU A C    1 
ATOM   1953 O O    . LEU A 1 253 ? 39.052  9.399  37.457  1.00 44.44  ? 254  LEU A O    1 
ATOM   1954 C CB   . LEU A 1 253 ? 38.863  11.193 34.891  1.00 40.91  ? 254  LEU A CB   1 
ATOM   1955 C CG   . LEU A 1 253 ? 38.395  11.147 33.438  1.00 43.25  ? 254  LEU A CG   1 
ATOM   1956 C CD1  . LEU A 1 253 ? 39.509  11.588 32.486  1.00 37.95  ? 254  LEU A CD1  1 
ATOM   1957 C CD2  . LEU A 1 253 ? 37.905  9.748  33.105  1.00 38.90  ? 254  LEU A CD2  1 
ATOM   1958 N N    . VAL A 1 254 ? 38.508  11.458 38.163  1.00 40.22  ? 255  VAL A N    1 
ATOM   1959 C CA   . VAL A 1 254 ? 39.141  11.285 39.466  1.00 41.25  ? 255  VAL A CA   1 
ATOM   1960 C C    . VAL A 1 254 ? 38.087  11.129 40.566  1.00 46.26  ? 255  VAL A C    1 
ATOM   1961 O O    . VAL A 1 254 ? 38.361  11.343 41.747  1.00 52.37  ? 255  VAL A O    1 
ATOM   1962 C CB   . VAL A 1 254 ? 40.110  12.440 39.771  1.00 35.32  ? 255  VAL A CB   1 
ATOM   1963 C CG1  . VAL A 1 254 ? 41.148  12.535 38.663  1.00 27.77  ? 255  VAL A CG1  1 
ATOM   1964 C CG2  . VAL A 1 254 ? 39.350  13.753 39.891  1.00 30.60  ? 255  VAL A CG2  1 
ATOM   1965 N N    . GLY A 1 255 ? 36.876  10.759 40.150  1.00 44.27  ? 256  GLY A N    1 
ATOM   1966 C CA   . GLY A 1 255 ? 35.813  10.394 41.063  1.00 38.72  ? 256  GLY A CA   1 
ATOM   1967 C C    . GLY A 1 255 ? 35.112  11.553 41.727  1.00 44.03  ? 256  GLY A C    1 
ATOM   1968 O O    . GLY A 1 255 ? 34.673  11.431 42.867  1.00 56.07  ? 256  GLY A O    1 
ATOM   1969 N N    . CYS A 1 256 ? 34.997  12.679 41.030  1.00 38.99  ? 257  CYS A N    1 
ATOM   1970 C CA   . CYS A 1 256 ? 34.328  13.841 41.610  1.00 42.08  ? 257  CYS A CA   1 
ATOM   1971 C C    . CYS A 1 256 ? 32.965  14.077 40.991  1.00 54.38  ? 257  CYS A C    1 
ATOM   1972 O O    . CYS A 1 256 ? 32.873  14.622 39.888  1.00 43.52  ? 257  CYS A O    1 
ATOM   1973 C CB   . CYS A 1 256 ? 35.197  15.096 41.505  1.00 39.41  ? 257  CYS A CB   1 
ATOM   1974 S SG   . CYS A 1 256 ? 36.552  15.103 42.704  1.00 56.57  ? 257  CYS A SG   1 
ATOM   1975 N N    . PRO A 1 257 ? 31.906  13.637 41.704  1.00 65.63  ? 258  PRO A N    1 
ATOM   1976 C CA   . PRO A 1 257 ? 30.495  13.828 41.382  1.00 69.57  ? 258  PRO A CA   1 
ATOM   1977 C C    . PRO A 1 257 ? 30.228  15.163 40.706  1.00 72.75  ? 258  PRO A C    1 
ATOM   1978 O O    . PRO A 1 257 ? 29.888  15.140 39.526  1.00 80.95  ? 258  PRO A O    1 
ATOM   1979 C CB   . PRO A 1 257 ? 29.828  13.796 42.763  1.00 73.95  ? 258  PRO A CB   1 
ATOM   1980 C CG   . PRO A 1 257 ? 30.896  13.220 43.739  1.00 56.00  ? 258  PRO A CG   1 
ATOM   1981 C CD   . PRO A 1 257 ? 32.048  12.793 42.904  1.00 61.29  ? 258  PRO A CD   1 
ATOM   1982 N N    . GLY A 1 262 ? 26.153  16.295 37.619  1.00 80.55  ? 263  GLY A N    1 
ATOM   1983 C CA   . GLY A 1 262 ? 27.560  16.281 38.007  1.00 79.64  ? 263  GLY A CA   1 
ATOM   1984 C C    . GLY A 1 262 ? 28.118  17.688 38.210  1.00 76.21  ? 263  GLY A C    1 
ATOM   1985 O O    . GLY A 1 262 ? 29.209  17.974 37.720  1.00 66.88  ? 263  GLY A O    1 
ATOM   1986 N N    . GLY A 1 263 ? 27.371  18.553 38.914  1.00 79.32  ? 264  GLY A N    1 
ATOM   1987 C CA   . GLY A 1 263 ? 27.879  19.881 39.314  1.00 78.24  ? 264  GLY A CA   1 
ATOM   1988 C C    . GLY A 1 263 ? 26.954  20.854 40.086  1.00 69.04  ? 264  GLY A C    1 
ATOM   1989 O O    . GLY A 1 263 ? 26.095  21.513 39.504  1.00 79.06  ? 264  GLY A O    1 
ATOM   1990 N N    . ASN A 1 264 ? 27.134  20.916 41.402  1.00 55.82  ? 265  ASN A N    1 
ATOM   1991 C CA   . ASN A 1 264 ? 27.141  22.197 42.099  1.00 46.91  ? 265  ASN A CA   1 
ATOM   1992 C C    . ASN A 1 264 ? 28.631  22.502 41.998  1.00 41.82  ? 265  ASN A C    1 
ATOM   1993 O O    . ASN A 1 264 ? 29.452  21.664 42.396  1.00 40.70  ? 265  ASN A O    1 
ATOM   1994 C CB   . ASN A 1 264 ? 26.702  22.054 43.570  1.00 42.94  ? 265  ASN A CB   1 
ATOM   1995 C CG   . ASN A 1 264 ? 27.053  23.292 44.439  1.00 52.01  ? 265  ASN A CG   1 
ATOM   1996 O OD1  . ASN A 1 264 ? 28.148  23.860 44.342  1.00 49.73  ? 265  ASN A OD1  1 
ATOM   1997 N ND2  . ASN A 1 264 ? 26.121  23.689 45.305  1.00 49.65  ? 265  ASN A ND2  1 
ATOM   1998 N N    . ASP A 1 265 ? 28.993  23.655 41.438  1.00 34.02  ? 266  ASP A N    1 
ATOM   1999 C CA   . ASP A 1 265 ? 30.400  23.936 41.153  1.00 32.62  ? 266  ASP A CA   1 
ATOM   2000 C C    . ASP A 1 265 ? 31.266  24.006 42.418  1.00 36.34  ? 266  ASP A C    1 
ATOM   2001 O O    . ASP A 1 265 ? 32.392  23.521 42.430  1.00 34.72  ? 266  ASP A O    1 
ATOM   2002 C CB   . ASP A 1 265 ? 30.550  25.223 40.338  1.00 38.39  ? 266  ASP A CB   1 
ATOM   2003 C CG   . ASP A 1 265 ? 30.287  25.021 38.849  1.00 48.49  ? 266  ASP A CG   1 
ATOM   2004 O OD1  . ASP A 1 265 ? 30.344  23.862 38.376  1.00 53.33  ? 266  ASP A OD1  1 
ATOM   2005 O OD2  . ASP A 1 265 ? 30.035  26.037 38.151  1.00 46.06  ? 266  ASP A OD2  1 
ATOM   2006 N N    . THR A 1 266 ? 30.744  24.621 43.474  1.00 37.66  ? 267  THR A N    1 
ATOM   2007 C CA   . THR A 1 266 ? 31.445  24.660 44.753  1.00 33.60  ? 267  THR A CA   1 
ATOM   2008 C C    . THR A 1 266 ? 31.781  23.261 45.267  1.00 38.61  ? 267  THR A C    1 
ATOM   2009 O O    . THR A 1 266 ? 32.920  23.002 45.658  1.00 44.46  ? 267  THR A O    1 
ATOM   2010 C CB   . THR A 1 266 ? 30.624  25.410 45.825  1.00 36.77  ? 267  THR A CB   1 
ATOM   2011 O OG1  . THR A 1 266 ? 30.427  26.767 45.405  1.00 41.74  ? 267  THR A OG1  1 
ATOM   2012 C CG2  . THR A 1 266 ? 31.342  25.409 47.175  1.00 31.11  ? 267  THR A CG2  1 
ATOM   2013 N N    . GLU A 1 267 ? 30.797  22.360 45.266  1.00 38.56  ? 268  GLU A N    1 
ATOM   2014 C CA   . GLU A 1 267 ? 31.027  20.990 45.743  1.00 42.02  ? 268  GLU A CA   1 
ATOM   2015 C C    . GLU A 1 267 ? 32.048  20.247 44.874  1.00 38.07  ? 268  GLU A C    1 
ATOM   2016 O O    . GLU A 1 267 ? 32.944  19.571 45.380  1.00 36.15  ? 268  GLU A O    1 
ATOM   2017 C CB   . GLU A 1 267 ? 29.713  20.207 45.811  1.00 48.84  ? 268  GLU A CB   1 
ATOM   2018 C CG   . GLU A 1 267 ? 29.025  20.260 47.172  1.00 65.58  ? 268  GLU A CG   1 
ATOM   2019 C CD   . GLU A 1 267 ? 27.506  20.395 47.069  1.00 82.90  ? 268  GLU A CD   1 
ATOM   2020 O OE1  . GLU A 1 267 ? 26.850  19.480 46.524  1.00 87.18  ? 268  GLU A OE1  1 
ATOM   2021 O OE2  . GLU A 1 267 ? 26.966  21.427 47.530  1.00 89.07  ? 268  GLU A OE2  1 
ATOM   2022 N N    . LEU A 1 268 ? 31.913  20.391 43.563  1.00 32.81  ? 269  LEU A N    1 
ATOM   2023 C CA   . LEU A 1 268 ? 32.801  19.716 42.633  1.00 36.80  ? 269  LEU A CA   1 
ATOM   2024 C C    . LEU A 1 268 ? 34.258  20.174 42.821  1.00 38.11  ? 269  LEU A C    1 
ATOM   2025 O O    . LEU A 1 268 ? 35.164  19.348 42.972  1.00 41.19  ? 269  LEU A O    1 
ATOM   2026 C CB   . LEU A 1 268 ? 32.300  19.911 41.197  1.00 34.06  ? 269  LEU A CB   1 
ATOM   2027 C CG   . LEU A 1 268 ? 33.070  19.241 40.066  1.00 41.62  ? 269  LEU A CG   1 
ATOM   2028 C CD1  . LEU A 1 268 ? 32.200  19.089 38.843  1.00 39.40  ? 269  LEU A CD1  1 
ATOM   2029 C CD2  . LEU A 1 268 ? 34.263  20.089 39.721  1.00 47.79  ? 269  LEU A CD2  1 
ATOM   2030 N N    . VAL A 1 269 ? 34.486  21.482 42.859  1.00 35.20  ? 270  VAL A N    1 
ATOM   2031 C CA   . VAL A 1 269 ? 35.853  21.980 43.031  1.00 38.69  ? 270  VAL A CA   1 
ATOM   2032 C C    . VAL A 1 269 ? 36.403  21.592 44.402  1.00 39.07  ? 270  VAL A C    1 
ATOM   2033 O O    . VAL A 1 269 ? 37.569  21.216 44.524  1.00 41.81  ? 270  VAL A O    1 
ATOM   2034 C CB   . VAL A 1 269 ? 35.970  23.513 42.792  1.00 30.52  ? 270  VAL A CB   1 
ATOM   2035 C CG1  . VAL A 1 269 ? 37.358  24.019 43.159  1.00 26.55  ? 270  VAL A CG1  1 
ATOM   2036 C CG2  . VAL A 1 269 ? 35.659  23.851 41.333  1.00 27.04  ? 270  VAL A CG2  1 
ATOM   2037 N N    . ALA A 1 270 ? 35.567  21.671 45.433  1.00 32.69  ? 271  ALA A N    1 
ATOM   2038 C CA   . ALA A 1 270 ? 36.005  21.273 46.766  1.00 30.92  ? 271  ALA A CA   1 
ATOM   2039 C C    . ALA A 1 270 ? 36.462  19.813 46.769  1.00 33.81  ? 271  ALA A C    1 
ATOM   2040 O O    . ALA A 1 270 ? 37.469  19.473 47.390  1.00 39.91  ? 271  ALA A O    1 
ATOM   2041 C CB   . ALA A 1 270 ? 34.915  21.508 47.785  1.00 28.36  ? 271  ALA A CB   1 
ATOM   2042 N N    . CYS A 1 271 ? 35.736  18.957 46.051  1.00 36.39  ? 272  CYS A N    1 
ATOM   2043 C CA   . CYS A 1 271 ? 36.167  17.573 45.864  1.00 39.37  ? 272  CYS A CA   1 
ATOM   2044 C C    . CYS A 1 271 ? 37.505  17.493 45.083  1.00 42.09  ? 272  CYS A C    1 
ATOM   2045 O O    . CYS A 1 271 ? 38.424  16.782 45.499  1.00 47.40  ? 272  CYS A O    1 
ATOM   2046 C CB   . CYS A 1 271 ? 35.044  16.730 45.227  1.00 36.97  ? 272  CYS A CB   1 
ATOM   2047 S SG   . CYS A 1 271 ? 35.557  15.154 44.490  1.00 96.41  ? 272  CYS A SG   1 
ATOM   2048 N N    . LEU A 1 272 ? 37.629  18.238 43.983  1.00 33.54  ? 273  LEU A N    1 
ATOM   2049 C CA   . LEU A 1 272 ? 38.918  18.340 43.277  1.00 36.23  ? 273  LEU A CA   1 
ATOM   2050 C C    . LEU A 1 272 ? 40.063  18.803 44.179  1.00 38.47  ? 273  LEU A C    1 
ATOM   2051 O O    . LEU A 1 272 ? 41.196  18.336 44.036  1.00 35.30  ? 273  LEU A O    1 
ATOM   2052 C CB   . LEU A 1 272 ? 38.834  19.260 42.053  1.00 32.36  ? 273  LEU A CB   1 
ATOM   2053 C CG   . LEU A 1 272 ? 38.183  18.656 40.809  1.00 37.83  ? 273  LEU A CG   1 
ATOM   2054 C CD1  . LEU A 1 272 ? 38.045  19.691 39.719  1.00 36.38  ? 273  LEU A CD1  1 
ATOM   2055 C CD2  . LEU A 1 272 ? 38.998  17.486 40.306  1.00 38.18  ? 273  LEU A CD2  1 
ATOM   2056 N N    . ARG A 1 273 ? 39.781  19.715 45.105  1.00 35.37  ? 274  ARG A N    1 
ATOM   2057 C CA   . ARG A 1 273 ? 40.847  20.234 45.962  1.00 31.99  ? 274  ARG A CA   1 
ATOM   2058 C C    . ARG A 1 273 ? 41.442  19.152 46.850  1.00 33.07  ? 274  ARG A C    1 
ATOM   2059 O O    . ARG A 1 273 ? 42.597  19.255 47.257  1.00 36.14  ? 274  ARG A O    1 
ATOM   2060 C CB   . ARG A 1 273 ? 40.397  21.465 46.771  1.00 25.35  ? 274  ARG A CB   1 
ATOM   2061 C CG   . ARG A 1 273 ? 40.327  22.730 45.890  1.00 35.98  ? 274  ARG A CG   1 
ATOM   2062 C CD   . ARG A 1 273 ? 40.339  24.033 46.673  1.00 35.59  ? 274  ARG A CD   1 
ATOM   2063 N NE   . ARG A 1 273 ? 39.007  24.625 46.766  1.00 47.29  ? 274  ARG A NE   1 
ATOM   2064 C CZ   . ARG A 1 273 ? 38.575  25.654 46.039  1.00 47.42  ? 274  ARG A CZ   1 
ATOM   2065 N NH1  . ARG A 1 273 ? 39.363  26.237 45.148  1.00 40.41  ? 274  ARG A NH1  1 
ATOM   2066 N NH2  . ARG A 1 273 ? 37.343  26.111 46.210  1.00 55.67  ? 274  ARG A NH2  1 
ATOM   2067 N N    . THR A 1 274 ? 40.673  18.098 47.122  1.00 32.42  ? 275  THR A N    1 
ATOM   2068 C CA   . THR A 1 274 ? 41.167  17.006 47.972  1.00 32.47  ? 275  THR A CA   1 
ATOM   2069 C C    . THR A 1 274 ? 42.071  16.025 47.228  1.00 36.13  ? 275  THR A C    1 
ATOM   2070 O O    . THR A 1 274 ? 42.713  15.188 47.847  1.00 43.96  ? 275  THR A O    1 
ATOM   2071 C CB   . THR A 1 274 ? 40.018  16.220 48.650  1.00 28.26  ? 275  THR A CB   1 
ATOM   2072 O OG1  . THR A 1 274 ? 39.424  15.322 47.705  1.00 31.45  ? 275  THR A OG1  1 
ATOM   2073 C CG2  . THR A 1 274 ? 38.954  17.184 49.190  1.00 29.52  ? 275  THR A CG2  1 
ATOM   2074 N N    . ARG A 1 275 ? 42.122  16.125 45.904  1.00 35.34  ? 276  ARG A N    1 
ATOM   2075 C CA   . ARG A 1 275 ? 42.918  15.189 45.111  1.00 29.51  ? 276  ARG A CA   1 
ATOM   2076 C C    . ARG A 1 275 ? 44.392  15.565 45.109  1.00 33.01  ? 276  ARG A C    1 
ATOM   2077 O O    . ARG A 1 275 ? 44.740  16.729 44.904  1.00 36.78  ? 276  ARG A O    1 
ATOM   2078 C CB   . ARG A 1 275 ? 42.399  15.105 43.670  1.00 28.23  ? 276  ARG A CB   1 
ATOM   2079 C CG   . ARG A 1 275 ? 40.986  14.547 43.551  1.00 37.96  ? 276  ARG A CG   1 
ATOM   2080 C CD   . ARG A 1 275 ? 40.935  13.129 44.052  1.00 38.21  ? 276  ARG A CD   1 
ATOM   2081 N NE   . ARG A 1 275 ? 39.631  12.507 43.865  1.00 36.91  ? 276  ARG A NE   1 
ATOM   2082 C CZ   . ARG A 1 275 ? 38.648  12.557 44.759  1.00 43.38  ? 276  ARG A CZ   1 
ATOM   2083 N NH1  . ARG A 1 275 ? 38.816  13.230 45.890  1.00 45.40  ? 276  ARG A NH1  1 
ATOM   2084 N NH2  . ARG A 1 275 ? 37.495  11.945 44.521  1.00 41.91  ? 276  ARG A NH2  1 
ATOM   2085 N N    . PRO A 1 276 ? 45.262  14.572 45.348  1.00 34.14  ? 277  PRO A N    1 
ATOM   2086 C CA   . PRO A 1 276 ? 46.715  14.767 45.236  1.00 32.38  ? 277  PRO A CA   1 
ATOM   2087 C C    . PRO A 1 276 ? 47.023  15.369 43.870  1.00 34.89  ? 277  PRO A C    1 
ATOM   2088 O O    . PRO A 1 276 ? 46.399  14.966 42.885  1.00 33.58  ? 277  PRO A O    1 
ATOM   2089 C CB   . PRO A 1 276 ? 47.270  13.338 45.302  1.00 30.72  ? 277  PRO A CB   1 
ATOM   2090 C CG   . PRO A 1 276 ? 46.217  12.544 46.052  1.00 30.74  ? 277  PRO A CG   1 
ATOM   2091 C CD   . PRO A 1 276 ? 44.892  13.187 45.713  1.00 29.76  ? 277  PRO A CD   1 
ATOM   2092 N N    . ALA A 1 277 ? 47.952  16.317 43.815  1.00 29.59  ? 278  ALA A N    1 
ATOM   2093 C CA   . ALA A 1 277 ? 48.262  17.003 42.569  1.00 27.11  ? 278  ALA A CA   1 
ATOM   2094 C C    . ALA A 1 277 ? 48.537  16.021 41.443  1.00 28.36  ? 278  ALA A C    1 
ATOM   2095 O O    . ALA A 1 277 ? 48.037  16.188 40.326  1.00 26.86  ? 278  ALA A O    1 
ATOM   2096 C CB   . ALA A 1 277 ? 49.433  17.957 42.755  1.00 22.80  ? 278  ALA A CB   1 
ATOM   2097 N N    . GLN A 1 278 ? 49.314  14.988 41.754  1.00 31.04  ? 279  GLN A N    1 
ATOM   2098 C CA   . GLN A 1 278 ? 49.745  14.020 40.754  1.00 30.80  ? 279  GLN A CA   1 
ATOM   2099 C C    . GLN A 1 278 ? 48.552  13.284 40.151  1.00 33.22  ? 279  GLN A C    1 
ATOM   2100 O O    . GLN A 1 278 ? 48.568  12.933 38.971  1.00 35.14  ? 279  GLN A O    1 
ATOM   2101 C CB   . GLN A 1 278 ? 50.745  13.021 41.360  1.00 27.00  ? 279  GLN A CB   1 
ATOM   2102 C CG   . GLN A 1 278 ? 51.428  12.121 40.320  1.00 32.60  ? 279  GLN A CG   1 
ATOM   2103 C CD   . GLN A 1 278 ? 52.219  12.905 39.249  1.00 39.98  ? 279  GLN A CD   1 
ATOM   2104 O OE1  . GLN A 1 278 ? 53.068  13.746 39.568  1.00 43.09  ? 279  GLN A OE1  1 
ATOM   2105 N NE2  . GLN A 1 278 ? 51.935  12.624 37.975  1.00 34.70  ? 279  GLN A NE2  1 
ATOM   2106 N N    . VAL A 1 279 ? 47.513  13.059 40.951  1.00 25.24  ? 280  VAL A N    1 
ATOM   2107 C CA   . VAL A 1 279 ? 46.337  12.359 40.439  1.00 26.90  ? 280  VAL A CA   1 
ATOM   2108 C C    . VAL A 1 279 ? 45.672  13.168 39.325  1.00 36.08  ? 280  VAL A C    1 
ATOM   2109 O O    . VAL A 1 279 ? 45.273  12.609 38.299  1.00 42.32  ? 280  VAL A O    1 
ATOM   2110 C CB   . VAL A 1 279 ? 45.326  12.042 41.551  1.00 25.70  ? 280  VAL A CB   1 
ATOM   2111 C CG1  . VAL A 1 279 ? 44.056  11.492 40.964  1.00 32.40  ? 280  VAL A CG1  1 
ATOM   2112 C CG2  . VAL A 1 279 ? 45.916  11.046 42.554  1.00 29.00  ? 280  VAL A CG2  1 
ATOM   2113 N N    . LEU A 1 280 ? 45.559  14.483 39.515  1.00 32.09  ? 281  LEU A N    1 
ATOM   2114 C CA   . LEU A 1 280 ? 44.948  15.320 38.486  1.00 34.19  ? 281  LEU A CA   1 
ATOM   2115 C C    . LEU A 1 280 ? 45.795  15.268 37.223  1.00 30.27  ? 281  LEU A C    1 
ATOM   2116 O O    . LEU A 1 280 ? 45.270  15.108 36.123  1.00 34.68  ? 281  LEU A O    1 
ATOM   2117 C CB   . LEU A 1 280 ? 44.785  16.766 38.952  1.00 34.89  ? 281  LEU A CB   1 
ATOM   2118 C CG   . LEU A 1 280 ? 43.955  17.052 40.198  1.00 32.93  ? 281  LEU A CG   1 
ATOM   2119 C CD1  . LEU A 1 280 ? 43.888  18.549 40.422  1.00 35.72  ? 281  LEU A CD1  1 
ATOM   2120 C CD2  . LEU A 1 280 ? 42.564  16.489 40.058  1.00 31.76  ? 281  LEU A CD2  1 
ATOM   2121 N N    . VAL A 1 281 ? 47.109  15.388 37.395  1.00 31.61  ? 282  VAL A N    1 
ATOM   2122 C CA   . VAL A 1 281 ? 48.048  15.332 36.282  1.00 27.94  ? 282  VAL A CA   1 
ATOM   2123 C C    . VAL A 1 281 ? 47.937  14.023 35.491  1.00 30.08  ? 282  VAL A C    1 
ATOM   2124 O O    . VAL A 1 281 ? 47.944  14.041 34.264  1.00 34.09  ? 282  VAL A O    1 
ATOM   2125 C CB   . VAL A 1 281 ? 49.493  15.585 36.758  1.00 30.99  ? 282  VAL A CB   1 
ATOM   2126 C CG1  . VAL A 1 281 ? 50.494  15.135 35.712  1.00 28.98  ? 282  VAL A CG1  1 
ATOM   2127 C CG2  . VAL A 1 281 ? 49.689  17.068 37.052  1.00 29.12  ? 282  VAL A CG2  1 
ATOM   2128 N N    . ASN A 1 282 ? 47.812  12.897 36.188  1.00 29.11  ? 283  ASN A N    1 
ATOM   2129 C CA   . ASN A 1 282 ? 47.694  11.594 35.534  1.00 30.51  ? 283  ASN A CA   1 
ATOM   2130 C C    . ASN A 1 282 ? 46.516  11.468 34.571  1.00 35.25  ? 283  ASN A C    1 
ATOM   2131 O O    . ASN A 1 282 ? 46.525  10.601 33.703  1.00 36.19  ? 283  ASN A O    1 
ATOM   2132 C CB   . ASN A 1 282 ? 47.592  10.463 36.565  1.00 33.45  ? 283  ASN A CB   1 
ATOM   2133 C CG   . ASN A 1 282 ? 48.866  10.263 37.352  1.00 38.49  ? 283  ASN A CG   1 
ATOM   2134 O OD1  . ASN A 1 282 ? 49.957  10.661 36.928  1.00 35.67  ? 283  ASN A OD1  1 
ATOM   2135 N ND2  . ASN A 1 282 ? 48.735  9.632  38.518  1.00 44.14  ? 283  ASN A ND2  1 
ATOM   2136 N N    . HIS A 1 283 ? 45.496  12.308 34.726  1.00 33.05  ? 284  HIS A N    1 
ATOM   2137 C CA   . HIS A 1 283 ? 44.305  12.193 33.879  1.00 30.98  ? 284  HIS A CA   1 
ATOM   2138 C C    . HIS A 1 283 ? 44.127  13.352 32.890  1.00 36.47  ? 284  HIS A C    1 
ATOM   2139 O O    . HIS A 1 283 ? 43.217  13.316 32.059  1.00 36.41  ? 284  HIS A O    1 
ATOM   2140 C CB   . HIS A 1 283 ? 43.038  12.034 34.734  1.00 30.72  ? 284  HIS A CB   1 
ATOM   2141 C CG   . HIS A 1 283 ? 43.004  10.768 35.539  1.00 36.95  ? 284  HIS A CG   1 
ATOM   2142 N ND1  . HIS A 1 283 ? 43.453  10.699 36.840  1.00 46.59  ? 284  HIS A ND1  1 
ATOM   2143 C CD2  . HIS A 1 283 ? 42.576  9.522  35.220  1.00 35.31  ? 284  HIS A CD2  1 
ATOM   2144 C CE1  . HIS A 1 283 ? 43.304  9.464  37.290  1.00 45.91  ? 284  HIS A CE1  1 
ATOM   2145 N NE2  . HIS A 1 283 ? 42.775  8.732  36.327  1.00 42.55  ? 284  HIS A NE2  1 
ATOM   2146 N N    . GLU A 1 284 ? 45.000  14.358 32.975  1.00 32.58  ? 285  GLU A N    1 
ATOM   2147 C CA   . GLU A 1 284 ? 44.886  15.582 32.167  1.00 36.05  ? 285  GLU A CA   1 
ATOM   2148 C C    . GLU A 1 284 ? 44.684  15.354 30.669  1.00 35.91  ? 285  GLU A C    1 
ATOM   2149 O O    . GLU A 1 284 ? 43.820  15.975 30.047  1.00 39.51  ? 285  GLU A O    1 
ATOM   2150 C CB   . GLU A 1 284 ? 46.099  16.498 32.382  1.00 43.26  ? 285  GLU A CB   1 
ATOM   2151 C CG   . GLU A 1 284 ? 45.861  17.628 33.392  1.00 57.62  ? 285  GLU A CG   1 
ATOM   2152 C CD   . GLU A 1 284 ? 47.083  18.547 33.584  1.00 62.17  ? 285  GLU A CD   1 
ATOM   2153 O OE1  . GLU A 1 284 ? 47.971  18.583 32.684  1.00 56.58  ? 285  GLU A OE1  1 
ATOM   2154 O OE2  . GLU A 1 284 ? 47.140  19.228 34.645  1.00 54.20  ? 285  GLU A OE2  1 
ATOM   2155 N N    . TRP A 1 285 ? 45.478  14.469 30.087  1.00 35.79  ? 286  TRP A N    1 
ATOM   2156 C CA   . TRP A 1 285 ? 45.426  14.271 28.644  1.00 45.21  ? 286  TRP A CA   1 
ATOM   2157 C C    . TRP A 1 285 ? 44.148  13.575 28.163  1.00 48.74  ? 286  TRP A C    1 
ATOM   2158 O O    . TRP A 1 285 ? 43.710  13.784 27.031  1.00 49.57  ? 286  TRP A O    1 
ATOM   2159 C CB   . TRP A 1 285 ? 46.684  13.543 28.158  1.00 47.90  ? 286  TRP A CB   1 
ATOM   2160 C CG   . TRP A 1 285 ? 47.936  14.400 28.255  1.00 51.33  ? 286  TRP A CG   1 
ATOM   2161 C CD1  . TRP A 1 285 ? 48.937  14.303 29.189  1.00 48.85  ? 286  TRP A CD1  1 
ATOM   2162 C CD2  . TRP A 1 285 ? 48.309  15.482 27.382  1.00 47.48  ? 286  TRP A CD2  1 
ATOM   2163 N NE1  . TRP A 1 285 ? 49.908  15.253 28.944  1.00 45.66  ? 286  TRP A NE1  1 
ATOM   2164 C CE2  . TRP A 1 285 ? 49.548  15.986 27.844  1.00 41.38  ? 286  TRP A CE2  1 
ATOM   2165 C CE3  . TRP A 1 285 ? 47.715  16.073 26.260  1.00 44.58  ? 286  TRP A CE3  1 
ATOM   2166 C CZ2  . TRP A 1 285 ? 50.198  17.053 27.223  1.00 36.12  ? 286  TRP A CZ2  1 
ATOM   2167 C CZ3  . TRP A 1 285 ? 48.365  17.131 25.642  1.00 41.66  ? 286  TRP A CZ3  1 
ATOM   2168 C CH2  . TRP A 1 285 ? 49.598  17.607 26.125  1.00 37.18  ? 286  TRP A CH2  1 
ATOM   2169 N N    . HIS A 1 286 ? 43.528  12.786 29.033  1.00 47.25  ? 287  HIS A N    1 
ATOM   2170 C CA   . HIS A 1 286 ? 42.360  11.998 28.645  1.00 50.69  ? 287  HIS A CA   1 
ATOM   2171 C C    . HIS A 1 286 ? 41.031  12.761 28.621  1.00 50.56  ? 287  HIS A C    1 
ATOM   2172 O O    . HIS A 1 286 ? 39.975  12.147 28.516  1.00 60.93  ? 287  HIS A O    1 
ATOM   2173 C CB   . HIS A 1 286 ? 42.259  10.740 29.515  1.00 59.06  ? 287  HIS A CB   1 
ATOM   2174 C CG   . HIS A 1 286 ? 43.515  9.918  29.516  1.00 77.02  ? 287  HIS A CG   1 
ATOM   2175 N ND1  . HIS A 1 286 ? 44.544  10.123 30.413  1.00 81.87  ? 287  HIS A ND1  1 
ATOM   2176 C CD2  . HIS A 1 286 ? 43.917  8.906  28.710  1.00 82.05  ? 287  HIS A CD2  1 
ATOM   2177 C CE1  . HIS A 1 286 ? 45.518  9.263  30.169  1.00 81.88  ? 287  HIS A CE1  1 
ATOM   2178 N NE2  . HIS A 1 286 ? 45.163  8.515  29.140  1.00 83.42  ? 287  HIS A NE2  1 
ATOM   2179 N N    . VAL A 1 287 ? 41.074  14.091 28.692  1.00 39.79  ? 288  VAL A N    1 
ATOM   2180 C CA   . VAL A 1 287 ? 39.834  14.868 28.592  1.00 43.26  ? 288  VAL A CA   1 
ATOM   2181 C C    . VAL A 1 287 ? 39.657  15.518 27.221  1.00 48.08  ? 288  VAL A C    1 
ATOM   2182 O O    . VAL A 1 287 ? 38.617  16.120 26.939  1.00 52.33  ? 288  VAL A O    1 
ATOM   2183 C CB   . VAL A 1 287 ? 39.688  15.937 29.721  1.00 38.44  ? 288  VAL A CB   1 
ATOM   2184 C CG1  . VAL A 1 287 ? 39.986  15.330 31.085  1.00 39.70  ? 288  VAL A CG1  1 
ATOM   2185 C CG2  . VAL A 1 287 ? 40.584  17.126 29.468  1.00 29.83  ? 288  VAL A CG2  1 
ATOM   2186 N N    . LEU A 1 288 ? 40.671  15.399 26.369  1.00 46.51  ? 289  LEU A N    1 
ATOM   2187 C CA   . LEU A 1 288 ? 40.586  15.970 25.031  1.00 47.23  ? 289  LEU A CA   1 
ATOM   2188 C C    . LEU A 1 288 ? 39.623  15.171 24.166  1.00 50.74  ? 289  LEU A C    1 
ATOM   2189 O O    . LEU A 1 288 ? 39.573  13.938 24.250  1.00 47.96  ? 289  LEU A O    1 
ATOM   2190 C CB   . LEU A 1 288 ? 41.964  16.070 24.367  1.00 43.51  ? 289  LEU A CB   1 
ATOM   2191 C CG   . LEU A 1 288 ? 42.760  17.331 24.718  1.00 45.33  ? 289  LEU A CG   1 
ATOM   2192 C CD1  . LEU A 1 288 ? 44.182  17.292 24.151  1.00 50.13  ? 289  LEU A CD1  1 
ATOM   2193 C CD2  . LEU A 1 288 ? 42.032  18.573 24.238  1.00 38.56  ? 289  LEU A CD2  1 
ATOM   2194 N N    . PRO A 1 289 ? 38.855  15.885 23.326  1.00 59.31  ? 290  PRO A N    1 
ATOM   2195 C CA   . PRO A 1 289 ? 37.774  15.369 22.471  1.00 63.85  ? 290  PRO A CA   1 
ATOM   2196 C C    . PRO A 1 289 ? 38.227  14.318 21.451  1.00 67.92  ? 290  PRO A C    1 
ATOM   2197 O O    . PRO A 1 289 ? 37.436  13.431 21.120  1.00 72.07  ? 290  PRO A O    1 
ATOM   2198 C CB   . PRO A 1 289 ? 37.258  16.627 21.757  1.00 62.32  ? 290  PRO A CB   1 
ATOM   2199 C CG   . PRO A 1 289 ? 38.389  17.609 21.825  1.00 58.70  ? 290  PRO A CG   1 
ATOM   2200 C CD   . PRO A 1 289 ? 39.067  17.333 23.137  1.00 56.84  ? 290  PRO A CD   1 
ATOM   2201 N N    . GLN A 1 290 ? 39.462  14.422 20.962  1.00 65.63  ? 291  GLN A N    1 
ATOM   2202 C CA   . GLN A 1 290 ? 40.026  13.415 20.058  1.00 67.06  ? 291  GLN A CA   1 
ATOM   2203 C C    . GLN A 1 290 ? 41.550  13.365 20.156  1.00 62.39  ? 291  GLN A C    1 
ATOM   2204 O O    . GLN A 1 290 ? 42.189  14.301 20.655  1.00 55.31  ? 291  GLN A O    1 
ATOM   2205 C CB   . GLN A 1 290 ? 39.630  13.695 18.601  1.00 67.86  ? 291  GLN A CB   1 
ATOM   2206 C CG   . GLN A 1 290 ? 40.225  14.990 18.036  1.00 71.81  ? 291  GLN A CG   1 
ATOM   2207 C CD   . GLN A 1 290 ? 40.374  14.988 16.514  1.00 76.31  ? 291  GLN A CD   1 
ATOM   2208 O OE1  . GLN A 1 290 ? 39.490  15.455 15.792  1.00 77.89  ? 291  GLN A OE1  1 
ATOM   2209 N NE2  . GLN A 1 290 ? 41.505  14.479 16.024  1.00 75.09  ? 291  GLN A NE2  1 
ATOM   2210 N N    . GLU A 1 291 ? 42.122  12.264 19.674  1.00 62.00  ? 292  GLU A N    1 
ATOM   2211 C CA   . GLU A 1 291 ? 43.563  12.165 19.482  1.00 65.27  ? 292  GLU A CA   1 
ATOM   2212 C C    . GLU A 1 291 ? 44.025  13.275 18.531  1.00 60.32  ? 292  GLU A C    1 
ATOM   2213 O O    . GLU A 1 291 ? 43.395  13.533 17.501  1.00 60.17  ? 292  GLU A O    1 
ATOM   2214 C CB   . GLU A 1 291 ? 43.921  10.798 18.899  1.00 73.87  ? 292  GLU A CB   1 
ATOM   2215 C CG   . GLU A 1 291 ? 45.312  10.735 18.285  1.00 84.31  ? 292  GLU A CG   1 
ATOM   2216 C CD   . GLU A 1 291 ? 45.431  9.669  17.207  1.00 92.50  ? 292  GLU A CD   1 
ATOM   2217 O OE1  . GLU A 1 291 ? 44.390  9.087  16.822  1.00 94.24  ? 292  GLU A OE1  1 
ATOM   2218 O OE2  . GLU A 1 291 ? 46.567  9.420  16.744  1.00 93.71  ? 292  GLU A OE2  1 
ATOM   2219 N N    . SER A 1 292 ? 45.121  13.937 18.877  1.00 54.49  ? 293  SER A N    1 
ATOM   2220 C CA   . SER A 1 292 ? 45.617  15.032 18.054  1.00 47.66  ? 293  SER A CA   1 
ATOM   2221 C C    . SER A 1 292 ? 47.054  15.400 18.394  1.00 39.03  ? 293  SER A C    1 
ATOM   2222 O O    . SER A 1 292 ? 47.631  14.893 19.361  1.00 42.11  ? 293  SER A O    1 
ATOM   2223 C CB   . SER A 1 292 ? 44.727  16.259 18.244  1.00 45.40  ? 293  SER A CB   1 
ATOM   2224 O OG   . SER A 1 292 ? 44.700  16.654 19.603  1.00 47.22  ? 293  SER A OG   1 
ATOM   2225 N N    . VAL A 1 293 ? 47.627  16.289 17.593  1.00 33.54  ? 294  VAL A N    1 
ATOM   2226 C CA   . VAL A 1 293 ? 48.854  16.978 17.982  1.00 33.64  ? 294  VAL A CA   1 
ATOM   2227 C C    . VAL A 1 293 ? 48.563  18.481 18.091  1.00 39.07  ? 294  VAL A C    1 
ATOM   2228 O O    . VAL A 1 293 ? 47.659  19.001 17.421  1.00 35.83  ? 294  VAL A O    1 
ATOM   2229 C CB   . VAL A 1 293 ? 50.021  16.717 16.994  1.00 35.14  ? 294  VAL A CB   1 
ATOM   2230 C CG1  . VAL A 1 293 ? 50.349  15.222 16.926  1.00 33.80  ? 294  VAL A CG1  1 
ATOM   2231 C CG2  . VAL A 1 293 ? 49.682  17.257 15.609  1.00 32.73  ? 294  VAL A CG2  1 
ATOM   2232 N N    . PHE A 1 294 ? 49.310  19.161 18.958  1.00 33.06  ? 295  PHE A N    1 
ATOM   2233 C CA   . PHE A 1 294 ? 49.189  20.601 19.138  1.00 28.60  ? 295  PHE A CA   1 
ATOM   2234 C C    . PHE A 1 294 ? 47.825  21.009 19.712  1.00 29.89  ? 295  PHE A C    1 
ATOM   2235 O O    . PHE A 1 294 ? 47.310  22.086 19.399  1.00 37.60  ? 295  PHE A O    1 
ATOM   2236 C CB   . PHE A 1 294 ? 49.492  21.326 17.812  1.00 31.95  ? 295  PHE A CB   1 
ATOM   2237 C CG   . PHE A 1 294 ? 50.406  22.523 17.956  1.00 30.48  ? 295  PHE A CG   1 
ATOM   2238 C CD1  . PHE A 1 294 ? 50.180  23.475 18.946  1.00 29.07  ? 295  PHE A CD1  1 
ATOM   2239 C CD2  . PHE A 1 294 ? 51.479  22.705 17.090  1.00 29.92  ? 295  PHE A CD2  1 
ATOM   2240 C CE1  . PHE A 1 294 ? 51.011  24.589 19.079  1.00 31.84  ? 295  PHE A CE1  1 
ATOM   2241 C CE2  . PHE A 1 294 ? 52.319  23.816 17.213  1.00 30.66  ? 295  PHE A CE2  1 
ATOM   2242 C CZ   . PHE A 1 294 ? 52.087  24.759 18.213  1.00 28.78  ? 295  PHE A CZ   1 
ATOM   2243 N N    . ARG A 1 295 ? 47.247  20.140 20.546  1.00 25.88  ? 296  ARG A N    1 
ATOM   2244 C CA   . ARG A 1 295 ? 46.046  20.471 21.326  1.00 27.82  ? 296  ARG A CA   1 
ATOM   2245 C C    . ARG A 1 295 ? 46.265  20.168 22.809  1.00 32.65  ? 296  ARG A C    1 
ATOM   2246 O O    . ARG A 1 295 ? 46.759  19.099 23.170  1.00 36.51  ? 296  ARG A O    1 
ATOM   2247 C CB   . ARG A 1 295 ? 44.812  19.724 20.821  1.00 30.64  ? 296  ARG A CB   1 
ATOM   2248 C CG   . ARG A 1 295 ? 44.275  20.230 19.496  1.00 39.71  ? 296  ARG A CG   1 
ATOM   2249 C CD   . ARG A 1 295 ? 44.019  21.743 19.512  1.00 40.23  ? 296  ARG A CD   1 
ATOM   2250 N NE   . ARG A 1 295 ? 43.402  22.171 18.259  1.00 40.82  ? 296  ARG A NE   1 
ATOM   2251 C CZ   . ARG A 1 295 ? 44.077  22.572 17.180  1.00 49.68  ? 296  ARG A CZ   1 
ATOM   2252 N NH1  . ARG A 1 295 ? 45.406  22.626 17.192  1.00 40.99  ? 296  ARG A NH1  1 
ATOM   2253 N NH2  . ARG A 1 295 ? 43.420  22.929 16.083  1.00 59.52  ? 296  ARG A NH2  1 
ATOM   2254 N N    . PHE A 1 296 ? 45.900  21.112 23.668  1.00 25.84  ? 297  PHE A N    1 
ATOM   2255 C CA   . PHE A 1 296 ? 46.204  20.980 25.091  1.00 26.63  ? 297  PHE A CA   1 
ATOM   2256 C C    . PHE A 1 296 ? 44.925  21.112 25.917  1.00 30.06  ? 297  PHE A C    1 
ATOM   2257 O O    . PHE A 1 296 ? 44.072  21.949 25.627  1.00 33.77  ? 297  PHE A O    1 
ATOM   2258 C CB   . PHE A 1 296 ? 47.269  22.013 25.485  1.00 24.74  ? 297  PHE A CB   1 
ATOM   2259 C CG   . PHE A 1 296 ? 48.346  22.186 24.437  1.00 29.52  ? 297  PHE A CG   1 
ATOM   2260 C CD1  . PHE A 1 296 ? 49.271  21.181 24.197  1.00 31.60  ? 297  PHE A CD1  1 
ATOM   2261 C CD2  . PHE A 1 296 ? 48.408  23.333 23.669  1.00 28.61  ? 297  PHE A CD2  1 
ATOM   2262 C CE1  . PHE A 1 296 ? 50.251  21.330 23.216  1.00 29.87  ? 297  PHE A CE1  1 
ATOM   2263 C CE2  . PHE A 1 296 ? 49.377  23.486 22.700  1.00 26.42  ? 297  PHE A CE2  1 
ATOM   2264 C CZ   . PHE A 1 296 ? 50.300  22.480 22.472  1.00 30.17  ? 297  PHE A CZ   1 
ATOM   2265 N N    . SER A 1 297 ? 44.780  20.260 26.921  1.00 32.02  ? 298  SER A N    1 
ATOM   2266 C CA   . SER A 1 297 ? 43.514  20.140 27.623  1.00 33.82  ? 298  SER A CA   1 
ATOM   2267 C C    . SER A 1 297 ? 43.075  21.448 28.263  1.00 31.19  ? 298  SER A C    1 
ATOM   2268 O O    . SER A 1 297 ? 41.941  21.882 28.090  1.00 26.15  ? 298  SER A O    1 
ATOM   2269 C CB   . SER A 1 297 ? 43.594  19.030 28.670  1.00 38.73  ? 298  SER A CB   1 
ATOM   2270 O OG   . SER A 1 297 ? 43.778  17.768 28.053  1.00 43.69  ? 298  SER A OG   1 
ATOM   2271 N N    . PHE A 1 298 ? 43.984  22.075 28.997  1.00 26.66  ? 299  PHE A N    1 
ATOM   2272 C CA   . PHE A 1 298 ? 43.635  23.228 29.808  1.00 25.31  ? 299  PHE A CA   1 
ATOM   2273 C C    . PHE A 1 298 ? 44.425  24.462 29.406  1.00 30.45  ? 299  PHE A C    1 
ATOM   2274 O O    . PHE A 1 298 ? 45.631  24.567 29.667  1.00 30.99  ? 299  PHE A O    1 
ATOM   2275 C CB   . PHE A 1 298 ? 43.840  22.896 31.292  1.00 29.63  ? 299  PHE A CB   1 
ATOM   2276 C CG   . PHE A 1 298 ? 42.932  21.811 31.780  1.00 32.67  ? 299  PHE A CG   1 
ATOM   2277 C CD1  . PHE A 1 298 ? 41.582  22.067 31.970  1.00 22.22  ? 299  PHE A CD1  1 
ATOM   2278 C CD2  . PHE A 1 298 ? 43.410  20.528 32.015  1.00 21.95  ? 299  PHE A CD2  1 
ATOM   2279 C CE1  . PHE A 1 298 ? 40.720  21.065 32.402  1.00 29.05  ? 299  PHE A CE1  1 
ATOM   2280 C CE2  . PHE A 1 298 ? 42.552  19.520 32.448  1.00 25.50  ? 299  PHE A CE2  1 
ATOM   2281 C CZ   . PHE A 1 298 ? 41.210  19.789 32.641  1.00 30.79  ? 299  PHE A CZ   1 
ATOM   2282 N N    . VAL A 1 299 ? 43.725  25.395 28.773  1.00 29.17  ? 300  VAL A N    1 
ATOM   2283 C CA   . VAL A 1 299 ? 44.349  26.581 28.214  1.00 22.58  ? 300  VAL A CA   1 
ATOM   2284 C C    . VAL A 1 299 ? 43.469  27.783 28.543  1.00 27.81  ? 300  VAL A C    1 
ATOM   2285 O O    . VAL A 1 299 ? 42.369  27.616 29.089  1.00 26.77  ? 300  VAL A O    1 
ATOM   2286 C CB   . VAL A 1 299 ? 44.517  26.440 26.684  1.00 22.67  ? 300  VAL A CB   1 
ATOM   2287 C CG1  . VAL A 1 299 ? 45.300  25.165 26.346  1.00 20.65  ? 300  VAL A CG1  1 
ATOM   2288 C CG2  . VAL A 1 299 ? 43.145  26.406 26.003  1.00 21.48  ? 300  VAL A CG2  1 
ATOM   2289 N N    . PRO A 1 300 ? 43.947  28.997 28.225  1.00 24.51  ? 301  PRO A N    1 
ATOM   2290 C CA   . PRO A 1 300 ? 43.158  30.203 28.490  1.00 24.60  ? 301  PRO A CA   1 
ATOM   2291 C C    . PRO A 1 300 ? 41.723  30.122 27.940  1.00 29.53  ? 301  PRO A C    1 
ATOM   2292 O O    . PRO A 1 300 ? 41.488  29.623 26.831  1.00 30.16  ? 301  PRO A O    1 
ATOM   2293 C CB   . PRO A 1 300 ? 43.959  31.287 27.770  1.00 21.39  ? 301  PRO A CB   1 
ATOM   2294 C CG   . PRO A 1 300 ? 45.383  30.817 27.922  1.00 20.43  ? 301  PRO A CG   1 
ATOM   2295 C CD   . PRO A 1 300 ? 45.303  29.321 27.737  1.00 20.73  ? 301  PRO A CD   1 
ATOM   2296 N N    . VAL A 1 301 ? 40.768  30.610 28.725  1.00 26.95  ? 302  VAL A N    1 
ATOM   2297 C CA   . VAL A 1 301 ? 39.363  30.552 28.347  1.00 26.93  ? 302  VAL A CA   1 
ATOM   2298 C C    . VAL A 1 301 ? 38.836  31.949 28.019  1.00 29.45  ? 302  VAL A C    1 
ATOM   2299 O O    . VAL A 1 301 ? 39.119  32.914 28.740  1.00 31.11  ? 302  VAL A O    1 
ATOM   2300 C CB   . VAL A 1 301 ? 38.512  29.901 29.466  1.00 24.01  ? 302  VAL A CB   1 
ATOM   2301 C CG1  . VAL A 1 301 ? 38.669  30.670 30.780  1.00 24.42  ? 302  VAL A CG1  1 
ATOM   2302 C CG2  . VAL A 1 301 ? 37.055  29.844 29.064  1.00 25.01  ? 302  VAL A CG2  1 
ATOM   2303 N N    . VAL A 1 302 ? 38.085  32.054 26.923  1.00 29.20  ? 303  VAL A N    1 
ATOM   2304 C CA   . VAL A 1 302 ? 37.451  33.312 26.541  1.00 25.83  ? 303  VAL A CA   1 
ATOM   2305 C C    . VAL A 1 302 ? 36.111  33.459 27.249  1.00 36.89  ? 303  VAL A C    1 
ATOM   2306 O O    . VAL A 1 302 ? 35.101  32.895 26.812  1.00 38.70  ? 303  VAL A O    1 
ATOM   2307 C CB   . VAL A 1 302 ? 37.236  33.406 25.026  1.00 32.33  ? 303  VAL A CB   1 
ATOM   2308 C CG1  . VAL A 1 302 ? 36.472  34.684 24.677  1.00 28.16  ? 303  VAL A CG1  1 
ATOM   2309 C CG2  . VAL A 1 302 ? 38.575  33.366 24.313  1.00 27.39  ? 303  VAL A CG2  1 
ATOM   2310 N N    . ASP A 1 303 ? 36.105  34.233 28.333  1.00 35.83  ? 304  ASP A N    1 
ATOM   2311 C CA   . ASP A 1 303 ? 34.946  34.307 29.229  1.00 38.76  ? 304  ASP A CA   1 
ATOM   2312 C C    . ASP A 1 303 ? 34.420  35.724 29.485  1.00 40.01  ? 304  ASP A C    1 
ATOM   2313 O O    . ASP A 1 303 ? 33.527  35.909 30.310  1.00 47.51  ? 304  ASP A O    1 
ATOM   2314 C CB   . ASP A 1 303 ? 35.300  33.680 30.576  1.00 40.51  ? 304  ASP A CB   1 
ATOM   2315 C CG   . ASP A 1 303 ? 36.414  34.432 31.289  1.00 46.54  ? 304  ASP A CG   1 
ATOM   2316 O OD1  . ASP A 1 303 ? 37.225  35.120 30.615  1.00 49.47  ? 304  ASP A OD1  1 
ATOM   2317 O OD2  . ASP A 1 303 ? 36.489  34.322 32.529  1.00 59.12  ? 304  ASP A OD2  1 
ATOM   2318 N N    . GLY A 1 304 ? 34.977  36.722 28.805  1.00 35.17  ? 305  GLY A N    1 
ATOM   2319 C CA   . GLY A 1 304 ? 34.508  38.086 28.981  1.00 39.37  ? 305  GLY A CA   1 
ATOM   2320 C C    . GLY A 1 304 ? 35.374  38.886 29.934  1.00 45.54  ? 305  GLY A C    1 
ATOM   2321 O O    . GLY A 1 304 ? 35.391  40.120 29.890  1.00 51.88  ? 305  GLY A O    1 
ATOM   2322 N N    . ASP A 1 305 ? 36.118  38.183 30.780  1.00 35.42  ? 306  ASP A N    1 
ATOM   2323 C CA   . ASP A 1 305 ? 36.881  38.843 31.830  1.00 43.68  ? 306  ASP A CA   1 
ATOM   2324 C C    . ASP A 1 305 ? 38.314  39.182 31.385  1.00 41.30  ? 306  ASP A C    1 
ATOM   2325 O O    . ASP A 1 305 ? 38.569  40.293 30.909  1.00 41.75  ? 306  ASP A O    1 
ATOM   2326 C CB   . ASP A 1 305 ? 36.872  37.988 33.103  1.00 44.50  ? 306  ASP A CB   1 
ATOM   2327 C CG   . ASP A 1 305 ? 37.464  38.710 34.293  1.00 51.26  ? 306  ASP A CG   1 
ATOM   2328 O OD1  . ASP A 1 305 ? 37.518  39.960 34.270  1.00 54.66  ? 306  ASP A OD1  1 
ATOM   2329 O OD2  . ASP A 1 305 ? 37.870  38.023 35.252  1.00 54.77  ? 306  ASP A OD2  1 
ATOM   2330 N N    . PHE A 1 306 ? 39.244  38.240 31.539  1.00 31.65  ? 307  PHE A N    1 
ATOM   2331 C CA   . PHE A 1 306 ? 40.599  38.477 31.062  1.00 32.50  ? 307  PHE A CA   1 
ATOM   2332 C C    . PHE A 1 306 ? 40.563  38.880 29.588  1.00 33.58  ? 307  PHE A C    1 
ATOM   2333 O O    . PHE A 1 306 ? 41.119  39.910 29.208  1.00 34.40  ? 307  PHE A O    1 
ATOM   2334 C CB   . PHE A 1 306 ? 41.503  37.258 31.269  1.00 24.73  ? 307  PHE A CB   1 
ATOM   2335 C CG   . PHE A 1 306 ? 42.967  37.599 31.262  1.00 31.39  ? 307  PHE A CG   1 
ATOM   2336 C CD1  . PHE A 1 306 ? 43.636  37.824 30.062  1.00 30.73  ? 307  PHE A CD1  1 
ATOM   2337 C CD2  . PHE A 1 306 ? 43.669  37.736 32.452  1.00 31.49  ? 307  PHE A CD2  1 
ATOM   2338 C CE1  . PHE A 1 306 ? 44.989  38.160 30.048  1.00 24.16  ? 307  PHE A CE1  1 
ATOM   2339 C CE2  . PHE A 1 306 ? 45.019  38.065 32.450  1.00 30.84  ? 307  PHE A CE2  1 
ATOM   2340 C CZ   . PHE A 1 306 ? 45.682  38.283 31.242  1.00 24.79  ? 307  PHE A CZ   1 
ATOM   2341 N N    . LEU A 1 307 ? 39.882  38.075 28.774  1.00 34.40  ? 308  LEU A N    1 
ATOM   2342 C CA   . LEU A 1 307 ? 39.647  38.398 27.365  1.00 30.85  ? 308  LEU A CA   1 
ATOM   2343 C C    . LEU A 1 307 ? 38.171  38.723 27.151  1.00 36.10  ? 308  LEU A C    1 
ATOM   2344 O O    . LEU A 1 307 ? 37.318  37.851 27.327  1.00 36.26  ? 308  LEU A O    1 
ATOM   2345 C CB   . LEU A 1 307 ? 40.032  37.211 26.484  1.00 32.02  ? 308  LEU A CB   1 
ATOM   2346 C CG   . LEU A 1 307 ? 41.500  36.782 26.507  1.00 34.06  ? 308  LEU A CG   1 
ATOM   2347 C CD1  . LEU A 1 307 ? 41.678  35.455 25.775  1.00 33.82  ? 308  LEU A CD1  1 
ATOM   2348 C CD2  . LEU A 1 307 ? 42.398  37.872 25.908  1.00 31.71  ? 308  LEU A CD2  1 
ATOM   2349 N N    . SER A 1 308 ? 37.865  39.963 26.771  1.00 36.15  ? 309  SER A N    1 
ATOM   2350 C CA   . SER A 1 308 ? 36.471  40.371 26.597  1.00 41.84  ? 309  SER A CA   1 
ATOM   2351 C C    . SER A 1 308 ? 35.842  39.762 25.343  1.00 39.68  ? 309  SER A C    1 
ATOM   2352 O O    . SER A 1 308 ? 34.629  39.800 25.170  1.00 47.85  ? 309  SER A O    1 
ATOM   2353 C CB   . SER A 1 308 ? 36.345  41.897 26.573  1.00 45.51  ? 309  SER A CB   1 
ATOM   2354 O OG   . SER A 1 308 ? 37.046  42.461 25.480  1.00 52.42  ? 309  SER A OG   1 
ATOM   2355 N N    . ASP A 1 309 ? 36.680  39.195 24.482  1.00 40.29  ? 310  ASP A N    1 
ATOM   2356 C CA   . ASP A 1 309 ? 36.247  38.599 23.222  1.00 42.43  ? 310  ASP A CA   1 
ATOM   2357 C C    . ASP A 1 309 ? 37.380  37.685 22.753  1.00 40.02  ? 310  ASP A C    1 
ATOM   2358 O O    . ASP A 1 309 ? 38.416  37.598 23.418  1.00 40.61  ? 310  ASP A O    1 
ATOM   2359 C CB   . ASP A 1 309 ? 35.980  39.693 22.186  1.00 43.50  ? 310  ASP A CB   1 
ATOM   2360 C CG   . ASP A 1 309 ? 34.945  39.285 21.140  1.00 53.15  ? 310  ASP A CG   1 
ATOM   2361 O OD1  . ASP A 1 309 ? 34.823  38.080 20.819  1.00 52.41  ? 310  ASP A OD1  1 
ATOM   2362 O OD2  . ASP A 1 309 ? 34.249  40.188 20.629  1.00 62.36  ? 310  ASP A OD2  1 
ATOM   2363 N N    . THR A 1 310 ? 37.193  36.998 21.627  1.00 34.37  ? 311  THR A N    1 
ATOM   2364 C CA   . THR A 1 310 ? 38.244  36.134 21.099  1.00 35.40  ? 311  THR A CA   1 
ATOM   2365 C C    . THR A 1 310 ? 39.421  37.005 20.705  1.00 35.26  ? 311  THR A C    1 
ATOM   2366 O O    . THR A 1 310 ? 39.244  38.169 20.335  1.00 37.78  ? 311  THR A O    1 
ATOM   2367 C CB   . THR A 1 310 ? 37.792  35.341 19.859  1.00 35.59  ? 311  THR A CB   1 
ATOM   2368 O OG1  . THR A 1 310 ? 37.784  36.208 18.716  1.00 41.46  ? 311  THR A OG1  1 
ATOM   2369 C CG2  . THR A 1 310 ? 36.403  34.767 20.074  1.00 30.97  ? 311  THR A CG2  1 
ATOM   2370 N N    . PRO A 1 311 ? 40.628  36.443 20.791  1.00 31.88  ? 312  PRO A N    1 
ATOM   2371 C CA   . PRO A 1 311 ? 41.828  37.191 20.423  1.00 33.01  ? 312  PRO A CA   1 
ATOM   2372 C C    . PRO A 1 311 ? 41.764  37.684 18.978  1.00 40.05  ? 312  PRO A C    1 
ATOM   2373 O O    . PRO A 1 311 ? 42.292  38.755 18.673  1.00 43.75  ? 312  PRO A O    1 
ATOM   2374 C CB   . PRO A 1 311 ? 42.946  36.164 20.608  1.00 31.75  ? 312  PRO A CB   1 
ATOM   2375 C CG   . PRO A 1 311 ? 42.413  35.215 21.652  1.00 31.93  ? 312  PRO A CG   1 
ATOM   2376 C CD   . PRO A 1 311 ? 40.940  35.117 21.360  1.00 33.34  ? 312  PRO A CD   1 
ATOM   2377 N N    A GLU A 1 312 ? 41.129  36.902 18.111  0.61 41.39  ? 313  GLU A N    1 
ATOM   2378 N N    B GLU A 1 312 ? 41.118  36.932 18.093  0.39 41.92  ? 313  GLU A N    1 
ATOM   2379 C CA   A GLU A 1 312 ? 40.914  37.304 16.724  0.61 45.54  ? 313  GLU A CA   1 
ATOM   2380 C CA   B GLU A 1 312 ? 40.984  37.386 16.709  0.39 45.18  ? 313  GLU A CA   1 
ATOM   2381 C C    A GLU A 1 312 ? 40.149  38.621 16.628  0.61 47.35  ? 313  GLU A C    1 
ATOM   2382 C C    B GLU A 1 312 ? 40.124  38.642 16.585  0.39 47.04  ? 313  GLU A C    1 
ATOM   2383 O O    A GLU A 1 312 ? 40.575  39.551 15.940  0.61 48.75  ? 313  GLU A O    1 
ATOM   2384 O O    B GLU A 1 312 ? 40.459  39.555 15.829  0.39 48.37  ? 313  GLU A O    1 
ATOM   2385 C CB   A GLU A 1 312 ? 40.154  36.216 15.961  0.61 47.26  ? 313  GLU A CB   1 
ATOM   2386 C CB   B GLU A 1 312 ? 40.444  36.284 15.795  0.39 47.67  ? 313  GLU A CB   1 
ATOM   2387 C CG   A GLU A 1 312 ? 40.986  34.988 15.599  0.61 51.03  ? 313  GLU A CG   1 
ATOM   2388 C CG   B GLU A 1 312 ? 40.250  36.748 14.354  0.39 50.53  ? 313  GLU A CG   1 
ATOM   2389 C CD   A GLU A 1 312 ? 41.003  33.927 16.688  0.61 56.35  ? 313  GLU A CD   1 
ATOM   2390 C CD   B GLU A 1 312 ? 40.315  35.615 13.348  0.39 53.41  ? 313  GLU A CD   1 
ATOM   2391 O OE1  A GLU A 1 312 ? 40.684  34.244 17.857  0.61 56.33  ? 313  GLU A OE1  1 
ATOM   2392 O OE1  B GLU A 1 312 ? 40.757  34.508 13.727  0.39 55.04  ? 313  GLU A OE1  1 
ATOM   2393 O OE2  A GLU A 1 312 ? 41.348  32.769 16.370  0.61 57.36  ? 313  GLU A OE2  1 
ATOM   2394 O OE2  B GLU A 1 312 ? 39.929  35.835 12.177  0.39 53.18  ? 313  GLU A OE2  1 
ATOM   2395 N N    . ALA A 1 313 ? 39.015  38.692 17.318  1.00 40.68  ? 314  ALA A N    1 
ATOM   2396 C CA   . ALA A 1 313 ? 38.171  39.883 17.283  1.00 36.30  ? 314  ALA A CA   1 
ATOM   2397 C C    . ALA A 1 313 ? 38.887  41.073 17.922  1.00 38.57  ? 314  ALA A C    1 
ATOM   2398 O O    . ALA A 1 313 ? 38.804  42.190 17.423  1.00 42.70  ? 314  ALA A O    1 
ATOM   2399 C CB   . ALA A 1 313 ? 36.833  39.626 17.968  1.00 30.61  ? 314  ALA A CB   1 
ATOM   2400 N N    . LEU A 1 314 ? 39.594  40.826 19.024  1.00 39.36  ? 315  LEU A N    1 
ATOM   2401 C CA   . LEU A 1 314 ? 40.254  41.902 19.760  1.00 36.27  ? 315  LEU A CA   1 
ATOM   2402 C C    . LEU A 1 314 ? 41.343  42.532 18.908  1.00 37.07  ? 315  LEU A C    1 
ATOM   2403 O O    . LEU A 1 314 ? 41.550  43.744 18.939  1.00 42.84  ? 315  LEU A O    1 
ATOM   2404 C CB   . LEU A 1 314 ? 40.826  41.392 21.088  1.00 29.04  ? 315  LEU A CB   1 
ATOM   2405 C CG   . LEU A 1 314 ? 39.796  40.936 22.131  1.00 34.53  ? 315  LEU A CG   1 
ATOM   2406 C CD1  . LEU A 1 314 ? 40.476  40.385 23.374  1.00 32.93  ? 315  LEU A CD1  1 
ATOM   2407 C CD2  . LEU A 1 314 ? 38.853  42.074 22.509  1.00 35.15  ? 315  LEU A CD2  1 
ATOM   2408 N N    . ILE A 1 315 ? 42.030  41.697 18.142  1.00 35.02  ? 316  ILE A N    1 
ATOM   2409 C CA   . ILE A 1 315 ? 43.063  42.160 17.231  1.00 43.50  ? 316  ILE A CA   1 
ATOM   2410 C C    . ILE A 1 315 ? 42.457  43.022 16.115  1.00 49.20  ? 316  ILE A C    1 
ATOM   2411 O O    . ILE A 1 315 ? 42.971  44.095 15.810  1.00 50.91  ? 316  ILE A O    1 
ATOM   2412 C CB   . ILE A 1 315 ? 43.850  40.967 16.644  1.00 44.66  ? 316  ILE A CB   1 
ATOM   2413 C CG1  . ILE A 1 315 ? 44.816  40.409 17.694  1.00 40.33  ? 316  ILE A CG1  1 
ATOM   2414 C CG2  . ILE A 1 315 ? 44.607  41.378 15.391  1.00 47.68  ? 316  ILE A CG2  1 
ATOM   2415 C CD1  . ILE A 1 315 ? 45.371  39.051 17.352  1.00 40.26  ? 316  ILE A CD1  1 
ATOM   2416 N N    . ASN A 1 316 ? 41.357  42.566 15.522  1.00 53.35  ? 317  ASN A N    1 
ATOM   2417 C CA   . ASN A 1 316 ? 40.704  43.319 14.445  1.00 54.95  ? 317  ASN A CA   1 
ATOM   2418 C C    . ASN A 1 316 ? 40.110  44.641 14.909  1.00 56.32  ? 317  ASN A C    1 
ATOM   2419 O O    . ASN A 1 316 ? 39.989  45.578 14.129  1.00 61.01  ? 317  ASN A O    1 
ATOM   2420 C CB   . ASN A 1 316 ? 39.635  42.471 13.756  1.00 50.61  ? 317  ASN A CB   1 
ATOM   2421 C CG   . ASN A 1 316 ? 40.212  41.239 13.098  1.00 57.06  ? 317  ASN A CG   1 
ATOM   2422 O OD1  . ASN A 1 316 ? 41.407  41.183 12.813  1.00 67.04  ? 317  ASN A OD1  1 
ATOM   2423 N ND2  . ASN A 1 316 ? 39.371  40.239 12.857  1.00 57.13  ? 317  ASN A ND2  1 
ATOM   2424 N N    . ALA A 1 317 ? 39.765  44.710 16.189  1.00 56.26  ? 318  ALA A N    1 
ATOM   2425 C CA   . ALA A 1 317 ? 39.068  45.865 16.742  1.00 55.68  ? 318  ALA A CA   1 
ATOM   2426 C C    . ALA A 1 317 ? 40.014  46.863 17.399  1.00 56.91  ? 318  ALA A C    1 
ATOM   2427 O O    . ALA A 1 317 ? 39.658  48.015 17.620  1.00 65.14  ? 318  ALA A O    1 
ATOM   2428 C CB   . ALA A 1 317 ? 38.021  45.407 17.743  1.00 53.48  ? 318  ALA A CB   1 
ATOM   2429 N N    . GLY A 1 318 ? 41.222  46.425 17.717  1.00 57.33  ? 319  GLY A N    1 
ATOM   2430 C CA   . GLY A 1 318 ? 42.125  47.264 18.481  1.00 54.54  ? 319  GLY A CA   1 
ATOM   2431 C C    . GLY A 1 318 ? 42.753  48.416 17.717  1.00 51.35  ? 319  GLY A C    1 
ATOM   2432 O O    . GLY A 1 318 ? 42.897  48.376 16.495  1.00 49.60  ? 319  GLY A O    1 
ATOM   2433 N N    . ASP A 1 319 ? 43.115  49.458 18.454  1.00 49.65  ? 320  ASP A N    1 
ATOM   2434 C CA   . ASP A 1 319 ? 43.983  50.498 17.930  1.00 50.28  ? 320  ASP A CA   1 
ATOM   2435 C C    . ASP A 1 319 ? 45.343  50.260 18.567  1.00 45.45  ? 320  ASP A C    1 
ATOM   2436 O O    . ASP A 1 319 ? 45.462  50.206 19.796  1.00 43.98  ? 320  ASP A O    1 
ATOM   2437 C CB   . ASP A 1 319 ? 43.454  51.890 18.285  1.00 51.73  ? 320  ASP A CB   1 
ATOM   2438 C CG   . ASP A 1 319 ? 44.471  52.994 18.017  1.00 65.80  ? 320  ASP A CG   1 
ATOM   2439 O OD1  . ASP A 1 319 ? 45.250  52.892 17.043  1.00 68.70  ? 320  ASP A OD1  1 
ATOM   2440 O OD2  . ASP A 1 319 ? 44.494  53.974 18.789  1.00 76.78  ? 320  ASP A OD2  1 
ATOM   2441 N N    . PHE A 1 320 ? 46.369  50.104 17.741  1.00 40.75  ? 321  PHE A N    1 
ATOM   2442 C CA   . PHE A 1 320 ? 47.674  49.744 18.270  1.00 37.73  ? 321  PHE A CA   1 
ATOM   2443 C C    . PHE A 1 320 ? 48.749  50.769 17.926  1.00 40.51  ? 321  PHE A C    1 
ATOM   2444 O O    . PHE A 1 320 ? 49.942  50.450 17.941  1.00 42.82  ? 321  PHE A O    1 
ATOM   2445 C CB   . PHE A 1 320 ? 48.085  48.359 17.768  1.00 38.91  ? 321  PHE A CB   1 
ATOM   2446 C CG   . PHE A 1 320 ? 47.144  47.258 18.173  1.00 37.67  ? 321  PHE A CG   1 
ATOM   2447 C CD1  . PHE A 1 320 ? 47.216  46.697 19.447  1.00 37.10  ? 321  PHE A CD1  1 
ATOM   2448 C CD2  . PHE A 1 320 ? 46.206  46.765 17.276  1.00 34.81  ? 321  PHE A CD2  1 
ATOM   2449 C CE1  . PHE A 1 320 ? 46.360  45.665 19.823  1.00 35.77  ? 321  PHE A CE1  1 
ATOM   2450 C CE2  . PHE A 1 320 ? 45.346  45.736 17.642  1.00 41.24  ? 321  PHE A CE2  1 
ATOM   2451 C CZ   . PHE A 1 320 ? 45.425  45.184 18.920  1.00 39.29  ? 321  PHE A CZ   1 
ATOM   2452 N N    . HIS A 1 321 ? 48.331  51.994 17.616  1.00 39.78  ? 322  HIS A N    1 
ATOM   2453 C CA   . HIS A 1 321 ? 49.283  53.087 17.444  1.00 40.30  ? 322  HIS A CA   1 
ATOM   2454 C C    . HIS A 1 321 ? 50.155  53.233 18.692  1.00 45.93  ? 322  HIS A C    1 
ATOM   2455 O O    . HIS A 1 321 ? 49.649  53.206 19.822  1.00 38.82  ? 322  HIS A O    1 
ATOM   2456 C CB   . HIS A 1 321 ? 48.553  54.396 17.145  1.00 43.40  ? 322  HIS A CB   1 
ATOM   2457 C CG   . HIS A 1 321 ? 48.124  54.533 15.717  1.00 45.40  ? 322  HIS A CG   1 
ATOM   2458 N ND1  . HIS A 1 321 ? 46.832  54.287 15.295  1.00 46.13  ? 322  HIS A ND1  1 
ATOM   2459 C CD2  . HIS A 1 321 ? 48.820  54.888 14.610  1.00 49.13  ? 322  HIS A CD2  1 
ATOM   2460 C CE1  . HIS A 1 321 ? 46.752  54.488 13.991  1.00 50.13  ? 322  HIS A CE1  1 
ATOM   2461 N NE2  . HIS A 1 321 ? 47.942  54.857 13.551  1.00 52.44  ? 322  HIS A NE2  1 
ATOM   2462 N N    . GLY A 1 322 ? 51.466  53.357 18.489  1.00 49.82  ? 323  GLY A N    1 
ATOM   2463 C CA   . GLY A 1 322 ? 52.394  53.506 19.599  1.00 44.76  ? 323  GLY A CA   1 
ATOM   2464 C C    . GLY A 1 322 ? 52.939  52.194 20.131  1.00 45.37  ? 323  GLY A C    1 
ATOM   2465 O O    . GLY A 1 322 ? 53.682  52.169 21.115  1.00 51.26  ? 323  GLY A O    1 
ATOM   2466 N N    . LEU A 1 323 ? 52.570  51.096 19.481  1.00 37.41  ? 324  LEU A N    1 
ATOM   2467 C CA   . LEU A 1 323 ? 53.039  49.778 19.892  1.00 29.42  ? 324  LEU A CA   1 
ATOM   2468 C C    . LEU A 1 323 ? 54.138  49.281 18.961  1.00 34.49  ? 324  LEU A C    1 
ATOM   2469 O O    . LEU A 1 323 ? 53.978  49.310 17.734  1.00 39.00  ? 324  LEU A O    1 
ATOM   2470 C CB   . LEU A 1 323 ? 51.880  48.785 19.870  1.00 26.75  ? 324  LEU A CB   1 
ATOM   2471 C CG   . LEU A 1 323 ? 52.233  47.341 20.198  1.00 27.19  ? 324  LEU A CG   1 
ATOM   2472 C CD1  . LEU A 1 323 ? 52.845  47.278 21.580  1.00 25.24  ? 324  LEU A CD1  1 
ATOM   2473 C CD2  . LEU A 1 323 ? 51.001  46.470 20.123  1.00 25.32  ? 324  LEU A CD2  1 
ATOM   2474 N N    . GLN A 1 324 ? 55.253  48.828 19.534  1.00 31.83  ? 325  GLN A N    1 
ATOM   2475 C CA   . GLN A 1 324 ? 56.257  48.125 18.745  1.00 27.87  ? 325  GLN A CA   1 
ATOM   2476 C C    . GLN A 1 324 ? 56.290  46.647 19.113  1.00 31.15  ? 325  GLN A C    1 
ATOM   2477 O O    . GLN A 1 324 ? 56.333  46.280 20.291  1.00 34.38  ? 325  GLN A O    1 
ATOM   2478 C CB   . GLN A 1 324 ? 57.644  48.756 18.877  1.00 28.67  ? 325  GLN A CB   1 
ATOM   2479 C CG   . GLN A 1 324 ? 57.677  50.240 18.522  1.00 31.68  ? 325  GLN A CG   1 
ATOM   2480 C CD   . GLN A 1 324 ? 57.536  51.110 19.742  1.00 37.82  ? 325  GLN A CD   1 
ATOM   2481 O OE1  . GLN A 1 324 ? 58.117  50.825 20.792  1.00 40.23  ? 325  GLN A OE1  1 
ATOM   2482 N NE2  . GLN A 1 324 ? 56.750  52.168 19.624  1.00 44.11  ? 325  GLN A NE2  1 
ATOM   2483 N N    . VAL A 1 325 ? 56.265  45.805 18.085  1.00 24.89  ? 326  VAL A N    1 
ATOM   2484 C CA   . VAL A 1 325 ? 56.239  44.376 18.268  1.00 21.56  ? 326  VAL A CA   1 
ATOM   2485 C C    . VAL A 1 325 ? 57.275  43.732 17.374  1.00 28.44  ? 326  VAL A C    1 
ATOM   2486 O O    . VAL A 1 325 ? 57.521  44.177 16.252  1.00 28.81  ? 326  VAL A O    1 
ATOM   2487 C CB   . VAL A 1 325 ? 54.868  43.776 17.922  1.00 25.49  ? 326  VAL A CB   1 
ATOM   2488 C CG1  . VAL A 1 325 ? 54.804  42.353 18.389  1.00 25.62  ? 326  VAL A CG1  1 
ATOM   2489 C CG2  . VAL A 1 325 ? 53.766  44.559 18.575  1.00 33.80  ? 326  VAL A CG2  1 
ATOM   2490 N N    . LEU A 1 326 ? 57.884  42.677 17.890  1.00 21.69  ? 327  LEU A N    1 
ATOM   2491 C CA   . LEU A 1 326 ? 58.798  41.857 17.127  1.00 20.21  ? 327  LEU A CA   1 
ATOM   2492 C C    . LEU A 1 326 ? 58.222  40.441 17.177  1.00 22.75  ? 327  LEU A C    1 
ATOM   2493 O O    . LEU A 1 326 ? 57.905  39.934 18.262  1.00 25.17  ? 327  LEU A O    1 
ATOM   2494 C CB   . LEU A 1 326 ? 60.189  41.920 17.750  1.00 23.14  ? 327  LEU A CB   1 
ATOM   2495 C CG   . LEU A 1 326 ? 61.289  40.965 17.291  1.00 34.43  ? 327  LEU A CG   1 
ATOM   2496 C CD1  . LEU A 1 326 ? 61.575  41.127 15.819  1.00 40.12  ? 327  LEU A CD1  1 
ATOM   2497 C CD2  . LEU A 1 326 ? 62.535  41.234 18.105  1.00 36.99  ? 327  LEU A CD2  1 
ATOM   2498 N N    . VAL A 1 327 ? 58.042  39.835 16.001  1.00 21.42  ? 328  VAL A N    1 
ATOM   2499 C CA   . VAL A 1 327 ? 57.403  38.526 15.878  1.00 24.35  ? 328  VAL A CA   1 
ATOM   2500 C C    . VAL A 1 327 ? 58.178  37.680 14.891  1.00 24.12  ? 328  VAL A C    1 
ATOM   2501 O O    . VAL A 1 327 ? 58.788  38.211 13.948  1.00 23.60  ? 328  VAL A O    1 
ATOM   2502 C CB   . VAL A 1 327 ? 55.946  38.645 15.385  1.00 24.83  ? 328  VAL A CB   1 
ATOM   2503 C CG1  . VAL A 1 327 ? 55.152  39.544 16.307  1.00 22.55  ? 328  VAL A CG1  1 
ATOM   2504 C CG2  . VAL A 1 327 ? 55.911  39.209 13.962  1.00 24.84  ? 328  VAL A CG2  1 
ATOM   2505 N N    . GLY A 1 328 ? 58.167  36.367 15.101  1.00 19.29  ? 329  GLY A N    1 
ATOM   2506 C CA   . GLY A 1 328 ? 58.833  35.481 14.172  1.00 19.42  ? 329  GLY A CA   1 
ATOM   2507 C C    . GLY A 1 328 ? 58.499  34.024 14.389  1.00 26.67  ? 329  GLY A C    1 
ATOM   2508 O O    . GLY A 1 328 ? 57.805  33.663 15.338  1.00 24.73  ? 329  GLY A O    1 
ATOM   2509 N N    . VAL A 1 329 ? 59.014  33.192 13.490  1.00 19.68  ? 330  VAL A N    1 
ATOM   2510 C CA   . VAL A 1 329 ? 58.841  31.761 13.536  1.00 26.76  ? 330  VAL A CA   1 
ATOM   2511 C C    . VAL A 1 329 ? 60.191  31.114 13.185  1.00 30.24  ? 330  VAL A C    1 
ATOM   2512 O O    . VAL A 1 329 ? 61.098  31.796 12.678  1.00 24.05  ? 330  VAL A O    1 
ATOM   2513 C CB   . VAL A 1 329 ? 57.768  31.325 12.528  1.00 28.31  ? 330  VAL A CB   1 
ATOM   2514 C CG1  . VAL A 1 329 ? 56.423  31.903 12.913  1.00 21.12  ? 330  VAL A CG1  1 
ATOM   2515 C CG2  . VAL A 1 329 ? 58.144  31.787 11.120  1.00 20.82  ? 330  VAL A CG2  1 
ATOM   2516 N N    . VAL A 1 330 ? 60.338  29.823 13.489  1.00 24.26  ? 331  VAL A N    1 
ATOM   2517 C CA   . VAL A 1 330 ? 61.482  29.051 13.010  1.00 21.95  ? 331  VAL A CA   1 
ATOM   2518 C C    . VAL A 1 330 ? 61.106  28.474 11.656  1.00 25.42  ? 331  VAL A C    1 
ATOM   2519 O O    . VAL A 1 330 ? 59.952  28.544 11.255  1.00 27.12  ? 331  VAL A O    1 
ATOM   2520 C CB   . VAL A 1 330 ? 61.855  27.897 13.958  1.00 20.77  ? 331  VAL A CB   1 
ATOM   2521 C CG1  . VAL A 1 330 ? 62.058  28.412 15.380  1.00 20.14  ? 331  VAL A CG1  1 
ATOM   2522 C CG2  . VAL A 1 330 ? 60.778  26.816 13.927  1.00 21.41  ? 331  VAL A CG2  1 
ATOM   2523 N N    . LYS A 1 331 ? 62.074  27.893 10.960  1.00 28.28  ? 332  LYS A N    1 
ATOM   2524 C CA   . LYS A 1 331 ? 61.852  27.414 9.601   1.00 30.91  ? 332  LYS A CA   1 
ATOM   2525 C C    . LYS A 1 331 ? 60.908  26.195 9.494   1.00 30.94  ? 332  LYS A C    1 
ATOM   2526 O O    . LYS A 1 331 ? 60.184  26.062 8.507   1.00 30.50  ? 332  LYS A O    1 
ATOM   2527 C CB   . LYS A 1 331 ? 63.198  27.110 8.940   1.00 31.31  ? 332  LYS A CB   1 
ATOM   2528 C CG   . LYS A 1 331 ? 63.105  26.728 7.467   1.00 35.58  ? 332  LYS A CG   1 
ATOM   2529 C CD   . LYS A 1 331 ? 64.503  26.586 6.853   1.00 45.01  ? 332  LYS A CD   1 
ATOM   2530 C CE   . LYS A 1 331 ? 64.459  25.951 5.470   1.00 50.33  ? 332  LYS A CE   1 
ATOM   2531 N NZ   . LYS A 1 331 ? 64.050  24.519 5.551   1.00 62.18  ? 332  LYS A NZ   1 
ATOM   2532 N N    . ASP A 1 332 ? 60.913  25.319 10.502  1.00 25.78  ? 333  ASP A N    1 
ATOM   2533 C CA   . ASP A 1 332 ? 60.077  24.100 10.481  1.00 27.50  ? 333  ASP A CA   1 
ATOM   2534 C C    . ASP A 1 332 ? 59.222  23.932 11.757  1.00 28.66  ? 333  ASP A C    1 
ATOM   2535 O O    . ASP A 1 332 ? 59.507  23.095 12.617  1.00 32.27  ? 333  ASP A O    1 
ATOM   2536 C CB   . ASP A 1 332 ? 60.959  22.862 10.253  1.00 32.10  ? 333  ASP A CB   1 
ATOM   2537 C CG   . ASP A 1 332 ? 61.823  22.975 8.993   1.00 42.34  ? 333  ASP A CG   1 
ATOM   2538 O OD1  . ASP A 1 332 ? 61.291  22.707 7.895   1.00 43.97  ? 333  ASP A OD1  1 
ATOM   2539 O OD2  . ASP A 1 332 ? 63.029  23.326 9.100   1.00 42.05  ? 333  ASP A OD2  1 
ATOM   2540 N N    . GLU A 1 333 ? 58.174  24.740 11.864  1.00 28.72  ? 334  GLU A N    1 
ATOM   2541 C CA   . GLU A 1 333 ? 57.323  24.799 13.055  1.00 28.47  ? 334  GLU A CA   1 
ATOM   2542 C C    . GLU A 1 333 ? 56.571  23.496 13.374  1.00 29.95  ? 334  GLU A C    1 
ATOM   2543 O O    . GLU A 1 333 ? 56.282  23.208 14.541  1.00 31.14  ? 334  GLU A O    1 
ATOM   2544 C CB   . GLU A 1 333 ? 56.318  25.955 12.914  1.00 28.50  ? 334  GLU A CB   1 
ATOM   2545 C CG   . GLU A 1 333 ? 56.927  27.353 13.014  1.00 35.78  ? 334  GLU A CG   1 
ATOM   2546 C CD   . GLU A 1 333 ? 57.310  27.721 14.457  1.00 46.63  ? 334  GLU A CD   1 
ATOM   2547 O OE1  . GLU A 1 333 ? 56.939  26.963 15.391  1.00 44.91  ? 334  GLU A OE1  1 
ATOM   2548 O OE2  . GLU A 1 333 ? 57.976  28.769 14.656  1.00 44.23  ? 334  GLU A OE2  1 
ATOM   2549 N N    . GLY A 1 334 ? 56.256  22.708 12.347  1.00 25.46  ? 335  GLY A N    1 
ATOM   2550 C CA   . GLY A 1 334 ? 55.379  21.563 12.540  1.00 28.28  ? 335  GLY A CA   1 
ATOM   2551 C C    . GLY A 1 334 ? 56.045  20.266 12.958  1.00 28.39  ? 335  GLY A C    1 
ATOM   2552 O O    . GLY A 1 334 ? 55.455  19.472 13.695  1.00 29.36  ? 335  GLY A O    1 
ATOM   2553 N N    . SER A 1 335 ? 57.275  20.058 12.489  1.00 32.06  ? 336  SER A N    1 
ATOM   2554 C CA   . SER A 1 335 ? 57.945  18.761 12.576  1.00 34.73  ? 336  SER A CA   1 
ATOM   2555 C C    . SER A 1 335 ? 57.975  18.139 13.979  1.00 35.82  ? 336  SER A C    1 
ATOM   2556 O O    . SER A 1 335 ? 57.636  16.972 14.151  1.00 38.65  ? 336  SER A O    1 
ATOM   2557 C CB   . SER A 1 335 ? 59.365  18.869 12.018  1.00 39.52  ? 336  SER A CB   1 
ATOM   2558 O OG   . SER A 1 335 ? 60.108  19.874 12.689  1.00 29.53  ? 336  SER A OG   1 
ATOM   2559 N N    . TYR A 1 336 ? 58.389  18.923 14.966  1.00 34.24  ? 337  TYR A N    1 
ATOM   2560 C CA   . TYR A 1 336 ? 58.506  18.462 16.346  1.00 37.73  ? 337  TYR A CA   1 
ATOM   2561 C C    . TYR A 1 336 ? 57.212  17.794 16.806  1.00 37.27  ? 337  TYR A C    1 
ATOM   2562 O O    . TYR A 1 336 ? 57.243  16.775 17.496  1.00 35.80  ? 337  TYR A O    1 
ATOM   2563 C CB   . TYR A 1 336 ? 58.873  19.658 17.245  1.00 42.75  ? 337  TYR A CB   1 
ATOM   2564 C CG   . TYR A 1 336 ? 58.834  19.414 18.741  1.00 50.75  ? 337  TYR A CG   1 
ATOM   2565 C CD1  . TYR A 1 336 ? 57.663  19.599 19.464  1.00 57.39  ? 337  TYR A CD1  1 
ATOM   2566 C CD2  . TYR A 1 336 ? 59.975  19.038 19.435  1.00 57.80  ? 337  TYR A CD2  1 
ATOM   2567 C CE1  . TYR A 1 336 ? 57.621  19.386 20.829  1.00 65.45  ? 337  TYR A CE1  1 
ATOM   2568 C CE2  . TYR A 1 336 ? 59.946  18.826 20.806  1.00 64.45  ? 337  TYR A CE2  1 
ATOM   2569 C CZ   . TYR A 1 336 ? 58.764  19.000 21.498  1.00 71.75  ? 337  TYR A CZ   1 
ATOM   2570 O OH   . TYR A 1 336 ? 58.723  18.791 22.863  1.00 79.08  ? 337  TYR A OH   1 
ATOM   2571 N N    . PHE A 1 337 ? 56.078  18.358 16.393  1.00 34.73  ? 338  PHE A N    1 
ATOM   2572 C CA   . PHE A 1 337 ? 54.775  17.913 16.887  1.00 33.98  ? 338  PHE A CA   1 
ATOM   2573 C C    . PHE A 1 337 ? 54.294  16.600 16.279  1.00 33.89  ? 338  PHE A C    1 
ATOM   2574 O O    . PHE A 1 337 ? 53.485  15.897 16.889  1.00 27.96  ? 338  PHE A O    1 
ATOM   2575 C CB   . PHE A 1 337 ? 53.728  19.029 16.724  1.00 27.26  ? 338  PHE A CB   1 
ATOM   2576 C CG   . PHE A 1 337 ? 54.079  20.270 17.487  1.00 34.41  ? 338  PHE A CG   1 
ATOM   2577 C CD1  . PHE A 1 337 ? 53.722  20.400 18.829  1.00 34.12  ? 338  PHE A CD1  1 
ATOM   2578 C CD2  . PHE A 1 337 ? 54.830  21.284 16.886  1.00 35.36  ? 338  PHE A CD2  1 
ATOM   2579 C CE1  . PHE A 1 337 ? 54.079  21.539 19.559  1.00 36.53  ? 338  PHE A CE1  1 
ATOM   2580 C CE2  . PHE A 1 337 ? 55.189  22.425 17.602  1.00 29.64  ? 338  PHE A CE2  1 
ATOM   2581 C CZ   . PHE A 1 337 ? 54.810  22.553 18.944  1.00 30.82  ? 338  PHE A CZ   1 
ATOM   2582 N N    . LEU A 1 338 ? 54.808  16.273 15.092  1.00 31.09  ? 339  LEU A N    1 
ATOM   2583 C CA   . LEU A 1 338 ? 54.397  15.068 14.366  1.00 30.01  ? 339  LEU A CA   1 
ATOM   2584 C C    . LEU A 1 338 ? 54.750  13.751 15.082  1.00 31.73  ? 339  LEU A C    1 
ATOM   2585 O O    . LEU A 1 338 ? 54.000  12.777 14.981  1.00 28.05  ? 339  LEU A O    1 
ATOM   2586 C CB   . LEU A 1 338 ? 54.937  15.090 12.930  1.00 33.85  ? 339  LEU A CB   1 
ATOM   2587 C CG   . LEU A 1 338 ? 54.438  16.323 12.153  1.00 36.78  ? 339  LEU A CG   1 
ATOM   2588 C CD1  . LEU A 1 338 ? 54.956  16.394 10.701  1.00 30.55  ? 339  LEU A CD1  1 
ATOM   2589 C CD2  . LEU A 1 338 ? 52.904  16.380 12.191  1.00 22.76  ? 339  LEU A CD2  1 
ATOM   2590 N N    . VAL A 1 339 ? 55.865  13.725 15.815  1.00 26.28  ? 340  VAL A N    1 
ATOM   2591 C CA   . VAL A 1 339 ? 56.247  12.512 16.535  1.00 30.20  ? 340  VAL A CA   1 
ATOM   2592 C C    . VAL A 1 339 ? 55.364  12.278 17.763  1.00 36.61  ? 340  VAL A C    1 
ATOM   2593 O O    . VAL A 1 339 ? 55.512  11.278 18.463  1.00 35.66  ? 340  VAL A O    1 
ATOM   2594 C CB   . VAL A 1 339 ? 57.748  12.498 16.935  1.00 33.11  ? 340  VAL A CB   1 
ATOM   2595 C CG1  . VAL A 1 339 ? 58.622  12.707 15.708  1.00 37.88  ? 340  VAL A CG1  1 
ATOM   2596 C CG2  . VAL A 1 339 ? 58.038  13.557 17.970  1.00 34.40  ? 340  VAL A CG2  1 
ATOM   2597 N N    . TYR A 1 340 ? 54.425  13.188 18.007  1.00 42.36  ? 341  TYR A N    1 
ATOM   2598 C CA   . TYR A 1 340 ? 53.541  13.062 19.166  1.00 42.24  ? 341  TYR A CA   1 
ATOM   2599 C C    . TYR A 1 340 ? 52.148  12.515 18.861  1.00 37.05  ? 341  TYR A C    1 
ATOM   2600 O O    . TYR A 1 340 ? 51.206  12.756 19.615  1.00 41.55  ? 341  TYR A O    1 
ATOM   2601 C CB   . TYR A 1 340 ? 53.450  14.394 19.918  1.00 44.19  ? 341  TYR A CB   1 
ATOM   2602 C CG   . TYR A 1 340 ? 54.672  14.663 20.760  1.00 44.58  ? 341  TYR A CG   1 
ATOM   2603 C CD1  . TYR A 1 340 ? 54.758  14.187 22.068  1.00 44.63  ? 341  TYR A CD1  1 
ATOM   2604 C CD2  . TYR A 1 340 ? 55.753  15.370 20.243  1.00 42.84  ? 341  TYR A CD2  1 
ATOM   2605 C CE1  . TYR A 1 340 ? 55.883  14.422 22.844  1.00 45.75  ? 341  TYR A CE1  1 
ATOM   2606 C CE2  . TYR A 1 340 ? 56.886  15.611 21.009  1.00 46.22  ? 341  TYR A CE2  1 
ATOM   2607 C CZ   . TYR A 1 340 ? 56.944  15.133 22.307  1.00 50.75  ? 341  TYR A CZ   1 
ATOM   2608 O OH   . TYR A 1 340 ? 58.070  15.370 23.062  1.00 58.30  ? 341  TYR A OH   1 
ATOM   2609 N N    . GLY A 1 341 ? 52.007  11.771 17.769  1.00 37.18  ? 342  GLY A N    1 
ATOM   2610 C CA   . GLY A 1 341 ? 50.723  11.153 17.487  1.00 38.31  ? 342  GLY A CA   1 
ATOM   2611 C C    . GLY A 1 341 ? 50.381  10.933 16.028  1.00 42.88  ? 342  GLY A C    1 
ATOM   2612 O O    . GLY A 1 341 ? 49.478  10.157 15.716  1.00 48.88  ? 342  GLY A O    1 
ATOM   2613 N N    . ALA A 1 342 ? 51.084  11.618 15.130  1.00 38.99  ? 343  ALA A N    1 
ATOM   2614 C CA   . ALA A 1 342 ? 50.841  11.435 13.699  1.00 38.67  ? 343  ALA A CA   1 
ATOM   2615 C C    . ALA A 1 342 ? 51.321  10.055 13.264  1.00 40.53  ? 343  ALA A C    1 
ATOM   2616 O O    . ALA A 1 342 ? 52.475  9.693  13.500  1.00 41.05  ? 343  ALA A O    1 
ATOM   2617 C CB   . ALA A 1 342 ? 51.528  12.520 12.888  1.00 34.48  ? 343  ALA A CB   1 
ATOM   2618 N N    . PRO A 1 343 ? 50.428  9.278  12.629  1.00 44.11  ? 344  PRO A N    1 
ATOM   2619 C CA   . PRO A 1 343 ? 50.722  7.909  12.176  1.00 41.01  ? 344  PRO A CA   1 
ATOM   2620 C C    . PRO A 1 343 ? 51.936  7.839  11.250  1.00 41.34  ? 344  PRO A C    1 
ATOM   2621 O O    . PRO A 1 343 ? 51.989  8.566  10.261  1.00 41.12  ? 344  PRO A O    1 
ATOM   2622 C CB   . PRO A 1 343 ? 49.445  7.497  11.420  1.00 37.01  ? 344  PRO A CB   1 
ATOM   2623 C CG   . PRO A 1 343 ? 48.689  8.776  11.166  1.00 37.83  ? 344  PRO A CG   1 
ATOM   2624 C CD   . PRO A 1 343 ? 49.043  9.680  12.318  1.00 39.32  ? 344  PRO A CD   1 
ATOM   2625 N N    . GLY A 1 344 ? 52.903  6.985  11.582  1.00 42.63  ? 345  GLY A N    1 
ATOM   2626 C CA   . GLY A 1 344 ? 54.076  6.800  10.746  1.00 43.10  ? 345  GLY A CA   1 
ATOM   2627 C C    . GLY A 1 344 ? 55.277  7.669  11.088  1.00 45.97  ? 345  GLY A C    1 
ATOM   2628 O O    . GLY A 1 344 ? 56.300  7.608  10.407  1.00 51.97  ? 345  GLY A O    1 
ATOM   2629 N N    . PHE A 1 345 ? 55.169  8.476  12.139  1.00 44.37  ? 346  PHE A N    1 
ATOM   2630 C CA   . PHE A 1 345 ? 56.257  9.390  12.487  1.00 42.38  ? 346  PHE A CA   1 
ATOM   2631 C C    . PHE A 1 345 ? 57.095  8.912  13.654  1.00 44.47  ? 346  PHE A C    1 
ATOM   2632 O O    . PHE A 1 345 ? 56.582  8.357  14.625  1.00 46.77  ? 346  PHE A O    1 
ATOM   2633 C CB   . PHE A 1 345 ? 55.728  10.797 12.777  1.00 38.02  ? 346  PHE A CB   1 
ATOM   2634 C CG   . PHE A 1 345 ? 55.441  11.592 11.541  1.00 37.56  ? 346  PHE A CG   1 
ATOM   2635 C CD1  . PHE A 1 345 ? 54.214  11.470 10.890  1.00 28.58  ? 346  PHE A CD1  1 
ATOM   2636 C CD2  . PHE A 1 345 ? 56.406  12.450 11.014  1.00 31.72  ? 346  PHE A CD2  1 
ATOM   2637 C CE1  . PHE A 1 345 ? 53.950  12.203 9.739   1.00 31.05  ? 346  PHE A CE1  1 
ATOM   2638 C CE2  . PHE A 1 345 ? 56.149  13.183 9.868   1.00 34.01  ? 346  PHE A CE2  1 
ATOM   2639 C CZ   . PHE A 1 345 ? 54.918  13.058 9.226   1.00 34.86  ? 346  PHE A CZ   1 
ATOM   2640 N N    . SER A 1 346 ? 58.395  9.151  13.549  1.00 42.63  ? 347  SER A N    1 
ATOM   2641 C CA   . SER A 1 346 ? 59.323  8.819  14.612  1.00 38.15  ? 347  SER A CA   1 
ATOM   2642 C C    . SER A 1 346 ? 60.577  9.680  14.479  1.00 41.93  ? 347  SER A C    1 
ATOM   2643 O O    . SER A 1 346 ? 60.959  10.068 13.369  1.00 44.05  ? 347  SER A O    1 
ATOM   2644 C CB   . SER A 1 346 ? 59.693  7.341  14.537  1.00 36.81  ? 347  SER A CB   1 
ATOM   2645 O OG   . SER A 1 346 ? 60.705  7.029  15.478  1.00 45.22  ? 347  SER A OG   1 
ATOM   2646 N N    . LYS A 1 347 ? 61.208  9.984  15.608  1.00 37.46  ? 348  LYS A N    1 
ATOM   2647 C CA   . LYS A 1 347 ? 62.494  10.664 15.590  1.00 40.83  ? 348  LYS A CA   1 
ATOM   2648 C C    . LYS A 1 347 ? 63.584  9.687  15.135  1.00 42.88  ? 348  LYS A C    1 
ATOM   2649 O O    . LYS A 1 347 ? 64.686  10.106 14.774  1.00 43.60  ? 348  LYS A O    1 
ATOM   2650 C CB   . LYS A 1 347 ? 62.840  11.211 16.979  1.00 37.12  ? 348  LYS A CB   1 
ATOM   2651 C CG   . LYS A 1 347 ? 63.654  10.244 17.844  1.00 36.06  ? 348  LYS A CG   1 
ATOM   2652 C CD   . LYS A 1 347 ? 63.934  10.838 19.222  1.00 38.91  ? 348  LYS A CD   1 
ATOM   2653 C CE   . LYS A 1 347 ? 64.836  9.929  20.051  1.00 35.48  ? 348  LYS A CE   1 
ATOM   2654 N NZ   . LYS A 1 347 ? 66.167  9.670  19.410  1.00 31.39  ? 348  LYS A NZ   1 
ATOM   2655 N N    . ASP A 1 348 ? 63.259  8.393  15.139  1.00 39.82  ? 349  ASP A N    1 
ATOM   2656 C CA   . ASP A 1 348 ? 64.250  7.332  14.927  1.00 43.84  ? 349  ASP A CA   1 
ATOM   2657 C C    . ASP A 1 348 ? 64.275  6.730  13.521  1.00 43.19  ? 349  ASP A C    1 
ATOM   2658 O O    . ASP A 1 348 ? 65.167  5.947  13.198  1.00 46.70  ? 349  ASP A O    1 
ATOM   2659 C CB   . ASP A 1 348 ? 64.086  6.224  15.977  1.00 45.74  ? 349  ASP A CB   1 
ATOM   2660 C CG   . ASP A 1 348 ? 64.439  6.695  17.383  1.00 47.62  ? 349  ASP A CG   1 
ATOM   2661 O OD1  . ASP A 1 348 ? 65.427  7.444  17.537  1.00 48.18  ? 349  ASP A OD1  1 
ATOM   2662 O OD2  . ASP A 1 348 ? 63.720  6.323  18.332  1.00 52.11  ? 349  ASP A OD2  1 
ATOM   2663 N N    . ASN A 1 349 ? 63.299  7.086  12.692  1.00 41.19  ? 350  ASN A N    1 
ATOM   2664 C CA   . ASN A 1 349 ? 63.344  6.740  11.270  1.00 39.28  ? 350  ASN A CA   1 
ATOM   2665 C C    . ASN A 1 349 ? 63.076  7.996  10.425  1.00 40.59  ? 350  ASN A C    1 
ATOM   2666 O O    . ASN A 1 349 ? 62.932  9.098  10.968  1.00 35.73  ? 350  ASN A O    1 
ATOM   2667 C CB   . ASN A 1 349 ? 62.390  5.573  10.919  1.00 34.16  ? 350  ASN A CB   1 
ATOM   2668 C CG   . ASN A 1 349 ? 60.910  5.916  11.129  1.00 36.93  ? 350  ASN A CG   1 
ATOM   2669 O OD1  . ASN A 1 349 ? 60.493  7.056  10.910  1.00 41.28  ? 350  ASN A OD1  1 
ATOM   2670 N ND2  . ASN A 1 349 ? 60.106  4.922  11.547  1.00 34.18  ? 350  ASN A ND2  1 
ATOM   2671 N N    . GLU A 1 350 ? 63.007  7.841  9.108   1.00 36.91  ? 351  GLU A N    1 
ATOM   2672 C CA   . GLU A 1 350 ? 62.840  9.004  8.243   1.00 39.34  ? 351  GLU A CA   1 
ATOM   2673 C C    . GLU A 1 350 ? 61.423  9.555  8.273   1.00 35.16  ? 351  GLU A C    1 
ATOM   2674 O O    . GLU A 1 350 ? 61.184  10.675 7.818   1.00 39.41  ? 351  GLU A O    1 
ATOM   2675 C CB   . GLU A 1 350 ? 63.266  8.691  6.803   1.00 43.26  ? 351  GLU A CB   1 
ATOM   2676 C CG   . GLU A 1 350 ? 64.762  8.504  6.650   1.00 56.05  ? 351  GLU A CG   1 
ATOM   2677 C CD   . GLU A 1 350 ? 65.531  9.723  7.112   1.00 68.79  ? 351  GLU A CD   1 
ATOM   2678 O OE1  . GLU A 1 350 ? 65.405  10.786 6.463   1.00 72.80  ? 351  GLU A OE1  1 
ATOM   2679 O OE2  . GLU A 1 350 ? 66.244  9.624  8.135   1.00 75.06  ? 351  GLU A OE2  1 
ATOM   2680 N N    . SER A 1 351 ? 60.492  8.773  8.812   1.00 31.02  ? 352  SER A N    1 
ATOM   2681 C CA   . SER A 1 351 ? 59.083  9.157  8.831   1.00 29.98  ? 352  SER A CA   1 
ATOM   2682 C C    . SER A 1 351 ? 58.598  9.440  7.405   1.00 35.52  ? 352  SER A C    1 
ATOM   2683 O O    . SER A 1 351 ? 57.953  10.460 7.133   1.00 34.42  ? 352  SER A O    1 
ATOM   2684 C CB   . SER A 1 351 ? 58.856  10.365 9.747   1.00 25.77  ? 352  SER A CB   1 
ATOM   2685 O OG   . SER A 1 351 ? 59.320  10.109 11.064  1.00 30.15  ? 352  SER A OG   1 
ATOM   2686 N N    . LEU A 1 352 ? 58.927  8.519  6.504   1.00 39.60  ? 353  LEU A N    1 
ATOM   2687 C CA   . LEU A 1 352 ? 58.502  8.596  5.115   1.00 45.28  ? 353  LEU A CA   1 
ATOM   2688 C C    . LEU A 1 352 ? 57.133  7.934  4.963   1.00 48.11  ? 353  LEU A C    1 
ATOM   2689 O O    . LEU A 1 352 ? 57.040  6.755  4.629   1.00 57.22  ? 353  LEU A O    1 
ATOM   2690 C CB   . LEU A 1 352 ? 59.543  7.930  4.208   1.00 41.08  ? 353  LEU A CB   1 
ATOM   2691 C CG   . LEU A 1 352 ? 60.893  8.657  4.170   1.00 35.54  ? 353  LEU A CG   1 
ATOM   2692 C CD1  . LEU A 1 352 ? 61.978  7.866  3.432   1.00 32.10  ? 353  LEU A CD1  1 
ATOM   2693 C CD2  . LEU A 1 352 ? 60.731  10.037 3.553   1.00 31.28  ? 353  LEU A CD2  1 
ATOM   2694 N N    . ILE A 1 353 ? 56.080  8.714  5.202   1.00 40.48  ? 354  ILE A N    1 
ATOM   2695 C CA   . ILE A 1 353 ? 54.709  8.210  5.288   1.00 34.72  ? 354  ILE A CA   1 
ATOM   2696 C C    . ILE A 1 353 ? 54.032  7.980  3.932   1.00 33.21  ? 354  ILE A C    1 
ATOM   2697 O O    . ILE A 1 353 ? 54.400  8.590  2.925   1.00 32.16  ? 354  ILE A O    1 
ATOM   2698 C CB   . ILE A 1 353 ? 53.815  9.170  6.106   1.00 35.79  ? 354  ILE A CB   1 
ATOM   2699 C CG1  . ILE A 1 353 ? 53.803  10.560 5.455   1.00 29.68  ? 354  ILE A CG1  1 
ATOM   2700 C CG2  . ILE A 1 353 ? 54.276  9.239  7.571   1.00 31.45  ? 354  ILE A CG2  1 
ATOM   2701 C CD1  . ILE A 1 353 ? 52.903  11.552 6.142   1.00 24.71  ? 354  ILE A CD1  1 
ATOM   2702 N N    . SER A 1 354 ? 53.026  7.105  3.929   1.00 28.89  ? 355  SER A N    1 
ATOM   2703 C CA   . SER A 1 354 ? 52.201  6.845  2.750   1.00 30.23  ? 355  SER A CA   1 
ATOM   2704 C C    . SER A 1 354 ? 51.105  7.903  2.587   1.00 33.15  ? 355  SER A C    1 
ATOM   2705 O O    . SER A 1 354 ? 50.885  8.732  3.475   1.00 34.00  ? 355  SER A O    1 
ATOM   2706 C CB   . SER A 1 354 ? 51.544  5.480  2.878   1.00 27.22  ? 355  SER A CB   1 
ATOM   2707 O OG   . SER A 1 354 ? 50.701  5.439  4.019   1.00 40.74  ? 355  SER A OG   1 
ATOM   2708 N N    . ARG A 1 355 ? 50.421  7.876  1.451   1.00 30.87  ? 356  ARG A N    1 
ATOM   2709 C CA   . ARG A 1 355 ? 49.311  8.785  1.222   1.00 32.49  ? 356  ARG A CA   1 
ATOM   2710 C C    . ARG A 1 355 ? 48.261  8.580  2.310   1.00 37.96  ? 356  ARG A C    1 
ATOM   2711 O O    . ARG A 1 355 ? 47.762  9.541  2.896   1.00 39.88  ? 356  ARG A O    1 
ATOM   2712 C CB   . ARG A 1 355 ? 48.698  8.522  -0.145  1.00 28.35  ? 356  ARG A CB   1 
ATOM   2713 C CG   . ARG A 1 355 ? 47.506  9.397  -0.459  1.00 32.23  ? 356  ARG A CG   1 
ATOM   2714 C CD   . ARG A 1 355 ? 47.943  10.775 -0.861  1.00 34.49  ? 356  ARG A CD   1 
ATOM   2715 N NE   . ARG A 1 355 ? 46.806  11.630 -1.187  1.00 36.38  ? 356  ARG A NE   1 
ATOM   2716 C CZ   . ARG A 1 355 ? 46.886  12.946 -1.329  1.00 29.76  ? 356  ARG A CZ   1 
ATOM   2717 N NH1  . ARG A 1 355 ? 48.053  13.551 -1.175  1.00 26.79  ? 356  ARG A NH1  1 
ATOM   2718 N NH2  . ARG A 1 355 ? 45.803  13.651 -1.621  1.00 26.07  ? 356  ARG A NH2  1 
ATOM   2719 N N    . ALA A 1 356 ? 47.954  7.317  2.590   1.00 35.91  ? 357  ALA A N    1 
ATOM   2720 C CA   . ALA A 1 356 ? 46.953  6.965  3.591   1.00 32.16  ? 357  ALA A CA   1 
ATOM   2721 C C    . ALA A 1 356 ? 47.299  7.533  4.973   1.00 31.92  ? 357  ALA A C    1 
ATOM   2722 O O    . ALA A 1 356 ? 46.414  8.006  5.694   1.00 32.74  ? 357  ALA A O    1 
ATOM   2723 C CB   . ALA A 1 356 ? 46.792  5.460  3.654   1.00 26.77  ? 357  ALA A CB   1 
ATOM   2724 N N    . GLU A 1 357 ? 48.581  7.476  5.336   1.00 29.74  ? 358  GLU A N    1 
ATOM   2725 C CA   . GLU A 1 357 ? 49.045  8.031  6.606   1.00 34.79  ? 358  GLU A CA   1 
ATOM   2726 C C    . GLU A 1 357 ? 48.945  9.551  6.608   1.00 35.31  ? 358  GLU A C    1 
ATOM   2727 O O    . GLU A 1 357 ? 48.591  10.158 7.617   1.00 41.07  ? 358  GLU A O    1 
ATOM   2728 C CB   . GLU A 1 357 ? 50.477  7.576  6.919   1.00 40.27  ? 358  GLU A CB   1 
ATOM   2729 C CG   . GLU A 1 357 ? 50.593  6.078  7.222   1.00 51.13  ? 358  GLU A CG   1 
ATOM   2730 C CD   . GLU A 1 357 ? 52.038  5.602  7.384   1.00 57.40  ? 358  GLU A CD   1 
ATOM   2731 O OE1  . GLU A 1 357 ? 52.925  6.091  6.651   1.00 56.01  ? 358  GLU A OE1  1 
ATOM   2732 O OE2  . GLU A 1 357 ? 52.284  4.729  8.246   1.00 60.42  ? 358  GLU A OE2  1 
ATOM   2733 N N    . PHE A 1 358 ? 49.255  10.156 5.467   1.00 29.44  ? 359  PHE A N    1 
ATOM   2734 C CA   . PHE A 1 358 ? 49.076  11.581 5.272   1.00 28.95  ? 359  PHE A CA   1 
ATOM   2735 C C    . PHE A 1 358 ? 47.637  12.007 5.526   1.00 30.26  ? 359  PHE A C    1 
ATOM   2736 O O    . PHE A 1 358 ? 47.385  12.961 6.264   1.00 28.23  ? 359  PHE A O    1 
ATOM   2737 C CB   . PHE A 1 358 ? 49.454  11.970 3.846   1.00 25.77  ? 359  PHE A CB   1 
ATOM   2738 C CG   . PHE A 1 358 ? 49.233  13.420 3.542   1.00 22.07  ? 359  PHE A CG   1 
ATOM   2739 C CD1  . PHE A 1 358 ? 50.057  14.392 4.098   1.00 27.01  ? 359  PHE A CD1  1 
ATOM   2740 C CD2  . PHE A 1 358 ? 48.212  13.818 2.688   1.00 23.80  ? 359  PHE A CD2  1 
ATOM   2741 C CE1  . PHE A 1 358 ? 49.863  15.737 3.811   1.00 28.00  ? 359  PHE A CE1  1 
ATOM   2742 C CE2  . PHE A 1 358 ? 48.012  15.166 2.395   1.00 23.94  ? 359  PHE A CE2  1 
ATOM   2743 C CZ   . PHE A 1 358 ? 48.836  16.124 2.956   1.00 21.44  ? 359  PHE A CZ   1 
ATOM   2744 N N    . LEU A 1 359 ? 46.698  11.300 4.902   1.00 26.21  ? 360  LEU A N    1 
ATOM   2745 C CA   . LEU A 1 359 ? 45.282  11.629 5.024   1.00 28.68  ? 360  LEU A CA   1 
ATOM   2746 C C    . LEU A 1 359 ? 44.807  11.468 6.457   1.00 33.89  ? 360  LEU A C    1 
ATOM   2747 O O    . LEU A 1 359 ? 44.032  12.283 6.958   1.00 36.45  ? 360  LEU A O    1 
ATOM   2748 C CB   . LEU A 1 359 ? 44.434  10.775 4.085   1.00 27.47  ? 360  LEU A CB   1 
ATOM   2749 C CG   . LEU A 1 359 ? 44.788  10.957 2.610   1.00 31.77  ? 360  LEU A CG   1 
ATOM   2750 C CD1  . LEU A 1 359 ? 43.938  10.065 1.713   1.00 32.14  ? 360  LEU A CD1  1 
ATOM   2751 C CD2  . LEU A 1 359 ? 44.638  12.406 2.217   1.00 25.52  ? 360  LEU A CD2  1 
ATOM   2752 N N    . ALA A 1 360 ? 45.280  10.420 7.123   1.00 31.45  ? 361  ALA A N    1 
ATOM   2753 C CA   . ALA A 1 360 ? 44.900  10.200 8.509   1.00 31.45  ? 361  ALA A CA   1 
ATOM   2754 C C    . ALA A 1 360 ? 45.582  11.229 9.420   1.00 37.34  ? 361  ALA A C    1 
ATOM   2755 O O    . ALA A 1 360 ? 45.007  11.651 10.426  1.00 34.49  ? 361  ALA A O    1 
ATOM   2756 C CB   . ALA A 1 360 ? 45.230  8.778  8.932   1.00 24.67  ? 361  ALA A CB   1 
ATOM   2757 N N    . GLY A 1 361 ? 46.803  11.632 9.054   1.00 35.83  ? 362  GLY A N    1 
ATOM   2758 C CA   . GLY A 1 361 ? 47.557  12.630 9.808   1.00 28.17  ? 362  GLY A CA   1 
ATOM   2759 C C    . GLY A 1 361 ? 46.918  14.010 9.757   1.00 30.62  ? 362  GLY A C    1 
ATOM   2760 O O    . GLY A 1 361 ? 46.977  14.770 10.722  1.00 33.28  ? 362  GLY A O    1 
ATOM   2761 N N    . VAL A 1 362 ? 46.287  14.332 8.632   1.00 27.38  ? 363  VAL A N    1 
ATOM   2762 C CA   . VAL A 1 362 ? 45.571  15.591 8.509   1.00 29.16  ? 363  VAL A CA   1 
ATOM   2763 C C    . VAL A 1 362 ? 44.466  15.738 9.569   1.00 32.30  ? 363  VAL A C    1 
ATOM   2764 O O    . VAL A 1 362 ? 44.325  16.808 10.169  1.00 34.36  ? 363  VAL A O    1 
ATOM   2765 C CB   . VAL A 1 362 ? 45.035  15.797 7.071   1.00 24.82  ? 363  VAL A CB   1 
ATOM   2766 C CG1  . VAL A 1 362 ? 43.960  16.880 7.038   1.00 20.56  ? 363  VAL A CG1  1 
ATOM   2767 C CG2  . VAL A 1 362 ? 46.180  16.174 6.151   1.00 22.32  ? 363  VAL A CG2  1 
ATOM   2768 N N    . ARG A 1 363 ? 43.701  14.672 9.814   1.00 29.77  ? 364  ARG A N    1 
ATOM   2769 C CA   . ARG A 1 363 ? 42.650  14.709 10.847  1.00 34.50  ? 364  ARG A CA   1 
ATOM   2770 C C    . ARG A 1 363 ? 43.216  14.860 12.265  1.00 36.97  ? 364  ARG A C    1 
ATOM   2771 O O    . ARG A 1 363 ? 42.594  15.489 13.122  1.00 37.03  ? 364  ARG A O    1 
ATOM   2772 C CB   . ARG A 1 363 ? 41.756  13.461 10.801  1.00 34.52  ? 364  ARG A CB   1 
ATOM   2773 C CG   . ARG A 1 363 ? 41.223  13.083 9.430   1.00 37.73  ? 364  ARG A CG   1 
ATOM   2774 C CD   . ARG A 1 363 ? 40.633  14.275 8.696   1.00 49.37  ? 364  ARG A CD   1 
ATOM   2775 N NE   . ARG A 1 363 ? 39.565  14.952 9.437   1.00 53.40  ? 364  ARG A NE   1 
ATOM   2776 C CZ   . ARG A 1 363 ? 38.265  14.681 9.312   1.00 48.35  ? 364  ARG A CZ   1 
ATOM   2777 N NH1  . ARG A 1 363 ? 37.857  13.723 8.481   1.00 37.81  ? 364  ARG A NH1  1 
ATOM   2778 N NH2  . ARG A 1 363 ? 37.373  15.373 10.020  1.00 44.08  ? 364  ARG A NH2  1 
ATOM   2779 N N    . VAL A 1 364 ? 44.383  14.259 12.505  1.00 34.97  ? 365  VAL A N    1 
ATOM   2780 C CA   . VAL A 1 364 ? 45.099  14.401 13.772  1.00 36.50  ? 365  VAL A CA   1 
ATOM   2781 C C    . VAL A 1 364 ? 45.613  15.834 13.919  1.00 38.17  ? 365  VAL A C    1 
ATOM   2782 O O    . VAL A 1 364 ? 45.431  16.467 14.959  1.00 39.32  ? 365  VAL A O    1 
ATOM   2783 C CB   . VAL A 1 364 ? 46.298  13.417 13.843  1.00 38.89  ? 365  VAL A CB   1 
ATOM   2784 C CG1  . VAL A 1 364 ? 47.155  13.670 15.075  1.00 33.20  ? 365  VAL A CG1  1 
ATOM   2785 C CG2  . VAL A 1 364 ? 45.812  11.974 13.818  1.00 32.97  ? 365  VAL A CG2  1 
ATOM   2786 N N    . GLY A 1 365 ? 46.246  16.341 12.863  1.00 34.43  ? 366  GLY A N    1 
ATOM   2787 C CA   . GLY A 1 365 ? 46.854  17.661 12.878  1.00 30.07  ? 366  GLY A CA   1 
ATOM   2788 C C    . GLY A 1 365 ? 45.890  18.830 12.773  1.00 33.82  ? 366  GLY A C    1 
ATOM   2789 O O    . GLY A 1 365 ? 46.196  19.944 13.208  1.00 38.32  ? 366  GLY A O    1 
ATOM   2790 N N    . VAL A 1 366 ? 44.732  18.593 12.171  1.00 29.09  ? 367  VAL A N    1 
ATOM   2791 C CA   . VAL A 1 366 ? 43.712  19.625 12.094  1.00 29.25  ? 367  VAL A CA   1 
ATOM   2792 C C    . VAL A 1 366 ? 42.462  19.071 12.749  1.00 32.80  ? 367  VAL A C    1 
ATOM   2793 O O    . VAL A 1 366 ? 41.470  18.755 12.078  1.00 32.15  ? 367  VAL A O    1 
ATOM   2794 C CB   . VAL A 1 366 ? 43.433  20.049 10.643  1.00 29.52  ? 367  VAL A CB   1 
ATOM   2795 C CG1  . VAL A 1 366 ? 42.501  21.260 10.623  1.00 24.35  ? 367  VAL A CG1  1 
ATOM   2796 C CG2  . VAL A 1 366 ? 44.744  20.376 9.938   1.00 21.68  ? 367  VAL A CG2  1 
ATOM   2797 N N    . PRO A 1 367 ? 42.512  18.944 14.081  1.00 32.18  ? 368  PRO A N    1 
ATOM   2798 C CA   . PRO A 1 367 ? 41.461  18.237 14.813  1.00 32.53  ? 368  PRO A CA   1 
ATOM   2799 C C    . PRO A 1 367 ? 40.168  19.041 14.877  1.00 37.96  ? 368  PRO A C    1 
ATOM   2800 O O    . PRO A 1 367 ? 40.180  20.279 14.811  1.00 37.30  ? 368  PRO A O    1 
ATOM   2801 C CB   . PRO A 1 367 ? 42.067  18.062 16.206  1.00 36.30  ? 368  PRO A CB   1 
ATOM   2802 C CG   . PRO A 1 367 ? 43.012  19.221 16.347  1.00 37.46  ? 368  PRO A CG   1 
ATOM   2803 C CD   . PRO A 1 367 ? 43.557  19.483 14.973  1.00 34.92  ? 368  PRO A CD   1 
ATOM   2804 N N    . GLN A 1 368 ? 39.059  18.314 14.966  1.00 42.87  ? 369  GLN A N    1 
ATOM   2805 C CA   . GLN A 1 368 ? 37.741  18.898 15.183  1.00 53.16  ? 369  GLN A CA   1 
ATOM   2806 C C    . GLN A 1 368 ? 37.284  19.950 14.161  1.00 53.95  ? 369  GLN A C    1 
ATOM   2807 O O    . GLN A 1 368 ? 36.715  20.978 14.528  1.00 52.84  ? 369  GLN A O    1 
ATOM   2808 C CB   . GLN A 1 368 ? 37.640  19.434 16.607  1.00 57.18  ? 369  GLN A CB   1 
ATOM   2809 C CG   . GLN A 1 368 ? 37.451  18.336 17.635  1.00 62.92  ? 369  GLN A CG   1 
ATOM   2810 C CD   . GLN A 1 368 ? 36.207  18.555 18.465  1.00 73.75  ? 369  GLN A CD   1 
ATOM   2811 O OE1  . GLN A 1 368 ? 36.058  19.592 19.121  1.00 76.15  ? 369  GLN A OE1  1 
ATOM   2812 N NE2  . GLN A 1 368 ? 35.294  17.590 18.429  1.00 75.97  ? 369  GLN A NE2  1 
ATOM   2813 N N    . VAL A 1 369 ? 37.528  19.678 12.884  1.00 49.93  ? 370  VAL A N    1 
ATOM   2814 C CA   . VAL A 1 369 ? 36.924  20.454 11.807  1.00 39.47  ? 370  VAL A CA   1 
ATOM   2815 C C    . VAL A 1 369 ? 36.117  19.489 10.947  1.00 35.30  ? 370  VAL A C    1 
ATOM   2816 O O    . VAL A 1 369 ? 36.326  18.275 10.999  1.00 38.48  ? 370  VAL A O    1 
ATOM   2817 C CB   . VAL A 1 369 ? 37.978  21.210 10.969  1.00 33.44  ? 370  VAL A CB   1 
ATOM   2818 C CG1  . VAL A 1 369 ? 38.838  22.065 11.873  1.00 28.55  ? 370  VAL A CG1  1 
ATOM   2819 C CG2  . VAL A 1 369 ? 38.862  20.233 10.193  1.00 35.37  ? 370  VAL A CG2  1 
ATOM   2820 N N    . SER A 1 370 ? 35.185  20.018 10.166  1.00 38.29  ? 371  SER A N    1 
ATOM   2821 C CA   . SER A 1 370 ? 34.350  19.180 9.306   1.00 38.25  ? 371  SER A CA   1 
ATOM   2822 C C    . SER A 1 370 ? 35.168  18.376 8.290   1.00 34.28  ? 371  SER A C    1 
ATOM   2823 O O    . SER A 1 370 ? 36.306  18.732 7.971   1.00 37.36  ? 371  SER A O    1 
ATOM   2824 C CB   . SER A 1 370 ? 33.336  20.048 8.563   1.00 38.11  ? 371  SER A CB   1 
ATOM   2825 O OG   . SER A 1 370 ? 33.976  20.922 7.644   1.00 36.78  ? 371  SER A OG   1 
ATOM   2826 N N    . ASP A 1 371 ? 34.583  17.299 7.776   1.00 28.24  ? 372  ASP A N    1 
ATOM   2827 C CA   . ASP A 1 371 ? 35.206  16.543 6.698   1.00 37.51  ? 372  ASP A CA   1 
ATOM   2828 C C    . ASP A 1 371 ? 35.503  17.417 5.475   1.00 38.00  ? 372  ASP A C    1 
ATOM   2829 O O    . ASP A 1 371 ? 36.524  17.239 4.813   1.00 38.40  ? 372  ASP A O    1 
ATOM   2830 C CB   . ASP A 1 371 ? 34.336  15.346 6.308   1.00 40.34  ? 372  ASP A CB   1 
ATOM   2831 C CG   . ASP A 1 371 ? 34.265  14.300 7.407   1.00 59.36  ? 372  ASP A CG   1 
ATOM   2832 O OD1  . ASP A 1 371 ? 35.184  14.258 8.255   1.00 64.54  ? 372  ASP A OD1  1 
ATOM   2833 O OD2  . ASP A 1 371 ? 33.290  13.519 7.430   1.00 70.00  ? 372  ASP A OD2  1 
ATOM   2834 N N    . LEU A 1 372 ? 34.618  18.364 5.184   1.00 35.30  ? 373  LEU A N    1 
ATOM   2835 C CA   . LEU A 1 372 ? 34.835  19.280 4.060   1.00 32.11  ? 373  LEU A CA   1 
ATOM   2836 C C    . LEU A 1 372 ? 36.096  20.124 4.281   1.00 34.81  ? 373  LEU A C    1 
ATOM   2837 O O    . LEU A 1 372 ? 36.952  20.232 3.396   1.00 31.68  ? 373  LEU A O    1 
ATOM   2838 C CB   . LEU A 1 372 ? 33.610  20.172 3.851   1.00 21.67  ? 373  LEU A CB   1 
ATOM   2839 C CG   . LEU A 1 372 ? 33.646  21.164 2.686   1.00 33.98  ? 373  LEU A CG   1 
ATOM   2840 C CD1  . LEU A 1 372 ? 33.599  20.454 1.323   1.00 33.59  ? 373  LEU A CD1  1 
ATOM   2841 C CD2  . LEU A 1 372 ? 32.508  22.173 2.812   1.00 31.27  ? 373  LEU A CD2  1 
ATOM   2842 N N    . ALA A 1 373 ? 36.216  20.697 5.477   1.00 32.05  ? 374  ALA A N    1 
ATOM   2843 C CA   . ALA A 1 373 ? 37.395  21.481 5.844   1.00 29.39  ? 374  ALA A CA   1 
ATOM   2844 C C    . ALA A 1 373 ? 38.663  20.647 5.669   1.00 25.43  ? 374  ALA A C    1 
ATOM   2845 O O    . ALA A 1 373 ? 39.652  21.106 5.088   1.00 27.71  ? 374  ALA A O    1 
ATOM   2846 C CB   . ALA A 1 373 ? 37.273  21.994 7.267   1.00 24.10  ? 374  ALA A CB   1 
ATOM   2847 N N    . ALA A 1 374 ? 38.612  19.407 6.136   1.00 23.53  ? 375  ALA A N    1 
ATOM   2848 C CA   . ALA A 1 374 ? 39.735  18.487 5.990   1.00 26.85  ? 375  ALA A CA   1 
ATOM   2849 C C    . ALA A 1 374 ? 40.095  18.252 4.520   1.00 32.46  ? 375  ALA A C    1 
ATOM   2850 O O    . ALA A 1 374 ? 41.275  18.155 4.171   1.00 31.90  ? 375  ALA A O    1 
ATOM   2851 C CB   . ALA A 1 374 ? 39.426  17.177 6.679   1.00 23.34  ? 375  ALA A CB   1 
ATOM   2852 N N    . GLU A 1 375 ? 39.074  18.158 3.668   1.00 28.19  ? 376  GLU A N    1 
ATOM   2853 C CA   . GLU A 1 375 ? 39.271  17.959 2.235   1.00 25.23  ? 376  GLU A CA   1 
ATOM   2854 C C    . GLU A 1 375 ? 39.946  19.184 1.642   1.00 27.82  ? 376  GLU A C    1 
ATOM   2855 O O    . GLU A 1 375 ? 40.809  19.070 0.772   1.00 30.74  ? 376  GLU A O    1 
ATOM   2856 C CB   . GLU A 1 375 ? 37.929  17.741 1.538   1.00 36.41  ? 376  GLU A CB   1 
ATOM   2857 C CG   . GLU A 1 375 ? 37.172  16.493 1.963   1.00 53.14  ? 376  GLU A CG   1 
ATOM   2858 C CD   . GLU A 1 375 ? 37.671  15.238 1.274   1.00 71.72  ? 376  GLU A CD   1 
ATOM   2859 O OE1  . GLU A 1 375 ? 38.868  15.193 0.910   1.00 75.66  ? 376  GLU A OE1  1 
ATOM   2860 O OE2  . GLU A 1 375 ? 36.862  14.296 1.101   1.00 78.72  ? 376  GLU A OE2  1 
ATOM   2861 N N    . ALA A 1 376 ? 39.547  20.360 2.121   1.00 19.98  ? 377  ALA A N    1 
ATOM   2862 C CA   . ALA A 1 376 ? 40.172  21.603 1.689   1.00 25.72  ? 377  ALA A CA   1 
ATOM   2863 C C    . ALA A 1 376 ? 41.666  21.608 2.041   1.00 22.17  ? 377  ALA A C    1 
ATOM   2864 O O    . ALA A 1 376 ? 42.513  21.983 1.218   1.00 23.35  ? 377  ALA A O    1 
ATOM   2865 C CB   . ALA A 1 376 ? 39.458  22.807 2.302   1.00 19.22  ? 377  ALA A CB   1 
ATOM   2866 N N    . VAL A 1 377 ? 41.989  21.183 3.259   1.00 20.08  ? 378  VAL A N    1 
ATOM   2867 C CA   . VAL A 1 377 ? 43.384  21.094 3.660   1.00 22.42  ? 378  VAL A CA   1 
ATOM   2868 C C    . VAL A 1 377 ? 44.162  20.162 2.723   1.00 23.35  ? 378  VAL A C    1 
ATOM   2869 O O    . VAL A 1 377 ? 45.238  20.509 2.252   1.00 24.49  ? 378  VAL A O    1 
ATOM   2870 C CB   . VAL A 1 377 ? 43.520  20.619 5.104   1.00 19.38  ? 378  VAL A CB   1 
ATOM   2871 C CG1  . VAL A 1 377 ? 45.000  20.445 5.471   1.00 19.38  ? 378  VAL A CG1  1 
ATOM   2872 C CG2  . VAL A 1 377 ? 42.841  21.598 6.022   1.00 19.27  ? 378  VAL A CG2  1 
ATOM   2873 N N    . VAL A 1 378 ? 43.602  18.991 2.442   1.00 20.83  ? 379  VAL A N    1 
ATOM   2874 C CA   . VAL A 1 378 ? 44.276  18.007 1.605   1.00 23.32  ? 379  VAL A CA   1 
ATOM   2875 C C    . VAL A 1 378 ? 44.490  18.562 0.205   1.00 27.49  ? 379  VAL A C    1 
ATOM   2876 O O    . VAL A 1 378 ? 45.516  18.299 -0.419  1.00 27.46  ? 379  VAL A O    1 
ATOM   2877 C CB   . VAL A 1 378 ? 43.468  16.704 1.520   1.00 24.46  ? 379  VAL A CB   1 
ATOM   2878 C CG1  . VAL A 1 378 ? 43.970  15.840 0.367   1.00 20.63  ? 379  VAL A CG1  1 
ATOM   2879 C CG2  . VAL A 1 378 ? 43.535  15.947 2.845   1.00 20.66  ? 379  VAL A CG2  1 
ATOM   2880 N N    . LEU A 1 379 ? 43.515  19.337 -0.274  1.00 31.59  ? 380  LEU A N    1 
ATOM   2881 C CA   . LEU A 1 379 ? 43.585  19.958 -1.599  1.00 29.03  ? 380  LEU A CA   1 
ATOM   2882 C C    . LEU A 1 379 ? 44.767  20.907 -1.689  1.00 27.70  ? 380  LEU A C    1 
ATOM   2883 O O    . LEU A 1 379 ? 45.529  20.864 -2.646  1.00 27.01  ? 380  LEU A O    1 
ATOM   2884 C CB   . LEU A 1 379 ? 42.297  20.733 -1.924  1.00 22.70  ? 380  LEU A CB   1 
ATOM   2885 C CG   . LEU A 1 379 ? 42.378  21.685 -3.129  1.00 20.86  ? 380  LEU A CG   1 
ATOM   2886 C CD1  . LEU A 1 379 ? 42.394  20.925 -4.460  1.00 21.13  ? 380  LEU A CD1  1 
ATOM   2887 C CD2  . LEU A 1 379 ? 41.239  22.714 -3.120  1.00 27.25  ? 380  LEU A CD2  1 
ATOM   2888 N N    A HIS A 1 380 ? 44.921  21.763 -0.681  0.48 26.54  ? 381  HIS A N    1 
ATOM   2889 N N    B HIS A 1 380 ? 44.911  21.753 -0.678  0.52 26.49  ? 381  HIS A N    1 
ATOM   2890 C CA   A HIS A 1 380 ? 45.972  22.776 -0.694  0.48 27.93  ? 381  HIS A CA   1 
ATOM   2891 C CA   B HIS A 1 380 ? 45.956  22.762 -0.680  0.52 27.96  ? 381  HIS A CA   1 
ATOM   2892 C C    A HIS A 1 380 ? 47.365  22.200 -0.440  0.48 26.91  ? 381  HIS A C    1 
ATOM   2893 C C    B HIS A 1 380 ? 47.353  22.193 -0.445  0.52 26.93  ? 381  HIS A C    1 
ATOM   2894 O O    A HIS A 1 380 ? 48.350  22.709 -0.967  0.48 26.62  ? 381  HIS A O    1 
ATOM   2895 O O    B HIS A 1 380 ? 48.328  22.701 -0.993  0.52 26.54  ? 381  HIS A O    1 
ATOM   2896 C CB   A HIS A 1 380 ? 45.671  23.887 0.320   0.48 28.50  ? 381  HIS A CB   1 
ATOM   2897 C CB   B HIS A 1 380 ? 45.644  23.847 0.350   0.52 27.81  ? 381  HIS A CB   1 
ATOM   2898 C CG   A HIS A 1 380 ? 46.573  25.079 0.202   0.48 31.35  ? 381  HIS A CG   1 
ATOM   2899 C CG   B HIS A 1 380 ? 44.715  24.904 -0.156  0.52 30.57  ? 381  HIS A CG   1 
ATOM   2900 N ND1  A HIS A 1 380 ? 46.177  26.257 -0.401  0.48 33.40  ? 381  HIS A ND1  1 
ATOM   2901 N ND1  B HIS A 1 380 ? 43.343  24.807 -0.052  0.52 31.63  ? 381  HIS A ND1  1 
ATOM   2902 C CD2  A HIS A 1 380 ? 47.849  25.282 0.613   0.48 30.34  ? 381  HIS A CD2  1 
ATOM   2903 C CD2  B HIS A 1 380 ? 44.965  26.082 -0.774  0.52 29.18  ? 381  HIS A CD2  1 
ATOM   2904 C CE1  A HIS A 1 380 ? 47.168  27.128 -0.359  0.48 18.72  ? 381  HIS A CE1  1 
ATOM   2905 C CE1  B HIS A 1 380 ? 42.790  25.884 -0.581  0.52 27.88  ? 381  HIS A CE1  1 
ATOM   2906 N NE2  A HIS A 1 380 ? 48.195  26.562 0.250   0.48 32.69  ? 381  HIS A NE2  1 
ATOM   2907 N NE2  B HIS A 1 380 ? 43.750  26.671 -1.027  0.52 28.31  ? 381  HIS A NE2  1 
ATOM   2908 N N    . TYR A 1 381 ? 47.455  21.148 0.369   1.00 23.99  ? 382  TYR A N    1 
ATOM   2909 C CA   . TYR A 1 381 ? 48.769  20.606 0.733   1.00 25.46  ? 382  TYR A CA   1 
ATOM   2910 C C    . TYR A 1 381 ? 49.196  19.393 -0.073  1.00 22.08  ? 382  TYR A C    1 
ATOM   2911 O O    . TYR A 1 381 ? 50.270  18.843 0.136   1.00 27.63  ? 382  TYR A O    1 
ATOM   2912 C CB   . TYR A 1 381 ? 48.871  20.356 2.242   1.00 26.17  ? 382  TYR A CB   1 
ATOM   2913 C CG   . TYR A 1 381 ? 48.964  21.647 3.002   1.00 25.65  ? 382  TYR A CG   1 
ATOM   2914 C CD1  . TYR A 1 381 ? 47.821  22.385 3.289   1.00 19.04  ? 382  TYR A CD1  1 
ATOM   2915 C CD2  . TYR A 1 381 ? 50.196  22.158 3.392   1.00 19.31  ? 382  TYR A CD2  1 
ATOM   2916 C CE1  . TYR A 1 381 ? 47.895  23.589 3.974   1.00 25.69  ? 382  TYR A CE1  1 
ATOM   2917 C CE2  . TYR A 1 381 ? 50.288  23.372 4.073   1.00 19.08  ? 382  TYR A CE2  1 
ATOM   2918 C CZ   . TYR A 1 381 ? 49.128  24.076 4.359   1.00 24.82  ? 382  TYR A CZ   1 
ATOM   2919 O OH   . TYR A 1 381 ? 49.188  25.273 5.022   1.00 21.74  ? 382  TYR A OH   1 
ATOM   2920 N N    . THR A 1 382 ? 48.358  18.984 -1.011  1.00 23.25  ? 383  THR A N    1 
ATOM   2921 C CA   . THR A 1 382 ? 48.743  17.924 -1.936  1.00 27.86  ? 383  THR A CA   1 
ATOM   2922 C C    . THR A 1 382 ? 49.394  18.556 -3.166  1.00 23.47  ? 383  THR A C    1 
ATOM   2923 O O    . THR A 1 382 ? 48.919  19.575 -3.664  1.00 29.58  ? 383  THR A O    1 
ATOM   2924 C CB   . THR A 1 382 ? 47.516  17.091 -2.354  1.00 25.93  ? 383  THR A CB   1 
ATOM   2925 O OG1  . THR A 1 382 ? 47.024  16.377 -1.208  1.00 25.07  ? 383  THR A OG1  1 
ATOM   2926 C CG2  . THR A 1 382 ? 47.875  16.096 -3.479  1.00 20.99  ? 383  THR A CG2  1 
ATOM   2927 N N    . ASP A 1 383 ? 50.500  17.987 -3.626  1.00 23.93  ? 384  ASP A N    1 
ATOM   2928 C CA   . ASP A 1 383 ? 51.035  18.341 -4.938  1.00 22.46  ? 384  ASP A CA   1 
ATOM   2929 C C    . ASP A 1 383 ? 50.463  17.325 -5.914  1.00 22.53  ? 384  ASP A C    1 
ATOM   2930 O O    . ASP A 1 383 ? 50.823  16.145 -5.864  1.00 21.81  ? 384  ASP A O    1 
ATOM   2931 C CB   . ASP A 1 383 ? 52.559  18.253 -4.931  1.00 26.14  ? 384  ASP A CB   1 
ATOM   2932 C CG   . ASP A 1 383 ? 53.181  18.520 -6.308  1.00 34.00  ? 384  ASP A CG   1 
ATOM   2933 O OD1  . ASP A 1 383 ? 52.448  18.589 -7.331  1.00 32.51  ? 384  ASP A OD1  1 
ATOM   2934 O OD2  . ASP A 1 383 ? 54.429  18.643 -6.364  1.00 34.63  ? 384  ASP A OD2  1 
ATOM   2935 N N    . TRP A 1 384 ? 49.585  17.776 -6.807  1.00 25.78  ? 385  TRP A N    1 
ATOM   2936 C CA   . TRP A 1 384 ? 48.829  16.843 -7.645  1.00 26.76  ? 385  TRP A CA   1 
ATOM   2937 C C    . TRP A 1 384 ? 49.610  16.238 -8.811  1.00 29.76  ? 385  TRP A C    1 
ATOM   2938 O O    . TRP A 1 384 ? 49.089  15.394 -9.546  1.00 30.12  ? 385  TRP A O    1 
ATOM   2939 C CB   . TRP A 1 384 ? 47.497  17.452 -8.077  1.00 24.02  ? 385  TRP A CB   1 
ATOM   2940 C CG   . TRP A 1 384 ? 46.639  17.709 -6.881  1.00 28.53  ? 385  TRP A CG   1 
ATOM   2941 C CD1  . TRP A 1 384 ? 46.515  18.887 -6.190  1.00 20.14  ? 385  TRP A CD1  1 
ATOM   2942 C CD2  . TRP A 1 384 ? 45.823  16.753 -6.195  1.00 23.55  ? 385  TRP A CD2  1 
ATOM   2943 N NE1  . TRP A 1 384 ? 45.653  18.723 -5.128  1.00 22.67  ? 385  TRP A NE1  1 
ATOM   2944 C CE2  . TRP A 1 384 ? 45.214  17.424 -5.110  1.00 22.50  ? 385  TRP A CE2  1 
ATOM   2945 C CE3  . TRP A 1 384 ? 45.541  15.399 -6.397  1.00 26.32  ? 385  TRP A CE3  1 
ATOM   2946 C CZ2  . TRP A 1 384 ? 44.336  16.783 -4.231  1.00 24.59  ? 385  TRP A CZ2  1 
ATOM   2947 C CZ3  . TRP A 1 384 ? 44.677  14.764 -5.530  1.00 25.69  ? 385  TRP A CZ3  1 
ATOM   2948 C CH2  . TRP A 1 384 ? 44.076  15.459 -4.461  1.00 25.97  ? 385  TRP A CH2  1 
ATOM   2949 N N    . LEU A 1 385 ? 50.867  16.651 -8.950  1.00 28.84  ? 386  LEU A N    1 
ATOM   2950 C CA   . LEU A 1 385 ? 51.797  15.955 -9.837  1.00 30.56  ? 386  LEU A CA   1 
ATOM   2951 C C    . LEU A 1 385 ? 52.576  14.874 -9.094  1.00 33.79  ? 386  LEU A C    1 
ATOM   2952 O O    . LEU A 1 385 ? 53.206  14.020 -9.717  1.00 34.81  ? 386  LEU A O    1 
ATOM   2953 C CB   . LEU A 1 385 ? 52.778  16.936 -10.472 1.00 31.96  ? 386  LEU A CB   1 
ATOM   2954 C CG   . LEU A 1 385 ? 52.191  17.871 -11.521 1.00 39.00  ? 386  LEU A CG   1 
ATOM   2955 C CD1  . LEU A 1 385 ? 53.256  18.841 -12.014 1.00 42.93  ? 386  LEU A CD1  1 
ATOM   2956 C CD2  . LEU A 1 385 ? 51.623  17.065 -12.670 1.00 38.99  ? 386  LEU A CD2  1 
ATOM   2957 N N    . HIS A 1 386 ? 52.556  14.923 -7.763  1.00 32.49  ? 387  HIS A N    1 
ATOM   2958 C CA   . HIS A 1 386 ? 53.287  13.943 -6.957  1.00 32.94  ? 387  HIS A CA   1 
ATOM   2959 C C    . HIS A 1 386 ? 52.468  13.600 -5.713  1.00 33.14  ? 387  HIS A C    1 
ATOM   2960 O O    . HIS A 1 386 ? 52.963  13.718 -4.597  1.00 26.65  ? 387  HIS A O    1 
ATOM   2961 C CB   . HIS A 1 386 ? 54.668  14.494 -6.551  1.00 32.46  ? 387  HIS A CB   1 
ATOM   2962 C CG   . HIS A 1 386 ? 55.493  14.986 -7.705  1.00 37.65  ? 387  HIS A CG   1 
ATOM   2963 N ND1  . HIS A 1 386 ? 56.321  14.159 -8.438  1.00 37.91  ? 387  HIS A ND1  1 
ATOM   2964 C CD2  . HIS A 1 386 ? 55.620  16.222 -8.249  1.00 35.37  ? 387  HIS A CD2  1 
ATOM   2965 C CE1  . HIS A 1 386 ? 56.919  14.863 -9.383  1.00 36.26  ? 387  HIS A CE1  1 
ATOM   2966 N NE2  . HIS A 1 386 ? 56.506  16.116 -9.296  1.00 37.07  ? 387  HIS A NE2  1 
ATOM   2967 N N    . PRO A 1 387 ? 51.209  13.168 -5.907  1.00 33.18  ? 388  PRO A N    1 
ATOM   2968 C CA   . PRO A 1 387 ? 50.287  13.040 -4.766  1.00 28.12  ? 388  PRO A CA   1 
ATOM   2969 C C    . PRO A 1 387 ? 50.713  11.991 -3.744  1.00 34.42  ? 388  PRO A C    1 
ATOM   2970 O O    . PRO A 1 387 ? 50.238  12.051 -2.600  1.00 35.86  ? 388  PRO A O    1 
ATOM   2971 C CB   . PRO A 1 387 ? 48.960  12.629 -5.423  1.00 24.87  ? 388  PRO A CB   1 
ATOM   2972 C CG   . PRO A 1 387 ? 49.373  11.982 -6.746  1.00 26.13  ? 388  PRO A CG   1 
ATOM   2973 C CD   . PRO A 1 387 ? 50.585  12.766 -7.188  1.00 26.39  ? 388  PRO A CD   1 
ATOM   2974 N N    . GLU A 1 388 ? 51.596  11.070 -4.137  1.00 31.07  ? 389  GLU A N    1 
ATOM   2975 C CA   . GLU A 1 388 ? 51.966  9.956  -3.266  1.00 34.06  ? 389  GLU A CA   1 
ATOM   2976 C C    . GLU A 1 388 ? 53.441  9.891  -2.873  1.00 35.02  ? 389  GLU A C    1 
ATOM   2977 O O    . GLU A 1 388 ? 53.877  8.909  -2.285  1.00 39.88  ? 389  GLU A O    1 
ATOM   2978 C CB   . GLU A 1 388 ? 51.544  8.626  -3.898  1.00 40.59  ? 389  GLU A CB   1 
ATOM   2979 C CG   . GLU A 1 388 ? 50.163  8.665  -4.526  1.00 52.13  ? 389  GLU A CG   1 
ATOM   2980 C CD   . GLU A 1 388 ? 49.354  7.423  -4.235  1.00 66.21  ? 389  GLU A CD   1 
ATOM   2981 O OE1  . GLU A 1 388 ? 49.952  6.390  -3.862  1.00 74.48  ? 389  GLU A OE1  1 
ATOM   2982 O OE2  . GLU A 1 388 ? 48.113  7.481  -4.375  1.00 71.92  ? 389  GLU A OE2  1 
ATOM   2983 N N    . ASP A 1 389 ? 54.214  10.922 -3.189  1.00 32.90  ? 390  ASP A N    1 
ATOM   2984 C CA   . ASP A 1 389 ? 55.636  10.901 -2.854  1.00 33.50  ? 390  ASP A CA   1 
ATOM   2985 C C    . ASP A 1 389 ? 55.858  11.080 -1.340  1.00 34.72  ? 390  ASP A C    1 
ATOM   2986 O O    . ASP A 1 389 ? 55.562  12.142 -0.774  1.00 37.21  ? 390  ASP A O    1 
ATOM   2987 C CB   . ASP A 1 389 ? 56.396  11.970 -3.645  1.00 31.23  ? 390  ASP A CB   1 
ATOM   2988 C CG   . ASP A 1 389 ? 57.849  12.063 -3.242  1.00 41.20  ? 390  ASP A CG   1 
ATOM   2989 O OD1  . ASP A 1 389 ? 58.479  11.005 -3.031  1.00 54.69  ? 390  ASP A OD1  1 
ATOM   2990 O OD2  . ASP A 1 389 ? 58.364  13.190 -3.121  1.00 45.69  ? 390  ASP A OD2  1 
ATOM   2991 N N    . PRO A 1 390 ? 56.401  10.041 -0.689  1.00 33.21  ? 391  PRO A N    1 
ATOM   2992 C CA   . PRO A 1 390 ? 56.528  9.955  0.775   1.00 32.54  ? 391  PRO A CA   1 
ATOM   2993 C C    . PRO A 1 390 ? 57.267  11.143 1.390   1.00 34.53  ? 391  PRO A C    1 
ATOM   2994 O O    . PRO A 1 390 ? 56.790  11.687 2.385   1.00 34.61  ? 391  PRO A O    1 
ATOM   2995 C CB   . PRO A 1 390 ? 57.338  8.673  0.983   1.00 34.59  ? 391  PRO A CB   1 
ATOM   2996 C CG   . PRO A 1 390 ? 57.140  7.882  -0.278  1.00 33.35  ? 391  PRO A CG   1 
ATOM   2997 C CD   . PRO A 1 390 ? 57.059  8.909  -1.366  1.00 27.62  ? 391  PRO A CD   1 
ATOM   2998 N N    . ALA A 1 391 ? 58.395  11.544 0.806   1.00 30.95  ? 392  ALA A N    1 
ATOM   2999 C CA   . ALA A 1 391 ? 59.153  12.684 1.324   1.00 34.23  ? 392  ALA A CA   1 
ATOM   3000 C C    . ALA A 1 391 ? 58.359  13.994 1.255   1.00 32.16  ? 392  ALA A C    1 
ATOM   3001 O O    . ALA A 1 391 ? 58.362  14.778 2.203   1.00 29.57  ? 392  ALA A O    1 
ATOM   3002 C CB   . ALA A 1 391 ? 60.481  12.817 0.595   1.00 35.92  ? 392  ALA A CB   1 
ATOM   3003 N N    . ARG A 1 392 ? 57.688  14.228 0.129   1.00 31.90  ? 393  ARG A N    1 
ATOM   3004 C CA   . ARG A 1 392 ? 56.839  15.408 -0.027  1.00 29.90  ? 393  ARG A CA   1 
ATOM   3005 C C    . ARG A 1 392 ? 55.660  15.373 0.939   1.00 29.10  ? 393  ARG A C    1 
ATOM   3006 O O    . ARG A 1 392 ? 55.264  16.404 1.468   1.00 31.71  ? 393  ARG A O    1 
ATOM   3007 C CB   . ARG A 1 392 ? 56.319  15.524 -1.461  1.00 30.40  ? 393  ARG A CB   1 
ATOM   3008 C CG   . ARG A 1 392 ? 57.327  16.016 -2.486  1.00 29.20  ? 393  ARG A CG   1 
ATOM   3009 C CD   . ARG A 1 392 ? 56.644  16.125 -3.851  1.00 34.44  ? 393  ARG A CD   1 
ATOM   3010 N NE   . ARG A 1 392 ? 57.491  16.725 -4.882  1.00 41.07  ? 393  ARG A NE   1 
ATOM   3011 C CZ   . ARG A 1 392 ? 58.311  16.038 -5.672  1.00 43.18  ? 393  ARG A CZ   1 
ATOM   3012 N NH1  . ARG A 1 392 ? 58.406  14.723 -5.547  1.00 46.37  ? 393  ARG A NH1  1 
ATOM   3013 N NH2  . ARG A 1 392 ? 59.035  16.662 -6.594  1.00 43.98  ? 393  ARG A NH2  1 
ATOM   3014 N N    . LEU A 1 393 ? 55.100  14.186 1.159   1.00 27.49  ? 394  LEU A N    1 
ATOM   3015 C CA   . LEU A 1 393 ? 53.996  14.026 2.103   1.00 27.88  ? 394  LEU A CA   1 
ATOM   3016 C C    . LEU A 1 393 ? 54.425  14.359 3.539   1.00 29.53  ? 394  LEU A C    1 
ATOM   3017 O O    . LEU A 1 393 ? 53.694  15.030 4.274   1.00 27.68  ? 394  LEU A O    1 
ATOM   3018 C CB   . LEU A 1 393 ? 53.437  12.607 2.027   1.00 27.40  ? 394  LEU A CB   1 
ATOM   3019 C CG   . LEU A 1 393 ? 52.699  12.298 0.728   1.00 26.30  ? 394  LEU A CG   1 
ATOM   3020 C CD1  . LEU A 1 393 ? 52.437  10.804 0.590   1.00 25.58  ? 394  LEU A CD1  1 
ATOM   3021 C CD2  . LEU A 1 393 ? 51.398  13.059 0.687   1.00 22.68  ? 394  LEU A CD2  1 
ATOM   3022 N N    . ARG A 1 394 ? 55.614  13.903 3.931   1.00 29.72  ? 395  ARG A N    1 
ATOM   3023 C CA   . ARG A 1 394 ? 56.132  14.192 5.263   1.00 28.56  ? 395  ARG A CA   1 
ATOM   3024 C C    . ARG A 1 394 ? 56.282  15.698 5.438   1.00 25.72  ? 395  ARG A C    1 
ATOM   3025 O O    . ARG A 1 394 ? 55.839  16.258 6.443   1.00 23.02  ? 395  ARG A O    1 
ATOM   3026 C CB   . ARG A 1 394 ? 57.470  13.487 5.495   1.00 30.60  ? 395  ARG A CB   1 
ATOM   3027 C CG   . ARG A 1 394 ? 58.043  13.677 6.889   1.00 31.53  ? 395  ARG A CG   1 
ATOM   3028 C CD   . ARG A 1 394 ? 59.506  13.267 6.953   1.00 30.79  ? 395  ARG A CD   1 
ATOM   3029 N NE   . ARG A 1 394 ? 60.327  14.072 6.056   1.00 37.32  ? 395  ARG A NE   1 
ATOM   3030 C CZ   . ARG A 1 394 ? 61.421  13.629 5.441   1.00 37.88  ? 395  ARG A CZ   1 
ATOM   3031 N NH1  . ARG A 1 394 ? 61.822  12.384 5.611   1.00 39.90  ? 395  ARG A NH1  1 
ATOM   3032 N NH2  . ARG A 1 394 ? 62.108  14.429 4.645   1.00 36.97  ? 395  ARG A NH2  1 
ATOM   3033 N N    . GLU A 1 395 ? 56.879  16.352 4.442   1.00 28.26  ? 396  GLU A N    1 
ATOM   3034 C CA   . GLU A 1 395 ? 57.060  17.807 4.472   1.00 27.89  ? 396  GLU A CA   1 
ATOM   3035 C C    . GLU A 1 395 ? 55.718  18.520 4.526   1.00 24.16  ? 396  GLU A C    1 
ATOM   3036 O O    . GLU A 1 395 ? 55.549  19.499 5.255   1.00 27.11  ? 396  GLU A O    1 
ATOM   3037 C CB   . GLU A 1 395 ? 57.845  18.282 3.242   1.00 33.01  ? 396  GLU A CB   1 
ATOM   3038 C CG   . GLU A 1 395 ? 59.231  18.818 3.555   1.00 50.66  ? 396  GLU A CG   1 
ATOM   3039 C CD   . GLU A 1 395 ? 60.142  17.761 4.169   1.00 68.30  ? 396  GLU A CD   1 
ATOM   3040 O OE1  . GLU A 1 395 ? 60.728  16.963 3.400   1.00 71.29  ? 396  GLU A OE1  1 
ATOM   3041 O OE2  . GLU A 1 395 ? 60.264  17.722 5.419   1.00 72.82  ? 396  GLU A OE2  1 
ATOM   3042 N N    . ALA A 1 396 ? 54.766  18.013 3.751   1.00 23.85  ? 397  ALA A N    1 
ATOM   3043 C CA   . ALA A 1 396 ? 53.452  18.633 3.643   1.00 22.90  ? 397  ALA A CA   1 
ATOM   3044 C C    . ALA A 1 396 ? 52.701  18.576 4.967   1.00 24.93  ? 397  ALA A C    1 
ATOM   3045 O O    . ALA A 1 396 ? 52.070  19.560 5.363   1.00 28.72  ? 397  ALA A O    1 
ATOM   3046 C CB   . ALA A 1 396 ? 52.644  17.983 2.536   1.00 21.32  ? 397  ALA A CB   1 
ATOM   3047 N N    . LEU A 1 397 ? 52.764  17.441 5.659   1.00 20.92  ? 398  LEU A N    1 
ATOM   3048 C CA   . LEU A 1 397 ? 52.065  17.331 6.942   1.00 28.15  ? 398  LEU A CA   1 
ATOM   3049 C C    . LEU A 1 397 ? 52.699  18.259 7.976   1.00 28.34  ? 398  LEU A C    1 
ATOM   3050 O O    . LEU A 1 397 ? 52.004  18.906 8.758   1.00 25.00  ? 398  LEU A O    1 
ATOM   3051 C CB   . LEU A 1 397 ? 52.037  15.891 7.458   1.00 30.95  ? 398  LEU A CB   1 
ATOM   3052 C CG   . LEU A 1 397 ? 51.034  15.676 8.596   1.00 30.42  ? 398  LEU A CG   1 
ATOM   3053 C CD1  . LEU A 1 397 ? 49.620  16.015 8.125   1.00 25.65  ? 398  LEU A CD1  1 
ATOM   3054 C CD2  . LEU A 1 397 ? 51.088  14.253 9.150   1.00 28.59  ? 398  LEU A CD2  1 
ATOM   3055 N N    . SER A 1 398 ? 54.022  18.336 7.957   1.00 20.76  ? 399  SER A N    1 
ATOM   3056 C CA   . SER A 1 398 ? 54.734  19.273 8.808   1.00 30.07  ? 399  SER A CA   1 
ATOM   3057 C C    . SER A 1 398 ? 54.252  20.707 8.547   1.00 26.78  ? 399  SER A C    1 
ATOM   3058 O O    . SER A 1 398 ? 53.989  21.468 9.484   1.00 29.62  ? 399  SER A O    1 
ATOM   3059 C CB   . SER A 1 398 ? 56.243  19.147 8.581   1.00 28.47  ? 399  SER A CB   1 
ATOM   3060 O OG   . SER A 1 398 ? 56.939  20.117 9.339   1.00 29.78  ? 399  SER A OG   1 
ATOM   3061 N N    . ASP A 1 399 ? 54.122  21.071 7.278   1.00 19.99  ? 400  ASP A N    1 
ATOM   3062 C CA   . ASP A 1 399 ? 53.614  22.396 6.929   1.00 20.71  ? 400  ASP A CA   1 
ATOM   3063 C C    . ASP A 1 399 ? 52.169  22.601 7.390   1.00 26.41  ? 400  ASP A C    1 
ATOM   3064 O O    . ASP A 1 399 ? 51.828  23.682 7.886   1.00 20.29  ? 400  ASP A O    1 
ATOM   3065 C CB   . ASP A 1 399 ? 53.717  22.642 5.419   1.00 26.51  ? 400  ASP A CB   1 
ATOM   3066 C CG   . ASP A 1 399 ? 55.159  22.777 4.941   1.00 44.26  ? 400  ASP A CG   1 
ATOM   3067 O OD1  . ASP A 1 399 ? 56.049  23.128 5.755   1.00 47.46  ? 400  ASP A OD1  1 
ATOM   3068 O OD2  . ASP A 1 399 ? 55.398  22.533 3.739   1.00 56.66  ? 400  ASP A OD2  1 
ATOM   3069 N N    . VAL A 1 400 ? 51.328  21.572 7.227   1.00 19.44  ? 401  VAL A N    1 
ATOM   3070 C CA   . VAL A 1 400 ? 49.933  21.652 7.674   1.00 21.79  ? 401  VAL A CA   1 
ATOM   3071 C C    . VAL A 1 400 ? 49.876  22.040 9.148   1.00 24.39  ? 401  VAL A C    1 
ATOM   3072 O O    . VAL A 1 400 ? 49.218  23.007 9.536   1.00 21.53  ? 401  VAL A O    1 
ATOM   3073 C CB   . VAL A 1 400 ? 49.187  20.307 7.494   1.00 25.60  ? 401  VAL A CB   1 
ATOM   3074 C CG1  . VAL A 1 400 ? 47.918  20.285 8.332   1.00 19.52  ? 401  VAL A CG1  1 
ATOM   3075 C CG2  . VAL A 1 400 ? 48.865  20.059 6.016   1.00 20.43  ? 401  VAL A CG2  1 
ATOM   3076 N N    . VAL A 1 401 ? 50.587  21.274 9.963   1.00 27.65  ? 402  VAL A N    1 
ATOM   3077 C CA   . VAL A 1 401 ? 50.578  21.476 11.398  1.00 22.53  ? 402  VAL A CA   1 
ATOM   3078 C C    . VAL A 1 401 ? 51.218  22.810 11.773  1.00 22.76  ? 402  VAL A C    1 
ATOM   3079 O O    . VAL A 1 401 ? 50.674  23.551 12.593  1.00 20.15  ? 402  VAL A O    1 
ATOM   3080 C CB   . VAL A 1 401 ? 51.296  20.322 12.111  1.00 24.37  ? 402  VAL A CB   1 
ATOM   3081 C CG1  . VAL A 1 401 ? 51.430  20.625 13.593  1.00 19.74  ? 402  VAL A CG1  1 
ATOM   3082 C CG2  . VAL A 1 401 ? 50.513  19.023 11.884  1.00 21.90  ? 402  VAL A CG2  1 
ATOM   3083 N N    . GLY A 1 402 ? 52.369  23.111 11.168  1.00 20.44  ? 403  GLY A N    1 
ATOM   3084 C CA   . GLY A 1 402 ? 53.074  24.348 11.442  1.00 19.01  ? 403  GLY A CA   1 
ATOM   3085 C C    . GLY A 1 402 ? 52.327  25.580 10.972  1.00 27.13  ? 403  GLY A C    1 
ATOM   3086 O O    . GLY A 1 402 ? 52.323  26.601 11.662  1.00 24.18  ? 403  GLY A O    1 
ATOM   3087 N N    . ASP A 1 403 ? 51.699  25.502 9.798   1.00 18.74  ? 404  ASP A N    1 
ATOM   3088 C CA   . ASP A 1 403 ? 50.974  26.661 9.272   1.00 18.59  ? 404  ASP A CA   1 
ATOM   3089 C C    . ASP A 1 403 ? 49.743  26.971 10.115  1.00 21.66  ? 404  ASP A C    1 
ATOM   3090 O O    . ASP A 1 403 ? 49.484  28.119 10.480  1.00 20.88  ? 404  ASP A O    1 
ATOM   3091 C CB   . ASP A 1 403 ? 50.560  26.443 7.808   1.00 22.88  ? 404  ASP A CB   1 
ATOM   3092 C CG   . ASP A 1 403 ? 51.762  26.390 6.854   1.00 28.80  ? 404  ASP A CG   1 
ATOM   3093 O OD1  . ASP A 1 403 ? 52.888  26.685 7.296   1.00 31.00  ? 404  ASP A OD1  1 
ATOM   3094 O OD2  . ASP A 1 403 ? 51.584  26.062 5.660   1.00 25.54  ? 404  ASP A OD2  1 
ATOM   3095 N N    . HIS A 1 404 ? 48.987  25.922 10.414  1.00 20.75  ? 405  HIS A N    1 
ATOM   3096 C CA   . HIS A 1 404 ? 47.712  26.045 11.082  1.00 22.44  ? 405  HIS A CA   1 
ATOM   3097 C C    . HIS A 1 404 ? 47.874  26.546 12.529  1.00 24.88  ? 405  HIS A C    1 
ATOM   3098 O O    . HIS A 1 404 ? 47.112  27.397 13.000  1.00 19.63  ? 405  HIS A O    1 
ATOM   3099 C CB   . HIS A 1 404 ? 47.015  24.689 11.055  1.00 20.48  ? 405  HIS A CB   1 
ATOM   3100 C CG   . HIS A 1 404 ? 45.718  24.660 11.786  1.00 30.13  ? 405  HIS A CG   1 
ATOM   3101 N ND1  . HIS A 1 404 ? 44.760  25.657 11.640  1.00 31.61  ? 405  HIS A ND1  1 
ATOM   3102 C CD2  . HIS A 1 404 ? 45.205  23.773 12.660  1.00 29.20  ? 405  HIS A CD2  1 
ATOM   3103 C CE1  . HIS A 1 404 ? 43.720  25.361 12.386  1.00 28.13  ? 405  HIS A CE1  1 
ATOM   3104 N NE2  . HIS A 1 404 ? 43.956  24.225 13.023  1.00 30.10  ? 405  HIS A NE2  1 
ATOM   3105 N N    . ASN A 1 405 ? 48.886  26.031 13.216  1.00 19.40  ? 406  ASN A N    1 
ATOM   3106 C CA   . ASN A 1 405 ? 49.098  26.337 14.631  1.00 21.21  ? 406  ASN A CA   1 
ATOM   3107 C C    . ASN A 1 405 ? 50.018  27.513 14.952  1.00 23.21  ? 406  ASN A C    1 
ATOM   3108 O O    . ASN A 1 405 ? 49.903  28.101 16.020  1.00 24.72  ? 406  ASN A O    1 
ATOM   3109 C CB   . ASN A 1 405 ? 49.576  25.085 15.373  1.00 18.84  ? 406  ASN A CB   1 
ATOM   3110 C CG   . ASN A 1 405 ? 48.501  24.032 15.443  1.00 30.18  ? 406  ASN A CG   1 
ATOM   3111 O OD1  . ASN A 1 405 ? 47.470  24.239 16.094  1.00 25.34  ? 406  ASN A OD1  1 
ATOM   3112 N ND2  . ASN A 1 405 ? 48.711  22.901 14.750  1.00 19.21  ? 406  ASN A ND2  1 
ATOM   3113 N N    . VAL A 1 406 ? 50.928  27.852 14.044  1.00 18.50  ? 407  VAL A N    1 
ATOM   3114 C CA   . VAL A 1 406 ? 51.936  28.872 14.333  1.00 18.49  ? 407  VAL A CA   1 
ATOM   3115 C C    . VAL A 1 406 ? 52.101  29.957 13.249  1.00 24.06  ? 407  VAL A C    1 
ATOM   3116 O O    . VAL A 1 406 ? 51.838  31.132 13.503  1.00 23.17  ? 407  VAL A O    1 
ATOM   3117 C CB   . VAL A 1 406 ? 53.316  28.233 14.643  1.00 21.18  ? 407  VAL A CB   1 
ATOM   3118 C CG1  . VAL A 1 406 ? 54.355  29.308 14.937  1.00 19.07  ? 407  VAL A CG1  1 
ATOM   3119 C CG2  . VAL A 1 406 ? 53.192  27.287 15.815  1.00 20.68  ? 407  VAL A CG2  1 
ATOM   3120 N N    . VAL A 1 407 ? 52.520  29.570 12.049  1.00 22.22  ? 408  VAL A N    1 
ATOM   3121 C CA   . VAL A 1 407 ? 52.867  30.569 11.038  1.00 21.57  ? 408  VAL A CA   1 
ATOM   3122 C C    . VAL A 1 407 ? 51.685  31.441 10.660  1.00 21.48  ? 408  VAL A C    1 
ATOM   3123 O O    . VAL A 1 407 ? 51.792  32.661 10.614  1.00 25.43  ? 408  VAL A O    1 
ATOM   3124 C CB   . VAL A 1 407 ? 53.449  29.939 9.765   1.00 27.78  ? 408  VAL A CB   1 
ATOM   3125 C CG1  . VAL A 1 407 ? 53.883  31.028 8.793   1.00 18.87  ? 408  VAL A CG1  1 
ATOM   3126 C CG2  . VAL A 1 407 ? 54.613  29.026 10.116  1.00 18.84  ? 408  VAL A CG2  1 
ATOM   3127 N N    . CYS A 1 408 ? 50.542  30.832 10.401  1.00 18.50  ? 409  CYS A N    1 
ATOM   3128 C CA   . CYS A 1 408 ? 49.408  31.636 9.951   1.00 19.33  ? 409  CYS A CA   1 
ATOM   3129 C C    . CYS A 1 408 ? 48.804  32.515 11.054  1.00 24.90  ? 409  CYS A C    1 
ATOM   3130 O O    . CYS A 1 408 ? 48.503  33.687 10.813  1.00 28.25  ? 409  CYS A O    1 
ATOM   3131 C CB   . CYS A 1 408 ? 48.398  30.771 9.201   1.00 19.45  ? 409  CYS A CB   1 
ATOM   3132 S SG   . CYS A 1 408 ? 49.190  30.099 7.669   1.00 27.74  ? 409  CYS A SG   1 
ATOM   3133 N N    . PRO A 1 409 ? 48.691  31.984 12.285  1.00 18.58  ? 410  PRO A N    1 
ATOM   3134 C CA   . PRO A 1 409 ? 48.300  32.860 13.408  1.00 18.71  ? 410  PRO A CA   1 
ATOM   3135 C C    . PRO A 1 409 ? 49.300  34.018 13.648  1.00 23.03  ? 410  PRO A C    1 
ATOM   3136 O O    . PRO A 1 409 ? 48.865  35.141 13.914  1.00 22.33  ? 410  PRO A O    1 
ATOM   3137 C CB   . PRO A 1 409 ? 48.254  31.901 14.612  1.00 18.65  ? 410  PRO A CB   1 
ATOM   3138 C CG   . PRO A 1 409 ? 47.971  30.537 13.995  1.00 18.57  ? 410  PRO A CG   1 
ATOM   3139 C CD   . PRO A 1 409 ? 48.740  30.561 12.669  1.00 18.49  ? 410  PRO A CD   1 
ATOM   3140 N N    . VAL A 1 410 ? 50.605  33.768 13.538  1.00 21.41  ? 411  VAL A N    1 
ATOM   3141 C CA   . VAL A 1 410 ? 51.591  34.846 13.648  1.00 18.90  ? 411  VAL A CA   1 
ATOM   3142 C C    . VAL A 1 410 ? 51.441  35.869 12.511  1.00 24.72  ? 411  VAL A C    1 
ATOM   3143 O O    . VAL A 1 410 ? 51.413  37.073 12.754  1.00 20.63  ? 411  VAL A O    1 
ATOM   3144 C CB   . VAL A 1 410 ? 53.029  34.308 13.670  1.00 22.04  ? 411  VAL A CB   1 
ATOM   3145 C CG1  . VAL A 1 410 ? 54.035  35.452 13.574  1.00 19.11  ? 411  VAL A CG1  1 
ATOM   3146 C CG2  . VAL A 1 410 ? 53.267  33.483 14.924  1.00 18.73  ? 411  VAL A CG2  1 
ATOM   3147 N N    . ALA A 1 411 ? 51.328  35.385 11.275  1.00 19.77  ? 412  ALA A N    1 
ATOM   3148 C CA   . ALA A 1 411 ? 51.122  36.266 10.119  1.00 29.27  ? 412  ALA A CA   1 
ATOM   3149 C C    . ALA A 1 411 ? 49.876  37.148 10.270  1.00 31.20  ? 412  ALA A C    1 
ATOM   3150 O O    . ALA A 1 411 ? 49.914  38.343 9.983   1.00 29.23  ? 412  ALA A O    1 
ATOM   3151 C CB   . ALA A 1 411 ? 51.041  35.450 8.824   1.00 23.62  ? 412  ALA A CB   1 
ATOM   3152 N N    . GLN A 1 412 ? 48.771  36.558 10.715  1.00 26.31  ? 413  GLN A N    1 
ATOM   3153 C CA   . GLN A 1 412 ? 47.549  37.329 10.908  1.00 26.77  ? 413  GLN A CA   1 
ATOM   3154 C C    . GLN A 1 412 ? 47.779  38.419 11.936  1.00 32.83  ? 413  GLN A C    1 
ATOM   3155 O O    . GLN A 1 412 ? 47.386  39.569 11.743  1.00 34.04  ? 413  GLN A O    1 
ATOM   3156 C CB   . GLN A 1 412 ? 46.403  36.438 11.375  1.00 25.83  ? 413  GLN A CB   1 
ATOM   3157 C CG   . GLN A 1 412 ? 45.111  37.190 11.585  1.00 31.59  ? 413  GLN A CG   1 
ATOM   3158 C CD   . GLN A 1 412 ? 43.922  36.258 11.655  1.00 50.01  ? 413  GLN A CD   1 
ATOM   3159 O OE1  . GLN A 1 412 ? 43.904  35.318 12.453  1.00 58.47  ? 413  GLN A OE1  1 
ATOM   3160 N NE2  . GLN A 1 412 ? 42.927  36.500 10.810  1.00 54.35  ? 413  GLN A NE2  1 
ATOM   3161 N N    . LEU A 1 413 ? 48.427  38.047 13.033  1.00 32.43  ? 414  LEU A N    1 
ATOM   3162 C CA   . LEU A 1 413 ? 48.704  38.982 14.109  1.00 31.62  ? 414  LEU A CA   1 
ATOM   3163 C C    . LEU A 1 413 ? 49.541  40.160 13.611  1.00 33.08  ? 414  LEU A C    1 
ATOM   3164 O O    . LEU A 1 413 ? 49.204  41.320 13.829  1.00 20.75  ? 414  LEU A O    1 
ATOM   3165 C CB   . LEU A 1 413 ? 49.450  38.263 15.228  1.00 23.35  ? 414  LEU A CB   1 
ATOM   3166 C CG   . LEU A 1 413 ? 49.820  39.186 16.383  1.00 30.55  ? 414  LEU A CG   1 
ATOM   3167 C CD1  . LEU A 1 413 ? 48.618  39.367 17.255  1.00 33.37  ? 414  LEU A CD1  1 
ATOM   3168 C CD2  . LEU A 1 413 ? 50.965  38.622 17.172  1.00 36.49  ? 414  LEU A CD2  1 
ATOM   3169 N N    . ALA A 1 414 ? 50.648  39.837 12.956  1.00 20.18  ? 415  ALA A N    1 
ATOM   3170 C CA   . ALA A 1 414 ? 51.569  40.833 12.433  1.00 27.12  ? 415  ALA A CA   1 
ATOM   3171 C C    . ALA A 1 414 ? 50.851  41.750 11.453  1.00 30.74  ? 415  ALA A C    1 
ATOM   3172 O O    . ALA A 1 414 ? 50.976  42.976 11.530  1.00 30.29  ? 415  ALA A O    1 
ATOM   3173 C CB   . ALA A 1 414 ? 52.739  40.140 11.739  1.00 24.69  ? 415  ALA A CB   1 
ATOM   3174 N N    . GLY A 1 415 ? 50.111  41.140 10.527  1.00 27.70  ? 416  GLY A N    1 
ATOM   3175 C CA   . GLY A 1 415 ? 49.363  41.874 9.522   1.00 28.93  ? 416  GLY A CA   1 
ATOM   3176 C C    . GLY A 1 415 ? 48.371  42.862 10.103  1.00 31.90  ? 416  GLY A C    1 
ATOM   3177 O O    . GLY A 1 415 ? 48.394  44.049 9.762   1.00 35.31  ? 416  GLY A O    1 
ATOM   3178 N N    . ARG A 1 416 ? 47.506  42.382 10.991  1.00 28.70  ? 417  ARG A N    1 
ATOM   3179 C CA   . ARG A 1 416 ? 46.493  43.241 11.579  1.00 29.70  ? 417  ARG A CA   1 
ATOM   3180 C C    . ARG A 1 416 ? 47.099  44.304 12.471  1.00 32.80  ? 417  ARG A C    1 
ATOM   3181 O O    . ARG A 1 416 ? 46.673  45.457 12.437  1.00 37.56  ? 417  ARG A O    1 
ATOM   3182 C CB   . ARG A 1 416 ? 45.462  42.427 12.349  1.00 30.56  ? 417  ARG A CB   1 
ATOM   3183 C CG   . ARG A 1 416 ? 44.685  41.496 11.456  1.00 38.98  ? 417  ARG A CG   1 
ATOM   3184 C CD   . ARG A 1 416 ? 44.261  42.215 10.194  1.00 43.89  ? 417  ARG A CD   1 
ATOM   3185 N NE   . ARG A 1 416 ? 42.849  42.007 9.917   1.00 54.02  ? 417  ARG A NE   1 
ATOM   3186 C CZ   . ARG A 1 416 ? 41.896  42.895 10.182  1.00 60.53  ? 417  ARG A CZ   1 
ATOM   3187 N NH1  . ARG A 1 416 ? 42.206  44.070 10.721  1.00 59.88  ? 417  ARG A NH1  1 
ATOM   3188 N NH2  . ARG A 1 416 ? 40.631  42.605 9.900   1.00 59.58  ? 417  ARG A NH2  1 
ATOM   3189 N N    . LEU A 1 417 ? 48.095  43.933 13.265  1.00 30.17  ? 418  LEU A N    1 
ATOM   3190 C CA   . LEU A 1 417 ? 48.724  44.922 14.137  1.00 33.10  ? 418  LEU A CA   1 
ATOM   3191 C C    . LEU A 1 417 ? 49.332  46.055 13.306  1.00 35.12  ? 418  LEU A C    1 
ATOM   3192 O O    . LEU A 1 417 ? 49.183  47.232 13.656  1.00 33.71  ? 418  LEU A O    1 
ATOM   3193 C CB   . LEU A 1 417 ? 49.784  44.292 15.050  1.00 31.28  ? 418  LEU A CB   1 
ATOM   3194 C CG   . LEU A 1 417 ? 49.357  43.356 16.184  1.00 32.49  ? 418  LEU A CG   1 
ATOM   3195 C CD1  . LEU A 1 417 ? 50.534  43.115 17.100  1.00 28.14  ? 418  LEU A CD1  1 
ATOM   3196 C CD2  . LEU A 1 417 ? 48.186  43.902 16.970  1.00 35.34  ? 418  LEU A CD2  1 
ATOM   3197 N N    . ALA A 1 418 ? 50.006  45.701 12.207  1.00 29.19  ? 419  ALA A N    1 
ATOM   3198 C CA   . ALA A 1 418 ? 50.615  46.710 11.331  1.00 29.43  ? 419  ALA A CA   1 
ATOM   3199 C C    . ALA A 1 418 ? 49.548  47.625 10.749  1.00 27.74  ? 419  ALA A C    1 
ATOM   3200 O O    . ALA A 1 418 ? 49.620  48.845 10.891  1.00 38.22  ? 419  ALA A O    1 
ATOM   3201 C CB   . ALA A 1 418 ? 51.421  46.062 10.217  1.00 23.07  ? 419  ALA A CB   1 
ATOM   3202 N N    . ALA A 1 419 ? 48.550  47.026 10.111  1.00 25.37  ? 420  ALA A N    1 
ATOM   3203 C CA   . ALA A 1 419 ? 47.465  47.780 9.481   1.00 30.80  ? 420  ALA A CA   1 
ATOM   3204 C C    . ALA A 1 419 ? 46.722  48.706 10.450  1.00 35.59  ? 420  ALA A C    1 
ATOM   3205 O O    . ALA A 1 419 ? 45.994  49.594 10.028  1.00 41.59  ? 420  ALA A O    1 
ATOM   3206 C CB   . ALA A 1 419 ? 46.491  46.830 8.814   1.00 23.85  ? 420  ALA A CB   1 
ATOM   3207 N N    . GLN A 1 420 ? 46.921  48.505 11.748  1.00 39.29  ? 421  GLN A N    1 
ATOM   3208 C CA   . GLN A 1 420 ? 46.173  49.250 12.750  1.00 32.46  ? 421  GLN A CA   1 
ATOM   3209 C C    . GLN A 1 420 ? 47.051  50.075 13.660  1.00 31.23  ? 421  GLN A C    1 
ATOM   3210 O O    . GLN A 1 420 ? 46.645  50.441 14.766  1.00 32.84  ? 421  GLN A O    1 
ATOM   3211 C CB   . GLN A 1 420 ? 45.273  48.306 13.545  1.00 34.88  ? 421  GLN A CB   1 
ATOM   3212 C CG   . GLN A 1 420 ? 44.198  47.681 12.654  1.00 40.79  ? 421  GLN A CG   1 
ATOM   3213 C CD   . GLN A 1 420 ? 43.538  46.478 13.286  1.00 45.38  ? 421  GLN A CD   1 
ATOM   3214 O OE1  . GLN A 1 420 ? 43.235  45.498 12.606  1.00 51.42  ? 421  GLN A OE1  1 
ATOM   3215 N NE2  . GLN A 1 420 ? 43.299  46.548 14.592  1.00 46.30  ? 421  GLN A NE2  1 
ATOM   3216 N N    . GLY A 1 421 ? 48.258  50.376 13.193  1.00 34.71  ? 422  GLY A N    1 
ATOM   3217 C CA   . GLY A 1 421 ? 49.068  51.387 13.848  1.00 33.59  ? 422  GLY A CA   1 
ATOM   3218 C C    . GLY A 1 421 ? 50.346  50.927 14.510  1.00 37.65  ? 422  GLY A C    1 
ATOM   3219 O O    . GLY A 1 421 ? 51.138  51.762 14.961  1.00 40.81  ? 422  GLY A O    1 
ATOM   3220 N N    . ALA A 1 422 ? 50.559  49.614 14.582  1.00 33.88  ? 423  ALA A N    1 
ATOM   3221 C CA   . ALA A 1 422 ? 51.739  49.084 15.285  1.00 36.14  ? 423  ALA A CA   1 
ATOM   3222 C C    . ALA A 1 422 ? 52.957  49.104 14.381  1.00 33.12  ? 423  ALA A C    1 
ATOM   3223 O O    . ALA A 1 422 ? 52.833  48.926 13.166  1.00 36.30  ? 423  ALA A O    1 
ATOM   3224 C CB   . ALA A 1 422 ? 51.485  47.659 15.779  1.00 31.72  ? 423  ALA A CB   1 
ATOM   3225 N N    . ARG A 1 423 ? 54.133  49.314 14.962  1.00 32.02  ? 424  ARG A N    1 
ATOM   3226 C CA   . ARG A 1 423 ? 55.355  49.034 14.222  1.00 31.89  ? 424  ARG A CA   1 
ATOM   3227 C C    . ARG A 1 423 ? 55.771  47.595 14.516  1.00 33.10  ? 424  ARG A C    1 
ATOM   3228 O O    . ARG A 1 423 ? 56.007  47.219 15.675  1.00 30.68  ? 424  ARG A O    1 
ATOM   3229 C CB   . ARG A 1 423 ? 56.478  50.010 14.573  1.00 39.09  ? 424  ARG A CB   1 
ATOM   3230 C CG   . ARG A 1 423 ? 57.564  50.055 13.493  1.00 50.11  ? 424  ARG A CG   1 
ATOM   3231 C CD   . ARG A 1 423 ? 58.319  51.387 13.451  1.00 62.29  ? 424  ARG A CD   1 
ATOM   3232 N NE   . ARG A 1 423 ? 59.476  51.399 14.345  1.00 69.42  ? 424  ARG A NE   1 
ATOM   3233 C CZ   . ARG A 1 423 ? 59.526  52.054 15.500  1.00 73.05  ? 424  ARG A CZ   1 
ATOM   3234 N NH1  . ARG A 1 423 ? 58.482  52.767 15.906  1.00 76.24  ? 424  ARG A NH1  1 
ATOM   3235 N NH2  . ARG A 1 423 ? 60.621  52.003 16.247  1.00 73.44  ? 424  ARG A NH2  1 
ATOM   3236 N N    . VAL A 1 424 ? 55.854  46.798 13.459  1.00 23.32  ? 425  VAL A N    1 
ATOM   3237 C CA   . VAL A 1 424 ? 56.053  45.360 13.567  1.00 23.74  ? 425  VAL A CA   1 
ATOM   3238 C C    . VAL A 1 424 ? 57.305  44.944 12.817  1.00 30.92  ? 425  VAL A C    1 
ATOM   3239 O O    . VAL A 1 424 ? 57.516  45.391 11.692  1.00 36.23  ? 425  VAL A O    1 
ATOM   3240 C CB   . VAL A 1 424 ? 54.888  44.610 12.898  1.00 24.26  ? 425  VAL A CB   1 
ATOM   3241 C CG1  . VAL A 1 424 ? 55.073  43.083 13.026  1.00 21.52  ? 425  VAL A CG1  1 
ATOM   3242 C CG2  . VAL A 1 424 ? 53.555  45.064 13.463  1.00 22.30  ? 425  VAL A CG2  1 
ATOM   3243 N N    . TYR A 1 425 ? 58.121  44.084 13.428  1.00 22.26  ? 426  TYR A N    1 
ATOM   3244 C CA   . TYR A 1 425 ? 59.256  43.465 12.739  1.00 27.00  ? 426  TYR A CA   1 
ATOM   3245 C C    . TYR A 1 425 ? 59.112  41.954 12.769  1.00 29.72  ? 426  TYR A C    1 
ATOM   3246 O O    . TYR A 1 425 ? 58.789  41.374 13.811  1.00 28.90  ? 426  TYR A O    1 
ATOM   3247 C CB   . TYR A 1 425 ? 60.584  43.862 13.390  1.00 24.18  ? 426  TYR A CB   1 
ATOM   3248 C CG   . TYR A 1 425 ? 60.844  45.333 13.320  1.00 26.15  ? 426  TYR A CG   1 
ATOM   3249 C CD1  . TYR A 1 425 ? 61.467  45.897 12.216  1.00 26.25  ? 426  TYR A CD1  1 
ATOM   3250 C CD2  . TYR A 1 425 ? 60.445  46.167 14.353  1.00 30.99  ? 426  TYR A CD2  1 
ATOM   3251 C CE1  . TYR A 1 425 ? 61.696  47.260 12.157  1.00 33.04  ? 426  TYR A CE1  1 
ATOM   3252 C CE2  . TYR A 1 425 ? 60.667  47.521 14.304  1.00 31.35  ? 426  TYR A CE2  1 
ATOM   3253 C CZ   . TYR A 1 425 ? 61.290  48.062 13.210  1.00 30.30  ? 426  TYR A CZ   1 
ATOM   3254 O OH   . TYR A 1 425 ? 61.489  49.415 13.174  1.00 32.91  ? 426  TYR A OH   1 
ATOM   3255 N N    . ALA A 1 426 ? 59.360  41.313 11.634  1.00 24.40  ? 427  ALA A N    1 
ATOM   3256 C CA   . ALA A 1 426 ? 59.153  39.874 11.545  1.00 22.45  ? 427  ALA A CA   1 
ATOM   3257 C C    . ALA A 1 426 ? 60.412  39.188 11.074  1.00 23.27  ? 427  ALA A C    1 
ATOM   3258 O O    . ALA A 1 426 ? 61.131  39.710 10.214  1.00 28.88  ? 427  ALA A O    1 
ATOM   3259 C CB   . ALA A 1 426 ? 58.017  39.561 10.602  1.00 27.60  ? 427  ALA A CB   1 
ATOM   3260 N N    . TYR A 1 427 ? 60.656  38.001 11.614  1.00 20.92  ? 428  TYR A N    1 
ATOM   3261 C CA   . TYR A 1 427 ? 61.821  37.216 11.223  1.00 21.95  ? 428  TYR A CA   1 
ATOM   3262 C C    . TYR A 1 427 ? 61.407  35.779 10.941  1.00 25.59  ? 428  TYR A C    1 
ATOM   3263 O O    . TYR A 1 427 ? 60.352  35.324 11.384  1.00 24.21  ? 428  TYR A O    1 
ATOM   3264 C CB   . TYR A 1 427 ? 62.884  37.230 12.332  1.00 21.25  ? 428  TYR A CB   1 
ATOM   3265 C CG   . TYR A 1 427 ? 62.442  36.514 13.597  1.00 23.10  ? 428  TYR A CG   1 
ATOM   3266 C CD1  . TYR A 1 427 ? 62.505  35.126 13.684  1.00 21.72  ? 428  TYR A CD1  1 
ATOM   3267 C CD2  . TYR A 1 427 ? 61.954  37.221 14.695  1.00 22.50  ? 428  TYR A CD2  1 
ATOM   3268 C CE1  . TYR A 1 427 ? 62.101  34.460 14.817  1.00 24.92  ? 428  TYR A CE1  1 
ATOM   3269 C CE2  . TYR A 1 427 ? 61.548  36.556 15.850  1.00 24.53  ? 428  TYR A CE2  1 
ATOM   3270 C CZ   . TYR A 1 427 ? 61.628  35.170 15.897  1.00 28.05  ? 428  TYR A CZ   1 
ATOM   3271 O OH   . TYR A 1 427 ? 61.234  34.466 17.015  1.00 28.02  ? 428  TYR A OH   1 
ATOM   3272 N N    . VAL A 1 428 ? 62.261  35.070 10.219  1.00 25.63  ? 429  VAL A N    1 
ATOM   3273 C CA   . VAL A 1 428 ? 62.212  33.622 10.162  1.00 22.01  ? 429  VAL A CA   1 
ATOM   3274 C C    . VAL A 1 428 ? 63.593  33.131 10.597  1.00 24.79  ? 429  VAL A C    1 
ATOM   3275 O O    . VAL A 1 428 ? 64.614  33.537 10.031  1.00 32.80  ? 429  VAL A O    1 
ATOM   3276 C CB   . VAL A 1 428 ? 61.869  33.121 8.745   1.00 24.48  ? 429  VAL A CB   1 
ATOM   3277 C CG1  . VAL A 1 428 ? 61.883  31.595 8.700   1.00 26.32  ? 429  VAL A CG1  1 
ATOM   3278 C CG2  . VAL A 1 428 ? 60.507  33.630 8.341   1.00 31.65  ? 429  VAL A CG2  1 
ATOM   3279 N N    . PHE A 1 429 ? 63.621  32.271 11.607  1.00 25.73  ? 430  PHE A N    1 
ATOM   3280 C CA   . PHE A 1 429 ? 64.869  31.750 12.145  1.00 22.34  ? 430  PHE A CA   1 
ATOM   3281 C C    . PHE A 1 429 ? 65.284  30.485 11.393  1.00 23.46  ? 430  PHE A C    1 
ATOM   3282 O O    . PHE A 1 429 ? 64.556  29.501 11.402  1.00 31.08  ? 430  PHE A O    1 
ATOM   3283 C CB   . PHE A 1 429 ? 64.685  31.446 13.629  1.00 23.33  ? 430  PHE A CB   1 
ATOM   3284 C CG   . PHE A 1 429 ? 65.934  30.981 14.304  1.00 27.60  ? 430  PHE A CG   1 
ATOM   3285 C CD1  . PHE A 1 429 ? 66.852  31.905 14.802  1.00 26.85  ? 430  PHE A CD1  1 
ATOM   3286 C CD2  . PHE A 1 429 ? 66.201  29.624 14.440  1.00 26.42  ? 430  PHE A CD2  1 
ATOM   3287 C CE1  . PHE A 1 429 ? 68.016  31.482 15.430  1.00 29.31  ? 430  PHE A CE1  1 
ATOM   3288 C CE2  . PHE A 1 429 ? 67.364  29.192 15.065  1.00 29.54  ? 430  PHE A CE2  1 
ATOM   3289 C CZ   . PHE A 1 429 ? 68.273  30.122 15.559  1.00 30.04  ? 430  PHE A CZ   1 
ATOM   3290 N N    . GLU A 1 430 ? 66.452  30.506 10.755  1.00 23.58  ? 431  GLU A N    1 
ATOM   3291 C CA   . GLU A 1 430 ? 66.808  29.460 9.796   1.00 29.34  ? 431  GLU A CA   1 
ATOM   3292 C C    . GLU A 1 430 ? 68.048  28.660 10.125  1.00 33.62  ? 431  GLU A C    1 
ATOM   3293 O O    . GLU A 1 430 ? 68.491  27.852 9.318   1.00 33.32  ? 431  GLU A O    1 
ATOM   3294 C CB   . GLU A 1 430 ? 66.968  30.046 8.394   1.00 30.00  ? 431  GLU A CB   1 
ATOM   3295 C CG   . GLU A 1 430 ? 65.650  30.443 7.769   1.00 47.08  ? 431  GLU A CG   1 
ATOM   3296 C CD   . GLU A 1 430 ? 65.760  30.760 6.290   1.00 53.70  ? 431  GLU A CD   1 
ATOM   3297 O OE1  . GLU A 1 430 ? 66.870  31.114 5.822   1.00 59.14  ? 431  GLU A OE1  1 
ATOM   3298 O OE2  . GLU A 1 430 ? 64.721  30.659 5.602   1.00 48.87  ? 431  GLU A OE2  1 
ATOM   3299 N N    . HIS A 1 431 ? 68.614  28.872 11.301  1.00 37.02  ? 432  HIS A N    1 
ATOM   3300 C CA   . HIS A 1 431 ? 69.805  28.124 11.671  1.00 33.47  ? 432  HIS A CA   1 
ATOM   3301 C C    . HIS A 1 431 ? 69.476  26.871 12.475  1.00 32.01  ? 432  HIS A C    1 
ATOM   3302 O O    . HIS A 1 431 ? 68.806  26.936 13.502  1.00 30.89  ? 432  HIS A O    1 
ATOM   3303 C CB   . HIS A 1 431 ? 70.780  28.996 12.466  1.00 30.31  ? 432  HIS A CB   1 
ATOM   3304 C CG   . HIS A 1 431 ? 71.988  28.253 12.938  1.00 31.39  ? 432  HIS A CG   1 
ATOM   3305 N ND1  . HIS A 1 431 ? 72.925  27.731 12.070  1.00 32.80  ? 432  HIS A ND1  1 
ATOM   3306 C CD2  . HIS A 1 431 ? 72.407  27.927 14.184  1.00 31.22  ? 432  HIS A CD2  1 
ATOM   3307 C CE1  . HIS A 1 431 ? 73.873  27.126 12.762  1.00 35.86  ? 432  HIS A CE1  1 
ATOM   3308 N NE2  . HIS A 1 431 ? 73.582  27.228 14.048  1.00 34.37  ? 432  HIS A NE2  1 
ATOM   3309 N N    . ARG A 1 432 ? 69.968  25.733 12.004  1.00 31.35  ? 433  ARG A N    1 
ATOM   3310 C CA   . ARG A 1 432 ? 69.869  24.503 12.758  1.00 31.45  ? 433  ARG A CA   1 
ATOM   3311 C C    . ARG A 1 432 ? 71.113  24.359 13.631  1.00 33.59  ? 433  ARG A C    1 
ATOM   3312 O O    . ARG A 1 432 ? 72.232  24.311 13.126  1.00 36.80  ? 433  ARG A O    1 
ATOM   3313 C CB   . ARG A 1 432 ? 69.739  23.311 11.810  1.00 34.91  ? 433  ARG A CB   1 
ATOM   3314 C CG   . ARG A 1 432 ? 69.667  21.973 12.518  1.00 35.37  ? 433  ARG A CG   1 
ATOM   3315 C CD   . ARG A 1 432 ? 69.434  20.843 11.544  1.00 32.19  ? 433  ARG A CD   1 
ATOM   3316 N NE   . ARG A 1 432 ? 69.682  19.556 12.187  1.00 38.02  ? 433  ARG A NE   1 
ATOM   3317 C CZ   . ARG A 1 432 ? 68.734  18.727 12.619  1.00 38.92  ? 433  ARG A CZ   1 
ATOM   3318 N NH1  . ARG A 1 432 ? 67.447  19.033 12.468  1.00 34.84  ? 433  ARG A NH1  1 
ATOM   3319 N NH2  . ARG A 1 432 ? 69.081  17.580 13.192  1.00 36.55  ? 433  ARG A NH2  1 
ATOM   3320 N N    . ALA A 1 433 ? 70.907  24.298 14.944  1.00 29.55  ? 434  ALA A N    1 
ATOM   3321 C CA   . ALA A 1 433 ? 71.995  24.192 15.911  1.00 32.83  ? 434  ALA A CA   1 
ATOM   3322 C C    . ALA A 1 433 ? 72.908  22.983 15.669  1.00 37.07  ? 434  ALA A C    1 
ATOM   3323 O O    . ALA A 1 433 ? 72.443  21.884 15.380  1.00 40.14  ? 434  ALA A O    1 
ATOM   3324 C CB   . ALA A 1 433 ? 71.428  24.143 17.321  1.00 24.16  ? 434  ALA A CB   1 
ATOM   3325 N N    . SER A 1 434 ? 74.210  23.186 15.806  1.00 34.26  ? 435  SER A N    1 
ATOM   3326 C CA   . SER A 1 434 ? 75.160  22.086 15.686  1.00 37.77  ? 435  SER A CA   1 
ATOM   3327 C C    . SER A 1 434 ? 74.953  21.040 16.784  1.00 40.59  ? 435  SER A C    1 
ATOM   3328 O O    . SER A 1 434 ? 75.360  19.893 16.633  1.00 44.18  ? 435  SER A O    1 
ATOM   3329 C CB   . SER A 1 434 ? 76.597  22.611 15.740  1.00 36.93  ? 435  SER A CB   1 
ATOM   3330 O OG   . SER A 1 434 ? 76.862  23.250 16.977  1.00 36.27  ? 435  SER A OG   1 
ATOM   3331 N N    . THR A 1 435 ? 74.313  21.441 17.881  1.00 40.66  ? 436  THR A N    1 
ATOM   3332 C CA   . THR A 1 435 ? 74.120  20.567 19.037  1.00 39.50  ? 436  THR A CA   1 
ATOM   3333 C C    . THR A 1 435 ? 72.745  19.894 19.047  1.00 38.43  ? 436  THR A C    1 
ATOM   3334 O O    . THR A 1 435 ? 72.410  19.157 19.972  1.00 40.41  ? 436  THR A O    1 
ATOM   3335 C CB   . THR A 1 435 ? 74.285  21.350 20.349  1.00 36.56  ? 436  THR A CB   1 
ATOM   3336 O OG1  . THR A 1 435 ? 73.404  22.480 20.332  1.00 37.72  ? 436  THR A OG1  1 
ATOM   3337 C CG2  . THR A 1 435 ? 75.709  21.841 20.504  1.00 34.35  ? 436  THR A CG2  1 
ATOM   3338 N N    . LEU A 1 436 ? 71.950  20.152 18.017  1.00 37.82  ? 437  LEU A N    1 
ATOM   3339 C CA   . LEU A 1 436 ? 70.584  19.627 17.948  1.00 40.12  ? 437  LEU A CA   1 
ATOM   3340 C C    . LEU A 1 436 ? 70.575  18.095 17.919  1.00 42.42  ? 437  LEU A C    1 
ATOM   3341 O O    . LEU A 1 436 ? 71.275  17.479 17.108  1.00 42.96  ? 437  LEU A O    1 
ATOM   3342 C CB   . LEU A 1 436 ? 69.880  20.177 16.709  1.00 38.23  ? 437  LEU A CB   1 
ATOM   3343 C CG   . LEU A 1 436 ? 68.363  20.069 16.680  1.00 38.00  ? 437  LEU A CG   1 
ATOM   3344 C CD1  . LEU A 1 436 ? 67.777  20.770 17.875  1.00 36.58  ? 437  LEU A CD1  1 
ATOM   3345 C CD2  . LEU A 1 436 ? 67.848  20.686 15.407  1.00 41.59  ? 437  LEU A CD2  1 
ATOM   3346 N N    . SER A 1 437 ? 69.779  17.482 18.796  1.00 36.21  ? 438  SER A N    1 
ATOM   3347 C CA   . SER A 1 437 ? 69.760  16.020 18.905  1.00 40.24  ? 438  SER A CA   1 
ATOM   3348 C C    . SER A 1 437 ? 68.612  15.369 18.121  1.00 39.33  ? 438  SER A C    1 
ATOM   3349 O O    . SER A 1 437 ? 68.596  14.152 17.922  1.00 40.98  ? 438  SER A O    1 
ATOM   3350 C CB   . SER A 1 437 ? 69.756  15.578 20.373  1.00 42.35  ? 438  SER A CB   1 
ATOM   3351 O OG   . SER A 1 437 ? 68.671  16.150 21.084  1.00 43.38  ? 438  SER A OG   1 
ATOM   3352 N N    . TRP A 1 438 ? 67.658  16.183 17.676  1.00 38.40  ? 439  TRP A N    1 
ATOM   3353 C CA   . TRP A 1 438 ? 66.581  15.698 16.820  1.00 37.12  ? 439  TRP A CA   1 
ATOM   3354 C C    . TRP A 1 438 ? 67.132  15.365 15.430  1.00 38.50  ? 439  TRP A C    1 
ATOM   3355 O O    . TRP A 1 438 ? 68.143  15.931 15.008  1.00 33.47  ? 439  TRP A O    1 
ATOM   3356 C CB   . TRP A 1 438 ? 65.456  16.741 16.723  1.00 28.97  ? 439  TRP A CB   1 
ATOM   3357 C CG   . TRP A 1 438 ? 64.770  16.960 18.022  1.00 31.59  ? 439  TRP A CG   1 
ATOM   3358 C CD1  . TRP A 1 438 ? 65.047  17.932 18.947  1.00 29.17  ? 439  TRP A CD1  1 
ATOM   3359 C CD2  . TRP A 1 438 ? 63.697  16.173 18.571  1.00 32.49  ? 439  TRP A CD2  1 
ATOM   3360 N NE1  . TRP A 1 438 ? 64.204  17.801 20.032  1.00 33.79  ? 439  TRP A NE1  1 
ATOM   3361 C CE2  . TRP A 1 438 ? 63.370  16.730 19.829  1.00 36.59  ? 439  TRP A CE2  1 
ATOM   3362 C CE3  . TRP A 1 438 ? 62.981  15.057 18.120  1.00 28.00  ? 439  TRP A CE3  1 
ATOM   3363 C CZ2  . TRP A 1 438 ? 62.351  16.205 20.640  1.00 37.80  ? 439  TRP A CZ2  1 
ATOM   3364 C CZ3  . TRP A 1 438 ? 61.980  14.534 18.925  1.00 32.79  ? 439  TRP A CZ3  1 
ATOM   3365 C CH2  . TRP A 1 438 ? 61.672  15.110 20.171  1.00 36.28  ? 439  TRP A CH2  1 
ATOM   3366 N N    . PRO A 1 439 ? 66.465  14.442 14.717  1.00 40.59  ? 440  PRO A N    1 
ATOM   3367 C CA   . PRO A 1 439 ? 66.899  13.982 13.389  1.00 39.22  ? 440  PRO A CA   1 
ATOM   3368 C C    . PRO A 1 439 ? 66.922  15.108 12.344  1.00 38.03  ? 440  PRO A C    1 
ATOM   3369 O O    . PRO A 1 439 ? 66.195  16.102 12.472  1.00 33.22  ? 440  PRO A O    1 
ATOM   3370 C CB   . PRO A 1 439 ? 65.842  12.933 13.017  1.00 33.74  ? 440  PRO A CB   1 
ATOM   3371 C CG   . PRO A 1 439 ? 64.643  13.292 13.837  1.00 37.32  ? 440  PRO A CG   1 
ATOM   3372 C CD   . PRO A 1 439 ? 65.196  13.819 15.131  1.00 38.99  ? 440  PRO A CD   1 
ATOM   3373 N N    . LEU A 1 440 ? 67.751  14.935 11.319  1.00 39.75  ? 441  LEU A N    1 
ATOM   3374 C CA   . LEU A 1 440 ? 67.924  15.940 10.276  1.00 40.80  ? 441  LEU A CA   1 
ATOM   3375 C C    . LEU A 1 440 ? 66.626  16.322 9.582   1.00 41.24  ? 441  LEU A C    1 
ATOM   3376 O O    . LEU A 1 440 ? 66.435  17.485 9.221   1.00 41.57  ? 441  LEU A O    1 
ATOM   3377 C CB   . LEU A 1 440 ? 68.937  15.458 9.237   1.00 46.35  ? 441  LEU A CB   1 
ATOM   3378 C CG   . LEU A 1 440 ? 70.023  16.464 8.854   1.00 55.37  ? 441  LEU A CG   1 
ATOM   3379 C CD1  . LEU A 1 440 ? 70.997  16.660 10.009  1.00 51.73  ? 441  LEU A CD1  1 
ATOM   3380 C CD2  . LEU A 1 440 ? 70.765  16.029 7.595   1.00 58.12  ? 441  LEU A CD2  1 
ATOM   3381 N N    . TRP A 1 441 ? 65.732  15.353 9.394   1.00 39.01  ? 442  TRP A N    1 
ATOM   3382 C CA   . TRP A 1 441 ? 64.479  15.620 8.693   1.00 33.67  ? 442  TRP A CA   1 
ATOM   3383 C C    . TRP A 1 441 ? 63.601  16.678 9.389   1.00 36.71  ? 442  TRP A C    1 
ATOM   3384 O O    . TRP A 1 441 ? 62.728  17.277 8.754   1.00 26.67  ? 442  TRP A O    1 
ATOM   3385 C CB   . TRP A 1 441 ? 63.698  14.320 8.390   1.00 33.96  ? 442  TRP A CB   1 
ATOM   3386 C CG   . TRP A 1 441 ? 63.006  13.646 9.573   1.00 35.53  ? 442  TRP A CG   1 
ATOM   3387 C CD1  . TRP A 1 441 ? 63.434  12.535 10.254  1.00 32.93  ? 442  TRP A CD1  1 
ATOM   3388 C CD2  . TRP A 1 441 ? 61.750  14.022 10.172  1.00 33.71  ? 442  TRP A CD2  1 
ATOM   3389 N NE1  . TRP A 1 441 ? 62.532  12.211 11.246  1.00 34.56  ? 442  TRP A NE1  1 
ATOM   3390 C CE2  . TRP A 1 441 ? 61.491  13.105 11.215  1.00 32.83  ? 442  TRP A CE2  1 
ATOM   3391 C CE3  . TRP A 1 441 ? 60.825  15.047 9.930   1.00 32.58  ? 442  TRP A CE3  1 
ATOM   3392 C CZ2  . TRP A 1 441 ? 60.350  13.187 12.020  1.00 31.27  ? 442  TRP A CZ2  1 
ATOM   3393 C CZ3  . TRP A 1 441 ? 59.692  15.127 10.727  1.00 32.17  ? 442  TRP A CZ3  1 
ATOM   3394 C CH2  . TRP A 1 441 ? 59.465  14.199 11.761  1.00 32.33  ? 442  TRP A CH2  1 
ATOM   3395 N N    . MET A 1 442 ? 63.839  16.925 10.678  1.00 35.38  ? 443  MET A N    1 
ATOM   3396 C CA   . MET A 1 442 ? 63.026  17.909 11.399  1.00 35.43  ? 443  MET A CA   1 
ATOM   3397 C C    . MET A 1 442 ? 63.467  19.351 11.127  1.00 38.13  ? 443  MET A C    1 
ATOM   3398 O O    . MET A 1 442 ? 62.822  20.298 11.588  1.00 39.45  ? 443  MET A O    1 
ATOM   3399 C CB   . MET A 1 442 ? 63.001  17.632 12.905  1.00 32.99  ? 443  MET A CB   1 
ATOM   3400 C CG   . MET A 1 442 ? 62.076  16.494 13.326  1.00 41.02  ? 443  MET A CG   1 
ATOM   3401 S SD   . MET A 1 442 ? 61.990  16.262 15.121  1.00 47.28  ? 443  MET A SD   1 
ATOM   3402 C CE   . MET A 1 442 ? 60.940  14.815 15.244  1.00 90.53  ? 443  MET A CE   1 
ATOM   3403 N N    . GLY A 1 443 ? 64.558  19.517 10.382  1.00 34.85  ? 444  GLY A N    1 
ATOM   3404 C CA   . GLY A 1 443 ? 65.057  20.847 10.047  1.00 30.88  ? 444  GLY A CA   1 
ATOM   3405 C C    . GLY A 1 443 ? 65.324  21.738 11.255  1.00 29.94  ? 444  GLY A C    1 
ATOM   3406 O O    . GLY A 1 443 ? 65.999  21.330 12.209  1.00 28.95  ? 444  GLY A O    1 
ATOM   3407 N N    . VAL A 1 444 ? 64.818  22.967 11.207  1.00 28.44  ? 445  VAL A N    1 
ATOM   3408 C CA   . VAL A 1 444 ? 64.884  23.851 12.369  1.00 33.43  ? 445  VAL A CA   1 
ATOM   3409 C C    . VAL A 1 444 ? 63.560  23.781 13.122  1.00 33.66  ? 445  VAL A C    1 
ATOM   3410 O O    . VAL A 1 444 ? 62.568  24.402 12.727  1.00 32.82  ? 445  VAL A O    1 
ATOM   3411 C CB   . VAL A 1 444 ? 65.183  25.301 11.981  1.00 31.60  ? 445  VAL A CB   1 
ATOM   3412 C CG1  . VAL A 1 444 ? 65.585  26.100 13.221  1.00 29.05  ? 445  VAL A CG1  1 
ATOM   3413 C CG2  . VAL A 1 444 ? 66.285  25.348 10.928  1.00 32.08  ? 445  VAL A CG2  1 
ATOM   3414 N N    . PRO A 1 445 ? 63.536  23.007 14.213  1.00 30.15  ? 446  PRO A N    1 
ATOM   3415 C CA   . PRO A 1 445 ? 62.263  22.738 14.890  1.00 29.74  ? 446  PRO A CA   1 
ATOM   3416 C C    . PRO A 1 445 ? 61.852  23.841 15.871  1.00 30.33  ? 446  PRO A C    1 
ATOM   3417 O O    . PRO A 1 445 ? 62.670  24.653 16.321  1.00 32.97  ? 446  PRO A O    1 
ATOM   3418 C CB   . PRO A 1 445 ? 62.536  21.430 15.659  1.00 29.89  ? 446  PRO A CB   1 
ATOM   3419 C CG   . PRO A 1 445 ? 63.948  21.000 15.268  1.00 28.74  ? 446  PRO A CG   1 
ATOM   3420 C CD   . PRO A 1 445 ? 64.646  22.247 14.807  1.00 25.16  ? 446  PRO A CD   1 
ATOM   3421 N N    . HIS A 1 446 ? 60.563  23.849 16.183  1.00 27.25  ? 447  HIS A N    1 
ATOM   3422 C CA   . HIS A 1 446 ? 59.984  24.724 17.184  1.00 28.53  ? 447  HIS A CA   1 
ATOM   3423 C C    . HIS A 1 446 ? 60.808  24.689 18.473  1.00 30.21  ? 447  HIS A C    1 
ATOM   3424 O O    . HIS A 1 446 ? 61.233  23.621 18.924  1.00 28.18  ? 447  HIS A O    1 
ATOM   3425 C CB   . HIS A 1 446 ? 58.564  24.242 17.469  1.00 29.06  ? 447  HIS A CB   1 
ATOM   3426 C CG   . HIS A 1 446 ? 57.782  25.146 18.361  1.00 36.43  ? 447  HIS A CG   1 
ATOM   3427 N ND1  . HIS A 1 446 ? 57.126  26.268 17.896  1.00 36.69  ? 447  HIS A ND1  1 
ATOM   3428 C CD2  . HIS A 1 446 ? 57.528  25.082 19.688  1.00 39.21  ? 447  HIS A CD2  1 
ATOM   3429 C CE1  . HIS A 1 446 ? 56.507  26.860 18.900  1.00 33.60  ? 447  HIS A CE1  1 
ATOM   3430 N NE2  . HIS A 1 446 ? 56.734  26.159 19.998  1.00 46.51  ? 447  HIS A NE2  1 
ATOM   3431 N N    . GLY A 1 447 ? 61.047  25.864 19.048  1.00 28.49  ? 448  GLY A N    1 
ATOM   3432 C CA   . GLY A 1 447 ? 61.760  25.968 20.304  1.00 22.93  ? 448  GLY A CA   1 
ATOM   3433 C C    . GLY A 1 447 ? 63.265  26.180 20.199  1.00 28.71  ? 448  GLY A C    1 
ATOM   3434 O O    . GLY A 1 447 ? 63.897  26.519 21.195  1.00 27.33  ? 448  GLY A O    1 
ATOM   3435 N N    . TYR A 1 448 ? 63.852  26.000 19.020  1.00 27.38  ? 449  TYR A N    1 
ATOM   3436 C CA   . TYR A 1 448 ? 65.323  25.983 18.943  1.00 33.81  ? 449  TYR A CA   1 
ATOM   3437 C C    . TYR A 1 448 ? 66.027  27.289 18.564  1.00 32.92  ? 449  TYR A C    1 
ATOM   3438 O O    . TYR A 1 448 ? 67.238  27.312 18.364  1.00 39.25  ? 449  TYR A O    1 
ATOM   3439 C CB   . TYR A 1 448 ? 65.836  24.750 18.172  1.00 34.48  ? 449  TYR A CB   1 
ATOM   3440 C CG   . TYR A 1 448 ? 65.631  23.528 19.022  1.00 36.36  ? 449  TYR A CG   1 
ATOM   3441 C CD1  . TYR A 1 448 ? 64.414  22.850 19.014  1.00 36.25  ? 449  TYR A CD1  1 
ATOM   3442 C CD2  . TYR A 1 448 ? 66.607  23.113 19.913  1.00 34.83  ? 449  TYR A CD2  1 
ATOM   3443 C CE1  . TYR A 1 448 ? 64.201  21.758 19.834  1.00 36.89  ? 449  TYR A CE1  1 
ATOM   3444 C CE2  . TYR A 1 448 ? 66.403  22.020 20.739  1.00 34.04  ? 449  TYR A CE2  1 
ATOM   3445 C CZ   . TYR A 1 448 ? 65.202  21.350 20.697  1.00 35.52  ? 449  TYR A CZ   1 
ATOM   3446 O OH   . TYR A 1 448 ? 64.995  20.270 21.527  1.00 38.60  ? 449  TYR A OH   1 
ATOM   3447 N N    . GLU A 1 449 ? 65.270  28.380 18.518  1.00 29.83  ? 450  GLU A N    1 
ATOM   3448 C CA   . GLU A 1 449 ? 65.873  29.706 18.436  1.00 30.21  ? 450  GLU A CA   1 
ATOM   3449 C C    . GLU A 1 449 ? 66.182  30.238 19.839  1.00 28.62  ? 450  GLU A C    1 
ATOM   3450 O O    . GLU A 1 449 ? 67.069  31.074 19.998  1.00 30.01  ? 450  GLU A O    1 
ATOM   3451 C CB   . GLU A 1 449 ? 64.956  30.690 17.694  1.00 20.54  ? 450  GLU A CB   1 
ATOM   3452 C CG   . GLU A 1 449 ? 63.888  31.338 18.574  1.00 49.11  ? 450  GLU A CG   1 
ATOM   3453 C CD   . GLU A 1 449 ? 62.763  30.381 18.981  1.00 52.29  ? 450  GLU A CD   1 
ATOM   3454 O OE1  . GLU A 1 449 ? 62.928  29.147 18.850  1.00 52.28  ? 450  GLU A OE1  1 
ATOM   3455 O OE2  . GLU A 1 449 ? 61.707  30.873 19.436  1.00 53.29  ? 450  GLU A OE2  1 
ATOM   3456 N N    . ILE A 1 450 ? 65.451  29.745 20.843  1.00 27.68  ? 451  ILE A N    1 
ATOM   3457 C CA   . ILE A 1 450 ? 65.489  30.305 22.200  1.00 27.67  ? 451  ILE A CA   1 
ATOM   3458 C C    . ILE A 1 450 ? 66.900  30.344 22.748  1.00 31.35  ? 451  ILE A C    1 
ATOM   3459 O O    . ILE A 1 450 ? 67.331  31.359 23.303  1.00 36.13  ? 451  ILE A O    1 
ATOM   3460 C CB   . ILE A 1 450 ? 64.618  29.508 23.209  1.00 27.43  ? 451  ILE A CB   1 
ATOM   3461 C CG1  . ILE A 1 450 ? 63.139  29.542 22.826  1.00 31.84  ? 451  ILE A CG1  1 
ATOM   3462 C CG2  . ILE A 1 450 ? 64.766  30.084 24.595  1.00 22.93  ? 451  ILE A CG2  1 
ATOM   3463 C CD1  . ILE A 1 450 ? 62.296  28.513 23.583  1.00 27.59  ? 451  ILE A CD1  1 
ATOM   3464 N N    . GLU A 1 451 ? 67.616  29.236 22.586  1.00 24.45  ? 452  GLU A N    1 
ATOM   3465 C CA   . GLU A 1 451 ? 68.959  29.117 23.137  1.00 24.02  ? 452  GLU A CA   1 
ATOM   3466 C C    . GLU A 1 451 ? 69.905  30.191 22.578  1.00 26.01  ? 452  GLU A C    1 
ATOM   3467 O O    . GLU A 1 451 ? 70.852  30.616 23.255  1.00 27.71  ? 452  GLU A O    1 
ATOM   3468 C CB   . GLU A 1 451 ? 69.500  27.690 22.945  1.00 28.17  ? 452  GLU A CB   1 
ATOM   3469 C CG   . GLU A 1 451 ? 69.402  27.133 21.512  1.00 39.78  ? 452  GLU A CG   1 
ATOM   3470 C CD   . GLU A 1 451 ? 69.563  25.600 21.438  1.00 50.07  ? 452  GLU A CD   1 
ATOM   3471 O OE1  . GLU A 1 451 ? 68.784  24.865 22.089  1.00 52.41  ? 452  GLU A OE1  1 
ATOM   3472 O OE2  . GLU A 1 451 ? 70.464  25.126 20.713  1.00 53.51  ? 452  GLU A OE2  1 
ATOM   3473 N N    . PHE A 1 452 ? 69.639  30.654 21.359  1.00 23.84  ? 453  PHE A N    1 
ATOM   3474 C CA   . PHE A 1 452 ? 70.472  31.704 20.770  1.00 25.19  ? 453  PHE A CA   1 
ATOM   3475 C C    . PHE A 1 452 ? 70.097  33.090 21.287  1.00 30.53  ? 453  PHE A C    1 
ATOM   3476 O O    . PHE A 1 452 ? 70.980  33.907 21.549  1.00 29.58  ? 453  PHE A O    1 
ATOM   3477 C CB   . PHE A 1 452 ? 70.441  31.651 19.237  1.00 26.84  ? 453  PHE A CB   1 
ATOM   3478 C CG   . PHE A 1 452 ? 71.120  30.445 18.679  1.00 27.45  ? 453  PHE A CG   1 
ATOM   3479 C CD1  . PHE A 1 452 ? 70.424  29.262 18.493  1.00 29.73  ? 453  PHE A CD1  1 
ATOM   3480 C CD2  . PHE A 1 452 ? 72.464  30.481 18.374  1.00 27.65  ? 453  PHE A CD2  1 
ATOM   3481 C CE1  . PHE A 1 452 ? 71.061  28.142 17.998  1.00 32.33  ? 453  PHE A CE1  1 
ATOM   3482 C CE2  . PHE A 1 452 ? 73.108  29.360 17.874  1.00 29.53  ? 453  PHE A CE2  1 
ATOM   3483 C CZ   . PHE A 1 452 ? 72.406  28.190 17.691  1.00 32.01  ? 453  PHE A CZ   1 
ATOM   3484 N N    . ILE A 1 453 ? 68.795  33.334 21.449  1.00 29.45  ? 454  ILE A N    1 
ATOM   3485 C CA   . ILE A 1 453 ? 68.296  34.585 22.023  1.00 29.39  ? 454  ILE A CA   1 
ATOM   3486 C C    . ILE A 1 453 ? 68.842  34.782 23.441  1.00 33.52  ? 454  ILE A C    1 
ATOM   3487 O O    . ILE A 1 453 ? 69.203  35.897 23.818  1.00 37.10  ? 454  ILE A O    1 
ATOM   3488 C CB   . ILE A 1 453 ? 66.752  34.622 22.071  1.00 29.73  ? 454  ILE A CB   1 
ATOM   3489 C CG1  . ILE A 1 453 ? 66.160  34.471 20.670  1.00 27.08  ? 454  ILE A CG1  1 
ATOM   3490 C CG2  . ILE A 1 453 ? 66.255  35.894 22.731  1.00 28.74  ? 454  ILE A CG2  1 
ATOM   3491 C CD1  . ILE A 1 453 ? 66.932  35.191 19.615  1.00 27.98  ? 454  ILE A CD1  1 
ATOM   3492 N N    . PHE A 1 454 ? 68.912  33.703 24.222  1.00 25.29  ? 455  PHE A N    1 
ATOM   3493 C CA   . PHE A 1 454 ? 69.470  33.790 25.571  1.00 23.19  ? 455  PHE A CA   1 
ATOM   3494 C C    . PHE A 1 454 ? 71.000  33.686 25.599  1.00 24.38  ? 455  PHE A C    1 
ATOM   3495 O O    . PHE A 1 454 ? 71.602  33.763 26.662  1.00 33.84  ? 455  PHE A O    1 
ATOM   3496 C CB   . PHE A 1 454 ? 68.864  32.734 26.496  1.00 20.89  ? 455  PHE A CB   1 
ATOM   3497 C CG   . PHE A 1 454 ? 67.522  33.104 27.039  1.00 27.51  ? 455  PHE A CG   1 
ATOM   3498 C CD1  . PHE A 1 454 ? 66.376  32.923 26.279  1.00 21.40  ? 455  PHE A CD1  1 
ATOM   3499 C CD2  . PHE A 1 454 ? 67.399  33.628 28.311  1.00 20.99  ? 455  PHE A CD2  1 
ATOM   3500 C CE1  . PHE A 1 454 ? 65.140  33.264 26.780  1.00 20.30  ? 455  PHE A CE1  1 
ATOM   3501 C CE2  . PHE A 1 454 ? 66.164  33.976 28.815  1.00 22.07  ? 455  PHE A CE2  1 
ATOM   3502 C CZ   . PHE A 1 454 ? 65.029  33.790 28.056  1.00 23.18  ? 455  PHE A CZ   1 
ATOM   3503 N N    . GLY A 1 455 ? 71.622  33.487 24.444  1.00 27.13  ? 456  GLY A N    1 
ATOM   3504 C CA   . GLY A 1 455 ? 73.076  33.473 24.375  1.00 26.70  ? 456  GLY A CA   1 
ATOM   3505 C C    . GLY A 1 455 ? 73.729  32.261 25.016  1.00 31.25  ? 456  GLY A C    1 
ATOM   3506 O O    . GLY A 1 455 ? 74.904  32.308 25.405  1.00 30.34  ? 456  GLY A O    1 
ATOM   3507 N N    . ILE A 1 456 ? 72.971  31.170 25.119  1.00 28.60  ? 457  ILE A N    1 
ATOM   3508 C CA   . ILE A 1 456 ? 73.486  29.924 25.682  1.00 25.17  ? 457  ILE A CA   1 
ATOM   3509 C C    . ILE A 1 456 ? 74.817  29.440 25.059  1.00 28.71  ? 457  ILE A C    1 
ATOM   3510 O O    . ILE A 1 456 ? 75.654  28.871 25.761  1.00 32.22  ? 457  ILE A O    1 
ATOM   3511 C CB   . ILE A 1 456 ? 72.428  28.795 25.637  1.00 33.72  ? 457  ILE A CB   1 
ATOM   3512 C CG1  . ILE A 1 456 ? 71.157  29.222 26.382  1.00 37.29  ? 457  ILE A CG1  1 
ATOM   3513 C CG2  . ILE A 1 456 ? 72.997  27.501 26.224  1.00 31.82  ? 457  ILE A CG2  1 
ATOM   3514 C CD1  . ILE A 1 456 ? 71.407  29.664 27.823  1.00 31.11  ? 457  ILE A CD1  1 
ATOM   3515 N N    . PRO A 1 457 ? 75.016  29.653 23.747  1.00 27.44  ? 458  PRO A N    1 
ATOM   3516 C CA   . PRO A 1 457 ? 76.296  29.215 23.159  1.00 31.17  ? 458  PRO A CA   1 
ATOM   3517 C C    . PRO A 1 457 ? 77.542  29.823 23.810  1.00 33.85  ? 458  PRO A C    1 
ATOM   3518 O O    . PRO A 1 457 ? 78.627  29.263 23.648  1.00 37.73  ? 458  PRO A O    1 
ATOM   3519 C CB   . PRO A 1 457 ? 76.188  29.669 21.700  1.00 24.93  ? 458  PRO A CB   1 
ATOM   3520 C CG   . PRO A 1 457 ? 74.682  29.644 21.414  1.00 24.17  ? 458  PRO A CG   1 
ATOM   3521 C CD   . PRO A 1 457 ? 74.045  30.086 22.717  1.00 24.63  ? 458  PRO A CD   1 
ATOM   3522 N N    . LEU A 1 458 ? 77.398  30.929 24.536  1.00 37.62  ? 459  LEU A N    1 
ATOM   3523 C CA   . LEU A 1 458 ? 78.548  31.544 25.203  1.00 34.11  ? 459  LEU A CA   1 
ATOM   3524 C C    . LEU A 1 458 ? 78.941  30.798 26.480  1.00 36.91  ? 459  LEU A C    1 
ATOM   3525 O O    . LEU A 1 458 ? 79.936  31.117 27.119  1.00 44.83  ? 459  LEU A O    1 
ATOM   3526 C CB   . LEU A 1 458 ? 78.284  33.020 25.500  1.00 30.45  ? 459  LEU A CB   1 
ATOM   3527 C CG   . LEU A 1 458 ? 77.849  33.859 24.306  1.00 37.22  ? 459  LEU A CG   1 
ATOM   3528 C CD1  . LEU A 1 458 ? 77.496  35.261 24.763  1.00 41.49  ? 459  LEU A CD1  1 
ATOM   3529 C CD2  . LEU A 1 458 ? 78.945  33.898 23.255  1.00 37.72  ? 459  LEU A CD2  1 
ATOM   3530 N N    . ASP A 1 459 ? 78.150  29.803 26.855  1.00 39.27  ? 460  ASP A N    1 
ATOM   3531 C CA   . ASP A 1 459 ? 78.498  28.952 27.980  1.00 46.24  ? 460  ASP A CA   1 
ATOM   3532 C C    . ASP A 1 459 ? 79.614  27.984 27.566  1.00 48.35  ? 460  ASP A C    1 
ATOM   3533 O O    . ASP A 1 459 ? 79.412  27.130 26.707  1.00 50.30  ? 460  ASP A O    1 
ATOM   3534 C CB   . ASP A 1 459 ? 77.260  28.179 28.438  1.00 48.75  ? 460  ASP A CB   1 
ATOM   3535 C CG   . ASP A 1 459 ? 77.499  27.374 29.701  1.00 54.60  ? 460  ASP A CG   1 
ATOM   3536 O OD1  . ASP A 1 459 ? 78.667  27.213 30.110  1.00 61.21  ? 460  ASP A OD1  1 
ATOM   3537 O OD2  . ASP A 1 459 ? 76.511  26.889 30.283  1.00 59.68  ? 460  ASP A OD2  1 
ATOM   3538 N N    . PRO A 1 460 ? 80.788  28.101 28.201  1.00 53.27  ? 461  PRO A N    1 
ATOM   3539 C CA   . PRO A 1 460 ? 81.978  27.289 27.897  1.00 57.36  ? 461  PRO A CA   1 
ATOM   3540 C C    . PRO A 1 460 ? 81.704  25.782 27.895  1.00 64.29  ? 461  PRO A C    1 
ATOM   3541 O O    . PRO A 1 460 ? 82.106  25.094 26.949  1.00 71.03  ? 461  PRO A O    1 
ATOM   3542 C CB   . PRO A 1 460 ? 82.927  27.621 29.044  1.00 55.50  ? 461  PRO A CB   1 
ATOM   3543 C CG   . PRO A 1 460 ? 82.467  28.930 29.567  1.00 57.84  ? 461  PRO A CG   1 
ATOM   3544 C CD   . PRO A 1 460 ? 80.990  28.973 29.368  1.00 53.59  ? 461  PRO A CD   1 
ATOM   3545 N N    . SER A 1 461 ? 81.027  25.293 28.937  1.00 57.09  ? 462  SER A N    1 
ATOM   3546 C CA   . SER A 1 461 ? 80.734  23.863 29.109  1.00 51.76  ? 462  SER A CA   1 
ATOM   3547 C C    . SER A 1 461 ? 79.939  23.260 27.956  1.00 58.69  ? 462  SER A C    1 
ATOM   3548 O O    . SER A 1 461 ? 79.847  22.036 27.821  1.00 59.33  ? 462  SER A O    1 
ATOM   3549 C CB   . SER A 1 461 ? 79.985  23.630 30.417  1.00 47.62  ? 462  SER A CB   1 
ATOM   3550 O OG   . SER A 1 461 ? 78.872  24.492 30.510  1.00 53.60  ? 462  SER A OG   1 
ATOM   3551 N N    . ARG A 1 462 ? 79.361  24.123 27.130  1.00 57.92  ? 463  ARG A N    1 
ATOM   3552 C CA   . ARG A 1 462 ? 78.647  23.673 25.948  1.00 54.67  ? 463  ARG A CA   1 
ATOM   3553 C C    . ARG A 1 462 ? 79.548  23.808 24.718  1.00 58.40  ? 463  ARG A C    1 
ATOM   3554 O O    . ARG A 1 462 ? 80.513  24.577 24.722  1.00 59.35  ? 463  ARG A O    1 
ATOM   3555 C CB   . ARG A 1 462 ? 77.339  24.442 25.813  1.00 47.08  ? 463  ARG A CB   1 
ATOM   3556 C CG   . ARG A 1 462 ? 76.398  24.080 26.933  1.00 46.29  ? 463  ARG A CG   1 
ATOM   3557 C CD   . ARG A 1 462 ? 75.292  25.076 27.154  1.00 45.43  ? 463  ARG A CD   1 
ATOM   3558 N NE   . ARG A 1 462 ? 74.575  24.745 28.383  1.00 51.19  ? 463  ARG A NE   1 
ATOM   3559 C CZ   . ARG A 1 462 ? 73.532  23.924 28.441  1.00 58.26  ? 463  ARG A CZ   1 
ATOM   3560 N NH1  . ARG A 1 462 ? 73.065  23.362 27.330  1.00 61.85  ? 463  ARG A NH1  1 
ATOM   3561 N NH2  . ARG A 1 462 ? 72.950  23.671 29.607  1.00 54.86  ? 463  ARG A NH2  1 
ATOM   3562 N N    . ASN A 1 463 ? 79.251  23.039 23.679  1.00 50.55  ? 464  ASN A N    1 
ATOM   3563 C CA   . ASN A 1 463 ? 80.193  22.893 22.582  1.00 46.68  ? 464  ASN A CA   1 
ATOM   3564 C C    . ASN A 1 463 ? 79.649  23.438 21.267  1.00 39.66  ? 464  ASN A C    1 
ATOM   3565 O O    . ASN A 1 463 ? 79.663  22.753 20.250  1.00 42.36  ? 464  ASN A O    1 
ATOM   3566 C CB   . ASN A 1 463 ? 80.616  21.424 22.450  1.00 47.98  ? 464  ASN A CB   1 
ATOM   3567 C CG   . ASN A 1 463 ? 81.072  20.825 23.779  1.00 59.54  ? 464  ASN A CG   1 
ATOM   3568 O OD1  . ASN A 1 463 ? 81.881  21.419 24.502  1.00 58.21  ? 464  ASN A OD1  1 
ATOM   3569 N ND2  . ASN A 1 463 ? 80.539  19.653 24.115  1.00 65.83  ? 464  ASN A ND2  1 
ATOM   3570 N N    . TYR A 1 464 ? 79.153  24.672 21.305  1.00 37.28  ? 465  TYR A N    1 
ATOM   3571 C CA   . TYR A 1 464 ? 78.734  25.371 20.097  1.00 39.14  ? 465  TYR A CA   1 
ATOM   3572 C C    . TYR A 1 464 ? 79.955  25.845 19.299  1.00 39.26  ? 465  TYR A C    1 
ATOM   3573 O O    . TYR A 1 464 ? 81.029  26.068 19.863  1.00 39.50  ? 465  TYR A O    1 
ATOM   3574 C CB   . TYR A 1 464 ? 77.851  26.563 20.455  1.00 30.99  ? 465  TYR A CB   1 
ATOM   3575 C CG   . TYR A 1 464 ? 76.479  26.200 20.969  1.00 30.06  ? 465  TYR A CG   1 
ATOM   3576 C CD1  . TYR A 1 464 ? 75.400  26.062 20.094  1.00 29.96  ? 465  TYR A CD1  1 
ATOM   3577 C CD2  . TYR A 1 464 ? 76.246  26.023 22.332  1.00 27.43  ? 465  TYR A CD2  1 
ATOM   3578 C CE1  . TYR A 1 464 ? 74.127  25.744 20.565  1.00 29.21  ? 465  TYR A CE1  1 
ATOM   3579 C CE2  . TYR A 1 464 ? 74.980  25.704 22.811  1.00 32.43  ? 465  TYR A CE2  1 
ATOM   3580 C CZ   . TYR A 1 464 ? 73.924  25.568 21.923  1.00 34.72  ? 465  TYR A CZ   1 
ATOM   3581 O OH   . TYR A 1 464 ? 72.666  25.256 22.395  1.00 36.44  ? 465  TYR A OH   1 
ATOM   3582 N N    . THR A 1 465 ? 79.802  25.999 17.989  1.00 34.80  ? 466  THR A N    1 
ATOM   3583 C CA   . THR A 1 465 ? 80.911  26.516 17.181  1.00 32.76  ? 466  THR A CA   1 
ATOM   3584 C C    . THR A 1 465 ? 81.101  28.004 17.451  1.00 33.83  ? 466  THR A C    1 
ATOM   3585 O O    . THR A 1 465 ? 80.194  28.671 17.965  1.00 37.83  ? 466  THR A O    1 
ATOM   3586 C CB   . THR A 1 465 ? 80.652  26.329 15.687  1.00 33.32  ? 466  THR A CB   1 
ATOM   3587 O OG1  . THR A 1 465 ? 79.484  27.072 15.314  1.00 37.48  ? 466  THR A OG1  1 
ATOM   3588 C CG2  . THR A 1 465 ? 80.439  24.864 15.376  1.00 35.34  ? 466  THR A CG2  1 
ATOM   3589 N N    . ALA A 1 466 ? 82.274  28.523 17.098  1.00 29.68  ? 467  ALA A N    1 
ATOM   3590 C CA   . ALA A 1 466 ? 82.550  29.947 17.255  1.00 32.14  ? 467  ALA A CA   1 
ATOM   3591 C C    . ALA A 1 466 ? 81.542  30.782 16.456  1.00 35.38  ? 467  ALA A C    1 
ATOM   3592 O O    . ALA A 1 466 ? 81.063  31.812 16.937  1.00 41.25  ? 467  ALA A O    1 
ATOM   3593 C CB   . ALA A 1 466 ? 83.973  30.264 16.843  1.00 26.91  ? 467  ALA A CB   1 
ATOM   3594 N N    . GLU A 1 467 ? 81.218  30.327 15.247  1.00 31.94  ? 468  GLU A N    1 
ATOM   3595 C CA   . GLU A 1 467 ? 80.220  30.994 14.425  1.00 35.83  ? 468  GLU A CA   1 
ATOM   3596 C C    . GLU A 1 467 ? 78.875  31.121 15.144  1.00 36.22  ? 468  GLU A C    1 
ATOM   3597 O O    . GLU A 1 467 ? 78.236  32.173 15.098  1.00 33.41  ? 468  GLU A O    1 
ATOM   3598 C CB   . GLU A 1 467 ? 80.044  30.270 13.090  1.00 42.15  ? 468  GLU A CB   1 
ATOM   3599 C CG   . GLU A 1 467 ? 80.625  31.024 11.900  1.00 64.31  ? 468  GLU A CG   1 
ATOM   3600 C CD   . GLU A 1 467 ? 80.033  32.426 11.734  1.00 82.39  ? 468  GLU A CD   1 
ATOM   3601 O OE1  . GLU A 1 467 ? 78.839  32.622 12.076  1.00 85.77  ? 468  GLU A OE1  1 
ATOM   3602 O OE2  . GLU A 1 467 ? 80.766  33.333 11.266  1.00 85.09  ? 468  GLU A OE2  1 
ATOM   3603 N N    . GLU A 1 468 ? 78.447  30.054 15.813  1.00 28.75  ? 469  GLU A N    1 
ATOM   3604 C CA   . GLU A 1 468 ? 77.202  30.108 16.556  1.00 30.05  ? 469  GLU A CA   1 
ATOM   3605 C C    . GLU A 1 468 ? 77.276  31.103 17.709  1.00 31.69  ? 469  GLU A C    1 
ATOM   3606 O O    . GLU A 1 468 ? 76.266  31.688 18.088  1.00 36.97  ? 469  GLU A O    1 
ATOM   3607 C CB   . GLU A 1 468 ? 76.820  28.718 17.060  1.00 30.24  ? 469  GLU A CB   1 
ATOM   3608 C CG   . GLU A 1 468 ? 76.467  27.792 15.929  1.00 34.18  ? 469  GLU A CG   1 
ATOM   3609 C CD   . GLU A 1 468 ? 76.131  26.398 16.389  1.00 40.48  ? 469  GLU A CD   1 
ATOM   3610 O OE1  . GLU A 1 468 ? 76.982  25.773 17.056  1.00 46.11  ? 469  GLU A OE1  1 
ATOM   3611 O OE2  . GLU A 1 468 ? 75.018  25.925 16.066  1.00 46.28  ? 469  GLU A OE2  1 
ATOM   3612 N N    . LYS A 1 469 ? 78.467  31.308 18.259  1.00 24.34  ? 470  LYS A N    1 
ATOM   3613 C CA   . LYS A 1 469 ? 78.613  32.265 19.349  1.00 31.97  ? 470  LYS A CA   1 
ATOM   3614 C C    . LYS A 1 469 ? 78.453  33.681 18.822  1.00 28.06  ? 470  LYS A C    1 
ATOM   3615 O O    . LYS A 1 469 ? 77.828  34.521 19.459  1.00 32.31  ? 470  LYS A O    1 
ATOM   3616 C CB   . LYS A 1 469 ? 79.954  32.083 20.061  1.00 30.03  ? 470  LYS A CB   1 
ATOM   3617 C CG   . LYS A 1 469 ? 80.095  30.709 20.685  1.00 28.45  ? 470  LYS A CG   1 
ATOM   3618 C CD   . LYS A 1 469 ? 81.453  30.534 21.297  1.00 29.04  ? 470  LYS A CD   1 
ATOM   3619 C CE   . LYS A 1 469 ? 81.647  29.114 21.737  1.00 23.49  ? 470  LYS A CE   1 
ATOM   3620 N NZ   . LYS A 1 469 ? 82.931  28.969 22.451  1.00 30.73  ? 470  LYS A NZ   1 
ATOM   3621 N N    . ILE A 1 470 ? 79.013  33.927 17.647  1.00 30.16  ? 471  ILE A N    1 
ATOM   3622 C CA   . ILE A 1 470 ? 78.872  35.206 16.958  1.00 31.22  ? 471  ILE A CA   1 
ATOM   3623 C C    . ILE A 1 470 ? 77.402  35.459 16.602  1.00 34.31  ? 471  ILE A C    1 
ATOM   3624 O O    . ILE A 1 470 ? 76.873  36.549 16.817  1.00 41.59  ? 471  ILE A O    1 
ATOM   3625 C CB   . ILE A 1 470 ? 79.733  35.202 15.694  1.00 34.33  ? 471  ILE A CB   1 
ATOM   3626 C CG1  . ILE A 1 470 ? 81.207  35.222 16.085  1.00 38.28  ? 471  ILE A CG1  1 
ATOM   3627 C CG2  . ILE A 1 470 ? 79.380  36.367 14.778  1.00 28.25  ? 471  ILE A CG2  1 
ATOM   3628 C CD1  . ILE A 1 470 ? 82.116  34.543 15.073  1.00 43.84  ? 471  ILE A CD1  1 
ATOM   3629 N N    . PHE A 1 471 ? 76.747  34.431 16.073  1.00 31.82  ? 472  PHE A N    1 
ATOM   3630 C CA   . PHE A 1 471 ? 75.328  34.493 15.735  1.00 31.27  ? 472  PHE A CA   1 
ATOM   3631 C C    . PHE A 1 471 ? 74.494  34.847 16.973  1.00 27.86  ? 472  PHE A C    1 
ATOM   3632 O O    . PHE A 1 471 ? 73.711  35.795 16.946  1.00 32.35  ? 472  PHE A O    1 
ATOM   3633 C CB   . PHE A 1 471 ? 74.895  33.152 15.132  1.00 31.40  ? 472  PHE A CB   1 
ATOM   3634 C CG   . PHE A 1 471 ? 73.470  33.121 14.654  1.00 28.86  ? 472  PHE A CG   1 
ATOM   3635 C CD1  . PHE A 1 471 ? 72.945  34.169 13.918  1.00 27.79  ? 472  PHE A CD1  1 
ATOM   3636 C CD2  . PHE A 1 471 ? 72.670  32.020 14.907  1.00 25.48  ? 472  PHE A CD2  1 
ATOM   3637 C CE1  . PHE A 1 471 ? 71.640  34.133 13.469  1.00 27.96  ? 472  PHE A CE1  1 
ATOM   3638 C CE2  . PHE A 1 471 ? 71.360  31.975 14.459  1.00 28.12  ? 472  PHE A CE2  1 
ATOM   3639 C CZ   . PHE A 1 471 ? 70.847  33.035 13.728  1.00 27.67  ? 472  PHE A CZ   1 
ATOM   3640 N N    . ALA A 1 472 ? 74.686  34.100 18.059  1.00 24.06  ? 473  ALA A N    1 
ATOM   3641 C CA   . ALA A 1 472 ? 74.009  34.380 19.337  1.00 26.00  ? 473  ALA A CA   1 
ATOM   3642 C C    . ALA A 1 472 ? 74.153  35.844 19.755  1.00 24.04  ? 473  ALA A C    1 
ATOM   3643 O O    . ALA A 1 472 ? 73.187  36.494 20.167  1.00 29.80  ? 473  ALA A O    1 
ATOM   3644 C CB   . ALA A 1 472 ? 74.553  33.476 20.426  1.00 27.59  ? 473  ALA A CB   1 
ATOM   3645 N N    . GLN A 1 473 ? 75.369  36.359 19.640  1.00 24.01  ? 474  GLN A N    1 
ATOM   3646 C CA   . GLN A 1 473 ? 75.627  37.755 19.941  1.00 31.28  ? 474  GLN A CA   1 
ATOM   3647 C C    . GLN A 1 473 ? 74.859  38.724 19.032  1.00 31.13  ? 474  GLN A C    1 
ATOM   3648 O O    . GLN A 1 473 ? 74.395  39.767 19.498  1.00 30.65  ? 474  GLN A O    1 
ATOM   3649 C CB   . GLN A 1 473 ? 77.135  38.027 19.914  1.00 28.03  ? 474  GLN A CB   1 
ATOM   3650 C CG   . GLN A 1 473 ? 77.886  37.251 20.996  1.00 33.81  ? 474  GLN A CG   1 
ATOM   3651 C CD   . GLN A 1 473 ? 79.387  37.550 21.029  1.00 38.47  ? 474  GLN A CD   1 
ATOM   3652 O OE1  . GLN A 1 473 ? 80.060  37.542 20.001  1.00 46.01  ? 474  GLN A OE1  1 
ATOM   3653 N NE2  . GLN A 1 473 ? 79.911  37.799 22.219  1.00 36.11  ? 474  GLN A NE2  1 
ATOM   3654 N N    . ARG A 1 474 ? 74.724  38.388 17.748  1.00 28.71  ? 475  ARG A N    1 
ATOM   3655 C CA   . ARG A 1 474 ? 73.943  39.228 16.832  1.00 33.73  ? 475  ARG A CA   1 
ATOM   3656 C C    . ARG A 1 474 ? 72.491  39.291 17.284  1.00 29.54  ? 475  ARG A C    1 
ATOM   3657 O O    . ARG A 1 474 ? 71.908  40.370 17.345  1.00 30.03  ? 475  ARG A O    1 
ATOM   3658 C CB   . ARG A 1 474 ? 74.004  38.722 15.378  1.00 32.24  ? 475  ARG A CB   1 
ATOM   3659 C CG   . ARG A 1 474 ? 75.240  39.129 14.599  1.00 35.66  ? 475  ARG A CG   1 
ATOM   3660 C CD   . ARG A 1 474 ? 75.199  38.626 13.138  1.00 41.18  ? 475  ARG A CD   1 
ATOM   3661 N NE   . ARG A 1 474 ? 73.937  38.949 12.477  1.00 37.17  ? 475  ARG A NE   1 
ATOM   3662 C CZ   . ARG A 1 474 ? 73.228  38.085 11.757  1.00 38.05  ? 475  ARG A CZ   1 
ATOM   3663 N NH1  . ARG A 1 474 ? 73.664  36.845 11.598  1.00 37.59  ? 475  ARG A NH1  1 
ATOM   3664 N NH2  . ARG A 1 474 ? 72.083  38.460 11.193  1.00 31.56  ? 475  ARG A NH2  1 
ATOM   3665 N N    . LEU A 1 475 ? 71.918  38.132 17.604  1.00 24.20  ? 476  LEU A N    1 
ATOM   3666 C CA   . LEU A 1 475 ? 70.505  38.057 17.997  1.00 28.66  ? 476  LEU A CA   1 
ATOM   3667 C C    . LEU A 1 475 ? 70.216  38.756 19.314  1.00 26.81  ? 476  LEU A C    1 
ATOM   3668 O O    . LEU A 1 475 ? 69.195  39.437 19.453  1.00 33.03  ? 476  LEU A O    1 
ATOM   3669 C CB   . LEU A 1 475 ? 70.027  36.610 18.090  1.00 24.18  ? 476  LEU A CB   1 
ATOM   3670 C CG   . LEU A 1 475 ? 70.089  35.808 16.799  1.00 32.78  ? 476  LEU A CG   1 
ATOM   3671 C CD1  . LEU A 1 475 ? 69.236  34.581 16.930  1.00 31.10  ? 476  LEU A CD1  1 
ATOM   3672 C CD2  . LEU A 1 475 ? 69.643  36.639 15.609  1.00 32.78  ? 476  LEU A CD2  1 
ATOM   3673 N N    . MET A 1 476 ? 71.103  38.570 20.285  1.00 27.29  ? 477  MET A N    1 
ATOM   3674 C CA   . MET A 1 476 ? 70.941  39.211 21.578  1.00 27.59  ? 477  MET A CA   1 
ATOM   3675 C C    . MET A 1 476 ? 70.916  40.711 21.375  1.00 29.20  ? 477  MET A C    1 
ATOM   3676 O O    . MET A 1 476 ? 70.119  41.426 22.004  1.00 24.78  ? 477  MET A O    1 
ATOM   3677 C CB   . MET A 1 476 ? 72.082  38.824 22.518  1.00 24.54  ? 477  MET A CB   1 
ATOM   3678 C CG   . MET A 1 476 ? 71.937  37.416 23.090  1.00 27.42  ? 477  MET A CG   1 
ATOM   3679 S SD   . MET A 1 476 ? 73.027  37.152 24.496  1.00 39.45  ? 477  MET A SD   1 
ATOM   3680 C CE   . MET A 1 476 ? 74.512  36.658 23.633  1.00 36.02  ? 477  MET A CE   1 
ATOM   3681 N N    . ARG A 1 477 ? 71.778  41.172 20.469  1.00 25.71  ? 478  ARG A N    1 
ATOM   3682 C CA   . ARG A 1 477 ? 71.872  42.592 20.120  1.00 29.34  ? 478  ARG A CA   1 
ATOM   3683 C C    . ARG A 1 477 ? 70.565  43.127 19.494  1.00 32.59  ? 478  ARG A C    1 
ATOM   3684 O O    . ARG A 1 477 ? 70.106  44.213 19.850  1.00 35.57  ? 478  ARG A O    1 
ATOM   3685 C CB   . ARG A 1 477 ? 73.056  42.819 19.176  1.00 24.07  ? 478  ARG A CB   1 
ATOM   3686 C CG   . ARG A 1 477 ? 73.156  44.241 18.645  1.00 29.70  ? 478  ARG A CG   1 
ATOM   3687 C CD   . ARG A 1 477 ? 73.319  45.243 19.784  1.00 38.36  ? 478  ARG A CD   1 
ATOM   3688 N NE   . ARG A 1 477 ? 74.452  44.906 20.647  1.00 43.37  ? 478  ARG A NE   1 
ATOM   3689 C CZ   . ARG A 1 477 ? 75.617  45.544 20.627  1.00 52.23  ? 478  ARG A CZ   1 
ATOM   3690 N NH1  . ARG A 1 477 ? 75.793  46.565 19.803  1.00 50.34  ? 478  ARG A NH1  1 
ATOM   3691 N NH2  . ARG A 1 477 ? 76.600  45.171 21.439  1.00 54.98  ? 478  ARG A NH2  1 
ATOM   3692 N N    . TYR A 1 478 ? 69.971  42.354 18.578  1.00 26.44  ? 479  TYR A N    1 
ATOM   3693 C CA   . TYR A 1 478 ? 68.694  42.713 17.929  1.00 28.47  ? 479  TYR A CA   1 
ATOM   3694 C C    . TYR A 1 478 ? 67.555  42.821 18.945  1.00 25.21  ? 479  TYR A C    1 
ATOM   3695 O O    . TYR A 1 478 ? 66.807  43.799 18.964  1.00 27.38  ? 479  TYR A O    1 
ATOM   3696 C CB   . TYR A 1 478 ? 68.286  41.642 16.907  1.00 27.88  ? 479  TYR A CB   1 
ATOM   3697 C CG   . TYR A 1 478 ? 69.075  41.599 15.621  1.00 27.56  ? 479  TYR A CG   1 
ATOM   3698 C CD1  . TYR A 1 478 ? 69.497  42.759 14.995  1.00 24.49  ? 479  TYR A CD1  1 
ATOM   3699 C CD2  . TYR A 1 478 ? 69.376  40.385 15.022  1.00 29.60  ? 479  TYR A CD2  1 
ATOM   3700 C CE1  . TYR A 1 478 ? 70.204  42.705 13.800  1.00 33.53  ? 479  TYR A CE1  1 
ATOM   3701 C CE2  . TYR A 1 478 ? 70.091  40.321 13.838  1.00 28.81  ? 479  TYR A CE2  1 
ATOM   3702 C CZ   . TYR A 1 478 ? 70.500  41.482 13.235  1.00 31.26  ? 479  TYR A CZ   1 
ATOM   3703 O OH   . TYR A 1 478 ? 71.209  41.416 12.062  1.00 36.20  ? 479  TYR A OH   1 
ATOM   3704 N N    . TRP A 1 479 ? 67.414  41.779 19.764  1.00 24.63  ? 480  TRP A N    1 
ATOM   3705 C CA   . TRP A 1 479 ? 66.421  41.748 20.829  1.00 27.45  ? 480  TRP A CA   1 
ATOM   3706 C C    . TRP A 1 479 ? 66.586  42.914 21.808  1.00 29.90  ? 480  TRP A C    1 
ATOM   3707 O O    . TRP A 1 479 ? 65.610  43.586 22.152  1.00 30.41  ? 480  TRP A O    1 
ATOM   3708 C CB   . TRP A 1 479 ? 66.499  40.415 21.573  1.00 22.68  ? 480  TRP A CB   1 
ATOM   3709 C CG   . TRP A 1 479 ? 65.492  39.393 21.087  1.00 26.57  ? 480  TRP A CG   1 
ATOM   3710 C CD1  . TRP A 1 479 ? 64.508  38.799 21.831  1.00 23.03  ? 480  TRP A CD1  1 
ATOM   3711 C CD2  . TRP A 1 479 ? 65.375  38.849 19.754  1.00 19.16  ? 480  TRP A CD2  1 
ATOM   3712 N NE1  . TRP A 1 479 ? 63.786  37.927 21.043  1.00 24.96  ? 480  TRP A NE1  1 
ATOM   3713 C CE2  . TRP A 1 479 ? 64.298  37.933 19.778  1.00 22.16  ? 480  TRP A CE2  1 
ATOM   3714 C CE3  . TRP A 1 479 ? 66.071  39.051 18.559  1.00 21.61  ? 480  TRP A CE3  1 
ATOM   3715 C CZ2  . TRP A 1 479 ? 63.903  37.213 18.636  1.00 26.84  ? 480  TRP A CZ2  1 
ATOM   3716 C CZ3  . TRP A 1 479 ? 65.685  38.334 17.431  1.00 23.05  ? 480  TRP A CZ3  1 
ATOM   3717 C CH2  . TRP A 1 479 ? 64.600  37.428 17.476  1.00 24.63  ? 480  TRP A CH2  1 
ATOM   3718 N N    . ALA A 1 480 ? 67.822  43.164 22.240  1.00 29.50  ? 481  ALA A N    1 
ATOM   3719 C CA   . ALA A 1 480 ? 68.088  44.249 23.191  1.00 29.33  ? 481  ALA A CA   1 
ATOM   3720 C C    . ALA A 1 480 ? 67.870  45.615 22.553  1.00 30.15  ? 481  ALA A C    1 
ATOM   3721 O O    . ALA A 1 480 ? 67.319  46.516 23.186  1.00 34.99  ? 481  ALA A O    1 
ATOM   3722 C CB   . ALA A 1 480 ? 69.475  44.144 23.761  1.00 22.02  ? 481  ALA A CB   1 
ATOM   3723 N N    . ASN A 1 481 ? 68.300  45.769 21.302  1.00 30.20  ? 482  ASN A N    1 
ATOM   3724 C CA   . ASN A 1 481 ? 68.059  47.013 20.570  1.00 30.37  ? 482  ASN A CA   1 
ATOM   3725 C C    . ASN A 1 481 ? 66.567  47.301 20.487  1.00 31.78  ? 482  ASN A C    1 
ATOM   3726 O O    . ASN A 1 481 ? 66.125  48.441 20.603  1.00 28.85  ? 482  ASN A O    1 
ATOM   3727 C CB   . ASN A 1 481 ? 68.616  46.920 19.155  1.00 30.59  ? 482  ASN A CB   1 
ATOM   3728 C CG   . ASN A 1 481 ? 70.100  47.172 19.087  1.00 30.61  ? 482  ASN A CG   1 
ATOM   3729 O OD1  . ASN A 1 481 ? 70.735  47.566 20.072  1.00 27.10  ? 482  ASN A OD1  1 
ATOM   3730 N ND2  . ASN A 1 481 ? 70.666  46.963 17.902  1.00 28.80  ? 482  ASN A ND2  1 
ATOM   3731 N N    . PHE A 1 482 ? 65.794  46.246 20.277  1.00 32.62  ? 483  PHE A N    1 
ATOM   3732 C CA   . PHE A 1 482 ? 64.359  46.379 20.198  1.00 30.93  ? 483  PHE A CA   1 
ATOM   3733 C C    . PHE A 1 482 ? 63.799  46.802 21.559  1.00 30.65  ? 483  PHE A C    1 
ATOM   3734 O O    . PHE A 1 482 ? 63.032  47.760 21.652  1.00 38.73  ? 483  PHE A O    1 
ATOM   3735 C CB   . PHE A 1 482 ? 63.716  45.080 19.701  1.00 26.66  ? 483  PHE A CB   1 
ATOM   3736 C CG   . PHE A 1 482 ? 62.221  45.130 19.697  1.00 23.89  ? 483  PHE A CG   1 
ATOM   3737 C CD1  . PHE A 1 482 ? 61.540  45.828 18.710  1.00 27.64  ? 483  PHE A CD1  1 
ATOM   3738 C CD2  . PHE A 1 482 ? 61.493  44.521 20.705  1.00 21.72  ? 483  PHE A CD2  1 
ATOM   3739 C CE1  . PHE A 1 482 ? 60.144  45.893 18.714  1.00 25.65  ? 483  PHE A CE1  1 
ATOM   3740 C CE2  . PHE A 1 482 ? 60.100  44.586 20.717  1.00 26.17  ? 483  PHE A CE2  1 
ATOM   3741 C CZ   . PHE A 1 482 ? 59.429  45.276 19.718  1.00 22.41  ? 483  PHE A CZ   1 
ATOM   3742 N N    . ALA A 1 483 ? 64.204  46.105 22.615  1.00 29.40  ? 484  ALA A N    1 
ATOM   3743 C CA   . ALA A 1 483 ? 63.796  46.473 23.974  1.00 32.71  ? 484  ALA A CA   1 
ATOM   3744 C C    . ALA A 1 483 ? 64.140  47.930 24.333  1.00 33.60  ? 484  ALA A C    1 
ATOM   3745 O O    . ALA A 1 483 ? 63.314  48.645 24.898  1.00 35.13  ? 484  ALA A O    1 
ATOM   3746 C CB   . ALA A 1 483 ? 64.396  45.520 24.982  1.00 21.61  ? 484  ALA A CB   1 
ATOM   3747 N N    . ARG A 1 484 ? 65.353  48.368 24.001  1.00 33.24  ? 485  ARG A N    1 
ATOM   3748 C CA   . ARG A 1 484 ? 65.771  49.746 24.268  1.00 35.79  ? 485  ARG A CA   1 
ATOM   3749 C C    . ARG A 1 484 ? 65.056  50.795 23.407  1.00 42.73  ? 485  ARG A C    1 
ATOM   3750 O O    . ARG A 1 484 ? 64.678  51.846 23.907  1.00 43.62  ? 485  ARG A O    1 
ATOM   3751 C CB   . ARG A 1 484 ? 67.280  49.901 24.073  1.00 34.15  ? 485  ARG A CB   1 
ATOM   3752 C CG   . ARG A 1 484 ? 68.144  49.143 25.069  1.00 32.39  ? 485  ARG A CG   1 
ATOM   3753 C CD   . ARG A 1 484 ? 69.607  49.517 24.885  1.00 36.30  ? 485  ARG A CD   1 
ATOM   3754 N NE   . ARG A 1 484 ? 70.202  48.828 23.742  1.00 38.61  ? 485  ARG A NE   1 
ATOM   3755 C CZ   . ARG A 1 484 ? 70.926  47.717 23.838  1.00 34.53  ? 485  ARG A CZ   1 
ATOM   3756 N NH1  . ARG A 1 484 ? 71.155  47.172 25.031  1.00 26.23  ? 485  ARG A NH1  1 
ATOM   3757 N NH2  . ARG A 1 484 ? 71.423  47.151 22.744  1.00 31.33  ? 485  ARG A NH2  1 
ATOM   3758 N N    . THR A 1 485 ? 64.877  50.513 22.118  1.00 41.79  ? 486  THR A N    1 
ATOM   3759 C CA   . THR A 1 485 ? 64.469  51.560 21.172  1.00 41.63  ? 486  THR A CA   1 
ATOM   3760 C C    . THR A 1 485 ? 63.229  51.243 20.354  1.00 41.36  ? 486  THR A C    1 
ATOM   3761 O O    . THR A 1 485 ? 62.743  52.100 19.632  1.00 46.33  ? 486  THR A O    1 
ATOM   3762 C CB   . THR A 1 485 ? 65.581  51.875 20.150  1.00 40.95  ? 486  THR A CB   1 
ATOM   3763 O OG1  . THR A 1 485 ? 65.612  50.845 19.152  1.00 38.59  ? 486  THR A OG1  1 
ATOM   3764 C CG2  . THR A 1 485 ? 66.944  51.980 20.835  1.00 38.65  ? 486  THR A CG2  1 
ATOM   3765 N N    . GLY A 1 486 ? 62.730  50.016 20.448  1.00 37.44  ? 487  GLY A N    1 
ATOM   3766 C CA   . GLY A 1 486 ? 61.589  49.610 19.652  1.00 34.24  ? 487  GLY A CA   1 
ATOM   3767 C C    . GLY A 1 486 ? 61.969  49.306 18.210  1.00 36.26  ? 487  GLY A C    1 
ATOM   3768 O O    . GLY A 1 486 ? 61.100  49.161 17.349  1.00 38.34  ? 487  GLY A O    1 
ATOM   3769 N N    . ASP A 1 487 ? 63.271  49.194 17.956  1.00 28.37  ? 488  ASP A N    1 
ATOM   3770 C CA   . ASP A 1 487 ? 63.800  48.970 16.613  1.00 34.07  ? 488  ASP A CA   1 
ATOM   3771 C C    . ASP A 1 487 ? 65.046  48.082 16.743  1.00 32.64  ? 488  ASP A C    1 
ATOM   3772 O O    . ASP A 1 487 ? 66.013  48.464 17.400  1.00 34.77  ? 488  ASP A O    1 
ATOM   3773 C CB   . ASP A 1 487 ? 64.165  50.334 16.004  1.00 41.24  ? 488  ASP A CB   1 
ATOM   3774 C CG   . ASP A 1 487 ? 64.733  50.241 14.586  1.00 44.74  ? 488  ASP A CG   1 
ATOM   3775 O OD1  . ASP A 1 487 ? 65.156  49.150 14.149  1.00 49.11  ? 488  ASP A OD1  1 
ATOM   3776 O OD2  . ASP A 1 487 ? 64.771  51.292 13.906  1.00 50.76  ? 488  ASP A OD2  1 
ATOM   3777 N N    . PRO A 1 488 ? 65.041  46.898 16.108  1.00 35.33  ? 489  PRO A N    1 
ATOM   3778 C CA   . PRO A 1 488 ? 66.181  45.984 16.302  1.00 34.34  ? 489  PRO A CA   1 
ATOM   3779 C C    . PRO A 1 488 ? 67.455  46.453 15.605  1.00 35.84  ? 489  PRO A C    1 
ATOM   3780 O O    . PRO A 1 488 ? 68.527  45.918 15.895  1.00 34.36  ? 489  PRO A O    1 
ATOM   3781 C CB   . PRO A 1 488 ? 65.688  44.658 15.692  1.00 28.24  ? 489  PRO A CB   1 
ATOM   3782 C CG   . PRO A 1 488 ? 64.647  45.072 14.685  1.00 32.46  ? 489  PRO A CG   1 
ATOM   3783 C CD   . PRO A 1 488 ? 63.999  46.327 15.232  1.00 35.01  ? 489  PRO A CD   1 
ATOM   3784 N N    . ASN A 1 489 ? 67.341  47.441 14.717  1.00 32.65  ? 490  ASN A N    1 
ATOM   3785 C CA   . ASN A 1 489 ? 68.476  47.893 13.912  1.00 37.26  ? 490  ASN A CA   1 
ATOM   3786 C C    . ASN A 1 489 ? 69.578  48.668 14.635  1.00 52.58  ? 490  ASN A C    1 
ATOM   3787 O O    . ASN A 1 489 ? 69.324  49.416 15.590  1.00 42.69  ? 490  ASN A O    1 
ATOM   3788 C CB   . ASN A 1 489 ? 68.001  48.720 12.712  1.00 31.68  ? 490  ASN A CB   1 
ATOM   3789 C CG   . ASN A 1 489 ? 67.353  47.873 11.643  1.00 36.08  ? 490  ASN A CG   1 
ATOM   3790 O OD1  . ASN A 1 489 ? 68.034  47.177 10.892  1.00 47.81  ? 490  ASN A OD1  1 
ATOM   3791 N ND2  . ASN A 1 489 ? 66.031  47.932 11.562  1.00 29.63  ? 490  ASN A ND2  1 
ATOM   3792 N N    . GLU A 1 490 ? 70.796  48.474 14.124  1.00 73.85  ? 491  GLU A N    1 
ATOM   3793 C CA   . GLU A 1 490 ? 71.995  49.222 14.491  1.00 89.70  ? 491  GLU A CA   1 
ATOM   3794 C C    . GLU A 1 490 ? 72.230  50.330 13.468  1.00 102.77 ? 491  GLU A C    1 
ATOM   3795 O O    . GLU A 1 490 ? 71.712  50.260 12.348  1.00 102.42 ? 491  GLU A O    1 
ATOM   3796 C CB   . GLU A 1 490 ? 73.210  48.292 14.434  1.00 91.26  ? 491  GLU A CB   1 
ATOM   3797 C CG   . GLU A 1 490 ? 73.217  47.154 15.433  1.00 90.10  ? 491  GLU A CG   1 
ATOM   3798 C CD   . GLU A 1 490 ? 73.747  47.591 16.777  1.00 89.77  ? 491  GLU A CD   1 
ATOM   3799 O OE1  . GLU A 1 490 ? 73.576  48.778 17.125  1.00 89.40  ? 491  GLU A OE1  1 
ATOM   3800 O OE2  . GLU A 1 490 ? 74.345  46.754 17.479  1.00 91.59  ? 491  GLU A OE2  1 
ATOM   3801 N N    . PRO A 1 491 ? 73.021  51.353 13.846  1.00 111.41 ? 492  PRO A N    1 
ATOM   3802 C CA   . PRO A 1 491 ? 73.578  52.346 12.915  1.00 114.82 ? 492  PRO A CA   1 
ATOM   3803 C C    . PRO A 1 491 ? 74.069  51.721 11.599  1.00 118.90 ? 492  PRO A C    1 
ATOM   3804 O O    . PRO A 1 491 ? 74.753  50.693 11.610  1.00 115.39 ? 492  PRO A O    1 
ATOM   3805 C CB   . PRO A 1 491 ? 74.739  52.934 13.715  1.00 111.36 ? 492  PRO A CB   1 
ATOM   3806 C CG   . PRO A 1 491 ? 74.213  52.927 15.125  1.00 110.55 ? 492  PRO A CG   1 
ATOM   3807 C CD   . PRO A 1 491 ? 73.292  51.717 15.249  1.00 109.75 ? 492  PRO A CD   1 
ATOM   3808 N N    . ARG A 1 492 ? 73.722  52.363 10.484  1.00 125.15 ? 493  ARG A N    1 
ATOM   3809 C CA   . ARG A 1 492 ? 73.805  51.759 9.148   1.00 126.79 ? 493  ARG A CA   1 
ATOM   3810 C C    . ARG A 1 492 ? 75.181  51.258 8.715   1.00 123.74 ? 493  ARG A C    1 
ATOM   3811 O O    . ARG A 1 492 ? 76.216  51.820 9.084   1.00 119.97 ? 493  ARG A O    1 
ATOM   3812 C CB   . ARG A 1 492 ? 73.240  52.714 8.090   1.00 127.91 ? 493  ARG A CB   1 
ATOM   3813 C CG   . ARG A 1 492 ? 72.929  52.055 6.752   1.00 125.80 ? 493  ARG A CG   1 
ATOM   3814 C CD   . ARG A 1 492 ? 71.904  52.863 5.969   1.00 124.89 ? 493  ARG A CD   1 
ATOM   3815 N NE   . ARG A 1 492 ? 70.641  52.986 6.693   1.00 121.64 ? 493  ARG A NE   1 
ATOM   3816 C CZ   . ARG A 1 492 ? 70.356  53.974 7.537   1.00 120.02 ? 493  ARG A CZ   1 
ATOM   3817 N NH1  . ARG A 1 492 ? 71.245  54.932 7.767   1.00 121.68 ? 493  ARG A NH1  1 
ATOM   3818 N NH2  . ARG A 1 492 ? 69.181  54.006 8.152   1.00 116.76 ? 493  ARG A NH2  1 
ATOM   3819 N N    . ASP A 1 493 ? 75.163  50.198 7.911   1.00 121.19 ? 494  ASP A N    1 
ATOM   3820 C CA   . ASP A 1 493 ? 76.373  49.533 7.460   1.00 116.46 ? 494  ASP A CA   1 
ATOM   3821 C C    . ASP A 1 493 ? 76.444  49.543 5.942   1.00 112.73 ? 494  ASP A C    1 
ATOM   3822 O O    . ASP A 1 493 ? 77.519  49.416 5.365   1.00 111.70 ? 494  ASP A O    1 
ATOM   3823 C CB   . ASP A 1 493 ? 76.400  48.092 7.975   1.00 114.46 ? 494  ASP A CB   1 
ATOM   3824 C CG   . ASP A 1 493 ? 77.798  47.507 7.994   1.00 115.39 ? 494  ASP A CG   1 
ATOM   3825 O OD1  . ASP A 1 493 ? 78.664  48.059 8.708   1.00 113.60 ? 494  ASP A OD1  1 
ATOM   3826 O OD2  . ASP A 1 493 ? 78.036  46.503 7.292   1.00 116.48 ? 494  ASP A OD2  1 
ATOM   3827 N N    . PRO A 1 497 ? 73.215  46.225 6.644   1.00 49.96  ? 498  PRO A N    1 
ATOM   3828 C CA   . PRO A 1 497 ? 72.023  45.452 6.248   1.00 58.40  ? 498  PRO A CA   1 
ATOM   3829 C C    . PRO A 1 497 ? 70.861  45.708 7.217   1.00 48.32  ? 498  PRO A C    1 
ATOM   3830 O O    . PRO A 1 497 ? 70.933  45.330 8.386   1.00 43.20  ? 498  PRO A O    1 
ATOM   3831 C CB   . PRO A 1 497 ? 72.500  44.002 6.353   1.00 56.53  ? 498  PRO A CB   1 
ATOM   3832 C CG   . PRO A 1 497 ? 73.536  44.037 7.444   1.00 51.24  ? 498  PRO A CG   1 
ATOM   3833 C CD   . PRO A 1 497 ? 74.184  45.412 7.402   1.00 49.41  ? 498  PRO A CD   1 
ATOM   3834 N N    . GLN A 1 498 ? 69.816  46.366 6.732   1.00 42.71  ? 499  GLN A N    1 
ATOM   3835 C CA   . GLN A 1 498 ? 68.762  46.870 7.604   1.00 46.03  ? 499  GLN A CA   1 
ATOM   3836 C C    . GLN A 1 498 ? 67.513  46.000 7.591   1.00 40.07  ? 499  GLN A C    1 
ATOM   3837 O O    . GLN A 1 498 ? 67.072  45.536 6.541   1.00 36.28  ? 499  GLN A O    1 
ATOM   3838 C CB   . GLN A 1 498 ? 68.392  48.309 7.218   1.00 53.95  ? 499  GLN A CB   1 
ATOM   3839 C CG   . GLN A 1 498 ? 69.489  49.338 7.478   1.00 59.37  ? 499  GLN A CG   1 
ATOM   3840 C CD   . GLN A 1 498 ? 69.830  49.471 8.952   1.00 65.53  ? 499  GLN A CD   1 
ATOM   3841 O OE1  . GLN A 1 498 ? 69.055  50.030 9.731   1.00 67.96  ? 499  GLN A OE1  1 
ATOM   3842 N NE2  . GLN A 1 498 ? 70.992  48.952 9.343   1.00 64.98  ? 499  GLN A NE2  1 
ATOM   3843 N N    . TRP A 1 499 ? 66.946  45.811 8.777   1.00 38.23  ? 500  TRP A N    1 
ATOM   3844 C CA   . TRP A 1 499 ? 65.717  45.058 8.984   1.00 36.92  ? 500  TRP A CA   1 
ATOM   3845 C C    . TRP A 1 499 ? 64.510  46.005 8.855   1.00 39.91  ? 500  TRP A C    1 
ATOM   3846 O O    . TRP A 1 499 ? 64.252  46.807 9.753   1.00 41.11  ? 500  TRP A O    1 
ATOM   3847 C CB   . TRP A 1 499 ? 65.796  44.460 10.388  1.00 32.67  ? 500  TRP A CB   1 
ATOM   3848 C CG   . TRP A 1 499 ? 64.745  43.476 10.782  1.00 30.73  ? 500  TRP A CG   1 
ATOM   3849 C CD1  . TRP A 1 499 ? 63.526  43.270 10.190  1.00 32.08  ? 500  TRP A CD1  1 
ATOM   3850 C CD2  . TRP A 1 499 ? 64.817  42.562 11.890  1.00 28.94  ? 500  TRP A CD2  1 
ATOM   3851 N NE1  . TRP A 1 499 ? 62.843  42.273 10.857  1.00 28.65  ? 500  TRP A NE1  1 
ATOM   3852 C CE2  . TRP A 1 499 ? 63.611  41.825 11.900  1.00 27.72  ? 500  TRP A CE2  1 
ATOM   3853 C CE3  . TRP A 1 499 ? 65.785  42.298 12.865  1.00 23.90  ? 500  TRP A CE3  1 
ATOM   3854 C CZ2  . TRP A 1 499 ? 63.349  40.838 12.859  1.00 26.32  ? 500  TRP A CZ2  1 
ATOM   3855 C CZ3  . TRP A 1 499 ? 65.532  41.312 13.808  1.00 27.23  ? 500  TRP A CZ3  1 
ATOM   3856 C CH2  . TRP A 1 499 ? 64.319  40.595 13.802  1.00 26.99  ? 500  TRP A CH2  1 
ATOM   3857 N N    . PRO A 1 500 ? 63.769  45.925 7.734   1.00 36.59  ? 501  PRO A N    1 
ATOM   3858 C CA   . PRO A 1 500 ? 62.632  46.830 7.520   1.00 35.29  ? 501  PRO A CA   1 
ATOM   3859 C C    . PRO A 1 500 ? 61.391  46.344 8.248   1.00 36.06  ? 501  PRO A C    1 
ATOM   3860 O O    . PRO A 1 500 ? 61.278  45.147 8.512   1.00 29.47  ? 501  PRO A O    1 
ATOM   3861 C CB   . PRO A 1 500 ? 62.391  46.722 6.013   1.00 31.28  ? 501  PRO A CB   1 
ATOM   3862 C CG   . PRO A 1 500 ? 62.760  45.327 5.699   1.00 36.67  ? 501  PRO A CG   1 
ATOM   3863 C CD   . PRO A 1 500 ? 63.945  45.001 6.601   1.00 38.40  ? 501  PRO A CD   1 
ATOM   3864 N N    . PRO A 1 501 ? 60.459  47.258 8.559   1.00 39.33  ? 502  PRO A N    1 
ATOM   3865 C CA   . PRO A 1 501 ? 59.220  46.872 9.250   1.00 26.38  ? 502  PRO A CA   1 
ATOM   3866 C C    . PRO A 1 501 ? 58.299  45.969 8.414   1.00 32.20  ? 502  PRO A C    1 
ATOM   3867 O O    . PRO A 1 501 ? 58.239  46.089 7.190   1.00 35.37  ? 502  PRO A O    1 
ATOM   3868 C CB   . PRO A 1 501 ? 58.537  48.218 9.524   1.00 28.20  ? 502  PRO A CB   1 
ATOM   3869 C CG   . PRO A 1 501 ? 59.643  49.241 9.466   1.00 28.00  ? 502  PRO A CG   1 
ATOM   3870 C CD   . PRO A 1 501 ? 60.582  48.720 8.408   1.00 28.90  ? 502  PRO A CD   1 
ATOM   3871 N N    . TYR A 1 502 ? 57.599  45.052 9.075   1.00 29.18  ? 503  TYR A N    1 
ATOM   3872 C CA   . TYR A 1 502 ? 56.583  44.265 8.402   1.00 33.92  ? 503  TYR A CA   1 
ATOM   3873 C C    . TYR A 1 502 ? 55.322  45.116 8.191   1.00 36.58  ? 503  TYR A C    1 
ATOM   3874 O O    . TYR A 1 502 ? 54.871  45.802 9.104   1.00 35.19  ? 503  TYR A O    1 
ATOM   3875 C CB   . TYR A 1 502 ? 56.248  43.027 9.232   1.00 27.54  ? 503  TYR A CB   1 
ATOM   3876 C CG   . TYR A 1 502 ? 55.269  42.076 8.568   1.00 26.20  ? 503  TYR A CG   1 
ATOM   3877 C CD1  . TYR A 1 502 ? 53.899  42.246 8.711   1.00 23.20  ? 503  TYR A CD1  1 
ATOM   3878 C CD2  . TYR A 1 502 ? 55.720  41.003 7.802   1.00 23.49  ? 503  TYR A CD2  1 
ATOM   3879 C CE1  . TYR A 1 502 ? 52.997  41.384 8.114   1.00 26.86  ? 503  TYR A CE1  1 
ATOM   3880 C CE2  . TYR A 1 502 ? 54.824  40.127 7.199   1.00 29.29  ? 503  TYR A CE2  1 
ATOM   3881 C CZ   . TYR A 1 502 ? 53.459  40.320 7.360   1.00 30.64  ? 503  TYR A CZ   1 
ATOM   3882 O OH   . TYR A 1 502 ? 52.557  39.453 6.764   1.00 36.17  ? 503  TYR A OH   1 
ATOM   3883 N N    . THR A 1 503 ? 54.756  45.061 6.989   1.00 36.27  ? 504  THR A N    1 
ATOM   3884 C CA   . THR A 1 503 ? 53.485  45.730 6.692   1.00 34.57  ? 504  THR A CA   1 
ATOM   3885 C C    . THR A 1 503 ? 52.545  44.791 5.938   1.00 34.89  ? 504  THR A C    1 
ATOM   3886 O O    . THR A 1 503 ? 53.002  43.858 5.271   1.00 35.85  ? 504  THR A O    1 
ATOM   3887 C CB   . THR A 1 503 ? 53.690  46.982 5.836   1.00 36.53  ? 504  THR A CB   1 
ATOM   3888 O OG1  . THR A 1 503 ? 54.350  46.602 4.620   1.00 37.61  ? 504  THR A OG1  1 
ATOM   3889 C CG2  . THR A 1 503 ? 54.527  48.024 6.587   1.00 34.90  ? 504  THR A CG2  1 
ATOM   3890 N N    . ALA A 1 504 ? 51.240  45.050 6.036   1.00 32.72  ? 505  ALA A N    1 
ATOM   3891 C CA   . ALA A 1 504 ? 50.237  44.172 5.439   1.00 36.07  ? 505  ALA A CA   1 
ATOM   3892 C C    . ALA A 1 504 ? 50.434  44.011 3.925   1.00 38.27  ? 505  ALA A C    1 
ATOM   3893 O O    . ALA A 1 504 ? 50.176  42.943 3.367   1.00 40.30  ? 505  ALA A O    1 
ATOM   3894 C CB   . ALA A 1 504 ? 48.828  44.663 5.759   1.00 32.22  ? 505  ALA A CB   1 
ATOM   3895 N N    . GLY A 1 505 ? 50.915  45.062 3.273   1.00 37.57  ? 506  GLY A N    1 
ATOM   3896 C CA   . GLY A 1 505 ? 51.137  45.021 1.838   1.00 33.44  ? 506  GLY A CA   1 
ATOM   3897 C C    . GLY A 1 505 ? 52.452  44.373 1.437   1.00 36.79  ? 506  GLY A C    1 
ATOM   3898 O O    . GLY A 1 505 ? 52.456  43.308 0.820   1.00 39.10  ? 506  GLY A O    1 
ATOM   3899 N N    . ALA A 1 506 ? 53.572  45.010 1.778   1.00 35.85  ? 507  ALA A N    1 
ATOM   3900 C CA   . ALA A 1 506 ? 54.883  44.489 1.380   1.00 32.50  ? 507  ALA A CA   1 
ATOM   3901 C C    . ALA A 1 506 ? 55.258  43.190 2.120   1.00 33.11  ? 507  ALA A C    1 
ATOM   3902 O O    . ALA A 1 506 ? 56.003  42.366 1.583   1.00 34.69  ? 507  ALA A O    1 
ATOM   3903 C CB   . ALA A 1 506 ? 55.955  45.542 1.555   1.00 29.88  ? 507  ALA A CB   1 
ATOM   3904 N N    . GLN A 1 507 ? 54.746  43.020 3.341   1.00 33.40  ? 508  GLN A N    1 
ATOM   3905 C CA   . GLN A 1 507 ? 54.930  41.780 4.108   1.00 33.75  ? 508  GLN A CA   1 
ATOM   3906 C C    . GLN A 1 507 ? 56.398  41.355 4.189   1.00 32.08  ? 508  GLN A C    1 
ATOM   3907 O O    . GLN A 1 507 ? 56.733  40.179 4.001   1.00 31.91  ? 508  GLN A O    1 
ATOM   3908 C CB   . GLN A 1 507 ? 54.095  40.645 3.495   1.00 30.21  ? 508  GLN A CB   1 
ATOM   3909 C CG   . GLN A 1 507 ? 52.594  40.928 3.388   1.00 29.54  ? 508  GLN A CG   1 
ATOM   3910 C CD   . GLN A 1 507 ? 51.877  39.935 2.469   1.00 33.32  ? 508  GLN A CD   1 
ATOM   3911 O OE1  . GLN A 1 507 ? 51.991  38.716 2.635   1.00 34.26  ? 508  GLN A OE1  1 
ATOM   3912 N NE2  . GLN A 1 507 ? 51.159  40.456 1.475   1.00 29.12  ? 508  GLN A NE2  1 
ATOM   3913 N N    . GLN A 1 508 ? 57.269  42.315 4.461   1.00 26.55  ? 509  GLN A N    1 
ATOM   3914 C CA   . GLN A 1 508 ? 58.705  42.047 4.534   1.00 33.62  ? 509  GLN A CA   1 
ATOM   3915 C C    . GLN A 1 508 ? 59.151  41.506 5.894   1.00 33.67  ? 509  GLN A C    1 
ATOM   3916 O O    . GLN A 1 508 ? 58.713  41.989 6.941   1.00 30.46  ? 509  GLN A O    1 
ATOM   3917 C CB   . GLN A 1 508 ? 59.489  43.320 4.232   1.00 28.65  ? 509  GLN A CB   1 
ATOM   3918 C CG   . GLN A 1 508 ? 59.302  43.867 2.833   1.00 35.53  ? 509  GLN A CG   1 
ATOM   3919 C CD   . GLN A 1 508 ? 59.976  45.212 2.659   1.00 37.16  ? 509  GLN A CD   1 
ATOM   3920 O OE1  . GLN A 1 508 ? 59.490  46.227 3.153   1.00 38.15  ? 509  GLN A OE1  1 
ATOM   3921 N NE2  . GLN A 1 508 ? 61.105  45.224 1.965   1.00 40.27  ? 509  GLN A NE2  1 
ATOM   3922 N N    . TYR A 1 509 ? 60.043  40.517 5.863   1.00 33.48  ? 510  TYR A N    1 
ATOM   3923 C CA   . TYR A 1 509 ? 60.623  39.943 7.076   1.00 30.18  ? 510  TYR A CA   1 
ATOM   3924 C C    . TYR A 1 509 ? 62.061  39.557 6.753   1.00 30.58  ? 510  TYR A C    1 
ATOM   3925 O O    . TYR A 1 509 ? 62.451  39.561 5.585   1.00 29.64  ? 510  TYR A O    1 
ATOM   3926 C CB   . TYR A 1 509 ? 59.842  38.702 7.513   1.00 23.83  ? 510  TYR A CB   1 
ATOM   3927 C CG   . TYR A 1 509 ? 59.959  37.550 6.541   1.00 31.71  ? 510  TYR A CG   1 
ATOM   3928 C CD1  . TYR A 1 509 ? 59.074  37.421 5.471   1.00 24.73  ? 510  TYR A CD1  1 
ATOM   3929 C CD2  . TYR A 1 509 ? 60.954  36.586 6.692   1.00 28.76  ? 510  TYR A CD2  1 
ATOM   3930 C CE1  . TYR A 1 509 ? 59.179  36.362 4.578   1.00 25.21  ? 510  TYR A CE1  1 
ATOM   3931 C CE2  . TYR A 1 509 ? 61.071  35.530 5.799   1.00 30.91  ? 510  TYR A CE2  1 
ATOM   3932 C CZ   . TYR A 1 509 ? 60.177  35.421 4.751   1.00 40.80  ? 510  TYR A CZ   1 
ATOM   3933 O OH   . TYR A 1 509 ? 60.290  34.373 3.871   1.00 46.04  ? 510  TYR A OH   1 
ATOM   3934 N N    . VAL A 1 510 ? 62.844  39.200 7.766   1.00 24.76  ? 511  VAL A N    1 
ATOM   3935 C CA   . VAL A 1 510 ? 64.232  38.820 7.518   1.00 32.68  ? 511  VAL A CA   1 
ATOM   3936 C C    . VAL A 1 510 ? 64.527  37.384 7.955   1.00 29.81  ? 511  VAL A C    1 
ATOM   3937 O O    . VAL A 1 510 ? 63.938  36.885 8.916   1.00 26.94  ? 511  VAL A O    1 
ATOM   3938 C CB   . VAL A 1 510 ? 65.224  39.779 8.218   1.00 32.87  ? 511  VAL A CB   1 
ATOM   3939 C CG1  . VAL A 1 510 ? 65.017  41.207 7.746   1.00 29.81  ? 511  VAL A CG1  1 
ATOM   3940 C CG2  . VAL A 1 510 ? 65.074  39.680 9.740   1.00 24.39  ? 511  VAL A CG2  1 
ATOM   3941 N N    . SER A 1 511 ? 65.433  36.721 7.235   1.00 28.87  ? 512  SER A N    1 
ATOM   3942 C CA   . SER A 1 511 ? 65.936  35.418 7.657   1.00 27.84  ? 512  SER A CA   1 
ATOM   3943 C C    . SER A 1 511 ? 67.055  35.603 8.682   1.00 34.03  ? 512  SER A C    1 
ATOM   3944 O O    . SER A 1 511 ? 67.996  36.368 8.474   1.00 25.46  ? 512  SER A O    1 
ATOM   3945 C CB   . SER A 1 511 ? 66.466  34.624 6.472   1.00 29.10  ? 512  SER A CB   1 
ATOM   3946 O OG   . SER A 1 511 ? 67.564  35.289 5.883   1.00 47.15  ? 512  SER A OG   1 
ATOM   3947 N N    . LEU A 1 512 ? 66.934  34.916 9.805   1.00 35.12  ? 513  LEU A N    1 
ATOM   3948 C CA   . LEU A 1 512 ? 67.987  34.919 10.794  1.00 31.99  ? 513  LEU A CA   1 
ATOM   3949 C C    . LEU A 1 512 ? 68.771  33.614 10.690  1.00 30.91  ? 513  LEU A C    1 
ATOM   3950 O O    . LEU A 1 512 ? 68.213  32.524 10.915  1.00 25.18  ? 513  LEU A O    1 
ATOM   3951 C CB   . LEU A 1 512 ? 67.388  35.043 12.192  1.00 29.81  ? 513  LEU A CB   1 
ATOM   3952 C CG   . LEU A 1 512 ? 66.629  36.329 12.494  1.00 29.29  ? 513  LEU A CG   1 
ATOM   3953 C CD1  . LEU A 1 512 ? 66.087  36.302 13.931  1.00 23.20  ? 513  LEU A CD1  1 
ATOM   3954 C CD2  . LEU A 1 512 ? 67.531  37.518 12.292  1.00 22.89  ? 513  LEU A CD2  1 
ATOM   3955 N N    . ASP A 1 513 ? 70.049  33.725 10.322  1.00 35.08  ? 514  ASP A N    1 
ATOM   3956 C CA   . ASP A 1 513 ? 71.006  32.620 10.463  1.00 40.76  ? 514  ASP A CA   1 
ATOM   3957 C C    . ASP A 1 513 ? 72.428  33.133 10.323  1.00 35.79  ? 514  ASP A C    1 
ATOM   3958 O O    . ASP A 1 513 ? 72.665  34.330 10.477  1.00 37.08  ? 514  ASP A O    1 
ATOM   3959 C CB   . ASP A 1 513 ? 70.730  31.479 9.485   1.00 51.34  ? 514  ASP A CB   1 
ATOM   3960 C CG   . ASP A 1 513 ? 70.860  31.907 8.059   1.00 69.52  ? 514  ASP A CG   1 
ATOM   3961 O OD1  . ASP A 1 513 ? 70.672  33.112 7.783   1.00 76.61  ? 514  ASP A OD1  1 
ATOM   3962 O OD2  . ASP A 1 513 ? 71.145  31.039 7.210   1.00 81.43  ? 514  ASP A OD2  1 
ATOM   3963 N N    . LEU A 1 514 ? 73.368  32.234 10.037  1.00 39.55  ? 515  LEU A N    1 
ATOM   3964 C CA   . LEU A 1 514 ? 74.795  32.579 10.093  1.00 42.47  ? 515  LEU A CA   1 
ATOM   3965 C C    . LEU A 1 514 ? 75.201  33.679 9.107   1.00 39.83  ? 515  LEU A C    1 
ATOM   3966 O O    . LEU A 1 514 ? 76.058  34.497 9.423   1.00 43.46  ? 515  LEU A O    1 
ATOM   3967 C CB   . LEU A 1 514 ? 75.668  31.330 9.936   1.00 42.83  ? 515  LEU A CB   1 
ATOM   3968 C CG   . LEU A 1 514 ? 75.423  30.264 11.008  1.00 43.11  ? 515  LEU A CG   1 
ATOM   3969 C CD1  . LEU A 1 514 ? 76.363  29.062 10.855  1.00 38.81  ? 515  LEU A CD1  1 
ATOM   3970 C CD2  . LEU A 1 514 ? 75.543  30.879 12.404  1.00 39.95  ? 515  LEU A CD2  1 
ATOM   3971 N N    . ARG A 1 515 ? 74.569  33.704 7.933   1.00 44.36  ? 516  ARG A N    1 
ATOM   3972 C CA   . ARG A 1 515 ? 74.789  34.754 6.933   1.00 45.04  ? 516  ARG A CA   1 
ATOM   3973 C C    . ARG A 1 515 ? 74.052  36.017 7.354   1.00 45.01  ? 516  ARG A C    1 
ATOM   3974 O O    . ARG A 1 515 ? 73.162  35.958 8.200   1.00 46.54  ? 516  ARG A O    1 
ATOM   3975 C CB   . ARG A 1 515 ? 74.254  34.315 5.568   1.00 43.41  ? 516  ARG A CB   1 
ATOM   3976 C CG   . ARG A 1 515 ? 74.826  33.013 5.031   1.00 53.75  ? 516  ARG A CG   1 
ATOM   3977 C CD   . ARG A 1 515 ? 73.864  32.378 4.021   1.00 68.76  ? 516  ARG A CD   1 
ATOM   3978 N NE   . ARG A 1 515 ? 72.493  32.316 4.543   1.00 81.32  ? 516  ARG A NE   1 
ATOM   3979 C CZ   . ARG A 1 515 ? 71.469  33.036 4.075   1.00 85.35  ? 516  ARG A CZ   1 
ATOM   3980 N NH1  . ARG A 1 515 ? 71.652  33.869 3.054   1.00 87.35  ? 516  ARG A NH1  1 
ATOM   3981 N NH2  . ARG A 1 515 ? 70.258  32.918 4.621   1.00 78.41  ? 516  ARG A NH2  1 
ATOM   3982 N N    . PRO A 1 516 ? 74.409  37.164 6.753   1.00 41.20  ? 517  PRO A N    1 
ATOM   3983 C CA   . PRO A 1 516 ? 73.785  38.459 7.074   1.00 37.13  ? 517  PRO A CA   1 
ATOM   3984 C C    . PRO A 1 516 ? 72.288  38.488 6.761   1.00 42.70  ? 517  PRO A C    1 
ATOM   3985 O O    . PRO A 1 516 ? 71.814  37.669 5.964   1.00 43.47  ? 517  PRO A O    1 
ATOM   3986 C CB   . PRO A 1 516 ? 74.508  39.440 6.142   1.00 35.58  ? 517  PRO A CB   1 
ATOM   3987 C CG   . PRO A 1 516 ? 75.802  38.756 5.792   1.00 40.01  ? 517  PRO A CG   1 
ATOM   3988 C CD   . PRO A 1 516 ? 75.469  37.294 5.737   1.00 40.78  ? 517  PRO A CD   1 
ATOM   3989 N N    . LEU A 1 517 ? 71.564  39.423 7.380   1.00 39.99  ? 518  LEU A N    1 
ATOM   3990 C CA   . LEU A 1 517 ? 70.138  39.597 7.112   1.00 40.25  ? 518  LEU A CA   1 
ATOM   3991 C C    . LEU A 1 517 ? 69.831  39.594 5.628   1.00 41.02  ? 518  LEU A C    1 
ATOM   3992 O O    . LEU A 1 517 ? 70.484  40.279 4.837   1.00 40.56  ? 518  LEU A O    1 
ATOM   3993 C CB   . LEU A 1 517 ? 69.622  40.910 7.686   1.00 38.41  ? 518  LEU A CB   1 
ATOM   3994 C CG   . LEU A 1 517 ? 69.622  41.010 9.196   1.00 35.27  ? 518  LEU A CG   1 
ATOM   3995 C CD1  . LEU A 1 517 ? 68.804  42.212 9.625   1.00 35.01  ? 518  LEU A CD1  1 
ATOM   3996 C CD2  . LEU A 1 517 ? 69.078  39.724 9.776   1.00 37.33  ? 518  LEU A CD2  1 
ATOM   3997 N N    . GLU A 1 518 ? 68.820  38.819 5.265   1.00 36.70  ? 519  GLU A N    1 
ATOM   3998 C CA   . GLU A 1 518 ? 68.304  38.805 3.916   1.00 37.50  ? 519  GLU A CA   1 
ATOM   3999 C C    . GLU A 1 518 ? 66.821  39.117 4.054   1.00 35.98  ? 519  GLU A C    1 
ATOM   4000 O O    . GLU A 1 518 ? 66.132  38.531 4.892   1.00 31.86  ? 519  GLU A O    1 
ATOM   4001 C CB   . GLU A 1 518 ? 68.555  37.438 3.287   1.00 46.47  ? 519  GLU A CB   1 
ATOM   4002 C CG   . GLU A 1 518 ? 67.900  37.195 1.954   1.00 64.59  ? 519  GLU A CG   1 
ATOM   4003 C CD   . GLU A 1 518 ? 68.048  35.742 1.514   1.00 77.81  ? 519  GLU A CD   1 
ATOM   4004 O OE1  . GLU A 1 518 ? 69.098  35.129 1.839   1.00 80.44  ? 519  GLU A OE1  1 
ATOM   4005 O OE2  . GLU A 1 518 ? 67.112  35.218 0.860   1.00 75.85  ? 519  GLU A OE2  1 
ATOM   4006 N N    . VAL A 1 519 ? 66.348  40.076 3.266   1.00 33.35  ? 520  VAL A N    1 
ATOM   4007 C CA   . VAL A 1 519 ? 64.966  40.538 3.335   1.00 35.42  ? 520  VAL A CA   1 
ATOM   4008 C C    . VAL A 1 519 ? 64.109  39.721 2.375   1.00 36.12  ? 520  VAL A C    1 
ATOM   4009 O O    . VAL A 1 519 ? 64.501  39.511 1.225   1.00 35.65  ? 520  VAL A O    1 
ATOM   4010 C CB   . VAL A 1 519 ? 64.861  42.028 2.952   1.00 37.04  ? 520  VAL A CB   1 
ATOM   4011 C CG1  . VAL A 1 519 ? 63.409  42.484 2.974   1.00 30.53  ? 520  VAL A CG1  1 
ATOM   4012 C CG2  . VAL A 1 519 ? 65.700  42.881 3.894   1.00 28.47  ? 520  VAL A CG2  1 
ATOM   4013 N N    . ARG A 1 520 ? 62.946  39.266 2.842   1.00 30.32  ? 521  ARG A N    1 
ATOM   4014 C CA   . ARG A 1 520 ? 62.023  38.499 2.004   1.00 30.52  ? 521  ARG A CA   1 
ATOM   4015 C C    . ARG A 1 520 ? 60.583  38.977 2.133   1.00 30.63  ? 521  ARG A C    1 
ATOM   4016 O O    . ARG A 1 520 ? 60.265  39.776 3.015   1.00 29.52  ? 521  ARG A O    1 
ATOM   4017 C CB   . ARG A 1 520 ? 62.100  37.014 2.348   1.00 31.32  ? 521  ARG A CB   1 
ATOM   4018 C CG   . ARG A 1 520 ? 63.493  36.454 2.214   1.00 40.14  ? 521  ARG A CG   1 
ATOM   4019 C CD   . ARG A 1 520 ? 63.541  34.993 2.569   1.00 42.46  ? 521  ARG A CD   1 
ATOM   4020 N NE   . ARG A 1 520 ? 64.922  34.521 2.599   1.00 43.47  ? 521  ARG A NE   1 
ATOM   4021 C CZ   . ARG A 1 520 ? 65.314  33.378 3.151   1.00 40.53  ? 521  ARG A CZ   1 
ATOM   4022 N NH1  . ARG A 1 520 ? 64.428  32.574 3.719   1.00 34.40  ? 521  ARG A NH1  1 
ATOM   4023 N NH2  . ARG A 1 520 ? 66.595  33.044 3.131   1.00 45.41  ? 521  ARG A NH2  1 
ATOM   4024 N N    . ARG A 1 521 ? 59.713  38.474 1.261   1.00 26.99  ? 522  ARG A N    1 
ATOM   4025 C CA   . ARG A 1 521 ? 58.311  38.879 1.267   1.00 28.40  ? 522  ARG A CA   1 
ATOM   4026 C C    . ARG A 1 521 ? 57.350  37.725 1.520   1.00 26.68  ? 522  ARG A C    1 
ATOM   4027 O O    . ARG A 1 521 ? 57.447  36.672 0.885   1.00 27.97  ? 522  ARG A O    1 
ATOM   4028 C CB   . ARG A 1 521 ? 57.942  39.538 -0.065  1.00 32.42  ? 522  ARG A CB   1 
ATOM   4029 C CG   . ARG A 1 521 ? 58.591  40.883 -0.304  1.00 38.47  ? 522  ARG A CG   1 
ATOM   4030 C CD   . ARG A 1 521 ? 57.889  41.642 -1.427  1.00 36.12  ? 522  ARG A CD   1 
ATOM   4031 N NE   . ARG A 1 521 ? 56.509  41.951 -1.059  1.00 37.95  ? 522  ARG A NE   1 
ATOM   4032 C CZ   . ARG A 1 521 ? 55.457  41.737 -1.842  1.00 37.75  ? 522  ARG A CZ   1 
ATOM   4033 N NH1  . ARG A 1 521 ? 55.631  41.224 -3.052  1.00 36.10  ? 522  ARG A NH1  1 
ATOM   4034 N NH2  . ARG A 1 521 ? 54.234  42.039 -1.417  1.00 37.18  ? 522  ARG A NH2  1 
ATOM   4035 N N    . GLY A 1 522 ? 56.403  37.938 2.429   1.00 31.83  ? 523  GLY A N    1 
ATOM   4036 C CA   . GLY A 1 522 ? 55.307  37.003 2.607   1.00 30.62  ? 523  GLY A CA   1 
ATOM   4037 C C    . GLY A 1 522 ? 55.610  35.855 3.549   1.00 36.71  ? 523  GLY A C    1 
ATOM   4038 O O    . GLY A 1 522 ? 56.470  35.008 3.271   1.00 34.29  ? 523  GLY A O    1 
ATOM   4039 N N    . LEU A 1 523 ? 54.895  35.828 4.669   1.00 35.01  ? 524  LEU A N    1 
ATOM   4040 C CA   . LEU A 1 523 ? 54.976  34.721 5.608   1.00 30.57  ? 524  LEU A CA   1 
ATOM   4041 C C    . LEU A 1 523 ? 54.006  33.609 5.158   1.00 30.78  ? 524  LEU A C    1 
ATOM   4042 O O    . LEU A 1 523 ? 52.862  33.540 5.642   1.00 26.78  ? 524  LEU A O    1 
ATOM   4043 C CB   . LEU A 1 523 ? 54.606  35.221 7.003   1.00 22.18  ? 524  LEU A CB   1 
ATOM   4044 C CG   . LEU A 1 523 ? 55.585  36.177 7.677   1.00 34.72  ? 524  LEU A CG   1 
ATOM   4045 C CD1  . LEU A 1 523 ? 55.009  36.768 8.975   1.00 30.31  ? 524  LEU A CD1  1 
ATOM   4046 C CD2  . LEU A 1 523 ? 56.893  35.448 7.948   1.00 34.68  ? 524  LEU A CD2  1 
ATOM   4047 N N    A ARG A 1 524 ? 54.469  32.761 4.238   0.55 28.24  ? 525  ARG A N    1 
ATOM   4048 N N    B ARG A 1 524 ? 54.457  32.751 4.243   0.45 28.35  ? 525  ARG A N    1 
ATOM   4049 C CA   A ARG A 1 524 ? 53.625  31.744 3.605   0.55 27.85  ? 525  ARG A CA   1 
ATOM   4050 C CA   B ARG A 1 524 ? 53.593  31.719 3.663   0.45 28.20  ? 525  ARG A CA   1 
ATOM   4051 C C    A ARG A 1 524 ? 52.277  32.338 3.217   0.55 27.94  ? 525  ARG A C    1 
ATOM   4052 C C    B ARG A 1 524 ? 52.266  32.337 3.220   0.45 27.92  ? 525  ARG A C    1 
ATOM   4053 O O    A ARG A 1 524 ? 51.219  31.846 3.615   0.55 27.56  ? 525  ARG A O    1 
ATOM   4054 O O    B ARG A 1 524 ? 51.196  31.854 3.594   0.45 27.48  ? 525  ARG A O    1 
ATOM   4055 C CB   A ARG A 1 524 ? 53.461  30.526 4.517   0.55 29.97  ? 525  ARG A CB   1 
ATOM   4056 C CB   B ARG A 1 524 ? 53.323  30.599 4.679   0.45 29.42  ? 525  ARG A CB   1 
ATOM   4057 C CG   A ARG A 1 524 ? 54.801  29.971 4.974   0.55 34.70  ? 525  ARG A CG   1 
ATOM   4058 C CG   B ARG A 1 524 ? 54.570  29.991 5.331   0.45 33.60  ? 525  ARG A CG   1 
ATOM   4059 C CD   A ARG A 1 524 ? 54.719  28.574 5.561   0.55 34.63  ? 525  ARG A CD   1 
ATOM   4060 C CD   B ARG A 1 524 ? 55.127  28.813 4.534   0.45 36.47  ? 525  ARG A CD   1 
ATOM   4061 N NE   A ARG A 1 524 ? 56.063  28.060 5.821   0.55 34.18  ? 525  ARG A NE   1 
ATOM   4062 N NE   B ARG A 1 524 ? 54.183  27.700 4.471   0.45 38.59  ? 525  ARG A NE   1 
ATOM   4063 C CZ   A ARG A 1 524 ? 56.340  26.798 6.121   0.55 34.29  ? 525  ARG A CZ   1 
ATOM   4064 C CZ   B ARG A 1 524 ? 54.166  26.786 3.506   0.45 37.69  ? 525  ARG A CZ   1 
ATOM   4065 N NH1  A ARG A 1 524 ? 55.362  25.912 6.199   0.55 37.26  ? 525  ARG A NH1  1 
ATOM   4066 N NH1  B ARG A 1 524 ? 55.050  26.849 2.518   0.45 33.26  ? 525  ARG A NH1  1 
ATOM   4067 N NH2  A ARG A 1 524 ? 57.595  26.424 6.339   0.55 30.60  ? 525  ARG A NH2  1 
ATOM   4068 N NH2  B ARG A 1 524 ? 53.262  25.811 3.528   0.45 22.17  ? 525  ARG A NH2  1 
ATOM   4069 N N    . ALA A 1 525 ? 52.342  33.415 2.442   1.00 28.35  ? 526  ALA A N    1 
ATOM   4070 C CA   . ALA A 1 525 ? 51.163  34.193 2.080   1.00 26.05  ? 526  ALA A CA   1 
ATOM   4071 C C    . ALA A 1 525 ? 50.034  33.371 1.453   1.00 28.64  ? 526  ALA A C    1 
ATOM   4072 O O    . ALA A 1 525 ? 48.870  33.538 1.829   1.00 31.19  ? 526  ALA A O    1 
ATOM   4073 C CB   . ALA A 1 525 ? 51.554  35.368 1.189   1.00 25.37  ? 526  ALA A CB   1 
ATOM   4074 N N    . GLN A 1 526 ? 50.365  32.469 0.532   1.00 23.09  ? 527  GLN A N    1 
ATOM   4075 C CA   . GLN A 1 526 ? 49.327  31.636 -0.089  1.00 24.80  ? 527  GLN A CA   1 
ATOM   4076 C C    . GLN A 1 526 ? 48.647  30.710 0.923   1.00 29.55  ? 527  GLN A C    1 
ATOM   4077 O O    . GLN A 1 526 ? 47.417  30.681 1.013   1.00 34.58  ? 527  GLN A O    1 
ATOM   4078 C CB   . GLN A 1 526 ? 49.885  30.830 -1.265  1.00 22.83  ? 527  GLN A CB   1 
ATOM   4079 C CG   . GLN A 1 526 ? 50.597  31.676 -2.301  1.00 30.80  ? 527  GLN A CG   1 
ATOM   4080 C CD   . GLN A 1 526 ? 49.715  32.793 -2.865  1.00 41.07  ? 527  GLN A CD   1 
ATOM   4081 O OE1  . GLN A 1 526 ? 50.124  33.953 -2.904  1.00 46.49  ? 527  GLN A OE1  1 
ATOM   4082 N NE2  . GLN A 1 526 ? 48.513  32.439 -3.321  1.00 44.01  ? 527  GLN A NE2  1 
ATOM   4083 N N    . ALA A 1 527 ? 49.442  29.960 1.682   1.00 29.24  ? 528  ALA A N    1 
ATOM   4084 C CA   . ALA A 1 527 ? 48.896  29.083 2.720   1.00 31.47  ? 528  ALA A CA   1 
ATOM   4085 C C    . ALA A 1 527 ? 48.025  29.880 3.689   1.00 30.96  ? 528  ALA A C    1 
ATOM   4086 O O    . ALA A 1 527 ? 46.877  29.518 3.979   1.00 31.06  ? 528  ALA A O    1 
ATOM   4087 C CB   . ALA A 1 527 ? 50.015  28.390 3.481   1.00 26.21  ? 528  ALA A CB   1 
ATOM   4088 N N    . CYS A 1 528 ? 48.578  30.983 4.172   1.00 22.16  ? 529  CYS A N    1 
ATOM   4089 C CA   . CYS A 1 528 ? 47.925  31.752 5.224   1.00 26.30  ? 529  CYS A CA   1 
ATOM   4090 C C    . CYS A 1 528 ? 46.637  32.459 4.795   1.00 28.51  ? 529  CYS A C    1 
ATOM   4091 O O    . CYS A 1 528 ? 45.761  32.712 5.631   1.00 25.08  ? 529  CYS A O    1 
ATOM   4092 C CB   . CYS A 1 528 ? 48.933  32.685 5.896   1.00 35.89  ? 529  CYS A CB   1 
ATOM   4093 S SG   . CYS A 1 528 ? 50.171  31.691 6.801   1.00 44.92  ? 529  CYS A SG   1 
ATOM   4094 N N    . ALA A 1 529 ? 46.504  32.736 3.496   1.00 23.19  ? 530  ALA A N    1 
ATOM   4095 C CA   . ALA A 1 529 ? 45.242  33.235 2.957   1.00 23.44  ? 530  ALA A CA   1 
ATOM   4096 C C    . ALA A 1 529 ? 44.180  32.146 3.141   1.00 23.76  ? 530  ALA A C    1 
ATOM   4097 O O    . ALA A 1 529 ? 43.038  32.422 3.534   1.00 21.52  ? 530  ALA A O    1 
ATOM   4098 C CB   . ALA A 1 529 ? 45.387  33.608 1.476   1.00 20.40  ? 530  ALA A CB   1 
ATOM   4099 N N    . PHE A 1 530 ? 44.566  30.906 2.864   1.00 21.73  ? 531  PHE A N    1 
ATOM   4100 C CA   . PHE A 1 530 ? 43.678  29.772 3.100   1.00 21.78  ? 531  PHE A CA   1 
ATOM   4101 C C    . PHE A 1 530 ? 43.280  29.664 4.579   1.00 25.03  ? 531  PHE A C    1 
ATOM   4102 O O    . PHE A 1 530 ? 42.097  29.599 4.897   1.00 22.05  ? 531  PHE A O    1 
ATOM   4103 C CB   . PHE A 1 530 ? 44.304  28.453 2.618   1.00 20.26  ? 531  PHE A CB   1 
ATOM   4104 C CG   . PHE A 1 530 ? 43.570  27.233 3.102   1.00 32.02  ? 531  PHE A CG   1 
ATOM   4105 C CD1  . PHE A 1 530 ? 42.355  26.862 2.531   1.00 34.49  ? 531  PHE A CD1  1 
ATOM   4106 C CD2  . PHE A 1 530 ? 44.078  26.464 4.144   1.00 31.87  ? 531  PHE A CD2  1 
ATOM   4107 C CE1  . PHE A 1 530 ? 41.656  25.741 2.984   1.00 38.89  ? 531  PHE A CE1  1 
ATOM   4108 C CE2  . PHE A 1 530 ? 43.390  25.336 4.595   1.00 32.80  ? 531  PHE A CE2  1 
ATOM   4109 C CZ   . PHE A 1 530 ? 42.179  24.976 4.014   1.00 38.29  ? 531  PHE A CZ   1 
ATOM   4110 N N    . TRP A 1 531 ? 44.259  29.651 5.482   1.00 20.42  ? 532  TRP A N    1 
ATOM   4111 C CA   . TRP A 1 531 ? 43.951  29.462 6.897   1.00 22.43  ? 532  TRP A CA   1 
ATOM   4112 C C    . TRP A 1 531 ? 43.255  30.672 7.508   1.00 27.31  ? 532  TRP A C    1 
ATOM   4113 O O    . TRP A 1 531 ? 42.352  30.525 8.323   1.00 27.08  ? 532  TRP A O    1 
ATOM   4114 C CB   . TRP A 1 531 ? 45.217  29.152 7.707   1.00 23.97  ? 532  TRP A CB   1 
ATOM   4115 C CG   . TRP A 1 531 ? 45.832  27.832 7.375   1.00 28.15  ? 532  TRP A CG   1 
ATOM   4116 C CD1  . TRP A 1 531 ? 46.951  27.615 6.623   1.00 21.82  ? 532  TRP A CD1  1 
ATOM   4117 C CD2  . TRP A 1 531 ? 45.349  26.534 7.764   1.00 29.97  ? 532  TRP A CD2  1 
ATOM   4118 N NE1  . TRP A 1 531 ? 47.203  26.264 6.534   1.00 27.83  ? 532  TRP A NE1  1 
ATOM   4119 C CE2  . TRP A 1 531 ? 46.236  25.580 7.221   1.00 28.17  ? 532  TRP A CE2  1 
ATOM   4120 C CE3  . TRP A 1 531 ? 44.262  26.092 8.522   1.00 21.21  ? 532  TRP A CE3  1 
ATOM   4121 C CZ2  . TRP A 1 531 ? 46.068  24.205 7.417   1.00 25.36  ? 532  TRP A CZ2  1 
ATOM   4122 C CZ3  . TRP A 1 531 ? 44.095  24.733 8.712   1.00 25.00  ? 532  TRP A CZ3  1 
ATOM   4123 C CH2  . TRP A 1 531 ? 44.991  23.804 8.162   1.00 25.99  ? 532  TRP A CH2  1 
ATOM   4124 N N    . ASN A 1 532 ? 43.685  31.869 7.122   1.00 24.98  ? 533  ASN A N    1 
ATOM   4125 C CA   . ASN A 1 532 ? 43.187  33.090 7.759   1.00 23.92  ? 533  ASN A CA   1 
ATOM   4126 C C    . ASN A 1 532 ? 41.966  33.740 7.088   1.00 26.55  ? 533  ASN A C    1 
ATOM   4127 O O    . ASN A 1 532 ? 41.145  34.346 7.759   1.00 24.18  ? 533  ASN A O    1 
ATOM   4128 C CB   . ASN A 1 532 ? 44.317  34.111 7.885   1.00 22.16  ? 533  ASN A CB   1 
ATOM   4129 C CG   . ASN A 1 532 ? 45.465  33.606 8.738   1.00 24.44  ? 533  ASN A CG   1 
ATOM   4130 O OD1  . ASN A 1 532 ? 45.258  32.865 9.688   1.00 27.14  ? 533  ASN A OD1  1 
ATOM   4131 N ND2  . ASN A 1 532 ? 46.680  34.024 8.409   1.00 23.57  ? 533  ASN A ND2  1 
ATOM   4132 N N    . ARG A 1 533 ? 41.860  33.620 5.767   1.00 28.39  ? 534  ARG A N    1 
ATOM   4133 C CA   . ARG A 1 533 ? 40.772  34.273 5.040   1.00 31.62  ? 534  ARG A CA   1 
ATOM   4134 C C    . ARG A 1 533 ? 39.654  33.324 4.613   1.00 32.84  ? 534  ARG A C    1 
ATOM   4135 O O    . ARG A 1 533 ? 38.491  33.667 4.718   1.00 36.89  ? 534  ARG A O    1 
ATOM   4136 C CB   . ARG A 1 533 ? 41.302  35.020 3.813   1.00 23.92  ? 534  ARG A CB   1 
ATOM   4137 C CG   . ARG A 1 533 ? 42.435  35.989 4.123   1.00 27.44  ? 534  ARG A CG   1 
ATOM   4138 C CD   . ARG A 1 533 ? 43.053  36.552 2.851   1.00 28.12  ? 534  ARG A CD   1 
ATOM   4139 N NE   . ARG A 1 533 ? 44.059  37.563 3.156   1.00 35.23  ? 534  ARG A NE   1 
ATOM   4140 C CZ   . ARG A 1 533 ? 43.775  38.840 3.385   1.00 38.07  ? 534  ARG A CZ   1 
ATOM   4141 N NH1  . ARG A 1 533 ? 42.515  39.243 3.329   1.00 38.79  ? 534  ARG A NH1  1 
ATOM   4142 N NH2  . ARG A 1 533 ? 44.742  39.704 3.677   1.00 38.36  ? 534  ARG A NH2  1 
ATOM   4143 N N    . PHE A 1 534 ? 40.000  32.138 4.123   1.00 30.60  ? 535  PHE A N    1 
ATOM   4144 C CA   . PHE A 1 534 ? 38.978  31.236 3.584   1.00 29.26  ? 535  PHE A CA   1 
ATOM   4145 C C    . PHE A 1 534 ? 38.381  30.237 4.580   1.00 30.69  ? 535  PHE A C    1 
ATOM   4146 O O    . PHE A 1 534 ? 37.160  30.157 4.709   1.00 30.40  ? 535  PHE A O    1 
ATOM   4147 C CB   . PHE A 1 534 ? 39.470  30.491 2.335   1.00 24.43  ? 535  PHE A CB   1 
ATOM   4148 C CG   . PHE A 1 534 ? 38.434  29.571 1.747   1.00 26.08  ? 535  PHE A CG   1 
ATOM   4149 C CD1  . PHE A 1 534 ? 37.343  30.086 1.051   1.00 26.14  ? 535  PHE A CD1  1 
ATOM   4150 C CD2  . PHE A 1 534 ? 38.533  28.195 1.904   1.00 29.03  ? 535  PHE A CD2  1 
ATOM   4151 C CE1  . PHE A 1 534 ? 36.372  29.241 0.508   1.00 31.85  ? 535  PHE A CE1  1 
ATOM   4152 C CE2  . PHE A 1 534 ? 37.567  27.336 1.365   1.00 31.98  ? 535  PHE A CE2  1 
ATOM   4153 C CZ   . PHE A 1 534 ? 36.488  27.859 0.664   1.00 32.66  ? 535  PHE A CZ   1 
ATOM   4154 N N    . LEU A 1 535 ? 39.231  29.477 5.268   1.00 26.09  ? 536  LEU A N    1 
ATOM   4155 C CA   . LEU A 1 535 ? 38.757  28.418 6.164   1.00 32.95  ? 536  LEU A CA   1 
ATOM   4156 C C    . LEU A 1 535 ? 37.688  28.869 7.171   1.00 33.64  ? 536  LEU A C    1 
ATOM   4157 O O    . LEU A 1 535 ? 36.694  28.168 7.381   1.00 33.40  ? 536  LEU A O    1 
ATOM   4158 C CB   . LEU A 1 535 ? 39.918  27.734 6.896   1.00 34.33  ? 536  LEU A CB   1 
ATOM   4159 C CG   . LEU A 1 535 ? 39.541  26.361 7.452   1.00 38.80  ? 536  LEU A CG   1 
ATOM   4160 C CD1  . LEU A 1 535 ? 39.248  25.424 6.294   1.00 43.97  ? 536  LEU A CD1  1 
ATOM   4161 C CD2  . LEU A 1 535 ? 40.630  25.790 8.330   1.00 40.52  ? 536  LEU A CD2  1 
ATOM   4162 N N    . PRO A 1 536 ? 37.879  30.043 7.789   1.00 31.01  ? 537  PRO A N    1 
ATOM   4163 C CA   . PRO A 1 536 ? 36.844  30.534 8.715   1.00 32.23  ? 537  PRO A CA   1 
ATOM   4164 C C    . PRO A 1 536 ? 35.473  30.672 8.038   1.00 36.33  ? 537  PRO A C    1 
ATOM   4165 O O    . PRO A 1 536 ? 34.461  30.332 8.663   1.00 39.44  ? 537  PRO A O    1 
ATOM   4166 C CB   . PRO A 1 536 ? 37.374  31.905 9.131   1.00 29.33  ? 537  PRO A CB   1 
ATOM   4167 C CG   . PRO A 1 536 ? 38.883  31.782 8.978   1.00 29.88  ? 537  PRO A CG   1 
ATOM   4168 C CD   . PRO A 1 536 ? 39.060  30.923 7.747   1.00 31.66  ? 537  PRO A CD   1 
ATOM   4169 N N    . LYS A 1 537 ? 35.447  31.135 6.782   1.00 32.51  ? 538  LYS A N    1 
ATOM   4170 C CA   . LYS A 1 537 ? 34.199  31.251 6.023   1.00 30.19  ? 538  LYS A CA   1 
ATOM   4171 C C    . LYS A 1 537 ? 33.595  29.892 5.732   1.00 33.45  ? 538  LYS A C    1 
ATOM   4172 O O    . LYS A 1 537 ? 32.378  29.719 5.759   1.00 34.19  ? 538  LYS A O    1 
ATOM   4173 C CB   . LYS A 1 537 ? 34.422  32.012 4.715   1.00 30.72  ? 538  LYS A CB   1 
ATOM   4174 C CG   . LYS A 1 537 ? 34.735  33.473 4.935   1.00 34.82  ? 538  LYS A CG   1 
ATOM   4175 C CD   . LYS A 1 537 ? 35.167  34.166 3.660   1.00 38.79  ? 538  LYS A CD   1 
ATOM   4176 C CE   . LYS A 1 537 ? 35.612  35.583 3.990   1.00 46.87  ? 538  LYS A CE   1 
ATOM   4177 N NZ   . LYS A 1 537 ? 35.956  36.326 2.755   1.00 59.89  ? 538  LYS A NZ   1 
ATOM   4178 N N    . LEU A 1 538 ? 34.457  28.925 5.450   1.00 36.21  ? 539  LEU A N    1 
ATOM   4179 C CA   . LEU A 1 538 ? 34.000  27.571 5.185   1.00 35.93  ? 539  LEU A CA   1 
ATOM   4180 C C    . LEU A 1 538 ? 33.397  26.940 6.440   1.00 38.89  ? 539  LEU A C    1 
ATOM   4181 O O    . LEU A 1 538 ? 32.403  26.220 6.360   1.00 40.38  ? 539  LEU A O    1 
ATOM   4182 C CB   . LEU A 1 538 ? 35.146  26.719 4.651   1.00 30.40  ? 539  LEU A CB   1 
ATOM   4183 C CG   . LEU A 1 538 ? 34.746  25.309 4.241   1.00 34.85  ? 539  LEU A CG   1 
ATOM   4184 C CD1  . LEU A 1 538 ? 35.661  24.807 3.157   1.00 40.24  ? 539  LEU A CD1  1 
ATOM   4185 C CD2  . LEU A 1 538 ? 34.812  24.403 5.447   1.00 33.96  ? 539  LEU A CD2  1 
ATOM   4186 N N    . LEU A 1 539 ? 33.998  27.217 7.596   1.00 42.79  ? 540  LEU A N    1 
ATOM   4187 C CA   . LEU A 1 539 ? 33.521  26.657 8.865   1.00 53.08  ? 540  LEU A CA   1 
ATOM   4188 C C    . LEU A 1 539 ? 32.187  27.264 9.332   1.00 54.39  ? 540  LEU A C    1 
ATOM   4189 O O    . LEU A 1 539 ? 31.413  26.602 10.009  1.00 58.98  ? 540  LEU A O    1 
ATOM   4190 C CB   . LEU A 1 539 ? 34.601  26.731 9.960   1.00 53.50  ? 540  LEU A CB   1 
ATOM   4191 C CG   . LEU A 1 539 ? 35.778  25.753 9.782   1.00 52.49  ? 540  LEU A CG   1 
ATOM   4192 C CD1  . LEU A 1 539 ? 36.732  25.758 10.969  1.00 48.61  ? 540  LEU A CD1  1 
ATOM   4193 C CD2  . LEU A 1 539 ? 35.285  24.337 9.509   1.00 50.56  ? 540  LEU A CD2  1 
ATOM   4194 N N    . SER A 1 540 ? 31.909  28.506 8.947   1.00 54.27  ? 541  SER A N    1 
ATOM   4195 C CA   . SER A 1 540 ? 30.594  29.099 9.190   1.00 53.81  ? 541  SER A CA   1 
ATOM   4196 C C    . SER A 1 540 ? 29.504  28.511 8.289   1.00 60.90  ? 541  SER A C    1 
ATOM   4197 O O    . SER A 1 540 ? 28.425  29.085 8.182   1.00 65.09  ? 541  SER A O    1 
ATOM   4198 C CB   . SER A 1 540 ? 30.635  30.609 8.971   1.00 46.62  ? 541  SER A CB   1 
ATOM   4199 O OG   . SER A 1 540 ? 31.695  31.197 9.690   1.00 49.79  ? 541  SER A OG   1 
ATOM   4200 N N    . ALA A 1 541 ? 29.781  27.380 7.641   1.00 60.97  ? 542  ALA A N    1 
ATOM   4201 C CA   . ALA A 1 541 ? 28.810  26.763 6.736   1.00 53.43  ? 542  ALA A CA   1 
ATOM   4202 C C    . ALA A 1 541 ? 29.086  25.274 6.492   1.00 52.08  ? 542  ALA A C    1 
ATOM   4203 O O    . ALA A 1 541 ? 29.057  24.454 7.417   1.00 49.53  ? 542  ALA A O    1 
ATOM   4204 C CB   . ALA A 1 541 ? 28.774  27.520 5.423   1.00 47.88  ? 542  ALA A CB   1 
ATOM   4205 N N    . GLU B 1 3   ? 103.249 34.657 69.685  1.00 92.69  ? 4    GLU B N    1 
ATOM   4206 C CA   . GLU B 1 3   ? 103.203 34.210 68.296  1.00 91.16  ? 4    GLU B CA   1 
ATOM   4207 C C    . GLU B 1 3   ? 101.913 34.692 67.615  1.00 87.84  ? 4    GLU B C    1 
ATOM   4208 O O    . GLU B 1 3   ? 100.831 34.637 68.211  1.00 90.30  ? 4    GLU B O    1 
ATOM   4209 C CB   . GLU B 1 3   ? 103.332 32.681 68.227  1.00 93.33  ? 4    GLU B CB   1 
ATOM   4210 C CG   . GLU B 1 3   ? 103.548 32.105 66.824  1.00 96.84  ? 4    GLU B CG   1 
ATOM   4211 C CD   . GLU B 1 3   ? 104.964 32.313 66.293  1.00 99.06  ? 4    GLU B CD   1 
ATOM   4212 O OE1  . GLU B 1 3   ? 105.752 33.024 66.954  1.00 103.97 ? 4    GLU B OE1  1 
ATOM   4213 O OE2  . GLU B 1 3   ? 105.290 31.760 65.216  1.00 92.97  ? 4    GLU B OE2  1 
ATOM   4214 N N    . ASP B 1 4   ? 102.041 35.173 66.376  1.00 77.74  ? 5    ASP B N    1 
ATOM   4215 C CA   . ASP B 1 4   ? 100.909 35.700 65.607  1.00 70.77  ? 5    ASP B CA   1 
ATOM   4216 C C    . ASP B 1 4   ? 100.283 34.645 64.678  1.00 71.35  ? 5    ASP B C    1 
ATOM   4217 O O    . ASP B 1 4   ? 100.888 34.246 63.681  1.00 67.30  ? 5    ASP B O    1 
ATOM   4218 C CB   . ASP B 1 4   ? 101.350 36.922 64.794  1.00 60.85  ? 5    ASP B CB   1 
ATOM   4219 C CG   . ASP B 1 4   ? 100.187 37.631 64.106  1.00 63.47  ? 5    ASP B CG   1 
ATOM   4220 O OD1  . ASP B 1 4   ? 99.123  37.003 63.876  1.00 56.87  ? 5    ASP B OD1  1 
ATOM   4221 O OD2  . ASP B 1 4   ? 100.347 38.831 63.786  1.00 67.45  ? 5    ASP B OD2  1 
ATOM   4222 N N    . ALA B 1 5   ? 99.056  34.231 65.002  1.00 69.94  ? 6    ALA B N    1 
ATOM   4223 C CA   . ALA B 1 5   ? 98.345  33.182 64.265  1.00 64.49  ? 6    ALA B CA   1 
ATOM   4224 C C    . ALA B 1 5   ? 98.080  33.538 62.808  1.00 66.58  ? 6    ALA B C    1 
ATOM   4225 O O    . ALA B 1 5   ? 97.896  32.652 61.973  1.00 68.32  ? 6    ALA B O    1 
ATOM   4226 C CB   . ALA B 1 5   ? 97.035  32.849 64.957  1.00 62.88  ? 6    ALA B CB   1 
ATOM   4227 N N    . GLU B 1 6   ? 98.047  34.833 62.509  1.00 63.70  ? 7    GLU B N    1 
ATOM   4228 C CA   . GLU B 1 6   ? 97.743  35.293 61.160  1.00 55.77  ? 7    GLU B CA   1 
ATOM   4229 C C    . GLU B 1 6   ? 98.878  35.020 60.167  1.00 49.42  ? 7    GLU B C    1 
ATOM   4230 O O    . GLU B 1 6   ? 98.664  34.982 58.949  1.00 42.59  ? 7    GLU B O    1 
ATOM   4231 C CB   . GLU B 1 6   ? 97.376  36.777 61.184  1.00 57.81  ? 7    GLU B CB   1 
ATOM   4232 C CG   . GLU B 1 6   ? 95.871  37.029 61.261  1.00 66.26  ? 7    GLU B CG   1 
ATOM   4233 C CD   . GLU B 1 6   ? 95.137  36.526 60.021  1.00 67.06  ? 7    GLU B CD   1 
ATOM   4234 O OE1  . GLU B 1 6   ? 95.802  36.376 58.975  1.00 65.57  ? 7    GLU B OE1  1 
ATOM   4235 O OE2  . GLU B 1 6   ? 93.908  36.279 60.086  1.00 64.08  ? 7    GLU B OE2  1 
ATOM   4236 N N    . LEU B 1 7   ? 100.079 34.815 60.698  1.00 42.99  ? 8    LEU B N    1 
ATOM   4237 C CA   . LEU B 1 7   ? 101.262 34.598 59.870  1.00 36.77  ? 8    LEU B CA   1 
ATOM   4238 C C    . LEU B 1 7   ? 101.652 33.132 59.810  1.00 32.21  ? 8    LEU B C    1 
ATOM   4239 O O    . LEU B 1 7   ? 102.681 32.780 59.222  1.00 29.98  ? 8    LEU B O    1 
ATOM   4240 C CB   . LEU B 1 7   ? 102.430 35.419 60.398  1.00 36.00  ? 8    LEU B CB   1 
ATOM   4241 C CG   . LEU B 1 7   ? 102.122 36.915 60.489  1.00 36.28  ? 8    LEU B CG   1 
ATOM   4242 C CD1  . LEU B 1 7   ? 103.263 37.648 61.177  1.00 36.84  ? 8    LEU B CD1  1 
ATOM   4243 C CD2  . LEU B 1 7   ? 101.833 37.498 59.097  1.00 23.94  ? 8    LEU B CD2  1 
ATOM   4244 N N    . LEU B 1 8   ? 100.832 32.286 60.433  1.00 29.60  ? 9    LEU B N    1 
ATOM   4245 C CA   . LEU B 1 8   ? 101.026 30.845 60.365  1.00 30.09  ? 9    LEU B CA   1 
ATOM   4246 C C    . LEU B 1 8   ? 100.007 30.293 59.389  1.00 35.81  ? 9    LEU B C    1 
ATOM   4247 O O    . LEU B 1 8   ? 98.805  30.516 59.539  1.00 39.55  ? 9    LEU B O    1 
ATOM   4248 C CB   . LEU B 1 8   ? 100.841 30.203 61.738  1.00 31.38  ? 9    LEU B CB   1 
ATOM   4249 C CG   . LEU B 1 8   ? 101.808 30.734 62.797  1.00 43.18  ? 9    LEU B CG   1 
ATOM   4250 C CD1  . LEU B 1 8   ? 101.431 30.249 64.201  1.00 42.37  ? 9    LEU B CD1  1 
ATOM   4251 C CD2  . LEU B 1 8   ? 103.240 30.326 62.453  1.00 43.60  ? 9    LEU B CD2  1 
ATOM   4252 N N    . VAL B 1 9   ? 100.490 29.587 58.374  1.00 33.34  ? 10   VAL B N    1 
ATOM   4253 C CA   . VAL B 1 9   ? 99.612  29.002 57.377  1.00 29.28  ? 10   VAL B CA   1 
ATOM   4254 C C    . VAL B 1 9   ? 100.059 27.582 57.086  1.00 30.13  ? 10   VAL B C    1 
ATOM   4255 O O    . VAL B 1 9   ? 101.260 27.292 57.060  1.00 29.78  ? 10   VAL B O    1 
ATOM   4256 C CB   . VAL B 1 9   ? 99.659  29.798 56.074  1.00 34.74  ? 10   VAL B CB   1 
ATOM   4257 C CG1  . VAL B 1 9   ? 98.827  29.115 55.011  1.00 36.72  ? 10   VAL B CG1  1 
ATOM   4258 C CG2  . VAL B 1 9   ? 99.164  31.202 56.306  1.00 42.66  ? 10   VAL B CG2  1 
ATOM   4259 N N    . THR B 1 10  ? 99.091  26.699 56.864  1.00 31.00  ? 11   THR B N    1 
ATOM   4260 C CA   . THR B 1 10  ? 99.378  25.329 56.469  1.00 31.72  ? 11   THR B CA   1 
ATOM   4261 C C    . THR B 1 10  ? 98.979  25.133 55.005  1.00 28.30  ? 11   THR B C    1 
ATOM   4262 O O    . THR B 1 10  ? 97.837  25.378 54.619  1.00 34.12  ? 11   THR B O    1 
ATOM   4263 C CB   . THR B 1 10  ? 98.624  24.319 57.366  1.00 32.60  ? 11   THR B CB   1 
ATOM   4264 O OG1  . THR B 1 10  ? 99.039  24.490 58.727  1.00 33.17  ? 11   THR B OG1  1 
ATOM   4265 C CG2  . THR B 1 10  ? 98.914  22.883 56.941  1.00 30.83  ? 11   THR B CG2  1 
ATOM   4266 N N    . VAL B 1 11  ? 99.927  24.715 54.182  1.00 26.33  ? 12   VAL B N    1 
ATOM   4267 C CA   . VAL B 1 11  ? 99.625  24.399 52.796  1.00 27.05  ? 12   VAL B CA   1 
ATOM   4268 C C    . VAL B 1 11  ? 99.743  22.893 52.674  1.00 28.82  ? 12   VAL B C    1 
ATOM   4269 O O    . VAL B 1 11  ? 100.031 22.220 53.665  1.00 36.39  ? 12   VAL B O    1 
ATOM   4270 C CB   . VAL B 1 11  ? 100.578 25.128 51.830  1.00 27.27  ? 12   VAL B CB   1 
ATOM   4271 C CG1  . VAL B 1 11  ? 100.338 26.635 51.891  1.00 23.19  ? 12   VAL B CG1  1 
ATOM   4272 C CG2  . VAL B 1 11  ? 102.042 24.802 52.158  1.00 22.12  ? 12   VAL B CG2  1 
ATOM   4273 N N    . ARG B 1 12  ? 99.532  22.354 51.483  1.00 31.35  ? 13   ARG B N    1 
ATOM   4274 C CA   . ARG B 1 12  ? 99.550  20.903 51.343  1.00 37.76  ? 13   ARG B CA   1 
ATOM   4275 C C    . ARG B 1 12  ? 100.878 20.307 51.767  1.00 36.81  ? 13   ARG B C    1 
ATOM   4276 O O    . ARG B 1 12  ? 100.911 19.259 52.392  1.00 42.07  ? 13   ARG B O    1 
ATOM   4277 C CB   . ARG B 1 12  ? 99.197  20.472 49.925  1.00 39.47  ? 13   ARG B CB   1 
ATOM   4278 C CG   . ARG B 1 12  ? 97.740  20.678 49.604  1.00 44.89  ? 13   ARG B CG   1 
ATOM   4279 C CD   . ARG B 1 12  ? 97.303  19.882 48.401  1.00 56.04  ? 13   ARG B CD   1 
ATOM   4280 N NE   . ARG B 1 12  ? 96.035  20.394 47.887  1.00 66.39  ? 13   ARG B NE   1 
ATOM   4281 C CZ   . ARG B 1 12  ? 95.327  19.830 46.915  1.00 69.63  ? 13   ARG B CZ   1 
ATOM   4282 N NH1  . ARG B 1 12  ? 95.750  18.709 46.339  1.00 67.80  ? 13   ARG B NH1  1 
ATOM   4283 N NH2  . ARG B 1 12  ? 94.191  20.391 46.523  1.00 69.27  ? 13   ARG B NH2  1 
ATOM   4284 N N    . GLY B 1 13  ? 101.971 20.988 51.447  1.00 39.23  ? 14   GLY B N    1 
ATOM   4285 C CA   . GLY B 1 13  ? 103.288 20.495 51.800  1.00 39.23  ? 14   GLY B CA   1 
ATOM   4286 C C    . GLY B 1 13  ? 103.610 20.532 53.287  1.00 35.56  ? 14   GLY B C    1 
ATOM   4287 O O    . GLY B 1 13  ? 104.529 19.851 53.727  1.00 37.32  ? 14   GLY B O    1 
ATOM   4288 N N    . GLY B 1 14  ? 102.872 21.330 54.058  1.00 31.75  ? 15   GLY B N    1 
ATOM   4289 C CA   . GLY B 1 14  ? 103.200 21.539 55.459  1.00 32.28  ? 15   GLY B CA   1 
ATOM   4290 C C    . GLY B 1 14  ? 103.066 22.991 55.902  1.00 33.43  ? 15   GLY B C    1 
ATOM   4291 O O    . GLY B 1 14  ? 102.420 23.795 55.227  1.00 35.75  ? 15   GLY B O    1 
ATOM   4292 N N    . ARG B 1 15  ? 103.692 23.334 57.027  1.00 29.44  ? 16   ARG B N    1 
ATOM   4293 C CA   . ARG B 1 15  ? 103.440 24.613 57.682  1.00 30.92  ? 16   ARG B CA   1 
ATOM   4294 C C    . ARG B 1 15  ? 104.431 25.705 57.308  1.00 33.35  ? 16   ARG B C    1 
ATOM   4295 O O    . ARG B 1 15  ? 105.625 25.443 57.164  1.00 37.59  ? 16   ARG B O    1 
ATOM   4296 C CB   . ARG B 1 15  ? 103.429 24.437 59.202  1.00 38.34  ? 16   ARG B CB   1 
ATOM   4297 C CG   . ARG B 1 15  ? 102.311 23.529 59.731  1.00 44.74  ? 16   ARG B CG   1 
ATOM   4298 C CD   . ARG B 1 15  ? 102.406 23.359 61.253  1.00 48.04  ? 16   ARG B CD   1 
ATOM   4299 N NE   . ARG B 1 15  ? 103.633 22.673 61.653  1.00 50.06  ? 16   ARG B NE   1 
ATOM   4300 C CZ   . ARG B 1 15  ? 104.230 22.830 62.831  1.00 58.75  ? 16   ARG B CZ   1 
ATOM   4301 N NH1  . ARG B 1 15  ? 103.720 23.658 63.732  1.00 56.49  ? 16   ARG B NH1  1 
ATOM   4302 N NH2  . ARG B 1 15  ? 105.343 22.164 63.104  1.00 64.39  ? 16   ARG B NH2  1 
ATOM   4303 N N    . LEU B 1 16  ? 103.919 26.930 57.171  1.00 30.64  ? 17   LEU B N    1 
ATOM   4304 C CA   . LEU B 1 16  ? 104.726 28.104 56.846  1.00 31.48  ? 17   LEU B CA   1 
ATOM   4305 C C    . LEU B 1 16  ? 104.599 29.174 57.928  1.00 32.94  ? 17   LEU B C    1 
ATOM   4306 O O    . LEU B 1 16  ? 103.569 29.266 58.610  1.00 33.45  ? 17   LEU B O    1 
ATOM   4307 C CB   . LEU B 1 16  ? 104.256 28.729 55.528  1.00 30.25  ? 17   LEU B CB   1 
ATOM   4308 C CG   . LEU B 1 16  ? 104.225 27.848 54.286  1.00 36.15  ? 17   LEU B CG   1 
ATOM   4309 C CD1  . LEU B 1 16  ? 103.476 28.564 53.166  1.00 35.61  ? 17   LEU B CD1  1 
ATOM   4310 C CD2  . LEU B 1 16  ? 105.641 27.501 53.857  1.00 35.22  ? 17   LEU B CD2  1 
ATOM   4311 N N    A ARG B 1 17  ? 105.638 29.992 58.062  0.46 31.48  ? 18   ARG B N    1 
ATOM   4312 N N    B ARG B 1 17  ? 105.646 29.981 58.081  0.54 31.40  ? 18   ARG B N    1 
ATOM   4313 C CA   A ARG B 1 17  ? 105.596 31.160 58.930  0.46 32.81  ? 18   ARG B CA   1 
ATOM   4314 C CA   B ARG B 1 17  ? 105.599 31.162 58.938  0.54 32.79  ? 18   ARG B CA   1 
ATOM   4315 C C    A ARG B 1 17  ? 105.871 32.413 58.095  0.46 33.76  ? 18   ARG B C    1 
ATOM   4316 C C    B ARG B 1 17  ? 105.869 32.410 58.092  0.54 33.89  ? 18   ARG B C    1 
ATOM   4317 O O    A ARG B 1 17  ? 106.938 32.553 57.491  0.46 34.14  ? 18   ARG B O    1 
ATOM   4318 O O    B ARG B 1 17  ? 106.931 32.545 57.476  0.54 34.15  ? 18   ARG B O    1 
ATOM   4319 C CB   A ARG B 1 17  ? 106.621 31.020 60.058  0.46 33.60  ? 18   ARG B CB   1 
ATOM   4320 C CB   B ARG B 1 17  ? 106.612 31.050 60.085  0.54 34.16  ? 18   ARG B CB   1 
ATOM   4321 C CG   A ARG B 1 17  ? 106.718 32.222 60.990  0.46 37.20  ? 18   ARG B CG   1 
ATOM   4322 C CG   B ARG B 1 17  ? 106.679 32.283 60.993  0.54 37.68  ? 18   ARG B CG   1 
ATOM   4323 C CD   A ARG B 1 17  ? 107.542 31.882 62.233  0.46 39.36  ? 18   ARG B CD   1 
ATOM   4324 C CD   B ARG B 1 17  ? 107.485 32.025 62.277  0.54 39.64  ? 18   ARG B CD   1 
ATOM   4325 N NE   A ARG B 1 17  ? 108.630 30.951 61.931  0.46 37.70  ? 18   ARG B NE   1 
ATOM   4326 N NE   B ARG B 1 17  ? 106.777 31.166 63.229  0.54 37.04  ? 18   ARG B NE   1 
ATOM   4327 C CZ   A ARG B 1 17  ? 109.859 31.316 61.577  0.46 35.11  ? 18   ARG B CZ   1 
ATOM   4328 C CZ   B ARG B 1 17  ? 107.205 29.970 63.630  0.54 35.77  ? 18   ARG B CZ   1 
ATOM   4329 N NH1  A ARG B 1 17  ? 110.178 32.604 61.481  0.46 29.28  ? 18   ARG B NH1  1 
ATOM   4330 N NH1  B ARG B 1 17  ? 108.353 29.484 63.177  0.54 33.74  ? 18   ARG B NH1  1 
ATOM   4331 N NH2  A ARG B 1 17  ? 110.770 30.390 61.318  0.46 36.18  ? 18   ARG B NH2  1 
ATOM   4332 N NH2  B ARG B 1 17  ? 106.489 29.261 64.494  0.54 35.10  ? 18   ARG B NH2  1 
ATOM   4333 N N    . GLY B 1 18  ? 104.899 33.317 58.050  1.00 29.03  ? 19   GLY B N    1 
ATOM   4334 C CA   . GLY B 1 18  ? 105.027 34.519 57.247  1.00 27.27  ? 19   GLY B CA   1 
ATOM   4335 C C    . GLY B 1 18  ? 105.517 35.725 58.026  1.00 34.57  ? 19   GLY B C    1 
ATOM   4336 O O    . GLY B 1 18  ? 105.947 35.616 59.177  1.00 36.97  ? 19   GLY B O    1 
ATOM   4337 N N    . ILE B 1 19  ? 105.453 36.886 57.386  1.00 34.46  ? 20   ILE B N    1 
ATOM   4338 C CA   . ILE B 1 19  ? 105.849 38.128 58.028  1.00 35.59  ? 20   ILE B CA   1 
ATOM   4339 C C    . ILE B 1 19  ? 104.848 39.241 57.720  1.00 32.28  ? 20   ILE B C    1 
ATOM   4340 O O    . ILE B 1 19  ? 104.224 39.248 56.658  1.00 35.10  ? 20   ILE B O    1 
ATOM   4341 C CB   . ILE B 1 19  ? 107.265 38.553 57.606  1.00 31.31  ? 20   ILE B CB   1 
ATOM   4342 C CG1  . ILE B 1 19  ? 107.733 39.748 58.435  1.00 36.22  ? 20   ILE B CG1  1 
ATOM   4343 C CG2  . ILE B 1 19  ? 107.317 38.882 56.103  1.00 27.43  ? 20   ILE B CG2  1 
ATOM   4344 C CD1  . ILE B 1 19  ? 109.185 40.145 58.152  1.00 36.08  ? 20   ILE B CD1  1 
ATOM   4345 N N    . ARG B 1 20  ? 104.695 40.163 58.665  1.00 29.96  ? 21   ARG B N    1 
ATOM   4346 C CA   . ARG B 1 20  ? 103.851 41.336 58.497  1.00 34.61  ? 21   ARG B CA   1 
ATOM   4347 C C    . ARG B 1 20  ? 104.698 42.453 57.908  1.00 33.49  ? 21   ARG B C    1 
ATOM   4348 O O    . ARG B 1 20  ? 105.774 42.764 58.423  1.00 34.61  ? 21   ARG B O    1 
ATOM   4349 C CB   . ARG B 1 20  ? 103.292 41.774 59.855  1.00 42.32  ? 21   ARG B CB   1 
ATOM   4350 C CG   . ARG B 1 20  ? 101.947 42.491 59.794  1.00 48.68  ? 21   ARG B CG   1 
ATOM   4351 C CD   . ARG B 1 20  ? 101.364 42.682 61.204  1.00 62.13  ? 21   ARG B CD   1 
ATOM   4352 N NE   . ARG B 1 20  ? 102.347 43.253 62.128  1.00 65.37  ? 21   ARG B NE   1 
ATOM   4353 C CZ   . ARG B 1 20  ? 102.835 42.621 63.191  1.00 62.28  ? 21   ARG B CZ   1 
ATOM   4354 N NH1  . ARG B 1 20  ? 102.418 41.394 63.493  1.00 53.46  ? 21   ARG B NH1  1 
ATOM   4355 N NH2  . ARG B 1 20  ? 103.737 43.224 63.956  1.00 63.36  ? 21   ARG B NH2  1 
ATOM   4356 N N    . LEU B 1 21  ? 104.221 43.038 56.816  1.00 29.48  ? 22   LEU B N    1 
ATOM   4357 C CA   . LEU B 1 21  ? 104.921 44.135 56.161  1.00 28.66  ? 22   LEU B CA   1 
ATOM   4358 C C    . LEU B 1 21  ? 104.144 45.428 56.347  1.00 32.93  ? 22   LEU B C    1 
ATOM   4359 O O    . LEU B 1 21  ? 102.911 45.410 56.342  1.00 41.40  ? 22   LEU B O    1 
ATOM   4360 C CB   . LEU B 1 21  ? 105.068 43.855 54.663  1.00 23.33  ? 22   LEU B CB   1 
ATOM   4361 C CG   . LEU B 1 21  ? 105.908 42.642 54.260  1.00 28.68  ? 22   LEU B CG   1 
ATOM   4362 C CD1  . LEU B 1 21  ? 106.038 42.542 52.741  1.00 28.72  ? 22   LEU B CD1  1 
ATOM   4363 C CD2  . LEU B 1 21  ? 107.274 42.732 54.887  1.00 27.01  ? 22   LEU B CD2  1 
ATOM   4364 N N    . LYS B 1 22  ? 104.860 46.545 56.491  1.00 30.17  ? 23   LYS B N    1 
ATOM   4365 C CA   . LYS B 1 22  ? 104.235 47.863 56.571  1.00 28.22  ? 23   LYS B CA   1 
ATOM   4366 C C    . LYS B 1 22  ? 104.057 48.511 55.192  1.00 26.77  ? 23   LYS B C    1 
ATOM   4367 O O    . LYS B 1 22  ? 104.879 48.329 54.297  1.00 29.13  ? 23   LYS B O    1 
ATOM   4368 C CB   . LYS B 1 22  ? 105.075 48.802 57.440  1.00 27.50  ? 23   LYS B CB   1 
ATOM   4369 C CG   . LYS B 1 22  ? 105.266 48.349 58.877  1.00 34.77  ? 23   LYS B CG   1 
ATOM   4370 C CD   . LYS B 1 22  ? 105.922 49.456 59.727  1.00 38.29  ? 23   LYS B CD   1 
ATOM   4371 C CE   . LYS B 1 22  ? 107.243 49.914 59.118  1.00 43.06  ? 23   LYS B CE   1 
ATOM   4372 N NZ   . LYS B 1 22  ? 107.981 50.915 59.973  1.00 50.59  ? 23   LYS B NZ   1 
ATOM   4373 N N    . THR B 1 23  ? 102.966 49.253 55.030  1.00 25.71  ? 24   THR B N    1 
ATOM   4374 C CA   . THR B 1 23  ? 102.818 50.208 53.941  1.00 33.17  ? 24   THR B CA   1 
ATOM   4375 C C    . THR B 1 23  ? 102.163 51.450 54.525  1.00 41.12  ? 24   THR B C    1 
ATOM   4376 O O    . THR B 1 23  ? 101.575 51.398 55.612  1.00 39.24  ? 24   THR B O    1 
ATOM   4377 C CB   . THR B 1 23  ? 101.911 49.704 52.779  1.00 31.22  ? 24   THR B CB   1 
ATOM   4378 O OG1  . THR B 1 23  ? 100.531 49.915 53.120  1.00 30.47  ? 24   THR B OG1  1 
ATOM   4379 C CG2  . THR B 1 23  ? 102.153 48.244 52.466  1.00 26.93  ? 24   THR B CG2  1 
ATOM   4380 N N    . PRO B 1 24  ? 102.244 52.567 53.789  1.00 35.39  ? 25   PRO B N    1 
ATOM   4381 C CA   . PRO B 1 24  ? 101.606 53.840 54.151  1.00 34.96  ? 25   PRO B CA   1 
ATOM   4382 C C    . PRO B 1 24  ? 100.097 53.687 54.377  1.00 32.32  ? 25   PRO B C    1 
ATOM   4383 O O    . PRO B 1 24  ? 99.511  54.509 55.070  1.00 34.90  ? 25   PRO B O    1 
ATOM   4384 C CB   . PRO B 1 24  ? 101.854 54.718 52.921  1.00 38.83  ? 25   PRO B CB   1 
ATOM   4385 C CG   . PRO B 1 24  ? 103.034 54.107 52.236  1.00 35.78  ? 25   PRO B CG   1 
ATOM   4386 C CD   . PRO B 1 24  ? 102.956 52.633 52.502  1.00 30.81  ? 25   PRO B CD   1 
ATOM   4387 N N    . GLY B 1 25  ? 99.480  52.655 53.803  1.00 30.28  ? 26   GLY B N    1 
ATOM   4388 C CA   . GLY B 1 25  ? 98.051  52.431 53.990  1.00 30.86  ? 26   GLY B CA   1 
ATOM   4389 C C    . GLY B 1 25  ? 97.684  51.376 55.036  1.00 35.48  ? 26   GLY B C    1 
ATOM   4390 O O    . GLY B 1 25  ? 96.505  51.028 55.185  1.00 31.59  ? 26   GLY B O    1 
ATOM   4391 N N    . GLY B 1 26  ? 98.679  50.879 55.773  1.00 28.71  ? 27   GLY B N    1 
ATOM   4392 C CA   . GLY B 1 26  ? 98.447  49.823 56.744  1.00 28.52  ? 27   GLY B CA   1 
ATOM   4393 C C    . GLY B 1 26  ? 99.171  48.532 56.378  1.00 34.23  ? 27   GLY B C    1 
ATOM   4394 O O    . GLY B 1 26  ? 99.788  48.433 55.315  1.00 29.27  ? 27   GLY B O    1 
ATOM   4395 N N    . PRO B 1 27  ? 99.096  47.523 57.262  1.00 31.29  ? 28   PRO B N    1 
ATOM   4396 C CA   . PRO B 1 27  ? 99.875  46.292 57.076  1.00 26.51  ? 28   PRO B CA   1 
ATOM   4397 C C    . PRO B 1 27  ? 99.335  45.322 56.029  1.00 30.80  ? 28   PRO B C    1 
ATOM   4398 O O    . PRO B 1 27  ? 98.191  45.388 55.574  1.00 31.74  ? 28   PRO B O    1 
ATOM   4399 C CB   . PRO B 1 27  ? 99.810  45.623 58.449  1.00 29.33  ? 28   PRO B CB   1 
ATOM   4400 C CG   . PRO B 1 27  ? 98.538  46.139 59.053  1.00 33.24  ? 28   PRO B CG   1 
ATOM   4401 C CD   . PRO B 1 27  ? 98.430  47.566 58.577  1.00 26.11  ? 28   PRO B CD   1 
ATOM   4402 N N    . VAL B 1 28  ? 100.207 44.384 55.688  1.00 26.86  ? 29   VAL B N    1 
ATOM   4403 C CA   . VAL B 1 28  ? 99.954  43.376 54.690  1.00 23.43  ? 29   VAL B CA   1 
ATOM   4404 C C    . VAL B 1 28  ? 100.696 42.132 55.168  1.00 26.05  ? 29   VAL B C    1 
ATOM   4405 O O    . VAL B 1 28  ? 101.723 42.248 55.846  1.00 33.78  ? 29   VAL B O    1 
ATOM   4406 C CB   . VAL B 1 28  ? 100.472 43.878 53.323  1.00 28.25  ? 29   VAL B CB   1 
ATOM   4407 C CG1  . VAL B 1 28  ? 101.189 42.793 52.560  1.00 22.35  ? 29   VAL B CG1  1 
ATOM   4408 C CG2  . VAL B 1 28  ? 99.336  44.482 52.526  1.00 25.45  ? 29   VAL B CG2  1 
ATOM   4409 N N    . SER B 1 29  ? 100.156 40.952 54.863  1.00 25.73  ? 30   SER B N    1 
ATOM   4410 C CA   . SER B 1 29  ? 100.794 39.687 55.215  1.00 25.23  ? 30   SER B CA   1 
ATOM   4411 C C    . SER B 1 29  ? 101.592 39.212 54.022  1.00 30.61  ? 30   SER B C    1 
ATOM   4412 O O    . SER B 1 29  ? 101.088 39.237 52.896  1.00 27.37  ? 30   SER B O    1 
ATOM   4413 C CB   . SER B 1 29  ? 99.747  38.614 55.528  1.00 24.01  ? 30   SER B CB   1 
ATOM   4414 O OG   . SER B 1 29  ? 98.940  38.992 56.615  1.00 31.14  ? 30   SER B OG   1 
ATOM   4415 N N    . ALA B 1 30  ? 102.818 38.751 54.260  1.00 27.68  ? 31   ALA B N    1 
ATOM   4416 C CA   . ALA B 1 30  ? 103.624 38.203 53.174  1.00 27.64  ? 31   ALA B CA   1 
ATOM   4417 C C    . ALA B 1 30  ? 104.234 36.850 53.520  1.00 32.68  ? 31   ALA B C    1 
ATOM   4418 O O    . ALA B 1 30  ? 104.728 36.625 54.635  1.00 30.79  ? 31   ALA B O    1 
ATOM   4419 C CB   . ALA B 1 30  ? 104.710 39.193 52.750  1.00 23.35  ? 31   ALA B CB   1 
ATOM   4420 N N    . PHE B 1 31  ? 104.193 35.946 52.554  1.00 26.12  ? 32   PHE B N    1 
ATOM   4421 C CA   . PHE B 1 31  ? 104.880 34.676 52.690  1.00 25.33  ? 32   PHE B CA   1 
ATOM   4422 C C    . PHE B 1 31  ? 105.836 34.555 51.512  1.00 27.64  ? 32   PHE B C    1 
ATOM   4423 O O    . PHE B 1 31  ? 105.416 34.390 50.354  1.00 25.10  ? 32   PHE B O    1 
ATOM   4424 C CB   . PHE B 1 31  ? 103.877 33.534 52.749  1.00 23.14  ? 32   PHE B CB   1 
ATOM   4425 C CG   . PHE B 1 31  ? 102.852 33.704 53.829  1.00 25.63  ? 32   PHE B CG   1 
ATOM   4426 C CD1  . PHE B 1 31  ? 101.793 34.588 53.665  1.00 23.74  ? 32   PHE B CD1  1 
ATOM   4427 C CD2  . PHE B 1 31  ? 102.951 32.998 55.020  1.00 26.07  ? 32   PHE B CD2  1 
ATOM   4428 C CE1  . PHE B 1 31  ? 100.837 34.751 54.668  1.00 28.35  ? 32   PHE B CE1  1 
ATOM   4429 C CE2  . PHE B 1 31  ? 101.997 33.156 56.034  1.00 29.64  ? 32   PHE B CE2  1 
ATOM   4430 C CZ   . PHE B 1 31  ? 100.940 34.034 55.856  1.00 27.96  ? 32   PHE B CZ   1 
ATOM   4431 N N    . LEU B 1 32  ? 107.121 34.693 51.825  1.00 20.60  ? 33   LEU B N    1 
ATOM   4432 C CA   . LEU B 1 32  ? 108.166 34.802 50.825  1.00 23.19  ? 33   LEU B CA   1 
ATOM   4433 C C    . LEU B 1 32  ? 109.068 33.591 50.919  1.00 23.76  ? 33   LEU B C    1 
ATOM   4434 O O    . LEU B 1 32  ? 109.398 33.155 52.028  1.00 23.25  ? 33   LEU B O    1 
ATOM   4435 C CB   . LEU B 1 32  ? 109.008 36.052 51.091  1.00 23.43  ? 33   LEU B CB   1 
ATOM   4436 C CG   . LEU B 1 32  ? 108.253 37.349 51.364  1.00 29.00  ? 33   LEU B CG   1 
ATOM   4437 C CD1  . LEU B 1 32  ? 109.238 38.494 51.656  1.00 25.48  ? 33   LEU B CD1  1 
ATOM   4438 C CD2  . LEU B 1 32  ? 107.345 37.684 50.193  1.00 27.66  ? 33   LEU B CD2  1 
ATOM   4439 N N    . GLY B 1 33  ? 109.491 33.071 49.765  1.00 24.63  ? 34   GLY B N    1 
ATOM   4440 C CA   . GLY B 1 33  ? 110.411 31.942 49.722  1.00 20.33  ? 34   GLY B CA   1 
ATOM   4441 C C    . GLY B 1 33  ? 109.733 30.613 50.030  1.00 25.89  ? 34   GLY B C    1 
ATOM   4442 O O    . GLY B 1 33  ? 110.295 29.785 50.739  1.00 29.40  ? 34   GLY B O    1 
ATOM   4443 N N    . ILE B 1 34  ? 108.524 30.413 49.505  1.00 23.85  ? 35   ILE B N    1 
ATOM   4444 C CA   . ILE B 1 34  ? 107.821 29.147 49.673  1.00 25.65  ? 35   ILE B CA   1 
ATOM   4445 C C    . ILE B 1 34  ? 108.296 28.179 48.590  1.00 28.79  ? 35   ILE B C    1 
ATOM   4446 O O    . ILE B 1 34  ? 108.135 28.447 47.404  1.00 27.41  ? 35   ILE B O    1 
ATOM   4447 C CB   . ILE B 1 34  ? 106.305 29.305 49.499  1.00 22.09  ? 35   ILE B CB   1 
ATOM   4448 C CG1  . ILE B 1 34  ? 105.726 30.339 50.458  1.00 24.82  ? 35   ILE B CG1  1 
ATOM   4449 C CG2  . ILE B 1 34  ? 105.616 27.984 49.710  1.00 20.55  ? 35   ILE B CG2  1 
ATOM   4450 C CD1  . ILE B 1 34  ? 104.245 30.637 50.189  1.00 22.40  ? 35   ILE B CD1  1 
ATOM   4451 N N    . PRO B 1 35  ? 108.874 27.038 48.992  1.00 32.32  ? 36   PRO B N    1 
ATOM   4452 C CA   . PRO B 1 35  ? 109.328 26.069 47.982  1.00 26.44  ? 36   PRO B CA   1 
ATOM   4453 C C    . PRO B 1 35  ? 108.136 25.444 47.257  1.00 26.01  ? 36   PRO B C    1 
ATOM   4454 O O    . PRO B 1 35  ? 107.233 24.979 47.935  1.00 23.39  ? 36   PRO B O    1 
ATOM   4455 C CB   . PRO B 1 35  ? 110.029 24.998 48.825  1.00 28.41  ? 36   PRO B CB   1 
ATOM   4456 C CG   . PRO B 1 35  ? 109.355 25.081 50.176  1.00 28.37  ? 36   PRO B CG   1 
ATOM   4457 C CD   . PRO B 1 35  ? 109.076 26.553 50.373  1.00 26.32  ? 36   PRO B CD   1 
ATOM   4458 N N    . PHE B 1 36  ? 108.126 25.432 45.924  1.00 20.83  ? 37   PHE B N    1 
ATOM   4459 C CA   . PHE B 1 36  ? 107.040 24.762 45.207  1.00 26.49  ? 37   PHE B CA   1 
ATOM   4460 C C    . PHE B 1 36  ? 107.529 23.625 44.310  1.00 26.81  ? 37   PHE B C    1 
ATOM   4461 O O    . PHE B 1 36  ? 106.730 22.932 43.698  1.00 31.88  ? 37   PHE B O    1 
ATOM   4462 C CB   . PHE B 1 36  ? 106.195 25.758 44.400  1.00 22.09  ? 37   PHE B CB   1 
ATOM   4463 C CG   . PHE B 1 36  ? 106.913 26.373 43.226  1.00 19.66  ? 37   PHE B CG   1 
ATOM   4464 C CD1  . PHE B 1 36  ? 107.642 27.553 43.380  1.00 23.32  ? 37   PHE B CD1  1 
ATOM   4465 C CD2  . PHE B 1 36  ? 106.832 25.795 41.961  1.00 18.61  ? 37   PHE B CD2  1 
ATOM   4466 C CE1  . PHE B 1 36  ? 108.292 28.138 42.295  1.00 21.43  ? 37   PHE B CE1  1 
ATOM   4467 C CE2  . PHE B 1 36  ? 107.466 26.372 40.864  1.00 22.29  ? 37   PHE B CE2  1 
ATOM   4468 C CZ   . PHE B 1 36  ? 108.206 27.546 41.029  1.00 23.97  ? 37   PHE B CZ   1 
ATOM   4469 N N    . ALA B 1 37  ? 108.843 23.438 44.244  1.00 24.47  ? 38   ALA B N    1 
ATOM   4470 C CA   . ALA B 1 37  ? 109.440 22.342 43.481  1.00 22.38  ? 38   ALA B CA   1 
ATOM   4471 C C    . ALA B 1 37  ? 110.648 21.814 44.234  1.00 26.94  ? 38   ALA B C    1 
ATOM   4472 O O    . ALA B 1 37  ? 111.269 22.550 45.004  1.00 28.70  ? 38   ALA B O    1 
ATOM   4473 C CB   . ALA B 1 37  ? 109.853 22.815 42.073  1.00 16.78  ? 38   ALA B CB   1 
ATOM   4474 N N    . GLU B 1 38  ? 110.985 20.545 44.020  1.00 29.24  ? 39   GLU B N    1 
ATOM   4475 C CA   . GLU B 1 38  ? 112.288 20.042 44.440  1.00 33.45  ? 39   GLU B CA   1 
ATOM   4476 C C    . GLU B 1 38  ? 113.381 20.831 43.705  1.00 30.10  ? 39   GLU B C    1 
ATOM   4477 O O    . GLU B 1 38  ? 113.233 21.145 42.527  1.00 26.58  ? 39   GLU B O    1 
ATOM   4478 C CB   . GLU B 1 38  ? 112.413 18.554 44.118  1.00 36.23  ? 39   GLU B CB   1 
ATOM   4479 C CG   . GLU B 1 38  ? 111.517 17.665 44.977  1.00 44.51  ? 39   GLU B CG   1 
ATOM   4480 C CD   . GLU B 1 38  ? 111.872 17.730 46.459  1.00 49.58  ? 39   GLU B CD   1 
ATOM   4481 O OE1  . GLU B 1 38  ? 113.059 17.537 46.794  1.00 53.68  ? 39   GLU B OE1  1 
ATOM   4482 O OE2  . GLU B 1 38  ? 110.971 17.984 47.290  1.00 52.42  ? 39   GLU B OE2  1 
ATOM   4483 N N    . PRO B 1 39  ? 114.469 21.180 44.404  1.00 31.02  ? 40   PRO B N    1 
ATOM   4484 C CA   . PRO B 1 39  ? 115.573 21.929 43.776  1.00 31.12  ? 40   PRO B CA   1 
ATOM   4485 C C    . PRO B 1 39  ? 116.101 21.233 42.524  1.00 36.97  ? 40   PRO B C    1 
ATOM   4486 O O    . PRO B 1 39  ? 116.529 20.081 42.596  1.00 39.05  ? 40   PRO B O    1 
ATOM   4487 C CB   . PRO B 1 39  ? 116.645 21.935 44.861  1.00 27.44  ? 40   PRO B CB   1 
ATOM   4488 C CG   . PRO B 1 39  ? 115.844 21.898 46.150  1.00 28.63  ? 40   PRO B CG   1 
ATOM   4489 C CD   . PRO B 1 39  ? 114.671 20.996 45.855  1.00 29.82  ? 40   PRO B CD   1 
ATOM   4490 N N    . PRO B 1 40  ? 116.062 21.928 41.378  1.00 30.43  ? 41   PRO B N    1 
ATOM   4491 C CA   . PRO B 1 40  ? 116.436 21.343 40.092  1.00 32.69  ? 41   PRO B CA   1 
ATOM   4492 C C    . PRO B 1 40  ? 117.955 21.421 39.891  1.00 38.38  ? 41   PRO B C    1 
ATOM   4493 O O    . PRO B 1 40  ? 118.437 22.139 39.013  1.00 36.85  ? 41   PRO B O    1 
ATOM   4494 C CB   . PRO B 1 40  ? 115.714 22.247 39.098  1.00 29.36  ? 41   PRO B CB   1 
ATOM   4495 C CG   . PRO B 1 40  ? 115.766 23.603 39.759  1.00 27.11  ? 41   PRO B CG   1 
ATOM   4496 C CD   . PRO B 1 40  ? 115.706 23.351 41.250  1.00 22.92  ? 41   PRO B CD   1 
ATOM   4497 N N    . MET B 1 41  ? 118.694 20.676 40.707  1.00 32.91  ? 42   MET B N    1 
ATOM   4498 C CA   . MET B 1 41  ? 120.148 20.699 40.660  1.00 40.29  ? 42   MET B CA   1 
ATOM   4499 C C    . MET B 1 41  ? 120.701 19.314 40.348  1.00 40.49  ? 42   MET B C    1 
ATOM   4500 O O    . MET B 1 41  ? 119.969 18.319 40.408  1.00 41.41  ? 42   MET B O    1 
ATOM   4501 C CB   . MET B 1 41  ? 120.699 21.154 42.009  1.00 42.91  ? 42   MET B CB   1 
ATOM   4502 C CG   . MET B 1 41  ? 119.899 22.255 42.671  1.00 41.39  ? 42   MET B CG   1 
ATOM   4503 S SD   . MET B 1 41  ? 120.730 22.837 44.153  1.00 71.92  ? 42   MET B SD   1 
ATOM   4504 C CE   . MET B 1 41  ? 122.289 23.374 43.455  1.00 54.24  ? 42   MET B CE   1 
ATOM   4505 N N    . GLY B 1 42  ? 121.995 19.255 40.035  1.00 31.30  ? 43   GLY B N    1 
ATOM   4506 C CA   . GLY B 1 42  ? 122.661 18.005 39.711  1.00 27.29  ? 43   GLY B CA   1 
ATOM   4507 C C    . GLY B 1 42  ? 122.003 17.283 38.548  1.00 33.54  ? 43   GLY B C    1 
ATOM   4508 O O    . GLY B 1 42  ? 121.869 17.840 37.453  1.00 33.22  ? 43   GLY B O    1 
ATOM   4509 N N    . PRO B 1 43  ? 121.580 16.035 38.781  1.00 34.90  ? 44   PRO B N    1 
ATOM   4510 C CA   . PRO B 1 43  ? 120.891 15.266 37.731  1.00 33.15  ? 44   PRO B CA   1 
ATOM   4511 C C    . PRO B 1 43  ? 119.552 15.901 37.348  1.00 31.96  ? 44   PRO B C    1 
ATOM   4512 O O    . PRO B 1 43  ? 119.013 15.597 36.287  1.00 36.22  ? 44   PRO B O    1 
ATOM   4513 C CB   . PRO B 1 43  ? 120.702 13.873 38.360  1.00 33.94  ? 44   PRO B CB   1 
ATOM   4514 C CG   . PRO B 1 43  ? 120.894 14.074 39.855  1.00 33.12  ? 44   PRO B CG   1 
ATOM   4515 C CD   . PRO B 1 43  ? 121.801 15.262 40.020  1.00 31.47  ? 44   PRO B CD   1 
ATOM   4516 N N    . ARG B 1 44  ? 119.035 16.803 38.175  1.00 35.03  ? 45   ARG B N    1 
ATOM   4517 C CA   . ARG B 1 44  ? 117.763 17.466 37.853  1.00 32.19  ? 45   ARG B CA   1 
ATOM   4518 C C    . ARG B 1 44  ? 117.862 18.694 36.927  1.00 32.09  ? 45   ARG B C    1 
ATOM   4519 O O    . ARG B 1 44  ? 116.842 19.174 36.420  1.00 31.90  ? 45   ARG B O    1 
ATOM   4520 C CB   . ARG B 1 44  ? 116.998 17.817 39.133  1.00 28.99  ? 45   ARG B CB   1 
ATOM   4521 C CG   . ARG B 1 44  ? 116.409 16.612 39.874  1.00 33.11  ? 45   ARG B CG   1 
ATOM   4522 C CD   . ARG B 1 44  ? 115.496 17.081 41.015  1.00 49.29  ? 45   ARG B CD   1 
ATOM   4523 N NE   . ARG B 1 44  ? 115.027 15.989 41.868  1.00 65.49  ? 45   ARG B NE   1 
ATOM   4524 C CZ   . ARG B 1 44  ? 113.895 15.317 41.674  1.00 74.54  ? 45   ARG B CZ   1 
ATOM   4525 N NH1  . ARG B 1 44  ? 113.109 15.621 40.650  1.00 74.54  ? 45   ARG B NH1  1 
ATOM   4526 N NH2  . ARG B 1 44  ? 113.548 14.340 42.503  1.00 76.80  ? 45   ARG B NH2  1 
ATOM   4527 N N    . ARG B 1 45  ? 119.076 19.199 36.707  1.00 30.11  ? 46   ARG B N    1 
ATOM   4528 C CA   . ARG B 1 45  ? 119.293 20.310 35.771  1.00 25.80  ? 46   ARG B CA   1 
ATOM   4529 C C    . ARG B 1 45  ? 118.783 19.971 34.357  1.00 24.49  ? 46   ARG B C    1 
ATOM   4530 O O    . ARG B 1 45  ? 119.034 18.872 33.847  1.00 29.05  ? 46   ARG B O    1 
ATOM   4531 C CB   . ARG B 1 45  ? 120.786 20.692 35.731  1.00 22.38  ? 46   ARG B CB   1 
ATOM   4532 C CG   . ARG B 1 45  ? 121.103 21.840 34.792  1.00 23.55  ? 46   ARG B CG   1 
ATOM   4533 C CD   . ARG B 1 45  ? 122.589 22.014 34.579  1.00 24.38  ? 46   ARG B CD   1 
ATOM   4534 N NE   . ARG B 1 45  ? 123.226 22.714 35.691  1.00 23.21  ? 46   ARG B NE   1 
ATOM   4535 C CZ   . ARG B 1 45  ? 124.538 22.886 35.805  1.00 27.71  ? 46   ARG B CZ   1 
ATOM   4536 N NH1  . ARG B 1 45  ? 125.347 22.415 34.865  1.00 25.56  ? 46   ARG B NH1  1 
ATOM   4537 N NH2  . ARG B 1 45  ? 125.034 23.531 36.849  1.00 17.22  ? 46   ARG B NH2  1 
ATOM   4538 N N    . PHE B 1 46  ? 118.060 20.909 33.741  1.00 22.32  ? 47   PHE B N    1 
ATOM   4539 C CA   . PHE B 1 46  ? 117.437 20.716 32.413  1.00 22.72  ? 47   PHE B CA   1 
ATOM   4540 C C    . PHE B 1 46  ? 116.164 19.874 32.439  1.00 27.98  ? 47   PHE B C    1 
ATOM   4541 O O    . PHE B 1 46  ? 115.490 19.736 31.409  1.00 27.49  ? 47   PHE B O    1 
ATOM   4542 C CB   . PHE B 1 46  ? 118.421 20.095 31.393  1.00 22.75  ? 47   PHE B CB   1 
ATOM   4543 C CG   . PHE B 1 46  ? 119.734 20.822 31.293  1.00 25.55  ? 47   PHE B CG   1 
ATOM   4544 C CD1  . PHE B 1 46  ? 119.768 22.184 31.049  1.00 25.78  ? 47   PHE B CD1  1 
ATOM   4545 C CD2  . PHE B 1 46  ? 120.931 20.147 31.478  1.00 20.15  ? 47   PHE B CD2  1 
ATOM   4546 C CE1  . PHE B 1 46  ? 120.970 22.867 30.966  1.00 24.84  ? 47   PHE B CE1  1 
ATOM   4547 C CE2  . PHE B 1 46  ? 122.144 20.828 31.399  1.00 27.00  ? 47   PHE B CE2  1 
ATOM   4548 C CZ   . PHE B 1 46  ? 122.163 22.189 31.143  1.00 23.72  ? 47   PHE B CZ   1 
ATOM   4549 N N    . LEU B 1 47  ? 115.834 19.295 33.592  1.00 22.72  ? 48   LEU B N    1 
ATOM   4550 C CA   . LEU B 1 47  ? 114.643 18.454 33.668  1.00 26.68  ? 48   LEU B CA   1 
ATOM   4551 C C    . LEU B 1 47  ? 113.424 19.239 34.139  1.00 26.47  ? 48   LEU B C    1 
ATOM   4552 O O    . LEU B 1 47  ? 113.558 20.260 34.808  1.00 22.17  ? 48   LEU B O    1 
ATOM   4553 C CB   . LEU B 1 47  ? 114.866 17.250 34.572  1.00 24.58  ? 48   LEU B CB   1 
ATOM   4554 C CG   . LEU B 1 47  ? 115.845 16.197 34.059  1.00 28.92  ? 48   LEU B CG   1 
ATOM   4555 C CD1  . LEU B 1 47  ? 115.812 14.959 34.965  1.00 20.59  ? 48   LEU B CD1  1 
ATOM   4556 C CD2  . LEU B 1 47  ? 115.540 15.826 32.623  1.00 23.96  ? 48   LEU B CD2  1 
ATOM   4557 N N    . PRO B 1 48  ? 112.228 18.773 33.753  1.00 27.92  ? 49   PRO B N    1 
ATOM   4558 C CA   . PRO B 1 48  ? 110.958 19.348 34.216  1.00 26.48  ? 49   PRO B CA   1 
ATOM   4559 C C    . PRO B 1 48  ? 110.932 19.384 35.740  1.00 24.80  ? 49   PRO B C    1 
ATOM   4560 O O    . PRO B 1 48  ? 111.510 18.502 36.368  1.00 23.76  ? 49   PRO B O    1 
ATOM   4561 C CB   . PRO B 1 48  ? 109.922 18.351 33.693  1.00 25.29  ? 49   PRO B CB   1 
ATOM   4562 C CG   . PRO B 1 48  ? 110.556 17.796 32.431  1.00 27.26  ? 49   PRO B CG   1 
ATOM   4563 C CD   . PRO B 1 48  ? 112.035 17.722 32.731  1.00 27.47  ? 49   PRO B CD   1 
ATOM   4564 N N    . PRO B 1 49  ? 110.280 20.393 36.334  1.00 25.15  ? 50   PRO B N    1 
ATOM   4565 C CA   . PRO B 1 49  ? 110.309 20.502 37.803  1.00 33.09  ? 50   PRO B CA   1 
ATOM   4566 C C    . PRO B 1 49  ? 109.492 19.389 38.464  1.00 36.22  ? 50   PRO B C    1 
ATOM   4567 O O    . PRO B 1 49  ? 108.487 18.961 37.907  1.00 32.03  ? 50   PRO B O    1 
ATOM   4568 C CB   . PRO B 1 49  ? 109.649 21.863 38.073  1.00 26.45  ? 50   PRO B CB   1 
ATOM   4569 C CG   . PRO B 1 49  ? 108.723 22.080 36.870  1.00 24.67  ? 50   PRO B CG   1 
ATOM   4570 C CD   . PRO B 1 49  ? 109.434 21.421 35.695  1.00 24.22  ? 50   PRO B CD   1 
ATOM   4571 N N    . GLU B 1 50  ? 109.919 18.917 39.628  1.00 36.98  ? 51   GLU B N    1 
ATOM   4572 C CA   . GLU B 1 50  ? 109.110 17.958 40.364  1.00 39.08  ? 51   GLU B CA   1 
ATOM   4573 C C    . GLU B 1 50  ? 108.477 18.668 41.548  1.00 32.37  ? 51   GLU B C    1 
ATOM   4574 O O    . GLU B 1 50  ? 109.106 19.528 42.160  1.00 34.46  ? 51   GLU B O    1 
ATOM   4575 C CB   . GLU B 1 50  ? 109.946 16.761 40.835  1.00 50.41  ? 51   GLU B CB   1 
ATOM   4576 C CG   . GLU B 1 50  ? 110.385 15.816 39.715  1.00 69.55  ? 51   GLU B CG   1 
ATOM   4577 C CD   . GLU B 1 50  ? 109.225 15.289 38.872  1.00 83.22  ? 51   GLU B CD   1 
ATOM   4578 O OE1  . GLU B 1 50  ? 108.183 14.909 39.452  1.00 87.29  ? 51   GLU B OE1  1 
ATOM   4579 O OE2  . GLU B 1 50  ? 109.361 15.255 37.625  1.00 86.11  ? 51   GLU B OE2  1 
ATOM   4580 N N    . PRO B 1 51  ? 107.231 18.308 41.875  1.00 32.00  ? 52   PRO B N    1 
ATOM   4581 C CA   . PRO B 1 51  ? 106.521 18.938 42.995  1.00 33.35  ? 52   PRO B CA   1 
ATOM   4582 C C    . PRO B 1 51  ? 107.314 18.817 44.300  1.00 31.40  ? 52   PRO B C    1 
ATOM   4583 O O    . PRO B 1 51  ? 107.966 17.792 44.528  1.00 26.56  ? 52   PRO B O    1 
ATOM   4584 C CB   . PRO B 1 51  ? 105.226 18.128 43.085  1.00 30.38  ? 52   PRO B CB   1 
ATOM   4585 C CG   . PRO B 1 51  ? 105.063 17.489 41.728  1.00 27.96  ? 52   PRO B CG   1 
ATOM   4586 C CD   . PRO B 1 51  ? 106.455 17.212 41.261  1.00 31.95  ? 52   PRO B CD   1 
ATOM   4587 N N    . LYS B 1 52  ? 107.282 19.859 45.130  1.00 28.75  ? 53   LYS B N    1 
ATOM   4588 C CA   . LYS B 1 52  ? 108.021 19.844 46.390  1.00 26.14  ? 53   LYS B CA   1 
ATOM   4589 C C    . LYS B 1 52  ? 107.440 18.778 47.308  1.00 32.85  ? 53   LYS B C    1 
ATOM   4590 O O    . LYS B 1 52  ? 106.231 18.741 47.528  1.00 36.81  ? 53   LYS B O    1 
ATOM   4591 C CB   . LYS B 1 52  ? 107.942 21.217 47.076  1.00 22.77  ? 53   LYS B CB   1 
ATOM   4592 C CG   . LYS B 1 52  ? 108.577 21.270 48.465  1.00 27.29  ? 53   LYS B CG   1 
ATOM   4593 C CD   . LYS B 1 52  ? 110.112 21.169 48.390  1.00 28.48  ? 53   LYS B CD   1 
ATOM   4594 C CE   . LYS B 1 52  ? 110.760 21.347 49.766  1.00 23.49  ? 53   LYS B CE   1 
ATOM   4595 N NZ   . LYS B 1 52  ? 112.251 21.265 49.646  1.00 32.08  ? 53   LYS B NZ   1 
ATOM   4596 N N    A GLN B 1 53  ? 108.297 17.907 47.834  0.47 35.33  ? 54   GLN B N    1 
ATOM   4597 N N    B GLN B 1 53  ? 108.297 17.914 47.839  0.53 35.34  ? 54   GLN B N    1 
ATOM   4598 C CA   A GLN B 1 53  ? 107.863 16.891 48.791  0.47 37.11  ? 54   GLN B CA   1 
ATOM   4599 C CA   B GLN B 1 53  ? 107.853 16.902 48.789  0.53 37.23  ? 54   GLN B CA   1 
ATOM   4600 C C    A GLN B 1 53  ? 107.484 17.558 50.113  0.47 35.99  ? 54   GLN B C    1 
ATOM   4601 C C    B GLN B 1 53  ? 107.493 17.551 50.123  0.53 35.94  ? 54   GLN B C    1 
ATOM   4602 O O    A GLN B 1 53  ? 108.094 18.553 50.505  0.47 35.75  ? 54   GLN B O    1 
ATOM   4603 O O    B GLN B 1 53  ? 108.125 18.525 50.532  0.53 35.88  ? 54   GLN B O    1 
ATOM   4604 C CB   A GLN B 1 53  ? 108.971 15.853 49.017  0.47 37.88  ? 54   GLN B CB   1 
ATOM   4605 C CB   B GLN B 1 53  ? 108.936 15.839 48.978  0.53 38.11  ? 54   GLN B CB   1 
ATOM   4606 C CG   A GLN B 1 53  ? 109.383 15.081 47.764  0.47 37.63  ? 54   GLN B CG   1 
ATOM   4607 C CG   B GLN B 1 53  ? 109.122 14.939 47.767  0.53 38.51  ? 54   GLN B CG   1 
ATOM   4608 C CD   A GLN B 1 53  ? 110.659 14.268 47.956  0.47 36.90  ? 54   GLN B CD   1 
ATOM   4609 C CD   B GLN B 1 53  ? 107.910 14.062 47.506  0.53 39.64  ? 54   GLN B CD   1 
ATOM   4610 O OE1  A GLN B 1 53  ? 110.988 13.854 49.067  0.47 38.72  ? 54   GLN B OE1  1 
ATOM   4611 O OE1  B GLN B 1 53  ? 107.442 13.353 48.396  0.53 47.55  ? 54   GLN B OE1  1 
ATOM   4612 N NE2  A GLN B 1 53  ? 111.387 14.046 46.867  0.47 35.46  ? 54   GLN B NE2  1 
ATOM   4613 N NE2  B GLN B 1 53  ? 107.392 14.113 46.287  0.53 35.23  ? 54   GLN B NE2  1 
ATOM   4614 N N    . PRO B 1 54  ? 106.458 17.022 50.792  1.00 35.70  ? 55   PRO B N    1 
ATOM   4615 C CA   . PRO B 1 54  ? 106.006 17.542 52.093  1.00 35.02  ? 55   PRO B CA   1 
ATOM   4616 C C    . PRO B 1 54  ? 107.155 17.586 53.091  1.00 37.12  ? 55   PRO B C    1 
ATOM   4617 O O    . PRO B 1 54  ? 108.063 16.754 53.036  1.00 41.97  ? 55   PRO B O    1 
ATOM   4618 C CB   . PRO B 1 54  ? 104.981 16.500 52.555  1.00 27.25  ? 55   PRO B CB   1 
ATOM   4619 C CG   . PRO B 1 54  ? 104.478 15.895 51.282  1.00 34.17  ? 55   PRO B CG   1 
ATOM   4620 C CD   . PRO B 1 54  ? 105.638 15.888 50.324  1.00 32.97  ? 55   PRO B CD   1 
ATOM   4621 N N    . TRP B 1 55  ? 107.114 18.562 53.985  1.00 35.63  ? 56   TRP B N    1 
ATOM   4622 C CA   . TRP B 1 55  ? 108.152 18.742 54.990  1.00 35.75  ? 56   TRP B CA   1 
ATOM   4623 C C    . TRP B 1 55  ? 107.513 18.698 56.365  1.00 35.36  ? 56   TRP B C    1 
ATOM   4624 O O    . TRP B 1 55  ? 106.316 18.960 56.506  1.00 38.94  ? 56   TRP B O    1 
ATOM   4625 C CB   . TRP B 1 55  ? 108.836 20.099 54.798  1.00 31.06  ? 56   TRP B CB   1 
ATOM   4626 C CG   . TRP B 1 55  ? 107.891 21.276 54.873  1.00 34.44  ? 56   TRP B CG   1 
ATOM   4627 C CD1  . TRP B 1 55  ? 107.515 21.962 55.999  1.00 28.41  ? 56   TRP B CD1  1 
ATOM   4628 C CD2  . TRP B 1 55  ? 107.218 21.910 53.771  1.00 34.32  ? 56   TRP B CD2  1 
ATOM   4629 N NE1  . TRP B 1 55  ? 106.648 22.976 55.663  1.00 30.28  ? 56   TRP B NE1  1 
ATOM   4630 C CE2  . TRP B 1 55  ? 106.449 22.968 54.304  1.00 32.38  ? 56   TRP B CE2  1 
ATOM   4631 C CE3  . TRP B 1 55  ? 107.191 21.682 52.389  1.00 28.68  ? 56   TRP B CE3  1 
ATOM   4632 C CZ2  . TRP B 1 55  ? 105.657 23.796 53.500  1.00 29.32  ? 56   TRP B CZ2  1 
ATOM   4633 C CZ3  . TRP B 1 55  ? 106.411 22.499 51.595  1.00 24.55  ? 56   TRP B CZ3  1 
ATOM   4634 C CH2  . TRP B 1 55  ? 105.651 23.545 52.149  1.00 26.46  ? 56   TRP B CH2  1 
ATOM   4635 N N    . SER B 1 56  ? 108.301 18.356 57.376  1.00 37.11  ? 57   SER B N    1 
ATOM   4636 C CA   . SER B 1 56  ? 107.846 18.485 58.757  1.00 46.04  ? 57   SER B CA   1 
ATOM   4637 C C    . SER B 1 56  ? 108.364 19.810 59.312  1.00 46.82  ? 57   SER B C    1 
ATOM   4638 O O    . SER B 1 56  ? 109.287 20.407 58.747  1.00 45.62  ? 57   SER B O    1 
ATOM   4639 C CB   . SER B 1 56  ? 108.339 17.319 59.610  1.00 45.33  ? 57   SER B CB   1 
ATOM   4640 O OG   . SER B 1 56  ? 109.742 17.178 59.502  1.00 52.85  ? 57   SER B OG   1 
ATOM   4641 N N    . GLY B 1 57  ? 107.764 20.277 60.402  1.00 46.03  ? 58   GLY B N    1 
ATOM   4642 C CA   . GLY B 1 57  ? 108.170 21.541 60.990  1.00 45.54  ? 58   GLY B CA   1 
ATOM   4643 C C    . GLY B 1 57  ? 107.693 22.742 60.193  1.00 46.02  ? 58   GLY B C    1 
ATOM   4644 O O    . GLY B 1 57  ? 106.813 22.623 59.333  1.00 47.76  ? 58   GLY B O    1 
ATOM   4645 N N    . VAL B 1 58  ? 108.287 23.901 60.468  1.00 44.94  ? 59   VAL B N    1 
ATOM   4646 C CA   . VAL B 1 58  ? 107.801 25.159 59.915  1.00 40.28  ? 59   VAL B CA   1 
ATOM   4647 C C    . VAL B 1 58  ? 108.826 25.810 58.988  1.00 41.40  ? 59   VAL B C    1 
ATOM   4648 O O    . VAL B 1 58  ? 109.908 26.207 59.428  1.00 46.48  ? 59   VAL B O    1 
ATOM   4649 C CB   . VAL B 1 58  ? 107.411 26.147 61.040  1.00 40.54  ? 59   VAL B CB   1 
ATOM   4650 C CG1  . VAL B 1 58  ? 106.643 27.336 60.471  1.00 39.50  ? 59   VAL B CG1  1 
ATOM   4651 C CG2  . VAL B 1 58  ? 106.574 25.443 62.102  1.00 36.27  ? 59   VAL B CG2  1 
ATOM   4652 N N    . VAL B 1 59  ? 108.482 25.905 57.705  1.00 33.72  ? 60   VAL B N    1 
ATOM   4653 C CA   . VAL B 1 59  ? 109.307 26.613 56.739  1.00 33.18  ? 60   VAL B CA   1 
ATOM   4654 C C    . VAL B 1 59  ? 109.236 28.107 57.041  1.00 38.52  ? 60   VAL B C    1 
ATOM   4655 O O    . VAL B 1 59  ? 108.147 28.685 57.171  1.00 40.83  ? 60   VAL B O    1 
ATOM   4656 C CB   . VAL B 1 59  ? 108.842 26.362 55.279  1.00 39.19  ? 60   VAL B CB   1 
ATOM   4657 C CG1  . VAL B 1 59  ? 109.508 27.354 54.316  1.00 35.01  ? 60   VAL B CG1  1 
ATOM   4658 C CG2  . VAL B 1 59  ? 109.131 24.937 54.859  1.00 35.27  ? 60   VAL B CG2  1 
ATOM   4659 N N    . ASP B 1 60  ? 110.402 28.726 57.160  1.00 36.28  ? 61   ASP B N    1 
ATOM   4660 C CA   . ASP B 1 60  ? 110.489 30.158 57.374  1.00 42.03  ? 61   ASP B CA   1 
ATOM   4661 C C    . ASP B 1 60  ? 110.235 30.871 56.046  1.00 35.59  ? 61   ASP B C    1 
ATOM   4662 O O    . ASP B 1 60  ? 111.037 30.777 55.122  1.00 36.39  ? 61   ASP B O    1 
ATOM   4663 C CB   . ASP B 1 60  ? 111.879 30.501 57.921  1.00 57.90  ? 61   ASP B CB   1 
ATOM   4664 C CG   . ASP B 1 60  ? 112.224 31.975 57.783  1.00 68.62  ? 61   ASP B CG   1 
ATOM   4665 O OD1  . ASP B 1 60  ? 111.423 32.827 58.221  1.00 72.70  ? 61   ASP B OD1  1 
ATOM   4666 O OD2  . ASP B 1 60  ? 113.305 32.279 57.234  1.00 72.94  ? 61   ASP B OD2  1 
ATOM   4667 N N    . ALA B 1 61  ? 109.106 31.567 55.949  1.00 30.44  ? 62   ALA B N    1 
ATOM   4668 C CA   . ALA B 1 61  ? 108.763 32.310 54.745  1.00 26.16  ? 62   ALA B CA   1 
ATOM   4669 C C    . ALA B 1 61  ? 108.759 33.816 55.012  1.00 26.51  ? 62   ALA B C    1 
ATOM   4670 O O    . ALA B 1 61  ? 107.802 34.510 54.673  1.00 32.59  ? 62   ALA B O    1 
ATOM   4671 C CB   . ALA B 1 61  ? 107.399 31.857 54.215  1.00 28.72  ? 62   ALA B CB   1 
ATOM   4672 N N    . THR B 1 62  ? 109.826 34.324 55.618  1.00 25.91  ? 63   THR B N    1 
ATOM   4673 C CA   . THR B 1 62  ? 109.883 35.740 55.976  1.00 37.86  ? 63   THR B CA   1 
ATOM   4674 C C    . THR B 1 62  ? 110.871 36.510 55.117  1.00 35.50  ? 63   THR B C    1 
ATOM   4675 O O    . THR B 1 62  ? 111.027 37.724 55.279  1.00 40.63  ? 63   THR B O    1 
ATOM   4676 C CB   . THR B 1 62  ? 110.302 35.939 57.435  1.00 40.09  ? 63   THR B CB   1 
ATOM   4677 O OG1  . THR B 1 62  ? 111.675 35.559 57.578  1.00 36.18  ? 63   THR B OG1  1 
ATOM   4678 C CG2  . THR B 1 62  ? 109.432 35.101 58.368  1.00 28.04  ? 63   THR B CG2  1 
ATOM   4679 N N    . THR B 1 63  ? 111.557 35.811 54.220  1.00 30.96  ? 64   THR B N    1 
ATOM   4680 C CA   . THR B 1 63  ? 112.520 36.483 53.354  1.00 31.58  ? 64   THR B CA   1 
ATOM   4681 C C    . THR B 1 63  ? 112.532 35.900 51.942  1.00 31.67  ? 64   THR B C    1 
ATOM   4682 O O    . THR B 1 63  ? 112.160 34.743 51.732  1.00 35.86  ? 64   THR B O    1 
ATOM   4683 C CB   . THR B 1 63  ? 113.944 36.486 53.977  1.00 46.16  ? 64   THR B CB   1 
ATOM   4684 O OG1  . THR B 1 63  ? 114.796 37.374 53.238  1.00 58.93  ? 64   THR B OG1  1 
ATOM   4685 C CG2  . THR B 1 63  ? 114.537 35.088 53.979  1.00 39.37  ? 64   THR B CG2  1 
ATOM   4686 N N    . PHE B 1 64  ? 112.930 36.711 50.968  1.00 29.48  ? 65   PHE B N    1 
ATOM   4687 C CA   . PHE B 1 64  ? 113.062 36.218 49.606  1.00 28.94  ? 65   PHE B CA   1 
ATOM   4688 C C    . PHE B 1 64  ? 114.137 35.147 49.514  1.00 30.09  ? 65   PHE B C    1 
ATOM   4689 O O    . PHE B 1 64  ? 115.161 35.206 50.192  1.00 35.38  ? 65   PHE B O    1 
ATOM   4690 C CB   . PHE B 1 64  ? 113.402 37.342 48.640  1.00 23.07  ? 65   PHE B CB   1 
ATOM   4691 C CG   . PHE B 1 64  ? 112.246 38.212 48.303  1.00 24.00  ? 65   PHE B CG   1 
ATOM   4692 C CD1  . PHE B 1 64  ? 111.152 37.697 47.627  1.00 22.14  ? 65   PHE B CD1  1 
ATOM   4693 C CD2  . PHE B 1 64  ? 112.259 39.559 48.634  1.00 23.33  ? 65   PHE B CD2  1 
ATOM   4694 C CE1  . PHE B 1 64  ? 110.082 38.502 47.305  1.00 26.35  ? 65   PHE B CE1  1 
ATOM   4695 C CE2  . PHE B 1 64  ? 111.185 40.379 48.313  1.00 24.80  ? 65   PHE B CE2  1 
ATOM   4696 C CZ   . PHE B 1 64  ? 110.098 39.851 47.648  1.00 23.04  ? 65   PHE B CZ   1 
ATOM   4697 N N    . GLN B 1 65  ? 113.899 34.176 48.650  1.00 27.45  ? 66   GLN B N    1 
ATOM   4698 C CA   . GLN B 1 65  ? 114.865 33.128 48.419  1.00 27.89  ? 66   GLN B CA   1 
ATOM   4699 C C    . GLN B 1 65  ? 115.803 33.518 47.276  1.00 27.39  ? 66   GLN B C    1 
ATOM   4700 O O    . GLN B 1 65  ? 115.671 34.588 46.689  1.00 32.00  ? 66   GLN B O    1 
ATOM   4701 C CB   . GLN B 1 65  ? 114.130 31.825 48.115  1.00 28.55  ? 66   GLN B CB   1 
ATOM   4702 C CG   . GLN B 1 65  ? 113.963 30.946 49.330  1.00 29.54  ? 66   GLN B CG   1 
ATOM   4703 C CD   . GLN B 1 65  ? 115.287 30.331 49.751  1.00 37.17  ? 66   GLN B CD   1 
ATOM   4704 O OE1  . GLN B 1 65  ? 116.292 30.423 49.031  1.00 40.18  ? 66   GLN B OE1  1 
ATOM   4705 N NE2  . GLN B 1 65  ? 115.293 29.686 50.906  1.00 30.63  ? 66   GLN B NE2  1 
ATOM   4706 N N    . SER B 1 66  ? 116.749 32.641 46.970  1.00 23.47  ? 67   SER B N    1 
ATOM   4707 C CA   . SER B 1 66  ? 117.753 32.880 45.939  1.00 25.74  ? 67   SER B CA   1 
ATOM   4708 C C    . SER B 1 66  ? 117.193 33.165 44.538  1.00 26.69  ? 67   SER B C    1 
ATOM   4709 O O    . SER B 1 66  ? 116.083 32.766 44.190  1.00 26.73  ? 67   SER B O    1 
ATOM   4710 C CB   . SER B 1 66  ? 118.679 31.672 45.872  1.00 29.08  ? 67   SER B CB   1 
ATOM   4711 O OG   . SER B 1 66  ? 119.073 31.299 47.175  1.00 42.41  ? 67   SER B OG   1 
ATOM   4712 N N    . VAL B 1 67  ? 117.996 33.847 43.735  1.00 27.97  ? 68   VAL B N    1 
ATOM   4713 C CA   . VAL B 1 67  ? 117.642 34.177 42.364  1.00 28.59  ? 68   VAL B CA   1 
ATOM   4714 C C    . VAL B 1 67  ? 118.179 33.064 41.478  1.00 27.31  ? 68   VAL B C    1 
ATOM   4715 O O    . VAL B 1 67  ? 119.258 32.524 41.734  1.00 27.09  ? 68   VAL B O    1 
ATOM   4716 C CB   . VAL B 1 67  ? 118.277 35.521 41.964  1.00 27.79  ? 68   VAL B CB   1 
ATOM   4717 C CG1  . VAL B 1 67  ? 118.131 35.795 40.459  1.00 21.87  ? 68   VAL B CG1  1 
ATOM   4718 C CG2  . VAL B 1 67  ? 117.688 36.651 42.809  1.00 24.20  ? 68   VAL B CG2  1 
ATOM   4719 N N    . CYS B 1 68  ? 117.429 32.709 40.444  1.00 23.48  ? 69   CYS B N    1 
ATOM   4720 C CA   . CYS B 1 68  ? 117.867 31.650 39.554  1.00 23.63  ? 69   CYS B CA   1 
ATOM   4721 C C    . CYS B 1 68  ? 119.140 32.086 38.847  1.00 24.28  ? 69   CYS B C    1 
ATOM   4722 O O    . CYS B 1 68  ? 119.272 33.243 38.434  1.00 28.02  ? 69   CYS B O    1 
ATOM   4723 C CB   . CYS B 1 68  ? 116.763 31.302 38.543  1.00 24.81  ? 69   CYS B CB   1 
ATOM   4724 S SG   . CYS B 1 68  ? 115.299 30.452 39.278  1.00 33.92  ? 69   CYS B SG   1 
ATOM   4725 N N    . TYR B 1 69  ? 120.082 31.160 38.720  1.00 24.91  ? 70   TYR B N    1 
ATOM   4726 C CA   . TYR B 1 69  ? 121.332 31.442 38.040  1.00 29.75  ? 70   TYR B CA   1 
ATOM   4727 C C    . TYR B 1 69  ? 121.145 32.162 36.710  1.00 28.34  ? 70   TYR B C    1 
ATOM   4728 O O    . TYR B 1 69  ? 120.377 31.718 35.852  1.00 25.28  ? 70   TYR B O    1 
ATOM   4729 C CB   . TYR B 1 69  ? 122.132 30.163 37.844  1.00 35.51  ? 70   TYR B CB   1 
ATOM   4730 C CG   . TYR B 1 69  ? 123.455 30.284 38.516  1.00 33.26  ? 70   TYR B CG   1 
ATOM   4731 C CD1  . TYR B 1 69  ? 124.487 30.981 37.911  1.00 32.21  ? 70   TYR B CD1  1 
ATOM   4732 C CD2  . TYR B 1 69  ? 123.665 29.757 39.785  1.00 38.05  ? 70   TYR B CD2  1 
ATOM   4733 C CE1  . TYR B 1 69  ? 125.709 31.132 38.541  1.00 37.06  ? 70   TYR B CE1  1 
ATOM   4734 C CE2  . TYR B 1 69  ? 124.891 29.898 40.424  1.00 37.90  ? 70   TYR B CE2  1 
ATOM   4735 C CZ   . TYR B 1 69  ? 125.903 30.589 39.792  1.00 41.73  ? 70   TYR B CZ   1 
ATOM   4736 O OH   . TYR B 1 69  ? 127.124 30.730 40.402  1.00 59.80  ? 70   TYR B OH   1 
ATOM   4737 N N    . GLN B 1 70  ? 121.839 33.286 36.546  1.00 27.41  ? 71   GLN B N    1 
ATOM   4738 C CA   . GLN B 1 70  ? 121.633 34.111 35.363  1.00 24.44  ? 71   GLN B CA   1 
ATOM   4739 C C    . GLN B 1 70  ? 122.748 35.100 35.135  1.00 25.78  ? 71   GLN B C    1 
ATOM   4740 O O    . GLN B 1 70  ? 123.461 35.463 36.065  1.00 24.40  ? 71   GLN B O    1 
ATOM   4741 C CB   . GLN B 1 70  ? 120.330 34.890 35.487  1.00 24.83  ? 71   GLN B CB   1 
ATOM   4742 C CG   . GLN B 1 70  ? 120.317 35.884 36.655  1.00 26.18  ? 71   GLN B CG   1 
ATOM   4743 C CD   . GLN B 1 70  ? 118.946 36.479 36.869  1.00 20.39  ? 71   GLN B CD   1 
ATOM   4744 O OE1  . GLN B 1 70  ? 118.726 37.648 36.592  1.00 20.67  ? 71   GLN B OE1  1 
ATOM   4745 N NE2  . GLN B 1 70  ? 118.006 35.663 37.355  1.00 20.12  ? 71   GLN B NE2  1 
ATOM   4746 N N    . TYR B 1 71  ? 122.877 35.523 33.879  1.00 25.75  ? 72   TYR B N    1 
ATOM   4747 C CA   . TYR B 1 71  ? 123.785 36.581 33.470  1.00 23.75  ? 72   TYR B CA   1 
ATOM   4748 C C    . TYR B 1 71  ? 123.467 37.856 34.254  1.00 30.39  ? 72   TYR B C    1 
ATOM   4749 O O    . TYR B 1 71  ? 122.293 38.178 34.470  1.00 34.62  ? 72   TYR B O    1 
ATOM   4750 C CB   . TYR B 1 71  ? 123.624 36.834 31.964  1.00 21.57  ? 72   TYR B CB   1 
ATOM   4751 C CG   . TYR B 1 71  ? 124.475 37.965 31.436  1.00 25.16  ? 72   TYR B CG   1 
ATOM   4752 C CD1  . TYR B 1 71  ? 125.837 37.788 31.184  1.00 27.08  ? 72   TYR B CD1  1 
ATOM   4753 C CD2  . TYR B 1 71  ? 123.917 39.218 31.179  1.00 33.56  ? 72   TYR B CD2  1 
ATOM   4754 C CE1  . TYR B 1 71  ? 126.627 38.842 30.694  1.00 32.95  ? 72   TYR B CE1  1 
ATOM   4755 C CE2  . TYR B 1 71  ? 124.693 40.277 30.696  1.00 34.66  ? 72   TYR B CE2  1 
ATOM   4756 C CZ   . TYR B 1 71  ? 126.044 40.084 30.452  1.00 38.43  ? 72   TYR B CZ   1 
ATOM   4757 O OH   . TYR B 1 71  ? 126.803 41.135 29.976  1.00 46.59  ? 72   TYR B OH   1 
ATOM   4758 N N    . VAL B 1 72  ? 124.505 38.560 34.707  1.00 26.66  ? 73   VAL B N    1 
ATOM   4759 C CA   . VAL B 1 72  ? 124.321 39.855 35.366  1.00 28.25  ? 73   VAL B CA   1 
ATOM   4760 C C    . VAL B 1 72  ? 124.802 40.975 34.444  1.00 33.38  ? 73   VAL B C    1 
ATOM   4761 O O    . VAL B 1 72  ? 125.961 40.985 34.038  1.00 38.72  ? 73   VAL B O    1 
ATOM   4762 C CB   . VAL B 1 72  ? 125.069 39.926 36.711  1.00 32.73  ? 73   VAL B CB   1 
ATOM   4763 C CG1  . VAL B 1 72  ? 125.005 41.335 37.289  1.00 31.44  ? 73   VAL B CG1  1 
ATOM   4764 C CG2  . VAL B 1 72  ? 124.496 38.919 37.695  1.00 28.88  ? 73   VAL B CG2  1 
ATOM   4765 N N    . ASP B 1 73  ? 123.910 41.904 34.102  1.00 36.69  ? 74   ASP B N    1 
ATOM   4766 C CA   . ASP B 1 73  ? 124.263 43.012 33.208  1.00 34.98  ? 74   ASP B CA   1 
ATOM   4767 C C    . ASP B 1 73  ? 125.406 43.871 33.769  1.00 34.68  ? 74   ASP B C    1 
ATOM   4768 O O    . ASP B 1 73  ? 125.365 44.266 34.927  1.00 41.62  ? 74   ASP B O    1 
ATOM   4769 C CB   . ASP B 1 73  ? 123.048 43.899 32.918  1.00 36.76  ? 74   ASP B CB   1 
ATOM   4770 C CG   . ASP B 1 73  ? 123.369 45.019 31.919  1.00 51.27  ? 74   ASP B CG   1 
ATOM   4771 O OD1  . ASP B 1 73  ? 123.498 44.720 30.715  1.00 61.21  ? 74   ASP B OD1  1 
ATOM   4772 O OD2  . ASP B 1 73  ? 123.523 46.188 32.333  1.00 49.96  ? 74   ASP B OD2  1 
ATOM   4773 N N    . THR B 1 74  ? 126.420 44.145 32.948  1.00 35.02  ? 75   THR B N    1 
ATOM   4774 C CA   . THR B 1 74  ? 127.558 44.979 33.371  1.00 47.33  ? 75   THR B CA   1 
ATOM   4775 C C    . THR B 1 74  ? 127.822 46.161 32.442  1.00 43.18  ? 75   THR B C    1 
ATOM   4776 O O    . THR B 1 74  ? 128.889 46.775 32.512  1.00 45.32  ? 75   THR B O    1 
ATOM   4777 C CB   . THR B 1 74  ? 128.872 44.170 33.474  1.00 51.77  ? 75   THR B CB   1 
ATOM   4778 O OG1  . THR B 1 74  ? 129.099 43.475 32.240  1.00 60.37  ? 75   THR B OG1  1 
ATOM   4779 C CG2  . THR B 1 74  ? 128.816 43.174 34.623  1.00 43.34  ? 75   THR B CG2  1 
ATOM   4780 N N    . LEU B 1 75  ? 126.855 46.473 31.580  1.00 40.94  ? 76   LEU B N    1 
ATOM   4781 C CA   . LEU B 1 75  ? 126.998 47.563 30.612  1.00 42.85  ? 76   LEU B CA   1 
ATOM   4782 C C    . LEU B 1 75  ? 127.308 48.897 31.300  1.00 42.19  ? 76   LEU B C    1 
ATOM   4783 O O    . LEU B 1 75  ? 128.198 49.633 30.873  1.00 44.59  ? 76   LEU B O    1 
ATOM   4784 C CB   . LEU B 1 75  ? 125.737 47.693 29.747  1.00 42.36  ? 76   LEU B CB   1 
ATOM   4785 C CG   . LEU B 1 75  ? 125.753 48.754 28.636  1.00 43.81  ? 76   LEU B CG   1 
ATOM   4786 C CD1  . LEU B 1 75  ? 126.732 48.374 27.537  1.00 38.72  ? 76   LEU B CD1  1 
ATOM   4787 C CD2  . LEU B 1 75  ? 124.360 48.978 28.056  1.00 42.86  ? 76   LEU B CD2  1 
ATOM   4788 N N    . TYR B 1 76  ? 126.571 49.199 32.364  1.00 39.70  ? 77   TYR B N    1 
ATOM   4789 C CA   . TYR B 1 76  ? 126.795 50.424 33.117  1.00 36.59  ? 77   TYR B CA   1 
ATOM   4790 C C    . TYR B 1 76  ? 126.863 50.140 34.616  1.00 36.49  ? 77   TYR B C    1 
ATOM   4791 O O    . TYR B 1 76  ? 125.875 50.326 35.335  1.00 38.34  ? 77   TYR B O    1 
ATOM   4792 C CB   . TYR B 1 76  ? 125.697 51.453 32.821  1.00 35.79  ? 77   TYR B CB   1 
ATOM   4793 C CG   . TYR B 1 76  ? 125.627 51.943 31.384  1.00 36.25  ? 77   TYR B CG   1 
ATOM   4794 C CD1  . TYR B 1 76  ? 126.645 52.715 30.833  1.00 37.54  ? 77   TYR B CD1  1 
ATOM   4795 C CD2  . TYR B 1 76  ? 124.526 51.658 30.592  1.00 32.90  ? 77   TYR B CD2  1 
ATOM   4796 C CE1  . TYR B 1 76  ? 126.569 53.173 29.527  1.00 39.12  ? 77   TYR B CE1  1 
ATOM   4797 C CE2  . TYR B 1 76  ? 124.440 52.100 29.291  1.00 34.77  ? 77   TYR B CE2  1 
ATOM   4798 C CZ   . TYR B 1 76  ? 125.456 52.861 28.756  1.00 44.43  ? 77   TYR B CZ   1 
ATOM   4799 O OH   . TYR B 1 76  ? 125.348 53.304 27.442  1.00 44.04  ? 77   TYR B OH   1 
ATOM   4800 N N    . PRO B 1 77  ? 128.035 49.692 35.092  1.00 44.04  ? 78   PRO B N    1 
ATOM   4801 C CA   . PRO B 1 77  ? 128.228 49.311 36.502  1.00 47.98  ? 78   PRO B CA   1 
ATOM   4802 C C    . PRO B 1 77  ? 127.852 50.442 37.459  1.00 43.52  ? 78   PRO B C    1 
ATOM   4803 O O    . PRO B 1 77  ? 128.377 51.543 37.312  1.00 41.42  ? 78   PRO B O    1 
ATOM   4804 C CB   . PRO B 1 77  ? 129.737 49.038 36.585  1.00 49.18  ? 78   PRO B CB   1 
ATOM   4805 C CG   . PRO B 1 77  ? 130.134 48.681 35.193  1.00 52.02  ? 78   PRO B CG   1 
ATOM   4806 C CD   . PRO B 1 77  ? 129.266 49.528 34.298  1.00 48.92  ? 78   PRO B CD   1 
ATOM   4807 N N    . GLY B 1 78  ? 126.956 50.177 38.410  1.00 38.96  ? 79   GLY B N    1 
ATOM   4808 C CA   . GLY B 1 78  ? 126.566 51.179 39.392  1.00 36.45  ? 79   GLY B CA   1 
ATOM   4809 C C    . GLY B 1 78  ? 125.397 52.075 38.998  1.00 39.38  ? 79   GLY B C    1 
ATOM   4810 O O    . GLY B 1 78  ? 124.843 52.790 39.833  1.00 41.85  ? 79   GLY B O    1 
ATOM   4811 N N    . PHE B 1 79  ? 125.028 52.039 37.723  1.00 38.47  ? 80   PHE B N    1 
ATOM   4812 C CA   . PHE B 1 79  ? 123.904 52.810 37.205  1.00 39.96  ? 80   PHE B CA   1 
ATOM   4813 C C    . PHE B 1 79  ? 122.578 52.207 37.675  1.00 37.91  ? 80   PHE B C    1 
ATOM   4814 O O    . PHE B 1 79  ? 122.335 51.014 37.477  1.00 42.46  ? 80   PHE B O    1 
ATOM   4815 C CB   . PHE B 1 79  ? 123.976 52.808 35.673  1.00 36.37  ? 80   PHE B CB   1 
ATOM   4816 C CG   . PHE B 1 79  ? 122.910 53.623 35.006  1.00 35.97  ? 80   PHE B CG   1 
ATOM   4817 C CD1  . PHE B 1 79  ? 122.751 54.973 35.310  1.00 32.71  ? 80   PHE B CD1  1 
ATOM   4818 C CD2  . PHE B 1 79  ? 122.091 53.053 34.040  1.00 31.71  ? 80   PHE B CD2  1 
ATOM   4819 C CE1  . PHE B 1 79  ? 121.767 55.733 34.678  1.00 29.05  ? 80   PHE B CE1  1 
ATOM   4820 C CE2  . PHE B 1 79  ? 121.111 53.804 33.402  1.00 30.97  ? 80   PHE B CE2  1 
ATOM   4821 C CZ   . PHE B 1 79  ? 120.949 55.144 33.719  1.00 30.11  ? 80   PHE B CZ   1 
ATOM   4822 N N    . GLU B 1 80  ? 121.720 53.026 38.283  1.00 34.23  ? 81   GLU B N    1 
ATOM   4823 C CA   . GLU B 1 80  ? 120.416 52.554 38.755  1.00 41.01  ? 81   GLU B CA   1 
ATOM   4824 C C    . GLU B 1 80  ? 119.524 52.031 37.626  1.00 42.32  ? 81   GLU B C    1 
ATOM   4825 O O    . GLU B 1 80  ? 118.758 51.068 37.813  1.00 31.71  ? 81   GLU B O    1 
ATOM   4826 C CB   . GLU B 1 80  ? 119.686 53.642 39.550  1.00 53.17  ? 81   GLU B CB   1 
ATOM   4827 C CG   . GLU B 1 80  ? 119.371 53.249 41.004  1.00 71.38  ? 81   GLU B CG   1 
ATOM   4828 C CD   . GLU B 1 80  ? 118.377 52.086 41.129  1.00 85.92  ? 81   GLU B CD   1 
ATOM   4829 O OE1  . GLU B 1 80  ? 117.201 52.255 40.731  1.00 91.18  ? 81   GLU B OE1  1 
ATOM   4830 O OE2  . GLU B 1 80  ? 118.767 51.005 41.636  1.00 88.70  ? 81   GLU B OE2  1 
ATOM   4831 N N    . GLY B 1 81  ? 119.628 52.659 36.455  1.00 39.51  ? 82   GLY B N    1 
ATOM   4832 C CA   . GLY B 1 81  ? 118.852 52.236 35.306  1.00 31.54  ? 82   GLY B CA   1 
ATOM   4833 C C    . GLY B 1 81  ? 118.990 50.757 35.006  1.00 31.38  ? 82   GLY B C    1 
ATOM   4834 O O    . GLY B 1 81  ? 118.023 50.107 34.592  1.00 33.89  ? 82   GLY B O    1 
ATOM   4835 N N    . THR B 1 82  ? 120.191 50.222 35.212  1.00 32.97  ? 83   THR B N    1 
ATOM   4836 C CA   . THR B 1 82  ? 120.433 48.801 34.968  1.00 34.34  ? 83   THR B CA   1 
ATOM   4837 C C    . THR B 1 82  ? 120.401 47.986 36.256  1.00 34.92  ? 83   THR B C    1 
ATOM   4838 O O    . THR B 1 82  ? 119.888 46.866 36.275  1.00 34.54  ? 83   THR B O    1 
ATOM   4839 C CB   . THR B 1 82  ? 121.768 48.563 34.248  1.00 34.01  ? 83   THR B CB   1 
ATOM   4840 O OG1  . THR B 1 82  ? 122.812 49.237 34.953  1.00 38.97  ? 83   THR B OG1  1 
ATOM   4841 C CG2  . THR B 1 82  ? 121.711 49.091 32.826  1.00 38.38  ? 83   THR B CG2  1 
ATOM   4842 N N    . GLU B 1 83  ? 120.954 48.544 37.327  1.00 30.15  ? 84   GLU B N    1 
ATOM   4843 C CA   . GLU B 1 83  ? 121.059 47.804 38.577  1.00 34.18  ? 84   GLU B CA   1 
ATOM   4844 C C    . GLU B 1 83  ? 119.705 47.381 39.156  1.00 33.02  ? 84   GLU B C    1 
ATOM   4845 O O    . GLU B 1 83  ? 119.615 46.352 39.826  1.00 31.40  ? 84   GLU B O    1 
ATOM   4846 C CB   . GLU B 1 83  ? 121.877 48.583 39.620  1.00 35.18  ? 84   GLU B CB   1 
ATOM   4847 C CG   . GLU B 1 83  ? 123.343 48.836 39.230  1.00 47.34  ? 84   GLU B CG   1 
ATOM   4848 C CD   . GLU B 1 83  ? 124.171 47.565 39.062  1.00 54.62  ? 84   GLU B CD   1 
ATOM   4849 O OE1  . GLU B 1 83  ? 123.653 46.453 39.342  1.00 57.89  ? 84   GLU B OE1  1 
ATOM   4850 O OE2  . GLU B 1 83  ? 125.352 47.685 38.655  1.00 53.45  ? 84   GLU B OE2  1 
ATOM   4851 N N    . MET B 1 84  ? 118.656 48.156 38.886  1.00 32.53  ? 85   MET B N    1 
ATOM   4852 C CA   . MET B 1 84  ? 117.318 47.825 39.398  1.00 31.42  ? 85   MET B CA   1 
ATOM   4853 C C    . MET B 1 84  ? 116.783 46.513 38.822  1.00 33.23  ? 85   MET B C    1 
ATOM   4854 O O    . MET B 1 84  ? 115.850 45.935 39.371  1.00 37.96  ? 85   MET B O    1 
ATOM   4855 C CB   . MET B 1 84  ? 116.324 48.959 39.129  1.00 27.41  ? 85   MET B CB   1 
ATOM   4856 C CG   . MET B 1 84  ? 116.061 49.232 37.643  1.00 33.38  ? 85   MET B CG   1 
ATOM   4857 S SD   . MET B 1 84  ? 114.968 50.661 37.364  1.00 46.00  ? 85   MET B SD   1 
ATOM   4858 C CE   . MET B 1 84  ? 113.390 49.933 37.854  1.00 24.33  ? 85   MET B CE   1 
ATOM   4859 N N    . TRP B 1 85  ? 117.381 46.041 37.728  1.00 28.15  ? 86   TRP B N    1 
ATOM   4860 C CA   . TRP B 1 85  ? 116.951 44.783 37.106  1.00 27.99  ? 86   TRP B CA   1 
ATOM   4861 C C    . TRP B 1 85  ? 117.885 43.630 37.444  1.00 31.13  ? 86   TRP B C    1 
ATOM   4862 O O    . TRP B 1 85  ? 117.612 42.482 37.102  1.00 29.95  ? 86   TRP B O    1 
ATOM   4863 C CB   . TRP B 1 85  ? 116.838 44.925 35.585  1.00 21.26  ? 86   TRP B CB   1 
ATOM   4864 C CG   . TRP B 1 85  ? 116.052 46.115 35.173  1.00 30.43  ? 86   TRP B CG   1 
ATOM   4865 C CD1  . TRP B 1 85  ? 116.536 47.278 34.629  1.00 26.35  ? 86   TRP B CD1  1 
ATOM   4866 C CD2  . TRP B 1 85  ? 114.630 46.285 35.282  1.00 30.63  ? 86   TRP B CD2  1 
ATOM   4867 N NE1  . TRP B 1 85  ? 115.498 48.152 34.383  1.00 30.95  ? 86   TRP B NE1  1 
ATOM   4868 C CE2  . TRP B 1 85  ? 114.321 47.570 34.777  1.00 30.67  ? 86   TRP B CE2  1 
ATOM   4869 C CE3  . TRP B 1 85  ? 113.591 45.477 35.753  1.00 24.19  ? 86   TRP B CE3  1 
ATOM   4870 C CZ2  . TRP B 1 85  ? 113.018 48.058 34.729  1.00 31.27  ? 86   TRP B CZ2  1 
ATOM   4871 C CZ3  . TRP B 1 85  ? 112.301 45.963 35.709  1.00 22.99  ? 86   TRP B CZ3  1 
ATOM   4872 C CH2  . TRP B 1 85  ? 112.023 47.241 35.199  1.00 29.66  ? 86   TRP B CH2  1 
ATOM   4873 N N    . ASN B 1 86  ? 118.997 43.932 38.104  1.00 28.03  ? 87   ASN B N    1 
ATOM   4874 C CA   . ASN B 1 86  ? 119.934 42.883 38.477  1.00 27.20  ? 87   ASN B CA   1 
ATOM   4875 C C    . ASN B 1 86  ? 119.513 42.130 39.736  1.00 27.87  ? 87   ASN B C    1 
ATOM   4876 O O    . ASN B 1 86  ? 118.775 42.661 40.573  1.00 25.16  ? 87   ASN B O    1 
ATOM   4877 C CB   . ASN B 1 86  ? 121.331 43.467 38.644  1.00 32.14  ? 87   ASN B CB   1 
ATOM   4878 C CG   . ASN B 1 86  ? 121.987 43.759 37.317  1.00 38.16  ? 87   ASN B CG   1 
ATOM   4879 O OD1  . ASN B 1 86  ? 121.763 43.041 36.334  1.00 27.87  ? 87   ASN B OD1  1 
ATOM   4880 N ND2  . ASN B 1 86  ? 122.796 44.816 37.271  1.00 34.69  ? 87   ASN B ND2  1 
ATOM   4881 N N    . PRO B 1 87  ? 119.981 40.884 39.864  1.00 26.06  ? 88   PRO B N    1 
ATOM   4882 C CA   . PRO B 1 87  ? 119.726 40.047 41.042  1.00 33.06  ? 88   PRO B CA   1 
ATOM   4883 C C    . PRO B 1 87  ? 120.039 40.808 42.314  1.00 32.56  ? 88   PRO B C    1 
ATOM   4884 O O    . PRO B 1 87  ? 121.097 41.428 42.403  1.00 33.62  ? 88   PRO B O    1 
ATOM   4885 C CB   . PRO B 1 87  ? 120.717 38.889 40.865  1.00 30.30  ? 88   PRO B CB   1 
ATOM   4886 C CG   . PRO B 1 87  ? 120.872 38.779 39.382  1.00 31.66  ? 88   PRO B CG   1 
ATOM   4887 C CD   . PRO B 1 87  ? 120.821 40.200 38.864  1.00 25.96  ? 88   PRO B CD   1 
ATOM   4888 N N    . ASN B 1 88  ? 119.113 40.791 43.266  1.00 32.28  ? 89   ASN B N    1 
ATOM   4889 C CA   . ASN B 1 88  ? 119.340 41.426 44.559  1.00 28.40  ? 89   ASN B CA   1 
ATOM   4890 C C    . ASN B 1 88  ? 119.370 40.372 45.659  1.00 26.90  ? 89   ASN B C    1 
ATOM   4891 O O    . ASN B 1 88  ? 119.207 40.683 46.829  1.00 35.47  ? 89   ASN B O    1 
ATOM   4892 C CB   . ASN B 1 88  ? 118.261 42.467 44.851  1.00 26.68  ? 89   ASN B CB   1 
ATOM   4893 C CG   . ASN B 1 88  ? 116.869 41.863 44.890  1.00 34.94  ? 89   ASN B CG   1 
ATOM   4894 O OD1  . ASN B 1 88  ? 116.634 40.758 44.381  1.00 35.30  ? 89   ASN B OD1  1 
ATOM   4895 N ND2  . ASN B 1 88  ? 115.930 42.594 45.482  1.00 28.31  ? 89   ASN B ND2  1 
ATOM   4896 N N    . ARG B 1 89  ? 119.552 39.118 45.260  1.00 27.13  ? 90   ARG B N    1 
ATOM   4897 C CA   . ARG B 1 89  ? 119.814 38.017 46.185  1.00 26.21  ? 90   ARG B CA   1 
ATOM   4898 C C    . ARG B 1 89  ? 120.840 37.129 45.511  1.00 28.03  ? 90   ARG B C    1 
ATOM   4899 O O    . ARG B 1 89  ? 121.013 37.192 44.296  1.00 34.77  ? 90   ARG B O    1 
ATOM   4900 C CB   . ARG B 1 89  ? 118.541 37.210 46.490  1.00 26.19  ? 90   ARG B CB   1 
ATOM   4901 C CG   . ARG B 1 89  ? 117.447 37.954 47.274  1.00 23.73  ? 90   ARG B CG   1 
ATOM   4902 C CD   . ARG B 1 89  ? 117.886 38.302 48.708  1.00 27.13  ? 90   ARG B CD   1 
ATOM   4903 N NE   . ARG B 1 89  ? 116.827 38.970 49.476  1.00 34.63  ? 90   ARG B NE   1 
ATOM   4904 C CZ   . ARG B 1 89  ? 116.454 40.239 49.291  1.00 39.28  ? 90   ARG B CZ   1 
ATOM   4905 N NH1  . ARG B 1 89  ? 117.040 40.976 48.353  1.00 38.11  ? 90   ARG B NH1  1 
ATOM   4906 N NH2  . ARG B 1 89  ? 115.486 40.776 50.031  1.00 32.94  ? 90   ARG B NH2  1 
ATOM   4907 N N    . GLU B 1 90  ? 121.529 36.314 46.298  1.00 32.20  ? 91   GLU B N    1 
ATOM   4908 C CA   . GLU B 1 90  ? 122.515 35.386 45.760  1.00 30.33  ? 91   GLU B CA   1 
ATOM   4909 C C    . GLU B 1 90  ? 121.913 34.485 44.682  1.00 32.20  ? 91   GLU B C    1 
ATOM   4910 O O    . GLU B 1 90  ? 120.730 34.101 44.743  1.00 26.94  ? 91   GLU B O    1 
ATOM   4911 C CB   . GLU B 1 90  ? 123.109 34.527 46.881  1.00 40.66  ? 91   GLU B CB   1 
ATOM   4912 C CG   . GLU B 1 90  ? 122.092 33.634 47.571  1.00 58.07  ? 91   GLU B CG   1 
ATOM   4913 C CD   . GLU B 1 90  ? 122.727 32.661 48.561  1.00 74.26  ? 91   GLU B CD   1 
ATOM   4914 O OE1  . GLU B 1 90  ? 123.288 33.122 49.581  1.00 79.38  ? 91   GLU B OE1  1 
ATOM   4915 O OE2  . GLU B 1 90  ? 122.653 31.433 48.324  1.00 77.27  ? 91   GLU B OE2  1 
ATOM   4916 N N    . LEU B 1 91  ? 122.736 34.161 43.690  1.00 21.31  ? 92   LEU B N    1 
ATOM   4917 C CA   . LEU B 1 91  ? 122.347 33.255 42.631  1.00 25.60  ? 92   LEU B CA   1 
ATOM   4918 C C    . LEU B 1 91  ? 122.420 31.805 43.114  1.00 27.92  ? 92   LEU B C    1 
ATOM   4919 O O    . LEU B 1 91  ? 123.267 31.455 43.928  1.00 29.15  ? 92   LEU B O    1 
ATOM   4920 C CB   . LEU B 1 91  ? 123.264 33.447 41.421  1.00 31.17  ? 92   LEU B CB   1 
ATOM   4921 C CG   . LEU B 1 91  ? 123.354 34.842 40.804  1.00 34.40  ? 92   LEU B CG   1 
ATOM   4922 C CD1  . LEU B 1 91  ? 124.339 34.860 39.642  1.00 27.01  ? 92   LEU B CD1  1 
ATOM   4923 C CD2  . LEU B 1 91  ? 121.996 35.296 40.333  1.00 33.83  ? 92   LEU B CD2  1 
ATOM   4924 N N    . SER B 1 92  ? 121.524 30.962 42.614  1.00 30.21  ? 93   SER B N    1 
ATOM   4925 C CA   . SER B 1 92  ? 121.568 29.532 42.922  1.00 29.83  ? 93   SER B CA   1 
ATOM   4926 C C    . SER B 1 92  ? 120.692 28.769 41.947  1.00 26.35  ? 93   SER B C    1 
ATOM   4927 O O    . SER B 1 92  ? 119.769 29.345 41.369  1.00 30.79  ? 93   SER B O    1 
ATOM   4928 C CB   . SER B 1 92  ? 121.096 29.275 44.357  1.00 21.22  ? 93   SER B CB   1 
ATOM   4929 O OG   . SER B 1 92  ? 120.903 27.890 44.563  1.00 27.13  ? 93   SER B OG   1 
ATOM   4930 N N    . GLU B 1 93  ? 120.972 27.485 41.753  1.00 28.82  ? 94   GLU B N    1 
ATOM   4931 C CA   . GLU B 1 93  ? 120.078 26.661 40.951  1.00 30.34  ? 94   GLU B CA   1 
ATOM   4932 C C    . GLU B 1 93  ? 118.909 26.185 41.813  1.00 34.64  ? 94   GLU B C    1 
ATOM   4933 O O    . GLU B 1 93  ? 117.910 25.680 41.302  1.00 37.56  ? 94   GLU B O    1 
ATOM   4934 C CB   . GLU B 1 93  ? 120.820 25.470 40.344  1.00 32.60  ? 94   GLU B CB   1 
ATOM   4935 C CG   . GLU B 1 93  ? 121.796 25.827 39.232  1.00 34.32  ? 94   GLU B CG   1 
ATOM   4936 C CD   . GLU B 1 93  ? 122.381 24.586 38.563  1.00 34.79  ? 94   GLU B CD   1 
ATOM   4937 O OE1  . GLU B 1 93  ? 121.708 24.059 37.656  1.00 26.32  ? 94   GLU B OE1  1 
ATOM   4938 O OE2  . GLU B 1 93  ? 123.490 24.129 38.958  1.00 28.47  ? 94   GLU B OE2  1 
ATOM   4939 N N    . ASP B 1 94  ? 119.052 26.345 43.126  1.00 29.84  ? 95   ASP B N    1 
ATOM   4940 C CA   . ASP B 1 94  ? 117.968 26.061 44.073  1.00 27.14  ? 95   ASP B CA   1 
ATOM   4941 C C    . ASP B 1 94  ? 117.154 27.357 44.230  1.00 24.00  ? 95   ASP B C    1 
ATOM   4942 O O    . ASP B 1 94  ? 117.309 28.081 45.202  1.00 28.52  ? 95   ASP B O    1 
ATOM   4943 C CB   . ASP B 1 94  ? 118.592 25.634 45.409  1.00 25.35  ? 95   ASP B CB   1 
ATOM   4944 C CG   . ASP B 1 94  ? 117.576 25.225 46.451  1.00 33.87  ? 95   ASP B CG   1 
ATOM   4945 O OD1  . ASP B 1 94  ? 116.363 25.468 46.270  1.00 34.50  ? 95   ASP B OD1  1 
ATOM   4946 O OD2  . ASP B 1 94  ? 118.013 24.660 47.481  1.00 36.64  ? 95   ASP B OD2  1 
ATOM   4947 N N    . CYS B 1 95  ? 116.288 27.644 43.264  1.00 18.87  ? 96   CYS B N    1 
ATOM   4948 C CA   . CYS B 1 95  ? 115.661 28.960 43.170  1.00 22.23  ? 96   CYS B CA   1 
ATOM   4949 C C    . CYS B 1 95  ? 114.156 28.883 42.972  1.00 21.16  ? 96   CYS B C    1 
ATOM   4950 O O    . CYS B 1 95  ? 113.500 29.906 42.780  1.00 21.82  ? 96   CYS B O    1 
ATOM   4951 C CB   . CYS B 1 95  ? 116.261 29.724 41.985  1.00 19.67  ? 96   CYS B CB   1 
ATOM   4952 S SG   . CYS B 1 95  ? 116.017 28.841 40.383  1.00 26.26  ? 96   CYS B SG   1 
ATOM   4953 N N    . LEU B 1 96  ? 113.615 27.672 42.996  1.00 18.01  ? 97   LEU B N    1 
ATOM   4954 C CA   . LEU B 1 96  ? 112.198 27.462 42.701  1.00 20.18  ? 97   LEU B CA   1 
ATOM   4955 C C    . LEU B 1 96  ? 111.316 27.715 43.930  1.00 20.20  ? 97   LEU B C    1 
ATOM   4956 O O    . LEU B 1 96  ? 110.819 26.784 44.570  1.00 18.94  ? 97   LEU B O    1 
ATOM   4957 C CB   . LEU B 1 96  ? 111.952 26.073 42.084  1.00 17.84  ? 97   LEU B CB   1 
ATOM   4958 C CG   . LEU B 1 96  ? 112.554 25.965 40.678  1.00 23.05  ? 97   LEU B CG   1 
ATOM   4959 C CD1  . LEU B 1 96  ? 112.119 24.694 39.933  1.00 17.38  ? 97   LEU B CD1  1 
ATOM   4960 C CD2  . LEU B 1 96  ? 112.199 27.204 39.839  1.00 16.32  ? 97   LEU B CD2  1 
ATOM   4961 N N    . TYR B 1 97  ? 111.138 28.996 44.247  1.00 20.43  ? 98   TYR B N    1 
ATOM   4962 C CA   . TYR B 1 97  ? 110.291 29.423 45.350  1.00 22.86  ? 98   TYR B CA   1 
ATOM   4963 C C    . TYR B 1 97  ? 109.291 30.413 44.808  1.00 21.09  ? 98   TYR B C    1 
ATOM   4964 O O    . TYR B 1 97  ? 109.512 31.019 43.756  1.00 23.33  ? 98   TYR B O    1 
ATOM   4965 C CB   . TYR B 1 97  ? 111.143 30.063 46.467  1.00 19.13  ? 98   TYR B CB   1 
ATOM   4966 C CG   . TYR B 1 97  ? 112.133 29.083 47.003  1.00 25.08  ? 98   TYR B CG   1 
ATOM   4967 C CD1  . TYR B 1 97  ? 113.327 28.834 46.320  1.00 25.48  ? 98   TYR B CD1  1 
ATOM   4968 C CD2  . TYR B 1 97  ? 111.856 28.349 48.146  1.00 22.28  ? 98   TYR B CD2  1 
ATOM   4969 C CE1  . TYR B 1 97  ? 114.225 27.893 46.781  1.00 25.45  ? 98   TYR B CE1  1 
ATOM   4970 C CE2  . TYR B 1 97  ? 112.755 27.404 48.625  1.00 24.85  ? 98   TYR B CE2  1 
ATOM   4971 C CZ   . TYR B 1 97  ? 113.933 27.186 47.937  1.00 29.66  ? 98   TYR B CZ   1 
ATOM   4972 O OH   . TYR B 1 97  ? 114.825 26.257 48.390  1.00 32.74  ? 98   TYR B OH   1 
ATOM   4973 N N    . LEU B 1 98  ? 108.186 30.581 45.521  1.00 20.34  ? 99   LEU B N    1 
ATOM   4974 C CA   . LEU B 1 98  ? 107.204 31.587 45.135  1.00 23.51  ? 99   LEU B CA   1 
ATOM   4975 C C    . LEU B 1 98  ? 106.797 32.419 46.355  1.00 22.99  ? 99   LEU B C    1 
ATOM   4976 O O    . LEU B 1 98  ? 107.107 32.063 47.496  1.00 23.59  ? 99   LEU B O    1 
ATOM   4977 C CB   . LEU B 1 98  ? 106.001 30.940 44.426  1.00 18.85  ? 99   LEU B CB   1 
ATOM   4978 C CG   . LEU B 1 98  ? 105.241 29.833 45.160  1.00 24.47  ? 99   LEU B CG   1 
ATOM   4979 C CD1  . LEU B 1 98  ? 104.341 30.422 46.248  1.00 18.96  ? 99   LEU B CD1  1 
ATOM   4980 C CD2  . LEU B 1 98  ? 104.413 28.994 44.187  1.00 18.16  ? 99   LEU B CD2  1 
ATOM   4981 N N    . ASN B 1 99  ? 106.121 33.532 46.102  1.00 23.97  ? 100  ASN B N    1 
ATOM   4982 C CA   . ASN B 1 99  ? 105.805 34.477 47.149  1.00 22.56  ? 100  ASN B CA   1 
ATOM   4983 C C    . ASN B 1 99  ? 104.338 34.846 47.103  1.00 26.29  ? 100  ASN B C    1 
ATOM   4984 O O    . ASN B 1 99  ? 103.782 35.054 46.023  1.00 31.89  ? 100  ASN B O    1 
ATOM   4985 C CB   . ASN B 1 99  ? 106.661 35.727 46.984  1.00 21.38  ? 100  ASN B CB   1 
ATOM   4986 C CG   . ASN B 1 99  ? 108.079 35.403 46.542  1.00 26.23  ? 100  ASN B CG   1 
ATOM   4987 O OD1  . ASN B 1 99  ? 108.907 34.965 47.342  1.00 25.30  ? 100  ASN B OD1  1 
ATOM   4988 N ND2  . ASN B 1 99  ? 108.363 35.622 45.257  1.00 28.01  ? 100  ASN B ND2  1 
ATOM   4989 N N    . VAL B 1 100 ? 103.715 34.911 48.276  1.00 19.37  ? 101  VAL B N    1 
ATOM   4990 C CA   . VAL B 1 100 ? 102.314 35.266 48.383  1.00 19.63  ? 101  VAL B CA   1 
ATOM   4991 C C    . VAL B 1 100 ? 102.158 36.501 49.274  1.00 27.09  ? 101  VAL B C    1 
ATOM   4992 O O    . VAL B 1 100 ? 102.698 36.550 50.381  1.00 28.84  ? 101  VAL B O    1 
ATOM   4993 C CB   . VAL B 1 100 ? 101.515 34.114 48.998  1.00 23.99  ? 101  VAL B CB   1 
ATOM   4994 C CG1  . VAL B 1 100 ? 100.012 34.400 48.939  1.00 20.76  ? 101  VAL B CG1  1 
ATOM   4995 C CG2  . VAL B 1 100 ? 101.857 32.810 48.295  1.00 20.18  ? 101  VAL B CG2  1 
ATOM   4996 N N    . TRP B 1 101 ? 101.438 37.503 48.783  1.00 24.51  ? 102  TRP B N    1 
ATOM   4997 C CA   . TRP B 1 101 ? 101.107 38.671 49.593  1.00 22.18  ? 102  TRP B CA   1 
ATOM   4998 C C    . TRP B 1 101 ? 99.615  38.634 49.742  1.00 24.00  ? 102  TRP B C    1 
ATOM   4999 O O    . TRP B 1 101 ? 98.908  38.299 48.793  1.00 29.02  ? 102  TRP B O    1 
ATOM   5000 C CB   . TRP B 1 101 ? 101.473 39.993 48.903  1.00 19.87  ? 102  TRP B CB   1 
ATOM   5001 C CG   . TRP B 1 101 ? 102.941 40.315 48.826  1.00 30.09  ? 102  TRP B CG   1 
ATOM   5002 C CD1  . TRP B 1 101 ? 103.654 41.090 49.692  1.00 34.64  ? 102  TRP B CD1  1 
ATOM   5003 C CD2  . TRP B 1 101 ? 103.863 39.902 47.804  1.00 18.79  ? 102  TRP B CD2  1 
ATOM   5004 N NE1  . TRP B 1 101 ? 104.957 41.175 49.281  1.00 27.36  ? 102  TRP B NE1  1 
ATOM   5005 C CE2  . TRP B 1 101 ? 105.111 40.456 48.136  1.00 23.16  ? 102  TRP B CE2  1 
ATOM   5006 C CE3  . TRP B 1 101 ? 103.747 39.124 46.655  1.00 25.37  ? 102  TRP B CE3  1 
ATOM   5007 C CZ2  . TRP B 1 101 ? 106.246 40.243 47.343  1.00 25.30  ? 102  TRP B CZ2  1 
ATOM   5008 C CZ3  . TRP B 1 101 ? 104.873 38.923 45.874  1.00 19.65  ? 102  TRP B CZ3  1 
ATOM   5009 C CH2  . TRP B 1 101 ? 106.103 39.482 46.221  1.00 21.52  ? 102  TRP B CH2  1 
ATOM   5010 N N    . THR B 1 102 ? 99.130  38.999 50.924  1.00 29.06  ? 103  THR B N    1 
ATOM   5011 C CA   . THR B 1 102 ? 97.704  38.976 51.186  1.00 32.55  ? 103  THR B CA   1 
ATOM   5012 C C    . THR B 1 102 ? 97.369  40.090 52.188  1.00 35.71  ? 103  THR B C    1 
ATOM   5013 O O    . THR B 1 102 ? 98.241  40.535 52.936  1.00 36.55  ? 103  THR B O    1 
ATOM   5014 C CB   . THR B 1 102 ? 97.276  37.579 51.708  1.00 35.39  ? 103  THR B CB   1 
ATOM   5015 O OG1  . THR B 1 102 ? 95.897  37.342 51.406  1.00 44.28  ? 103  THR B OG1  1 
ATOM   5016 C CG2  . THR B 1 102 ? 97.489  37.484 53.205  1.00 31.74  ? 103  THR B CG2  1 
ATOM   5017 N N    . PRO B 1 103 ? 96.119  40.576 52.172  1.00 23.91  ? 104  PRO B N    1 
ATOM   5018 C CA   . PRO B 1 103 ? 95.685  41.604 53.124  1.00 25.58  ? 104  PRO B CA   1 
ATOM   5019 C C    . PRO B 1 103 ? 95.799  41.122 54.566  1.00 32.70  ? 104  PRO B C    1 
ATOM   5020 O O    . PRO B 1 103 ? 95.747  39.917 54.820  1.00 39.03  ? 104  PRO B O    1 
ATOM   5021 C CB   . PRO B 1 103 ? 94.214  41.824 52.757  1.00 25.21  ? 104  PRO B CB   1 
ATOM   5022 C CG   . PRO B 1 103 ? 94.155  41.485 51.281  1.00 26.89  ? 104  PRO B CG   1 
ATOM   5023 C CD   . PRO B 1 103 ? 95.116  40.322 51.121  1.00 23.74  ? 104  PRO B CD   1 
ATOM   5024 N N    . TYR B 1 104 ? 95.960  42.063 55.493  1.00 29.55  ? 105  TYR B N    1 
ATOM   5025 C CA   . TYR B 1 104 ? 95.997  41.767 56.917  1.00 35.18  ? 105  TYR B CA   1 
ATOM   5026 C C    . TYR B 1 104 ? 94.846  42.520 57.586  1.00 42.52  ? 105  TYR B C    1 
ATOM   5027 O O    . TYR B 1 104 ? 94.716  43.738 57.442  1.00 42.80  ? 105  TYR B O    1 
ATOM   5028 C CB   . TYR B 1 104 ? 97.334  42.215 57.496  1.00 41.50  ? 105  TYR B CB   1 
ATOM   5029 C CG   . TYR B 1 104 ? 97.625  41.775 58.918  1.00 51.81  ? 105  TYR B CG   1 
ATOM   5030 C CD1  . TYR B 1 104 ? 96.886  42.260 59.996  1.00 52.27  ? 105  TYR B CD1  1 
ATOM   5031 C CD2  . TYR B 1 104 ? 98.687  40.910 59.185  1.00 52.72  ? 105  TYR B CD2  1 
ATOM   5032 C CE1  . TYR B 1 104 ? 97.181  41.864 61.298  1.00 53.38  ? 105  TYR B CE1  1 
ATOM   5033 C CE2  . TYR B 1 104 ? 98.989  40.514 60.471  1.00 47.14  ? 105  TYR B CE2  1 
ATOM   5034 C CZ   . TYR B 1 104 ? 98.238  40.989 61.521  1.00 54.65  ? 105  TYR B CZ   1 
ATOM   5035 O OH   . TYR B 1 104 ? 98.555  40.578 62.791  1.00 60.03  ? 105  TYR B OH   1 
ATOM   5036 N N    . PRO B 1 105 ? 93.999  41.792 58.319  1.00 50.23  ? 106  PRO B N    1 
ATOM   5037 C CA   . PRO B 1 105 ? 94.183  40.350 58.500  1.00 53.37  ? 106  PRO B CA   1 
ATOM   5038 C C    . PRO B 1 105 ? 93.709  39.576 57.266  1.00 50.52  ? 106  PRO B C    1 
ATOM   5039 O O    . PRO B 1 105 ? 92.982  40.135 56.434  1.00 46.20  ? 106  PRO B O    1 
ATOM   5040 C CB   . PRO B 1 105 ? 93.285  40.049 59.706  1.00 48.13  ? 106  PRO B CB   1 
ATOM   5041 C CG   . PRO B 1 105 ? 92.161  41.022 59.555  1.00 44.99  ? 106  PRO B CG   1 
ATOM   5042 C CD   . PRO B 1 105 ? 92.769  42.282 58.972  1.00 43.52  ? 106  PRO B CD   1 
ATOM   5043 N N    . ARG B 1 106 ? 94.128  38.316 57.160  1.00 55.58  ? 107  ARG B N    1 
ATOM   5044 C CA   . ARG B 1 106 ? 93.795  37.445 56.027  1.00 56.25  ? 107  ARG B CA   1 
ATOM   5045 C C    . ARG B 1 106 ? 92.324  37.519 55.656  1.00 52.85  ? 107  ARG B C    1 
ATOM   5046 O O    . ARG B 1 106 ? 91.455  37.452 56.523  1.00 62.89  ? 107  ARG B O    1 
ATOM   5047 C CB   . ARG B 1 106 ? 94.179  35.999 56.360  1.00 62.87  ? 107  ARG B CB   1 
ATOM   5048 C CG   . ARG B 1 106 ? 93.841  34.944 55.305  1.00 65.63  ? 107  ARG B CG   1 
ATOM   5049 C CD   . ARG B 1 106 ? 94.265  33.560 55.804  1.00 65.19  ? 107  ARG B CD   1 
ATOM   5050 N NE   . ARG B 1 106 ? 95.567  33.619 56.471  1.00 66.10  ? 107  ARG B NE   1 
ATOM   5051 C CZ   . ARG B 1 106 ? 96.027  32.703 57.319  1.00 69.18  ? 107  ARG B CZ   1 
ATOM   5052 N NH1  . ARG B 1 106 ? 95.296  31.635 57.617  1.00 68.50  ? 107  ARG B NH1  1 
ATOM   5053 N NH2  . ARG B 1 106 ? 97.223  32.860 57.876  1.00 70.08  ? 107  ARG B NH2  1 
ATOM   5054 N N    . PRO B 1 107 ? 92.041  37.659 54.357  1.00 54.58  ? 108  PRO B N    1 
ATOM   5055 C CA   . PRO B 1 107 ? 90.665  37.772 53.866  1.00 62.37  ? 108  PRO B CA   1 
ATOM   5056 C C    . PRO B 1 107 ? 89.879  36.512 54.221  1.00 73.37  ? 108  PRO B C    1 
ATOM   5057 O O    . PRO B 1 107 ? 90.236  35.406 53.804  1.00 75.57  ? 108  PRO B O    1 
ATOM   5058 C CB   . PRO B 1 107 ? 90.835  37.877 52.343  1.00 58.91  ? 108  PRO B CB   1 
ATOM   5059 C CG   . PRO B 1 107 ? 92.284  38.197 52.117  1.00 54.08  ? 108  PRO B CG   1 
ATOM   5060 C CD   . PRO B 1 107 ? 93.022  37.587 53.261  1.00 54.52  ? 108  PRO B CD   1 
ATOM   5061 N N    . THR B 1 108 ? 88.820  36.678 55.001  1.00 77.00  ? 109  THR B N    1 
ATOM   5062 C CA   . THR B 1 108 ? 88.015  35.539 55.419  1.00 75.54  ? 109  THR B CA   1 
ATOM   5063 C C    . THR B 1 108 ? 87.187  34.982 54.269  1.00 73.63  ? 109  THR B C    1 
ATOM   5064 O O    . THR B 1 108 ? 86.691  33.867 54.355  1.00 75.02  ? 109  THR B O    1 
ATOM   5065 C CB   . THR B 1 108 ? 87.097  35.888 56.607  1.00 71.36  ? 109  THR B CB   1 
ATOM   5066 O OG1  . THR B 1 108 ? 86.451  37.150 56.370  1.00 66.59  ? 109  THR B OG1  1 
ATOM   5067 C CG2  . THR B 1 108 ? 87.908  35.957 57.899  1.00 68.60  ? 109  THR B CG2  1 
ATOM   5068 N N    . SER B 1 109 ? 87.052  35.759 53.196  1.00 69.44  ? 110  SER B N    1 
ATOM   5069 C CA   . SER B 1 109 ? 86.294  35.330 52.019  1.00 67.97  ? 110  SER B CA   1 
ATOM   5070 C C    . SER B 1 109 ? 87.134  35.378 50.736  1.00 68.69  ? 110  SER B C    1 
ATOM   5071 O O    . SER B 1 109 ? 88.052  36.194 50.624  1.00 69.09  ? 110  SER B O    1 
ATOM   5072 C CB   . SER B 1 109 ? 85.034  36.178 51.864  1.00 61.29  ? 110  SER B CB   1 
ATOM   5073 O OG   . SER B 1 109 ? 85.318  37.543 52.066  1.00 57.59  ? 110  SER B OG   1 
ATOM   5074 N N    . PRO B 1 110 ? 86.810  34.506 49.761  1.00 64.60  ? 111  PRO B N    1 
ATOM   5075 C CA   . PRO B 1 110 ? 87.567  34.351 48.507  1.00 61.53  ? 111  PRO B CA   1 
ATOM   5076 C C    . PRO B 1 110 ? 87.829  35.685 47.802  1.00 61.92  ? 111  PRO B C    1 
ATOM   5077 O O    . PRO B 1 110 ? 86.918  36.475 47.551  1.00 65.46  ? 111  PRO B O    1 
ATOM   5078 C CB   . PRO B 1 110 ? 86.666  33.452 47.659  1.00 59.13  ? 111  PRO B CB   1 
ATOM   5079 C CG   . PRO B 1 110 ? 85.864  32.678 48.666  1.00 58.78  ? 111  PRO B CG   1 
ATOM   5080 C CD   . PRO B 1 110 ? 85.622  33.636 49.798  1.00 60.96  ? 111  PRO B CD   1 
ATOM   5081 N N    . THR B 1 111 ? 89.099  35.919 47.502  1.00 58.33  ? 112  THR B N    1 
ATOM   5082 C CA   . THR B 1 111 ? 89.572  37.180 46.957  1.00 52.41  ? 112  THR B CA   1 
ATOM   5083 C C    . THR B 1 111 ? 90.239  36.884 45.610  1.00 46.05  ? 112  THR B C    1 
ATOM   5084 O O    . THR B 1 111 ? 90.934  35.876 45.480  1.00 43.00  ? 112  THR B O    1 
ATOM   5085 C CB   . THR B 1 111 ? 90.604  37.803 47.925  1.00 52.16  ? 112  THR B CB   1 
ATOM   5086 O OG1  . THR B 1 111 ? 89.952  38.204 49.138  1.00 57.94  ? 112  THR B OG1  1 
ATOM   5087 C CG2  . THR B 1 111 ? 91.308  38.997 47.305  1.00 50.88  ? 112  THR B CG2  1 
ATOM   5088 N N    . PRO B 1 112 ? 90.026  37.754 44.604  1.00 42.20  ? 113  PRO B N    1 
ATOM   5089 C CA   . PRO B 1 112 ? 90.707  37.623 43.303  1.00 34.03  ? 113  PRO B CA   1 
ATOM   5090 C C    . PRO B 1 112 ? 92.215  37.500 43.480  1.00 28.54  ? 113  PRO B C    1 
ATOM   5091 O O    . PRO B 1 112 ? 92.789  38.135 44.371  1.00 29.77  ? 113  PRO B O    1 
ATOM   5092 C CB   . PRO B 1 112 ? 90.395  38.952 42.606  1.00 36.42  ? 113  PRO B CB   1 
ATOM   5093 C CG   . PRO B 1 112 ? 90.033  39.907 43.735  1.00 40.75  ? 113  PRO B CG   1 
ATOM   5094 C CD   . PRO B 1 112 ? 89.288  39.025 44.707  1.00 40.86  ? 113  PRO B CD   1 
ATOM   5095 N N    . VAL B 1 113 ? 92.845  36.686 42.641  1.00 26.22  ? 114  VAL B N    1 
ATOM   5096 C CA   . VAL B 1 113 ? 94.277  36.439 42.734  1.00 25.16  ? 114  VAL B CA   1 
ATOM   5097 C C    . VAL B 1 113 ? 95.016  36.957 41.494  1.00 24.06  ? 114  VAL B C    1 
ATOM   5098 O O    . VAL B 1 113 ? 94.662  36.608 40.364  1.00 24.18  ? 114  VAL B O    1 
ATOM   5099 C CB   . VAL B 1 113 ? 94.551  34.926 42.881  1.00 24.56  ? 114  VAL B CB   1 
ATOM   5100 C CG1  . VAL B 1 113 ? 96.043  34.661 43.023  1.00 18.92  ? 114  VAL B CG1  1 
ATOM   5101 C CG2  . VAL B 1 113 ? 93.774  34.357 44.065  1.00 23.54  ? 114  VAL B CG2  1 
ATOM   5102 N N    . LEU B 1 114 ? 96.044  37.780 41.707  1.00 23.78  ? 115  LEU B N    1 
ATOM   5103 C CA   . LEU B 1 114 ? 96.941  38.191 40.633  1.00 21.81  ? 115  LEU B CA   1 
ATOM   5104 C C    . LEU B 1 114 ? 98.252  37.413 40.714  1.00 26.84  ? 115  LEU B C    1 
ATOM   5105 O O    . LEU B 1 114 ? 98.895  37.356 41.768  1.00 27.06  ? 115  LEU B O    1 
ATOM   5106 C CB   . LEU B 1 114 ? 97.232  39.685 40.721  1.00 26.79  ? 115  LEU B CB   1 
ATOM   5107 C CG   . LEU B 1 114 ? 96.125  40.596 40.203  1.00 30.07  ? 115  LEU B CG   1 
ATOM   5108 C CD1  . LEU B 1 114 ? 96.085  41.885 40.987  1.00 31.18  ? 115  LEU B CD1  1 
ATOM   5109 C CD2  . LEU B 1 114 ? 96.372  40.887 38.734  1.00 36.01  ? 115  LEU B CD2  1 
ATOM   5110 N N    . VAL B 1 115 ? 98.652  36.814 39.602  1.00 16.15  ? 116  VAL B N    1 
ATOM   5111 C CA   . VAL B 1 115 ? 99.911  36.076 39.552  1.00 16.12  ? 116  VAL B CA   1 
ATOM   5112 C C    . VAL B 1 115 ? 100.834 36.791 38.592  1.00 19.24  ? 116  VAL B C    1 
ATOM   5113 O O    . VAL B 1 115 ? 100.512 36.969 37.408  1.00 25.17  ? 116  VAL B O    1 
ATOM   5114 C CB   . VAL B 1 115 ? 99.711  34.614 39.074  1.00 22.53  ? 116  VAL B CB   1 
ATOM   5115 C CG1  . VAL B 1 115 ? 101.045 33.844 39.068  1.00 15.48  ? 116  VAL B CG1  1 
ATOM   5116 C CG2  . VAL B 1 115 ? 98.692  33.905 39.950  1.00 16.58  ? 116  VAL B CG2  1 
ATOM   5117 N N    . TRP B 1 116 ? 101.980 37.207 39.110  1.00 18.14  ? 117  TRP B N    1 
ATOM   5118 C CA   . TRP B 1 116 ? 102.948 37.978 38.347  1.00 14.56  ? 117  TRP B CA   1 
ATOM   5119 C C    . TRP B 1 116 ? 104.059 37.071 37.805  1.00 21.58  ? 117  TRP B C    1 
ATOM   5120 O O    . TRP B 1 116 ? 104.594 36.225 38.529  1.00 19.06  ? 117  TRP B O    1 
ATOM   5121 C CB   . TRP B 1 116 ? 103.533 39.068 39.242  1.00 16.71  ? 117  TRP B CB   1 
ATOM   5122 C CG   . TRP B 1 116 ? 104.713 39.781 38.659  1.00 20.24  ? 117  TRP B CG   1 
ATOM   5123 C CD1  . TRP B 1 116 ? 106.006 39.687 39.066  1.00 19.02  ? 117  TRP B CD1  1 
ATOM   5124 C CD2  . TRP B 1 116 ? 104.700 40.709 37.570  1.00 20.76  ? 117  TRP B CD2  1 
ATOM   5125 N NE1  . TRP B 1 116 ? 106.806 40.505 38.309  1.00 19.65  ? 117  TRP B NE1  1 
ATOM   5126 C CE2  . TRP B 1 116 ? 106.032 41.136 37.373  1.00 21.10  ? 117  TRP B CE2  1 
ATOM   5127 C CE3  . TRP B 1 116 ? 103.696 41.216 36.743  1.00 23.17  ? 117  TRP B CE3  1 
ATOM   5128 C CZ2  . TRP B 1 116 ? 106.384 42.048 36.384  1.00 17.08  ? 117  TRP B CZ2  1 
ATOM   5129 C CZ3  . TRP B 1 116 ? 104.046 42.124 35.753  1.00 26.83  ? 117  TRP B CZ3  1 
ATOM   5130 C CH2  . TRP B 1 116 ? 105.379 42.531 35.583  1.00 24.20  ? 117  TRP B CH2  1 
ATOM   5131 N N    . ILE B 1 117 ? 104.375 37.231 36.523  1.00 20.17  ? 118  ILE B N    1 
ATOM   5132 C CA   . ILE B 1 117 ? 105.472 36.509 35.892  1.00 19.64  ? 118  ILE B CA   1 
ATOM   5133 C C    . ILE B 1 117 ? 106.457 37.543 35.355  1.00 19.76  ? 118  ILE B C    1 
ATOM   5134 O O    . ILE B 1 117 ? 106.164 38.212 34.368  1.00 26.36  ? 118  ILE B O    1 
ATOM   5135 C CB   . ILE B 1 117 ? 104.989 35.661 34.705  1.00 17.81  ? 118  ILE B CB   1 
ATOM   5136 C CG1  . ILE B 1 117 ? 103.919 34.662 35.135  1.00 20.00  ? 118  ILE B CG1  1 
ATOM   5137 C CG2  . ILE B 1 117 ? 106.163 34.927 34.065  1.00 14.55  ? 118  ILE B CG2  1 
ATOM   5138 C CD1  . ILE B 1 117 ? 103.385 33.802 33.972  1.00 13.95  ? 118  ILE B CD1  1 
ATOM   5139 N N    . TYR B 1 118 ? 107.612 37.687 36.002  1.00 17.15  ? 119  TYR B N    1 
ATOM   5140 C CA   . TYR B 1 118 ? 108.586 38.699 35.579  1.00 18.89  ? 119  TYR B CA   1 
ATOM   5141 C C    . TYR B 1 118 ? 109.155 38.422 34.188  1.00 19.23  ? 119  TYR B C    1 
ATOM   5142 O O    . TYR B 1 118 ? 109.184 37.272 33.727  1.00 13.35  ? 119  TYR B O    1 
ATOM   5143 C CB   . TYR B 1 118 ? 109.754 38.818 36.573  1.00 17.87  ? 119  TYR B CB   1 
ATOM   5144 C CG   . TYR B 1 118 ? 110.521 37.514 36.809  1.00 14.71  ? 119  TYR B CG   1 
ATOM   5145 C CD1  . TYR B 1 118 ? 111.396 36.995 35.843  1.00 18.23  ? 119  TYR B CD1  1 
ATOM   5146 C CD2  . TYR B 1 118 ? 110.389 36.830 38.003  1.00 14.10  ? 119  TYR B CD2  1 
ATOM   5147 C CE1  . TYR B 1 118 ? 112.094 35.794 36.066  1.00 17.58  ? 119  TYR B CE1  1 
ATOM   5148 C CE2  . TYR B 1 118 ? 111.085 35.651 38.240  1.00 19.30  ? 119  TYR B CE2  1 
ATOM   5149 C CZ   . TYR B 1 118 ? 111.930 35.135 37.279  1.00 16.68  ? 119  TYR B CZ   1 
ATOM   5150 O OH   . TYR B 1 118 ? 112.603 33.954 37.543  1.00 20.79  ? 119  TYR B OH   1 
ATOM   5151 N N    . GLY B 1 119 ? 109.631 39.491 33.551  1.00 17.52  ? 120  GLY B N    1 
ATOM   5152 C CA   . GLY B 1 119 ? 110.314 39.432 32.271  1.00 13.76  ? 120  GLY B CA   1 
ATOM   5153 C C    . GLY B 1 119 ? 111.815 39.465 32.507  1.00 13.97  ? 120  GLY B C    1 
ATOM   5154 O O    . GLY B 1 119 ? 112.269 39.387 33.656  1.00 23.43  ? 120  GLY B O    1 
ATOM   5155 N N    . GLY B 1 120 ? 112.585 39.574 31.428  1.00 19.17  ? 121  GLY B N    1 
ATOM   5156 C CA   . GLY B 1 120 ? 114.033 39.470 31.489  1.00 14.46  ? 121  GLY B CA   1 
ATOM   5157 C C    . GLY B 1 120 ? 114.581 38.603 30.365  1.00 20.34  ? 121  GLY B C    1 
ATOM   5158 O O    . GLY B 1 120 ? 115.599 37.906 30.526  1.00 23.11  ? 121  GLY B O    1 
ATOM   5159 N N    . GLY B 1 121 ? 113.890 38.640 29.227  1.00 16.35  ? 122  GLY B N    1 
ATOM   5160 C CA   . GLY B 1 121 ? 114.348 38.002 28.003  1.00 20.05  ? 122  GLY B CA   1 
ATOM   5161 C C    . GLY B 1 121 ? 114.515 36.493 28.106  1.00 21.55  ? 122  GLY B C    1 
ATOM   5162 O O    . GLY B 1 121 ? 115.195 35.891 27.269  1.00 20.22  ? 122  GLY B O    1 
ATOM   5163 N N    . PHE B 1 122 ? 113.884 35.884 29.115  1.00 19.12  ? 123  PHE B N    1 
ATOM   5164 C CA   . PHE B 1 122 ? 114.061 34.459 29.418  1.00 17.63  ? 123  PHE B CA   1 
ATOM   5165 C C    . PHE B 1 122 ? 115.503 34.139 29.814  1.00 17.64  ? 123  PHE B C    1 
ATOM   5166 O O    . PHE B 1 122 ? 115.853 32.972 29.931  1.00 21.11  ? 123  PHE B O    1 
ATOM   5167 C CB   . PHE B 1 122 ? 113.664 33.560 28.229  1.00 15.57  ? 123  PHE B CB   1 
ATOM   5168 C CG   . PHE B 1 122 ? 112.205 33.637 27.857  1.00 18.56  ? 123  PHE B CG   1 
ATOM   5169 C CD1  . PHE B 1 122 ? 111.231 33.117 28.697  1.00 16.52  ? 123  PHE B CD1  1 
ATOM   5170 C CD2  . PHE B 1 122 ? 111.813 34.222 26.658  1.00 13.94  ? 123  PHE B CD2  1 
ATOM   5171 C CE1  . PHE B 1 122 ? 109.878 33.186 28.347  1.00 21.96  ? 123  PHE B CE1  1 
ATOM   5172 C CE2  . PHE B 1 122 ? 110.478 34.290 26.306  1.00 16.08  ? 123  PHE B CE2  1 
ATOM   5173 C CZ   . PHE B 1 122 ? 109.506 33.771 27.157  1.00 18.48  ? 123  PHE B CZ   1 
ATOM   5174 N N    . TYR B 1 123 ? 116.338 35.161 30.014  1.00 16.68  ? 124  TYR B N    1 
ATOM   5175 C CA   . TYR B 1 123 ? 117.716 34.910 30.475  1.00 23.71  ? 124  TYR B CA   1 
ATOM   5176 C C    . TYR B 1 123 ? 118.026 35.514 31.847  1.00 21.64  ? 124  TYR B C    1 
ATOM   5177 O O    . TYR B 1 123 ? 119.116 35.318 32.384  1.00 29.01  ? 124  TYR B O    1 
ATOM   5178 C CB   . TYR B 1 123 ? 118.738 35.419 29.469  1.00 15.34  ? 124  TYR B CB   1 
ATOM   5179 C CG   . TYR B 1 123 ? 118.823 36.924 29.415  1.00 19.55  ? 124  TYR B CG   1 
ATOM   5180 C CD1  . TYR B 1 123 ? 119.610 37.631 30.316  1.00 18.87  ? 124  TYR B CD1  1 
ATOM   5181 C CD2  . TYR B 1 123 ? 118.120 37.642 28.457  1.00 22.10  ? 124  TYR B CD2  1 
ATOM   5182 C CE1  . TYR B 1 123 ? 119.690 39.009 30.265  1.00 21.79  ? 124  TYR B CE1  1 
ATOM   5183 C CE2  . TYR B 1 123 ? 118.200 39.019 28.393  1.00 25.54  ? 124  TYR B CE2  1 
ATOM   5184 C CZ   . TYR B 1 123 ? 118.985 39.695 29.303  1.00 30.20  ? 124  TYR B CZ   1 
ATOM   5185 O OH   . TYR B 1 123 ? 119.061 41.065 29.244  1.00 36.43  ? 124  TYR B OH   1 
ATOM   5186 N N    . SER B 1 124 ? 117.071 36.256 32.394  1.00 24.21  ? 125  SER B N    1 
ATOM   5187 C CA   . SER B 1 124 ? 117.260 36.927 33.669  1.00 24.97  ? 125  SER B CA   1 
ATOM   5188 C C    . SER B 1 124 ? 115.927 37.237 34.329  1.00 25.79  ? 125  SER B C    1 
ATOM   5189 O O    . SER B 1 124 ? 114.870 36.968 33.762  1.00 23.36  ? 125  SER B O    1 
ATOM   5190 C CB   . SER B 1 124 ? 118.013 38.233 33.446  1.00 25.28  ? 125  SER B CB   1 
ATOM   5191 O OG   . SER B 1 124 ? 117.221 39.156 32.720  1.00 22.81  ? 125  SER B OG   1 
ATOM   5192 N N    . GLY B 1 125 ? 115.988 37.844 35.513  1.00 25.84  ? 126  GLY B N    1 
ATOM   5193 C CA   . GLY B 1 125 ? 114.796 38.242 36.228  1.00 14.79  ? 126  GLY B CA   1 
ATOM   5194 C C    . GLY B 1 125 ? 114.725 37.577 37.590  1.00 20.69  ? 126  GLY B C    1 
ATOM   5195 O O    . GLY B 1 125 ? 115.414 36.592 37.848  1.00 18.18  ? 126  GLY B O    1 
ATOM   5196 N N    . ALA B 1 126 ? 113.892 38.118 38.472  1.00 15.80  ? 127  ALA B N    1 
ATOM   5197 C CA   . ALA B 1 126 ? 113.703 37.537 39.796  1.00 20.38  ? 127  ALA B CA   1 
ATOM   5198 C C    . ALA B 1 126 ? 112.458 38.136 40.395  1.00 21.97  ? 127  ALA B C    1 
ATOM   5199 O O    . ALA B 1 126 ? 112.120 39.287 40.107  1.00 21.88  ? 127  ALA B O    1 
ATOM   5200 C CB   . ALA B 1 126 ? 114.918 37.807 40.701  1.00 16.54  ? 127  ALA B CB   1 
ATOM   5201 N N    . SER B 1 127 ? 111.767 37.355 41.217  1.00 21.70  ? 128  SER B N    1 
ATOM   5202 C CA   . SER B 1 127 ? 110.552 37.846 41.851  1.00 24.98  ? 128  SER B CA   1 
ATOM   5203 C C    . SER B 1 127 ? 110.867 38.763 43.042  1.00 27.09  ? 128  SER B C    1 
ATOM   5204 O O    . SER B 1 127 ? 109.972 39.398 43.586  1.00 25.11  ? 128  SER B O    1 
ATOM   5205 C CB   . SER B 1 127 ? 109.643 36.680 42.269  1.00 26.35  ? 128  SER B CB   1 
ATOM   5206 O OG   . SER B 1 127 ? 110.262 35.865 43.243  1.00 25.83  ? 128  SER B OG   1 
ATOM   5207 N N    . SER B 1 128 ? 112.138 38.854 43.427  1.00 16.73  ? 129  SER B N    1 
ATOM   5208 C CA   . SER B 1 128 ? 112.500 39.607 44.634  1.00 23.52  ? 129  SER B CA   1 
ATOM   5209 C C    . SER B 1 128 ? 112.924 41.051 44.371  1.00 23.89  ? 129  SER B C    1 
ATOM   5210 O O    . SER B 1 128 ? 113.229 41.782 45.316  1.00 23.47  ? 129  SER B O    1 
ATOM   5211 C CB   . SER B 1 128 ? 113.623 38.906 45.385  1.00 22.29  ? 129  SER B CB   1 
ATOM   5212 O OG   . SER B 1 128 ? 114.717 38.666 44.525  1.00 18.08  ? 129  SER B OG   1 
ATOM   5213 N N    . LEU B 1 129 ? 112.952 41.458 43.102  1.00 19.42  ? 130  LEU B N    1 
ATOM   5214 C CA   . LEU B 1 129 ? 113.313 42.836 42.763  1.00 26.29  ? 130  LEU B CA   1 
ATOM   5215 C C    . LEU B 1 129 ? 112.373 43.817 43.455  1.00 25.94  ? 130  LEU B C    1 
ATOM   5216 O O    . LEU B 1 129 ? 111.158 43.575 43.542  1.00 28.19  ? 130  LEU B O    1 
ATOM   5217 C CB   . LEU B 1 129 ? 113.298 43.060 41.244  1.00 22.55  ? 130  LEU B CB   1 
ATOM   5218 C CG   . LEU B 1 129 ? 114.157 42.067 40.457  1.00 26.19  ? 130  LEU B CG   1 
ATOM   5219 C CD1  . LEU B 1 129 ? 114.183 42.400 38.974  1.00 17.96  ? 130  LEU B CD1  1 
ATOM   5220 C CD2  . LEU B 1 129 ? 115.576 41.999 41.015  1.00 23.65  ? 130  LEU B CD2  1 
ATOM   5221 N N    . ASP B 1 130 ? 112.955 44.899 43.966  1.00 24.70  ? 131  ASP B N    1 
ATOM   5222 C CA   . ASP B 1 130 ? 112.215 45.984 44.604  1.00 31.14  ? 131  ASP B CA   1 
ATOM   5223 C C    . ASP B 1 130 ? 111.019 46.412 43.782  1.00 29.74  ? 131  ASP B C    1 
ATOM   5224 O O    . ASP B 1 130 ? 109.914 46.542 44.294  1.00 31.62  ? 131  ASP B O    1 
ATOM   5225 C CB   . ASP B 1 130 ? 113.124 47.194 44.784  1.00 29.78  ? 131  ASP B CB   1 
ATOM   5226 C CG   . ASP B 1 130 ? 114.209 46.953 45.797  1.00 41.54  ? 131  ASP B CG   1 
ATOM   5227 O OD1  . ASP B 1 130 ? 114.175 45.887 46.444  1.00 41.87  ? 131  ASP B OD1  1 
ATOM   5228 O OD2  . ASP B 1 130 ? 115.084 47.837 45.952  1.00 53.24  ? 131  ASP B OD2  1 
ATOM   5229 N N    . VAL B 1 131 ? 111.256 46.604 42.492  1.00 21.86  ? 132  VAL B N    1 
ATOM   5230 C CA   . VAL B 1 131 ? 110.216 47.058 41.587  1.00 26.11  ? 132  VAL B CA   1 
ATOM   5231 C C    . VAL B 1 131 ? 108.995 46.114 41.527  1.00 27.85  ? 132  VAL B C    1 
ATOM   5232 O O    . VAL B 1 131 ? 107.926 46.521 41.086  1.00 25.70  ? 132  VAL B O    1 
ATOM   5233 C CB   . VAL B 1 131 ? 110.809 47.362 40.180  1.00 34.76  ? 132  VAL B CB   1 
ATOM   5234 C CG1  . VAL B 1 131 ? 111.424 46.115 39.574  1.00 33.61  ? 132  VAL B CG1  1 
ATOM   5235 C CG2  . VAL B 1 131 ? 109.766 47.952 39.274  1.00 37.98  ? 132  VAL B CG2  1 
ATOM   5236 N N    . TYR B 1 132 ? 109.132 44.876 42.004  1.00 26.38  ? 133  TYR B N    1 
ATOM   5237 C CA   . TYR B 1 132 ? 107.987 43.958 42.029  1.00 29.05  ? 133  TYR B CA   1 
ATOM   5238 C C    . TYR B 1 132 ? 107.407 43.733 43.419  1.00 27.65  ? 133  TYR B C    1 
ATOM   5239 O O    . TYR B 1 132 ? 106.699 42.752 43.637  1.00 32.35  ? 133  TYR B O    1 
ATOM   5240 C CB   . TYR B 1 132 ? 108.328 42.589 41.442  1.00 15.94  ? 133  TYR B CB   1 
ATOM   5241 C CG   . TYR B 1 132 ? 108.973 42.605 40.078  1.00 21.40  ? 133  TYR B CG   1 
ATOM   5242 C CD1  . TYR B 1 132 ? 108.641 43.557 39.125  1.00 19.66  ? 133  TYR B CD1  1 
ATOM   5243 C CD2  . TYR B 1 132 ? 109.930 41.653 39.751  1.00 17.94  ? 133  TYR B CD2  1 
ATOM   5244 C CE1  . TYR B 1 132 ? 109.261 43.546 37.861  1.00 21.93  ? 133  TYR B CE1  1 
ATOM   5245 C CE2  . TYR B 1 132 ? 110.536 41.631 38.527  1.00 23.37  ? 133  TYR B CE2  1 
ATOM   5246 C CZ   . TYR B 1 132 ? 110.204 42.574 37.582  1.00 22.30  ? 133  TYR B CZ   1 
ATOM   5247 O OH   . TYR B 1 132 ? 110.847 42.535 36.369  1.00 17.86  ? 133  TYR B OH   1 
ATOM   5248 N N    . ASP B 1 133 ? 107.707 44.627 44.353  1.00 24.39  ? 134  ASP B N    1 
ATOM   5249 C CA   . ASP B 1 133 ? 107.190 44.501 45.716  1.00 22.09  ? 134  ASP B CA   1 
ATOM   5250 C C    . ASP B 1 133 ? 105.657 44.555 45.695  1.00 25.59  ? 134  ASP B C    1 
ATOM   5251 O O    . ASP B 1 133 ? 105.066 45.561 45.309  1.00 27.25  ? 134  ASP B O    1 
ATOM   5252 C CB   . ASP B 1 133 ? 107.751 45.634 46.573  1.00 27.03  ? 134  ASP B CB   1 
ATOM   5253 C CG   . ASP B 1 133 ? 107.452 45.461 48.056  1.00 36.54  ? 134  ASP B CG   1 
ATOM   5254 O OD1  . ASP B 1 133 ? 106.785 44.475 48.443  1.00 44.13  ? 134  ASP B OD1  1 
ATOM   5255 O OD2  . ASP B 1 133 ? 107.878 46.336 48.837  1.00 38.78  ? 134  ASP B OD2  1 
ATOM   5256 N N    . GLY B 1 134 ? 105.012 43.471 46.118  1.00 28.98  ? 135  GLY B N    1 
ATOM   5257 C CA   . GLY B 1 134 ? 103.576 43.352 45.968  1.00 20.80  ? 135  GLY B CA   1 
ATOM   5258 C C    . GLY B 1 134 ? 102.757 44.059 47.034  1.00 28.46  ? 135  GLY B C    1 
ATOM   5259 O O    . GLY B 1 134 ? 101.522 44.091 46.943  1.00 28.87  ? 135  GLY B O    1 
ATOM   5260 N N    . ARG B 1 135 ? 103.420 44.636 48.033  1.00 20.95  ? 136  ARG B N    1 
ATOM   5261 C CA   . ARG B 1 135 ? 102.702 45.119 49.211  1.00 26.78  ? 136  ARG B CA   1 
ATOM   5262 C C    . ARG B 1 135 ? 101.689 46.236 48.941  1.00 26.63  ? 136  ARG B C    1 
ATOM   5263 O O    . ARG B 1 135 ? 100.669 46.327 49.622  1.00 30.01  ? 136  ARG B O    1 
ATOM   5264 C CB   . ARG B 1 135 ? 103.683 45.556 50.305  1.00 28.13  ? 136  ARG B CB   1 
ATOM   5265 C CG   . ARG B 1 135 ? 104.306 46.911 50.067  1.00 29.07  ? 136  ARG B CG   1 
ATOM   5266 C CD   . ARG B 1 135 ? 105.288 47.242 51.174  1.00 35.11  ? 136  ARG B CD   1 
ATOM   5267 N NE   . ARG B 1 135 ? 106.479 46.401 51.128  1.00 28.21  ? 136  ARG B NE   1 
ATOM   5268 C CZ   . ARG B 1 135 ? 107.355 46.279 52.123  1.00 36.58  ? 136  ARG B CZ   1 
ATOM   5269 N NH1  . ARG B 1 135 ? 107.172 46.930 53.275  1.00 27.67  ? 136  ARG B NH1  1 
ATOM   5270 N NH2  . ARG B 1 135 ? 108.407 45.485 51.972  1.00 35.08  ? 136  ARG B NH2  1 
ATOM   5271 N N    . PHE B 1 136 ? 101.953 47.081 47.956  1.00 22.23  ? 137  PHE B N    1 
ATOM   5272 C CA   . PHE B 1 136 ? 101.108 48.261 47.770  1.00 21.47  ? 137  PHE B CA   1 
ATOM   5273 C C    . PHE B 1 136 ? 99.834  47.909 47.045  1.00 28.13  ? 137  PHE B C    1 
ATOM   5274 O O    . PHE B 1 136 ? 98.764  48.440 47.369  1.00 29.89  ? 137  PHE B O    1 
ATOM   5275 C CB   . PHE B 1 136 ? 101.854 49.355 47.011  1.00 24.18  ? 137  PHE B CB   1 
ATOM   5276 C CG   . PHE B 1 136 ? 103.152 49.735 47.641  1.00 26.98  ? 137  PHE B CG   1 
ATOM   5277 C CD1  . PHE B 1 136 ? 103.175 50.479 48.807  1.00 29.93  ? 137  PHE B CD1  1 
ATOM   5278 C CD2  . PHE B 1 136 ? 104.354 49.323 47.085  1.00 23.03  ? 137  PHE B CD2  1 
ATOM   5279 C CE1  . PHE B 1 136 ? 104.384 50.822 49.409  1.00 30.83  ? 137  PHE B CE1  1 
ATOM   5280 C CE2  . PHE B 1 136 ? 105.562 49.663 47.689  1.00 27.92  ? 137  PHE B CE2  1 
ATOM   5281 C CZ   . PHE B 1 136 ? 105.571 50.408 48.847  1.00 28.17  ? 137  PHE B CZ   1 
ATOM   5282 N N    . LEU B 1 137 ? 99.967  47.026 46.054  1.00 27.81  ? 138  LEU B N    1 
ATOM   5283 C CA   . LEU B 1 137 ? 98.838  46.528 45.272  1.00 29.57  ? 138  LEU B CA   1 
ATOM   5284 C C    . LEU B 1 137 ? 97.865  45.822 46.192  1.00 30.47  ? 138  LEU B C    1 
ATOM   5285 O O    . LEU B 1 137 ? 96.651  46.022 46.116  1.00 28.88  ? 138  LEU B O    1 
ATOM   5286 C CB   . LEU B 1 137 ? 99.324  45.527 44.217  1.00 29.90  ? 138  LEU B CB   1 
ATOM   5287 C CG   . LEU B 1 137 ? 99.113  45.949 42.772  1.00 34.60  ? 138  LEU B CG   1 
ATOM   5288 C CD1  . LEU B 1 137 ? 99.635  44.872 41.816  1.00 30.95  ? 138  LEU B CD1  1 
ATOM   5289 C CD2  . LEU B 1 137 ? 97.636  46.258 42.540  1.00 18.65  ? 138  LEU B CD2  1 
ATOM   5290 N N    . VAL B 1 138 ? 98.410  44.985 47.067  1.00 20.10  ? 139  VAL B N    1 
ATOM   5291 C CA   . VAL B 1 138 ? 97.582  44.161 47.926  1.00 26.35  ? 139  VAL B CA   1 
ATOM   5292 C C    . VAL B 1 138 ? 96.849  45.020 48.949  1.00 29.08  ? 139  VAL B C    1 
ATOM   5293 O O    . VAL B 1 138 ? 95.679  44.792 49.221  1.00 30.54  ? 139  VAL B O    1 
ATOM   5294 C CB   . VAL B 1 138 ? 98.407  43.053 48.602  1.00 30.85  ? 139  VAL B CB   1 
ATOM   5295 C CG1  . VAL B 1 138 ? 97.598  42.359 49.670  1.00 26.89  ? 139  VAL B CG1  1 
ATOM   5296 C CG2  . VAL B 1 138 ? 98.861  42.050 47.557  1.00 19.74  ? 139  VAL B CG2  1 
ATOM   5297 N N    . GLN B 1 139 ? 97.524  46.028 49.495  1.00 28.55  ? 140  GLN B N    1 
ATOM   5298 C CA   . GLN B 1 139 ? 96.886  46.896 50.479  1.00 29.36  ? 140  GLN B CA   1 
ATOM   5299 C C    . GLN B 1 139 ? 95.792  47.737 49.826  1.00 34.76  ? 140  GLN B C    1 
ATOM   5300 O O    . GLN B 1 139 ? 94.666  47.800 50.321  1.00 39.45  ? 140  GLN B O    1 
ATOM   5301 C CB   . GLN B 1 139 ? 97.915  47.814 51.154  1.00 30.29  ? 140  GLN B CB   1 
ATOM   5302 C CG   . GLN B 1 139 ? 97.391  48.590 52.367  1.00 28.10  ? 140  GLN B CG   1 
ATOM   5303 C CD   . GLN B 1 139 ? 96.418  49.695 51.992  1.00 32.14  ? 140  GLN B CD   1 
ATOM   5304 O OE1  . GLN B 1 139 ? 96.547  50.310 50.933  1.00 34.42  ? 140  GLN B OE1  1 
ATOM   5305 N NE2  . GLN B 1 139 ? 95.418  49.938 52.853  1.00 33.18  ? 140  GLN B NE2  1 
ATOM   5306 N N    . ALA B 1 140 ? 96.141  48.404 48.731  1.00 31.87  ? 141  ALA B N    1 
ATOM   5307 C CA   . ALA B 1 140 ? 95.224  49.328 48.072  1.00 34.48  ? 141  ALA B CA   1 
ATOM   5308 C C    . ALA B 1 140 ? 94.039  48.615 47.410  1.00 36.06  ? 141  ALA B C    1 
ATOM   5309 O O    . ALA B 1 140 ? 92.913  49.104 47.465  1.00 30.31  ? 141  ALA B O    1 
ATOM   5310 C CB   . ALA B 1 140 ? 95.973  50.180 47.044  1.00 31.27  ? 141  ALA B CB   1 
ATOM   5311 N N    . GLU B 1 141 ? 94.291  47.472 46.773  1.00 25.35  ? 142  GLU B N    1 
ATOM   5312 C CA   . GLU B 1 141 ? 93.246  46.840 45.979  1.00 25.07  ? 142  GLU B CA   1 
ATOM   5313 C C    . GLU B 1 141 ? 92.713  45.528 46.546  1.00 31.47  ? 142  GLU B C    1 
ATOM   5314 O O    . GLU B 1 141 ? 91.842  44.905 45.947  1.00 35.08  ? 142  GLU B O    1 
ATOM   5315 C CB   . GLU B 1 141 ? 93.690  46.681 44.515  1.00 21.63  ? 142  GLU B CB   1 
ATOM   5316 C CG   . GLU B 1 141 ? 93.788  48.030 43.770  1.00 26.02  ? 142  GLU B CG   1 
ATOM   5317 C CD   . GLU B 1 141 ? 92.486  48.843 43.834  1.00 30.21  ? 142  GLU B CD   1 
ATOM   5318 O OE1  . GLU B 1 141 ? 91.387  48.238 43.837  1.00 34.38  ? 142  GLU B OE1  1 
ATOM   5319 O OE2  . GLU B 1 141 ? 92.555  50.090 43.880  1.00 35.71  ? 142  GLU B OE2  1 
ATOM   5320 N N    . ARG B 1 142 ? 93.233  45.136 47.705  1.00 30.81  ? 143  ARG B N    1 
ATOM   5321 C CA   . ARG B 1 142 ? 92.756  43.965 48.446  1.00 29.35  ? 143  ARG B CA   1 
ATOM   5322 C C    . ARG B 1 142 ? 92.593  42.708 47.610  1.00 30.94  ? 143  ARG B C    1 
ATOM   5323 O O    . ARG B 1 142 ? 91.579  42.024 47.673  1.00 31.92  ? 143  ARG B O    1 
ATOM   5324 C CB   . ARG B 1 142 ? 91.491  44.294 49.238  1.00 27.16  ? 143  ARG B CB   1 
ATOM   5325 C CG   . ARG B 1 142 ? 91.780  45.370 50.282  1.00 31.96  ? 143  ARG B CG   1 
ATOM   5326 C CD   . ARG B 1 142 ? 90.583  45.745 51.135  1.00 39.99  ? 143  ARG B CD   1 
ATOM   5327 N NE   . ARG B 1 142 ? 90.073  44.634 51.944  1.00 48.55  ? 143  ARG B NE   1 
ATOM   5328 C CZ   . ARG B 1 142 ? 90.666  44.161 53.037  1.00 43.03  ? 143  ARG B CZ   1 
ATOM   5329 N NH1  . ARG B 1 142 ? 91.818  44.671 53.449  1.00 40.04  ? 143  ARG B NH1  1 
ATOM   5330 N NH2  . ARG B 1 142 ? 90.114  43.161 53.706  1.00 40.83  ? 143  ARG B NH2  1 
ATOM   5331 N N    . THR B 1 143 ? 93.611  42.419 46.817  1.00 36.01  ? 144  THR B N    1 
ATOM   5332 C CA   . THR B 1 143 ? 93.693  41.155 46.113  1.00 38.72  ? 144  THR B CA   1 
ATOM   5333 C C    . THR B 1 143 ? 94.768  40.326 46.798  1.00 30.67  ? 144  THR B C    1 
ATOM   5334 O O    . THR B 1 143 ? 95.539  40.840 47.607  1.00 29.83  ? 144  THR B O    1 
ATOM   5335 C CB   . THR B 1 143 ? 94.100  41.352 44.641  1.00 40.27  ? 144  THR B CB   1 
ATOM   5336 O OG1  . THR B 1 143 ? 95.294  42.144 44.590  1.00 44.42  ? 144  THR B OG1  1 
ATOM   5337 C CG2  . THR B 1 143 ? 93.001  42.062 43.874  1.00 38.59  ? 144  THR B CG2  1 
ATOM   5338 N N    . VAL B 1 144 ? 94.810  39.042 46.474  1.00 23.75  ? 145  VAL B N    1 
ATOM   5339 C CA   . VAL B 1 144 ? 95.963  38.226 46.787  1.00 23.57  ? 145  VAL B CA   1 
ATOM   5340 C C    . VAL B 1 144 ? 96.922  38.342 45.601  1.00 25.32  ? 145  VAL B C    1 
ATOM   5341 O O    . VAL B 1 144 ? 96.484  38.385 44.443  1.00 28.98  ? 145  VAL B O    1 
ATOM   5342 C CB   . VAL B 1 144 ? 95.552  36.777 47.026  1.00 26.70  ? 145  VAL B CB   1 
ATOM   5343 C CG1  . VAL B 1 144 ? 96.791  35.897 47.186  1.00 28.40  ? 145  VAL B CG1  1 
ATOM   5344 C CG2  . VAL B 1 144 ? 94.647  36.693 48.274  1.00 23.37  ? 145  VAL B CG2  1 
ATOM   5345 N N    . LEU B 1 145 ? 98.219  38.444 45.890  1.00 21.70  ? 146  LEU B N    1 
ATOM   5346 C CA   . LEU B 1 145 ? 99.246  38.569 44.849  1.00 18.40  ? 146  LEU B CA   1 
ATOM   5347 C C    . LEU B 1 145 ? 100.269 37.456 45.029  1.00 22.76  ? 146  LEU B C    1 
ATOM   5348 O O    . LEU B 1 145 ? 100.750 37.210 46.140  1.00 24.13  ? 146  LEU B O    1 
ATOM   5349 C CB   . LEU B 1 145 ? 99.932  39.947 44.905  1.00 20.85  ? 146  LEU B CB   1 
ATOM   5350 C CG   . LEU B 1 145 ? 101.193 40.260 44.071  1.00 30.97  ? 146  LEU B CG   1 
ATOM   5351 C CD1  . LEU B 1 145 ? 101.031 40.004 42.583  1.00 27.48  ? 146  LEU B CD1  1 
ATOM   5352 C CD2  . LEU B 1 145 ? 101.595 41.707 44.261  1.00 40.44  ? 146  LEU B CD2  1 
ATOM   5353 N N    . VAL B 1 146 ? 100.583 36.780 43.931  1.00 17.16  ? 147  VAL B N    1 
ATOM   5354 C CA   . VAL B 1 146 ? 101.542 35.683 43.922  1.00 19.07  ? 147  VAL B CA   1 
ATOM   5355 C C    . VAL B 1 146 ? 102.589 35.953 42.841  1.00 22.53  ? 147  VAL B C    1 
ATOM   5356 O O    . VAL B 1 146 ? 102.263 36.416 41.745  1.00 23.02  ? 147  VAL B O    1 
ATOM   5357 C CB   . VAL B 1 146 ? 100.854 34.348 43.574  1.00 22.04  ? 147  VAL B CB   1 
ATOM   5358 C CG1  . VAL B 1 146 ? 101.847 33.190 43.674  1.00 17.21  ? 147  VAL B CG1  1 
ATOM   5359 C CG2  . VAL B 1 146 ? 99.654  34.109 44.473  1.00 18.92  ? 147  VAL B CG2  1 
ATOM   5360 N N    . SER B 1 147 ? 103.850 35.675 43.140  1.00 19.29  ? 148  SER B N    1 
ATOM   5361 C CA   . SER B 1 147 ? 104.871 35.726 42.109  1.00 21.15  ? 148  SER B CA   1 
ATOM   5362 C C    . SER B 1 147 ? 105.774 34.534 42.329  1.00 21.84  ? 148  SER B C    1 
ATOM   5363 O O    . SER B 1 147 ? 105.942 34.084 43.475  1.00 19.85  ? 148  SER B O    1 
ATOM   5364 C CB   . SER B 1 147 ? 105.669 37.022 42.175  1.00 20.88  ? 148  SER B CB   1 
ATOM   5365 O OG   . SER B 1 147 ? 106.455 37.066 43.347  1.00 25.67  ? 148  SER B OG   1 
ATOM   5366 N N    . MET B 1 148 ? 106.338 34.008 41.243  1.00 18.01  ? 149  MET B N    1 
ATOM   5367 C CA   . MET B 1 148 ? 107.243 32.869 41.354  1.00 20.06  ? 149  MET B CA   1 
ATOM   5368 C C    . MET B 1 148 ? 108.563 33.119 40.653  1.00 17.87  ? 149  MET B C    1 
ATOM   5369 O O    . MET B 1 148 ? 108.657 33.975 39.764  1.00 18.16  ? 149  MET B O    1 
ATOM   5370 C CB   . MET B 1 148 ? 106.593 31.604 40.792  1.00 21.07  ? 149  MET B CB   1 
ATOM   5371 C CG   . MET B 1 148 ? 106.834 31.402 39.296  1.00 25.93  ? 149  MET B CG   1 
ATOM   5372 S SD   . MET B 1 148 ? 105.999 32.635 38.273  1.00 26.07  ? 149  MET B SD   1 
ATOM   5373 C CE   . MET B 1 148 ? 104.279 32.191 38.579  1.00 14.81  ? 149  MET B CE   1 
ATOM   5374 N N    . ASN B 1 149 ? 109.590 32.386 41.075  1.00 19.18  ? 150  ASN B N    1 
ATOM   5375 C CA   . ASN B 1 149 ? 110.823 32.318 40.306  1.00 17.96  ? 150  ASN B CA   1 
ATOM   5376 C C    . ASN B 1 149 ? 110.701 31.170 39.311  1.00 20.65  ? 150  ASN B C    1 
ATOM   5377 O O    . ASN B 1 149 ? 110.086 30.156 39.603  1.00 21.77  ? 150  ASN B O    1 
ATOM   5378 C CB   . ASN B 1 149 ? 112.015 32.076 41.217  1.00 19.10  ? 150  ASN B CB   1 
ATOM   5379 C CG   . ASN B 1 149 ? 112.560 33.353 41.840  1.00 27.08  ? 150  ASN B CG   1 
ATOM   5380 O OD1  . ASN B 1 149 ? 112.035 34.460 41.640  1.00 23.13  ? 150  ASN B OD1  1 
ATOM   5381 N ND2  . ASN B 1 149 ? 113.632 33.197 42.607  1.00 30.49  ? 150  ASN B ND2  1 
ATOM   5382 N N    . TYR B 1 150 ? 111.269 31.340 38.128  1.00 19.72  ? 151  TYR B N    1 
ATOM   5383 C CA   . TYR B 1 150 ? 111.351 30.248 37.176  1.00 17.80  ? 151  TYR B CA   1 
ATOM   5384 C C    . TYR B 1 150 ? 112.734 30.238 36.564  1.00 19.63  ? 151  TYR B C    1 
ATOM   5385 O O    . TYR B 1 150 ? 113.370 31.295 36.433  1.00 19.21  ? 151  TYR B O    1 
ATOM   5386 C CB   . TYR B 1 150 ? 110.286 30.376 36.088  1.00 16.95  ? 151  TYR B CB   1 
ATOM   5387 C CG   . TYR B 1 150 ? 110.353 31.650 35.265  1.00 13.68  ? 151  TYR B CG   1 
ATOM   5388 C CD1  . TYR B 1 150 ? 109.725 32.816 35.696  1.00 18.99  ? 151  TYR B CD1  1 
ATOM   5389 C CD2  . TYR B 1 150 ? 111.003 31.670 34.032  1.00 13.53  ? 151  TYR B CD2  1 
ATOM   5390 C CE1  . TYR B 1 150 ? 109.768 33.986 34.931  1.00 13.39  ? 151  TYR B CE1  1 
ATOM   5391 C CE2  . TYR B 1 150 ? 111.050 32.825 33.262  1.00 13.85  ? 151  TYR B CE2  1 
ATOM   5392 C CZ   . TYR B 1 150 ? 110.434 33.976 33.716  1.00 16.13  ? 151  TYR B CZ   1 
ATOM   5393 O OH   . TYR B 1 150 ? 110.480 35.121 32.950  1.00 17.49  ? 151  TYR B OH   1 
ATOM   5394 N N    . ARG B 1 151 ? 113.201 29.057 36.179  1.00 19.47  ? 152  ARG B N    1 
ATOM   5395 C CA   . ARG B 1 151 ? 114.542 28.941 35.608  1.00 24.69  ? 152  ARG B CA   1 
ATOM   5396 C C    . ARG B 1 151 ? 114.670 29.726 34.304  1.00 24.02  ? 152  ARG B C    1 
ATOM   5397 O O    . ARG B 1 151 ? 113.758 29.719 33.468  1.00 22.99  ? 152  ARG B O    1 
ATOM   5398 C CB   . ARG B 1 151 ? 114.884 27.470 35.367  1.00 23.27  ? 152  ARG B CB   1 
ATOM   5399 C CG   . ARG B 1 151 ? 115.239 26.734 36.638  1.00 18.43  ? 152  ARG B CG   1 
ATOM   5400 C CD   . ARG B 1 151 ? 115.358 25.238 36.377  1.00 16.27  ? 152  ARG B CD   1 
ATOM   5401 N NE   . ARG B 1 151 ? 114.053 24.587 36.299  1.00 19.95  ? 152  ARG B NE   1 
ATOM   5402 C CZ   . ARG B 1 151 ? 113.878 23.308 35.987  1.00 23.08  ? 152  ARG B CZ   1 
ATOM   5403 N NH1  . ARG B 1 151 ? 114.937 22.545 35.735  1.00 18.14  ? 152  ARG B NH1  1 
ATOM   5404 N NH2  . ARG B 1 151 ? 112.648 22.798 35.929  1.00 19.74  ? 152  ARG B NH2  1 
ATOM   5405 N N    . VAL B 1 152 ? 115.805 30.399 34.129  1.00 18.10  ? 153  VAL B N    1 
ATOM   5406 C CA   . VAL B 1 152 ? 116.040 31.144 32.901  1.00 17.17  ? 153  VAL B CA   1 
ATOM   5407 C C    . VAL B 1 152 ? 117.340 30.697 32.255  1.00 20.23  ? 153  VAL B C    1 
ATOM   5408 O O    . VAL B 1 152 ? 118.045 29.842 32.797  1.00 23.59  ? 153  VAL B O    1 
ATOM   5409 C CB   . VAL B 1 152 ? 116.056 32.672 33.153  1.00 19.66  ? 153  VAL B CB   1 
ATOM   5410 C CG1  . VAL B 1 152 ? 114.663 33.176 33.602  1.00 13.94  ? 153  VAL B CG1  1 
ATOM   5411 C CG2  . VAL B 1 152 ? 117.131 33.035 34.181  1.00 17.00  ? 153  VAL B CG2  1 
ATOM   5412 N N    . GLY B 1 153 ? 117.656 31.278 31.102  1.00 22.19  ? 154  GLY B N    1 
ATOM   5413 C CA   . GLY B 1 153 ? 118.886 30.955 30.406  1.00 16.16  ? 154  GLY B CA   1 
ATOM   5414 C C    . GLY B 1 153 ? 118.887 29.498 29.983  1.00 16.26  ? 154  GLY B C    1 
ATOM   5415 O O    . GLY B 1 153 ? 117.828 28.898 29.800  1.00 20.71  ? 154  GLY B O    1 
ATOM   5416 N N    . ALA B 1 154 ? 120.078 28.932 29.825  1.00 19.02  ? 155  ALA B N    1 
ATOM   5417 C CA   . ALA B 1 154 ? 120.222 27.514 29.534  1.00 22.63  ? 155  ALA B CA   1 
ATOM   5418 C C    . ALA B 1 154 ? 119.446 26.652 30.553  1.00 25.25  ? 155  ALA B C    1 
ATOM   5419 O O    . ALA B 1 154 ? 118.879 25.622 30.192  1.00 18.21  ? 155  ALA B O    1 
ATOM   5420 C CB   . ALA B 1 154 ? 121.687 27.144 29.526  1.00 18.28  ? 155  ALA B CB   1 
ATOM   5421 N N    . PHE B 1 155 ? 119.421 27.075 31.818  1.00 16.28  ? 156  PHE B N    1 
ATOM   5422 C CA   . PHE B 1 155 ? 118.807 26.262 32.878  1.00 16.10  ? 156  PHE B CA   1 
ATOM   5423 C C    . PHE B 1 155 ? 117.328 26.059 32.672  1.00 15.66  ? 156  PHE B C    1 
ATOM   5424 O O    . PHE B 1 155 ? 116.775 25.029 33.059  1.00 23.28  ? 156  PHE B O    1 
ATOM   5425 C CB   . PHE B 1 155 ? 119.070 26.872 34.258  1.00 16.29  ? 156  PHE B CB   1 
ATOM   5426 C CG   . PHE B 1 155 ? 120.511 27.183 34.482  1.00 26.89  ? 156  PHE B CG   1 
ATOM   5427 C CD1  . PHE B 1 155 ? 121.392 26.177 34.828  1.00 19.71  ? 156  PHE B CD1  1 
ATOM   5428 C CD2  . PHE B 1 155 ? 121.004 28.473 34.273  1.00 21.16  ? 156  PHE B CD2  1 
ATOM   5429 C CE1  . PHE B 1 155 ? 122.737 26.448 35.001  1.00 24.58  ? 156  PHE B CE1  1 
ATOM   5430 C CE2  . PHE B 1 155 ? 122.339 28.743 34.456  1.00 21.82  ? 156  PHE B CE2  1 
ATOM   5431 C CZ   . PHE B 1 155 ? 123.208 27.730 34.818  1.00 24.65  ? 156  PHE B CZ   1 
ATOM   5432 N N    . GLY B 1 156 ? 116.688 27.042 32.052  1.00 19.37  ? 157  GLY B N    1 
ATOM   5433 C CA   . GLY B 1 156 ? 115.266 26.956 31.803  1.00 14.81  ? 157  GLY B CA   1 
ATOM   5434 C C    . GLY B 1 156 ? 114.913 26.596 30.382  1.00 18.90  ? 157  GLY B C    1 
ATOM   5435 O O    . GLY B 1 156 ? 113.812 26.089 30.139  1.00 20.11  ? 157  GLY B O    1 
ATOM   5436 N N    . PHE B 1 157 ? 115.823 26.831 29.434  1.00 17.10  ? 158  PHE B N    1 
ATOM   5437 C CA   . PHE B 1 157 ? 115.403 26.754 28.023  1.00 25.43  ? 158  PHE B CA   1 
ATOM   5438 C C    . PHE B 1 157 ? 116.352 26.085 27.041  1.00 24.80  ? 158  PHE B C    1 
ATOM   5439 O O    . PHE B 1 157 ? 116.060 26.046 25.852  1.00 25.47  ? 158  PHE B O    1 
ATOM   5440 C CB   . PHE B 1 157 ? 114.963 28.138 27.508  1.00 20.30  ? 158  PHE B CB   1 
ATOM   5441 C CG   . PHE B 1 157 ? 113.824 28.713 28.291  1.00 20.94  ? 158  PHE B CG   1 
ATOM   5442 C CD1  . PHE B 1 157 ? 112.516 28.316 28.033  1.00 20.09  ? 158  PHE B CD1  1 
ATOM   5443 C CD2  . PHE B 1 157 ? 114.060 29.599 29.330  1.00 19.25  ? 158  PHE B CD2  1 
ATOM   5444 C CE1  . PHE B 1 157 ? 111.449 28.820 28.783  1.00 22.64  ? 158  PHE B CE1  1 
ATOM   5445 C CE2  . PHE B 1 157 ? 112.998 30.111 30.092  1.00 18.14  ? 158  PHE B CE2  1 
ATOM   5446 C CZ   . PHE B 1 157 ? 111.691 29.721 29.818  1.00 16.04  ? 158  PHE B CZ   1 
ATOM   5447 N N    . LEU B 1 158 ? 117.478 25.568 27.524  1.00 20.59  ? 159  LEU B N    1 
ATOM   5448 C CA   . LEU B 1 158 ? 118.315 24.727 26.679  1.00 28.02  ? 159  LEU B CA   1 
ATOM   5449 C C    . LEU B 1 158 ? 117.497 23.516 26.234  1.00 31.24  ? 159  LEU B C    1 
ATOM   5450 O O    . LEU B 1 158 ? 116.910 22.818 27.059  1.00 25.85  ? 159  LEU B O    1 
ATOM   5451 C CB   . LEU B 1 158 ? 119.577 24.265 27.409  1.00 30.13  ? 159  LEU B CB   1 
ATOM   5452 C CG   . LEU B 1 158 ? 120.479 23.376 26.549  1.00 27.69  ? 159  LEU B CG   1 
ATOM   5453 C CD1  . LEU B 1 158 ? 121.936 23.747 26.709  1.00 24.88  ? 159  LEU B CD1  1 
ATOM   5454 C CD2  . LEU B 1 158 ? 120.264 21.927 26.912  1.00 26.72  ? 159  LEU B CD2  1 
ATOM   5455 N N    . ALA B 1 159 ? 117.446 23.277 24.927  1.00 29.98  ? 160  ALA B N    1 
ATOM   5456 C CA   . ALA B 1 159 ? 116.653 22.172 24.404  1.00 31.12  ? 160  ALA B CA   1 
ATOM   5457 C C    . ALA B 1 159 ? 117.452 21.328 23.423  1.00 26.38  ? 160  ALA B C    1 
ATOM   5458 O O    . ALA B 1 159 ? 118.052 21.850 22.493  1.00 25.08  ? 160  ALA B O    1 
ATOM   5459 C CB   . ALA B 1 159 ? 115.380 22.702 23.741  1.00 25.67  ? 160  ALA B CB   1 
ATOM   5460 N N    . LEU B 1 160 ? 117.482 20.024 23.659  1.00 29.77  ? 161  LEU B N    1 
ATOM   5461 C CA   . LEU B 1 160 ? 117.836 19.063 22.624  1.00 28.83  ? 161  LEU B CA   1 
ATOM   5462 C C    . LEU B 1 160 ? 116.524 18.346 22.303  1.00 36.37  ? 161  LEU B C    1 
ATOM   5463 O O    . LEU B 1 160 ? 116.195 17.334 22.930  1.00 40.76  ? 161  LEU B O    1 
ATOM   5464 C CB   . LEU B 1 160 ? 118.891 18.077 23.124  1.00 30.33  ? 161  LEU B CB   1 
ATOM   5465 C CG   . LEU B 1 160 ? 120.318 18.606 23.300  1.00 32.32  ? 161  LEU B CG   1 
ATOM   5466 C CD1  . LEU B 1 160 ? 121.169 17.590 24.025  1.00 34.64  ? 161  LEU B CD1  1 
ATOM   5467 C CD2  . LEU B 1 160 ? 120.958 18.956 21.941  1.00 24.45  ? 161  LEU B CD2  1 
ATOM   5468 N N    . PRO B 1 161 ? 115.750 18.892 21.342  1.00 37.69  ? 162  PRO B N    1 
ATOM   5469 C CA   . PRO B 1 161 ? 114.358 18.452 21.145  1.00 38.62  ? 162  PRO B CA   1 
ATOM   5470 C C    . PRO B 1 161 ? 114.268 16.968 20.795  1.00 40.53  ? 162  PRO B C    1 
ATOM   5471 O O    . PRO B 1 161 ? 115.095 16.460 20.027  1.00 38.70  ? 162  PRO B O    1 
ATOM   5472 C CB   . PRO B 1 161 ? 113.871 19.336 19.993  1.00 33.43  ? 162  PRO B CB   1 
ATOM   5473 C CG   . PRO B 1 161 ? 114.756 20.565 20.070  1.00 27.27  ? 162  PRO B CG   1 
ATOM   5474 C CD   . PRO B 1 161 ? 116.105 19.998 20.434  1.00 30.81  ? 162  PRO B CD   1 
ATOM   5475 N N    . GLY B 1 162 ? 113.300 16.280 21.397  1.00 39.55  ? 163  GLY B N    1 
ATOM   5476 C CA   . GLY B 1 162 ? 113.181 14.841 21.250  1.00 43.68  ? 163  GLY B CA   1 
ATOM   5477 C C    . GLY B 1 162 ? 113.863 14.049 22.354  1.00 47.93  ? 163  GLY B C    1 
ATOM   5478 O O    . GLY B 1 162 ? 113.525 12.892 22.586  1.00 53.24  ? 163  GLY B O    1 
ATOM   5479 N N    . SER B 1 163 ? 114.831 14.664 23.029  1.00 45.70  ? 164  SER B N    1 
ATOM   5480 C CA   . SER B 1 163 ? 115.551 13.996 24.108  1.00 40.24  ? 164  SER B CA   1 
ATOM   5481 C C    . SER B 1 163 ? 114.782 14.096 25.426  1.00 40.54  ? 164  SER B C    1 
ATOM   5482 O O    . SER B 1 163 ? 114.024 15.040 25.647  1.00 46.95  ? 164  SER B O    1 
ATOM   5483 C CB   . SER B 1 163 ? 116.933 14.617 24.293  1.00 37.54  ? 164  SER B CB   1 
ATOM   5484 O OG   . SER B 1 163 ? 116.859 15.706 25.198  1.00 39.66  ? 164  SER B OG   1 
ATOM   5485 N N    . ARG B 1 164 ? 114.994 13.124 26.304  1.00 40.97  ? 165  ARG B N    1 
ATOM   5486 C CA   . ARG B 1 164 ? 114.388 13.154 27.626  1.00 45.28  ? 165  ARG B CA   1 
ATOM   5487 C C    . ARG B 1 164 ? 115.294 13.864 28.629  1.00 41.01  ? 165  ARG B C    1 
ATOM   5488 O O    . ARG B 1 164 ? 114.861 14.203 29.723  1.00 48.10  ? 165  ARG B O    1 
ATOM   5489 C CB   . ARG B 1 164 ? 114.080 11.733 28.110  1.00 60.54  ? 165  ARG B CB   1 
ATOM   5490 C CG   . ARG B 1 164 ? 113.227 10.911 27.140  1.00 72.87  ? 165  ARG B CG   1 
ATOM   5491 C CD   . ARG B 1 164 ? 112.095 10.178 27.853  1.00 81.88  ? 165  ARG B CD   1 
ATOM   5492 N NE   . ARG B 1 164 ? 112.581 9.249  28.873  1.00 89.10  ? 165  ARG B NE   1 
ATOM   5493 C CZ   . ARG B 1 164 ? 112.041 9.113  30.081  1.00 90.77  ? 165  ARG B CZ   1 
ATOM   5494 N NH1  . ARG B 1 164 ? 110.992 9.852  30.428  1.00 88.11  ? 165  ARG B NH1  1 
ATOM   5495 N NH2  . ARG B 1 164 ? 112.550 8.241  30.944  1.00 91.97  ? 165  ARG B NH2  1 
ATOM   5496 N N    . GLU B 1 165 ? 116.550 14.084 28.253  1.00 39.75  ? 166  GLU B N    1 
ATOM   5497 C CA   . GLU B 1 165 ? 117.523 14.687 29.160  1.00 44.58  ? 166  GLU B CA   1 
ATOM   5498 C C    . GLU B 1 165 ? 117.473 16.208 29.126  1.00 41.72  ? 166  GLU B C    1 
ATOM   5499 O O    . GLU B 1 165 ? 117.836 16.863 30.093  1.00 44.51  ? 166  GLU B O    1 
ATOM   5500 C CB   . GLU B 1 165 ? 118.943 14.210 28.843  1.00 49.19  ? 166  GLU B CB   1 
ATOM   5501 C CG   . GLU B 1 165 ? 119.159 12.713 28.984  1.00 55.03  ? 166  GLU B CG   1 
ATOM   5502 C CD   . GLU B 1 165 ? 119.071 11.973 27.649  1.00 66.47  ? 166  GLU B CD   1 
ATOM   5503 O OE1  . GLU B 1 165 ? 118.722 12.604 26.618  1.00 62.46  ? 166  GLU B OE1  1 
ATOM   5504 O OE2  . GLU B 1 165 ? 119.356 10.753 27.636  1.00 72.98  ? 166  GLU B OE2  1 
ATOM   5505 N N    . ALA B 1 166 ? 117.023 16.762 28.006  1.00 35.37  ? 167  ALA B N    1 
ATOM   5506 C CA   . ALA B 1 166 ? 116.906 18.206 27.852  1.00 29.80  ? 167  ALA B CA   1 
ATOM   5507 C C    . ALA B 1 166 ? 115.773 18.533 26.882  1.00 30.29  ? 167  ALA B C    1 
ATOM   5508 O O    . ALA B 1 166 ? 116.009 18.960 25.748  1.00 31.95  ? 167  ALA B O    1 
ATOM   5509 C CB   . ALA B 1 166 ? 118.228 18.801 27.369  1.00 26.39  ? 167  ALA B CB   1 
ATOM   5510 N N    . PRO B 1 167 ? 114.535 18.330 27.339  1.00 23.48  ? 168  PRO B N    1 
ATOM   5511 C CA   . PRO B 1 167 ? 113.304 18.432 26.542  1.00 25.49  ? 168  PRO B CA   1 
ATOM   5512 C C    . PRO B 1 167 ? 112.953 19.871 26.197  1.00 34.52  ? 168  PRO B C    1 
ATOM   5513 O O    . PRO B 1 167 ? 112.210 20.105 25.238  1.00 39.57  ? 168  PRO B O    1 
ATOM   5514 C CB   . PRO B 1 167 ? 112.240 17.820 27.466  1.00 19.52  ? 168  PRO B CB   1 
ATOM   5515 C CG   . PRO B 1 167 ? 112.781 18.074 28.873  1.00 21.21  ? 168  PRO B CG   1 
ATOM   5516 C CD   . PRO B 1 167 ? 114.279 17.976 28.749  1.00 21.83  ? 168  PRO B CD   1 
ATOM   5517 N N    . GLY B 1 168 ? 113.482 20.823 26.961  1.00 33.35  ? 169  GLY B N    1 
ATOM   5518 C CA   . GLY B 1 168 ? 113.244 22.228 26.677  1.00 33.18  ? 169  GLY B CA   1 
ATOM   5519 C C    . GLY B 1 168 ? 111.956 22.742 27.312  1.00 31.03  ? 169  GLY B C    1 
ATOM   5520 O O    . GLY B 1 168 ? 111.077 21.955 27.669  1.00 29.52  ? 169  GLY B O    1 
ATOM   5521 N N    . ASN B 1 169 ? 111.854 24.064 27.458  1.00 26.52  ? 170  ASN B N    1 
ATOM   5522 C CA   . ASN B 1 169 ? 110.660 24.696 28.016  1.00 20.90  ? 170  ASN B CA   1 
ATOM   5523 C C    . ASN B 1 169 ? 110.439 24.476 29.514  1.00 21.08  ? 170  ASN B C    1 
ATOM   5524 O O    . ASN B 1 169 ? 109.350 24.757 30.020  1.00 25.75  ? 170  ASN B O    1 
ATOM   5525 C CB   . ASN B 1 169 ? 109.409 24.258 27.242  1.00 17.81  ? 170  ASN B CB   1 
ATOM   5526 C CG   . ASN B 1 169 ? 109.407 24.759 25.819  1.00 24.88  ? 170  ASN B CG   1 
ATOM   5527 O OD1  . ASN B 1 169 ? 110.119 25.704 25.476  1.00 23.48  ? 170  ASN B OD1  1 
ATOM   5528 N ND2  . ASN B 1 169 ? 108.592 24.134 24.977  1.00 23.64  ? 170  ASN B ND2  1 
ATOM   5529 N N    . VAL B 1 170 ? 111.460 24.008 30.229  1.00 24.46  ? 171  VAL B N    1 
ATOM   5530 C CA   . VAL B 1 170 ? 111.267 23.680 31.642  1.00 23.85  ? 171  VAL B CA   1 
ATOM   5531 C C    . VAL B 1 170 ? 110.976 24.909 32.512  1.00 21.87  ? 171  VAL B C    1 
ATOM   5532 O O    . VAL B 1 170 ? 110.233 24.825 33.493  1.00 20.98  ? 171  VAL B O    1 
ATOM   5533 C CB   . VAL B 1 170 ? 112.388 22.765 32.212  1.00 21.70  ? 171  VAL B CB   1 
ATOM   5534 C CG1  . VAL B 1 170 ? 112.516 21.495 31.356  1.00 17.84  ? 171  VAL B CG1  1 
ATOM   5535 C CG2  . VAL B 1 170 ? 113.726 23.496 32.293  1.00 21.41  ? 171  VAL B CG2  1 
ATOM   5536 N N    . GLY B 1 171 ? 111.528 26.054 32.129  1.00 19.39  ? 172  GLY B N    1 
ATOM   5537 C CA   . GLY B 1 171 ? 111.177 27.294 32.784  1.00 15.42  ? 172  GLY B CA   1 
ATOM   5538 C C    . GLY B 1 171 ? 109.678 27.560 32.695  1.00 22.88  ? 172  GLY B C    1 
ATOM   5539 O O    . GLY B 1 171 ? 109.053 28.038 33.652  1.00 19.55  ? 172  GLY B O    1 
ATOM   5540 N N    . LEU B 1 172 ? 109.086 27.246 31.545  1.00 19.80  ? 173  LEU B N    1 
ATOM   5541 C CA   . LEU B 1 172 ? 107.648 27.406 31.377  1.00 24.21  ? 173  LEU B CA   1 
ATOM   5542 C C    . LEU B 1 172 ? 106.905 26.419 32.277  1.00 20.38  ? 173  LEU B C    1 
ATOM   5543 O O    . LEU B 1 172 ? 105.839 26.730 32.805  1.00 16.86  ? 173  LEU B O    1 
ATOM   5544 C CB   . LEU B 1 172 ? 107.240 27.198 29.914  1.00 23.15  ? 173  LEU B CB   1 
ATOM   5545 C CG   . LEU B 1 172 ? 107.581 28.299 28.919  1.00 22.00  ? 173  LEU B CG   1 
ATOM   5546 C CD1  . LEU B 1 172 ? 107.108 27.895 27.510  1.00 19.81  ? 173  LEU B CD1  1 
ATOM   5547 C CD2  . LEU B 1 172 ? 106.933 29.609 29.358  1.00 16.67  ? 173  LEU B CD2  1 
ATOM   5548 N N    . LEU B 1 173 ? 107.469 25.226 32.440  1.00 15.90  ? 174  LEU B N    1 
ATOM   5549 C CA   . LEU B 1 173 ? 106.843 24.216 33.294  1.00 20.85  ? 174  LEU B CA   1 
ATOM   5550 C C    . LEU B 1 173 ? 107.018 24.645 34.753  1.00 18.90  ? 174  LEU B C    1 
ATOM   5551 O O    . LEU B 1 173 ? 106.182 24.332 35.589  1.00 22.96  ? 174  LEU B O    1 
ATOM   5552 C CB   . LEU B 1 173 ? 107.418 22.816 33.036  1.00 16.42  ? 174  LEU B CB   1 
ATOM   5553 C CG   . LEU B 1 173 ? 107.119 22.207 31.661  1.00 29.26  ? 174  LEU B CG   1 
ATOM   5554 C CD1  . LEU B 1 173 ? 107.819 20.849 31.438  1.00 18.42  ? 174  LEU B CD1  1 
ATOM   5555 C CD2  . LEU B 1 173 ? 105.617 22.046 31.449  1.00 21.32  ? 174  LEU B CD2  1 
ATOM   5556 N N    . ASP B 1 174 ? 108.089 25.387 35.050  1.00 21.49  ? 175  ASP B N    1 
ATOM   5557 C CA   . ASP B 1 174 ? 108.263 25.925 36.398  1.00 21.89  ? 175  ASP B CA   1 
ATOM   5558 C C    . ASP B 1 174 ? 107.085 26.842 36.681  1.00 26.92  ? 175  ASP B C    1 
ATOM   5559 O O    . ASP B 1 174 ? 106.450 26.740 37.736  1.00 28.15  ? 175  ASP B O    1 
ATOM   5560 C CB   . ASP B 1 174 ? 109.583 26.707 36.553  1.00 15.39  ? 175  ASP B CB   1 
ATOM   5561 C CG   . ASP B 1 174 ? 110.824 25.819 36.451  1.00 28.53  ? 175  ASP B CG   1 
ATOM   5562 O OD1  . ASP B 1 174 ? 110.686 24.579 36.560  1.00 21.98  ? 175  ASP B OD1  1 
ATOM   5563 O OD2  . ASP B 1 174 ? 111.943 26.369 36.269  1.00 24.01  ? 175  ASP B OD2  1 
ATOM   5564 N N    . GLN B 1 175 ? 106.790 27.727 35.726  1.00 18.83  ? 176  GLN B N    1 
ATOM   5565 C CA   . GLN B 1 175 ? 105.632 28.610 35.843  1.00 23.00  ? 176  GLN B CA   1 
ATOM   5566 C C    . GLN B 1 175 ? 104.313 27.825 35.984  1.00 21.27  ? 176  GLN B C    1 
ATOM   5567 O O    . GLN B 1 175 ? 103.456 28.172 36.798  1.00 22.78  ? 176  GLN B O    1 
ATOM   5568 C CB   . GLN B 1 175 ? 105.562 29.576 34.652  1.00 23.71  ? 176  GLN B CB   1 
ATOM   5569 C CG   . GLN B 1 175 ? 106.733 30.551 34.547  1.00 18.67  ? 176  GLN B CG   1 
ATOM   5570 C CD   . GLN B 1 175 ? 106.740 31.300 33.228  1.00 22.14  ? 176  GLN B CD   1 
ATOM   5571 O OE1  . GLN B 1 175 ? 105.763 31.258 32.480  1.00 22.57  ? 176  GLN B OE1  1 
ATOM   5572 N NE2  . GLN B 1 175 ? 107.843 31.993 32.936  1.00 15.81  ? 176  GLN B NE2  1 
ATOM   5573 N N    . ARG B 1 176 ? 104.156 26.763 35.202  1.00 15.99  ? 177  ARG B N    1 
ATOM   5574 C CA   . ARG B 1 176 ? 102.928 25.963 35.251  1.00 21.51  ? 177  ARG B CA   1 
ATOM   5575 C C    . ARG B 1 176 ? 102.774 25.290 36.605  1.00 21.67  ? 177  ARG B C    1 
ATOM   5576 O O    . ARG B 1 176 ? 101.678 25.264 37.169  1.00 19.84  ? 177  ARG B O    1 
ATOM   5577 C CB   . ARG B 1 176 ? 102.892 24.900 34.154  1.00 16.70  ? 177  ARG B CB   1 
ATOM   5578 C CG   . ARG B 1 176 ? 101.676 23.993 34.272  1.00 19.04  ? 177  ARG B CG   1 
ATOM   5579 C CD   . ARG B 1 176 ? 101.597 22.998 33.146  1.00 23.72  ? 177  ARG B CD   1 
ATOM   5580 N NE   . ARG B 1 176 ? 101.323 23.668 31.877  1.00 32.03  ? 177  ARG B NE   1 
ATOM   5581 C CZ   . ARG B 1 176 ? 101.550 23.131 30.684  1.00 33.76  ? 177  ARG B CZ   1 
ATOM   5582 N NH1  . ARG B 1 176 ? 102.057 21.912 30.600  1.00 30.87  ? 177  ARG B NH1  1 
ATOM   5583 N NH2  . ARG B 1 176 ? 101.272 23.818 29.577  1.00 29.72  ? 177  ARG B NH2  1 
ATOM   5584 N N    . LEU B 1 177 ? 103.881 24.759 37.121  1.00 18.36  ? 178  LEU B N    1 
ATOM   5585 C CA   . LEU B 1 177 ? 103.908 24.167 38.461  1.00 18.71  ? 178  LEU B CA   1 
ATOM   5586 C C    . LEU B 1 177 ? 103.480 25.199 39.514  1.00 18.66  ? 178  LEU B C    1 
ATOM   5587 O O    . LEU B 1 177 ? 102.634 24.907 40.353  1.00 20.41  ? 178  LEU B O    1 
ATOM   5588 C CB   . LEU B 1 177 ? 105.292 23.581 38.787  1.00 19.51  ? 178  LEU B CB   1 
ATOM   5589 C CG   . LEU B 1 177 ? 105.351 22.726 40.057  1.00 23.91  ? 178  LEU B CG   1 
ATOM   5590 C CD1  . LEU B 1 177 ? 104.377 21.544 39.940  1.00 18.74  ? 178  LEU B CD1  1 
ATOM   5591 C CD2  . LEU B 1 177 ? 106.768 22.237 40.369  1.00 21.64  ? 178  LEU B CD2  1 
ATOM   5592 N N    . ALA B 1 178 ? 104.018 26.416 39.438  1.00 22.46  ? 179  ALA B N    1 
ATOM   5593 C CA   . ALA B 1 178 ? 103.613 27.457 40.384  1.00 17.37  ? 179  ALA B CA   1 
ATOM   5594 C C    . ALA B 1 178 ? 102.104 27.717 40.291  1.00 20.60  ? 179  ALA B C    1 
ATOM   5595 O O    . ALA B 1 178 ? 101.425 27.848 41.311  1.00 23.82  ? 179  ALA B O    1 
ATOM   5596 C CB   . ALA B 1 178 ? 104.411 28.730 40.166  1.00 15.94  ? 179  ALA B CB   1 
ATOM   5597 N N    . LEU B 1 179 ? 101.584 27.762 39.067  1.00 21.37  ? 180  LEU B N    1 
ATOM   5598 C CA   . LEU B 1 179 ? 100.146 27.953 38.840  1.00 24.02  ? 180  LEU B CA   1 
ATOM   5599 C C    . LEU B 1 179 ? 99.298  26.810 39.402  1.00 21.97  ? 180  LEU B C    1 
ATOM   5600 O O    . LEU B 1 179 ? 98.206  27.043 39.925  1.00 25.23  ? 180  LEU B O    1 
ATOM   5601 C CB   . LEU B 1 179 ? 99.844  28.140 37.349  1.00 25.70  ? 180  LEU B CB   1 
ATOM   5602 C CG   . LEU B 1 179 ? 100.336 29.445 36.710  1.00 28.03  ? 180  LEU B CG   1 
ATOM   5603 C CD1  . LEU B 1 179 ? 100.150 29.423 35.208  1.00 27.40  ? 180  LEU B CD1  1 
ATOM   5604 C CD2  . LEU B 1 179 ? 99.611  30.640 37.309  1.00 31.27  ? 180  LEU B CD2  1 
ATOM   5605 N N    . GLN B 1 180 ? 99.780  25.577 39.281  1.00 21.58  ? 181  GLN B N    1 
ATOM   5606 C CA   . GLN B 1 180 ? 99.073  24.452 39.882  1.00 22.54  ? 181  GLN B CA   1 
ATOM   5607 C C    . GLN B 1 180 ? 99.132  24.589 41.399  1.00 30.16  ? 181  GLN B C    1 
ATOM   5608 O O    . GLN B 1 180 ? 98.164  24.272 42.105  1.00 26.75  ? 181  GLN B O    1 
ATOM   5609 C CB   . GLN B 1 180 ? 99.673  23.118 39.435  1.00 22.85  ? 181  GLN B CB   1 
ATOM   5610 C CG   . GLN B 1 180 ? 99.463  22.832 37.958  1.00 41.14  ? 181  GLN B CG   1 
ATOM   5611 C CD   . GLN B 1 180 ? 100.242 21.625 37.461  1.00 46.87  ? 181  GLN B CD   1 
ATOM   5612 O OE1  . GLN B 1 180 ? 101.168 21.150 38.120  1.00 51.26  ? 181  GLN B OE1  1 
ATOM   5613 N NE2  . GLN B 1 180 ? 99.867  21.125 36.289  1.00 41.56  ? 181  GLN B NE2  1 
ATOM   5614 N N    . TRP B 1 181 ? 100.264 25.083 41.896  1.00 17.81  ? 182  TRP B N    1 
ATOM   5615 C CA   . TRP B 1 181 ? 100.429 25.262 43.329  1.00 23.04  ? 182  TRP B CA   1 
ATOM   5616 C C    . TRP B 1 181 ? 99.346  26.212 43.827  1.00 23.40  ? 182  TRP B C    1 
ATOM   5617 O O    . TRP B 1 181 ? 98.697  25.959 44.852  1.00 22.20  ? 182  TRP B O    1 
ATOM   5618 C CB   . TRP B 1 181 ? 101.832 25.783 43.665  1.00 17.51  ? 182  TRP B CB   1 
ATOM   5619 C CG   . TRP B 1 181 ? 102.091 25.874 45.134  1.00 26.80  ? 182  TRP B CG   1 
ATOM   5620 C CD1  . TRP B 1 181 ? 102.675 24.925 45.922  1.00 26.16  ? 182  TRP B CD1  1 
ATOM   5621 C CD2  . TRP B 1 181 ? 101.771 26.978 45.999  1.00 22.95  ? 182  TRP B CD2  1 
ATOM   5622 N NE1  . TRP B 1 181 ? 102.745 25.373 47.220  1.00 27.75  ? 182  TRP B NE1  1 
ATOM   5623 C CE2  . TRP B 1 181 ? 102.196 26.627 47.295  1.00 21.95  ? 182  TRP B CE2  1 
ATOM   5624 C CE3  . TRP B 1 181 ? 101.171 28.227 45.799  1.00 23.53  ? 182  TRP B CE3  1 
ATOM   5625 C CZ2  . TRP B 1 181 ? 102.030 27.479 48.397  1.00 20.55  ? 182  TRP B CZ2  1 
ATOM   5626 C CZ3  . TRP B 1 181 ? 101.018 29.079 46.891  1.00 23.00  ? 182  TRP B CZ3  1 
ATOM   5627 C CH2  . TRP B 1 181 ? 101.445 28.698 48.174  1.00 20.81  ? 182  TRP B CH2  1 
ATOM   5628 N N    . VAL B 1 182 ? 99.134  27.283 43.069  1.00 21.26  ? 183  VAL B N    1 
ATOM   5629 C CA   . VAL B 1 182 ? 98.130  28.282 43.399  1.00 19.07  ? 183  VAL B CA   1 
ATOM   5630 C C    . VAL B 1 182 ? 96.733  27.678 43.430  1.00 25.75  ? 183  VAL B C    1 
ATOM   5631 O O    . VAL B 1 182 ? 95.939  27.967 44.339  1.00 26.26  ? 183  VAL B O    1 
ATOM   5632 C CB   . VAL B 1 182 ? 98.183  29.452 42.405  1.00 19.72  ? 183  VAL B CB   1 
ATOM   5633 C CG1  . VAL B 1 182 ? 96.928  30.305 42.519  1.00 18.47  ? 183  VAL B CG1  1 
ATOM   5634 C CG2  . VAL B 1 182 ? 99.458  30.271 42.643  1.00 17.51  ? 183  VAL B CG2  1 
ATOM   5635 N N    . GLN B 1 183 ? 96.435  26.834 42.447  1.00 23.04  ? 184  GLN B N    1 
ATOM   5636 C CA   . GLN B 1 183 ? 95.159  26.117 42.435  1.00 28.09  ? 184  GLN B CA   1 
ATOM   5637 C C    . GLN B 1 183 ? 94.973  25.332 43.715  1.00 23.70  ? 184  GLN B C    1 
ATOM   5638 O O    . GLN B 1 183 ? 93.906  25.359 44.318  1.00 25.73  ? 184  GLN B O    1 
ATOM   5639 C CB   . GLN B 1 183 ? 95.045  25.187 41.219  1.00 22.91  ? 184  GLN B CB   1 
ATOM   5640 C CG   . GLN B 1 183 ? 94.794  25.945 39.926  1.00 23.81  ? 184  GLN B CG   1 
ATOM   5641 C CD   . GLN B 1 183 ? 93.496  26.725 39.983  1.00 30.19  ? 184  GLN B CD   1 
ATOM   5642 O OE1  . GLN B 1 183 ? 92.423  26.141 40.108  1.00 36.68  ? 184  GLN B OE1  1 
ATOM   5643 N NE2  . GLN B 1 183 ? 93.589  28.053 39.921  1.00 22.87  ? 184  GLN B NE2  1 
ATOM   5644 N N    . GLU B 1 184 ? 96.025  24.658 44.155  1.00 23.90  ? 185  GLU B N    1 
ATOM   5645 C CA   . GLU B 1 184 ? 95.901  23.778 45.311  1.00 30.67  ? 185  GLU B CA   1 
ATOM   5646 C C    . GLU B 1 184 ? 95.943  24.501 46.662  1.00 34.97  ? 185  GLU B C    1 
ATOM   5647 O O    . GLU B 1 184 ? 95.317  24.051 47.608  1.00 36.07  ? 185  GLU B O    1 
ATOM   5648 C CB   . GLU B 1 184 ? 96.948  22.666 45.239  1.00 41.60  ? 185  GLU B CB   1 
ATOM   5649 C CG   . GLU B 1 184 ? 96.860  21.871 43.932  1.00 55.58  ? 185  GLU B CG   1 
ATOM   5650 C CD   . GLU B 1 184 ? 97.748  20.634 43.907  1.00 67.20  ? 185  GLU B CD   1 
ATOM   5651 O OE1  . GLU B 1 184 ? 98.298  20.260 44.968  1.00 70.87  ? 185  GLU B OE1  1 
ATOM   5652 O OE2  . GLU B 1 184 ? 97.887  20.028 42.818  1.00 68.36  ? 185  GLU B OE2  1 
ATOM   5653 N N    . ASN B 1 185 ? 96.641  25.633 46.744  1.00 30.17  ? 186  ASN B N    1 
ATOM   5654 C CA   . ASN B 1 185 ? 96.935  26.227 48.047  1.00 22.52  ? 186  ASN B CA   1 
ATOM   5655 C C    . ASN B 1 185 ? 96.468  27.649 48.308  1.00 26.78  ? 186  ASN B C    1 
ATOM   5656 O O    . ASN B 1 185 ? 96.467  28.097 49.458  1.00 27.04  ? 186  ASN B O    1 
ATOM   5657 C CB   . ASN B 1 185 ? 98.433  26.129 48.339  1.00 22.60  ? 186  ASN B CB   1 
ATOM   5658 C CG   . ASN B 1 185 ? 98.925  24.706 48.292  1.00 24.78  ? 186  ASN B CG   1 
ATOM   5659 O OD1  . ASN B 1 185 ? 98.578  23.897 49.146  1.00 26.90  ? 186  ASN B OD1  1 
ATOM   5660 N ND2  . ASN B 1 185 ? 99.721  24.387 47.282  1.00 25.48  ? 186  ASN B ND2  1 
ATOM   5661 N N    . VAL B 1 186 ? 96.059  28.365 47.269  1.00 20.18  ? 187  VAL B N    1 
ATOM   5662 C CA   . VAL B 1 186 ? 95.848  29.789 47.453  1.00 26.97  ? 187  VAL B CA   1 
ATOM   5663 C C    . VAL B 1 186 ? 94.643  30.115 48.336  1.00 32.01  ? 187  VAL B C    1 
ATOM   5664 O O    . VAL B 1 186 ? 94.619  31.177 48.966  1.00 31.32  ? 187  VAL B O    1 
ATOM   5665 C CB   . VAL B 1 186 ? 95.799  30.562 46.133  1.00 24.79  ? 187  VAL B CB   1 
ATOM   5666 C CG1  . VAL B 1 186 ? 94.432  30.396 45.451  1.00 20.28  ? 187  VAL B CG1  1 
ATOM   5667 C CG2  . VAL B 1 186 ? 96.101  32.023 46.401  1.00 23.24  ? 187  VAL B CG2  1 
ATOM   5668 N N    . ALA B 1 187 ? 93.666  29.206 48.395  1.00 25.37  ? 188  ALA B N    1 
ATOM   5669 C CA   . ALA B 1 187 ? 92.511  29.405 49.275  1.00 30.10  ? 188  ALA B CA   1 
ATOM   5670 C C    . ALA B 1 187 ? 92.961  29.520 50.725  1.00 27.37  ? 188  ALA B C    1 
ATOM   5671 O O    . ALA B 1 187 ? 92.311  30.175 51.524  1.00 34.75  ? 188  ALA B O    1 
ATOM   5672 C CB   . ALA B 1 187 ? 91.478  28.272 49.123  1.00 23.28  ? 188  ALA B CB   1 
ATOM   5673 N N    . ALA B 1 188 ? 94.080  28.882 51.054  1.00 24.36  ? 189  ALA B N    1 
ATOM   5674 C CA   . ALA B 1 188 ? 94.597  28.885 52.421  1.00 30.96  ? 189  ALA B CA   1 
ATOM   5675 C C    . ALA B 1 188 ? 95.097  30.271 52.823  1.00 34.54  ? 189  ALA B C    1 
ATOM   5676 O O    . ALA B 1 188 ? 95.382  30.503 53.994  1.00 35.26  ? 189  ALA B O    1 
ATOM   5677 C CB   . ALA B 1 188 ? 95.714  27.858 52.576  1.00 22.41  ? 189  ALA B CB   1 
ATOM   5678 N N    . PHE B 1 189 ? 95.222  31.173 51.847  1.00 27.02  ? 190  PHE B N    1 
ATOM   5679 C CA   . PHE B 1 189 ? 95.570  32.569 52.113  1.00 27.96  ? 190  PHE B CA   1 
ATOM   5680 C C    . PHE B 1 189 ? 94.379  33.485 51.819  1.00 30.38  ? 190  PHE B C    1 
ATOM   5681 O O    . PHE B 1 189 ? 94.515  34.710 51.807  1.00 30.95  ? 190  PHE B O    1 
ATOM   5682 C CB   . PHE B 1 189 ? 96.773  33.008 51.266  1.00 28.14  ? 190  PHE B CB   1 
ATOM   5683 C CG   . PHE B 1 189 ? 97.955  32.076 51.346  1.00 29.18  ? 190  PHE B CG   1 
ATOM   5684 C CD1  . PHE B 1 189 ? 97.981  30.898 50.605  1.00 22.86  ? 190  PHE B CD1  1 
ATOM   5685 C CD2  . PHE B 1 189 ? 99.046  32.387 52.146  1.00 27.88  ? 190  PHE B CD2  1 
ATOM   5686 C CE1  . PHE B 1 189 ? 99.065  30.046 50.669  1.00 22.20  ? 190  PHE B CE1  1 
ATOM   5687 C CE2  . PHE B 1 189 ? 100.139 31.537 52.213  1.00 32.29  ? 190  PHE B CE2  1 
ATOM   5688 C CZ   . PHE B 1 189 ? 100.148 30.367 51.477  1.00 31.63  ? 190  PHE B CZ   1 
ATOM   5689 N N    . GLY B 1 190 ? 93.215  32.894 51.569  1.00 27.70  ? 191  GLY B N    1 
ATOM   5690 C CA   . GLY B 1 190 ? 92.019  33.680 51.315  1.00 34.62  ? 191  GLY B CA   1 
ATOM   5691 C C    . GLY B 1 190 ? 91.821  34.053 49.855  1.00 37.35  ? 191  GLY B C    1 
ATOM   5692 O O    . GLY B 1 190 ? 90.992  34.905 49.529  1.00 34.30  ? 191  GLY B O    1 
ATOM   5693 N N    . GLY B 1 191 ? 92.577  33.416 48.967  1.00 33.96  ? 192  GLY B N    1 
ATOM   5694 C CA   . GLY B 1 191 ? 92.442  33.699 47.551  1.00 32.30  ? 192  GLY B CA   1 
ATOM   5695 C C    . GLY B 1 191 ? 91.472  32.738 46.888  1.00 33.13  ? 192  GLY B C    1 
ATOM   5696 O O    . GLY B 1 191 ? 91.319  31.600 47.328  1.00 42.27  ? 192  GLY B O    1 
ATOM   5697 N N    . ASP B 1 192 ? 90.816  33.202 45.829  1.00 31.29  ? 193  ASP B N    1 
ATOM   5698 C CA   . ASP B 1 192 ? 89.908  32.377 45.037  1.00 34.02  ? 193  ASP B CA   1 
ATOM   5699 C C    . ASP B 1 192 ? 90.624  31.803 43.802  1.00 36.51  ? 193  ASP B C    1 
ATOM   5700 O O    . ASP B 1 192 ? 90.966  32.536 42.869  1.00 36.35  ? 193  ASP B O    1 
ATOM   5701 C CB   . ASP B 1 192 ? 88.695  33.211 44.608  1.00 37.59  ? 193  ASP B CB   1 
ATOM   5702 C CG   . ASP B 1 192 ? 87.734  32.442 43.716  1.00 43.43  ? 193  ASP B CG   1 
ATOM   5703 O OD1  . ASP B 1 192 ? 87.816  31.190 43.665  1.00 47.94  ? 193  ASP B OD1  1 
ATOM   5704 O OD2  . ASP B 1 192 ? 86.885  33.095 43.070  1.00 42.68  ? 193  ASP B OD2  1 
ATOM   5705 N N    . PRO B 1 193 ? 90.823  30.479 43.785  1.00 28.90  ? 194  PRO B N    1 
ATOM   5706 C CA   . PRO B 1 193 ? 91.514  29.794 42.684  1.00 25.95  ? 194  PRO B CA   1 
ATOM   5707 C C    . PRO B 1 193 ? 90.718  29.836 41.374  1.00 34.02  ? 194  PRO B C    1 
ATOM   5708 O O    . PRO B 1 193 ? 91.324  29.719 40.299  1.00 30.52  ? 194  PRO B O    1 
ATOM   5709 C CB   . PRO B 1 193 ? 91.643  28.356 43.200  1.00 29.14  ? 194  PRO B CB   1 
ATOM   5710 C CG   . PRO B 1 193 ? 90.439  28.192 44.105  1.00 24.31  ? 194  PRO B CG   1 
ATOM   5711 C CD   . PRO B 1 193 ? 90.295  29.537 44.790  1.00 23.49  ? 194  PRO B CD   1 
ATOM   5712 N N    . THR B 1 194 ? 89.395  30.001 41.461  1.00 30.97  ? 195  THR B N    1 
ATOM   5713 C CA   . THR B 1 194 ? 88.560  30.199 40.266  1.00 30.83  ? 195  THR B CA   1 
ATOM   5714 C C    . THR B 1 194 ? 88.652  31.628 39.682  1.00 34.05  ? 195  THR B C    1 
ATOM   5715 O O    . THR B 1 194 ? 88.042  31.928 38.650  1.00 37.99  ? 195  THR B O    1 
ATOM   5716 C CB   . THR B 1 194 ? 87.053  29.924 40.535  1.00 32.87  ? 195  THR B CB   1 
ATOM   5717 O OG1  . THR B 1 194 ? 86.496  31.027 41.262  1.00 32.96  ? 195  THR B OG1  1 
ATOM   5718 C CG2  . THR B 1 194 ? 86.835  28.634 41.312  1.00 24.78  ? 195  THR B CG2  1 
ATOM   5719 N N    . SER B 1 195 ? 89.382  32.519 40.339  1.00 29.09  ? 196  SER B N    1 
ATOM   5720 C CA   . SER B 1 195 ? 89.489  33.888 39.828  1.00 31.38  ? 196  SER B CA   1 
ATOM   5721 C C    . SER B 1 195 ? 90.945  34.363 39.778  1.00 28.46  ? 196  SER B C    1 
ATOM   5722 O O    . SER B 1 195 ? 91.335  35.346 40.429  1.00 29.16  ? 196  SER B O    1 
ATOM   5723 C CB   . SER B 1 195 ? 88.631  34.844 40.656  1.00 39.31  ? 196  SER B CB   1 
ATOM   5724 O OG   . SER B 1 195 ? 88.600  36.127 40.054  1.00 58.20  ? 196  SER B OG   1 
ATOM   5725 N N    . VAL B 1 196 ? 91.748  33.647 39.000  1.00 22.74  ? 197  VAL B N    1 
ATOM   5726 C CA   . VAL B 1 196 ? 93.160  33.967 38.849  1.00 23.85  ? 197  VAL B CA   1 
ATOM   5727 C C    . VAL B 1 196 ? 93.397  34.793 37.585  1.00 23.24  ? 197  VAL B C    1 
ATOM   5728 O O    . VAL B 1 196 ? 93.038  34.373 36.481  1.00 24.53  ? 197  VAL B O    1 
ATOM   5729 C CB   . VAL B 1 196 ? 94.004  32.673 38.810  1.00 21.83  ? 197  VAL B CB   1 
ATOM   5730 C CG1  . VAL B 1 196 ? 95.488  32.976 38.523  1.00 18.58  ? 197  VAL B CG1  1 
ATOM   5731 C CG2  . VAL B 1 196 ? 93.853  31.914 40.119  1.00 20.85  ? 197  VAL B CG2  1 
ATOM   5732 N N    . THR B 1 197 ? 94.008  35.963 37.752  1.00 19.95  ? 198  THR B N    1 
ATOM   5733 C CA   . THR B 1 197 ? 94.491  36.755 36.623  1.00 19.21  ? 198  THR B CA   1 
ATOM   5734 C C    . THR B 1 197 ? 96.019  36.658 36.533  1.00 22.58  ? 198  THR B C    1 
ATOM   5735 O O    . THR B 1 197 ? 96.727  36.928 37.509  1.00 26.24  ? 198  THR B O    1 
ATOM   5736 C CB   . THR B 1 197 ? 94.078  38.245 36.760  1.00 25.46  ? 198  THR B CB   1 
ATOM   5737 O OG1  . THR B 1 197 ? 92.649  38.347 36.747  1.00 31.43  ? 198  THR B OG1  1 
ATOM   5738 C CG2  . THR B 1 197 ? 94.661  39.110 35.613  1.00 19.47  ? 198  THR B CG2  1 
ATOM   5739 N N    . LEU B 1 198 ? 96.521  36.274 35.361  1.00 25.28  ? 199  LEU B N    1 
ATOM   5740 C CA   . LEU B 1 198 ? 97.954  36.254 35.095  1.00 17.62  ? 199  LEU B CA   1 
ATOM   5741 C C    . LEU B 1 198 ? 98.378  37.588 34.503  1.00 26.75  ? 199  LEU B C    1 
ATOM   5742 O O    . LEU B 1 198 ? 97.721  38.113 33.599  1.00 19.82  ? 199  LEU B O    1 
ATOM   5743 C CB   . LEU B 1 198 ? 98.300  35.158 34.091  1.00 27.21  ? 199  LEU B CB   1 
ATOM   5744 C CG   . LEU B 1 198 ? 98.394  33.703 34.530  1.00 32.77  ? 199  LEU B CG   1 
ATOM   5745 C CD1  . LEU B 1 198 ? 98.925  32.851 33.363  1.00 24.81  ? 199  LEU B CD1  1 
ATOM   5746 C CD2  . LEU B 1 198 ? 99.314  33.579 35.736  1.00 36.27  ? 199  LEU B CD2  1 
ATOM   5747 N N    . PHE B 1 199 ? 99.474  38.147 35.002  1.00 17.34  ? 200  PHE B N    1 
ATOM   5748 C CA   . PHE B 1 199 ? 100.052 39.294 34.335  1.00 20.84  ? 200  PHE B CA   1 
ATOM   5749 C C    . PHE B 1 199 ? 101.565 39.229 34.361  1.00 22.86  ? 200  PHE B C    1 
ATOM   5750 O O    . PHE B 1 199 ? 102.148 38.598 35.240  1.00 26.33  ? 200  PHE B O    1 
ATOM   5751 C CB   . PHE B 1 199 ? 99.486  40.640 34.830  1.00 23.09  ? 200  PHE B CB   1 
ATOM   5752 C CG   . PHE B 1 199 ? 99.907  41.033 36.224  1.00 27.85  ? 200  PHE B CG   1 
ATOM   5753 C CD1  . PHE B 1 199 ? 99.901  40.115 37.270  1.00 29.12  ? 200  PHE B CD1  1 
ATOM   5754 C CD2  . PHE B 1 199 ? 100.254 42.352 36.496  1.00 29.26  ? 200  PHE B CD2  1 
ATOM   5755 C CE1  . PHE B 1 199 ? 100.265 40.503 38.560  1.00 23.94  ? 200  PHE B CE1  1 
ATOM   5756 C CE2  . PHE B 1 199 ? 100.622 42.749 37.782  1.00 27.78  ? 200  PHE B CE2  1 
ATOM   5757 C CZ   . PHE B 1 199 ? 100.623 41.823 38.815  1.00 22.37  ? 200  PHE B CZ   1 
ATOM   5758 N N    . GLY B 1 200 ? 102.182 39.847 33.359  1.00 24.87  ? 201  GLY B N    1 
ATOM   5759 C CA   . GLY B 1 200 ? 103.618 39.776 33.179  1.00 16.72  ? 201  GLY B CA   1 
ATOM   5760 C C    . GLY B 1 200 ? 104.049 40.800 32.159  1.00 24.12  ? 201  GLY B C    1 
ATOM   5761 O O    . GLY B 1 200 ? 103.224 41.310 31.391  1.00 24.61  ? 201  GLY B O    1 
ATOM   5762 N N    . GLU B 1 201 ? 105.344 41.098 32.139  1.00 23.52  ? 202  GLU B N    1 
ATOM   5763 C CA   . GLU B 1 201 ? 105.864 42.136 31.270  1.00 25.88  ? 202  GLU B CA   1 
ATOM   5764 C C    . GLU B 1 201 ? 107.017 41.552 30.435  1.00 25.94  ? 202  GLU B C    1 
ATOM   5765 O O    . GLU B 1 201 ? 107.766 40.723 30.954  1.00 25.53  ? 202  GLU B O    1 
ATOM   5766 C CB   . GLU B 1 201 ? 106.302 43.315 32.145  1.00 20.84  ? 202  GLU B CB   1 
ATOM   5767 C CG   . GLU B 1 201 ? 106.710 44.562 31.392  1.00 31.98  ? 202  GLU B CG   1 
ATOM   5768 C CD   . GLU B 1 201 ? 108.181 44.526 31.047  1.00 43.64  ? 202  GLU B CD   1 
ATOM   5769 O OE1  . GLU B 1 201 ? 108.870 43.591 31.534  1.00 42.17  ? 202  GLU B OE1  1 
ATOM   5770 O OE2  . GLU B 1 201 ? 108.639 45.420 30.296  1.00 42.29  ? 202  GLU B OE2  1 
HETATM 5771 N N    . SGB B 1 202 ? 107.134 41.949 29.155  1.00 25.26  ? 203  SGB B N    1 
HETATM 5772 C CA   . SGB B 1 202 ? 108.217 41.479 28.258  1.00 29.94  ? 203  SGB B CA   1 
HETATM 5773 C C    . SGB B 1 202 ? 108.209 39.944 28.077  1.00 27.96  ? 203  SGB B C    1 
HETATM 5774 O O    . SGB B 1 202 ? 107.224 39.395 27.602  1.00 29.14  ? 203  SGB B O    1 
HETATM 5775 C CB   . SGB B 1 202 ? 109.531 42.025 28.822  1.00 38.05  ? 203  SGB B CB   1 
HETATM 5776 O OG   . SGB B 1 202 ? 110.539 42.217 27.827  1.00 51.85  ? 203  SGB B OG   1 
HETATM 5777 O O1   . SGB B 1 202 ? 111.900 40.265 28.780  1.00 24.56  ? 203  SGB B O1   1 
HETATM 5778 P P1   . SGB B 1 202 ? 112.019 41.598 28.077  1.00 31.88  ? 203  SGB B P1   1 
HETATM 5779 C C1   . SGB B 1 202 ? 112.717 41.525 26.443  1.00 39.14  ? 203  SGB B C1   1 
HETATM 5780 O O2   . SGB B 1 202 ? 112.831 42.677 28.923  1.00 43.24  ? 203  SGB B O2   1 
HETATM 5781 C C2   . SGB B 1 202 ? 114.119 43.061 28.453  1.00 46.44  ? 203  SGB B C2   1 
HETATM 5782 C C4   . SGB B 1 202 ? 115.063 41.872 28.589  1.00 40.71  ? 203  SGB B C4   1 
HETATM 5783 C C3   . SGB B 1 202 ? 114.583 44.273 29.247  1.00 46.29  ? 203  SGB B C3   1 
ATOM   5784 N N    . ALA B 1 203 ? 109.278 39.241 28.462  1.00 24.25  ? 204  ALA B N    1 
ATOM   5785 C CA   . ALA B 1 203 ? 109.230 37.770 28.456  1.00 20.40  ? 204  ALA B CA   1 
ATOM   5786 C C    . ALA B 1 203 ? 108.149 37.252 29.405  1.00 19.93  ? 204  ALA B C    1 
ATOM   5787 O O    . ALA B 1 203 ? 107.628 36.138 29.241  1.00 16.00  ? 204  ALA B O    1 
ATOM   5788 C CB   . ALA B 1 203 ? 110.579 37.169 28.800  1.00 19.12  ? 204  ALA B CB   1 
ATOM   5789 N N    . GLY B 1 204 ? 107.807 38.060 30.404  1.00 20.43  ? 205  GLY B N    1 
ATOM   5790 C CA   . GLY B 1 204 ? 106.683 37.739 31.275  1.00 17.26  ? 205  GLY B CA   1 
ATOM   5791 C C    . GLY B 1 204 ? 105.366 37.699 30.503  1.00 18.08  ? 205  GLY B C    1 
ATOM   5792 O O    . GLY B 1 204 ? 104.602 36.728 30.582  1.00 19.38  ? 205  GLY B O    1 
ATOM   5793 N N    . ALA B 1 205 ? 105.106 38.763 29.744  1.00 21.56  ? 206  ALA B N    1 
ATOM   5794 C CA   . ALA B 1 205 ? 103.935 38.811 28.868  1.00 19.08  ? 206  ALA B CA   1 
ATOM   5795 C C    . ALA B 1 205 ? 103.960 37.661 27.853  1.00 20.53  ? 206  ALA B C    1 
ATOM   5796 O O    . ALA B 1 205 ? 102.933 37.042 27.585  1.00 24.21  ? 206  ALA B O    1 
ATOM   5797 C CB   . ALA B 1 205 ? 103.858 40.160 28.162  1.00 18.31  ? 206  ALA B CB   1 
ATOM   5798 N N    . ALA B 1 206 ? 105.131 37.372 27.290  1.00 19.09  ? 207  ALA B N    1 
ATOM   5799 C CA   . ALA B 1 206 ? 105.238 36.278 26.330  1.00 21.84  ? 207  ALA B CA   1 
ATOM   5800 C C    . ALA B 1 206 ? 104.860 34.959 27.007  1.00 21.59  ? 207  ALA B C    1 
ATOM   5801 O O    . ALA B 1 206 ? 104.181 34.112 26.414  1.00 23.47  ? 207  ALA B O    1 
ATOM   5802 C CB   . ALA B 1 206 ? 106.651 36.202 25.748  1.00 17.56  ? 207  ALA B CB   1 
ATOM   5803 N N    . SER B 1 207 ? 105.295 34.794 28.253  1.00 19.39  ? 208  SER B N    1 
ATOM   5804 C CA   . SER B 1 207 ? 104.975 33.591 29.018  1.00 16.10  ? 208  SER B CA   1 
ATOM   5805 C C    . SER B 1 207 ? 103.469 33.497 29.217  1.00 16.34  ? 208  SER B C    1 
ATOM   5806 O O    . SER B 1 207 ? 102.870 32.438 29.007  1.00 20.94  ? 208  SER B O    1 
ATOM   5807 C CB   . SER B 1 207 ? 105.648 33.630 30.394  1.00 18.41  ? 208  SER B CB   1 
ATOM   5808 O OG   . SER B 1 207 ? 107.048 33.508 30.298  1.00 17.53  ? 208  SER B OG   1 
ATOM   5809 N N    . VAL B 1 208 ? 102.856 34.598 29.644  1.00 16.47  ? 209  VAL B N    1 
ATOM   5810 C CA   . VAL B 1 208 ? 101.408 34.604 29.831  1.00 16.81  ? 209  VAL B CA   1 
ATOM   5811 C C    . VAL B 1 208 ? 100.712 34.116 28.555  1.00 17.24  ? 209  VAL B C    1 
ATOM   5812 O O    . VAL B 1 208 ? 99.847  33.245 28.606  1.00 21.25  ? 209  VAL B O    1 
ATOM   5813 C CB   . VAL B 1 208 ? 100.875 35.999 30.162  1.00 17.03  ? 209  VAL B CB   1 
ATOM   5814 C CG1  . VAL B 1 208 ? 99.351  35.983 30.129  1.00 17.53  ? 209  VAL B CG1  1 
ATOM   5815 C CG2  . VAL B 1 208 ? 101.403 36.465 31.508  1.00 16.75  ? 209  VAL B CG2  1 
ATOM   5816 N N    . GLY B 1 209 ? 101.109 34.691 27.418  1.00 18.91  ? 210  GLY B N    1 
ATOM   5817 C CA   . GLY B 1 209 ? 100.545 34.345 26.128  1.00 18.16  ? 210  GLY B CA   1 
ATOM   5818 C C    . GLY B 1 209 ? 100.699 32.865 25.825  1.00 23.65  ? 210  GLY B C    1 
ATOM   5819 O O    . GLY B 1 209 ? 99.789  32.241 25.270  1.00 24.15  ? 210  GLY B O    1 
ATOM   5820 N N    . MET B 1 210 ? 101.833 32.292 26.212  1.00 18.55  ? 211  MET B N    1 
ATOM   5821 C CA   . MET B 1 210 ? 102.065 30.876 25.957  1.00 23.68  ? 211  MET B CA   1 
ATOM   5822 C C    . MET B 1 210 ? 101.204 29.968 26.822  1.00 23.76  ? 211  MET B C    1 
ATOM   5823 O O    . MET B 1 210 ? 100.730 28.930 26.353  1.00 24.63  ? 211  MET B O    1 
ATOM   5824 C CB   . MET B 1 210 ? 103.547 30.545 26.074  1.00 20.88  ? 211  MET B CB   1 
ATOM   5825 C CG   . MET B 1 210 ? 104.321 31.021 24.850  1.00 20.90  ? 211  MET B CG   1 
ATOM   5826 S SD   . MET B 1 210 ? 106.080 30.934 25.141  1.00 35.98  ? 211  MET B SD   1 
ATOM   5827 C CE   . MET B 1 210 ? 106.656 32.156 23.943  1.00 36.91  ? 211  MET B CE   1 
ATOM   5828 N N    . HIS B 1 211 ? 100.982 30.362 28.072  1.00 17.80  ? 212  HIS B N    1 
ATOM   5829 C CA   . HIS B 1 211 ? 100.008 29.662 28.905  1.00 24.37  ? 212  HIS B CA   1 
ATOM   5830 C C    . HIS B 1 211 ? 98.584  29.743 28.338  1.00 26.73  ? 212  HIS B C    1 
ATOM   5831 O O    . HIS B 1 211 ? 97.816  28.785 28.463  1.00 24.51  ? 212  HIS B O    1 
ATOM   5832 C CB   . HIS B 1 211 ? 100.049 30.174 30.347  1.00 22.36  ? 212  HIS B CB   1 
ATOM   5833 C CG   . HIS B 1 211 ? 101.336 29.867 31.037  1.00 24.15  ? 212  HIS B CG   1 
ATOM   5834 N ND1  . HIS B 1 211 ? 101.711 28.583 31.356  1.00 22.31  ? 212  HIS B ND1  1 
ATOM   5835 C CD2  . HIS B 1 211 ? 102.340 30.676 31.456  1.00 21.67  ? 212  HIS B CD2  1 
ATOM   5836 C CE1  . HIS B 1 211 ? 102.901 28.609 31.933  1.00 25.80  ? 212  HIS B CE1  1 
ATOM   5837 N NE2  . HIS B 1 211 ? 103.304 29.862 32.005  1.00 27.13  ? 212  HIS B NE2  1 
ATOM   5838 N N    . LEU B 1 212 ? 98.240  30.880 27.729  1.00 21.50  ? 213  LEU B N    1 
ATOM   5839 C CA   . LEU B 1 212 ? 96.941  31.046 27.056  1.00 25.30  ? 213  LEU B CA   1 
ATOM   5840 C C    . LEU B 1 212 ? 96.793  30.052 25.918  1.00 29.11  ? 213  LEU B C    1 
ATOM   5841 O O    . LEU B 1 212 ? 95.707  29.534 25.684  1.00 36.09  ? 213  LEU B O    1 
ATOM   5842 C CB   . LEU B 1 212 ? 96.792  32.471 26.489  1.00 31.93  ? 213  LEU B CB   1 
ATOM   5843 C CG   . LEU B 1 212 ? 96.249  33.540 27.434  1.00 34.37  ? 213  LEU B CG   1 
ATOM   5844 C CD1  . LEU B 1 212 ? 96.098  34.876 26.734  1.00 31.96  ? 213  LEU B CD1  1 
ATOM   5845 C CD2  . LEU B 1 212 ? 94.907  33.095 28.001  1.00 39.17  ? 213  LEU B CD2  1 
ATOM   5846 N N    . LEU B 1 213 ? 97.895  29.782 25.214  1.00 27.68  ? 214  LEU B N    1 
ATOM   5847 C CA   . LEU B 1 213 ? 97.856  28.908 24.039  1.00 27.20  ? 214  LEU B CA   1 
ATOM   5848 C C    . LEU B 1 213 ? 98.205  27.443 24.340  1.00 27.41  ? 214  LEU B C    1 
ATOM   5849 O O    . LEU B 1 213 ? 98.271  26.624 23.421  1.00 27.62  ? 214  LEU B O    1 
ATOM   5850 C CB   . LEU B 1 213 ? 98.771  29.468 22.946  1.00 19.83  ? 214  LEU B CB   1 
ATOM   5851 C CG   . LEU B 1 213 ? 98.465  30.936 22.639  1.00 26.34  ? 214  LEU B CG   1 
ATOM   5852 C CD1  . LEU B 1 213 ? 99.588  31.599 21.872  1.00 19.72  ? 214  LEU B CD1  1 
ATOM   5853 C CD2  . LEU B 1 213 ? 97.144  31.068 21.872  1.00 28.97  ? 214  LEU B CD2  1 
ATOM   5854 N N    . SER B 1 214 ? 98.435  27.112 25.615  1.00 19.42  ? 215  SER B N    1 
ATOM   5855 C CA   . SER B 1 214 ? 98.746  25.724 26.006  1.00 22.02  ? 215  SER B CA   1 
ATOM   5856 C C    . SER B 1 214 ? 97.659  25.147 26.922  1.00 25.50  ? 215  SER B C    1 
ATOM   5857 O O    . SER B 1 214 ? 97.527  25.570 28.073  1.00 30.04  ? 215  SER B O    1 
ATOM   5858 C CB   . SER B 1 214 ? 100.105 25.659 26.698  1.00 29.62  ? 215  SER B CB   1 
ATOM   5859 O OG   . SER B 1 214 ? 100.475 24.324 26.978  1.00 36.09  ? 215  SER B OG   1 
ATOM   5860 N N    . PRO B 1 215 ? 96.865  24.187 26.408  1.00 24.80  ? 216  PRO B N    1 
ATOM   5861 C CA   . PRO B 1 215 ? 95.668  23.756 27.153  1.00 28.37  ? 216  PRO B CA   1 
ATOM   5862 C C    . PRO B 1 215 ? 95.886  23.255 28.598  1.00 30.31  ? 216  PRO B C    1 
ATOM   5863 O O    . PRO B 1 215 ? 95.034  23.525 29.440  1.00 34.04  ? 216  PRO B O    1 
ATOM   5864 C CB   . PRO B 1 215 ? 95.049  22.678 26.240  1.00 28.49  ? 216  PRO B CB   1 
ATOM   5865 C CG   . PRO B 1 215 ? 95.468  23.121 24.836  1.00 23.57  ? 216  PRO B CG   1 
ATOM   5866 C CD   . PRO B 1 215 ? 96.909  23.603 25.049  1.00 21.90  ? 216  PRO B CD   1 
ATOM   5867 N N    . PRO B 1 216 ? 97.000  22.566 28.890  1.00 30.37  ? 217  PRO B N    1 
ATOM   5868 C CA   . PRO B 1 216 ? 97.240  22.193 30.295  1.00 29.57  ? 217  PRO B CA   1 
ATOM   5869 C C    . PRO B 1 216 ? 97.422  23.415 31.210  1.00 33.03  ? 217  PRO B C    1 
ATOM   5870 O O    . PRO B 1 216 ? 97.074  23.342 32.385  1.00 37.75  ? 217  PRO B O    1 
ATOM   5871 C CB   . PRO B 1 216 ? 98.538  21.378 30.230  1.00 26.32  ? 217  PRO B CB   1 
ATOM   5872 C CG   . PRO B 1 216 ? 98.591  20.868 28.820  1.00 24.29  ? 217  PRO B CG   1 
ATOM   5873 C CD   . PRO B 1 216 ? 97.992  21.971 27.982  1.00 26.48  ? 217  PRO B CD   1 
ATOM   5874 N N    . SER B 1 217 ? 97.950  24.518 30.679  1.00 31.60  ? 218  SER B N    1 
ATOM   5875 C CA   . SER B 1 217 ? 98.068  25.758 31.452  1.00 29.37  ? 218  SER B CA   1 
ATOM   5876 C C    . SER B 1 217 ? 96.761  26.537 31.521  1.00 32.80  ? 218  SER B C    1 
ATOM   5877 O O    . SER B 1 217 ? 96.463  27.169 32.530  1.00 30.33  ? 218  SER B O    1 
ATOM   5878 C CB   . SER B 1 217 ? 99.156  26.659 30.875  1.00 22.11  ? 218  SER B CB   1 
ATOM   5879 O OG   . SER B 1 217 ? 100.429 26.169 31.202  1.00 28.31  ? 218  SER B OG   1 
ATOM   5880 N N    . ARG B 1 218 ? 95.995  26.480 30.437  1.00 34.17  ? 219  ARG B N    1 
ATOM   5881 C CA   . ARG B 1 218 ? 94.815  27.311 30.260  1.00 35.49  ? 219  ARG B CA   1 
ATOM   5882 C C    . ARG B 1 218 ? 93.743  27.040 31.323  1.00 36.57  ? 219  ARG B C    1 
ATOM   5883 O O    . ARG B 1 218 ? 92.974  27.932 31.691  1.00 38.70  ? 219  ARG B O    1 
ATOM   5884 C CB   . ARG B 1 218 ? 94.264  27.113 28.844  1.00 40.22  ? 219  ARG B CB   1 
ATOM   5885 C CG   . ARG B 1 218 ? 93.088  27.996 28.484  1.00 42.50  ? 219  ARG B CG   1 
ATOM   5886 C CD   . ARG B 1 218 ? 93.452  29.464 28.527  1.00 42.24  ? 219  ARG B CD   1 
ATOM   5887 N NE   . ARG B 1 218 ? 92.278  30.315 28.336  1.00 49.70  ? 219  ARG B NE   1 
ATOM   5888 C CZ   . ARG B 1 218 ? 91.600  30.892 29.327  1.00 48.66  ? 219  ARG B CZ   1 
ATOM   5889 N NH1  . ARG B 1 218 ? 91.983  30.718 30.586  1.00 43.06  ? 219  ARG B NH1  1 
ATOM   5890 N NH2  . ARG B 1 218 ? 90.541  31.648 29.057  1.00 49.85  ? 219  ARG B NH2  1 
ATOM   5891 N N    . GLY B 1 219 ? 93.709  25.816 31.837  1.00 34.21  ? 220  GLY B N    1 
ATOM   5892 C CA   . GLY B 1 219 ? 92.788  25.494 32.913  1.00 23.00  ? 220  GLY B CA   1 
ATOM   5893 C C    . GLY B 1 219 ? 93.187  26.076 34.260  1.00 29.41  ? 220  GLY B C    1 
ATOM   5894 O O    . GLY B 1 219 ? 92.423  25.995 35.210  1.00 34.21  ? 220  GLY B O    1 
ATOM   5895 N N    . LEU B 1 220 ? 94.371  26.680 34.344  1.00 26.79  ? 221  LEU B N    1 
ATOM   5896 C CA   . LEU B 1 220 ? 94.908  27.139 35.628  1.00 27.24  ? 221  LEU B CA   1 
ATOM   5897 C C    . LEU B 1 220 ? 94.666  28.617 35.951  1.00 28.93  ? 221  LEU B C    1 
ATOM   5898 O O    . LEU B 1 220 ? 95.091  29.105 37.003  1.00 35.36  ? 221  LEU B O    1 
ATOM   5899 C CB   . LEU B 1 220 ? 96.406  26.835 35.709  1.00 21.18  ? 221  LEU B CB   1 
ATOM   5900 C CG   . LEU B 1 220 ? 96.740  25.381 35.371  1.00 29.06  ? 221  LEU B CG   1 
ATOM   5901 C CD1  . LEU B 1 220 ? 98.251  25.148 35.380  1.00 24.66  ? 221  LEU B CD1  1 
ATOM   5902 C CD2  . LEU B 1 220 ? 96.039  24.455 36.340  1.00 19.40  ? 221  LEU B CD2  1 
ATOM   5903 N N    . PHE B 1 221 ? 93.987  29.333 35.061  1.00 26.79  ? 222  PHE B N    1 
ATOM   5904 C CA   . PHE B 1 221 ? 93.736  30.749 35.304  1.00 29.32  ? 222  PHE B CA   1 
ATOM   5905 C C    . PHE B 1 221 ? 92.594  31.273 34.450  1.00 27.59  ? 222  PHE B C    1 
ATOM   5906 O O    . PHE B 1 221 ? 92.191  30.633 33.492  1.00 25.59  ? 222  PHE B O    1 
ATOM   5907 C CB   . PHE B 1 221 ? 95.006  31.566 35.045  1.00 23.09  ? 222  PHE B CB   1 
ATOM   5908 C CG   . PHE B 1 221 ? 95.416  31.596 33.602  1.00 28.79  ? 222  PHE B CG   1 
ATOM   5909 C CD1  . PHE B 1 221 ? 96.116  30.533 33.043  1.00 26.11  ? 222  PHE B CD1  1 
ATOM   5910 C CD2  . PHE B 1 221 ? 95.100  32.685 32.798  1.00 33.73  ? 222  PHE B CD2  1 
ATOM   5911 C CE1  . PHE B 1 221 ? 96.500  30.557 31.706  1.00 30.69  ? 222  PHE B CE1  1 
ATOM   5912 C CE2  . PHE B 1 221 ? 95.487  32.721 31.460  1.00 38.66  ? 222  PHE B CE2  1 
ATOM   5913 C CZ   . PHE B 1 221 ? 96.189  31.653 30.913  1.00 35.09  ? 222  PHE B CZ   1 
ATOM   5914 N N    . HIS B 1 222 ? 92.107  32.464 34.786  1.00 27.37  ? 223  HIS B N    1 
ATOM   5915 C CA   . HIS B 1 222 ? 90.913  33.000 34.156  1.00 29.99  ? 223  HIS B CA   1 
ATOM   5916 C C    . HIS B 1 222 ? 91.167  34.154 33.174  1.00 29.70  ? 223  HIS B C    1 
ATOM   5917 O O    . HIS B 1 222 ? 90.668  34.136 32.053  1.00 42.51  ? 223  HIS B O    1 
ATOM   5918 C CB   . HIS B 1 222 ? 89.910  33.430 35.235  1.00 39.05  ? 223  HIS B CB   1 
ATOM   5919 C CG   . HIS B 1 222 ? 88.563  33.790 34.692  1.00 49.16  ? 223  HIS B CG   1 
ATOM   5920 N ND1  . HIS B 1 222 ? 87.708  34.654 35.340  1.00 57.64  ? 223  HIS B ND1  1 
ATOM   5921 C CD2  . HIS B 1 222 ? 87.927  33.405 33.559  1.00 54.58  ? 223  HIS B CD2  1 
ATOM   5922 C CE1  . HIS B 1 222 ? 86.600  34.786 34.630  1.00 60.22  ? 223  HIS B CE1  1 
ATOM   5923 N NE2  . HIS B 1 222 ? 86.708  34.040 33.546  1.00 59.16  ? 223  HIS B NE2  1 
ATOM   5924 N N    . ARG B 1 223 ? 91.915  35.164 33.603  1.00 30.90  ? 224  ARG B N    1 
ATOM   5925 C CA   . ARG B 1 223 ? 92.188  36.337 32.770  1.00 27.36  ? 224  ARG B CA   1 
ATOM   5926 C C    . ARG B 1 223 ? 93.675  36.540 32.618  1.00 19.80  ? 224  ARG B C    1 
ATOM   5927 O O    . ARG B 1 223 ? 94.465  35.933 33.335  1.00 22.72  ? 224  ARG B O    1 
ATOM   5928 C CB   . ARG B 1 223 ? 91.594  37.595 33.398  1.00 23.29  ? 224  ARG B CB   1 
ATOM   5929 C CG   . ARG B 1 223 ? 90.140  37.462 33.698  1.00 26.21  ? 224  ARG B CG   1 
ATOM   5930 C CD   . ARG B 1 223 ? 89.533  38.742 34.263  1.00 30.69  ? 224  ARG B CD   1 
ATOM   5931 N NE   . ARG B 1 223 ? 88.081  38.593 34.302  1.00 39.65  ? 224  ARG B NE   1 
ATOM   5932 C CZ   . ARG B 1 223 ? 87.379  38.397 35.406  1.00 44.86  ? 224  ARG B CZ   1 
ATOM   5933 N NH1  . ARG B 1 223 ? 87.991  38.365 36.579  1.00 51.46  ? 224  ARG B NH1  1 
ATOM   5934 N NH2  . ARG B 1 223 ? 86.062  38.253 35.337  1.00 51.44  ? 224  ARG B NH2  1 
ATOM   5935 N N    . ALA B 1 224 ? 94.048  37.427 31.700  1.00 21.24  ? 225  ALA B N    1 
ATOM   5936 C CA   . ALA B 1 224 ? 95.448  37.660 31.364  1.00 19.75  ? 225  ALA B CA   1 
ATOM   5937 C C    . ALA B 1 224 ? 95.750  39.133 31.070  1.00 19.29  ? 225  ALA B C    1 
ATOM   5938 O O    . ALA B 1 224 ? 94.932  39.847 30.481  1.00 20.65  ? 225  ALA B O    1 
ATOM   5939 C CB   . ALA B 1 224 ? 95.835  36.798 30.174  1.00 19.06  ? 225  ALA B CB   1 
ATOM   5940 N N    . VAL B 1 225 ? 96.936  39.572 31.479  1.00 18.87  ? 226  VAL B N    1 
ATOM   5941 C CA   . VAL B 1 225 ? 97.416  40.914 31.214  1.00 18.93  ? 226  VAL B CA   1 
ATOM   5942 C C    . VAL B 1 225 ? 98.794  40.746 30.631  1.00 18.46  ? 226  VAL B C    1 
ATOM   5943 O O    . VAL B 1 225 ? 99.647  40.128 31.256  1.00 23.07  ? 226  VAL B O    1 
ATOM   5944 C CB   . VAL B 1 225 ? 97.542  41.748 32.500  1.00 20.97  ? 226  VAL B CB   1 
ATOM   5945 C CG1  . VAL B 1 225 ? 98.080  43.142 32.173  1.00 19.21  ? 226  VAL B CG1  1 
ATOM   5946 C CG2  . VAL B 1 225 ? 96.200  41.832 33.240  1.00 19.48  ? 226  VAL B CG2  1 
ATOM   5947 N N    . LEU B 1 226 ? 99.010  41.269 29.428  1.00 18.70  ? 227  LEU B N    1 
ATOM   5948 C CA   . LEU B 1 226 ? 100.315 41.176 28.776  1.00 24.17  ? 227  LEU B CA   1 
ATOM   5949 C C    . LEU B 1 226 ? 100.846 42.580 28.559  1.00 22.07  ? 227  LEU B C    1 
ATOM   5950 O O    . LEU B 1 226 ? 100.266 43.355 27.794  1.00 27.17  ? 227  LEU B O    1 
ATOM   5951 C CB   . LEU B 1 226 ? 100.220 40.458 27.425  1.00 20.33  ? 227  LEU B CB   1 
ATOM   5952 C CG   . LEU B 1 226 ? 99.820  38.987 27.407  1.00 24.22  ? 227  LEU B CG   1 
ATOM   5953 C CD1  . LEU B 1 226 ? 98.328  38.846 27.541  1.00 18.80  ? 227  LEU B CD1  1 
ATOM   5954 C CD2  . LEU B 1 226 ? 100.313 38.347 26.112  1.00 21.93  ? 227  LEU B CD2  1 
ATOM   5955 N N    . GLN B 1 227 ? 101.941 42.909 29.231  1.00 18.38  ? 228  GLN B N    1 
ATOM   5956 C CA   . GLN B 1 227 ? 102.474 44.265 29.200  1.00 24.80  ? 228  GLN B CA   1 
ATOM   5957 C C    . GLN B 1 227 ? 103.766 44.275 28.396  1.00 26.62  ? 228  GLN B C    1 
ATOM   5958 O O    . GLN B 1 227 ? 104.758 43.652 28.802  1.00 19.36  ? 228  GLN B O    1 
ATOM   5959 C CB   . GLN B 1 227 ? 102.740 44.770 30.627  1.00 18.68  ? 228  GLN B CB   1 
ATOM   5960 C CG   . GLN B 1 227 ? 101.500 44.793 31.539  1.00 23.40  ? 228  GLN B CG   1 
ATOM   5961 C CD   . GLN B 1 227 ? 101.831 45.048 33.026  1.00 30.30  ? 228  GLN B CD   1 
ATOM   5962 O OE1  . GLN B 1 227 ? 101.064 44.661 33.922  1.00 36.10  ? 228  GLN B OE1  1 
ATOM   5963 N NE2  . GLN B 1 227 ? 102.971 45.694 33.288  1.00 32.33  ? 228  GLN B NE2  1 
ATOM   5964 N N    . SER B 1 228 ? 103.740 44.964 27.252  1.00 25.75  ? 229  SER B N    1 
ATOM   5965 C CA   . SER B 1 228 ? 104.931 45.177 26.431  1.00 25.95  ? 229  SER B CA   1 
ATOM   5966 C C    . SER B 1 228 ? 105.573 43.866 26.021  1.00 27.46  ? 229  SER B C    1 
ATOM   5967 O O    . SER B 1 228 ? 106.797 43.708 26.137  1.00 23.14  ? 229  SER B O    1 
ATOM   5968 C CB   . SER B 1 228 ? 105.967 46.020 27.185  1.00 23.60  ? 229  SER B CB   1 
ATOM   5969 O OG   . SER B 1 228 ? 105.524 47.349 27.352  1.00 25.13  ? 229  SER B OG   1 
ATOM   5970 N N    . GLY B 1 229 ? 104.755 42.929 25.546  1.00 19.84  ? 230  GLY B N    1 
ATOM   5971 C CA   . GLY B 1 229 ? 105.261 41.620 25.167  1.00 21.37  ? 230  GLY B CA   1 
ATOM   5972 C C    . GLY B 1 229 ? 104.178 40.696 24.640  1.00 26.39  ? 230  GLY B C    1 
ATOM   5973 O O    . GLY B 1 229 ? 102.990 40.897 24.893  1.00 24.33  ? 230  GLY B O    1 
ATOM   5974 N N    . ALA B 1 230 ? 104.588 39.671 23.910  1.00 22.15  ? 231  ALA B N    1 
ATOM   5975 C CA   . ALA B 1 230 ? 103.637 38.755 23.307  1.00 26.37  ? 231  ALA B CA   1 
ATOM   5976 C C    . ALA B 1 230 ? 104.348 37.459 22.928  1.00 22.46  ? 231  ALA B C    1 
ATOM   5977 O O    . ALA B 1 230 ? 105.547 37.467 22.662  1.00 18.99  ? 231  ALA B O    1 
ATOM   5978 C CB   . ALA B 1 230 ? 102.987 39.404 22.081  1.00 23.39  ? 231  ALA B CB   1 
ATOM   5979 N N    . PRO B 1 231 ? 103.606 36.344 22.888  1.00 20.32  ? 232  PRO B N    1 
ATOM   5980 C CA   . PRO B 1 231 ? 104.246 35.056 22.582  1.00 18.09  ? 232  PRO B CA   1 
ATOM   5981 C C    . PRO B 1 231 ? 104.604 34.967 21.107  1.00 29.47  ? 232  PRO B C    1 
ATOM   5982 O O    . PRO B 1 231 ? 105.461 34.156 20.757  1.00 26.03  ? 232  PRO B O    1 
ATOM   5983 C CB   . PRO B 1 231 ? 103.169 34.020 22.959  1.00 19.78  ? 232  PRO B CB   1 
ATOM   5984 C CG   . PRO B 1 231 ? 101.840 34.775 22.869  1.00 18.56  ? 232  PRO B CG   1 
ATOM   5985 C CD   . PRO B 1 231 ? 102.143 36.241 23.095  1.00 21.00  ? 232  PRO B CD   1 
ATOM   5986 N N    . ASN B 1 232 ? 103.971 35.796 20.270  1.00 25.37  ? 233  ASN B N    1 
ATOM   5987 C CA   . ASN B 1 232 ? 104.298 35.870 18.842  1.00 22.89  ? 233  ASN B CA   1 
ATOM   5988 C C    . ASN B 1 232 ? 105.466 36.803 18.435  1.00 23.02  ? 233  ASN B C    1 
ATOM   5989 O O    . ASN B 1 232 ? 105.780 36.916 17.253  1.00 25.99  ? 233  ASN B O    1 
ATOM   5990 C CB   . ASN B 1 232 ? 103.047 36.197 18.003  1.00 21.22  ? 233  ASN B CB   1 
ATOM   5991 C CG   . ASN B 1 232 ? 102.212 37.320 18.609  1.00 26.38  ? 233  ASN B CG   1 
ATOM   5992 O OD1  . ASN B 1 232 ? 101.901 37.303 19.801  1.00 31.49  ? 233  ASN B OD1  1 
ATOM   5993 N ND2  . ASN B 1 232 ? 101.858 38.304 17.794  1.00 23.40  ? 233  ASN B ND2  1 
ATOM   5994 N N    . GLY B 1 233 ? 106.143 37.452 19.375  1.00 40.36  ? 234  GLY B N    1 
ATOM   5995 C CA   . GLY B 1 233 ? 107.386 38.139 19.005  1.00 54.55  ? 234  GLY B CA   1 
ATOM   5996 C C    . GLY B 1 233 ? 108.367 37.301 18.162  1.00 51.87  ? 234  GLY B C    1 
ATOM   5997 O O    . GLY B 1 233 ? 108.299 36.070 18.173  1.00 60.94  ? 234  GLY B O    1 
ATOM   5998 N N    . PRO B 1 234 ? 109.271 37.961 17.406  1.00 34.42  ? 235  PRO B N    1 
ATOM   5999 C CA   . PRO B 1 234 ? 110.359 37.259 16.703  1.00 26.14  ? 235  PRO B CA   1 
ATOM   6000 C C    . PRO B 1 234 ? 111.520 36.835 17.629  1.00 25.55  ? 235  PRO B C    1 
ATOM   6001 O O    . PRO B 1 234 ? 112.495 36.267 17.157  1.00 28.82  ? 235  PRO B O    1 
ATOM   6002 C CB   . PRO B 1 234 ? 110.849 38.306 15.695  1.00 22.57  ? 235  PRO B CB   1 
ATOM   6003 C CG   . PRO B 1 234 ? 110.527 39.616 16.341  1.00 24.85  ? 235  PRO B CG   1 
ATOM   6004 C CD   . PRO B 1 234 ? 109.220 39.390 17.046  1.00 26.01  ? 235  PRO B CD   1 
ATOM   6005 N N    . TRP B 1 235 ? 111.401 37.099 18.926  1.00 23.14  ? 236  TRP B N    1 
ATOM   6006 C CA   . TRP B 1 235 ? 112.447 36.775 19.901  1.00 23.65  ? 236  TRP B CA   1 
ATOM   6007 C C    . TRP B 1 235 ? 111.982 35.728 20.934  1.00 22.72  ? 236  TRP B C    1 
ATOM   6008 O O    . TRP B 1 235 ? 112.798 35.108 21.603  1.00 24.56  ? 236  TRP B O    1 
ATOM   6009 C CB   . TRP B 1 235 ? 112.859 38.050 20.646  1.00 18.89  ? 236  TRP B CB   1 
ATOM   6010 C CG   . TRP B 1 235 ? 111.667 38.771 21.228  1.00 18.70  ? 236  TRP B CG   1 
ATOM   6011 C CD1  . TRP B 1 235 ? 110.908 39.730 20.610  1.00 19.12  ? 236  TRP B CD1  1 
ATOM   6012 C CD2  . TRP B 1 235 ? 111.083 38.580 22.534  1.00 18.35  ? 236  TRP B CD2  1 
ATOM   6013 N NE1  . TRP B 1 235 ? 109.896 40.139 21.445  1.00 18.86  ? 236  TRP B NE1  1 
ATOM   6014 C CE2  . TRP B 1 235 ? 109.979 39.454 22.623  1.00 21.50  ? 236  TRP B CE2  1 
ATOM   6015 C CE3  . TRP B 1 235 ? 111.389 37.761 23.621  1.00 21.67  ? 236  TRP B CE3  1 
ATOM   6016 C CZ2  . TRP B 1 235 ? 109.179 39.532 23.774  1.00 25.47  ? 236  TRP B CZ2  1 
ATOM   6017 C CZ3  . TRP B 1 235 ? 110.591 37.841 24.760  1.00 17.27  ? 236  TRP B CZ3  1 
ATOM   6018 C CH2  . TRP B 1 235 ? 109.500 38.720 24.824  1.00 29.20  ? 236  TRP B CH2  1 
ATOM   6019 N N    . ALA B 1 236 ? 110.669 35.547 21.063  1.00 19.19  ? 237  ALA B N    1 
ATOM   6020 C CA   . ALA B 1 236 ? 110.095 34.787 22.180  1.00 20.48  ? 237  ALA B CA   1 
ATOM   6021 C C    . ALA B 1 236 ? 110.131 33.271 21.966  1.00 24.85  ? 237  ALA B C    1 
ATOM   6022 O O    . ALA B 1 236 ? 110.029 32.496 22.921  1.00 25.57  ? 237  ALA B O    1 
ATOM   6023 C CB   . ALA B 1 236 ? 108.670 35.253 22.463  1.00 19.75  ? 237  ALA B CB   1 
ATOM   6024 N N    . THR B 1 237 ? 110.283 32.851 20.712  1.00 20.64  ? 238  THR B N    1 
ATOM   6025 C CA   . THR B 1 237 ? 110.351 31.430 20.405  1.00 23.30  ? 238  THR B CA   1 
ATOM   6026 C C    . THR B 1 237 ? 111.480 31.135 19.438  1.00 25.84  ? 238  THR B C    1 
ATOM   6027 O O    . THR B 1 237 ? 111.919 32.009 18.689  1.00 29.07  ? 238  THR B O    1 
ATOM   6028 C CB   . THR B 1 237 ? 109.029 30.887 19.797  1.00 23.58  ? 238  THR B CB   1 
ATOM   6029 O OG1  . THR B 1 237 ? 108.735 31.595 18.593  1.00 28.95  ? 238  THR B OG1  1 
ATOM   6030 C CG2  . THR B 1 237 ? 107.870 31.048 20.762  1.00 23.89  ? 238  THR B CG2  1 
ATOM   6031 N N    . VAL B 1 238 ? 111.929 29.884 19.452  1.00 24.33  ? 239  VAL B N    1 
ATOM   6032 C CA   . VAL B 1 238 ? 112.944 29.411 18.515  1.00 25.86  ? 239  VAL B CA   1 
ATOM   6033 C C    . VAL B 1 238 ? 112.456 28.053 17.984  1.00 27.94  ? 239  VAL B C    1 
ATOM   6034 O O    . VAL B 1 238 ? 111.686 27.355 18.674  1.00 25.36  ? 239  VAL B O    1 
ATOM   6035 C CB   . VAL B 1 238 ? 114.322 29.317 19.224  1.00 20.90  ? 239  VAL B CB   1 
ATOM   6036 C CG1  . VAL B 1 238 ? 114.354 28.129 20.210  1.00 18.73  ? 239  VAL B CG1  1 
ATOM   6037 C CG2  . VAL B 1 238 ? 115.440 29.232 18.249  1.00 33.03  ? 239  VAL B CG2  1 
ATOM   6038 N N    . GLY B 1 239 ? 112.848 27.702 16.755  1.00 32.34  ? 240  GLY B N    1 
ATOM   6039 C CA   . GLY B 1 239 ? 112.475 26.423 16.160  1.00 20.78  ? 240  GLY B CA   1 
ATOM   6040 C C    . GLY B 1 239 ? 113.364 25.285 16.666  1.00 34.53  ? 240  GLY B C    1 
ATOM   6041 O O    . GLY B 1 239 ? 114.430 25.541 17.245  1.00 32.34  ? 240  GLY B O    1 
ATOM   6042 N N    . MET B 1 240 ? 112.948 24.034 16.455  1.00 25.64  ? 241  MET B N    1 
ATOM   6043 C CA   . MET B 1 240 ? 113.697 22.896 16.986  1.00 27.63  ? 241  MET B CA   1 
ATOM   6044 C C    . MET B 1 240 ? 115.148 22.857 16.483  1.00 29.45  ? 241  MET B C    1 
ATOM   6045 O O    . MET B 1 240 ? 116.083 22.645 17.264  1.00 28.87  ? 241  MET B O    1 
ATOM   6046 C CB   . MET B 1 240 ? 112.984 21.577 16.693  1.00 26.94  ? 241  MET B CB   1 
ATOM   6047 C CG   . MET B 1 240 ? 111.650 21.391 17.432  1.00 30.02  ? 241  MET B CG   1 
ATOM   6048 S SD   . MET B 1 240 ? 110.720 19.902 16.928  1.00 47.99  ? 241  MET B SD   1 
ATOM   6049 C CE   . MET B 1 240 ? 111.705 18.585 17.644  1.00 83.13  ? 241  MET B CE   1 
ATOM   6050 N N    . GLY B 1 241 ? 115.331 23.079 15.189  1.00 25.51  ? 242  GLY B N    1 
ATOM   6051 C CA   . GLY B 1 241 ? 116.655 23.042 14.594  1.00 25.85  ? 242  GLY B CA   1 
ATOM   6052 C C    . GLY B 1 241 ? 117.598 24.055 15.221  1.00 31.73  ? 242  GLY B C    1 
ATOM   6053 O O    . GLY B 1 241 ? 118.710 23.709 15.625  1.00 31.50  ? 242  GLY B O    1 
ATOM   6054 N N    . GLU B 1 242 ? 117.156 25.305 15.320  1.00 33.07  ? 243  GLU B N    1 
ATOM   6055 C CA   . GLU B 1 242 ? 118.006 26.358 15.862  1.00 32.45  ? 243  GLU B CA   1 
ATOM   6056 C C    . GLU B 1 242 ? 118.258 26.124 17.354  1.00 33.05  ? 243  GLU B C    1 
ATOM   6057 O O    . GLU B 1 242 ? 119.355 26.395 17.855  1.00 37.27  ? 243  GLU B O    1 
ATOM   6058 C CB   . GLU B 1 242 ? 117.409 27.745 15.579  1.00 27.33  ? 243  GLU B CB   1 
ATOM   6059 C CG   . GLU B 1 242 ? 118.169 28.929 16.186  1.00 33.37  ? 243  GLU B CG   1 
ATOM   6060 C CD   . GLU B 1 242 ? 119.575 29.155 15.600  1.00 38.26  ? 243  GLU B CD   1 
ATOM   6061 O OE1  . GLU B 1 242 ? 119.983 28.445 14.653  1.00 44.83  ? 243  GLU B OE1  1 
ATOM   6062 O OE2  . GLU B 1 242 ? 120.276 30.065 16.101  1.00 36.89  ? 243  GLU B OE2  1 
ATOM   6063 N N    . ALA B 1 243 ? 117.258 25.595 18.055  1.00 26.79  ? 244  ALA B N    1 
ATOM   6064 C CA   . ALA B 1 243 ? 117.429 25.280 19.470  1.00 29.95  ? 244  ALA B CA   1 
ATOM   6065 C C    . ALA B 1 243 ? 118.525 24.229 19.637  1.00 31.52  ? 244  ALA B C    1 
ATOM   6066 O O    . ALA B 1 243 ? 119.434 24.392 20.463  1.00 25.90  ? 244  ALA B O    1 
ATOM   6067 C CB   . ALA B 1 243 ? 116.145 24.797 20.069  1.00 29.49  ? 244  ALA B CB   1 
ATOM   6068 N N    . ARG B 1 244 ? 118.431 23.154 18.854  1.00 29.27  ? 245  ARG B N    1 
ATOM   6069 C CA   . ARG B 1 244 ? 119.462 22.119 18.849  1.00 30.36  ? 245  ARG B CA   1 
ATOM   6070 C C    . ARG B 1 244 ? 120.824 22.694 18.499  1.00 31.21  ? 245  ARG B C    1 
ATOM   6071 O O    . ARG B 1 244 ? 121.823 22.358 19.129  1.00 31.26  ? 245  ARG B O    1 
ATOM   6072 C CB   . ARG B 1 244 ? 119.117 20.987 17.878  1.00 34.31  ? 245  ARG B CB   1 
ATOM   6073 C CG   . ARG B 1 244 ? 120.259 19.982 17.685  1.00 32.78  ? 245  ARG B CG   1 
ATOM   6074 C CD   . ARG B 1 244 ? 119.774 18.700 16.997  1.00 31.56  ? 245  ARG B CD   1 
ATOM   6075 N NE   . ARG B 1 244 ? 118.770 18.021 17.807  1.00 33.21  ? 245  ARG B NE   1 
ATOM   6076 C CZ   . ARG B 1 244 ? 119.052 17.151 18.773  1.00 36.31  ? 245  ARG B CZ   1 
ATOM   6077 N NH1  . ARG B 1 244 ? 120.315 16.839 19.034  1.00 38.04  ? 245  ARG B NH1  1 
ATOM   6078 N NH2  . ARG B 1 244 ? 118.071 16.585 19.472  1.00 32.42  ? 245  ARG B NH2  1 
ATOM   6079 N N    . ARG B 1 245 ? 120.875 23.571 17.503  1.00 24.84  ? 246  ARG B N    1 
ATOM   6080 C CA   . ARG B 1 245 ? 122.161 24.135 17.139  1.00 29.10  ? 246  ARG B CA   1 
ATOM   6081 C C    . ARG B 1 245 ? 122.758 24.905 18.313  1.00 28.48  ? 246  ARG B C    1 
ATOM   6082 O O    . ARG B 1 245 ? 123.939 24.764 18.607  1.00 28.52  ? 246  ARG B O    1 
ATOM   6083 C CB   . ARG B 1 245 ? 122.075 25.032 15.906  1.00 27.13  ? 246  ARG B CB   1 
ATOM   6084 C CG   . ARG B 1 245 ? 123.455 25.423 15.394  1.00 28.20  ? 246  ARG B CG   1 
ATOM   6085 C CD   . ARG B 1 245 ? 123.405 26.638 14.464  1.00 34.62  ? 246  ARG B CD   1 
ATOM   6086 N NE   . ARG B 1 245 ? 122.930 27.855 15.130  1.00 37.23  ? 246  ARG B NE   1 
ATOM   6087 C CZ   . ARG B 1 245 ? 123.675 28.615 15.934  1.00 38.08  ? 246  ARG B CZ   1 
ATOM   6088 N NH1  . ARG B 1 245 ? 124.932 28.279 16.207  1.00 38.73  ? 246  ARG B NH1  1 
ATOM   6089 N NH2  . ARG B 1 245 ? 123.160 29.712 16.477  1.00 35.24  ? 246  ARG B NH2  1 
ATOM   6090 N N    . ARG B 1 246 ? 121.938 25.702 18.990  1.00 28.91  ? 247  ARG B N    1 
ATOM   6091 C CA   . ARG B 1 246 ? 122.432 26.519 20.102  1.00 28.04  ? 247  ARG B CA   1 
ATOM   6092 C C    . ARG B 1 246 ? 122.892 25.704 21.299  1.00 28.70  ? 247  ARG B C    1 
ATOM   6093 O O    . ARG B 1 246 ? 123.921 26.020 21.904  1.00 26.06  ? 247  ARG B O    1 
ATOM   6094 C CB   . ARG B 1 246 ? 121.377 27.526 20.537  1.00 32.35  ? 247  ARG B CB   1 
ATOM   6095 C CG   . ARG B 1 246 ? 121.107 28.578 19.484  1.00 32.40  ? 247  ARG B CG   1 
ATOM   6096 C CD   . ARG B 1 246 ? 119.975 29.471 19.908  1.00 26.17  ? 247  ARG B CD   1 
ATOM   6097 N NE   . ARG B 1 246 ? 119.618 30.397 18.845  1.00 28.54  ? 247  ARG B NE   1 
ATOM   6098 C CZ   . ARG B 1 246 ? 118.773 31.401 18.993  1.00 27.28  ? 247  ARG B CZ   1 
ATOM   6099 N NH1  . ARG B 1 246 ? 118.201 31.616 20.173  1.00 19.39  ? 247  ARG B NH1  1 
ATOM   6100 N NH2  . ARG B 1 246 ? 118.514 32.189 17.961  1.00 23.83  ? 247  ARG B NH2  1 
ATOM   6101 N N    . ALA B 1 247 ? 122.122 24.673 21.648  1.00 28.57  ? 248  ALA B N    1 
ATOM   6102 C CA   . ALA B 1 247 ? 122.478 23.779 22.746  1.00 29.17  ? 248  ALA B CA   1 
ATOM   6103 C C    . ALA B 1 247 ? 123.811 23.096 22.450  1.00 30.86  ? 248  ALA B C    1 
ATOM   6104 O O    . ALA B 1 247 ? 124.694 23.008 23.312  1.00 30.55  ? 248  ALA B O    1 
ATOM   6105 C CB   . ALA B 1 247 ? 121.373 22.743 22.980  1.00 20.23  ? 248  ALA B CB   1 
ATOM   6106 N N    . THR B 1 248 ? 123.958 22.621 21.220  1.00 32.55  ? 249  THR B N    1 
ATOM   6107 C CA   . THR B 1 248 ? 125.172 21.927 20.817  1.00 29.83  ? 249  THR B CA   1 
ATOM   6108 C C    . THR B 1 248 ? 126.373 22.858 20.873  1.00 29.12  ? 249  THR B C    1 
ATOM   6109 O O    . THR B 1 248 ? 127.438 22.487 21.382  1.00 35.81  ? 249  THR B O    1 
ATOM   6110 C CB   . THR B 1 248 ? 125.045 21.334 19.409  1.00 34.54  ? 249  THR B CB   1 
ATOM   6111 O OG1  . THR B 1 248 ? 123.913 20.455 19.365  1.00 35.83  ? 249  THR B OG1  1 
ATOM   6112 C CG2  . THR B 1 248 ? 126.298 20.545 19.059  1.00 31.06  ? 249  THR B CG2  1 
ATOM   6113 N N    A GLN B 1 249 ? 126.214 24.073 20.361  0.53 24.56  ? 250  GLN B N    1 
ATOM   6114 N N    B GLN B 1 249 ? 126.198 24.071 20.364  0.47 24.76  ? 250  GLN B N    1 
ATOM   6115 C CA   A GLN B 1 249 ? 127.316 25.032 20.392  0.53 27.16  ? 250  GLN B CA   1 
ATOM   6116 C CA   B GLN B 1 249 ? 127.266 25.066 20.374  0.47 26.96  ? 250  GLN B CA   1 
ATOM   6117 C C    A GLN B 1 249 ? 127.683 25.424 21.825  0.53 28.84  ? 250  GLN B C    1 
ATOM   6118 C C    B GLN B 1 249 ? 127.664 25.460 21.801  0.47 28.37  ? 250  GLN B C    1 
ATOM   6119 O O    A GLN B 1 249 ? 128.860 25.618 22.129  0.53 28.92  ? 250  GLN B O    1 
ATOM   6120 O O    B GLN B 1 249 ? 128.842 25.681 22.078  0.47 29.00  ? 250  GLN B O    1 
ATOM   6121 C CB   A GLN B 1 249 ? 127.014 26.282 19.558  0.53 31.32  ? 250  GLN B CB   1 
ATOM   6122 C CB   B GLN B 1 249 ? 126.854 26.298 19.565  0.47 23.45  ? 250  GLN B CB   1 
ATOM   6123 C CG   A GLN B 1 249 ? 128.271 27.113 19.302  0.53 36.31  ? 250  GLN B CG   1 
ATOM   6124 C CG   B GLN B 1 249 ? 127.933 27.367 19.452  0.47 35.69  ? 250  GLN B CG   1 
ATOM   6125 C CD   A GLN B 1 249 ? 127.996 28.527 18.822  0.53 35.46  ? 250  GLN B CD   1 
ATOM   6126 C CD   B GLN B 1 249 ? 129.171 26.903 18.682  0.47 38.99  ? 250  GLN B CD   1 
ATOM   6127 O OE1  A GLN B 1 249 ? 126.855 28.894 18.526  0.53 34.45  ? 250  GLN B OE1  1 
ATOM   6128 O OE1  B GLN B 1 249 ? 129.149 25.880 17.988  0.47 36.29  ? 250  GLN B OE1  1 
ATOM   6129 N NE2  A GLN B 1 249 ? 129.051 29.334 18.748  0.53 24.99  ? 250  GLN B NE2  1 
ATOM   6130 N NE2  B GLN B 1 249 ? 130.260 27.662 18.804  0.47 39.71  ? 250  GLN B NE2  1 
ATOM   6131 N N    . LEU B 1 250 ? 126.687 25.544 22.703  1.00 22.28  ? 251  LEU B N    1 
ATOM   6132 C CA   . LEU B 1 250 ? 126.978 25.844 24.114  1.00 32.18  ? 251  LEU B CA   1 
ATOM   6133 C C    . LEU B 1 250 ? 127.849 24.730 24.694  1.00 28.31  ? 251  LEU B C    1 
ATOM   6134 O O    . LEU B 1 250 ? 128.884 24.984 25.321  1.00 30.85  ? 251  LEU B O    1 
ATOM   6135 C CB   . LEU B 1 250 ? 125.705 26.019 24.964  1.00 27.61  ? 251  LEU B CB   1 
ATOM   6136 C CG   . LEU B 1 250 ? 125.971 26.358 26.443  1.00 26.84  ? 251  LEU B CG   1 
ATOM   6137 C CD1  . LEU B 1 250 ? 126.620 27.739 26.590  1.00 22.77  ? 251  LEU B CD1  1 
ATOM   6138 C CD2  . LEU B 1 250 ? 124.716 26.284 27.281  1.00 29.05  ? 251  LEU B CD2  1 
ATOM   6139 N N    . ALA B 1 251 ? 127.434 23.494 24.451  1.00 26.17  ? 252  ALA B N    1 
ATOM   6140 C CA   . ALA B 1 251 ? 128.200 22.342 24.908  1.00 30.87  ? 252  ALA B CA   1 
ATOM   6141 C C    . ALA B 1 251 ? 129.652 22.435 24.425  1.00 32.95  ? 252  ALA B C    1 
ATOM   6142 O O    . ALA B 1 251 ? 130.577 22.332 25.224  1.00 30.14  ? 252  ALA B O    1 
ATOM   6143 C CB   . ALA B 1 251 ? 127.539 21.045 24.452  1.00 24.39  ? 252  ALA B CB   1 
ATOM   6144 N N    . HIS B 1 252 ? 129.840 22.658 23.126  1.00 30.34  ? 253  HIS B N    1 
ATOM   6145 C CA   . HIS B 1 252 ? 131.176 22.794 22.545  1.00 32.42  ? 253  HIS B CA   1 
ATOM   6146 C C    . HIS B 1 252 ? 132.021 23.868 23.253  1.00 37.07  ? 253  HIS B C    1 
ATOM   6147 O O    . HIS B 1 252 ? 133.169 23.615 23.613  1.00 35.96  ? 253  HIS B O    1 
ATOM   6148 C CB   . HIS B 1 252 ? 131.092 23.057 21.027  1.00 34.04  ? 253  HIS B CB   1 
ATOM   6149 C CG   . HIS B 1 252 ? 132.361 23.588 20.425  1.00 58.06  ? 253  HIS B CG   1 
ATOM   6150 N ND1  . HIS B 1 252 ? 132.692 24.929 20.437  1.00 64.10  ? 253  HIS B ND1  1 
ATOM   6151 C CD2  . HIS B 1 252 ? 133.373 22.960 19.773  1.00 64.12  ? 253  HIS B CD2  1 
ATOM   6152 C CE1  . HIS B 1 252 ? 133.855 25.102 19.832  1.00 61.34  ? 253  HIS B CE1  1 
ATOM   6153 N NE2  . HIS B 1 252 ? 134.289 23.924 19.419  1.00 61.00  ? 253  HIS B NE2  1 
ATOM   6154 N N    . LEU B 1 253 ? 131.440 25.049 23.461  1.00 38.40  ? 254  LEU B N    1 
ATOM   6155 C CA   . LEU B 1 253 ? 132.127 26.171 24.100  1.00 32.86  ? 254  LEU B CA   1 
ATOM   6156 C C    . LEU B 1 253 ? 132.553 25.903 25.544  1.00 32.34  ? 254  LEU B C    1 
ATOM   6157 O O    . LEU B 1 253 ? 133.511 26.508 26.038  1.00 28.14  ? 254  LEU B O    1 
ATOM   6158 C CB   . LEU B 1 253 ? 131.230 27.407 24.091  1.00 29.08  ? 254  LEU B CB   1 
ATOM   6159 C CG   . LEU B 1 253 ? 130.911 28.003 22.731  1.00 29.34  ? 254  LEU B CG   1 
ATOM   6160 C CD1  . LEU B 1 253 ? 129.809 29.058 22.862  1.00 24.48  ? 254  LEU B CD1  1 
ATOM   6161 C CD2  . LEU B 1 253 ? 132.173 28.600 22.131  1.00 25.95  ? 254  LEU B CD2  1 
ATOM   6162 N N    . VAL B 1 254 ? 131.828 25.033 26.238  1.00 27.46  ? 255  VAL B N    1 
ATOM   6163 C CA   . VAL B 1 254 ? 132.208 24.731 27.616  1.00 26.15  ? 255  VAL B CA   1 
ATOM   6164 C C    . VAL B 1 254 ? 133.019 23.438 27.729  1.00 28.15  ? 255  VAL B C    1 
ATOM   6165 O O    . VAL B 1 254 ? 133.215 22.918 28.828  1.00 31.85  ? 255  VAL B O    1 
ATOM   6166 C CB   . VAL B 1 254 ? 131.008 24.766 28.600  1.00 32.58  ? 255  VAL B CB   1 
ATOM   6167 C CG1  . VAL B 1 254 ? 130.345 26.148 28.573  1.00 23.16  ? 255  VAL B CG1  1 
ATOM   6168 C CG2  . VAL B 1 254 ? 130.009 23.659 28.285  1.00 23.23  ? 255  VAL B CG2  1 
ATOM   6169 N N    . GLY B 1 255 ? 133.514 22.952 26.588  1.00 29.33  ? 256  GLY B N    1 
ATOM   6170 C CA   . GLY B 1 255 ? 134.399 21.795 26.563  1.00 32.06  ? 256  GLY B CA   1 
ATOM   6171 C C    . GLY B 1 255 ? 133.720 20.436 26.663  1.00 36.19  ? 256  GLY B C    1 
ATOM   6172 O O    . GLY B 1 255 ? 134.298 19.493 27.194  1.00 47.58  ? 256  GLY B O    1 
ATOM   6173 N N    . CYS B 1 256 ? 132.498 20.339 26.142  1.00 33.59  ? 257  CYS B N    1 
ATOM   6174 C CA   . CYS B 1 256 ? 131.731 19.094 26.111  1.00 34.70  ? 257  CYS B CA   1 
ATOM   6175 C C    . CYS B 1 256 ? 131.606 18.586 24.689  1.00 44.79  ? 257  CYS B C    1 
ATOM   6176 O O    . CYS B 1 256 ? 131.452 19.376 23.764  1.00 49.25  ? 257  CYS B O    1 
ATOM   6177 C CB   . CYS B 1 256 ? 130.329 19.315 26.696  1.00 31.96  ? 257  CYS B CB   1 
ATOM   6178 S SG   . CYS B 1 256 ? 130.353 19.481 28.484  1.00 50.68  ? 257  CYS B SG   1 
ATOM   6179 N N    . PRO B 1 257 ? 131.668 17.261 24.507  1.00 57.03  ? 258  PRO B N    1 
ATOM   6180 C CA   . PRO B 1 257 ? 131.488 16.683 23.174  1.00 62.29  ? 258  PRO B CA   1 
ATOM   6181 C C    . PRO B 1 257 ? 130.030 16.769 22.709  1.00 72.62  ? 258  PRO B C    1 
ATOM   6182 O O    . PRO B 1 257 ? 129.758 16.903 21.508  1.00 79.51  ? 258  PRO B O    1 
ATOM   6183 C CB   . PRO B 1 257 ? 131.899 15.227 23.381  1.00 57.84  ? 258  PRO B CB   1 
ATOM   6184 C CG   . PRO B 1 257 ? 131.594 14.963 24.816  1.00 57.05  ? 258  PRO B CG   1 
ATOM   6185 C CD   . PRO B 1 257 ? 131.939 16.229 25.524  1.00 60.13  ? 258  PRO B CD   1 
ATOM   6186 N N    . ASN B 1 264 ? 125.752 12.340 20.589  1.00 47.04  ? 265  ASN B N    1 
ATOM   6187 C CA   . ASN B 1 264 ? 124.811 11.649 21.464  1.00 48.80  ? 265  ASN B CA   1 
ATOM   6188 C C    . ASN B 1 264 ? 124.237 12.620 22.504  1.00 48.90  ? 265  ASN B C    1 
ATOM   6189 O O    . ASN B 1 264 ? 124.976 13.158 23.334  1.00 48.66  ? 265  ASN B O    1 
ATOM   6190 C CB   . ASN B 1 264 ? 125.517 10.461 22.128  1.00 56.03  ? 265  ASN B CB   1 
ATOM   6191 C CG   . ASN B 1 264 ? 124.582 9.592  22.952  1.00 58.29  ? 265  ASN B CG   1 
ATOM   6192 O OD1  . ASN B 1 264 ? 123.795 10.095 23.749  1.00 61.75  ? 265  ASN B OD1  1 
ATOM   6193 N ND2  . ASN B 1 264 ? 124.687 8.270  22.781  1.00 59.29  ? 265  ASN B ND2  1 
ATOM   6194 N N    . ASP B 1 265 ? 122.924 12.845 22.449  1.00 47.74  ? 266  ASP B N    1 
ATOM   6195 C CA   . ASP B 1 265 ? 122.260 13.785 23.353  1.00 43.85  ? 266  ASP B CA   1 
ATOM   6196 C C    . ASP B 1 265 ? 122.502 13.452 24.819  1.00 40.77  ? 266  ASP B C    1 
ATOM   6197 O O    . ASP B 1 265 ? 122.775 14.334 25.629  1.00 33.35  ? 266  ASP B O    1 
ATOM   6198 C CB   . ASP B 1 265 ? 120.753 13.838 23.089  1.00 40.18  ? 266  ASP B CB   1 
ATOM   6199 C CG   . ASP B 1 265 ? 120.403 14.554 21.793  1.00 48.92  ? 266  ASP B CG   1 
ATOM   6200 O OD1  . ASP B 1 265 ? 121.306 15.165 21.185  1.00 54.33  ? 266  ASP B OD1  1 
ATOM   6201 O OD2  . ASP B 1 265 ? 119.213 14.516 21.390  1.00 51.48  ? 266  ASP B OD2  1 
ATOM   6202 N N    . THR B 1 266 ? 122.402 12.171 25.150  1.00 42.42  ? 267  THR B N    1 
ATOM   6203 C CA   . THR B 1 266 ? 122.611 11.713 26.518  1.00 35.98  ? 267  THR B CA   1 
ATOM   6204 C C    . THR B 1 266 ? 123.987 12.123 27.050  1.00 40.35  ? 267  THR B C    1 
ATOM   6205 O O    . THR B 1 266 ? 124.079 12.712 28.127  1.00 44.56  ? 267  THR B O    1 
ATOM   6206 C CB   . THR B 1 266 ? 122.419 10.194 26.614  1.00 40.21  ? 267  THR B CB   1 
ATOM   6207 O OG1  . THR B 1 266 ? 121.116 9.859  26.122  1.00 44.56  ? 267  THR B OG1  1 
ATOM   6208 C CG2  . THR B 1 266 ? 122.551 9.709  28.056  1.00 37.83  ? 267  THR B CG2  1 
ATOM   6209 N N    . GLU B 1 267 ? 125.045 11.835 26.287  1.00 44.54  ? 268  GLU B N    1 
ATOM   6210 C CA   . GLU B 1 267 ? 126.417 12.168 26.692  1.00 45.81  ? 268  GLU B CA   1 
ATOM   6211 C C    . GLU B 1 267 ? 126.601 13.678 26.788  1.00 38.53  ? 268  GLU B C    1 
ATOM   6212 O O    . GLU B 1 267 ? 127.202 14.197 27.725  1.00 37.47  ? 268  GLU B O    1 
ATOM   6213 C CB   . GLU B 1 267 ? 127.441 11.589 25.703  1.00 54.53  ? 268  GLU B CB   1 
ATOM   6214 C CG   . GLU B 1 267 ? 127.472 10.057 25.617  1.00 72.43  ? 268  GLU B CG   1 
ATOM   6215 C CD   . GLU B 1 267 ? 128.055 9.538  24.294  1.00 88.68  ? 268  GLU B CD   1 
ATOM   6216 O OE1  . GLU B 1 267 ? 128.609 10.351 23.515  1.00 95.41  ? 268  GLU B OE1  1 
ATOM   6217 O OE2  . GLU B 1 267 ? 127.950 8.314  24.030  1.00 91.31  ? 268  GLU B OE2  1 
ATOM   6218 N N    . LEU B 1 268 ? 126.067 14.381 25.805  1.00 36.91  ? 269  LEU B N    1 
ATOM   6219 C CA   . LEU B 1 268 ? 126.175 15.831 25.757  1.00 33.33  ? 269  LEU B CA   1 
ATOM   6220 C C    . LEU B 1 268 ? 125.553 16.480 27.001  1.00 32.52  ? 269  LEU B C    1 
ATOM   6221 O O    . LEU B 1 268 ? 126.174 17.324 27.656  1.00 34.90  ? 269  LEU B O    1 
ATOM   6222 C CB   . LEU B 1 268 ? 125.525 16.331 24.472  1.00 35.81  ? 269  LEU B CB   1 
ATOM   6223 C CG   . LEU B 1 268 ? 125.819 17.739 23.990  1.00 42.09  ? 269  LEU B CG   1 
ATOM   6224 C CD1  . LEU B 1 268 ? 125.481 17.854 22.512  1.00 36.30  ? 269  LEU B CD1  1 
ATOM   6225 C CD2  . LEU B 1 268 ? 124.970 18.701 24.800  1.00 48.05  ? 269  LEU B CD2  1 
ATOM   6226 N N    . VAL B 1 269 ? 124.348 16.059 27.364  1.00 31.26  ? 270  VAL B N    1 
ATOM   6227 C CA   . VAL B 1 269 ? 123.699 16.636 28.539  1.00 30.39  ? 270  VAL B CA   1 
ATOM   6228 C C    . VAL B 1 269 ? 124.401 16.239 29.841  1.00 36.19  ? 270  VAL B C    1 
ATOM   6229 O O    . VAL B 1 269 ? 124.524 17.050 30.763  1.00 35.40  ? 270  VAL B O    1 
ATOM   6230 C CB   . VAL B 1 269 ? 122.215 16.295 28.577  1.00 28.74  ? 270  VAL B CB   1 
ATOM   6231 C CG1  . VAL B 1 269 ? 121.578 16.849 29.825  1.00 30.51  ? 270  VAL B CG1  1 
ATOM   6232 C CG2  . VAL B 1 269 ? 121.540 16.891 27.356  1.00 33.27  ? 270  VAL B CG2  1 
ATOM   6233 N N    . ALA B 1 270 ? 124.881 15.001 29.905  1.00 30.65  ? 271  ALA B N    1 
ATOM   6234 C CA   . ALA B 1 270 ? 125.590 14.541 31.091  1.00 32.43  ? 271  ALA B CA   1 
ATOM   6235 C C    . ALA B 1 270 ? 126.844 15.389 31.315  1.00 35.28  ? 271  ALA B C    1 
ATOM   6236 O O    . ALA B 1 270 ? 127.145 15.764 32.440  1.00 35.91  ? 271  ALA B O    1 
ATOM   6237 C CB   . ALA B 1 270 ? 125.948 13.065 30.973  1.00 24.76  ? 271  ALA B CB   1 
ATOM   6238 N N    . CYS B 1 271 ? 127.570 15.696 30.244  1.00 33.18  ? 272  CYS B N    1 
ATOM   6239 C CA   . CYS B 1 271 ? 128.733 16.569 30.369  1.00 35.10  ? 272  CYS B CA   1 
ATOM   6240 C C    . CYS B 1 271 ? 128.331 17.992 30.810  1.00 31.29  ? 272  CYS B C    1 
ATOM   6241 O O    . CYS B 1 271 ? 128.912 18.537 31.752  1.00 38.33  ? 272  CYS B O    1 
ATOM   6242 C CB   . CYS B 1 271 ? 129.580 16.576 29.083  1.00 36.90  ? 272  CYS B CB   1 
ATOM   6243 S SG   . CYS B 1 271 ? 131.064 17.666 29.163  1.00 59.89  ? 272  CYS B SG   1 
ATOM   6244 N N    . LEU B 1 272 ? 127.334 18.578 30.149  1.00 26.72  ? 273  LEU B N    1 
ATOM   6245 C CA   . LEU B 1 272 ? 126.796 19.863 30.590  1.00 28.54  ? 273  LEU B CA   1 
ATOM   6246 C C    . LEU B 1 272 ? 126.441 19.864 32.069  1.00 30.00  ? 273  LEU B C    1 
ATOM   6247 O O    . LEU B 1 272 ? 126.685 20.852 32.752  1.00 32.28  ? 273  LEU B O    1 
ATOM   6248 C CB   . LEU B 1 272 ? 125.569 20.259 29.786  1.00 26.12  ? 273  LEU B CB   1 
ATOM   6249 C CG   . LEU B 1 272 ? 125.881 20.721 28.369  1.00 31.69  ? 273  LEU B CG   1 
ATOM   6250 C CD1  . LEU B 1 272 ? 124.591 20.847 27.565  1.00 27.17  ? 273  LEU B CD1  1 
ATOM   6251 C CD2  . LEU B 1 272 ? 126.642 22.038 28.396  1.00 28.12  ? 273  LEU B CD2  1 
ATOM   6252 N N    . ARG B 1 273 ? 125.878 18.762 32.562  1.00 26.80  ? 274  ARG B N    1 
ATOM   6253 C CA   . ARG B 1 273 ? 125.448 18.699 33.962  1.00 27.72  ? 274  ARG B CA   1 
ATOM   6254 C C    . ARG B 1 273 ? 126.622 18.758 34.933  1.00 30.67  ? 274  ARG B C    1 
ATOM   6255 O O    . ARG B 1 273 ? 126.451 19.149 36.079  1.00 26.40  ? 274  ARG B O    1 
ATOM   6256 C CB   . ARG B 1 273 ? 124.583 17.456 34.254  1.00 23.90  ? 274  ARG B CB   1 
ATOM   6257 C CG   . ARG B 1 273 ? 123.182 17.489 33.656  1.00 29.73  ? 274  ARG B CG   1 
ATOM   6258 C CD   . ARG B 1 273 ? 122.245 16.524 34.385  1.00 34.03  ? 274  ARG B CD   1 
ATOM   6259 N NE   . ARG B 1 273 ? 121.700 15.492 33.505  1.00 50.39  ? 274  ARG B NE   1 
ATOM   6260 C CZ   . ARG B 1 273 ? 120.474 15.509 32.977  1.00 55.70  ? 274  ARG B CZ   1 
ATOM   6261 N NH1  . ARG B 1 273 ? 119.636 16.506 33.229  1.00 48.87  ? 274  ARG B NH1  1 
ATOM   6262 N NH2  . ARG B 1 273 ? 120.079 14.518 32.190  1.00 63.19  ? 274  ARG B NH2  1 
ATOM   6263 N N    . THR B 1 274 ? 127.818 18.388 34.475  1.00 30.09  ? 275  THR B N    1 
ATOM   6264 C CA   . THR B 1 274 ? 128.994 18.446 35.351  1.00 28.85  ? 275  THR B CA   1 
ATOM   6265 C C    . THR B 1 274 ? 129.544 19.867 35.487  1.00 31.36  ? 275  THR B C    1 
ATOM   6266 O O    . THR B 1 274 ? 130.422 20.113 36.307  1.00 36.08  ? 275  THR B O    1 
ATOM   6267 C CB   . THR B 1 274 ? 130.141 17.490 34.881  1.00 38.70  ? 275  THR B CB   1 
ATOM   6268 O OG1  . THR B 1 274 ? 130.833 18.059 33.757  1.00 32.45  ? 275  THR B OG1  1 
ATOM   6269 C CG2  . THR B 1 274 ? 129.591 16.097 34.517  1.00 24.39  ? 275  THR B CG2  1 
ATOM   6270 N N    . ARG B 1 275 ? 129.040 20.802 34.684  1.00 26.35  ? 276  ARG B N    1 
ATOM   6271 C CA   . ARG B 1 275 ? 129.622 22.153 34.653  1.00 29.97  ? 276  ARG B CA   1 
ATOM   6272 C C    . ARG B 1 275 ? 129.016 23.089 35.702  1.00 28.68  ? 276  ARG B C    1 
ATOM   6273 O O    . ARG B 1 275 ? 127.799 23.153 35.847  1.00 29.51  ? 276  ARG B O    1 
ATOM   6274 C CB   . ARG B 1 275 ? 129.465 22.773 33.258  1.00 31.21  ? 276  ARG B CB   1 
ATOM   6275 C CG   . ARG B 1 275 ? 130.215 22.038 32.139  1.00 29.68  ? 276  ARG B CG   1 
ATOM   6276 C CD   . ARG B 1 275 ? 131.698 22.252 32.260  1.00 34.29  ? 276  ARG B CD   1 
ATOM   6277 N NE   . ARG B 1 275 ? 132.455 21.710 31.131  1.00 41.34  ? 276  ARG B NE   1 
ATOM   6278 C CZ   . ARG B 1 275 ? 133.150 20.576 31.169  1.00 37.54  ? 276  ARG B CZ   1 
ATOM   6279 N NH1  . ARG B 1 275 ? 133.180 19.852 32.274  1.00 41.28  ? 276  ARG B NH1  1 
ATOM   6280 N NH2  . ARG B 1 275 ? 133.816 20.166 30.102  1.00 35.18  ? 276  ARG B NH2  1 
ATOM   6281 N N    . PRO B 1 276 ? 129.869 23.812 36.445  1.00 30.92  ? 277  PRO B N    1 
ATOM   6282 C CA   . PRO B 1 276 ? 129.361 24.841 37.361  1.00 27.59  ? 277  PRO B CA   1 
ATOM   6283 C C    . PRO B 1 276 ? 128.405 25.768 36.612  1.00 32.02  ? 277  PRO B C    1 
ATOM   6284 O O    . PRO B 1 276 ? 128.682 26.123 35.466  1.00 24.11  ? 277  PRO B O    1 
ATOM   6285 C CB   . PRO B 1 276 ? 130.618 25.627 37.745  1.00 24.46  ? 277  PRO B CB   1 
ATOM   6286 C CG   . PRO B 1 276 ? 131.762 24.665 37.558  1.00 27.21  ? 277  PRO B CG   1 
ATOM   6287 C CD   . PRO B 1 276 ? 131.344 23.733 36.438  1.00 32.01  ? 277  PRO B CD   1 
ATOM   6288 N N    . ALA B 1 277 ? 127.302 26.143 37.246  1.00 32.14  ? 278  ALA B N    1 
ATOM   6289 C CA   . ALA B 1 277 ? 126.306 26.991 36.611  1.00 34.49  ? 278  ALA B CA   1 
ATOM   6290 C C    . ALA B 1 277 ? 126.911 28.247 35.997  1.00 29.09  ? 278  ALA B C    1 
ATOM   6291 O O    . ALA B 1 277 ? 126.534 28.647 34.897  1.00 25.18  ? 278  ALA B O    1 
ATOM   6292 C CB   . ALA B 1 277 ? 125.209 27.355 37.602  1.00 33.28  ? 278  ALA B CB   1 
ATOM   6293 N N    . GLN B 1 278 ? 127.850 28.868 36.699  1.00 27.87  ? 279  GLN B N    1 
ATOM   6294 C CA   . GLN B 1 278 ? 128.418 30.117 36.212  1.00 24.42  ? 279  GLN B CA   1 
ATOM   6295 C C    . GLN B 1 278 ? 129.122 29.933 34.853  1.00 28.44  ? 279  GLN B C    1 
ATOM   6296 O O    . GLN B 1 278 ? 129.223 30.869 34.061  1.00 26.79  ? 279  GLN B O    1 
ATOM   6297 C CB   . GLN B 1 278 ? 129.362 30.722 37.253  1.00 22.37  ? 279  GLN B CB   1 
ATOM   6298 C CG   . GLN B 1 278 ? 129.839 32.135 36.912  1.00 30.42  ? 279  GLN B CG   1 
ATOM   6299 C CD   . GLN B 1 278 ? 128.691 33.117 36.660  1.00 37.91  ? 279  GLN B CD   1 
ATOM   6300 O OE1  . GLN B 1 278 ? 127.780 33.262 37.480  1.00 41.90  ? 279  GLN B OE1  1 
ATOM   6301 N NE2  . GLN B 1 278 ? 128.740 33.796 35.521  1.00 37.66  ? 279  GLN B NE2  1 
ATOM   6302 N N    . VAL B 1 279 ? 129.594 28.720 34.584  1.00 27.27  ? 280  VAL B N    1 
ATOM   6303 C CA   . VAL B 1 279 ? 130.297 28.445 33.342  1.00 31.55  ? 280  VAL B CA   1 
ATOM   6304 C C    . VAL B 1 279 ? 129.357 28.478 32.127  1.00 29.68  ? 280  VAL B C    1 
ATOM   6305 O O    . VAL B 1 279 ? 129.729 28.977 31.074  1.00 28.05  ? 280  VAL B O    1 
ATOM   6306 C CB   . VAL B 1 279 ? 131.074 27.114 33.420  1.00 33.01  ? 280  VAL B CB   1 
ATOM   6307 C CG1  . VAL B 1 279 ? 131.463 26.635 32.030  1.00 31.15  ? 280  VAL B CG1  1 
ATOM   6308 C CG2  . VAL B 1 279 ? 132.313 27.283 34.293  1.00 25.88  ? 280  VAL B CG2  1 
ATOM   6309 N N    . LEU B 1 280 ? 128.142 27.964 32.276  1.00 28.31  ? 281  LEU B N    1 
ATOM   6310 C CA   . LEU B 1 280 ? 127.165 28.044 31.186  1.00 30.63  ? 281  LEU B CA   1 
ATOM   6311 C C    . LEU B 1 280 ? 126.803 29.500 30.928  1.00 35.59  ? 281  LEU B C    1 
ATOM   6312 O O    . LEU B 1 280 ? 126.843 29.971 29.785  1.00 39.08  ? 281  LEU B O    1 
ATOM   6313 C CB   . LEU B 1 280 ? 125.911 27.240 31.505  1.00 20.31  ? 281  LEU B CB   1 
ATOM   6314 C CG   . LEU B 1 280 ? 126.124 25.806 31.994  1.00 25.16  ? 281  LEU B CG   1 
ATOM   6315 C CD1  . LEU B 1 280 ? 124.807 25.019 31.937  1.00 32.62  ? 281  LEU B CD1  1 
ATOM   6316 C CD2  . LEU B 1 280 ? 127.184 25.103 31.173  1.00 22.14  ? 281  LEU B CD2  1 
ATOM   6317 N N    . VAL B 1 281 ? 126.468 30.212 32.000  1.00 28.34  ? 282  VAL B N    1 
ATOM   6318 C CA   . VAL B 1 281 ? 126.170 31.641 31.921  1.00 30.87  ? 282  VAL B CA   1 
ATOM   6319 C C    . VAL B 1 281 ? 127.237 32.437 31.156  1.00 29.52  ? 282  VAL B C    1 
ATOM   6320 O O    . VAL B 1 281 ? 126.905 33.255 30.294  1.00 31.33  ? 282  VAL B O    1 
ATOM   6321 C CB   . VAL B 1 281 ? 125.955 32.242 33.328  1.00 29.91  ? 282  VAL B CB   1 
ATOM   6322 C CG1  . VAL B 1 281 ? 125.841 33.749 33.263  1.00 33.14  ? 282  VAL B CG1  1 
ATOM   6323 C CG2  . VAL B 1 281 ? 124.703 31.641 33.971  1.00 26.15  ? 282  VAL B CG2  1 
ATOM   6324 N N    . ASN B 1 282 ? 128.508 32.192 31.462  1.00 26.66  ? 283  ASN B N    1 
ATOM   6325 C CA   . ASN B 1 282 ? 129.608 32.917 30.822  1.00 27.41  ? 283  ASN B CA   1 
ATOM   6326 C C    . ASN B 1 282 ? 129.677 32.782 29.304  1.00 26.85  ? 283  ASN B C    1 
ATOM   6327 O O    . ASN B 1 282 ? 130.331 33.581 28.651  1.00 30.96  ? 283  ASN B O    1 
ATOM   6328 C CB   . ASN B 1 282 ? 130.960 32.500 31.419  1.00 29.42  ? 283  ASN B CB   1 
ATOM   6329 C CG   . ASN B 1 282 ? 131.090 32.871 32.880  1.00 38.26  ? 283  ASN B CG   1 
ATOM   6330 O OD1  . ASN B 1 282 ? 130.285 33.641 33.410  1.00 38.44  ? 283  ASN B OD1  1 
ATOM   6331 N ND2  . ASN B 1 282 ? 132.109 32.318 33.547  1.00 37.71  ? 283  ASN B ND2  1 
ATOM   6332 N N    . HIS B 1 283 ? 129.012 31.775 28.746  1.00 24.48  ? 284  HIS B N    1 
ATOM   6333 C CA   . HIS B 1 283 ? 129.078 31.540 27.303  1.00 32.35  ? 284  HIS B CA   1 
ATOM   6334 C C    . HIS B 1 283 ? 127.732 31.665 26.584  1.00 33.66  ? 284  HIS B C    1 
ATOM   6335 O O    . HIS B 1 283 ? 127.686 31.605 25.353  1.00 32.52  ? 284  HIS B O    1 
ATOM   6336 C CB   . HIS B 1 283 ? 129.711 30.169 27.010  1.00 28.90  ? 284  HIS B CB   1 
ATOM   6337 C CG   . HIS B 1 283 ? 131.143 30.072 27.435  1.00 41.02  ? 284  HIS B CG   1 
ATOM   6338 N ND1  . HIS B 1 283 ? 131.522 29.599 28.671  1.00 42.74  ? 284  HIS B ND1  1 
ATOM   6339 C CD2  . HIS B 1 283 ? 132.283 30.415 26.788  1.00 34.09  ? 284  HIS B CD2  1 
ATOM   6340 C CE1  . HIS B 1 283 ? 132.844 29.638 28.765  1.00 43.06  ? 284  HIS B CE1  1 
ATOM   6341 N NE2  . HIS B 1 283 ? 133.326 30.125 27.639  1.00 40.74  ? 284  HIS B NE2  1 
ATOM   6342 N N    . GLU B 1 284 ? 126.660 31.851 27.351  1.00 29.74  ? 285  GLU B N    1 
ATOM   6343 C CA   . GLU B 1 284 ? 125.296 31.935 26.809  1.00 34.06  ? 285  GLU B CA   1 
ATOM   6344 C C    . GLU B 1 284 ? 125.131 32.874 25.620  1.00 28.66  ? 285  GLU B C    1 
ATOM   6345 O O    . GLU B 1 284 ? 124.460 32.523 24.656  1.00 32.04  ? 285  GLU B O    1 
ATOM   6346 C CB   . GLU B 1 284 ? 124.291 32.333 27.894  1.00 37.20  ? 285  GLU B CB   1 
ATOM   6347 C CG   . GLU B 1 284 ? 123.741 31.160 28.688  1.00 55.25  ? 285  GLU B CG   1 
ATOM   6348 C CD   . GLU B 1 284 ? 122.628 31.582 29.644  1.00 62.34  ? 285  GLU B CD   1 
ATOM   6349 O OE1  . GLU B 1 284 ? 122.095 32.712 29.457  1.00 59.12  ? 285  GLU B OE1  1 
ATOM   6350 O OE2  . GLU B 1 284 ? 122.299 30.783 30.571  1.00 54.86  ? 285  GLU B OE2  1 
ATOM   6351 N N    . TRP B 1 285 ? 125.739 34.054 25.686  1.00 24.54  ? 286  TRP B N    1 
ATOM   6352 C CA   . TRP B 1 285 ? 125.543 35.054 24.641  1.00 29.88  ? 286  TRP B CA   1 
ATOM   6353 C C    . TRP B 1 285 ? 126.176 34.664 23.311  1.00 31.13  ? 286  TRP B C    1 
ATOM   6354 O O    . TRP B 1 285 ? 125.705 35.066 22.239  1.00 32.16  ? 286  TRP B O    1 
ATOM   6355 C CB   . TRP B 1 285 ? 126.029 36.427 25.109  1.00 27.24  ? 286  TRP B CB   1 
ATOM   6356 C CG   . TRP B 1 285 ? 125.091 37.025 26.127  1.00 40.75  ? 286  TRP B CG   1 
ATOM   6357 C CD1  . TRP B 1 285 ? 125.291 37.119 27.477  1.00 42.56  ? 286  TRP B CD1  1 
ATOM   6358 C CD2  . TRP B 1 285 ? 123.791 37.582 25.874  1.00 36.71  ? 286  TRP B CD2  1 
ATOM   6359 N NE1  . TRP B 1 285 ? 124.205 37.713 28.073  1.00 39.63  ? 286  TRP B NE1  1 
ATOM   6360 C CE2  . TRP B 1 285 ? 123.270 38.005 27.114  1.00 38.06  ? 286  TRP B CE2  1 
ATOM   6361 C CE3  . TRP B 1 285 ? 123.023 37.767 24.720  1.00 34.00  ? 286  TRP B CE3  1 
ATOM   6362 C CZ2  . TRP B 1 285 ? 122.007 38.600 27.232  1.00 36.50  ? 286  TRP B CZ2  1 
ATOM   6363 C CZ3  . TRP B 1 285 ? 121.776 38.363 24.837  1.00 30.15  ? 286  TRP B CZ3  1 
ATOM   6364 C CH2  . TRP B 1 285 ? 121.281 38.774 26.082  1.00 30.01  ? 286  TRP B CH2  1 
ATOM   6365 N N    . HIS B 1 286 ? 127.212 33.839 23.385  1.00 26.85  ? 287  HIS B N    1 
ATOM   6366 C CA   . HIS B 1 286 ? 128.018 33.526 22.213  1.00 34.78  ? 287  HIS B CA   1 
ATOM   6367 C C    . HIS B 1 286 ? 127.392 32.518 21.255  1.00 34.91  ? 287  HIS B C    1 
ATOM   6368 O O    . HIS B 1 286 ? 127.925 32.282 20.175  1.00 42.02  ? 287  HIS B O    1 
ATOM   6369 C CB   . HIS B 1 286 ? 129.426 33.126 22.653  1.00 41.95  ? 287  HIS B CB   1 
ATOM   6370 C CG   . HIS B 1 286 ? 130.114 34.199 23.444  1.00 68.04  ? 287  HIS B CG   1 
ATOM   6371 N ND1  . HIS B 1 286 ? 130.000 34.309 24.817  1.00 73.86  ? 287  HIS B ND1  1 
ATOM   6372 C CD2  . HIS B 1 286 ? 130.879 35.245 23.046  1.00 73.55  ? 287  HIS B CD2  1 
ATOM   6373 C CE1  . HIS B 1 286 ? 130.689 35.358 25.231  1.00 74.55  ? 287  HIS B CE1  1 
ATOM   6374 N NE2  . HIS B 1 286 ? 131.229 35.944 24.176  1.00 75.49  ? 287  HIS B NE2  1 
ATOM   6375 N N    . VAL B 1 287 ? 126.243 31.952 21.620  1.00 32.18  ? 288  VAL B N    1 
ATOM   6376 C CA   . VAL B 1 287 ? 125.596 30.987 20.724  1.00 33.24  ? 288  VAL B CA   1 
ATOM   6377 C C    . VAL B 1 287 ? 124.598 31.611 19.744  1.00 36.30  ? 288  VAL B C    1 
ATOM   6378 O O    . VAL B 1 287 ? 124.061 30.922 18.871  1.00 39.83  ? 288  VAL B O    1 
ATOM   6379 C CB   . VAL B 1 287 ? 124.933 29.848 21.490  1.00 33.43  ? 288  VAL B CB   1 
ATOM   6380 C CG1  . VAL B 1 287 ? 125.911 29.277 22.515  1.00 36.04  ? 288  VAL B CG1  1 
ATOM   6381 C CG2  . VAL B 1 287 ? 123.680 30.348 22.154  1.00 20.68  ? 288  VAL B CG2  1 
ATOM   6382 N N    . LEU B 1 288 ? 124.352 32.910 19.886  1.00 38.30  ? 289  LEU B N    1 
ATOM   6383 C CA   . LEU B 1 288 ? 123.521 33.619 18.918  1.00 37.12  ? 289  LEU B CA   1 
ATOM   6384 C C    . LEU B 1 288 ? 124.229 33.651 17.562  1.00 36.18  ? 289  LEU B C    1 
ATOM   6385 O O    . LEU B 1 288 ? 125.446 33.839 17.490  1.00 35.17  ? 289  LEU B O    1 
ATOM   6386 C CB   . LEU B 1 288 ? 123.190 35.038 19.396  1.00 31.89  ? 289  LEU B CB   1 
ATOM   6387 C CG   . LEU B 1 288 ? 122.124 35.145 20.492  1.00 34.15  ? 289  LEU B CG   1 
ATOM   6388 C CD1  . LEU B 1 288 ? 122.061 36.564 21.052  1.00 29.49  ? 289  LEU B CD1  1 
ATOM   6389 C CD2  . LEU B 1 288 ? 120.752 34.681 19.986  1.00 29.68  ? 289  LEU B CD2  1 
ATOM   6390 N N    . PRO B 1 289 ? 123.455 33.454 16.483  1.00 37.95  ? 290  PRO B N    1 
ATOM   6391 C CA   . PRO B 1 289 ? 123.950 33.406 15.099  1.00 36.03  ? 290  PRO B CA   1 
ATOM   6392 C C    . PRO B 1 289 ? 124.554 34.727 14.621  1.00 41.04  ? 290  PRO B C    1 
ATOM   6393 O O    . PRO B 1 289 ? 125.350 34.710 13.688  1.00 43.77  ? 290  PRO B O    1 
ATOM   6394 C CB   . PRO B 1 289 ? 122.690 33.081 14.288  1.00 35.26  ? 290  PRO B CB   1 
ATOM   6395 C CG   . PRO B 1 289 ? 121.546 33.571 15.147  1.00 34.20  ? 290  PRO B CG   1 
ATOM   6396 C CD   . PRO B 1 289 ? 121.989 33.282 16.557  1.00 31.88  ? 290  PRO B CD   1 
ATOM   6397 N N    . GLN B 1 290 ? 124.193 35.853 15.232  1.00 43.69  ? 291  GLN B N    1 
ATOM   6398 C CA   . GLN B 1 290 ? 124.831 37.124 14.865  1.00 49.41  ? 291  GLN B CA   1 
ATOM   6399 C C    . GLN B 1 290 ? 124.740 38.186 15.959  1.00 44.85  ? 291  GLN B C    1 
ATOM   6400 O O    . GLN B 1 290 ? 124.037 38.020 16.960  1.00 41.93  ? 291  GLN B O    1 
ATOM   6401 C CB   . GLN B 1 290 ? 124.240 37.689 13.565  1.00 50.98  ? 291  GLN B CB   1 
ATOM   6402 C CG   . GLN B 1 290 ? 122.833 38.253 13.744  1.00 56.46  ? 291  GLN B CG   1 
ATOM   6403 C CD   . GLN B 1 290 ? 122.398 39.177 12.615  1.00 65.56  ? 291  GLN B CD   1 
ATOM   6404 O OE1  . GLN B 1 290 ? 121.822 38.730 11.619  1.00 67.08  ? 291  GLN B OE1  1 
ATOM   6405 N NE2  . GLN B 1 290 ? 122.656 40.480 12.776  1.00 63.72  ? 291  GLN B NE2  1 
ATOM   6406 N N    . GLU B 1 291 ? 125.475 39.273 15.754  1.00 47.23  ? 292  GLU B N    1 
ATOM   6407 C CA   . GLU B 1 291 ? 125.351 40.460 16.581  1.00 52.09  ? 292  GLU B CA   1 
ATOM   6408 C C    . GLU B 1 291 ? 123.938 41.030 16.413  1.00 48.91  ? 292  GLU B C    1 
ATOM   6409 O O    . GLU B 1 291 ? 123.412 41.113 15.297  1.00 51.72  ? 292  GLU B O    1 
ATOM   6410 C CB   . GLU B 1 291 ? 126.388 41.503 16.159  1.00 65.76  ? 292  GLU B CB   1 
ATOM   6411 C CG   . GLU B 1 291 ? 126.091 42.915 16.657  1.00 78.19  ? 292  GLU B CG   1 
ATOM   6412 C CD   . GLU B 1 291 ? 126.954 43.981 15.994  1.00 87.06  ? 292  GLU B CD   1 
ATOM   6413 O OE1  . GLU B 1 291 ? 127.509 43.718 14.901  1.00 83.84  ? 292  GLU B OE1  1 
ATOM   6414 O OE2  . GLU B 1 291 ? 127.074 45.085 16.573  1.00 92.58  ? 292  GLU B OE2  1 
ATOM   6415 N N    . SER B 1 292 ? 123.324 41.425 17.522  1.00 39.17  ? 293  SER B N    1 
ATOM   6416 C CA   . SER B 1 292 ? 121.947 41.890 17.490  1.00 36.95  ? 293  SER B CA   1 
ATOM   6417 C C    . SER B 1 292 ? 121.550 42.598 18.775  1.00 35.49  ? 293  SER B C    1 
ATOM   6418 O O    . SER B 1 292 ? 122.265 42.540 19.779  1.00 37.79  ? 293  SER B O    1 
ATOM   6419 C CB   . SER B 1 292 ? 121.012 40.702 17.268  1.00 33.52  ? 293  SER B CB   1 
ATOM   6420 O OG   . SER B 1 292 ? 121.197 39.727 18.275  1.00 34.27  ? 293  SER B OG   1 
ATOM   6421 N N    . VAL B 1 293 ? 120.406 43.275 18.734  1.00 29.18  ? 294  VAL B N    1 
ATOM   6422 C CA   . VAL B 1 293 ? 119.720 43.650 19.966  1.00 28.50  ? 294  VAL B CA   1 
ATOM   6423 C C    . VAL B 1 293 ? 118.370 42.928 19.996  1.00 28.80  ? 294  VAL B C    1 
ATOM   6424 O O    . VAL B 1 293 ? 117.850 42.510 18.950  1.00 31.10  ? 294  VAL B O    1 
ATOM   6425 C CB   . VAL B 1 293 ? 119.545 45.180 20.109  1.00 32.49  ? 294  VAL B CB   1 
ATOM   6426 C CG1  . VAL B 1 293 ? 120.900 45.882 20.033  1.00 33.93  ? 294  VAL B CG1  1 
ATOM   6427 C CG2  . VAL B 1 293 ? 118.615 45.717 19.033  1.00 23.51  ? 294  VAL B CG2  1 
ATOM   6428 N N    . PHE B 1 294 ? 117.822 42.752 21.190  1.00 28.42  ? 295  PHE B N    1 
ATOM   6429 C CA   . PHE B 1 294 ? 116.516 42.111 21.356  1.00 31.03  ? 295  PHE B CA   1 
ATOM   6430 C C    . PHE B 1 294 ? 116.469 40.652 20.876  1.00 30.20  ? 295  PHE B C    1 
ATOM   6431 O O    . PHE B 1 294 ? 115.429 40.176 20.425  1.00 30.46  ? 295  PHE B O    1 
ATOM   6432 C CB   . PHE B 1 294 ? 115.419 42.951 20.682  1.00 25.24  ? 295  PHE B CB   1 
ATOM   6433 C CG   . PHE B 1 294 ? 114.188 43.121 21.525  1.00 24.73  ? 295  PHE B CG   1 
ATOM   6434 C CD1  . PHE B 1 294 ? 113.534 42.017 22.058  1.00 19.54  ? 295  PHE B CD1  1 
ATOM   6435 C CD2  . PHE B 1 294 ? 113.673 44.384 21.779  1.00 28.69  ? 295  PHE B CD2  1 
ATOM   6436 C CE1  . PHE B 1 294 ? 112.385 42.163 22.827  1.00 21.34  ? 295  PHE B CE1  1 
ATOM   6437 C CE2  . PHE B 1 294 ? 112.526 44.539 22.548  1.00 20.17  ? 295  PHE B CE2  1 
ATOM   6438 C CZ   . PHE B 1 294 ? 111.885 43.428 23.081  1.00 19.48  ? 295  PHE B CZ   1 
ATOM   6439 N N    . ARG B 1 295 ? 117.602 39.954 20.965  1.00 23.87  ? 296  ARG B N    1 
ATOM   6440 C CA   . ARG B 1 295 ? 117.633 38.509 20.757  1.00 21.73  ? 296  ARG B CA   1 
ATOM   6441 C C    . ARG B 1 295 ? 118.329 37.850 21.935  1.00 26.38  ? 296  ARG B C    1 
ATOM   6442 O O    . ARG B 1 295 ? 119.323 38.375 22.460  1.00 25.32  ? 296  ARG B O    1 
ATOM   6443 C CB   . ARG B 1 295 ? 118.344 38.111 19.460  1.00 21.44  ? 296  ARG B CB   1 
ATOM   6444 C CG   . ARG B 1 295 ? 117.611 38.489 18.176  1.00 29.94  ? 296  ARG B CG   1 
ATOM   6445 C CD   . ARG B 1 295 ? 116.231 37.855 18.043  1.00 34.82  ? 296  ARG B CD   1 
ATOM   6446 N NE   . ARG B 1 295 ? 115.627 38.249 16.770  1.00 43.08  ? 296  ARG B NE   1 
ATOM   6447 C CZ   . ARG B 1 295 ? 114.844 39.315 16.603  1.00 42.82  ? 296  ARG B CZ   1 
ATOM   6448 N NH1  . ARG B 1 295 ? 114.535 40.092 17.630  1.00 36.47  ? 296  ARG B NH1  1 
ATOM   6449 N NH2  . ARG B 1 295 ? 114.359 39.599 15.403  1.00 51.23  ? 296  ARG B NH2  1 
ATOM   6450 N N    . PHE B 1 296 ? 117.812 36.691 22.331  1.00 21.55  ? 297  PHE B N    1 
ATOM   6451 C CA   . PHE B 1 296 ? 118.317 35.976 23.501  1.00 26.58  ? 297  PHE B CA   1 
ATOM   6452 C C    . PHE B 1 296 ? 118.527 34.515 23.148  1.00 26.95  ? 297  PHE B C    1 
ATOM   6453 O O    . PHE B 1 296 ? 117.795 33.953 22.321  1.00 26.09  ? 297  PHE B O    1 
ATOM   6454 C CB   . PHE B 1 296 ? 117.335 36.153 24.663  1.00 26.20  ? 297  PHE B CB   1 
ATOM   6455 C CG   . PHE B 1 296 ? 116.685 37.501 24.673  1.00 24.92  ? 297  PHE B CG   1 
ATOM   6456 C CD1  . PHE B 1 296 ? 117.417 38.634 25.006  1.00 18.56  ? 297  PHE B CD1  1 
ATOM   6457 C CD2  . PHE B 1 296 ? 115.360 37.648 24.295  1.00 22.89  ? 297  PHE B CD2  1 
ATOM   6458 C CE1  . PHE B 1 296 ? 116.825 39.889 24.990  1.00 28.12  ? 297  PHE B CE1  1 
ATOM   6459 C CE2  . PHE B 1 296 ? 114.754 38.913 24.273  1.00 20.67  ? 297  PHE B CE2  1 
ATOM   6460 C CZ   . PHE B 1 296 ? 115.488 40.031 24.623  1.00 24.52  ? 297  PHE B CZ   1 
ATOM   6461 N N    . SER B 1 297 ? 119.532 33.900 23.762  1.00 29.45  ? 298  SER B N    1 
ATOM   6462 C CA   . SER B 1 297 ? 119.992 32.584 23.307  1.00 29.02  ? 298  SER B CA   1 
ATOM   6463 C C    . SER B 1 297 ? 119.021 31.440 23.556  1.00 26.76  ? 298  SER B C    1 
ATOM   6464 O O    . SER B 1 297 ? 118.777 30.616 22.670  1.00 26.63  ? 298  SER B O    1 
ATOM   6465 C CB   . SER B 1 297 ? 121.352 32.254 23.921  1.00 33.92  ? 298  SER B CB   1 
ATOM   6466 O OG   . SER B 1 297 ? 122.316 33.199 23.506  1.00 39.71  ? 298  SER B OG   1 
ATOM   6467 N N    . PHE B 1 298 ? 118.480 31.368 24.765  1.00 17.89  ? 299  PHE B N    1 
ATOM   6468 C CA   . PHE B 1 298 ? 117.663 30.216 25.126  1.00 18.73  ? 299  PHE B CA   1 
ATOM   6469 C C    . PHE B 1 298 ? 116.261 30.641 25.469  1.00 20.92  ? 299  PHE B C    1 
ATOM   6470 O O    . PHE B 1 298 ? 116.039 31.250 26.522  1.00 18.06  ? 299  PHE B O    1 
ATOM   6471 C CB   . PHE B 1 298 ? 118.314 29.436 26.276  1.00 20.66  ? 299  PHE B CB   1 
ATOM   6472 C CG   . PHE B 1 298 ? 119.610 28.827 25.886  1.00 26.15  ? 299  PHE B CG   1 
ATOM   6473 C CD1  . PHE B 1 298 ? 119.631 27.705 25.066  1.00 18.25  ? 299  PHE B CD1  1 
ATOM   6474 C CD2  . PHE B 1 298 ? 120.814 29.416 26.257  1.00 19.25  ? 299  PHE B CD2  1 
ATOM   6475 C CE1  . PHE B 1 298 ? 120.838 27.147 24.652  1.00 18.82  ? 299  PHE B CE1  1 
ATOM   6476 C CE2  . PHE B 1 298 ? 122.025 28.859 25.844  1.00 23.95  ? 299  PHE B CE2  1 
ATOM   6477 C CZ   . PHE B 1 298 ? 122.034 27.725 25.042  1.00 21.26  ? 299  PHE B CZ   1 
ATOM   6478 N N    . VAL B 1 299 ? 115.333 30.337 24.561  1.00 17.19  ? 300  VAL B N    1 
ATOM   6479 C CA   . VAL B 1 299 ? 113.949 30.763 24.695  1.00 17.87  ? 300  VAL B CA   1 
ATOM   6480 C C    . VAL B 1 299 ? 113.001 29.578 24.513  1.00 18.61  ? 300  VAL B C    1 
ATOM   6481 O O    . VAL B 1 299 ? 113.447 28.472 24.216  1.00 18.19  ? 300  VAL B O    1 
ATOM   6482 C CB   . VAL B 1 299 ? 113.611 31.933 23.726  1.00 20.50  ? 300  VAL B CB   1 
ATOM   6483 C CG1  . VAL B 1 299 ? 114.515 33.111 24.016  1.00 17.28  ? 300  VAL B CG1  1 
ATOM   6484 C CG2  . VAL B 1 299 ? 113.745 31.503 22.275  1.00 17.69  ? 300  VAL B CG2  1 
ATOM   6485 N N    . PRO B 1 300 ? 111.697 29.790 24.745  1.00 24.77  ? 301  PRO B N    1 
ATOM   6486 C CA   . PRO B 1 300 ? 110.747 28.694 24.498  1.00 21.61  ? 301  PRO B CA   1 
ATOM   6487 C C    . PRO B 1 300 ? 110.896 28.114 23.092  1.00 22.49  ? 301  PRO B C    1 
ATOM   6488 O O    . PRO B 1 300 ? 111.050 28.862 22.117  1.00 27.79  ? 301  PRO B O    1 
ATOM   6489 C CB   . PRO B 1 300 ? 109.391 29.378 24.668  1.00 19.82  ? 301  PRO B CB   1 
ATOM   6490 C CG   . PRO B 1 300 ? 109.674 30.385 25.775  1.00 19.53  ? 301  PRO B CG   1 
ATOM   6491 C CD   . PRO B 1 300 ? 111.073 30.924 25.455  1.00 19.49  ? 301  PRO B CD   1 
ATOM   6492 N N    . VAL B 1 301 ? 110.872 26.787 23.002  1.00 25.00  ? 302  VAL B N    1 
ATOM   6493 C CA   . VAL B 1 301 ? 110.981 26.098 21.725  1.00 24.36  ? 302  VAL B CA   1 
ATOM   6494 C C    . VAL B 1 301 ? 109.615 25.566 21.265  1.00 24.60  ? 302  VAL B C    1 
ATOM   6495 O O    . VAL B 1 301 ? 108.850 25.020 22.059  1.00 26.91  ? 302  VAL B O    1 
ATOM   6496 C CB   . VAL B 1 301 ? 112.013 24.936 21.813  1.00 29.05  ? 302  VAL B CB   1 
ATOM   6497 C CG1  . VAL B 1 301 ? 111.603 23.935 22.879  1.00 34.45  ? 302  VAL B CG1  1 
ATOM   6498 C CG2  . VAL B 1 301 ? 112.175 24.245 20.469  1.00 23.38  ? 302  VAL B CG2  1 
ATOM   6499 N N    . VAL B 1 302 ? 109.309 25.733 19.983  1.00 23.62  ? 303  VAL B N    1 
ATOM   6500 C CA   . VAL B 1 302 ? 108.116 25.121 19.405  1.00 22.54  ? 303  VAL B CA   1 
ATOM   6501 C C    . VAL B 1 302 ? 108.445 23.707 18.960  1.00 28.90  ? 303  VAL B C    1 
ATOM   6502 O O    . VAL B 1 302 ? 109.055 23.501 17.904  1.00 30.56  ? 303  VAL B O    1 
ATOM   6503 C CB   . VAL B 1 302 ? 107.582 25.915 18.192  1.00 27.25  ? 303  VAL B CB   1 
ATOM   6504 C CG1  . VAL B 1 302 ? 106.281 25.280 17.650  1.00 25.53  ? 303  VAL B CG1  1 
ATOM   6505 C CG2  . VAL B 1 302 ? 107.345 27.371 18.579  1.00 25.05  ? 303  VAL B CG2  1 
ATOM   6506 N N    . ASP B 1 303 ? 108.028 22.730 19.756  1.00 29.70  ? 304  ASP B N    1 
ATOM   6507 C CA   . ASP B 1 303 ? 108.384 21.343 19.483  1.00 34.57  ? 304  ASP B CA   1 
ATOM   6508 C C    . ASP B 1 303 ? 107.153 20.439 19.450  1.00 38.02  ? 304  ASP B C    1 
ATOM   6509 O O    . ASP B 1 303 ? 107.282 19.217 19.441  1.00 37.03  ? 304  ASP B O    1 
ATOM   6510 C CB   . ASP B 1 303 ? 109.369 20.835 20.534  1.00 36.26  ? 304  ASP B CB   1 
ATOM   6511 C CG   . ASP B 1 303 ? 108.793 20.887 21.947  1.00 49.72  ? 304  ASP B CG   1 
ATOM   6512 O OD1  . ASP B 1 303 ? 107.746 21.559 22.157  1.00 52.60  ? 304  ASP B OD1  1 
ATOM   6513 O OD2  . ASP B 1 303 ? 109.402 20.269 22.851  1.00 53.85  ? 304  ASP B OD2  1 
ATOM   6514 N N    . GLY B 1 304 ? 105.963 21.036 19.450  1.00 32.72  ? 305  GLY B N    1 
ATOM   6515 C CA   . GLY B 1 304 ? 104.737 20.260 19.351  1.00 36.50  ? 305  GLY B CA   1 
ATOM   6516 C C    . GLY B 1 304 ? 104.167 19.804 20.686  1.00 43.52  ? 305  GLY B C    1 
ATOM   6517 O O    . GLY B 1 304 ? 103.060 19.259 20.731  1.00 43.66  ? 305  GLY B O    1 
ATOM   6518 N N    . ASP B 1 305 ? 104.916 20.029 21.766  1.00 38.45  ? 306  ASP B N    1 
ATOM   6519 C CA   . ASP B 1 305 ? 104.478 19.664 23.111  1.00 38.02  ? 306  ASP B CA   1 
ATOM   6520 C C    . ASP B 1 305 ? 103.815 20.856 23.834  1.00 37.14  ? 306  ASP B C    1 
ATOM   6521 O O    . ASP B 1 305 ? 102.600 21.055 23.711  1.00 34.67  ? 306  ASP B O    1 
ATOM   6522 C CB   . ASP B 1 305 ? 105.654 19.108 23.927  1.00 43.56  ? 306  ASP B CB   1 
ATOM   6523 C CG   . ASP B 1 305 ? 105.200 18.323 25.163  1.00 52.27  ? 306  ASP B CG   1 
ATOM   6524 O OD1  . ASP B 1 305 ? 103.971 18.249 25.431  1.00 47.86  ? 306  ASP B OD1  1 
ATOM   6525 O OD2  . ASP B 1 305 ? 106.082 17.777 25.868  1.00 58.14  ? 306  ASP B OD2  1 
ATOM   6526 N N    . PHE B 1 306 ? 104.597 21.648 24.577  1.00 31.01  ? 307  PHE B N    1 
ATOM   6527 C CA   . PHE B 1 306 ? 104.026 22.803 25.270  1.00 25.74  ? 307  PHE B CA   1 
ATOM   6528 C C    . PHE B 1 306 ? 103.201 23.667 24.302  1.00 29.62  ? 307  PHE B C    1 
ATOM   6529 O O    . PHE B 1 306 ? 102.071 24.052 24.606  1.00 33.39  ? 307  PHE B O    1 
ATOM   6530 C CB   . PHE B 1 306 ? 105.100 23.646 25.956  1.00 22.03  ? 307  PHE B CB   1 
ATOM   6531 C CG   . PHE B 1 306 ? 104.551 24.607 26.985  1.00 28.62  ? 307  PHE B CG   1 
ATOM   6532 C CD1  . PHE B 1 306 ? 103.994 25.823 26.592  1.00 21.24  ? 307  PHE B CD1  1 
ATOM   6533 C CD2  . PHE B 1 306 ? 104.576 24.289 28.346  1.00 21.72  ? 307  PHE B CD2  1 
ATOM   6534 C CE1  . PHE B 1 306 ? 103.468 26.722 27.541  1.00 22.99  ? 307  PHE B CE1  1 
ATOM   6535 C CE2  . PHE B 1 306 ? 104.071 25.178 29.306  1.00 29.24  ? 307  PHE B CE2  1 
ATOM   6536 C CZ   . PHE B 1 306 ? 103.505 26.404 28.901  1.00 22.11  ? 307  PHE B CZ   1 
ATOM   6537 N N    . LEU B 1 307 ? 103.777 23.944 23.134  1.00 28.74  ? 308  LEU B N    1 
ATOM   6538 C CA   . LEU B 1 307 ? 103.091 24.626 22.042  1.00 30.95  ? 308  LEU B CA   1 
ATOM   6539 C C    . LEU B 1 307 ? 102.986 23.658 20.871  1.00 34.83  ? 308  LEU B C    1 
ATOM   6540 O O    . LEU B 1 307 ? 104.009 23.254 20.317  1.00 31.74  ? 308  LEU B O    1 
ATOM   6541 C CB   . LEU B 1 307 ? 103.900 25.850 21.605  1.00 29.37  ? 308  LEU B CB   1 
ATOM   6542 C CG   . LEU B 1 307 ? 104.126 26.896 22.696  1.00 34.87  ? 308  LEU B CG   1 
ATOM   6543 C CD1  . LEU B 1 307 ? 105.153 27.947 22.277  1.00 35.15  ? 308  LEU B CD1  1 
ATOM   6544 C CD2  . LEU B 1 307 ? 102.782 27.539 23.090  1.00 26.78  ? 308  LEU B CD2  1 
ATOM   6545 N N    . SER B 1 308 ? 101.766 23.289 20.488  1.00 30.28  ? 309  SER B N    1 
ATOM   6546 C CA   . SER B 1 308 ? 101.580 22.334 19.394  1.00 32.41  ? 309  SER B CA   1 
ATOM   6547 C C    . SER B 1 308 ? 101.773 22.979 18.018  1.00 33.63  ? 309  SER B C    1 
ATOM   6548 O O    . SER B 1 308 ? 101.641 22.313 17.000  1.00 37.00  ? 309  SER B O    1 
ATOM   6549 C CB   . SER B 1 308 ? 100.196 21.697 19.478  1.00 38.29  ? 309  SER B CB   1 
ATOM   6550 O OG   . SER B 1 308 ? 99.188  22.687 19.422  1.00 45.56  ? 309  SER B OG   1 
ATOM   6551 N N    . ASP B 1 309 ? 102.064 24.279 17.993  1.00 32.40  ? 310  ASP B N    1 
ATOM   6552 C CA   . ASP B 1 309 ? 102.339 24.996 16.748  1.00 35.05  ? 310  ASP B CA   1 
ATOM   6553 C C    . ASP B 1 309 ? 102.916 26.350 17.126  1.00 31.13  ? 310  ASP B C    1 
ATOM   6554 O O    . ASP B 1 309 ? 103.043 26.650 18.313  1.00 27.77  ? 310  ASP B O    1 
ATOM   6555 C CB   . ASP B 1 309 ? 101.059 25.178 15.924  1.00 42.90  ? 310  ASP B CB   1 
ATOM   6556 C CG   . ASP B 1 309 ? 101.340 25.347 14.429  1.00 52.06  ? 310  ASP B CG   1 
ATOM   6557 O OD1  . ASP B 1 309 ? 102.448 25.820 14.070  1.00 56.01  ? 310  ASP B OD1  1 
ATOM   6558 O OD2  . ASP B 1 309 ? 100.454 25.004 13.614  1.00 50.15  ? 310  ASP B OD2  1 
ATOM   6559 N N    . THR B 1 310 ? 103.278 27.169 16.141  1.00 29.68  ? 311  THR B N    1 
ATOM   6560 C CA   . THR B 1 310 ? 103.748 28.521 16.453  1.00 33.53  ? 311  THR B CA   1 
ATOM   6561 C C    . THR B 1 310 ? 102.626 29.284 17.156  1.00 34.40  ? 311  THR B C    1 
ATOM   6562 O O    . THR B 1 310 ? 101.439 29.011 16.931  1.00 37.09  ? 311  THR B O    1 
ATOM   6563 C CB   . THR B 1 310 ? 104.177 29.304 15.201  1.00 34.66  ? 311  THR B CB   1 
ATOM   6564 O OG1  . THR B 1 310 ? 103.038 29.503 14.355  1.00 38.64  ? 311  THR B OG1  1 
ATOM   6565 C CG2  . THR B 1 310 ? 105.267 28.545 14.434  1.00 22.23  ? 311  THR B CG2  1 
ATOM   6566 N N    . PRO B 1 311 ? 102.995 30.237 18.018  1.00 27.72  ? 312  PRO B N    1 
ATOM   6567 C CA   . PRO B 1 311 ? 101.968 31.039 18.687  1.00 25.75  ? 312  PRO B CA   1 
ATOM   6568 C C    . PRO B 1 311 ? 101.067 31.740 17.673  1.00 31.19  ? 312  PRO B C    1 
ATOM   6569 O O    . PRO B 1 311 ? 99.852  31.832 17.883  1.00 39.70  ? 312  PRO B O    1 
ATOM   6570 C CB   . PRO B 1 311 ? 102.789 32.046 19.496  1.00 30.36  ? 312  PRO B CB   1 
ATOM   6571 C CG   . PRO B 1 311 ? 104.091 31.316 19.774  1.00 30.26  ? 312  PRO B CG   1 
ATOM   6572 C CD   . PRO B 1 311 ? 104.354 30.554 18.496  1.00 29.28  ? 312  PRO B CD   1 
ATOM   6573 N N    A GLU B 1 312 ? 101.671 32.214 16.587  0.49 30.84  ? 313  GLU B N    1 
ATOM   6574 N N    B GLU B 1 312 ? 101.630 32.216 16.569  0.51 30.85  ? 313  GLU B N    1 
ATOM   6575 C CA   A GLU B 1 312 ? 100.942 32.858 15.498  0.49 35.14  ? 313  GLU B CA   1 
ATOM   6576 C CA   B GLU B 1 312 ? 100.800 32.887 15.570  0.51 34.35  ? 313  GLU B CA   1 
ATOM   6577 C C    A GLU B 1 312 ? 99.851  31.944 14.938  0.49 33.74  ? 313  GLU B C    1 
ATOM   6578 C C    B GLU B 1 312 ? 99.796  31.932 14.925  0.51 33.42  ? 313  GLU B C    1 
ATOM   6579 O O    A GLU B 1 312 ? 98.696  32.350 14.794  0.49 33.27  ? 313  GLU B O    1 
ATOM   6580 O O    B GLU B 1 312 ? 98.642  32.301 14.702  0.51 33.09  ? 313  GLU B O    1 
ATOM   6581 C CB   A GLU B 1 312 ? 101.914 33.272 14.385  0.49 38.43  ? 313  GLU B CB   1 
ATOM   6582 C CB   B GLU B 1 312 ? 101.646 33.589 14.508  0.51 39.58  ? 313  GLU B CB   1 
ATOM   6583 C CG   A GLU B 1 312 ? 102.973 34.310 14.792  0.49 37.34  ? 313  GLU B CG   1 
ATOM   6584 C CG   B GLU B 1 312 ? 100.946 34.801 13.901  0.51 46.94  ? 313  GLU B CG   1 
ATOM   6585 C CD   A GLU B 1 312 ? 104.196 33.696 15.479  0.49 36.65  ? 313  GLU B CD   1 
ATOM   6586 C CD   B GLU B 1 312 ? 101.123 34.884 12.399  0.51 51.10  ? 313  GLU B CD   1 
ATOM   6587 O OE1  A GLU B 1 312 ? 104.131 32.524 15.904  0.49 37.89  ? 313  GLU B OE1  1 
ATOM   6588 O OE1  B GLU B 1 312 ? 102.147 34.371 11.896  0.51 53.46  ? 313  GLU B OE1  1 
ATOM   6589 O OE2  A GLU B 1 312 ? 105.229 34.393 15.599  0.49 29.53  ? 313  GLU B OE2  1 
ATOM   6590 O OE2  B GLU B 1 312 ? 100.233 35.449 11.722  0.51 48.32  ? 313  GLU B OE2  1 
ATOM   6591 N N    . ALA B 1 313 ? 100.223 30.706 14.634  1.00 31.56  ? 314  ALA B N    1 
ATOM   6592 C CA   . ALA B 1 313 ? 99.284  29.719 14.107  1.00 31.21  ? 314  ALA B CA   1 
ATOM   6593 C C    . ALA B 1 313 ? 98.173  29.442 15.123  1.00 33.33  ? 314  ALA B C    1 
ATOM   6594 O O    . ALA B 1 313 ? 96.990  29.377 14.769  1.00 37.17  ? 314  ALA B O    1 
ATOM   6595 C CB   . ALA B 1 313 ? 100.007 28.428 13.738  1.00 27.39  ? 314  ALA B CB   1 
ATOM   6596 N N    . LEU B 1 314 ? 98.563  29.283 16.388  1.00 38.15  ? 315  LEU B N    1 
ATOM   6597 C CA   . LEU B 1 314 ? 97.613  28.959 17.455  1.00 34.92  ? 315  LEU B CA   1 
ATOM   6598 C C    . LEU B 1 314 ? 96.614  30.087 17.673  1.00 34.98  ? 315  LEU B C    1 
ATOM   6599 O O    . LEU B 1 314 ? 95.416  29.844 17.851  1.00 41.04  ? 315  LEU B O    1 
ATOM   6600 C CB   . LEU B 1 314 ? 98.353  28.650 18.752  1.00 32.84  ? 315  LEU B CB   1 
ATOM   6601 C CG   . LEU B 1 314 ? 99.137  27.337 18.700  1.00 31.08  ? 315  LEU B CG   1 
ATOM   6602 C CD1  . LEU B 1 314 ? 99.993  27.141 19.958  1.00 26.64  ? 315  LEU B CD1  1 
ATOM   6603 C CD2  . LEU B 1 314 ? 98.187  26.170 18.503  1.00 26.60  ? 315  LEU B CD2  1 
ATOM   6604 N N    . ILE B 1 315 ? 97.120  31.316 17.652  1.00 32.97  ? 316  ILE B N    1 
ATOM   6605 C CA   . ILE B 1 315 ? 96.290  32.507 17.783  1.00 39.97  ? 316  ILE B CA   1 
ATOM   6606 C C    . ILE B 1 315 ? 95.205  32.584 16.702  1.00 46.46  ? 316  ILE B C    1 
ATOM   6607 O O    . ILE B 1 315 ? 94.071  32.945 16.991  1.00 53.74  ? 316  ILE B O    1 
ATOM   6608 C CB   . ILE B 1 315 ? 97.151  33.795 17.794  1.00 39.28  ? 316  ILE B CB   1 
ATOM   6609 C CG1  . ILE B 1 315 ? 97.925  33.893 19.106  1.00 36.60  ? 316  ILE B CG1  1 
ATOM   6610 C CG2  . ILE B 1 315 ? 96.279  35.025 17.635  1.00 43.80  ? 316  ILE B CG2  1 
ATOM   6611 C CD1  . ILE B 1 315 ? 99.125  34.825 19.053  1.00 40.14  ? 316  ILE B CD1  1 
ATOM   6612 N N    . ASN B 1 316 ? 95.543  32.222 15.469  1.00 47.74  ? 317  ASN B N    1 
ATOM   6613 C CA   . ASN B 1 316 ? 94.576  32.283 14.371  1.00 45.11  ? 317  ASN B CA   1 
ATOM   6614 C C    . ASN B 1 316 ? 93.561  31.156 14.375  1.00 48.82  ? 317  ASN B C    1 
ATOM   6615 O O    . ASN B 1 316 ? 92.449  31.323 13.886  1.00 58.38  ? 317  ASN B O    1 
ATOM   6616 C CB   . ASN B 1 316 ? 95.298  32.329 13.030  1.00 40.53  ? 317  ASN B CB   1 
ATOM   6617 C CG   . ASN B 1 316 ? 96.220  33.507 12.926  1.00 43.97  ? 317  ASN B CG   1 
ATOM   6618 O OD1  . ASN B 1 316 ? 96.048  34.504 13.626  1.00 56.32  ? 317  ASN B OD1  1 
ATOM   6619 N ND2  . ASN B 1 316 ? 97.215  33.404 12.064  1.00 38.56  ? 317  ASN B ND2  1 
ATOM   6620 N N    . ALA B 1 317 ? 93.949  30.009 14.924  1.00 46.02  ? 318  ALA B N    1 
ATOM   6621 C CA   . ALA B 1 317 ? 93.063  28.850 14.994  1.00 43.98  ? 318  ALA B CA   1 
ATOM   6622 C C    . ALA B 1 317 ? 92.107  28.901 16.193  1.00 47.30  ? 318  ALA B C    1 
ATOM   6623 O O    . ALA B 1 317 ? 91.084  28.213 16.208  1.00 54.30  ? 318  ALA B O    1 
ATOM   6624 C CB   . ALA B 1 317 ? 93.875  27.569 15.028  1.00 39.36  ? 318  ALA B CB   1 
ATOM   6625 N N    . GLY B 1 318 ? 92.440  29.718 17.191  1.00 44.05  ? 319  GLY B N    1 
ATOM   6626 C CA   . GLY B 1 318 ? 91.726  29.711 18.458  1.00 37.35  ? 319  GLY B CA   1 
ATOM   6627 C C    . GLY B 1 318 ? 90.344  30.344 18.487  1.00 36.06  ? 319  GLY B C    1 
ATOM   6628 O O    . GLY B 1 318 ? 90.079  31.339 17.798  1.00 33.75  ? 319  GLY B O    1 
ATOM   6629 N N    . ASP B 1 319 ? 89.453  29.751 19.279  1.00 31.32  ? 320  ASP B N    1 
ATOM   6630 C CA   . ASP B 1 319 ? 88.200  30.398 19.639  1.00 33.11  ? 320  ASP B CA   1 
ATOM   6631 C C    . ASP B 1 319 ? 88.454  31.079 20.975  1.00 31.66  ? 320  ASP B C    1 
ATOM   6632 O O    . ASP B 1 319 ? 88.707  30.402 21.977  1.00 28.84  ? 320  ASP B O    1 
ATOM   6633 C CB   . ASP B 1 319 ? 87.070  29.370 19.784  1.00 33.10  ? 320  ASP B CB   1 
ATOM   6634 C CG   . ASP B 1 319 ? 85.737  29.998 20.236  1.00 43.64  ? 320  ASP B CG   1 
ATOM   6635 O OD1  . ASP B 1 319 ? 85.679  31.222 20.503  1.00 40.52  ? 320  ASP B OD1  1 
ATOM   6636 O OD2  . ASP B 1 319 ? 84.736  29.252 20.349  1.00 48.89  ? 320  ASP B OD2  1 
ATOM   6637 N N    . PHE B 1 320 ? 88.382  32.407 21.007  1.00 29.94  ? 321  PHE B N    1 
ATOM   6638 C CA   . PHE B 1 320 ? 88.666  33.116 22.254  1.00 31.32  ? 321  PHE B CA   1 
ATOM   6639 C C    . PHE B 1 320 ? 87.469  33.791 22.940  1.00 31.98  ? 321  PHE B C    1 
ATOM   6640 O O    . PHE B 1 320 ? 87.649  34.703 23.757  1.00 26.26  ? 321  PHE B O    1 
ATOM   6641 C CB   . PHE B 1 320 ? 89.810  34.105 22.048  1.00 28.72  ? 321  PHE B CB   1 
ATOM   6642 C CG   . PHE B 1 320 ? 91.119  33.443 21.732  1.00 31.26  ? 321  PHE B CG   1 
ATOM   6643 C CD1  . PHE B 1 320 ? 91.876  32.866 22.743  1.00 27.90  ? 321  PHE B CD1  1 
ATOM   6644 C CD2  . PHE B 1 320 ? 91.589  33.387 20.428  1.00 30.28  ? 321  PHE B CD2  1 
ATOM   6645 C CE1  . PHE B 1 320 ? 93.084  32.252 22.461  1.00 28.56  ? 321  PHE B CE1  1 
ATOM   6646 C CE2  . PHE B 1 320 ? 92.800  32.780 20.136  1.00 32.71  ? 321  PHE B CE2  1 
ATOM   6647 C CZ   . PHE B 1 320 ? 93.549  32.210 21.151  1.00 32.82  ? 321  PHE B CZ   1 
ATOM   6648 N N    . HIS B 1 321 ? 86.257  33.337 22.631  1.00 34.16  ? 322  HIS B N    1 
ATOM   6649 C CA   . HIS B 1 321 ? 85.091  33.762 23.409  1.00 33.90  ? 322  HIS B CA   1 
ATOM   6650 C C    . HIS B 1 321 ? 85.299  33.343 24.857  1.00 32.48  ? 322  HIS B C    1 
ATOM   6651 O O    . HIS B 1 321 ? 85.795  32.243 25.117  1.00 29.79  ? 322  HIS B O    1 
ATOM   6652 C CB   . HIS B 1 321 ? 83.797  33.154 22.853  1.00 30.38  ? 322  HIS B CB   1 
ATOM   6653 C CG   . HIS B 1 321 ? 83.416  33.695 21.513  1.00 34.85  ? 322  HIS B CG   1 
ATOM   6654 N ND1  . HIS B 1 321 ? 83.895  33.164 20.331  1.00 26.58  ? 322  HIS B ND1  1 
ATOM   6655 C CD2  . HIS B 1 321 ? 82.631  34.745 21.165  1.00 34.48  ? 322  HIS B CD2  1 
ATOM   6656 C CE1  . HIS B 1 321 ? 83.406  33.853 19.315  1.00 45.00  ? 322  HIS B CE1  1 
ATOM   6657 N NE2  . HIS B 1 321 ? 82.634  34.816 19.793  1.00 39.86  ? 322  HIS B NE2  1 
ATOM   6658 N N    . GLY B 1 322 ? 84.957  34.226 25.794  1.00 28.83  ? 323  GLY B N    1 
ATOM   6659 C CA   . GLY B 1 322 ? 85.074  33.904 27.203  1.00 28.76  ? 323  GLY B CA   1 
ATOM   6660 C C    . GLY B 1 322 ? 86.378  34.381 27.820  1.00 33.81  ? 323  GLY B C    1 
ATOM   6661 O O    . GLY B 1 322 ? 86.538  34.370 29.044  1.00 37.08  ? 323  GLY B O    1 
ATOM   6662 N N    . LEU B 1 323 ? 87.320  34.784 26.973  1.00 25.22  ? 324  LEU B N    1 
ATOM   6663 C CA   . LEU B 1 323 ? 88.574  35.354 27.457  1.00 23.32  ? 324  LEU B CA   1 
ATOM   6664 C C    . LEU B 1 323 ? 88.527  36.893 27.453  1.00 22.65  ? 324  LEU B C    1 
ATOM   6665 O O    . LEU B 1 323 ? 88.095  37.523 26.466  1.00 23.07  ? 324  LEU B O    1 
ATOM   6666 C CB   . LEU B 1 323 ? 89.756  34.865 26.608  1.00 22.32  ? 324  LEU B CB   1 
ATOM   6667 C CG   . LEU B 1 323 ? 91.109  35.517 26.918  1.00 29.53  ? 324  LEU B CG   1 
ATOM   6668 C CD1  . LEU B 1 323 ? 91.624  35.008 28.251  1.00 24.43  ? 324  LEU B CD1  1 
ATOM   6669 C CD2  . LEU B 1 323 ? 92.134  35.266 25.815  1.00 25.82  ? 324  LEU B CD2  1 
ATOM   6670 N N    . GLN B 1 324 ? 88.958  37.492 28.561  1.00 22.01  ? 325  GLN B N    1 
ATOM   6671 C CA   . GLN B 1 324 ? 89.265  38.921 28.580  1.00 21.63  ? 325  GLN B CA   1 
ATOM   6672 C C    . GLN B 1 324 ? 90.762  39.087 28.754  1.00 27.05  ? 325  GLN B C    1 
ATOM   6673 O O    . GLN B 1 324 ? 91.386  38.353 29.530  1.00 20.96  ? 325  GLN B O    1 
ATOM   6674 C CB   . GLN B 1 324 ? 88.541  39.672 29.712  1.00 21.84  ? 325  GLN B CB   1 
ATOM   6675 C CG   . GLN B 1 324 ? 87.027  39.561 29.698  1.00 28.51  ? 325  GLN B CG   1 
ATOM   6676 C CD   . GLN B 1 324 ? 86.568  38.372 30.495  1.00 36.64  ? 325  GLN B CD   1 
ATOM   6677 O OE1  . GLN B 1 324 ? 87.046  38.150 31.614  1.00 37.91  ? 325  GLN B OE1  1 
ATOM   6678 N NE2  . GLN B 1 324 ? 85.664  37.572 29.919  1.00 36.16  ? 325  GLN B NE2  1 
ATOM   6679 N N    . VAL B 1 325 ? 91.323  40.063 28.044  1.00 22.06  ? 326  VAL B N    1 
ATOM   6680 C CA   . VAL B 1 325 ? 92.754  40.315 28.062  1.00 20.62  ? 326  VAL B CA   1 
ATOM   6681 C C    . VAL B 1 325 ? 93.023  41.805 28.158  1.00 25.67  ? 326  VAL B C    1 
ATOM   6682 O O    . VAL B 1 325 ? 92.331  42.608 27.530  1.00 30.84  ? 326  VAL B O    1 
ATOM   6683 C CB   . VAL B 1 325 ? 93.430  39.784 26.784  1.00 25.23  ? 326  VAL B CB   1 
ATOM   6684 C CG1  . VAL B 1 325 ? 94.886  40.139 26.789  1.00 27.11  ? 326  VAL B CG1  1 
ATOM   6685 C CG2  . VAL B 1 325 ? 93.294  38.298 26.707  1.00 32.75  ? 326  VAL B CG2  1 
ATOM   6686 N N    . LEU B 1 326 ? 94.023  42.173 28.949  1.00 22.31  ? 327  LEU B N    1 
ATOM   6687 C CA   . LEU B 1 326 ? 94.510  43.549 28.975  1.00 19.98  ? 327  LEU B CA   1 
ATOM   6688 C C    . LEU B 1 326 ? 95.932  43.567 28.396  1.00 19.38  ? 327  LEU B C    1 
ATOM   6689 O O    . LEU B 1 326 ? 96.810  42.847 28.869  1.00 29.39  ? 327  LEU B O    1 
ATOM   6690 C CB   . LEU B 1 326 ? 94.486  44.089 30.406  1.00 30.71  ? 327  LEU B CB   1 
ATOM   6691 C CG   . LEU B 1 326 ? 94.954  45.526 30.678  1.00 37.79  ? 327  LEU B CG   1 
ATOM   6692 C CD1  . LEU B 1 326 ? 94.167  46.503 29.854  1.00 42.09  ? 327  LEU B CD1  1 
ATOM   6693 C CD2  . LEU B 1 326 ? 94.799  45.866 32.144  1.00 34.22  ? 327  LEU B CD2  1 
ATOM   6694 N N    . VAL B 1 327 ? 96.151  44.368 27.358  1.00 22.38  ? 328  VAL B N    1 
ATOM   6695 C CA   . VAL B 1 327 ? 97.460  44.435 26.705  1.00 20.94  ? 328  VAL B CA   1 
ATOM   6696 C C    . VAL B 1 327 ? 97.858  45.882 26.497  1.00 21.84  ? 328  VAL B C    1 
ATOM   6697 O O    . VAL B 1 327 ? 96.997  46.758 26.402  1.00 24.63  ? 328  VAL B O    1 
ATOM   6698 C CB   . VAL B 1 327 ? 97.470  43.697 25.343  1.00 24.50  ? 328  VAL B CB   1 
ATOM   6699 C CG1  . VAL B 1 327 ? 96.923  42.290 25.511  1.00 25.39  ? 328  VAL B CG1  1 
ATOM   6700 C CG2  . VAL B 1 327 ? 96.635  44.452 24.324  1.00 19.29  ? 328  VAL B CG2  1 
ATOM   6701 N N    . GLY B 1 328 ? 99.158  46.142 26.420  1.00 19.06  ? 329  GLY B N    1 
ATOM   6702 C CA   . GLY B 1 328 ? 99.617  47.507 26.267  1.00 19.21  ? 329  GLY B CA   1 
ATOM   6703 C C    . GLY B 1 328 ? 101.112 47.611 26.036  1.00 21.63  ? 329  GLY B C    1 
ATOM   6704 O O    . GLY B 1 328 ? 101.845 46.629 26.153  1.00 20.52  ? 329  GLY B O    1 
ATOM   6705 N N    . VAL B 1 329 ? 101.563 48.820 25.726  1.00 21.37  ? 330  VAL B N    1 
ATOM   6706 C CA   . VAL B 1 329 ? 102.966 49.068 25.443  1.00 23.63  ? 330  VAL B CA   1 
ATOM   6707 C C    . VAL B 1 329 ? 103.338 50.398 26.064  1.00 23.21  ? 330  VAL B C    1 
ATOM   6708 O O    . VAL B 1 329 ? 102.450 51.163 26.447  1.00 21.23  ? 330  VAL B O    1 
ATOM   6709 C CB   . VAL B 1 329 ? 103.212 49.135 23.927  1.00 19.47  ? 330  VAL B CB   1 
ATOM   6710 C CG1  . VAL B 1 329 ? 103.035 47.755 23.307  1.00 19.20  ? 330  VAL B CG1  1 
ATOM   6711 C CG2  . VAL B 1 329 ? 102.247 50.136 23.286  1.00 19.71  ? 330  VAL B CG2  1 
ATOM   6712 N N    . VAL B 1 330 ? 104.639 50.669 26.185  1.00 23.40  ? 331  VAL B N    1 
ATOM   6713 C CA   . VAL B 1 330 ? 105.104 52.010 26.554  1.00 22.79  ? 331  VAL B CA   1 
ATOM   6714 C C    . VAL B 1 330 ? 105.385 52.828 25.294  1.00 25.93  ? 331  VAL B C    1 
ATOM   6715 O O    . VAL B 1 330 ? 105.599 52.271 24.214  1.00 27.79  ? 331  VAL B O    1 
ATOM   6716 C CB   . VAL B 1 330 ? 106.381 51.987 27.421  1.00 24.87  ? 331  VAL B CB   1 
ATOM   6717 C CG1  . VAL B 1 330 ? 106.132 51.267 28.756  1.00 20.47  ? 331  VAL B CG1  1 
ATOM   6718 C CG2  . VAL B 1 330 ? 107.532 51.347 26.644  1.00 21.23  ? 331  VAL B CG2  1 
ATOM   6719 N N    . LYS B 1 331 ? 105.397 54.147 25.445  1.00 27.02  ? 332  LYS B N    1 
ATOM   6720 C CA   . LYS B 1 331 ? 105.545 55.071 24.318  1.00 27.04  ? 332  LYS B CA   1 
ATOM   6721 C C    . LYS B 1 331 ? 106.810 54.840 23.488  1.00 26.68  ? 332  LYS B C    1 
ATOM   6722 O O    . LYS B 1 331 ? 106.776 54.969 22.269  1.00 29.50  ? 332  LYS B O    1 
ATOM   6723 C CB   . LYS B 1 331 ? 105.502 56.514 24.831  1.00 26.18  ? 332  LYS B CB   1 
ATOM   6724 C CG   . LYS B 1 331 ? 105.366 57.583 23.772  1.00 29.82  ? 332  LYS B CG   1 
ATOM   6725 C CD   . LYS B 1 331 ? 105.193 58.939 24.451  1.00 37.26  ? 332  LYS B CD   1 
ATOM   6726 C CE   . LYS B 1 331 ? 104.914 60.052 23.453  1.00 40.41  ? 332  LYS B CE   1 
ATOM   6727 N NZ   . LYS B 1 331 ? 106.110 60.378 22.628  1.00 44.61  ? 332  LYS B NZ   1 
ATOM   6728 N N    . ASP B 1 332 ? 107.921 54.494 24.135  1.00 28.47  ? 333  ASP B N    1 
ATOM   6729 C CA   . ASP B 1 332 ? 109.184 54.292 23.406  1.00 29.02  ? 333  ASP B CA   1 
ATOM   6730 C C    . ASP B 1 332 ? 109.820 52.915 23.634  1.00 28.73  ? 333  ASP B C    1 
ATOM   6731 O O    . ASP B 1 332 ? 110.878 52.805 24.258  1.00 31.19  ? 333  ASP B O    1 
ATOM   6732 C CB   . ASP B 1 332 ? 110.182 55.404 23.761  1.00 28.20  ? 333  ASP B CB   1 
ATOM   6733 C CG   . ASP B 1 332 ? 109.615 56.800 23.514  1.00 36.81  ? 333  ASP B CG   1 
ATOM   6734 O OD1  . ASP B 1 332 ? 109.628 57.240 22.339  1.00 39.13  ? 333  ASP B OD1  1 
ATOM   6735 O OD2  . ASP B 1 332 ? 109.154 57.448 24.487  1.00 33.48  ? 333  ASP B OD2  1 
ATOM   6736 N N    . GLU B 1 333 ? 109.177 51.878 23.099  1.00 27.10  ? 334  GLU B N    1 
ATOM   6737 C CA   . GLU B 1 333 ? 109.576 50.481 23.335  1.00 26.79  ? 334  GLU B CA   1 
ATOM   6738 C C    . GLU B 1 333 ? 111.007 50.135 22.930  1.00 29.25  ? 334  GLU B C    1 
ATOM   6739 O O    . GLU B 1 333 ? 111.658 49.315 23.574  1.00 31.49  ? 334  GLU B O    1 
ATOM   6740 C CB   . GLU B 1 333 ? 108.613 49.524 22.628  1.00 23.80  ? 334  GLU B CB   1 
ATOM   6741 C CG   . GLU B 1 333 ? 107.264 49.373 23.318  1.00 27.79  ? 334  GLU B CG   1 
ATOM   6742 C CD   . GLU B 1 333 ? 107.374 48.636 24.654  1.00 39.46  ? 334  GLU B CD   1 
ATOM   6743 O OE1  . GLU B 1 333 ? 108.489 48.153 24.979  1.00 38.27  ? 334  GLU B OE1  1 
ATOM   6744 O OE2  . GLU B 1 333 ? 106.351 48.539 25.381  1.00 39.11  ? 334  GLU B OE2  1 
ATOM   6745 N N    . GLY B 1 334 ? 111.499 50.760 21.871  1.00 21.15  ? 335  GLY B N    1 
ATOM   6746 C CA   . GLY B 1 334 ? 112.787 50.385 21.321  1.00 21.38  ? 335  GLY B CA   1 
ATOM   6747 C C    . GLY B 1 334 ? 114.014 51.022 21.943  1.00 25.60  ? 335  GLY B C    1 
ATOM   6748 O O    . GLY B 1 334 ? 115.087 50.428 21.914  1.00 24.18  ? 335  GLY B O    1 
ATOM   6749 N N    . SER B 1 335 ? 113.867 52.221 22.500  1.00 31.27  ? 336  SER B N    1 
ATOM   6750 C CA   . SER B 1 335 ? 115.023 53.045 22.884  1.00 33.70  ? 336  SER B CA   1 
ATOM   6751 C C    . SER B 1 335 ? 116.054 52.346 23.796  1.00 32.24  ? 336  SER B C    1 
ATOM   6752 O O    . SER B 1 335 ? 117.258 52.413 23.549  1.00 28.18  ? 336  SER B O    1 
ATOM   6753 C CB   . SER B 1 335 ? 114.553 54.375 23.492  1.00 33.26  ? 336  SER B CB   1 
ATOM   6754 O OG   . SER B 1 335 ? 113.781 54.162 24.659  1.00 29.71  ? 336  SER B OG   1 
ATOM   6755 N N    . TYR B 1 336 ? 115.572 51.668 24.833  1.00 38.04  ? 337  TYR B N    1 
ATOM   6756 C CA   . TYR B 1 336 ? 116.423 50.992 25.819  1.00 38.72  ? 337  TYR B CA   1 
ATOM   6757 C C    . TYR B 1 336 ? 117.391 50.004 25.160  1.00 33.52  ? 337  TYR B C    1 
ATOM   6758 O O    . TYR B 1 336 ? 118.578 49.952 25.481  1.00 33.33  ? 337  TYR B O    1 
ATOM   6759 C CB   . TYR B 1 336 ? 115.515 50.282 26.854  1.00 42.72  ? 337  TYR B CB   1 
ATOM   6760 C CG   . TYR B 1 336 ? 116.185 49.300 27.801  1.00 47.78  ? 337  TYR B CG   1 
ATOM   6761 C CD1  . TYR B 1 336 ? 116.355 47.966 27.444  1.00 50.40  ? 337  TYR B CD1  1 
ATOM   6762 C CD2  . TYR B 1 336 ? 116.606 49.695 29.073  1.00 54.60  ? 337  TYR B CD2  1 
ATOM   6763 C CE1  . TYR B 1 336 ? 116.955 47.056 28.313  1.00 59.45  ? 337  TYR B CE1  1 
ATOM   6764 C CE2  . TYR B 1 336 ? 117.208 48.790 29.953  1.00 57.78  ? 337  TYR B CE2  1 
ATOM   6765 C CZ   . TYR B 1 336 ? 117.379 47.474 29.563  1.00 64.09  ? 337  TYR B CZ   1 
ATOM   6766 O OH   . TYR B 1 336 ? 117.970 46.571 30.419  1.00 68.31  ? 337  TYR B OH   1 
ATOM   6767 N N    . PHE B 1 337 ? 116.875 49.213 24.232  1.00 30.06  ? 338  PHE B N    1 
ATOM   6768 C CA   . PHE B 1 337 ? 117.672 48.154 23.636  1.00 27.87  ? 338  PHE B CA   1 
ATOM   6769 C C    . PHE B 1 337 ? 118.791 48.662 22.743  1.00 31.17  ? 338  PHE B C    1 
ATOM   6770 O O    . PHE B 1 337 ? 119.754 47.940 22.506  1.00 30.34  ? 338  PHE B O    1 
ATOM   6771 C CB   . PHE B 1 337 ? 116.763 47.192 22.866  1.00 28.20  ? 338  PHE B CB   1 
ATOM   6772 C CG   . PHE B 1 337 ? 115.743 46.525 23.735  1.00 30.75  ? 338  PHE B CG   1 
ATOM   6773 C CD1  . PHE B 1 337 ? 114.517 47.127 23.972  1.00 29.43  ? 338  PHE B CD1  1 
ATOM   6774 C CD2  . PHE B 1 337 ? 116.025 45.306 24.345  1.00 28.70  ? 338  PHE B CD2  1 
ATOM   6775 C CE1  . PHE B 1 337 ? 113.577 46.522 24.801  1.00 31.57  ? 338  PHE B CE1  1 
ATOM   6776 C CE2  . PHE B 1 337 ? 115.088 44.695 25.166  1.00 31.73  ? 338  PHE B CE2  1 
ATOM   6777 C CZ   . PHE B 1 337 ? 113.864 45.307 25.397  1.00 29.79  ? 338  PHE B CZ   1 
ATOM   6778 N N    . LEU B 1 338 ? 118.672 49.894 22.247  1.00 28.83  ? 339  LEU B N    1 
ATOM   6779 C CA   . LEU B 1 338 ? 119.654 50.415 21.294  1.00 30.23  ? 339  LEU B CA   1 
ATOM   6780 C C    . LEU B 1 338 ? 121.083 50.508 21.854  1.00 32.62  ? 339  LEU B C    1 
ATOM   6781 O O    . LEU B 1 338 ? 122.059 50.316 21.113  1.00 29.63  ? 339  LEU B O    1 
ATOM   6782 C CB   . LEU B 1 338 ? 119.200 51.765 20.731  1.00 35.27  ? 339  LEU B CB   1 
ATOM   6783 C CG   . LEU B 1 338 ? 117.935 51.704 19.867  1.00 39.62  ? 339  LEU B CG   1 
ATOM   6784 C CD1  . LEU B 1 338 ? 117.418 53.103 19.510  1.00 39.63  ? 339  LEU B CD1  1 
ATOM   6785 C CD2  . LEU B 1 338 ? 118.198 50.889 18.607  1.00 35.32  ? 339  LEU B CD2  1 
ATOM   6786 N N    . VAL B 1 339 ? 121.199 50.786 23.155  1.00 32.78  ? 340  VAL B N    1 
ATOM   6787 C CA   . VAL B 1 339 ? 122.510 50.936 23.797  1.00 38.18  ? 340  VAL B CA   1 
ATOM   6788 C C    . VAL B 1 339 ? 123.222 49.602 24.037  1.00 38.73  ? 340  VAL B C    1 
ATOM   6789 O O    . VAL B 1 339 ? 124.340 49.577 24.539  1.00 38.31  ? 340  VAL B O    1 
ATOM   6790 C CB   . VAL B 1 339 ? 122.419 51.738 25.119  1.00 35.89  ? 340  VAL B CB   1 
ATOM   6791 C CG1  . VAL B 1 339 ? 121.909 53.148 24.844  1.00 39.81  ? 340  VAL B CG1  1 
ATOM   6792 C CG2  . VAL B 1 339 ? 121.507 51.036 26.109  1.00 32.50  ? 340  VAL B CG2  1 
ATOM   6793 N N    . TYR B 1 340 ? 122.576 48.499 23.666  1.00 37.69  ? 341  TYR B N    1 
ATOM   6794 C CA   . TYR B 1 340 ? 123.173 47.176 23.835  1.00 36.68  ? 341  TYR B CA   1 
ATOM   6795 C C    . TYR B 1 340 ? 123.749 46.602 22.543  1.00 37.19  ? 341  TYR B C    1 
ATOM   6796 O O    . TYR B 1 340 ? 123.945 45.385 22.437  1.00 39.85  ? 341  TYR B O    1 
ATOM   6797 C CB   . TYR B 1 340 ? 122.168 46.196 24.461  1.00 30.25  ? 341  TYR B CB   1 
ATOM   6798 C CG   . TYR B 1 340 ? 121.936 46.469 25.926  1.00 33.99  ? 341  TYR B CG   1 
ATOM   6799 C CD1  . TYR B 1 340 ? 121.010 47.421 26.338  1.00 33.41  ? 341  TYR B CD1  1 
ATOM   6800 C CD2  . TYR B 1 340 ? 122.677 45.809 26.900  1.00 36.70  ? 341  TYR B CD2  1 
ATOM   6801 C CE1  . TYR B 1 340 ? 120.811 47.689 27.689  1.00 37.77  ? 341  TYR B CE1  1 
ATOM   6802 C CE2  . TYR B 1 340 ? 122.486 46.069 28.247  1.00 35.89  ? 341  TYR B CE2  1 
ATOM   6803 C CZ   . TYR B 1 340 ? 121.551 47.010 28.635  1.00 39.92  ? 341  TYR B CZ   1 
ATOM   6804 O OH   . TYR B 1 340 ? 121.357 47.278 29.970  1.00 43.32  ? 341  TYR B OH   1 
ATOM   6805 N N    . GLY B 1 341 ? 124.026 47.461 21.564  1.00 33.57  ? 342  GLY B N    1 
ATOM   6806 C CA   . GLY B 1 341 ? 124.637 46.979 20.334  1.00 36.77  ? 342  GLY B CA   1 
ATOM   6807 C C    . GLY B 1 341 ? 124.470 47.769 19.049  1.00 38.47  ? 342  GLY B C    1 
ATOM   6808 O O    . GLY B 1 341 ? 125.211 47.540 18.092  1.00 43.77  ? 342  GLY B O    1 
ATOM   6809 N N    . ALA B 1 342 ? 123.504 48.682 18.997  1.00 38.55  ? 343  ALA B N    1 
ATOM   6810 C CA   . ALA B 1 342 ? 123.367 49.528 17.808  1.00 33.20  ? 343  ALA B CA   1 
ATOM   6811 C C    . ALA B 1 342 ? 124.504 50.557 17.764  1.00 39.31  ? 343  ALA B C    1 
ATOM   6812 O O    . ALA B 1 342 ? 124.766 51.261 18.747  1.00 39.90  ? 343  ALA B O    1 
ATOM   6813 C CB   . ALA B 1 342 ? 122.010 50.209 17.760  1.00 23.80  ? 343  ALA B CB   1 
ATOM   6814 N N    . PRO B 1 343 ? 125.201 50.631 16.621  1.00 38.83  ? 344  PRO B N    1 
ATOM   6815 C CA   . PRO B 1 343 ? 126.352 51.527 16.474  1.00 35.24  ? 344  PRO B CA   1 
ATOM   6816 C C    . PRO B 1 343 ? 125.969 52.994 16.668  1.00 37.63  ? 344  PRO B C    1 
ATOM   6817 O O    . PRO B 1 343 ? 124.931 53.441 16.167  1.00 35.40  ? 344  PRO B O    1 
ATOM   6818 C CB   . PRO B 1 343 ? 126.817 51.274 15.036  1.00 38.01  ? 344  PRO B CB   1 
ATOM   6819 C CG   . PRO B 1 343 ? 125.648 50.626 14.347  1.00 40.61  ? 344  PRO B CG   1 
ATOM   6820 C CD   . PRO B 1 343 ? 124.956 49.830 15.409  1.00 38.02  ? 344  PRO B CD   1 
ATOM   6821 N N    . GLY B 1 344 ? 126.804 53.724 17.406  1.00 34.20  ? 345  GLY B N    1 
ATOM   6822 C CA   . GLY B 1 344 ? 126.573 55.133 17.652  1.00 33.19  ? 345  GLY B CA   1 
ATOM   6823 C C    . GLY B 1 344 ? 125.682 55.421 18.847  1.00 39.63  ? 345  GLY B C    1 
ATOM   6824 O O    . GLY B 1 344 ? 125.389 56.580 19.125  1.00 44.30  ? 345  GLY B O    1 
ATOM   6825 N N    . PHE B 1 345 ? 125.250 54.388 19.566  1.00 39.27  ? 346  PHE B N    1 
ATOM   6826 C CA   . PHE B 1 345 ? 124.337 54.617 20.684  1.00 35.18  ? 346  PHE B CA   1 
ATOM   6827 C C    . PHE B 1 345 ? 124.986 54.592 22.065  1.00 40.98  ? 346  PHE B C    1 
ATOM   6828 O O    . PHE B 1 345 ? 125.890 53.800 22.329  1.00 44.40  ? 346  PHE B O    1 
ATOM   6829 C CB   . PHE B 1 345 ? 123.163 53.650 20.621  1.00 28.65  ? 346  PHE B CB   1 
ATOM   6830 C CG   . PHE B 1 345 ? 122.083 54.089 19.682  1.00 31.51  ? 346  PHE B CG   1 
ATOM   6831 C CD1  . PHE B 1 345 ? 122.194 53.861 18.318  1.00 31.13  ? 346  PHE B CD1  1 
ATOM   6832 C CD2  . PHE B 1 345 ? 120.962 54.745 20.160  1.00 30.44  ? 346  PHE B CD2  1 
ATOM   6833 C CE1  . PHE B 1 345 ? 121.197 54.266 17.456  1.00 36.28  ? 346  PHE B CE1  1 
ATOM   6834 C CE2  . PHE B 1 345 ? 119.959 55.160 19.296  1.00 32.87  ? 346  PHE B CE2  1 
ATOM   6835 C CZ   . PHE B 1 345 ? 120.075 54.916 17.948  1.00 38.62  ? 346  PHE B CZ   1 
ATOM   6836 N N    . SER B 1 346 ? 124.516 55.474 22.942  1.00 44.51  ? 347  SER B N    1 
ATOM   6837 C CA   . SER B 1 346 ? 124.994 55.529 24.327  1.00 42.52  ? 347  SER B CA   1 
ATOM   6838 C C    . SER B 1 346 ? 123.956 56.238 25.194  1.00 37.14  ? 347  SER B C    1 
ATOM   6839 O O    . SER B 1 346 ? 123.254 57.136 24.724  1.00 37.09  ? 347  SER B O    1 
ATOM   6840 C CB   . SER B 1 346 ? 126.343 56.265 24.403  1.00 40.80  ? 347  SER B CB   1 
ATOM   6841 O OG   . SER B 1 346 ? 126.891 56.241 25.719  1.00 40.13  ? 347  SER B OG   1 
ATOM   6842 N N    . LYS B 1 347 ? 123.843 55.837 26.452  1.00 38.61  ? 348  LYS B N    1 
ATOM   6843 C CA   . LYS B 1 347 ? 122.982 56.563 27.374  1.00 38.45  ? 348  LYS B CA   1 
ATOM   6844 C C    . LYS B 1 347 ? 123.660 57.879 27.767  1.00 42.04  ? 348  LYS B C    1 
ATOM   6845 O O    . LYS B 1 347 ? 123.026 58.773 28.330  1.00 38.29  ? 348  LYS B O    1 
ATOM   6846 C CB   . LYS B 1 347 ? 122.700 55.732 28.629  1.00 31.19  ? 348  LYS B CB   1 
ATOM   6847 C CG   . LYS B 1 347 ? 123.753 55.872 29.713  1.00 28.67  ? 348  LYS B CG   1 
ATOM   6848 C CD   . LYS B 1 347 ? 123.347 55.141 30.979  1.00 31.96  ? 348  LYS B CD   1 
ATOM   6849 C CE   . LYS B 1 347 ? 124.352 55.397 32.093  1.00 35.24  ? 348  LYS B CE   1 
ATOM   6850 N NZ   . LYS B 1 347 ? 124.465 56.853 32.409  1.00 39.28  ? 348  LYS B NZ   1 
ATOM   6851 N N    . ASP B 1 348 ? 124.952 57.986 27.469  1.00 43.23  ? 349  ASP B N    1 
ATOM   6852 C CA   . ASP B 1 348 ? 125.742 59.130 27.914  1.00 43.94  ? 349  ASP B CA   1 
ATOM   6853 C C    . ASP B 1 348 ? 125.915 60.260 26.900  1.00 41.77  ? 349  ASP B C    1 
ATOM   6854 O O    . ASP B 1 348 ? 126.538 61.267 27.213  1.00 46.40  ? 349  ASP B O    1 
ATOM   6855 C CB   . ASP B 1 348 ? 127.094 58.664 28.448  1.00 43.22  ? 349  ASP B CB   1 
ATOM   6856 C CG   . ASP B 1 348 ? 126.972 57.977 29.799  1.00 51.27  ? 349  ASP B CG   1 
ATOM   6857 O OD1  . ASP B 1 348 ? 126.213 58.481 30.662  1.00 51.76  ? 349  ASP B OD1  1 
ATOM   6858 O OD2  . ASP B 1 348 ? 127.627 56.931 29.995  1.00 51.87  ? 349  ASP B OD2  1 
ATOM   6859 N N    . ASN B 1 349 ? 125.374 60.097 25.694  1.00 40.37  ? 350  ASN B N    1 
ATOM   6860 C CA   . ASN B 1 349 ? 125.258 61.221 24.756  1.00 41.68  ? 350  ASN B CA   1 
ATOM   6861 C C    . ASN B 1 349 ? 123.879 61.243 24.087  1.00 43.51  ? 350  ASN B C    1 
ATOM   6862 O O    . ASN B 1 349 ? 122.993 60.464 24.456  1.00 45.70  ? 350  ASN B O    1 
ATOM   6863 C CB   . ASN B 1 349 ? 126.419 61.275 23.728  1.00 31.08  ? 350  ASN B CB   1 
ATOM   6864 C CG   . ASN B 1 349 ? 126.510 60.029 22.852  1.00 39.12  ? 350  ASN B CG   1 
ATOM   6865 O OD1  . ASN B 1 349 ? 125.486 59.451 22.462  1.00 37.05  ? 350  ASN B OD1  1 
ATOM   6866 N ND2  . ASN B 1 349 ? 127.743 59.605 22.537  1.00 30.32  ? 350  ASN B ND2  1 
ATOM   6867 N N    . GLU B 1 350 ? 123.690 62.135 23.119  1.00 35.00  ? 351  GLU B N    1 
ATOM   6868 C CA   . GLU B 1 350 ? 122.394 62.273 22.467  1.00 42.02  ? 351  GLU B CA   1 
ATOM   6869 C C    . GLU B 1 350 ? 122.157 61.154 21.459  1.00 38.12  ? 351  GLU B C    1 
ATOM   6870 O O    . GLU B 1 350 ? 121.062 61.035 20.902  1.00 30.85  ? 351  GLU B O    1 
ATOM   6871 C CB   . GLU B 1 350 ? 122.270 63.635 21.766  1.00 49.58  ? 351  GLU B CB   1 
ATOM   6872 C CG   . GLU B 1 350 ? 122.231 64.827 22.709  1.00 61.99  ? 351  GLU B CG   1 
ATOM   6873 C CD   . GLU B 1 350 ? 121.164 64.682 23.779  1.00 71.03  ? 351  GLU B CD   1 
ATOM   6874 O OE1  . GLU B 1 350 ? 119.986 64.997 23.494  1.00 70.49  ? 351  GLU B OE1  1 
ATOM   6875 O OE2  . GLU B 1 350 ? 121.502 64.245 24.902  1.00 78.28  ? 351  GLU B OE2  1 
ATOM   6876 N N    . SER B 1 351 ? 123.191 60.353 21.220  1.00 27.18  ? 352  SER B N    1 
ATOM   6877 C CA   . SER B 1 351 ? 123.113 59.257 20.266  1.00 29.11  ? 352  SER B CA   1 
ATOM   6878 C C    . SER B 1 351 ? 122.546 59.730 18.923  1.00 34.50  ? 352  SER B C    1 
ATOM   6879 O O    . SER B 1 351 ? 121.641 59.106 18.364  1.00 37.07  ? 352  SER B O    1 
ATOM   6880 C CB   . SER B 1 351 ? 122.263 58.119 20.848  1.00 28.60  ? 352  SER B CB   1 
ATOM   6881 O OG   . SER B 1 351 ? 122.897 57.546 21.981  1.00 33.54  ? 352  SER B OG   1 
ATOM   6882 N N    . LEU B 1 352 ? 123.070 60.846 18.426  1.00 34.54  ? 353  LEU B N    1 
ATOM   6883 C CA   . LEU B 1 352 ? 122.680 61.372 17.120  1.00 35.79  ? 353  LEU B CA   1 
ATOM   6884 C C    . LEU B 1 352 ? 123.464 60.682 16.012  1.00 39.85  ? 353  LEU B C    1 
ATOM   6885 O O    . LEU B 1 352 ? 124.541 61.134 15.629  1.00 49.53  ? 353  LEU B O    1 
ATOM   6886 C CB   . LEU B 1 352 ? 122.929 62.876 17.058  1.00 32.20  ? 353  LEU B CB   1 
ATOM   6887 C CG   . LEU B 1 352 ? 122.102 63.696 18.037  1.00 33.53  ? 353  LEU B CG   1 
ATOM   6888 C CD1  . LEU B 1 352 ? 122.526 65.157 17.993  1.00 32.82  ? 353  LEU B CD1  1 
ATOM   6889 C CD2  . LEU B 1 352 ? 120.640 63.549 17.703  1.00 28.76  ? 353  LEU B CD2  1 
ATOM   6890 N N    . ILE B 1 353 ? 122.902 59.602 15.489  1.00 40.51  ? 354  ILE B N    1 
ATOM   6891 C CA   . ILE B 1 353 ? 123.590 58.747 14.529  1.00 38.69  ? 354  ILE B CA   1 
ATOM   6892 C C    . ILE B 1 353 ? 123.503 59.251 13.081  1.00 38.10  ? 354  ILE B C    1 
ATOM   6893 O O    . ILE B 1 353 ? 122.588 59.991 12.711  1.00 40.83  ? 354  ILE B O    1 
ATOM   6894 C CB   . ILE B 1 353 ? 123.035 57.310 14.598  1.00 37.64  ? 354  ILE B CB   1 
ATOM   6895 C CG1  . ILE B 1 353 ? 121.531 57.309 14.310  1.00 30.05  ? 354  ILE B CG1  1 
ATOM   6896 C CG2  . ILE B 1 353 ? 123.308 56.696 15.981  1.00 39.62  ? 354  ILE B CG2  1 
ATOM   6897 C CD1  . ILE B 1 353 ? 120.963 55.937 13.962  1.00 28.98  ? 354  ILE B CD1  1 
ATOM   6898 N N    . SER B 1 354 ? 124.462 58.819 12.269  1.00 33.33  ? 355  SER B N    1 
ATOM   6899 C CA   . SER B 1 354 ? 124.509 59.122 10.844  1.00 30.61  ? 355  SER B CA   1 
ATOM   6900 C C    . SER B 1 354 ? 123.685 58.109 10.054  1.00 33.12  ? 355  SER B C    1 
ATOM   6901 O O    . SER B 1 354 ? 123.293 57.054 10.582  1.00 27.82  ? 355  SER B O    1 
ATOM   6902 C CB   . SER B 1 354 ? 125.954 59.036 10.355  1.00 31.68  ? 355  SER B CB   1 
ATOM   6903 O OG   . SER B 1 354 ? 126.408 57.688 10.416  1.00 35.58  ? 355  SER B OG   1 
ATOM   6904 N N    . ARG B 1 355 ? 123.448 58.414 8.779   1.00 29.93  ? 356  ARG B N    1 
ATOM   6905 C CA   . ARG B 1 355 ? 122.728 57.499 7.896   1.00 31.87  ? 356  ARG B CA   1 
ATOM   6906 C C    . ARG B 1 355 ? 123.389 56.113 7.885   1.00 32.64  ? 356  ARG B C    1 
ATOM   6907 O O    . ARG B 1 355 ? 122.715 55.093 8.049   1.00 36.94  ? 356  ARG B O    1 
ATOM   6908 C CB   . ARG B 1 355 ? 122.629 58.084 6.480   1.00 27.86  ? 356  ARG B CB   1 
ATOM   6909 C CG   . ARG B 1 355 ? 121.915 57.186 5.460   1.00 31.84  ? 356  ARG B CG   1 
ATOM   6910 C CD   . ARG B 1 355 ? 120.427 57.448 5.438   1.00 34.05  ? 356  ARG B CD   1 
ATOM   6911 N NE   . ARG B 1 355 ? 119.711 56.516 4.573   1.00 37.85  ? 356  ARG B NE   1 
ATOM   6912 C CZ   . ARG B 1 355 ? 118.419 56.234 4.704   1.00 34.00  ? 356  ARG B CZ   1 
ATOM   6913 N NH1  . ARG B 1 355 ? 117.717 56.823 5.662   1.00 33.89  ? 356  ARG B NH1  1 
ATOM   6914 N NH2  . ARG B 1 355 ? 117.834 55.363 3.887   1.00 27.51  ? 356  ARG B NH2  1 
ATOM   6915 N N    . ALA B 1 356 ? 124.708 56.086 7.717   1.00 26.44  ? 357  ALA B N    1 
ATOM   6916 C CA   . ALA B 1 356 ? 125.461 54.830 7.694   1.00 29.12  ? 357  ALA B CA   1 
ATOM   6917 C C    . ALA B 1 356 ? 125.254 53.973 8.961   1.00 31.28  ? 357  ALA B C    1 
ATOM   6918 O O    . ALA B 1 356 ? 125.095 52.746 8.870   1.00 31.81  ? 357  ALA B O    1 
ATOM   6919 C CB   . ALA B 1 356 ? 126.940 55.118 7.467   1.00 29.71  ? 357  ALA B CB   1 
ATOM   6920 N N    . GLU B 1 357 ? 125.265 54.616 10.131  1.00 31.54  ? 358  GLU B N    1 
ATOM   6921 C CA   . GLU B 1 357 ? 125.004 53.922 11.392  1.00 35.79  ? 358  GLU B CA   1 
ATOM   6922 C C    . GLU B 1 357 ? 123.551 53.444 11.448  1.00 37.65  ? 358  GLU B C    1 
ATOM   6923 O O    . GLU B 1 357 ? 123.263 52.356 11.953  1.00 37.63  ? 358  GLU B O    1 
ATOM   6924 C CB   . GLU B 1 357 ? 125.317 54.818 12.596  1.00 41.74  ? 358  GLU B CB   1 
ATOM   6925 C CG   . GLU B 1 357 ? 126.786 55.242 12.719  1.00 49.32  ? 358  GLU B CG   1 
ATOM   6926 C CD   . GLU B 1 357 ? 127.013 56.340 13.773  1.00 54.38  ? 358  GLU B CD   1 
ATOM   6927 O OE1  . GLU B 1 357 ? 126.196 57.282 13.857  1.00 57.45  ? 358  GLU B OE1  1 
ATOM   6928 O OE2  . GLU B 1 357 ? 128.015 56.266 14.516  1.00 55.77  ? 358  GLU B OE2  1 
ATOM   6929 N N    . PHE B 1 358 ? 122.640 54.259 10.925  1.00 33.43  ? 359  PHE B N    1 
ATOM   6930 C CA   . PHE B 1 358 ? 121.244 53.867 10.834  1.00 33.94  ? 359  PHE B CA   1 
ATOM   6931 C C    . PHE B 1 358 ? 121.131 52.592 10.015  1.00 32.38  ? 359  PHE B C    1 
ATOM   6932 O O    . PHE B 1 358 ? 120.522 51.609 10.453  1.00 32.39  ? 359  PHE B O    1 
ATOM   6933 C CB   . PHE B 1 358 ? 120.396 54.979 10.200  1.00 29.87  ? 359  PHE B CB   1 
ATOM   6934 C CG   . PHE B 1 358 ? 118.976 54.570 9.924   1.00 29.83  ? 359  PHE B CG   1 
ATOM   6935 C CD1  . PHE B 1 358 ? 118.042 54.497 10.951  1.00 28.00  ? 359  PHE B CD1  1 
ATOM   6936 C CD2  . PHE B 1 358 ? 118.569 54.254 8.640   1.00 27.58  ? 359  PHE B CD2  1 
ATOM   6937 C CE1  . PHE B 1 358 ? 116.732 54.129 10.697  1.00 20.05  ? 359  PHE B CE1  1 
ATOM   6938 C CE2  . PHE B 1 358 ? 117.261 53.882 8.388   1.00 21.80  ? 359  PHE B CE2  1 
ATOM   6939 C CZ   . PHE B 1 358 ? 116.348 53.818 9.416   1.00 22.32  ? 359  PHE B CZ   1 
ATOM   6940 N N    . LEU B 1 359 ? 121.741 52.614 8.832   1.00 28.10  ? 360  LEU B N    1 
ATOM   6941 C CA   . LEU B 1 359 ? 121.701 51.475 7.919   1.00 28.37  ? 360  LEU B CA   1 
ATOM   6942 C C    . LEU B 1 359 ? 122.311 50.238 8.570   1.00 30.45  ? 360  LEU B C    1 
ATOM   6943 O O    . LEU B 1 359 ? 121.749 49.145 8.495   1.00 31.93  ? 360  LEU B O    1 
ATOM   6944 C CB   . LEU B 1 359 ? 122.394 51.811 6.597   1.00 30.33  ? 360  LEU B CB   1 
ATOM   6945 C CG   . LEU B 1 359 ? 121.660 52.854 5.743   1.00 34.04  ? 360  LEU B CG   1 
ATOM   6946 C CD1  . LEU B 1 359 ? 122.427 53.200 4.469   1.00 33.81  ? 360  LEU B CD1  1 
ATOM   6947 C CD2  . LEU B 1 359 ? 120.262 52.365 5.403   1.00 26.28  ? 360  LEU B CD2  1 
ATOM   6948 N N    . ALA B 1 360 ? 123.440 50.410 9.248   1.00 29.35  ? 361  ALA B N    1 
ATOM   6949 C CA   . ALA B 1 360 ? 124.043 49.278 9.958   1.00 31.46  ? 361  ALA B CA   1 
ATOM   6950 C C    . ALA B 1 360 ? 123.174 48.831 11.130  1.00 33.87  ? 361  ALA B C    1 
ATOM   6951 O O    . ALA B 1 360 ? 123.073 47.632 11.412  1.00 37.48  ? 361  ALA B O    1 
ATOM   6952 C CB   . ALA B 1 360 ? 125.450 49.618 10.439  1.00 29.44  ? 361  ALA B CB   1 
ATOM   6953 N N    . GLY B 1 361 ? 122.561 49.794 11.819  1.00 26.96  ? 362  GLY B N    1 
ATOM   6954 C CA   . GLY B 1 361 ? 121.737 49.490 12.978  1.00 26.65  ? 362  GLY B CA   1 
ATOM   6955 C C    . GLY B 1 361 ? 120.517 48.661 12.617  1.00 26.79  ? 362  GLY B C    1 
ATOM   6956 O O    . GLY B 1 361 ? 120.054 47.852 13.418  1.00 30.22  ? 362  GLY B O    1 
ATOM   6957 N N    . VAL B 1 362 ? 119.994 48.857 11.411  1.00 26.19  ? 363  VAL B N    1 
ATOM   6958 C CA   . VAL B 1 362 ? 118.869 48.056 10.935  1.00 23.33  ? 363  VAL B CA   1 
ATOM   6959 C C    . VAL B 1 362 ? 119.228 46.573 10.858  1.00 26.69  ? 363  VAL B C    1 
ATOM   6960 O O    . VAL B 1 362 ? 118.418 45.724 11.227  1.00 32.29  ? 363  VAL B O    1 
ATOM   6961 C CB   . VAL B 1 362 ? 118.378 48.546 9.572   1.00 26.47  ? 363  VAL B CB   1 
ATOM   6962 C CG1  . VAL B 1 362 ? 117.494 47.501 8.909   1.00 22.98  ? 363  VAL B CG1  1 
ATOM   6963 C CG2  . VAL B 1 362 ? 117.654 49.887 9.719   1.00 21.76  ? 363  VAL B CG2  1 
ATOM   6964 N N    . ARG B 1 363 ? 120.438 46.258 10.391  1.00 26.02  ? 364  ARG B N    1 
ATOM   6965 C CA   . ARG B 1 363 ? 120.867 44.859 10.289  1.00 30.23  ? 364  ARG B CA   1 
ATOM   6966 C C    . ARG B 1 363 ? 120.989 44.225 11.667  1.00 31.57  ? 364  ARG B C    1 
ATOM   6967 O O    . ARG B 1 363 ? 120.748 43.035 11.830  1.00 34.59  ? 364  ARG B O    1 
ATOM   6968 C CB   . ARG B 1 363 ? 122.204 44.724 9.556   1.00 33.94  ? 364  ARG B CB   1 
ATOM   6969 C CG   . ARG B 1 363 ? 122.247 45.316 8.148   1.00 42.28  ? 364  ARG B CG   1 
ATOM   6970 C CD   . ARG B 1 363 ? 121.000 44.996 7.317   1.00 46.29  ? 364  ARG B CD   1 
ATOM   6971 N NE   . ARG B 1 363 ? 120.690 43.565 7.190   1.00 48.11  ? 364  ARG B NE   1 
ATOM   6972 C CZ   . ARG B 1 363 ? 120.958 42.820 6.114   1.00 46.81  ? 364  ARG B CZ   1 
ATOM   6973 N NH1  . ARG B 1 363 ? 121.573 43.359 5.062   1.00 38.95  ? 364  ARG B NH1  1 
ATOM   6974 N NH2  . ARG B 1 363 ? 120.614 41.531 6.090   1.00 37.66  ? 364  ARG B NH2  1 
ATOM   6975 N N    . VAL B 1 364 ? 121.379 45.032 12.652  1.00 31.73  ? 365  VAL B N    1 
ATOM   6976 C CA   . VAL B 1 364 ? 121.489 44.589 14.041  1.00 31.43  ? 365  VAL B CA   1 
ATOM   6977 C C    . VAL B 1 364 ? 120.120 44.467 14.723  1.00 31.47  ? 365  VAL B C    1 
ATOM   6978 O O    . VAL B 1 364 ? 119.895 43.569 15.537  1.00 34.82  ? 365  VAL B O    1 
ATOM   6979 C CB   . VAL B 1 364 ? 122.348 45.566 14.861  1.00 30.34  ? 365  VAL B CB   1 
ATOM   6980 C CG1  . VAL B 1 364 ? 122.199 45.284 16.349  1.00 28.21  ? 365  VAL B CG1  1 
ATOM   6981 C CG2  . VAL B 1 364 ? 123.812 45.477 14.444  1.00 28.13  ? 365  VAL B CG2  1 
ATOM   6982 N N    . GLY B 1 365 ? 119.209 45.376 14.389  1.00 27.69  ? 366  GLY B N    1 
ATOM   6983 C CA   . GLY B 1 365 ? 117.910 45.405 15.034  1.00 29.63  ? 366  GLY B CA   1 
ATOM   6984 C C    . GLY B 1 365 ? 116.929 44.448 14.385  1.00 36.18  ? 366  GLY B C    1 
ATOM   6985 O O    . GLY B 1 365 ? 115.962 44.018 15.020  1.00 42.51  ? 366  GLY B O    1 
ATOM   6986 N N    . VAL B 1 366 ? 117.170 44.114 13.118  1.00 29.45  ? 367  VAL B N    1 
ATOM   6987 C CA   . VAL B 1 366 ? 116.336 43.134 12.431  1.00 28.04  ? 367  VAL B CA   1 
ATOM   6988 C C    . VAL B 1 366 ? 117.230 42.032 11.902  1.00 26.49  ? 367  VAL B C    1 
ATOM   6989 O O    . VAL B 1 366 ? 117.379 41.869 10.698  1.00 29.16  ? 367  VAL B O    1 
ATOM   6990 C CB   . VAL B 1 366 ? 115.527 43.769 11.280  1.00 31.40  ? 367  VAL B CB   1 
ATOM   6991 C CG1  . VAL B 1 366 ? 114.425 42.816 10.813  1.00 26.45  ? 367  VAL B CG1  1 
ATOM   6992 C CG2  . VAL B 1 366 ? 114.931 45.107 11.714  1.00 28.97  ? 367  VAL B CG2  1 
ATOM   6993 N N    . PRO B 1 367 ? 117.822 41.258 12.816  1.00 30.18  ? 368  PRO B N    1 
ATOM   6994 C CA   . PRO B 1 367 ? 118.808 40.238 12.457  1.00 30.96  ? 368  PRO B CA   1 
ATOM   6995 C C    . PRO B 1 367 ? 118.200 39.068 11.688  1.00 33.64  ? 368  PRO B C    1 
ATOM   6996 O O    . PRO B 1 367 ? 116.995 38.821 11.765  1.00 36.48  ? 368  PRO B O    1 
ATOM   6997 C CB   . PRO B 1 367 ? 119.301 39.755 13.817  1.00 32.00  ? 368  PRO B CB   1 
ATOM   6998 C CG   . PRO B 1 367 ? 118.120 39.935 14.706  1.00 32.64  ? 368  PRO B CG   1 
ATOM   6999 C CD   . PRO B 1 367 ? 117.483 41.213 14.252  1.00 28.95  ? 368  PRO B CD   1 
ATOM   7000 N N    . GLN B 1 368 ? 119.035 38.370 10.925  1.00 39.76  ? 369  GLN B N    1 
ATOM   7001 C CA   . GLN B 1 368 ? 118.625 37.125 10.276  1.00 47.84  ? 369  GLN B CA   1 
ATOM   7002 C C    . GLN B 1 368 ? 117.478 37.253 9.258   1.00 42.03  ? 369  GLN B C    1 
ATOM   7003 O O    . GLN B 1 368 ? 116.693 36.322 9.078   1.00 43.01  ? 369  GLN B O    1 
ATOM   7004 C CB   . GLN B 1 368 ? 118.281 36.075 11.337  1.00 55.00  ? 369  GLN B CB   1 
ATOM   7005 C CG   . GLN B 1 368 ? 119.399 35.822 12.355  1.00 56.91  ? 369  GLN B CG   1 
ATOM   7006 C CD   . GLN B 1 368 ? 120.579 35.077 11.760  1.00 60.98  ? 369  GLN B CD   1 
ATOM   7007 O OE1  . GLN B 1 368 ? 120.567 33.846 11.667  1.00 67.01  ? 369  GLN B OE1  1 
ATOM   7008 N NE2  . GLN B 1 368 ? 121.607 35.817 11.357  1.00 53.51  ? 369  GLN B NE2  1 
ATOM   7009 N N    . VAL B 1 369 ? 117.378 38.397 8.596   1.00 40.16  ? 370  VAL B N    1 
ATOM   7010 C CA   . VAL B 1 369 ? 116.504 38.493 7.438   1.00 41.80  ? 370  VAL B CA   1 
ATOM   7011 C C    . VAL B 1 369 ? 117.361 38.781 6.216   1.00 39.02  ? 370  VAL B C    1 
ATOM   7012 O O    . VAL B 1 369 ? 118.502 39.215 6.341   1.00 39.90  ? 370  VAL B O    1 
ATOM   7013 C CB   . VAL B 1 369 ? 115.388 39.561 7.600   1.00 32.88  ? 370  VAL B CB   1 
ATOM   7014 C CG1  . VAL B 1 369 ? 114.578 39.297 8.862   1.00 28.80  ? 370  VAL B CG1  1 
ATOM   7015 C CG2  . VAL B 1 369 ? 115.974 40.975 7.615   1.00 28.56  ? 370  VAL B CG2  1 
ATOM   7016 N N    . SER B 1 370 ? 116.807 38.524 5.038   1.00 39.45  ? 371  SER B N    1 
ATOM   7017 C CA   . SER B 1 370 ? 117.496 38.778 3.777   1.00 37.27  ? 371  SER B CA   1 
ATOM   7018 C C    . SER B 1 370 ? 117.762 40.272 3.556   1.00 39.17  ? 371  SER B C    1 
ATOM   7019 O O    . SER B 1 370 ? 117.102 41.135 4.157   1.00 36.64  ? 371  SER B O    1 
ATOM   7020 C CB   . SER B 1 370 ? 116.663 38.233 2.616   1.00 35.40  ? 371  SER B CB   1 
ATOM   7021 O OG   . SER B 1 370 ? 115.399 38.870 2.554   1.00 43.58  ? 371  SER B OG   1 
ATOM   7022 N N    . ASP B 1 371 ? 118.734 40.566 2.696   1.00 34.52  ? 372  ASP B N    1 
ATOM   7023 C CA   . ASP B 1 371 ? 119.051 41.937 2.338   1.00 36.77  ? 372  ASP B CA   1 
ATOM   7024 C C    . ASP B 1 371 ? 117.805 42.643 1.826   1.00 36.85  ? 372  ASP B C    1 
ATOM   7025 O O    . ASP B 1 371 ? 117.594 43.829 2.121   1.00 30.72  ? 372  ASP B O    1 
ATOM   7026 C CB   . ASP B 1 371 ? 120.143 41.980 1.268   1.00 43.10  ? 372  ASP B CB   1 
ATOM   7027 C CG   . ASP B 1 371 ? 121.508 41.595 1.805   1.00 58.66  ? 372  ASP B CG   1 
ATOM   7028 O OD1  . ASP B 1 371 ? 121.711 41.689 3.036   1.00 59.79  ? 372  ASP B OD1  1 
ATOM   7029 O OD2  . ASP B 1 371 ? 122.379 41.204 0.990   1.00 65.34  ? 372  ASP B OD2  1 
ATOM   7030 N N    . LEU B 1 372 ? 116.983 41.913 1.065   1.00 27.83  ? 373  LEU B N    1 
ATOM   7031 C CA   . LEU B 1 372 ? 115.751 42.490 0.532   1.00 29.33  ? 373  LEU B CA   1 
ATOM   7032 C C    . LEU B 1 372 ? 114.818 42.934 1.666   1.00 28.52  ? 373  LEU B C    1 
ATOM   7033 O O    . LEU B 1 372 ? 114.275 44.039 1.638   1.00 29.82  ? 373  LEU B O    1 
ATOM   7034 C CB   . LEU B 1 372 ? 115.041 41.529 -0.423  1.00 26.50  ? 373  LEU B CB   1 
ATOM   7035 C CG   . LEU B 1 372 ? 113.727 42.140 -0.934  1.00 33.22  ? 373  LEU B CG   1 
ATOM   7036 C CD1  . LEU B 1 372 ? 113.999 43.342 -1.824  1.00 20.81  ? 373  LEU B CD1  1 
ATOM   7037 C CD2  . LEU B 1 372 ? 112.850 41.121 -1.660  1.00 30.63  ? 373  LEU B CD2  1 
ATOM   7038 N N    . ALA B 1 373 ? 114.665 42.086 2.678   1.00 24.54  ? 374  ALA B N    1 
ATOM   7039 C CA   . ALA B 1 373 ? 113.838 42.430 3.830   1.00 24.53  ? 374  ALA B CA   1 
ATOM   7040 C C    . ALA B 1 373 ? 114.372 43.680 4.530   1.00 25.54  ? 374  ALA B C    1 
ATOM   7041 O O    . ALA B 1 373 ? 113.609 44.587 4.877   1.00 31.75  ? 374  ALA B O    1 
ATOM   7042 C CB   . ALA B 1 373 ? 113.760 41.257 4.791   1.00 25.19  ? 374  ALA B CB   1 
ATOM   7043 N N    . ALA B 1 374 ? 115.686 43.735 4.713   1.00 23.03  ? 375  ALA B N    1 
ATOM   7044 C CA   . ALA B 1 374 ? 116.312 44.897 5.338   1.00 26.55  ? 375  ALA B CA   1 
ATOM   7045 C C    . ALA B 1 374 ? 116.036 46.192 4.549   1.00 29.77  ? 375  ALA B C    1 
ATOM   7046 O O    . ALA B 1 374 ? 115.700 47.236 5.140   1.00 31.43  ? 375  ALA B O    1 
ATOM   7047 C CB   . ALA B 1 374 ? 117.808 44.662 5.516   1.00 21.25  ? 375  ALA B CB   1 
ATOM   7048 N N    . GLU B 1 375 ? 116.156 46.123 3.223   1.00 23.19  ? 376  GLU B N    1 
ATOM   7049 C CA   . GLU B 1 375 ? 115.854 47.274 2.369   1.00 25.11  ? 376  GLU B CA   1 
ATOM   7050 C C    . GLU B 1 375 ? 114.414 47.736 2.538   1.00 24.86  ? 376  GLU B C    1 
ATOM   7051 O O    . GLU B 1 375 ? 114.136 48.936 2.577   1.00 25.74  ? 376  GLU B O    1 
ATOM   7052 C CB   . GLU B 1 375 ? 116.107 46.937 0.898   1.00 38.55  ? 376  GLU B CB   1 
ATOM   7053 C CG   . GLU B 1 375 ? 117.571 46.719 0.550   1.00 55.48  ? 376  GLU B CG   1 
ATOM   7054 C CD   . GLU B 1 375 ? 118.351 48.018 0.470   1.00 74.48  ? 376  GLU B CD   1 
ATOM   7055 O OE1  . GLU B 1 375 ? 117.770 49.090 0.763   1.00 75.91  ? 376  GLU B OE1  1 
ATOM   7056 O OE2  . GLU B 1 375 ? 119.549 47.964 0.108   1.00 84.88  ? 376  GLU B OE2  1 
ATOM   7057 N N    . ALA B 1 376 ? 113.493 46.781 2.628   1.00 19.40  ? 377  ALA B N    1 
ATOM   7058 C CA   . ALA B 1 376 ? 112.094 47.116 2.860   1.00 21.48  ? 377  ALA B CA   1 
ATOM   7059 C C    . ALA B 1 376 ? 111.973 47.881 4.175   1.00 20.46  ? 377  ALA B C    1 
ATOM   7060 O O    . ALA B 1 376 ? 111.236 48.865 4.266   1.00 28.19  ? 377  ALA B O    1 
ATOM   7061 C CB   . ALA B 1 376 ? 111.229 45.861 2.881   1.00 17.85  ? 377  ALA B CB   1 
ATOM   7062 N N    . VAL B 1 377 ? 112.695 47.426 5.196   1.00 19.29  ? 378  VAL B N    1 
ATOM   7063 C CA   . VAL B 1 377 ? 112.655 48.120 6.471   1.00 20.55  ? 378  VAL B CA   1 
ATOM   7064 C C    . VAL B 1 377 ? 113.162 49.546 6.301   1.00 24.62  ? 378  VAL B C    1 
ATOM   7065 O O    . VAL B 1 377 ? 112.518 50.495 6.735   1.00 22.04  ? 378  VAL B O    1 
ATOM   7066 C CB   . VAL B 1 377 ? 113.465 47.399 7.550   1.00 19.27  ? 378  VAL B CB   1 
ATOM   7067 C CG1  . VAL B 1 377 ? 113.455 48.220 8.837   1.00 19.21  ? 378  VAL B CG1  1 
ATOM   7068 C CG2  . VAL B 1 377 ? 112.887 46.019 7.799   1.00 19.15  ? 378  VAL B CG2  1 
ATOM   7069 N N    . VAL B 1 378 ? 114.311 49.686 5.649   1.00 24.65  ? 379  VAL B N    1 
ATOM   7070 C CA   . VAL B 1 378 ? 114.892 50.993 5.402   1.00 18.89  ? 379  VAL B CA   1 
ATOM   7071 C C    . VAL B 1 378 ? 113.933 51.884 4.636   1.00 26.52  ? 379  VAL B C    1 
ATOM   7072 O O    . VAL B 1 378 ? 113.797 53.078 4.945   1.00 22.28  ? 379  VAL B O    1 
ATOM   7073 C CB   . VAL B 1 378 ? 116.204 50.880 4.626   1.00 25.43  ? 379  VAL B CB   1 
ATOM   7074 C CG1  . VAL B 1 378 ? 116.624 52.242 4.121   1.00 24.21  ? 379  VAL B CG1  1 
ATOM   7075 C CG2  . VAL B 1 378 ? 117.291 50.269 5.507   1.00 21.02  ? 379  VAL B CG2  1 
ATOM   7076 N N    . LEU B 1 379 ? 113.267 51.304 3.639   1.00 21.09  ? 380  LEU B N    1 
ATOM   7077 C CA   . LEU B 1 379 ? 112.278 52.042 2.864   1.00 23.50  ? 380  LEU B CA   1 
ATOM   7078 C C    . LEU B 1 379 ? 111.207 52.641 3.776   1.00 29.04  ? 380  LEU B C    1 
ATOM   7079 O O    . LEU B 1 379 ? 110.885 53.822 3.677   1.00 28.15  ? 380  LEU B O    1 
ATOM   7080 C CB   . LEU B 1 379 ? 111.610 51.134 1.818   1.00 24.05  ? 380  LEU B CB   1 
ATOM   7081 C CG   . LEU B 1 379 ? 110.338 51.673 1.143   1.00 23.22  ? 380  LEU B CG   1 
ATOM   7082 C CD1  . LEU B 1 379 ? 110.644 52.850 0.232   1.00 25.09  ? 380  LEU B CD1  1 
ATOM   7083 C CD2  . LEU B 1 379 ? 109.569 50.573 0.396   1.00 27.06  ? 380  LEU B CD2  1 
ATOM   7084 N N    A HIS B 1 380 ? 110.673 51.822 4.676   0.47 25.60  ? 381  HIS B N    1 
ATOM   7085 N N    B HIS B 1 380 ? 110.668 51.830 4.675   0.53 25.51  ? 381  HIS B N    1 
ATOM   7086 C CA   A HIS B 1 380 ? 109.534 52.236 5.488   0.47 25.79  ? 381  HIS B CA   1 
ATOM   7087 C CA   B HIS B 1 380 ? 109.537 52.281 5.478   0.53 26.26  ? 381  HIS B CA   1 
ATOM   7088 C C    A HIS B 1 380 ? 109.894 53.225 6.595   0.47 26.71  ? 381  HIS B C    1 
ATOM   7089 C C    B HIS B 1 380 ? 109.902 53.250 6.590   0.53 26.71  ? 381  HIS B C    1 
ATOM   7090 O O    A HIS B 1 380 ? 109.093 54.082 6.942   0.47 25.61  ? 381  HIS B O    1 
ATOM   7091 O O    B HIS B 1 380 ? 109.113 54.118 6.935   0.53 25.56  ? 381  HIS B O    1 
ATOM   7092 C CB   A HIS B 1 380 ? 108.822 51.021 6.086   0.47 22.82  ? 381  HIS B CB   1 
ATOM   7093 C CB   B HIS B 1 380 ? 108.759 51.092 6.036   0.53 23.13  ? 381  HIS B CB   1 
ATOM   7094 C CG   A HIS B 1 380 ? 107.526 51.353 6.755   0.47 25.20  ? 381  HIS B CG   1 
ATOM   7095 C CG   B HIS B 1 380 ? 107.840 50.469 5.038   0.53 23.29  ? 381  HIS B CG   1 
ATOM   7096 N ND1  A HIS B 1 380 ? 106.307 51.224 6.124   0.47 26.40  ? 381  HIS B ND1  1 
ATOM   7097 N ND1  B HIS B 1 380 ? 108.281 49.601 4.062   0.53 23.04  ? 381  HIS B ND1  1 
ATOM   7098 C CD2  A HIS B 1 380 ? 107.257 51.822 7.999   0.47 27.86  ? 381  HIS B CD2  1 
ATOM   7099 C CD2  B HIS B 1 380 ? 106.508 50.615 4.843   0.53 22.94  ? 381  HIS B CD2  1 
ATOM   7100 C CE1  A HIS B 1 380 ? 105.343 51.591 6.951   0.47 26.96  ? 381  HIS B CE1  1 
ATOM   7101 C CE1  B HIS B 1 380 ? 107.255 49.223 3.321   0.53 22.09  ? 381  HIS B CE1  1 
ATOM   7102 N NE2  A HIS B 1 380 ? 105.893 51.962 8.093   0.47 32.06  ? 381  HIS B NE2  1 
ATOM   7103 N NE2  B HIS B 1 380 ? 106.170 49.825 3.771   0.53 23.55  ? 381  HIS B NE2  1 
ATOM   7104 N N    . TYR B 1 381 ? 111.094 53.104 7.153   1.00 29.19  ? 382  TYR B N    1 
ATOM   7105 C CA   . TYR B 1 381 ? 111.483 53.950 8.273   1.00 23.92  ? 382  TYR B CA   1 
ATOM   7106 C C    . TYR B 1 381 ? 112.345 55.134 7.874   1.00 24.04  ? 382  TYR B C    1 
ATOM   7107 O O    . TYR B 1 381 ? 112.799 55.903 8.719   1.00 32.20  ? 382  TYR B O    1 
ATOM   7108 C CB   . TYR B 1 381 ? 112.114 53.118 9.382   1.00 22.29  ? 382  TYR B CB   1 
ATOM   7109 C CG   . TYR B 1 381 ? 111.089 52.277 10.104  1.00 24.33  ? 382  TYR B CG   1 
ATOM   7110 C CD1  . TYR B 1 381 ? 110.634 51.075 9.560   1.00 21.57  ? 382  TYR B CD1  1 
ATOM   7111 C CD2  . TYR B 1 381 ? 110.550 52.697 11.312  1.00 20.60  ? 382  TYR B CD2  1 
ATOM   7112 C CE1  . TYR B 1 381 ? 109.675 50.305 10.215  1.00 23.19  ? 382  TYR B CE1  1 
ATOM   7113 C CE2  . TYR B 1 381 ? 109.595 51.930 11.980  1.00 17.03  ? 382  TYR B CE2  1 
ATOM   7114 C CZ   . TYR B 1 381 ? 109.167 50.743 11.427  1.00 25.36  ? 382  TYR B CZ   1 
ATOM   7115 O OH   . TYR B 1 381 ? 108.224 49.999 12.083  1.00 22.51  ? 382  TYR B OH   1 
ATOM   7116 N N    . THR B 1 382 ? 112.547 55.302 6.575   1.00 25.84  ? 383  THR B N    1 
ATOM   7117 C CA   . THR B 1 382 ? 113.255 56.478 6.092   1.00 26.68  ? 383  THR B CA   1 
ATOM   7118 C C    . THR B 1 382 ? 112.240 57.551 5.727   1.00 26.18  ? 383  THR B C    1 
ATOM   7119 O O    . THR B 1 382 ? 111.236 57.264 5.067   1.00 25.90  ? 383  THR B O    1 
ATOM   7120 C CB   . THR B 1 382 ? 114.149 56.160 4.871   1.00 27.15  ? 383  THR B CB   1 
ATOM   7121 O OG1  . THR B 1 382 ? 115.243 55.318 5.275   1.00 27.13  ? 383  THR B OG1  1 
ATOM   7122 C CG2  . THR B 1 382 ? 114.699 57.433 4.259   1.00 19.61  ? 383  THR B CG2  1 
ATOM   7123 N N    . ASP B 1 383 ? 112.492 58.779 6.178   1.00 25.92  ? 384  ASP B N    1 
ATOM   7124 C CA   . ASP B 1 383 ? 111.749 59.937 5.701   1.00 27.66  ? 384  ASP B CA   1 
ATOM   7125 C C    . ASP B 1 383 ? 112.541 60.477 4.518   1.00 28.69  ? 384  ASP B C    1 
ATOM   7126 O O    . ASP B 1 383 ? 113.574 61.121 4.698   1.00 22.25  ? 384  ASP B O    1 
ATOM   7127 C CB   . ASP B 1 383 ? 111.644 61.001 6.800   1.00 27.49  ? 384  ASP B CB   1 
ATOM   7128 C CG   . ASP B 1 383 ? 110.892 62.256 6.345   1.00 35.02  ? 384  ASP B CG   1 
ATOM   7129 O OD1  . ASP B 1 383 ? 110.651 62.427 5.126   1.00 36.90  ? 384  ASP B OD1  1 
ATOM   7130 O OD2  . ASP B 1 383 ? 110.551 63.087 7.218   1.00 37.32  ? 384  ASP B OD2  1 
ATOM   7131 N N    . TRP B 1 384 ? 112.053 60.224 3.307   1.00 25.13  ? 385  TRP B N    1 
ATOM   7132 C CA   . TRP B 1 384 ? 112.816 60.554 2.112   1.00 25.45  ? 385  TRP B CA   1 
ATOM   7133 C C    . TRP B 1 384 ? 112.910 62.054 1.812   1.00 31.35  ? 385  TRP B C    1 
ATOM   7134 O O    . TRP B 1 384 ? 113.582 62.468 0.853   1.00 31.97  ? 385  TRP B O    1 
ATOM   7135 C CB   . TRP B 1 384 ? 112.287 59.757 0.930   1.00 26.38  ? 385  TRP B CB   1 
ATOM   7136 C CG   . TRP B 1 384 ? 112.485 58.303 1.169   1.00 28.88  ? 385  TRP B CG   1 
ATOM   7137 C CD1  . TRP B 1 384 ? 111.570 57.419 1.649   1.00 25.30  ? 385  TRP B CD1  1 
ATOM   7138 C CD2  . TRP B 1 384 ? 113.704 57.568 0.989   1.00 28.74  ? 385  TRP B CD2  1 
ATOM   7139 N NE1  . TRP B 1 384 ? 112.132 56.173 1.757   1.00 26.81  ? 385  TRP B NE1  1 
ATOM   7140 C CE2  . TRP B 1 384 ? 113.433 56.236 1.356   1.00 23.57  ? 385  TRP B CE2  1 
ATOM   7141 C CE3  . TRP B 1 384 ? 114.982 57.911 0.550   1.00 20.24  ? 385  TRP B CE3  1 
ATOM   7142 C CZ2  . TRP B 1 384 ? 114.410 55.240 1.290   1.00 19.33  ? 385  TRP B CZ2  1 
ATOM   7143 C CZ3  . TRP B 1 384 ? 115.949 56.916 0.482   1.00 21.17  ? 385  TRP B CZ3  1 
ATOM   7144 C CH2  . TRP B 1 384 ? 115.654 55.596 0.848   1.00 20.16  ? 385  TRP B CH2  1 
ATOM   7145 N N    . LEU B 1 385 ? 112.245 62.863 2.631   1.00 26.52  ? 386  LEU B N    1 
ATOM   7146 C CA   . LEU B 1 385 ? 112.467 64.313 2.595   1.00 35.45  ? 386  LEU B CA   1 
ATOM   7147 C C    . LEU B 1 385 ? 113.641 64.724 3.490   1.00 37.58  ? 386  LEU B C    1 
ATOM   7148 O O    . LEU B 1 385 ? 114.235 65.786 3.298   1.00 37.09  ? 386  LEU B O    1 
ATOM   7149 C CB   . LEU B 1 385 ? 111.202 65.071 3.006   1.00 38.52  ? 386  LEU B CB   1 
ATOM   7150 C CG   . LEU B 1 385 ? 110.095 65.084 1.951   1.00 40.15  ? 386  LEU B CG   1 
ATOM   7151 C CD1  . LEU B 1 385 ? 108.899 65.885 2.418   1.00 35.34  ? 386  LEU B CD1  1 
ATOM   7152 C CD2  . LEU B 1 385 ? 110.632 65.635 0.652   1.00 34.14  ? 386  LEU B CD2  1 
ATOM   7153 N N    . HIS B 1 386 ? 113.957 63.871 4.465   1.00 38.67  ? 387  HIS B N    1 
ATOM   7154 C CA   . HIS B 1 386 ? 115.019 64.125 5.440   1.00 38.85  ? 387  HIS B CA   1 
ATOM   7155 C C    . HIS B 1 386 ? 115.800 62.841 5.706   1.00 35.46  ? 387  HIS B C    1 
ATOM   7156 O O    . HIS B 1 386 ? 115.900 62.412 6.852   1.00 26.74  ? 387  HIS B O    1 
ATOM   7157 C CB   . HIS B 1 386 ? 114.416 64.620 6.763   1.00 37.69  ? 387  HIS B CB   1 
ATOM   7158 C CG   . HIS B 1 386 ? 113.525 65.813 6.609   1.00 43.23  ? 387  HIS B CG   1 
ATOM   7159 N ND1  . HIS B 1 386 ? 114.009 67.104 6.583   1.00 41.46  ? 387  HIS B ND1  1 
ATOM   7160 C CD2  . HIS B 1 386 ? 112.182 65.908 6.451   1.00 41.77  ? 387  HIS B CD2  1 
ATOM   7161 C CE1  . HIS B 1 386 ? 113.000 67.945 6.427   1.00 39.01  ? 387  HIS B CE1  1 
ATOM   7162 N NE2  . HIS B 1 386 ? 111.883 67.245 6.341   1.00 38.73  ? 387  HIS B NE2  1 
ATOM   7163 N N    . PRO B 1 387 ? 116.363 62.229 4.651   1.00 34.35  ? 388  PRO B N    1 
ATOM   7164 C CA   . PRO B 1 387 ? 116.939 60.885 4.775   1.00 26.23  ? 388  PRO B CA   1 
ATOM   7165 C C    . PRO B 1 387 ? 118.163 60.795 5.692   1.00 32.15  ? 388  PRO B C    1 
ATOM   7166 O O    . PRO B 1 387 ? 118.509 59.684 6.104   1.00 29.75  ? 388  PRO B O    1 
ATOM   7167 C CB   . PRO B 1 387 ? 117.333 60.538 3.328   1.00 23.29  ? 388  PRO B CB   1 
ATOM   7168 C CG   . PRO B 1 387 ? 117.545 61.871 2.663   1.00 22.76  ? 388  PRO B CG   1 
ATOM   7169 C CD   . PRO B 1 387 ? 116.514 62.778 3.288   1.00 35.51  ? 388  PRO B CD   1 
ATOM   7170 N N    . GLU B 1 388 ? 118.788 61.929 6.015   1.00 37.10  ? 389  GLU B N    1 
ATOM   7171 C CA   . GLU B 1 388 ? 120.051 61.925 6.760   1.00 35.23  ? 389  GLU B CA   1 
ATOM   7172 C C    . GLU B 1 388 ? 120.069 62.731 8.080   1.00 38.24  ? 389  GLU B C    1 
ATOM   7173 O O    . GLU B 1 388 ? 121.128 62.915 8.685   1.00 39.24  ? 389  GLU B O    1 
ATOM   7174 C CB   . GLU B 1 388 ? 121.181 62.386 5.838   1.00 36.87  ? 389  GLU B CB   1 
ATOM   7175 C CG   . GLU B 1 388 ? 121.257 61.586 4.551   1.00 47.62  ? 389  GLU B CG   1 
ATOM   7176 C CD   . GLU B 1 388 ? 122.665 61.468 3.994   1.00 64.97  ? 389  GLU B CD   1 
ATOM   7177 O OE1  . GLU B 1 388 ? 123.606 62.029 4.598   1.00 74.35  ? 389  GLU B OE1  1 
ATOM   7178 O OE2  . GLU B 1 388 ? 122.831 60.803 2.946   1.00 69.40  ? 389  GLU B OE2  1 
ATOM   7179 N N    . ASP B 1 389 ? 118.905 63.208 8.515   1.00 37.52  ? 390  ASP B N    1 
ATOM   7180 C CA   . ASP B 1 389 ? 118.782 63.958 9.765   1.00 38.04  ? 390  ASP B CA   1 
ATOM   7181 C C    . ASP B 1 389 ? 119.002 63.043 10.978  1.00 35.29  ? 390  ASP B C    1 
ATOM   7182 O O    . ASP B 1 389 ? 118.207 62.134 11.232  1.00 36.51  ? 390  ASP B O    1 
ATOM   7183 C CB   . ASP B 1 389 ? 117.402 64.631 9.842   1.00 42.40  ? 390  ASP B CB   1 
ATOM   7184 C CG   . ASP B 1 389 ? 117.166 65.346 11.167  1.00 50.56  ? 390  ASP B CG   1 
ATOM   7185 O OD1  . ASP B 1 389 ? 118.151 65.789 11.789  1.00 56.53  ? 390  ASP B OD1  1 
ATOM   7186 O OD2  . ASP B 1 389 ? 115.993 65.471 11.587  1.00 54.27  ? 390  ASP B OD2  1 
ATOM   7187 N N    . PRO B 1 390 ? 120.087 63.286 11.727  1.00 35.68  ? 391  PRO B N    1 
ATOM   7188 C CA   . PRO B 1 390 ? 120.533 62.450 12.852  1.00 35.31  ? 391  PRO B CA   1 
ATOM   7189 C C    . PRO B 1 390 ? 119.445 62.177 13.897  1.00 36.08  ? 391  PRO B C    1 
ATOM   7190 O O    . PRO B 1 390 ? 119.253 61.016 14.268  1.00 37.35  ? 391  PRO B O    1 
ATOM   7191 C CB   . PRO B 1 390 ? 121.685 63.263 13.455  1.00 32.46  ? 391  PRO B CB   1 
ATOM   7192 C CG   . PRO B 1 390 ? 122.238 64.013 12.280  1.00 32.00  ? 391  PRO B CG   1 
ATOM   7193 C CD   . PRO B 1 390 ? 121.040 64.376 11.432  1.00 29.74  ? 391  PRO B CD   1 
ATOM   7194 N N    . ALA B 1 391 ? 118.745 63.216 14.344  1.00 34.99  ? 392  ALA B N    1 
ATOM   7195 C CA   . ALA B 1 391 ? 117.673 63.062 15.332  1.00 39.16  ? 392  ALA B CA   1 
ATOM   7196 C C    . ALA B 1 391 ? 116.541 62.160 14.837  1.00 35.08  ? 392  ALA B C    1 
ATOM   7197 O O    . ALA B 1 391 ? 116.027 61.316 15.584  1.00 28.17  ? 392  ALA B O    1 
ATOM   7198 C CB   . ALA B 1 391 ? 117.121 64.420 15.734  1.00 35.74  ? 392  ALA B CB   1 
ATOM   7199 N N    . ARG B 1 392 ? 116.136 62.363 13.587  1.00 33.13  ? 393  ARG B N    1 
ATOM   7200 C CA   . ARG B 1 392 ? 115.068 61.565 13.002  1.00 28.98  ? 393  ARG B CA   1 
ATOM   7201 C C    . ARG B 1 392 ? 115.504 60.117 12.811  1.00 29.39  ? 393  ARG B C    1 
ATOM   7202 O O    . ARG B 1 392 ? 114.684 59.196 12.879  1.00 28.48  ? 393  ARG B O    1 
ATOM   7203 C CB   . ARG B 1 392 ? 114.653 62.149 11.657  1.00 28.21  ? 393  ARG B CB   1 
ATOM   7204 C CG   . ARG B 1 392 ? 113.796 63.403 11.713  1.00 27.06  ? 393  ARG B CG   1 
ATOM   7205 C CD   . ARG B 1 392 ? 113.530 63.836 10.278  1.00 31.45  ? 393  ARG B CD   1 
ATOM   7206 N NE   . ARG B 1 392 ? 112.445 64.801 10.114  1.00 33.33  ? 393  ARG B NE   1 
ATOM   7207 C CZ   . ARG B 1 392 ? 112.631 66.117 10.047  1.00 39.02  ? 393  ARG B CZ   1 
ATOM   7208 N NH1  . ARG B 1 392 ? 113.852 66.618 10.163  1.00 42.90  ? 393  ARG B NH1  1 
ATOM   7209 N NH2  . ARG B 1 392 ? 111.602 66.931 9.876   1.00 41.04  ? 393  ARG B NH2  1 
ATOM   7210 N N    . LEU B 1 393 ? 116.795 59.926 12.546  1.00 27.53  ? 394  LEU B N    1 
ATOM   7211 C CA   . LEU B 1 393 ? 117.341 58.585 12.348  1.00 26.12  ? 394  LEU B CA   1 
ATOM   7212 C C    . LEU B 1 393 ? 117.362 57.824 13.677  1.00 27.69  ? 394  LEU B C    1 
ATOM   7213 O O    . LEU B 1 393 ? 117.028 56.638 13.733  1.00 27.57  ? 394  LEU B O    1 
ATOM   7214 C CB   . LEU B 1 393 ? 118.737 58.660 11.730  1.00 22.28  ? 394  LEU B CB   1 
ATOM   7215 C CG   . LEU B 1 393 ? 118.812 59.088 10.261  1.00 28.16  ? 394  LEU B CG   1 
ATOM   7216 C CD1  . LEU B 1 393 ? 120.247 59.423 9.868   1.00 24.55  ? 394  LEU B CD1  1 
ATOM   7217 C CD2  . LEU B 1 393 ? 118.266 58.008 9.338   1.00 21.69  ? 394  LEU B CD2  1 
ATOM   7218 N N    . ARG B 1 394 ? 117.747 58.522 14.741  1.00 24.64  ? 395  ARG B N    1 
ATOM   7219 C CA   . ARG B 1 394 ? 117.723 57.957 16.081  1.00 27.09  ? 395  ARG B CA   1 
ATOM   7220 C C    . ARG B 1 394 ? 116.316 57.468 16.409  1.00 30.31  ? 395  ARG B C    1 
ATOM   7221 O O    . ARG B 1 394 ? 116.138 56.306 16.750  1.00 29.81  ? 395  ARG B O    1 
ATOM   7222 C CB   . ARG B 1 394 ? 118.187 58.986 17.123  1.00 25.29  ? 395  ARG B CB   1 
ATOM   7223 C CG   . ARG B 1 394 ? 118.429 58.395 18.510  1.00 30.87  ? 395  ARG B CG   1 
ATOM   7224 C CD   . ARG B 1 394 ? 118.656 59.482 19.551  1.00 33.62  ? 395  ARG B CD   1 
ATOM   7225 N NE   . ARG B 1 394 ? 117.537 60.416 19.576  1.00 38.98  ? 395  ARG B NE   1 
ATOM   7226 C CZ   . ARG B 1 394 ? 117.643 61.714 19.846  1.00 38.20  ? 395  ARG B CZ   1 
ATOM   7227 N NH1  . ARG B 1 394 ? 118.821 62.245 20.120  1.00 41.05  ? 395  ARG B NH1  1 
ATOM   7228 N NH2  . ARG B 1 394 ? 116.563 62.479 19.843  1.00 36.27  ? 395  ARG B NH2  1 
ATOM   7229 N N    . GLU B 1 395 ? 115.322 58.349 16.282  1.00 31.89  ? 396  GLU B N    1 
ATOM   7230 C CA   . GLU B 1 395 ? 113.933 57.985 16.549  1.00 30.62  ? 396  GLU B CA   1 
ATOM   7231 C C    . GLU B 1 395 ? 113.497 56.828 15.665  1.00 26.96  ? 396  GLU B C    1 
ATOM   7232 O O    . GLU B 1 395 ? 112.773 55.941 16.109  1.00 28.99  ? 396  GLU B O    1 
ATOM   7233 C CB   . GLU B 1 395 ? 112.995 59.186 16.332  1.00 32.40  ? 396  GLU B CB   1 
ATOM   7234 C CG   . GLU B 1 395 ? 112.556 59.921 17.613  1.00 47.94  ? 396  GLU B CG   1 
ATOM   7235 C CD   . GLU B 1 395 ? 113.712 60.559 18.398  1.00 66.75  ? 396  GLU B CD   1 
ATOM   7236 O OE1  . GLU B 1 395 ? 114.077 61.722 18.093  1.00 72.02  ? 396  GLU B OE1  1 
ATOM   7237 O OE2  . GLU B 1 395 ? 114.246 59.907 19.333  1.00 70.60  ? 396  GLU B OE2  1 
ATOM   7238 N N    . ALA B 1 396 ? 113.942 56.825 14.414  1.00 22.64  ? 397  ALA B N    1 
ATOM   7239 C CA   . ALA B 1 396 ? 113.447 55.826 13.466  1.00 23.41  ? 397  ALA B CA   1 
ATOM   7240 C C    . ALA B 1 396 ? 113.993 54.442 13.784  1.00 26.78  ? 397  ALA B C    1 
ATOM   7241 O O    . ALA B 1 396 ? 113.278 53.455 13.656  1.00 22.83  ? 397  ALA B O    1 
ATOM   7242 C CB   . ALA B 1 396 ? 113.753 56.223 12.028  1.00 19.16  ? 397  ALA B CB   1 
ATOM   7243 N N    . LEU B 1 397 ? 115.251 54.365 14.214  1.00 19.72  ? 398  LEU B N    1 
ATOM   7244 C CA   . LEU B 1 397 ? 115.823 53.075 14.575  1.00 19.82  ? 398  LEU B CA   1 
ATOM   7245 C C    . LEU B 1 397 ? 115.182 52.537 15.858  1.00 30.06  ? 398  LEU B C    1 
ATOM   7246 O O    . LEU B 1 397 ? 114.967 51.334 16.005  1.00 27.25  ? 398  LEU B O    1 
ATOM   7247 C CB   . LEU B 1 397 ? 117.340 53.168 14.727  1.00 21.40  ? 398  LEU B CB   1 
ATOM   7248 C CG   . LEU B 1 397 ? 117.995 51.795 14.896  1.00 26.62  ? 398  LEU B CG   1 
ATOM   7249 C CD1  . LEU B 1 397 ? 117.644 50.894 13.711  1.00 22.12  ? 398  LEU B CD1  1 
ATOM   7250 C CD2  . LEU B 1 397 ? 119.510 51.934 15.028  1.00 32.38  ? 398  LEU B CD2  1 
ATOM   7251 N N    . SER B 1 398 ? 114.869 53.436 16.783  1.00 25.82  ? 399  SER B N    1 
ATOM   7252 C CA   . SER B 1 398 ? 114.148 53.055 17.989  1.00 26.32  ? 399  SER B CA   1 
ATOM   7253 C C    . SER B 1 398 ? 112.777 52.477 17.616  1.00 23.64  ? 399  SER B C    1 
ATOM   7254 O O    . SER B 1 398 ? 112.354 51.460 18.168  1.00 21.30  ? 399  SER B O    1 
ATOM   7255 C CB   . SER B 1 398 ? 113.987 54.264 18.910  1.00 27.04  ? 399  SER B CB   1 
ATOM   7256 O OG   . SER B 1 398 ? 113.186 53.943 20.040  1.00 33.85  ? 399  SER B OG   1 
ATOM   7257 N N    . ASP B 1 399 ? 112.096 53.134 16.680  1.00 21.62  ? 400  ASP B N    1 
ATOM   7258 C CA   . ASP B 1 399 ? 110.815 52.654 16.168  1.00 25.60  ? 400  ASP B CA   1 
ATOM   7259 C C    . ASP B 1 399 ? 110.947 51.304 15.474  1.00 28.98  ? 400  ASP B C    1 
ATOM   7260 O O    . ASP B 1 399 ? 110.094 50.428 15.648  1.00 24.64  ? 400  ASP B O    1 
ATOM   7261 C CB   . ASP B 1 399 ? 110.198 53.652 15.187  1.00 29.94  ? 400  ASP B CB   1 
ATOM   7262 C CG   . ASP B 1 399 ? 109.593 54.864 15.878  1.00 48.05  ? 400  ASP B CG   1 
ATOM   7263 O OD1  . ASP B 1 399 ? 109.304 54.798 17.095  1.00 51.51  ? 400  ASP B OD1  1 
ATOM   7264 O OD2  . ASP B 1 399 ? 109.387 55.884 15.183  1.00 54.76  ? 400  ASP B OD2  1 
ATOM   7265 N N    . VAL B 1 400 ? 111.999 51.129 14.675  1.00 24.60  ? 401  VAL B N    1 
ATOM   7266 C CA   . VAL B 1 400 ? 112.221 49.830 14.035  1.00 24.14  ? 401  VAL B CA   1 
ATOM   7267 C C    . VAL B 1 400 ? 112.292 48.722 15.089  1.00 27.86  ? 401  VAL B C    1 
ATOM   7268 O O    . VAL B 1 400 ? 111.564 47.731 15.023  1.00 23.71  ? 401  VAL B O    1 
ATOM   7269 C CB   . VAL B 1 400 ? 113.508 49.812 13.179  1.00 27.22  ? 401  VAL B CB   1 
ATOM   7270 C CG1  . VAL B 1 400 ? 113.873 48.377 12.816  1.00 18.57  ? 401  VAL B CG1  1 
ATOM   7271 C CG2  . VAL B 1 400 ? 113.337 50.681 11.911  1.00 18.24  ? 401  VAL B CG2  1 
ATOM   7272 N N    . VAL B 1 401 ? 113.161 48.913 16.074  1.00 18.73  ? 402  VAL B N    1 
ATOM   7273 C CA   . VAL B 1 401 ? 113.366 47.921 17.104  1.00 19.02  ? 402  VAL B CA   1 
ATOM   7274 C C    . VAL B 1 401 ? 112.104 47.694 17.942  1.00 22.98  ? 402  VAL B C    1 
ATOM   7275 O O    . VAL B 1 401 ? 111.750 46.554 18.241  1.00 20.41  ? 402  VAL B O    1 
ATOM   7276 C CB   . VAL B 1 401 ? 114.558 48.299 18.004  1.00 25.97  ? 402  VAL B CB   1 
ATOM   7277 C CG1  . VAL B 1 401 ? 114.605 47.378 19.210  1.00 21.49  ? 402  VAL B CG1  1 
ATOM   7278 C CG2  . VAL B 1 401 ? 115.871 48.244 17.203  1.00 20.55  ? 402  VAL B CG2  1 
ATOM   7279 N N    . GLY B 1 402 ? 111.416 48.772 18.308  1.00 23.20  ? 403  GLY B N    1 
ATOM   7280 C CA   . GLY B 1 402 ? 110.195 48.659 19.098  1.00 24.71  ? 403  GLY B CA   1 
ATOM   7281 C C    . GLY B 1 402 ? 109.014 48.053 18.342  1.00 19.40  ? 403  GLY B C    1 
ATOM   7282 O O    . GLY B 1 402 ? 108.261 47.239 18.903  1.00 18.86  ? 403  GLY B O    1 
ATOM   7283 N N    . ASP B 1 403 ? 108.851 48.438 17.076  1.00 17.75  ? 404  ASP B N    1 
ATOM   7284 C CA   . ASP B 1 403 ? 107.725 47.975 16.277  1.00 19.03  ? 404  ASP B CA   1 
ATOM   7285 C C    . ASP B 1 403 ? 107.860 46.476 15.987  1.00 24.62  ? 404  ASP B C    1 
ATOM   7286 O O    . ASP B 1 403 ? 106.934 45.698 16.212  1.00 26.87  ? 404  ASP B O    1 
ATOM   7287 C CB   . ASP B 1 403 ? 107.618 48.770 14.963  1.00 19.64  ? 404  ASP B CB   1 
ATOM   7288 C CG   . ASP B 1 403 ? 107.299 50.273 15.174  1.00 23.48  ? 404  ASP B CG   1 
ATOM   7289 O OD1  . ASP B 1 403 ? 106.976 50.708 16.310  1.00 20.24  ? 404  ASP B OD1  1 
ATOM   7290 O OD2  . ASP B 1 403 ? 107.375 51.028 14.168  1.00 25.34  ? 404  ASP B OD2  1 
ATOM   7291 N N    . HIS B 1 404 ? 109.029 46.091 15.492  1.00 17.59  ? 405  HIS B N    1 
ATOM   7292 C CA   . HIS B 1 404 ? 109.356 44.706 15.158  1.00 20.06  ? 405  HIS B CA   1 
ATOM   7293 C C    . HIS B 1 404 ? 109.235 43.771 16.366  1.00 21.96  ? 405  HIS B C    1 
ATOM   7294 O O    . HIS B 1 404 ? 108.690 42.677 16.276  1.00 19.75  ? 405  HIS B O    1 
ATOM   7295 C CB   . HIS B 1 404 ? 110.794 44.664 14.624  1.00 18.10  ? 405  HIS B CB   1 
ATOM   7296 C CG   . HIS B 1 404 ? 111.283 43.308 14.250  1.00 28.85  ? 405  HIS B CG   1 
ATOM   7297 N ND1  . HIS B 1 404 ? 110.511 42.396 13.537  1.00 25.65  ? 405  HIS B ND1  1 
ATOM   7298 C CD2  . HIS B 1 404 ? 112.477 42.697 14.444  1.00 29.46  ? 405  HIS B CD2  1 
ATOM   7299 C CE1  . HIS B 1 404 ? 111.202 41.300 13.335  1.00 21.51  ? 405  HIS B CE1  1 
ATOM   7300 N NE2  . HIS B 1 404 ? 112.410 41.452 13.871  1.00 28.94  ? 405  HIS B NE2  1 
ATOM   7301 N N    . ASN B 1 405 ? 109.746 44.207 17.506  1.00 23.05  ? 406  ASN B N    1 
ATOM   7302 C CA   . ASN B 1 405 ? 109.820 43.328 18.656  1.00 18.89  ? 406  ASN B CA   1 
ATOM   7303 C C    . ASN B 1 405 ? 108.664 43.389 19.649  1.00 21.34  ? 406  ASN B C    1 
ATOM   7304 O O    . ASN B 1 405 ? 108.430 42.420 20.334  1.00 19.26  ? 406  ASN B O    1 
ATOM   7305 C CB   . ASN B 1 405 ? 111.145 43.526 19.390  1.00 21.41  ? 406  ASN B CB   1 
ATOM   7306 C CG   . ASN B 1 405 ? 112.331 43.049 18.573  1.00 23.15  ? 406  ASN B CG   1 
ATOM   7307 O OD1  . ASN B 1 405 ? 112.507 41.843 18.358  1.00 22.38  ? 406  ASN B OD1  1 
ATOM   7308 N ND2  . ASN B 1 405 ? 113.148 43.987 18.114  1.00 19.56  ? 406  ASN B ND2  1 
ATOM   7309 N N    . VAL B 1 406 ? 107.951 44.508 19.737  1.00 19.82  ? 407  VAL B N    1 
ATOM   7310 C CA   . VAL B 1 406 ? 106.936 44.650 20.784  1.00 19.98  ? 407  VAL B CA   1 
ATOM   7311 C C    . VAL B 1 406 ? 105.581 45.140 20.298  1.00 19.45  ? 407  VAL B C    1 
ATOM   7312 O O    . VAL B 1 406 ? 104.577 44.451 20.448  1.00 21.55  ? 407  VAL B O    1 
ATOM   7313 C CB   . VAL B 1 406 ? 107.405 45.586 21.923  1.00 22.89  ? 407  VAL B CB   1 
ATOM   7314 C CG1  . VAL B 1 406 ? 106.286 45.743 22.972  1.00 17.59  ? 407  VAL B CG1  1 
ATOM   7315 C CG2  . VAL B 1 406 ? 108.673 45.048 22.571  1.00 14.92  ? 407  VAL B CG2  1 
ATOM   7316 N N    . VAL B 1 407 ? 105.553 46.334 19.719  1.00 18.32  ? 408  VAL B N    1 
ATOM   7317 C CA   . VAL B 1 407 ? 104.293 46.955 19.345  1.00 16.58  ? 408  VAL B CA   1 
ATOM   7318 C C    . VAL B 1 407 ? 103.514 46.124 18.331  1.00 18.80  ? 408  VAL B C    1 
ATOM   7319 O O    . VAL B 1 407 ? 102.320 45.848 18.500  1.00 19.20  ? 408  VAL B O    1 
ATOM   7320 C CB   . VAL B 1 407 ? 104.518 48.353 18.776  1.00 23.14  ? 408  VAL B CB   1 
ATOM   7321 C CG1  . VAL B 1 407 ? 103.184 48.993 18.433  1.00 20.00  ? 408  VAL B CG1  1 
ATOM   7322 C CG2  . VAL B 1 407 ? 105.295 49.202 19.777  1.00 16.27  ? 408  VAL B CG2  1 
ATOM   7323 N N    . CYS B 1 408 ? 104.182 45.719 17.266  1.00 15.92  ? 409  CYS B N    1 
ATOM   7324 C CA   . CYS B 1 408 ? 103.461 45.014 16.211  1.00 21.93  ? 409  CYS B CA   1 
ATOM   7325 C C    . CYS B 1 408 ? 103.084 43.569 16.592  1.00 22.80  ? 409  CYS B C    1 
ATOM   7326 O O    . CYS B 1 408 ? 101.993 43.112 16.265  1.00 24.98  ? 409  CYS B O    1 
ATOM   7327 C CB   . CYS B 1 408 ? 104.209 45.137 14.889  1.00 18.79  ? 409  CYS B CB   1 
ATOM   7328 S SG   . CYS B 1 408 ? 104.285 46.898 14.389  1.00 27.93  ? 409  CYS B SG   1 
ATOM   7329 N N    . PRO B 1 409 ? 103.970 42.860 17.313  1.00 21.53  ? 410  PRO B N    1 
ATOM   7330 C CA   . PRO B 1 409 ? 103.504 41.580 17.868  1.00 21.30  ? 410  PRO B CA   1 
ATOM   7331 C C    . PRO B 1 409 ? 102.320 41.754 18.849  1.00 26.80  ? 410  PRO B C    1 
ATOM   7332 O O    . PRO B 1 409 ? 101.426 40.899 18.854  1.00 15.58  ? 410  PRO B O    1 
ATOM   7333 C CB   . PRO B 1 409 ? 104.757 41.022 18.568  1.00 15.08  ? 410  PRO B CB   1 
ATOM   7334 C CG   . PRO B 1 409 ? 105.915 41.618 17.757  1.00 18.44  ? 410  PRO B CG   1 
ATOM   7335 C CD   . PRO B 1 409 ? 105.435 43.022 17.419  1.00 15.34  ? 410  PRO B CD   1 
ATOM   7336 N N    . VAL B 1 410 ? 102.296 42.835 19.637  1.00 17.20  ? 411  VAL B N    1 
ATOM   7337 C CA   . VAL B 1 410 ? 101.180 43.075 20.559  1.00 15.55  ? 411  VAL B CA   1 
ATOM   7338 C C    . VAL B 1 410 ? 99.899  43.419 19.793  1.00 24.20  ? 411  VAL B C    1 
ATOM   7339 O O    . VAL B 1 410 ? 98.813  42.911 20.118  1.00 22.93  ? 411  VAL B O    1 
ATOM   7340 C CB   . VAL B 1 410 ? 101.506 44.158 21.627  1.00 19.17  ? 411  VAL B CB   1 
ATOM   7341 C CG1  . VAL B 1 410 ? 100.243 44.698 22.285  1.00 16.05  ? 411  VAL B CG1  1 
ATOM   7342 C CG2  . VAL B 1 410 ? 102.439 43.599 22.687  1.00 15.90  ? 411  VAL B CG2  1 
ATOM   7343 N N    . ALA B 1 411 ? 100.025 44.258 18.766  1.00 18.71  ? 412  ALA B N    1 
ATOM   7344 C CA   . ALA B 1 411 ? 98.863  44.638 17.965  1.00 26.47  ? 412  ALA B CA   1 
ATOM   7345 C C    . ALA B 1 411 ? 98.237  43.422 17.285  1.00 27.26  ? 412  ALA B C    1 
ATOM   7346 O O    . ALA B 1 411 ? 97.018  43.282 17.251  1.00 28.24  ? 412  ALA B O    1 
ATOM   7347 C CB   . ALA B 1 411 ? 99.232  45.698 16.936  1.00 24.81  ? 412  ALA B CB   1 
ATOM   7348 N N    . GLN B 1 412 ? 99.070  42.534 16.757  1.00 24.74  ? 413  GLN B N    1 
ATOM   7349 C CA   . GLN B 1 412 ? 98.560  41.322 16.117  1.00 21.16  ? 413  GLN B CA   1 
ATOM   7350 C C    . GLN B 1 412 ? 97.815  40.439 17.108  1.00 22.01  ? 413  GLN B C    1 
ATOM   7351 O O    . GLN B 1 412 ? 96.702  39.993 16.829  1.00 23.98  ? 413  GLN B O    1 
ATOM   7352 C CB   . GLN B 1 412 ? 99.689  40.532 15.468  1.00 19.85  ? 413  GLN B CB   1 
ATOM   7353 C CG   . GLN B 1 412 ? 99.213  39.338 14.663  1.00 29.03  ? 413  GLN B CG   1 
ATOM   7354 C CD   . GLN B 1 412 ? 100.353 38.671 13.926  1.00 42.33  ? 413  GLN B CD   1 
ATOM   7355 O OE1  . GLN B 1 412 ? 101.275 38.126 14.541  1.00 41.47  ? 413  GLN B OE1  1 
ATOM   7356 N NE2  . GLN B 1 412 ? 100.313 38.732 12.603  1.00 48.95  ? 413  GLN B NE2  1 
ATOM   7357 N N    . LEU B 1 413 ? 98.435  40.190 18.260  1.00 18.61  ? 414  LEU B N    1 
ATOM   7358 C CA   . LEU B 1 413 ? 97.800  39.452 19.344  1.00 18.41  ? 414  LEU B CA   1 
ATOM   7359 C C    . LEU B 1 413 ? 96.437  40.061 19.646  1.00 29.19  ? 414  LEU B C    1 
ATOM   7360 O O    . LEU B 1 413 ? 95.411  39.371 19.628  1.00 31.14  ? 414  LEU B O    1 
ATOM   7361 C CB   . LEU B 1 413 ? 98.660  39.515 20.608  1.00 17.54  ? 414  LEU B CB   1 
ATOM   7362 C CG   . LEU B 1 413 ? 98.097  38.649 21.737  1.00 26.31  ? 414  LEU B CG   1 
ATOM   7363 C CD1  . LEU B 1 413 ? 97.994  37.234 21.244  1.00 32.07  ? 414  LEU B CD1  1 
ATOM   7364 C CD2  . LEU B 1 413 ? 98.967  38.686 22.965  1.00 29.76  ? 414  LEU B CD2  1 
ATOM   7365 N N    . ALA B 1 414 ? 96.431  41.365 19.905  1.00 16.67  ? 415  ALA B N    1 
ATOM   7366 C CA   . ALA B 1 414 ? 95.197  42.058 20.258  1.00 17.02  ? 415  ALA B CA   1 
ATOM   7367 C C    . ALA B 1 414 ? 94.129  41.961 19.153  1.00 24.20  ? 415  ALA B C    1 
ATOM   7368 O O    . ALA B 1 414 ? 92.966  41.657 19.435  1.00 27.33  ? 415  ALA B O    1 
ATOM   7369 C CB   . ALA B 1 414 ? 95.487  43.497 20.600  1.00 17.61  ? 415  ALA B CB   1 
ATOM   7370 N N    . GLY B 1 415 ? 94.532  42.208 17.905  1.00 23.09  ? 416  GLY B N    1 
ATOM   7371 C CA   . GLY B 1 415 ? 93.631  42.143 16.769  1.00 18.24  ? 416  GLY B CA   1 
ATOM   7372 C C    . GLY B 1 415 ? 93.034  40.768 16.543  1.00 20.38  ? 416  GLY B C    1 
ATOM   7373 O O    . GLY B 1 415 ? 91.818  40.622 16.327  1.00 29.96  ? 416  GLY B O    1 
ATOM   7374 N N    . ARG B 1 416 ? 93.882  39.747 16.584  1.00 21.86  ? 417  ARG B N    1 
ATOM   7375 C CA   . ARG B 1 416 ? 93.422  38.387 16.347  1.00 29.31  ? 417  ARG B CA   1 
ATOM   7376 C C    . ARG B 1 416 ? 92.557  37.891 17.497  1.00 29.88  ? 417  ARG B C    1 
ATOM   7377 O O    . ARG B 1 416 ? 91.527  37.259 17.267  1.00 36.41  ? 417  ARG B O    1 
ATOM   7378 C CB   . ARG B 1 416 ? 94.600  37.442 16.098  1.00 30.57  ? 417  ARG B CB   1 
ATOM   7379 C CG   . ARG B 1 416 ? 95.402  37.807 14.861  1.00 32.10  ? 417  ARG B CG   1 
ATOM   7380 C CD   . ARG B 1 416 ? 94.501  37.968 13.643  1.00 31.30  ? 417  ARG B CD   1 
ATOM   7381 N NE   . ARG B 1 416 ? 94.250  36.693 12.986  1.00 45.63  ? 417  ARG B NE   1 
ATOM   7382 C CZ   . ARG B 1 416 ? 93.052  36.264 12.600  1.00 53.20  ? 417  ARG B CZ   1 
ATOM   7383 N NH1  . ARG B 1 416 ? 91.977  37.011 12.807  1.00 49.21  ? 417  ARG B NH1  1 
ATOM   7384 N NH2  . ARG B 1 416 ? 92.932  35.083 12.004  1.00 58.27  ? 417  ARG B NH2  1 
ATOM   7385 N N    . LEU B 1 417 ? 92.957  38.195 18.731  1.00 25.09  ? 418  LEU B N    1 
ATOM   7386 C CA   . LEU B 1 417 ? 92.169  37.749 19.876  1.00 28.43  ? 418  LEU B CA   1 
ATOM   7387 C C    . LEU B 1 417 ? 90.789  38.379 19.833  1.00 26.77  ? 418  LEU B C    1 
ATOM   7388 O O    . LEU B 1 417 ? 89.783  37.689 20.010  1.00 31.17  ? 418  LEU B O    1 
ATOM   7389 C CB   . LEU B 1 417 ? 92.862  38.045 21.208  1.00 21.37  ? 418  LEU B CB   1 
ATOM   7390 C CG   . LEU B 1 417 ? 94.097  37.204 21.546  1.00 31.04  ? 418  LEU B CG   1 
ATOM   7391 C CD1  . LEU B 1 417 ? 94.549  37.468 22.980  1.00 29.02  ? 418  LEU B CD1  1 
ATOM   7392 C CD2  . LEU B 1 417 ? 93.838  35.730 21.336  1.00 34.95  ? 418  LEU B CD2  1 
ATOM   7393 N N    . ALA B 1 418 ? 90.737  39.682 19.579  1.00 20.52  ? 419  ALA B N    1 
ATOM   7394 C CA   . ALA B 1 418 ? 89.442  40.373 19.495  1.00 27.68  ? 419  ALA B CA   1 
ATOM   7395 C C    . ALA B 1 418 ? 88.573  39.764 18.396  1.00 32.74  ? 419  ALA B C    1 
ATOM   7396 O O    . ALA B 1 418 ? 87.398  39.449 18.617  1.00 34.57  ? 419  ALA B O    1 
ATOM   7397 C CB   . ALA B 1 418 ? 89.630  41.861 19.268  1.00 19.29  ? 419  ALA B CB   1 
ATOM   7398 N N    . ALA B 1 419 ? 89.159  39.589 17.214  1.00 32.77  ? 420  ALA B N    1 
ATOM   7399 C CA   . ALA B 1 419 ? 88.402  39.077 16.073  1.00 32.97  ? 420  ALA B CA   1 
ATOM   7400 C C    . ALA B 1 419 ? 87.875  37.669 16.318  1.00 34.32  ? 420  ALA B C    1 
ATOM   7401 O O    . ALA B 1 419 ? 86.932  37.236 15.658  1.00 38.08  ? 420  ALA B O    1 
ATOM   7402 C CB   . ALA B 1 419 ? 89.237  39.117 14.804  1.00 25.82  ? 420  ALA B CB   1 
ATOM   7403 N N    . GLN B 1 420 ? 88.488  36.954 17.256  1.00 29.75  ? 421  GLN B N    1 
ATOM   7404 C CA   . GLN B 1 420 ? 88.062  35.595 17.567  1.00 29.04  ? 421  GLN B CA   1 
ATOM   7405 C C    . GLN B 1 420 ? 87.396  35.440 18.930  1.00 31.11  ? 421  GLN B C    1 
ATOM   7406 O O    . GLN B 1 420 ? 87.380  34.342 19.503  1.00 28.74  ? 421  GLN B O    1 
ATOM   7407 C CB   . GLN B 1 420 ? 89.215  34.621 17.384  1.00 30.29  ? 421  GLN B CB   1 
ATOM   7408 C CG   . GLN B 1 420 ? 89.556  34.457 15.915  1.00 47.47  ? 421  GLN B CG   1 
ATOM   7409 C CD   . GLN B 1 420 ? 91.009  34.176 15.693  1.00 56.82  ? 421  GLN B CD   1 
ATOM   7410 O OE1  . GLN B 1 420 ? 91.670  34.870 14.926  1.00 64.70  ? 421  GLN B OE1  1 
ATOM   7411 N NE2  . GLN B 1 420 ? 91.524  33.158 16.365  1.00 58.32  ? 421  GLN B NE2  1 
ATOM   7412 N N    . GLY B 1 421 ? 86.847  36.542 19.438  1.00 20.93  ? 422  GLY B N    1 
ATOM   7413 C CA   . GLY B 1 421 ? 85.865  36.466 20.511  1.00 22.86  ? 422  GLY B CA   1 
ATOM   7414 C C    . GLY B 1 421 ? 86.284  36.943 21.887  1.00 27.09  ? 422  GLY B C    1 
ATOM   7415 O O    . GLY B 1 421 ? 85.466  36.987 22.804  1.00 34.16  ? 422  GLY B O    1 
ATOM   7416 N N    . ALA B 1 422 ? 87.558  37.286 22.040  1.00 24.44  ? 423  ALA B N    1 
ATOM   7417 C CA   . ALA B 1 422 ? 88.065  37.776 23.314  1.00 23.73  ? 423  ALA B CA   1 
ATOM   7418 C C    . ALA B 1 422 ? 87.682  39.237 23.445  1.00 28.02  ? 423  ALA B C    1 
ATOM   7419 O O    . ALA B 1 422 ? 87.574  39.949 22.443  1.00 31.03  ? 423  ALA B O    1 
ATOM   7420 C CB   . ALA B 1 422 ? 89.571  37.627 23.381  1.00 21.45  ? 423  ALA B CB   1 
ATOM   7421 N N    . ARG B 1 423 ? 87.473  39.690 24.677  1.00 27.89  ? 424  ARG B N    1 
ATOM   7422 C CA   . ARG B 1 423 ? 87.276  41.110 24.906  1.00 28.49  ? 424  ARG B CA   1 
ATOM   7423 C C    . ARG B 1 423 ? 88.629  41.700 25.295  1.00 29.57  ? 424  ARG B C    1 
ATOM   7424 O O    . ARG B 1 423 ? 89.202  41.344 26.333  1.00 30.01  ? 424  ARG B O    1 
ATOM   7425 C CB   . ARG B 1 423 ? 86.221  41.366 25.989  1.00 19.90  ? 424  ARG B CB   1 
ATOM   7426 C CG   . ARG B 1 423 ? 85.793  42.834 26.051  1.00 38.74  ? 424  ARG B CG   1 
ATOM   7427 C CD   . ARG B 1 423 ? 84.488  43.046 26.807  1.00 47.84  ? 424  ARG B CD   1 
ATOM   7428 N NE   . ARG B 1 423 ? 84.697  43.122 28.253  1.00 57.65  ? 424  ARG B NE   1 
ATOM   7429 C CZ   . ARG B 1 423 ? 84.290  42.203 29.123  1.00 57.45  ? 424  ARG B CZ   1 
ATOM   7430 N NH1  . ARG B 1 423 ? 83.641  41.128 28.700  1.00 57.18  ? 424  ARG B NH1  1 
ATOM   7431 N NH2  . ARG B 1 423 ? 84.530  42.362 30.417  1.00 57.78  ? 424  ARG B NH2  1 
ATOM   7432 N N    . VAL B 1 424 ? 89.143  42.592 24.456  1.00 27.41  ? 425  VAL B N    1 
ATOM   7433 C CA   . VAL B 1 424 ? 90.506  43.096 24.623  1.00 27.46  ? 425  VAL B CA   1 
ATOM   7434 C C    . VAL B 1 424 ? 90.523  44.579 24.999  1.00 27.08  ? 425  VAL B C    1 
ATOM   7435 O O    . VAL B 1 424 ? 89.795  45.394 24.418  1.00 24.39  ? 425  VAL B O    1 
ATOM   7436 C CB   . VAL B 1 424 ? 91.323  42.891 23.328  1.00 24.61  ? 425  VAL B CB   1 
ATOM   7437 C CG1  . VAL B 1 424 ? 92.766  43.353 23.517  1.00 17.49  ? 425  VAL B CG1  1 
ATOM   7438 C CG2  . VAL B 1 424 ? 91.262  41.428 22.887  1.00 18.03  ? 425  VAL B CG2  1 
ATOM   7439 N N    . TYR B 1 425 ? 91.355  44.927 25.974  1.00 21.04  ? 426  TYR B N    1 
ATOM   7440 C CA   . TYR B 1 425 ? 91.604  46.328 26.294  1.00 23.53  ? 426  TYR B CA   1 
ATOM   7441 C C    . TYR B 1 425 ? 93.081  46.658 26.049  1.00 29.16  ? 426  TYR B C    1 
ATOM   7442 O O    . TYR B 1 425 ? 93.967  45.916 26.477  1.00 33.11  ? 426  TYR B O    1 
ATOM   7443 C CB   . TYR B 1 425 ? 91.231  46.614 27.745  1.00 19.08  ? 426  TYR B CB   1 
ATOM   7444 C CG   . TYR B 1 425 ? 89.775  46.397 28.044  1.00 24.04  ? 426  TYR B CG   1 
ATOM   7445 C CD1  . TYR B 1 425 ? 89.298  45.136 28.380  1.00 26.04  ? 426  TYR B CD1  1 
ATOM   7446 C CD2  . TYR B 1 425 ? 88.862  47.455 27.983  1.00 26.58  ? 426  TYR B CD2  1 
ATOM   7447 C CE1  . TYR B 1 425 ? 87.941  44.926 28.663  1.00 21.48  ? 426  TYR B CE1  1 
ATOM   7448 C CE2  . TYR B 1 425 ? 87.506  47.254 28.264  1.00 23.32  ? 426  TYR B CE2  1 
ATOM   7449 C CZ   . TYR B 1 425 ? 87.061  45.983 28.597  1.00 24.19  ? 426  TYR B CZ   1 
ATOM   7450 O OH   . TYR B 1 425 ? 85.733  45.764 28.875  1.00 27.35  ? 426  TYR B OH   1 
ATOM   7451 N N    . ALA B 1 426 ? 93.337  47.768 25.364  1.00 23.77  ? 427  ALA B N    1 
ATOM   7452 C CA   . ALA B 1 426 ? 94.699  48.141 24.991  1.00 21.27  ? 427  ALA B CA   1 
ATOM   7453 C C    . ALA B 1 426 ? 95.073  49.536 25.510  1.00 21.40  ? 427  ALA B C    1 
ATOM   7454 O O    . ALA B 1 426 ? 94.242  50.448 25.542  1.00 22.53  ? 427  ALA B O    1 
ATOM   7455 C CB   . ALA B 1 426 ? 94.872  48.068 23.468  1.00 17.49  ? 427  ALA B CB   1 
ATOM   7456 N N    . TYR B 1 427 ? 96.331  49.711 25.894  1.00 19.88  ? 428  TYR B N    1 
ATOM   7457 C CA   . TYR B 1 427 ? 96.792  51.003 26.387  1.00 21.69  ? 428  TYR B CA   1 
ATOM   7458 C C    . TYR B 1 427 ? 98.159  51.333 25.811  1.00 20.37  ? 428  TYR B C    1 
ATOM   7459 O O    . TYR B 1 427 ? 98.942  50.437 25.475  1.00 21.39  ? 428  TYR B O    1 
ATOM   7460 C CB   . TYR B 1 427 ? 96.884  50.997 27.926  1.00 23.49  ? 428  TYR B CB   1 
ATOM   7461 C CG   . TYR B 1 427 ? 97.949  50.055 28.458  1.00 21.91  ? 428  TYR B CG   1 
ATOM   7462 C CD1  . TYR B 1 427 ? 99.275  50.460 28.548  1.00 20.36  ? 428  TYR B CD1  1 
ATOM   7463 C CD2  . TYR B 1 427 ? 97.627  48.760 28.864  1.00 18.75  ? 428  TYR B CD2  1 
ATOM   7464 C CE1  . TYR B 1 427 ? 100.259 49.604 29.020  1.00 21.82  ? 428  TYR B CE1  1 
ATOM   7465 C CE2  . TYR B 1 427 ? 98.609  47.888 29.339  1.00 22.43  ? 428  TYR B CE2  1 
ATOM   7466 C CZ   . TYR B 1 427 ? 99.922  48.318 29.411  1.00 27.50  ? 428  TYR B CZ   1 
ATOM   7467 O OH   . TYR B 1 427 ? 100.906 47.474 29.881  1.00 29.92  ? 428  TYR B OH   1 
ATOM   7468 N N    . VAL B 1 428 ? 98.448  52.626 25.709  1.00 22.00  ? 429  VAL B N    1 
ATOM   7469 C CA   . VAL B 1 428 ? 99.824  53.084 25.561  1.00 22.84  ? 429  VAL B CA   1 
ATOM   7470 C C    . VAL B 1 428 ? 100.189 53.875 26.809  1.00 26.99  ? 429  VAL B C    1 
ATOM   7471 O O    . VAL B 1 428 ? 99.500  54.843 27.164  1.00 26.21  ? 429  VAL B O    1 
ATOM   7472 C CB   . VAL B 1 428 ? 100.014 53.953 24.321  1.00 20.01  ? 429  VAL B CB   1 
ATOM   7473 C CG1  . VAL B 1 428 ? 101.469 54.354 24.202  1.00 22.78  ? 429  VAL B CG1  1 
ATOM   7474 C CG2  . VAL B 1 428 ? 99.596  53.165 23.094  1.00 30.03  ? 429  VAL B CG2  1 
ATOM   7475 N N    . PHE B 1 429 ? 101.254 53.451 27.484  1.00 23.17  ? 430  PHE B N    1 
ATOM   7476 C CA   . PHE B 1 429 ? 101.682 54.112 28.713  1.00 22.35  ? 430  PHE B CA   1 
ATOM   7477 C C    . PHE B 1 429 ? 102.653 55.234 28.355  1.00 21.42  ? 430  PHE B C    1 
ATOM   7478 O O    . PHE B 1 429 ? 103.718 54.983 27.788  1.00 25.56  ? 430  PHE B O    1 
ATOM   7479 C CB   . PHE B 1 429 ? 102.319 53.094 29.660  1.00 17.62  ? 430  PHE B CB   1 
ATOM   7480 C CG   . PHE B 1 429 ? 102.855 53.691 30.928  1.00 23.43  ? 430  PHE B CG   1 
ATOM   7481 C CD1  . PHE B 1 429 ? 104.165 54.149 30.998  1.00 30.64  ? 430  PHE B CD1  1 
ATOM   7482 C CD2  . PHE B 1 429 ? 102.061 53.774 32.060  1.00 25.65  ? 430  PHE B CD2  1 
ATOM   7483 C CE1  . PHE B 1 429 ? 104.674 54.691 32.175  1.00 28.07  ? 430  PHE B CE1  1 
ATOM   7484 C CE2  . PHE B 1 429 ? 102.562 54.319 33.238  1.00 30.88  ? 430  PHE B CE2  1 
ATOM   7485 C CZ   . PHE B 1 429 ? 103.869 54.778 33.290  1.00 30.09  ? 430  PHE B CZ   1 
ATOM   7486 N N    . GLU B 1 430 ? 102.291 56.469 28.689  1.00 27.46  ? 431  GLU B N    1 
ATOM   7487 C CA   . GLU B 1 430 ? 102.987 57.632 28.131  1.00 33.96  ? 431  GLU B CA   1 
ATOM   7488 C C    . GLU B 1 430 ? 103.626 58.553 29.151  1.00 33.53  ? 431  GLU B C    1 
ATOM   7489 O O    . GLU B 1 430 ? 104.093 59.632 28.804  1.00 30.29  ? 431  GLU B O    1 
ATOM   7490 C CB   . GLU B 1 430 ? 102.041 58.440 27.240  1.00 32.95  ? 431  GLU B CB   1 
ATOM   7491 C CG   . GLU B 1 430 ? 101.642 57.706 25.979  1.00 43.12  ? 431  GLU B CG   1 
ATOM   7492 C CD   . GLU B 1 430 ? 101.002 58.607 24.947  1.00 52.37  ? 431  GLU B CD   1 
ATOM   7493 O OE1  . GLU B 1 430 ? 100.131 59.420 25.328  1.00 56.01  ? 431  GLU B OE1  1 
ATOM   7494 O OE2  . GLU B 1 430 ? 101.369 58.494 23.754  1.00 56.47  ? 431  GLU B OE2  1 
ATOM   7495 N N    . HIS B 1 431 ? 103.644 58.144 30.409  1.00 29.05  ? 432  HIS B N    1 
ATOM   7496 C CA   . HIS B 1 431 ? 104.275 58.968 31.428  1.00 26.05  ? 432  HIS B CA   1 
ATOM   7497 C C    . HIS B 1 431 ? 105.741 58.584 31.706  1.00 24.65  ? 432  HIS B C    1 
ATOM   7498 O O    . HIS B 1 431 ? 106.052 57.439 32.040  1.00 28.94  ? 432  HIS B O    1 
ATOM   7499 C CB   . HIS B 1 431 ? 103.477 58.915 32.722  1.00 22.70  ? 432  HIS B CB   1 
ATOM   7500 C CG   . HIS B 1 431 ? 104.135 59.637 33.847  1.00 27.86  ? 432  HIS B CG   1 
ATOM   7501 N ND1  . HIS B 1 431 ? 104.294 61.006 33.857  1.00 35.32  ? 432  HIS B ND1  1 
ATOM   7502 C CD2  . HIS B 1 431 ? 104.706 59.180 34.988  1.00 32.37  ? 432  HIS B CD2  1 
ATOM   7503 C CE1  . HIS B 1 431 ? 104.912 61.365 34.969  1.00 34.04  ? 432  HIS B CE1  1 
ATOM   7504 N NE2  . HIS B 1 431 ? 105.173 60.278 35.672  1.00 31.45  ? 432  HIS B NE2  1 
ATOM   7505 N N    . ARG B 1 432 ? 106.639 59.550 31.571  1.00 27.23  ? 433  ARG B N    1 
ATOM   7506 C CA   . ARG B 1 432 ? 108.037 59.340 31.925  1.00 29.71  ? 433  ARG B CA   1 
ATOM   7507 C C    . ARG B 1 432 ? 108.254 59.668 33.399  1.00 31.04  ? 433  ARG B C    1 
ATOM   7508 O O    . ARG B 1 432 ? 108.091 60.816 33.810  1.00 31.09  ? 433  ARG B O    1 
ATOM   7509 C CB   . ARG B 1 432 ? 108.941 60.218 31.063  1.00 31.34  ? 433  ARG B CB   1 
ATOM   7510 C CG   . ARG B 1 432 ? 110.402 60.194 31.494  1.00 36.69  ? 433  ARG B CG   1 
ATOM   7511 C CD   . ARG B 1 432 ? 111.278 60.955 30.525  1.00 31.42  ? 433  ARG B CD   1 
ATOM   7512 N NE   . ARG B 1 432 ? 112.627 61.128 31.050  1.00 32.11  ? 433  ARG B NE   1 
ATOM   7513 C CZ   . ARG B 1 432 ? 113.698 60.471 30.617  1.00 32.89  ? 433  ARG B CZ   1 
ATOM   7514 N NH1  . ARG B 1 432 ? 113.597 59.585 29.627  1.00 29.55  ? 433  ARG B NH1  1 
ATOM   7515 N NH2  . ARG B 1 432 ? 114.875 60.712 31.177  1.00 31.83  ? 433  ARG B NH2  1 
ATOM   7516 N N    . ALA B 1 433 ? 108.613 58.656 34.186  1.00 32.61  ? 434  ALA B N    1 
ATOM   7517 C CA   . ALA B 1 433 ? 108.819 58.811 35.629  1.00 29.60  ? 434  ALA B CA   1 
ATOM   7518 C C    . ALA B 1 433 ? 109.769 59.962 35.947  1.00 33.95  ? 434  ALA B C    1 
ATOM   7519 O O    . ALA B 1 433 ? 110.825 60.086 35.330  1.00 34.66  ? 434  ALA B O    1 
ATOM   7520 C CB   . ALA B 1 433 ? 109.369 57.517 36.219  1.00 23.63  ? 434  ALA B CB   1 
ATOM   7521 N N    . SER B 1 434 ? 109.405 60.792 36.922  1.00 29.09  ? 435  SER B N    1 
ATOM   7522 C CA   . SER B 1 434 ? 110.292 61.865 37.365  1.00 31.96  ? 435  SER B CA   1 
ATOM   7523 C C    . SER B 1 434 ? 111.626 61.312 37.876  1.00 34.22  ? 435  SER B C    1 
ATOM   7524 O O    . SER B 1 434 ? 112.633 62.001 37.834  1.00 32.52  ? 435  SER B O    1 
ATOM   7525 C CB   . SER B 1 434 ? 109.631 62.683 38.474  1.00 33.29  ? 435  SER B CB   1 
ATOM   7526 O OG   . SER B 1 434 ? 109.525 61.911 39.658  1.00 36.61  ? 435  SER B OG   1 
ATOM   7527 N N    . THR B 1 435 ? 111.624 60.070 38.352  1.00 32.99  ? 436  THR B N    1 
ATOM   7528 C CA   . THR B 1 435 ? 112.822 59.442 38.928  1.00 37.56  ? 436  THR B CA   1 
ATOM   7529 C C    . THR B 1 435 ? 113.676 58.687 37.915  1.00 33.93  ? 436  THR B C    1 
ATOM   7530 O O    . THR B 1 435 ? 114.627 58.003 38.291  1.00 36.54  ? 436  THR B O    1 
ATOM   7531 C CB   . THR B 1 435 ? 112.436 58.404 39.997  1.00 36.60  ? 436  THR B CB   1 
ATOM   7532 O OG1  . THR B 1 435 ? 111.537 57.443 39.415  1.00 32.26  ? 436  THR B OG1  1 
ATOM   7533 C CG2  . THR B 1 435 ? 111.768 59.074 41.197  1.00 34.50  ? 436  THR B CG2  1 
ATOM   7534 N N    . LEU B 1 436 ? 113.314 58.768 36.640  1.00 32.33  ? 437  LEU B N    1 
ATOM   7535 C CA   . LEU B 1 436 ? 113.985 57.977 35.608  1.00 32.67  ? 437  LEU B CA   1 
ATOM   7536 C C    . LEU B 1 436 ? 115.432 58.471 35.420  1.00 36.56  ? 437  LEU B C    1 
ATOM   7537 O O    . LEU B 1 436 ? 115.678 59.680 35.299  1.00 32.43  ? 437  LEU B O    1 
ATOM   7538 C CB   . LEU B 1 436 ? 113.196 58.062 34.302  1.00 36.90  ? 437  LEU B CB   1 
ATOM   7539 C CG   . LEU B 1 436 ? 113.421 57.033 33.193  1.00 46.69  ? 437  LEU B CG   1 
ATOM   7540 C CD1  . LEU B 1 436 ? 113.490 55.638 33.752  1.00 44.04  ? 437  LEU B CD1  1 
ATOM   7541 C CD2  . LEU B 1 436 ? 112.297 57.119 32.173  1.00 49.64  ? 437  LEU B CD2  1 
ATOM   7542 N N    . SER B 1 437 ? 116.384 57.539 35.418  1.00 31.03  ? 438  SER B N    1 
ATOM   7543 C CA   . SER B 1 437 ? 117.803 57.893 35.362  1.00 33.79  ? 438  SER B CA   1 
ATOM   7544 C C    . SER B 1 437 ? 118.385 57.772 33.954  1.00 31.27  ? 438  SER B C    1 
ATOM   7545 O O    . SER B 1 437 ? 119.487 58.249 33.702  1.00 31.45  ? 438  SER B O    1 
ATOM   7546 C CB   . SER B 1 437 ? 118.604 57.026 36.327  1.00 36.69  ? 438  SER B CB   1 
ATOM   7547 O OG   . SER B 1 437 ? 118.457 55.657 35.993  1.00 37.34  ? 438  SER B OG   1 
ATOM   7548 N N    . TRP B 1 438 ? 117.651 57.115 33.052  1.00 32.16  ? 439  TRP B N    1 
ATOM   7549 C CA   . TRP B 1 438 ? 118.033 57.049 31.644  1.00 33.94  ? 439  TRP B CA   1 
ATOM   7550 C C    . TRP B 1 438 ? 117.820 58.421 30.995  1.00 34.05  ? 439  TRP B C    1 
ATOM   7551 O O    . TRP B 1 438 ? 116.963 59.191 31.436  1.00 28.55  ? 439  TRP B O    1 
ATOM   7552 C CB   . TRP B 1 438 ? 117.188 56.019 30.893  1.00 32.78  ? 439  TRP B CB   1 
ATOM   7553 C CG   . TRP B 1 438 ? 117.372 54.624 31.343  1.00 30.76  ? 439  TRP B CG   1 
ATOM   7554 C CD1  . TRP B 1 438 ? 116.585 53.938 32.223  1.00 28.39  ? 439  TRP B CD1  1 
ATOM   7555 C CD2  . TRP B 1 438 ? 118.400 53.717 30.930  1.00 32.81  ? 439  TRP B CD2  1 
ATOM   7556 N NE1  . TRP B 1 438 ? 117.066 52.665 32.392  1.00 28.18  ? 439  TRP B NE1  1 
ATOM   7557 C CE2  . TRP B 1 438 ? 118.179 52.499 31.608  1.00 33.81  ? 439  TRP B CE2  1 
ATOM   7558 C CE3  . TRP B 1 438 ? 119.494 53.819 30.067  1.00 29.23  ? 439  TRP B CE3  1 
ATOM   7559 C CZ2  . TRP B 1 438 ? 119.008 51.381 31.439  1.00 31.20  ? 439  TRP B CZ2  1 
ATOM   7560 C CZ3  . TRP B 1 438 ? 120.320 52.713 29.904  1.00 29.25  ? 439  TRP B CZ3  1 
ATOM   7561 C CH2  . TRP B 1 438 ? 120.068 51.508 30.584  1.00 32.72  ? 439  TRP B CH2  1 
ATOM   7562 N N    . PRO B 1 439 ? 118.577 58.716 29.924  1.00 29.73  ? 440  PRO B N    1 
ATOM   7563 C CA   . PRO B 1 439 ? 118.530 60.057 29.331  1.00 27.98  ? 440  PRO B CA   1 
ATOM   7564 C C    . PRO B 1 439 ? 117.162 60.385 28.724  1.00 32.88  ? 440  PRO B C    1 
ATOM   7565 O O    . PRO B 1 439 ? 116.346 59.495 28.449  1.00 37.02  ? 440  PRO B O    1 
ATOM   7566 C CB   . PRO B 1 439 ? 119.607 59.996 28.237  1.00 26.33  ? 440  PRO B CB   1 
ATOM   7567 C CG   . PRO B 1 439 ? 119.686 58.536 27.863  1.00 28.46  ? 440  PRO B CG   1 
ATOM   7568 C CD   . PRO B 1 439 ? 119.433 57.790 29.154  1.00 27.42  ? 440  PRO B CD   1 
ATOM   7569 N N    . LEU B 1 440 ? 116.930 61.676 28.531  1.00 33.40  ? 441  LEU B N    1 
ATOM   7570 C CA   . LEU B 1 440 ? 115.686 62.195 27.991  1.00 30.31  ? 441  LEU B CA   1 
ATOM   7571 C C    . LEU B 1 440 ? 115.347 61.659 26.592  1.00 31.68  ? 441  LEU B C    1 
ATOM   7572 O O    . LEU B 1 440 ? 114.169 61.478 26.266  1.00 34.08  ? 441  LEU B O    1 
ATOM   7573 C CB   . LEU B 1 440 ? 115.729 63.726 27.982  1.00 32.82  ? 441  LEU B CB   1 
ATOM   7574 C CG   . LEU B 1 440 ? 114.371 64.411 27.866  1.00 47.54  ? 441  LEU B CG   1 
ATOM   7575 C CD1  . LEU B 1 440 ? 113.487 64.017 29.040  1.00 43.82  ? 441  LEU B CD1  1 
ATOM   7576 C CD2  . LEU B 1 440 ? 114.520 65.925 27.786  1.00 56.40  ? 441  LEU B CD2  1 
ATOM   7577 N N    . TRP B 1 441 ? 116.366 61.392 25.775  1.00 30.14  ? 442  TRP B N    1 
ATOM   7578 C CA   . TRP B 1 441 ? 116.121 60.958 24.396  1.00 31.02  ? 442  TRP B CA   1 
ATOM   7579 C C    . TRP B 1 441 ? 115.456 59.587 24.327  1.00 30.54  ? 442  TRP B C    1 
ATOM   7580 O O    . TRP B 1 441 ? 114.846 59.226 23.313  1.00 33.44  ? 442  TRP B O    1 
ATOM   7581 C CB   . TRP B 1 441 ? 117.392 61.011 23.526  1.00 31.53  ? 442  TRP B CB   1 
ATOM   7582 C CG   . TRP B 1 441 ? 118.456 59.969 23.823  1.00 31.42  ? 442  TRP B CG   1 
ATOM   7583 C CD1  . TRP B 1 441 ? 119.621 60.168 24.505  1.00 31.81  ? 442  TRP B CD1  1 
ATOM   7584 C CD2  . TRP B 1 441 ? 118.473 58.587 23.400  1.00 29.39  ? 442  TRP B CD2  1 
ATOM   7585 N NE1  . TRP B 1 441 ? 120.350 59.003 24.554  1.00 29.23  ? 442  TRP B NE1  1 
ATOM   7586 C CE2  . TRP B 1 441 ? 119.673 58.019 23.881  1.00 28.51  ? 442  TRP B CE2  1 
ATOM   7587 C CE3  . TRP B 1 441 ? 117.589 57.779 22.669  1.00 28.09  ? 442  TRP B CE3  1 
ATOM   7588 C CZ2  . TRP B 1 441 ? 120.009 56.671 23.666  1.00 33.09  ? 442  TRP B CZ2  1 
ATOM   7589 C CZ3  . TRP B 1 441 ? 117.923 56.447 22.452  1.00 31.80  ? 442  TRP B CZ3  1 
ATOM   7590 C CH2  . TRP B 1 441 ? 119.125 55.905 22.951  1.00 36.77  ? 442  TRP B CH2  1 
ATOM   7591 N N    . MET B 1 442 ? 115.573 58.827 25.410  1.00 28.17  ? 443  MET B N    1 
ATOM   7592 C CA   . MET B 1 442 ? 114.956 57.514 25.470  1.00 24.87  ? 443  MET B CA   1 
ATOM   7593 C C    . MET B 1 442 ? 113.438 57.558 25.722  1.00 26.32  ? 443  MET B C    1 
ATOM   7594 O O    . MET B 1 442 ? 112.755 56.550 25.530  1.00 30.07  ? 443  MET B O    1 
ATOM   7595 C CB   . MET B 1 442 ? 115.667 56.632 26.493  1.00 23.01  ? 443  MET B CB   1 
ATOM   7596 C CG   . MET B 1 442 ? 116.999 56.059 26.010  1.00 33.33  ? 443  MET B CG   1 
ATOM   7597 S SD   . MET B 1 442 ? 117.668 54.847 27.180  1.00 38.32  ? 443  MET B SD   1 
ATOM   7598 C CE   . MET B 1 442 ? 118.877 53.982 26.175  1.00 72.54  ? 443  MET B CE   1 
ATOM   7599 N N    . GLY B 1 443 ? 112.906 58.717 26.124  1.00 28.51  ? 444  GLY B N    1 
ATOM   7600 C CA   . GLY B 1 443 ? 111.462 58.876 26.304  1.00 21.93  ? 444  GLY B CA   1 
ATOM   7601 C C    . GLY B 1 443 ? 110.923 58.044 27.467  1.00 27.75  ? 444  GLY B C    1 
ATOM   7602 O O    . GLY B 1 443 ? 111.506 58.023 28.553  1.00 31.69  ? 444  GLY B O    1 
ATOM   7603 N N    . VAL B 1 444 ? 109.799 57.372 27.244  1.00 20.84  ? 445  VAL B N    1 
ATOM   7604 C CA   . VAL B 1 444 ? 109.254 56.411 28.204  1.00 22.57  ? 445  VAL B CA   1 
ATOM   7605 C C    . VAL B 1 444 ? 109.755 55.017 27.823  1.00 21.97  ? 445  VAL B C    1 
ATOM   7606 O O    . VAL B 1 444 ? 109.170 54.369 26.967  1.00 29.05  ? 445  VAL B O    1 
ATOM   7607 C CB   . VAL B 1 444 ? 107.718 56.420 28.140  1.00 23.39  ? 445  VAL B CB   1 
ATOM   7608 C CG1  . VAL B 1 444 ? 107.109 55.601 29.273  1.00 24.54  ? 445  VAL B CG1  1 
ATOM   7609 C CG2  . VAL B 1 444 ? 107.204 57.857 28.177  1.00 29.19  ? 445  VAL B CG2  1 
ATOM   7610 N N    . PRO B 1 445 ? 110.852 54.551 28.443  1.00 25.10  ? 446  PRO B N    1 
ATOM   7611 C CA   . PRO B 1 445 ? 111.463 53.315 27.929  1.00 23.51  ? 446  PRO B CA   1 
ATOM   7612 C C    . PRO B 1 445 ? 110.761 52.066 28.425  1.00 25.74  ? 446  PRO B C    1 
ATOM   7613 O O    . PRO B 1 445 ? 109.963 52.121 29.367  1.00 26.40  ? 446  PRO B O    1 
ATOM   7614 C CB   . PRO B 1 445 ? 112.897 53.351 28.502  1.00 20.63  ? 446  PRO B CB   1 
ATOM   7615 C CG   . PRO B 1 445 ? 113.047 54.725 29.149  1.00 27.36  ? 446  PRO B CG   1 
ATOM   7616 C CD   . PRO B 1 445 ? 111.657 55.148 29.522  1.00 26.14  ? 446  PRO B CD   1 
ATOM   7617 N N    . HIS B 1 446 ? 111.089 50.945 27.788  1.00 26.34  ? 447  HIS B N    1 
ATOM   7618 C CA   . HIS B 1 446 ? 110.561 49.630 28.109  1.00 27.82  ? 447  HIS B CA   1 
ATOM   7619 C C    . HIS B 1 446 ? 110.774 49.291 29.589  1.00 32.26  ? 447  HIS B C    1 
ATOM   7620 O O    . HIS B 1 446 ? 111.856 49.524 30.139  1.00 30.34  ? 447  HIS B O    1 
ATOM   7621 C CB   . HIS B 1 446 ? 111.279 48.614 27.224  1.00 31.99  ? 447  HIS B CB   1 
ATOM   7622 C CG   . HIS B 1 446 ? 110.826 47.200 27.414  1.00 40.20  ? 447  HIS B CG   1 
ATOM   7623 N ND1  . HIS B 1 446 ? 109.671 46.705 26.849  1.00 41.05  ? 447  HIS B ND1  1 
ATOM   7624 C CD2  . HIS B 1 446 ? 111.396 46.167 28.080  1.00 43.54  ? 447  HIS B CD2  1 
ATOM   7625 C CE1  . HIS B 1 446 ? 109.543 45.426 27.164  1.00 39.07  ? 447  HIS B CE1  1 
ATOM   7626 N NE2  . HIS B 1 446 ? 110.573 45.077 27.911  1.00 44.60  ? 447  HIS B NE2  1 
ATOM   7627 N N    . GLY B 1 447 ? 109.738 48.765 30.238  1.00 23.65  ? 448  GLY B N    1 
ATOM   7628 C CA   . GLY B 1 447 ? 109.839 48.388 31.639  1.00 25.40  ? 448  GLY B CA   1 
ATOM   7629 C C    . GLY B 1 447 ? 109.408 49.439 32.660  1.00 27.56  ? 448  GLY B C    1 
ATOM   7630 O O    . GLY B 1 447 ? 109.194 49.106 33.829  1.00 29.55  ? 448  GLY B O    1 
ATOM   7631 N N    . TYR B 1 448 ? 109.266 50.698 32.246  1.00 19.57  ? 449  TYR B N    1 
ATOM   7632 C CA   . TYR B 1 448 ? 109.063 51.776 33.229  1.00 26.54  ? 449  TYR B CA   1 
ATOM   7633 C C    . TYR B 1 448 ? 107.613 52.110 33.586  1.00 26.92  ? 449  TYR B C    1 
ATOM   7634 O O    . TYR B 1 448 ? 107.345 53.085 34.281  1.00 32.69  ? 449  TYR B O    1 
ATOM   7635 C CB   . TYR B 1 448 ? 109.966 53.007 32.943  1.00 18.13  ? 449  TYR B CB   1 
ATOM   7636 C CG   . TYR B 1 448 ? 111.394 52.621 33.234  1.00 24.29  ? 449  TYR B CG   1 
ATOM   7637 C CD1  . TYR B 1 448 ? 112.173 51.980 32.264  1.00 24.87  ? 449  TYR B CD1  1 
ATOM   7638 C CD2  . TYR B 1 448 ? 111.932 52.779 34.507  1.00 23.70  ? 449  TYR B CD2  1 
ATOM   7639 C CE1  . TYR B 1 448 ? 113.472 51.550 32.547  1.00 25.30  ? 449  TYR B CE1  1 
ATOM   7640 C CE2  . TYR B 1 448 ? 113.232 52.358 34.799  1.00 25.65  ? 449  TYR B CE2  1 
ATOM   7641 C CZ   . TYR B 1 448 ? 113.992 51.744 33.813  1.00 27.96  ? 449  TYR B CZ   1 
ATOM   7642 O OH   . TYR B 1 448 ? 115.272 51.323 34.083  1.00 30.88  ? 449  TYR B OH   1 
ATOM   7643 N N    . GLU B 1 449 ? 106.688 51.254 33.160  1.00 29.06  ? 450  GLU B N    1 
ATOM   7644 C CA   . GLU B 1 449 ? 105.321 51.335 33.646  1.00 27.29  ? 450  GLU B CA   1 
ATOM   7645 C C    . GLU B 1 449 ? 105.159 50.463 34.899  1.00 28.86  ? 450  GLU B C    1 
ATOM   7646 O O    . GLU B 1 449 ? 104.313 50.736 35.754  1.00 29.02  ? 450  GLU B O    1 
ATOM   7647 C CB   . GLU B 1 449 ? 104.318 50.928 32.547  1.00 26.65  ? 450  GLU B CB   1 
ATOM   7648 C CG   . GLU B 1 449 ? 103.961 49.431 32.489  1.00 36.90  ? 450  GLU B CG   1 
ATOM   7649 C CD   . GLU B 1 449 ? 105.037 48.544 31.830  1.00 45.35  ? 450  GLU B CD   1 
ATOM   7650 O OE1  . GLU B 1 449 ? 106.235 48.927 31.798  1.00 41.01  ? 450  GLU B OE1  1 
ATOM   7651 O OE2  . GLU B 1 449 ? 104.676 47.446 31.350  1.00 53.83  ? 450  GLU B OE2  1 
ATOM   7652 N N    . ILE B 1 450 ? 105.988 49.425 35.003  1.00 18.71  ? 451  ILE B N    1 
ATOM   7653 C CA   . ILE B 1 450 ? 105.837 48.419 36.045  1.00 23.92  ? 451  ILE B CA   1 
ATOM   7654 C C    . ILE B 1 450 ? 105.747 49.009 37.455  1.00 24.91  ? 451  ILE B C    1 
ATOM   7655 O O    . ILE B 1 450 ? 104.888 48.620 38.246  1.00 22.21  ? 451  ILE B O    1 
ATOM   7656 C CB   . ILE B 1 450 ? 106.986 47.409 36.017  1.00 26.02  ? 451  ILE B CB   1 
ATOM   7657 C CG1  . ILE B 1 450 ? 107.126 46.801 34.621  1.00 27.40  ? 451  ILE B CG1  1 
ATOM   7658 C CG2  . ILE B 1 450 ? 106.771 46.330 37.087  1.00 25.42  ? 451  ILE B CG2  1 
ATOM   7659 C CD1  . ILE B 1 450 ? 108.241 45.766 34.516  1.00 17.61  ? 451  ILE B CD1  1 
ATOM   7660 N N    . GLU B 1 451 ? 106.629 49.949 37.762  1.00 22.57  ? 452  GLU B N    1 
ATOM   7661 C CA   . GLU B 1 451 ? 106.663 50.554 39.087  1.00 27.33  ? 452  GLU B CA   1 
ATOM   7662 C C    . GLU B 1 451 ? 105.355 51.290 39.404  1.00 27.28  ? 452  GLU B C    1 
ATOM   7663 O O    . GLU B 1 451 ? 104.975 51.434 40.575  1.00 29.14  ? 452  GLU B O    1 
ATOM   7664 C CB   . GLU B 1 451 ? 107.867 51.499 39.207  1.00 29.75  ? 452  GLU B CB   1 
ATOM   7665 C CG   . GLU B 1 451 ? 107.853 52.645 38.196  1.00 34.17  ? 452  GLU B CG   1 
ATOM   7666 C CD   . GLU B 1 451 ? 109.252 53.222 37.940  1.00 50.45  ? 452  GLU B CD   1 
ATOM   7667 O OE1  . GLU B 1 451 ? 110.225 52.439 37.790  1.00 50.42  ? 452  GLU B OE1  1 
ATOM   7668 O OE2  . GLU B 1 451 ? 109.376 54.464 37.874  1.00 57.44  ? 452  GLU B OE2  1 
ATOM   7669 N N    . PHE B 1 452 ? 104.673 51.766 38.367  1.00 22.50  ? 453  PHE B N    1 
ATOM   7670 C CA   . PHE B 1 452 ? 103.386 52.404 38.581  1.00 23.39  ? 453  PHE B CA   1 
ATOM   7671 C C    . PHE B 1 452 ? 102.286 51.384 38.857  1.00 26.08  ? 453  PHE B C    1 
ATOM   7672 O O    . PHE B 1 452 ? 101.464 51.591 39.744  1.00 26.69  ? 453  PHE B O    1 
ATOM   7673 C CB   . PHE B 1 452 ? 103.049 53.352 37.432  1.00 22.24  ? 453  PHE B CB   1 
ATOM   7674 C CG   . PHE B 1 452 ? 103.890 54.586 37.449  1.00 27.84  ? 453  PHE B CG   1 
ATOM   7675 C CD1  . PHE B 1 452 ? 105.159 54.584 36.885  1.00 27.76  ? 453  PHE B CD1  1 
ATOM   7676 C CD2  . PHE B 1 452 ? 103.446 55.729 38.099  1.00 28.60  ? 453  PHE B CD2  1 
ATOM   7677 C CE1  . PHE B 1 452 ? 105.955 55.711 36.941  1.00 33.03  ? 453  PHE B CE1  1 
ATOM   7678 C CE2  . PHE B 1 452 ? 104.232 56.855 38.151  1.00 25.83  ? 453  PHE B CE2  1 
ATOM   7679 C CZ   . PHE B 1 452 ? 105.490 56.850 37.576  1.00 30.89  ? 453  PHE B CZ   1 
ATOM   7680 N N    . ILE B 1 453 ? 102.292 50.276 38.121  1.00 21.52  ? 454  ILE B N    1 
ATOM   7681 C CA   . ILE B 1 453 ? 101.300 49.229 38.323  1.00 22.99  ? 454  ILE B CA   1 
ATOM   7682 C C    . ILE B 1 453 ? 101.424 48.647 39.733  1.00 29.55  ? 454  ILE B C    1 
ATOM   7683 O O    . ILE B 1 453 ? 100.419 48.365 40.387  1.00 35.23  ? 454  ILE B O    1 
ATOM   7684 C CB   . ILE B 1 453 ? 101.450 48.114 37.289  1.00 28.40  ? 454  ILE B CB   1 
ATOM   7685 C CG1  . ILE B 1 453 ? 101.324 48.685 35.874  1.00 23.02  ? 454  ILE B CG1  1 
ATOM   7686 C CG2  . ILE B 1 453 ? 100.432 47.009 37.544  1.00 31.31  ? 454  ILE B CG2  1 
ATOM   7687 C CD1  . ILE B 1 453 ? 100.085 49.514 35.684  1.00 34.68  ? 454  ILE B CD1  1 
ATOM   7688 N N    . PHE B 1 454 ? 102.657 48.495 40.210  1.00 23.10  ? 455  PHE B N    1 
ATOM   7689 C CA   . PHE B 1 454 ? 102.883 47.963 41.546  1.00 21.11  ? 455  PHE B CA   1 
ATOM   7690 C C    . PHE B 1 454 ? 102.753 49.008 42.659  1.00 26.38  ? 455  PHE B C    1 
ATOM   7691 O O    . PHE B 1 454 ? 102.896 48.676 43.830  1.00 25.41  ? 455  PHE B O    1 
ATOM   7692 C CB   . PHE B 1 454 ? 104.233 47.253 41.631  1.00 22.36  ? 455  PHE B CB   1 
ATOM   7693 C CG   . PHE B 1 454 ? 104.204 45.853 41.100  1.00 29.98  ? 455  PHE B CG   1 
ATOM   7694 C CD1  . PHE B 1 454 ? 104.371 45.606 39.746  1.00 28.00  ? 455  PHE B CD1  1 
ATOM   7695 C CD2  . PHE B 1 454 ? 103.985 44.781 41.948  1.00 31.22  ? 455  PHE B CD2  1 
ATOM   7696 C CE1  . PHE B 1 454 ? 104.333 44.314 39.255  1.00 28.46  ? 455  PHE B CE1  1 
ATOM   7697 C CE2  . PHE B 1 454 ? 103.941 43.490 41.460  1.00 30.12  ? 455  PHE B CE2  1 
ATOM   7698 C CZ   . PHE B 1 454 ? 104.115 43.253 40.113  1.00 29.40  ? 455  PHE B CZ   1 
ATOM   7699 N N    . GLY B 1 455 ? 102.472 50.257 42.295  1.00 28.36  ? 456  GLY B N    1 
ATOM   7700 C CA   . GLY B 1 455 ? 102.251 51.306 43.278  1.00 26.55  ? 456  GLY B CA   1 
ATOM   7701 C C    . GLY B 1 455 ? 103.505 51.728 44.021  1.00 24.63  ? 456  GLY B C    1 
ATOM   7702 O O    . GLY B 1 455 ? 103.425 52.280 45.112  1.00 28.22  ? 456  GLY B O    1 
ATOM   7703 N N    . ILE B 1 456 ? 104.670 51.481 43.428  1.00 28.17  ? 457  ILE B N    1 
ATOM   7704 C CA   . ILE B 1 456 ? 105.936 51.876 44.043  1.00 22.20  ? 457  ILE B CA   1 
ATOM   7705 C C    . ILE B 1 456 ? 105.977 53.357 44.465  1.00 28.31  ? 457  ILE B C    1 
ATOM   7706 O O    . ILE B 1 456 ? 106.554 53.690 45.505  1.00 29.19  ? 457  ILE B O    1 
ATOM   7707 C CB   . ILE B 1 456 ? 107.150 51.550 43.138  1.00 26.00  ? 457  ILE B CB   1 
ATOM   7708 C CG1  . ILE B 1 456 ? 107.188 50.054 42.819  1.00 23.68  ? 457  ILE B CG1  1 
ATOM   7709 C CG2  . ILE B 1 456 ? 108.455 51.973 43.824  1.00 23.14  ? 457  ILE B CG2  1 
ATOM   7710 C CD1  . ILE B 1 456 ? 107.026 49.167 44.061  1.00 24.60  ? 457  ILE B CD1  1 
ATOM   7711 N N    . PRO B 1 457 ? 105.370 54.257 43.667  1.00 28.87  ? 458  PRO B N    1 
ATOM   7712 C CA   . PRO B 1 457 ? 105.388 55.666 44.078  1.00 31.88  ? 458  PRO B CA   1 
ATOM   7713 C C    . PRO B 1 457 ? 104.753 55.941 45.453  1.00 36.74  ? 458  PRO B C    1 
ATOM   7714 O O    . PRO B 1 457 ? 104.976 57.017 46.004  1.00 42.89  ? 458  PRO B O    1 
ATOM   7715 C CB   . PRO B 1 457 ? 104.614 56.347 42.952  1.00 28.55  ? 458  PRO B CB   1 
ATOM   7716 C CG   . PRO B 1 457 ? 104.961 55.523 41.749  1.00 21.22  ? 458  PRO B CG   1 
ATOM   7717 C CD   . PRO B 1 457 ? 104.926 54.112 42.271  1.00 20.79  ? 458  PRO B CD   1 
ATOM   7718 N N    . LEU B 1 458 ? 103.989 54.992 45.993  1.00 34.77  ? 459  LEU B N    1 
ATOM   7719 C CA   . LEU B 1 458 ? 103.423 55.134 47.338  1.00 33.03  ? 459  LEU B CA   1 
ATOM   7720 C C    . LEU B 1 458 ? 104.472 54.999 48.458  1.00 32.31  ? 459  LEU B C    1 
ATOM   7721 O O    . LEU B 1 458 ? 104.215 55.380 49.594  1.00 39.71  ? 459  LEU B O    1 
ATOM   7722 C CB   . LEU B 1 458 ? 102.277 54.141 47.556  1.00 35.26  ? 459  LEU B CB   1 
ATOM   7723 C CG   . LEU B 1 458 ? 101.097 54.254 46.585  1.00 38.81  ? 459  LEU B CG   1 
ATOM   7724 C CD1  . LEU B 1 458 ? 99.961  53.322 46.998  1.00 30.82  ? 459  LEU B CD1  1 
ATOM   7725 C CD2  . LEU B 1 458 ? 100.623 55.700 46.504  1.00 41.27  ? 459  LEU B CD2  1 
ATOM   7726 N N    . ASP B 1 459 ? 105.644 54.455 48.135  1.00 33.11  ? 460  ASP B N    1 
ATOM   7727 C CA   . ASP B 1 459 ? 106.732 54.336 49.100  1.00 36.78  ? 460  ASP B CA   1 
ATOM   7728 C C    . ASP B 1 459 ? 107.365 55.706 49.343  1.00 42.92  ? 460  ASP B C    1 
ATOM   7729 O O    . ASP B 1 459 ? 107.974 56.293 48.442  1.00 40.46  ? 460  ASP B O    1 
ATOM   7730 C CB   . ASP B 1 459 ? 107.796 53.355 48.599  1.00 35.70  ? 460  ASP B CB   1 
ATOM   7731 C CG   . ASP B 1 459 ? 108.854 53.045 49.653  1.00 46.51  ? 460  ASP B CG   1 
ATOM   7732 O OD1  . ASP B 1 459 ? 108.899 53.728 50.709  1.00 48.35  ? 460  ASP B OD1  1 
ATOM   7733 O OD2  . ASP B 1 459 ? 109.653 52.115 49.416  1.00 51.87  ? 460  ASP B OD2  1 
ATOM   7734 N N    . PRO B 1 460 ? 107.227 56.216 50.571  1.00 47.75  ? 461  PRO B N    1 
ATOM   7735 C CA   . PRO B 1 460 ? 107.697 57.558 50.945  1.00 52.34  ? 461  PRO B CA   1 
ATOM   7736 C C    . PRO B 1 460 ? 109.213 57.702 50.784  1.00 53.09  ? 461  PRO B C    1 
ATOM   7737 O O    . PRO B 1 460 ? 109.687 58.767 50.390  1.00 56.04  ? 461  PRO B O    1 
ATOM   7738 C CB   . PRO B 1 460 ? 107.306 57.670 52.424  1.00 48.53  ? 461  PRO B CB   1 
ATOM   7739 C CG   . PRO B 1 460 ? 106.252 56.636 52.624  1.00 50.55  ? 461  PRO B CG   1 
ATOM   7740 C CD   . PRO B 1 460 ? 106.595 55.512 51.696  1.00 46.30  ? 461  PRO B CD   1 
ATOM   7741 N N    . SER B 1 461 ? 109.950 56.631 51.075  1.00 49.40  ? 462  SER B N    1 
ATOM   7742 C CA   . SER B 1 461 ? 111.403 56.626 50.956  1.00 48.05  ? 462  SER B CA   1 
ATOM   7743 C C    . SER B 1 461 ? 111.875 56.847 49.519  1.00 51.34  ? 462  SER B C    1 
ATOM   7744 O O    . SER B 1 461 ? 113.054 57.116 49.282  1.00 56.74  ? 462  SER B O    1 
ATOM   7745 C CB   . SER B 1 461 ? 111.976 55.316 51.493  1.00 48.15  ? 462  SER B CB   1 
ATOM   7746 O OG   . SER B 1 461 ? 111.488 54.207 50.770  1.00 50.71  ? 462  SER B OG   1 
ATOM   7747 N N    . ARG B 1 462 ? 110.964 56.729 48.558  1.00 44.81  ? 463  ARG B N    1 
ATOM   7748 C CA   . ARG B 1 462 ? 111.297 57.075 47.180  1.00 39.15  ? 463  ARG B CA   1 
ATOM   7749 C C    . ARG B 1 462 ? 110.853 58.510 46.880  1.00 43.07  ? 463  ARG B C    1 
ATOM   7750 O O    . ARG B 1 462 ? 110.182 59.142 47.699  1.00 46.61  ? 463  ARG B O    1 
ATOM   7751 C CB   . ARG B 1 462 ? 110.713 56.049 46.212  1.00 28.94  ? 463  ARG B CB   1 
ATOM   7752 C CG   . ARG B 1 462 ? 111.018 54.634 46.673  1.00 38.42  ? 463  ARG B CG   1 
ATOM   7753 C CD   . ARG B 1 462 ? 110.858 53.587 45.593  1.00 47.94  ? 463  ARG B CD   1 
ATOM   7754 N NE   . ARG B 1 462 ? 111.571 52.366 45.959  1.00 55.01  ? 463  ARG B NE   1 
ATOM   7755 C CZ   . ARG B 1 462 ? 112.777 52.051 45.504  1.00 63.51  ? 463  ARG B CZ   1 
ATOM   7756 N NH1  . ARG B 1 462 ? 113.389 52.859 44.651  1.00 66.72  ? 463  ARG B NH1  1 
ATOM   7757 N NH2  . ARG B 1 462 ? 113.370 50.928 45.890  1.00 67.24  ? 463  ARG B NH2  1 
ATOM   7758 N N    . ASN B 1 463 ? 111.245 59.034 45.727  1.00 45.51  ? 464  ASN B N    1 
ATOM   7759 C CA   . ASN B 1 463 ? 111.141 60.469 45.494  1.00 46.41  ? 464  ASN B CA   1 
ATOM   7760 C C    . ASN B 1 463 ? 110.157 60.817 44.389  1.00 40.26  ? 464  ASN B C    1 
ATOM   7761 O O    . ASN B 1 463 ? 110.397 61.728 43.598  1.00 44.99  ? 464  ASN B O    1 
ATOM   7762 C CB   . ASN B 1 463 ? 112.523 61.058 45.171  1.00 53.36  ? 464  ASN B CB   1 
ATOM   7763 C CG   . ASN B 1 463 ? 113.594 60.637 46.174  1.00 64.37  ? 464  ASN B CG   1 
ATOM   7764 O OD1  . ASN B 1 463 ? 113.308 60.409 47.353  1.00 68.40  ? 464  ASN B OD1  1 
ATOM   7765 N ND2  . ASN B 1 463 ? 114.838 60.535 45.705  1.00 68.56  ? 464  ASN B ND2  1 
ATOM   7766 N N    . TYR B 1 464 ? 109.054 60.078 44.329  1.00 34.29  ? 465  TYR B N    1 
ATOM   7767 C CA   . TYR B 1 464 ? 108.015 60.349 43.347  1.00 32.23  ? 465  TYR B CA   1 
ATOM   7768 C C    . TYR B 1 464 ? 107.184 61.559 43.776  1.00 34.70  ? 465  TYR B C    1 
ATOM   7769 O O    . TYR B 1 464 ? 107.093 61.877 44.964  1.00 36.93  ? 465  TYR B O    1 
ATOM   7770 C CB   . TYR B 1 464 ? 107.126 59.118 43.152  1.00 28.04  ? 465  TYR B CB   1 
ATOM   7771 C CG   . TYR B 1 464 ? 107.809 57.948 42.455  1.00 27.00  ? 465  TYR B CG   1 
ATOM   7772 C CD1  . TYR B 1 464 ? 107.801 57.836 41.064  1.00 27.61  ? 465  TYR B CD1  1 
ATOM   7773 C CD2  . TYR B 1 464 ? 108.456 56.954 43.187  1.00 23.84  ? 465  TYR B CD2  1 
ATOM   7774 C CE1  . TYR B 1 464 ? 108.423 56.764 40.426  1.00 32.60  ? 465  TYR B CE1  1 
ATOM   7775 C CE2  . TYR B 1 464 ? 109.074 55.880 42.559  1.00 32.94  ? 465  TYR B CE2  1 
ATOM   7776 C CZ   . TYR B 1 464 ? 109.052 55.789 41.182  1.00 35.07  ? 465  TYR B CZ   1 
ATOM   7777 O OH   . TYR B 1 464 ? 109.663 54.721 40.572  1.00 37.90  ? 465  TYR B OH   1 
ATOM   7778 N N    . THR B 1 465 ? 106.591 62.239 42.801  1.00 34.18  ? 466  THR B N    1 
ATOM   7779 C CA   . THR B 1 465 ? 105.740 63.402 43.068  1.00 34.84  ? 466  THR B CA   1 
ATOM   7780 C C    . THR B 1 465 ? 104.349 63.007 43.565  1.00 35.12  ? 466  THR B C    1 
ATOM   7781 O O    . THR B 1 465 ? 103.915 61.852 43.414  1.00 31.38  ? 466  THR B O    1 
ATOM   7782 C CB   . THR B 1 465 ? 105.551 64.246 41.802  1.00 31.44  ? 466  THR B CB   1 
ATOM   7783 O OG1  . THR B 1 465 ? 104.823 63.482 40.832  1.00 30.76  ? 466  THR B OG1  1 
ATOM   7784 C CG2  . THR B 1 465 ? 106.891 64.632 41.212  1.00 27.89  ? 466  THR B CG2  1 
ATOM   7785 N N    . ALA B 1 466 ? 103.647 63.977 44.143  1.00 33.79  ? 467  ALA B N    1 
ATOM   7786 C CA   . ALA B 1 466 ? 102.262 63.786 44.564  1.00 35.10  ? 467  ALA B CA   1 
ATOM   7787 C C    . ALA B 1 466 ? 101.385 63.330 43.394  1.00 34.80  ? 467  ALA B C    1 
ATOM   7788 O O    . ALA B 1 466 ? 100.546 62.436 43.547  1.00 34.59  ? 467  ALA B O    1 
ATOM   7789 C CB   . ALA B 1 466 ? 101.708 65.072 45.178  1.00 27.43  ? 467  ALA B CB   1 
ATOM   7790 N N    . GLU B 1 467 ? 101.574 63.941 42.229  1.00 31.62  ? 468  GLU B N    1 
ATOM   7791 C CA   . GLU B 1 467 ? 100.786 63.558 41.064  1.00 34.71  ? 468  GLU B CA   1 
ATOM   7792 C C    . GLU B 1 467 ? 101.072 62.129 40.629  1.00 35.58  ? 468  GLU B C    1 
ATOM   7793 O O    . GLU B 1 467 ? 100.155 61.404 40.233  1.00 40.17  ? 468  GLU B O    1 
ATOM   7794 C CB   . GLU B 1 467 ? 100.960 64.544 39.897  1.00 29.17  ? 468  GLU B CB   1 
ATOM   7795 C CG   . GLU B 1 467 ? 99.717  65.424 39.659  1.00 42.87  ? 468  GLU B CG   1 
ATOM   7796 C CD   . GLU B 1 467 ? 98.423  64.606 39.404  1.00 96.50  ? 468  GLU B CD   1 
ATOM   7797 O OE1  . GLU B 1 467 ? 98.512  63.399 39.055  1.00 93.63  ? 468  GLU B OE1  1 
ATOM   7798 O OE2  . GLU B 1 467 ? 97.312  65.174 39.554  1.00 91.48  ? 468  GLU B OE2  1 
ATOM   7799 N N    . GLU B 1 468 ? 102.331 61.713 40.719  1.00 29.98  ? 469  GLU B N    1 
ATOM   7800 C CA   . GLU B 1 468 ? 102.682 60.352 40.340  1.00 25.98  ? 469  GLU B CA   1 
ATOM   7801 C C    . GLU B 1 468 ? 102.034 59.322 41.259  1.00 29.57  ? 469  GLU B C    1 
ATOM   7802 O O    . GLU B 1 468 ? 101.691 58.231 40.805  1.00 30.65  ? 469  GLU B O    1 
ATOM   7803 C CB   . GLU B 1 468 ? 104.196 60.179 40.268  1.00 24.73  ? 469  GLU B CB   1 
ATOM   7804 C CG   . GLU B 1 468 ? 104.811 60.837 39.033  1.00 26.08  ? 469  GLU B CG   1 
ATOM   7805 C CD   . GLU B 1 468 ? 106.337 60.808 39.023  1.00 37.04  ? 469  GLU B CD   1 
ATOM   7806 O OE1  . GLU B 1 468 ? 106.948 61.111 40.069  1.00 40.08  ? 469  GLU B OE1  1 
ATOM   7807 O OE2  . GLU B 1 468 ? 106.929 60.488 37.965  1.00 45.58  ? 469  GLU B OE2  1 
ATOM   7808 N N    . LYS B 1 469 ? 101.846 59.668 42.537  1.00 28.86  ? 470  LYS B N    1 
ATOM   7809 C CA   . LYS B 1 469 ? 101.170 58.761 43.473  1.00 34.16  ? 470  LYS B CA   1 
ATOM   7810 C C    . LYS B 1 469 ? 99.703  58.548 43.095  1.00 31.02  ? 470  LYS B C    1 
ATOM   7811 O O    . LYS B 1 469 ? 99.241  57.411 42.999  1.00 30.92  ? 470  LYS B O    1 
ATOM   7812 C CB   . LYS B 1 469 ? 101.292 59.252 44.922  1.00 37.27  ? 470  LYS B CB   1 
ATOM   7813 C CG   . LYS B 1 469 ? 102.732 59.280 45.404  1.00 45.91  ? 470  LYS B CG   1 
ATOM   7814 C CD   . LYS B 1 469 ? 102.895 59.971 46.751  1.00 45.43  ? 470  LYS B CD   1 
ATOM   7815 C CE   . LYS B 1 469 ? 104.371 60.163 47.067  1.00 44.17  ? 470  LYS B CE   1 
ATOM   7816 N NZ   . LYS B 1 469 ? 104.569 60.657 48.453  1.00 48.45  ? 470  LYS B NZ   1 
ATOM   7817 N N    . ILE B 1 470 ? 98.986  59.650 42.886  1.00 23.29  ? 471  ILE B N    1 
ATOM   7818 C CA   . ILE B 1 470 ? 97.612  59.616 42.385  1.00 31.62  ? 471  ILE B CA   1 
ATOM   7819 C C    . ILE B 1 470 ? 97.502  58.780 41.094  1.00 33.49  ? 471  ILE B C    1 
ATOM   7820 O O    . ILE B 1 470 ? 96.602  57.950 40.943  1.00 38.27  ? 471  ILE B O    1 
ATOM   7821 C CB   . ILE B 1 470 ? 97.103  61.053 42.136  1.00 34.93  ? 471  ILE B CB   1 
ATOM   7822 C CG1  . ILE B 1 470 ? 96.942  61.788 43.466  1.00 34.58  ? 471  ILE B CG1  1 
ATOM   7823 C CG2  . ILE B 1 470 ? 95.796  61.063 41.348  1.00 30.33  ? 471  ILE B CG2  1 
ATOM   7824 C CD1  . ILE B 1 470 ? 96.901  63.295 43.311  1.00 37.23  ? 471  ILE B CD1  1 
ATOM   7825 N N    . PHE B 1 471 ? 98.442  58.995 40.182  1.00 25.06  ? 472  PHE B N    1 
ATOM   7826 C CA   . PHE B 1 471 ? 98.513  58.243 38.940  1.00 28.82  ? 472  PHE B CA   1 
ATOM   7827 C C    . PHE B 1 471 ? 98.690  56.742 39.226  1.00 30.29  ? 472  PHE B C    1 
ATOM   7828 O O    . PHE B 1 471 ? 97.971  55.903 38.670  1.00 27.13  ? 472  PHE B O    1 
ATOM   7829 C CB   . PHE B 1 471 ? 99.650  58.809 38.072  1.00 27.30  ? 472  PHE B CB   1 
ATOM   7830 C CG   . PHE B 1 471 ? 99.840  58.107 36.757  1.00 24.73  ? 472  PHE B CG   1 
ATOM   7831 C CD1  . PHE B 1 471 ? 98.776  57.937 35.873  1.00 28.67  ? 472  PHE B CD1  1 
ATOM   7832 C CD2  . PHE B 1 471 ? 101.095 57.653 36.381  1.00 27.68  ? 472  PHE B CD2  1 
ATOM   7833 C CE1  . PHE B 1 471 ? 98.961  57.285 34.646  1.00 27.49  ? 472  PHE B CE1  1 
ATOM   7834 C CE2  . PHE B 1 471 ? 101.291 57.006 35.148  1.00 30.12  ? 472  PHE B CE2  1 
ATOM   7835 C CZ   . PHE B 1 471 ? 100.218 56.825 34.283  1.00 24.77  ? 472  PHE B CZ   1 
ATOM   7836 N N    . ALA B 1 472 ? 99.627  56.396 40.103  1.00 26.74  ? 473  ALA B N    1 
ATOM   7837 C CA   . ALA B 1 472 ? 99.825  54.986 40.453  1.00 24.84  ? 473  ALA B CA   1 
ATOM   7838 C C    . ALA B 1 472 ? 98.534  54.386 41.018  1.00 28.41  ? 473  ALA B C    1 
ATOM   7839 O O    . ALA B 1 472 ? 98.140  53.271 40.647  1.00 28.84  ? 473  ALA B O    1 
ATOM   7840 C CB   . ALA B 1 472 ? 100.975 54.825 41.438  1.00 25.52  ? 473  ALA B CB   1 
ATOM   7841 N N    . GLN B 1 473 ? 97.869  55.127 41.908  1.00 21.78  ? 474  GLN B N    1 
ATOM   7842 C CA   . GLN B 1 473 ? 96.595  54.663 42.447  1.00 24.78  ? 474  GLN B CA   1 
ATOM   7843 C C    . GLN B 1 473 ? 95.560  54.438 41.350  1.00 26.58  ? 474  GLN B C    1 
ATOM   7844 O O    . GLN B 1 473 ? 94.790  53.483 41.430  1.00 25.93  ? 474  GLN B O    1 
ATOM   7845 C CB   . GLN B 1 473 ? 96.058  55.600 43.527  1.00 21.92  ? 474  GLN B CB   1 
ATOM   7846 C CG   . GLN B 1 473 ? 96.814  55.531 44.848  1.00 26.49  ? 474  GLN B CG   1 
ATOM   7847 C CD   . GLN B 1 473 ? 96.493  56.721 45.748  1.00 35.25  ? 474  GLN B CD   1 
ATOM   7848 O OE1  . GLN B 1 473 ? 96.468  57.870 45.303  1.00 40.15  ? 474  GLN B OE1  1 
ATOM   7849 N NE2  . GLN B 1 473 ? 96.230  56.446 47.010  1.00 30.14  ? 474  GLN B NE2  1 
ATOM   7850 N N    . ARG B 1 474 ? 95.546  55.298 40.326  1.00 25.30  ? 475  ARG B N    1 
ATOM   7851 C CA   . ARG B 1 474 ? 94.638  55.094 39.187  1.00 28.13  ? 475  ARG B CA   1 
ATOM   7852 C C    . ARG B 1 474 ? 94.970  53.794 38.471  1.00 24.56  ? 475  ARG B C    1 
ATOM   7853 O O    . ARG B 1 474 ? 94.080  53.025 38.123  1.00 24.53  ? 475  ARG B O    1 
ATOM   7854 C CB   . ARG B 1 474 ? 94.719  56.239 38.165  1.00 31.25  ? 475  ARG B CB   1 
ATOM   7855 C CG   . ARG B 1 474 ? 93.832  57.443 38.445  1.00 36.62  ? 475  ARG B CG   1 
ATOM   7856 C CD   . ARG B 1 474 ? 93.957  58.495 37.335  1.00 38.06  ? 475  ARG B CD   1 
ATOM   7857 N NE   . ARG B 1 474 ? 93.600  57.965 36.018  1.00 35.25  ? 475  ARG B NE   1 
ATOM   7858 C CZ   . ARG B 1 474 ? 94.285  58.203 34.903  1.00 32.83  ? 475  ARG B CZ   1 
ATOM   7859 N NH1  . ARG B 1 474 ? 95.368  58.968 34.941  1.00 29.69  ? 475  ARG B NH1  1 
ATOM   7860 N NH2  . ARG B 1 474 ? 93.889  57.673 33.751  1.00 27.75  ? 475  ARG B NH2  1 
ATOM   7861 N N    . LEU B 1 475 ? 96.256  53.556 38.240  1.00 19.83  ? 476  LEU B N    1 
ATOM   7862 C CA   . LEU B 1 475 ? 96.662  52.367 37.486  1.00 25.73  ? 476  LEU B CA   1 
ATOM   7863 C C    . LEU B 1 475 ? 96.368  51.060 38.235  1.00 28.42  ? 476  LEU B C    1 
ATOM   7864 O O    . LEU B 1 475 ? 95.893  50.081 37.625  1.00 27.06  ? 476  LEU B O    1 
ATOM   7865 C CB   . LEU B 1 475 ? 98.136  52.450 37.059  1.00 27.01  ? 476  LEU B CB   1 
ATOM   7866 C CG   . LEU B 1 475 ? 98.502  53.531 36.032  1.00 35.91  ? 476  LEU B CG   1 
ATOM   7867 C CD1  . LEU B 1 475 ? 99.852  53.243 35.409  1.00 38.04  ? 476  LEU B CD1  1 
ATOM   7868 C CD2  . LEU B 1 475 ? 97.449  53.683 34.931  1.00 30.42  ? 476  LEU B CD2  1 
ATOM   7869 N N    . MET B 1 476 ? 96.647  51.045 39.543  1.00 23.82  ? 477  MET B N    1 
ATOM   7870 C CA   . MET B 1 476 ? 96.362  49.872 40.377  1.00 23.83  ? 477  MET B CA   1 
ATOM   7871 C C    . MET B 1 476 ? 94.870  49.573 40.316  1.00 25.98  ? 477  MET B C    1 
ATOM   7872 O O    . MET B 1 476 ? 94.466  48.412 40.208  1.00 27.50  ? 477  MET B O    1 
ATOM   7873 C CB   . MET B 1 476 ? 96.801  50.095 41.835  1.00 22.51  ? 477  MET B CB   1 
ATOM   7874 C CG   . MET B 1 476 ? 98.308  50.300 42.013  1.00 20.01  ? 477  MET B CG   1 
ATOM   7875 S SD   . MET B 1 476 ? 98.859  50.170 43.731  1.00 36.88  ? 477  MET B SD   1 
ATOM   7876 C CE   . MET B 1 476 ? 98.228  51.721 44.422  1.00 28.96  ? 477  MET B CE   1 
ATOM   7877 N N    . ARG B 1 477 ? 94.061  50.632 40.347  1.00 17.96  ? 478  ARG B N    1 
ATOM   7878 C CA   . ARG B 1 477 ? 92.598  50.507 40.274  1.00 18.92  ? 478  ARG B CA   1 
ATOM   7879 C C    . ARG B 1 477 ? 92.140  49.922 38.937  1.00 22.85  ? 478  ARG B C    1 
ATOM   7880 O O    . ARG B 1 477 ? 91.250  49.071 38.913  1.00 26.36  ? 478  ARG B O    1 
ATOM   7881 C CB   . ARG B 1 477 ? 91.916  51.863 40.524  1.00 19.50  ? 478  ARG B CB   1 
ATOM   7882 C CG   . ARG B 1 477 ? 90.395  51.847 40.389  1.00 29.20  ? 478  ARG B CG   1 
ATOM   7883 C CD   . ARG B 1 477 ? 89.728  50.877 41.363  1.00 34.39  ? 478  ARG B CD   1 
ATOM   7884 N NE   . ARG B 1 477 ? 90.145  51.135 42.741  1.00 40.79  ? 478  ARG B NE   1 
ATOM   7885 C CZ   . ARG B 1 477 ? 89.582  52.040 43.531  1.00 41.34  ? 478  ARG B CZ   1 
ATOM   7886 N NH1  . ARG B 1 477 ? 88.565  52.777 43.088  1.00 33.96  ? 478  ARG B NH1  1 
ATOM   7887 N NH2  . ARG B 1 477 ? 90.038  52.208 44.761  1.00 41.44  ? 478  ARG B NH2  1 
ATOM   7888 N N    . TYR B 1 478 ? 92.732  50.366 37.824  1.00 20.68  ? 479  TYR B N    1 
ATOM   7889 C CA   . TYR B 1 478 ? 92.364  49.804 36.511  1.00 21.81  ? 479  TYR B CA   1 
ATOM   7890 C C    . TYR B 1 478 ? 92.689  48.307 36.477  1.00 25.57  ? 479  TYR B C    1 
ATOM   7891 O O    . TYR B 1 478 ? 91.849  47.485 36.081  1.00 25.00  ? 479  TYR B O    1 
ATOM   7892 C CB   . TYR B 1 478 ? 93.124  50.486 35.365  1.00 21.53  ? 479  TYR B CB   1 
ATOM   7893 C CG   . TYR B 1 478 ? 92.688  51.894 35.015  1.00 24.94  ? 479  TYR B CG   1 
ATOM   7894 C CD1  . TYR B 1 478 ? 91.342  52.230 34.915  1.00 22.41  ? 479  TYR B CD1  1 
ATOM   7895 C CD2  . TYR B 1 478 ? 93.637  52.886 34.765  1.00 24.86  ? 479  TYR B CD2  1 
ATOM   7896 C CE1  . TYR B 1 478 ? 90.950  53.521 34.582  1.00 20.31  ? 479  TYR B CE1  1 
ATOM   7897 C CE2  . TYR B 1 478 ? 93.256  54.174 34.432  1.00 25.21  ? 479  TYR B CE2  1 
ATOM   7898 C CZ   . TYR B 1 478 ? 91.913  54.482 34.341  1.00 27.17  ? 479  TYR B CZ   1 
ATOM   7899 O OH   . TYR B 1 478 ? 91.534  55.758 34.014  1.00 31.25  ? 479  TYR B OH   1 
ATOM   7900 N N    . TRP B 1 479 ? 93.917  47.969 36.879  1.00 17.60  ? 480  TRP B N    1 
ATOM   7901 C CA   . TRP B 1 479 ? 94.392  46.584 36.859  1.00 22.92  ? 480  TRP B CA   1 
ATOM   7902 C C    . TRP B 1 479 ? 93.565  45.692 37.777  1.00 26.57  ? 480  TRP B C    1 
ATOM   7903 O O    . TRP B 1 479 ? 93.167  44.590 37.400  1.00 26.40  ? 480  TRP B O    1 
ATOM   7904 C CB   . TRP B 1 479 ? 95.866  46.515 37.272  1.00 17.97  ? 480  TRP B CB   1 
ATOM   7905 C CG   . TRP B 1 479 ? 96.830  46.382 36.118  1.00 23.08  ? 480  TRP B CG   1 
ATOM   7906 C CD1  . TRP B 1 479 ? 97.681  45.335 35.883  1.00 25.96  ? 480  TRP B CD1  1 
ATOM   7907 C CD2  . TRP B 1 479 ? 97.052  47.329 35.054  1.00 23.19  ? 480  TRP B CD2  1 
ATOM   7908 N NE1  . TRP B 1 479 ? 98.412  45.569 34.742  1.00 25.89  ? 480  TRP B NE1  1 
ATOM   7909 C CE2  . TRP B 1 479 ? 98.056  46.786 34.219  1.00 22.01  ? 480  TRP B CE2  1 
ATOM   7910 C CE3  . TRP B 1 479 ? 96.504  48.579 34.730  1.00 25.95  ? 480  TRP B CE3  1 
ATOM   7911 C CZ2  . TRP B 1 479 ? 98.513  47.442 33.064  1.00 18.59  ? 480  TRP B CZ2  1 
ATOM   7912 C CZ3  . TRP B 1 479 ? 96.968  49.241 33.593  1.00 20.84  ? 480  TRP B CZ3  1 
ATOM   7913 C CH2  . TRP B 1 479 ? 97.961  48.664 32.770  1.00 20.69  ? 480  TRP B CH2  1 
ATOM   7914 N N    . ALA B 1 480 ? 93.292  46.180 38.980  1.00 24.71  ? 481  ALA B N    1 
ATOM   7915 C CA   . ALA B 1 480 ? 92.507  45.415 39.942  1.00 25.58  ? 481  ALA B CA   1 
ATOM   7916 C C    . ALA B 1 480 ? 91.046  45.247 39.480  1.00 27.69  ? 481  ALA B C    1 
ATOM   7917 O O    . ALA B 1 480 ? 90.452  44.162 39.628  1.00 27.41  ? 481  ALA B O    1 
ATOM   7918 C CB   . ALA B 1 480 ? 92.577  46.063 41.307  1.00 19.66  ? 481  ALA B CB   1 
ATOM   7919 N N    . ASN B 1 481 ? 90.473  46.321 38.935  1.00 23.58  ? 482  ASN B N    1 
ATOM   7920 C CA   . ASN B 1 481 ? 89.130  46.269 38.359  1.00 25.83  ? 482  ASN B CA   1 
ATOM   7921 C C    . ASN B 1 481 ? 89.084  45.173 37.322  1.00 26.43  ? 482  ASN B C    1 
ATOM   7922 O O    . ASN B 1 481 ? 88.167  44.348 37.319  1.00 21.10  ? 482  ASN B O    1 
ATOM   7923 C CB   . ASN B 1 481 ? 88.753  47.600 37.699  1.00 22.82  ? 482  ASN B CB   1 
ATOM   7924 C CG   . ASN B 1 481 ? 88.251  48.630 38.701  1.00 32.18  ? 482  ASN B CG   1 
ATOM   7925 O OD1  . ASN B 1 481 ? 88.128  48.344 39.897  1.00 31.47  ? 482  ASN B OD1  1 
ATOM   7926 N ND2  . ASN B 1 481 ? 87.961  49.843 38.215  1.00 23.97  ? 482  ASN B ND2  1 
ATOM   7927 N N    . PHE B 1 482 ? 90.089  45.171 36.447  1.00 20.06  ? 483  PHE B N    1 
ATOM   7928 C CA   . PHE B 1 482 ? 90.150  44.186 35.383  1.00 24.80  ? 483  PHE B CA   1 
ATOM   7929 C C    . PHE B 1 482 ? 90.235  42.775 35.975  1.00 27.51  ? 483  PHE B C    1 
ATOM   7930 O O    . PHE B 1 482 ? 89.530  41.867 35.540  1.00 26.25  ? 483  PHE B O    1 
ATOM   7931 C CB   . PHE B 1 482 ? 91.326  44.445 34.438  1.00 17.21  ? 483  PHE B CB   1 
ATOM   7932 C CG   . PHE B 1 482 ? 91.511  43.364 33.414  1.00 24.20  ? 483  PHE B CG   1 
ATOM   7933 C CD1  . PHE B 1 482 ? 90.739  43.342 32.255  1.00 23.66  ? 483  PHE B CD1  1 
ATOM   7934 C CD2  . PHE B 1 482 ? 92.425  42.346 33.622  1.00 16.78  ? 483  PHE B CD2  1 
ATOM   7935 C CE1  . PHE B 1 482 ? 90.905  42.329 31.301  1.00 19.30  ? 483  PHE B CE1  1 
ATOM   7936 C CE2  . PHE B 1 482 ? 92.598  41.325 32.675  1.00 24.99  ? 483  PHE B CE2  1 
ATOM   7937 C CZ   . PHE B 1 482 ? 91.832  41.319 31.515  1.00 18.54  ? 483  PHE B CZ   1 
ATOM   7938 N N    . ALA B 1 483 ? 91.096  42.598 36.971  1.00 24.88  ? 484  ALA B N    1 
ATOM   7939 C CA   . ALA B 1 483 ? 91.224  41.306 37.635  1.00 23.59  ? 484  ALA B CA   1 
ATOM   7940 C C    . ALA B 1 483 ? 89.887  40.835 38.235  1.00 26.90  ? 484  ALA B C    1 
ATOM   7941 O O    . ALA B 1 483 ? 89.560  39.649 38.188  1.00 28.74  ? 484  ALA B O    1 
ATOM   7942 C CB   . ALA B 1 483 ? 92.294  41.378 38.701  1.00 17.92  ? 484  ALA B CB   1 
ATOM   7943 N N    . ARG B 1 484 ? 89.122  41.765 38.800  1.00 28.73  ? 485  ARG B N    1 
ATOM   7944 C CA   . ARG B 1 484 ? 87.858  41.421 39.452  1.00 28.18  ? 485  ARG B CA   1 
ATOM   7945 C C    . ARG B 1 484 ? 86.709  41.151 38.481  1.00 27.75  ? 485  ARG B C    1 
ATOM   7946 O O    . ARG B 1 484 ? 85.908  40.267 38.726  1.00 31.22  ? 485  ARG B O    1 
ATOM   7947 C CB   . ARG B 1 484 ? 87.426  42.516 40.441  1.00 25.94  ? 485  ARG B CB   1 
ATOM   7948 C CG   . ARG B 1 484 ? 88.235  42.582 41.748  1.00 24.56  ? 485  ARG B CG   1 
ATOM   7949 C CD   . ARG B 1 484 ? 87.689  43.684 42.680  1.00 26.26  ? 485  ARG B CD   1 
ATOM   7950 N NE   . ARG B 1 484 ? 87.934  45.034 42.152  1.00 27.78  ? 485  ARG B NE   1 
ATOM   7951 C CZ   . ARG B 1 484 ? 88.952  45.803 42.523  1.00 27.02  ? 485  ARG B CZ   1 
ATOM   7952 N NH1  . ARG B 1 484 ? 89.818  45.358 43.429  1.00 21.67  ? 485  ARG B NH1  1 
ATOM   7953 N NH2  . ARG B 1 484 ? 89.109  47.015 41.992  1.00 27.46  ? 485  ARG B NH2  1 
ATOM   7954 N N    . THR B 1 485 ? 86.627  41.909 37.388  1.00 25.37  ? 486  THR B N    1 
ATOM   7955 C CA   . THR B 1 485 ? 85.436  41.886 36.530  1.00 26.99  ? 486  THR B CA   1 
ATOM   7956 C C    . THR B 1 485 ? 85.703  41.642 35.050  1.00 26.27  ? 486  THR B C    1 
ATOM   7957 O O    . THR B 1 485 ? 84.772  41.391 34.290  1.00 31.92  ? 486  THR B O    1 
ATOM   7958 C CB   . THR B 1 485 ? 84.690  43.224 36.574  1.00 29.69  ? 486  THR B CB   1 
ATOM   7959 O OG1  . THR B 1 485 ? 85.462  44.204 35.863  1.00 31.50  ? 486  THR B OG1  1 
ATOM   7960 C CG2  . THR B 1 485 ? 84.465  43.675 38.008  1.00 27.52  ? 486  THR B CG2  1 
ATOM   7961 N N    . GLY B 1 486 ? 86.955  41.767 34.627  1.00 21.96  ? 487  GLY B N    1 
ATOM   7962 C CA   . GLY B 1 486 ? 87.268  41.641 33.212  1.00 26.39  ? 487  GLY B CA   1 
ATOM   7963 C C    . GLY B 1 486 ? 87.141  42.962 32.473  1.00 27.11  ? 487  GLY B C    1 
ATOM   7964 O O    . GLY B 1 486 ? 87.223  43.016 31.247  1.00 28.24  ? 487  GLY B O    1 
ATOM   7965 N N    . ASP B 1 487 ? 86.975  44.039 33.229  1.00 23.69  ? 488  ASP B N    1 
ATOM   7966 C CA   . ASP B 1 487 ? 86.773  45.367 32.657  1.00 29.65  ? 488  ASP B CA   1 
ATOM   7967 C C    . ASP B 1 487 ? 87.493  46.374 33.566  1.00 23.90  ? 488  ASP B C    1 
ATOM   7968 O O    . ASP B 1 487 ? 87.142  46.502 34.742  1.00 30.79  ? 488  ASP B O    1 
ATOM   7969 C CB   . ASP B 1 487 ? 85.258  45.650 32.602  1.00 33.07  ? 488  ASP B CB   1 
ATOM   7970 C CG   . ASP B 1 487 ? 84.916  46.969 31.929  1.00 38.85  ? 488  ASP B CG   1 
ATOM   7971 O OD1  . ASP B 1 487 ? 85.822  47.809 31.742  1.00 44.32  ? 488  ASP B OD1  1 
ATOM   7972 O OD2  . ASP B 1 487 ? 83.727  47.174 31.595  1.00 43.14  ? 488  ASP B OD2  1 
ATOM   7973 N N    . PRO B 1 488 ? 88.507  47.082 33.035  1.00 23.11  ? 489  PRO B N    1 
ATOM   7974 C CA   . PRO B 1 488 ? 89.289  48.014 33.873  1.00 21.25  ? 489  PRO B CA   1 
ATOM   7975 C C    . PRO B 1 488 ? 88.471  49.223 34.324  1.00 27.40  ? 489  PRO B C    1 
ATOM   7976 O O    . PRO B 1 488 ? 88.840  49.901 35.283  1.00 33.64  ? 489  PRO B O    1 
ATOM   7977 C CB   . PRO B 1 488 ? 90.409  48.476 32.941  1.00 17.90  ? 489  PRO B CB   1 
ATOM   7978 C CG   . PRO B 1 488 ? 89.792  48.350 31.541  1.00 18.40  ? 489  PRO B CG   1 
ATOM   7979 C CD   . PRO B 1 488 ? 88.947  47.095 31.624  1.00 19.34  ? 489  PRO B CD   1 
ATOM   7980 N N    . ASN B 1 489 ? 87.363  49.481 33.640  1.00 26.90  ? 490  ASN B N    1 
ATOM   7981 C CA   . ASN B 1 489 ? 86.583  50.687 33.890  1.00 30.89  ? 490  ASN B CA   1 
ATOM   7982 C C    . ASN B 1 489 ? 85.994  50.872 35.282  1.00 42.94  ? 490  ASN B C    1 
ATOM   7983 O O    . ASN B 1 489 ? 85.458  49.933 35.887  1.00 39.71  ? 490  ASN B O    1 
ATOM   7984 C CB   . ASN B 1 489 ? 85.463  50.812 32.869  1.00 29.35  ? 490  ASN B CB   1 
ATOM   7985 C CG   . ASN B 1 489 ? 85.967  51.253 31.534  1.00 34.02  ? 490  ASN B CG   1 
ATOM   7986 O OD1  . ASN B 1 489 ? 86.408  52.390 31.379  1.00 39.68  ? 490  ASN B OD1  1 
ATOM   7987 N ND2  . ASN B 1 489 ? 85.916  50.353 30.550  1.00 27.42  ? 490  ASN B ND2  1 
ATOM   7988 N N    . GLU B 1 490 ? 86.105  52.113 35.757  1.00 50.19  ? 491  GLU B N    1 
ATOM   7989 C CA   . GLU B 1 490 ? 85.398  52.595 36.931  1.00 56.54  ? 491  GLU B CA   1 
ATOM   7990 C C    . GLU B 1 490 ? 84.005  53.062 36.500  1.00 60.17  ? 491  GLU B C    1 
ATOM   7991 O O    . GLU B 1 490 ? 83.774  53.302 35.313  1.00 60.60  ? 491  GLU B O    1 
ATOM   7992 C CB   . GLU B 1 490 ? 86.169  53.768 37.550  1.00 58.58  ? 491  GLU B CB   1 
ATOM   7993 C CG   . GLU B 1 490 ? 87.378  53.380 38.407  1.00 62.19  ? 491  GLU B CG   1 
ATOM   7994 C CD   . GLU B 1 490 ? 86.986  52.836 39.783  1.00 67.53  ? 491  GLU B CD   1 
ATOM   7995 O OE1  . GLU B 1 490 ? 86.260  51.819 39.845  1.00 67.85  ? 491  GLU B OE1  1 
ATOM   7996 O OE2  . GLU B 1 490 ? 87.405  53.426 40.804  1.00 69.77  ? 491  GLU B OE2  1 
ATOM   7997 N N    . PRO B 1 491 ? 83.070  53.182 37.458  1.00 60.82  ? 492  PRO B N    1 
ATOM   7998 C CA   . PRO B 1 491 ? 81.744  53.759 37.193  1.00 63.74  ? 492  PRO B CA   1 
ATOM   7999 C C    . PRO B 1 491 ? 81.826  55.065 36.398  1.00 72.28  ? 492  PRO B C    1 
ATOM   8000 O O    . PRO B 1 491 ? 82.753  55.854 36.588  1.00 74.43  ? 492  PRO B O    1 
ATOM   8001 C CB   . PRO B 1 491 ? 81.202  54.037 38.599  1.00 56.02  ? 492  PRO B CB   1 
ATOM   8002 C CG   . PRO B 1 491 ? 81.823  52.974 39.444  1.00 56.37  ? 492  PRO B CG   1 
ATOM   8003 C CD   . PRO B 1 491 ? 83.200  52.708 38.849  1.00 59.58  ? 492  PRO B CD   1 
ATOM   8004 N N    . ARG B 1 492 ? 80.848  55.287 35.527  1.00 79.40  ? 493  ARG B N    1 
ATOM   8005 C CA   . ARG B 1 492 ? 80.863  56.410 34.589  1.00 86.59  ? 493  ARG B CA   1 
ATOM   8006 C C    . ARG B 1 492 ? 81.008  57.792 35.236  1.00 89.37  ? 493  ARG B C    1 
ATOM   8007 O O    . ARG B 1 492 ? 80.585  58.013 36.376  1.00 84.09  ? 493  ARG B O    1 
ATOM   8008 C CB   . ARG B 1 492 ? 79.608  56.370 33.714  1.00 90.21  ? 493  ARG B CB   1 
ATOM   8009 C CG   . ARG B 1 492 ? 79.618  57.334 32.544  1.00 91.70  ? 493  ARG B CG   1 
ATOM   8010 C CD   . ARG B 1 492 ? 78.715  56.818 31.440  1.00 95.66  ? 493  ARG B CD   1 
ATOM   8011 N NE   . ARG B 1 492 ? 79.147  55.502 30.972  1.00 97.96  ? 493  ARG B NE   1 
ATOM   8012 C CZ   . ARG B 1 492 ? 78.602  54.348 31.354  1.00 96.37  ? 493  ARG B CZ   1 
ATOM   8013 N NH1  . ARG B 1 492 ? 77.588  54.338 32.209  1.00 95.31  ? 493  ARG B NH1  1 
ATOM   8014 N NH2  . ARG B 1 492 ? 79.071  53.202 30.873  1.00 93.25  ? 493  ARG B NH2  1 
ATOM   8015 N N    . ASP B 1 493 ? 81.611  58.713 34.484  1.00 94.45  ? 494  ASP B N    1 
ATOM   8016 C CA   . ASP B 1 493 ? 81.833  60.080 34.943  1.00 97.44  ? 494  ASP B CA   1 
ATOM   8017 C C    . ASP B 1 493 ? 81.976  61.037 33.763  1.00 92.47  ? 494  ASP B C    1 
ATOM   8018 O O    . ASP B 1 493 ? 81.716  62.235 33.886  1.00 89.69  ? 494  ASP B O    1 
ATOM   8019 C CB   . ASP B 1 493 ? 83.084  60.150 35.818  1.00 101.87 ? 494  ASP B CB   1 
ATOM   8020 C CG   . ASP B 1 493 ? 83.167  61.438 36.611  1.00 105.24 ? 494  ASP B CG   1 
ATOM   8021 O OD1  . ASP B 1 493 ? 83.702  62.436 36.081  1.00 108.18 ? 494  ASP B OD1  1 
ATOM   8022 O OD2  . ASP B 1 493 ? 82.694  61.451 37.768  1.00 103.86 ? 494  ASP B OD2  1 
ATOM   8023 N N    . PRO B 1 497 ? 85.398  59.339 31.759  1.00 52.84  ? 498  PRO B N    1 
ATOM   8024 C CA   . PRO B 1 497 ? 85.831  58.974 30.397  1.00 52.59  ? 498  PRO B CA   1 
ATOM   8025 C C    . PRO B 1 497 ? 86.195  57.480 30.316  1.00 45.75  ? 498  PRO B C    1 
ATOM   8026 O O    . PRO B 1 497 ? 87.082  57.002 31.032  1.00 45.89  ? 498  PRO B O    1 
ATOM   8027 C CB   . PRO B 1 497 ? 87.050  59.870 30.162  1.00 49.35  ? 498  PRO B CB   1 
ATOM   8028 C CG   . PRO B 1 497 ? 87.591  60.130 31.541  1.00 49.76  ? 498  PRO B CG   1 
ATOM   8029 C CD   . PRO B 1 497 ? 86.408  60.138 32.477  1.00 53.45  ? 498  PRO B CD   1 
ATOM   8030 N N    . GLN B 1 498 ? 85.489  56.752 29.458  1.00 35.86  ? 499  GLN B N    1 
ATOM   8031 C CA   . GLN B 1 498 ? 85.509  55.298 29.485  1.00 35.63  ? 499  GLN B CA   1 
ATOM   8032 C C    . GLN B 1 498 ? 86.550  54.694 28.554  1.00 39.24  ? 499  GLN B C    1 
ATOM   8033 O O    . GLN B 1 498 ? 86.797  55.201 27.454  1.00 40.73  ? 499  GLN B O    1 
ATOM   8034 C CB   . GLN B 1 498 ? 84.128  54.751 29.121  1.00 32.84  ? 499  GLN B CB   1 
ATOM   8035 C CG   . GLN B 1 498 ? 83.049  55.037 30.164  1.00 37.36  ? 499  GLN B CG   1 
ATOM   8036 C CD   . GLN B 1 498 ? 83.208  54.201 31.425  1.00 46.30  ? 499  GLN B CD   1 
ATOM   8037 O OE1  . GLN B 1 498 ? 83.001  52.982 31.405  1.00 53.38  ? 499  GLN B OE1  1 
ATOM   8038 N NE2  . GLN B 1 498 ? 83.582  54.850 32.530  1.00 36.15  ? 499  GLN B NE2  1 
ATOM   8039 N N    . TRP B 1 499 ? 87.135  53.593 29.013  1.00 29.25  ? 500  TRP B N    1 
ATOM   8040 C CA   . TRP B 1 499 ? 88.107  52.805 28.268  1.00 25.48  ? 500  TRP B CA   1 
ATOM   8041 C C    . TRP B 1 499 ? 87.358  51.786 27.396  1.00 28.70  ? 500  TRP B C    1 
ATOM   8042 O O    . TRP B 1 499 ? 86.856  50.797 27.912  1.00 32.21  ? 500  TRP B O    1 
ATOM   8043 C CB   . TRP B 1 499 ? 89.011  52.092 29.287  1.00 23.40  ? 500  TRP B CB   1 
ATOM   8044 C CG   . TRP B 1 499 ? 90.203  51.393 28.721  1.00 24.15  ? 500  TRP B CG   1 
ATOM   8045 C CD1  . TRP B 1 499 ? 90.395  51.020 27.424  1.00 23.11  ? 500  TRP B CD1  1 
ATOM   8046 C CD2  . TRP B 1 499 ? 91.385  50.991 29.435  1.00 22.32  ? 500  TRP B CD2  1 
ATOM   8047 N NE1  . TRP B 1 499 ? 91.618  50.413 27.284  1.00 21.72  ? 500  TRP B NE1  1 
ATOM   8048 C CE2  . TRP B 1 499 ? 92.244  50.376 28.501  1.00 20.10  ? 500  TRP B CE2  1 
ATOM   8049 C CE3  . TRP B 1 499 ? 91.797  51.094 30.767  1.00 23.20  ? 500  TRP B CE3  1 
ATOM   8050 C CZ2  . TRP B 1 499 ? 93.495  49.864 28.857  1.00 16.74  ? 500  TRP B CZ2  1 
ATOM   8051 C CZ3  . TRP B 1 499 ? 93.040  50.586 31.120  1.00 21.63  ? 500  TRP B CZ3  1 
ATOM   8052 C CH2  . TRP B 1 499 ? 93.873  49.975 30.167  1.00 21.26  ? 500  TRP B CH2  1 
ATOM   8053 N N    . PRO B 1 500 ? 87.275  52.019 26.069  1.00 29.06  ? 501  PRO B N    1 
ATOM   8054 C CA   . PRO B 1 500 ? 86.527  51.071 25.222  1.00 28.50  ? 501  PRO B CA   1 
ATOM   8055 C C    . PRO B 1 500 ? 87.380  49.864 24.844  1.00 29.49  ? 501  PRO B C    1 
ATOM   8056 O O    . PRO B 1 500 ? 88.606  49.962 24.825  1.00 28.26  ? 501  PRO B O    1 
ATOM   8057 C CB   . PRO B 1 500 ? 86.225  51.887 23.960  1.00 22.80  ? 501  PRO B CB   1 
ATOM   8058 C CG   . PRO B 1 500 ? 87.397  52.815 23.853  1.00 30.59  ? 501  PRO B CG   1 
ATOM   8059 C CD   . PRO B 1 500 ? 87.857  53.120 25.279  1.00 30.16  ? 501  PRO B CD   1 
ATOM   8060 N N    . PRO B 1 501 ? 86.735  48.729 24.552  1.00 25.12  ? 502  PRO B N    1 
ATOM   8061 C CA   . PRO B 1 501 ? 87.484  47.542 24.120  1.00 23.10  ? 502  PRO B CA   1 
ATOM   8062 C C    . PRO B 1 501 ? 88.187  47.771 22.774  1.00 26.30  ? 502  PRO B C    1 
ATOM   8063 O O    . PRO B 1 501 ? 87.682  48.505 21.915  1.00 27.97  ? 502  PRO B O    1 
ATOM   8064 C CB   . PRO B 1 501 ? 86.396  46.467 23.960  1.00 20.75  ? 502  PRO B CB   1 
ATOM   8065 C CG   . PRO B 1 501 ? 85.220  46.969 24.746  1.00 26.29  ? 502  PRO B CG   1 
ATOM   8066 C CD   . PRO B 1 501 ? 85.292  48.472 24.717  1.00 24.00  ? 502  PRO B CD   1 
ATOM   8067 N N    . TYR B 1 502 ? 89.350  47.146 22.602  1.00 26.37  ? 503  TYR B N    1 
ATOM   8068 C CA   . TYR B 1 502 ? 90.064  47.173 21.333  1.00 26.31  ? 503  TYR B CA   1 
ATOM   8069 C C    . TYR B 1 502 ? 89.411  46.199 20.373  1.00 24.84  ? 503  TYR B C    1 
ATOM   8070 O O    . TYR B 1 502 ? 89.143  45.058 20.736  1.00 27.08  ? 503  TYR B O    1 
ATOM   8071 C CB   . TYR B 1 502 ? 91.515  46.743 21.547  1.00 23.94  ? 503  TYR B CB   1 
ATOM   8072 C CG   . TYR B 1 502 ? 92.384  46.778 20.300  1.00 21.03  ? 503  TYR B CG   1 
ATOM   8073 C CD1  . TYR B 1 502 ? 92.472  45.675 19.447  1.00 23.24  ? 503  TYR B CD1  1 
ATOM   8074 C CD2  . TYR B 1 502 ? 93.132  47.909 19.989  1.00 19.49  ? 503  TYR B CD2  1 
ATOM   8075 C CE1  . TYR B 1 502 ? 93.277  45.705 18.313  1.00 23.69  ? 503  TYR B CE1  1 
ATOM   8076 C CE2  . TYR B 1 502 ? 93.937  47.948 18.860  1.00 19.83  ? 503  TYR B CE2  1 
ATOM   8077 C CZ   . TYR B 1 502 ? 94.011  46.851 18.029  1.00 26.90  ? 503  TYR B CZ   1 
ATOM   8078 O OH   . TYR B 1 502 ? 94.818  46.912 16.913  1.00 36.07  ? 503  TYR B OH   1 
ATOM   8079 N N    . THR B 1 503 ? 89.165  46.641 19.147  1.00 24.14  ? 504  THR B N    1 
ATOM   8080 C CA   . THR B 1 503 ? 88.641  45.753 18.106  1.00 30.55  ? 504  THR B CA   1 
ATOM   8081 C C    . THR B 1 503 ? 89.490  45.853 16.844  1.00 35.92  ? 504  THR B C    1 
ATOM   8082 O O    . THR B 1 503 ? 90.177  46.858 16.636  1.00 37.76  ? 504  THR B O    1 
ATOM   8083 C CB   . THR B 1 503 ? 87.203  46.103 17.743  1.00 28.94  ? 504  THR B CB   1 
ATOM   8084 O OG1  . THR B 1 503 ? 87.135  47.491 17.392  1.00 34.96  ? 504  THR B OG1  1 
ATOM   8085 C CG2  . THR B 1 503 ? 86.275  45.830 18.921  1.00 27.16  ? 504  THR B CG2  1 
ATOM   8086 N N    . ALA B 1 504 ? 89.440  44.822 16.002  1.00 32.41  ? 505  ALA B N    1 
ATOM   8087 C CA   . ALA B 1 504 ? 90.281  44.798 14.806  1.00 33.77  ? 505  ALA B CA   1 
ATOM   8088 C C    . ALA B 1 504 ? 89.944  45.955 13.860  1.00 32.30  ? 505  ALA B C    1 
ATOM   8089 O O    . ALA B 1 504 ? 90.833  46.522 13.221  1.00 33.91  ? 505  ALA B O    1 
ATOM   8090 C CB   . ALA B 1 504 ? 90.183  43.460 14.091  1.00 32.10  ? 505  ALA B CB   1 
ATOM   8091 N N    . GLY B 1 505 ? 88.666  46.315 13.792  1.00 28.53  ? 506  GLY B N    1 
ATOM   8092 C CA   . GLY B 1 505 ? 88.235  47.463 13.003  1.00 32.22  ? 506  GLY B CA   1 
ATOM   8093 C C    . GLY B 1 505 ? 88.606  48.822 13.597  1.00 36.99  ? 506  GLY B C    1 
ATOM   8094 O O    . GLY B 1 505 ? 89.519  49.491 13.105  1.00 32.66  ? 506  GLY B O    1 
ATOM   8095 N N    . ALA B 1 506 ? 87.906  49.231 14.656  1.00 30.24  ? 507  ALA B N    1 
ATOM   8096 C CA   . ALA B 1 506 ? 88.097  50.565 15.240  1.00 27.06  ? 507  ALA B CA   1 
ATOM   8097 C C    . ALA B 1 506 ? 89.482  50.773 15.883  1.00 25.80  ? 507  ALA B C    1 
ATOM   8098 O O    . ALA B 1 506 ? 89.986  51.902 15.938  1.00 25.87  ? 507  ALA B O    1 
ATOM   8099 C CB   . ALA B 1 506 ? 86.972  50.883 16.232  1.00 23.97  ? 507  ALA B CB   1 
ATOM   8100 N N    . GLN B 1 507 ? 90.078  49.686 16.372  1.00 23.71  ? 508  GLN B N    1 
ATOM   8101 C CA   . GLN B 1 507 ? 91.437  49.695 16.926  1.00 27.15  ? 508  GLN B CA   1 
ATOM   8102 C C    . GLN B 1 507 ? 91.652  50.738 18.024  1.00 29.63  ? 508  GLN B C    1 
ATOM   8103 O O    . GLN B 1 507 ? 92.706  51.381 18.093  1.00 26.70  ? 508  GLN B O    1 
ATOM   8104 C CB   . GLN B 1 507 ? 92.469  49.874 15.803  1.00 26.30  ? 508  GLN B CB   1 
ATOM   8105 C CG   . GLN B 1 507 ? 92.371  48.821 14.704  1.00 25.39  ? 508  GLN B CG   1 
ATOM   8106 C CD   . GLN B 1 507 ? 93.149  49.208 13.451  1.00 32.71  ? 508  GLN B CD   1 
ATOM   8107 O OE1  . GLN B 1 507 ? 94.372  49.348 13.484  1.00 32.38  ? 508  GLN B OE1  1 
ATOM   8108 N NE2  . GLN B 1 507 ? 92.436  49.408 12.347  1.00 32.06  ? 508  GLN B NE2  1 
ATOM   8109 N N    . GLN B 1 508 ? 90.661  50.890 18.892  1.00 24.07  ? 509  GLN B N    1 
ATOM   8110 C CA   . GLN B 1 508 ? 90.741  51.897 19.936  1.00 24.85  ? 509  GLN B CA   1 
ATOM   8111 C C    . GLN B 1 508 ? 91.565  51.451 21.137  1.00 25.40  ? 509  GLN B C    1 
ATOM   8112 O O    . GLN B 1 508 ? 91.430  50.319 21.626  1.00 24.26  ? 509  GLN B O    1 
ATOM   8113 C CB   . GLN B 1 508 ? 89.342  52.294 20.390  1.00 21.39  ? 509  GLN B CB   1 
ATOM   8114 C CG   . GLN B 1 508 ? 88.600  53.096 19.367  1.00 28.81  ? 509  GLN B CG   1 
ATOM   8115 C CD   . GLN B 1 508 ? 87.159  53.310 19.756  1.00 29.52  ? 509  GLN B CD   1 
ATOM   8116 O OE1  . GLN B 1 508 ? 86.436  52.356 20.016  1.00 31.08  ? 509  GLN B OE1  1 
ATOM   8117 N NE2  . GLN B 1 508 ? 86.735  54.567 19.798  1.00 28.36  ? 509  GLN B NE2  1 
ATOM   8118 N N    . TYR B 1 509 ? 92.416  52.355 21.607  1.00 23.33  ? 510  TYR B N    1 
ATOM   8119 C CA   . TYR B 1 509 ? 93.190  52.128 22.820  1.00 25.29  ? 510  TYR B CA   1 
ATOM   8120 C C    . TYR B 1 509 ? 93.172  53.422 23.634  1.00 29.63  ? 510  TYR B C    1 
ATOM   8121 O O    . TYR B 1 509 ? 92.663  54.440 23.160  1.00 28.17  ? 510  TYR B O    1 
ATOM   8122 C CB   . TYR B 1 509 ? 94.625  51.719 22.476  1.00 19.86  ? 510  TYR B CB   1 
ATOM   8123 C CG   . TYR B 1 509 ? 95.418  52.783 21.752  1.00 22.81  ? 510  TYR B CG   1 
ATOM   8124 C CD1  . TYR B 1 509 ? 95.367  52.897 20.358  1.00 21.98  ? 510  TYR B CD1  1 
ATOM   8125 C CD2  . TYR B 1 509 ? 96.247  53.658 22.454  1.00 20.93  ? 510  TYR B CD2  1 
ATOM   8126 C CE1  . TYR B 1 509 ? 96.111  53.866 19.686  1.00 24.54  ? 510  TYR B CE1  1 
ATOM   8127 C CE2  . TYR B 1 509 ? 96.989  54.635 21.788  1.00 23.17  ? 510  TYR B CE2  1 
ATOM   8128 C CZ   . TYR B 1 509 ? 96.919  54.734 20.409  1.00 27.43  ? 510  TYR B CZ   1 
ATOM   8129 O OH   . TYR B 1 509 ? 97.645  55.710 19.757  1.00 36.00  ? 510  TYR B OH   1 
ATOM   8130 N N    . VAL B 1 510 ? 93.721  53.401 24.847  1.00 20.15  ? 511  VAL B N    1 
ATOM   8131 C CA   . VAL B 1 510 ? 93.815  54.641 25.609  1.00 20.05  ? 511  VAL B CA   1 
ATOM   8132 C C    . VAL B 1 510 ? 95.245  54.957 25.971  1.00 23.38  ? 511  VAL B C    1 
ATOM   8133 O O    . VAL B 1 510 ? 96.059  54.052 26.149  1.00 28.86  ? 511  VAL B O    1 
ATOM   8134 C CB   . VAL B 1 510 ? 93.000  54.598 26.910  1.00 27.18  ? 511  VAL B CB   1 
ATOM   8135 C CG1  . VAL B 1 510 ? 91.530  54.474 26.604  1.00 23.53  ? 511  VAL B CG1  1 
ATOM   8136 C CG2  . VAL B 1 510 ? 93.492  53.449 27.822  1.00 18.17  ? 511  VAL B CG2  1 
ATOM   8137 N N    . SER B 1 511 ? 95.550  56.246 26.093  1.00 23.31  ? 512  SER B N    1 
ATOM   8138 C CA   . SER B 1 511 ? 96.830  56.651 26.654  1.00 22.02  ? 512  SER B CA   1 
ATOM   8139 C C    . SER B 1 511 ? 96.734  56.779 28.177  1.00 28.13  ? 512  SER B C    1 
ATOM   8140 O O    . SER B 1 511 ? 95.803  57.397 28.718  1.00 25.84  ? 512  SER B O    1 
ATOM   8141 C CB   . SER B 1 511 ? 97.294  57.970 26.057  1.00 25.27  ? 512  SER B CB   1 
ATOM   8142 O OG   . SER B 1 511 ? 96.317  58.958 26.259  1.00 35.71  ? 512  SER B OG   1 
ATOM   8143 N N    . LEU B 1 512 ? 97.696  56.175 28.862  1.00 23.08  ? 513  LEU B N    1 
ATOM   8144 C CA   . LEU B 1 512 ? 97.783  56.287 30.299  1.00 24.12  ? 513  LEU B CA   1 
ATOM   8145 C C    . LEU B 1 512 ? 98.894  57.269 30.655  1.00 29.30  ? 513  LEU B C    1 
ATOM   8146 O O    . LEU B 1 512 ? 100.072 57.007 30.401  1.00 28.40  ? 513  LEU B O    1 
ATOM   8147 C CB   . LEU B 1 512 ? 98.088  54.918 30.910  1.00 26.41  ? 513  LEU B CB   1 
ATOM   8148 C CG   . LEU B 1 512 ? 97.072  53.822 30.583  1.00 26.35  ? 513  LEU B CG   1 
ATOM   8149 C CD1  . LEU B 1 512 ? 97.527  52.466 31.114  1.00 23.32  ? 513  LEU B CD1  1 
ATOM   8150 C CD2  . LEU B 1 512 ? 95.698  54.178 31.150  1.00 19.43  ? 513  LEU B CD2  1 
ATOM   8151 N N    . ASP B 1 513 ? 98.512  58.418 31.203  1.00 28.77  ? 514  ASP B N    1 
ATOM   8152 C CA   . ASP B 1 513 ? 99.444  59.251 31.971  1.00 44.84  ? 514  ASP B CA   1 
ATOM   8153 C C    . ASP B 1 513 ? 98.684  60.142 32.937  1.00 41.53  ? 514  ASP B C    1 
ATOM   8154 O O    . ASP B 1 513 ? 97.584  59.791 33.367  1.00 43.18  ? 514  ASP B O    1 
ATOM   8155 C CB   . ASP B 1 513 ? 100.430 60.058 31.102  1.00 53.54  ? 514  ASP B CB   1 
ATOM   8156 C CG   . ASP B 1 513 ? 99.755  60.806 29.992  1.00 64.87  ? 514  ASP B CG   1 
ATOM   8157 O OD1  . ASP B 1 513 ? 98.509  60.885 30.007  1.00 74.55  ? 514  ASP B OD1  1 
ATOM   8158 O OD2  . ASP B 1 513 ? 100.472 61.323 29.105  1.00 68.53  ? 514  ASP B OD2  1 
ATOM   8159 N N    . LEU B 1 514 ? 99.268  61.284 33.280  1.00 35.85  ? 515  LEU B N    1 
ATOM   8160 C CA   . LEU B 1 514 ? 98.726  62.099 34.366  1.00 36.74  ? 515  LEU B CA   1 
ATOM   8161 C C    . LEU B 1 514 ? 97.361  62.709 34.049  1.00 33.07  ? 515  LEU B C    1 
ATOM   8162 O O    . LEU B 1 514 ? 96.509  62.796 34.925  1.00 44.94  ? 515  LEU B O    1 
ATOM   8163 C CB   . LEU B 1 514 ? 99.732  63.162 34.780  1.00 39.67  ? 515  LEU B CB   1 
ATOM   8164 C CG   . LEU B 1 514 ? 101.092 62.579 35.146  1.00 35.50  ? 515  LEU B CG   1 
ATOM   8165 C CD1  . LEU B 1 514 ? 102.079 63.711 35.439  1.00 31.95  ? 515  LEU B CD1  1 
ATOM   8166 C CD2  . LEU B 1 514 ? 100.951 61.648 36.344  1.00 30.15  ? 515  LEU B CD2  1 
ATOM   8167 N N    . ARG B 1 515 ? 97.154  63.117 32.801  1.00 35.90  ? 516  ARG B N    1 
ATOM   8168 C CA   . ARG B 1 515 ? 95.848  63.604 32.356  1.00 38.18  ? 516  ARG B CA   1 
ATOM   8169 C C    . ARG B 1 515 ? 94.884  62.436 32.218  1.00 33.84  ? 516  ARG B C    1 
ATOM   8170 O O    . ARG B 1 515 ? 95.306  61.295 32.067  1.00 33.85  ? 516  ARG B O    1 
ATOM   8171 C CB   . ARG B 1 515 ? 95.951  64.290 30.995  1.00 42.74  ? 516  ARG B CB   1 
ATOM   8172 C CG   . ARG B 1 515 ? 96.900  65.480 30.910  1.00 54.04  ? 516  ARG B CG   1 
ATOM   8173 C CD   . ARG B 1 515 ? 97.360  65.616 29.465  1.00 68.39  ? 516  ARG B CD   1 
ATOM   8174 N NE   . ARG B 1 515 ? 97.552  64.280 28.892  1.00 83.03  ? 516  ARG B NE   1 
ATOM   8175 C CZ   . ARG B 1 515 ? 97.014  63.846 27.751  1.00 88.53  ? 516  ARG B CZ   1 
ATOM   8176 N NH1  . ARG B 1 515 ? 96.254  64.651 27.017  1.00 91.22  ? 516  ARG B NH1  1 
ATOM   8177 N NH2  . ARG B 1 515 ? 97.250  62.602 27.336  1.00 84.72  ? 516  ARG B NH2  1 
ATOM   8178 N N    . PRO B 1 516 ? 93.575  62.725 32.244  1.00 36.40  ? 517  PRO B N    1 
ATOM   8179 C CA   . PRO B 1 516 ? 92.531  61.697 32.112  1.00 35.91  ? 517  PRO B CA   1 
ATOM   8180 C C    . PRO B 1 516 ? 92.689  60.870 30.831  1.00 38.54  ? 517  PRO B C    1 
ATOM   8181 O O    . PRO B 1 516 ? 93.319  61.344 29.874  1.00 35.29  ? 517  PRO B O    1 
ATOM   8182 C CB   . PRO B 1 516 ? 91.247  62.517 32.027  1.00 34.98  ? 517  PRO B CB   1 
ATOM   8183 C CG   . PRO B 1 516 ? 91.594  63.822 32.719  1.00 36.19  ? 517  PRO B CG   1 
ATOM   8184 C CD   . PRO B 1 516 ? 93.017  64.083 32.371  1.00 32.21  ? 517  PRO B CD   1 
ATOM   8185 N N    . LEU B 1 517 ? 92.128  59.660 30.823  1.00 35.74  ? 518  LEU B N    1 
ATOM   8186 C CA   . LEU B 1 517 ? 92.153  58.800 29.644  1.00 38.08  ? 518  LEU B CA   1 
ATOM   8187 C C    . LEU B 1 517 ? 91.819  59.589 28.399  1.00 40.21  ? 518  LEU B C    1 
ATOM   8188 O O    . LEU B 1 517 ? 90.974  60.481 28.412  1.00 41.41  ? 518  LEU B O    1 
ATOM   8189 C CB   . LEU B 1 517 ? 91.127  57.673 29.750  1.00 36.99  ? 518  LEU B CB   1 
ATOM   8190 C CG   . LEU B 1 517 ? 91.321  56.575 30.779  1.00 36.80  ? 518  LEU B CG   1 
ATOM   8191 C CD1  . LEU B 1 517 ? 90.331  55.461 30.512  1.00 34.31  ? 518  LEU B CD1  1 
ATOM   8192 C CD2  . LEU B 1 517 ? 92.749  56.066 30.722  1.00 39.83  ? 518  LEU B CD2  1 
ATOM   8193 N N    . GLU B 1 518 ? 92.492  59.252 27.316  1.00 37.02  ? 519  GLU B N    1 
ATOM   8194 C CA   . GLU B 1 518 ? 92.139  59.795 26.029  1.00 39.70  ? 519  GLU B CA   1 
ATOM   8195 C C    . GLU B 1 518 ? 92.081  58.583 25.112  1.00 29.73  ? 519  GLU B C    1 
ATOM   8196 O O    . GLU B 1 518 ? 92.978  57.744 25.135  1.00 29.97  ? 519  GLU B O    1 
ATOM   8197 C CB   . GLU B 1 518 ? 93.190  60.814 25.600  1.00 45.94  ? 519  GLU B CB   1 
ATOM   8198 C CG   . GLU B 1 518 ? 93.106  61.270 24.167  1.00 64.50  ? 519  GLU B CG   1 
ATOM   8199 C CD   . GLU B 1 518 ? 94.243  62.216 23.816  1.00 72.75  ? 519  GLU B CD   1 
ATOM   8200 O OE1  . GLU B 1 518 ? 94.774  62.867 24.752  1.00 76.52  ? 519  GLU B OE1  1 
ATOM   8201 O OE2  . GLU B 1 518 ? 94.603  62.295 22.616  1.00 67.82  ? 519  GLU B OE2  1 
ATOM   8202 N N    . VAL B 1 519 ? 90.994  58.455 24.359  1.00 27.19  ? 520  VAL B N    1 
ATOM   8203 C CA   . VAL B 1 519 ? 90.829  57.338 23.438  1.00 26.52  ? 520  VAL B CA   1 
ATOM   8204 C C    . VAL B 1 519 ? 91.462  57.673 22.098  1.00 30.23  ? 520  VAL B C    1 
ATOM   8205 O O    . VAL B 1 519 ? 91.206  58.747 21.545  1.00 28.79  ? 520  VAL B O    1 
ATOM   8206 C CB   . VAL B 1 519 ? 89.350  57.036 23.178  1.00 29.80  ? 520  VAL B CB   1 
ATOM   8207 C CG1  . VAL B 1 519 ? 89.220  55.858 22.196  1.00 30.03  ? 520  VAL B CG1  1 
ATOM   8208 C CG2  . VAL B 1 519 ? 88.628  56.739 24.483  1.00 27.92  ? 520  VAL B CG2  1 
ATOM   8209 N N    . ARG B 1 520 ? 92.264  56.752 21.574  1.00 28.56  ? 521  ARG B N    1 
ATOM   8210 C CA   . ARG B 1 520 ? 92.893  56.921 20.268  1.00 33.93  ? 521  ARG B CA   1 
ATOM   8211 C C    . ARG B 1 520 ? 92.710  55.685 19.391  1.00 33.79  ? 521  ARG B C    1 
ATOM   8212 O O    . ARG B 1 520 ? 92.281  54.636 19.886  1.00 30.20  ? 521  ARG B O    1 
ATOM   8213 C CB   . ARG B 1 520 ? 94.376  57.201 20.441  1.00 35.12  ? 521  ARG B CB   1 
ATOM   8214 C CG   . ARG B 1 520 ? 94.656  58.352 21.359  1.00 40.69  ? 521  ARG B CG   1 
ATOM   8215 C CD   . ARG B 1 520 ? 96.077  58.828 21.188  1.00 43.00  ? 521  ARG B CD   1 
ATOM   8216 N NE   . ARG B 1 520 ? 96.381  59.884 22.143  1.00 45.72  ? 521  ARG B NE   1 
ATOM   8217 C CZ   . ARG B 1 520 ? 97.495  59.934 22.861  1.00 43.23  ? 521  ARG B CZ   1 
ATOM   8218 N NH1  . ARG B 1 520 ? 98.417  58.990 22.713  1.00 39.82  ? 521  ARG B NH1  1 
ATOM   8219 N NH2  . ARG B 1 520 ? 97.681  60.927 23.722  1.00 39.22  ? 521  ARG B NH2  1 
ATOM   8220 N N    . ARG B 1 521 ? 93.045  55.813 18.101  1.00 30.49  ? 522  ARG B N    1 
ATOM   8221 C CA   . ARG B 1 521 ? 92.882  54.719 17.132  1.00 30.32  ? 522  ARG B CA   1 
ATOM   8222 C C    . ARG B 1 521 ? 94.208  54.268 16.523  1.00 33.21  ? 522  ARG B C    1 
ATOM   8223 O O    . ARG B 1 521 ? 95.013  55.092 16.087  1.00 38.44  ? 522  ARG B O    1 
ATOM   8224 C CB   . ARG B 1 521 ? 91.939  55.118 15.988  1.00 30.84  ? 522  ARG B CB   1 
ATOM   8225 C CG   . ARG B 1 521 ? 90.471  55.318 16.363  1.00 37.91  ? 522  ARG B CG   1 
ATOM   8226 C CD   . ARG B 1 521 ? 89.569  55.289 15.118  1.00 36.30  ? 522  ARG B CD   1 
ATOM   8227 N NE   . ARG B 1 521 ? 89.542  53.959 14.498  1.00 41.55  ? 522  ARG B NE   1 
ATOM   8228 C CZ   . ARG B 1 521 ? 89.727  53.717 13.199  1.00 44.60  ? 522  ARG B CZ   1 
ATOM   8229 N NH1  . ARG B 1 521 ? 89.947  54.722 12.360  1.00 43.38  ? 522  ARG B NH1  1 
ATOM   8230 N NH2  . ARG B 1 521 ? 89.691  52.468 12.735  1.00 33.82  ? 522  ARG B NH2  1 
ATOM   8231 N N    . GLY B 1 522 ? 94.423  52.957 16.479  1.00 34.81  ? 523  GLY B N    1 
ATOM   8232 C CA   . GLY B 1 522 ? 95.570  52.395 15.786  1.00 34.52  ? 523  GLY B CA   1 
ATOM   8233 C C    . GLY B 1 522 ? 96.852  52.258 16.590  1.00 31.79  ? 523  GLY B C    1 
ATOM   8234 O O    . GLY B 1 522 ? 97.483  53.249 16.965  1.00 33.29  ? 523  GLY B O    1 
ATOM   8235 N N    . LEU B 1 523 ? 97.241  51.018 16.850  1.00 28.97  ? 524  LEU B N    1 
ATOM   8236 C CA   . LEU B 1 523 ? 98.541  50.755 17.431  1.00 31.02  ? 524  LEU B CA   1 
ATOM   8237 C C    . LEU B 1 523 ? 99.539  50.721 16.283  1.00 30.93  ? 524  LEU B C    1 
ATOM   8238 O O    . LEU B 1 523 ? 99.885  49.634 15.781  1.00 24.63  ? 524  LEU B O    1 
ATOM   8239 C CB   . LEU B 1 523 ? 98.541  49.422 18.180  1.00 26.18  ? 524  LEU B CB   1 
ATOM   8240 C CG   . LEU B 1 523 ? 97.683  49.463 19.441  1.00 33.87  ? 524  LEU B CG   1 
ATOM   8241 C CD1  . LEU B 1 523 ? 97.439  48.065 20.034  1.00 32.13  ? 524  LEU B CD1  1 
ATOM   8242 C CD2  . LEU B 1 523 ? 98.357  50.362 20.450  1.00 30.24  ? 524  LEU B CD2  1 
ATOM   8243 N N    A ARG B 1 524 ? 99.988  51.907 15.873  0.54 26.05  ? 525  ARG B N    1 
ATOM   8244 N N    B ARG B 1 524 ? 99.992  51.901 15.860  0.46 26.47  ? 525  ARG B N    1 
ATOM   8245 C CA   A ARG B 1 524 ? 100.898 52.055 14.738  0.54 28.56  ? 525  ARG B CA   1 
ATOM   8246 C CA   B ARG B 1 524 ? 100.938 52.004 14.750  0.46 28.82  ? 525  ARG B CA   1 
ATOM   8247 C C    A ARG B 1 524 ? 100.453 51.196 13.561  0.54 27.58  ? 525  ARG B C    1 
ATOM   8248 C C    B ARG B 1 524 ? 100.457 51.185 13.553  0.46 27.57  ? 525  ARG B C    1 
ATOM   8249 O O    A ARG B 1 524 ? 101.196 50.337 13.074  0.54 26.15  ? 525  ARG B O    1 
ATOM   8250 O O    B ARG B 1 524 ? 101.188 50.333 13.041  0.46 26.10  ? 525  ARG B O    1 
ATOM   8251 C CB   A ARG B 1 524 ? 102.336 51.738 15.159  0.54 30.55  ? 525  ARG B CB   1 
ATOM   8252 C CB   B ARG B 1 524 ? 102.324 51.520 15.190  0.46 30.11  ? 525  ARG B CB   1 
ATOM   8253 C CG   A ARG B 1 524 ? 102.791 52.615 16.320  0.54 31.36  ? 525  ARG B CG   1 
ATOM   8254 C CG   B ARG B 1 524 ? 102.917 52.295 16.371  0.46 31.13  ? 525  ARG B CG   1 
ATOM   8255 C CD   A ARG B 1 524 ? 104.279 52.546 16.590  0.54 26.74  ? 525  ARG B CD   1 
ATOM   8256 C CD   B ARG B 1 524 ? 103.757 53.473 15.904  0.46 32.29  ? 525  ARG B CD   1 
ATOM   8257 N NE   A ARG B 1 524 ? 104.619 53.396 17.727  0.54 21.52  ? 525  ARG B NE   1 
ATOM   8258 N NE   B ARG B 1 524 ? 104.844 53.036 15.034  0.46 41.07  ? 525  ARG B NE   1 
ATOM   8259 C CZ   A ARG B 1 524 ? 105.842 53.823 18.015  0.54 25.84  ? 525  ARG B CZ   1 
ATOM   8260 C CZ   B ARG B 1 524 ? 105.725 53.848 14.457  0.46 41.29  ? 525  ARG B CZ   1 
ATOM   8261 N NH1  A ARG B 1 524 ? 106.866 53.479 17.248  0.54 29.65  ? 525  ARG B NH1  1 
ATOM   8262 N NH1  B ARG B 1 524 ? 105.662 55.156 14.659  0.46 40.44  ? 525  ARG B NH1  1 
ATOM   8263 N NH2  A ARG B 1 524 ? 106.039 54.596 19.076  0.54 22.44  ? 525  ARG B NH2  1 
ATOM   8264 N NH2  B ARG B 1 524 ? 106.670 53.344 13.681  0.46 13.58  ? 525  ARG B NH2  1 
ATOM   8265 N N    . ALA B 1 525 ? 99.222  51.435 13.125  1.00 26.69  ? 526  ALA B N    1 
ATOM   8266 C CA   . ALA B 1 525 ? 98.590  50.629 12.082  1.00 26.07  ? 526  ALA B CA   1 
ATOM   8267 C C    . ALA B 1 525 ? 99.404  50.513 10.798  1.00 26.32  ? 526  ALA B C    1 
ATOM   8268 O O    . ALA B 1 525 ? 99.514  49.424 10.228  1.00 26.58  ? 526  ALA B O    1 
ATOM   8269 C CB   . ALA B 1 525 ? 97.203  51.151 11.783  1.00 23.64  ? 526  ALA B CB   1 
ATOM   8270 N N    . GLN B 1 526 ? 99.981  51.619 10.344  1.00 23.80  ? 527  GLN B N    1 
ATOM   8271 C CA   . GLN B 1 526 ? 100.744 51.579 9.104   1.00 23.26  ? 527  GLN B CA   1 
ATOM   8272 C C    . GLN B 1 526 ? 101.992 50.712 9.266   1.00 23.35  ? 527  GLN B C    1 
ATOM   8273 O O    . GLN B 1 526 ? 102.208 49.778 8.498   1.00 26.21  ? 527  GLN B O    1 
ATOM   8274 C CB   . GLN B 1 526 ? 101.089 52.991 8.627   1.00 20.67  ? 527  GLN B CB   1 
ATOM   8275 C CG   . GLN B 1 526 ? 99.876  53.917 8.574   1.00 27.87  ? 527  GLN B CG   1 
ATOM   8276 C CD   . GLN B 1 526 ? 98.764  53.413 7.637   1.00 37.82  ? 527  GLN B CD   1 
ATOM   8277 O OE1  . GLN B 1 526 ? 97.580  53.565 7.933   1.00 42.97  ? 527  GLN B OE1  1 
ATOM   8278 N NE2  . GLN B 1 526 ? 99.147  52.834 6.503   1.00 40.77  ? 527  GLN B NE2  1 
ATOM   8279 N N    . ALA B 1 527 ? 102.802 51.004 10.275  1.00 22.38  ? 528  ALA B N    1 
ATOM   8280 C CA   . ALA B 1 527 ? 103.998 50.205 10.528  1.00 23.11  ? 528  ALA B CA   1 
ATOM   8281 C C    . ALA B 1 527 ? 103.650 48.721 10.716  1.00 24.50  ? 528  ALA B C    1 
ATOM   8282 O O    . ALA B 1 527 ? 104.307 47.829 10.174  1.00 34.74  ? 528  ALA B O    1 
ATOM   8283 C CB   . ALA B 1 527 ? 104.740 50.738 11.741  1.00 24.06  ? 528  ALA B CB   1 
ATOM   8284 N N    . CYS B 1 528 ? 102.600 48.456 11.473  1.00 21.61  ? 529  CYS B N    1 
ATOM   8285 C CA   . CYS B 1 528 ? 102.249 47.073 11.802  1.00 25.39  ? 529  CYS B CA   1 
ATOM   8286 C C    . CYS B 1 528 ? 101.652 46.271 10.640  1.00 25.28  ? 529  CYS B C    1 
ATOM   8287 O O    . CYS B 1 528 ? 101.754 45.037 10.611  1.00 26.06  ? 529  CYS B O    1 
ATOM   8288 C CB   . CYS B 1 528 ? 101.384 47.043 13.063  1.00 30.86  ? 529  CYS B CB   1 
ATOM   8289 S SG   . CYS B 1 528 ? 102.366 47.631 14.506  1.00 37.67  ? 529  CYS B SG   1 
ATOM   8290 N N    . ALA B 1 529 ? 101.070 46.964 9.662   1.00 19.73  ? 530  ALA B N    1 
ATOM   8291 C CA   . ALA B 1 529 ? 100.640 46.288 8.443   1.00 19.80  ? 530  ALA B CA   1 
ATOM   8292 C C    . ALA B 1 529 ? 101.890 45.744 7.768   1.00 21.89  ? 530  ALA B C    1 
ATOM   8293 O O    . ALA B 1 529 ? 101.902 44.624 7.241   1.00 23.73  ? 530  ALA B O    1 
ATOM   8294 C CB   . ALA B 1 529 ? 99.892  47.244 7.515   1.00 15.84  ? 530  ALA B CB   1 
ATOM   8295 N N    . PHE B 1 530 ? 102.954 46.538 7.811   1.00 20.94  ? 531  PHE B N    1 
ATOM   8296 C CA   . PHE B 1 530 ? 104.224 46.126 7.216   1.00 25.32  ? 531  PHE B CA   1 
ATOM   8297 C C    . PHE B 1 530 ? 104.793 44.848 7.858   1.00 25.78  ? 531  PHE B C    1 
ATOM   8298 O O    . PHE B 1 530 ? 105.033 43.864 7.159   1.00 28.25  ? 531  PHE B O    1 
ATOM   8299 C CB   . PHE B 1 530 ? 105.246 47.264 7.267   1.00 22.75  ? 531  PHE B CB   1 
ATOM   8300 C CG   . PHE B 1 530 ? 106.646 46.818 6.970   1.00 29.18  ? 531  PHE B CG   1 
ATOM   8301 C CD1  . PHE B 1 530 ? 107.029 46.501 5.678   1.00 29.43  ? 531  PHE B CD1  1 
ATOM   8302 C CD2  . PHE B 1 530 ? 107.575 46.700 7.984   1.00 24.50  ? 531  PHE B CD2  1 
ATOM   8303 C CE1  . PHE B 1 530 ? 108.320 46.070 5.410   1.00 36.34  ? 531  PHE B CE1  1 
ATOM   8304 C CE2  . PHE B 1 530 ? 108.864 46.272 7.721   1.00 28.22  ? 531  PHE B CE2  1 
ATOM   8305 C CZ   . PHE B 1 530 ? 109.237 45.956 6.436   1.00 33.41  ? 531  PHE B CZ   1 
ATOM   8306 N N    . TRP B 1 531 ? 104.981 44.867 9.181   1.00 15.69  ? 532  TRP B N    1 
ATOM   8307 C CA   . TRP B 1 531 ? 105.570 43.747 9.915   1.00 21.69  ? 532  TRP B CA   1 
ATOM   8308 C C    . TRP B 1 531 ? 104.671 42.516 9.957   1.00 27.12  ? 532  TRP B C    1 
ATOM   8309 O O    . TRP B 1 531 ? 105.145 41.385 9.826   1.00 31.22  ? 532  TRP B O    1 
ATOM   8310 C CB   . TRP B 1 531 ? 105.901 44.167 11.358  1.00 13.57  ? 532  TRP B CB   1 
ATOM   8311 C CG   . TRP B 1 531 ? 106.959 45.231 11.418  1.00 23.22  ? 532  TRP B CG   1 
ATOM   8312 C CD1  . TRP B 1 531 ? 106.767 46.569 11.614  1.00 23.16  ? 532  TRP B CD1  1 
ATOM   8313 C CD2  . TRP B 1 531 ? 108.373 45.048 11.240  1.00 20.72  ? 532  TRP B CD2  1 
ATOM   8314 N NE1  . TRP B 1 531 ? 107.974 47.229 11.575  1.00 24.15  ? 532  TRP B NE1  1 
ATOM   8315 C CE2  . TRP B 1 531 ? 108.975 46.319 11.350  1.00 23.46  ? 532  TRP B CE2  1 
ATOM   8316 C CE3  . TRP B 1 531 ? 109.186 43.933 10.997  1.00 20.96  ? 532  TRP B CE3  1 
ATOM   8317 C CZ2  . TRP B 1 531 ? 110.363 46.507 11.234  1.00 23.45  ? 532  TRP B CZ2  1 
ATOM   8318 C CZ3  . TRP B 1 531 ? 110.560 44.116 10.865  1.00 18.91  ? 532  TRP B CZ3  1 
ATOM   8319 C CH2  . TRP B 1 531 ? 111.134 45.393 10.985  1.00 22.46  ? 532  TRP B CH2  1 
ATOM   8320 N N    . ASN B 1 532 ? 103.376 42.739 10.161  1.00 19.34  ? 533  ASN B N    1 
ATOM   8321 C CA   . ASN B 1 532 ? 102.451 41.637 10.391  1.00 23.71  ? 533  ASN B CA   1 
ATOM   8322 C C    . ASN B 1 532 ? 101.844 41.090 9.102   1.00 23.91  ? 533  ASN B C    1 
ATOM   8323 O O    . ASN B 1 532 ? 101.619 39.904 8.999   1.00 26.80  ? 533  ASN B O    1 
ATOM   8324 C CB   . ASN B 1 532 ? 101.355 42.036 11.397  1.00 22.84  ? 533  ASN B CB   1 
ATOM   8325 C CG   . ASN B 1 532 ? 101.921 42.411 12.767  1.00 25.71  ? 533  ASN B CG   1 
ATOM   8326 O OD1  . ASN B 1 532 ? 102.953 41.891 13.193  1.00 30.17  ? 533  ASN B OD1  1 
ATOM   8327 N ND2  . ASN B 1 532 ? 101.241 43.319 13.461  1.00 23.20  ? 533  ASN B ND2  1 
ATOM   8328 N N    . ARG B 1 533 ? 101.617 41.943 8.106   1.00 19.09  ? 534  ARG B N    1 
ATOM   8329 C CA   . ARG B 1 533 ? 100.949 41.480 6.886   1.00 27.19  ? 534  ARG B CA   1 
ATOM   8330 C C    . ARG B 1 533 ? 101.894 41.246 5.704   1.00 28.01  ? 534  ARG B C    1 
ATOM   8331 O O    . ARG B 1 533 ? 101.860 40.195 5.081   1.00 27.99  ? 534  ARG B O    1 
ATOM   8332 C CB   . ARG B 1 533 ? 99.828  42.439 6.465   1.00 16.69  ? 534  ARG B CB   1 
ATOM   8333 C CG   . ARG B 1 533 ? 98.754  42.681 7.526   1.00 18.44  ? 534  ARG B CG   1 
ATOM   8334 C CD   . ARG B 1 533 ? 97.787  43.795 7.102   1.00 25.92  ? 534  ARG B CD   1 
ATOM   8335 N NE   . ARG B 1 533 ? 96.836  44.113 8.161   1.00 29.69  ? 534  ARG B NE   1 
ATOM   8336 C CZ   . ARG B 1 533 ? 95.741  43.402 8.409   1.00 37.32  ? 534  ARG B CZ   1 
ATOM   8337 N NH1  . ARG B 1 533 ? 95.458  42.345 7.660   1.00 36.86  ? 534  ARG B NH1  1 
ATOM   8338 N NH2  . ARG B 1 533 ? 94.932  43.744 9.404   1.00 38.77  ? 534  ARG B NH2  1 
ATOM   8339 N N    . PHE B 1 534 ? 102.733 42.224 5.390   1.00 28.76  ? 535  PHE B N    1 
ATOM   8340 C CA   . PHE B 1 534 ? 103.585 42.119 4.208   1.00 24.40  ? 535  PHE B CA   1 
ATOM   8341 C C    . PHE B 1 534 ? 104.882 41.326 4.408   1.00 27.94  ? 535  PHE B C    1 
ATOM   8342 O O    . PHE B 1 534 ? 105.182 40.426 3.635   1.00 30.02  ? 535  PHE B O    1 
ATOM   8343 C CB   . PHE B 1 534 ? 103.927 43.497 3.650   1.00 21.59  ? 535  PHE B CB   1 
ATOM   8344 C CG   . PHE B 1 534 ? 104.775 43.439 2.421   1.00 27.50  ? 535  PHE B CG   1 
ATOM   8345 C CD1  . PHE B 1 534 ? 104.242 43.003 1.219   1.00 27.94  ? 535  PHE B CD1  1 
ATOM   8346 C CD2  . PHE B 1 534 ? 106.110 43.800 2.468   1.00 30.77  ? 535  PHE B CD2  1 
ATOM   8347 C CE1  . PHE B 1 534 ? 105.029 42.938 0.073   1.00 30.68  ? 535  PHE B CE1  1 
ATOM   8348 C CE2  . PHE B 1 534 ? 106.904 43.737 1.334   1.00 30.91  ? 535  PHE B CE2  1 
ATOM   8349 C CZ   . PHE B 1 534 ? 106.360 43.308 0.133   1.00 31.43  ? 535  PHE B CZ   1 
ATOM   8350 N N    . LEU B 1 535 ? 105.654 41.671 5.433   1.00 32.75  ? 536  LEU B N    1 
ATOM   8351 C CA   . LEU B 1 535 ? 106.983 41.081 5.623   1.00 33.15  ? 536  LEU B CA   1 
ATOM   8352 C C    . LEU B 1 535 ? 107.009 39.546 5.602   1.00 32.76  ? 536  LEU B C    1 
ATOM   8353 O O    . LEU B 1 535 ? 107.870 38.954 4.949   1.00 38.76  ? 536  LEU B O    1 
ATOM   8354 C CB   . LEU B 1 535 ? 107.644 41.622 6.895   1.00 33.57  ? 536  LEU B CB   1 
ATOM   8355 C CG   . LEU B 1 535 ? 109.142 41.346 7.043   1.00 36.73  ? 536  LEU B CG   1 
ATOM   8356 C CD1  . LEU B 1 535 ? 109.908 41.826 5.816   1.00 29.70  ? 536  LEU B CD1  1 
ATOM   8357 C CD2  . LEU B 1 535 ? 109.697 42.006 8.293   1.00 34.67  ? 536  LEU B CD2  1 
ATOM   8358 N N    . PRO B 1 536 ? 106.067 38.895 6.303   1.00 29.45  ? 537  PRO B N    1 
ATOM   8359 C CA   . PRO B 1 536 ? 106.035 37.427 6.238   1.00 26.22  ? 537  PRO B CA   1 
ATOM   8360 C C    . PRO B 1 536 ? 105.917 36.909 4.793   1.00 33.12  ? 537  PRO B C    1 
ATOM   8361 O O    . PRO B 1 536 ? 106.627 35.968 4.419   1.00 33.31  ? 537  PRO B O    1 
ATOM   8362 C CB   . PRO B 1 536 ? 104.784 37.072 7.041   1.00 25.88  ? 537  PRO B CB   1 
ATOM   8363 C CG   . PRO B 1 536 ? 104.580 38.252 7.984   1.00 26.32  ? 537  PRO B CG   1 
ATOM   8364 C CD   . PRO B 1 536 ? 105.022 39.444 7.192   1.00 28.00  ? 537  PRO B CD   1 
ATOM   8365 N N    . LYS B 1 537 ? 105.050 37.518 3.987   1.00 30.82  ? 538  LYS B N    1 
ATOM   8366 C CA   . LYS B 1 537 ? 104.953 37.136 2.572   1.00 34.64  ? 538  LYS B CA   1 
ATOM   8367 C C    . LYS B 1 537 ? 106.291 37.287 1.856   1.00 35.32  ? 538  LYS B C    1 
ATOM   8368 O O    . LYS B 1 537 ? 106.715 36.407 1.115   1.00 37.35  ? 538  LYS B O    1 
ATOM   8369 C CB   . LYS B 1 537 ? 103.864 37.943 1.868   1.00 31.55  ? 538  LYS B CB   1 
ATOM   8370 C CG   . LYS B 1 537 ? 102.492 37.636 2.415   1.00 31.36  ? 538  LYS B CG   1 
ATOM   8371 C CD   . LYS B 1 537 ? 101.443 38.621 1.948   1.00 39.93  ? 538  LYS B CD   1 
ATOM   8372 C CE   . LYS B 1 537 ? 100.095 38.226 2.540   1.00 46.38  ? 538  LYS B CE   1 
ATOM   8373 N NZ   . LYS B 1 537 ? 99.124  39.344 2.563   1.00 51.41  ? 538  LYS B NZ   1 
ATOM   8374 N N    . LEU B 1 538 ? 106.960 38.403 2.110   1.00 40.39  ? 539  LEU B N    1 
ATOM   8375 C CA   . LEU B 1 538 ? 108.261 38.676 1.517   1.00 34.25  ? 539  LEU B CA   1 
ATOM   8376 C C    . LEU B 1 538 ? 109.298 37.640 1.934   1.00 35.90  ? 539  LEU B C    1 
ATOM   8377 O O    . LEU B 1 538 ? 110.100 37.189 1.116   1.00 41.22  ? 539  LEU B O    1 
ATOM   8378 C CB   . LEU B 1 538 ? 108.728 40.076 1.901   1.00 29.10  ? 539  LEU B CB   1 
ATOM   8379 C CG   . LEU B 1 538 ? 110.033 40.505 1.244   1.00 41.12  ? 539  LEU B CG   1 
ATOM   8380 C CD1  . LEU B 1 538 ? 110.012 41.984 0.921   1.00 41.95  ? 539  LEU B CD1  1 
ATOM   8381 C CD2  . LEU B 1 538 ? 111.196 40.172 2.156   1.00 41.43  ? 539  LEU B CD2  1 
ATOM   8382 N N    . LEU B 1 539 ? 109.274 37.257 3.205   1.00 41.69  ? 540  LEU B N    1 
ATOM   8383 C CA   . LEU B 1 539 ? 110.210 36.257 3.718   1.00 49.28  ? 540  LEU B CA   1 
ATOM   8384 C C    . LEU B 1 539 ? 109.965 34.856 3.125   1.00 48.95  ? 540  LEU B C    1 
ATOM   8385 O O    . LEU B 1 539 ? 110.917 34.113 2.889   1.00 54.47  ? 540  LEU B O    1 
ATOM   8386 C CB   . LEU B 1 539 ? 110.210 36.241 5.256   1.00 49.34  ? 540  LEU B CB   1 
ATOM   8387 C CG   . LEU B 1 539 ? 110.751 37.513 5.938   1.00 51.42  ? 540  LEU B CG   1 
ATOM   8388 C CD1  . LEU B 1 539 ? 110.562 37.483 7.450   1.00 50.87  ? 540  LEU B CD1  1 
ATOM   8389 C CD2  . LEU B 1 539 ? 112.221 37.753 5.611   1.00 47.36  ? 540  LEU B CD2  1 
ATOM   8390 N N    . SER B 1 540 ? 108.704 34.510 2.860   1.00 42.33  ? 541  SER B N    1 
ATOM   8391 C CA   . SER B 1 540 ? 108.384 33.225 2.230   1.00 46.05  ? 541  SER B CA   1 
ATOM   8392 C C    . SER B 1 540 ? 108.945 33.117 0.813   1.00 52.46  ? 541  SER B C    1 
ATOM   8393 O O    . SER B 1 540 ? 109.088 32.013 0.286   1.00 51.99  ? 541  SER B O    1 
ATOM   8394 C CB   . SER B 1 540 ? 106.880 32.983 2.196   1.00 45.49  ? 541  SER B CB   1 
ATOM   8395 O OG   . SER B 1 540 ? 106.344 32.997 3.499   1.00 53.95  ? 541  SER B OG   1 
ATOM   8396 N N    . ALA B 1 541 ? 109.264 34.261 0.207   1.00 53.85  ? 542  ALA B N    1 
ATOM   8397 C CA   . ALA B 1 541 ? 109.785 34.297 -1.156  1.00 46.73  ? 542  ALA B CA   1 
ATOM   8398 C C    . ALA B 1 541 ? 111.147 35.002 -1.260  1.00 47.65  ? 542  ALA B C    1 
ATOM   8399 O O    . ALA B 1 541 ? 112.137 34.610 -0.628  1.00 49.04  ? 542  ALA B O    1 
ATOM   8400 C CB   . ALA B 1 541 ? 108.777 34.958 -2.059  1.00 44.41  ? 542  ALA B CB   1 
HETATM 8401 O OH2  . 1PE C 2 .   ? 29.354  34.313 31.739  1.00 80.85  ? 1543 1PE A OH2  1 
HETATM 8402 C C12  . 1PE C 2 .   ? 30.294  35.237 32.253  1.00 76.86  ? 1543 1PE A C12  1 
HETATM 8403 C C22  . 1PE C 2 .   ? 31.337  34.542 33.164  1.00 74.66  ? 1543 1PE A C22  1 
HETATM 8404 O OH3  . 1PE C 2 .   ? 31.837  35.528 34.109  1.00 73.11  ? 1543 1PE A OH3  1 
HETATM 8405 C C13  . 1PE C 2 .   ? 33.489  37.218 34.686  1.00 70.01  ? 1543 1PE A C13  1 
HETATM 8406 C C23  . 1PE C 2 .   ? 33.230  35.770 34.163  1.00 69.78  ? 1543 1PE A C23  1 
HETATM 8407 O OH4  . 1PE C 2 .   ? 33.408  38.158 33.575  1.00 71.86  ? 1543 1PE A OH4  1 
HETATM 8408 C C14  . 1PE C 2 .   ? 32.823  40.272 32.495  1.00 70.37  ? 1543 1PE A C14  1 
HETATM 8409 C C24  . 1PE C 2 .   ? 33.089  39.555 33.837  1.00 70.96  ? 1543 1PE A C24  1 
HETATM 8410 O OH5  . 1PE C 2 .   ? 31.635  39.759 31.860  1.00 69.09  ? 1543 1PE A OH5  1 
HETATM 8411 C C15  . 1PE C 2 .   ? 31.084  38.506 29.824  1.00 74.63  ? 1543 1PE A C15  1 
HETATM 8412 C C25  . 1PE C 2 .   ? 31.569  39.842 30.413  1.00 73.36  ? 1543 1PE A C25  1 
HETATM 8413 O OH6  . 1PE C 2 .   ? 31.187  38.473 28.384  1.00 75.47  ? 1543 1PE A OH6  1 
HETATM 8414 C C16  . 1PE C 2 .   ? 31.934  37.112 26.499  1.00 71.07  ? 1543 1PE A C16  1 
HETATM 8415 C C26  . 1PE C 2 .   ? 31.158  37.148 27.844  1.00 76.50  ? 1543 1PE A C26  1 
HETATM 8416 O OH7  . 1PE C 2 .   ? 32.019  35.793 26.046  1.00 64.79  ? 1543 1PE A OH7  1 
HETATM 8417 H HO2  . 1PE C 2 .   ? 28.675  34.765 31.324  1.00 97.02  ? 1543 1PE A HO2  1 
HETATM 8418 H H121 . 1PE C 2 .   ? 30.757  35.674 31.508  1.00 92.23  ? 1543 1PE A H121 1 
HETATM 8419 H H122 . 1PE C 2 .   ? 29.814  35.920 32.778  1.00 92.23  ? 1543 1PE A H122 1 
HETATM 8420 H H221 . 1PE C 2 .   ? 30.912  33.803 33.651  1.00 89.59  ? 1543 1PE A H221 1 
HETATM 8421 H H222 . 1PE C 2 .   ? 32.080  34.196 32.615  1.00 89.59  ? 1543 1PE A H222 1 
HETATM 8422 H H131 . 1PE C 2 .   ? 34.382  37.268 35.084  1.00 84.02  ? 1543 1PE A H131 1 
HETATM 8423 H H132 . 1PE C 2 .   ? 32.816  37.445 35.361  1.00 84.02  ? 1543 1PE A H132 1 
HETATM 8424 H H231 . 1PE C 2 .   ? 33.606  35.685 33.263  1.00 83.74  ? 1543 1PE A H231 1 
HETATM 8425 H H232 . 1PE C 2 .   ? 33.654  35.118 34.756  1.00 83.74  ? 1543 1PE A H232 1 
HETATM 8426 H H141 . 1PE C 2 .   ? 32.738  41.232 32.642  1.00 84.44  ? 1543 1PE A H141 1 
HETATM 8427 H H142 . 1PE C 2 .   ? 33.575  40.107 31.905  1.00 84.44  ? 1543 1PE A H142 1 
HETATM 8428 H H241 . 1PE C 2 .   ? 32.286  39.607 34.399  1.00 85.15  ? 1543 1PE A H241 1 
HETATM 8429 H H242 . 1PE C 2 .   ? 33.839  39.983 34.297  1.00 85.15  ? 1543 1PE A H242 1 
HETATM 8430 H H151 . 1PE C 2 .   ? 30.158  38.357 30.086  1.00 89.56  ? 1543 1PE A H151 1 
HETATM 8431 H H152 . 1PE C 2 .   ? 31.638  37.784 30.190  1.00 89.56  ? 1543 1PE A H152 1 
HETATM 8432 H H251 . 1PE C 2 .   ? 32.464  40.025 30.070  1.00 88.03  ? 1543 1PE A H251 1 
HETATM 8433 H H252 . 1PE C 2 .   ? 30.966  40.563 30.148  1.00 88.03  ? 1543 1PE A H252 1 
HETATM 8434 H H161 . 1PE C 2 .   ? 32.826  37.470 26.629  1.00 85.29  ? 1543 1PE A H161 1 
HETATM 8435 H H162 . 1PE C 2 .   ? 31.457  37.653 25.833  1.00 85.29  ? 1543 1PE A H162 1 
HETATM 8436 H H261 . 1PE C 2 .   ? 31.583  36.531 28.476  1.00 91.80  ? 1543 1PE A H261 1 
HETATM 8437 H H262 . 1PE C 2 .   ? 30.227  36.875 27.698  1.00 91.80  ? 1543 1PE A H262 1 
HETATM 8438 H HO7  . 1PE C 2 .   ? 32.337  35.787 25.233  1.00 77.75  ? 1543 1PE A HO7  1 
HETATM 8439 O O    . HOH D 3 .   ? 82.409  39.086 40.939  1.00 43.72  ? 2001 HOH A O    1 
HETATM 8440 O O    . HOH D 3 .   ? 62.511  30.479 41.103  1.00 22.71  ? 2002 HOH A O    1 
HETATM 8441 O O    . HOH D 3 .   ? 57.814  39.831 46.658  1.00 31.00  ? 2003 HOH A O    1 
HETATM 8442 O O    . HOH D 3 .   ? 45.792  26.336 41.358  1.00 29.55  ? 2004 HOH A O    1 
HETATM 8443 O O    . HOH D 3 .   ? 70.616  30.265 53.350  1.00 27.52  ? 2005 HOH A O    1 
HETATM 8444 O O    . HOH D 3 .   ? 61.372  26.493 38.781  1.00 30.08  ? 2006 HOH A O    1 
HETATM 8445 O O    . HOH D 3 .   ? 56.641  25.918 36.505  1.00 28.56  ? 2007 HOH A O    1 
HETATM 8446 O O    . HOH D 3 .   ? 50.872  23.932 37.633  1.00 26.30  ? 2008 HOH A O    1 
HETATM 8447 O O    . HOH D 3 .   ? 54.167  14.847 36.792  1.00 28.96  ? 2009 HOH A O    1 
HETATM 8448 O O    . HOH D 3 .   ? 50.532  19.445 33.142  1.00 24.15  ? 2010 HOH A O    1 
HETATM 8449 O O    . HOH D 3 .   ? 59.634  17.330 26.437  1.00 37.10  ? 2011 HOH A O    1 
HETATM 8450 O O    . HOH D 3 .   ? 59.246  23.084 28.912  1.00 28.96  ? 2012 HOH A O    1 
HETATM 8451 O O    . HOH D 3 .   ? 54.195  29.789 45.612  1.00 19.41  ? 2013 HOH A O    1 
HETATM 8452 O O    . HOH D 3 .   ? 58.753  32.806 32.478  1.00 14.95  ? 2014 HOH A O    1 
HETATM 8453 O O    . HOH D 3 .   ? 59.431  28.608 25.925  1.00 27.59  ? 2015 HOH A O    1 
HETATM 8454 O O    . HOH D 3 .   ? 53.216  26.650 29.280  1.00 17.59  ? 2016 HOH A O    1 
HETATM 8455 O O    . HOH D 3 .   ? 59.156  25.893 29.088  1.00 27.74  ? 2017 HOH A O    1 
HETATM 8456 O O    . HOH D 3 .   ? 58.638  25.031 25.352  1.00 64.43  ? 2018 HOH A O    1 
HETATM 8457 O O    . HOH D 3 .   ? 64.318  32.157 33.418  1.00 22.79  ? 2019 HOH A O    1 
HETATM 8458 O O    . HOH D 3 .   ? 67.058  22.571 32.001  1.00 37.90  ? 2020 HOH A O    1 
HETATM 8459 O O    . HOH D 3 .   ? 40.535  25.662 30.168  1.00 25.78  ? 2021 HOH A O    1 
HETATM 8460 O O    . HOH D 3 .   ? 41.487  28.897 31.905  1.00 21.51  ? 2022 HOH A O    1 
HETATM 8461 O O    . HOH D 3 .   ? 38.503  23.829 32.057  1.00 21.59  ? 2023 HOH A O    1 
HETATM 8462 O O    . HOH D 3 .   ? 41.140  40.916 33.584  1.00 40.81  ? 2024 HOH A O    1 
HETATM 8463 O O    . HOH D 3 .   ? 56.824  49.583 30.528  1.00 30.20  ? 2025 HOH A O    1 
HETATM 8464 O O    . HOH D 3 .   ? 40.271  41.700 26.572  1.00 36.52  ? 2026 HOH A O    1 
HETATM 8465 O O    . HOH D 3 .   ? 60.840  31.969 16.977  1.00 26.80  ? 2027 HOH A O    1 
HETATM 8466 O O    . HOH D 3 .   ? 43.141  31.417 20.291  1.00 25.80  ? 2028 HOH A O    1 
HETATM 8467 O O    . HOH D 3 .   ? 41.258  25.408 21.449  1.00 31.81  ? 2029 HOH A O    1 
HETATM 8468 O O    . HOH D 3 .   ? 44.578  23.484 23.166  1.00 29.79  ? 2030 HOH A O    1 
HETATM 8469 O O    . HOH D 3 .   ? 30.348  27.423 31.455  1.00 32.32  ? 2031 HOH A O    1 
HETATM 8470 O O    . HOH D 3 .   ? 32.834  26.361 23.921  1.00 39.28  ? 2032 HOH A O    1 
HETATM 8471 O O    . HOH D 3 .   ? 41.861  23.154 22.653  1.00 23.30  ? 2033 HOH A O    1 
HETATM 8472 O O    . HOH D 3 .   ? 22.696  21.434 39.207  1.00 46.04  ? 2034 HOH A O    1 
HETATM 8473 O O    . HOH D 3 .   ? 26.396  25.013 47.065  1.00 36.01  ? 2035 HOH A O    1 
HETATM 8474 O O    . HOH D 3 .   ? 45.966  13.842 21.858  1.00 51.34  ? 2036 HOH A O    1 
HETATM 8475 O O    . HOH D 3 .   ? 48.720  13.018 20.808  1.00 20.60  ? 2037 HOH A O    1 
HETATM 8476 O O    . HOH D 3 .   ? 47.383  17.086 21.363  1.00 37.70  ? 2038 HOH A O    1 
HETATM 8477 O O    . HOH D 3 .   ? 47.326  20.695 15.324  1.00 33.87  ? 2039 HOH A O    1 
HETATM 8478 O O    . HOH D 3 .   ? 46.689  21.085 29.768  1.00 37.31  ? 2040 HOH A O    1 
HETATM 8479 O O    . HOH D 3 .   ? 31.581  37.665 32.376  1.00 38.72  ? 2041 HOH A O    1 
HETATM 8480 O O    . HOH D 3 .   ? 57.569  26.687 9.287   1.00 40.15  ? 2042 HOH A O    1 
HETATM 8481 O O    . HOH D 3 .   ? 56.702  23.129 9.238   1.00 36.97  ? 2043 HOH A O    1 
HETATM 8482 O O    . HOH D 3 .   ? 41.707  13.227 5.631   1.00 33.85  ? 2044 HOH A O    1 
HETATM 8483 O O    . HOH D 3 .   ? 52.290  17.134 -0.826  1.00 29.78  ? 2045 HOH A O    1 
HETATM 8484 O O    . HOH D 3 .   ? 53.143  10.360 -6.553  1.00 41.22  ? 2046 HOH A O    1 
HETATM 8485 O O    . HOH D 3 .   ? 55.857  19.046 0.491   1.00 29.63  ? 2047 HOH A O    1 
HETATM 8486 O O    . HOH D 3 .   ? 55.183  25.428 9.016   1.00 37.21  ? 2048 HOH A O    1 
HETATM 8487 O O    . HOH D 3 .   ? 44.892  28.707 11.476  1.00 24.78  ? 2049 HOH A O    1 
HETATM 8488 O O    . HOH D 3 .   ? 60.024  42.764 9.127   1.00 25.11  ? 2050 HOH A O    1 
HETATM 8489 O O    . HOH D 3 .   ? 70.754  36.620 9.312   1.00 27.62  ? 2051 HOH A O    1 
HETATM 8490 O O    . HOH D 3 .   ? 57.064  45.156 4.990   1.00 35.14  ? 2052 HOH A O    1 
HETATM 8491 O O    . HOH D 3 .   ? 58.200  34.155 1.424   1.00 33.30  ? 2053 HOH A O    1 
HETATM 8492 O O    . HOH D 3 .   ? 50.967  35.327 5.364   1.00 28.29  ? 2054 HOH A O    1 
HETATM 8493 O O    . HOH E 3 .   ? 102.346 22.754 49.466  1.00 34.17  ? 2001 HOH B O    1 
HETATM 8494 O O    . HOH E 3 .   ? 101.848 22.005 43.255  1.00 41.12  ? 2002 HOH B O    1 
HETATM 8495 O O    . HOH E 3 .   ? 111.302 34.023 46.914  1.00 36.88  ? 2003 HOH B O    1 
HETATM 8496 O O    . HOH E 3 .   ? 104.275 21.727 44.456  1.00 37.43  ? 2004 HOH B O    1 
HETATM 8497 O O    . HOH E 3 .   ? 112.253 24.775 45.843  1.00 23.76  ? 2005 HOH B O    1 
HETATM 8498 O O    . HOH E 3 .   ? 112.620 19.777 40.364  1.00 28.37  ? 2006 HOH B O    1 
HETATM 8499 O O    . HOH E 3 .   ? 118.985 24.153 37.361  1.00 22.43  ? 2007 HOH B O    1 
HETATM 8500 O O    . HOH E 3 .   ? 118.294 28.615 47.708  1.00 27.15  ? 2008 HOH B O    1 
HETATM 8501 O O    . HOH E 3 .   ? 114.990 34.140 39.287  1.00 25.70  ? 2009 HOH B O    1 
HETATM 8502 O O    . HOH E 3 .   ? 118.098 29.909 35.924  1.00 25.71  ? 2010 HOH B O    1 
HETATM 8503 O O    . HOH E 3 .   ? 118.974 28.079 37.947  1.00 35.76  ? 2011 HOH B O    1 
HETATM 8504 O O    . HOH E 3 .   ? 120.883 31.496 33.088  1.00 32.73  ? 2012 HOH B O    1 
HETATM 8505 O O    . HOH E 3 .   ? 128.530 28.282 39.604  1.00 34.42  ? 2013 HOH B O    1 
HETATM 8506 O O    . HOH E 3 .   ? 126.184 35.665 36.656  1.00 23.97  ? 2014 HOH B O    1 
HETATM 8507 O O    . HOH E 3 .   ? 117.359 39.671 38.141  1.00 25.69  ? 2015 HOH B O    1 
HETATM 8508 O O    . HOH E 3 .   ? 89.873  29.220 36.132  1.00 36.76  ? 2016 HOH B O    1 
HETATM 8509 O O    . HOH E 3 .   ? 127.126 37.154 34.631  1.00 35.20  ? 2017 HOH B O    1 
HETATM 8510 O O    . HOH E 3 .   ? 114.325 46.797 41.503  1.00 31.33  ? 2018 HOH B O    1 
HETATM 8511 O O    . HOH E 3 .   ? 108.013 42.804 49.958  1.00 49.04  ? 2019 HOH B O    1 
HETATM 8512 O O    . HOH E 3 .   ? 107.461 36.213 38.792  1.00 13.48  ? 2020 HOH B O    1 
HETATM 8513 O O    . HOH E 3 .   ? 112.948 36.382 31.825  1.00 13.95  ? 2021 HOH B O    1 
HETATM 8514 O O    . HOH E 3 .   ? 112.619 40.736 35.987  1.00 22.89  ? 2022 HOH B O    1 
HETATM 8515 O O    . HOH E 3 .   ? 116.972 33.797 27.173  1.00 22.05  ? 2023 HOH B O    1 
HETATM 8516 O O    . HOH E 3 .   ? 115.829 45.472 43.185  1.00 25.41  ? 2024 HOH B O    1 
HETATM 8517 O O    . HOH E 3 .   ? 102.591 46.381 45.008  1.00 25.70  ? 2025 HOH B O    1 
HETATM 8518 O O    . HOH E 3 .   ? 89.546  48.978 45.555  1.00 36.63  ? 2026 HOH B O    1 
HETATM 8519 O O    . HOH E 3 .   ? 113.257 25.718 25.407  1.00 22.68  ? 2027 HOH B O    1 
HETATM 8520 O O    . HOH E 3 .   ? 118.612 25.064 23.133  1.00 19.89  ? 2028 HOH B O    1 
HETATM 8521 O O    . HOH E 3 .   ? 96.427  29.064 39.389  1.00 23.00  ? 2029 HOH B O    1 
HETATM 8522 O O    . HOH E 3 .   ? 93.332  26.844 46.736  1.00 29.44  ? 2030 HOH B O    1 
HETATM 8523 O O    . HOH E 3 .   ? 91.089  30.923 37.661  1.00 29.53  ? 2031 HOH B O    1 
HETATM 8524 O O    . HOH E 3 .   ? 107.429 47.772 29.335  1.00 30.06  ? 2032 HOH B O    1 
HETATM 8525 O O    . HOH E 3 .   ? 99.428  24.385 22.428  1.00 30.96  ? 2033 HOH B O    1 
HETATM 8526 O O    . HOH E 3 .   ? 103.360 48.070 29.078  1.00 23.90  ? 2034 HOH B O    1 
HETATM 8527 O O    . HOH E 3 .   ? 115.640 35.418 21.344  1.00 20.88  ? 2035 HOH B O    1 
HETATM 8528 O O    . HOH E 3 .   ? 127.296 25.938 40.112  1.00 23.54  ? 2036 HOH B O    1 
HETATM 8529 O O    . HOH E 3 .   ? 119.408 32.916 27.013  1.00 28.65  ? 2037 HOH B O    1 
HETATM 8530 O O    . HOH E 3 .   ? 124.033 40.263 20.488  1.00 44.16  ? 2038 HOH B O    1 
HETATM 8531 O O    . HOH E 3 .   ? 120.920 40.381 21.244  1.00 32.21  ? 2039 HOH B O    1 
HETATM 8532 O O    . HOH E 3 .   ? 124.166 42.872 21.670  1.00 25.48  ? 2040 HOH B O    1 
HETATM 8533 O O    . HOH E 3 .   ? 120.697 35.162 26.068  1.00 31.29  ? 2041 HOH B O    1 
HETATM 8534 O O    . HOH E 3 .   ? 86.459  29.714 23.501  1.00 46.65  ? 2042 HOH B O    1 
HETATM 8535 O O    . HOH E 3 .   ? 106.874 52.380 21.125  1.00 29.30  ? 2043 HOH B O    1 
HETATM 8536 O O    . HOH E 3 .   ? 112.731 50.954 25.461  1.00 31.06  ? 2044 HOH B O    1 
HETATM 8537 O O    . HOH E 3 .   ? 119.128 54.043 1.790   1.00 34.54  ? 2045 HOH B O    1 
HETATM 8538 O O    . HOH E 3 .   ? 119.485 41.136 8.886   1.00 36.30  ? 2046 HOH B O    1 
HETATM 8539 O O    . HOH E 3 .   ? 113.813 58.628 9.249   1.00 29.16  ? 2047 HOH B O    1 
HETATM 8540 O O    . HOH E 3 .   ? 118.586 64.815 5.623   1.00 33.36  ? 2048 HOH B O    1 
HETATM 8541 O O    . HOH E 3 .   ? 111.931 59.736 13.073  1.00 26.47  ? 2049 HOH B O    1 
HETATM 8542 O O    . HOH E 3 .   ? 108.292 51.296 18.878  1.00 39.00  ? 2050 HOH B O    1 
HETATM 8543 O O    . HOH E 3 .   ? 87.653  43.320 22.266  1.00 26.44  ? 2051 HOH B O    1 
HETATM 8544 O O    . HOH E 3 .   ? 83.936  47.755 28.632  1.00 31.44  ? 2052 HOH B O    1 
HETATM 8545 O O    . HOH E 3 .   ? 91.266  49.558 24.295  1.00 18.20  ? 2053 HOH B O    1 
HETATM 8546 O O    . HOH E 3 .   ? 95.531  58.677 31.336  1.00 19.64  ? 2054 HOH B O    1 
HETATM 8547 O O    . HOH E 3 .   ? 85.791  45.911 40.579  1.00 31.78  ? 2055 HOH B O    1 
HETATM 8548 O O    . HOH E 3 .   ? 88.080  49.409 19.356  1.00 25.45  ? 2056 HOH B O    1 
HETATM 8549 O O    . HOH E 3 .   ? 97.443  55.992 16.797  1.00 34.29  ? 2057 HOH B O    1 
HETATM 8550 O O    . HOH E 3 .   ? 98.041  53.986 13.809  1.00 32.57  ? 2058 HOH B O    1 
HETATM 8551 O O    . HOH E 3 .   ? 98.461  47.955 14.405  1.00 31.41  ? 2059 HOH B O    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLU A 3   ? 0.9346 1.1750 0.8807 -0.1471 -0.1420 0.0067  4   GLU A N   
2    C CA  . GLU A 3   ? 0.9723 1.1880 0.9112 -0.1422 -0.1383 0.0053  4   GLU A CA  
3    C C   . GLU A 3   ? 0.9909 1.1887 0.9277 -0.1558 -0.1375 0.0036  4   GLU A C   
4    O O   . GLU A 3   ? 1.0319 1.2079 0.9526 -0.1690 -0.1422 -0.0029 4   GLU A O   
5    C CB  . GLU A 3   ? 1.0143 1.2064 0.9297 -0.1377 -0.1411 -0.0021 4   GLU A CB  
6    C CG  . GLU A 3   ? 1.1013 1.2759 1.0107 -0.1269 -0.1367 -0.0019 4   GLU A CG  
7    C CD  . GLU A 3   ? 1.1009 1.2951 1.0229 -0.1101 -0.1320 0.0064  4   GLU A CD  
8    O OE1 . GLU A 3   ? 1.1621 1.3823 1.1004 -0.1058 -0.1317 0.0130  4   GLU A OE1 
9    O OE2 . GLU A 3   ? 0.9661 1.1441 0.8833 -0.0985 -0.1260 0.0063  4   GLU A OE2 
10   N N   . ASP A 4   ? 0.9231 1.1290 0.8754 -0.1523 -0.1316 0.0097  5   ASP A N   
11   C CA  . ASP A 4   ? 0.8348 1.0287 0.7877 -0.1644 -0.1297 0.0106  5   ASP A CA  
12   C C   . ASP A 4   ? 0.8539 1.0075 0.7872 -0.1666 -0.1310 0.0054  5   ASP A C   
13   O O   . ASP A 4   ? 0.8663 1.0114 0.7984 -0.1542 -0.1282 0.0058  5   ASP A O   
14   C CB  . ASP A 4   ? 0.8148 1.0330 0.7902 -0.1574 -0.1226 0.0184  5   ASP A CB  
15   C CG  . ASP A 4   ? 0.8361 1.0491 0.8138 -0.1704 -0.1199 0.0209  5   ASP A CG  
16   O OD1 . ASP A 4   ? 0.8729 1.0556 0.8334 -0.1830 -0.1232 0.0174  5   ASP A OD1 
17   O OD2 . ASP A 4   ? 0.8074 1.0460 0.8032 -0.1672 -0.1144 0.0264  5   ASP A OD2 
18   N N   . ALA A 5   ? 0.8199 0.9475 0.7375 -0.1817 -0.1353 0.0008  6   ALA A N   
19   C CA  . ALA A 5   ? 0.7560 0.8400 0.6517 -0.1832 -0.1377 -0.0053 6   ALA A CA  
20   C C   . ALA A 5   ? 0.6929 0.7660 0.5944 -0.1783 -0.1319 -0.0004 6   ALA A C   
21   O O   . ALA A 5   ? 0.6530 0.6948 0.5430 -0.1668 -0.1287 -0.0041 6   ALA A O   
22   C CB  . ALA A 5   ? 0.7865 0.8428 0.6647 -0.1998 -0.1436 -0.0105 6   ALA A CB  
23   N N   . GLU A 6   ? 0.6479 0.7468 0.5682 -0.1837 -0.1282 0.0077  7   GLU A N   
24   C CA  . GLU A 6   ? 0.6420 0.7331 0.5691 -0.1777 -0.1211 0.0127  7   GLU A CA  
25   C C   . GLU A 6   ? 0.5539 0.6508 0.4912 -0.1541 -0.1131 0.0140  7   GLU A C   
26   O O   . GLU A 6   ? 0.4573 0.5408 0.3964 -0.1457 -0.1073 0.0162  7   GLU A O   
27   C CB  . GLU A 6   ? 0.7205 0.8416 0.6648 -0.1889 -0.1185 0.0205  7   GLU A CB  
28   C CG  . GLU A 6   ? 0.8572 0.9651 0.7918 -0.2088 -0.1210 0.0219  7   GLU A CG  
29   C CD  . GLU A 6   ? 0.9534 1.0220 0.8719 -0.2157 -0.1222 0.0226  7   GLU A CD  
30   O OE1 . GLU A 6   ? 0.9847 1.0435 0.9049 -0.2037 -0.1184 0.0236  7   GLU A OE1 
31   O OE2 . GLU A 6   ? 0.9774 1.0232 0.8815 -0.2309 -0.1262 0.0228  7   GLU A OE2 
32   N N   . LEU A 7   ? 0.4722 0.5892 0.4154 -0.1444 -0.1135 0.0131  8   LEU A N   
33   C CA  . LEU A 7   ? 0.4508 0.5749 0.4040 -0.1243 -0.1067 0.0156  8   LEU A CA  
34   C C   . LEU A 7   ? 0.4790 0.5798 0.4167 -0.1132 -0.1064 0.0098  8   LEU A C   
35   O O   . LEU A 7   ? 0.4789 0.5848 0.4224 -0.0980 -0.1015 0.0117  8   LEU A O   
36   C CB  . LEU A 7   ? 0.3531 0.5164 0.3251 -0.1194 -0.1065 0.0206  8   LEU A CB  
37   C CG  . LEU A 7   ? 0.3897 0.5811 0.3783 -0.1286 -0.1061 0.0255  8   LEU A CG  
38   C CD1 . LEU A 7   ? 0.3625 0.5924 0.3688 -0.1215 -0.1071 0.0295  8   LEU A CD1 
39   C CD2 . LEU A 7   ? 0.3711 0.5554 0.3665 -0.1242 -0.0989 0.0286  8   LEU A CD2 
40   N N   . LEU A 8   ? 0.4973 0.5724 0.4148 -0.1212 -0.1118 0.0025  9   LEU A N   
41   C CA  . LEU A 8   ? 0.4243 0.4772 0.3249 -0.1109 -0.1116 -0.0048 9   LEU A CA  
42   C C   . LEU A 8   ? 0.4444 0.4599 0.3311 -0.1098 -0.1109 -0.0093 9   LEU A C   
43   O O   . LEU A 8   ? 0.6532 0.6505 0.5310 -0.1236 -0.1158 -0.0108 9   LEU A O   
44   C CB  . LEU A 8   ? 0.4092 0.4625 0.2951 -0.1188 -0.1194 -0.0116 9   LEU A CB  
45   C CG  . LEU A 8   ? 0.4378 0.5274 0.3353 -0.1164 -0.1206 -0.0072 9   LEU A CG  
46   C CD1 . LEU A 8   ? 0.4713 0.5632 0.3541 -0.1267 -0.1295 -0.0137 9   LEU A CD1 
47   C CD2 . LEU A 8   ? 0.3682 0.4640 0.2700 -0.0977 -0.1138 -0.0045 9   LEU A CD2 
48   N N   . VAL A 9   ? 0.3843 0.3889 0.2690 -0.0935 -0.1051 -0.0108 10  VAL A N   
49   C CA  . VAL A 9   ? 0.4883 0.4595 0.3612 -0.0888 -0.1042 -0.0147 10  VAL A CA  
50   C C   . VAL A 9   ? 0.4526 0.4139 0.3153 -0.0724 -0.1013 -0.0216 10  VAL A C   
51   O O   . VAL A 9   ? 0.3847 0.3682 0.2561 -0.0626 -0.0965 -0.0192 10  VAL A O   
52   C CB  . VAL A 9   ? 0.5233 0.4974 0.4109 -0.0847 -0.0985 -0.0069 10  VAL A CB  
53   C CG1 . VAL A 9   ? 0.5539 0.4954 0.4296 -0.0771 -0.0978 -0.0105 10  VAL A CG1 
54   C CG2 . VAL A 9   ? 0.6349 0.6195 0.5312 -0.1008 -0.1007 -0.0006 10  VAL A CG2 
55   N N   . THR A 10  ? 0.5002 0.4283 0.3439 -0.0693 -0.1042 -0.0300 11  THR A N   
56   C CA  . THR A 10  ? 0.4906 0.4106 0.3250 -0.0521 -0.1006 -0.0372 11  THR A CA  
57   C C   . THR A 10  ? 0.4746 0.3785 0.3115 -0.0408 -0.0965 -0.0358 11  THR A C   
58   O O   . THR A 10  ? 0.5226 0.3977 0.3503 -0.0451 -0.1007 -0.0371 11  THR A O   
59   C CB  . THR A 10  ? 0.5457 0.4413 0.3548 -0.0529 -0.1070 -0.0501 11  THR A CB  
60   O OG1 . THR A 10  ? 0.6153 0.5304 0.4223 -0.0617 -0.1105 -0.0515 11  THR A OG1 
61   C CG2 . THR A 10  ? 0.5579 0.4462 0.3576 -0.0333 -0.1024 -0.0582 11  THR A CG2 
62   N N   . VAL A 11  ? 0.5037 0.4264 0.3529 -0.0271 -0.0888 -0.0324 12  VAL A N   
63   C CA  . VAL A 11  ? 0.5224 0.4340 0.3743 -0.0146 -0.0850 -0.0318 12  VAL A CA  
64   C C   . VAL A 11  ? 0.5167 0.4256 0.3581 0.0016  -0.0821 -0.0408 12  VAL A C   
65   O O   . VAL A 11  ? 0.5264 0.4424 0.3587 0.0021  -0.0828 -0.0468 12  VAL A O   
66   C CB  . VAL A 11  ? 0.3944 0.3306 0.2688 -0.0121 -0.0786 -0.0213 12  VAL A CB  
67   C CG1 . VAL A 11  ? 0.3505 0.2881 0.2338 -0.0261 -0.0809 -0.0137 12  VAL A CG1 
68   C CG2 . VAL A 11  ? 0.3523 0.3195 0.2369 -0.0091 -0.0739 -0.0182 12  VAL A CG2 
69   N N   . ARG A 12  ? 0.5229 0.4245 0.3659 0.0153  -0.0789 -0.0420 13  ARG A N   
70   C CA  . ARG A 12  ? 0.6363 0.5352 0.4682 0.0318  -0.0764 -0.0520 13  ARG A CA  
71   C C   . ARG A 12  ? 0.6124 0.5450 0.4507 0.0367  -0.0698 -0.0512 13  ARG A C   
72   O O   . ARG A 12  ? 0.6451 0.5781 0.4697 0.0445  -0.0692 -0.0607 13  ARG A O   
73   C CB  . ARG A 12  ? 0.7139 0.6024 0.5479 0.0466  -0.0744 -0.0529 13  ARG A CB  
74   C CG  . ARG A 12  ? 0.9219 0.7687 0.7397 0.0459  -0.0824 -0.0577 13  ARG A CG  
75   C CD  . ARG A 12  ? 1.0846 0.9197 0.9019 0.0632  -0.0815 -0.0598 13  ARG A CD  
76   N NE  . ARG A 12  ? 1.2012 0.9965 1.0059 0.0592  -0.0898 -0.0598 13  ARG A NE  
77   C CZ  . ARG A 12  ? 1.2257 1.0020 1.0265 0.0727  -0.0919 -0.0609 13  ARG A CZ  
78   N NH1 . ARG A 12  ? 1.2411 1.0376 1.0510 0.0914  -0.0861 -0.0629 13  ARG A NH1 
79   N NH2 . ARG A 12  ? 1.2073 0.9453 0.9948 0.0670  -0.1002 -0.0594 13  ARG A NH2 
80   N N   . GLY A 13  ? 0.5870 0.5466 0.4449 0.0317  -0.0654 -0.0399 14  GLY A N   
81   C CA  . GLY A 13  ? 0.5774 0.5678 0.4419 0.0348  -0.0595 -0.0367 14  GLY A CA  
82   C C   . GLY A 13  ? 0.6051 0.6029 0.4606 0.0262  -0.0627 -0.0384 14  GLY A C   
83   O O   . GLY A 13  ? 0.5566 0.5742 0.4090 0.0306  -0.0589 -0.0392 14  GLY A O   
84   N N   . GLY A 14  ? 0.5938 0.5777 0.4451 0.0133  -0.0696 -0.0386 15  GLY A N   
85   C CA  . GLY A 14  ? 0.3802 0.3733 0.2248 0.0037  -0.0737 -0.0394 15  GLY A CA  
86   C C   . GLY A 14  ? 0.3986 0.3902 0.2504 -0.0119 -0.0795 -0.0336 15  GLY A C   
87   O O   . GLY A 14  ? 0.4659 0.4426 0.3226 -0.0166 -0.0812 -0.0313 15  GLY A O   
88   N N   . ARG A 15  ? 0.3697 0.3790 0.2222 -0.0200 -0.0824 -0.0308 16  ARG A N   
89   C CA  . ARG A 15  ? 0.4489 0.4623 0.3086 -0.0346 -0.0881 -0.0260 16  ARG A CA  
90   C C   . ARG A 15  ? 0.4280 0.4640 0.3111 -0.0357 -0.0845 -0.0135 16  ARG A C   
91   O O   . ARG A 15  ? 0.3884 0.4431 0.2804 -0.0281 -0.0797 -0.0075 16  ARG A O   
92   C CB  . ARG A 15  ? 0.4495 0.4714 0.2980 -0.0429 -0.0944 -0.0300 16  ARG A CB  
93   C CG  . ARG A 15  ? 0.5737 0.5685 0.3980 -0.0466 -0.1006 -0.0433 16  ARG A CG  
94   C CD  . ARG A 15  ? 0.6498 0.6550 0.4638 -0.0568 -0.1078 -0.0470 16  ARG A CD  
95   N NE  . ARG A 15  ? 0.7116 0.7367 0.5204 -0.0480 -0.1047 -0.0476 16  ARG A NE  
96   C CZ  . ARG A 15  ? 0.7707 0.8170 0.5771 -0.0542 -0.1091 -0.0456 16  ARG A CZ  
97   N NH1 . ARG A 15  ? 0.7257 0.7779 0.5361 -0.0690 -0.1169 -0.0434 16  ARG A NH1 
98   N NH2 . ARG A 15  ? 0.7949 0.8584 0.5951 -0.0458 -0.1059 -0.0453 16  ARG A NH2 
99   N N   . LEU A 16  ? 0.4594 0.4931 0.3513 -0.0455 -0.0873 -0.0098 17  LEU A N   
100  C CA  . LEU A 16  ? 0.4412 0.4942 0.3541 -0.0464 -0.0845 0.0003  17  LEU A CA  
101  C C   . LEU A 16  ? 0.4095 0.4780 0.3288 -0.0588 -0.0900 0.0033  17  LEU A C   
102  O O   . LEU A 16  ? 0.4601 0.5179 0.3702 -0.0705 -0.0956 -0.0012 17  LEU A O   
103  C CB  . LEU A 16  ? 0.3847 0.4245 0.3045 -0.0452 -0.0813 0.0024  17  LEU A CB  
104  C CG  . LEU A 16  ? 0.3776 0.4081 0.2972 -0.0324 -0.0755 0.0016  17  LEU A CG  
105  C CD1 . LEU A 16  ? 0.3665 0.3833 0.2910 -0.0329 -0.0740 0.0035  17  LEU A CD1 
106  C CD2 . LEU A 16  ? 0.3261 0.3783 0.2582 -0.0245 -0.0705 0.0081  17  LEU A CD2 
107  N N   A ARG A 17  ? 0.3836 0.4773 0.3186 -0.0563 -0.0887 0.0110  18  ARG A N   
108  N N   B ARG A 17  ? 0.3666 0.4603 0.3015 -0.0562 -0.0887 0.0110  18  ARG A N   
109  C CA  A ARG A 17  ? 0.3882 0.5020 0.3335 -0.0657 -0.0931 0.0147  18  ARG A CA  
110  C CA  B ARG A 17  ? 0.3905 0.5047 0.3360 -0.0654 -0.0929 0.0149  18  ARG A CA  
111  C C   A ARG A 17  ? 0.3836 0.5085 0.3480 -0.0625 -0.0888 0.0215  18  ARG A C   
112  C C   B ARG A 17  ? 0.4023 0.5261 0.3665 -0.0624 -0.0885 0.0214  18  ARG A C   
113  O O   A ARG A 17  ? 0.3773 0.5070 0.3504 -0.0517 -0.0842 0.0261  18  ARG A O   
114  O O   B ARG A 17  ? 0.3720 0.4987 0.3445 -0.0515 -0.0836 0.0257  18  ARG A O   
115  C CB  A ARG A 17  ? 0.3845 0.5199 0.3302 -0.0642 -0.0968 0.0172  18  ARG A CB  
116  C CB  B ARG A 17  ? 0.3684 0.5054 0.3161 -0.0629 -0.0962 0.0181  18  ARG A CB  
117  C CG  A ARG A 17  ? 0.3855 0.5484 0.3464 -0.0694 -0.1006 0.0226  18  ARG A CG  
118  C CG  B ARG A 17  ? 0.3766 0.5392 0.3366 -0.0705 -0.1011 0.0222  18  ARG A CG  
119  C CD  A ARG A 17  ? 0.4255 0.6047 0.3800 -0.0743 -0.1080 0.0217  18  ARG A CD  
120  C CD  B ARG A 17  ? 0.4107 0.5951 0.3721 -0.0663 -0.1051 0.0261  18  ARG A CD  
121  N NE  A ARG A 17  ? 0.4774 0.6468 0.4152 -0.0689 -0.1081 0.0183  18  ARG A NE  
122  N NE  B ARG A 17  ? 0.4632 0.6423 0.4055 -0.0714 -0.1102 0.0199  18  ARG A NE  
123  C CZ  A ARG A 17  ? 0.4897 0.6653 0.4292 -0.0574 -0.1048 0.0237  18  ARG A CZ  
124  C CZ  B ARG A 17  ? 0.5044 0.6774 0.4342 -0.0638 -0.1087 0.0187  18  ARG A CZ  
125  N NH1 A ARG A 17  ? 0.4784 0.6659 0.4350 -0.0497 -0.1019 0.0324  18  ARG A NH1 
126  N NH1 B ARG A 17  ? 0.4947 0.6663 0.4297 -0.0519 -0.1023 0.0243  18  ARG A NH1 
127  N NH2 A ARG A 17  ? 0.5037 0.6730 0.4269 -0.0537 -0.1045 0.0204  18  ARG A NH2 
128  N NH2 B ARG A 17  ? 0.5155 0.6847 0.4270 -0.0689 -0.1136 0.0118  18  ARG A NH2 
129  N N   . GLY A 18  ? 0.3666 0.4951 0.3364 -0.0727 -0.0904 0.0220  19  GLY A N   
130  C CA  . GLY A 18  ? 0.2776 0.4160 0.2633 -0.0702 -0.0860 0.0269  19  GLY A CA  
131  C C   . GLY A 18  ? 0.3220 0.4919 0.3229 -0.0731 -0.0883 0.0310  19  GLY A C   
132  O O   . GLY A 18  ? 0.3301 0.5155 0.3308 -0.0747 -0.0932 0.0313  19  GLY A O   
133  N N   . ILE A 19  ? 0.2743 0.4549 0.2879 -0.0734 -0.0850 0.0337  20  ILE A N   
134  C CA  . ILE A 19  ? 0.2137 0.4266 0.2440 -0.0724 -0.0859 0.0373  20  ILE A CA  
135  C C   . ILE A 19  ? 0.3248 0.5480 0.3604 -0.0843 -0.0848 0.0374  20  ILE A C   
136  O O   . ILE A 19  ? 0.2890 0.4931 0.3185 -0.0881 -0.0814 0.0366  20  ILE A O   
137  C CB  . ILE A 19  ? 0.4045 0.6231 0.4468 -0.0556 -0.0818 0.0408  20  ILE A CB  
138  C CG1 . ILE A 19  ? 0.4528 0.7027 0.5100 -0.0499 -0.0845 0.0440  20  ILE A CG1 
139  C CG2 . ILE A 19  ? 0.3690 0.5780 0.4156 -0.0521 -0.0755 0.0407  20  ILE A CG2 
140  C CD1 . ILE A 19  ? 0.4665 0.7179 0.5343 -0.0336 -0.0812 0.0470  20  ILE A CD1 
141  N N   . ARG A 20  ? 0.3677 0.6223 0.4140 -0.0909 -0.0878 0.0389  21  ARG A N   
142  C CA  . ARG A 20  ? 0.3486 0.6189 0.4012 -0.1028 -0.0861 0.0400  21  ARG A CA  
143  C C   . ARG A 20  ? 0.3579 0.6515 0.4281 -0.0914 -0.0801 0.0419  21  ARG A C   
144  O O   . ARG A 20  ? 0.3626 0.6771 0.4441 -0.0810 -0.0793 0.0424  21  ARG A O   
145  C CB  . ARG A 20  ? 0.4093 0.6951 0.4613 -0.1156 -0.0892 0.0395  21  ARG A CB  
146  C CG  . ARG A 20  ? 0.5300 0.8318 0.5876 -0.1265 -0.0850 0.0413  21  ARG A CG  
147  C CD  . ARG A 20  ? 0.7466 1.0641 0.8037 -0.1386 -0.0879 0.0414  21  ARG A CD  
148  N NE  . ARG A 20  ? 0.9344 1.2858 1.0078 -0.1278 -0.0860 0.0424  21  ARG A NE  
149  C CZ  . ARG A 20  ? 1.0395 1.3986 1.1162 -0.1181 -0.0898 0.0417  21  ARG A CZ  
150  N NH1 . ARG A 20  ? 1.0991 1.4365 1.1637 -0.1181 -0.0952 0.0398  21  ARG A NH1 
151  N NH2 . ARG A 20  ? 1.0021 1.3908 1.0933 -0.1081 -0.0884 0.0428  21  ARG A NH2 
152  N N   . LEU A 21  ? 0.3423 0.6259 0.4116 -0.0916 -0.0747 0.0421  22  LEU A N   
153  C CA  . LEU A 21  ? 0.3375 0.6411 0.4211 -0.0811 -0.0690 0.0426  22  LEU A CA  
154  C C   . LEU A 21  ? 0.3928 0.7235 0.4833 -0.0906 -0.0656 0.0432  22  LEU A C   
155  O O   . LEU A 21  ? 0.3941 0.7188 0.4758 -0.1078 -0.0657 0.0446  22  LEU A O   
156  C CB  . LEU A 21  ? 0.3165 0.5932 0.3934 -0.0755 -0.0636 0.0417  22  LEU A CB  
157  C CG  . LEU A 21  ? 0.2763 0.5224 0.3453 -0.0642 -0.0637 0.0408  22  LEU A CG  
158  C CD1 . LEU A 21  ? 0.2334 0.4654 0.3016 -0.0574 -0.0582 0.0400  22  LEU A CD1 
159  C CD2 . LEU A 21  ? 0.2260 0.4832 0.3038 -0.0508 -0.0660 0.0414  22  LEU A CD2 
160  N N   . LYS A 22  ? 0.4542 0.8110 0.5585 -0.0785 -0.0620 0.0422  23  LYS A N   
161  C CA  . LYS A 22  ? 0.3940 0.7770 0.5043 -0.0841 -0.0568 0.0423  23  LYS A CA  
162  C C   . LYS A 22  ? 0.3832 0.7649 0.4942 -0.0818 -0.0509 0.0417  23  LYS A C   
163  O O   . LYS A 22  ? 0.3945 0.7657 0.5085 -0.0679 -0.0500 0.0399  23  LYS A O   
164  C CB  . LYS A 22  ? 0.4515 0.8636 0.5756 -0.0708 -0.0557 0.0407  23  LYS A CB  
165  C CG  . LYS A 22  ? 0.5840 1.0027 0.7078 -0.0747 -0.0614 0.0417  23  LYS A CG  
166  C CD  . LYS A 22  ? 0.7191 1.1691 0.8567 -0.0627 -0.0605 0.0406  23  LYS A CD  
167  C CE  . LYS A 22  ? 0.8024 1.2496 0.9485 -0.0393 -0.0598 0.0384  23  LYS A CE  
168  N NZ  . LYS A 22  ? 0.8374 1.3142 0.9966 -0.0264 -0.0588 0.0367  23  LYS A NZ  
169  N N   . THR A 23  ? 0.4077 0.7987 0.5145 -0.0963 -0.0473 0.0437  24  THR A N   
170  C CA  . THR A 23  ? 0.5048 0.9012 0.6125 -0.0944 -0.0411 0.0431  24  THR A CA  
171  C C   . THR A 23  ? 0.5687 0.9962 0.6792 -0.1020 -0.0357 0.0441  24  THR A C   
172  O O   . THR A 23  ? 0.5595 0.9958 0.6666 -0.1160 -0.0377 0.0470  24  THR A O   
173  C CB  . THR A 23  ? 0.5273 0.8945 0.6214 -0.1065 -0.0423 0.0461  24  THR A CB  
174  O OG1 . THR A 23  ? 0.5504 0.9182 0.6342 -0.1273 -0.0416 0.0507  24  THR A OG1 
175  C CG2 . THR A 23  ? 0.5198 0.8520 0.6047 -0.1055 -0.0487 0.0461  24  THR A CG2 
176  N N   . PRO A 24  ? 0.6312 1.0763 0.7474 -0.0928 -0.0291 0.0413  25  PRO A N   
177  C CA  . PRO A 24  ? 0.6750 1.1523 0.7932 -0.0988 -0.0235 0.0418  25  PRO A CA  
178  C C   . PRO A 24  ? 0.6471 1.1178 0.7511 -0.1229 -0.0232 0.0485  25  PRO A C   
179  O O   . PRO A 24  ? 0.7776 1.2679 0.8794 -0.1283 -0.0178 0.0497  25  PRO A O   
180  C CB  . PRO A 24  ? 0.6760 1.1651 0.8000 -0.0825 -0.0171 0.0364  25  PRO A CB  
181  C CG  . PRO A 24  ? 0.6572 1.1280 0.7876 -0.0634 -0.0203 0.0320  25  PRO A CG  
182  C CD  . PRO A 24  ? 0.6511 1.0894 0.7729 -0.0740 -0.0270 0.0365  25  PRO A CD  
183  N N   . GLY A 25  ? 0.5922 1.0341 0.6854 -0.1370 -0.0295 0.0527  26  GLY A N   
184  C CA  . GLY A 25  ? 0.5596 0.9904 0.6377 -0.1604 -0.0311 0.0594  26  GLY A CA  
185  C C   . GLY A 25  ? 0.6071 1.0229 0.6791 -0.1723 -0.0385 0.0615  26  GLY A C   
186  O O   . GLY A 25  ? 0.8010 1.2173 0.8634 -0.1911 -0.0404 0.0664  26  GLY A O   
187  N N   . GLY A 26  ? 0.4613 0.8641 0.5381 -0.1613 -0.0429 0.0577  27  GLY A N   
188  C CA  . GLY A 26  ? 0.4849 0.8712 0.5549 -0.1708 -0.0504 0.0583  27  GLY A CA  
189  C C   . GLY A 26  ? 0.5194 0.8782 0.5880 -0.1601 -0.0553 0.0549  27  GLY A C   
190  O O   . GLY A 26  ? 0.4595 0.8111 0.5325 -0.1463 -0.0532 0.0527  27  GLY A O   
191  N N   . PRO A 27  ? 0.4958 0.8394 0.5574 -0.1668 -0.0622 0.0542  28  PRO A N   
192  C CA  . PRO A 27  ? 0.4228 0.7440 0.4820 -0.1569 -0.0674 0.0507  28  PRO A CA  
193  C C   . PRO A 27  ? 0.4078 0.6913 0.4535 -0.1598 -0.0700 0.0508  28  PRO A C   
194  O O   . PRO A 27  ? 0.4358 0.6995 0.4680 -0.1752 -0.0712 0.0537  28  PRO A O   
195  C CB  . PRO A 27  ? 0.4054 0.7232 0.4581 -0.1672 -0.0738 0.0499  28  PRO A CB  
196  C CG  . PRO A 27  ? 0.4210 0.7400 0.4649 -0.1880 -0.0736 0.0539  28  PRO A CG  
197  C CD  . PRO A 27  ? 0.4222 0.7701 0.4767 -0.1850 -0.0656 0.0566  28  PRO A CD  
198  N N   . VAL A 28  ? 0.3666 0.6397 0.4152 -0.1447 -0.0713 0.0480  29  VAL A N   
199  C CA  . VAL A 28  ? 0.2527 0.4825 0.2856 -0.1395 -0.0711 0.0467  29  VAL A CA  
200  C C   . VAL A 28  ? 0.2888 0.5021 0.3172 -0.1290 -0.0749 0.0429  29  VAL A C   
201  O O   . VAL A 28  ? 0.3119 0.5466 0.3519 -0.1193 -0.0754 0.0420  29  VAL A O   
202  C CB  . VAL A 28  ? 0.3169 0.5446 0.3548 -0.1256 -0.0639 0.0470  29  VAL A CB  
203  C CG1 . VAL A 28  ? 0.2334 0.4244 0.2608 -0.1140 -0.0638 0.0447  29  VAL A CG1 
204  C CG2 . VAL A 28  ? 0.2814 0.5150 0.3166 -0.1380 -0.0605 0.0509  29  VAL A CG2 
205  N N   . SER A 29  ? 0.3412 0.5174 0.3522 -0.1308 -0.0778 0.0408  30  SER A N   
206  C CA  . SER A 29  ? 0.3763 0.5377 0.3816 -0.1203 -0.0804 0.0369  30  SER A CA  
207  C C   . SER A 29  ? 0.3868 0.5330 0.3930 -0.1030 -0.0754 0.0363  30  SER A C   
208  O O   . SER A 29  ? 0.3860 0.5131 0.3860 -0.1025 -0.0728 0.0370  30  SER A O   
209  C CB  . SER A 29  ? 0.4404 0.5718 0.4257 -0.1306 -0.0867 0.0334  30  SER A CB  
210  O OG  . SER A 29  ? 0.5008 0.6459 0.4846 -0.1478 -0.0926 0.0335  30  SER A OG  
211  N N   . ALA A 30  ? 0.2780 0.4334 0.2919 -0.0894 -0.0744 0.0356  31  ALA A N   
212  C CA  . ALA A 30  ? 0.2527 0.3955 0.2680 -0.0746 -0.0701 0.0354  31  ALA A CA  
213  C C   . ALA A 30  ? 0.2986 0.4292 0.3065 -0.0671 -0.0720 0.0332  31  ALA A C   
214  O O   . ALA A 30  ? 0.3344 0.4783 0.3441 -0.0668 -0.0753 0.0332  31  ALA A O   
215  C CB  . ALA A 30  ? 0.1902 0.3548 0.2222 -0.0645 -0.0661 0.0377  31  ALA A CB  
216  N N   . PHE A 31  ? 0.2588 0.3661 0.2583 -0.0611 -0.0699 0.0316  32  PHE A N   
217  C CA  . PHE A 31  ? 0.2772 0.3750 0.2703 -0.0525 -0.0700 0.0297  32  PHE A CA  
218  C C   . PHE A 31  ? 0.3073 0.4043 0.3085 -0.0408 -0.0649 0.0321  32  PHE A C   
219  O O   . PHE A 31  ? 0.2999 0.3820 0.2977 -0.0383 -0.0625 0.0313  32  PHE A O   
220  C CB  . PHE A 31  ? 0.2752 0.3471 0.2506 -0.0558 -0.0723 0.0247  32  PHE A CB  
221  C CG  . PHE A 31  ? 0.3086 0.3769 0.2741 -0.0693 -0.0782 0.0218  32  PHE A CG  
222  C CD1 . PHE A 31  ? 0.3152 0.3786 0.2787 -0.0815 -0.0800 0.0230  32  PHE A CD1 
223  C CD2 . PHE A 31  ? 0.3584 0.4291 0.3161 -0.0709 -0.0823 0.0184  32  PHE A CD2 
224  C CE1 . PHE A 31  ? 0.4000 0.4599 0.3543 -0.0962 -0.0861 0.0210  32  PHE A CE1 
225  C CE2 . PHE A 31  ? 0.4438 0.5109 0.3919 -0.0847 -0.0886 0.0153  32  PHE A CE2 
226  C CZ  . PHE A 31  ? 0.4428 0.5040 0.3894 -0.0979 -0.0906 0.0167  32  PHE A CZ  
227  N N   . LEU A 32  ? 0.2406 0.3534 0.2522 -0.0341 -0.0641 0.0353  33  LEU A N   
228  C CA  . LEU A 32  ? 0.2424 0.3555 0.2627 -0.0249 -0.0602 0.0381  33  LEU A CA  
229  C C   . LEU A 32  ? 0.2471 0.3561 0.2639 -0.0181 -0.0595 0.0395  33  LEU A C   
230  O O   . LEU A 32  ? 0.2911 0.4072 0.3047 -0.0182 -0.0621 0.0404  33  LEU A O   
231  C CB  . LEU A 32  ? 0.2203 0.3519 0.2543 -0.0218 -0.0603 0.0410  33  LEU A CB  
232  C CG  . LEU A 32  ? 0.2750 0.4180 0.3133 -0.0292 -0.0606 0.0398  33  LEU A CG  
233  C CD1 . LEU A 32  ? 0.2705 0.4346 0.3228 -0.0237 -0.0605 0.0416  33  LEU A CD1 
234  C CD2 . LEU A 32  ? 0.1698 0.3001 0.2045 -0.0323 -0.0576 0.0383  33  LEU A CD2 
235  N N   . GLY A 33  ? 0.2816 0.3812 0.2987 -0.0129 -0.0561 0.0399  34  GLY A N   
236  C CA  . GLY A 33  ? 0.2562 0.3552 0.2708 -0.0077 -0.0548 0.0421  34  GLY A CA  
237  C C   . GLY A 33  ? 0.3271 0.4188 0.3282 -0.0081 -0.0550 0.0379  34  GLY A C   
238  O O   . GLY A 33  ? 0.2909 0.3885 0.2871 -0.0067 -0.0557 0.0391  34  GLY A O   
239  N N   . ILE A 34  ? 0.3411 0.4196 0.3352 -0.0095 -0.0548 0.0330  35  ILE A N   
240  C CA  . ILE A 34  ? 0.2785 0.3473 0.2592 -0.0074 -0.0550 0.0277  35  ILE A CA  
241  C C   . ILE A 34  ? 0.2929 0.3617 0.2747 0.0007  -0.0506 0.0282  35  ILE A C   
242  O O   . ILE A 34  ? 0.3279 0.3923 0.3153 0.0032  -0.0488 0.0289  35  ILE A O   
243  C CB  . ILE A 34  ? 0.2785 0.3298 0.2497 -0.0115 -0.0575 0.0223  35  ILE A CB  
244  C CG1 . ILE A 34  ? 0.2877 0.3414 0.2587 -0.0218 -0.0617 0.0225  35  ILE A CG1 
245  C CG2 . ILE A 34  ? 0.2690 0.3077 0.2247 -0.0073 -0.0583 0.0154  35  ILE A CG2 
246  C CD1 . ILE A 34  ? 0.2387 0.2738 0.2005 -0.0287 -0.0647 0.0192  35  ILE A CD1 
247  N N   . PRO A 35  ? 0.3004 0.3765 0.2769 0.0045  -0.0491 0.0278  36  PRO A N   
248  C CA  . PRO A 35  ? 0.2978 0.3788 0.2764 0.0114  -0.0445 0.0287  36  PRO A CA  
249  C C   . PRO A 35  ? 0.3760 0.4441 0.3474 0.0168  -0.0441 0.0217  36  PRO A C   
250  O O   . PRO A 35  ? 0.3734 0.4300 0.3317 0.0173  -0.0466 0.0149  36  PRO A O   
251  C CB  . PRO A 35  ? 0.2486 0.3416 0.2203 0.0131  -0.0431 0.0293  36  PRO A CB  
252  C CG  . PRO A 35  ? 0.2726 0.3595 0.2325 0.0092  -0.0476 0.0242  36  PRO A CG  
253  C CD  . PRO A 35  ? 0.2546 0.3358 0.2214 0.0024  -0.0514 0.0261  36  PRO A CD  
254  N N   . PHE A 36  ? 0.3166 0.3854 0.2958 0.0209  -0.0417 0.0232  37  PHE A N   
255  C CA  . PHE A 36  ? 0.3052 0.3623 0.2775 0.0281  -0.0418 0.0171  37  PHE A CA  
256  C C   . PHE A 36  ? 0.3239 0.3948 0.2999 0.0370  -0.0373 0.0167  37  PHE A C   
257  O O   . PHE A 36  ? 0.3709 0.4356 0.3407 0.0457  -0.0372 0.0109  37  PHE A O   
258  C CB  . PHE A 36  ? 0.3013 0.3442 0.2763 0.0256  -0.0446 0.0177  37  PHE A CB  
259  C CG  . PHE A 36  ? 0.3188 0.3711 0.3079 0.0251  -0.0426 0.0235  37  PHE A CG  
260  C CD1 . PHE A 36  ? 0.2423 0.2999 0.2403 0.0179  -0.0429 0.0287  37  PHE A CD1 
261  C CD2 . PHE A 36  ? 0.3061 0.3621 0.2993 0.0322  -0.0410 0.0232  37  PHE A CD2 
262  C CE1 . PHE A 36  ? 0.2803 0.3441 0.2896 0.0172  -0.0417 0.0328  37  PHE A CE1 
263  C CE2 . PHE A 36  ? 0.2979 0.3623 0.3033 0.0305  -0.0400 0.0280  37  PHE A CE2 
264  C CZ  . PHE A 36  ? 0.2984 0.3652 0.3111 0.0227  -0.0404 0.0325  37  PHE A CZ  
265  N N   . ALA A 37  ? 0.2943 0.3843 0.2802 0.0347  -0.0339 0.0233  38  ALA A N   
266  C CA  . ALA A 37  ? 0.2538 0.3622 0.2436 0.0408  -0.0292 0.0241  38  ALA A CA  
267  C C   . ALA A 37  ? 0.3283 0.4543 0.3181 0.0370  -0.0262 0.0291  38  ALA A C   
268  O O   . ALA A 37  ? 0.3625 0.4860 0.3520 0.0299  -0.0283 0.0335  38  ALA A O   
269  C CB  . ALA A 37  ? 0.2091 0.3244 0.2128 0.0402  -0.0282 0.0288  38  ALA A CB  
270  N N   . GLU A 38  ? 0.3006 0.4456 0.2902 0.0422  -0.0213 0.0288  39  GLU A N   
271  C CA  . GLU A 38  ? 0.3796 0.5438 0.3709 0.0369  -0.0181 0.0363  39  GLU A CA  
272  C C   . GLU A 38  ? 0.3962 0.5633 0.4016 0.0283  -0.0188 0.0465  39  GLU A C   
273  O O   . GLU A 38  ? 0.3790 0.5432 0.3937 0.0289  -0.0195 0.0465  39  GLU A O   
274  C CB  . GLU A 38  ? 0.3705 0.5582 0.3598 0.0437  -0.0120 0.0342  39  GLU A CB  
275  C CG  . GLU A 38  ? 0.5128 0.6981 0.4855 0.0528  -0.0111 0.0234  39  GLU A CG  
276  C CD  . GLU A 38  ? 0.6180 0.7983 0.5788 0.0471  -0.0134 0.0242  39  GLU A CD  
277  O OE1 . GLU A 38  ? 0.7037 0.8963 0.6676 0.0389  -0.0123 0.0343  39  GLU A OE1 
278  O OE2 . GLU A 38  ? 0.6169 0.7803 0.5646 0.0504  -0.0169 0.0152  39  GLU A OE2 
279  N N   . PRO A 39  ? 0.4755 0.6461 0.4814 0.0205  -0.0195 0.0550  40  PRO A N   
280  C CA  . PRO A 39  ? 0.3708 0.5406 0.3884 0.0126  -0.0209 0.0643  40  PRO A CA  
281  C C   . PRO A 39  ? 0.3512 0.5380 0.3780 0.0112  -0.0171 0.0678  40  PRO A C   
282  O O   . PRO A 39  ? 0.3568 0.5640 0.3814 0.0113  -0.0126 0.0702  40  PRO A O   
283  C CB  . PRO A 39  ? 0.3199 0.4923 0.3331 0.0064  -0.0220 0.0728  40  PRO A CB  
284  C CG  . PRO A 39  ? 0.3849 0.5522 0.3857 0.0104  -0.0237 0.0666  40  PRO A CG  
285  C CD  . PRO A 39  ? 0.3983 0.5695 0.3930 0.0187  -0.0205 0.0560  40  PRO A CD  
286  N N   . PRO A 40  ? 0.3683 0.5489 0.4054 0.0095  -0.0191 0.0679  41  PRO A N   
287  C CA  . PRO A 40  ? 0.3404 0.5377 0.3877 0.0074  -0.0166 0.0706  41  PRO A CA  
288  C C   . PRO A 40  ? 0.3797 0.5838 0.4327 -0.0045 -0.0167 0.0821  41  PRO A C   
289  O O   . PRO A 40  ? 0.4055 0.6059 0.4676 -0.0107 -0.0192 0.0854  41  PRO A O   
290  C CB  . PRO A 40  ? 0.3097 0.4931 0.3633 0.0092  -0.0203 0.0663  41  PRO A CB  
291  C CG  . PRO A 40  ? 0.3699 0.5306 0.4204 0.0062  -0.0246 0.0667  41  PRO A CG  
292  C CD  . PRO A 40  ? 0.2986 0.4575 0.3381 0.0085  -0.0240 0.0659  41  PRO A CD  
293  N N   . MET A 41  ? 0.3454 0.5581 0.3917 -0.0082 -0.0146 0.0882  42  MET A N   
294  C CA  . MET A 41  ? 0.3691 0.5841 0.4178 -0.0203 -0.0156 0.1006  42  MET A CA  
295  C C   . MET A 41  ? 0.3816 0.6268 0.4322 -0.0248 -0.0097 0.1060  42  MET A C   
296  O O   . MET A 41  ? 0.4043 0.6687 0.4527 -0.0164 -0.0047 0.0993  42  MET A O   
297  C CB  . MET A 41  ? 0.4046 0.6077 0.4432 -0.0221 -0.0182 0.1057  42  MET A CB  
298  C CG  . MET A 41  ? 0.4056 0.5858 0.4409 -0.0160 -0.0229 0.0993  42  MET A CG  
299  S SD  . MET A 41  ? 1.1307 1.2974 1.1592 -0.0202 -0.0279 0.1087  42  MET A SD  
300  C CE  . MET A 41  ? 0.6838 0.8414 0.7203 -0.0314 -0.0311 0.1200  42  MET A CE  
301  N N   . GLY A 42  ? 0.3196 0.5688 0.3735 -0.0381 -0.0105 0.1181  43  GLY A N   
302  C CA  . GLY A 42  ? 0.2772 0.5573 0.3327 -0.0455 -0.0049 0.1257  43  GLY A CA  
303  C C   . GLY A 42  ? 0.3266 0.6332 0.3926 -0.0411 -0.0004 0.1195  43  GLY A C   
304  O O   . GLY A 42  ? 0.2914 0.5941 0.3683 -0.0441 -0.0034 0.1182  43  GLY A O   
305  N N   . PRO A 43  ? 0.3633 0.6980 0.4256 -0.0332 0.0066  0.1152  44  PRO A N   
306  C CA  . PRO A 43  ? 0.3108 0.6748 0.3821 -0.0251 0.0115  0.1082  44  PRO A CA  
307  C C   . PRO A 43  ? 0.3685 0.7153 0.4426 -0.0112 0.0082  0.0953  44  PRO A C   
308  O O   . PRO A 43  ? 0.3999 0.7647 0.4840 -0.0054 0.0096  0.0905  44  PRO A O   
309  C CB  . PRO A 43  ? 0.2462 0.6365 0.3077 -0.0170 0.0191  0.1050  44  PRO A CB  
310  C CG  . PRO A 43  ? 0.2815 0.6484 0.3273 -0.0170 0.0168  0.1062  44  PRO A CG  
311  C CD  . PRO A 43  ? 0.3311 0.6722 0.3791 -0.0312 0.0101  0.1173  44  PRO A CD  
312  N N   . ARG A 44  ? 0.2943 0.6080 0.3596 -0.0063 0.0035  0.0904  45  ARG A N   
313  C CA  . ARG A 44  ? 0.3078 0.6026 0.3736 0.0052  0.0000  0.0794  45  ARG A CA  
314  C C   . ARG A 44  ? 0.3454 0.6200 0.4197 -0.0010 -0.0062 0.0811  45  ARG A C   
315  O O   . ARG A 44  ? 0.2752 0.5343 0.3497 0.0070  -0.0094 0.0733  45  ARG A O   
316  C CB  . ARG A 44  ? 0.2624 0.5359 0.3140 0.0140  -0.0014 0.0719  45  ARG A CB  
317  C CG  . ARG A 44  ? 0.3467 0.6377 0.3887 0.0247  0.0041  0.0652  45  ARG A CG  
318  C CD  . ARG A 44  ? 0.5044 0.7705 0.5327 0.0335  0.0012  0.0558  45  ARG A CD  
319  N NE  . ARG A 44  ? 0.6575 0.9326 0.6720 0.0369  0.0047  0.0532  45  ARG A NE  
320  C CZ  . ARG A 44  ? 0.7404 1.0185 0.7448 0.0501  0.0070  0.0418  45  ARG A CZ  
321  N NH1 . ARG A 44  ? 0.7676 1.0390 0.7744 0.0616  0.0058  0.0327  45  ARG A NH1 
322  N NH2 . ARG A 44  ? 0.7212 1.0079 0.7120 0.0522  0.0100  0.0394  45  ARG A NH2 
323  N N   . ARG A 45  ? 0.3522 0.6262 0.4325 -0.0153 -0.0082 0.0911  46  ARG A N   
324  C CA  . ARG A 45  ? 0.3201 0.5768 0.4078 -0.0213 -0.0140 0.0919  46  ARG A CA  
325  C C   . ARG A 45  ? 0.2639 0.5393 0.3627 -0.0178 -0.0137 0.0877  46  ARG A C   
326  O O   . ARG A 45  ? 0.2133 0.5200 0.3187 -0.0189 -0.0094 0.0901  46  ARG A O   
327  C CB  . ARG A 45  ? 0.2594 0.5096 0.3494 -0.0375 -0.0168 0.1032  46  ARG A CB  
328  C CG  . ARG A 45  ? 0.2874 0.5184 0.3836 -0.0444 -0.0231 0.1034  46  ARG A CG  
329  C CD  . ARG A 45  ? 0.3067 0.5333 0.4049 -0.0610 -0.0260 0.1146  46  ARG A CD  
330  N NE  . ARG A 45  ? 0.1990 0.3996 0.2880 -0.0635 -0.0291 0.1195  46  ARG A NE  
331  C CZ  . ARG A 45  ? 0.3488 0.5385 0.4362 -0.0766 -0.0326 0.1299  46  ARG A CZ  
332  N NH1 . ARG A 45  ? 0.2506 0.4535 0.3450 -0.0903 -0.0331 0.1366  46  ARG A NH1 
333  N NH2 . ARG A 45  ? 0.2236 0.3891 0.3024 -0.0763 -0.0361 0.1340  46  ARG A NH2 
334  N N   . PHE A 46  ? 0.1912 0.4491 0.2918 -0.0133 -0.0183 0.0816  47  PHE A N   
335  C CA  . PHE A 46  ? 0.1553 0.4268 0.2650 -0.0086 -0.0196 0.0773  47  PHE A CA  
336  C C   . PHE A 46  ? 0.3039 0.5871 0.4111 0.0082  -0.0166 0.0692  47  PHE A C   
337  O O   . PHE A 46  ? 0.2703 0.5632 0.3839 0.0148  -0.0184 0.0653  47  PHE A O   
338  C CB  . PHE A 46  ? 0.1697 0.4685 0.2921 -0.0204 -0.0191 0.0842  47  PHE A CB  
339  C CG  . PHE A 46  ? 0.2061 0.4908 0.3298 -0.0377 -0.0230 0.0923  47  PHE A CG  
340  C CD1 . PHE A 46  ? 0.1960 0.4498 0.3168 -0.0404 -0.0290 0.0900  47  PHE A CD1 
341  C CD2 . PHE A 46  ? 0.1823 0.4840 0.3092 -0.0511 -0.0206 0.1023  47  PHE A CD2 
342  C CE1 . PHE A 46  ? 0.2603 0.4981 0.3811 -0.0548 -0.0332 0.0964  47  PHE A CE1 
343  C CE2 . PHE A 46  ? 0.1798 0.4640 0.3063 -0.0672 -0.0251 0.1101  47  PHE A CE2 
344  C CZ  . PHE A 46  ? 0.2233 0.4744 0.3466 -0.0683 -0.0316 0.1066  47  PHE A CZ  
345  N N   . LEU A 47  ? 0.2903 0.5716 0.3874 0.0156  -0.0128 0.0663  48  LEU A N   
346  C CA  . LEU A 47  ? 0.2587 0.5487 0.3515 0.0323  -0.0103 0.0577  48  LEU A CA  
347  C C   . LEU A 47  ? 0.2578 0.5154 0.3397 0.0411  -0.0144 0.0503  48  LEU A C   
348  O O   . LEU A 47  ? 0.2505 0.4832 0.3266 0.0347  -0.0173 0.0517  48  LEU A O   
349  C CB  . LEU A 47  ? 0.1710 0.4790 0.2573 0.0361  -0.0038 0.0573  48  LEU A CB  
350  C CG  . LEU A 47  ? 0.3753 0.7221 0.4717 0.0288  0.0015  0.0645  48  LEU A CG  
351  C CD1 . LEU A 47  ? 0.1810 0.5473 0.2691 0.0354  0.0085  0.0622  48  LEU A CD1 
352  C CD2 . LEU A 47  ? 0.2356 0.6079 0.3464 0.0332  0.0012  0.0631  48  LEU A CD2 
353  N N   . PRO A 48  ? 0.2070 0.4653 0.2862 0.0560  -0.0149 0.0427  49  PRO A N   
354  C CA  . PRO A 48  ? 0.1900 0.4166 0.2572 0.0635  -0.0191 0.0362  49  PRO A CA  
355  C C   . PRO A 48  ? 0.3123 0.5236 0.3664 0.0622  -0.0175 0.0342  49  PRO A C   
356  O O   . PRO A 48  ? 0.3634 0.5916 0.4154 0.0623  -0.0127 0.0349  49  PRO A O   
357  C CB  . PRO A 48  ? 0.2036 0.4378 0.2692 0.0809  -0.0191 0.0289  49  PRO A CB  
358  C CG  . PRO A 48  ? 0.2321 0.5030 0.3138 0.0809  -0.0167 0.0325  49  PRO A CG  
359  C CD  . PRO A 48  ? 0.2000 0.4889 0.2871 0.0665  -0.0121 0.0400  49  PRO A CD  
360  N N   . PRO A 49  ? 0.2713 0.4530 0.3165 0.0603  -0.0217 0.0321  50  PRO A N   
361  C CA  . PRO A 49  ? 0.2612 0.4298 0.2948 0.0575  -0.0211 0.0307  50  PRO A CA  
362  C C   . PRO A 49  ? 0.3230 0.4927 0.3448 0.0696  -0.0191 0.0223  50  PRO A C   
363  O O   . PRO A 49  ? 0.3728 0.5369 0.3912 0.0813  -0.0206 0.0160  50  PRO A O   
364  C CB  . PRO A 49  ? 0.2065 0.3464 0.2347 0.0537  -0.0265 0.0296  50  PRO A CB  
365  C CG  . PRO A 49  ? 0.1962 0.3298 0.2263 0.0611  -0.0296 0.0267  50  PRO A CG  
366  C CD  . PRO A 49  ? 0.2395 0.4005 0.2835 0.0618  -0.0271 0.0304  50  PRO A CD  
367  N N   . GLU A 50  ? 0.3708 0.5469 0.3855 0.0675  -0.0160 0.0222  51  GLU A N   
368  C CA  . GLU A 50  ? 0.4093 0.5825 0.4096 0.0781  -0.0146 0.0130  51  GLU A CA  
369  C C   . GLU A 50  ? 0.3872 0.5309 0.3744 0.0742  -0.0194 0.0094  51  GLU A C   
370  O O   . GLU A 50  ? 0.3608 0.4995 0.3497 0.0626  -0.0209 0.0155  51  GLU A O   
371  C CB  . GLU A 50  ? 0.4781 0.6777 0.4766 0.0772  -0.0084 0.0147  51  GLU A CB  
372  C CG  . GLU A 50  ? 0.7212 0.9552 0.7313 0.0816  -0.0027 0.0171  51  GLU A CG  
373  C CD  . GLU A 50  ? 0.9399 1.1790 0.9470 0.0998  -0.0017 0.0066  51  GLU A CD  
374  O OE1 . GLU A 50  ? 1.0243 1.2566 1.0164 0.1100  -0.0008 -0.0031 51  GLU A OE1 
375  O OE2 . GLU A 50  ? 0.9699 1.2191 0.9890 0.1044  -0.0022 0.0077  51  GLU A OE2 
376  N N   . PRO A 51  ? 0.3979 0.5219 0.3718 0.0838  -0.0223 -0.0003 52  PRO A N   
377  C CA  . PRO A 51  ? 0.3868 0.4832 0.3468 0.0790  -0.0274 -0.0043 52  PRO A CA  
378  C C   . PRO A 51  ? 0.4279 0.5323 0.3816 0.0719  -0.0258 -0.0031 52  PRO A C   
379  O O   . PRO A 51  ? 0.3995 0.5250 0.3509 0.0762  -0.0208 -0.0044 52  PRO A O   
380  C CB  . PRO A 51  ? 0.4112 0.4896 0.3565 0.0926  -0.0298 -0.0158 52  PRO A CB  
381  C CG  . PRO A 51  ? 0.4246 0.5146 0.3795 0.1041  -0.0281 -0.0160 52  PRO A CG  
382  C CD  . PRO A 51  ? 0.3794 0.5050 0.3509 0.0997  -0.0218 -0.0079 52  PRO A CD  
383  N N   . LYS A 52  ? 0.4298 0.5202 0.3809 0.0610  -0.0299 -0.0002 53  LYS A N   
384  C CA  . LYS A 52  ? 0.4396 0.5374 0.3851 0.0541  -0.0297 0.0017  53  LYS A CA  
385  C C   . LYS A 52  ? 0.4131 0.5060 0.3399 0.0608  -0.0300 -0.0090 53  LYS A C   
386  O O   . LYS A 52  ? 0.4041 0.4733 0.3190 0.0642  -0.0344 -0.0176 53  LYS A O   
387  C CB  . LYS A 52  ? 0.3923 0.4770 0.3399 0.0425  -0.0348 0.0061  53  LYS A CB  
388  C CG  . LYS A 52  ? 0.4115 0.5011 0.3520 0.0358  -0.0365 0.0074  53  LYS A CG  
389  C CD  . LYS A 52  ? 0.3900 0.5035 0.3377 0.0336  -0.0323 0.0162  53  LYS A CD  
390  C CE  . LYS A 52  ? 0.3186 0.4360 0.2617 0.0261  -0.0355 0.0200  53  LYS A CE  
391  N NZ  . LYS A 52  ? 0.3683 0.5049 0.3188 0.0229  -0.0326 0.0310  53  LYS A NZ  
392  N N   A GLN A 53  ? 0.4183 0.5327 0.3413 0.0622  -0.0256 -0.0083 54  GLN A N   
393  N N   B GLN A 53  ? 0.4166 0.5310 0.3396 0.0623  -0.0255 -0.0084 54  GLN A N   
394  C CA  A GLN A 53  ? 0.4719 0.5848 0.3760 0.0685  -0.0254 -0.0189 54  GLN A CA  
395  C CA  B GLN A 53  ? 0.4665 0.5786 0.3705 0.0688  -0.0255 -0.0192 54  GLN A CA  
396  C C   A GLN A 53  ? 0.4545 0.5498 0.3464 0.0596  -0.0320 -0.0218 54  GLN A C   
397  C C   B GLN A 53  ? 0.4537 0.5492 0.3455 0.0598  -0.0319 -0.0218 54  GLN A C   
398  O O   A GLN A 53  ? 0.4264 0.5252 0.3255 0.0485  -0.0343 -0.0129 54  GLN A O   
399  O O   B GLN A 53  ? 0.4274 0.5273 0.3263 0.0487  -0.0340 -0.0128 54  GLN A O   
400  C CB  A GLN A 53  ? 0.5101 0.6546 0.4136 0.0708  -0.0184 -0.0158 54  GLN A CB  
401  C CB  B GLN A 53  ? 0.5200 0.6635 0.4228 0.0723  -0.0183 -0.0172 54  GLN A CB  
402  C CG  A GLN A 53  ? 0.5373 0.7044 0.4535 0.0784  -0.0116 -0.0130 54  GLN A CG  
403  C CG  B GLN A 53  ? 0.5759 0.7387 0.4875 0.0833  -0.0118 -0.0180 54  GLN A CG  
404  C CD  A GLN A 53  ? 0.4993 0.7001 0.4199 0.0745  -0.0050 -0.0042 54  GLN A CD  
405  C CD  B GLN A 53  ? 0.6109 0.7575 0.5134 0.0985  -0.0131 -0.0318 54  GLN A CD  
406  O OE1 A GLN A 53  ? 0.4449 0.6525 0.3558 0.0689  -0.0050 -0.0019 54  GLN A OE1 
407  O OE1 B GLN A 53  ? 0.6726 0.8139 0.5575 0.1069  -0.0132 -0.0435 54  GLN A OE1 
408  N NE2 A GLN A 53  ? 0.5134 0.7362 0.4484 0.0765  0.0003  0.0014  54  GLN A NE2 
409  N NE2 B GLN A 53  ? 0.5890 0.7260 0.5023 0.1024  -0.0148 -0.0306 54  GLN A NE2 
410  N N   . PRO A 54  ? 0.5178 0.5942 0.3910 0.0649  -0.0355 -0.0346 55  PRO A N   
411  C CA  . PRO A 54  ? 0.5352 0.5949 0.3956 0.0554  -0.0425 -0.0384 55  PRO A CA  
412  C C   . PRO A 54  ? 0.5109 0.5928 0.3706 0.0477  -0.0417 -0.0320 55  PRO A C   
413  O O   . PRO A 54  ? 0.4264 0.5327 0.2871 0.0524  -0.0354 -0.0290 55  PRO A O   
414  C CB  . PRO A 54  ? 0.5870 0.6280 0.4253 0.0652  -0.0447 -0.0544 55  PRO A CB  
415  C CG  . PRO A 54  ? 0.5980 0.6353 0.4406 0.0796  -0.0411 -0.0583 55  PRO A CG  
416  C CD  . PRO A 54  ? 0.5355 0.6049 0.3984 0.0805  -0.0335 -0.0466 55  PRO A CD  
417  N N   . TRP A 55  ? 0.4794 0.5542 0.3380 0.0359  -0.0480 -0.0291 56  TRP A N   
418  C CA  . TRP A 55  ? 0.4162 0.5103 0.2742 0.0286  -0.0489 -0.0222 56  TRP A CA  
419  C C   . TRP A 55  ? 0.4132 0.4957 0.2530 0.0227  -0.0562 -0.0310 56  TRP A C   
420  O O   . TRP A 55  ? 0.4171 0.4748 0.2498 0.0199  -0.0617 -0.0390 56  TRP A O   
421  C CB  . TRP A 55  ? 0.3506 0.4523 0.2279 0.0198  -0.0503 -0.0084 56  TRP A CB  
422  C CG  . TRP A 55  ? 0.4395 0.5224 0.3215 0.0121  -0.0564 -0.0093 56  TRP A CG  
423  C CD1 . TRP A 55  ? 0.3818 0.4605 0.2588 0.0024  -0.0635 -0.0105 56  TRP A CD1 
424  C CD2 . TRP A 55  ? 0.3859 0.4541 0.2778 0.0127  -0.0561 -0.0087 56  TRP A CD2 
425  N NE1 . TRP A 55  ? 0.4453 0.5088 0.3291 -0.0036 -0.0669 -0.0104 56  TRP A NE1 
426  C CE2 . TRP A 55  ? 0.4038 0.4599 0.2961 0.0027  -0.0625 -0.0092 56  TRP A CE2 
427  C CE3 . TRP A 55  ? 0.4503 0.5165 0.3508 0.0204  -0.0511 -0.0075 56  TRP A CE3 
428  C CZ2 . TRP A 55  ? 0.4162 0.4575 0.3160 0.0000  -0.0637 -0.0081 56  TRP A CZ2 
429  C CZ3 . TRP A 55  ? 0.4308 0.4813 0.3386 0.0183  -0.0530 -0.0067 56  TRP A CZ3 
430  C CH2 . TRP A 55  ? 0.3980 0.4359 0.3048 0.0081  -0.0589 -0.0068 56  TRP A CH2 
431  N N   . SER A 56  ? 0.4535 0.5535 0.2850 0.0200  -0.0568 -0.0293 57  SER A N   
432  C CA  . SER A 56  ? 0.5015 0.5941 0.3171 0.0125  -0.0647 -0.0363 57  SER A CA  
433  C C   . SER A 56  ? 0.4631 0.5631 0.2922 0.0006  -0.0701 -0.0253 57  SER A C   
434  O O   . SER A 56  ? 0.5607 0.6730 0.4083 0.0002  -0.0671 -0.0129 57  SER A O   
435  C CB  . SER A 56  ? 0.4956 0.6050 0.2938 0.0161  -0.0630 -0.0405 57  SER A CB  
436  O OG  . SER A 56  ? 0.5503 0.6865 0.3583 0.0140  -0.0598 -0.0263 57  SER A OG  
437  N N   . GLY A 57  ? 0.5096 0.6027 0.3297 -0.0089 -0.0785 -0.0302 58  GLY A N   
438  C CA  . GLY A 57  ? 0.5227 0.6265 0.3563 -0.0193 -0.0839 -0.0205 58  GLY A CA  
439  C C   . GLY A 57  ? 0.4690 0.5631 0.3209 -0.0227 -0.0837 -0.0156 58  GLY A C   
440  O O   . GLY A 57  ? 0.5321 0.6064 0.3832 -0.0192 -0.0813 -0.0209 58  GLY A O   
441  N N   . VAL A 58  ? 0.3866 0.4953 0.2543 -0.0287 -0.0864 -0.0055 59  VAL A N   
442  C CA  . VAL A 58  ? 0.4366 0.5399 0.3210 -0.0330 -0.0867 -0.0011 59  VAL A CA  
443  C C   . VAL A 58  ? 0.4225 0.5382 0.3265 -0.0272 -0.0814 0.0104  59  VAL A C   
444  O O   . VAL A 58  ? 0.3370 0.4712 0.2473 -0.0258 -0.0821 0.0188  59  VAL A O   
445  C CB  . VAL A 58  ? 0.4091 0.5202 0.2975 -0.0451 -0.0945 -0.0001 59  VAL A CB  
446  C CG1 . VAL A 58  ? 0.4220 0.5237 0.3225 -0.0506 -0.0944 0.0013  59  VAL A CG1 
447  C CG2 . VAL A 58  ? 0.3505 0.4534 0.2184 -0.0527 -0.1014 -0.0105 59  VAL A CG2 
448  N N   . VAL A 59  ? 0.3681 0.4720 0.2805 -0.0239 -0.0769 0.0108  60  VAL A N   
449  C CA  . VAL A 59  ? 0.3738 0.4858 0.3047 -0.0199 -0.0728 0.0203  60  VAL A CA  
450  C C   . VAL A 59  ? 0.4099 0.5275 0.3542 -0.0264 -0.0763 0.0242  60  VAL A C   
451  O O   . VAL A 59  ? 0.4598 0.5669 0.4031 -0.0328 -0.0784 0.0197  60  VAL A O   
452  C CB  . VAL A 59  ? 0.3509 0.4498 0.2847 -0.0136 -0.0669 0.0187  60  VAL A CB  
453  C CG1 . VAL A 59  ? 0.2751 0.3786 0.2275 -0.0123 -0.0642 0.0267  60  VAL A CG1 
454  C CG2 . VAL A 59  ? 0.3452 0.4472 0.2709 -0.0057 -0.0621 0.0173  60  VAL A CG2 
455  N N   . ASP A 60  ? 0.3527 0.4872 0.3091 -0.0244 -0.0771 0.0328  61  ASP A N   
456  C CA  . ASP A 60  ? 0.3262 0.4700 0.2976 -0.0276 -0.0793 0.0366  61  ASP A CA  
457  C C   . ASP A 60  ? 0.3402 0.4756 0.3226 -0.0242 -0.0743 0.0381  61  ASP A C   
458  O O   . ASP A 60  ? 0.2912 0.4277 0.2808 -0.0172 -0.0708 0.0436  61  ASP A O   
459  C CB  . ASP A 60  ? 0.5058 0.6686 0.4858 -0.0238 -0.0821 0.0449  61  ASP A CB  
460  C CG  . ASP A 60  ? 0.7478 0.9255 0.7233 -0.0297 -0.0893 0.0440  61  ASP A CG  
461  O OD1 . ASP A 60  ? 0.8002 0.9768 0.7607 -0.0316 -0.0914 0.0408  61  ASP A OD1 
462  O OD2 . ASP A 60  ? 0.8971 1.0897 0.8841 -0.0323 -0.0929 0.0461  61  ASP A OD2 
463  N N   . ALA A 61  ? 0.2913 0.4177 0.2738 -0.0300 -0.0743 0.0337  62  ALA A N   
464  C CA  . ALA A 61  ? 0.2654 0.3859 0.2576 -0.0277 -0.0702 0.0351  62  ALA A CA  
465  C C   . ALA A 61  ? 0.2778 0.4139 0.2831 -0.0310 -0.0719 0.0379  62  ALA A C   
466  O O   . ALA A 61  ? 0.2660 0.4004 0.2723 -0.0382 -0.0723 0.0356  62  ALA A O   
467  C CB  . ALA A 61  ? 0.3210 0.4215 0.3039 -0.0313 -0.0691 0.0294  62  ALA A CB  
468  N N   . THR A 62  ? 0.2553 0.4068 0.2703 -0.0252 -0.0729 0.0432  63  THR A N   
469  C CA  . THR A 62  ? 0.2147 0.3857 0.2422 -0.0261 -0.0752 0.0453  63  THR A CA  
470  C C   . THR A 62  ? 0.2396 0.4146 0.2805 -0.0173 -0.0722 0.0487  63  THR A C   
471  O O   . THR A 62  ? 0.2647 0.4576 0.3168 -0.0151 -0.0738 0.0500  63  THR A O   
472  C CB  . THR A 62  ? 0.2661 0.4542 0.2938 -0.0255 -0.0807 0.0482  63  THR A CB  
473  O OG1 . THR A 62  ? 0.3389 0.5232 0.3651 -0.0166 -0.0802 0.0532  63  THR A OG1 
474  C CG2 . THR A 62  ? 0.2155 0.4018 0.2296 -0.0355 -0.0847 0.0437  63  THR A CG2 
475  N N   . THR A 63  ? 0.2439 0.4035 0.2838 -0.0118 -0.0682 0.0496  64  THR A N   
476  C CA  . THR A 63  ? 0.2289 0.3885 0.2795 -0.0037 -0.0661 0.0520  64  THR A CA  
477  C C   . THR A 63  ? 0.2080 0.3494 0.2552 -0.0020 -0.0618 0.0515  64  THR A C   
478  O O   . THR A 63  ? 0.2690 0.4007 0.3069 -0.0039 -0.0608 0.0511  64  THR A O   
479  C CB  . THR A 63  ? 0.3033 0.4703 0.3591 0.0046  -0.0694 0.0579  64  THR A CB  
480  O OG1 . THR A 63  ? 0.3155 0.4849 0.3824 0.0124  -0.0688 0.0585  64  THR A OG1 
481  C CG2 . THR A 63  ? 0.3039 0.4578 0.3522 0.0070  -0.0688 0.0623  64  THR A CG2 
482  N N   . PHE A 64  ? 0.1740 0.3121 0.2286 0.0019  -0.0594 0.0509  65  PHE A N   
483  C CA  . PHE A 64  ? 0.2837 0.4068 0.3362 0.0033  -0.0561 0.0506  65  PHE A CA  
484  C C   . PHE A 64  ? 0.3010 0.4180 0.3514 0.0067  -0.0565 0.0556  65  PHE A C   
485  O O   . PHE A 64  ? 0.3630 0.4837 0.4169 0.0111  -0.0592 0.0602  65  PHE A O   
486  C CB  . PHE A 64  ? 0.3450 0.4666 0.4053 0.0070  -0.0543 0.0488  65  PHE A CB  
487  C CG  . PHE A 64  ? 0.2708 0.3979 0.3319 0.0025  -0.0526 0.0444  65  PHE A CG  
488  C CD1 . PHE A 64  ? 0.1902 0.3079 0.2441 -0.0030 -0.0507 0.0422  65  PHE A CD1 
489  C CD2 . PHE A 64  ? 0.2135 0.3560 0.2824 0.0044  -0.0530 0.0429  65  PHE A CD2 
490  C CE1 . PHE A 64  ? 0.2238 0.3454 0.2769 -0.0083 -0.0495 0.0396  65  PHE A CE1 
491  C CE2 . PHE A 64  ? 0.1649 0.3149 0.2340 -0.0011 -0.0510 0.0398  65  PHE A CE2 
492  C CZ  . PHE A 64  ? 0.2042 0.3428 0.2648 -0.0082 -0.0494 0.0387  65  PHE A CZ  
493  N N   . GLN A 65  ? 0.3109 0.4192 0.3554 0.0049  -0.0539 0.0552  66  GLN A N   
494  C CA  . GLN A 65  ? 0.3025 0.4074 0.3448 0.0064  -0.0533 0.0603  66  GLN A CA  
495  C C   . GLN A 65  ? 0.2583 0.3556 0.3072 0.0087  -0.0525 0.0628  66  GLN A C   
496  O O   . GLN A 65  ? 0.2232 0.3177 0.2778 0.0102  -0.0525 0.0597  66  GLN A O   
497  C CB  . GLN A 65  ? 0.3104 0.4133 0.3440 0.0042  -0.0507 0.0580  66  GLN A CB  
498  C CG  . GLN A 65  ? 0.3483 0.4577 0.3733 0.0034  -0.0519 0.0596  66  GLN A CG  
499  C CD  . GLN A 65  ? 0.3418 0.4543 0.3671 0.0046  -0.0522 0.0677  66  GLN A CD  
500  O OE1 . GLN A 65  ? 0.4005 0.5085 0.4328 0.0057  -0.0522 0.0721  66  GLN A OE1 
501  N NE2 . GLN A 65  ? 0.2319 0.3512 0.2484 0.0039  -0.0527 0.0698  66  GLN A NE2 
502  N N   . SER A 66  ? 0.2680 0.3624 0.3155 0.0080  -0.0520 0.0683  67  SER A N   
503  C CA  . SER A 66  ? 0.3031 0.3886 0.3559 0.0084  -0.0525 0.0713  67  SER A CA  
504  C C   . SER A 66  ? 0.2661 0.3469 0.3223 0.0073  -0.0503 0.0660  67  SER A C   
505  O O   . SER A 66  ? 0.2849 0.3687 0.3383 0.0060  -0.0477 0.0618  67  SER A O   
506  C CB  . SER A 66  ? 0.2885 0.3732 0.3384 0.0053  -0.0524 0.0793  67  SER A CB  
507  O OG  . SER A 66  ? 0.3622 0.4501 0.4083 0.0064  -0.0552 0.0854  67  SER A OG  
508  N N   . VAL A 67  ? 0.2801 0.3522 0.3412 0.0083  -0.0519 0.0661  68  VAL A N   
509  C CA  . VAL A 67  ? 0.2902 0.3578 0.3540 0.0068  -0.0506 0.0618  68  VAL A CA  
510  C C   . VAL A 67  ? 0.3116 0.3790 0.3752 0.0019  -0.0495 0.0659  68  VAL A C   
511  O O   . VAL A 67  ? 0.3238 0.3892 0.3869 -0.0007 -0.0508 0.0728  68  VAL A O   
512  C CB  . VAL A 67  ? 0.3260 0.3840 0.3938 0.0101  -0.0533 0.0594  68  VAL A CB  
513  C CG1 . VAL A 67  ? 0.3051 0.3572 0.3744 0.0073  -0.0529 0.0557  68  VAL A CG1 
514  C CG2 . VAL A 67  ? 0.3139 0.3776 0.3832 0.0153  -0.0534 0.0544  68  VAL A CG2 
515  N N   . CYS A 68  ? 0.1905 0.2617 0.2545 0.0002  -0.0472 0.0623  69  CYS A N   
516  C CA  . CYS A 68  ? 0.1987 0.2744 0.2643 -0.0043 -0.0460 0.0658  69  CYS A CA  
517  C C   . CYS A 68  ? 0.2490 0.3153 0.3185 -0.0087 -0.0491 0.0690  69  CYS A C   
518  O O   . CYS A 68  ? 0.2928 0.3487 0.3638 -0.0072 -0.0516 0.0649  69  CYS A O   
519  C CB  . CYS A 68  ? 0.2868 0.3688 0.3528 -0.0034 -0.0440 0.0609  69  CYS A CB  
520  S SG  . CYS A 68  ? 0.4357 0.5250 0.4948 0.0013  -0.0411 0.0577  69  CYS A SG  
521  N N   . TYR A 69  ? 0.1976 0.2671 0.2678 -0.0147 -0.0491 0.0764  70  TYR A N   
522  C CA  . TYR A 69  ? 0.2754 0.3330 0.3477 -0.0210 -0.0529 0.0807  70  TYR A CA  
523  C C   . TYR A 69  ? 0.2827 0.3353 0.3585 -0.0227 -0.0546 0.0744  70  TYR A C   
524  O O   . TYR A 69  ? 0.2514 0.3160 0.3296 -0.0230 -0.0523 0.0710  70  TYR A O   
525  C CB  . TYR A 69  ? 0.3341 0.4007 0.4068 -0.0297 -0.0519 0.0898  70  TYR A CB  
526  C CG  . TYR A 69  ? 0.3850 0.4377 0.4543 -0.0338 -0.0557 0.0985  70  TYR A CG  
527  C CD1 . TYR A 69  ? 0.4038 0.4364 0.4735 -0.0385 -0.0612 0.0998  70  TYR A CD1 
528  C CD2 . TYR A 69  ? 0.4032 0.4609 0.4675 -0.0326 -0.0547 0.1053  70  TYR A CD2 
529  C CE1 . TYR A 69  ? 0.5061 0.5217 0.5713 -0.0415 -0.0657 0.1083  70  TYR A CE1 
530  C CE2 . TYR A 69  ? 0.4261 0.4695 0.4861 -0.0358 -0.0591 0.1144  70  TYR A CE2 
531  C CZ  . TYR A 69  ? 0.5799 0.6012 0.6404 -0.0401 -0.0647 0.1161  70  TYR A CZ  
532  O OH  . TYR A 69  ? 0.8104 0.8137 0.8653 -0.0429 -0.0700 0.1258  70  TYR A OH  
533  N N   . GLN A 70  ? 0.1996 0.2341 0.2749 -0.0231 -0.0591 0.0726  71  GLN A N   
534  C CA  . GLN A 70  ? 0.2112 0.2402 0.2879 -0.0232 -0.0609 0.0649  71  GLN A CA  
535  C C   . GLN A 70  ? 0.3454 0.3517 0.4199 -0.0243 -0.0665 0.0634  71  GLN A C   
536  O O   . GLN A 70  ? 0.2964 0.2900 0.3682 -0.0206 -0.0688 0.0665  71  GLN A O   
537  C CB  . GLN A 70  ? 0.2072 0.2418 0.2827 -0.0146 -0.0583 0.0569  71  GLN A CB  
538  C CG  . GLN A 70  ? 0.2229 0.2500 0.2961 -0.0064 -0.0588 0.0543  71  GLN A CG  
539  C CD  . GLN A 70  ? 0.2819 0.3178 0.3541 -0.0006 -0.0558 0.0476  71  GLN A CD  
540  O OE1 . GLN A 70  ? 0.2776 0.3090 0.3489 0.0033  -0.0566 0.0410  71  GLN A OE1 
541  N NE2 . GLN A 70  ? 0.2016 0.2497 0.2729 -0.0006 -0.0525 0.0492  71  GLN A NE2 
542  N N   . TYR A 71  ? 0.3310 0.3318 0.4060 -0.0287 -0.0692 0.0583  72  TYR A N   
543  C CA  . TYR A 71  ? 0.3629 0.3401 0.4342 -0.0286 -0.0748 0.0538  72  TYR A CA  
544  C C   . TYR A 71  ? 0.4043 0.3745 0.4729 -0.0155 -0.0744 0.0466  72  TYR A C   
545  O O   . TYR A 71  ? 0.4493 0.4340 0.5188 -0.0093 -0.0701 0.0417  72  TYR A O   
546  C CB  . TYR A 71  ? 0.3930 0.3700 0.4646 -0.0347 -0.0772 0.0474  72  TYR A CB  
547  C CG  . TYR A 71  ? 0.4146 0.3665 0.4806 -0.0340 -0.0832 0.0401  72  TYR A CG  
548  C CD1 . TYR A 71  ? 0.4305 0.3607 0.4936 -0.0428 -0.0895 0.0445  72  TYR A CD1 
549  C CD2 . TYR A 71  ? 0.4632 0.4123 0.5256 -0.0250 -0.0828 0.0287  72  TYR A CD2 
550  C CE1 . TYR A 71  ? 0.4594 0.3628 0.5158 -0.0416 -0.0958 0.0367  72  TYR A CE1 
551  C CE2 . TYR A 71  ? 0.5595 0.4854 0.6156 -0.0230 -0.0883 0.0204  72  TYR A CE2 
552  C CZ  . TYR A 71  ? 0.5484 0.4500 0.6012 -0.0309 -0.0951 0.0241  72  TYR A CZ  
553  O OH  . TYR A 71  ? 0.6637 0.5384 0.7087 -0.0285 -0.1013 0.0151  72  TYR A OH  
554  N N   . VAL A 72  ? 0.3957 0.3441 0.4607 -0.0114 -0.0791 0.0461  73  VAL A N   
555  C CA  . VAL A 72  ? 0.3533 0.2968 0.4167 0.0021  -0.0790 0.0387  73  VAL A CA  
556  C C   . VAL A 72  ? 0.4620 0.3867 0.5207 0.0051  -0.0833 0.0282  73  VAL A C   
557  O O   . VAL A 72  ? 0.5567 0.4574 0.6112 0.0004  -0.0896 0.0295  73  VAL A O   
558  C CB  . VAL A 72  ? 0.4203 0.3543 0.4830 0.0084  -0.0815 0.0455  73  VAL A CB  
559  C CG1 . VAL A 72  ? 0.4581 0.3883 0.5203 0.0236  -0.0822 0.0372  73  VAL A CG1 
560  C CG2 . VAL A 72  ? 0.3930 0.3470 0.4589 0.0063  -0.0771 0.0542  73  VAL A CG2 
561  N N   . ASP A 73  ? 0.4710 0.4060 0.5291 0.0123  -0.0802 0.0179  74  ASP A N   
562  C CA  . ASP A 73  ? 0.4556 0.3759 0.5080 0.0156  -0.0836 0.0062  74  ASP A CA  
563  C C   . ASP A 73  ? 0.5225 0.4180 0.5707 0.0260  -0.0888 0.0025  74  ASP A C   
564  O O   . ASP A 73  ? 0.6110 0.5109 0.6621 0.0368  -0.0874 0.0043  74  ASP A O   
565  C CB  . ASP A 73  ? 0.5432 0.4824 0.5948 0.0215  -0.0785 -0.0033 74  ASP A CB  
566  C CG  . ASP A 73  ? 0.7287 0.6559 0.7729 0.0223  -0.0817 -0.0155 74  ASP A CG  
567  O OD1 . ASP A 73  ? 0.8693 0.7946 0.9114 0.0114  -0.0840 -0.0157 74  ASP A OD1 
568  O OD2 . ASP A 73  ? 0.7477 0.6688 0.7880 0.0342  -0.0820 -0.0253 74  ASP A OD2 
569  N N   . THR A 74  ? 0.6088 0.4780 0.6501 0.0229  -0.0953 -0.0028 75  THR A N   
570  C CA  . THR A 74  ? 0.7077 0.5470 0.7430 0.0329  -0.1018 -0.0070 75  THR A CA  
571  C C   . THR A 74  ? 0.7037 0.5264 0.7304 0.0375  -0.1053 -0.0225 75  THR A C   
572  O O   . THR A 74  ? 0.7781 0.5699 0.7974 0.0447  -0.1121 -0.0278 75  THR A O   
573  C CB  . THR A 74  ? 0.7593 0.5719 0.7918 0.0227  -0.1089 0.0047  75  THR A CB  
574  O OG1 . THR A 74  ? 0.8170 0.6248 0.8476 0.0049  -0.1116 0.0065  75  THR A OG1 
575  C CG2 . THR A 74  ? 0.6569 0.4847 0.6961 0.0206  -0.1058 0.0193  75  THR A CG2 
576  N N   . LEU A 75  ? 0.6121 0.4540 0.6383 0.0337  -0.1011 -0.0298 76  LEU A N   
577  C CA  . LEU A 75  ? 0.6685 0.4988 0.6853 0.0375  -0.1038 -0.0453 76  LEU A CA  
578  C C   . LEU A 75  ? 0.6742 0.4949 0.6866 0.0579  -0.1041 -0.0571 76  LEU A C   
579  O O   . LEU A 75  ? 0.6953 0.4866 0.6977 0.0630  -0.1107 -0.0675 76  LEU A O   
580  C CB  . LEU A 75  ? 0.6417 0.5007 0.6591 0.0326  -0.0979 -0.0500 76  LEU A CB  
581  C CG  . LEU A 75  ? 0.7109 0.5628 0.7173 0.0351  -0.1002 -0.0660 76  LEU A CG  
582  C CD1 . LEU A 75  ? 0.6636 0.4842 0.6620 0.0234  -0.1098 -0.0685 76  LEU A CD1 
583  C CD2 . LEU A 75  ? 0.7163 0.5995 0.7230 0.0310  -0.0940 -0.0683 76  LEU A CD2 
584  N N   . TYR A 76  ? 0.6155 0.4616 0.6354 0.0695  -0.0973 -0.0556 77  TYR A N   
585  C CA  . TYR A 76  ? 0.6179 0.4628 0.6366 0.0903  -0.0967 -0.0657 77  TYR A CA  
586  C C   . TYR A 76  ? 0.6473 0.5022 0.6756 0.0986  -0.0952 -0.0555 77  TYR A C   
587  O O   . TYR A 76  ? 0.5976 0.4858 0.6339 0.1032  -0.0878 -0.0540 77  TYR A O   
588  C CB  . TYR A 76  ? 0.5685 0.4437 0.5866 0.0974  -0.0889 -0.0772 77  TYR A CB  
589  C CG  . TYR A 76  ? 0.6036 0.4714 0.6106 0.0927  -0.0904 -0.0896 77  TYR A CG  
590  C CD1 . TYR A 76  ? 0.6215 0.4587 0.6170 0.1012  -0.0970 -0.1032 77  TYR A CD1 
591  C CD2 . TYR A 76  ? 0.6210 0.5118 0.6277 0.0804  -0.0857 -0.0882 77  TYR A CD2 
592  C CE1 . TYR A 76  ? 0.6756 0.5066 0.6596 0.0965  -0.0988 -0.1154 77  TYR A CE1 
593  C CE2 . TYR A 76  ? 0.6451 0.5309 0.6408 0.0761  -0.0876 -0.0994 77  TYR A CE2 
594  C CZ  . TYR A 76  ? 0.6704 0.5271 0.6548 0.0837  -0.0940 -0.1132 77  TYR A CZ  
595  O OH  . TYR A 76  ? 0.6711 0.5232 0.6434 0.0790  -0.0963 -0.1251 77  TYR A OH  
596  N N   . PRO A 77  ? 0.6982 0.5240 0.7249 0.0998  -0.1027 -0.0480 78  PRO A N   
597  C CA  . PRO A 77  ? 0.6822 0.5165 0.7170 0.1065  -0.1023 -0.0369 78  PRO A CA  
598  C C   . PRO A 77  ? 0.6161 0.4705 0.6562 0.1277  -0.0989 -0.0450 78  PRO A C   
599  O O   . PRO A 77  ? 0.5863 0.4267 0.6208 0.1429  -0.1017 -0.0581 78  PRO A O   
600  C CB  . PRO A 77  ? 0.6690 0.4613 0.6971 0.1056  -0.1127 -0.0301 78  PRO A CB  
601  C CG  . PRO A 77  ? 0.6800 0.4486 0.6993 0.0895  -0.1170 -0.0325 78  PRO A CG  
602  C CD  . PRO A 77  ? 0.6556 0.4387 0.6720 0.0931  -0.1124 -0.0486 78  PRO A CD  
603  N N   . GLY A 78  ? 0.6397 0.5275 0.6902 0.1287  -0.0930 -0.0378 79  GLY A N   
604  C CA  . GLY A 78  ? 0.6295 0.5418 0.6871 0.1471  -0.0897 -0.0437 79  GLY A CA  
605  C C   . GLY A 78  ? 0.6059 0.5514 0.6658 0.1498  -0.0810 -0.0549 79  GLY A C   
606  O O   . GLY A 78  ? 0.6228 0.5972 0.6903 0.1623  -0.0768 -0.0590 79  GLY A O   
607  N N   . PHE A 79  ? 0.5536 0.4969 0.6070 0.1375  -0.0786 -0.0593 80  PHE A N   
608  C CA  . PHE A 79  ? 0.4739 0.4458 0.5266 0.1382  -0.0709 -0.0692 80  PHE A CA  
609  C C   . PHE A 79  ? 0.4681 0.4744 0.5287 0.1264  -0.0637 -0.0596 80  PHE A C   
610  O O   . PHE A 79  ? 0.5198 0.5217 0.5805 0.1108  -0.0641 -0.0493 80  PHE A O   
611  C CB  . PHE A 79  ? 0.4667 0.4202 0.5078 0.1296  -0.0725 -0.0770 80  PHE A CB  
612  C CG  . PHE A 79  ? 0.4595 0.4404 0.4975 0.1284  -0.0652 -0.0861 80  PHE A CG  
613  C CD1 . PHE A 79  ? 0.3859 0.3881 0.4246 0.1445  -0.0605 -0.0978 80  PHE A CD1 
614  C CD2 . PHE A 79  ? 0.4326 0.4193 0.4665 0.1115  -0.0630 -0.0826 80  PHE A CD2 
615  C CE1 . PHE A 79  ? 0.4510 0.4800 0.4856 0.1423  -0.0534 -0.1052 80  PHE A CE1 
616  C CE2 . PHE A 79  ? 0.4650 0.4761 0.4945 0.1099  -0.0567 -0.0896 80  PHE A CE2 
617  C CZ  . PHE A 79  ? 0.4646 0.4967 0.4939 0.1244  -0.0517 -0.1006 80  PHE A CZ  
618  N N   . GLU A 80  ? 0.4105 0.4510 0.4776 0.1339  -0.0574 -0.0631 81  GLU A N   
619  C CA  . GLU A 80  ? 0.4153 0.4872 0.4889 0.1227  -0.0512 -0.0547 81  GLU A CA  
620  C C   . GLU A 80  ? 0.4294 0.5018 0.4965 0.1054  -0.0484 -0.0518 81  GLU A C   
621  O O   . GLU A 80  ? 0.4883 0.5667 0.5581 0.0929  -0.0473 -0.0411 81  GLU A O   
622  C CB  . GLU A 80  ? 0.5307 0.6404 0.6105 0.1322  -0.0447 -0.0610 81  GLU A CB  
623  C CG  . GLU A 80  ? 0.7373 0.8720 0.8288 0.1319  -0.0432 -0.0520 81  GLU A CG  
624  C CD  . GLU A 80  ? 0.9425 1.0850 1.0344 0.1127  -0.0410 -0.0404 81  GLU A CD  
625  O OE1 . GLU A 80  ? 1.0168 1.1741 1.1047 0.1027  -0.0357 -0.0414 81  GLU A OE1 
626  O OE2 . GLU A 80  ? 1.0029 1.1360 1.0982 0.1081  -0.0447 -0.0304 81  GLU A OE2 
627  N N   . GLY A 81  ? 0.4161 0.4821 0.4742 0.1055  -0.0478 -0.0616 82  GLY A N   
628  C CA  . GLY A 81  ? 0.4253 0.4933 0.4767 0.0908  -0.0458 -0.0594 82  GLY A CA  
629  C C   . GLY A 81  ? 0.4594 0.5065 0.5101 0.0779  -0.0503 -0.0495 82  GLY A C   
630  O O   . GLY A 81  ? 0.4112 0.4651 0.4596 0.0658  -0.0484 -0.0442 82  GLY A O   
631  N N   . THR A 82  ? 0.4273 0.4497 0.4795 0.0806  -0.0564 -0.0466 83  THR A N   
632  C CA  . THR A 82  ? 0.4396 0.4455 0.4920 0.0684  -0.0602 -0.0365 83  THR A CA  
633  C C   . THR A 82  ? 0.4049 0.4152 0.4653 0.0672  -0.0604 -0.0249 83  THR A C   
634  O O   . THR A 82  ? 0.4307 0.4432 0.4926 0.0564  -0.0598 -0.0157 83  THR A O   
635  C CB  . THR A 82  ? 0.4873 0.4607 0.5338 0.0679  -0.0676 -0.0399 83  THR A CB  
636  O OG1 . THR A 82  ? 0.4998 0.4587 0.5468 0.0818  -0.0712 -0.0442 83  THR A OG1 
637  C CG2 . THR A 82  ? 0.4834 0.4525 0.5209 0.0653  -0.0681 -0.0505 83  THR A CG2 
638  N N   . GLU A 83  ? 0.4104 0.4227 0.4753 0.0793  -0.0613 -0.0258 84  GLU A N   
639  C CA  . GLU A 83  ? 0.4918 0.5080 0.5632 0.0793  -0.0623 -0.0153 84  GLU A CA  
640  C C   . GLU A 83  ? 0.4626 0.5056 0.5384 0.0717  -0.0568 -0.0094 84  GLU A C   
641  O O   . GLU A 83  ? 0.4343 0.4778 0.5124 0.0655  -0.0576 0.0003  84  GLU A O   
642  C CB  . GLU A 83  ? 0.5767 0.5920 0.6522 0.0954  -0.0651 -0.0180 84  GLU A CB  
643  C CG  . GLU A 83  ? 0.7179 0.7000 0.7877 0.1038  -0.0722 -0.0226 84  GLU A CG  
644  C CD  . GLU A 83  ? 0.7831 0.7375 0.8491 0.0934  -0.0781 -0.0124 84  GLU A CD  
645  O OE1 . GLU A 83  ? 0.7733 0.7362 0.8415 0.0808  -0.0760 -0.0025 84  GLU A OE1 
646  O OE2 . GLU A 83  ? 0.8214 0.7454 0.8818 0.0978  -0.0848 -0.0145 84  GLU A OE2 
647  N N   . MET A 84  ? 0.3931 0.4573 0.4686 0.0717  -0.0515 -0.0152 85  MET A N   
648  C CA  . MET A 84  ? 0.3301 0.4173 0.4080 0.0636  -0.0469 -0.0100 85  MET A CA  
649  C C   . MET A 84  ? 0.3181 0.3978 0.3923 0.0503  -0.0470 -0.0027 85  MET A C   
650  O O   . MET A 84  ? 0.3612 0.4525 0.4366 0.0438  -0.0449 0.0031  85  MET A O   
651  C CB  . MET A 84  ? 0.3063 0.4155 0.3827 0.0644  -0.0415 -0.0171 85  MET A CB  
652  C CG  . MET A 84  ? 0.3525 0.4538 0.4202 0.0601  -0.0406 -0.0227 85  MET A CG  
653  S SD  . MET A 84  ? 0.6117 0.7412 0.6762 0.0616  -0.0340 -0.0305 85  MET A SD  
654  C CE  . MET A 84  ? 0.3973 0.5430 0.4617 0.0470  -0.0307 -0.0199 85  MET A CE  
655  N N   . TRP A 85  ? 0.2933 0.3540 0.3629 0.0466  -0.0497 -0.0035 86  TRP A N   
656  C CA  . TRP A 85  ? 0.3030 0.3584 0.3701 0.0358  -0.0501 0.0027  86  TRP A CA  
657  C C   . TRP A 85  ? 0.3191 0.3609 0.3884 0.0331  -0.0536 0.0104  86  TRP A C   
658  O O   . TRP A 85  ? 0.2646 0.3045 0.3330 0.0253  -0.0537 0.0158  86  TRP A O   
659  C CB  . TRP A 85  ? 0.2121 0.2596 0.2734 0.0320  -0.0510 -0.0024 86  TRP A CB  
660  C CG  . TRP A 85  ? 0.3351 0.3958 0.3923 0.0344  -0.0476 -0.0098 86  TRP A CG  
661  C CD1 . TRP A 85  ? 0.3427 0.4007 0.3963 0.0410  -0.0479 -0.0197 86  TRP A CD1 
662  C CD2 . TRP A 85  ? 0.4052 0.4836 0.4602 0.0297  -0.0433 -0.0079 86  TRP A CD2 
663  N NE1 . TRP A 85  ? 0.4555 0.5318 0.5052 0.0407  -0.0434 -0.0238 86  TRP A NE1 
664  C CE2 . TRP A 85  ? 0.3973 0.4856 0.4477 0.0330  -0.0407 -0.0159 86  TRP A CE2 
665  C CE3 . TRP A 85  ? 0.3551 0.4406 0.4105 0.0228  -0.0417 -0.0002 86  TRP A CE3 
666  C CZ2 . TRP A 85  ? 0.3613 0.4670 0.4075 0.0284  -0.0365 -0.0151 86  TRP A CZ2 
667  C CZ3 . TRP A 85  ? 0.3599 0.4593 0.4108 0.0185  -0.0383 0.0002  86  TRP A CZ3 
668  C CH2 . TRP A 85  ? 0.3060 0.4158 0.3525 0.0206  -0.0357 -0.0065 86  TRP A CH2 
669  N N   . ASN A 86  ? 0.2669 0.2997 0.3387 0.0402  -0.0568 0.0111  87  ASN A N   
670  C CA  . ASN A 86  ? 0.3499 0.3690 0.4224 0.0372  -0.0605 0.0193  87  ASN A CA  
671  C C   . ASN A 86  ? 0.3440 0.3752 0.4194 0.0361  -0.0591 0.0269  87  ASN A C   
672  O O   . ASN A 86  ? 0.3284 0.3759 0.4063 0.0399  -0.0566 0.0253  87  ASN A O   
673  C CB  . ASN A 86  ? 0.3873 0.3869 0.4591 0.0451  -0.0658 0.0176  87  ASN A CB  
674  C CG  . ASN A 86  ? 0.4386 0.4188 0.5055 0.0427  -0.0690 0.0118  87  ASN A CG  
675  O OD1 . ASN A 86  ? 0.4756 0.4562 0.5406 0.0331  -0.0683 0.0120  87  ASN A OD1 
676  N ND2 . ASN A 86  ? 0.4282 0.3908 0.4927 0.0518  -0.0734 0.0063  87  ASN A ND2 
677  N N   . PRO A 87  ? 0.3976 0.4222 0.4722 0.0302  -0.0607 0.0353  88  PRO A N   
678  C CA  . PRO A 87  ? 0.3886 0.4241 0.4641 0.0287  -0.0596 0.0421  88  PRO A CA  
679  C C   . PRO A 87  ? 0.3860 0.4262 0.4643 0.0376  -0.0616 0.0428  88  PRO A C   
680  O O   . PRO A 87  ? 0.3723 0.3993 0.4510 0.0441  -0.0658 0.0431  88  PRO A O   
681  C CB  . PRO A 87  ? 0.3601 0.3853 0.4335 0.0222  -0.0617 0.0504  88  PRO A CB  
682  C CG  . PRO A 87  ? 0.3877 0.4024 0.4600 0.0169  -0.0624 0.0475  88  PRO A CG  
683  C CD  . PRO A 87  ? 0.3645 0.3726 0.4369 0.0238  -0.0637 0.0385  88  PRO A CD  
684  N N   . ASN A 88  ? 0.3329 0.3913 0.4129 0.0379  -0.0593 0.0430  89  ASN A N   
685  C CA  . ASN A 88  ? 0.3321 0.4007 0.4162 0.0458  -0.0614 0.0436  89  ASN A CA  
686  C C   . ASN A 88  ? 0.3642 0.4389 0.4465 0.0425  -0.0628 0.0516  89  ASN A C   
687  O O   . ASN A 88  ? 0.4071 0.4955 0.4924 0.0467  -0.0643 0.0527  89  ASN A O   
688  C CB  . ASN A 88  ? 0.3651 0.4538 0.4530 0.0478  -0.0580 0.0368  89  ASN A CB  
689  C CG  . ASN A 88  ? 0.4411 0.5411 0.5260 0.0378  -0.0544 0.0377  89  ASN A CG  
690  O OD1 . ASN A 88  ? 0.3182 0.4096 0.3981 0.0306  -0.0534 0.0403  89  ASN A OD1 
691  N ND2 . ASN A 88  ? 0.4446 0.5641 0.5325 0.0373  -0.0528 0.0354  89  ASN A ND2 
692  N N   . ARG A 89  ? 0.3118 0.3785 0.3891 0.0349  -0.0622 0.0568  90  ARG A N   
693  C CA  . ARG A 89  ? 0.2639 0.3337 0.3375 0.0317  -0.0635 0.0646  90  ARG A CA  
694  C C   . ARG A 89  ? 0.3757 0.4295 0.4459 0.0278  -0.0650 0.0709  90  ARG A C   
695  O O   . ARG A 89  ? 0.3074 0.3502 0.3783 0.0257  -0.0644 0.0682  90  ARG A O   
696  C CB  . ARG A 89  ? 0.2927 0.3738 0.3626 0.0247  -0.0597 0.0633  90  ARG A CB  
697  C CG  . ARG A 89  ? 0.3901 0.4867 0.4619 0.0252  -0.0589 0.0587  90  ARG A CG  
698  C CD  . ARG A 89  ? 0.5176 0.6231 0.5926 0.0313  -0.0630 0.0616  90  ARG A CD  
699  N NE  . ARG A 89  ? 0.5663 0.6896 0.6417 0.0287  -0.0630 0.0595  90  ARG A NE  
700  C CZ  . ARG A 89  ? 0.5079 0.6449 0.5892 0.0303  -0.0623 0.0545  90  ARG A CZ  
701  N NH1 . ARG A 89  ? 0.3968 0.5321 0.4837 0.0358  -0.0609 0.0502  90  ARG A NH1 
702  N NH2 . ARG A 89  ? 0.5789 0.7322 0.6601 0.0255  -0.0629 0.0535  90  ARG A NH2 
703  N N   . GLU A 90  ? 0.3560 0.4096 0.4220 0.0257  -0.0670 0.0796  91  GLU A N   
704  C CA  . GLU A 90  ? 0.4312 0.4716 0.4935 0.0201  -0.0682 0.0871  91  GLU A CA  
705  C C   . GLU A 90  ? 0.3880 0.4320 0.4494 0.0115  -0.0634 0.0856  91  GLU A C   
706  O O   . GLU A 90  ? 0.3066 0.3637 0.3673 0.0100  -0.0594 0.0813  91  GLU A O   
707  C CB  . GLU A 90  ? 0.5318 0.5740 0.5886 0.0190  -0.0710 0.0975  91  GLU A CB  
708  C CG  . GLU A 90  ? 0.6873 0.7466 0.7394 0.0139  -0.0670 0.0987  91  GLU A CG  
709  C CD  . GLU A 90  ? 0.9207 0.9818 0.9655 0.0116  -0.0694 0.1097  91  GLU A CD  
710  O OE1 . GLU A 90  ? 0.9803 1.0310 1.0242 0.0158  -0.0752 0.1163  91  GLU A OE1 
711  O OE2 . GLU A 90  ? 0.9859 1.0587 1.0251 0.0062  -0.0658 0.1117  91  GLU A OE2 
712  N N   . LEU A 91  ? 0.3222 0.3542 0.3835 0.0060  -0.0645 0.0892  92  LEU A N   
713  C CA  . LEU A 91  ? 0.2902 0.3280 0.3522 -0.0017 -0.0606 0.0883  92  LEU A CA  
714  C C   . LEU A 91  ? 0.3717 0.4221 0.4295 -0.0071 -0.0578 0.0955  92  LEU A C   
715  O O   . LEU A 91  ? 0.4164 0.4640 0.4701 -0.0092 -0.0602 0.1045  92  LEU A O   
716  C CB  . LEU A 91  ? 0.2649 0.2872 0.3284 -0.0073 -0.0635 0.0901  92  LEU A CB  
717  C CG  . LEU A 91  ? 0.3200 0.3273 0.3860 -0.0023 -0.0666 0.0824  92  LEU A CG  
718  C CD1 . LEU A 91  ? 0.2981 0.2900 0.3640 -0.0103 -0.0699 0.0843  92  LEU A CD1 
719  C CD2 . LEU A 91  ? 0.3468 0.3653 0.4155 0.0013  -0.0628 0.0723  92  LEU A CD2 
720  N N   . SER A 92  ? 0.3245 0.3890 0.3825 -0.0089 -0.0530 0.0916  93  SER A N   
721  C CA  . SER A 92  ? 0.2623 0.3412 0.3162 -0.0128 -0.0496 0.0968  93  SER A CA  
722  C C   . SER A 92  ? 0.2571 0.3485 0.3133 -0.0144 -0.0450 0.0921  93  SER A C   
723  O O   . SER A 92  ? 0.2961 0.3860 0.3550 -0.0108 -0.0443 0.0840  93  SER A O   
724  C CB  . SER A 92  ? 0.1925 0.2788 0.2401 -0.0082 -0.0493 0.0965  93  SER A CB  
725  O OG  . SER A 92  ? 0.2580 0.3592 0.3002 -0.0110 -0.0455 0.0997  93  SER A OG  
726  N N   . GLU A 93  ? 0.2833 0.3882 0.3382 -0.0193 -0.0418 0.0974  94  GLU A N   
727  C CA  . GLU A 93  ? 0.3074 0.4278 0.3644 -0.0183 -0.0373 0.0926  94  GLU A CA  
728  C C   . GLU A 93  ? 0.3301 0.4573 0.3805 -0.0108 -0.0347 0.0862  94  GLU A C   
729  O O   . GLU A 93  ? 0.3990 0.5324 0.4499 -0.0064 -0.0323 0.0794  94  GLU A O   
730  C CB  . GLU A 93  ? 0.2682 0.4046 0.3271 -0.0258 -0.0344 0.1000  94  GLU A CB  
731  C CG  . GLU A 93  ? 0.3341 0.4658 0.4007 -0.0343 -0.0369 0.1037  94  GLU A CG  
732  C CD  . GLU A 93  ? 0.4480 0.6002 0.5176 -0.0435 -0.0337 0.1115  94  GLU A CD  
733  O OE1 . GLU A 93  ? 0.3340 0.5052 0.4091 -0.0420 -0.0302 0.1074  94  GLU A OE1 
734  O OE2 . GLU A 93  ? 0.4977 0.6480 0.5640 -0.0520 -0.0349 0.1220  94  GLU A OE2 
735  N N   . ASP A 94  ? 0.2611 0.3859 0.3047 -0.0093 -0.0360 0.0884  95  ASP A N   
736  C CA  . ASP A 94  ? 0.2860 0.4135 0.3219 -0.0035 -0.0351 0.0818  95  ASP A CA  
737  C C   . ASP A 94  ? 0.3091 0.4235 0.3468 -0.0003 -0.0383 0.0756  95  ASP A C   
738  O O   . ASP A 94  ? 0.2538 0.3625 0.2908 0.0001  -0.0417 0.0772  95  ASP A O   
739  C CB  . ASP A 94  ? 0.1864 0.3192 0.2141 -0.0046 -0.0358 0.0875  95  ASP A CB  
740  C CG  . ASP A 94  ? 0.3474 0.4816 0.3661 0.0000  -0.0361 0.0806  95  ASP A CG  
741  O OD1 . ASP A 94  ? 0.3691 0.4994 0.3871 0.0037  -0.0355 0.0717  95  ASP A OD1 
742  O OD2 . ASP A 94  ? 0.3795 0.5180 0.3910 -0.0007 -0.0377 0.0845  95  ASP A OD2 
743  N N   . CYS A 95  ? 0.2583 0.3698 0.2987 0.0020  -0.0373 0.0689  96  CYS A N   
744  C CA  . CYS A 95  ? 0.2241 0.3249 0.2669 0.0034  -0.0398 0.0640  96  CYS A CA  
745  C C   . CYS A 95  ? 0.2332 0.3316 0.2717 0.0065  -0.0389 0.0565  96  CYS A C   
746  O O   . CYS A 95  ? 0.2436 0.3346 0.2836 0.0066  -0.0404 0.0530  96  CYS A O   
747  C CB  . CYS A 95  ? 0.2241 0.3190 0.2751 0.0014  -0.0410 0.0652  96  CYS A CB  
748  S SG  . CYS A 95  ? 0.3149 0.4165 0.3702 0.0003  -0.0385 0.0641  96  CYS A SG  
749  N N   . LEU A 96  ? 0.2125 0.3165 0.2448 0.0093  -0.0366 0.0540  97  LEU A N   
750  C CA  . LEU A 96  ? 0.2076 0.3053 0.2345 0.0131  -0.0366 0.0470  97  LEU A CA  
751  C C   . LEU A 96  ? 0.2292 0.3190 0.2467 0.0127  -0.0388 0.0428  97  LEU A C   
752  O O   . LEU A 96  ? 0.2359 0.3257 0.2439 0.0153  -0.0384 0.0390  97  LEU A O   
753  C CB  . LEU A 96  ? 0.1841 0.2901 0.2093 0.0183  -0.0335 0.0449  97  LEU A CB  
754  C CG  . LEU A 96  ? 0.2647 0.3790 0.3003 0.0177  -0.0322 0.0482  97  LEU A CG  
755  C CD1 . LEU A 96  ? 0.1976 0.3244 0.2329 0.0239  -0.0292 0.0457  97  LEU A CD1 
756  C CD2 . LEU A 96  ? 0.2618 0.3656 0.3018 0.0164  -0.0349 0.0468  97  LEU A CD2 
757  N N   . TYR A 97  ? 0.2268 0.3108 0.2471 0.0091  -0.0414 0.0430  98  TYR A N   
758  C CA  . TYR A 97  ? 0.2833 0.3621 0.2967 0.0063  -0.0440 0.0398  98  TYR A CA  
759  C C   . TYR A 97  ? 0.2420 0.3120 0.2560 0.0036  -0.0455 0.0375  98  TYR A C   
760  O O   . TYR A 97  ? 0.2702 0.3403 0.2916 0.0038  -0.0447 0.0390  98  TYR A O   
761  C CB  . TYR A 97  ? 0.2330 0.3196 0.2497 0.0035  -0.0458 0.0437  98  TYR A CB  
762  C CG  . TYR A 97  ? 0.2718 0.3670 0.2867 0.0051  -0.0447 0.0477  98  TYR A CG  
763  C CD1 . TYR A 97  ? 0.2173 0.3171 0.2391 0.0060  -0.0429 0.0534  98  TYR A CD1 
764  C CD2 . TYR A 97  ? 0.3437 0.4425 0.3489 0.0046  -0.0459 0.0461  98  TYR A CD2 
765  C CE1 . TYR A 97  ? 0.2463 0.3544 0.2655 0.0060  -0.0419 0.0586  98  TYR A CE1 
766  C CE2 . TYR A 97  ? 0.2792 0.3873 0.2814 0.0056  -0.0448 0.0505  98  TYR A CE2 
767  C CZ  . TYR A 97  ? 0.3388 0.4518 0.3481 0.0061  -0.0426 0.0572  98  TYR A CZ  
768  O OH  . TYR A 97  ? 0.3509 0.4736 0.3563 0.0057  -0.0414 0.0629  98  TYR A OH  
769  N N   . LEU A 98  ? 0.2543 0.3165 0.2596 0.0003  -0.0478 0.0338  99  LEU A N   
770  C CA  . LEU A 98  ? 0.2910 0.3457 0.2954 -0.0042 -0.0493 0.0328  99  LEU A CA  
771  C C   . LEU A 98  ? 0.2579 0.3162 0.2606 -0.0117 -0.0520 0.0326  99  LEU A C   
772  O O   . LEU A 98  ? 0.2587 0.3232 0.2594 -0.0127 -0.0533 0.0324  99  LEU A O   
773  C CB  . LEU A 98  ? 0.2080 0.2468 0.2027 -0.0021 -0.0503 0.0295  99  LEU A CB  
774  C CG  . LEU A 98  ? 0.2805 0.3085 0.2618 -0.0004 -0.0522 0.0247  99  LEU A CG  
775  C CD1 . LEU A 98  ? 0.2211 0.2432 0.1948 -0.0096 -0.0560 0.0230  99  LEU A CD1 
776  C CD2 . LEU A 98  ? 0.2228 0.2352 0.1963 0.0058  -0.0530 0.0216  99  LEU A CD2 
777  N N   . ASN A 99  ? 0.2344 0.2908 0.2379 -0.0174 -0.0528 0.0329  100 ASN A N   
778  C CA  . ASN A 99  ? 0.2458 0.3118 0.2513 -0.0252 -0.0546 0.0335  100 ASN A CA  
779  C C   . ASN A 99  ? 0.2538 0.3080 0.2496 -0.0340 -0.0570 0.0324  100 ASN A C   
780  O O   . ASN A 99  ? 0.2623 0.3057 0.2548 -0.0336 -0.0563 0.0329  100 ASN A O   
781  C CB  . ASN A 99  ? 0.1741 0.2555 0.1926 -0.0238 -0.0525 0.0360  100 ASN A CB  
782  C CG  . ASN A 99  ? 0.2968 0.3836 0.3236 -0.0152 -0.0507 0.0378  100 ASN A CG  
783  O OD1 . ASN A 99  ? 0.2795 0.3730 0.3082 -0.0129 -0.0518 0.0392  100 ASN A OD1 
784  N ND2 . ASN A 99  ? 0.2154 0.2986 0.2463 -0.0112 -0.0485 0.0382  100 ASN A ND2 
785  N N   . VAL A 100 ? 0.2226 0.2782 0.2131 -0.0426 -0.0604 0.0313  101 VAL A N   
786  C CA  . VAL A 100 ? 0.2326 0.2760 0.2131 -0.0537 -0.0634 0.0312  101 VAL A CA  
787  C C   . VAL A 100 ? 0.2895 0.3530 0.2765 -0.0647 -0.0644 0.0334  101 VAL A C   
788  O O   . VAL A 100 ? 0.3304 0.4095 0.3225 -0.0656 -0.0658 0.0328  101 VAL A O   
789  C CB  . VAL A 100 ? 0.2842 0.3052 0.2482 -0.0561 -0.0678 0.0270  101 VAL A CB  
790  C CG1 . VAL A 100 ? 0.2717 0.2756 0.2238 -0.0690 -0.0719 0.0277  101 VAL A CG1 
791  C CG2 . VAL A 100 ? 0.2627 0.2687 0.2217 -0.0435 -0.0663 0.0242  101 VAL A CG2 
792  N N   . TRP A 101 ? 0.2993 0.3649 0.2866 -0.0727 -0.0636 0.0363  102 TRP A N   
793  C CA  . TRP A 101 ? 0.2285 0.3147 0.2210 -0.0849 -0.0644 0.0385  102 TRP A CA  
794  C C   . TRP A 101 ? 0.3319 0.4001 0.3098 -0.1001 -0.0686 0.0398  102 TRP A C   
795  O O   . TRP A 101 ? 0.3210 0.3682 0.2892 -0.1011 -0.0687 0.0415  102 TRP A O   
796  C CB  . TRP A 101 ? 0.2531 0.3601 0.2574 -0.0832 -0.0594 0.0411  102 TRP A CB  
797  C CG  . TRP A 101 ? 0.2734 0.3996 0.2926 -0.0701 -0.0561 0.0399  102 TRP A CG  
798  C CD1 . TRP A 101 ? 0.2264 0.3800 0.2582 -0.0687 -0.0558 0.0399  102 TRP A CD1 
799  C CD2 . TRP A 101 ? 0.2119 0.3301 0.2345 -0.0566 -0.0533 0.0389  102 TRP A CD2 
800  N NE1 . TRP A 101 ? 0.2281 0.3877 0.2696 -0.0545 -0.0533 0.0389  102 TRP A NE1 
801  C CE2 . TRP A 101 ? 0.2145 0.3527 0.2505 -0.0481 -0.0517 0.0384  102 TRP A CE2 
802  C CE3 . TRP A 101 ? 0.2174 0.3141 0.2330 -0.0512 -0.0526 0.0385  102 TRP A CE3 
803  C CZ2 . TRP A 101 ? 0.1723 0.3066 0.2138 -0.0360 -0.0496 0.0376  102 TRP A CZ2 
804  C CZ3 . TRP A 101 ? 0.1885 0.2857 0.2111 -0.0396 -0.0501 0.0377  102 TRP A CZ3 
805  C CH2 . TRP A 101 ? 0.1856 0.3000 0.2204 -0.0329 -0.0487 0.0374  102 TRP A CH2 
806  N N   . THR A 102 ? 0.2970 0.3726 0.2725 -0.1125 -0.0728 0.0395  103 THR A N   
807  C CA  . THR A 102 ? 0.3273 0.3842 0.2880 -0.1296 -0.0777 0.0413  103 THR A CA  
808  C C   . THR A 102 ? 0.3430 0.4284 0.3109 -0.1462 -0.0790 0.0445  103 THR A C   
809  O O   . THR A 102 ? 0.3666 0.4828 0.3489 -0.1432 -0.0779 0.0434  103 THR A O   
810  C CB  . THR A 102 ? 0.4253 0.4516 0.3693 -0.1299 -0.0839 0.0361  103 THR A CB  
811  O OG1 . THR A 102 ? 0.5627 0.5610 0.4892 -0.1444 -0.0892 0.0378  103 THR A OG1 
812  C CG2 . THR A 102 ? 0.3079 0.3517 0.2557 -0.1337 -0.0872 0.0327  103 THR A CG2 
813  N N   . PRO A 103 ? 0.3637 0.4407 0.3222 -0.1638 -0.0814 0.0489  104 PRO A N   
814  C CA  . PRO A 103 ? 0.4285 0.5362 0.3945 -0.1817 -0.0825 0.0525  104 PRO A CA  
815  C C   . PRO A 103 ? 0.4919 0.6059 0.4572 -0.1887 -0.0888 0.0486  104 PRO A C   
816  O O   . PRO A 103 ? 0.5508 0.6346 0.5021 -0.1862 -0.0939 0.0437  104 PRO A O   
817  C CB  . PRO A 103 ? 0.4482 0.5351 0.3988 -0.2006 -0.0853 0.0585  104 PRO A CB  
818  C CG  . PRO A 103 ? 0.4411 0.5026 0.3846 -0.1878 -0.0821 0.0597  104 PRO A CG  
819  C CD  . PRO A 103 ? 0.3912 0.4362 0.3344 -0.1674 -0.0823 0.0525  104 PRO A CD  
820  N N   . TYR A 104 ? 0.5910 0.7460 0.5714 -0.1964 -0.0883 0.0503  105 TYR A N   
821  C CA  . TYR A 104 ? 0.6444 0.8092 0.6247 -0.2030 -0.0934 0.0474  105 TYR A CA  
822  C C   . TYR A 104 ? 0.6727 0.8429 0.6474 -0.2219 -0.0934 0.0521  105 TYR A C   
823  O O   . TYR A 104 ? 0.6822 0.8831 0.6682 -0.2241 -0.0873 0.0567  105 TYR A O   
824  C CB  . TYR A 104 ? 0.6820 0.8864 0.6830 -0.1885 -0.0896 0.0460  105 TYR A CB  
825  C CG  . TYR A 104 ? 0.7152 0.9287 0.7165 -0.1889 -0.0941 0.0425  105 TYR A CG  
826  C CD1 . TYR A 104 ? 0.7054 0.9314 0.7053 -0.2032 -0.0957 0.0441  105 TYR A CD1 
827  C CD2 . TYR A 104 ? 0.7206 0.9328 0.7239 -0.1748 -0.0967 0.0383  105 TYR A CD2 
828  C CE1 . TYR A 104 ? 0.6490 0.8849 0.6496 -0.2035 -0.1002 0.0408  105 TYR A CE1 
829  C CE2 . TYR A 104 ? 0.6969 0.9185 0.6998 -0.1748 -0.1009 0.0355  105 TYR A CE2 
830  C CZ  . TYR A 104 ? 0.7352 0.9686 0.7371 -0.1890 -0.1027 0.0365  105 TYR A CZ  
831  O OH  . TYR A 104 ? 0.7705 1.0138 0.7720 -0.1890 -0.1073 0.0336  105 TYR A OH  
832  N N   . PRO A 105 ? 0.7048 0.8448 0.6609 -0.2352 -0.1004 0.0506  106 PRO A N   
833  C CA  . PRO A 105 ? 0.6724 0.7758 0.6129 -0.2318 -0.1077 0.0435  106 PRO A CA  
834  C C   . PRO A 105 ? 0.6607 0.7223 0.5858 -0.2294 -0.1099 0.0431  106 PRO A C   
835  O O   . PRO A 105 ? 0.6465 0.7015 0.5691 -0.2351 -0.1070 0.0494  106 PRO A O   
836  C CB  . PRO A 105 ? 0.6234 0.7125 0.5497 -0.2486 -0.1137 0.0426  106 PRO A CB  
837  C CG  . PRO A 105 ? 0.6124 0.7080 0.5374 -0.2635 -0.1108 0.0511  106 PRO A CG  
838  C CD  . PRO A 105 ? 0.6771 0.8161 0.6244 -0.2549 -0.1018 0.0556  106 PRO A CD  
839  N N   . ARG A 106 ? 0.6619 0.6954 0.5760 -0.2179 -0.1137 0.0356  107 ARG A N   
840  C CA  . ARG A 106 ? 0.6728 0.6638 0.5717 -0.2062 -0.1131 0.0337  107 ARG A CA  
841  C C   . ARG A 106 ? 0.7504 0.7079 0.6309 -0.2239 -0.1182 0.0382  107 ARG A C   
842  O O   . ARG A 106 ? 0.8418 0.7894 0.7115 -0.2422 -0.1247 0.0383  107 ARG A O   
843  C CB  . ARG A 106 ? 0.6651 0.6321 0.5516 -0.1941 -0.1169 0.0239  107 ARG A CB  
844  C CG  . ARG A 106 ? 0.7319 0.6678 0.6094 -0.1743 -0.1142 0.0203  107 ARG A CG  
845  C CD  . ARG A 106 ? 0.8450 0.7704 0.7143 -0.1617 -0.1164 0.0104  107 ARG A CD  
846  N NE  . ARG A 106 ? 0.8825 0.8471 0.7687 -0.1560 -0.1132 0.0099  107 ARG A NE  
847  C CZ  . ARG A 106 ? 0.9420 0.9081 0.8236 -0.1482 -0.1150 0.0029  107 ARG A CZ  
848  N NH1 . ARG A 106 ? 0.9975 0.9295 0.8582 -0.1445 -0.1194 -0.0055 107 ARG A NH1 
849  N NH2 . ARG A 106 ? 0.8977 0.8994 0.7946 -0.1435 -0.1125 0.0044  107 ARG A NH2 
850  N N   . PRO A 107 ? 0.7716 0.7116 0.6484 -0.2168 -0.1146 0.0427  108 PRO A N   
851  C CA  . PRO A 107 ? 0.7870 0.6933 0.6453 -0.2326 -0.1197 0.0487  108 PRO A CA  
852  C C   . PRO A 107 ? 0.9031 0.7611 0.7362 -0.2388 -0.1300 0.0425  108 PRO A C   
853  O O   . PRO A 107 ? 0.9132 0.7576 0.7413 -0.2238 -0.1316 0.0327  108 PRO A O   
854  C CB  . PRO A 107 ? 0.6964 0.5898 0.5546 -0.2157 -0.1143 0.0519  108 PRO A CB  
855  C CG  . PRO A 107 ? 0.6657 0.6015 0.5483 -0.1992 -0.1049 0.0508  108 PRO A CG  
856  C CD  . PRO A 107 ? 0.6592 0.6098 0.5483 -0.1942 -0.1062 0.0428  108 PRO A CD  
857  N N   . THR A 108 ? 0.9691 0.8046 0.7868 -0.2547 -0.1342 0.0483  109 THR A N   
858  C CA  . THR A 108 ? 1.0563 0.8463 0.8499 -0.2577 -0.1429 0.0425  109 THR A CA  
859  C C   . THR A 108 ? 1.1027 0.8422 0.8758 -0.2509 -0.1472 0.0443  109 THR A C   
860  O O   . THR A 108 ? 1.1830 0.8793 0.9356 -0.2457 -0.1542 0.0372  109 THR A O   
861  C CB  . THR A 108 ? 1.0833 0.8810 0.8722 -0.2782 -0.1456 0.0468  109 THR A CB  
862  O OG1 . THR A 108 ? 1.0640 0.8883 0.8617 -0.2902 -0.1406 0.0591  109 THR A OG1 
863  C CG2 . THR A 108 ? 1.0506 0.8830 0.8527 -0.2807 -0.1447 0.0408  109 THR A CG2 
864  N N   . SER A 109 ? 1.0052 0.7514 0.7839 -0.2498 -0.1427 0.0536  110 SER A N   
865  C CA  . SER A 109 ? 0.9910 0.6942 0.7534 -0.2394 -0.1460 0.0559  110 SER A CA  
866  C C   . SER A 109 ? 1.0046 0.7239 0.7818 -0.2192 -0.1389 0.0553  110 SER A C   
867  O O   . SER A 109 ? 0.9741 0.7414 0.7743 -0.2172 -0.1300 0.0577  110 SER A O   
868  C CB  . SER A 109 ? 1.0070 0.7006 0.7590 -0.2533 -0.1474 0.0683  110 SER A CB  
869  O OG  . SER A 109 ? 0.9823 0.7220 0.7522 -0.2633 -0.1396 0.0776  110 SER A OG  
870  N N   . PRO A 110 ? 1.0073 0.6929 0.7735 -0.1985 -0.1408 0.0513  111 PRO A N   
871  C CA  . PRO A 110 ? 0.9410 0.6448 0.7218 -0.1736 -0.1327 0.0500  111 PRO A CA  
872  C C   . PRO A 110 ? 0.8706 0.6096 0.6675 -0.1781 -0.1250 0.0607  111 PRO A C   
873  O O   . PRO A 110 ? 0.8468 0.5731 0.6340 -0.1910 -0.1276 0.0709  111 PRO A O   
874  C CB  . PRO A 110 ? 0.9856 0.6408 0.7464 -0.1592 -0.1389 0.0484  111 PRO A CB  
875  C CG  . PRO A 110 ? 1.0254 0.6385 0.7633 -0.1679 -0.1493 0.0418  111 PRO A CG  
876  C CD  . PRO A 110 ? 1.0143 0.6409 0.7524 -0.1978 -0.1517 0.0474  111 PRO A CD  
877  N N   . THR A 111 ? 0.8282 0.6102 0.6483 -0.1673 -0.1160 0.0580  112 THR A N   
878  C CA  . THR A 111 ? 0.7472 0.5664 0.5837 -0.1702 -0.1082 0.0655  112 THR A CA  
879  C C   . THR A 111 ? 0.6537 0.4790 0.4988 -0.1480 -0.1029 0.0645  112 THR A C   
880  O O   . THR A 111 ? 0.6314 0.4555 0.4815 -0.1297 -0.1014 0.0565  112 THR A O   
881  C CB  . THR A 111 ? 0.7115 0.5768 0.5685 -0.1757 -0.1025 0.0633  112 THR A CB  
882  O OG1 . THR A 111 ? 0.8058 0.6693 0.6560 -0.1974 -0.1079 0.0643  112 THR A OG1 
883  C CG2 . THR A 111 ? 0.6605 0.5637 0.5336 -0.1772 -0.0945 0.0696  112 THR A CG2 
884  N N   . PRO A 112 ? 0.6256 0.4595 0.4723 -0.1505 -0.0999 0.0729  113 PRO A N   
885  C CA  . PRO A 112 ? 0.6384 0.4827 0.4943 -0.1318 -0.0950 0.0725  113 PRO A CA  
886  C C   . PRO A 112 ? 0.5807 0.4590 0.4583 -0.1186 -0.0878 0.0652  113 PRO A C   
887  O O   . PRO A 112 ? 0.4880 0.3953 0.3780 -0.1259 -0.0841 0.0638  113 PRO A O   
888  C CB  . PRO A 112 ? 0.6458 0.5060 0.5023 -0.1428 -0.0919 0.0823  113 PRO A CB  
889  C CG  . PRO A 112 ? 0.6797 0.5500 0.5334 -0.1669 -0.0930 0.0872  113 PRO A CG  
890  C CD  . PRO A 112 ? 0.6226 0.4596 0.4622 -0.1725 -0.1011 0.0834  113 PRO A CD  
891  N N   . VAL A 113 ? 0.3819 0.2562 0.2636 -0.0993 -0.0863 0.0609  114 VAL A N   
892  C CA  . VAL A 113 ? 0.3966 0.2983 0.2968 -0.0867 -0.0802 0.0550  114 VAL A CA  
893  C C   . VAL A 113 ? 0.4303 0.3506 0.3414 -0.0780 -0.0752 0.0572  114 VAL A C   
894  O O   . VAL A 113 ? 0.4265 0.3319 0.3307 -0.0714 -0.0772 0.0599  114 VAL A O   
895  C CB  . VAL A 113 ? 0.3779 0.2645 0.2756 -0.0719 -0.0821 0.0474  114 VAL A CB  
896  C CG1 . VAL A 113 ? 0.3239 0.2391 0.2399 -0.0612 -0.0761 0.0428  114 VAL A CG1 
897  C CG2 . VAL A 113 ? 0.4135 0.2793 0.2980 -0.0799 -0.0877 0.0438  114 VAL A CG2 
898  N N   . LEU A 114 ? 0.3729 0.3253 0.3006 -0.0779 -0.0693 0.0559  115 LEU A N   
899  C CA  . LEU A 114 ? 0.3172 0.2877 0.2560 -0.0689 -0.0646 0.0558  115 LEU A CA  
900  C C   . LEU A 114 ? 0.3966 0.3767 0.3477 -0.0553 -0.0620 0.0498  115 LEU A C   
901  O O   . LEU A 114 ? 0.3706 0.3631 0.3294 -0.0560 -0.0605 0.0467  115 LEU A O   
902  C CB  . LEU A 114 ? 0.3544 0.3527 0.3017 -0.0777 -0.0600 0.0582  115 LEU A CB  
903  C CG  . LEU A 114 ? 0.4547 0.4496 0.3913 -0.0886 -0.0607 0.0652  115 LEU A CG  
904  C CD1 . LEU A 114 ? 0.4974 0.5190 0.4395 -0.1016 -0.0569 0.0675  115 LEU A CD1 
905  C CD2 . LEU A 114 ? 0.3900 0.3876 0.3278 -0.0794 -0.0590 0.0659  115 LEU A CD2 
906  N N   . VAL A 115 ? 0.3143 0.2896 0.2670 -0.0435 -0.0619 0.0488  116 VAL A N   
907  C CA  . VAL A 115 ? 0.2394 0.2249 0.2035 -0.0321 -0.0594 0.0443  116 VAL A CA  
908  C C   . VAL A 115 ? 0.3261 0.3292 0.3015 -0.0277 -0.0558 0.0445  116 VAL A C   
909  O O   . VAL A 115 ? 0.3234 0.3223 0.2958 -0.0246 -0.0569 0.0463  116 VAL A O   
910  C CB  . VAL A 115 ? 0.2666 0.2352 0.2249 -0.0214 -0.0622 0.0420  116 VAL A CB  
911  C CG1 . VAL A 115 ? 0.2568 0.2399 0.2274 -0.0115 -0.0589 0.0385  116 VAL A CG1 
912  C CG2 . VAL A 115 ? 0.2696 0.2176 0.2149 -0.0245 -0.0662 0.0401  116 VAL A CG2 
913  N N   . TRP A 116 ? 0.2212 0.2429 0.2086 -0.0272 -0.0523 0.0423  117 TRP A N   
914  C CA  . TRP A 116 ? 0.2591 0.2959 0.2565 -0.0237 -0.0493 0.0413  117 TRP A CA  
915  C C   . TRP A 116 ? 0.2546 0.2928 0.2595 -0.0144 -0.0489 0.0393  117 TRP A C   
916  O O   . TRP A 116 ? 0.2579 0.2970 0.2665 -0.0113 -0.0486 0.0381  117 TRP A O   
917  C CB  . TRP A 116 ? 0.2555 0.3100 0.2616 -0.0268 -0.0464 0.0399  117 TRP A CB  
918  C CG  . TRP A 116 ? 0.2577 0.3246 0.2733 -0.0217 -0.0439 0.0375  117 TRP A CG  
919  C CD1 . TRP A 116 ? 0.2122 0.2863 0.2379 -0.0159 -0.0428 0.0352  117 TRP A CD1 
920  C CD2 . TRP A 116 ? 0.2323 0.3037 0.2463 -0.0222 -0.0428 0.0369  117 TRP A CD2 
921  N NE1 . TRP A 116 ? 0.2257 0.3062 0.2561 -0.0127 -0.0414 0.0326  117 TRP A NE1 
922  C CE2 . TRP A 116 ? 0.2643 0.3444 0.2877 -0.0162 -0.0412 0.0331  117 TRP A CE2 
923  C CE3 . TRP A 116 ? 0.2360 0.3040 0.2403 -0.0274 -0.0434 0.0395  117 TRP A CE3 
924  C CZ2 . TRP A 116 ? 0.2176 0.3033 0.2408 -0.0149 -0.0401 0.0304  117 TRP A CZ2 
925  C CZ3 . TRP A 116 ? 0.2201 0.2960 0.2244 -0.0262 -0.0420 0.0377  117 TRP A CZ3 
926  C CH2 . TRP A 116 ? 0.2445 0.3293 0.2581 -0.0199 -0.0402 0.0324  117 TRP A CH2 
927  N N   . ILE A 117 ? 0.2683 0.3082 0.2751 -0.0109 -0.0490 0.0393  118 ILE A N   
928  C CA  . ILE A 117 ? 0.2660 0.3106 0.2813 -0.0044 -0.0486 0.0378  118 ILE A CA  
929  C C   . ILE A 117 ? 0.2731 0.3279 0.2957 -0.0047 -0.0471 0.0359  118 ILE A C   
930  O O   . ILE A 117 ? 0.2239 0.2798 0.2435 -0.0059 -0.0477 0.0356  118 ILE A O   
931  C CB  . ILE A 117 ? 0.2603 0.2986 0.2720 0.0005  -0.0512 0.0389  118 ILE A CB  
932  C CG1 . ILE A 117 ? 0.1942 0.2193 0.1971 0.0029  -0.0533 0.0397  118 ILE A CG1 
933  C CG2 . ILE A 117 ? 0.1682 0.2153 0.1899 0.0052  -0.0507 0.0379  118 ILE A CG2 
934  C CD1 . ILE A 117 ? 0.2445 0.2634 0.2434 0.0097  -0.0564 0.0406  118 ILE A CD1 
935  N N   . TYR A 118 ? 0.2571 0.3182 0.2880 -0.0034 -0.0455 0.0345  119 TYR A N   
936  C CA  . TYR A 118 ? 0.2091 0.2763 0.2458 -0.0026 -0.0447 0.0317  119 TYR A CA  
937  C C   . TYR A 118 ? 0.1933 0.2593 0.2320 -0.0010 -0.0464 0.0307  119 TYR A C   
938  O O   . TYR A 118 ? 0.1848 0.2487 0.2242 0.0005  -0.0478 0.0327  119 TYR A O   
939  C CB  . TYR A 118 ? 0.1867 0.2576 0.2309 -0.0005 -0.0438 0.0311  119 TYR A CB  
940  C CG  . TYR A 118 ? 0.1948 0.2630 0.2428 0.0014  -0.0446 0.0336  119 TYR A CG  
941  C CD1 . TYR A 118 ? 0.1986 0.2653 0.2505 0.0022  -0.0457 0.0340  119 TYR A CD1 
942  C CD2 . TYR A 118 ? 0.1712 0.2400 0.2186 0.0015  -0.0441 0.0358  119 TYR A CD2 
943  C CE1 . TYR A 118 ? 0.2451 0.3124 0.3005 0.0027  -0.0458 0.0372  119 TYR A CE1 
944  C CE2 . TYR A 118 ? 0.2004 0.2691 0.2502 0.0030  -0.0442 0.0384  119 TYR A CE2 
945  C CZ  . TYR A 118 ? 0.2307 0.2994 0.2847 0.0035  -0.0448 0.0394  119 TYR A CZ  
946  O OH  . TYR A 118 ? 0.2602 0.3318 0.3165 0.0038  -0.0444 0.0427  119 TYR A OH  
947  N N   . GLY A 119 ? 0.2001 0.2688 0.2398 -0.0011 -0.0464 0.0270  120 GLY A N   
948  C CA  . GLY A 119 ? 0.1701 0.2376 0.2117 -0.0008 -0.0487 0.0250  120 GLY A CA  
949  C C   . GLY A 119 ? 0.2167 0.2817 0.2657 0.0003  -0.0494 0.0233  120 GLY A C   
950  O O   . GLY A 119 ? 0.2469 0.3111 0.2997 0.0017  -0.0482 0.0251  120 GLY A O   
951  N N   . GLY A 120 ? 0.1913 0.2538 0.2412 -0.0009 -0.0519 0.0202  121 GLY A N   
952  C CA  . GLY A 120 ? 0.2007 0.2569 0.2561 -0.0014 -0.0538 0.0195  121 GLY A CA  
953  C C   . GLY A 120 ? 0.2325 0.2888 0.2908 -0.0059 -0.0571 0.0211  121 GLY A C   
954  O O   . GLY A 120 ? 0.2659 0.3186 0.3293 -0.0087 -0.0586 0.0239  121 GLY A O   
955  N N   . GLY A 121 ? 0.1840 0.2458 0.2389 -0.0072 -0.0586 0.0200  122 GLY A N   
956  C CA  . GLY A 121 ? 0.2331 0.2985 0.2910 -0.0118 -0.0625 0.0205  122 GLY A CA  
957  C C   . GLY A 121 ? 0.1952 0.2683 0.2606 -0.0136 -0.0624 0.0268  122 GLY A C   
958  O O   . GLY A 121 ? 0.2072 0.2853 0.2775 -0.0188 -0.0654 0.0279  122 GLY A O   
959  N N   . PHE A 122 ? 0.1597 0.2353 0.2255 -0.0096 -0.0589 0.0306  123 PHE A N   
960  C CA  . PHE A 122 ? 0.1551 0.2394 0.2268 -0.0098 -0.0576 0.0359  123 PHE A CA  
961  C C   . PHE A 122 ? 0.2731 0.3548 0.3502 -0.0149 -0.0577 0.0389  123 PHE A C   
962  O O   . PHE A 122 ? 0.2407 0.3321 0.3229 -0.0167 -0.0565 0.0437  123 PHE A O   
963  C CB  . PHE A 122 ? 0.1544 0.2521 0.2294 -0.0098 -0.0597 0.0372  123 PHE A CB  
964  C CG  . PHE A 122 ? 0.1803 0.2790 0.2489 -0.0034 -0.0598 0.0363  123 PHE A CG  
965  C CD1 . PHE A 122 ? 0.1512 0.2482 0.2163 0.0026  -0.0571 0.0380  123 PHE A CD1 
966  C CD2 . PHE A 122 ? 0.1581 0.2579 0.2229 -0.0037 -0.0634 0.0341  123 PHE A CD2 
967  C CE1 . PHE A 122 ? 0.2057 0.2994 0.2634 0.0078  -0.0582 0.0379  123 PHE A CE1 
968  C CE2 . PHE A 122 ? 0.1658 0.2645 0.2233 0.0017  -0.0643 0.0347  123 PHE A CE2 
969  C CZ  . PHE A 122 ? 0.1628 0.2571 0.2167 0.0074  -0.0618 0.0368  123 PHE A CZ  
970  N N   . TYR A 123 ? 0.1964 0.2650 0.2717 -0.0167 -0.0591 0.0362  124 TYR A N   
971  C CA  . TYR A 123 ? 0.2376 0.2991 0.3161 -0.0215 -0.0604 0.0398  124 TYR A CA  
972  C C   . TYR A 123 ? 0.2298 0.2806 0.3057 -0.0170 -0.0589 0.0401  124 TYR A C   
973  O O   . TYR A 123 ? 0.2613 0.3049 0.3386 -0.0198 -0.0601 0.0444  124 TYR A O   
974  C CB  . TYR A 123 ? 0.1859 0.2384 0.2648 -0.0285 -0.0654 0.0371  124 TYR A CB  
975  C CG  . TYR A 123 ? 0.2802 0.3178 0.3530 -0.0248 -0.0673 0.0291  124 TYR A CG  
976  C CD1 . TYR A 123 ? 0.2204 0.2428 0.2910 -0.0214 -0.0678 0.0282  124 TYR A CD1 
977  C CD2 . TYR A 123 ? 0.2692 0.3093 0.3380 -0.0239 -0.0688 0.0226  124 TYR A CD2 
978  C CE1 . TYR A 123 ? 0.2636 0.2750 0.3290 -0.0163 -0.0690 0.0200  124 TYR A CE1 
979  C CE2 . TYR A 123 ? 0.3069 0.3360 0.3694 -0.0200 -0.0698 0.0146  124 TYR A CE2 
980  C CZ  . TYR A 123 ? 0.3204 0.3357 0.3816 -0.0157 -0.0697 0.0130  124 TYR A CZ  
981  O OH  . TYR A 123 ? 0.4045 0.4110 0.4598 -0.0101 -0.0703 0.0042  124 TYR A OH  
982  N N   . SER A 124 ? 0.2027 0.2534 0.2746 -0.0106 -0.0567 0.0362  125 SER A N   
983  C CA  . SER A 124 ? 0.2202 0.2649 0.2907 -0.0057 -0.0556 0.0358  125 SER A CA  
984  C C   . SER A 124 ? 0.2678 0.3196 0.3351 -0.0011 -0.0524 0.0338  125 SER A C   
985  O O   . SER A 124 ? 0.2189 0.2769 0.2837 -0.0015 -0.0514 0.0328  125 SER A O   
986  C CB  . SER A 124 ? 0.2394 0.2713 0.3082 -0.0036 -0.0584 0.0303  125 SER A CB  
987  O OG  . SER A 124 ? 0.2245 0.2586 0.2898 -0.0023 -0.0582 0.0233  125 SER A OG  
988  N N   . GLY A 125 ? 0.1613 0.2119 0.2283 0.0029  -0.0514 0.0334  126 GLY A N   
989  C CA  . GLY A 125 ? 0.1550 0.2129 0.2191 0.0053  -0.0488 0.0320  126 GLY A CA  
990  C C   . GLY A 125 ? 0.2162 0.2777 0.2809 0.0060  -0.0478 0.0365  126 GLY A C   
991  O O   . GLY A 125 ? 0.1705 0.2307 0.2369 0.0047  -0.0484 0.0413  126 GLY A O   
992  N N   . ALA A 126 ? 0.1533 0.2206 0.2160 0.0074  -0.0463 0.0352  127 ALA A N   
993  C CA  . ALA A 126 ? 0.1911 0.2627 0.2531 0.0074  -0.0459 0.0385  127 ALA A CA  
994  C C   . ALA A 126 ? 0.2586 0.3368 0.3173 0.0060  -0.0446 0.0364  127 ALA A C   
995  O O   . ALA A 126 ? 0.2803 0.3626 0.3395 0.0063  -0.0438 0.0329  127 ALA A O   
996  C CB  . ALA A 126 ? 0.1688 0.2396 0.2349 0.0108  -0.0476 0.0407  127 ALA A CB  
997  N N   . SER A 127 ? 0.1592 0.2390 0.2139 0.0037  -0.0445 0.0383  128 SER A N   
998  C CA  . SER A 127 ? 0.2379 0.3223 0.2886 0.0001  -0.0441 0.0370  128 SER A CA  
999  C C   . SER A 127 ? 0.2717 0.3673 0.3274 0.0012  -0.0446 0.0368  128 SER A C   
1000 O O   . SER A 127 ? 0.2361 0.3397 0.2906 -0.0027 -0.0442 0.0357  128 SER A O   
1001 C CB  . SER A 127 ? 0.2352 0.3145 0.2783 -0.0028 -0.0447 0.0380  128 SER A CB  
1002 O OG  . SER A 127 ? 0.2514 0.3332 0.2949 -0.0015 -0.0455 0.0400  128 SER A OG  
1003 N N   . SER A 128 ? 0.2296 0.3262 0.2910 0.0064  -0.0458 0.0382  129 SER A N   
1004 C CA  . SER A 128 ? 0.2369 0.3450 0.3035 0.0094  -0.0471 0.0386  129 SER A CA  
1005 C C   . SER A 128 ? 0.2273 0.3431 0.3001 0.0144  -0.0464 0.0347  129 SER A C   
1006 O O   . SER A 128 ? 0.2532 0.3818 0.3314 0.0181  -0.0473 0.0343  129 SER A O   
1007 C CB  . SER A 128 ? 0.1818 0.2866 0.2501 0.0133  -0.0496 0.0430  129 SER A CB  
1008 O OG  . SER A 128 ? 0.2522 0.3452 0.3219 0.0163  -0.0501 0.0441  129 SER A OG  
1009 N N   . LEU A 129 ? 0.2013 0.3106 0.2730 0.0152  -0.0448 0.0314  130 LEU A N   
1010 C CA  . LEU A 129 ? 0.2586 0.3747 0.3344 0.0208  -0.0437 0.0262  130 LEU A CA  
1011 C C   . LEU A 129 ? 0.2768 0.4136 0.3548 0.0187  -0.0415 0.0243  130 LEU A C   
1012 O O   . LEU A 129 ? 0.3069 0.4478 0.3802 0.0098  -0.0402 0.0260  130 LEU A O   
1013 C CB  . LEU A 129 ? 0.1634 0.2701 0.2353 0.0198  -0.0425 0.0227  130 LEU A CB  
1014 C CG  . LEU A 129 ? 0.3076 0.3966 0.3782 0.0202  -0.0448 0.0245  130 LEU A CG  
1015 C CD1 . LEU A 129 ? 0.3062 0.3887 0.3733 0.0192  -0.0444 0.0201  130 LEU A CD1 
1016 C CD2 . LEU A 129 ? 0.2451 0.3271 0.3202 0.0270  -0.0479 0.0258  130 LEU A CD2 
1017 N N   . ASP A 130 ? 0.2335 0.3833 0.3185 0.0268  -0.0413 0.0208  131 ASP A N   
1018 C CA  . ASP A 130 ? 0.2765 0.4518 0.3659 0.0254  -0.0389 0.0189  131 ASP A CA  
1019 C C   . ASP A 130 ? 0.2434 0.4244 0.3269 0.0168  -0.0351 0.0173  131 ASP A C   
1020 O O   . ASP A 130 ? 0.2778 0.4731 0.3602 0.0077  -0.0337 0.0196  131 ASP A O   
1021 C CB  . ASP A 130 ? 0.2574 0.4458 0.3552 0.0384  -0.0388 0.0137  131 ASP A CB  
1022 C CG  . ASP A 130 ? 0.4291 0.6144 0.5327 0.0472  -0.0435 0.0166  131 ASP A CG  
1023 O OD1 . ASP A 130 ? 0.4811 0.6612 0.5828 0.0415  -0.0461 0.0228  131 ASP A OD1 
1024 O OD2 . ASP A 130 ? 0.5387 0.7262 0.6478 0.0603  -0.0449 0.0126  131 ASP A OD2 
1025 N N   . VAL A 131 ? 0.2283 0.3970 0.3068 0.0186  -0.0339 0.0140  132 VAL A N   
1026 C CA  . VAL A 131 ? 0.2187 0.3920 0.2902 0.0112  -0.0307 0.0129  132 VAL A CA  
1027 C C   . VAL A 131 ? 0.2683 0.4316 0.3314 -0.0009 -0.0315 0.0190  132 VAL A C   
1028 O O   . VAL A 131 ? 0.2693 0.4365 0.3256 -0.0085 -0.0296 0.0200  132 VAL A O   
1029 C CB  . VAL A 131 ? 0.4265 0.5892 0.4942 0.0168  -0.0301 0.0073  132 VAL A CB  
1030 C CG1 . VAL A 131 ? 0.4161 0.5535 0.4804 0.0166  -0.0337 0.0096  132 VAL A CG1 
1031 C CG2 . VAL A 131 ? 0.4374 0.6092 0.4976 0.0104  -0.0266 0.0060  132 VAL A CG2 
1032 N N   . TYR A 132 ? 0.2367 0.3870 0.2993 -0.0022 -0.0347 0.0230  133 TYR A N   
1033 C CA  . TYR A 132 ? 0.2567 0.3955 0.3107 -0.0115 -0.0360 0.0275  133 TYR A CA  
1034 C C   . TYR A 132 ? 0.3421 0.4890 0.3963 -0.0182 -0.0373 0.0305  133 TYR A C   
1035 O O   . TYR A 132 ? 0.3078 0.4422 0.3542 -0.0248 -0.0394 0.0335  133 TYR A O   
1036 C CB  . TYR A 132 ? 0.2295 0.3481 0.2807 -0.0085 -0.0384 0.0290  133 TYR A CB  
1037 C CG  . TYR A 132 ? 0.2607 0.3706 0.3115 -0.0038 -0.0382 0.0266  133 TYR A CG  
1038 C CD1 . TYR A 132 ? 0.2248 0.3388 0.2722 -0.0049 -0.0364 0.0239  133 TYR A CD1 
1039 C CD2 . TYR A 132 ? 0.1736 0.2722 0.2269 0.0007  -0.0401 0.0271  133 TYR A CD2 
1040 C CE1 . TYR A 132 ? 0.2683 0.3744 0.3146 -0.0012 -0.0370 0.0210  133 TYR A CE1 
1041 C CE2 . TYR A 132 ? 0.1695 0.2608 0.2227 0.0034  -0.0406 0.0249  133 TYR A CE2 
1042 C CZ  . TYR A 132 ? 0.2613 0.3557 0.3108 0.0026  -0.0394 0.0215  133 TYR A CZ  
1043 O OH  . TYR A 132 ? 0.2667 0.3538 0.3155 0.0045  -0.0407 0.0188  133 TYR A OH  
1044 N N   . ASP A 133 ? 0.2867 0.4542 0.3496 -0.0160 -0.0367 0.0293  134 ASP A N   
1045 C CA  . ASP A 133 ? 0.3269 0.5065 0.3915 -0.0230 -0.0384 0.0318  134 ASP A CA  
1046 C C   . ASP A 133 ? 0.3578 0.5366 0.4131 -0.0373 -0.0383 0.0346  134 ASP A C   
1047 O O   . ASP A 133 ? 0.3179 0.5104 0.3729 -0.0423 -0.0352 0.0345  134 ASP A O   
1048 C CB  . ASP A 133 ? 0.3121 0.5196 0.3888 -0.0175 -0.0373 0.0296  134 ASP A CB  
1049 C CG  . ASP A 133 ? 0.3413 0.5640 0.4218 -0.0234 -0.0402 0.0321  134 ASP A CG  
1050 O OD1 . ASP A 133 ? 0.3482 0.5607 0.4203 -0.0343 -0.0426 0.0350  134 ASP A OD1 
1051 O OD2 . ASP A 133 ? 0.3974 0.6428 0.4890 -0.0166 -0.0404 0.0307  134 ASP A OD2 
1052 N N   . GLY A 134 ? 0.2985 0.4609 0.3454 -0.0441 -0.0417 0.0371  135 GLY A N   
1053 C CA  . GLY A 134 ? 0.2495 0.4032 0.2850 -0.0576 -0.0429 0.0402  135 GLY A CA  
1054 C C   . GLY A 134 ? 0.3120 0.4846 0.3487 -0.0705 -0.0439 0.0423  135 GLY A C   
1055 O O   . GLY A 134 ? 0.3364 0.5007 0.3627 -0.0839 -0.0454 0.0456  135 GLY A O   
1056 N N   . ARG A 135 ? 0.2826 0.4806 0.3317 -0.0671 -0.0436 0.0408  136 ARG A N   
1057 C CA  . ARG A 135 ? 0.2811 0.5004 0.3330 -0.0797 -0.0453 0.0428  136 ARG A CA  
1058 C C   . ARG A 135 ? 0.2510 0.4868 0.3012 -0.0924 -0.0422 0.0456  136 ARG A C   
1059 O O   . ARG A 135 ? 0.3318 0.5685 0.3754 -0.1091 -0.0447 0.0493  136 ARG A O   
1060 C CB  . ARG A 135 ? 0.2363 0.4830 0.3034 -0.0714 -0.0459 0.0408  136 ARG A CB  
1061 C CG  . ARG A 135 ? 0.3159 0.5919 0.3962 -0.0625 -0.0410 0.0385  136 ARG A CG  
1062 C CD  . ARG A 135 ? 0.2738 0.5752 0.3686 -0.0528 -0.0427 0.0368  136 ARG A CD  
1063 N NE  . ARG A 135 ? 0.3346 0.6167 0.4297 -0.0391 -0.0453 0.0357  136 ARG A NE  
1064 C CZ  . ARG A 135 ? 0.4335 0.7268 0.5366 -0.0315 -0.0491 0.0360  136 ARG A CZ  
1065 N NH1 . ARG A 135 ? 0.4363 0.7618 0.5491 -0.0352 -0.0508 0.0367  136 ARG A NH1 
1066 N NH2 . ARG A 135 ? 0.3735 0.6470 0.4749 -0.0206 -0.0513 0.0362  136 ARG A NH2 
1067 N N   . PHE A 136 ? 0.2095 0.4571 0.2642 -0.0854 -0.0368 0.0441  137 PHE A N   
1068 C CA  . PHE A 136 ? 0.2058 0.4736 0.2589 -0.0967 -0.0329 0.0468  137 PHE A CA  
1069 C C   . PHE A 136 ? 0.2282 0.4702 0.2636 -0.1106 -0.0343 0.0524  137 PHE A C   
1070 O O   . PHE A 136 ? 0.3184 0.5710 0.3488 -0.1279 -0.0343 0.0575  137 PHE A O   
1071 C CB  . PHE A 136 ? 0.1805 0.4676 0.2418 -0.0838 -0.0268 0.0423  137 PHE A CB  
1072 C CG  . PHE A 136 ? 0.3166 0.6221 0.3935 -0.0674 -0.0262 0.0367  137 PHE A CG  
1073 C CD1 . PHE A 136 ? 0.2842 0.6267 0.3742 -0.0687 -0.0254 0.0362  137 PHE A CD1 
1074 C CD2 . PHE A 136 ? 0.2608 0.5467 0.3392 -0.0510 -0.0270 0.0325  137 PHE A CD2 
1075 C CE1 . PHE A 136 ? 0.3069 0.6652 0.4109 -0.0519 -0.0258 0.0315  137 PHE A CE1 
1076 C CE2 . PHE A 136 ? 0.3163 0.6154 0.4076 -0.0358 -0.0275 0.0282  137 PHE A CE2 
1077 C CZ  . PHE A 136 ? 0.3395 0.6741 0.4434 -0.0354 -0.0270 0.0277  137 PHE A CZ  
1078 N N   . LEU A 137 ? 0.2355 0.4444 0.2613 -0.1034 -0.0360 0.0518  138 LEU A N   
1079 C CA  . LEU A 137 ? 0.3439 0.5242 0.3521 -0.1137 -0.0387 0.0570  138 LEU A CA  
1080 C C   . LEU A 137 ? 0.3622 0.5269 0.3609 -0.1287 -0.0446 0.0608  138 LEU A C   
1081 O O   . LEU A 137 ? 0.3733 0.5294 0.3599 -0.1447 -0.0465 0.0669  138 LEU A O   
1082 C CB  . LEU A 137 ? 0.2968 0.4468 0.2990 -0.1009 -0.0403 0.0548  138 LEU A CB  
1083 C CG  . LEU A 137 ? 0.2994 0.4452 0.2962 -0.0969 -0.0375 0.0557  138 LEU A CG  
1084 C CD1 . LEU A 137 ? 0.2977 0.4165 0.2907 -0.0845 -0.0400 0.0534  138 LEU A CD1 
1085 C CD2 . LEU A 137 ? 0.2946 0.4347 0.2773 -0.1129 -0.0384 0.0632  138 LEU A CD2 
1086 N N   . VAL A 138 ? 0.3433 0.5029 0.3464 -0.1237 -0.0480 0.0571  139 VAL A N   
1087 C CA  . VAL A 138 ? 0.3259 0.4676 0.3188 -0.1361 -0.0544 0.0587  139 VAL A CA  
1088 C C   . VAL A 138 ? 0.3260 0.4929 0.3215 -0.1549 -0.0548 0.0627  139 VAL A C   
1089 O O   . VAL A 138 ? 0.4014 0.5520 0.3831 -0.1723 -0.0589 0.0677  139 VAL A O   
1090 C CB  . VAL A 138 ? 0.3041 0.4395 0.3012 -0.1261 -0.0574 0.0534  139 VAL A CB  
1091 C CG1 . VAL A 138 ? 0.3243 0.4441 0.3103 -0.1398 -0.0642 0.0538  139 VAL A CG1 
1092 C CG2 . VAL A 138 ? 0.2379 0.3479 0.2309 -0.1101 -0.0570 0.0505  139 VAL A CG2 
1093 N N   . GLN A 139 ? 0.3544 0.5613 0.3673 -0.1515 -0.0508 0.0609  140 GLN A N   
1094 C CA  . GLN A 139 ? 0.4330 0.6727 0.4518 -0.1687 -0.0505 0.0646  140 GLN A CA  
1095 C C   . GLN A 139 ? 0.4274 0.6729 0.4383 -0.1834 -0.0473 0.0714  140 GLN A C   
1096 O O   . GLN A 139 ? 0.4349 0.6779 0.4368 -0.2049 -0.0508 0.0774  140 GLN A O   
1097 C CB  . GLN A 139 ? 0.4836 0.7672 0.5241 -0.1578 -0.0465 0.0606  140 GLN A CB  
1098 C CG  . GLN A 139 ? 0.5876 0.8990 0.6339 -0.1699 -0.0480 0.0621  140 GLN A CG  
1099 C CD  . GLN A 139 ? 0.6519 0.9861 0.6960 -0.1809 -0.0426 0.0664  140 GLN A CD  
1100 O OE1 . GLN A 139 ? 0.6190 0.9683 0.6671 -0.1752 -0.0363 0.0663  140 GLN A OE1 
1101 N NE2 . GLN A 139 ? 0.6945 1.0321 0.7315 -0.1969 -0.0452 0.0700  140 GLN A NE2 
1102 N N   . ALA A 140 ? 0.3881 0.6402 0.4011 -0.1728 -0.0411 0.0707  141 ALA A N   
1103 C CA  . ALA A 140 ? 0.3997 0.6602 0.4046 -0.1855 -0.0374 0.0773  141 ALA A CA  
1104 C C   . ALA A 140 ? 0.4827 0.7011 0.4649 -0.1993 -0.0428 0.0845  141 ALA A C   
1105 O O   . ALA A 140 ? 0.4949 0.7183 0.4680 -0.2193 -0.0431 0.0927  141 ALA A O   
1106 C CB  . ALA A 140 ? 0.2993 0.5736 0.3097 -0.1694 -0.0301 0.0736  141 ALA A CB  
1107 N N   . GLU A 141 ? 0.4841 0.6615 0.4568 -0.1882 -0.0472 0.0820  142 GLU A N   
1108 C CA  . GLU A 141 ? 0.4757 0.6126 0.4268 -0.1964 -0.0521 0.0883  142 GLU A CA  
1109 C C   . GLU A 141 ? 0.5244 0.6226 0.4630 -0.2016 -0.0609 0.0879  142 GLU A C   
1110 O O   . GLU A 141 ? 0.5909 0.6506 0.5107 -0.2058 -0.0661 0.0923  142 GLU A O   
1111 C CB  . GLU A 141 ? 0.4024 0.5234 0.3495 -0.1796 -0.0498 0.0868  142 GLU A CB  
1112 C CG  . GLU A 141 ? 0.4519 0.6038 0.4041 -0.1782 -0.0422 0.0884  142 GLU A CG  
1113 C CD  . GLU A 141 ? 0.5607 0.7218 0.5016 -0.2006 -0.0415 0.0988  142 GLU A CD  
1114 O OE1 . GLU A 141 ? 0.5041 0.6332 0.4275 -0.2149 -0.0482 0.1063  142 GLU A OE1 
1115 O OE2 . GLU A 141 ? 0.6206 0.8210 0.5695 -0.2039 -0.0344 0.0995  142 GLU A OE2 
1116 N N   . ARG A 142 ? 0.5409 0.5427 0.5335 -0.1933 0.0193  -0.0124 143 ARG A N   
1117 C CA  . ARG A 142 ? 0.5696 0.5457 0.5480 -0.1857 0.0008  -0.0052 143 ARG A CA  
1118 C C   . ARG A 142 ? 0.5387 0.4888 0.4820 -0.1715 -0.0089 0.0013  143 ARG A C   
1119 O O   . ARG A 142 ? 0.6430 0.5642 0.5579 -0.1742 -0.0176 0.0088  143 ARG A O   
1120 C CB  . ARG A 142 ? 0.6295 0.5903 0.5989 -0.2035 -0.0027 0.0001  143 ARG A CB  
1121 C CG  . ARG A 142 ? 0.7772 0.7613 0.7871 -0.2140 -0.0002 -0.0055 143 ARG A CG  
1122 C CD  . ARG A 142 ? 0.9071 0.8712 0.9073 -0.2287 -0.0094 0.0005  143 ARG A CD  
1123 N NE  . ARG A 142 ? 0.9615 0.8976 0.9434 -0.2171 -0.0288 0.0043  143 ARG A NE  
1124 C CZ  . ARG A 142 ? 0.9604 0.9035 0.9621 -0.2078 -0.0401 0.0008  143 ARG A CZ  
1125 N NH1 . ARG A 142 ? 0.9569 0.9333 1.0009 -0.2075 -0.0360 -0.0049 143 ARG A NH1 
1126 N NH2 . ARG A 142 ? 0.9371 0.8537 0.9165 -0.1991 -0.0559 0.0029  143 ARG A NH2 
1127 N N   . THR A 143 ? 0.5414 0.5019 0.4893 -0.1565 -0.0073 -0.0019 144 THR A N   
1128 C CA  . THR A 143 ? 0.4715 0.4127 0.3938 -0.1412 -0.0161 0.0029  144 THR A CA  
1129 C C   . THR A 143 ? 0.4329 0.3813 0.3714 -0.1250 -0.0235 -0.0002 144 THR A C   
1130 O O   . THR A 143 ? 0.4003 0.3692 0.3695 -0.1255 -0.0220 -0.0050 144 THR A O   
1131 C CB  . THR A 143 ? 0.6165 0.5647 0.5278 -0.1389 -0.0079 0.0028  144 THR A CB  
1132 O OG1 . THR A 143 ? 0.6364 0.6147 0.5776 -0.1384 0.0033  -0.0064 144 THR A OG1 
1133 C CG2 . THR A 143 ? 0.6807 0.6183 0.5671 -0.1561 -0.0025 0.0083  144 THR A CG2 
1134 N N   . VAL A 144 ? 0.4432 0.3753 0.3623 -0.1109 -0.0318 0.0028  145 VAL A N   
1135 C CA  . VAL A 144 ? 0.4030 0.3444 0.3336 -0.0965 -0.0363 0.0004  145 VAL A CA  
1136 C C   . VAL A 144 ? 0.4176 0.3746 0.3539 -0.0887 -0.0290 -0.0009 145 VAL A C   
1137 O O   . VAL A 144 ? 0.4235 0.3730 0.3417 -0.0886 -0.0261 0.0017  145 VAL A O   
1138 C CB  . VAL A 144 ? 0.4151 0.3335 0.3235 -0.0860 -0.0471 0.0022  145 VAL A CB  
1139 C CG1 . VAL A 144 ? 0.4168 0.3467 0.3336 -0.0730 -0.0501 0.0003  145 VAL A CG1 
1140 C CG2 . VAL A 144 ? 0.3866 0.2885 0.2891 -0.0950 -0.0548 0.0020  145 VAL A CG2 
1141 N N   . LEU A 145 ? 0.2730 0.2510 0.2351 -0.0833 -0.0271 -0.0042 146 LEU A N   
1142 C CA  . LEU A 145 ? 0.2705 0.2627 0.2406 -0.0762 -0.0210 -0.0061 146 LEU A CA  
1143 C C   . LEU A 145 ? 0.3233 0.3180 0.2961 -0.0623 -0.0276 -0.0039 146 LEU A C   
1144 O O   . LEU A 145 ? 0.3786 0.3758 0.3618 -0.0607 -0.0343 -0.0029 146 LEU A O   
1145 C CB  . LEU A 145 ? 0.3442 0.3597 0.3456 -0.0835 -0.0109 -0.0127 146 LEU A CB  
1146 C CG  . LEU A 145 ? 0.4639 0.4945 0.4776 -0.0781 -0.0040 -0.0169 146 LEU A CG  
1147 C CD1 . LEU A 145 ? 0.5286 0.5491 0.5131 -0.0764 -0.0024 -0.0145 146 LEU A CD1 
1148 C CD2 . LEU A 145 ? 0.5075 0.5577 0.5500 -0.0875 0.0081  -0.0264 146 LEU A CD2 
1149 N N   . VAL A 146 ? 0.3294 0.3236 0.2916 -0.0536 -0.0262 -0.0026 147 VAL A N   
1150 C CA  . VAL A 146 ? 0.3257 0.3241 0.2895 -0.0416 -0.0303 -0.0005 147 VAL A CA  
1151 C C   . VAL A 146 ? 0.3458 0.3598 0.3224 -0.0377 -0.0245 -0.0017 147 VAL A C   
1152 O O   . VAL A 146 ? 0.3855 0.3985 0.3533 -0.0396 -0.0201 -0.0029 147 VAL A O   
1153 C CB  . VAL A 146 ? 0.3347 0.3153 0.2719 -0.0331 -0.0352 0.0019  147 VAL A CB  
1154 C CG1 . VAL A 146 ? 0.2391 0.2271 0.1781 -0.0223 -0.0370 0.0031  147 VAL A CG1 
1155 C CG2 . VAL A 146 ? 0.2836 0.2453 0.2064 -0.0374 -0.0411 0.0016  147 VAL A CG2 
1156 N N   . SER A 147 ? 0.3174 0.3448 0.3138 -0.0334 -0.0256 -0.0008 148 SER A N   
1157 C CA  . SER A 147 ? 0.3196 0.3595 0.3273 -0.0289 -0.0217 -0.0014 148 SER A CA  
1158 C C   . SER A 147 ? 0.3055 0.3483 0.3120 -0.0201 -0.0264 0.0040  148 SER A C   
1159 O O   . SER A 147 ? 0.3229 0.3628 0.3278 -0.0197 -0.0323 0.0075  148 SER A O   
1160 C CB  . SER A 147 ? 0.3274 0.3824 0.3662 -0.0344 -0.0163 -0.0066 148 SER A CB  
1161 O OG  . SER A 147 ? 0.3149 0.3761 0.3766 -0.0343 -0.0217 -0.0040 148 SER A OG  
1162 N N   . MET A 148 ? 0.2736 0.3227 0.2793 -0.0145 -0.0240 0.0049  149 MET A N   
1163 C CA  . MET A 148 ? 0.2657 0.3209 0.2725 -0.0080 -0.0265 0.0101  149 MET A CA  
1164 C C   . MET A 148 ? 0.2650 0.3348 0.2941 -0.0080 -0.0240 0.0109  149 MET A C   
1165 O O   . MET A 148 ? 0.2834 0.3574 0.3211 -0.0109 -0.0197 0.0059  149 MET A O   
1166 C CB  . MET A 148 ? 0.2239 0.2726 0.2086 0.0000  -0.0263 0.0107  149 MET A CB  
1167 C CG  . MET A 148 ? 0.3128 0.3688 0.3001 0.0041  -0.0233 0.0102  149 MET A CG  
1168 S SD  . MET A 148 ? 0.3405 0.3916 0.3245 -0.0025 -0.0215 0.0059  149 MET A SD  
1169 C CE  . MET A 148 ? 0.3181 0.3477 0.2757 0.0000  -0.0256 0.0065  149 MET A CE  
1170 N N   . ASN A 149 ? 0.2001 0.2769 0.2373 -0.0061 -0.0269 0.0172  150 ASN A N   
1171 C CA  . ASN A 149 ? 0.1643 0.2533 0.2188 -0.0052 -0.0251 0.0196  150 ASN A CA  
1172 C C   . ASN A 149 ? 0.2253 0.3180 0.2655 0.0010  -0.0224 0.0209  150 ASN A C   
1173 O O   . ASN A 149 ? 0.2061 0.2944 0.2272 0.0054  -0.0226 0.0224  150 ASN A O   
1174 C CB  . ASN A 149 ? 0.1556 0.2498 0.2256 -0.0076 -0.0304 0.0280  150 ASN A CB  
1175 C CG  . ASN A 149 ? 0.2695 0.3645 0.3676 -0.0125 -0.0335 0.0266  150 ASN A CG  
1176 O OD1 . ASN A 149 ? 0.2743 0.3675 0.3796 -0.0147 -0.0296 0.0176  150 ASN A OD1 
1177 N ND2 . ASN A 149 ? 0.2737 0.3718 0.3890 -0.0147 -0.0406 0.0355  150 ASN A ND2 
1178 N N   . TYR A 150 ? 0.1926 0.2942 0.2440 0.0012  -0.0197 0.0193  151 TYR A N   
1179 C CA  . TYR A 150 ? 0.1534 0.2628 0.1990 0.0069  -0.0179 0.0214  151 TYR A CA  
1180 C C   . TYR A 150 ? 0.1353 0.2579 0.2026 0.0039  -0.0173 0.0247  151 TYR A C   
1181 O O   . TYR A 150 ? 0.2027 0.3258 0.2878 -0.0016 -0.0179 0.0220  151 TYR A O   
1182 C CB  . TYR A 150 ? 0.1604 0.2658 0.1947 0.0100  -0.0175 0.0163  151 TYR A CB  
1183 C CG  . TYR A 150 ? 0.1445 0.2507 0.1869 0.0036  -0.0171 0.0109  151 TYR A CG  
1184 C CD1 . TYR A 150 ? 0.1482 0.2447 0.1854 -0.0021 -0.0162 0.0058  151 TYR A CD1 
1185 C CD2 . TYR A 150 ? 0.1436 0.2611 0.1985 0.0020  -0.0169 0.0100  151 TYR A CD2 
1186 C CE1 . TYR A 150 ? 0.2083 0.3066 0.2506 -0.0094 -0.0138 -0.0010 151 TYR A CE1 
1187 C CE2 . TYR A 150 ? 0.1701 0.2879 0.2292 -0.0051 -0.0160 0.0032  151 TYR A CE2 
1188 C CZ  . TYR A 150 ? 0.1970 0.3053 0.2489 -0.0109 -0.0137 -0.0028 151 TYR A CZ  
1189 O OH  . TYR A 150 ? 0.2165 0.3262 0.2703 -0.0192 -0.0108 -0.0114 151 TYR A OH  
1190 N N   . ARG A 151 ? 0.1365 0.2699 0.2040 0.0069  -0.0155 0.0297  152 ARG A N   
1191 C CA  . ARG A 151 ? 0.2161 0.3617 0.3044 0.0028  -0.0153 0.0342  152 ARG A CA  
1192 C C   . ARG A 151 ? 0.2517 0.4011 0.3523 0.0006  -0.0156 0.0278  152 ARG A C   
1193 O O   . ARG A 151 ? 0.2892 0.4375 0.3792 0.0039  -0.0157 0.0227  152 ARG A O   
1194 C CB  . ARG A 151 ? 0.2197 0.3784 0.3052 0.0053  -0.0118 0.0405  152 ARG A CB  
1195 C CG  . ARG A 151 ? 0.1446 0.3017 0.2183 0.0034  -0.0112 0.0477  152 ARG A CG  
1196 C CD  . ARG A 151 ? 0.1523 0.3242 0.2200 0.0058  -0.0044 0.0509  152 ARG A CD  
1197 N NE  . ARG A 151 ? 0.2579 0.4276 0.3086 0.0153  -0.0001 0.0431  152 ARG A NE  
1198 C CZ  . ARG A 151 ? 0.2448 0.4275 0.2919 0.0202  0.0075  0.0415  152 ARG A CZ  
1199 N NH1 . ARG A 151 ? 0.2041 0.4047 0.2614 0.0151  0.0126  0.0480  152 ARG A NH1 
1200 N NH2 . ARG A 151 ? 0.2224 0.4002 0.2578 0.0299  0.0104  0.0332  152 ARG A NH2 
1201 N N   . VAL A 152 ? 0.1185 0.2709 0.2409 -0.0057 -0.0169 0.0281  153 VAL A N   
1202 C CA  . VAL A 152 ? 0.2312 0.3867 0.3648 -0.0096 -0.0171 0.0205  153 VAL A CA  
1203 C C   . VAL A 152 ? 0.1796 0.3465 0.3336 -0.0137 -0.0181 0.0252  153 VAL A C   
1204 O O   . VAL A 152 ? 0.1736 0.3460 0.3327 -0.0141 -0.0181 0.0354  153 VAL A O   
1205 C CB  . VAL A 152 ? 0.2753 0.4212 0.4187 -0.0146 -0.0166 0.0115  153 VAL A CB  
1206 C CG1 . VAL A 152 ? 0.1530 0.2893 0.2759 -0.0129 -0.0149 0.0059  153 VAL A CG1 
1207 C CG2 . VAL A 152 ? 0.2096 0.3524 0.3746 -0.0172 -0.0188 0.0170  153 VAL A CG2 
1208 N N   . GLY A 153 ? 0.2200 0.3904 0.3841 -0.0181 -0.0191 0.0180  154 GLY A N   
1209 C CA  . GLY A 153 ? 0.1120 0.2928 0.2962 -0.0232 -0.0207 0.0217  154 GLY A CA  
1210 C C   . GLY A 153 ? 0.1505 0.3467 0.3313 -0.0194 -0.0197 0.0310  154 GLY A C   
1211 O O   . GLY A 153 ? 0.1880 0.3874 0.3517 -0.0122 -0.0184 0.0306  154 GLY A O   
1212 N N   . ALA A 154 ? 0.1494 0.3551 0.3481 -0.0247 -0.0198 0.0390  155 ALA A N   
1213 C CA  . ALA A 154 ? 0.1857 0.4095 0.3851 -0.0228 -0.0166 0.0473  155 ALA A CA  
1214 C C   . ALA A 154 ? 0.2218 0.4453 0.4007 -0.0154 -0.0117 0.0518  155 ALA A C   
1215 O O   . ALA A 154 ? 0.2503 0.4861 0.4228 -0.0090 -0.0077 0.0517  155 ALA A O   
1216 C CB  . ALA A 154 ? 0.1157 0.3476 0.3366 -0.0323 -0.0169 0.0570  155 ALA A CB  
1217 N N   . PHE A 155 ? 0.1658 0.3752 0.3360 -0.0162 -0.0123 0.0547  156 PHE A N   
1218 C CA  . PHE A 155 ? 0.1966 0.4050 0.3461 -0.0115 -0.0082 0.0588  156 PHE A CA  
1219 C C   . PHE A 155 ? 0.2525 0.4576 0.3843 -0.0014 -0.0065 0.0500  156 PHE A C   
1220 O O   . PHE A 155 ? 0.1327 0.3425 0.2506 0.0044  -0.0014 0.0504  156 PHE A O   
1221 C CB  . PHE A 155 ? 0.1568 0.3501 0.3016 -0.0154 -0.0122 0.0640  156 PHE A CB  
1222 C CG  . PHE A 155 ? 0.2403 0.4331 0.4058 -0.0251 -0.0166 0.0738  156 PHE A CG  
1223 C CD1 . PHE A 155 ? 0.2552 0.4573 0.4197 -0.0317 -0.0149 0.0870  156 PHE A CD1 
1224 C CD2 . PHE A 155 ? 0.2028 0.3857 0.3895 -0.0284 -0.0222 0.0693  156 PHE A CD2 
1225 C CE1 . PHE A 155 ? 0.2749 0.4742 0.4590 -0.0417 -0.0207 0.0982  156 PHE A CE1 
1226 C CE2 . PHE A 155 ? 0.2049 0.3848 0.4142 -0.0367 -0.0275 0.0782  156 PHE A CE2 
1227 C CZ  . PHE A 155 ? 0.2755 0.4628 0.4835 -0.0436 -0.0277 0.0939  156 PHE A CZ  
1228 N N   . GLY A 156 ? 0.1957 0.3919 0.3274 0.0000  -0.0106 0.0417  157 GLY A N   
1229 C CA  . GLY A 156 ? 0.1626 0.3529 0.2775 0.0081  -0.0109 0.0352  157 GLY A CA  
1230 C C   . GLY A 156 ? 0.2078 0.4094 0.3290 0.0118  -0.0130 0.0323  157 GLY A C   
1231 O O   . GLY A 156 ? 0.1920 0.3919 0.3025 0.0202  -0.0136 0.0298  157 GLY A O   
1232 N N   . PHE A 157 ? 0.1192 0.3314 0.2590 0.0055  -0.0155 0.0327  158 PHE A N   
1233 C CA  . PHE A 157 ? 0.1845 0.4057 0.3295 0.0075  -0.0206 0.0297  158 PHE A CA  
1234 C C   . PHE A 157 ? 0.1918 0.4347 0.3601 0.0043  -0.0211 0.0332  158 PHE A C   
1235 O O   . PHE A 157 ? 0.2304 0.4824 0.4055 0.0053  -0.0274 0.0314  158 PHE A O   
1236 C CB  . PHE A 157 ? 0.1361 0.3439 0.2717 0.0023  -0.0266 0.0225  158 PHE A CB  
1237 C CG  . PHE A 157 ? 0.1684 0.3576 0.2810 0.0058  -0.0262 0.0195  158 PHE A CG  
1238 C CD1 . PHE A 157 ? 0.1563 0.3411 0.2546 0.0137  -0.0297 0.0199  158 PHE A CD1 
1239 C CD2 . PHE A 157 ? 0.1333 0.3096 0.2415 0.0014  -0.0229 0.0169  158 PHE A CD2 
1240 C CE1 . PHE A 157 ? 0.1439 0.3104 0.2213 0.0157  -0.0295 0.0179  158 PHE A CE1 
1241 C CE2 . PHE A 157 ? 0.1726 0.3334 0.2617 0.0034  -0.0223 0.0143  158 PHE A CE2 
1242 C CZ  . PHE A 157 ? 0.1716 0.3269 0.2440 0.0100  -0.0254 0.0150  158 PHE A CZ  
1243 N N   . LEU A 158 ? 0.1396 0.3913 0.3205 -0.0007 -0.0157 0.0393  159 LEU A N   
1244 C CA  . LEU A 158 ? 0.1889 0.4634 0.3929 -0.0044 -0.0148 0.0437  159 LEU A CA  
1245 C C   . LEU A 158 ? 0.1675 0.4577 0.3733 0.0066  -0.0118 0.0435  159 LEU A C   
1246 O O   . LEU A 158 ? 0.1687 0.4546 0.3603 0.0148  -0.0058 0.0429  159 LEU A O   
1247 C CB  . LEU A 158 ? 0.2327 0.5130 0.4469 -0.0126 -0.0089 0.0525  159 LEU A CB  
1248 C CG  . LEU A 158 ? 0.2187 0.5223 0.4579 -0.0194 -0.0073 0.0578  159 LEU A CG  
1249 C CD1 . LEU A 158 ? 0.1192 0.4154 0.3677 -0.0321 -0.0075 0.0645  159 LEU A CD1 
1250 C CD2 . LEU A 158 ? 0.1193 0.4424 0.3593 -0.0131 0.0026  0.0607  159 LEU A CD2 
1251 N N   . ALA A 159 ? 0.1473 0.4549 0.3720 0.0071  -0.0170 0.0429  160 ALA A N   
1252 C CA  . ALA A 159 ? 0.2265 0.5491 0.4588 0.0191  -0.0159 0.0417  160 ALA A CA  
1253 C C   . ALA A 159 ? 0.1747 0.5182 0.4334 0.0160  -0.0151 0.0429  160 ALA A C   
1254 O O   . ALA A 159 ? 0.1316 0.4754 0.4004 0.0074  -0.0234 0.0424  160 ALA A O   
1255 C CB  . ALA A 159 ? 0.1249 0.4338 0.3451 0.0261  -0.0274 0.0373  160 ALA A CB  
1256 N N   . LEU A 160 ? 0.1538 0.5130 0.4222 0.0222  -0.0043 0.0431  161 LEU A N   
1257 C CA  . LEU A 160 ? 0.2065 0.5853 0.5012 0.0220  -0.0031 0.0421  161 LEU A CA  
1258 C C   . LEU A 160 ? 0.2419 0.6274 0.5445 0.0383  -0.0037 0.0371  161 LEU A C   
1259 O O   . LEU A 160 ? 0.2167 0.6127 0.5228 0.0459  0.0093  0.0342  161 LEU A O   
1260 C CB  . LEU A 160 ? 0.1388 0.5320 0.4412 0.0143  0.0116  0.0457  161 LEU A CB  
1261 C CG  . LEU A 160 ? 0.2183 0.6037 0.5164 -0.0018 0.0113  0.0523  161 LEU A CG  
1262 C CD1 . LEU A 160 ? 0.1851 0.5821 0.4826 -0.0091 0.0261  0.0586  161 LEU A CD1 
1263 C CD2 . LEU A 160 ? 0.1388 0.5268 0.4556 -0.0104 0.0011  0.0514  161 LEU A CD2 
1264 N N   . PRO A 161 ? 0.2466 0.6251 0.5511 0.0433  -0.0194 0.0358  162 PRO A N   
1265 C CA  . PRO A 161 ? 0.2123 0.5907 0.5228 0.0594  -0.0242 0.0326  162 PRO A CA  
1266 C C   . PRO A 161 ? 0.2311 0.6313 0.5710 0.0675  -0.0142 0.0282  162 PRO A C   
1267 O O   . PRO A 161 ? 0.2315 0.6491 0.5940 0.0600  -0.0123 0.0284  162 PRO A O   
1268 C CB  . PRO A 161 ? 0.2197 0.5920 0.5331 0.0576  -0.0450 0.0347  162 PRO A CB  
1269 C CG  . PRO A 161 ? 0.2398 0.6008 0.5342 0.0420  -0.0490 0.0371  162 PRO A CG  
1270 C CD  . PRO A 161 ? 0.2239 0.5936 0.5246 0.0329  -0.0343 0.0376  162 PRO A CD  
1271 N N   . GLY A 162 ? 0.2590 0.6583 0.5992 0.0822  -0.0072 0.0231  163 GLY A N   
1272 C CA  . GLY A 162 ? 0.2455 0.6653 0.6141 0.0907  0.0055  0.0163  163 GLY A CA  
1273 C C   . GLY A 162 ? 0.2693 0.6981 0.6269 0.0868  0.0286  0.0130  163 GLY A C   
1274 O O   . GLY A 162 ? 0.2175 0.6561 0.5857 0.0967  0.0425  0.0046  163 GLY A O   
1275 N N   . SER A 163 ? 0.2200 0.6449 0.5564 0.0719  0.0325  0.0194  164 SER A N   
1276 C CA  . SER A 163 ? 0.2981 0.7311 0.6206 0.0653  0.0520  0.0190  164 SER A CA  
1277 C C   . SER A 163 ? 0.3103 0.7282 0.6024 0.0730  0.0577  0.0151  164 SER A C   
1278 O O   . SER A 163 ? 0.3499 0.7479 0.6260 0.0778  0.0452  0.0165  164 SER A O   
1279 C CB  . SER A 163 ? 0.2288 0.6600 0.5406 0.0465  0.0512  0.0291  164 SER A CB  
1280 O OG  . SER A 163 ? 0.2959 0.7055 0.5786 0.0437  0.0450  0.0336  164 SER A OG  
1281 N N   . ARG A 164 ? 0.2735 0.7002 0.5553 0.0731  0.0764  0.0097  165 ARG A N   
1282 C CA  . ARG A 164 ? 0.3348 0.7468 0.5842 0.0782  0.0818  0.0054  165 ARG A CA  
1283 C C   . ARG A 164 ? 0.2646 0.6653 0.4831 0.0619  0.0830  0.0153  165 ARG A C   
1284 O O   . ARG A 164 ? 0.2939 0.6666 0.4799 0.0620  0.0798  0.0139  165 ARG A O   
1285 C CB  . ARG A 164 ? 0.5064 0.9252 0.7549 0.0884  0.0992  -0.0090 165 ARG A CB  
1286 C CG  . ARG A 164 ? 0.6905 1.0992 0.9547 0.1087  0.0920  -0.0195 165 ARG A CG  
1287 C CD  . ARG A 164 ? 0.8450 1.2454 1.0926 0.1194  0.1056  -0.0348 165 ARG A CD  
1288 N NE  . ARG A 164 ? 0.9842 1.4045 1.2421 0.1163  0.1270  -0.0438 165 ARG A NE  
1289 C CZ  . ARG A 164 ? 1.0530 1.4690 1.3015 0.1240  0.1423  -0.0597 165 ARG A CZ  
1290 N NH1 . ARG A 164 ? 1.0665 1.4578 1.2955 0.1356  0.1373  -0.0685 165 ARG A NH1 
1291 N NH2 . ARG A 164 ? 1.0767 1.5117 1.3346 0.1195  0.1628  -0.0670 165 ARG A NH2 
1292 N N   . GLU A 165 ? 0.2535 0.6694 0.4819 0.0468  0.0848  0.0257  166 GLU A N   
1293 C CA  . GLU A 165 ? 0.3178 0.7207 0.5216 0.0305  0.0831  0.0371  166 GLU A CA  
1294 C C   . GLU A 165 ? 0.2891 0.6646 0.4855 0.0275  0.0643  0.0429  166 GLU A C   
1295 O O   . GLU A 165 ? 0.3670 0.7220 0.5396 0.0192  0.0605  0.0488  166 GLU A O   
1296 C CB  . GLU A 165 ? 0.4549 0.8780 0.6700 0.0143  0.0909  0.0467  166 GLU A CB  
1297 C CG  . GLU A 165 ? 0.6653 1.1079 0.8822 0.0137  0.1102  0.0397  166 GLU A CG  
1298 C CD  . GLU A 165 ? 0.9248 1.3841 1.1785 0.0227  0.1122  0.0308  166 GLU A CD  
1299 O OE1 . GLU A 165 ? 0.9888 1.4436 1.2636 0.0282  0.0970  0.0313  166 GLU A OE1 
1300 O OE2 . GLU A 165 ? 1.0053 1.4819 1.2670 0.0235  0.1289  0.0232  166 GLU A OE2 
1301 N N   . ALA A 166 ? 0.2059 0.5817 0.4228 0.0335  0.0525  0.0410  167 ALA A N   
1302 C CA  . ALA A 166 ? 0.2172 0.5670 0.4243 0.0314  0.0366  0.0431  167 ALA A CA  
1303 C C   . ALA A 166 ? 0.1776 0.5235 0.3952 0.0427  0.0254  0.0373  167 ALA A C   
1304 O O   . ALA A 166 ? 0.1482 0.5019 0.3848 0.0389  0.0158  0.0397  167 ALA A O   
1305 C CB  . ALA A 166 ? 0.1377 0.4893 0.3554 0.0163  0.0308  0.0523  167 ALA A CB  
1306 N N   . PRO A 167 ? 0.2043 0.5365 0.4082 0.0554  0.0253  0.0300  168 PRO A N   
1307 C CA  . PRO A 167 ? 0.2604 0.5882 0.4737 0.0674  0.0146  0.0257  168 PRO A CA  
1308 C C   . PRO A 167 ? 0.2376 0.5439 0.4388 0.0623  -0.0012 0.0285  168 PRO A C   
1309 O O   . PRO A 167 ? 0.3175 0.6240 0.5287 0.0670  -0.0131 0.0285  168 PRO A O   
1310 C CB  . PRO A 167 ? 0.2473 0.5608 0.4440 0.0798  0.0204  0.0177  168 PRO A CB  
1311 C CG  . PRO A 167 ? 0.2156 0.5131 0.3821 0.0710  0.0275  0.0190  168 PRO A CG  
1312 C CD  . PRO A 167 ? 0.1709 0.4882 0.3472 0.0576  0.0343  0.0264  168 PRO A CD  
1313 N N   . GLY A 168 ? 0.2114 0.4999 0.3917 0.0523  -0.0015 0.0308  169 GLY A N   
1314 C CA  . GLY A 168 ? 0.2398 0.5094 0.4084 0.0463  -0.0132 0.0313  169 GLY A CA  
1315 C C   . GLY A 168 ? 0.2418 0.4850 0.3844 0.0518  -0.0165 0.0278  169 GLY A C   
1316 O O   . GLY A 168 ? 0.2221 0.4611 0.3589 0.0623  -0.0123 0.0246  169 GLY A O   
1317 N N   . ASN A 169 ? 0.2334 0.4589 0.3612 0.0440  -0.0230 0.0276  170 ASN A N   
1318 C CA  . ASN A 169 ? 0.2131 0.4141 0.3170 0.0466  -0.0266 0.0251  170 ASN A CA  
1319 C C   . ASN A 169 ? 0.2468 0.4360 0.3352 0.0489  -0.0185 0.0234  170 ASN A C   
1320 O O   . ASN A 169 ? 0.2653 0.4348 0.3353 0.0521  -0.0210 0.0211  170 ASN A O   
1321 C CB  . ASN A 169 ? 0.1890 0.3863 0.2930 0.0567  -0.0350 0.0250  170 ASN A CB  
1322 C CG  . ASN A 169 ? 0.2643 0.4679 0.3762 0.0520  -0.0471 0.0277  170 ASN A CG  
1323 O OD1 . ASN A 169 ? 0.2420 0.4459 0.3512 0.0400  -0.0491 0.0273  170 ASN A OD1 
1324 N ND2 . ASN A 169 ? 0.1917 0.4001 0.3142 0.0613  -0.0559 0.0300  170 ASN A ND2 
1325 N N   . VAL A 170 ? 0.1991 0.3993 0.2933 0.0459  -0.0098 0.0252  171 VAL A N   
1326 C CA  . VAL A 170 ? 0.2353 0.4248 0.3123 0.0467  -0.0036 0.0242  171 VAL A CA  
1327 C C   . VAL A 170 ? 0.2538 0.4215 0.3143 0.0405  -0.0080 0.0236  171 VAL A C   
1328 O O   . VAL A 170 ? 0.2925 0.4451 0.3355 0.0431  -0.0073 0.0211  171 VAL A O   
1329 C CB  . VAL A 170 ? 0.2215 0.4263 0.3038 0.0419  0.0055  0.0283  171 VAL A CB  
1330 C CG1 . VAL A 170 ? 0.1587 0.3872 0.2577 0.0479  0.0124  0.0274  171 VAL A CG1 
1331 C CG2 . VAL A 170 ? 0.2081 0.4159 0.3004 0.0298  0.0030  0.0347  171 VAL A CG2 
1332 N N   . GLY A 171 ? 0.2518 0.4186 0.3195 0.0320  -0.0121 0.0248  172 GLY A N   
1333 C CA  . GLY A 171 ? 0.1457 0.2952 0.2028 0.0261  -0.0150 0.0225  172 GLY A CA  
1334 C C   . GLY A 171 ? 0.2620 0.3953 0.3015 0.0301  -0.0191 0.0190  172 GLY A C   
1335 O O   . GLY A 171 ? 0.2205 0.3384 0.2466 0.0277  -0.0193 0.0173  172 GLY A O   
1336 N N   . LEU A 172 ? 0.1892 0.3254 0.2298 0.0356  -0.0235 0.0189  173 LEU A N   
1337 C CA  . LEU A 172 ? 0.2095 0.3281 0.2333 0.0390  -0.0291 0.0178  173 LEU A CA  
1338 C C   . LEU A 172 ? 0.3298 0.4395 0.3449 0.0484  -0.0262 0.0163  173 LEU A C   
1339 O O   . LEU A 172 ? 0.2978 0.3878 0.2963 0.0487  -0.0289 0.0149  173 LEU A O   
1340 C CB  . LEU A 172 ? 0.2232 0.3462 0.2517 0.0420  -0.0374 0.0200  173 LEU A CB  
1341 C CG  . LEU A 172 ? 0.2543 0.3803 0.2823 0.0308  -0.0423 0.0201  173 LEU A CG  
1342 C CD1 . LEU A 172 ? 0.2353 0.3693 0.2698 0.0336  -0.0525 0.0237  173 LEU A CD1 
1343 C CD2 . LEU A 172 ? 0.2743 0.3814 0.2808 0.0217  -0.0432 0.0181  173 LEU A CD2 
1344 N N   . LEU A 173 ? 0.1839 0.3081 0.2096 0.0547  -0.0200 0.0157  174 LEU A N   
1345 C CA  . LEU A 173 ? 0.2927 0.4100 0.3093 0.0628  -0.0151 0.0115  174 LEU A CA  
1346 C C   . LEU A 173 ? 0.2728 0.3784 0.2730 0.0559  -0.0123 0.0107  174 LEU A C   
1347 O O   . LEU A 173 ? 0.3248 0.4145 0.3096 0.0593  -0.0121 0.0066  174 LEU A O   
1348 C CB  . LEU A 173 ? 0.1968 0.3355 0.2285 0.0700  -0.0071 0.0097  174 LEU A CB  
1349 C CG  . LEU A 173 ? 0.3957 0.5462 0.4473 0.0800  -0.0105 0.0092  174 LEU A CG  
1350 C CD1 . LEU A 173 ? 0.1996 0.3753 0.2698 0.0860  0.0001  0.0063  174 LEU A CD1 
1351 C CD2 . LEU A 173 ? 0.2169 0.3470 0.2618 0.0898  -0.0178 0.0061  174 LEU A CD2 
1352 N N   . ASP A 174 ? 0.2643 0.3769 0.2697 0.0460  -0.0113 0.0147  175 ASP A N   
1353 C CA  . ASP A 174 ? 0.2661 0.3678 0.2605 0.0387  -0.0118 0.0154  175 ASP A CA  
1354 C C   . ASP A 174 ? 0.2762 0.3573 0.2579 0.0366  -0.0171 0.0127  175 ASP A C   
1355 O O   . ASP A 174 ? 0.2534 0.3206 0.2207 0.0360  -0.0180 0.0105  175 ASP A O   
1356 C CB  . ASP A 174 ? 0.2669 0.3783 0.2757 0.0292  -0.0121 0.0203  175 ASP A CB  
1357 C CG  . ASP A 174 ? 0.3594 0.4891 0.3791 0.0283  -0.0076 0.0252  175 ASP A CG  
1358 O OD1 . ASP A 174 ? 0.3025 0.4385 0.3155 0.0338  -0.0022 0.0240  175 ASP A OD1 
1359 O OD2 . ASP A 174 ? 0.3733 0.5109 0.4089 0.0214  -0.0088 0.0298  175 ASP A OD2 
1360 N N   . GLN A 175 ? 0.2650 0.3446 0.2510 0.0342  -0.0207 0.0131  176 GLN A N   
1361 C CA  . GLN A 175 ? 0.2349 0.2963 0.2077 0.0304  -0.0250 0.0116  176 GLN A CA  
1362 C C   . GLN A 175 ? 0.2778 0.3227 0.2361 0.0384  -0.0279 0.0099  176 GLN A C   
1363 O O   . GLN A 175 ? 0.3055 0.3332 0.2502 0.0354  -0.0297 0.0083  176 GLN A O   
1364 C CB  . GLN A 175 ? 0.2237 0.2878 0.1997 0.0253  -0.0280 0.0125  176 GLN A CB  
1365 C CG  . GLN A 175 ? 0.1924 0.2700 0.1835 0.0169  -0.0247 0.0115  176 GLN A CG  
1366 C CD  . GLN A 175 ? 0.2653 0.3459 0.2562 0.0111  -0.0272 0.0104  176 GLN A CD  
1367 O OE1 . GLN A 175 ? 0.2884 0.3599 0.2656 0.0119  -0.0326 0.0123  176 GLN A OE1 
1368 N NE2 . GLN A 175 ? 0.1703 0.2625 0.1758 0.0045  -0.0242 0.0075  176 GLN A NE2 
1369 N N   . ARG A 176 ? 0.3010 0.3510 0.2649 0.0486  -0.0288 0.0098  177 ARG A N   
1370 C CA  . ARG A 176 ? 0.3089 0.3426 0.2643 0.0582  -0.0318 0.0069  177 ARG A CA  
1371 C C   . ARG A 176 ? 0.3692 0.3945 0.3136 0.0599  -0.0270 0.0012  177 ARG A C   
1372 O O   . ARG A 176 ? 0.3199 0.3231 0.2502 0.0607  -0.0305 -0.0017 177 ARG A O   
1373 C CB  . ARG A 176 ? 0.2857 0.3308 0.2566 0.0705  -0.0325 0.0065  177 ARG A CB  
1374 C CG  . ARG A 176 ? 0.3544 0.3822 0.3219 0.0823  -0.0355 0.0021  177 ARG A CG  
1375 C CD  . ARG A 176 ? 0.3910 0.4323 0.3804 0.0953  -0.0368 0.0013  177 ARG A CD  
1376 N NE  . ARG A 176 ? 0.4072 0.4476 0.4031 0.0942  -0.0488 0.0097  177 ARG A NE  
1377 C CZ  . ARG A 176 ? 0.5050 0.5628 0.5236 0.1020  -0.0525 0.0120  177 ARG A CZ  
1378 N NH1 . ARG A 176 ? 0.4947 0.5736 0.5336 0.1115  -0.0431 0.0059  177 ARG A NH1 
1379 N NH2 . ARG A 176 ? 0.4929 0.5484 0.5138 0.0990  -0.0656 0.0206  177 ARG A NH2 
1380 N N   . LEU A 177 ? 0.3012 0.3430 0.2502 0.0589  -0.0198 0.0001  178 LEU A N   
1381 C CA  . LEU A 177 ? 0.2741 0.3095 0.2091 0.0587  -0.0157 -0.0051 178 LEU A CA  
1382 C C   . LEU A 177 ? 0.3520 0.3702 0.2735 0.0486  -0.0209 -0.0041 178 LEU A C   
1383 O O   . LEU A 177 ? 0.3506 0.3510 0.2566 0.0492  -0.0225 -0.0093 178 LEU A O   
1384 C CB  . LEU A 177 ? 0.2571 0.3139 0.1971 0.0561  -0.0082 -0.0037 178 LEU A CB  
1385 C CG  . LEU A 177 ? 0.3569 0.4098 0.2786 0.0542  -0.0038 -0.0087 178 LEU A CG  
1386 C CD1 . LEU A 177 ? 0.3064 0.3506 0.2202 0.0654  0.0011  -0.0201 178 LEU A CD1 
1387 C CD2 . LEU A 177 ? 0.2944 0.3686 0.2191 0.0484  0.0022  -0.0038 178 LEU A CD2 
1388 N N   . ALA A 178 ? 0.3050 0.3288 0.2343 0.0392  -0.0233 0.0016  179 ALA A N   
1389 C CA  . ALA A 178 ? 0.3231 0.3344 0.2455 0.0294  -0.0275 0.0024  179 ALA A CA  
1390 C C   . ALA A 178 ? 0.3893 0.3781 0.2996 0.0297  -0.0322 0.0004  179 ALA A C   
1391 O O   . ALA A 178 ? 0.4196 0.3927 0.3179 0.0253  -0.0352 -0.0020 179 ALA A O   
1392 C CB  . ALA A 178 ? 0.2481 0.2713 0.1862 0.0206  -0.0275 0.0067  179 ALA A CB  
1393 N N   . LEU A 179 ? 0.2983 0.2852 0.2116 0.0337  -0.0342 0.0024  180 LEU A N   
1394 C CA  . LEU A 179 ? 0.3670 0.3309 0.2684 0.0340  -0.0403 0.0029  180 LEU A CA  
1395 C C   . LEU A 179 ? 0.3351 0.2809 0.2260 0.0425  -0.0418 -0.0031 180 LEU A C   
1396 O O   . LEU A 179 ? 0.4041 0.3275 0.2826 0.0384  -0.0466 -0.0040 180 LEU A O   
1397 C CB  . LEU A 179 ? 0.3314 0.2974 0.2376 0.0371  -0.0443 0.0079  180 LEU A CB  
1398 C CG  . LEU A 179 ? 0.3800 0.3580 0.2907 0.0260  -0.0434 0.0121  180 LEU A CG  
1399 C CD1 . LEU A 179 ? 0.3025 0.2812 0.2133 0.0274  -0.0494 0.0174  180 LEU A CD1 
1400 C CD2 . LEU A 179 ? 0.3934 0.3608 0.2943 0.0123  -0.0431 0.0123  180 LEU A CD2 
1401 N N   . GLN A 180 ? 0.3206 0.2761 0.2170 0.0535  -0.0370 -0.0082 181 GLN A N   
1402 C CA  . GLN A 180 ? 0.3819 0.3223 0.2691 0.0616  -0.0359 -0.0175 181 GLN A CA  
1403 C C   . GLN A 180 ? 0.4213 0.3532 0.2926 0.0526  -0.0354 -0.0216 181 GLN A C   
1404 O O   . GLN A 180 ? 0.4708 0.3804 0.3289 0.0535  -0.0382 -0.0283 181 GLN A O   
1405 C CB  . GLN A 180 ? 0.4101 0.3679 0.3079 0.0739  -0.0279 -0.0235 181 GLN A CB  
1406 C CG  . GLN A 180 ? 0.5548 0.5196 0.4714 0.0847  -0.0303 -0.0205 181 GLN A CG  
1407 C CD  . GLN A 180 ? 0.6360 0.6262 0.5688 0.0943  -0.0208 -0.0253 181 GLN A CD  
1408 O OE1 . GLN A 180 ? 0.6943 0.7009 0.6238 0.0899  -0.0121 -0.0275 181 GLN A OE1 
1409 N NE2 . GLN A 180 ? 0.5506 0.5448 0.5023 0.1067  -0.0230 -0.0259 181 GLN A NE2 
1410 N N   . TRP A 181 ? 0.3301 0.2792 0.2042 0.0436  -0.0331 -0.0174 182 TRP A N   
1411 C CA  . TRP A 181 ? 0.3725 0.3161 0.2343 0.0339  -0.0351 -0.0192 182 TRP A CA  
1412 C C   . TRP A 181 ? 0.3846 0.3077 0.2402 0.0251  -0.0425 -0.0176 182 TRP A C   
1413 O O   . TRP A 181 ? 0.4131 0.3198 0.2547 0.0205  -0.0464 -0.0226 182 TRP A O   
1414 C CB  . TRP A 181 ? 0.3734 0.3397 0.2452 0.0266  -0.0335 -0.0126 182 TRP A CB  
1415 C CG  . TRP A 181 ? 0.4022 0.3663 0.2638 0.0172  -0.0374 -0.0127 182 TRP A CG  
1416 C CD1 . TRP A 181 ? 0.3766 0.3470 0.2260 0.0161  -0.0354 -0.0149 182 TRP A CD1 
1417 C CD2 . TRP A 181 ? 0.3326 0.2891 0.1956 0.0061  -0.0448 -0.0098 182 TRP A CD2 
1418 N NE1 . TRP A 181 ? 0.3410 0.3067 0.1829 0.0051  -0.0432 -0.0126 182 TRP A NE1 
1419 C CE2 . TRP A 181 ? 0.3347 0.2925 0.1872 -0.0005 -0.0490 -0.0098 182 TRP A CE2 
1420 C CE3 . TRP A 181 ? 0.3480 0.2979 0.2200 0.0002  -0.0479 -0.0071 182 TRP A CE3 
1421 C CZ2 . TRP A 181 ? 0.3336 0.2870 0.1884 -0.0118 -0.0577 -0.0070 182 TRP A CZ2 
1422 C CZ3 . TRP A 181 ? 0.3446 0.2912 0.2195 -0.0111 -0.0541 -0.0055 182 TRP A CZ3 
1423 C CH2 . TRP A 181 ? 0.3211 0.2696 0.1893 -0.0164 -0.0597 -0.0053 182 TRP A CH2 
1424 N N   . VAL A 182 ? 0.3649 0.2896 0.2301 0.0213  -0.0442 -0.0110 183 VAL A N   
1425 C CA  . VAL A 182 ? 0.3849 0.2925 0.2449 0.0115  -0.0496 -0.0084 183 VAL A CA  
1426 C C   . VAL A 182 ? 0.4624 0.3411 0.3081 0.0161  -0.0545 -0.0126 183 VAL A C   
1427 O O   . VAL A 182 ? 0.4747 0.3354 0.3101 0.0085  -0.0591 -0.0151 183 VAL A O   
1428 C CB  . VAL A 182 ? 0.3574 0.2732 0.2269 0.0068  -0.0486 -0.0015 183 VAL A CB  
1429 C CG1 . VAL A 182 ? 0.3853 0.2831 0.2466 -0.0043 -0.0527 0.0016  183 VAL A CG1 
1430 C CG2 . VAL A 182 ? 0.3724 0.3135 0.2583 0.0015  -0.0439 0.0006  183 VAL A CG2 
1431 N N   . GLN A 183 ? 0.4046 0.2786 0.2524 0.0285  -0.0545 -0.0136 184 GLN A N   
1432 C CA  . GLN A 183 ? 0.5254 0.3711 0.3642 0.0355  -0.0597 -0.0185 184 GLN A CA  
1433 C C   . GLN A 183 ? 0.5398 0.3737 0.3664 0.0365  -0.0586 -0.0302 184 GLN A C   
1434 O O   . GLN A 183 ? 0.5918 0.3992 0.4073 0.0322  -0.0646 -0.0334 184 GLN A O   
1435 C CB  . GLN A 183 ? 0.5336 0.3808 0.3830 0.0512  -0.0597 -0.0189 184 GLN A CB  
1436 C CG  . GLN A 183 ? 0.5246 0.3726 0.3800 0.0487  -0.0655 -0.0068 184 GLN A CG  
1437 C CD  . GLN A 183 ? 0.5694 0.3895 0.4122 0.0382  -0.0746 0.0000  184 GLN A CD  
1438 O OE1 . GLN A 183 ? 0.5813 0.3735 0.4187 0.0430  -0.0811 -0.0028 184 GLN A OE1 
1439 N NE2 . GLN A 183 ? 0.5401 0.3673 0.3787 0.0231  -0.0745 0.0083  184 GLN A NE2 
1440 N N   . GLU A 184 ? 0.5257 0.3788 0.3525 0.0403  -0.0513 -0.0361 185 GLU A N   
1441 C CA  . GLU A 184 ? 0.5567 0.4002 0.3677 0.0401  -0.0497 -0.0482 185 GLU A CA  
1442 C C   . GLU A 184 ? 0.5812 0.4199 0.3807 0.0243  -0.0552 -0.0469 185 GLU A C   
1443 O O   . GLU A 184 ? 0.5591 0.3782 0.3427 0.0212  -0.0584 -0.0561 185 GLU A O   
1444 C CB  . GLU A 184 ? 0.6083 0.4748 0.4201 0.0473  -0.0396 -0.0542 185 GLU A CB  
1445 C CG  . GLU A 184 ? 0.7703 0.6421 0.5955 0.0638  -0.0334 -0.0588 185 GLU A CG  
1446 C CD  . GLU A 184 ? 0.9354 0.8284 0.7590 0.0695  -0.0215 -0.0673 185 GLU A CD  
1447 O OE1 . GLU A 184 ? 1.0112 0.9101 0.8178 0.0602  -0.0192 -0.0700 185 GLU A OE1 
1448 O OE2 . GLU A 184 ? 0.9764 0.8810 0.8160 0.0825  -0.0149 -0.0706 185 GLU A OE2 
1449 N N   . ASN A 185 ? 0.5365 0.3930 0.3461 0.0143  -0.0565 -0.0364 186 ASN A N   
1450 C CA  . ASN A 185 ? 0.4751 0.3339 0.2798 0.0005  -0.0618 -0.0349 186 ASN A CA  
1451 C C   . ASN A 185 ? 0.5208 0.3762 0.3350 -0.0122 -0.0674 -0.0272 186 ASN A C   
1452 O O   . ASN A 185 ? 0.5842 0.4384 0.3967 -0.0237 -0.0734 -0.0269 186 ASN A O   
1453 C CB  . ASN A 185 ? 0.4773 0.3632 0.2876 -0.0014 -0.0588 -0.0310 186 ASN A CB  
1454 C CG  . ASN A 185 ? 0.4977 0.3894 0.2959 0.0074  -0.0520 -0.0386 186 ASN A CG  
1455 O OD1 . ASN A 185 ? 0.5314 0.4108 0.3090 0.0059  -0.0531 -0.0482 186 ASN A OD1 
1456 N ND2 . ASN A 185 ? 0.3800 0.2912 0.1904 0.0157  -0.0444 -0.0351 186 ASN A ND2 
1457 N N   . VAL A 186 ? 0.5094 0.3650 0.3337 -0.0113 -0.0656 -0.0210 187 VAL A N   
1458 C CA  . VAL A 186 ? 0.4861 0.3453 0.3209 -0.0245 -0.0674 -0.0141 187 VAL A CA  
1459 C C   . VAL A 186 ? 0.5004 0.3366 0.3254 -0.0356 -0.0747 -0.0162 187 VAL A C   
1460 O O   . VAL A 186 ? 0.4704 0.3138 0.3055 -0.0487 -0.0766 -0.0129 187 VAL A O   
1461 C CB  . VAL A 186 ? 0.5216 0.3849 0.3639 -0.0237 -0.0636 -0.0075 187 VAL A CB  
1462 C CG1 . VAL A 186 ? 0.5574 0.3922 0.3863 -0.0225 -0.0682 -0.0064 187 VAL A CG1 
1463 C CG2 . VAL A 186 ? 0.4765 0.3557 0.3339 -0.0369 -0.0608 -0.0027 187 VAL A CG2 
1464 N N   . ALA A 187 ? 0.4716 0.2810 0.2797 -0.0302 -0.0785 -0.0225 188 ALA A N   
1465 C CA  . ALA A 187 ? 0.5550 0.3383 0.3527 -0.0406 -0.0862 -0.0251 188 ALA A CA  
1466 C C   . ALA A 187 ? 0.5550 0.3436 0.3508 -0.0506 -0.0913 -0.0293 188 ALA A C   
1467 O O   . ALA A 187 ? 0.6123 0.3894 0.4076 -0.0639 -0.0977 -0.0286 188 ALA A O   
1468 C CB  . ALA A 187 ? 0.5026 0.2541 0.2851 -0.0309 -0.0894 -0.0325 188 ALA A CB  
1469 N N   . ALA A 188 ? 0.5805 0.3867 0.3752 -0.0454 -0.0894 -0.0326 189 ALA A N   
1470 C CA  . ALA A 188 ? 0.5975 0.4110 0.3902 -0.0556 -0.0965 -0.0343 189 ALA A CA  
1471 C C   . ALA A 188 ? 0.5735 0.4089 0.3913 -0.0674 -0.0988 -0.0249 189 ALA A C   
1472 O O   . ALA A 188 ? 0.6229 0.4624 0.4447 -0.0784 -0.1074 -0.0245 189 ALA A O   
1473 C CB  . ALA A 188 ? 0.4552 0.2816 0.2377 -0.0485 -0.0944 -0.0383 189 ALA A CB  
1474 N N   . PHE A 189 ? 0.5650 0.4151 0.4010 -0.0651 -0.0912 -0.0183 190 PHE A N   
1475 C CA  . PHE A 189 ? 0.5169 0.3874 0.3799 -0.0757 -0.0907 -0.0120 190 PHE A CA  
1476 C C   . PHE A 189 ? 0.5517 0.4100 0.4171 -0.0860 -0.0891 -0.0101 190 PHE A C   
1477 O O   . PHE A 189 ? 0.5881 0.4631 0.4760 -0.0956 -0.0856 -0.0064 190 PHE A O   
1478 C CB  . PHE A 189 ? 0.5030 0.3995 0.3856 -0.0690 -0.0823 -0.0075 190 PHE A CB  
1479 C CG  . PHE A 189 ? 0.4830 0.3921 0.3640 -0.0602 -0.0834 -0.0071 190 PHE A CG  
1480 C CD1 . PHE A 189 ? 0.4890 0.3908 0.3507 -0.0481 -0.0795 -0.0105 190 PHE A CD1 
1481 C CD2 . PHE A 189 ? 0.4877 0.4169 0.3886 -0.0646 -0.0885 -0.0028 190 PHE A CD2 
1482 C CE1 . PHE A 189 ? 0.4921 0.4069 0.3512 -0.0421 -0.0791 -0.0096 190 PHE A CE1 
1483 C CE2 . PHE A 189 ? 0.4256 0.3653 0.3230 -0.0586 -0.0903 -0.0002 190 PHE A CE2 
1484 C CZ  . PHE A 189 ? 0.4392 0.3720 0.3142 -0.0481 -0.0848 -0.0037 190 PHE A CZ  
1485 N N   . GLY A 190 ? 0.6246 0.3387 0.3624 -0.1006 -0.1456 0.0019  191 GLY A N   
1486 C CA  . GLY A 190 ? 0.6481 0.3541 0.3851 -0.1116 -0.1512 0.0084  191 GLY A CA  
1487 C C   . GLY A 190 ? 0.7023 0.4167 0.4536 -0.1006 -0.1440 0.0111  191 GLY A C   
1488 O O   . GLY A 190 ? 0.6718 0.3854 0.4263 -0.1089 -0.1476 0.0179  191 GLY A O   
1489 N N   . GLY A 191 ? 0.6377 0.3609 0.3973 -0.0828 -0.1342 0.0064  192 GLY A N   
1490 C CA  . GLY A 191 ? 0.6328 0.3650 0.4051 -0.0719 -0.1274 0.0086  192 GLY A CA  
1491 C C   . GLY A 191 ? 0.7033 0.4002 0.4565 -0.0635 -0.1263 0.0058  192 GLY A C   
1492 O O   . GLY A 191 ? 0.7999 0.4660 0.5305 -0.0593 -0.1270 -0.0012 192 GLY A O   
1493 N N   . ASP A 192 ? 0.6940 0.3962 0.4565 -0.0606 -0.1244 0.0115  193 ASP A N   
1494 C CA  . ASP A 192 ? 0.6591 0.3325 0.4084 -0.0513 -0.1230 0.0111  193 ASP A CA  
1495 C C   . ASP A 192 ? 0.6689 0.3553 0.4290 -0.0315 -0.1127 0.0083  193 ASP A C   
1496 O O   . ASP A 192 ? 0.6916 0.4073 0.4724 -0.0286 -0.1087 0.0130  193 ASP A O   
1497 C CB  . ASP A 192 ? 0.6902 0.3654 0.4446 -0.0615 -0.1279 0.0211  193 ASP A CB  
1498 C CG  . ASP A 192 ? 0.7644 0.4052 0.5033 -0.0548 -0.1289 0.0227  193 ASP A CG  
1499 O OD1 . ASP A 192 ? 0.8335 0.4511 0.5598 -0.0399 -0.1246 0.0157  193 ASP A OD1 
1500 O OD2 . ASP A 192 ? 0.8213 0.4591 0.5615 -0.0641 -0.1339 0.0316  193 ASP A OD2 
1501 N N   . PRO A 193 ? 0.7304 0.3958 0.4763 -0.0179 -0.1083 0.0005  194 PRO A N   
1502 C CA  . PRO A 193 ? 0.6713 0.3508 0.4280 0.0006  -0.0986 -0.0014 194 PRO A CA  
1503 C C   . PRO A 193 ? 0.6971 0.3732 0.4586 0.0086  -0.0967 0.0047  194 PRO A C   
1504 O O   . PRO A 193 ? 0.6700 0.3655 0.4451 0.0214  -0.0896 0.0055  194 PRO A O   
1505 C CB  . PRO A 193 ? 0.6771 0.3317 0.4140 0.0116  -0.0950 -0.0108 194 PRO A CB  
1506 C CG  . PRO A 193 ? 0.6989 0.3149 0.4104 0.0012  -0.1032 -0.0133 194 PRO A CG  
1507 C CD  . PRO A 193 ? 0.7735 0.4029 0.4926 -0.0194 -0.1117 -0.0069 194 PRO A CD  
1508 N N   . THR A 194 ? 0.7137 0.3664 0.4646 0.0005  -0.1035 0.0098  195 THR A N   
1509 C CA  . THR A 194 ? 0.7277 0.3788 0.4840 0.0064  -0.1029 0.0176  195 THR A CA  
1510 C C   . THR A 194 ? 0.7875 0.4760 0.5661 -0.0023 -0.1034 0.0259  195 THR A C   
1511 O O   . THR A 194 ? 0.8225 0.5217 0.6106 0.0036  -0.1013 0.0323  195 THR A O   
1512 C CB  . THR A 194 ? 0.7830 0.3923 0.5188 0.0016  -0.1102 0.0210  195 THR A CB  
1513 O OG1 . THR A 194 ? 0.8143 0.4189 0.5446 -0.0195 -0.1192 0.0240  195 THR A OG1 
1514 C CG2 . THR A 194 ? 0.6978 0.2680 0.4108 0.0135  -0.1082 0.0119  195 THR A CG2 
1515 N N   . SER A 195 ? 0.7633 0.4722 0.5500 -0.0161 -0.1061 0.0257  196 SER A N   
1516 C CA  . SER A 195 ? 0.7229 0.4675 0.5298 -0.0245 -0.1058 0.0322  196 SER A CA  
1517 C C   . SER A 195 ? 0.6170 0.3962 0.4421 -0.0220 -0.0999 0.0276  196 SER A C   
1518 O O   . SER A 195 ? 0.6055 0.4027 0.4391 -0.0333 -0.1021 0.0280  196 SER A O   
1519 C CB  . SER A 195 ? 0.7576 0.5000 0.5613 -0.0440 -0.1142 0.0383  196 SER A CB  
1520 O OG  . SER A 195 ? 0.7979 0.5759 0.6207 -0.0511 -0.1128 0.0442  196 SER A OG  
1521 N N   . VAL A 196 ? 0.5169 0.3057 0.3489 -0.0071 -0.0926 0.0238  197 VAL A N   
1522 C CA  . VAL A 196 ? 0.4427 0.2621 0.2918 -0.0045 -0.0872 0.0198  197 VAL A CA  
1523 C C   . VAL A 196 ? 0.4401 0.2887 0.3070 -0.0029 -0.0834 0.0238  197 VAL A C   
1524 O O   . VAL A 196 ? 0.5003 0.3468 0.3669 0.0053  -0.0814 0.0270  197 VAL A O   
1525 C CB  . VAL A 196 ? 0.4291 0.2432 0.2748 0.0090  -0.0817 0.0129  197 VAL A CB  
1526 C CG1 . VAL A 196 ? 0.3647 0.2100 0.2290 0.0108  -0.0766 0.0100  197 VAL A CG1 
1527 C CG2 . VAL A 196 ? 0.4207 0.2069 0.2471 0.0066  -0.0853 0.0079  197 VAL A CG2 
1528 N N   . THR A 197 ? 0.4013 0.2770 0.2831 -0.0108 -0.0825 0.0237  198 THR A N   
1529 C CA  . THR A 197 ? 0.4413 0.3457 0.3391 -0.0104 -0.0785 0.0256  198 THR A CA  
1530 C C   . THR A 197 ? 0.3880 0.3133 0.2997 -0.0048 -0.0726 0.0194  198 THR A C   
1531 O O   . THR A 197 ? 0.4335 0.3664 0.3511 -0.0097 -0.0728 0.0163  198 THR A O   
1532 C CB  . THR A 197 ? 0.4427 0.3630 0.3470 -0.0240 -0.0813 0.0302  198 THR A CB  
1533 O OG1 . THR A 197 ? 0.5251 0.4270 0.4170 -0.0304 -0.0872 0.0374  198 THR A OG1 
1534 C CG2 . THR A 197 ? 0.3403 0.2908 0.2596 -0.0233 -0.0764 0.0305  198 THR A CG2 
1535 N N   . LEU A 198 ? 0.3248 0.2592 0.2422 0.0049  -0.0679 0.0184  199 LEU A N   
1536 C CA  . LEU A 198 ? 0.3467 0.3004 0.2774 0.0093  -0.0627 0.0131  199 LEU A CA  
1537 C C   . LEU A 198 ? 0.3403 0.3200 0.2850 0.0027  -0.0608 0.0130  199 LEU A C   
1538 O O   . LEU A 198 ? 0.3580 0.3456 0.3034 0.0003  -0.0611 0.0169  199 LEU A O   
1539 C CB  . LEU A 198 ? 0.3988 0.3543 0.3306 0.0211  -0.0586 0.0128  199 LEU A CB  
1540 C CG  . LEU A 198 ? 0.4882 0.4246 0.4097 0.0310  -0.0575 0.0108  199 LEU A CG  
1541 C CD1 . LEU A 198 ? 0.4064 0.3545 0.3346 0.0418  -0.0524 0.0109  199 LEU A CD1 
1542 C CD2 . LEU A 198 ? 0.5715 0.5052 0.4929 0.0284  -0.0576 0.0059  199 LEU A CD2 
1543 N N   . PHE A 199 ? 0.2992 0.2921 0.2548 0.0000  -0.0588 0.0085  200 PHE A N   
1544 C CA  . PHE A 199 ? 0.3124 0.3297 0.2815 -0.0034 -0.0553 0.0064  200 PHE A CA  
1545 C C   . PHE A 199 ? 0.2692 0.2974 0.2501 0.0011  -0.0509 0.0003  200 PHE A C   
1546 O O   . PHE A 199 ? 0.3060 0.3261 0.2869 0.0040  -0.0513 -0.0016 200 PHE A O   
1547 C CB  . PHE A 199 ? 0.3503 0.3774 0.3226 -0.0139 -0.0570 0.0084  200 PHE A CB  
1548 C CG  . PHE A 199 ? 0.3356 0.3628 0.3126 -0.0179 -0.0585 0.0070  200 PHE A CG  
1549 C CD1 . PHE A 199 ? 0.4019 0.4097 0.3701 -0.0169 -0.0623 0.0077  200 PHE A CD1 
1550 C CD2 . PHE A 199 ? 0.3401 0.3878 0.3302 -0.0229 -0.0560 0.0051  200 PHE A CD2 
1551 C CE1 . PHE A 199 ? 0.4149 0.4248 0.3878 -0.0216 -0.0645 0.0074  200 PHE A CE1 
1552 C CE2 . PHE A 199 ? 0.4216 0.4718 0.4180 -0.0263 -0.0576 0.0050  200 PHE A CE2 
1553 C CZ  . PHE A 199 ? 0.3709 0.4028 0.3589 -0.0261 -0.0623 0.0067  200 PHE A CZ  
1554 N N   . GLY A 200 ? 0.2650 0.3108 0.2550 0.0013  -0.0471 -0.0025 201 GLY A N   
1555 C CA  . GLY A 200 ? 0.2469 0.3020 0.2481 0.0046  -0.0433 -0.0081 201 GLY A CA  
1556 C C   . GLY A 200 ? 0.2240 0.2981 0.2339 0.0014  -0.0397 -0.0120 201 GLY A C   
1557 O O   . GLY A 200 ? 0.2339 0.3155 0.2400 -0.0024 -0.0400 -0.0099 201 GLY A O   
1558 N N   . GLU A 201 ? 0.2279 0.3093 0.2485 0.0028  -0.0365 -0.0179 202 GLU A N   
1559 C CA  . GLU A 201 ? 0.2116 0.3089 0.2396 -0.0004 -0.0327 -0.0235 202 GLU A CA  
1560 C C   . GLU A 201 ? 0.2592 0.3590 0.2923 0.0030  -0.0306 -0.0274 202 GLU A C   
1561 O O   . GLU A 201 ? 0.2220 0.3136 0.2580 0.0074  -0.0309 -0.0271 202 GLU A O   
1562 C CB  . GLU A 201 ? 0.1940 0.2976 0.2311 -0.0031 -0.0306 -0.0273 202 GLU A CB  
1563 C CG  . GLU A 201 ? 0.2920 0.4113 0.3354 -0.0062 -0.0259 -0.0343 202 GLU A CG  
1564 C CD  . GLU A 201 ? 0.4729 0.5927 0.5250 -0.0030 -0.0226 -0.0415 202 GLU A CD  
1565 O OE1 . GLU A 201 ? 0.4133 0.5227 0.4685 0.0013  -0.0241 -0.0401 202 GLU A OE1 
1566 O OE2 . GLU A 201 ? 0.5090 0.6390 0.5637 -0.0054 -0.0188 -0.0485 202 GLU A OE2 
1567 N N   . SGB A 202 ? 0.3501 0.4615 0.3832 0.0002  -0.0288 -0.0304 203 SGB A N   
1568 C CA  . SGB A 202 ? 0.3977 0.5128 0.4349 0.0014  -0.0276 -0.0336 203 SGB A CA  
1569 C C   . SGB A 202 ? 0.2955 0.4042 0.3292 0.0067  -0.0298 -0.0273 203 SGB A C   
1570 O O   . SGB A 202 ? 0.2835 0.3916 0.3095 0.0083  -0.0320 -0.0212 203 SGB A O   
1571 C CB  . SGB A 202 ? 0.5065 0.6198 0.5544 0.0018  -0.0248 -0.0406 203 SGB A CB  
1572 O OG  . SGB A 202 ? 0.6149 0.7344 0.6665 -0.0006 -0.0230 -0.0462 203 SGB A OG  
1573 O O1  . SGB A 202 ? 0.2240 0.3273 0.2839 0.0071  -0.0248 -0.0413 203 SGB A O1  
1574 P P1  . SGB A 202 ? 0.3096 0.4223 0.3699 0.0016  -0.0225 -0.0486 203 SGB A P1  
1575 C C1  . SGB A 202 ? 0.2852 0.4075 0.3435 -0.0033 -0.0230 -0.0506 203 SGB A C1  
1576 O O2  . SGB A 202 ? 0.5042 0.6152 0.5734 0.0009  -0.0190 -0.0571 203 SGB A O2  
1577 C C2  . SGB A 202 ? 0.5154 0.6174 0.5940 0.0036  -0.0186 -0.0585 203 SGB A C2  
1578 C C4  . SGB A 202 ? 0.4429 0.5441 0.5300 0.0046  -0.0150 -0.0655 203 SGB A C4  
1579 C C3  . SGB A 202 ? 0.4867 0.5885 0.5668 0.0005  -0.0190 -0.0611 203 SGB A C3  
1580 N N   . ALA A 203 ? 0.2010 0.3055 0.2406 0.0099  -0.0292 -0.0283 204 ALA A N   
1581 C CA  . ALA A 203 ? 0.1565 0.2552 0.1929 0.0160  -0.0304 -0.0223 204 ALA A CA  
1582 C C   . ALA A 203 ? 0.2583 0.3441 0.2858 0.0202  -0.0324 -0.0174 204 ALA A C   
1583 O O   . ALA A 203 ? 0.2142 0.2954 0.2355 0.0257  -0.0332 -0.0123 204 ALA A O   
1584 C CB  . ALA A 203 ? 0.1850 0.2810 0.2289 0.0178  -0.0294 -0.0238 204 ALA A CB  
1585 N N   . GLY A 204 ? 0.2390 0.3189 0.2660 0.0176  -0.0331 -0.0191 205 GLY A N   
1586 C CA  . GLY A 204 ? 0.2367 0.3037 0.2539 0.0193  -0.0357 -0.0148 205 GLY A CA  
1587 C C   . GLY A 204 ? 0.3091 0.3766 0.3177 0.0185  -0.0374 -0.0106 205 GLY A C   
1588 O O   . GLY A 204 ? 0.2604 0.3159 0.2593 0.0228  -0.0394 -0.0058 205 GLY A O   
1589 N N   . ALA A 205 ? 0.2095 0.2903 0.2211 0.0131  -0.0366 -0.0122 206 ALA A N   
1590 C CA  . ALA A 205 ? 0.2020 0.2857 0.2063 0.0115  -0.0385 -0.0071 206 ALA A CA  
1591 C C   . ALA A 205 ? 0.2708 0.3570 0.2732 0.0174  -0.0388 -0.0028 206 ALA A C   
1592 O O   . ALA A 205 ? 0.2611 0.3400 0.2556 0.0211  -0.0410 0.0037  206 ALA A O   
1593 C CB  . ALA A 205 ? 0.1786 0.2780 0.1859 0.0038  -0.0373 -0.0101 206 ALA A CB  
1594 N N   . ALA A 206 ? 0.2200 0.3165 0.2301 0.0183  -0.0366 -0.0058 207 ALA A N   
1595 C CA  . ALA A 206 ? 0.2623 0.3638 0.2726 0.0241  -0.0367 -0.0010 207 ALA A CA  
1596 C C   . ALA A 206 ? 0.2697 0.3559 0.2744 0.0335  -0.0367 0.0031  207 ALA A C   
1597 O O   . ALA A 206 ? 0.3354 0.4209 0.3362 0.0398  -0.0374 0.0093  207 ALA A O   
1598 C CB  . ALA A 206 ? 0.1689 0.2832 0.1887 0.0220  -0.0347 -0.0049 207 ALA A CB  
1599 N N   . SER A 207 ? 0.2364 0.3106 0.2405 0.0347  -0.0360 -0.0003 208 SER A N   
1600 C CA  . SER A 207 ? 0.2431 0.3017 0.2395 0.0428  -0.0358 0.0022  208 SER A CA  
1601 C C   . SER A 207 ? 0.3059 0.3500 0.2906 0.0449  -0.0384 0.0063  208 SER A C   
1602 O O   . SER A 207 ? 0.2485 0.2839 0.2264 0.0536  -0.0381 0.0104  208 SER A O   
1603 C CB  . SER A 207 ? 0.2157 0.2645 0.2122 0.0415  -0.0355 -0.0020 208 SER A CB  
1604 O OG  . SER A 207 ? 0.2751 0.3340 0.2820 0.0402  -0.0334 -0.0048 208 SER A OG  
1605 N N   . VAL A 208 ? 0.2703 0.3115 0.2526 0.0372  -0.0409 0.0055  209 VAL A N   
1606 C CA  . VAL A 208 ? 0.2530 0.2797 0.2242 0.0371  -0.0442 0.0100  209 VAL A CA  
1607 C C   . VAL A 208 ? 0.3230 0.3546 0.2926 0.0421  -0.0447 0.0164  209 VAL A C   
1608 O O   . VAL A 208 ? 0.4134 0.4293 0.3740 0.0492  -0.0458 0.0208  209 VAL A O   
1609 C CB  . VAL A 208 ? 0.2595 0.2888 0.2308 0.0264  -0.0467 0.0093  209 VAL A CB  
1610 C CG1 . VAL A 208 ? 0.2609 0.2769 0.2211 0.0249  -0.0507 0.0157  209 VAL A CG1 
1611 C CG2 . VAL A 208 ? 0.2393 0.2631 0.2122 0.0223  -0.0469 0.0046  209 VAL A CG2 
1612 N N   . GLY A 209 ? 0.2566 0.3097 0.2350 0.0386  -0.0439 0.0170  210 GLY A N   
1613 C CA  . GLY A 209 ? 0.2871 0.3492 0.2657 0.0423  -0.0449 0.0242  210 GLY A CA  
1614 C C   . GLY A 209 ? 0.3038 0.3624 0.2824 0.0547  -0.0428 0.0276  210 GLY A C   
1615 O O   . GLY A 209 ? 0.3664 0.4197 0.3407 0.0620  -0.0440 0.0347  210 GLY A O   
1616 N N   . MET A 210 ? 0.2778 0.3396 0.2616 0.0576  -0.0395 0.0229  211 MET A N   
1617 C CA  . MET A 210 ? 0.3665 0.4285 0.3511 0.0692  -0.0366 0.0259  211 MET A CA  
1618 C C   . MET A 210 ? 0.3816 0.4183 0.3537 0.0784  -0.0362 0.0268  211 MET A C   
1619 O O   . MET A 210 ? 0.4002 0.4349 0.3706 0.0897  -0.0344 0.0317  211 MET A O   
1620 C CB  . MET A 210 ? 0.3465 0.4193 0.3395 0.0684  -0.0334 0.0213  211 MET A CB  
1621 C CG  . MET A 210 ? 0.3576 0.4544 0.3622 0.0608  -0.0337 0.0211  211 MET A CG  
1622 S SD  . MET A 210 ? 0.4883 0.5959 0.5030 0.0579  -0.0309 0.0164  211 MET A SD  
1623 C CE  . MET A 210 ? 0.2952 0.4223 0.3185 0.0451  -0.0329 0.0134  211 MET A CE  
1624 N N   . HIS A 211 ? 0.2586 0.2761 0.2219 0.0738  -0.0379 0.0221  212 HIS A N   
1625 C CA  . HIS A 211 ? 0.2910 0.2814 0.2397 0.0805  -0.0386 0.0223  212 HIS A CA  
1626 C C   . HIS A 211 ? 0.3895 0.3703 0.3322 0.0829  -0.0418 0.0292  212 HIS A C   
1627 O O   . HIS A 211 ? 0.3269 0.2883 0.2597 0.0929  -0.0413 0.0313  212 HIS A O   
1628 C CB  . HIS A 211 ? 0.2713 0.2449 0.2119 0.0729  -0.0407 0.0165  212 HIS A CB  
1629 C CG  . HIS A 211 ? 0.3830 0.3618 0.3276 0.0726  -0.0378 0.0110  212 HIS A CG  
1630 N ND1 . HIS A 211 ? 0.3829 0.3539 0.3215 0.0822  -0.0343 0.0094  212 HIS A ND1 
1631 C CD2 . HIS A 211 ? 0.2794 0.2705 0.2333 0.0642  -0.0379 0.0073  212 HIS A CD2 
1632 C CE1 . HIS A 211 ? 0.4033 0.3824 0.3474 0.0787  -0.0328 0.0057  212 HIS A CE1 
1633 N NE2 . HIS A 211 ? 0.2951 0.2854 0.2488 0.0682  -0.0351 0.0044  212 HIS A NE2 
1634 N N   . LEU A 212 ? 0.2758 0.2699 0.2240 0.0740  -0.0449 0.0326  213 LEU A N   
1635 C CA  . LEU A 212 ? 0.4047 0.3939 0.3490 0.0751  -0.0484 0.0409  213 LEU A CA  
1636 C C   . LEU A 212 ? 0.4200 0.4177 0.3689 0.0879  -0.0464 0.0477  213 LEU A C   
1637 O O   . LEU A 212 ? 0.4694 0.4540 0.4124 0.0947  -0.0483 0.0545  213 LEU A O   
1638 C CB  . LEU A 212 ? 0.4312 0.4385 0.3812 0.0624  -0.0516 0.0432  213 LEU A CB  
1639 C CG  . LEU A 212 ? 0.5807 0.5749 0.5230 0.0513  -0.0554 0.0421  213 LEU A CG  
1640 C CD1 . LEU A 212 ? 0.5482 0.5640 0.4964 0.0397  -0.0573 0.0443  213 LEU A CD1 
1641 C CD2 . LEU A 212 ? 0.6367 0.6033 0.5659 0.0555  -0.0591 0.0479  213 LEU A CD2 
1642 N N   . LEU A 213 ? 0.4204 0.4405 0.3806 0.0910  -0.0426 0.0465  214 LEU A N   
1643 C CA  . LEU A 213 ? 0.3296 0.3665 0.2980 0.1009  -0.0411 0.0544  214 LEU A CA  
1644 C C   . LEU A 213 ? 0.3992 0.4312 0.3672 0.1153  -0.0355 0.0531  214 LEU A C   
1645 O O   . LEU A 213 ? 0.5056 0.5540 0.4820 0.1249  -0.0332 0.0594  214 LEU A O   
1646 C CB  . LEU A 213 ? 0.2592 0.3286 0.2411 0.0923  -0.0414 0.0552  214 LEU A CB  
1647 C CG  . LEU A 213 ? 0.2937 0.3710 0.2755 0.0779  -0.0459 0.0553  214 LEU A CG  
1648 C CD1 . LEU A 213 ? 0.2654 0.3714 0.2583 0.0690  -0.0456 0.0532  214 LEU A CD1 
1649 C CD2 . LEU A 213 ? 0.3418 0.4162 0.3198 0.0797  -0.0502 0.0657  214 LEU A CD2 
1650 N N   . SER A 214 ? 0.4080 0.4194 0.3664 0.1165  -0.0334 0.0453  215 SER A N   
1651 C CA  . SER A 214 ? 0.4107 0.4151 0.3656 0.1299  -0.0277 0.0431  215 SER A CA  
1652 C C   . SER A 214 ? 0.4669 0.4359 0.4042 0.1370  -0.0282 0.0410  215 SER A C   
1653 O O   . SER A 214 ? 0.5074 0.4565 0.4338 0.1288  -0.0308 0.0348  215 SER A O   
1654 C CB  . SER A 214 ? 0.3544 0.3654 0.3116 0.1247  -0.0248 0.0354  215 SER A CB  
1655 O OG  . SER A 214 ? 0.4331 0.4388 0.3859 0.1371  -0.0190 0.0335  215 SER A OG  
1656 N N   . PRO A 215 ? 0.4409 0.4017 0.3755 0.1521  -0.0259 0.0464  216 PRO A N   
1657 C CA  . PRO A 215 ? 0.5586 0.4827 0.4756 0.1603  -0.0264 0.0448  216 PRO A CA  
1658 C C   . PRO A 215 ? 0.5825 0.4813 0.4832 0.1592  -0.0246 0.0340  216 PRO A C   
1659 O O   . PRO A 215 ? 0.5710 0.4411 0.4571 0.1532  -0.0291 0.0309  216 PRO A O   
1660 C CB  . PRO A 215 ? 0.5309 0.4588 0.4522 0.1798  -0.0215 0.0514  216 PRO A CB  
1661 C CG  . PRO A 215 ? 0.4929 0.4569 0.4338 0.1765  -0.0235 0.0612  216 PRO A CG  
1662 C CD  . PRO A 215 ? 0.5107 0.4975 0.4599 0.1610  -0.0241 0.0560  216 PRO A CD  
1663 N N   . PRO A 216 ? 0.5093 0.4194 0.4121 0.1638  -0.0186 0.0289  217 PRO A N   
1664 C CA  . PRO A 216 ? 0.5706 0.4589 0.4573 0.1618  -0.0173 0.0191  217 PRO A CA  
1665 C C   . PRO A 216 ? 0.5581 0.4395 0.4410 0.1432  -0.0239 0.0151  217 PRO A C   
1666 O O   . PRO A 216 ? 0.6889 0.5433 0.5549 0.1397  -0.0261 0.0091  217 PRO A O   
1667 C CB  . PRO A 216 ? 0.5301 0.4423 0.4251 0.1665  -0.0105 0.0170  217 PRO A CB  
1668 C CG  . PRO A 216 ? 0.4866 0.4243 0.3976 0.1774  -0.0068 0.0256  217 PRO A CG  
1669 C CD  . PRO A 216 ? 0.4257 0.3698 0.3453 0.1696  -0.0133 0.0325  217 PRO A CD  
1670 N N   . SER A 217 ? 0.5011 0.4067 0.3992 0.1317  -0.0270 0.0183  218 SER A N   
1671 C CA  . SER A 217 ? 0.5167 0.4188 0.4135 0.1151  -0.0327 0.0153  218 SER A CA  
1672 C C   . SER A 217 ? 0.5485 0.4316 0.4373 0.1091  -0.0389 0.0186  218 SER A C   
1673 O O   . SER A 217 ? 0.5362 0.4035 0.4160 0.0985  -0.0436 0.0154  218 SER A O   
1674 C CB  . SER A 217 ? 0.4275 0.3612 0.3428 0.1055  -0.0331 0.0166  218 SER A CB  
1675 O OG  . SER A 217 ? 0.4151 0.3640 0.3372 0.1074  -0.0287 0.0134  218 SER A OG  
1676 N N   . ARG A 218 ? 0.6434 0.5290 0.5360 0.1157  -0.0394 0.0261  219 ARG A N   
1677 C CA  . ARG A 218 ? 0.6459 0.5208 0.5349 0.1086  -0.0456 0.0318  219 ARG A CA  
1678 C C   . ARG A 218 ? 0.5862 0.4225 0.4551 0.1075  -0.0494 0.0292  219 ARG A C   
1679 O O   . ARG A 218 ? 0.6302 0.4563 0.4943 0.0958  -0.0556 0.0319  219 ARG A O   
1680 C CB  . ARG A 218 ? 0.6179 0.5055 0.5160 0.1168  -0.0454 0.0416  219 ARG A CB  
1681 C CG  . ARG A 218 ? 0.6363 0.5153 0.5314 0.1094  -0.0520 0.0494  219 ARG A CG  
1682 C CD  . ARG A 218 ? 0.6463 0.5426 0.5476 0.0913  -0.0559 0.0489  219 ARG A CD  
1683 N NE  . ARG A 218 ? 0.7817 0.6666 0.6770 0.0822  -0.0624 0.0556  219 ARG A NE  
1684 C CZ  . ARG A 218 ? 0.7208 0.5832 0.6042 0.0725  -0.0668 0.0535  219 ARG A CZ  
1685 N NH1 . ARG A 218 ? 0.7091 0.5578 0.5849 0.0706  -0.0657 0.0446  219 ARG A NH1 
1686 N NH2 . ARG A 218 ? 0.6698 0.5247 0.5488 0.0636  -0.0727 0.0610  219 ARG A NH2 
1687 N N   . GLY A 219 ? 0.4714 0.2863 0.3276 0.1188  -0.0456 0.0238  220 GLY A N   
1688 C CA  . GLY A 219 ? 0.4825 0.2585 0.3172 0.1169  -0.0492 0.0195  220 GLY A CA  
1689 C C   . GLY A 219 ? 0.5690 0.3379 0.3955 0.1028  -0.0525 0.0123  220 GLY A C   
1690 O O   . GLY A 219 ? 0.6269 0.3642 0.4349 0.0983  -0.0567 0.0088  220 GLY A O   
1691 N N   . LEU A 220 ? 0.5006 0.2981 0.3407 0.0954  -0.0512 0.0104  221 LEU A N   
1692 C CA  . LEU A 220 ? 0.4868 0.2811 0.3216 0.0833  -0.0541 0.0045  221 LEU A CA  
1693 C C   . LEU A 220 ? 0.5498 0.3533 0.3914 0.0663  -0.0605 0.0080  221 LEU A C   
1694 O O   . LEU A 220 ? 0.5665 0.3704 0.4061 0.0556  -0.0635 0.0046  221 LEU A O   
1695 C CB  . LEU A 220 ? 0.4321 0.2494 0.2767 0.0861  -0.0487 0.0003  221 LEU A CB  
1696 C CG  . LEU A 220 ? 0.4929 0.3106 0.3348 0.1025  -0.0410 -0.0023 221 LEU A CG  
1697 C CD1 . LEU A 220 ? 0.3843 0.2284 0.2384 0.1022  -0.0368 -0.0044 221 LEU A CD1 
1698 C CD2 . LEU A 220 ? 0.4430 0.2267 0.2610 0.1086  -0.0405 -0.0084 221 LEU A CD2 
1699 N N   . PHE A 221 ? 0.5410 0.3538 0.3909 0.0638  -0.0625 0.0152  222 PHE A N   
1700 C CA  . PHE A 221 ? 0.5171 0.3394 0.3726 0.0481  -0.0680 0.0188  222 PHE A CA  
1701 C C   . PHE A 221 ? 0.4883 0.3060 0.3432 0.0460  -0.0716 0.0273  222 PHE A C   
1702 O O   . PHE A 221 ? 0.5294 0.3416 0.3833 0.0574  -0.0697 0.0312  222 PHE A O   
1703 C CB  . PHE A 221 ? 0.4386 0.2962 0.3136 0.0429  -0.0652 0.0177  222 PHE A CB  
1704 C CG  . PHE A 221 ? 0.4263 0.3075 0.3151 0.0501  -0.0609 0.0211  222 PHE A CG  
1705 C CD1 . PHE A 221 ? 0.4292 0.3167 0.3217 0.0629  -0.0552 0.0190  222 PHE A CD1 
1706 C CD2 . PHE A 221 ? 0.4688 0.3677 0.3669 0.0432  -0.0627 0.0267  222 PHE A CD2 
1707 C CE1 . PHE A 221 ? 0.4479 0.3589 0.3537 0.0683  -0.0520 0.0229  222 PHE A CE1 
1708 C CE2 . PHE A 221 ? 0.4656 0.3870 0.3755 0.0486  -0.0595 0.0298  222 PHE A CE2 
1709 C CZ  . PHE A 221 ? 0.4254 0.3528 0.3394 0.0609  -0.0544 0.0281  222 PHE A CZ  
1710 N N   . HIS A 222 ? 0.5006 0.3226 0.3570 0.0314  -0.0769 0.0311  223 HIS A N   
1711 C CA  . HIS A 222 ? 0.5462 0.3610 0.3995 0.0270  -0.0815 0.0401  223 HIS A CA  
1712 C C   . HIS A 222 ? 0.5144 0.3622 0.3834 0.0199  -0.0811 0.0458  223 HIS A C   
1713 O O   . HIS A 222 ? 0.5208 0.3723 0.3918 0.0226  -0.0821 0.0535  223 HIS A O   
1714 C CB  . HIS A 222 ? 0.6358 0.4230 0.4736 0.0151  -0.0889 0.0416  223 HIS A CB  
1715 C CG  . HIS A 222 ? 0.7424 0.5166 0.5746 0.0108  -0.0943 0.0517  223 HIS A CG  
1716 N ND1 . HIS A 222 ? 0.8019 0.5823 0.6351 -0.0057 -0.1000 0.0581  223 HIS A ND1 
1717 C CD2 . HIS A 222 ? 0.8196 0.5762 0.6459 0.0210  -0.0948 0.0575  223 HIS A CD2 
1718 C CE1 . HIS A 222 ? 0.8679 0.6343 0.6952 -0.0064 -0.1041 0.0676  223 HIS A CE1 
1719 N NE2 . HIS A 222 ? 0.8997 0.6508 0.7230 0.0100  -0.1013 0.0675  223 HIS A NE2 
1720 N N   . ARG A 223 ? 0.5008 0.3724 0.3805 0.0110  -0.0798 0.0420  224 ARG A N   
1721 C CA  . ARG A 223 ? 0.4309 0.3334 0.3239 0.0034  -0.0788 0.0455  224 ARG A CA  
1722 C C   . ARG A 223 ? 0.3910 0.3205 0.2986 0.0054  -0.0730 0.0384  224 ARG A C   
1723 O O   . ARG A 223 ? 0.4305 0.3558 0.3386 0.0093  -0.0707 0.0316  224 ARG A O   
1724 C CB  . ARG A 223 ? 0.3575 0.2623 0.2489 -0.0125 -0.0837 0.0490  224 ARG A CB  
1725 C CG  . ARG A 223 ? 0.3875 0.2718 0.2671 -0.0175 -0.0899 0.0582  224 ARG A CG  
1726 C CD  . ARG A 223 ? 0.4467 0.3281 0.3224 -0.0335 -0.0953 0.0614  224 ARG A CD  
1727 N NE  . ARG A 223 ? 0.5906 0.4477 0.4534 -0.0378 -0.1018 0.0708  224 ARG A NE  
1728 C CZ  . ARG A 223 ? 0.6418 0.4747 0.4922 -0.0477 -0.1085 0.0736  224 ARG A CZ  
1729 N NH1 . ARG A 223 ? 0.5415 0.3732 0.3909 -0.0551 -0.1099 0.0682  224 ARG A NH1 
1730 N NH2 . ARG A 223 ? 0.8136 0.6234 0.6528 -0.0507 -0.1144 0.0827  224 ARG A NH2 
1731 N N   . ALA A 224 ? 0.3639 0.3204 0.2826 0.0019  -0.0708 0.0400  225 ALA A N   
1732 C CA  . ALA A 224 ? 0.2831 0.2632 0.2151 0.0043  -0.0654 0.0333  225 ALA A CA  
1733 C C   . ALA A 224 ? 0.3512 0.3566 0.2927 -0.0060 -0.0641 0.0322  225 ALA A C   
1734 O O   . ALA A 224 ? 0.4260 0.4396 0.3660 -0.0125 -0.0661 0.0383  225 ALA A O   
1735 C CB  . ALA A 224 ? 0.2921 0.2798 0.2280 0.0148  -0.0624 0.0345  225 ALA A CB  
1736 N N   . VAL A 225 ? 0.3117 0.3295 0.2629 -0.0071 -0.0605 0.0246  226 VAL A N   
1737 C CA  . VAL A 225 ? 0.2628 0.3055 0.2244 -0.0143 -0.0575 0.0213  226 VAL A CA  
1738 C C   . VAL A 225 ? 0.2961 0.3527 0.2680 -0.0088 -0.0523 0.0140  226 VAL A C   
1739 O O   . VAL A 225 ? 0.3212 0.3713 0.2964 -0.0036 -0.0509 0.0094  226 VAL A O   
1740 C CB  . VAL A 225 ? 0.2835 0.3275 0.2484 -0.0215 -0.0581 0.0191  226 VAL A CB  
1741 C CG1 . VAL A 225 ? 0.2234 0.2935 0.1996 -0.0270 -0.0538 0.0149  226 VAL A CG1 
1742 C CG2 . VAL A 225 ? 0.2537 0.2830 0.2079 -0.0287 -0.0640 0.0267  226 VAL A CG2 
1743 N N   . LEU A 226 ? 0.2800 0.3555 0.2562 -0.0107 -0.0501 0.0134  227 LEU A N   
1744 C CA  . LEU A 226 ? 0.2464 0.3349 0.2314 -0.0073 -0.0458 0.0067  227 LEU A CA  
1745 C C   . LEU A 226 ? 0.2450 0.3530 0.2373 -0.0142 -0.0422 0.0005  227 LEU A C   
1746 O O   . LEU A 226 ? 0.2614 0.3830 0.2513 -0.0201 -0.0420 0.0023  227 LEU A O   
1747 C CB  . LEU A 226 ? 0.2544 0.3484 0.2374 -0.0032 -0.0464 0.0106  227 LEU A CB  
1748 C CG  . LEU A 226 ? 0.3262 0.4042 0.3044 0.0064  -0.0482 0.0155  227 LEU A CG  
1749 C CD1 . LEU A 226 ? 0.3317 0.3962 0.2995 0.0064  -0.0526 0.0243  227 LEU A CD1 
1750 C CD2 . LEU A 226 ? 0.3153 0.4057 0.2982 0.0112  -0.0468 0.0162  227 LEU A CD2 
1751 N N   . GLN A 227 ? 0.2471 0.3564 0.2480 -0.0131 -0.0391 -0.0068 228 GLN A N   
1752 C CA  . GLN A 227 ? 0.2393 0.3649 0.2477 -0.0179 -0.0348 -0.0138 228 GLN A CA  
1753 C C   . GLN A 227 ? 0.2337 0.3672 0.2483 -0.0156 -0.0312 -0.0214 228 GLN A C   
1754 O O   . GLN A 227 ? 0.2746 0.4003 0.2947 -0.0104 -0.0305 -0.0244 228 GLN A O   
1755 C CB  . GLN A 227 ? 0.2075 0.3294 0.2227 -0.0182 -0.0340 -0.0160 228 GLN A CB  
1756 C CG  . GLN A 227 ? 0.3849 0.4991 0.3936 -0.0225 -0.0383 -0.0083 228 GLN A CG  
1757 C CD  . GLN A 227 ? 0.4805 0.5898 0.4952 -0.0226 -0.0391 -0.0089 228 GLN A CD  
1758 O OE1 . GLN A 227 ? 0.4470 0.5442 0.4553 -0.0252 -0.0439 -0.0029 228 GLN A OE1 
1759 N NE2 . GLN A 227 ? 0.4915 0.6096 0.5185 -0.0202 -0.0347 -0.0158 228 GLN A NE2 
1760 N N   . SER A 228 ? 0.2325 0.3812 0.2455 -0.0202 -0.0292 -0.0243 229 SER A N   
1761 C CA  . SER A 228 ? 0.2732 0.4294 0.2913 -0.0200 -0.0259 -0.0329 229 SER A CA  
1762 C C   . SER A 228 ? 0.2501 0.3988 0.2697 -0.0148 -0.0278 -0.0313 229 SER A C   
1763 O O   . SER A 228 ? 0.2820 0.4286 0.3087 -0.0129 -0.0256 -0.0376 229 SER A O   
1764 C CB  . SER A 228 ? 0.1958 0.3525 0.2237 -0.0191 -0.0212 -0.0422 229 SER A CB  
1765 O OG  . SER A 228 ? 0.2911 0.4577 0.3194 -0.0232 -0.0183 -0.0441 229 SER A OG  
1766 N N   . GLY A 229 ? 0.2016 0.3466 0.2149 -0.0124 -0.0317 -0.0224 230 GLY A N   
1767 C CA  . GLY A 229 ? 0.1783 0.3193 0.1933 -0.0069 -0.0330 -0.0198 230 GLY A CA  
1768 C C   . GLY A 229 ? 0.2410 0.3798 0.2490 -0.0036 -0.0368 -0.0094 230 GLY A C   
1769 O O   . GLY A 229 ? 0.2745 0.4088 0.2759 -0.0048 -0.0389 -0.0041 230 GLY A O   
1770 N N   . ALA A 230 ? 0.1770 0.3191 0.1867 0.0006  -0.0377 -0.0061 231 ALA A N   
1771 C CA  . ALA A 230 ? 0.1832 0.3254 0.1882 0.0054  -0.0408 0.0040  231 ALA A CA  
1772 C C   . ALA A 230 ? 0.2933 0.4372 0.3036 0.0121  -0.0403 0.0060  231 ALA A C   
1773 O O   . ALA A 230 ? 0.2439 0.3960 0.2608 0.0091  -0.0386 0.0004  231 ALA A O   
1774 C CB  . ALA A 230 ? 0.1874 0.3465 0.1890 -0.0012 -0.0429 0.0076  231 ALA A CB  
1775 N N   . PRO A 231 ? 0.3174 0.4538 0.3248 0.0211  -0.0416 0.0140  232 PRO A N   
1776 C CA  . PRO A 231 ? 0.2992 0.4389 0.3117 0.0288  -0.0404 0.0170  232 PRO A CA  
1777 C C   . PRO A 231 ? 0.3548 0.5173 0.3732 0.0251  -0.0416 0.0201  232 PRO A C   
1778 O O   . PRO A 231 ? 0.4053 0.5761 0.4307 0.0272  -0.0403 0.0203  232 PRO A O   
1779 C CB  . PRO A 231 ? 0.3276 0.4540 0.3337 0.0394  -0.0413 0.0250  232 PRO A CB  
1780 C CG  . PRO A 231 ? 0.2860 0.4094 0.2849 0.0353  -0.0445 0.0290  232 PRO A CG  
1781 C CD  . PRO A 231 ? 0.2847 0.4092 0.2834 0.0245  -0.0441 0.0210  232 PRO A CD  
1782 N N   . ASN A 232 ? 0.2527 0.4264 0.2679 0.0187  -0.0443 0.0229  233 ASN A N   
1783 C CA  . ASN A 232 ? 0.2963 0.4931 0.3157 0.0133  -0.0465 0.0260  233 ASN A CA  
1784 C C   . ASN A 232 ? 0.2872 0.4945 0.3096 0.0018  -0.0456 0.0160  233 ASN A C   
1785 O O   . ASN A 232 ? 0.3025 0.5284 0.3277 -0.0042 -0.0478 0.0177  233 ASN A O   
1786 C CB  . ASN A 232 ? 0.1915 0.3973 0.2055 0.0113  -0.0504 0.0348  233 ASN A CB  
1787 C CG  . ASN A 232 ? 0.2562 0.4521 0.2618 0.0060  -0.0507 0.0319  233 ASN A CG  
1788 O OD1 . ASN A 232 ? 0.3526 0.5291 0.3552 0.0096  -0.0490 0.0289  233 ASN A OD1 
1789 N ND2 . ASN A 232 ? 0.2196 0.4300 0.2209 -0.0034 -0.0531 0.0332  233 ASN A ND2 
1790 N N   . GLY A 233 ? 0.3970 0.5927 0.4192 -0.0014 -0.0427 0.0058  234 GLY A N   
1791 C CA  . GLY A 233 ? 0.6109 0.8125 0.6365 -0.0103 -0.0413 -0.0043 234 GLY A CA  
1792 C C   . GLY A 233 ? 0.6336 0.8441 0.6668 -0.0109 -0.0419 -0.0031 234 GLY A C   
1793 O O   . GLY A 233 ? 0.7145 0.9212 0.7524 -0.0025 -0.0413 0.0025  234 GLY A O   
1794 N N   . PRO A 234 ? 0.4036 0.6261 0.4376 -0.0214 -0.0431 -0.0086 235 PRO A N   
1795 C CA  . PRO A 234 ? 0.2561 0.4886 0.2973 -0.0245 -0.0446 -0.0070 235 PRO A CA  
1796 C C   . PRO A 234 ? 0.2246 0.4437 0.2728 -0.0212 -0.0419 -0.0111 235 PRO A C   
1797 O O   . PRO A 234 ? 0.2629 0.4893 0.3175 -0.0241 -0.0430 -0.0090 235 PRO A O   
1798 C CB  . PRO A 234 ? 0.2280 0.4710 0.2653 -0.0382 -0.0465 -0.0148 235 PRO A CB  
1799 C CG  . PRO A 234 ? 0.2448 0.4777 0.2749 -0.0407 -0.0435 -0.0246 235 PRO A CG  
1800 C CD  . PRO A 234 ? 0.2257 0.4521 0.2531 -0.0314 -0.0428 -0.0175 235 PRO A CD  
1801 N N   . TRP A 235 ? 0.1974 0.3984 0.2447 -0.0158 -0.0387 -0.0156 236 TRP A N   
1802 C CA  . TRP A 235 ? 0.2245 0.4123 0.2778 -0.0135 -0.0364 -0.0197 236 TRP A CA  
1803 C C   . TRP A 235 ? 0.1884 0.3658 0.2424 -0.0022 -0.0348 -0.0135 236 TRP A C   
1804 O O   . TRP A 235 ? 0.2046 0.3744 0.2636 0.0006  -0.0335 -0.0137 236 TRP A O   
1805 C CB  . TRP A 235 ? 0.1633 0.3388 0.2155 -0.0175 -0.0340 -0.0312 236 TRP A CB  
1806 C CG  . TRP A 235 ? 0.2612 0.4319 0.3071 -0.0144 -0.0328 -0.0320 236 TRP A CG  
1807 C CD1 . TRP A 235 ? 0.2531 0.4320 0.2923 -0.0196 -0.0333 -0.0342 236 TRP A CD1 
1808 C CD2 . TRP A 235 ? 0.2021 0.3595 0.2472 -0.0067 -0.0314 -0.0298 236 TRP A CD2 
1809 N NE1 . TRP A 235 ? 0.2482 0.4200 0.2832 -0.0156 -0.0321 -0.0330 236 TRP A NE1 
1810 C CE2 . TRP A 235 ? 0.2546 0.4128 0.2931 -0.0079 -0.0312 -0.0305 236 TRP A CE2 
1811 C CE3 . TRP A 235 ? 0.2661 0.4116 0.3148 0.0003  -0.0305 -0.0272 236 TRP A CE3 
1812 C CZ2 . TRP A 235 ? 0.2451 0.3921 0.2809 -0.0030 -0.0306 -0.0285 236 TRP A CZ2 
1813 C CZ3 . TRP A 235 ? 0.2246 0.3587 0.2697 0.0053  -0.0300 -0.0259 236 TRP A CZ3 
1814 C CH2 . TRP A 235 ? 0.3119 0.4466 0.3509 0.0034  -0.0302 -0.0265 236 TRP A CH2 
1815 N N   . ALA A 236 ? 0.2304 0.4063 0.2783 0.0039  -0.0352 -0.0082 237 ALA A N   
1816 C CA  . ALA A 236 ? 0.2128 0.3750 0.2580 0.0141  -0.0337 -0.0043 237 ALA A CA  
1817 C C   . ALA A 236 ? 0.3080 0.4756 0.3556 0.0223  -0.0333 0.0044  237 ALA A C   
1818 O O   . ALA A 236 ? 0.2825 0.4387 0.3282 0.0303  -0.0314 0.0063  237 ALA A O   
1819 C CB  . ALA A 236 ? 0.2003 0.3555 0.2371 0.0164  -0.0345 -0.0028 237 ALA A CB  
1820 N N   . THR A 237 ? 0.1570 0.3433 0.2088 0.0204  -0.0349 0.0097  238 THR A N   
1821 C CA  . THR A 237 ? 0.2412 0.4363 0.2971 0.0286  -0.0338 0.0184  238 THR A CA  
1822 C C   . THR A 237 ? 0.2366 0.4510 0.3015 0.0214  -0.0352 0.0205  238 THR A C   
1823 O O   . THR A 237 ? 0.2172 0.4394 0.2832 0.0104  -0.0378 0.0164  238 THR A O   
1824 C CB  . THR A 237 ? 0.2445 0.4457 0.2970 0.0368  -0.0347 0.0272  238 THR A CB  
1825 O OG1 . THR A 237 ? 0.2278 0.4448 0.2810 0.0289  -0.0384 0.0290  238 THR A OG1 
1826 C CG2 . THR A 237 ? 0.2780 0.4579 0.3204 0.0435  -0.0340 0.0260  238 THR A CG2 
1827 N N   . VAL A 238 ? 0.2875 0.5100 0.3583 0.0272  -0.0333 0.0270  239 VAL A N   
1828 C CA  . VAL A 238 ? 0.1521 0.3955 0.2324 0.0205  -0.0348 0.0313  239 VAL A CA  
1829 C C   . VAL A 238 ? 0.2435 0.5045 0.3285 0.0312  -0.0333 0.0433  239 VAL A C   
1830 O O   . VAL A 238 ? 0.2163 0.4679 0.2968 0.0443  -0.0299 0.0460  239 VAL A O   
1831 C CB  . VAL A 238 ? 0.2637 0.4996 0.3484 0.0152  -0.0336 0.0268  239 VAL A CB  
1832 C CG1 . VAL A 238 ? 0.2347 0.4660 0.3200 0.0263  -0.0293 0.0315  239 VAL A CG1 
1833 C CG2 . VAL A 238 ? 0.2733 0.5261 0.3661 0.0031  -0.0367 0.0284  239 VAL A CG2 
1834 N N   . GLY A 239 ? 0.2824 0.5689 0.3761 0.0258  -0.0358 0.0503  240 GLY A N   
1835 C CA  . GLY A 239 ? 0.1543 0.4615 0.2549 0.0361  -0.0341 0.0625  240 GLY A CA  
1836 C C   . GLY A 239 ? 0.2892 0.6014 0.3960 0.0412  -0.0297 0.0661  240 GLY A C   
1837 O O   . GLY A 239 ? 0.2650 0.5657 0.3713 0.0345  -0.0291 0.0600  240 GLY A O   
1838 N N   . MET A 240 ? 0.2155 0.5454 0.3283 0.0530  -0.0264 0.0765  241 MET A N   
1839 C CA  . MET A 240 ? 0.2280 0.5625 0.3448 0.0597  -0.0210 0.0800  241 MET A CA  
1840 C C   . MET A 240 ? 0.2142 0.5651 0.3408 0.0460  -0.0230 0.0823  241 MET A C   
1841 O O   . MET A 240 ? 0.1707 0.5137 0.2968 0.0451  -0.0202 0.0802  241 MET A O   
1842 C CB  . MET A 240 ? 0.2173 0.5635 0.3359 0.0756  -0.0155 0.0893  241 MET A CB  
1843 C CG  . MET A 240 ? 0.3301 0.6551 0.4382 0.0927  -0.0112 0.0864  241 MET A CG  
1844 S SD  . MET A 240 ? 0.4849 0.8161 0.5920 0.1090  -0.0050 0.0953  241 MET A SD  
1845 C CE  . MET A 240 ? 0.5995 0.9473 0.7120 0.1113  0.0019  0.1002  241 MET A CE  
1846 N N   . GLY A 241 ? 0.1510 0.5216 0.2845 0.0344  -0.0280 0.0867  242 GLY A N   
1847 C CA  . GLY A 241 ? 0.1514 0.5348 0.2924 0.0195  -0.0307 0.0892  242 GLY A CA  
1848 C C   . GLY A 241 ? 0.1902 0.5555 0.3287 0.0064  -0.0344 0.0785  242 GLY A C   
1849 O O   . GLY A 241 ? 0.1961 0.5582 0.3379 0.0005  -0.0337 0.0783  242 GLY A O   
1850 N N   . GLU A 242 ? 0.1993 0.5474 0.3293 0.0019  -0.0375 0.0691  243 GLU A N   
1851 C CA  . GLU A 242 ? 0.2978 0.6219 0.4225 -0.0089 -0.0395 0.0572  243 GLU A CA  
1852 C C   . GLU A 242 ? 0.2444 0.5456 0.3650 -0.0013 -0.0347 0.0529  243 GLU A C   
1853 O O   . GLU A 242 ? 0.2339 0.5237 0.3560 -0.0095 -0.0356 0.0486  243 GLU A O   
1854 C CB  . GLU A 242 ? 0.3452 0.6570 0.4611 -0.0133 -0.0424 0.0481  243 GLU A CB  
1855 C CG  . GLU A 242 ? 0.3998 0.6882 0.5108 -0.0236 -0.0438 0.0352  243 GLU A CG  
1856 C CD  . GLU A 242 ? 0.3900 0.6841 0.5068 -0.0395 -0.0479 0.0342  243 GLU A CD  
1857 O OE1 . GLU A 242 ? 0.4495 0.7685 0.5736 -0.0450 -0.0507 0.0434  243 GLU A OE1 
1858 O OE2 . GLU A 242 ? 0.3276 0.6011 0.4421 -0.0466 -0.0484 0.0245  243 GLU A OE2 
1859 N N   . ALA A 243 ? 0.1804 0.4744 0.2955 0.0140  -0.0301 0.0542  244 ALA A N   
1860 C CA  . ALA A 243 ? 0.2404 0.5143 0.3506 0.0203  -0.0262 0.0506  244 ALA A CA  
1861 C C   . ALA A 243 ? 0.2111 0.4978 0.3290 0.0188  -0.0242 0.0579  244 ALA A C   
1862 O O   . ALA A 243 ? 0.1490 0.4226 0.2668 0.0140  -0.0242 0.0549  244 ALA A O   
1863 C CB  . ALA A 243 ? 0.1928 0.4557 0.2940 0.0360  -0.0220 0.0503  244 ALA A CB  
1864 N N   . ARG A 244 ? 0.2118 0.5255 0.3372 0.0225  -0.0227 0.0685  245 ARG A N   
1865 C CA  . ARG A 244 ? 0.1862 0.5167 0.3197 0.0205  -0.0206 0.0769  245 ARG A CA  
1866 C C   . ARG A 244 ? 0.1767 0.5076 0.3168 0.0022  -0.0259 0.0761  245 ARG A C   
1867 O O   . ARG A 244 ? 0.2456 0.5722 0.3878 -0.0016 -0.0250 0.0780  245 ARG A O   
1868 C CB  . ARG A 244 ? 0.1492 0.5124 0.2912 0.0277  -0.0180 0.0890  245 ARG A CB  
1869 C CG  . ARG A 244 ? 0.1502 0.5356 0.3016 0.0254  -0.0153 0.0991  245 ARG A CG  
1870 C CD  . ARG A 244 ? 0.2255 0.6292 0.3769 0.0382  -0.0090 0.1081  245 ARG A CD  
1871 N NE  . ARG A 244 ? 0.2280 0.6215 0.3708 0.0570  -0.0016 0.1061  245 ARG A NE  
1872 C CZ  . ARG A 244 ? 0.2946 0.6882 0.4351 0.0632  0.0041  0.1077  245 ARG A CZ  
1873 N NH1 . ARG A 244 ? 0.1608 0.5652 0.3082 0.0521  0.0031  0.1125  245 ARG A NH1 
1874 N NH2 . ARG A 244 ? 0.3058 0.6881 0.4362 0.0801  0.0106  0.1045  245 ARG A NH2 
1875 N N   . ARG A 245 ? 0.1846 0.5198 0.3272 -0.0094 -0.0317 0.0734  246 ARG A N   
1876 C CA  . ARG A 245 ? 0.2487 0.5810 0.3959 -0.0275 -0.0372 0.0711  246 ARG A CA  
1877 C C   . ARG A 245 ? 0.2447 0.5452 0.3864 -0.0304 -0.0373 0.0614  246 ARG A C   
1878 O O   . ARG A 245 ? 0.2000 0.4961 0.3462 -0.0389 -0.0388 0.0634  246 ARG A O   
1879 C CB  . ARG A 245 ? 0.2377 0.5756 0.3846 -0.0388 -0.0432 0.0671  246 ARG A CB  
1880 C CG  . ARG A 245 ? 0.3036 0.6416 0.4551 -0.0585 -0.0493 0.0658  246 ARG A CG  
1881 C CD  . ARG A 245 ? 0.3779 0.7136 0.5247 -0.0701 -0.0550 0.0577  246 ARG A CD  
1882 N NE  . ARG A 245 ? 0.4272 0.7346 0.5635 -0.0665 -0.0537 0.0439  246 ARG A NE  
1883 C CZ  . ARG A 245 ? 0.4919 0.7714 0.6250 -0.0696 -0.0532 0.0344  246 ARG A CZ  
1884 N NH1 . ARG A 245 ? 0.4626 0.7366 0.6017 -0.0765 -0.0543 0.0374  246 ARG A NH1 
1885 N NH2 . ARG A 245 ? 0.3535 0.6115 0.4782 -0.0655 -0.0517 0.0226  246 ARG A NH2 
1886 N N   . ARG A 246 ? 0.2204 0.4996 0.3530 -0.0232 -0.0359 0.0517  247 ARG A N   
1887 C CA  . ARG A 246 ? 0.2025 0.4531 0.3307 -0.0243 -0.0358 0.0428  247 ARG A CA  
1888 C C   . ARG A 246 ? 0.2373 0.4824 0.3659 -0.0178 -0.0322 0.0477  247 ARG A C   
1889 O O   . ARG A 246 ? 0.2182 0.4499 0.3494 -0.0243 -0.0338 0.0463  247 ARG A O   
1890 C CB  . ARG A 246 ? 0.2120 0.4457 0.3310 -0.0174 -0.0347 0.0331  247 ARG A CB  
1891 C CG  . ARG A 246 ? 0.2727 0.5100 0.3899 -0.0253 -0.0383 0.0272  247 ARG A CG  
1892 C CD  . ARG A 246 ? 0.1563 0.3774 0.2647 -0.0199 -0.0372 0.0180  247 ARG A CD  
1893 N NE  . ARG A 246 ? 0.2241 0.4521 0.3297 -0.0273 -0.0403 0.0135  247 ARG A NE  
1894 C CZ  . ARG A 246 ? 0.2520 0.4707 0.3501 -0.0253 -0.0400 0.0060  247 ARG A CZ  
1895 N NH1 . ARG A 246 ? 0.2427 0.4444 0.3361 -0.0165 -0.0369 0.0022  247 ARG A NH1 
1896 N NH2 . ARG A 246 ? 0.1949 0.4225 0.2899 -0.0331 -0.0429 0.0028  247 ARG A NH2 
1897 N N   . ALA A 247 ? 0.2070 0.4616 0.3324 -0.0048 -0.0274 0.0533  248 ALA A N   
1898 C CA  . ALA A 247 ? 0.1552 0.4060 0.2785 0.0018  -0.0236 0.0576  248 ALA A CA  
1899 C C   . ALA A 247 ? 0.2353 0.5009 0.3682 -0.0080 -0.0250 0.0666  248 ALA A C   
1900 O O   . ALA A 247 ? 0.1995 0.4539 0.3334 -0.0123 -0.0257 0.0677  248 ALA A O   
1901 C CB  . ALA A 247 ? 0.1737 0.4343 0.2912 0.0172  -0.0179 0.0617  248 ALA A CB  
1902 N N   . THR A 248 ? 0.2358 0.5275 0.3763 -0.0122 -0.0258 0.0740  249 THR A N   
1903 C CA  . THR A 248 ? 0.3074 0.6171 0.4578 -0.0226 -0.0274 0.0842  249 THR A CA  
1904 C C   . THR A 248 ? 0.3055 0.5978 0.4595 -0.0387 -0.0335 0.0804  249 THR A C   
1905 O O   . THR A 248 ? 0.3006 0.5932 0.4592 -0.0452 -0.0343 0.0868  249 THR A O   
1906 C CB  . THR A 248 ? 0.2966 0.6389 0.4555 -0.0257 -0.0282 0.0928  249 THR A CB  
1907 O OG1 . THR A 248 ? 0.2974 0.6553 0.4540 -0.0090 -0.0219 0.0971  249 THR A OG1 
1908 C CG2 . THR A 248 ? 0.1658 0.5282 0.3354 -0.0378 -0.0302 0.1042  249 THR A CG2 
1909 N N   A GLN A 249 ? 0.2626 0.5392 0.4142 -0.0448 -0.0376 0.0700  250 GLN A N   
1910 N N   B GLN A 249 ? 0.2616 0.5382 0.4131 -0.0445 -0.0375 0.0699  250 GLN A N   
1911 C CA  A GLN A 249 ? 0.2926 0.5500 0.4469 -0.0589 -0.0430 0.0649  250 GLN A CA  
1912 C CA  B GLN A 249 ? 0.2972 0.5543 0.4511 -0.0586 -0.0429 0.0643  250 GLN A CA  
1913 C C   A GLN A 249 ? 0.2810 0.5115 0.4322 -0.0549 -0.0418 0.0606  250 GLN A C   
1914 C C   B GLN A 249 ? 0.2844 0.5149 0.4354 -0.0549 -0.0419 0.0604  250 GLN A C   
1915 O O   A GLN A 249 ? 0.2696 0.4896 0.4255 -0.0641 -0.0449 0.0630  250 GLN A O   
1916 O O   B GLN A 249 ? 0.2704 0.4907 0.4264 -0.0644 -0.0450 0.0628  250 GLN A O   
1917 C CB  A GLN A 249 ? 0.3289 0.5774 0.4803 -0.0665 -0.0470 0.0540  250 GLN A CB  
1918 C CB  B GLN A 249 ? 0.3209 0.5689 0.4711 -0.0644 -0.0464 0.0531  250 GLN A CB  
1919 C CG  A GLN A 249 ? 0.3751 0.6063 0.5295 -0.0825 -0.0527 0.0492  250 GLN A CG  
1920 C CG  B GLN A 249 ? 0.3687 0.5959 0.5205 -0.0789 -0.0517 0.0459  250 GLN A CG  
1921 C CD  A GLN A 249 ? 0.3799 0.5968 0.5286 -0.0881 -0.0554 0.0355  250 GLN A CD  
1922 C CD  B GLN A 249 ? 0.3909 0.6302 0.5510 -0.0941 -0.0562 0.0552  250 GLN A CD  
1923 O OE1 A GLN A 249 ? 0.3777 0.6051 0.5216 -0.0840 -0.0546 0.0322  250 GLN A OE1 
1924 O OE1 B GLN A 249 ? 0.4233 0.6913 0.5889 -0.0950 -0.0558 0.0670  250 GLN A OE1 
1925 N NE2 A GLN A 249 ? 0.3478 0.5401 0.4965 -0.0973 -0.0585 0.0276  250 GLN A NE2 
1926 N NE2 B GLN A 249 ? 0.3967 0.6140 0.5583 -0.1060 -0.0606 0.0501  250 GLN A NE2 
1927 N N   . LEU A 250 ? 0.2757 0.4952 0.4190 -0.0416 -0.0380 0.0550  251 LEU A N   
1928 C CA  . LEU A 250 ? 0.3570 0.5545 0.4976 -0.0371 -0.0370 0.0525  251 LEU A CA  
1929 C C   . LEU A 250 ? 0.3319 0.5385 0.4760 -0.0377 -0.0358 0.0643  251 LEU A C   
1930 O O   . LEU A 250 ? 0.2780 0.4709 0.4257 -0.0436 -0.0384 0.0663  251 LEU A O   
1931 C CB  . LEU A 250 ? 0.3098 0.4987 0.4409 -0.0232 -0.0332 0.0466  251 LEU A CB  
1932 C CG  . LEU A 250 ? 0.3545 0.5233 0.4829 -0.0188 -0.0328 0.0450  251 LEU A CG  
1933 C CD1 . LEU A 250 ? 0.3826 0.5304 0.5160 -0.0266 -0.0367 0.0381  251 LEU A CD1 
1934 C CD2 . LEU A 250 ? 0.3244 0.4857 0.4425 -0.0065 -0.0295 0.0401  251 LEU A CD2 
1935 N N   . ALA A 251 ? 0.3080 0.5382 0.4508 -0.0313 -0.0317 0.0724  252 ALA A N   
1936 C CA  . ALA A 251 ? 0.3185 0.5619 0.4634 -0.0310 -0.0294 0.0840  252 ALA A CA  
1937 C C   . ALA A 251 ? 0.3126 0.5598 0.4679 -0.0470 -0.0344 0.0912  252 ALA A C   
1938 O O   . ALA A 251 ? 0.3112 0.5522 0.4685 -0.0511 -0.0355 0.0974  252 ALA A O   
1939 C CB  . ALA A 251 ? 0.3250 0.5966 0.4685 -0.0219 -0.0237 0.0909  252 ALA A CB  
1940 N N   . HIS A 252 ? 0.3129 0.5695 0.4741 -0.0567 -0.0380 0.0906  253 HIS A N   
1941 C CA  . HIS A 252 ? 0.3954 0.6546 0.5657 -0.0738 -0.0436 0.0969  253 HIS A CA  
1942 C C   . HIS A 252 ? 0.3972 0.6236 0.5682 -0.0809 -0.0482 0.0910  253 HIS A C   
1943 O O   . HIS A 252 ? 0.4334 0.6560 0.6100 -0.0904 -0.0513 0.0991  253 HIS A O   
1944 C CB  . HIS A 252 ? 0.4535 0.7274 0.6279 -0.0830 -0.0471 0.0954  253 HIS A CB  
1945 C CG  . HIS A 252 ? 0.5691 0.8451 0.7517 -0.1022 -0.0537 0.1011  253 HIS A CG  
1946 N ND1 . HIS A 252 ? 0.6352 0.8875 0.8174 -0.1141 -0.0598 0.0916  253 HIS A ND1 
1947 C CD2 . HIS A 252 ? 0.5548 0.8536 0.7458 -0.1123 -0.0553 0.1153  253 HIS A CD2 
1948 C CE1 . HIS A 252 ? 0.6268 0.8848 0.8161 -0.1311 -0.0653 0.0994  253 HIS A CE1 
1949 N NE2 . HIS A 252 ? 0.5838 0.8708 0.7790 -0.1308 -0.0630 0.1144  253 HIS A NE2 
1950 N N   . LEU A 253 ? 0.3520 0.5554 0.5177 -0.0758 -0.0485 0.0775  254 LEU A N   
1951 C CA  . LEU A 253 ? 0.3977 0.5698 0.5647 -0.0803 -0.0521 0.0707  254 LEU A CA  
1952 C C   . LEU A 253 ? 0.4001 0.5609 0.5677 -0.0756 -0.0513 0.0769  254 LEU A C   
1953 O O   . LEU A 253 ? 0.4588 0.5986 0.6311 -0.0820 -0.0552 0.0769  254 LEU A O   
1954 C CB  . LEU A 253 ? 0.4129 0.5673 0.5742 -0.0740 -0.0512 0.0553  254 LEU A CB  
1955 C CG  . LEU A 253 ? 0.4416 0.6001 0.6017 -0.0816 -0.0535 0.0474  254 LEU A CG  
1956 C CD1 . LEU A 253 ? 0.3821 0.5241 0.5358 -0.0748 -0.0519 0.0327  254 LEU A CD1 
1957 C CD2 . LEU A 253 ? 0.3874 0.5374 0.5533 -0.0985 -0.0595 0.0483  254 LEU A CD2 
1958 N N   . VAL A 254 ? 0.3973 0.5713 0.5597 -0.0645 -0.0464 0.0821  255 VAL A N   
1959 C CA  . VAL A 254 ? 0.4133 0.5794 0.5745 -0.0602 -0.0457 0.0884  255 VAL A CA  
1960 C C   . VAL A 254 ? 0.4684 0.6575 0.6319 -0.0642 -0.0444 0.1037  255 VAL A C   
1961 O O   . VAL A 254 ? 0.5464 0.7378 0.7058 -0.0588 -0.0422 0.1103  255 VAL A O   
1962 C CB  . VAL A 254 ? 0.3434 0.5036 0.4949 -0.0454 -0.0415 0.0821  255 VAL A CB  
1963 C CG1 . VAL A 254 ? 0.2551 0.3949 0.4053 -0.0426 -0.0427 0.0681  255 VAL A CG1 
1964 C CG2 . VAL A 254 ? 0.2784 0.4618 0.4226 -0.0365 -0.0358 0.0838  255 VAL A CG2 
1965 N N   . GLY A 255 ? 0.4460 0.7385 0.4976 -0.1254 -0.0328 0.0893  256 GLY A N   
1966 C CA  . GLY A 255 ? 0.3659 0.6890 0.4165 -0.1355 -0.0376 0.0940  256 GLY A CA  
1967 C C   . GLY A 255 ? 0.4188 0.7800 0.4743 -0.1270 -0.0417 0.0914  256 GLY A C   
1968 O O   . GLY A 255 ? 0.5619 0.9475 0.6209 -0.1309 -0.0449 0.0960  256 GLY A O   
1969 N N   . CYS A 256 ? 0.3532 0.7196 0.4088 -0.1152 -0.0412 0.0841  257 CYS A N   
1970 C CA  . CYS A 256 ? 0.3795 0.7794 0.4398 -0.1052 -0.0436 0.0811  257 CYS A CA  
1971 C C   . CYS A 256 ? 0.5279 0.9545 0.5836 -0.1085 -0.0457 0.0794  257 CYS A C   
1972 O O   . CYS A 256 ? 0.3933 0.8141 0.4463 -0.1031 -0.0448 0.0751  257 CYS A O   
1973 C CB  . CYS A 256 ? 0.3474 0.7368 0.4130 -0.0876 -0.0415 0.0754  257 CYS A CB  
1974 S SG  . CYS A 256 ? 0.5668 0.9427 0.6398 -0.0834 -0.0405 0.0791  257 CYS A SG  
1975 N N   . PRO A 257 ? 0.6661 1.1118 0.7157 -0.1156 -0.0463 0.0829  258 PRO A N   
1976 C CA  . PRO A 257 ? 0.7120 1.1779 0.7535 -0.1166 -0.0454 0.0826  258 PRO A CA  
1977 C C   . PRO A 257 ? 0.7483 1.2224 0.7934 -0.1008 -0.0436 0.0772  258 PRO A C   
1978 O O   . PRO A 257 ? 0.8533 1.3276 0.8948 -0.1046 -0.0447 0.0770  258 PRO A O   
1979 C CB  . PRO A 257 ? 0.7626 1.2452 0.8018 -0.1157 -0.0437 0.0850  258 PRO A CB  
1980 C CG  . PRO A 257 ? 0.5389 1.0069 0.5821 -0.1196 -0.0449 0.0882  258 PRO A CG  
1981 C CD  . PRO A 257 ? 0.6117 1.0564 0.6605 -0.1239 -0.0469 0.0887  258 PRO A CD  
1982 N N   . GLY A 262 ? 0.8305 1.3687 0.8615 -0.1020 -0.0411 0.0845  263 GLY A N   
1983 C CA  . GLY A 262 ? 0.8255 1.3390 0.8613 -0.0979 -0.0423 0.0794  263 GLY A CA  
1984 C C   . GLY A 262 ? 0.7793 1.2907 0.8258 -0.0763 -0.0405 0.0741  263 GLY A C   
1985 O O   . GLY A 262 ? 0.6663 1.1583 0.7167 -0.0717 -0.0420 0.0704  263 GLY A O   
1986 N N   . GLY A 263 ? 0.8107 1.3420 0.8613 -0.0637 -0.0371 0.0739  264 GLY A N   
1987 C CA  . GLY A 263 ? 0.7949 1.3238 0.8541 -0.0439 -0.0348 0.0683  264 GLY A CA  
1988 C C   . GLY A 263 ? 0.6692 1.2220 0.7321 -0.0302 -0.0306 0.0677  264 GLY A C   
1989 O O   . GLY A 263 ? 0.7899 1.3587 0.8551 -0.0226 -0.0293 0.0703  264 GLY A O   
1990 N N   . ASN A 264 ? 0.5005 1.0566 0.5639 -0.0278 -0.0285 0.0648  265 ASN A N   
1991 C CA  . ASN A 264 ? 0.3829 0.9472 0.4523 -0.0101 -0.0247 0.0594  265 ASN A CA  
1992 C C   . ASN A 264 ? 0.3262 0.8637 0.3989 -0.0061 -0.0262 0.0541  265 ASN A C   
1993 O O   . ASN A 264 ? 0.3179 0.8406 0.3879 -0.0170 -0.0284 0.0544  265 ASN A O   
1994 C CB  . ASN A 264 ? 0.3278 0.9090 0.3945 -0.0119 -0.0219 0.0583  265 ASN A CB  
1995 C CG  . ASN A 264 ? 0.4397 1.0248 0.5116 0.0042  -0.0179 0.0506  265 ASN A CG  
1996 O OD1 . ASN A 264 ? 0.4158 0.9822 0.4914 0.0109  -0.0180 0.0455  265 ASN A OD1 
1997 N ND2 . ASN A 264 ? 0.4015 1.0118 0.4732 0.0097  -0.0140 0.0497  265 ASN A ND2 
1998 N N   . ASP A 265 ? 0.2279 0.7586 0.3063 0.0091  -0.0250 0.0504  266 ASP A N   
1999 C CA  . ASP A 265 ? 0.2178 0.7231 0.2987 0.0124  -0.0268 0.0463  266 ASP A CA  
2000 C C   . ASP A 265 ? 0.2667 0.7662 0.3477 0.0122  -0.0256 0.0419  266 ASP A C   
2001 O O   . ASP A 265 ? 0.2527 0.7331 0.3332 0.0055  -0.0284 0.0419  266 ASP A O   
2002 C CB  . ASP A 265 ? 0.2909 0.7905 0.3771 0.0292  -0.0255 0.0436  266 ASP A CB  
2003 C CG  . ASP A 265 ? 0.4204 0.9158 0.5060 0.0259  -0.0286 0.0485  266 ASP A CG  
2004 O OD1 . ASP A 265 ? 0.4848 0.9758 0.5656 0.0100  -0.0321 0.0522  266 ASP A OD1 
2005 O OD2 . ASP A 265 ? 0.3880 0.8844 0.4777 0.0390  -0.0273 0.0486  266 ASP A OD2 
2006 N N   . THR A 266 ? 0.2772 0.7947 0.3590 0.0193  -0.0214 0.0384  267 THR A N   
2007 C CA  . THR A 266 ? 0.2264 0.7432 0.3070 0.0168  -0.0201 0.0344  267 THR A CA  
2008 C C   . THR A 266 ? 0.2936 0.8043 0.3692 -0.0018 -0.0237 0.0398  267 THR A C   
2009 O O   . THR A 266 ? 0.3728 0.8681 0.4483 -0.0071 -0.0256 0.0398  267 THR A O   
2010 C CB  . THR A 266 ? 0.2579 0.7999 0.3391 0.0252  -0.0143 0.0297  267 THR A CB  
2011 O OG1 . THR A 266 ? 0.3183 0.8624 0.4051 0.0445  -0.0096 0.0245  267 THR A OG1 
2012 C CG2 . THR A 266 ? 0.1863 0.7304 0.2652 0.0199  -0.0131 0.0256  267 THR A CG2 
2013 N N   . GLU A 267 ? 0.2903 0.8131 0.3617 -0.0117 -0.0243 0.0453  268 GLU A N   
2014 C CA  . GLU A 267 ? 0.3379 0.8544 0.4045 -0.0289 -0.0271 0.0512  268 GLU A CA  
2015 C C   . GLU A 267 ? 0.2960 0.7867 0.3640 -0.0361 -0.0313 0.0545  268 GLU A C   
2016 O O   . GLU A 267 ? 0.2760 0.7536 0.3440 -0.0444 -0.0332 0.0575  268 GLU A O   
2017 C CB  . GLU A 267 ? 0.4199 0.9548 0.4812 -0.0378 -0.0269 0.0564  268 GLU A CB  
2018 C CG  . GLU A 267 ? 0.6256 1.1828 0.6832 -0.0393 -0.0239 0.0559  268 GLU A CG  
2019 C CD  . GLU A 267 ? 0.8369 1.4210 0.8921 -0.0368 -0.0215 0.0578  268 GLU A CD  
2020 O OE1 . GLU A 267 ? 0.8915 1.4785 0.9425 -0.0474 -0.0234 0.0642  268 GLU A OE1 
2021 O OE2 . GLU A 267 ? 0.9078 1.5110 0.9655 -0.0243 -0.0176 0.0530  268 GLU A OE2 
2022 N N   . LEU A 268 ? 0.2307 0.7156 0.3003 -0.0329 -0.0325 0.0546  269 LEU A N   
2023 C CA  . LEU A 268 ? 0.2880 0.7513 0.3588 -0.0397 -0.0360 0.0571  269 LEU A CA  
2024 C C   . LEU A 268 ? 0.3090 0.7539 0.3850 -0.0339 -0.0366 0.0546  269 LEU A C   
2025 O O   . LEU A 268 ? 0.3532 0.7819 0.4300 -0.0425 -0.0382 0.0586  269 LEU A O   
2026 C CB  . LEU A 268 ? 0.2533 0.7172 0.3237 -0.0374 -0.0370 0.0571  269 LEU A CB  
2027 C CG  . LEU A 268 ? 0.3551 0.8003 0.4258 -0.0454 -0.0404 0.0590  269 LEU A CG  
2028 C CD1 . LEU A 268 ? 0.3261 0.7785 0.3924 -0.0498 -0.0415 0.0606  269 LEU A CD1 
2029 C CD2 . LEU A 268 ? 0.4418 0.8599 0.5140 -0.0334 -0.0384 0.0542  269 LEU A CD2 
2030 N N   . VAL A 269 ? 0.2711 0.7167 0.3497 -0.0193 -0.0345 0.0487  270 VAL A N   
2031 C CA  . VAL A 269 ? 0.3249 0.7428 0.4024 -0.0141 -0.0331 0.0457  270 VAL A CA  
2032 C C   . VAL A 269 ? 0.3286 0.7497 0.4061 -0.0213 -0.0334 0.0480  270 VAL A C   
2033 O O   . VAL A 269 ? 0.3704 0.7702 0.4481 -0.0254 -0.0341 0.0510  270 VAL A O   
2034 C CB  . VAL A 269 ? 0.2237 0.6355 0.3004 0.0023  -0.0298 0.0382  270 VAL A CB  
2035 C CG1 . VAL A 269 ? 0.1829 0.5691 0.2568 0.0052  -0.0287 0.0355  270 VAL A CG1 
2036 C CG2 . VAL A 269 ? 0.1819 0.5865 0.2591 0.0086  -0.0303 0.0378  270 VAL A CG2 
2037 N N   . ALA A 270 ? 0.2382 0.6878 0.3161 -0.0232 -0.0327 0.0474  271 ALA A N   
2038 C CA  . ALA A 270 ? 0.2155 0.6680 0.2912 -0.0316 -0.0328 0.0501  271 ALA A CA  
2039 C C   . ALA A 270 ? 0.2561 0.6963 0.3324 -0.0457 -0.0359 0.0596  271 ALA A C   
2040 O O   . ALA A 270 ? 0.3358 0.7667 0.4140 -0.0511 -0.0372 0.0642  271 ALA A O   
2041 C CB  . ALA A 270 ? 0.1765 0.6535 0.2476 -0.0319 -0.0296 0.0474  271 ALA A CB  
2042 N N   . CYS A 271 ? 0.2888 0.7297 0.3639 -0.0518 -0.0370 0.0630  272 CYS A N   
2043 C CA  . CYS A 271 ? 0.3301 0.7590 0.4070 -0.0647 -0.0399 0.0716  272 CYS A CA  
2044 C C   . CYS A 271 ? 0.3721 0.7733 0.4539 -0.0621 -0.0402 0.0732  272 CYS A C   
2045 O O   . CYS A 271 ? 0.4428 0.8301 0.5279 -0.0681 -0.0407 0.0801  272 CYS A O   
2046 C CB  . CYS A 271 ? 0.2989 0.7348 0.3711 -0.0731 -0.0407 0.0740  272 CYS A CB  
2047 S SG  . CYS A 271 ? 1.0562 1.4754 1.1316 -0.0886 -0.0439 0.0826  272 CYS A SG  
2048 N N   . LEU A 272 ? 0.2690 0.6563 0.3490 -0.0521 -0.0383 0.0670  273 LEU A N   
2049 C CA  . LEU A 272 ? 0.3135 0.6686 0.3944 -0.0474 -0.0366 0.0668  273 LEU A CA  
2050 C C   . LEU A 272 ? 0.3431 0.6915 0.4270 -0.0440 -0.0362 0.0684  273 LEU A C   
2051 O O   . LEU A 272 ? 0.3089 0.6362 0.3962 -0.0456 -0.0356 0.0736  273 LEU A O   
2052 C CB  . LEU A 272 ? 0.2689 0.6139 0.3469 -0.0367 -0.0350 0.0596  273 LEU A CB  
2053 C CG  . LEU A 272 ? 0.3408 0.6816 0.4152 -0.0418 -0.0351 0.0596  273 LEU A CG  
2054 C CD1 . LEU A 272 ? 0.3248 0.6606 0.3971 -0.0313 -0.0343 0.0535  273 LEU A CD1 
2055 C CD2 . LEU A 272 ? 0.3542 0.6683 0.4281 -0.0504 -0.0336 0.0642  273 LEU A CD2 
2056 N N   . ARG A 273 ? 0.2982 0.6650 0.3805 -0.0398 -0.0363 0.0642  274 ARG A N   
2057 C CA  . ARG A 273 ? 0.2570 0.6186 0.3398 -0.0385 -0.0361 0.0652  274 ARG A CA  
2058 C C   . ARG A 273 ? 0.2682 0.6322 0.3561 -0.0501 -0.0383 0.0762  274 ARG A C   
2059 O O   . ARG A 273 ? 0.3096 0.6637 0.4000 -0.0508 -0.0386 0.0808  274 ARG A O   
2060 C CB  . ARG A 273 ? 0.1690 0.5476 0.2466 -0.0325 -0.0345 0.0570  274 ARG A CB  
2061 C CG  . ARG A 273 ? 0.3089 0.6756 0.3825 -0.0186 -0.0317 0.0474  274 ARG A CG  
2062 C CD  . ARG A 273 ? 0.3043 0.6763 0.3715 -0.0120 -0.0288 0.0393  274 ARG A CD  
2063 N NE  . ARG A 273 ? 0.4463 0.8386 0.5118 -0.0050 -0.0259 0.0326  274 ARG A NE  
2064 C CZ  . ARG A 273 ? 0.4503 0.8372 0.5141 0.0082  -0.0229 0.0255  274 ARG A CZ  
2065 N NH1 . ARG A 273 ? 0.3707 0.7318 0.4328 0.0149  -0.0228 0.0236  274 ARG A NH1 
2066 N NH2 . ARG A 273 ? 0.5475 0.9560 0.6118 0.0149  -0.0198 0.0212  274 ARG A NH2 
2067 N N   . THR A 274 ? 0.2548 0.6323 0.3445 -0.0598 -0.0400 0.0817  275 THR A N   
2068 C CA  . THR A 274 ? 0.2528 0.6330 0.3480 -0.0712 -0.0423 0.0938  275 THR A CA  
2069 C C   . THR A 274 ? 0.3064 0.6588 0.4075 -0.0729 -0.0412 0.1019  275 THR A C   
2070 O O   . THR A 274 ? 0.4042 0.7542 0.5118 -0.0800 -0.0424 0.1133  275 THR A O   
2071 C CB  . THR A 274 ? 0.1946 0.5934 0.2858 -0.0810 -0.0436 0.0967  275 THR A CB  
2072 O OG1 . THR A 274 ? 0.2354 0.6308 0.3286 -0.0860 -0.0443 0.0988  275 THR A OG1 
2073 C CG2 . THR A 274 ? 0.2076 0.6251 0.2890 -0.0761 -0.0414 0.0865  275 THR A CG2 
2074 N N   . ARG A 275 ? 0.3041 0.6357 0.4029 -0.0665 -0.0385 0.0965  276 ARG A N   
2075 C CA  . ARG A 275 ? 0.2382 0.5419 0.3413 -0.0678 -0.0358 0.1026  276 ARG A CA  
2076 C C   . ARG A 275 ? 0.2858 0.5732 0.3950 -0.0612 -0.0343 0.1064  276 ARG A C   
2077 O O   . ARG A 275 ? 0.3351 0.6212 0.4413 -0.0527 -0.0341 0.0994  276 ARG A O   
2078 C CB  . ARG A 275 ? 0.2290 0.5176 0.3260 -0.0654 -0.0331 0.0951  276 ARG A CB  
2079 C CG  . ARG A 275 ? 0.3490 0.6530 0.4401 -0.0741 -0.0347 0.0933  276 ARG A CG  
2080 C CD  . ARG A 275 ? 0.3524 0.6536 0.4460 -0.0866 -0.0351 0.1035  276 ARG A CD  
2081 N NE  . ARG A 275 ? 0.3340 0.6479 0.4205 -0.0970 -0.0367 0.1024  276 ARG A NE  
2082 C CZ  . ARG A 275 ? 0.4060 0.7511 0.4913 -0.1029 -0.0407 0.1035  276 ARG A CZ  
2083 N NH1 . ARG A 275 ? 0.4234 0.7886 0.5132 -0.0992 -0.0429 0.1045  276 ARG A NH1 
2084 N NH2 . ARG A 275 ? 0.3856 0.7426 0.4644 -0.1133 -0.0422 0.1034  276 ARG A NH2 
2085 N N   . PRO A 276 ? 0.3013 0.5768 0.4192 -0.0651 -0.0330 0.1185  277 PRO A N   
2086 C CA  . PRO A 276 ? 0.2815 0.5416 0.4070 -0.0590 -0.0310 0.1244  277 PRO A CA  
2087 C C   . PRO A 276 ? 0.3219 0.5609 0.4431 -0.0496 -0.0273 0.1149  277 PRO A C   
2088 O O   . PRO A 276 ? 0.3110 0.5381 0.4270 -0.0501 -0.0247 0.1091  277 PRO A O   
2089 C CB  . PRO A 276 ? 0.2618 0.5080 0.3973 -0.0639 -0.0284 0.1381  277 PRO A CB  
2090 C CG  . PRO A 276 ? 0.2572 0.5198 0.3908 -0.0751 -0.0314 0.1419  277 PRO A CG  
2091 C CD  . PRO A 276 ? 0.2445 0.5202 0.3659 -0.0756 -0.0332 0.1281  277 PRO A CD  
2092 N N   . ALA A 277 ? 0.2555 0.4909 0.3778 -0.0424 -0.0274 0.1136  278 ALA A N   
2093 C CA  . ALA A 277 ? 0.2316 0.4491 0.3494 -0.0338 -0.0245 0.1048  278 ALA A CA  
2094 C C   . ALA A 277 ? 0.2548 0.4475 0.3752 -0.0333 -0.0189 0.1064  278 ALA A C   
2095 O O   . ALA A 277 ? 0.2419 0.4239 0.3548 -0.0311 -0.0167 0.0971  278 ALA A O   
2096 C CB  . ALA A 277 ? 0.1769 0.3924 0.2969 -0.0282 -0.0253 0.1063  278 ALA A CB  
2097 N N   . GLN A 278 ? 0.2882 0.4721 0.4189 -0.0356 -0.0160 0.1185  279 GLN A N   
2098 C CA  . GLN A 278 ? 0.2931 0.4503 0.4268 -0.0344 -0.0088 0.1206  279 GLN A CA  
2099 C C   . GLN A 278 ? 0.3291 0.4795 0.4534 -0.0414 -0.0070 0.1141  279 GLN A C   
2100 O O   . GLN A 278 ? 0.3625 0.4911 0.4817 -0.0406 -0.0013 0.1084  279 GLN A O   
2101 C CB  . GLN A 278 ? 0.2423 0.3932 0.3906 -0.0349 -0.0057 0.1367  279 GLN A CB  
2102 C CG  . GLN A 278 ? 0.3219 0.4423 0.4746 -0.0309 0.0038  0.1390  279 GLN A CG  
2103 C CD  . GLN A 278 ? 0.4203 0.5275 0.5713 -0.0217 0.0075  0.1321  279 GLN A CD  
2104 O OE1 . GLN A 278 ? 0.4546 0.5715 0.6110 -0.0163 0.0047  0.1357  279 GLN A OE1 
2105 N NE2 . GLN A 278 ? 0.3635 0.4490 0.5059 -0.0213 0.0136  0.1223  279 GLN A NE2 
2106 N N   . VAL A 279 ? 0.2227 0.3927 0.3437 -0.0494 -0.0117 0.1148  280 VAL A N   
2107 C CA  . VAL A 279 ? 0.2479 0.4148 0.3594 -0.0580 -0.0108 0.1095  280 VAL A CA  
2108 C C   . VAL A 279 ? 0.3682 0.5345 0.4683 -0.0553 -0.0110 0.0961  280 VAL A C   
2109 O O   . VAL A 279 ? 0.4551 0.6054 0.5473 -0.0599 -0.0070 0.0912  280 VAL A O   
2110 C CB  . VAL A 279 ? 0.2247 0.4168 0.3350 -0.0673 -0.0164 0.1133  280 VAL A CB  
2111 C CG1 . VAL A 279 ? 0.3132 0.5058 0.4122 -0.0767 -0.0163 0.1073  280 VAL A CG1 
2112 C CG2 . VAL A 279 ? 0.2632 0.4541 0.3844 -0.0720 -0.0162 0.1281  280 VAL A CG2 
2113 N N   . LEU A 280 ? 0.3125 0.4956 0.4113 -0.0483 -0.0153 0.0906  281 LEU A N   
2114 C CA  . LEU A 280 ? 0.3418 0.5258 0.4315 -0.0447 -0.0159 0.0796  281 LEU A CA  
2115 C C   . LEU A 280 ? 0.3017 0.4584 0.3900 -0.0404 -0.0102 0.0765  281 LEU A C   
2116 O O   . LEU A 280 ? 0.3633 0.5113 0.4430 -0.0437 -0.0081 0.0701  281 LEU A O   
2117 C CB  . LEU A 280 ? 0.3443 0.5475 0.4336 -0.0366 -0.0205 0.0749  281 LEU A CB  
2118 C CG  . LEU A 280 ? 0.3100 0.5417 0.3997 -0.0392 -0.0251 0.0759  281 LEU A CG  
2119 C CD1 . LEU A 280 ? 0.3421 0.5854 0.4295 -0.0298 -0.0274 0.0693  281 LEU A CD1 
2120 C CD2 . LEU A 280 ? 0.2922 0.5380 0.3764 -0.0474 -0.0265 0.0741  281 LEU A CD2 
2121 N N   . VAL A 281 ? 0.3199 0.4648 0.4165 -0.0339 -0.0078 0.0817  282 VAL A N   
2122 C CA  . VAL A 281 ? 0.2815 0.4017 0.3783 -0.0291 -0.0018 0.0797  282 VAL A CA  
2123 C C   . VAL A 281 ? 0.3174 0.4151 0.4103 -0.0362 0.0055  0.0795  282 VAL A C   
2124 O O   . VAL A 281 ? 0.3760 0.4581 0.4612 -0.0365 0.0097  0.0723  282 VAL A O   
2125 C CB  . VAL A 281 ? 0.3179 0.4334 0.4262 -0.0217 -0.0005 0.0877  282 VAL A CB  
2126 C CG1 . VAL A 281 ? 0.3004 0.3897 0.4111 -0.0179 0.0076  0.0881  282 VAL A CG1 
2127 C CG2 . VAL A 281 ? 0.2899 0.4197 0.3968 -0.0151 -0.0061 0.0840  282 VAL A CG2 
2128 N N   . ASN A 282 ? 0.3046 0.3999 0.4017 -0.0427 0.0071  0.0873  283 ASN A N   
2129 C CA  . ASN A 282 ? 0.3321 0.4030 0.4243 -0.0504 0.0148  0.0872  283 ASN A CA  
2130 C C   . ASN A 282 ? 0.3981 0.4673 0.4739 -0.0599 0.0149  0.0767  283 ASN A C   
2131 O O   . ASN A 282 ? 0.4208 0.4655 0.4887 -0.0662 0.0224  0.0734  283 ASN A O   
2132 C CB  . ASN A 282 ? 0.3671 0.4381 0.4657 -0.0568 0.0153  0.0980  283 ASN A CB  
2133 C CG  . ASN A 282 ? 0.4263 0.4941 0.5418 -0.0489 0.0173  0.1107  283 ASN A CG  
2134 O OD1 . ASN A 282 ? 0.3919 0.4496 0.5140 -0.0393 0.0212  0.1116  283 ASN A OD1 
2135 N ND2 . ASN A 282 ? 0.4918 0.5704 0.6149 -0.0536 0.0143  0.1217  283 ASN A ND2 
2136 N N   . HIS A 283 ? 0.3633 0.4587 0.4338 -0.0615 0.0070  0.0720  284 HIS A N   
2137 C CA  . HIS A 283 ? 0.3405 0.4400 0.3965 -0.0715 0.0060  0.0643  284 HIS A CA  
2138 C C   . HIS A 283 ? 0.4099 0.5156 0.4602 -0.0661 0.0038  0.0559  284 HIS A C   
2139 O O   . HIS A 283 ? 0.4115 0.5215 0.4503 -0.0744 0.0029  0.0503  284 HIS A O   
2140 C CB  . HIS A 283 ? 0.3289 0.4558 0.3827 -0.0798 -0.0008 0.0668  284 HIS A CB  
2141 C CG  . HIS A 283 ? 0.4091 0.5293 0.4655 -0.0885 0.0011  0.0748  284 HIS A CG  
2142 N ND1 . HIS A 283 ? 0.5238 0.6539 0.5925 -0.0844 -0.0015 0.0840  284 HIS A ND1 
2143 C CD2 . HIS A 283 ? 0.3969 0.5005 0.4441 -0.1020 0.0053  0.0754  284 HIS A CD2 
2144 C CE1 . HIS A 283 ? 0.5183 0.6392 0.5868 -0.0942 0.0007  0.0907  284 HIS A CE1 
2145 N NE2 . HIS A 283 ? 0.4860 0.5894 0.5412 -0.1048 0.0051  0.0854  284 HIS A NE2 
2146 N N   . GLU A 284 ? 0.3577 0.4643 0.4158 -0.0534 0.0026  0.0559  285 GLU A N   
2147 C CA  . GLU A 284 ? 0.4007 0.5141 0.4548 -0.0470 -0.0003 0.0493  285 GLU A CA  
2148 C C   . GLU A 284 ? 0.4078 0.5065 0.4500 -0.0536 0.0038  0.0425  285 GLU A C   
2149 O O   . GLU A 284 ? 0.4510 0.5641 0.4862 -0.0557 -0.0003 0.0382  285 GLU A O   
2150 C CB  . GLU A 284 ? 0.4907 0.5994 0.5536 -0.0341 -0.0005 0.0509  285 GLU A CB  
2151 C CG  . GLU A 284 ? 0.6630 0.7954 0.7311 -0.0265 -0.0076 0.0521  285 GLU A CG  
2152 C CD  . GLU A 284 ? 0.7204 0.8469 0.7947 -0.0160 -0.0079 0.0535  285 GLU A CD  
2153 O OE1 . GLU A 284 ? 0.6561 0.7637 0.7299 -0.0132 -0.0037 0.0521  285 GLU A OE1 
2154 O OE2 . GLU A 284 ? 0.6132 0.7545 0.6919 -0.0115 -0.0121 0.0558  285 GLU A OE2 
2155 N N   . TRP A 285 ? 0.4165 0.4870 0.4565 -0.0568 0.0123  0.0419  286 TRP A N   
2156 C CA  . TRP A 285 ? 0.5452 0.5998 0.5728 -0.0635 0.0173  0.0345  286 TRP A CA  
2157 C C   . TRP A 285 ? 0.5930 0.6525 0.6062 -0.0798 0.0168  0.0311  286 TRP A C   
2158 O O   . TRP A 285 ? 0.6075 0.6670 0.6091 -0.0867 0.0171  0.0252  286 TRP A O   
2159 C CB  . TRP A 285 ? 0.5896 0.6117 0.6186 -0.0615 0.0282  0.0341  286 TRP A CB  
2160 C CG  . TRP A 285 ? 0.6301 0.6495 0.6707 -0.0469 0.0284  0.0366  286 TRP A CG  
2161 C CD1 . TRP A 285 ? 0.5948 0.6112 0.6499 -0.0377 0.0298  0.0447  286 TRP A CD1 
2162 C CD2 . TRP A 285 ? 0.5815 0.6027 0.6196 -0.0411 0.0267  0.0318  286 TRP A CD2 
2163 N NE1 . TRP A 285 ? 0.5526 0.5688 0.6136 -0.0272 0.0292  0.0449  286 TRP A NE1 
2164 C CE2 . TRP A 285 ? 0.5012 0.5193 0.5518 -0.0290 0.0273  0.0369  286 TRP A CE2 
2165 C CE3 . TRP A 285 ? 0.5470 0.5732 0.5736 -0.0458 0.0243  0.0248  286 TRP A CE3 
2166 C CZ2 . TRP A 285 ? 0.4343 0.4527 0.4853 -0.0217 0.0257  0.0344  286 TRP A CZ2 
2167 C CZ3 . TRP A 285 ? 0.5096 0.5359 0.5374 -0.0379 0.0227  0.0228  286 TRP A CZ3 
2168 C CH2 . TRP A 285 ? 0.4505 0.4720 0.4900 -0.0261 0.0235  0.0272  286 TRP A CH2 
2169 N N   . HIS A 286 ? 0.5718 0.6379 0.5856 -0.0870 0.0155  0.0355  287 HIS A N   
2170 C CA  . HIS A 286 ? 0.6190 0.6888 0.6183 -0.1044 0.0152  0.0333  287 HIS A CA  
2171 C C   . HIS A 286 ? 0.6064 0.7122 0.6023 -0.1080 0.0056  0.0331  287 HIS A C   
2172 O O   . HIS A 286 ? 0.7378 0.8536 0.7235 -0.1227 0.0038  0.0333  287 HIS A O   
2173 C CB  . HIS A 286 ? 0.7280 0.7878 0.7281 -0.1123 0.0183  0.0386  287 HIS A CB  
2174 C CG  . HIS A 286 ? 0.9657 0.9901 0.9704 -0.1083 0.0286  0.0402  287 HIS A CG  
2175 N ND1 . HIS A 286 ? 1.0222 1.0445 1.0442 -0.0942 0.0291  0.0473  287 HIS A ND1 
2176 C CD2 . HIS A 286 ? 1.0443 1.0344 1.0386 -0.1164 0.0395  0.0359  287 HIS A CD2 
2177 C CE1 . HIS A 286 ? 1.0323 1.0224 1.0563 -0.0927 0.0396  0.0485  287 HIS A CE1 
2178 N NE2 . HIS A 286 ? 1.0646 1.0333 1.0718 -0.1054 0.0467  0.0411  287 HIS A NE2 
2179 N N   . VAL A 287 ? 0.4609 0.5858 0.4650 -0.0948 -0.0001 0.0332  288 VAL A N   
2180 C CA  . VAL A 287 ? 0.4941 0.6528 0.4966 -0.0960 -0.0081 0.0339  288 VAL A CA  
2181 C C   . VAL A 287 ? 0.5573 0.7178 0.5518 -0.0977 -0.0089 0.0295  288 VAL A C   
2182 O O   . VAL A 287 ? 0.6024 0.7906 0.5952 -0.0996 -0.0150 0.0310  288 VAL A O   
2183 C CB  . VAL A 287 ? 0.4200 0.6039 0.4365 -0.0810 -0.0144 0.0377  288 VAL A CB  
2184 C CG1 . VAL A 287 ? 0.4339 0.6164 0.4582 -0.0798 -0.0138 0.0424  288 VAL A CG1 
2185 C CG2 . VAL A 287 ? 0.3110 0.4884 0.3342 -0.0654 -0.0147 0.0356  288 VAL A CG2 
2186 N N   . LEU A 288 ? 0.5482 0.6806 0.5385 -0.0970 -0.0025 0.0249  289 LEU A N   
2187 C CA  . LEU A 288 ? 0.5599 0.6927 0.5418 -0.1000 -0.0030 0.0209  289 LEU A CA  
2188 C C   . LEU A 288 ? 0.6089 0.7452 0.5738 -0.1209 -0.0021 0.0187  289 LEU A C   
2189 O O   . LEU A 288 ? 0.5825 0.7016 0.5383 -0.1338 0.0034  0.0170  289 LEU A O   
2190 C CB  . LEU A 288 ? 0.5227 0.6258 0.5045 -0.0940 0.0039  0.0165  289 LEU A CB  
2191 C CG  . LEU A 288 ? 0.5402 0.6469 0.5353 -0.0750 0.0006  0.0183  289 LEU A CG  
2192 C CD1 . LEU A 288 ? 0.6104 0.6885 0.6060 -0.0699 0.0079  0.0149  289 LEU A CD1 
2193 C CD2 . LEU A 288 ? 0.4459 0.5778 0.4415 -0.0707 -0.0073 0.0195  289 LEU A CD2 
2194 N N   . PRO A 289 ? 0.7116 0.8703 0.6716 -0.1247 -0.0077 0.0194  290 PRO A N   
2195 C CA  . PRO A 289 ? 0.7700 0.9417 0.7141 -0.1453 -0.0093 0.0191  290 PRO A CA  
2196 C C   . PRO A 289 ? 0.8387 0.9781 0.7639 -0.1627 -0.0001 0.0113  290 PRO A C   
2197 O O   . PRO A 289 ? 0.8958 1.0372 0.8055 -0.1830 0.0009  0.0104  290 PRO A O   
2198 C CB  . PRO A 289 ? 0.7404 0.9397 0.6879 -0.1400 -0.0167 0.0225  290 PRO A CB  
2199 C CG  . PRO A 289 ? 0.6950 0.8810 0.6542 -0.1201 -0.0158 0.0211  290 PRO A CG  
2200 C CD  . PRO A 289 ? 0.6722 0.8448 0.6426 -0.1086 -0.0130 0.0213  290 PRO A CD  
2201 N N   . GLN A 290 ? 0.8192 0.9297 0.7446 -0.1555 0.0069  0.0059  291 GLN A N   
2202 C CA  . GLN A 290 ? 0.8545 0.9305 0.7627 -0.1698 0.0179  -0.0025 291 GLN A CA  
2203 C C   . GLN A 290 ? 0.8036 0.8471 0.7199 -0.1556 0.0268  -0.0062 291 GLN A C   
2204 O O   . GLN A 290 ? 0.7062 0.7561 0.6392 -0.1365 0.0232  -0.0027 291 GLN A O   
2205 C CB  . GLN A 290 ? 0.8678 0.9508 0.7599 -0.1841 0.0171  -0.0063 291 GLN A CB  
2206 C CG  . GLN A 290 ? 0.9123 1.0029 0.8134 -0.1699 0.0135  -0.0055 291 GLN A CG  
2207 C CD  . GLN A 290 ? 0.9779 1.0600 0.8615 -0.1842 0.0174  -0.0118 291 GLN A CD  
2208 O OE1 . GLN A 290 ? 0.9914 1.1001 0.8680 -0.1945 0.0102  -0.0085 291 GLN A OE1 
2209 N NE2 . GLN A 290 ? 0.9764 1.0230 0.8535 -0.1846 0.0289  -0.0201 291 GLN A NE2 
2210 N N   . GLU A 291 ? 0.8145 0.8231 0.7182 -0.1656 0.0389  -0.0132 292 GLU A N   
2211 C CA  . GLU A 291 ? 0.8642 0.8422 0.7735 -0.1542 0.0490  -0.0171 292 GLU A CA  
2212 C C   . GLU A 291 ? 0.7989 0.7842 0.7089 -0.1481 0.0466  -0.0194 292 GLU A C   
2213 O O   . GLU A 291 ? 0.7979 0.7946 0.6938 -0.1613 0.0438  -0.0225 292 GLU A O   
2214 C CB  . GLU A 291 ? 0.9914 0.9312 0.8839 -0.1683 0.0636  -0.0252 292 GLU A CB  
2215 C CG  . GLU A 291 ? 1.1331 1.0431 1.0272 -0.1596 0.0756  -0.0309 292 GLU A CG  
2216 C CD  . GLU A 291 ? 1.2556 1.1325 1.1264 -0.1775 0.0897  -0.0419 292 GLU A CD  
2217 O OE1 . GLU A 291 ? 1.2835 1.1625 1.1347 -0.1987 0.0890  -0.0455 292 GLU A OE1 
2218 O OE2 . GLU A 291 ? 1.2799 1.1292 1.1514 -0.1708 0.1020  -0.0470 292 GLU A OE2 
2219 N N   . SER A 292 ? 0.7214 0.7017 0.6473 -0.1291 0.0472  -0.0170 293 SER A N   
2220 C CA  . SER A 292 ? 0.6321 0.6191 0.5595 -0.1227 0.0444  -0.0183 293 SER A CA  
2221 C C   . SER A 292 ? 0.5228 0.4950 0.4650 -0.1047 0.0488  -0.0168 293 SER A C   
2222 O O   . SER A 292 ? 0.5619 0.5226 0.5155 -0.0958 0.0529  -0.0133 293 SER A O   
2223 C CB  . SER A 292 ? 0.5892 0.6126 0.5231 -0.1180 0.0300  -0.0119 293 SER A CB  
2224 O OG  . SER A 292 ? 0.6024 0.6384 0.5535 -0.1034 0.0240  -0.0049 293 SER A OG  
2225 N N   . VAL A 293 ? 0.4526 0.4269 0.3947 -0.1000 0.0476  -0.0184 294 VAL A N   
2226 C CA  . VAL A 293 ? 0.4503 0.4202 0.4078 -0.0824 0.0479  -0.0149 294 VAL A CA  
2227 C C   . VAL A 293 ? 0.5078 0.5040 0.4727 -0.0735 0.0348  -0.0098 294 VAL A C   
2228 O O   . VAL A 293 ? 0.4638 0.4772 0.4202 -0.0813 0.0281  -0.0102 294 VAL A O   
2229 C CB  . VAL A 293 ? 0.4789 0.4250 0.4313 -0.0828 0.0594  -0.0209 294 VAL A CB  
2230 C CG1 . VAL A 293 ? 0.4739 0.3906 0.4197 -0.0898 0.0741  -0.0260 294 VAL A CG1 
2231 C CG2 . VAL A 293 ? 0.4510 0.4041 0.3885 -0.0939 0.0572  -0.0262 294 VAL A CG2 
2232 N N   . PHE A 294 ? 0.4257 0.4247 0.4058 -0.0577 0.0314  -0.0043 295 PHE A N   
2233 C CA  . PHE A 294 ? 0.3605 0.3789 0.3473 -0.0480 0.0206  0.0001  295 PHE A CA  
2234 C C   . PHE A 294 ? 0.3681 0.4113 0.3562 -0.0488 0.0109  0.0037  295 PHE A C   
2235 O O   . PHE A 294 ? 0.4600 0.5203 0.4482 -0.0458 0.0027  0.0060  295 PHE A O   
2236 C CB  . PHE A 294 ? 0.4057 0.4237 0.3846 -0.0512 0.0197  -0.0028 295 PHE A CB  
2237 C CG  . PHE A 294 ? 0.3836 0.4032 0.3714 -0.0381 0.0153  0.0009  295 PHE A CG  
2238 C CD1 . PHE A 294 ? 0.3577 0.3913 0.3555 -0.0269 0.0064  0.0065  295 PHE A CD1 
2239 C CD2 . PHE A 294 ? 0.3817 0.3886 0.3667 -0.0380 0.0203  -0.0016 295 PHE A CD2 
2240 C CE1 . PHE A 294 ? 0.3911 0.4241 0.3947 -0.0166 0.0024  0.0096  295 PHE A CE1 
2241 C CE2 . PHE A 294 ? 0.3881 0.3968 0.3801 -0.0275 0.0157  0.0023  295 PHE A CE2 
2242 C CZ  . PHE A 294 ? 0.3573 0.3782 0.3581 -0.0172 0.0066  0.0078  295 PHE A CZ  
2243 N N   . ARG A 295 ? 0.3162 0.3614 0.3057 -0.0524 0.0122  0.0048  296 ARG A N   
2244 C CA  . ARG A 295 ? 0.3313 0.4012 0.3246 -0.0512 0.0039  0.0090  296 ARG A CA  
2245 C C   . ARG A 295 ? 0.3885 0.4587 0.3933 -0.0433 0.0039  0.0129  296 ARG A C   
2246 O O   . ARG A 295 ? 0.4427 0.4963 0.4484 -0.0465 0.0110  0.0126  296 ARG A O   
2247 C CB  . ARG A 295 ? 0.3676 0.4474 0.3492 -0.0674 0.0036  0.0073  296 ARG A CB  
2248 C CG  . ARG A 295 ? 0.4825 0.5726 0.4536 -0.0759 0.0003  0.0058  296 ARG A CG  
2249 C CD  . ARG A 295 ? 0.4794 0.5902 0.4589 -0.0637 -0.0090 0.0109  296 ARG A CD  
2250 N NE  . ARG A 295 ? 0.4856 0.6095 0.4560 -0.0727 -0.0128 0.0116  296 ARG A NE  
2251 C CZ  . ARG A 295 ? 0.6030 0.7169 0.5677 -0.0748 -0.0113 0.0091  296 ARG A CZ  
2252 N NH1 . ARG A 295 ? 0.4997 0.5906 0.4672 -0.0676 -0.0058 0.0057  296 ARG A NH1 
2253 N NH2 . ARG A 295 ? 0.7252 0.8543 0.6818 -0.0845 -0.0155 0.0109  296 ARG A NH2 
2254 N N   . PHE A 296 ? 0.2933 0.3820 0.3066 -0.0332 -0.0036 0.0169  297 PHE A N   
2255 C CA  . PHE A 296 ? 0.2992 0.3896 0.3230 -0.0258 -0.0040 0.0207  297 PHE A CA  
2256 C C   . PHE A 296 ? 0.3336 0.4487 0.3596 -0.0262 -0.0099 0.0233  297 PHE A C   
2257 O O   . PHE A 296 ? 0.3749 0.5084 0.3996 -0.0240 -0.0156 0.0237  297 PHE A O   
2258 C CB  . PHE A 296 ? 0.2742 0.3599 0.3058 -0.0129 -0.0058 0.0225  297 PHE A CB  
2259 C CG  . PHE A 296 ? 0.3418 0.4094 0.3703 -0.0123 -0.0016 0.0201  297 PHE A CG  
2260 C CD1 . PHE A 296 ? 0.3748 0.4221 0.4036 -0.0157 0.0071  0.0194  297 PHE A CD1 
2261 C CD2 . PHE A 296 ? 0.3303 0.4013 0.3557 -0.0084 -0.0059 0.0190  297 PHE A CD2 
2262 C CE1 . PHE A 296 ? 0.3590 0.3911 0.3849 -0.0151 0.0117  0.0170  297 PHE A CE1 
2263 C CE2 . PHE A 296 ? 0.3086 0.3647 0.3307 -0.0088 -0.0022 0.0169  297 PHE A CE2 
2264 C CZ  . PHE A 296 ? 0.3622 0.3996 0.3845 -0.0122 0.0068  0.0157  297 PHE A CZ  
2265 N N   . SER A 297 ? 0.3569 0.4732 0.3866 -0.0291 -0.0083 0.0258  298 SER A N   
2266 C CA  . SER A 297 ? 0.3715 0.5115 0.4019 -0.0324 -0.0128 0.0280  298 SER A CA  
2267 C C   . SER A 297 ? 0.3291 0.4899 0.3659 -0.0206 -0.0192 0.0295  298 SER A C   
2268 O O   . SER A 297 ? 0.2585 0.4410 0.2940 -0.0210 -0.0234 0.0302  298 SER A O   
2269 C CB  . SER A 297 ? 0.4337 0.5701 0.4677 -0.0372 -0.0101 0.0311  298 SER A CB  
2270 O OG  . SER A 297 ? 0.5056 0.6224 0.5321 -0.0489 -0.0035 0.0295  298 SER A OG  
2271 N N   . PHE A 298 ? 0.2717 0.4259 0.3154 -0.0102 -0.0193 0.0304  299 PHE A N   
2272 C CA  . PHE A 298 ? 0.2477 0.4178 0.2962 0.0004  -0.0237 0.0310  299 PHE A CA  
2273 C C   . PHE A 298 ? 0.3161 0.4759 0.3649 0.0104  -0.0249 0.0293  299 PHE A C   
2274 O O   . PHE A 298 ? 0.3275 0.4714 0.3785 0.0135  -0.0230 0.0297  299 PHE A O   
2275 C CB  . PHE A 298 ? 0.2987 0.4738 0.3533 0.0016  -0.0235 0.0336  299 PHE A CB  
2276 C CG  . PHE A 298 ? 0.3329 0.5211 0.3872 -0.0080 -0.0233 0.0358  299 PHE A CG  
2277 C CD1 . PHE A 298 ? 0.1924 0.4059 0.2461 -0.0085 -0.0267 0.0360  299 PHE A CD1 
2278 C CD2 . PHE A 298 ? 0.2012 0.3768 0.2560 -0.0165 -0.0196 0.0385  299 PHE A CD2 
2279 C CE1 . PHE A 298 ? 0.2745 0.5019 0.3273 -0.0186 -0.0270 0.0385  299 PHE A CE1 
2280 C CE2 . PHE A 298 ? 0.2430 0.4295 0.2964 -0.0265 -0.0197 0.0409  299 PHE A CE2 
2281 C CZ  . PHE A 298 ? 0.3018 0.5147 0.3536 -0.0282 -0.0238 0.0408  299 PHE A CZ  
2282 N N   . VAL A 299 ? 0.2972 0.4673 0.3441 0.0151  -0.0282 0.0285  300 VAL A N   
2283 C CA  . VAL A 299 ? 0.2175 0.3773 0.2633 0.0235  -0.0297 0.0273  300 VAL A CA  
2284 C C   . VAL A 299 ? 0.2775 0.4534 0.3256 0.0338  -0.0332 0.0277  300 VAL A C   
2285 O O   . VAL A 299 ? 0.2566 0.4531 0.3075 0.0339  -0.0342 0.0289  300 VAL A O   
2286 C CB  . VAL A 299 ? 0.2233 0.3745 0.2633 0.0176  -0.0292 0.0266  300 VAL A CB  
2287 C CG1 . VAL A 299 ? 0.2044 0.3387 0.2416 0.0076  -0.0238 0.0254  300 VAL A CG1 
2288 C CG2 . VAL A 299 ? 0.2023 0.3740 0.2399 0.0131  -0.0321 0.0282  300 VAL A CG2 
2289 N N   . PRO A 300 ? 0.2392 0.4056 0.2863 0.0426  -0.0348 0.0269  301 PRO A N   
2290 C CA  . PRO A 300 ? 0.2359 0.4137 0.2852 0.0539  -0.0369 0.0274  301 PRO A CA  
2291 C C   . PRO A 300 ? 0.2893 0.4913 0.3413 0.0534  -0.0389 0.0309  301 PRO A C   
2292 O O   . PRO A 300 ? 0.2970 0.5024 0.3464 0.0451  -0.0402 0.0330  301 PRO A O   
2293 C CB  . PRO A 300 ? 0.2023 0.3622 0.2483 0.0598  -0.0383 0.0270  301 PRO A CB  
2294 C CG  . PRO A 300 ? 0.1978 0.3376 0.2410 0.0543  -0.0363 0.0252  301 PRO A CG  
2295 C CD  . PRO A 300 ? 0.2000 0.3437 0.2440 0.0430  -0.0340 0.0259  301 PRO A CD  
2296 N N   . VAL A 301 ? 0.2490 0.4691 0.3058 0.0616  -0.0389 0.0317  302 VAL A N   
2297 C CA  . VAL A 301 ? 0.2381 0.4857 0.2993 0.0619  -0.0407 0.0365  302 VAL A CA  
2298 C C   . VAL A 301 ? 0.2666 0.5201 0.3321 0.0763  -0.0418 0.0396  302 VAL A C   
2299 O O   . VAL A 301 ? 0.2909 0.5342 0.3571 0.0881  -0.0397 0.0365  302 VAL A O   
2300 C CB  . VAL A 301 ? 0.1927 0.4618 0.2577 0.0598  -0.0392 0.0366  302 VAL A CB  
2301 C CG1 . VAL A 301 ? 0.1983 0.4642 0.2655 0.0712  -0.0363 0.0327  302 VAL A CG1 
2302 C CG2 . VAL A 301 ? 0.1932 0.4940 0.2633 0.0597  -0.0412 0.0427  302 VAL A CG2 
2303 N N   . VAL A 302 ? 0.2574 0.5268 0.3253 0.0747  -0.0450 0.0460  303 VAL A N   
2304 C CA  . VAL A 302 ? 0.2096 0.4880 0.2837 0.0888  -0.0462 0.0514  303 VAL A CA  
2305 C C   . VAL A 302 ? 0.3365 0.6452 0.4199 0.0970  -0.0446 0.0552  303 VAL A C   
2306 O O   . VAL A 302 ? 0.3487 0.6857 0.4360 0.0905  -0.0470 0.0618  303 VAL A O   
2307 C CB  . VAL A 302 ? 0.2899 0.5750 0.3634 0.0832  -0.0507 0.0584  303 VAL A CB  
2308 C CG1 . VAL A 302 ? 0.2299 0.5278 0.3123 0.0987  -0.0521 0.0663  303 VAL A CG1 
2309 C CG2 . VAL A 302 ? 0.2402 0.4959 0.3048 0.0763  -0.0516 0.0544  303 VAL A CG2 
2310 N N   . ASP A 303 ? 0.3240 0.6271 0.4101 0.1106  -0.0403 0.0511  304 ASP A N   
2311 C CA  . ASP A 303 ? 0.3495 0.6797 0.4437 0.1186  -0.0371 0.0529  304 ASP A CA  
2312 C C   . ASP A 303 ? 0.3622 0.6943 0.4637 0.1394  -0.0332 0.0549  304 ASP A C   
2313 O O   . ASP A 303 ? 0.4481 0.8005 0.5565 0.1484  -0.0289 0.0553  304 ASP A O   
2314 C CB  . ASP A 303 ? 0.3746 0.6999 0.4646 0.1139  -0.0337 0.0448  304 ASP A CB  
2315 C CG  . ASP A 303 ? 0.4639 0.7573 0.5472 0.1204  -0.0302 0.0364  304 ASP A CG  
2316 O OD1 . ASP A 303 ? 0.5104 0.7798 0.5895 0.1234  -0.0315 0.0359  304 ASP A OD1 
2317 O OD2 . ASP A 303 ? 0.6239 0.9172 0.7053 0.1211  -0.0263 0.0307  304 ASP A OD2 
2318 N N   . GLY A 304 ? 0.3087 0.6190 0.4086 0.1473  -0.0340 0.0560  305 GLY A N   
2319 C CA  . GLY A 304 ? 0.3604 0.6685 0.4668 0.1675  -0.0296 0.0583  305 GLY A CA  
2320 C C   . GLY A 304 ? 0.4526 0.7275 0.5503 0.1753  -0.0240 0.0476  305 GLY A C   
2321 O O   . GLY A 304 ? 0.5379 0.7970 0.6364 0.1901  -0.0205 0.0478  305 GLY A O   
2322 N N   . ASP A 305 ? 0.3310 0.5949 0.4198 0.1644  -0.0230 0.0387  306 ASP A N   
2323 C CA  . ASP A 305 ? 0.4478 0.6846 0.5272 0.1691  -0.0176 0.0285  306 ASP A CA  
2324 C C   . ASP A 305 ? 0.4331 0.6349 0.5014 0.1630  -0.0206 0.0250  306 ASP A C   
2325 O O   . ASP A 305 ? 0.4459 0.6283 0.5119 0.1724  -0.0200 0.0260  306 ASP A O   
2326 C CB  . ASP A 305 ? 0.4558 0.7026 0.5323 0.1609  -0.0148 0.0220  306 ASP A CB  
2327 C CG  . ASP A 305 ? 0.5522 0.7766 0.6188 0.1654  -0.0085 0.0118  306 ASP A CG  
2328 O OD1 . ASP A 305 ? 0.6026 0.8080 0.6662 0.1783  -0.0043 0.0095  306 ASP A OD1 
2329 O OD2 . ASP A 305 ? 0.5980 0.8235 0.6593 0.1552  -0.0077 0.0064  306 ASP A OD2 
2330 N N   . PHE A 306 ? 0.3155 0.5098 0.3773 0.1477  -0.0236 0.0217  307 PHE A N   
2331 C CA  . PHE A 306 ? 0.3389 0.5043 0.3915 0.1414  -0.0265 0.0197  307 PHE A CA  
2332 C C   . PHE A 306 ? 0.3526 0.5152 0.4081 0.1436  -0.0311 0.0270  307 PHE A C   
2333 O O   . PHE A 306 ? 0.3722 0.5122 0.4227 0.1493  -0.0314 0.0268  307 PHE A O   
2334 C CB  . PHE A 306 ? 0.2428 0.4055 0.2914 0.1252  -0.0290 0.0177  307 PHE A CB  
2335 C CG  . PHE A 306 ? 0.3400 0.4739 0.3787 0.1200  -0.0301 0.0143  307 PHE A CG  
2336 C CD1 . PHE A 306 ? 0.3368 0.4572 0.3734 0.1173  -0.0340 0.0177  307 PHE A CD1 
2337 C CD2 . PHE A 306 ? 0.3477 0.4699 0.3790 0.1172  -0.0272 0.0082  307 PHE A CD2 
2338 C CE1 . PHE A 306 ? 0.2647 0.3607 0.2924 0.1123  -0.0351 0.0153  307 PHE A CE1 
2339 C CE2 . PHE A 306 ? 0.3504 0.4487 0.3726 0.1115  -0.0286 0.0062  307 PHE A CE2 
2340 C CZ  . PHE A 306 ? 0.2786 0.3640 0.2994 0.1094  -0.0325 0.0099  307 PHE A CZ  
2341 N N   . LEU A 307 ? 0.3526 0.5388 0.4155 0.1379  -0.0347 0.0338  308 LEU A N   
2342 C CA  . LEU A 307 ? 0.3052 0.4953 0.3716 0.1388  -0.0393 0.0420  308 LEU A CA  
2343 C C   . LEU A 307 ? 0.3582 0.5771 0.4365 0.1494  -0.0388 0.0500  308 LEU A C   
2344 O O   . LEU A 307 ? 0.3490 0.5956 0.4332 0.1446  -0.0390 0.0526  308 LEU A O   
2345 C CB  . LEU A 307 ? 0.3189 0.5145 0.3831 0.1220  -0.0438 0.0439  308 LEU A CB  
2346 C CG  . LEU A 307 ? 0.3563 0.5267 0.4110 0.1115  -0.0442 0.0380  308 LEU A CG  
2347 C CD1 . LEU A 307 ? 0.3512 0.5293 0.4045 0.0959  -0.0463 0.0393  308 LEU A CD1 
2348 C CD2 . LEU A 307 ? 0.3369 0.4821 0.3858 0.1158  -0.0459 0.0383  308 LEU A CD2 
2349 N N   . SER A 308 ? 0.3594 0.5724 0.4417 0.1638  -0.0381 0.0549  309 SER A N   
2350 C CA  . SER A 308 ? 0.4176 0.6589 0.5134 0.1763  -0.0368 0.0642  309 SER A CA  
2351 C C   . SER A 308 ? 0.3787 0.6478 0.4811 0.1673  -0.0435 0.0755  309 SER A C   
2352 O O   . SER A 308 ? 0.4714 0.7642 0.5825 0.1691  -0.0424 0.0826  309 SER A O   
2353 C CB  . SER A 308 ? 0.4685 0.6932 0.5672 0.1954  -0.0332 0.0669  309 SER A CB  
2354 O OG  . SER A 308 ? 0.5639 0.7695 0.6584 0.1932  -0.0383 0.0714  309 SER A OG  
2355 N N   . ASP A 309 ? 0.3928 0.6511 0.4870 0.1519  -0.0487 0.0747  310 ASP A N   
2356 C CA  . ASP A 309 ? 0.4118 0.6922 0.5083 0.1400  -0.0549 0.0839  310 ASP A CA  
2357 C C   . ASP A 309 ? 0.3914 0.6539 0.4755 0.1215  -0.0573 0.0772  310 ASP A C   
2358 O O   . ASP A 309 ? 0.4101 0.6464 0.4864 0.1200  -0.0545 0.0674  310 ASP A O   
2359 C CB  . ASP A 309 ? 0.4239 0.7035 0.5255 0.1476  -0.0578 0.0942  310 ASP A CB  
2360 C CG  . ASP A 309 ? 0.5345 0.8437 0.6411 0.1372  -0.0616 0.1050  310 ASP A CG  
2361 O OD1 . ASP A 309 ? 0.5208 0.8472 0.6235 0.1208  -0.0645 0.1047  310 ASP A OD1 
2362 O OD2 . ASP A 309 ? 0.6468 0.9617 0.7609 0.1451  -0.0616 0.1140  310 ASP A OD2 
2363 N N   . THR A 310 ? 0.3156 0.5927 0.3977 0.1071  -0.0620 0.0825  311 THR A N   
2364 C CA  . THR A 310 ? 0.3385 0.5980 0.4087 0.0902  -0.0629 0.0761  311 THR A CA  
2365 C C   . THR A 310 ? 0.3487 0.5777 0.4132 0.0942  -0.0637 0.0737  311 THR A C   
2366 O O   . THR A 310 ? 0.3798 0.6067 0.4488 0.1055  -0.0657 0.0802  311 THR A O   
2367 C CB  . THR A 310 ? 0.3352 0.6147 0.4023 0.0734  -0.0671 0.0820  311 THR A CB  
2368 O OG1 . THR A 310 ? 0.4085 0.6900 0.4770 0.0754  -0.0717 0.0906  311 THR A OG1 
2369 C CG2 . THR A 310 ? 0.2624 0.5778 0.3365 0.0706  -0.0678 0.0881  311 THR A CG2 
2370 N N   . PRO A 311 ? 0.3167 0.5226 0.3719 0.0850  -0.0620 0.0652  312 PRO A N   
2371 C CA  . PRO A 311 ? 0.3424 0.5206 0.3913 0.0868  -0.0628 0.0629  312 PRO A CA  
2372 C C   . PRO A 311 ? 0.4302 0.6132 0.4781 0.0830  -0.0681 0.0711  312 PRO A C   
2373 O O   . PRO A 311 ? 0.4830 0.6498 0.5295 0.0900  -0.0700 0.0734  312 PRO A O   
2374 C CB  . PRO A 311 ? 0.3345 0.4965 0.3753 0.0747  -0.0599 0.0544  312 PRO A CB  
2375 C CG  . PRO A 311 ? 0.3318 0.5055 0.3757 0.0729  -0.0564 0.0505  312 PRO A CG  
2376 C CD  . PRO A 311 ? 0.3373 0.5415 0.3881 0.0737  -0.0586 0.0577  312 PRO A CD  
2377 N N   A GLU A 312 ? 0.4400 0.6450 0.4877 0.0707  -0.0704 0.0755  313 GLU A N   
2378 N N   B GLU A 312 ? 0.4466 0.6517 0.4944 0.0710  -0.0705 0.0757  313 GLU A N   
2379 C CA  A GLU A 312 ? 0.4894 0.7046 0.5362 0.0652  -0.0758 0.0844  313 GLU A CA  
2380 C CA  B GLU A 312 ? 0.4856 0.6990 0.5323 0.0658  -0.0759 0.0844  313 GLU A CA  
2381 C C   A GLU A 312 ? 0.5055 0.7309 0.5628 0.0811  -0.0791 0.0956  313 GLU A C   
2382 C C   B GLU A 312 ? 0.5012 0.7274 0.5587 0.0811  -0.0794 0.0960  313 GLU A C   
2383 O O   A GLU A 312 ? 0.5271 0.7417 0.5834 0.0846  -0.0826 0.1007  313 GLU A O   
2384 O O   B GLU A 312 ? 0.5210 0.7389 0.5780 0.0842  -0.0831 0.1021  313 GLU A O   
2385 C CB  A GLU A 312 ? 0.5034 0.7446 0.5478 0.0485  -0.0773 0.0876  313 GLU A CB  
2386 C CB  B GLU A 312 ? 0.5111 0.7466 0.5534 0.0473  -0.0775 0.0868  313 GLU A CB  
2387 C CG  A GLU A 312 ? 0.5596 0.7878 0.5915 0.0305  -0.0739 0.0780  313 GLU A CG  
2388 C CG  B GLU A 312 ? 0.5439 0.7914 0.5846 0.0402  -0.0834 0.0966  313 GLU A CG  
2389 C CD  A GLU A 312 ? 0.6285 0.8528 0.6596 0.0281  -0.0683 0.0693  313 GLU A CD  
2390 C CD  B GLU A 312 ? 0.5814 0.8371 0.6107 0.0175  -0.0835 0.0942  313 GLU A CD  
2391 O OE1 A GLU A 312 ? 0.6254 0.8509 0.6641 0.0412  -0.0668 0.0686  313 GLU A OE1 
2392 O OE1 B GLU A 312 ? 0.6082 0.8529 0.6301 0.0083  -0.0780 0.0836  313 GLU A OE1 
2393 O OE2 A GLU A 312 ? 0.6460 0.8652 0.6681 0.0129  -0.0651 0.0632  313 GLU A OE2 
2394 O OE2 B GLU A 312 ? 0.5734 0.8461 0.6009 0.0086  -0.0886 0.1030  313 GLU A OE2 
2395 N N   . ALA A 313 ? 0.4105 0.6570 0.4783 0.0910  -0.0778 0.0998  314 ALA A N   
2396 C CA  . ALA A 313 ? 0.3470 0.6053 0.4269 0.1080  -0.0796 0.1112  314 ALA A CA  
2397 C C   . ALA A 313 ? 0.3867 0.6130 0.4657 0.1240  -0.0768 0.1072  314 ALA A C   
2398 O O   . ALA A 313 ? 0.4392 0.6605 0.5226 0.1340  -0.0793 0.1159  314 ALA A O   
2399 C CB  . ALA A 313 ? 0.2618 0.5485 0.3527 0.1145  -0.0769 0.1151  314 ALA A CB  
2400 N N   . LEU A 314 ? 0.4060 0.6106 0.4789 0.1255  -0.0716 0.0946  315 LEU A N   
2401 C CA  . LEU A 314 ? 0.3782 0.5522 0.4479 0.1387  -0.0683 0.0896  315 LEU A CA  
2402 C C   . LEU A 314 ? 0.3991 0.5489 0.4603 0.1343  -0.0722 0.0906  315 LEU A C   
2403 O O   . LEU A 314 ? 0.4786 0.6096 0.5394 0.1457  -0.0722 0.0934  315 LEU A O   
2404 C CB  . LEU A 314 ? 0.2936 0.4527 0.3572 0.1377  -0.0627 0.0765  315 LEU A CB  
2405 C CG  . LEU A 314 ? 0.3535 0.5336 0.4249 0.1439  -0.0582 0.0747  315 LEU A CG  
2406 C CD1 . LEU A 314 ? 0.3405 0.5059 0.4049 0.1403  -0.0535 0.0625  315 LEU A CD1 
2407 C CD2 . LEU A 314 ? 0.3562 0.5418 0.4375 0.1638  -0.0551 0.0805  315 LEU A CD2 
2408 N N   . ILE A 315 ? 0.3757 0.5256 0.4294 0.1172  -0.0750 0.0882  316 ILE A N   
2409 C CA  . ILE A 315 ? 0.4921 0.6233 0.5376 0.1107  -0.0789 0.0895  316 ILE A CA  
2410 C C   . ILE A 315 ? 0.5583 0.7012 0.6097 0.1147  -0.0846 0.1034  316 ILE A C   
2411 O O   . ILE A 315 ? 0.5874 0.7108 0.6360 0.1204  -0.0869 0.1069  316 ILE A O   
2412 C CB  . ILE A 315 ? 0.5094 0.6409 0.5464 0.0917  -0.0792 0.0836  316 ILE A CB  
2413 C CG1 . ILE A 315 ? 0.4631 0.5752 0.4939 0.0893  -0.0740 0.0716  316 ILE A CG1 
2414 C CG2 . ILE A 315 ? 0.5528 0.6756 0.5831 0.0834  -0.0839 0.0878  316 ILE A CG2 
2415 C CD1 . ILE A 315 ? 0.4631 0.5781 0.4884 0.0733  -0.0720 0.0657  316 ILE A CD1 
2416 N N   . ASN A 316 ? 0.5973 0.7728 0.6568 0.1111  -0.0873 0.1122  317 ASN A N   
2417 C CA  . ASN A 316 ? 0.6097 0.8017 0.6764 0.1140  -0.0933 0.1276  317 ASN A CA  
2418 C C   . ASN A 316 ? 0.6264 0.8106 0.7030 0.1346  -0.0914 0.1340  317 ASN A C   
2419 O O   . ASN A 316 ? 0.6865 0.8660 0.7655 0.1372  -0.0947 0.1428  317 ASN A O   
2420 C CB  . ASN A 316 ? 0.5398 0.7710 0.6123 0.1033  -0.0964 0.1357  317 ASN A CB  
2421 C CG  . ASN A 316 ? 0.6246 0.8586 0.6848 0.0805  -0.0971 0.1285  317 ASN A CG  
2422 O OD1 . ASN A 316 ? 0.7627 0.9727 0.8119 0.0729  -0.0968 0.1210  317 ASN A OD1 
2423 N ND2 . ASN A 316 ? 0.6153 0.8784 0.6768 0.0693  -0.0976 0.1307  317 ASN A ND2 
2424 N N   . ALA A 317 ? 0.6262 0.8050 0.7066 0.1471  -0.0848 0.1274  318 ALA A N   
2425 C CA  . ALA A 317 ? 0.6190 0.7887 0.7080 0.1647  -0.0803 0.1301  318 ALA A CA  
2426 C C   . ALA A 317 ? 0.6503 0.7808 0.7314 0.1756  -0.0772 0.1238  318 ALA A C   
2427 O O   . ALA A 317 ? 0.7578 0.8737 0.8434 0.1889  -0.0741 0.1267  318 ALA A O   
2428 C CB  . ALA A 317 ? 0.5819 0.7705 0.6796 0.1713  -0.0740 0.1268  318 ALA A CB  
2429 N N   . GLY A 318 ? 0.6661 0.7779 0.7342 0.1685  -0.0775 0.1143  319 GLY A N   
2430 C CA  . GLY A 318 ? 0.6471 0.7204 0.7046 0.1748  -0.0736 0.1056  319 GLY A CA  
2431 C C   . GLY A 318 ? 0.6166 0.6660 0.6686 0.1768  -0.0778 0.1120  319 GLY A C   
2432 O O   . GLY A 318 ? 0.5909 0.6501 0.6436 0.1679  -0.0848 0.1210  319 GLY A O   
2433 N N   . ASP A 319 ? 0.6079 0.6250 0.6534 0.1878  -0.0733 0.1074  320 ASP A N   
2434 C CA  . ASP A 319 ? 0.6293 0.6161 0.6648 0.1867  -0.0767 0.1103  320 ASP A CA  
2435 C C   . ASP A 319 ? 0.5825 0.5437 0.6008 0.1749  -0.0753 0.0965  320 ASP A C   
2436 O O   . ASP A 319 ? 0.5697 0.5186 0.5827 0.1786  -0.0687 0.0856  320 ASP A O   
2437 C CB  . ASP A 319 ? 0.6536 0.6193 0.6926 0.2040  -0.0718 0.1141  320 ASP A CB  
2438 C CG  . ASP A 319 ? 0.8494 0.7766 0.8742 0.2029  -0.0741 0.1146  320 ASP A CG  
2439 O OD1 . ASP A 319 ? 0.8886 0.8147 0.9070 0.1908  -0.0822 0.1195  320 ASP A OD1 
2440 O OD2 . ASP A 319 ? 1.0001 0.8978 1.0195 0.2127  -0.0674 0.1095  320 ASP A OD2 
2441 N N   . PHE A 320 ? 0.5278 0.4830 0.5376 0.1602  -0.0815 0.0974  321 PHE A N   
2442 C CA  . PHE A 320 ? 0.5003 0.4374 0.4959 0.1479  -0.0806 0.0861  321 PHE A CA  
2443 C C   . PHE A 320 ? 0.5503 0.4564 0.5324 0.1435  -0.0840 0.0873  321 PHE A C   
2444 O O   . PHE A 320 ? 0.5863 0.4830 0.5576 0.1302  -0.0857 0.0818  321 PHE A O   
2445 C CB  . PHE A 320 ? 0.5071 0.4669 0.5042 0.1321  -0.0832 0.0837  321 PHE A CB  
2446 C CG  . PHE A 320 ? 0.4785 0.4665 0.4862 0.1336  -0.0798 0.0814  321 PHE A CG  
2447 C CD1 . PHE A 320 ? 0.4725 0.4585 0.4786 0.1346  -0.0739 0.0711  321 PHE A CD1 
2448 C CD2 . PHE A 320 ? 0.4289 0.4464 0.4475 0.1323  -0.0829 0.0901  321 PHE A CD2 
2449 C CE1 . PHE A 320 ? 0.4440 0.4559 0.4594 0.1349  -0.0711 0.0693  321 PHE A CE1 
2450 C CE2 . PHE A 320 ? 0.4987 0.5422 0.5258 0.1320  -0.0802 0.0882  321 PHE A CE2 
2451 C CZ  . PHE A 320 ? 0.4757 0.5159 0.5013 0.1335  -0.0742 0.0777  321 PHE A CZ  
2452 N N   . HIS A 321 ? 0.5460 0.4366 0.5289 0.1547  -0.0849 0.0954  322 HIS A N   
2453 C CA  . HIS A 321 ? 0.5687 0.4254 0.5370 0.1514  -0.0874 0.0962  322 HIS A CA  
2454 C C   . HIS A 321 ? 0.6540 0.4843 0.6067 0.1474  -0.0822 0.0828  322 HIS A C   
2455 O O   . HIS A 321 ? 0.5652 0.3915 0.5183 0.1562  -0.0748 0.0751  322 HIS A O   
2456 C CB  . HIS A 321 ? 0.6119 0.4528 0.5841 0.1670  -0.0871 0.1063  322 HIS A CB  
2457 C CG  . HIS A 321 ? 0.6272 0.4875 0.6101 0.1663  -0.0949 0.1220  322 HIS A CG  
2458 N ND1 . HIS A 321 ? 0.6202 0.5107 0.6217 0.1764  -0.0951 0.1321  322 HIS A ND1 
2459 C CD2 . HIS A 321 ? 0.6778 0.5337 0.6551 0.1556  -0.1030 0.1300  322 HIS A CD2 
2460 C CE1 . HIS A 321 ? 0.6647 0.5686 0.6714 0.1712  -0.1032 0.1458  322 HIS A CE1 
2461 N NE2 . HIS A 321 ? 0.7059 0.5886 0.6980 0.1590  -0.1080 0.1446  322 HIS A NE2 
2462 N N   . GLY A 322 ? 0.7131 0.5280 0.6517 0.1330  -0.0862 0.0804  323 GLY A N   
2463 C CA  . GLY A 322 ? 0.6619 0.4540 0.5846 0.1263  -0.0825 0.0694  323 GLY A CA  
2464 C C   . GLY A 322 ? 0.6626 0.4744 0.5867 0.1155  -0.0811 0.0617  323 GLY A C   
2465 O O   . GLY A 322 ? 0.7455 0.5442 0.6581 0.1091  -0.0782 0.0535  323 GLY A O   
2466 N N   . LEU A 323 ? 0.5469 0.3900 0.4846 0.1130  -0.0831 0.0650  324 LEU A N   
2467 C CA  . LEU A 323 ? 0.4385 0.3002 0.3790 0.1035  -0.0814 0.0589  324 LEU A CA  
2468 C C   . LEU A 323 ? 0.5014 0.3699 0.4392 0.0889  -0.0864 0.0618  324 LEU A C   
2469 O O   . LEU A 323 ? 0.5539 0.4320 0.4960 0.0868  -0.0911 0.0693  324 LEU A O   
2470 C CB  . LEU A 323 ? 0.3897 0.2806 0.3460 0.1096  -0.0789 0.0593  324 LEU A CB  
2471 C CG  . LEU A 323 ? 0.3874 0.2977 0.3480 0.1005  -0.0769 0.0540  324 LEU A CG  
2472 C CD1 . LEU A 323 ? 0.3694 0.2674 0.3221 0.0983  -0.0725 0.0455  324 LEU A CD1 
2473 C CD2 . LEU A 323 ? 0.3501 0.2873 0.3246 0.1059  -0.0748 0.0552  324 LEU A CD2 
2474 N N   . GLN A 324 ? 0.4713 0.3362 0.4020 0.0787  -0.0852 0.0566  325 GLN A N   
2475 C CA  . GLN A 324 ? 0.4173 0.2933 0.3482 0.0660  -0.0880 0.0588  325 GLN A CA  
2476 C C   . GLN A 324 ? 0.4486 0.3462 0.3888 0.0626  -0.0837 0.0544  325 GLN A C   
2477 O O   . GLN A 324 ? 0.4897 0.3868 0.4299 0.0639  -0.0796 0.0488  325 GLN A O   
2478 C CB  . GLN A 324 ? 0.4383 0.2959 0.3551 0.0560  -0.0907 0.0590  325 GLN A CB  
2479 C CG  . GLN A 324 ? 0.4885 0.3211 0.3941 0.0580  -0.0949 0.0633  325 GLN A CG  
2480 C CD  . GLN A 324 ? 0.5780 0.3860 0.4729 0.0633  -0.0916 0.0580  325 GLN A CD  
2481 O OE1 . GLN A 324 ? 0.6115 0.4166 0.5006 0.0581  -0.0885 0.0520  325 GLN A OE1 
2482 N NE2 . GLN A 324 ? 0.6644 0.4547 0.5567 0.0737  -0.0918 0.0604  325 GLN A NE2 
2483 N N   . VAL A 325 ? 0.3609 0.2765 0.3081 0.0576  -0.0845 0.0570  326 VAL A N   
2484 C CA  . VAL A 325 ? 0.3097 0.2439 0.2655 0.0542  -0.0799 0.0534  326 VAL A CA  
2485 C C   . VAL A 325 ? 0.3949 0.3357 0.3502 0.0432  -0.0800 0.0549  326 VAL A C   
2486 O O   . VAL A 325 ? 0.4010 0.3409 0.3526 0.0388  -0.0840 0.0594  326 VAL A O   
2487 C CB  . VAL A 325 ? 0.3502 0.3023 0.3160 0.0596  -0.0787 0.0539  326 VAL A CB  
2488 C CG1 . VAL A 325 ? 0.3446 0.3113 0.3175 0.0566  -0.0733 0.0491  326 VAL A CG1 
2489 C CG2 . VAL A 325 ? 0.4564 0.4038 0.4240 0.0719  -0.0787 0.0542  326 VAL A CG2 
2490 N N   . LEU A 326 ? 0.3057 0.2535 0.2649 0.0391  -0.0751 0.0514  327 LEU A N   
2491 C CA  . LEU A 326 ? 0.2838 0.2395 0.2447 0.0303  -0.0727 0.0520  327 LEU A CA  
2492 C C   . LEU A 326 ? 0.3080 0.2784 0.2782 0.0305  -0.0667 0.0483  327 LEU A C   
2493 O O   . LEU A 326 ? 0.3361 0.3089 0.3111 0.0347  -0.0634 0.0454  327 LEU A O   
2494 C CB  . LEU A 326 ? 0.3242 0.2736 0.2816 0.0255  -0.0717 0.0528  327 LEU A CB  
2495 C CG  . LEU A 326 ? 0.4628 0.4211 0.4243 0.0183  -0.0672 0.0537  327 LEU A CG  
2496 C CD1 . LEU A 326 ? 0.5351 0.4961 0.4932 0.0123  -0.0689 0.0561  327 LEU A CD1 
2497 C CD2 . LEU A 326 ? 0.4976 0.4515 0.4563 0.0147  -0.0674 0.0564  327 LEU A CD2 
2498 N N   . VAL A 327 ? 0.2875 0.2673 0.2591 0.0252  -0.0652 0.0484  328 VAL A N   
2499 C CA  . VAL A 327 ? 0.3186 0.3103 0.2964 0.0237  -0.0595 0.0446  328 VAL A CA  
2500 C C   . VAL A 327 ? 0.3146 0.3100 0.2917 0.0148  -0.0544 0.0432  328 VAL A C   
2501 O O   . VAL A 327 ? 0.3107 0.3039 0.2821 0.0096  -0.0569 0.0458  328 VAL A O   
2502 C CB  . VAL A 327 ? 0.3211 0.3223 0.2999 0.0258  -0.0624 0.0455  328 VAL A CB  
2503 C CG1 . VAL A 327 ? 0.2930 0.2906 0.2733 0.0361  -0.0664 0.0470  328 VAL A CG1 
2504 C CG2 . VAL A 327 ? 0.3222 0.3261 0.2956 0.0199  -0.0669 0.0496  328 VAL A CG2 
2505 N N   . GLY A 328 ? 0.2502 0.2502 0.2324 0.0130  -0.0467 0.0391  329 GLY A N   
2506 C CA  . GLY A 328 ? 0.2516 0.2533 0.2328 0.0052  -0.0398 0.0367  329 GLY A CA  
2507 C C   . GLY A 328 ? 0.3410 0.3455 0.3269 0.0036  -0.0310 0.0318  329 GLY A C   
2508 O O   . GLY A 328 ? 0.3141 0.3207 0.3049 0.0083  -0.0307 0.0308  329 GLY A O   
2509 N N   . VAL A 329 ? 0.2534 0.2572 0.2372 -0.0034 -0.0233 0.0285  330 VAL A N   
2510 C CA  . VAL A 329 ? 0.3426 0.3451 0.3290 -0.0061 -0.0133 0.0233  330 VAL A CA  
2511 C C   . VAL A 329 ? 0.3880 0.3845 0.3767 -0.0078 -0.0036 0.0222  330 VAL A C   
2512 O O   . VAL A 329 ? 0.3103 0.3067 0.2968 -0.0089 -0.0054 0.0251  330 VAL A O   
2513 C CB  . VAL A 329 ? 0.3632 0.3710 0.3415 -0.0152 -0.0125 0.0188  330 VAL A CB  
2514 C CG1 . VAL A 329 ? 0.2691 0.2859 0.2474 -0.0124 -0.0214 0.0213  330 VAL A CG1 
2515 C CG2 . VAL A 329 ? 0.2708 0.2804 0.2400 -0.0237 -0.0134 0.0186  330 VAL A CG2 
2516 N N   . VAL A 330 ? 0.3121 0.3038 0.3058 -0.0074 0.0069  0.0189  331 VAL A N   
2517 C CA  . VAL A 330 ? 0.2841 0.2697 0.2803 -0.0086 0.0185  0.0173  331 VAL A CA  
2518 C C   . VAL A 330 ? 0.3329 0.3154 0.3177 -0.0192 0.0252  0.0094  331 VAL A C   
2519 O O   . VAL A 330 ? 0.3558 0.3421 0.3325 -0.0257 0.0207  0.0063  331 VAL A O   
2520 C CB  . VAL A 330 ? 0.2673 0.2472 0.2748 -0.0025 0.0280  0.0181  331 VAL A CB  
2521 C CG1 . VAL A 330 ? 0.2543 0.2392 0.2718 0.0061  0.0208  0.0258  331 VAL A CG1 
2522 C CG2 . VAL A 330 ? 0.2783 0.2529 0.2821 -0.0069 0.0334  0.0116  331 VAL A CG2 
2523 N N   . LYS A 331 ? 0.3053 0.4389 0.3304 0.0039  -0.0049 0.0121  332 LYS A N   
2524 C CA  . LYS A 331 ? 0.3408 0.4701 0.3635 0.0077  -0.0044 0.0087  332 LYS A CA  
2525 C C   . LYS A 331 ? 0.3430 0.4627 0.3699 0.0146  -0.0069 0.0073  332 LYS A C   
2526 O O   . LYS A 331 ? 0.3417 0.4523 0.3648 0.0163  -0.0073 0.0049  332 LYS A O   
2527 C CB  . LYS A 331 ? 0.3401 0.4849 0.3645 0.0093  -0.0018 0.0069  332 LYS A CB  
2528 C CG  . LYS A 331 ? 0.3958 0.5389 0.4172 0.0127  -0.0009 0.0029  332 LYS A CG  
2529 C CD  . LYS A 331 ? 0.5082 0.6709 0.5310 0.0134  0.0019  0.0005  332 LYS A CD  
2530 C CE  . LYS A 331 ? 0.5759 0.7390 0.5974 0.0187  0.0025  -0.0042 332 LYS A CE  
2531 N NZ  . LYS A 331 ? 0.7259 0.8825 0.7542 0.0293  -0.0003 -0.0065 332 LYS A NZ  
2532 N N   . ASP A 332 ? 0.2748 0.3960 0.3087 0.0178  -0.0089 0.0092  333 ASP A N   
2533 C CA  . ASP A 332 ? 0.2990 0.4103 0.3355 0.0230  -0.0121 0.0086  333 ASP A CA  
2534 C C   . ASP A 332 ? 0.3145 0.4211 0.3533 0.0205  -0.0149 0.0120  333 ASP A C   
2535 O O   . ASP A 332 ? 0.3578 0.4666 0.4016 0.0224  -0.0172 0.0142  333 ASP A O   
2536 C CB  . ASP A 332 ? 0.3542 0.4703 0.3953 0.0305  -0.0133 0.0070  333 ASP A CB  
2537 C CG  . ASP A 332 ? 0.4817 0.6061 0.5210 0.0334  -0.0105 0.0029  333 ASP A CG  
2538 O OD1 . ASP A 332 ? 0.5059 0.6228 0.5418 0.0359  -0.0106 -0.0001 333 ASP A OD1 
2539 O OD2 . ASP A 332 ? 0.4723 0.6120 0.5135 0.0328  -0.0081 0.0026  333 ASP A OD2 
2540 N N   . GLU A 333 ? 0.3185 0.4195 0.3533 0.0163  -0.0151 0.0120  334 GLU A N   
2541 C CA  . GLU A 333 ? 0.3151 0.4151 0.3516 0.0130  -0.0173 0.0144  334 GLU A CA  
2542 C C   . GLU A 333 ? 0.3349 0.4292 0.3739 0.0147  -0.0210 0.0157  334 GLU A C   
2543 O O   . GLU A 333 ? 0.3481 0.4451 0.3900 0.0119  -0.0231 0.0187  334 GLU A O   
2544 C CB  . GLU A 333 ? 0.3188 0.4145 0.3496 0.0096  -0.0172 0.0127  334 GLU A CB  
2545 C CG  . GLU A 333 ? 0.4112 0.5106 0.4378 0.0060  -0.0153 0.0126  334 GLU A CG  
2546 C CD  . GLU A 333 ? 0.5445 0.6523 0.5748 0.0026  -0.0156 0.0155  334 GLU A CD  
2547 O OE1 . GLU A 333 ? 0.5200 0.6307 0.5557 0.0028  -0.0173 0.0175  334 GLU A OE1 
2548 O OE2 . GLU A 333 ? 0.5141 0.6252 0.5410 -0.0008 -0.0144 0.0160  334 GLU A OE2 
2549 N N   . GLY A 334 ? 0.2814 0.3674 0.3184 0.0186  -0.0221 0.0135  335 GLY A N   
2550 C CA  . GLY A 334 ? 0.3199 0.3979 0.3568 0.0188  -0.0262 0.0147  335 GLY A CA  
2551 C C   . GLY A 334 ? 0.3211 0.3967 0.3608 0.0221  -0.0298 0.0169  335 GLY A C   
2552 O O   . GLY A 334 ? 0.3350 0.4060 0.3745 0.0195  -0.0340 0.0200  335 GLY A O   
2553 N N   . SER A 335 ? 0.3658 0.4449 0.4074 0.0278  -0.0286 0.0153  336 SER A N   
2554 C CA  . SER A 335 ? 0.4007 0.4754 0.4436 0.0337  -0.0329 0.0156  336 SER A CA  
2555 C C   . SER A 335 ? 0.4140 0.4880 0.4589 0.0310  -0.0373 0.0205  336 SER A C   
2556 O O   . SER A 335 ? 0.4545 0.5171 0.4969 0.0322  -0.0432 0.0221  336 SER A O   
2557 C CB  . SER A 335 ? 0.4572 0.5416 0.5028 0.0401  -0.0303 0.0124  336 SER A CB  
2558 O OG  . SER A 335 ? 0.3249 0.4232 0.3739 0.0366  -0.0265 0.0139  336 SER A OG  
2559 N N   . TYR A 336 ? 0.3890 0.4744 0.4377 0.0269  -0.0349 0.0230  337 TYR A N   
2560 C CA  . TYR A 336 ? 0.4319 0.5188 0.4829 0.0237  -0.0385 0.0278  337 TYR A CA  
2561 C C   . TYR A 336 ? 0.4307 0.5076 0.4779 0.0180  -0.0432 0.0309  337 TYR A C   
2562 O O   . TYR A 336 ? 0.4147 0.4849 0.4606 0.0173  -0.0491 0.0344  337 TYR A O   
2563 C CB  . TYR A 336 ? 0.4894 0.5905 0.5443 0.0187  -0.0343 0.0295  337 TYR A CB  
2564 C CG  . TYR A 336 ? 0.5888 0.6934 0.6461 0.0137  -0.0372 0.0346  337 TYR A CG  
2565 C CD1 . TYR A 336 ? 0.6734 0.7780 0.7293 0.0062  -0.0384 0.0370  337 TYR A CD1 
2566 C CD2 . TYR A 336 ? 0.6751 0.7851 0.7360 0.0165  -0.0388 0.0366  337 TYR A CD2 
2567 C CE1 . TYR A 336 ? 0.7732 0.8825 0.8310 0.0009  -0.0410 0.0416  337 TYR A CE1 
2568 C CE2 . TYR A 336 ? 0.7576 0.8709 0.8204 0.0115  -0.0416 0.0414  337 TYR A CE2 
2569 C CZ  . TYR A 336 ? 0.8508 0.9636 0.9119 0.0034  -0.0426 0.0441  337 TYR A CZ  
2570 O OH  . TYR A 336 ? 0.9415 1.0590 1.0042 -0.0024 -0.0454 0.0489  337 TYR A OH  
2571 N N   . PHE A 337 ? 0.3997 0.4757 0.4443 0.0139  -0.0411 0.0294  338 PHE A N   
2572 C CA  . PHE A 337 ? 0.3928 0.4643 0.4341 0.0069  -0.0448 0.0321  338 PHE A CA  
2573 C C   . PHE A 337 ? 0.3989 0.4545 0.4344 0.0083  -0.0504 0.0324  338 PHE A C   
2574 O O   . PHE A 337 ? 0.3267 0.3773 0.3585 0.0018  -0.0553 0.0361  338 PHE A O   
2575 C CB  . PHE A 337 ? 0.3055 0.3839 0.3462 0.0026  -0.0409 0.0297  338 PHE A CB  
2576 C CG  . PHE A 337 ? 0.3904 0.4822 0.4350 0.0004  -0.0369 0.0297  338 PHE A CG  
2577 C CD1 . PHE A 337 ? 0.3832 0.4837 0.4297 -0.0060 -0.0383 0.0330  338 PHE A CD1 
2578 C CD2 . PHE A 337 ? 0.4008 0.4964 0.4464 0.0042  -0.0322 0.0266  338 PHE A CD2 
2579 C CE1 . PHE A 337 ? 0.4087 0.5209 0.4585 -0.0077 -0.0350 0.0328  338 PHE A CE1 
2580 C CE2 . PHE A 337 ? 0.3241 0.4301 0.3719 0.0017  -0.0293 0.0268  338 PHE A CE2 
2581 C CZ  . PHE A 337 ? 0.3356 0.4497 0.3857 -0.0038 -0.0308 0.0297  338 PHE A CZ  
2582 N N   . LEU A 338 ? 0.3663 0.4144 0.4005 0.0163  -0.0501 0.0286  339 LEU A N   
2583 C CA  . LEU A 338 ? 0.3601 0.3918 0.3882 0.0188  -0.0556 0.0280  339 LEU A CA  
2584 C C   . LEU A 338 ? 0.3870 0.4070 0.4115 0.0191  -0.0639 0.0320  339 LEU A C   
2585 O O   . LEU A 338 ? 0.3476 0.3533 0.3648 0.0159  -0.0701 0.0340  339 LEU A O   
2586 C CB  . LEU A 338 ? 0.4101 0.4383 0.4378 0.0279  -0.0530 0.0222  339 LEU A CB  
2587 C CG  . LEU A 338 ? 0.4441 0.4803 0.4730 0.0264  -0.0461 0.0187  339 LEU A CG  
2588 C CD1 . LEU A 338 ? 0.3662 0.4002 0.3942 0.0342  -0.0434 0.0132  339 LEU A CD1 
2589 C CD2 . LEU A 338 ? 0.2690 0.3018 0.2939 0.0190  -0.0471 0.0198  339 LEU A CD2 
2590 N N   . VAL A 339 ? 0.3149 0.3404 0.3434 0.0225  -0.0646 0.0335  340 VAL A N   
2591 C CA  . VAL A 339 ? 0.3699 0.3834 0.3943 0.0233  -0.0734 0.0373  340 VAL A CA  
2592 C C   . VAL A 339 ? 0.4524 0.4650 0.4736 0.0111  -0.0773 0.0440  340 VAL A C   
2593 O O   . VAL A 339 ? 0.4459 0.4471 0.4619 0.0092  -0.0855 0.0484  340 VAL A O   
2594 C CB  . VAL A 339 ? 0.4028 0.4230 0.4324 0.0315  -0.0735 0.0364  340 VAL A CB  
2595 C CG1 . VAL A 339 ? 0.4608 0.4851 0.4934 0.0429  -0.0697 0.0294  340 VAL A CG1 
2596 C CG2 . VAL A 339 ? 0.4105 0.4491 0.4473 0.0260  -0.0680 0.0390  340 VAL A CG2 
2597 N N   . TYR A 340 ? 0.5205 0.5452 0.5440 0.0028  -0.0721 0.0446  341 TYR A N   
2598 C CA  . TYR A 340 ? 0.5185 0.5469 0.5395 -0.0093 -0.0750 0.0502  341 TYR A CA  
2599 C C   . TYR A 340 ? 0.4580 0.4786 0.4711 -0.0174 -0.0786 0.0516  341 TYR A C   
2600 O O   . TYR A 340 ? 0.5120 0.5424 0.5244 -0.0280 -0.0785 0.0545  341 TYR A O   
2601 C CB  . TYR A 340 ? 0.5335 0.5833 0.5621 -0.0136 -0.0679 0.0501  341 TYR A CB  
2602 C CG  . TYR A 340 ? 0.5340 0.5913 0.5683 -0.0105 -0.0670 0.0518  341 TYR A CG  
2603 C CD1 . TYR A 340 ? 0.5347 0.5932 0.5679 -0.0172 -0.0718 0.0577  341 TYR A CD1 
2604 C CD2 . TYR A 340 ? 0.5079 0.5716 0.5480 -0.0017 -0.0616 0.0476  341 TYR A CD2 
2605 C CE1 . TYR A 340 ? 0.5447 0.6104 0.5832 -0.0142 -0.0710 0.0592  341 TYR A CE1 
2606 C CE2 . TYR A 340 ? 0.5463 0.6182 0.5915 0.0008  -0.0607 0.0491  341 TYR A CE2 
2607 C CZ  . TYR A 340 ? 0.6036 0.6763 0.6483 -0.0050 -0.0654 0.0548  341 TYR A CZ  
2608 O OH  . TYR A 340 ? 0.6946 0.7759 0.7445 -0.0024 -0.0645 0.0562  341 TYR A OH  
2609 N N   . GLY A 341 ? 0.4670 0.4713 0.4742 -0.0127 -0.0819 0.0492  342 GLY A N   
2610 C CA  . GLY A 341 ? 0.4869 0.4828 0.4857 -0.0210 -0.0861 0.0509  342 GLY A CA  
2611 C C   . GLY A 341 ? 0.5496 0.5348 0.5449 -0.0152 -0.0853 0.0460  342 GLY A C   
2612 O O   . GLY A 341 ? 0.6323 0.6060 0.6189 -0.0212 -0.0905 0.0477  342 GLY A O   
2613 N N   . ALA A 342 ? 0.4968 0.4863 0.4983 -0.0045 -0.0791 0.0402  343 ALA A N   
2614 C CA  . ALA A 342 ? 0.4969 0.4771 0.4955 0.0015  -0.0781 0.0352  343 ALA A CA  
2615 C C   . ALA A 342 ? 0.5305 0.4883 0.5212 0.0072  -0.0867 0.0354  343 ALA A C   
2616 O O   . ALA A 342 ? 0.5379 0.4916 0.5301 0.0149  -0.0894 0.0350  343 ALA A O   
2617 C CB  . ALA A 342 ? 0.4376 0.4287 0.4439 0.0104  -0.0696 0.0293  343 ALA A CB  
2618 N N   . PRO A 343 ? 0.5836 0.5269 0.5654 0.0037  -0.0914 0.0355  344 PRO A N   
2619 C CA  . PRO A 343 ? 0.5559 0.4746 0.5278 0.0086  -0.1010 0.0355  344 PRO A CA  
2620 C C   . PRO A 343 ? 0.5600 0.4753 0.5355 0.0243  -0.0997 0.0289  344 PRO A C   
2621 O O   . PRO A 343 ? 0.5524 0.4768 0.5332 0.0297  -0.0923 0.0234  344 PRO A O   
2622 C CB  . PRO A 343 ? 0.5110 0.4203 0.4747 0.0020  -0.1031 0.0354  344 PRO A CB  
2623 C CG  . PRO A 343 ? 0.5118 0.4424 0.4831 -0.0021 -0.0931 0.0331  344 PRO A CG  
2624 C CD  . PRO A 343 ? 0.5214 0.4711 0.5013 -0.0052 -0.0884 0.0355  344 PRO A CD  
2625 N N   . GLY A 344 ? 0.5816 0.4846 0.5538 0.0316  -0.1072 0.0292  345 GLY A N   
2626 C CA  . GLY A 344 ? 0.5872 0.4884 0.5622 0.0472  -0.1071 0.0223  345 GLY A CA  
2627 C C   . GLY A 344 ? 0.6128 0.5346 0.5994 0.0540  -0.1003 0.0199  345 GLY A C   
2628 O O   . GLY A 344 ? 0.6865 0.6117 0.6764 0.0666  -0.0993 0.0137  345 GLY A O   
2629 N N   . PHE A 345 ? 0.5855 0.5224 0.5781 0.0456  -0.0957 0.0246  346 PHE A N   
2630 C CA  . PHE A 345 ? 0.5500 0.5072 0.5531 0.0505  -0.0889 0.0227  346 PHE A CA  
2631 C C   . PHE A 345 ? 0.5768 0.5325 0.5803 0.0523  -0.0947 0.0263  346 PHE A C   
2632 O O   . PHE A 345 ? 0.6111 0.5570 0.6089 0.0439  -0.1011 0.0327  346 PHE A O   
2633 C CB  . PHE A 345 ? 0.4859 0.4626 0.4960 0.0418  -0.0791 0.0242  346 PHE A CB  
2634 C CG  . PHE A 345 ? 0.4769 0.4607 0.4896 0.0441  -0.0716 0.0189  346 PHE A CG  
2635 C CD1 . PHE A 345 ? 0.3677 0.3433 0.3750