data_5FWV
# 
_entry.id   5FWV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5FWV         
PDBE  EBI-66262    
WWPDB D_1290066262 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 5FWS unspecified . 
PDB 5FWT unspecified . 
PDB 5FWU unspecified . 
PDB 5FWW unspecified . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        5FWV 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2016-02-21 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zebisch, M.'   1 
'Jackson, V.A.' 2 
'Jones, E.Y.'   3 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the Dual-Mode Wnt Regulator Kremen1 and Insight Into Ternary Complex Formation with Lrp6 and Dickkopf' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            24 
_citation.page_first                1599 
_citation.page_last                 ? 
_citation.year                      2016 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   27524201 
_citation.pdbx_database_id_DOI      10.1016/J.STR.2016.06.020 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zebisch, M.'   1 ? 
primary 'Jackson, V.A.' 2 ? 
primary 'Zhao, Y.'      3 ? 
primary 'Jones, E.Y.'   4 ? 
# 
_cell.entry_id           5FWV 
_cell.length_a           67.844 
_cell.length_b           67.844 
_cell.length_c           198.193 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5FWV 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'KREMEN PROTEIN 1'                       44551.777 1 ? ? 'ECD, RESIDUES 29-373' ? 
2 non-polymer syn 'CHLORIDE ION'                           35.453    5 ? ? ?                      ? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   2 ? ? ?                      ? 
4 water       nat water                                    18.015    2 ? ? ?                      ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGILPSPGMPALLSLVSLLSVLLMGCVAETGAPSPGLGPGPECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTL
KYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCIS
FCRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMSSVVYSPD
FPDTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDFVILYFFSDRIN
QAQGFAVLYQAVKEEGSENLYFQGGSLPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGTHHHH
HHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGILPSPGMPALLSLVSLLSVLLMGCVAETGAPSPGLGPGPECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTL
KYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCIS
FCRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMSSVVYSPD
FPDTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDFVILYFFSDRIN
QAQGFAVLYQAVKEEGSENLYFQGGSLPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGTHHHH
HHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   ILE n 
1 4   LEU n 
1 5   PRO n 
1 6   SER n 
1 7   PRO n 
1 8   GLY n 
1 9   MET n 
1 10  PRO n 
1 11  ALA n 
1 12  LEU n 
1 13  LEU n 
1 14  SER n 
1 15  LEU n 
1 16  VAL n 
1 17  SER n 
1 18  LEU n 
1 19  LEU n 
1 20  SER n 
1 21  VAL n 
1 22  LEU n 
1 23  LEU n 
1 24  MET n 
1 25  GLY n 
1 26  CYS n 
1 27  VAL n 
1 28  ALA n 
1 29  GLU n 
1 30  THR n 
1 31  GLY n 
1 32  ALA n 
1 33  PRO n 
1 34  SER n 
1 35  PRO n 
1 36  GLY n 
1 37  LEU n 
1 38  GLY n 
1 39  PRO n 
1 40  GLY n 
1 41  PRO n 
1 42  GLU n 
1 43  CYS n 
1 44  PHE n 
1 45  THR n 
1 46  ALA n 
1 47  ASN n 
1 48  GLY n 
1 49  ALA n 
1 50  ASP n 
1 51  TYR n 
1 52  ARG n 
1 53  GLY n 
1 54  THR n 
1 55  GLN n 
1 56  ASN n 
1 57  TRP n 
1 58  THR n 
1 59  ALA n 
1 60  LEU n 
1 61  GLN n 
1 62  GLY n 
1 63  GLY n 
1 64  LYS n 
1 65  PRO n 
1 66  CYS n 
1 67  LEU n 
1 68  PHE n 
1 69  TRP n 
1 70  ASN n 
1 71  GLU n 
1 72  THR n 
1 73  PHE n 
1 74  GLN n 
1 75  HIS n 
1 76  PRO n 
1 77  TYR n 
1 78  ASN n 
1 79  THR n 
1 80  LEU n 
1 81  LYS n 
1 82  TYR n 
1 83  PRO n 
1 84  ASN n 
1 85  GLY n 
1 86  GLU n 
1 87  GLY n 
1 88  GLY n 
1 89  LEU n 
1 90  GLY n 
1 91  GLU n 
1 92  HIS n 
1 93  ASN n 
1 94  TYR n 
1 95  CYS n 
1 96  ARG n 
1 97  ASN n 
1 98  PRO n 
1 99  ASP n 
1 100 GLY n 
1 101 ASP n 
1 102 VAL n 
1 103 SER n 
1 104 PRO n 
1 105 TRP n 
1 106 CYS n 
1 107 TYR n 
1 108 VAL n 
1 109 ALA n 
1 110 GLU n 
1 111 HIS n 
1 112 GLU n 
1 113 ASP n 
1 114 GLY n 
1 115 VAL n 
1 116 TYR n 
1 117 TRP n 
1 118 LYS n 
1 119 TYR n 
1 120 CYS n 
1 121 GLU n 
1 122 ILE n 
1 123 PRO n 
1 124 ALA n 
1 125 CYS n 
1 126 GLN n 
1 127 MET n 
1 128 PRO n 
1 129 GLY n 
1 130 ASN n 
1 131 LEU n 
1 132 GLY n 
1 133 CYS n 
1 134 TYR n 
1 135 LYS n 
1 136 ASP n 
1 137 HIS n 
1 138 GLY n 
1 139 ASN n 
1 140 PRO n 
1 141 PRO n 
1 142 PRO n 
1 143 LEU n 
1 144 THR n 
1 145 GLY n 
1 146 THR n 
1 147 SER n 
1 148 LYS n 
1 149 THR n 
1 150 SER n 
1 151 ASN n 
1 152 LYS n 
1 153 LEU n 
1 154 THR n 
1 155 ILE n 
1 156 GLN n 
1 157 THR n 
1 158 CYS n 
1 159 ILE n 
1 160 SER n 
1 161 PHE n 
1 162 CYS n 
1 163 ARG n 
1 164 SER n 
1 165 GLN n 
1 166 ARG n 
1 167 PHE n 
1 168 LYS n 
1 169 PHE n 
1 170 ALA n 
1 171 GLY n 
1 172 MET n 
1 173 GLU n 
1 174 SER n 
1 175 GLY n 
1 176 TYR n 
1 177 ALA n 
1 178 CYS n 
1 179 PHE n 
1 180 CYS n 
1 181 GLY n 
1 182 ASN n 
1 183 ASN n 
1 184 PRO n 
1 185 ASP n 
1 186 TYR n 
1 187 TRP n 
1 188 LYS n 
1 189 TYR n 
1 190 GLY n 
1 191 GLU n 
1 192 ALA n 
1 193 ALA n 
1 194 SER n 
1 195 THR n 
1 196 GLU n 
1 197 CYS n 
1 198 ASN n 
1 199 SER n 
1 200 VAL n 
1 201 CYS n 
1 202 PHE n 
1 203 GLY n 
1 204 ASP n 
1 205 HIS n 
1 206 THR n 
1 207 GLN n 
1 208 PRO n 
1 209 CYS n 
1 210 GLY n 
1 211 GLY n 
1 212 ASP n 
1 213 GLY n 
1 214 ARG n 
1 215 ILE n 
1 216 ILE n 
1 217 LEU n 
1 218 PHE n 
1 219 ASP n 
1 220 THR n 
1 221 LEU n 
1 222 VAL n 
1 223 GLY n 
1 224 ALA n 
1 225 CYS n 
1 226 GLY n 
1 227 GLY n 
1 228 ASN n 
1 229 TYR n 
1 230 SER n 
1 231 ALA n 
1 232 MET n 
1 233 SER n 
1 234 SER n 
1 235 VAL n 
1 236 VAL n 
1 237 TYR n 
1 238 SER n 
1 239 PRO n 
1 240 ASP n 
1 241 PHE n 
1 242 PRO n 
1 243 ASP n 
1 244 THR n 
1 245 TYR n 
1 246 ALA n 
1 247 THR n 
1 248 GLY n 
1 249 ARG n 
1 250 VAL n 
1 251 CYS n 
1 252 TYR n 
1 253 TRP n 
1 254 THR n 
1 255 ILE n 
1 256 ARG n 
1 257 VAL n 
1 258 PRO n 
1 259 GLY n 
1 260 ALA n 
1 261 SER n 
1 262 HIS n 
1 263 ILE n 
1 264 HIS n 
1 265 PHE n 
1 266 SER n 
1 267 PHE n 
1 268 PRO n 
1 269 LEU n 
1 270 PHE n 
1 271 ASP n 
1 272 ILE n 
1 273 ARG n 
1 274 ASP n 
1 275 SER n 
1 276 ALA n 
1 277 ASP n 
1 278 MET n 
1 279 VAL n 
1 280 GLU n 
1 281 LEU n 
1 282 LEU n 
1 283 ASP n 
1 284 GLY n 
1 285 TYR n 
1 286 THR n 
1 287 HIS n 
1 288 ARG n 
1 289 VAL n 
1 290 LEU n 
1 291 ALA n 
1 292 ARG n 
1 293 PHE n 
1 294 HIS n 
1 295 GLY n 
1 296 ARG n 
1 297 SER n 
1 298 ARG n 
1 299 PRO n 
1 300 PRO n 
1 301 LEU n 
1 302 SER n 
1 303 PHE n 
1 304 ASN n 
1 305 VAL n 
1 306 SER n 
1 307 LEU n 
1 308 ASP n 
1 309 PHE n 
1 310 VAL n 
1 311 ILE n 
1 312 LEU n 
1 313 TYR n 
1 314 PHE n 
1 315 PHE n 
1 316 SER n 
1 317 ASP n 
1 318 ARG n 
1 319 ILE n 
1 320 ASN n 
1 321 GLN n 
1 322 ALA n 
1 323 GLN n 
1 324 GLY n 
1 325 PHE n 
1 326 ALA n 
1 327 VAL n 
1 328 LEU n 
1 329 TYR n 
1 330 GLN n 
1 331 ALA n 
1 332 VAL n 
1 333 LYS n 
1 334 GLU n 
1 335 GLU n 
1 336 GLY n 
1 337 SER n 
1 338 GLU n 
1 339 ASN n 
1 340 LEU n 
1 341 TYR n 
1 342 PHE n 
1 343 GLN n 
1 344 GLY n 
1 345 GLY n 
1 346 SER n 
1 347 LEU n 
1 348 PRO n 
1 349 GLN n 
1 350 GLU n 
1 351 ARG n 
1 352 PRO n 
1 353 ALA n 
1 354 VAL n 
1 355 ASN n 
1 356 GLN n 
1 357 THR n 
1 358 VAL n 
1 359 ALA n 
1 360 GLU n 
1 361 VAL n 
1 362 ILE n 
1 363 THR n 
1 364 GLU n 
1 365 GLN n 
1 366 ALA n 
1 367 ASN n 
1 368 LEU n 
1 369 SER n 
1 370 VAL n 
1 371 SER n 
1 372 ALA n 
1 373 ALA n 
1 374 ARG n 
1 375 SER n 
1 376 SER n 
1 377 LYS n 
1 378 VAL n 
1 379 LEU n 
1 380 TYR n 
1 381 VAL n 
1 382 ILE n 
1 383 THR n 
1 384 THR n 
1 385 SER n 
1 386 PRO n 
1 387 SER n 
1 388 HIS n 
1 389 PRO n 
1 390 PRO n 
1 391 GLN n 
1 392 THR n 
1 393 VAL n 
1 394 PRO n 
1 395 GLY n 
1 396 THR n 
1 397 HIS n 
1 398 HIS n 
1 399 HIS n 
1 400 HIS n 
1 401 HIS n 
1 402 HIS n 
1 403 HIS n 
1 404 HIS n 
1 405 HIS n 
1 406 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               HUMAN 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PHLSEC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KREM1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q96MU8 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5FWV 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 40 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 395 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q96MU8 
_struct_ref_seq.db_align_beg                  29 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  373 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       29 
_struct_ref_seq.pdbx_auth_seq_align_end       384 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5FWV MET A 1   ? UNP Q96MU8 ? ? 'initiating methionine' -10 1  
1 5FWV GLY A 2   ? UNP Q96MU8 ? ? 'expression tag'        -9  2  
1 5FWV ILE A 3   ? UNP Q96MU8 ? ? 'expression tag'        -8  3  
1 5FWV LEU A 4   ? UNP Q96MU8 ? ? 'expression tag'        -7  4  
1 5FWV PRO A 5   ? UNP Q96MU8 ? ? 'expression tag'        -6  5  
1 5FWV SER A 6   ? UNP Q96MU8 ? ? 'expression tag'        -5  6  
1 5FWV PRO A 7   ? UNP Q96MU8 ? ? 'expression tag'        -4  7  
1 5FWV GLY A 8   ? UNP Q96MU8 ? ? 'expression tag'        -3  8  
1 5FWV MET A 9   ? UNP Q96MU8 ? ? 'expression tag'        -2  9  
1 5FWV PRO A 10  ? UNP Q96MU8 ? ? 'expression tag'        -1  10 
1 5FWV ALA A 11  ? UNP Q96MU8 ? ? 'expression tag'        0   11 
1 5FWV LEU A 12  ? UNP Q96MU8 ? ? 'expression tag'        1   12 
1 5FWV LEU A 13  ? UNP Q96MU8 ? ? 'expression tag'        2   13 
1 5FWV SER A 14  ? UNP Q96MU8 ? ? 'expression tag'        3   14 
1 5FWV LEU A 15  ? UNP Q96MU8 ? ? 'expression tag'        4   15 
1 5FWV VAL A 16  ? UNP Q96MU8 ? ? 'expression tag'        5   16 
1 5FWV SER A 17  ? UNP Q96MU8 ? ? 'expression tag'        6   17 
1 5FWV LEU A 18  ? UNP Q96MU8 ? ? 'expression tag'        7   18 
1 5FWV LEU A 19  ? UNP Q96MU8 ? ? 'expression tag'        8   19 
1 5FWV SER A 20  ? UNP Q96MU8 ? ? 'expression tag'        9   20 
1 5FWV VAL A 21  ? UNP Q96MU8 ? ? 'expression tag'        10  21 
1 5FWV LEU A 22  ? UNP Q96MU8 ? ? 'expression tag'        11  22 
1 5FWV LEU A 23  ? UNP Q96MU8 ? ? 'expression tag'        12  23 
1 5FWV MET A 24  ? UNP Q96MU8 ? ? 'expression tag'        13  24 
1 5FWV GLY A 25  ? UNP Q96MU8 ? ? 'expression tag'        14  25 
1 5FWV CYS A 26  ? UNP Q96MU8 ? ? 'expression tag'        15  26 
1 5FWV VAL A 27  ? UNP Q96MU8 ? ? 'expression tag'        16  27 
1 5FWV ALA A 28  ? UNP Q96MU8 ? ? 'expression tag'        17  28 
1 5FWV GLU A 29  ? UNP Q96MU8 ? ? 'expression tag'        18  29 
1 5FWV THR A 30  ? UNP Q96MU8 ? ? 'expression tag'        19  30 
1 5FWV GLY A 31  ? UNP Q96MU8 ? ? 'expression tag'        20  31 
1 5FWV ALA A 32  ? UNP Q96MU8 ? ? 'expression tag'        21  32 
1 5FWV PRO A 33  ? UNP Q96MU8 ? ? 'expression tag'        22  33 
1 5FWV SER A 34  ? UNP Q96MU8 ? ? 'expression tag'        23  34 
1 5FWV PRO A 35  ? UNP Q96MU8 ? ? 'expression tag'        24  35 
1 5FWV GLY A 36  ? UNP Q96MU8 ? ? 'expression tag'        25  36 
1 5FWV LEU A 37  ? UNP Q96MU8 ? ? 'expression tag'        26  37 
1 5FWV GLY A 38  ? UNP Q96MU8 ? ? 'expression tag'        27  38 
1 5FWV PRO A 39  ? UNP Q96MU8 ? ? 'expression tag'        28  39 
1 5FWV GLY A 336 ? UNP Q96MU8 ? ? insertion               325 40 
1 5FWV SER A 337 ? UNP Q96MU8 ? ? insertion               326 41 
1 5FWV GLU A 338 ? UNP Q96MU8 ? ? insertion               327 42 
1 5FWV ASN A 339 ? UNP Q96MU8 ? ? insertion               328 43 
1 5FWV LEU A 340 ? UNP Q96MU8 ? ? insertion               329 44 
1 5FWV TYR A 341 ? UNP Q96MU8 ? ? insertion               330 45 
1 5FWV PHE A 342 ? UNP Q96MU8 ? ? insertion               331 46 
1 5FWV GLN A 343 ? UNP Q96MU8 ? ? insertion               332 47 
1 5FWV GLY A 344 ? UNP Q96MU8 ? ? insertion               333 48 
1 5FWV GLY A 345 ? UNP Q96MU8 ? ? insertion               334 49 
1 5FWV SER A 346 ? UNP Q96MU8 ? ? insertion               335 50 
1 5FWV THR A 396 ? UNP Q96MU8 ? ? 'expression tag'        385 51 
1 5FWV HIS A 397 ? UNP Q96MU8 ? ? 'expression tag'        386 52 
1 5FWV HIS A 398 ? UNP Q96MU8 ? ? 'expression tag'        387 53 
1 5FWV HIS A 399 ? UNP Q96MU8 ? ? 'expression tag'        388 54 
1 5FWV HIS A 400 ? UNP Q96MU8 ? ? 'expression tag'        389 55 
1 5FWV HIS A 401 ? UNP Q96MU8 ? ? 'expression tag'        390 56 
1 5FWV HIS A 402 ? UNP Q96MU8 ? ? 'expression tag'        391 57 
1 5FWV HIS A 403 ? UNP Q96MU8 ? ? 'expression tag'        392 58 
1 5FWV HIS A 404 ? UNP Q96MU8 ? ? 'expression tag'        393 59 
1 5FWV HIS A 405 ? UNP Q96MU8 ? ? 'expression tag'        394 60 
1 5FWV HIS A 406 ? UNP Q96MU8 ? ? 'expression tag'        395 61 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CL  non-polymer                  . 'CHLORIDE ION'                           ? 'Cl -1'          35.453  
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          5FWV 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.3 
_exptl_crystal.density_percent_sol   62.6 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1 M HEPES/MOPS 7.5 30 % P550MME_P20K DRIED OUT' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS' 
_diffrn_detector.pdbx_collection_date   2013-09-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_wavelength             0.9795 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5FWV 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             67.80 
_reflns.d_resolution_high            3.20 
_reflns.number_obs                   8171 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.8 
_reflns.pdbx_Rmerge_I_obs            0.30 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.10 
_reflns.B_iso_Wilson_estimate        76.6 
_reflns.pdbx_redundancy              22.7 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5FWV 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     7732 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             64.19 
_refine.ls_d_res_high                            3.20 
_refine.ls_percent_reflns_obs                    98.61 
_refine.ls_R_factor_obs                          0.19880 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19549 
_refine.ls_R_factor_R_free                       0.26484 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.6 
_refine.ls_number_reflns_R_free                  376 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.937 
_refine.correlation_coeff_Fo_to_Fc_free          0.864 
_refine.B_iso_mean                               75.628 
_refine.aniso_B[1][1]                            -0.21 
_refine.aniso_B[2][2]                            -0.21 
_refine.aniso_B[3][3]                            0.42 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      NONE 
_refine.pdbx_method_to_determine_struct          OTHER 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.476 
_refine.overall_SU_ML                            0.401 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             53.731 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2305 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         33 
_refine_hist.number_atoms_solvent             2 
_refine_hist.number_atoms_total               2340 
_refine_hist.d_res_high                       3.20 
_refine_hist.d_res_low                        64.19 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.016  0.019  ? 2419 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.003  0.020  ? 2091 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.872  1.936  ? 3296 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.096  3.000  ? 4822 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       7.579  5.000  ? 293  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       28.311 23.445 ? 119  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.656 15.000 ? 335  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.416 15.000 ? 13   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.100  0.200  ? 330  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.021  ? 2802 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.002  0.020  ? 617  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  2.237  4.360  ? 1175 'X-RAY DIFFRACTION' ? 
r_mcbond_other               2.229  4.360  ? 1174 'X-RAY DIFFRACTION' ? 
r_mcangle_it                 3.883  6.535  ? 1467 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.371  4.668  ? 1244 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.200 
_refine_ls_shell.d_res_low                        3.283 
_refine_ls_shell.number_reflns_R_work             487 
_refine_ls_shell.R_factor_R_work                  0.323 
_refine_ls_shell.percent_reflns_obs               90.78 
_refine_ls_shell.R_factor_R_free                  0.349 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             25 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  5FWV 
_struct.title                     'Wnt modulator Kremen crystal form III at 3.2A' 
_struct.pdbx_descriptor           'KREMEN PROTEIN 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        5FWV 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'SIGNALING PROTEIN, WNT, CELL SURFACE, SIGNALLING, MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
H N N 2 ? 
I N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 85  ? LEU A 89  ? GLY A 74  LEU A 78  5 ? 5  
HELX_P HELX_P2 2 THR A 154 ? GLN A 165 ? THR A 143 GLN A 154 1 ? 12 
HELX_P HELX_P3 3 ASP A 185 ? TYR A 189 ? ASP A 174 TYR A 178 5 ? 5  
HELX_P HELX_P4 4 ALA A 193 ? CYS A 197 ? ALA A 182 CYS A 186 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 43  SG  ? ? ? 1_555 A CYS 125 SG ? ? A CYS 32  A CYS 114  1_555 ? ? ? ? ? ? ? 2.075 ? ?               
disulf2 disulf ?   ? A CYS 66  SG  ? ? ? 1_555 A CYS 106 SG ? ? A CYS 55  A CYS 95   1_555 ? ? ? ? ? ? ? 2.014 ? ?               
disulf3 disulf ?   ? A CYS 95  SG  ? ? ? 1_555 A CYS 120 SG ? ? A CYS 84  A CYS 109  1_555 ? ? ? ? ? ? ? 2.074 ? ?               
disulf4 disulf ?   ? A CYS 133 SG  ? ? ? 1_555 A CYS 197 SG ? ? A CYS 122 A CYS 186  1_555 ? ? ? ? ? ? ? 2.065 ? ?               
disulf5 disulf ?   ? A CYS 158 SG  ? ? ? 1_555 A CYS 178 SG ? ? A CYS 147 A CYS 167  1_555 ? ? ? ? ? ? ? 2.050 ? ?               
disulf6 disulf ?   ? A CYS 162 SG  ? ? ? 1_555 A CYS 180 SG ? ? A CYS 151 A CYS 169  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf7 disulf ?   ? A CYS 201 SG  ? ? ? 1_555 A CYS 209 SG ? ? A CYS 190 A CYS 198  1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf8 disulf ?   ? A CYS 225 SG  ? ? ? 1_555 A CYS 251 SG ? ? A CYS 214 A CYS 240  1_555 ? ? ? ? ? ? ? 2.108 ? ?               
covale1 covale one ? A ASN 56  ND2 ? ? ? 1_555 F NAG .   C1 ? ? A ASN 45  A NAG 1327 1_555 ? ? ? ? ? ? ? 1.444 ? N-Glycosylation 
covale2 covale one ? A ASN 70  ND2 ? ? ? 1_555 G NAG .   C1 ? ? A ASN 59  A NAG 1328 1_555 ? ? ? ? ? ? ? 1.433 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASN 139 A . ? ASN 128 A PRO 140 A ? PRO 129 A 1 -14.67 
2 PHE 241 A . ? PHE 230 A PRO 242 A ? PRO 231 A 1 6.75   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2 ? 
AB ? 6 ? 
AC ? 2 ? 
AD ? 5 ? 
AE ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AB 5 6 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? parallel      
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AD 4 5 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 TRP A 105 ? TYR A 107 ? TRP A 94  TYR A 96  
AA 2 TRP A 117 ? TYR A 119 ? TRP A 106 TYR A 108 
AB 1 SER A 147 ? THR A 149 ? SER A 136 THR A 138 
AB 2 ALA A 177 ? GLY A 181 ? ALA A 166 GLY A 170 
AB 3 PHE A 169 ? GLU A 173 ? PHE A 158 GLU A 162 
AB 4 ARG A 214 ? ASP A 219 ? ARG A 203 ASP A 208 
AB 5 ASN A 130 ? LYS A 135 ? ASN A 119 LYS A 124 
AB 6 GLU A 191 ? ALA A 192 ? GLU A 180 ALA A 181 
AC 1 VAL A 200 ? CYS A 201 ? VAL A 189 CYS A 190 
AC 2 ASP A 204 ? PRO A 208 ? ASP A 193 PRO A 197 
AD 1 GLY A 227 ? TYR A 229 ? GLY A 216 TYR A 218 
AD 2 VAL A 250 ? ARG A 256 ? VAL A 239 ARG A 245 
AD 3 PHE A 309 ? PHE A 315 ? PHE A 298 PHE A 304 
AD 4 MET A 278 ? ASP A 283 ? MET A 267 ASP A 272 
AD 5 VAL A 289 ? HIS A 294 ? VAL A 278 HIS A 283 
AE 1 SER A 233 ? TYR A 237 ? SER A 222 TYR A 226 
AE 2 GLY A 324 ? VAL A 332 ? GLY A 313 VAL A 321 
AE 3 HIS A 262 ? ASP A 271 ? HIS A 251 ASP A 260 
AE 4 PHE A 303 ? VAL A 305 ? PHE A 292 VAL A 294 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N CYS A 106 ? N CYS A 95  O LYS A 118 ? O LYS A 107 
AB 1 2 N LYS A 148 ? N LYS A 137 O CYS A 178 ? O CYS A 167 
AB 2 3 N GLY A 181 ? N GLY A 170 O PHE A 169 ? O PHE A 158 
AB 3 4 N MET A 172 ? N MET A 161 O ILE A 216 ? O ILE A 205 
AB 4 5 O LEU A 217 ? O LEU A 206 N LEU A 131 ? N LEU A 120 
AB 5 6 N CYS A 133 ? N CYS A 122 O ALA A 192 ? O ALA A 181 
AC 1 2 O CYS A 201 ? O CYS A 190 N ASP A 204 ? N ASP A 193 
AD 1 2 N GLY A 227 ? N GLY A 216 O TYR A 252 ? O TYR A 241 
AD 2 3 N ILE A 255 ? N ILE A 244 O VAL A 310 ? O VAL A 299 
AD 3 4 N PHE A 315 ? N PHE A 304 O MET A 278 ? O MET A 267 
AD 4 5 O LEU A 281 ? O LEU A 270 N LEU A 290 ? N LEU A 279 
AE 1 2 N VAL A 236 ? N VAL A 225 O VAL A 327 ? O VAL A 316 
AE 2 3 N VAL A 332 ? N VAL A 321 O HIS A 262 ? O HIS A 251 
AE 3 4 N PHE A 265 ? N PHE A 254 O PHE A 303 ? O PHE A 292 
# 
_database_PDB_matrix.entry_id          5FWV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5FWV 
_atom_sites.fract_transf_matrix[1][1]   0.014740 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014740 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005046 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1 40  ? -3.727  37.334 19.107 1.00 99.26  ? 29   GLY A N   1 
ATOM   2    C  CA  . GLY A 1 40  ? -2.444  36.673 18.731 1.00 96.28  ? 29   GLY A CA  1 
ATOM   3    C  C   . GLY A 1 40  ? -2.387  35.181 19.062 1.00 96.25  ? 29   GLY A C   1 
ATOM   4    O  O   . GLY A 1 40  ? -2.906  34.740 20.099 1.00 97.39  ? 29   GLY A O   1 
ATOM   5    N  N   . PRO A 1 41  ? -1.734  34.383 18.196 1.00 91.58  ? 30   PRO A N   1 
ATOM   6    C  CA  . PRO A 1 41  ? -1.476  32.988 18.566 1.00 85.15  ? 30   PRO A CA  1 
ATOM   7    C  C   . PRO A 1 41  ? -0.388  32.938 19.657 1.00 75.67  ? 30   PRO A C   1 
ATOM   8    O  O   . PRO A 1 41  ? 0.444   33.855 19.771 1.00 72.16  ? 30   PRO A O   1 
ATOM   9    C  CB  . PRO A 1 41  ? -0.976  32.386 17.268 1.00 86.20  ? 30   PRO A CB  1 
ATOM   10   C  CG  . PRO A 1 41  ? -0.196  33.513 16.670 1.00 90.63  ? 30   PRO A CG  1 
ATOM   11   C  CD  . PRO A 1 41  ? -0.961  34.768 17.000 1.00 90.32  ? 30   PRO A CD  1 
ATOM   12   N  N   . GLU A 1 42  ? -0.390  31.883 20.450 1.00 87.63  ? 31   GLU A N   1 
ATOM   13   C  CA  . GLU A 1 42  ? 0.373   31.906 21.669 1.00 79.17  ? 31   GLU A CA  1 
ATOM   14   C  C   . GLU A 1 42  ? 1.584   31.056 21.649 1.00 72.92  ? 31   GLU A C   1 
ATOM   15   O  O   . GLU A 1 42  ? 2.240   30.968 22.652 1.00 70.58  ? 31   GLU A O   1 
ATOM   16   C  CB  . GLU A 1 42  ? -0.493  31.407 22.790 1.00 79.54  ? 31   GLU A CB  1 
ATOM   17   C  CG  . GLU A 1 42  ? -1.723  32.250 23.012 1.00 82.64  ? 31   GLU A CG  1 
ATOM   18   C  CD  . GLU A 1 42  ? -2.294  32.024 24.402 1.00 82.03  ? 31   GLU A CD  1 
ATOM   19   O  OE1 . GLU A 1 42  ? -1.579  32.303 25.396 1.00 79.99  ? 31   GLU A OE1 1 
ATOM   20   O  OE2 . GLU A 1 42  ? -3.448  31.556 24.504 1.00 83.34  ? 31   GLU A OE2 1 
ATOM   21   N  N   . CYS A 1 43  ? 1.849   30.361 20.554 1.00 71.14  ? 32   CYS A N   1 
ATOM   22   C  CA  . CYS A 1 43  ? 3.077   29.564 20.412 1.00 66.61  ? 32   CYS A CA  1 
ATOM   23   C  C   . CYS A 1 43  ? 3.502   29.722 19.001 1.00 66.11  ? 32   CYS A C   1 
ATOM   24   O  O   . CYS A 1 43  ? 2.631   29.727 18.114 1.00 68.25  ? 32   CYS A O   1 
ATOM   25   C  CB  . CYS A 1 43  ? 2.803   28.086 20.632 1.00 64.83  ? 32   CYS A CB  1 
ATOM   26   S  SG  . CYS A 1 43  ? 2.240   27.684 22.315 1.00 66.21  ? 32   CYS A SG  1 
ATOM   27   N  N   . PHE A 1 44  ? 4.808   29.875 18.794 1.00 63.25  ? 33   PHE A N   1 
ATOM   28   C  CA  . PHE A 1 44  ? 5.423   29.929 17.459 1.00 62.29  ? 33   PHE A CA  1 
ATOM   29   C  C   . PHE A 1 44  ? 6.486   28.855 17.343 1.00 61.24  ? 33   PHE A C   1 
ATOM   30   O  O   . PHE A 1 44  ? 7.502   29.050 16.681 1.00 61.31  ? 33   PHE A O   1 
ATOM   31   C  CB  . PHE A 1 44  ? 6.061   31.297 17.228 1.00 64.00  ? 33   PHE A CB  1 
ATOM   32   C  CG  . PHE A 1 44  ? 5.071   32.386 17.036 1.00 65.79  ? 33   PHE A CG  1 
ATOM   33   C  CD1 . PHE A 1 44  ? 4.378   32.918 18.122 1.00 66.92  ? 33   PHE A CD1 1 
ATOM   34   C  CD2 . PHE A 1 44  ? 4.815   32.881 15.776 1.00 66.99  ? 33   PHE A CD2 1 
ATOM   35   C  CE1 . PHE A 1 44  ? 3.437   33.933 17.951 1.00 68.73  ? 33   PHE A CE1 1 
ATOM   36   C  CE2 . PHE A 1 44  ? 3.885   33.891 15.603 1.00 69.55  ? 33   PHE A CE2 1 
ATOM   37   C  CZ  . PHE A 1 44  ? 3.196   34.420 16.692 1.00 70.10  ? 33   PHE A CZ  1 
ATOM   38   N  N   . THR A 1 45  ? 6.280   27.748 18.050 1.00 60.53  ? 34   THR A N   1 
ATOM   39   C  CA  . THR A 1 45  ? 7.151   26.581 17.967 1.00 60.76  ? 34   THR A CA  1 
ATOM   40   C  C   . THR A 1 45  ? 6.271   25.439 17.604 1.00 60.10  ? 34   THR A C   1 
ATOM   41   O  O   . THR A 1 45  ? 5.038   25.529 17.733 1.00 60.54  ? 34   THR A O   1 
ATOM   42   C  CB  . THR A 1 45  ? 7.721   26.200 19.319 1.00 60.51  ? 34   THR A CB  1 
ATOM   43   O  OG1 . THR A 1 45  ? 6.650   26.159 20.276 1.00 59.62  ? 34   THR A OG1 1 
ATOM   44   C  CG2 . THR A 1 45  ? 8.757   27.179 19.745 1.00 62.15  ? 34   THR A CG2 1 
ATOM   45   N  N   . ALA A 1 46  ? 6.882   24.340 17.202 1.00 59.24  ? 35   ALA A N   1 
ATOM   46   C  CA  . ALA A 1 46  ? 6.073   23.190 16.857 1.00 59.51  ? 35   ALA A CA  1 
ATOM   47   C  C   . ALA A 1 46  ? 5.461   22.461 18.064 1.00 57.22  ? 35   ALA A C   1 
ATOM   48   O  O   . ALA A 1 46  ? 4.445   21.784 17.889 1.00 57.68  ? 35   ALA A O   1 
ATOM   49   C  CB  . ALA A 1 46  ? 6.882   22.224 16.033 1.00 62.39  ? 35   ALA A CB  1 
ATOM   50   N  N   . ASN A 1 47  ? 6.067   22.590 19.253 1.00 53.77  ? 36   ASN A N   1 
ATOM   51   C  CA  . ASN A 1 47  ? 5.716   21.773 20.417 1.00 52.28  ? 36   ASN A CA  1 
ATOM   52   C  C   . ASN A 1 47  ? 5.335   22.608 21.614 1.00 51.37  ? 36   ASN A C   1 
ATOM   53   O  O   . ASN A 1 47  ? 5.389   22.153 22.767 1.00 49.25  ? 36   ASN A O   1 
ATOM   54   C  CB  . ASN A 1 47  ? 6.905   20.897 20.783 1.00 52.74  ? 36   ASN A CB  1 
ATOM   55   C  CG  . ASN A 1 47  ? 8.098   21.699 21.202 1.00 52.80  ? 36   ASN A CG  1 
ATOM   56   O  OD1 . ASN A 1 47  ? 8.115   22.917 21.052 1.00 53.28  ? 36   ASN A OD1 1 
ATOM   57   N  ND2 . ASN A 1 47  ? 9.108   21.023 21.720 1.00 54.21  ? 36   ASN A ND2 1 
ATOM   58   N  N   . GLY A 1 48  ? 4.995   23.861 21.354 1.00 52.45  ? 37   GLY A N   1 
ATOM   59   C  CA  . GLY A 1 48  ? 4.686   24.793 22.429 1.00 52.91  ? 37   GLY A CA  1 
ATOM   60   C  C   . GLY A 1 48  ? 5.737   24.955 23.512 1.00 53.74  ? 37   GLY A C   1 
ATOM   61   O  O   . GLY A 1 48  ? 5.410   25.292 24.640 1.00 56.58  ? 37   GLY A O   1 
ATOM   62   N  N   . ALA A 1 49  ? 7.003   24.738 23.173 1.00 55.67  ? 38   ALA A N   1 
ATOM   63   C  CA  . ALA A 1 49  ? 8.157   25.029 24.061 1.00 56.23  ? 38   ALA A CA  1 
ATOM   64   C  C   . ALA A 1 49  ? 8.047   26.405 24.676 1.00 55.69  ? 38   ALA A C   1 
ATOM   65   O  O   . ALA A 1 49  ? 8.306   26.601 25.855 1.00 56.66  ? 38   ALA A O   1 
ATOM   66   C  CB  . ALA A 1 49  ? 9.450   24.966 23.243 1.00 58.67  ? 38   ALA A CB  1 
ATOM   67   N  N   . ASP A 1 50  ? 7.640   27.334 23.820 1.00 56.02  ? 39   ASP A N   1 
ATOM   68   C  CA  . ASP A 1 50  ? 7.526   28.742 24.126 1.00 56.08  ? 39   ASP A CA  1 
ATOM   69   C  C   . ASP A 1 50  ? 6.188   29.152 24.706 1.00 53.70  ? 39   ASP A C   1 
ATOM   70   O  O   . ASP A 1 50  ? 5.994   30.347 24.907 1.00 54.78  ? 39   ASP A O   1 
ATOM   71   C  CB  . ASP A 1 50  ? 7.813   29.569 22.856 1.00 57.69  ? 39   ASP A CB  1 
ATOM   72   C  CG  . ASP A 1 50  ? 6.767   29.385 21.802 1.00 57.31  ? 39   ASP A CG  1 
ATOM   73   O  OD1 . ASP A 1 50  ? 6.153   28.315 21.715 1.00 57.15  ? 39   ASP A OD1 1 
ATOM   74   O  OD2 . ASP A 1 50  ? 6.526   30.321 21.049 1.00 61.72  ? 39   ASP A OD2 1 
ATOM   75   N  N   . TYR A 1 51  ? 5.280   28.217 24.994 1.00 51.50  ? 40   TYR A N   1 
ATOM   76   C  CA  . TYR A 1 51  ? 3.969   28.610 25.534 1.00 53.49  ? 40   TYR A CA  1 
ATOM   77   C  C   . TYR A 1 51  ? 4.162   29.152 26.918 1.00 55.99  ? 40   TYR A C   1 
ATOM   78   O  O   . TYR A 1 51  ? 4.812   28.474 27.741 1.00 56.78  ? 40   TYR A O   1 
ATOM   79   C  CB  . TYR A 1 51  ? 3.006   27.449 25.681 1.00 52.84  ? 40   TYR A CB  1 
ATOM   80   C  CG  . TYR A 1 51  ? 1.654   27.850 26.263 1.00 54.13  ? 40   TYR A CG  1 
ATOM   81   C  CD1 . TYR A 1 51  ? 0.759   28.641 25.540 1.00 56.82  ? 40   TYR A CD1 1 
ATOM   82   C  CD2 . TYR A 1 51  ? 1.268   27.434 27.521 1.00 54.40  ? 40   TYR A CD2 1 
ATOM   83   C  CE1 . TYR A 1 51  ? -0.486  28.994 26.054 1.00 58.23  ? 40   TYR A CE1 1 
ATOM   84   C  CE2 . TYR A 1 51  ? 0.031   27.791 28.050 1.00 57.07  ? 40   TYR A CE2 1 
ATOM   85   C  CZ  . TYR A 1 51  ? -0.848  28.573 27.310 1.00 58.66  ? 40   TYR A CZ  1 
ATOM   86   O  OH  . TYR A 1 51  ? -2.074  28.952 27.825 1.00 61.47  ? 40   TYR A OH  1 
ATOM   87   N  N   . ARG A 1 52  ? 3.615   30.353 27.163 1.00 57.76  ? 41   ARG A N   1 
ATOM   88   C  CA  . ARG A 1 52  ? 3.715   31.035 28.458 1.00 57.44  ? 41   ARG A CA  1 
ATOM   89   C  C   . ARG A 1 52  ? 2.389   31.567 28.916 1.00 58.78  ? 41   ARG A C   1 
ATOM   90   O  O   . ARG A 1 52  ? 2.323   32.437 29.743 1.00 60.42  ? 41   ARG A O   1 
ATOM   91   C  CB  . ARG A 1 52  ? 4.697   32.193 28.333 1.00 59.55  ? 41   ARG A CB  1 
ATOM   92   C  CG  . ARG A 1 52  ? 6.127   31.760 28.107 1.00 58.78  ? 41   ARG A CG  1 
ATOM   93   C  CD  . ARG A 1 52  ? 6.701   31.136 29.367 1.00 58.32  ? 41   ARG A CD  1 
ATOM   94   N  NE  . ARG A 1 52  ? 8.032   30.634 29.122 1.00 57.70  ? 41   ARG A NE  1 
ATOM   95   C  CZ  . ARG A 1 52  ? 8.307   29.527 28.441 1.00 56.18  ? 41   ARG A CZ  1 
ATOM   96   N  NH1 . ARG A 1 52  ? 7.370   28.757 27.916 1.00 56.19  ? 41   ARG A NH1 1 
ATOM   97   N  NH2 . ARG A 1 52  ? 9.553   29.171 28.275 1.00 57.36  ? 41   ARG A NH2 1 
ATOM   98   N  N   . GLY A 1 53  ? 1.310   31.040 28.372 1.00 60.41  ? 42   GLY A N   1 
ATOM   99   C  CA  . GLY A 1 53  ? -0.028  31.570 28.637 1.00 62.71  ? 42   GLY A CA  1 
ATOM   100  C  C   . GLY A 1 53  ? -0.438  30.955 29.938 1.00 61.84  ? 42   GLY A C   1 
ATOM   101  O  O   . GLY A 1 53  ? 0.406   30.389 30.657 1.00 59.07  ? 42   GLY A O   1 
ATOM   102  N  N   . THR A 1 54  ? -1.733  31.032 30.223 1.00 63.07  ? 43   THR A N   1 
ATOM   103  C  CA  . THR A 1 54  ? -2.222  30.771 31.569 1.00 62.33  ? 43   THR A CA  1 
ATOM   104  C  C   . THR A 1 54  ? -3.177  29.600 31.692 1.00 62.76  ? 43   THR A C   1 
ATOM   105  O  O   . THR A 1 54  ? -3.828  29.471 32.708 1.00 65.07  ? 43   THR A O   1 
ATOM   106  C  CB  . THR A 1 54  ? -2.918  32.012 32.070 1.00 64.22  ? 43   THR A CB  1 
ATOM   107  O  OG1 . THR A 1 54  ? -4.046  32.246 31.233 1.00 64.49  ? 43   THR A OG1 1 
ATOM   108  C  CG2 . THR A 1 54  ? -1.973  33.187 31.997 1.00 64.78  ? 43   THR A CG2 1 
ATOM   109  N  N   . GLN A 1 55  ? -3.257  28.742 30.685 1.00 61.82  ? 44   GLN A N   1 
ATOM   110  C  CA  . GLN A 1 55  ? -4.143  27.613 30.767 1.00 64.82  ? 44   GLN A CA  1 
ATOM   111  C  C   . GLN A 1 55  ? -3.620  26.784 31.895 1.00 66.37  ? 44   GLN A C   1 
ATOM   112  O  O   . GLN A 1 55  ? -2.438  26.500 31.934 1.00 65.67  ? 44   GLN A O   1 
ATOM   113  C  CB  . GLN A 1 55  ? -4.126  26.783 29.482 1.00 64.76  ? 44   GLN A CB  1 
ATOM   114  C  CG  . GLN A 1 55  ? -5.085  25.583 29.515 1.00 67.78  ? 44   GLN A CG  1 
ATOM   115  C  CD  . GLN A 1 55  ? -5.543  25.056 28.142 1.00 68.32  ? 44   GLN A CD  1 
ATOM   116  O  OE1 . GLN A 1 55  ? -5.603  25.789 27.155 1.00 67.80  ? 44   GLN A OE1 1 
ATOM   117  N  NE2 . GLN A 1 55  ? -5.892  23.775 28.095 1.00 69.76  ? 44   GLN A NE2 1 
ATOM   118  N  N   . ASN A 1 56  ? -4.503  26.411 32.813 1.00 71.98  ? 45   ASN A N   1 
ATOM   119  C  CA  . ASN A 1 56  ? -4.186  25.461 33.874 1.00 72.29  ? 45   ASN A CA  1 
ATOM   120  C  C   . ASN A 1 56  ? -5.128  24.243 33.935 1.00 73.84  ? 45   ASN A C   1 
ATOM   121  O  O   . ASN A 1 56  ? -5.304  23.647 34.965 1.00 74.15  ? 45   ASN A O   1 
ATOM   122  C  CB  . ASN A 1 56  ? -4.070  26.178 35.219 1.00 77.22  ? 45   ASN A CB  1 
ATOM   123  C  CG  . ASN A 1 56  ? -5.134  27.229 35.442 1.00 87.10  ? 45   ASN A CG  1 
ATOM   124  O  OD1 . ASN A 1 56  ? -6.186  27.203 34.818 1.00 89.24  ? 45   ASN A OD1 1 
ATOM   125  N  ND2 . ASN A 1 56  ? -4.850  28.169 36.359 1.00 98.22  ? 45   ASN A ND2 1 
ATOM   126  N  N   . TRP A 1 57  ? -5.693  23.840 32.809 1.00 76.36  ? 46   TRP A N   1 
ATOM   127  C  CA  . TRP A 1 57  ? -6.438  22.589 32.701 1.00 80.72  ? 46   TRP A CA  1 
ATOM   128  C  C   . TRP A 1 57  ? -5.840  21.734 31.584 1.00 77.94  ? 46   TRP A C   1 
ATOM   129  O  O   . TRP A 1 57  ? -5.292  22.273 30.630 1.00 77.09  ? 46   TRP A O   1 
ATOM   130  C  CB  . TRP A 1 57  ? -7.894  22.916 32.396 1.00 89.68  ? 46   TRP A CB  1 
ATOM   131  C  CG  . TRP A 1 57  ? -8.638  23.443 33.606 1.00 97.39  ? 46   TRP A CG  1 
ATOM   132  C  CD1 . TRP A 1 57  ? -8.710  24.749 34.033 1.00 100.71 ? 46   TRP A CD1 1 
ATOM   133  C  CD2 . TRP A 1 57  ? -9.406  22.666 34.560 1.00 101.54 ? 46   TRP A CD2 1 
ATOM   134  N  NE1 . TRP A 1 57  ? -9.473  24.829 35.197 1.00 105.00 ? 46   TRP A NE1 1 
ATOM   135  C  CE2 . TRP A 1 57  ? -9.907  23.573 35.539 1.00 104.33 ? 46   TRP A CE2 1 
ATOM   136  C  CE3 . TRP A 1 57  ? -9.716  21.298 34.680 1.00 101.41 ? 46   TRP A CE3 1 
ATOM   137  C  CZ2 . TRP A 1 57  ? -10.690 23.156 36.616 1.00 106.82 ? 46   TRP A CZ2 1 
ATOM   138  C  CZ3 . TRP A 1 57  ? -10.499 20.889 35.751 1.00 106.03 ? 46   TRP A CZ3 1 
ATOM   139  C  CH2 . TRP A 1 57  ? -10.979 21.819 36.706 1.00 108.27 ? 46   TRP A CH2 1 
ATOM   140  N  N   . THR A 1 58  ? -5.939  20.412 31.675 1.00 78.81  ? 47   THR A N   1 
ATOM   141  C  CA  . THR A 1 58  ? -5.438  19.551 30.593 1.00 80.66  ? 47   THR A CA  1 
ATOM   142  C  C   . THR A 1 58  ? -6.221  19.819 29.308 1.00 85.59  ? 47   THR A C   1 
ATOM   143  O  O   . THR A 1 58  ? -5.740  19.616 28.197 1.00 84.82  ? 47   THR A O   1 
ATOM   144  C  CB  . THR A 1 58  ? -5.543  18.023 30.905 1.00 83.38  ? 47   THR A CB  1 
ATOM   145  O  OG1 . THR A 1 58  ? -6.893  17.651 31.168 1.00 87.72  ? 47   THR A OG1 1 
ATOM   146  C  CG2 . THR A 1 58  ? -4.703  17.616 32.089 1.00 82.34  ? 47   THR A CG2 1 
ATOM   147  N  N   . ALA A 1 59  ? -7.464  20.236 29.485 1.00 94.17  ? 48   ALA A N   1 
ATOM   148  C  CA  . ALA A 1 59  ? -8.326  20.655 28.391 1.00 99.79  ? 48   ALA A CA  1 
ATOM   149  C  C   . ALA A 1 59  ? -9.397  21.604 28.949 1.00 105.11 ? 48   ALA A C   1 
ATOM   150  O  O   . ALA A 1 59  ? -9.771  21.537 30.118 1.00 108.87 ? 48   ALA A O   1 
ATOM   151  C  CB  . ALA A 1 59  ? -8.964  19.438 27.729 1.00 102.60 ? 48   ALA A CB  1 
ATOM   152  N  N   . LEU A 1 60  ? -9.885  22.493 28.104 1.00 107.16 ? 49   LEU A N   1 
ATOM   153  C  CA  . LEU A 1 60  ? -10.917 23.441 28.507 1.00 110.19 ? 49   LEU A CA  1 
ATOM   154  C  C   . LEU A 1 60  ? -12.229 22.684 28.641 1.00 111.85 ? 49   LEU A C   1 
ATOM   155  O  O   . LEU A 1 60  ? -13.052 22.974 29.491 1.00 113.89 ? 49   LEU A O   1 
ATOM   156  C  CB  . LEU A 1 60  ? -10.997 24.589 27.484 1.00 112.55 ? 49   LEU A CB  1 
ATOM   157  C  CG  . LEU A 1 60  ? -9.651  25.358 27.326 1.00 109.21 ? 49   LEU A CG  1 
ATOM   158  C  CD1 . LEU A 1 60  ? -9.636  26.314 26.146 1.00 107.07 ? 49   LEU A CD1 1 
ATOM   159  C  CD2 . LEU A 1 60  ? -9.285  26.093 28.617 1.00 111.11 ? 49   LEU A CD2 1 
ATOM   160  N  N   . GLN A 1 61  ? -12.383 21.661 27.826 1.00 111.52 ? 50   GLN A N   1 
ATOM   161  C  CA  . GLN A 1 61  ? -13.582 20.869 27.825 1.00 118.03 ? 50   GLN A CA  1 
ATOM   162  C  C   . GLN A 1 61  ? -13.266 19.421 28.255 1.00 113.57 ? 50   GLN A C   1 
ATOM   163  O  O   . GLN A 1 61  ? -12.491 18.721 27.608 1.00 110.96 ? 50   GLN A O   1 
ATOM   164  C  CB  . GLN A 1 61  ? -14.197 20.941 26.416 1.00 124.20 ? 50   GLN A CB  1 
ATOM   165  C  CG  . GLN A 1 61  ? -15.716 20.909 26.402 1.00 133.79 ? 50   GLN A CG  1 
ATOM   166  C  CD  . GLN A 1 61  ? -16.268 19.607 26.953 1.00 140.45 ? 50   GLN A CD  1 
ATOM   167  O  OE1 . GLN A 1 61  ? -15.917 18.523 26.483 1.00 143.04 ? 50   GLN A OE1 1 
ATOM   168  N  NE2 . GLN A 1 61  ? -17.131 19.706 27.954 1.00 145.18 ? 50   GLN A NE2 1 
ATOM   169  N  N   . GLY A 1 62  ? -13.862 18.981 29.355 1.00 112.41 ? 51   GLY A N   1 
ATOM   170  C  CA  . GLY A 1 62  ? -13.632 17.627 29.878 1.00 109.79 ? 51   GLY A CA  1 
ATOM   171  C  C   . GLY A 1 62  ? -12.319 17.359 30.595 1.00 101.40 ? 51   GLY A C   1 
ATOM   172  O  O   . GLY A 1 62  ? -12.025 16.223 30.937 1.00 99.46  ? 51   GLY A O   1 
ATOM   173  N  N   . GLY A 1 63  ? -11.540 18.395 30.859 1.00 95.89  ? 52   GLY A N   1 
ATOM   174  C  CA  . GLY A 1 63  ? -10.175 18.211 31.353 1.00 92.92  ? 52   GLY A CA  1 
ATOM   175  C  C   . GLY A 1 63  ? -9.972  18.074 32.866 1.00 95.33  ? 52   GLY A C   1 
ATOM   176  O  O   . GLY A 1 63  ? -10.935 18.184 33.620 1.00 103.61 ? 52   GLY A O   1 
ATOM   177  N  N   . LYS A 1 64  ? -8.719  17.836 33.290 1.00 91.30  ? 53   LYS A N   1 
ATOM   178  C  CA  . LYS A 1 64  ? -8.301  17.851 34.698 1.00 90.15  ? 53   LYS A CA  1 
ATOM   179  C  C   . LYS A 1 64  ? -7.362  19.004 34.970 1.00 83.34  ? 53   LYS A C   1 
ATOM   180  O  O   . LYS A 1 64  ? -6.724  19.501 34.041 1.00 82.50  ? 53   LYS A O   1 
ATOM   181  C  CB  . LYS A 1 64  ? -7.525  16.595 35.037 1.00 92.70  ? 53   LYS A CB  1 
ATOM   182  C  CG  . LYS A 1 64  ? -8.191  15.283 34.675 1.00 100.45 ? 53   LYS A CG  1 
ATOM   183  C  CD  . LYS A 1 64  ? -7.735  14.183 35.676 1.00 105.00 ? 53   LYS A CD  1 
ATOM   184  C  CE  . LYS A 1 64  ? -7.741  12.772 35.096 1.00 110.53 ? 53   LYS A CE  1 
ATOM   185  N  NZ  . LYS A 1 64  ? -9.062  12.414 34.500 1.00 118.18 ? 53   LYS A NZ  1 
ATOM   186  N  N   . PRO A 1 65  ? -7.232  19.415 36.243 1.00 80.70  ? 54   PRO A N   1 
ATOM   187  C  CA  . PRO A 1 65  ? -6.460  20.611 36.520 1.00 76.00  ? 54   PRO A CA  1 
ATOM   188  C  C   . PRO A 1 65  ? -4.992  20.314 36.819 1.00 71.40  ? 54   PRO A C   1 
ATOM   189  O  O   . PRO A 1 65  ? -4.640  19.239 37.333 1.00 72.15  ? 54   PRO A O   1 
ATOM   190  C  CB  . PRO A 1 65  ? -7.168  21.193 37.739 1.00 78.94  ? 54   PRO A CB  1 
ATOM   191  C  CG  . PRO A 1 65  ? -7.671  19.996 38.469 1.00 83.29  ? 54   PRO A CG  1 
ATOM   192  C  CD  . PRO A 1 65  ? -7.780  18.852 37.488 1.00 84.42  ? 54   PRO A CD  1 
ATOM   193  N  N   . CYS A 1 66  ? -4.159  21.289 36.493 1.00 67.11  ? 55   CYS A N   1 
ATOM   194  C  CA  . CYS A 1 66  ? -2.729  21.195 36.642 1.00 64.33  ? 55   CYS A CA  1 
ATOM   195  C  C   . CYS A 1 66  ? -2.216  21.406 38.044 1.00 65.50  ? 55   CYS A C   1 
ATOM   196  O  O   . CYS A 1 66  ? -2.731  22.225 38.767 1.00 69.96  ? 55   CYS A O   1 
ATOM   197  C  CB  . CYS A 1 66  ? -2.123  22.299 35.838 1.00 62.98  ? 55   CYS A CB  1 
ATOM   198  S  SG  . CYS A 1 66  ? -2.272  22.052 34.085 1.00 64.64  ? 55   CYS A SG  1 
ATOM   199  N  N   . LEU A 1 67  ? -1.142  20.718 38.413 1.00 64.57  ? 56   LEU A N   1 
ATOM   200  C  CA  . LEU A 1 67  ? -0.472  20.975 39.693 1.00 63.17  ? 56   LEU A CA  1 
ATOM   201  C  C   . LEU A 1 67  ? 0.431   22.155 39.553 1.00 63.43  ? 56   LEU A C   1 
ATOM   202  O  O   . LEU A 1 67  ? 0.840   22.535 38.439 1.00 62.19  ? 56   LEU A O   1 
ATOM   203  C  CB  . LEU A 1 67  ? 0.393   19.801 40.147 1.00 60.27  ? 56   LEU A CB  1 
ATOM   204  C  CG  . LEU A 1 67  ? -0.340  18.487 40.348 1.00 60.85  ? 56   LEU A CG  1 
ATOM   205  C  CD1 . LEU A 1 67  ? 0.578   17.414 40.902 1.00 60.34  ? 56   LEU A CD1 1 
ATOM   206  C  CD2 . LEU A 1 67  ? -1.612  18.701 41.152 1.00 62.93  ? 56   LEU A CD2 1 
ATOM   207  N  N   . PHE A 1 68  ? 0.793   22.683 40.713 1.00 66.36  ? 57   PHE A N   1 
ATOM   208  C  CA  . PHE A 1 68  ? 1.634   23.842 40.768 1.00 66.36  ? 57   PHE A CA  1 
ATOM   209  C  C   . PHE A 1 68  ? 3.091   23.423 40.737 1.00 66.08  ? 57   PHE A C   1 
ATOM   210  O  O   . PHE A 1 68  ? 3.517   22.497 41.457 1.00 62.99  ? 57   PHE A O   1 
ATOM   211  C  CB  . PHE A 1 68  ? 1.353   24.630 41.990 1.00 68.72  ? 57   PHE A CB  1 
ATOM   212  C  CG  . PHE A 1 68  ? 0.109   25.402 41.897 1.00 72.70  ? 57   PHE A CG  1 
ATOM   213  C  CD1 . PHE A 1 68  ? -1.122  24.785 42.097 1.00 76.51  ? 57   PHE A CD1 1 
ATOM   214  C  CD2 . PHE A 1 68  ? 0.156   26.756 41.616 1.00 75.37  ? 57   PHE A CD2 1 
ATOM   215  C  CE1 . PHE A 1 68  ? -2.292  25.516 42.033 1.00 80.42  ? 57   PHE A CE1 1 
ATOM   216  C  CE2 . PHE A 1 68  ? -1.008  27.514 41.557 1.00 79.42  ? 57   PHE A CE2 1 
ATOM   217  C  CZ  . PHE A 1 68  ? -2.236  26.890 41.766 1.00 81.88  ? 57   PHE A CZ  1 
ATOM   218  N  N   . TRP A 1 69  ? 3.851   24.132 39.894 1.00 65.74  ? 58   TRP A N   1 
ATOM   219  C  CA  . TRP A 1 69  ? 5.218   23.768 39.603 1.00 63.27  ? 58   TRP A CA  1 
ATOM   220  C  C   . TRP A 1 69  ? 6.072   24.096 40.758 1.00 62.44  ? 58   TRP A C   1 
ATOM   221  O  O   . TRP A 1 69  ? 7.170   23.643 40.798 1.00 61.37  ? 58   TRP A O   1 
ATOM   222  C  CB  . TRP A 1 69  ? 5.747   24.472 38.351 1.00 64.82  ? 58   TRP A CB  1 
ATOM   223  C  CG  . TRP A 1 69  ? 4.975   24.157 37.090 1.00 67.19  ? 58   TRP A CG  1 
ATOM   224  C  CD1 . TRP A 1 69  ? 4.044   24.938 36.518 1.00 70.41  ? 58   TRP A CD1 1 
ATOM   225  C  CD2 . TRP A 1 69  ? 5.073   22.986 36.264 1.00 68.24  ? 58   TRP A CD2 1 
ATOM   226  N  NE1 . TRP A 1 69  ? 3.563   24.352 35.382 1.00 71.73  ? 58   TRP A NE1 1 
ATOM   227  C  CE2 . TRP A 1 69  ? 4.173   23.142 35.217 1.00 69.87  ? 58   TRP A CE2 1 
ATOM   228  C  CE3 . TRP A 1 69  ? 5.848   21.833 36.306 1.00 70.82  ? 58   TRP A CE3 1 
ATOM   229  C  CZ2 . TRP A 1 69  ? 4.019   22.193 34.220 1.00 71.33  ? 58   TRP A CZ2 1 
ATOM   230  C  CZ3 . TRP A 1 69  ? 5.684   20.878 35.325 1.00 70.21  ? 58   TRP A CZ3 1 
ATOM   231  C  CH2 . TRP A 1 69  ? 4.782   21.064 34.300 1.00 71.10  ? 58   TRP A CH2 1 
ATOM   232  N  N   . ASN A 1 70  ? 5.574   24.915 41.678 1.00 66.87  ? 59   ASN A N   1 
ATOM   233  C  CA  . ASN A 1 70  ? 6.259   25.219 42.929 1.00 71.20  ? 59   ASN A CA  1 
ATOM   234  C  C   . ASN A 1 70  ? 5.830   24.323 44.079 1.00 70.14  ? 59   ASN A C   1 
ATOM   235  O  O   . ASN A 1 70  ? 6.206   24.579 45.223 1.00 70.31  ? 59   ASN A O   1 
ATOM   236  C  CB  . ASN A 1 70  ? 6.068   26.688 43.296 1.00 78.12  ? 59   ASN A CB  1 
ATOM   237  C  CG  . ASN A 1 70  ? 4.613   27.044 43.612 1.00 86.39  ? 59   ASN A CG  1 
ATOM   238  O  OD1 . ASN A 1 70  ? 3.709   26.578 42.935 1.00 85.03  ? 59   ASN A OD1 1 
ATOM   239  N  ND2 . ASN A 1 70  ? 4.395   27.891 44.655 1.00 98.57  ? 59   ASN A ND2 1 
ATOM   240  N  N   . GLU A 1 71  ? 5.054   23.279 43.763 1.00 68.01  ? 60   GLU A N   1 
ATOM   241  C  CA  . GLU A 1 71  ? 4.705   22.200 44.692 1.00 66.55  ? 60   GLU A CA  1 
ATOM   242  C  C   . GLU A 1 71  ? 4.985   20.794 44.086 1.00 61.86  ? 60   GLU A C   1 
ATOM   243  O  O   . GLU A 1 71  ? 4.638   19.768 44.657 1.00 63.74  ? 60   GLU A O   1 
ATOM   244  C  CB  . GLU A 1 71  ? 3.227   22.345 45.121 1.00 68.48  ? 60   GLU A CB  1 
ATOM   245  C  CG  . GLU A 1 71  ? 2.863   23.749 45.580 1.00 71.46  ? 60   GLU A CG  1 
ATOM   246  C  CD  . GLU A 1 71  ? 1.369   23.987 45.748 1.00 76.41  ? 60   GLU A CD  1 
ATOM   247  O  OE1 . GLU A 1 71  ? 0.589   23.038 45.464 1.00 77.57  ? 60   GLU A OE1 1 
ATOM   248  O  OE2 . GLU A 1 71  ? 0.989   25.138 46.153 1.00 78.34  ? 60   GLU A OE2 1 
ATOM   249  N  N   . THR A 1 72  ? 5.637   20.710 42.956 1.00 57.05  ? 61   THR A N   1 
ATOM   250  C  CA  . THR A 1 72  ? 5.733   19.421 42.301 1.00 57.47  ? 61   THR A CA  1 
ATOM   251  C  C   . THR A 1 72  ? 7.050   18.722 42.637 1.00 56.55  ? 61   THR A C   1 
ATOM   252  O  O   . THR A 1 72  ? 7.836   18.358 41.764 1.00 55.27  ? 61   THR A O   1 
ATOM   253  C  CB  . THR A 1 72  ? 5.571   19.613 40.795 1.00 56.82  ? 61   THR A CB  1 
ATOM   254  O  OG1 . THR A 1 72  ? 6.339   20.758 40.391 1.00 56.64  ? 61   THR A OG1 1 
ATOM   255  C  CG2 . THR A 1 72  ? 4.099   19.821 40.441 1.00 57.17  ? 61   THR A CG2 1 
ATOM   256  N  N   . PHE A 1 73  ? 7.286   18.514 43.922 1.00 56.97  ? 62   PHE A N   1 
ATOM   257  C  CA  . PHE A 1 73  ? 8.620   18.111 44.368 1.00 56.44  ? 62   PHE A CA  1 
ATOM   258  C  C   . PHE A 1 73  ? 8.840   16.630 44.383 1.00 58.82  ? 62   PHE A C   1 
ATOM   259  O  O   . PHE A 1 73  ? 9.966   16.191 44.481 1.00 59.93  ? 62   PHE A O   1 
ATOM   260  C  CB  . PHE A 1 73  ? 8.926   18.737 45.703 1.00 56.12  ? 62   PHE A CB  1 
ATOM   261  C  CG  . PHE A 1 73  ? 8.961   20.223 45.638 1.00 54.02  ? 62   PHE A CG  1 
ATOM   262  C  CD1 . PHE A 1 73  ? 9.920   20.864 44.873 1.00 53.18  ? 62   PHE A CD1 1 
ATOM   263  C  CD2 . PHE A 1 73  ? 8.041   20.971 46.282 1.00 54.01  ? 62   PHE A CD2 1 
ATOM   264  C  CE1 . PHE A 1 73  ? 9.961   22.241 44.768 1.00 52.95  ? 62   PHE A CE1 1 
ATOM   265  C  CE2 . PHE A 1 73  ? 8.078   22.338 46.186 1.00 54.39  ? 62   PHE A CE2 1 
ATOM   266  C  CZ  . PHE A 1 73  ? 9.026   22.979 45.421 1.00 53.52  ? 62   PHE A CZ  1 
ATOM   267  N  N   . GLN A 1 74  ? 7.756   15.878 44.280 1.00 61.09  ? 63   GLN A N   1 
ATOM   268  C  CA  . GLN A 1 74  ? 7.792   14.450 44.071 1.00 63.95  ? 63   GLN A CA  1 
ATOM   269  C  C   . GLN A 1 74  ? 8.191   14.176 42.646 1.00 62.13  ? 63   GLN A C   1 
ATOM   270  O  O   . GLN A 1 74  ? 8.543   13.072 42.328 1.00 64.15  ? 63   GLN A O   1 
ATOM   271  C  CB  . GLN A 1 74  ? 6.454   13.773 44.403 1.00 67.87  ? 63   GLN A CB  1 
ATOM   272  C  CG  . GLN A 1 74  ? 5.234   14.263 43.625 1.00 71.14  ? 63   GLN A CG  1 
ATOM   273  C  CD  . GLN A 1 74  ? 4.769   15.694 43.986 1.00 75.68  ? 63   GLN A CD  1 
ATOM   274  O  OE1 . GLN A 1 74  ? 5.443   16.414 44.723 1.00 82.79  ? 63   GLN A OE1 1 
ATOM   275  N  NE2 . GLN A 1 74  ? 3.619   16.113 43.449 1.00 77.67  ? 63   GLN A NE2 1 
ATOM   276  N  N   . HIS A 1 75  ? 8.132   15.156 41.765 1.00 59.50  ? 64   HIS A N   1 
ATOM   277  C  CA  . HIS A 1 75  ? 8.572   14.924 40.413 1.00 58.67  ? 64   HIS A CA  1 
ATOM   278  C  C   . HIS A 1 75  ? 9.839   15.697 40.125 1.00 57.03  ? 64   HIS A C   1 
ATOM   279  O  O   . HIS A 1 75  ? 10.261  16.504 40.937 1.00 56.48  ? 64   HIS A O   1 
ATOM   280  C  CB  . HIS A 1 75  ? 7.429   15.210 39.413 1.00 57.79  ? 64   HIS A CB  1 
ATOM   281  C  CG  . HIS A 1 75  ? 6.076   14.618 39.795 1.00 59.37  ? 64   HIS A CG  1 
ATOM   282  N  ND1 . HIS A 1 75  ? 4.994   15.409 40.128 1.00 60.37  ? 64   HIS A ND1 1 
ATOM   283  C  CD2 . HIS A 1 75  ? 5.605   13.343 39.825 1.00 60.52  ? 64   HIS A CD2 1 
ATOM   284  C  CE1 . HIS A 1 75  ? 3.932   14.650 40.368 1.00 61.27  ? 64   HIS A CE1 1 
ATOM   285  N  NE2 . HIS A 1 75  ? 4.279   13.394 40.192 1.00 61.79  ? 64   HIS A NE2 1 
ATOM   286  N  N   . PRO A 1 76  ? 10.498  15.403 38.999 1.00 57.38  ? 65   PRO A N   1 
ATOM   287  C  CA  . PRO A 1 76  ? 11.661  16.209 38.646 1.00 57.56  ? 65   PRO A CA  1 
ATOM   288  C  C   . PRO A 1 76  ? 11.327  17.660 38.417 1.00 55.31  ? 65   PRO A C   1 
ATOM   289  O  O   . PRO A 1 76  ? 12.080  18.522 38.809 1.00 55.66  ? 65   PRO A O   1 
ATOM   290  C  CB  . PRO A 1 76  ? 12.129  15.606 37.324 1.00 57.88  ? 65   PRO A CB  1 
ATOM   291  C  CG  . PRO A 1 76  ? 11.630  14.218 37.359 1.00 59.33  ? 65   PRO A CG  1 
ATOM   292  C  CD  . PRO A 1 76  ? 10.326  14.280 38.067 1.00 58.60  ? 65   PRO A CD  1 
ATOM   293  N  N   . TYR A 1 77  ? 10.180  17.914 37.808 1.00 53.97  ? 66   TYR A N   1 
ATOM   294  C  CA  . TYR A 1 77  ? 9.940   19.192 37.153 1.00 52.39  ? 66   TYR A CA  1 
ATOM   295  C  C   . TYR A 1 77  ? 9.222   20.062 38.144 1.00 52.10  ? 66   TYR A C   1 
ATOM   296  O  O   . TYR A 1 77  ? 8.092   19.810 38.492 1.00 51.88  ? 66   TYR A O   1 
ATOM   297  C  CB  . TYR A 1 77  ? 9.176   19.014 35.813 1.00 50.47  ? 66   TYR A CB  1 
ATOM   298  C  CG  . TYR A 1 77  ? 10.105  18.542 34.726 1.00 51.10  ? 66   TYR A CG  1 
ATOM   299  C  CD1 . TYR A 1 77  ? 10.998  19.418 34.125 1.00 51.94  ? 66   TYR A CD1 1 
ATOM   300  C  CD2 . TYR A 1 77  ? 10.176  17.197 34.357 1.00 53.54  ? 66   TYR A CD2 1 
ATOM   301  C  CE1 . TYR A 1 77  ? 11.906  18.993 33.127 1.00 54.15  ? 66   TYR A CE1 1 
ATOM   302  C  CE2 . TYR A 1 77  ? 11.088  16.742 33.357 1.00 55.57  ? 66   TYR A CE2 1 
ATOM   303  C  CZ  . TYR A 1 77  ? 11.963  17.648 32.731 1.00 54.70  ? 66   TYR A CZ  1 
ATOM   304  O  OH  . TYR A 1 77  ? 12.860  17.261 31.740 1.00 52.13  ? 66   TYR A OH  1 
ATOM   305  N  N   . ASN A 1 78  ? 9.929   21.069 38.630 1.00 53.31  ? 67   ASN A N   1 
ATOM   306  C  CA  . ASN A 1 78  ? 9.440   21.954 39.678 1.00 53.74  ? 67   ASN A CA  1 
ATOM   307  C  C   . ASN A 1 78  ? 10.398  23.144 39.792 1.00 54.72  ? 67   ASN A C   1 
ATOM   308  O  O   . ASN A 1 78  ? 11.509  23.113 39.248 1.00 56.40  ? 67   ASN A O   1 
ATOM   309  C  CB  . ASN A 1 78  ? 9.344   21.216 41.023 1.00 54.31  ? 67   ASN A CB  1 
ATOM   310  C  CG  . ASN A 1 78  ? 10.671  20.625 41.452 1.00 56.82  ? 67   ASN A CG  1 
ATOM   311  O  OD1 . ASN A 1 78  ? 11.685  21.339 41.485 1.00 57.58  ? 67   ASN A OD1 1 
ATOM   312  N  ND2 . ASN A 1 78  ? 10.696  19.308 41.747 1.00 57.84  ? 67   ASN A ND2 1 
ATOM   313  N  N   . THR A 1 79  ? 9.986   24.153 40.543 1.00 54.84  ? 68   THR A N   1 
ATOM   314  C  CA  . THR A 1 79  ? 10.759  25.368 40.703 1.00 55.82  ? 68   THR A CA  1 
ATOM   315  C  C   . THR A 1 79  ? 12.083  25.212 41.435 1.00 57.35  ? 68   THR A C   1 
ATOM   316  O  O   . THR A 1 79  ? 12.840  26.167 41.496 1.00 58.80  ? 68   THR A O   1 
ATOM   317  C  CB  . THR A 1 79  ? 9.944   26.455 41.440 1.00 57.91  ? 68   THR A CB  1 
ATOM   318  O  OG1 . THR A 1 79  ? 9.461   25.996 42.715 1.00 57.90  ? 68   THR A OG1 1 
ATOM   319  C  CG2 . THR A 1 79  ? 8.783   26.876 40.585 1.00 57.90  ? 68   THR A CG2 1 
ATOM   320  N  N   . LEU A 1 80  ? 12.371  24.050 42.005 1.00 57.60  ? 69   LEU A N   1 
ATOM   321  C  CA  . LEU A 1 80  ? 13.648  23.881 42.646 1.00 61.58  ? 69   LEU A CA  1 
ATOM   322  C  C   . LEU A 1 80  ? 14.636  23.503 41.612 1.00 65.59  ? 69   LEU A C   1 
ATOM   323  O  O   . LEU A 1 80  ? 15.703  24.079 41.577 1.00 68.89  ? 69   LEU A O   1 
ATOM   324  C  CB  . LEU A 1 80  ? 13.626  22.856 43.772 1.00 61.46  ? 69   LEU A CB  1 
ATOM   325  C  CG  . LEU A 1 80  ? 13.515  23.526 45.123 1.00 62.97  ? 69   LEU A CG  1 
ATOM   326  C  CD1 . LEU A 1 80  ? 13.234  22.477 46.148 1.00 63.80  ? 69   LEU A CD1 1 
ATOM   327  C  CD2 . LEU A 1 80  ? 14.801  24.254 45.491 1.00 66.68  ? 69   LEU A CD2 1 
ATOM   328  N  N   . LYS A 1 81  ? 14.297  22.538 40.764 1.00 70.12  ? 70   LYS A N   1 
ATOM   329  C  CA  . LYS A 1 81  ? 15.189  22.161 39.652 1.00 75.37  ? 70   LYS A CA  1 
ATOM   330  C  C   . LYS A 1 81  ? 15.314  23.348 38.718 1.00 71.79  ? 70   LYS A C   1 
ATOM   331  O  O   . LYS A 1 81  ? 16.398  23.675 38.290 1.00 73.29  ? 70   LYS A O   1 
ATOM   332  C  CB  . LYS A 1 81  ? 14.636  20.957 38.900 1.00 80.50  ? 70   LYS A CB  1 
ATOM   333  C  CG  . LYS A 1 81  ? 15.434  20.508 37.680 1.00 87.48  ? 70   LYS A CG  1 
ATOM   334  C  CD  . LYS A 1 81  ? 14.509  19.872 36.621 1.00 90.06  ? 70   LYS A CD  1 
ATOM   335  C  CE  . LYS A 1 81  ? 15.259  18.953 35.654 1.00 93.73  ? 70   LYS A CE  1 
ATOM   336  N  NZ  . LYS A 1 81  ? 15.845  17.754 36.337 1.00 96.27  ? 70   LYS A NZ  1 
ATOM   337  N  N   . TYR A 1 82  ? 14.193  23.999 38.443 1.00 67.72  ? 71   TYR A N   1 
ATOM   338  C  CA  . TYR A 1 82  ? 14.151  25.178 37.610 1.00 67.80  ? 71   TYR A CA  1 
ATOM   339  C  C   . TYR A 1 82  ? 13.721  26.486 38.344 1.00 66.49  ? 71   TYR A C   1 
ATOM   340  O  O   . TYR A 1 82  ? 12.599  27.001 38.115 1.00 62.07  ? 71   TYR A O   1 
ATOM   341  C  CB  . TYR A 1 82  ? 13.234  24.873 36.404 1.00 67.82  ? 71   TYR A CB  1 
ATOM   342  C  CG  . TYR A 1 82  ? 13.781  23.896 35.329 1.00 69.49  ? 71   TYR A CG  1 
ATOM   343  C  CD1 . TYR A 1 82  ? 15.062  23.326 35.393 1.00 72.24  ? 71   TYR A CD1 1 
ATOM   344  C  CD2 . TYR A 1 82  ? 13.017  23.586 34.218 1.00 70.05  ? 71   TYR A CD2 1 
ATOM   345  C  CE1 . TYR A 1 82  ? 15.537  22.469 34.411 1.00 73.39  ? 71   TYR A CE1 1 
ATOM   346  C  CE2 . TYR A 1 82  ? 13.499  22.729 33.220 1.00 72.19  ? 71   TYR A CE2 1 
ATOM   347  C  CZ  . TYR A 1 82  ? 14.752  22.167 33.323 1.00 73.33  ? 71   TYR A CZ  1 
ATOM   348  O  OH  . TYR A 1 82  ? 15.196  21.325 32.320 1.00 76.75  ? 71   TYR A OH  1 
ATOM   349  N  N   . PRO A 1 83  ? 14.629  27.054 39.192 1.00 68.32  ? 72   PRO A N   1 
ATOM   350  C  CA  . PRO A 1 83  ? 14.392  28.388 39.724 1.00 72.39  ? 72   PRO A CA  1 
ATOM   351  C  C   . PRO A 1 83  ? 14.786  29.273 38.589 1.00 80.62  ? 72   PRO A C   1 
ATOM   352  O  O   . PRO A 1 83  ? 15.169  28.755 37.542 1.00 82.12  ? 72   PRO A O   1 
ATOM   353  C  CB  . PRO A 1 83  ? 15.405  28.502 40.827 1.00 72.87  ? 72   PRO A CB  1 
ATOM   354  C  CG  . PRO A 1 83  ? 16.555  27.728 40.322 1.00 72.45  ? 72   PRO A CG  1 
ATOM   355  C  CD  . PRO A 1 83  ? 16.030  26.667 39.402 1.00 69.16  ? 72   PRO A CD  1 
ATOM   356  N  N   . ASN A 1 84  ? 14.739  30.587 38.744 1.00 88.98  ? 73   ASN A N   1 
ATOM   357  C  CA  . ASN A 1 84  ? 15.110  31.478 37.592 1.00 93.02  ? 73   ASN A CA  1 
ATOM   358  C  C   . ASN A 1 84  ? 14.143  31.378 36.401 1.00 86.52  ? 73   ASN A C   1 
ATOM   359  O  O   . ASN A 1 84  ? 14.472  31.852 35.312 1.00 86.33  ? 73   ASN A O   1 
ATOM   360  C  CB  . ASN A 1 84  ? 16.550  31.227 37.022 1.00 96.65  ? 73   ASN A CB  1 
ATOM   361  C  CG  . ASN A 1 84  ? 17.659  31.206 38.083 1.00 101.44 ? 73   ASN A CG  1 
ATOM   362  O  OD1 . ASN A 1 84  ? 18.626  30.461 37.950 1.00 99.05  ? 73   ASN A OD1 1 
ATOM   363  N  ND2 . ASN A 1 84  ? 17.541  32.037 39.109 1.00 107.73 ? 73   ASN A ND2 1 
ATOM   364  N  N   . GLY A 1 85  ? 12.981  30.752 36.600 1.00 80.97  ? 74   GLY A N   1 
ATOM   365  C  CA  . GLY A 1 85  ? 11.929  30.766 35.602 1.00 77.65  ? 74   GLY A CA  1 
ATOM   366  C  C   . GLY A 1 85  ? 12.220  29.964 34.362 1.00 75.13  ? 74   GLY A C   1 
ATOM   367  O  O   . GLY A 1 85  ? 11.534  30.110 33.365 1.00 73.87  ? 74   GLY A O   1 
ATOM   368  N  N   . GLU A 1 86  ? 13.211  29.083 34.450 1.00 75.08  ? 75   GLU A N   1 
ATOM   369  C  CA  . GLU A 1 86  ? 13.660  28.285 33.318 1.00 72.92  ? 75   GLU A CA  1 
ATOM   370  C  C   . GLU A 1 86  ? 12.449  27.487 32.845 1.00 66.68  ? 75   GLU A C   1 
ATOM   371  O  O   . GLU A 1 86  ? 11.717  26.930 33.657 1.00 67.03  ? 75   GLU A O   1 
ATOM   372  C  CB  . GLU A 1 86  ? 14.787  27.333 33.758 1.00 76.60  ? 75   GLU A CB  1 
ATOM   373  C  CG  . GLU A 1 86  ? 16.036  28.022 34.347 1.00 86.65  ? 75   GLU A CG  1 
ATOM   374  C  CD  . GLU A 1 86  ? 16.963  27.122 35.218 1.00 92.89  ? 75   GLU A CD  1 
ATOM   375  O  OE1 . GLU A 1 86  ? 16.915  25.860 35.135 1.00 98.42  ? 75   GLU A OE1 1 
ATOM   376  O  OE2 . GLU A 1 86  ? 17.783  27.674 35.989 1.00 93.92  ? 75   GLU A OE2 1 
ATOM   377  N  N   . GLY A 1 87  ? 12.185  27.477 31.553 1.00 61.81  ? 76   GLY A N   1 
ATOM   378  C  CA  . GLY A 1 87  ? 11.102  26.657 31.027 1.00 58.98  ? 76   GLY A CA  1 
ATOM   379  C  C   . GLY A 1 87  ? 9.696   27.218 31.194 1.00 58.28  ? 76   GLY A C   1 
ATOM   380  O  O   . GLY A 1 87  ? 8.690   26.584 30.878 1.00 55.85  ? 76   GLY A O   1 
ATOM   381  N  N   . GLY A 1 88  ? 9.629   28.437 31.673 1.00 61.70  ? 77   GLY A N   1 
ATOM   382  C  CA  . GLY A 1 88  ? 8.386   29.046 31.961 1.00 62.72  ? 77   GLY A CA  1 
ATOM   383  C  C   . GLY A 1 88  ? 7.869   28.536 33.271 1.00 64.10  ? 77   GLY A C   1 
ATOM   384  O  O   . GLY A 1 88  ? 6.772   28.913 33.610 1.00 67.01  ? 77   GLY A O   1 
ATOM   385  N  N   . LEU A 1 89  ? 8.629   27.718 34.013 1.00 63.52  ? 78   LEU A N   1 
ATOM   386  C  CA  . LEU A 1 89  ? 8.136   27.206 35.287 1.00 65.81  ? 78   LEU A CA  1 
ATOM   387  C  C   . LEU A 1 89  ? 8.294   28.238 36.376 1.00 68.55  ? 78   LEU A C   1 
ATOM   388  O  O   . LEU A 1 89  ? 9.263   28.984 36.350 1.00 74.81  ? 78   LEU A O   1 
ATOM   389  C  CB  . LEU A 1 89  ? 8.899   25.974 35.728 1.00 67.11  ? 78   LEU A CB  1 
ATOM   390  C  CG  . LEU A 1 89  ? 8.902   24.722 34.859 1.00 67.42  ? 78   LEU A CG  1 
ATOM   391  C  CD1 . LEU A 1 89  ? 9.534   23.571 35.655 1.00 66.51  ? 78   LEU A CD1 1 
ATOM   392  C  CD2 . LEU A 1 89  ? 7.496   24.368 34.367 1.00 67.08  ? 78   LEU A CD2 1 
ATOM   393  N  N   . GLY A 1 90  ? 7.384   28.235 37.353 1.00 65.80  ? 79   GLY A N   1 
ATOM   394  C  CA  . GLY A 1 90  ? 7.367   29.251 38.420 1.00 66.96  ? 79   GLY A CA  1 
ATOM   395  C  C   . GLY A 1 90  ? 6.186   29.057 39.353 1.00 67.78  ? 79   GLY A C   1 
ATOM   396  O  O   . GLY A 1 90  ? 5.647   27.947 39.428 1.00 63.42  ? 79   GLY A O   1 
ATOM   397  N  N   . GLU A 1 91  ? 5.745   30.113 40.050 1.00 72.89  ? 80   GLU A N   1 
ATOM   398  C  CA  . GLU A 1 91  ? 4.669   29.948 41.066 1.00 76.77  ? 80   GLU A CA  1 
ATOM   399  C  C   . GLU A 1 91  ? 3.268   29.933 40.457 1.00 73.52  ? 80   GLU A C   1 
ATOM   400  O  O   . GLU A 1 91  ? 2.446   30.764 40.784 1.00 73.81  ? 80   GLU A O   1 
ATOM   401  C  CB  . GLU A 1 91  ? 4.764   30.996 42.218 1.00 85.65  ? 80   GLU A CB  1 
ATOM   402  C  CG  . GLU A 1 91  ? 5.470   30.524 43.507 1.00 88.76  ? 80   GLU A CG  1 
ATOM   403  C  CD  . GLU A 1 91  ? 6.972   30.673 43.432 1.00 91.09  ? 80   GLU A CD  1 
ATOM   404  O  OE1 . GLU A 1 91  ? 7.378   31.828 43.325 1.00 98.66  ? 80   GLU A OE1 1 
ATOM   405  O  OE2 . GLU A 1 91  ? 7.743   29.674 43.453 1.00 87.65  ? 80   GLU A OE2 1 
ATOM   406  N  N   . HIS A 1 92  ? 3.003   28.943 39.609 1.00 69.85  ? 81   HIS A N   1 
ATOM   407  C  CA  . HIS A 1 92  ? 1.717   28.784 38.916 1.00 69.43  ? 81   HIS A CA  1 
ATOM   408  C  C   . HIS A 1 92  ? 1.495   27.305 38.620 1.00 69.54  ? 81   HIS A C   1 
ATOM   409  O  O   . HIS A 1 92  ? 2.308   26.449 39.016 1.00 68.60  ? 81   HIS A O   1 
ATOM   410  C  CB  . HIS A 1 92  ? 1.682   29.580 37.609 1.00 67.57  ? 81   HIS A CB  1 
ATOM   411  C  CG  . HIS A 1 92  ? 2.804   29.261 36.675 1.00 65.33  ? 81   HIS A CG  1 
ATOM   412  N  ND1 . HIS A 1 92  ? 3.952   30.017 36.620 1.00 67.02  ? 81   HIS A ND1 1 
ATOM   413  C  CD2 . HIS A 1 92  ? 2.974   28.270 35.770 1.00 63.70  ? 81   HIS A CD2 1 
ATOM   414  C  CE1 . HIS A 1 92  ? 4.780   29.513 35.724 1.00 65.09  ? 81   HIS A CE1 1 
ATOM   415  N  NE2 . HIS A 1 92  ? 4.208   28.447 35.194 1.00 63.63  ? 81   HIS A NE2 1 
ATOM   416  N  N   . ASN A 1 93  ? 0.371   27.027 37.950 1.00 70.47  ? 82   ASN A N   1 
ATOM   417  C  CA  . ASN A 1 93  ? -0.009  25.689 37.498 1.00 67.14  ? 82   ASN A CA  1 
ATOM   418  C  C   . ASN A 1 93  ? -0.381  25.736 36.031 1.00 64.01  ? 82   ASN A C   1 
ATOM   419  O  O   . ASN A 1 93  ? -1.263  25.036 35.587 1.00 66.99  ? 82   ASN A O   1 
ATOM   420  C  CB  . ASN A 1 93  ? -1.167  25.118 38.350 1.00 70.22  ? 82   ASN A CB  1 
ATOM   421  C  CG  . ASN A 1 93  ? -2.470  25.972 38.303 1.00 75.10  ? 82   ASN A CG  1 
ATOM   422  O  OD1 . ASN A 1 93  ? -2.500  27.204 38.037 1.00 78.04  ? 82   ASN A OD1 1 
ATOM   423  N  ND2 . ASN A 1 93  ? -3.561  25.306 38.597 1.00 77.59  ? 82   ASN A ND2 1 
ATOM   424  N  N   . TYR A 1 94  ? 0.279   26.594 35.285 1.00 60.83  ? 83   TYR A N   1 
ATOM   425  C  CA  . TYR A 1 94  ? 0.038   26.721 33.871 1.00 60.57  ? 83   TYR A CA  1 
ATOM   426  C  C   . TYR A 1 94  ? 0.708   25.654 33.062 1.00 58.17  ? 83   TYR A C   1 
ATOM   427  O  O   . TYR A 1 94  ? 1.809   25.220 33.408 1.00 56.60  ? 83   TYR A O   1 
ATOM   428  C  CB  . TYR A 1 94  ? 0.556   28.050 33.391 1.00 61.95  ? 83   TYR A CB  1 
ATOM   429  C  CG  . TYR A 1 94  ? -0.032  29.222 34.118 1.00 65.34  ? 83   TYR A CG  1 
ATOM   430  C  CD1 . TYR A 1 94  ? -1.377  29.240 34.501 1.00 67.69  ? 83   TYR A CD1 1 
ATOM   431  C  CD2 . TYR A 1 94  ? 0.732   30.331 34.382 1.00 65.56  ? 83   TYR A CD2 1 
ATOM   432  C  CE1 . TYR A 1 94  ? -1.919  30.329 35.121 1.00 70.42  ? 83   TYR A CE1 1 
ATOM   433  C  CE2 . TYR A 1 94  ? 0.187   31.424 35.009 1.00 69.32  ? 83   TYR A CE2 1 
ATOM   434  C  CZ  . TYR A 1 94  ? -1.133  31.405 35.369 1.00 71.55  ? 83   TYR A CZ  1 
ATOM   435  O  OH  . TYR A 1 94  ? -1.666  32.481 36.003 1.00 77.42  ? 83   TYR A OH  1 
ATOM   436  N  N   . CYS A 1 95  ? 0.067   25.273 31.955 1.00 57.93  ? 84   CYS A N   1 
ATOM   437  C  CA  . CYS A 1 95  ? 0.620   24.265 31.063 1.00 56.12  ? 84   CYS A CA  1 
ATOM   438  C  C   . CYS A 1 95  ? 1.988   24.745 30.553 1.00 53.98  ? 84   CYS A C   1 
ATOM   439  O  O   . CYS A 1 95  ? 2.132   25.918 30.218 1.00 52.73  ? 84   CYS A O   1 
ATOM   440  C  CB  . CYS A 1 95  ? -0.347  23.976 29.924 1.00 56.81  ? 84   CYS A CB  1 
ATOM   441  S  SG  . CYS A 1 95  ? -1.894  23.256 30.501 1.00 60.60  ? 84   CYS A SG  1 
ATOM   442  N  N   . ARG A 1 96  ? 2.994   23.861 30.592 1.00 52.75  ? 85   ARG A N   1 
ATOM   443  C  CA  . ARG A 1 96  ? 4.335   24.144 30.056 1.00 52.35  ? 85   ARG A CA  1 
ATOM   444  C  C   . ARG A 1 96  ? 4.965   22.903 29.432 1.00 51.77  ? 85   ARG A C   1 
ATOM   445  O  O   . ARG A 1 96  ? 4.450   21.823 29.507 1.00 51.50  ? 85   ARG A O   1 
ATOM   446  C  CB  . ARG A 1 96  ? 5.253   24.685 31.148 1.00 54.48  ? 85   ARG A CB  1 
ATOM   447  C  CG  . ARG A 1 96  ? 4.853   26.028 31.776 1.00 56.75  ? 85   ARG A CG  1 
ATOM   448  C  CD  . ARG A 1 96  ? 5.091   27.211 30.848 1.00 57.90  ? 85   ARG A CD  1 
ATOM   449  N  NE  . ARG A 1 96  ? 4.731   28.516 31.434 1.00 59.52  ? 85   ARG A NE  1 
ATOM   450  C  CZ  . ARG A 1 96  ? 3.530   29.099 31.357 1.00 59.78  ? 85   ARG A CZ  1 
ATOM   451  N  NH1 . ARG A 1 96  ? 2.506   28.533 30.708 1.00 59.12  ? 85   ARG A NH1 1 
ATOM   452  N  NH2 . ARG A 1 96  ? 3.354   30.277 31.930 1.00 61.19  ? 85   ARG A NH2 1 
ATOM   453  N  N   . ASN A 1 97  ? 6.076   23.083 28.766 1.00 55.51  ? 86   ASN A N   1 
ATOM   454  C  CA  . ASN A 1 97  ? 6.780   21.985 28.130 1.00 58.37  ? 86   ASN A CA  1 
ATOM   455  C  C   . ASN A 1 97  ? 8.275   22.231 28.334 1.00 61.16  ? 86   ASN A C   1 
ATOM   456  O  O   . ASN A 1 97  ? 8.967   22.687 27.430 1.00 65.40  ? 86   ASN A O   1 
ATOM   457  C  CB  . ASN A 1 97  ? 6.456   21.922 26.644 1.00 59.41  ? 86   ASN A CB  1 
ATOM   458  C  CG  . ASN A 1 97  ? 7.241   20.847 25.936 1.00 63.00  ? 86   ASN A CG  1 
ATOM   459  O  OD1 . ASN A 1 97  ? 7.831   19.965 26.579 1.00 62.47  ? 86   ASN A OD1 1 
ATOM   460  N  ND2 . ASN A 1 97  ? 7.267   20.909 24.603 1.00 66.94  ? 86   ASN A ND2 1 
ATOM   461  N  N   . PRO A 1 98  ? 8.767   21.975 29.543 1.00 60.87  ? 87   PRO A N   1 
ATOM   462  C  CA  . PRO A 1 98  ? 10.163  22.180 29.872 1.00 61.09  ? 87   PRO A CA  1 
ATOM   463  C  C   . PRO A 1 98  ? 11.030  20.955 29.670 1.00 61.37  ? 87   PRO A C   1 
ATOM   464  O  O   . PRO A 1 98  ? 12.208  21.016 29.976 1.00 64.35  ? 87   PRO A O   1 
ATOM   465  C  CB  . PRO A 1 98  ? 10.089  22.505 31.354 1.00 61.66  ? 87   PRO A CB  1 
ATOM   466  C  CG  . PRO A 1 98  ? 8.983   21.639 31.828 1.00 60.55  ? 87   PRO A CG  1 
ATOM   467  C  CD  . PRO A 1 98  ? 7.974   21.627 30.733 1.00 60.14  ? 87   PRO A CD  1 
ATOM   468  N  N   . ASP A 1 99  ? 10.454  19.848 29.214 1.00 60.92  ? 88   ASP A N   1 
ATOM   469  C  CA  . ASP A 1 99  ? 11.223  18.629 28.979 1.00 62.64  ? 88   ASP A CA  1 
ATOM   470  C  C   . ASP A 1 99  ? 11.419  18.410 27.501 1.00 62.27  ? 88   ASP A C   1 
ATOM   471  O  O   . ASP A 1 99  ? 11.726  17.299 27.088 1.00 62.95  ? 88   ASP A O   1 
ATOM   472  C  CB  . ASP A 1 99  ? 10.573  17.382 29.662 1.00 64.23  ? 88   ASP A CB  1 
ATOM   473  C  CG  . ASP A 1 99  ? 9.182   16.990 29.102 1.00 63.13  ? 88   ASP A CG  1 
ATOM   474  O  OD1 . ASP A 1 99  ? 8.447   17.882 28.641 1.00 60.03  ? 88   ASP A OD1 1 
ATOM   475  O  OD2 . ASP A 1 99  ? 8.810   15.785 29.205 1.00 64.28  ? 88   ASP A OD2 1 
ATOM   476  N  N   . GLY A 1 100 ? 11.275  19.486 26.722 1.00 61.17  ? 89   GLY A N   1 
ATOM   477  C  CA  . GLY A 1 100 ? 11.090  19.428 25.259 1.00 60.46  ? 89   GLY A CA  1 
ATOM   478  C  C   . GLY A 1 100 ? 10.319  18.238 24.741 1.00 59.76  ? 89   GLY A C   1 
ATOM   479  O  O   . GLY A 1 100 ? 10.824  17.538 23.904 1.00 60.11  ? 89   GLY A O   1 
ATOM   480  N  N   . ASP A 1 101 ? 9.133   17.973 25.283 1.00 60.11  ? 90   ASP A N   1 
ATOM   481  C  CA  . ASP A 1 101 ? 8.253   16.933 24.738 1.00 64.26  ? 90   ASP A CA  1 
ATOM   482  C  C   . ASP A 1 101 ? 7.577   17.523 23.501 1.00 62.40  ? 90   ASP A C   1 
ATOM   483  O  O   . ASP A 1 101 ? 7.920   18.633 23.082 1.00 61.87  ? 90   ASP A O   1 
ATOM   484  C  CB  . ASP A 1 101 ? 7.203   16.441 25.766 1.00 67.81  ? 90   ASP A CB  1 
ATOM   485  C  CG  . ASP A 1 101 ? 6.880   14.920 25.630 1.00 72.48  ? 90   ASP A CG  1 
ATOM   486  O  OD1 . ASP A 1 101 ? 6.795   14.413 24.464 1.00 71.52  ? 90   ASP A OD1 1 
ATOM   487  O  OD2 . ASP A 1 101 ? 6.722   14.257 26.708 1.00 75.85  ? 90   ASP A OD2 1 
ATOM   488  N  N   . VAL A 1 102 ? 6.641   16.788 22.910 1.00 59.76  ? 91   VAL A N   1 
ATOM   489  C  CA  . VAL A 1 102 ? 6.035   17.228 21.680 1.00 59.55  ? 91   VAL A CA  1 
ATOM   490  C  C   . VAL A 1 102 ? 4.908   18.207 21.857 1.00 57.97  ? 91   VAL A C   1 
ATOM   491  O  O   . VAL A 1 102 ? 4.342   18.666 20.885 1.00 58.21  ? 91   VAL A O   1 
ATOM   492  C  CB  . VAL A 1 102 ? 5.495   16.053 20.883 1.00 64.66  ? 91   VAL A CB  1 
ATOM   493  C  CG1 . VAL A 1 102 ? 6.616   15.060 20.617 1.00 69.69  ? 91   VAL A CG1 1 
ATOM   494  C  CG2 . VAL A 1 102 ? 4.324   15.382 21.582 1.00 65.80  ? 91   VAL A CG2 1 
ATOM   495  N  N   . SER A 1 103 ? 4.553   18.522 23.090 1.00 57.95  ? 92   SER A N   1 
ATOM   496  C  CA  . SER A 1 103 ? 3.458   19.454 23.343 1.00 57.48  ? 92   SER A CA  1 
ATOM   497  C  C   . SER A 1 103 ? 3.495   19.887 24.811 1.00 56.25  ? 92   SER A C   1 
ATOM   498  O  O   . SER A 1 103 ? 4.142   19.217 25.624 1.00 56.23  ? 92   SER A O   1 
ATOM   499  C  CB  . SER A 1 103 ? 2.140   18.773 23.010 1.00 59.51  ? 92   SER A CB  1 
ATOM   500  O  OG  . SER A 1 103 ? 1.126   19.194 23.886 1.00 61.98  ? 92   SER A OG  1 
ATOM   501  N  N   . PRO A 1 104 ? 2.817   20.998 25.157 1.00 54.04  ? 93   PRO A N   1 
ATOM   502  C  CA  . PRO A 1 104 ? 2.737   21.358 26.562 1.00 53.08  ? 93   PRO A CA  1 
ATOM   503  C  C   . PRO A 1 104 ? 1.910   20.379 27.384 1.00 54.48  ? 93   PRO A C   1 
ATOM   504  O  O   . PRO A 1 104 ? 1.084   19.637 26.852 1.00 54.15  ? 93   PRO A O   1 
ATOM   505  C  CB  . PRO A 1 104 ? 2.077   22.727 26.540 1.00 53.26  ? 93   PRO A CB  1 
ATOM   506  C  CG  . PRO A 1 104 ? 2.276   23.223 25.176 1.00 53.45  ? 93   PRO A CG  1 
ATOM   507  C  CD  . PRO A 1 104 ? 2.191   22.016 24.308 1.00 53.84  ? 93   PRO A CD  1 
ATOM   508  N  N   . TRP A 1 105 ? 2.160   20.392 28.686 1.00 55.77  ? 94   TRP A N   1 
ATOM   509  C  CA  . TRP A 1 105 ? 1.585   19.434 29.616 1.00 57.39  ? 94   TRP A CA  1 
ATOM   510  C  C   . TRP A 1 105 ? 1.586   19.961 31.042 1.00 56.86  ? 94   TRP A C   1 
ATOM   511  O  O   . TRP A 1 105 ? 2.061   21.064 31.322 1.00 55.43  ? 94   TRP A O   1 
ATOM   512  C  CB  . TRP A 1 105 ? 2.369   18.139 29.549 1.00 57.75  ? 94   TRP A CB  1 
ATOM   513  C  CG  . TRP A 1 105 ? 3.836   18.254 29.830 1.00 57.68  ? 94   TRP A CG  1 
ATOM   514  C  CD1 . TRP A 1 105 ? 4.797   18.614 28.952 1.00 58.30  ? 94   TRP A CD1 1 
ATOM   515  C  CD2 . TRP A 1 105 ? 4.515   17.936 31.057 1.00 59.43  ? 94   TRP A CD2 1 
ATOM   516  N  NE1 . TRP A 1 105 ? 6.036   18.551 29.543 1.00 60.25  ? 94   TRP A NE1 1 
ATOM   517  C  CE2 . TRP A 1 105 ? 5.886   18.146 30.839 1.00 60.05  ? 94   TRP A CE2 1 
ATOM   518  C  CE3 . TRP A 1 105 ? 4.098   17.491 32.315 1.00 59.42  ? 94   TRP A CE3 1 
ATOM   519  C  CZ2 . TRP A 1 105 ? 6.833   17.955 31.836 1.00 60.37  ? 94   TRP A CZ2 1 
ATOM   520  C  CZ3 . TRP A 1 105 ? 5.040   17.278 33.296 1.00 59.53  ? 94   TRP A CZ3 1 
ATOM   521  C  CH2 . TRP A 1 105 ? 6.385   17.525 33.064 1.00 60.74  ? 94   TRP A CH2 1 
ATOM   522  N  N   . CYS A 1 106 ? 1.017   19.181 31.942 1.00 57.73  ? 95   CYS A N   1 
ATOM   523  C  CA  . CYS A 1 106 ? 1.158   19.491 33.333 1.00 59.93  ? 95   CYS A CA  1 
ATOM   524  C  C   . CYS A 1 106 ? 0.899   18.286 34.187 1.00 64.59  ? 95   CYS A C   1 
ATOM   525  O  O   . CYS A 1 106 ? 0.473   17.243 33.684 1.00 66.08  ? 95   CYS A O   1 
ATOM   526  C  CB  . CYS A 1 106 ? 0.231   20.622 33.730 1.00 61.23  ? 95   CYS A CB  1 
ATOM   527  S  SG  . CYS A 1 106 ? -1.511  20.203 33.844 1.00 64.83  ? 95   CYS A SG  1 
ATOM   528  N  N   . TYR A 1 107 ? 1.166   18.426 35.486 1.00 67.34  ? 96   TYR A N   1 
ATOM   529  C  CA  . TYR A 1 107 ? 1.019   17.298 36.384 1.00 69.40  ? 96   TYR A CA  1 
ATOM   530  C  C   . TYR A 1 107 ? -0.374  17.300 36.927 1.00 72.40  ? 96   TYR A C   1 
ATOM   531  O  O   . TYR A 1 107 ? -0.795  18.227 37.579 1.00 73.78  ? 96   TYR A O   1 
ATOM   532  C  CB  . TYR A 1 107 ? 2.008   17.422 37.517 1.00 69.38  ? 96   TYR A CB  1 
ATOM   533  C  CG  . TYR A 1 107 ? 3.425   17.022 37.167 1.00 65.99  ? 96   TYR A CG  1 
ATOM   534  C  CD1 . TYR A 1 107 ? 3.727   15.713 36.795 1.00 66.90  ? 96   TYR A CD1 1 
ATOM   535  C  CD2 . TYR A 1 107 ? 4.477   17.930 37.260 1.00 63.22  ? 96   TYR A CD2 1 
ATOM   536  C  CE1 . TYR A 1 107 ? 5.042   15.328 36.489 1.00 66.64  ? 96   TYR A CE1 1 
ATOM   537  C  CE2 . TYR A 1 107 ? 5.791   17.555 36.957 1.00 62.61  ? 96   TYR A CE2 1 
ATOM   538  C  CZ  . TYR A 1 107 ? 6.082   16.246 36.573 1.00 64.04  ? 96   TYR A CZ  1 
ATOM   539  O  OH  . TYR A 1 107 ? 7.365   15.799 36.256 1.00 62.86  ? 96   TYR A OH  1 
ATOM   540  N  N   . VAL A 1 108 ? -1.103  16.259 36.659 1.00 77.33  ? 97   VAL A N   1 
ATOM   541  C  CA  . VAL A 1 108 ? -2.448  16.197 37.157 1.00 86.65  ? 97   VAL A CA  1 
ATOM   542  C  C   . VAL A 1 108 ? -2.545  15.839 38.634 1.00 87.67  ? 97   VAL A C   1 
ATOM   543  O  O   . VAL A 1 108 ? -3.391  16.388 39.319 1.00 94.77  ? 97   VAL A O   1 
ATOM   544  C  CB  . VAL A 1 108 ? -3.328  15.202 36.367 1.00 96.93  ? 97   VAL A CB  1 
ATOM   545  C  CG1 . VAL A 1 108 ? -3.496  15.675 34.920 1.00 98.86  ? 97   VAL A CG1 1 
ATOM   546  C  CG2 . VAL A 1 108 ? -2.798  13.765 36.439 1.00 100.71 ? 97   VAL A CG2 1 
ATOM   547  N  N   . ALA A 1 109 ? -1.714  14.926 39.122 1.00 84.32  ? 98   ALA A N   1 
ATOM   548  C  CA  . ALA A 1 109 ? -1.959  14.235 40.425 1.00 87.52  ? 98   ALA A CA  1 
ATOM   549  C  C   . ALA A 1 109 ? -2.857  13.039 40.303 1.00 91.43  ? 98   ALA A C   1 
ATOM   550  O  O   . ALA A 1 109 ? -4.027  13.143 39.931 1.00 89.07  ? 98   ALA A O   1 
ATOM   551  C  CB  . ALA A 1 109 ? -2.513  15.126 41.529 1.00 88.32  ? 98   ALA A CB  1 
ATOM   552  N  N   . GLU A 1 110 ? -2.281  11.924 40.740 1.00 95.55  ? 99   GLU A N   1 
ATOM   553  C  CA  . GLU A 1 110 ? -2.648  10.598 40.309 1.00 101.74 ? 99   GLU A CA  1 
ATOM   554  C  C   . GLU A 1 110 ? -3.905  10.197 41.020 1.00 108.91 ? 99   GLU A C   1 
ATOM   555  O  O   . GLU A 1 110 ? -4.066  10.524 42.181 1.00 108.56 ? 99   GLU A O   1 
ATOM   556  C  CB  . GLU A 1 110 ? -1.485  9.644  40.594 1.00 103.07 ? 99   GLU A CB  1 
ATOM   557  C  CG  . GLU A 1 110 ? -1.845  8.166  40.553 1.00 113.98 ? 99   GLU A CG  1 
ATOM   558  C  CD  . GLU A 1 110 ? -0.623  7.262  40.622 1.00 118.35 ? 99   GLU A CD  1 
ATOM   559  O  OE1 . GLU A 1 110 ? 0.514   7.801  40.399 1.00 116.91 ? 99   GLU A OE1 1 
ATOM   560  O  OE2 . GLU A 1 110 ? -0.815  6.035  40.912 1.00 121.13 ? 99   GLU A OE2 1 
ATOM   561  N  N   . HIS A 1 111 ? -4.809  9.513  40.333 1.00 117.23 ? 100  HIS A N   1 
ATOM   562  C  CA  . HIS A 1 111 ? -6.079  9.169  40.962 1.00 127.43 ? 100  HIS A CA  1 
ATOM   563  C  C   . HIS A 1 111 ? -6.371  7.670  41.028 1.00 134.25 ? 100  HIS A C   1 
ATOM   564  O  O   . HIS A 1 111 ? -7.537  7.271  41.091 1.00 144.65 ? 100  HIS A O   1 
ATOM   565  C  CB  . HIS A 1 111 ? -7.234  10.021 40.365 1.00 131.23 ? 100  HIS A CB  1 
ATOM   566  C  CG  . HIS A 1 111 ? -7.533  11.254 41.173 1.00 132.23 ? 100  HIS A CG  1 
ATOM   567  N  ND1 . HIS A 1 111 ? -8.090  11.206 42.439 1.00 136.56 ? 100  HIS A ND1 1 
ATOM   568  C  CD2 . HIS A 1 111 ? -7.309  12.564 40.915 1.00 128.70 ? 100  HIS A CD2 1 
ATOM   569  C  CE1 . HIS A 1 111 ? -8.214  12.432 42.915 1.00 133.88 ? 100  HIS A CE1 1 
ATOM   570  N  NE2 . HIS A 1 111 ? -7.754  13.275 42.008 1.00 129.69 ? 100  HIS A NE2 1 
ATOM   571  N  N   . GLU A 1 112 ? -5.321  6.846  41.109 1.00 130.59 ? 101  GLU A N   1 
ATOM   572  C  CA  . GLU A 1 112 ? -5.450  5.366  41.054 1.00 134.40 ? 101  GLU A CA  1 
ATOM   573  C  C   . GLU A 1 112 ? -5.430  4.859  39.603 1.00 133.20 ? 101  GLU A C   1 
ATOM   574  O  O   . GLU A 1 112 ? -5.202  3.676  39.358 1.00 135.66 ? 101  GLU A O   1 
ATOM   575  C  CB  . GLU A 1 112 ? -6.699  4.839  41.827 1.00 140.70 ? 101  GLU A CB  1 
ATOM   576  C  CG  . GLU A 1 112 ? -6.923  3.342  41.801 1.00 147.48 ? 101  GLU A CG  1 
ATOM   577  C  CD  . GLU A 1 112 ? -5.707  2.548  42.218 1.00 147.11 ? 101  GLU A CD  1 
ATOM   578  O  OE1 . GLU A 1 112 ? -4.995  2.975  43.149 1.00 144.86 ? 101  GLU A OE1 1 
ATOM   579  O  OE2 . GLU A 1 112 ? -5.463  1.491  41.619 1.00 150.02 ? 101  GLU A OE2 1 
ATOM   580  N  N   . ASP A 1 113 ? -5.756  5.765  38.673 1.00 128.74 ? 102  ASP A N   1 
ATOM   581  C  CA  . ASP A 1 113 ? -5.354  5.758  37.272 1.00 123.48 ? 102  ASP A CA  1 
ATOM   582  C  C   . ASP A 1 113 ? -3.964  5.197  37.063 1.00 118.98 ? 102  ASP A C   1 
ATOM   583  O  O   . ASP A 1 113 ? -3.768  4.405  36.169 1.00 117.87 ? 102  ASP A O   1 
ATOM   584  C  CB  . ASP A 1 113 ? -5.359  7.225  36.754 1.00 117.23 ? 102  ASP A CB  1 
ATOM   585  C  CG  . ASP A 1 113 ? -6.513  7.548  35.843 1.00 118.19 ? 102  ASP A CG  1 
ATOM   586  O  OD1 . ASP A 1 113 ? -7.315  6.653  35.519 1.00 122.07 ? 102  ASP A OD1 1 
ATOM   587  O  OD2 . ASP A 1 113 ? -6.590  8.730  35.436 1.00 113.66 ? 102  ASP A OD2 1 
ATOM   588  N  N   . GLY A 1 114 ? -3.012  5.618  37.892 1.00 114.66 ? 103  GLY A N   1 
ATOM   589  C  CA  . GLY A 1 114 ? -1.610  5.383  37.633 1.00 109.58 ? 103  GLY A CA  1 
ATOM   590  C  C   . GLY A 1 114 ? -1.031  6.500  36.786 1.00 101.78 ? 103  GLY A C   1 
ATOM   591  O  O   . GLY A 1 114 ? 0.106   6.387  36.407 1.00 97.12  ? 103  GLY A O   1 
ATOM   592  N  N   . VAL A 1 115 ? -1.775  7.586  36.545 1.00 99.78  ? 104  VAL A N   1 
ATOM   593  C  CA  . VAL A 1 115 ? -1.371  8.614  35.589 1.00 97.29  ? 104  VAL A CA  1 
ATOM   594  C  C   . VAL A 1 115 ? -1.026  9.904  36.318 1.00 93.69  ? 104  VAL A C   1 
ATOM   595  O  O   . VAL A 1 115 ? -1.941  10.599 36.730 1.00 97.42  ? 104  VAL A O   1 
ATOM   596  C  CB  . VAL A 1 115 ? -2.500  8.907  34.562 1.00 99.51  ? 104  VAL A CB  1 
ATOM   597  C  CG1 . VAL A 1 115 ? -2.115  10.035 33.574 1.00 95.84  ? 104  VAL A CG1 1 
ATOM   598  C  CG2 . VAL A 1 115 ? -2.856  7.635  33.810 1.00 104.49 ? 104  VAL A CG2 1 
ATOM   599  N  N   . TYR A 1 116 ? 0.263   10.252 36.438 1.00 87.97  ? 105  TYR A N   1 
ATOM   600  C  CA  . TYR A 1 116 ? 0.642   11.486 37.180 1.00 82.01  ? 105  TYR A CA  1 
ATOM   601  C  C   . TYR A 1 116 ? 0.508   12.809 36.416 1.00 76.28  ? 105  TYR A C   1 
ATOM   602  O  O   . TYR A 1 116 ? 0.208   13.856 37.025 1.00 75.77  ? 105  TYR A O   1 
ATOM   603  C  CB  . TYR A 1 116 ? 2.026   11.373 37.854 1.00 81.08  ? 105  TYR A CB  1 
ATOM   604  C  CG  . TYR A 1 116 ? 3.238   10.913 37.046 1.00 78.28  ? 105  TYR A CG  1 
ATOM   605  C  CD1 . TYR A 1 116 ? 4.027   11.823 36.369 1.00 74.96  ? 105  TYR A CD1 1 
ATOM   606  C  CD2 . TYR A 1 116 ? 3.669   9.588  37.078 1.00 79.79  ? 105  TYR A CD2 1 
ATOM   607  C  CE1 . TYR A 1 116 ? 5.177   11.413 35.677 1.00 75.13  ? 105  TYR A CE1 1 
ATOM   608  C  CE2 . TYR A 1 116 ? 4.808   9.169  36.384 1.00 79.22  ? 105  TYR A CE2 1 
ATOM   609  C  CZ  . TYR A 1 116 ? 5.560   10.082 35.669 1.00 76.48  ? 105  TYR A CZ  1 
ATOM   610  O  OH  . TYR A 1 116 ? 6.696   9.706  34.964 1.00 73.77  ? 105  TYR A OH  1 
ATOM   611  N  N   . TRP A 1 117 ? 0.700   12.738 35.096 1.00 72.90  ? 106  TRP A N   1 
ATOM   612  C  CA  . TRP A 1 117 ? 0.700   13.895 34.178 1.00 67.01  ? 106  TRP A CA  1 
ATOM   613  C  C   . TRP A 1 117 ? -0.093  13.651 32.893 1.00 68.18  ? 106  TRP A C   1 
ATOM   614  O  O   . TRP A 1 117 ? -0.256  12.526 32.475 1.00 70.82  ? 106  TRP A O   1 
ATOM   615  C  CB  . TRP A 1 117 ? 2.121   14.206 33.777 1.00 62.72  ? 106  TRP A CB  1 
ATOM   616  C  CG  . TRP A 1 117 ? 2.714   13.201 32.817 1.00 62.37  ? 106  TRP A CG  1 
ATOM   617  C  CD1 . TRP A 1 117 ? 3.305   12.039 33.123 1.00 65.33  ? 106  TRP A CD1 1 
ATOM   618  C  CD2 . TRP A 1 117 ? 2.757   13.300 31.420 1.00 61.51  ? 106  TRP A CD2 1 
ATOM   619  N  NE1 . TRP A 1 117 ? 3.705   11.388 32.003 1.00 65.73  ? 106  TRP A NE1 1 
ATOM   620  C  CE2 . TRP A 1 117 ? 3.392   12.154 30.934 1.00 62.88  ? 106  TRP A CE2 1 
ATOM   621  C  CE3 . TRP A 1 117 ? 2.302   14.240 30.521 1.00 62.31  ? 106  TRP A CE3 1 
ATOM   622  C  CZ2 . TRP A 1 117 ? 3.614   11.926 29.600 1.00 63.91  ? 106  TRP A CZ2 1 
ATOM   623  C  CZ3 . TRP A 1 117 ? 2.542   14.034 29.178 1.00 62.22  ? 106  TRP A CZ3 1 
ATOM   624  C  CH2 . TRP A 1 117 ? 3.187   12.869 28.732 1.00 63.73  ? 106  TRP A CH2 1 
ATOM   625  N  N   . LYS A 1 118 ? -0.534  14.733 32.257 1.00 67.47  ? 107  LYS A N   1 
ATOM   626  C  CA  . LYS A 1 118 ? -1.169  14.704 30.945 1.00 69.51  ? 107  LYS A CA  1 
ATOM   627  C  C   . LYS A 1 118 ? -0.750  15.881 30.061 1.00 68.01  ? 107  LYS A C   1 
ATOM   628  O  O   . LYS A 1 118 ? -0.423  16.968 30.564 1.00 65.15  ? 107  LYS A O   1 
ATOM   629  C  CB  . LYS A 1 118 ? -2.687  14.673 31.098 1.00 73.77  ? 107  LYS A CB  1 
ATOM   630  C  CG  . LYS A 1 118 ? -3.261  13.279 30.823 1.00 81.53  ? 107  LYS A CG  1 
ATOM   631  C  CD  . LYS A 1 118 ? -4.579  12.962 31.534 1.00 87.95  ? 107  LYS A CD  1 
ATOM   632  C  CE  . LYS A 1 118 ? -5.686  14.010 31.299 1.00 90.20  ? 107  LYS A CE  1 
ATOM   633  N  NZ  . LYS A 1 118 ? -6.658  13.671 30.222 1.00 93.22  ? 107  LYS A NZ  1 
ATOM   634  N  N   . TYR A 1 119 ? -0.751  15.657 28.740 1.00 69.59  ? 108  TYR A N   1 
ATOM   635  C  CA  . TYR A 1 119 ? -0.578  16.749 27.757 1.00 66.57  ? 108  TYR A CA  1 
ATOM   636  C  C   . TYR A 1 119 ? -1.754  17.706 27.841 1.00 66.31  ? 108  TYR A C   1 
ATOM   637  O  O   . TYR A 1 119 ? -2.842  17.286 28.181 1.00 69.10  ? 108  TYR A O   1 
ATOM   638  C  CB  . TYR A 1 119 ? -0.512  16.191 26.340 1.00 67.69  ? 108  TYR A CB  1 
ATOM   639  C  CG  . TYR A 1 119 ? 0.762   15.424 25.964 1.00 66.02  ? 108  TYR A CG  1 
ATOM   640  C  CD1 . TYR A 1 119 ? 1.972   16.087 25.820 1.00 62.59  ? 108  TYR A CD1 1 
ATOM   641  C  CD2 . TYR A 1 119 ? 0.735   14.053 25.679 1.00 67.21  ? 108  TYR A CD2 1 
ATOM   642  C  CE1 . TYR A 1 119 ? 3.124   15.406 25.469 1.00 61.57  ? 108  TYR A CE1 1 
ATOM   643  C  CE2 . TYR A 1 119 ? 1.882   13.381 25.305 1.00 65.84  ? 108  TYR A CE2 1 
ATOM   644  C  CZ  . TYR A 1 119 ? 3.066   14.071 25.205 1.00 63.01  ? 108  TYR A CZ  1 
ATOM   645  O  OH  . TYR A 1 119 ? 4.222   13.464 24.816 1.00 65.14  ? 108  TYR A OH  1 
ATOM   646  N  N   . CYS A 1 120 ? -1.524  18.978 27.551 1.00 64.07  ? 109  CYS A N   1 
ATOM   647  C  CA  . CYS A 1 120 ? -2.571  19.980 27.585 1.00 66.20  ? 109  CYS A CA  1 
ATOM   648  C  C   . CYS A 1 120 ? -3.007  20.188 26.161 1.00 69.06  ? 109  CYS A C   1 
ATOM   649  O  O   . CYS A 1 120 ? -2.191  20.182 25.280 1.00 66.06  ? 109  CYS A O   1 
ATOM   650  C  CB  . CYS A 1 120 ? -2.060  21.293 28.144 1.00 63.57  ? 109  CYS A CB  1 
ATOM   651  S  SG  . CYS A 1 120 ? -1.818  21.265 29.925 1.00 62.98  ? 109  CYS A SG  1 
ATOM   652  N  N   . GLU A 1 121 ? -4.299  20.350 25.941 1.00 76.78  ? 110  GLU A N   1 
ATOM   653  C  CA  . GLU A 1 121 ? -4.852  20.581 24.618 1.00 81.99  ? 110  GLU A CA  1 
ATOM   654  C  C   . GLU A 1 121 ? -5.183  22.096 24.587 1.00 78.45  ? 110  GLU A C   1 
ATOM   655  O  O   . GLU A 1 121 ? -6.197  22.532 25.150 1.00 82.02  ? 110  GLU A O   1 
ATOM   656  C  CB  . GLU A 1 121 ? -6.084  19.661 24.418 1.00 93.51  ? 110  GLU A CB  1 
ATOM   657  C  CG  . GLU A 1 121 ? -6.233  19.061 23.018 1.00 103.86 ? 110  GLU A CG  1 
ATOM   658  C  CD  . GLU A 1 121 ? -6.653  20.073 21.938 1.00 115.05 ? 110  GLU A CD  1 
ATOM   659  O  OE1 . GLU A 1 121 ? -7.269  21.113 22.281 1.00 126.75 ? 110  GLU A OE1 1 
ATOM   660  O  OE2 . GLU A 1 121 ? -6.380  19.839 20.730 1.00 119.33 ? 110  GLU A OE2 1 
ATOM   661  N  N   . ILE A 1 122 ? -4.306  22.895 23.973 1.00 71.50  ? 111  ILE A N   1 
ATOM   662  C  CA  . ILE A 1 122 ? -4.395  24.364 24.024 1.00 69.57  ? 111  ILE A CA  1 
ATOM   663  C  C   . ILE A 1 122 ? -4.638  24.924 22.642 1.00 69.05  ? 111  ILE A C   1 
ATOM   664  O  O   . ILE A 1 122 ? -3.706  25.073 21.858 1.00 66.61  ? 111  ILE A O   1 
ATOM   665  C  CB  . ILE A 1 122 ? -3.110  25.012 24.563 1.00 67.99  ? 111  ILE A CB  1 
ATOM   666  C  CG1 . ILE A 1 122 ? -2.620  24.287 25.830 1.00 69.26  ? 111  ILE A CG1 1 
ATOM   667  C  CG2 . ILE A 1 122 ? -3.303  26.517 24.815 1.00 68.37  ? 111  ILE A CG2 1 
ATOM   668  C  CD1 . ILE A 1 122 ? -1.309  24.841 26.378 1.00 67.09  ? 111  ILE A CD1 1 
ATOM   669  N  N   . PRO A 1 123 ? -5.889  25.269 22.339 1.00 71.07  ? 112  PRO A N   1 
ATOM   670  C  CA  . PRO A 1 123 ? -6.183  25.657 20.988 1.00 71.31  ? 112  PRO A CA  1 
ATOM   671  C  C   . PRO A 1 123 ? -5.444  26.942 20.544 1.00 68.51  ? 112  PRO A C   1 
ATOM   672  O  O   . PRO A 1 123 ? -5.086  27.042 19.389 1.00 68.31  ? 112  PRO A O   1 
ATOM   673  C  CB  . PRO A 1 123 ? -7.702  25.786 21.000 1.00 75.57  ? 112  PRO A CB  1 
ATOM   674  C  CG  . PRO A 1 123 ? -7.980  26.276 22.367 1.00 77.09  ? 112  PRO A CG  1 
ATOM   675  C  CD  . PRO A 1 123 ? -7.017  25.537 23.235 1.00 74.54  ? 112  PRO A CD  1 
ATOM   676  N  N   . ALA A 1 124 ? -5.150  27.878 21.437 1.00 67.54  ? 113  ALA A N   1 
ATOM   677  C  CA  . ALA A 1 124 ? -4.418  29.101 21.031 1.00 67.64  ? 113  ALA A CA  1 
ATOM   678  C  C   . ALA A 1 124 ? -2.881  28.909 20.774 1.00 64.82  ? 113  ALA A C   1 
ATOM   679  O  O   . ALA A 1 124 ? -2.171  29.820 20.281 1.00 65.30  ? 113  ALA A O   1 
ATOM   680  C  CB  . ALA A 1 124 ? -4.680  30.207 22.050 1.00 69.02  ? 113  ALA A CB  1 
ATOM   681  N  N   . CYS A 1 125 ? -2.387  27.716 21.092 1.00 62.63  ? 114  CYS A N   1 
ATOM   682  C  CA  . CYS A 1 125 ? -0.973  27.405 20.997 1.00 61.22  ? 114  CYS A CA  1 
ATOM   683  C  C   . CYS A 1 125 ? -0.759  26.578 19.755 1.00 61.26  ? 114  CYS A C   1 
ATOM   684  O  O   . CYS A 1 125 ? -0.617  25.355 19.822 1.00 61.21  ? 114  CYS A O   1 
ATOM   685  C  CB  . CYS A 1 125 ? -0.523  26.607 22.231 1.00 60.84  ? 114  CYS A CB  1 
ATOM   686  S  SG  . CYS A 1 125 ? 1.152   25.923 22.175 1.00 57.42  ? 114  CYS A SG  1 
ATOM   687  N  N   . GLN A 1 126 ? -0.716  27.228 18.608 1.00 62.45  ? 115  GLN A N   1 
ATOM   688  C  CA  . GLN A 1 126 ? -0.632  26.471 17.374 1.00 62.09  ? 115  GLN A CA  1 
ATOM   689  C  C   . GLN A 1 126 ? 0.144   27.298 16.392 1.00 61.63  ? 115  GLN A C   1 
ATOM   690  O  O   . GLN A 1 126 ? -0.375  28.308 15.887 1.00 62.01  ? 115  GLN A O   1 
ATOM   691  C  CB  . GLN A 1 126 ? -2.043  26.153 16.870 1.00 64.70  ? 115  GLN A CB  1 
ATOM   692  C  CG  . GLN A 1 126 ? -2.091  25.086 15.782 1.00 66.42  ? 115  GLN A CG  1 
ATOM   693  C  CD  . GLN A 1 126 ? -3.465  24.907 15.144 1.00 70.23  ? 115  GLN A CD  1 
ATOM   694  O  OE1 . GLN A 1 126 ? -3.660  24.022 14.310 1.00 73.85  ? 115  GLN A OE1 1 
ATOM   695  N  NE2 . GLN A 1 126 ? -4.414  25.758 15.506 1.00 72.40  ? 115  GLN A NE2 1 
ATOM   696  N  N   . MET A 1 127 ? 1.386   26.882 16.127 1.00 59.17  ? 116  MET A N   1 
ATOM   697  C  CA  . MET A 1 127 ? 2.299   27.773 15.418 1.00 58.76  ? 116  MET A CA  1 
ATOM   698  C  C   . MET A 1 127 ? 1.718   28.143 14.068 1.00 59.20  ? 116  MET A C   1 
ATOM   699  O  O   . MET A 1 127 ? 1.128   27.279 13.397 1.00 60.53  ? 116  MET A O   1 
ATOM   700  C  CB  . MET A 1 127 ? 3.681   27.170 15.266 1.00 57.91  ? 116  MET A CB  1 
ATOM   701  C  CG  . MET A 1 127 ? 3.735   25.938 14.400 1.00 58.90  ? 116  MET A CG  1 
ATOM   702  S  SD  . MET A 1 127 ? 5.425   25.460 13.977 1.00 58.85  ? 116  MET A SD  1 
ATOM   703  C  CE  . MET A 1 127 ? 5.665   26.269 12.399 1.00 60.53  ? 116  MET A CE  1 
ATOM   704  N  N   . PRO A 1 128 ? 1.843   29.422 13.674 1.00 59.23  ? 117  PRO A N   1 
ATOM   705  C  CA  . PRO A 1 128 ? 1.405   29.796 12.332 1.00 61.09  ? 117  PRO A CA  1 
ATOM   706  C  C   . PRO A 1 128 ? 2.054   28.900 11.321 1.00 61.12  ? 117  PRO A C   1 
ATOM   707  O  O   . PRO A 1 128 ? 3.251   28.636 11.416 1.00 58.59  ? 117  PRO A O   1 
ATOM   708  C  CB  . PRO A 1 128 ? 1.892   31.221 12.189 1.00 62.36  ? 117  PRO A CB  1 
ATOM   709  C  CG  . PRO A 1 128 ? 1.772   31.751 13.568 1.00 61.82  ? 117  PRO A CG  1 
ATOM   710  C  CD  . PRO A 1 128 ? 2.177   30.612 14.470 1.00 59.41  ? 117  PRO A CD  1 
ATOM   711  N  N   . GLY A 1 129 ? 1.236   28.372 10.424 1.00 52.40  ? 118  GLY A N   1 
ATOM   712  C  CA  . GLY A 1 129 ? 1.674   27.359 9.482  1.00 52.15  ? 118  GLY A CA  1 
ATOM   713  C  C   . GLY A 1 129 ? 1.242   25.947 9.834  1.00 52.35  ? 118  GLY A C   1 
ATOM   714  O  O   . GLY A 1 129 ? 1.149   25.087 8.934  1.00 50.93  ? 118  GLY A O   1 
ATOM   715  N  N   . ASN A 1 130 ? 1.004   25.677 11.122 1.00 54.39  ? 119  ASN A N   1 
ATOM   716  C  CA  . ASN A 1 130 ? 0.399   24.406 11.511 1.00 54.96  ? 119  ASN A CA  1 
ATOM   717  C  C   . ASN A 1 130 ? -1.096  24.531 11.249 1.00 55.85  ? 119  ASN A C   1 
ATOM   718  O  O   . ASN A 1 130 ? -1.760  25.295 11.935 1.00 57.28  ? 119  ASN A O   1 
ATOM   719  C  CB  . ASN A 1 130 ? 0.661   24.120 12.987 1.00 56.37  ? 119  ASN A CB  1 
ATOM   720  C  CG  . ASN A 1 130 ? 0.098   22.775 13.459 1.00 56.89  ? 119  ASN A CG  1 
ATOM   721  O  OD1 . ASN A 1 130 ? -0.843  22.216 12.907 1.00 57.95  ? 119  ASN A OD1 1 
ATOM   722  N  ND2 . ASN A 1 130 ? 0.669   22.272 14.532 1.00 59.09  ? 119  ASN A ND2 1 
ATOM   723  N  N   . LEU A 1 131 ? -1.615  23.764 10.296 1.00 54.57  ? 120  LEU A N   1 
ATOM   724  C  CA  . LEU A 1 131 ? -3.010  23.881 9.878  1.00 58.83  ? 120  LEU A CA  1 
ATOM   725  C  C   . LEU A 1 131 ? -4.019  23.042 10.649 1.00 59.02  ? 120  LEU A C   1 
ATOM   726  O  O   . LEU A 1 131 ? -5.234  23.142 10.407 1.00 58.53  ? 120  LEU A O   1 
ATOM   727  C  CB  . LEU A 1 131 ? -3.113  23.525 8.408  1.00 61.77  ? 120  LEU A CB  1 
ATOM   728  C  CG  . LEU A 1 131 ? -2.194  24.380 7.533  1.00 64.51  ? 120  LEU A CG  1 
ATOM   729  C  CD1 . LEU A 1 131 ? -2.332  23.997 6.060  1.00 65.77  ? 120  LEU A CD1 1 
ATOM   730  C  CD2 . LEU A 1 131 ? -2.481  25.868 7.755  1.00 66.15  ? 120  LEU A CD2 1 
ATOM   731  N  N   . GLY A 1 132 ? -3.503  22.204 11.545 1.00 58.61  ? 121  GLY A N   1 
ATOM   732  C  CA  . GLY A 1 132 ? -4.314  21.370 12.410 1.00 59.48  ? 121  GLY A CA  1 
ATOM   733  C  C   . GLY A 1 132 ? -4.063  19.889 12.271 1.00 56.03  ? 121  GLY A C   1 
ATOM   734  O  O   . GLY A 1 132 ? -3.194  19.436 11.548 1.00 50.39  ? 121  GLY A O   1 
ATOM   735  N  N   . CYS A 1 133 ? -4.883  19.148 12.985 1.00 58.53  ? 122  CYS A N   1 
ATOM   736  C  CA  . CYS A 1 133 ? -4.724  17.730 13.108 1.00 60.06  ? 122  CYS A CA  1 
ATOM   737  C  C   . CYS A 1 133 ? -5.977  17.154 12.506 1.00 59.48  ? 122  CYS A C   1 
ATOM   738  O  O   . CYS A 1 133 ? -7.060  17.535 12.880 1.00 63.52  ? 122  CYS A O   1 
ATOM   739  C  CB  . CYS A 1 133 ? -4.601  17.369 14.595 1.00 62.84  ? 122  CYS A CB  1 
ATOM   740  S  SG  . CYS A 1 133 ? -4.369  15.613 14.940 1.00 65.51  ? 122  CYS A SG  1 
ATOM   741  N  N   . TYR A 1 134 ? -5.854  16.254 11.557 1.00 56.30  ? 123  TYR A N   1 
ATOM   742  C  CA  . TYR A 1 134 ? -7.025  15.774 10.896 1.00 56.79  ? 123  TYR A CA  1 
ATOM   743  C  C   . TYR A 1 134 ? -7.023  14.297 10.843 1.00 57.34  ? 123  TYR A C   1 
ATOM   744  O  O   . TYR A 1 134 ? -5.981  13.678 10.978 1.00 55.47  ? 123  TYR A O   1 
ATOM   745  C  CB  . TYR A 1 134 ? -7.066  16.347 9.496  1.00 56.48  ? 123  TYR A CB  1 
ATOM   746  C  CG  . TYR A 1 134 ? -7.236  17.828 9.554  1.00 56.35  ? 123  TYR A CG  1 
ATOM   747  C  CD1 . TYR A 1 134 ? -6.135  18.645 9.681  1.00 56.05  ? 123  TYR A CD1 1 
ATOM   748  C  CD2 . TYR A 1 134 ? -8.506  18.418 9.545  1.00 57.31  ? 123  TYR A CD2 1 
ATOM   749  C  CE1 . TYR A 1 134 ? -6.290  20.009 9.764  1.00 56.56  ? 123  TYR A CE1 1 
ATOM   750  C  CE2 . TYR A 1 134 ? -8.666  19.779 9.629  1.00 56.46  ? 123  TYR A CE2 1 
ATOM   751  C  CZ  . TYR A 1 134 ? -7.546  20.548 9.745  1.00 56.60  ? 123  TYR A CZ  1 
ATOM   752  O  OH  . TYR A 1 134 ? -7.623  21.874 9.841  1.00 60.01  ? 123  TYR A OH  1 
ATOM   753  N  N   . LYS A 1 135 ? -8.216  13.753 10.633 1.00 60.00  ? 124  LYS A N   1 
ATOM   754  C  CA  . LYS A 1 135 ? -8.424  12.333 10.473 1.00 61.96  ? 124  LYS A CA  1 
ATOM   755  C  C   . LYS A 1 135 ? -8.135  11.879 9.024  1.00 63.55  ? 124  LYS A C   1 
ATOM   756  O  O   . LYS A 1 135 ? -8.507  12.586 8.061  1.00 64.89  ? 124  LYS A O   1 
ATOM   757  C  CB  . LYS A 1 135 ? -9.840  11.999 10.860 1.00 64.38  ? 124  LYS A CB  1 
ATOM   758  C  CG  . LYS A 1 135 ? -10.231 12.481 12.237 1.00 65.41  ? 124  LYS A CG  1 
ATOM   759  C  CD  . LYS A 1 135 ? -11.528 11.796 12.720 1.00 71.05  ? 124  LYS A CD  1 
ATOM   760  C  CE  . LYS A 1 135 ? -12.112 12.387 14.014 1.00 71.45  ? 124  LYS A CE  1 
ATOM   761  N  NZ  . LYS A 1 135 ? -13.299 11.633 14.478 1.00 75.72  ? 124  LYS A NZ  1 
ATOM   762  N  N   . ASP A 1 136 ? -7.440  10.733 8.899  1.00 65.13  ? 125  ASP A N   1 
ATOM   763  C  CA  . ASP A 1 136 ? -7.099  10.084 7.642  1.00 67.48  ? 125  ASP A CA  1 
ATOM   764  C  C   . ASP A 1 136 ? -7.766  8.758  7.768  1.00 73.82  ? 125  ASP A C   1 
ATOM   765  O  O   . ASP A 1 136 ? -7.375  7.968  8.596  1.00 74.41  ? 125  ASP A O   1 
ATOM   766  C  CB  . ASP A 1 136 ? -5.560  9.897  7.489  1.00 67.02  ? 125  ASP A CB  1 
ATOM   767  C  CG  . ASP A 1 136 ? -5.141  9.083  6.198  1.00 71.26  ? 125  ASP A CG  1 
ATOM   768  O  OD1 . ASP A 1 136 ? -6.045  8.685  5.390  1.00 76.21  ? 125  ASP A OD1 1 
ATOM   769  O  OD2 . ASP A 1 136 ? -3.907  8.847  5.983  1.00 68.68  ? 125  ASP A OD2 1 
ATOM   770  N  N   . HIS A 1 137 ? -8.736  8.485  6.912  1.00 83.20  ? 126  HIS A N   1 
ATOM   771  C  CA  . HIS A 1 137 ? -9.502  7.246  6.966  1.00 95.01  ? 126  HIS A CA  1 
ATOM   772  C  C   . HIS A 1 137 ? -9.089  6.269  5.861  1.00 102.04 ? 126  HIS A C   1 
ATOM   773  O  O   . HIS A 1 137 ? -9.810  5.312  5.592  1.00 106.42 ? 126  HIS A O   1 
ATOM   774  C  CB  . HIS A 1 137 ? -10.999 7.561  6.947  1.00 100.60 ? 126  HIS A CB  1 
ATOM   775  C  CG  . HIS A 1 137 ? -11.503 8.050  8.277  1.00 107.23 ? 126  HIS A CG  1 
ATOM   776  N  ND1 . HIS A 1 137 ? -12.380 9.108  8.401  1.00 111.77 ? 126  HIS A ND1 1 
ATOM   777  C  CD2 . HIS A 1 137 ? -11.220 7.646  9.546  1.00 108.85 ? 126  HIS A CD2 1 
ATOM   778  C  CE1 . HIS A 1 137 ? -12.634 9.320  9.685  1.00 110.80 ? 126  HIS A CE1 1 
ATOM   779  N  NE2 . HIS A 1 137 ? -11.935 8.453  10.400 1.00 110.66 ? 126  HIS A NE2 1 
ATOM   780  N  N   . GLY A 1 138 ? -7.890  6.470  5.285  1.00 104.99 ? 127  GLY A N   1 
ATOM   781  C  CA  . GLY A 1 138 ? -7.443  5.772  4.076  1.00 106.26 ? 127  GLY A CA  1 
ATOM   782  C  C   . GLY A 1 138 ? -8.172  6.310  2.861  1.00 108.81 ? 127  GLY A C   1 
ATOM   783  O  O   . GLY A 1 138 ? -8.603  7.453  2.860  1.00 107.76 ? 127  GLY A O   1 
ATOM   784  N  N   . ASN A 1 139 ? -8.385  5.445  1.882  1.00 114.20 ? 128  ASN A N   1 
ATOM   785  C  CA  . ASN A 1 139 ? -8.833  5.852  0.566  1.00 117.44 ? 128  ASN A CA  1 
ATOM   786  C  C   . ASN A 1 139 ? -10.155 6.602  0.500  1.00 112.92 ? 128  ASN A C   1 
ATOM   787  O  O   . ASN A 1 139 ? -11.151 6.168  1.099  1.00 111.33 ? 128  ASN A O   1 
ATOM   788  C  CB  . ASN A 1 139 ? -8.964  4.619  -0.350 1.00 128.40 ? 128  ASN A CB  1 
ATOM   789  C  CG  . ASN A 1 139 ? -7.621  3.979  -0.671 1.00 130.99 ? 128  ASN A CG  1 
ATOM   790  O  OD1 . ASN A 1 139 ? -6.536  4.579  -0.419 1.00 125.81 ? 128  ASN A OD1 1 
ATOM   791  N  ND2 . ASN A 1 139 ? -7.677  2.757  -1.239 1.00 132.27 ? 128  ASN A ND2 1 
ATOM   792  N  N   . PRO A 1 140 ? -10.165 7.725  -0.228 1.00 106.36 ? 129  PRO A N   1 
ATOM   793  C  CA  . PRO A 1 140 ? -8.944  8.450  -0.706 1.00 98.74  ? 129  PRO A CA  1 
ATOM   794  C  C   . PRO A 1 140 ? -8.349  9.252  0.447  1.00 94.28  ? 129  PRO A C   1 
ATOM   795  O  O   . PRO A 1 140 ? -9.108  9.775  1.232  1.00 98.21  ? 129  PRO A O   1 
ATOM   796  C  CB  . PRO A 1 140 ? -9.485  9.409  -1.750 1.00 99.05  ? 129  PRO A CB  1 
ATOM   797  C  CG  . PRO A 1 140 ? -10.969 9.475  -1.514 1.00 104.44 ? 129  PRO A CG  1 
ATOM   798  C  CD  . PRO A 1 140 ? -11.392 8.174  -0.910 1.00 108.09 ? 129  PRO A CD  1 
ATOM   799  N  N   . PRO A 1 141 ? -7.012  9.346  0.591  1.00 89.40  ? 130  PRO A N   1 
ATOM   800  C  CA  . PRO A 1 141 ? -6.469  10.083 1.740  1.00 81.42  ? 130  PRO A CA  1 
ATOM   801  C  C   . PRO A 1 141 ? -6.612  11.603 1.618  1.00 75.66  ? 130  PRO A C   1 
ATOM   802  O  O   . PRO A 1 141 ? -7.071  12.111 0.578  1.00 73.73  ? 130  PRO A O   1 
ATOM   803  C  CB  . PRO A 1 141 ? -4.996  9.664  1.749  1.00 81.30  ? 130  PRO A CB  1 
ATOM   804  C  CG  . PRO A 1 141 ? -4.709  9.475  0.333  1.00 83.92  ? 130  PRO A CG  1 
ATOM   805  C  CD  . PRO A 1 141 ? -5.924  8.688  -0.132 1.00 90.25  ? 130  PRO A CD  1 
ATOM   806  N  N   . PRO A 1 142 ? -6.244  12.329 2.694  1.00 70.90  ? 131  PRO A N   1 
ATOM   807  C  CA  . PRO A 1 142 ? -6.613  13.738 2.771  1.00 68.57  ? 131  PRO A CA  1 
ATOM   808  C  C   . PRO A 1 142 ? -5.802  14.579 1.866  1.00 66.08  ? 131  PRO A C   1 
ATOM   809  O  O   . PRO A 1 142 ? -6.341  15.493 1.266  1.00 66.04  ? 131  PRO A O   1 
ATOM   810  C  CB  . PRO A 1 142 ? -6.306  14.128 4.220  1.00 66.58  ? 131  PRO A CB  1 
ATOM   811  C  CG  . PRO A 1 142 ? -6.071  12.858 4.932  1.00 68.60  ? 131  PRO A CG  1 
ATOM   812  C  CD  . PRO A 1 142 ? -5.538  11.907 3.916  1.00 70.07  ? 131  PRO A CD  1 
ATOM   813  N  N   . LEU A 1 143 ? -4.504  14.290 1.823  1.00 64.23  ? 132  LEU A N   1 
ATOM   814  C  CA  . LEU A 1 143 ? -3.616  14.864 0.844  1.00 62.47  ? 132  LEU A CA  1 
ATOM   815  C  C   . LEU A 1 143 ? -3.359  13.817 -0.216 1.00 64.01  ? 132  LEU A C   1 
ATOM   816  O  O   . LEU A 1 143 ? -2.917  12.692 0.087  1.00 67.30  ? 132  LEU A O   1 
ATOM   817  C  CB  . LEU A 1 143 ? -2.334  15.282 1.516  1.00 59.49  ? 132  LEU A CB  1 
ATOM   818  C  CG  . LEU A 1 143 ? -2.473  16.444 2.498  1.00 57.39  ? 132  LEU A CG  1 
ATOM   819  C  CD1 . LEU A 1 143 ? -1.088  16.750 2.998  1.00 56.81  ? 132  LEU A CD1 1 
ATOM   820  C  CD2 . LEU A 1 143 ? -3.097  17.718 1.942  1.00 56.58  ? 132  LEU A CD2 1 
ATOM   821  N  N   . THR A 1 144 ? -3.653  14.188 -1.453 1.00 63.67  ? 133  THR A N   1 
ATOM   822  C  CA  . THR A 1 144 ? -3.626  13.256 -2.558 1.00 67.27  ? 133  THR A CA  1 
ATOM   823  C  C   . THR A 1 144 ? -2.498  13.492 -3.484 1.00 65.88  ? 133  THR A C   1 
ATOM   824  O  O   . THR A 1 144 ? -2.555  12.950 -4.579 1.00 67.91  ? 133  THR A O   1 
ATOM   825  C  CB  . THR A 1 144 ? -4.873  13.328 -3.440 1.00 71.53  ? 133  THR A CB  1 
ATOM   826  O  OG1 . THR A 1 144 ? -5.199  14.700 -3.650 1.00 71.18  ? 133  THR A OG1 1 
ATOM   827  C  CG2 . THR A 1 144 ? -6.023  12.585 -2.789 1.00 75.81  ? 133  THR A CG2 1 
ATOM   828  N  N   . GLY A 1 145 ? -1.457  14.216 -3.064 1.00 62.14  ? 134  GLY A N   1 
ATOM   829  C  CA  . GLY A 1 145 ? -0.221  14.245 -3.837 1.00 62.11  ? 134  GLY A CA  1 
ATOM   830  C  C   . GLY A 1 145 ? 0.646   12.995 -3.743 1.00 60.63  ? 134  GLY A C   1 
ATOM   831  O  O   . GLY A 1 145 ? 0.226   11.899 -3.993 1.00 64.35  ? 134  GLY A O   1 
ATOM   832  N  N   . THR A 1 146 ? 1.880   13.187 -3.375 1.00 57.89  ? 135  THR A N   1 
ATOM   833  C  CA  . THR A 1 146 ? 2.878   12.176 -3.483 1.00 57.93  ? 135  THR A CA  1 
ATOM   834  C  C   . THR A 1 146 ? 3.497   12.044 -2.082 1.00 58.88  ? 135  THR A C   1 
ATOM   835  O  O   . THR A 1 146 ? 3.481   13.006 -1.325 1.00 61.53  ? 135  THR A O   1 
ATOM   836  C  CB  . THR A 1 146 ? 3.869   12.616 -4.552 1.00 56.12  ? 135  THR A CB  1 
ATOM   837  O  OG1 . THR A 1 146 ? 4.860   11.634 -4.670 1.00 58.07  ? 135  THR A OG1 1 
ATOM   838  C  CG2 . THR A 1 146 ? 4.590   13.836 -4.193 1.00 53.48  ? 135  THR A CG2 1 
ATOM   839  N  N   . SER A 1 147 ? 3.968   10.864 -1.696 1.00 60.55  ? 136  SER A N   1 
ATOM   840  C  CA  . SER A 1 147 ? 4.463   10.622 -0.322 1.00 58.44  ? 136  SER A CA  1 
ATOM   841  C  C   . SER A 1 147 ? 5.852   10.014 -0.167 1.00 55.69  ? 136  SER A C   1 
ATOM   842  O  O   . SER A 1 147 ? 6.443   9.523  -1.108 1.00 55.87  ? 136  SER A O   1 
ATOM   843  C  CB  . SER A 1 147 ? 3.469   9.692  0.392  1.00 63.35  ? 136  SER A CB  1 
ATOM   844  O  OG  . SER A 1 147 ? 3.359   8.434  -0.286 1.00 70.47  ? 136  SER A OG  1 
ATOM   845  N  N   . LYS A 1 148 ? 6.342   10.046 1.068  1.00 52.64  ? 137  LYS A N   1 
ATOM   846  C  CA  . LYS A 1 148 ? 7.545   9.349  1.470  1.00 51.56  ? 137  LYS A CA  1 
ATOM   847  C  C   . LYS A 1 148 ? 7.338   8.841  2.860  1.00 50.34  ? 137  LYS A C   1 
ATOM   848  O  O   . LYS A 1 148 ? 6.453   9.282  3.567  1.00 47.76  ? 137  LYS A O   1 
ATOM   849  C  CB  . LYS A 1 148 ? 8.739   10.281 1.494  1.00 51.05  ? 137  LYS A CB  1 
ATOM   850  C  CG  . LYS A 1 148 ? 8.643   11.374 2.516  1.00 49.85  ? 137  LYS A CG  1 
ATOM   851  C  CD  . LYS A 1 148 ? 9.642   12.474 2.260  1.00 52.12  ? 137  LYS A CD  1 
ATOM   852  C  CE  . LYS A 1 148 ? 10.873  12.414 3.154  1.00 53.62  ? 137  LYS A CE  1 
ATOM   853  N  NZ  . LYS A 1 148 ? 11.894  13.441 2.757  1.00 54.02  ? 137  LYS A NZ  1 
ATOM   854  N  N   . THR A 1 149 ? 8.213   7.926  3.240  1.00 51.42  ? 138  THR A N   1 
ATOM   855  C  CA  . THR A 1 149 ? 8.332   7.397  4.591  1.00 49.67  ? 138  THR A CA  1 
ATOM   856  C  C   . THR A 1 149 ? 9.805   7.664  4.943  1.00 49.74  ? 138  THR A C   1 
ATOM   857  O  O   . THR A 1 149 ? 10.602  7.739  4.014  1.00 51.66  ? 138  THR A O   1 
ATOM   858  C  CB  . THR A 1 149 ? 7.903   5.921  4.591  1.00 51.24  ? 138  THR A CB  1 
ATOM   859  O  OG1 . THR A 1 149 ? 7.805   5.485  5.906  1.00 53.45  ? 138  THR A OG1 1 
ATOM   860  C  CG2 . THR A 1 149 ? 8.834   4.965  3.934  1.00 52.61  ? 138  THR A CG2 1 
ATOM   861  N  N   . SER A 1 150 ? 10.174  7.907  6.212  1.00 49.11  ? 139  SER A N   1 
ATOM   862  C  CA  . SER A 1 150 ? 11.595  8.260  6.560  1.00 49.72  ? 139  SER A CA  1 
ATOM   863  C  C   . SER A 1 150 ? 12.025  7.883  7.938  1.00 50.49  ? 139  SER A C   1 
ATOM   864  O  O   . SER A 1 150 ? 11.324  8.228  8.916  1.00 51.95  ? 139  SER A O   1 
ATOM   865  C  CB  . SER A 1 150 ? 11.922  9.789  6.383  1.00 47.97  ? 139  SER A CB  1 
ATOM   866  O  OG  . SER A 1 150 ? 13.235  10.160 6.872  1.00 46.11  ? 139  SER A OG  1 
ATOM   867  N  N   . ASN A 1 151 ? 13.202  7.271  8.053  1.00 51.11  ? 140  ASN A N   1 
ATOM   868  C  CA  . ASN A 1 151 ? 13.716  6.992  9.378  1.00 52.81  ? 140  ASN A CA  1 
ATOM   869  C  C   . ASN A 1 151 ? 14.196  8.176  10.169 1.00 52.52  ? 140  ASN A C   1 
ATOM   870  O  O   . ASN A 1 151 ? 14.307  8.062  11.342 1.00 54.43  ? 140  ASN A O   1 
ATOM   871  C  CB  . ASN A 1 151 ? 14.744  5.883  9.360  1.00 55.83  ? 140  ASN A CB  1 
ATOM   872  C  CG  . ASN A 1 151 ? 15.977  6.231  8.603  1.00 56.53  ? 140  ASN A CG  1 
ATOM   873  O  OD1 . ASN A 1 151 ? 16.326  7.400  8.454  1.00 57.44  ? 140  ASN A OD1 1 
ATOM   874  N  ND2 . ASN A 1 151 ? 16.676  5.196  8.128  1.00 58.91  ? 140  ASN A ND2 1 
ATOM   875  N  N   . LYS A 1 152 ? 14.426  9.323  9.544  1.00 53.80  ? 141  LYS A N   1 
ATOM   876  C  CA  . LYS A 1 152 ? 14.697  10.542 10.284 1.00 55.24  ? 141  LYS A CA  1 
ATOM   877  C  C   . LYS A 1 152 ? 13.681  11.630 10.021 1.00 52.51  ? 141  LYS A C   1 
ATOM   878  O  O   . LYS A 1 152 ? 14.034  12.820 9.977  1.00 50.28  ? 141  LYS A O   1 
ATOM   879  C  CB  . LYS A 1 152 ? 16.088  11.027 9.919  1.00 62.30  ? 141  LYS A CB  1 
ATOM   880  C  CG  . LYS A 1 152 ? 16.316  11.731 8.539  1.00 66.47  ? 141  LYS A CG  1 
ATOM   881  C  CD  . LYS A 1 152 ? 17.454  11.125 7.696  1.00 73.40  ? 141  LYS A CD  1 
ATOM   882  C  CE  . LYS A 1 152 ? 18.742  10.722 8.460  1.00 79.18  ? 141  LYS A CE  1 
ATOM   883  N  NZ  . LYS A 1 152 ? 19.755  11.799 8.423  1.00 83.75  ? 141  LYS A NZ  1 
ATOM   884  N  N   . LEU A 1 153 ? 12.422  11.247 9.862  1.00 51.99  ? 142  LEU A N   1 
ATOM   885  C  CA  . LEU A 1 153 ? 11.421  12.219 9.444  1.00 52.21  ? 142  LEU A CA  1 
ATOM   886  C  C   . LEU A 1 153 ? 11.262  13.282 10.503 1.00 49.96  ? 142  LEU A C   1 
ATOM   887  O  O   . LEU A 1 153 ? 11.184  12.973 11.688 1.00 53.45  ? 142  LEU A O   1 
ATOM   888  C  CB  . LEU A 1 153 ? 10.053  11.570 9.184  1.00 53.96  ? 142  LEU A CB  1 
ATOM   889  C  CG  . LEU A 1 153 ? 9.011   12.539 8.554  1.00 54.09  ? 142  LEU A CG  1 
ATOM   890  C  CD1 . LEU A 1 153 ? 9.246   12.815 7.066  1.00 53.58  ? 142  LEU A CD1 1 
ATOM   891  C  CD2 . LEU A 1 153 ? 7.591   12.042 8.786  1.00 53.47  ? 142  LEU A CD2 1 
ATOM   892  N  N   . THR A 1 154 ? 11.231  14.527 10.076 1.00 47.35  ? 143  THR A N   1 
ATOM   893  C  CA  . THR A 1 154 ? 10.811  15.621 10.943 1.00 48.53  ? 143  THR A CA  1 
ATOM   894  C  C   . THR A 1 154 ? 9.806   16.410 10.184 1.00 46.51  ? 143  THR A C   1 
ATOM   895  O  O   . THR A 1 154 ? 9.692   16.234 8.967  1.00 50.58  ? 143  THR A O   1 
ATOM   896  C  CB  . THR A 1 154 ? 11.964  16.582 11.303 1.00 50.20  ? 143  THR A CB  1 
ATOM   897  O  OG1 . THR A 1 154 ? 12.290  17.404 10.179 1.00 50.41  ? 143  THR A OG1 1 
ATOM   898  C  CG2 . THR A 1 154 ? 13.177  15.825 11.707 1.00 52.37  ? 143  THR A CG2 1 
ATOM   899  N  N   . ILE A 1 155 ? 9.085   17.272 10.881 1.00 42.23  ? 144  ILE A N   1 
ATOM   900  C  CA  . ILE A 1 155 ? 8.300   18.277 10.209 1.00 41.71  ? 144  ILE A CA  1 
ATOM   901  C  C   . ILE A 1 155 ? 9.021   18.959 9.009  1.00 40.64  ? 144  ILE A C   1 
ATOM   902  O  O   . ILE A 1 155 ? 8.514   18.943 7.894  1.00 39.67  ? 144  ILE A O   1 
ATOM   903  C  CB  . ILE A 1 155 ? 7.757   19.342 11.169 1.00 43.61  ? 144  ILE A CB  1 
ATOM   904  C  CG1 . ILE A 1 155 ? 6.924   18.705 12.268 1.00 45.66  ? 144  ILE A CG1 1 
ATOM   905  C  CG2 . ILE A 1 155 ? 6.820   20.314 10.453 1.00 43.71  ? 144  ILE A CG2 1 
ATOM   906  C  CD1 . ILE A 1 155 ? 6.540   19.668 13.387 1.00 47.05  ? 144  ILE A CD1 1 
ATOM   907  N  N   . GLN A 1 156 ? 10.174  19.558 9.215  1.00 40.91  ? 145  GLN A N   1 
ATOM   908  C  CA  . GLN A 1 156 ? 10.784  20.308 8.135  1.00 42.64  ? 145  GLN A CA  1 
ATOM   909  C  C   . GLN A 1 156 ? 11.113  19.412 6.990  1.00 43.68  ? 145  GLN A C   1 
ATOM   910  O  O   . GLN A 1 156 ? 11.009  19.814 5.838  1.00 46.58  ? 145  GLN A O   1 
ATOM   911  C  CB  . GLN A 1 156 ? 12.097  20.969 8.557  1.00 45.26  ? 145  GLN A CB  1 
ATOM   912  C  CG  . GLN A 1 156 ? 12.805  21.748 7.421  1.00 46.38  ? 145  GLN A CG  1 
ATOM   913  C  CD  . GLN A 1 156 ? 11.906  22.722 6.612  1.00 45.32  ? 145  GLN A CD  1 
ATOM   914  O  OE1 . GLN A 1 156 ? 11.996  22.748 5.400  1.00 45.40  ? 145  GLN A OE1 1 
ATOM   915  N  NE2 . GLN A 1 156 ? 11.068  23.515 7.280  1.00 44.21  ? 145  GLN A NE2 1 
ATOM   916  N  N   . THR A 1 157 ? 11.594  18.221 7.301  1.00 43.61  ? 146  THR A N   1 
ATOM   917  C  CA  . THR A 1 157 ? 11.916  17.239 6.274  1.00 43.25  ? 146  THR A CA  1 
ATOM   918  C  C   . THR A 1 157 ? 10.729  16.940 5.429  1.00 45.53  ? 146  THR A C   1 
ATOM   919  O  O   . THR A 1 157 ? 10.886  16.794 4.219  1.00 46.93  ? 146  THR A O   1 
ATOM   920  C  CB  . THR A 1 157 ? 12.321  15.966 6.960  1.00 41.52  ? 146  THR A CB  1 
ATOM   921  O  OG1 . THR A 1 157 ? 13.563  16.235 7.485  1.00 42.21  ? 146  THR A OG1 1 
ATOM   922  C  CG2 . THR A 1 157 ? 12.481  14.771 6.103  1.00 41.45  ? 146  THR A CG2 1 
ATOM   923  N  N   . CYS A 1 158 ? 9.554   16.793 6.061  1.00 46.16  ? 147  CYS A N   1 
ATOM   924  C  CA  . CYS A 1 158 ? 8.350   16.540 5.294  1.00 48.74  ? 147  CYS A CA  1 
ATOM   925  C  C   . CYS A 1 158 ? 7.993   17.776 4.435  1.00 48.05  ? 147  CYS A C   1 
ATOM   926  O  O   . CYS A 1 158 ? 7.720   17.688 3.232  1.00 46.81  ? 147  CYS A O   1 
ATOM   927  C  CB  . CYS A 1 158 ? 7.170   16.152 6.185  1.00 49.84  ? 147  CYS A CB  1 
ATOM   928  S  SG  . CYS A 1 158 ? 5.780   15.527 5.192  1.00 53.99  ? 147  CYS A SG  1 
ATOM   929  N  N   . ILE A 1 159 ? 8.028   18.932 5.070  1.00 47.19  ? 148  ILE A N   1 
ATOM   930  C  CA  . ILE A 1 159 ? 7.753   20.162 4.382  1.00 47.19  ? 148  ILE A CA  1 
ATOM   931  C  C   . ILE A 1 159 ? 8.650   20.321 3.199  1.00 47.41  ? 148  ILE A C   1 
ATOM   932  O  O   . ILE A 1 159 ? 8.181   20.715 2.167  1.00 51.26  ? 148  ILE A O   1 
ATOM   933  C  CB  . ILE A 1 159 ? 7.909   21.374 5.318  1.00 48.81  ? 148  ILE A CB  1 
ATOM   934  C  CG1 . ILE A 1 159 ? 6.685   21.425 6.213  1.00 47.98  ? 148  ILE A CG1 1 
ATOM   935  C  CG2 . ILE A 1 159 ? 8.093   22.692 4.541  1.00 50.70  ? 148  ILE A CG2 1 
ATOM   936  C  CD1 . ILE A 1 159 ? 6.760   22.465 7.292  1.00 49.59  ? 148  ILE A CD1 1 
ATOM   937  N  N   . SER A 1 160 ? 9.936   20.063 3.370  1.00 47.47  ? 149  SER A N   1 
ATOM   938  C  CA  . SER A 1 160 ? 10.914  20.285 2.320  1.00 49.65  ? 149  SER A CA  1 
ATOM   939  C  C   . SER A 1 160 ? 10.701  19.385 1.103  1.00 50.28  ? 149  SER A C   1 
ATOM   940  O  O   . SER A 1 160 ? 10.837  19.825 -0.012 1.00 52.81  ? 149  SER A O   1 
ATOM   941  C  CB  . SER A 1 160 ? 12.313  20.069 2.855  1.00 51.24  ? 149  SER A CB  1 
ATOM   942  O  OG  . SER A 1 160 ? 13.202  20.097 1.765  1.00 56.26  ? 149  SER A OG  1 
ATOM   943  N  N   . PHE A 1 161 ? 10.384  18.119 1.339  1.00 50.97  ? 150  PHE A N   1 
ATOM   944  C  CA  . PHE A 1 161 ? 10.075  17.147 0.292  1.00 50.38  ? 150  PHE A CA  1 
ATOM   945  C  C   . PHE A 1 161 ? 8.881   17.628 -0.482 1.00 51.21  ? 150  PHE A C   1 
ATOM   946  O  O   . PHE A 1 161 ? 8.915   17.714 -1.708 1.00 54.29  ? 150  PHE A O   1 
ATOM   947  C  CB  . PHE A 1 161 ? 9.748   15.812 0.929  1.00 49.26  ? 150  PHE A CB  1 
ATOM   948  C  CG  . PHE A 1 161 ? 9.185   14.789 -0.019 1.00 50.81  ? 150  PHE A CG  1 
ATOM   949  C  CD1 . PHE A 1 161 ? 10.006  14.122 -0.914 1.00 52.53  ? 150  PHE A CD1 1 
ATOM   950  C  CD2 . PHE A 1 161 ? 7.836   14.425 0.055  1.00 50.75  ? 150  PHE A CD2 1 
ATOM   951  C  CE1 . PHE A 1 161 ? 9.482   13.151 -1.755 1.00 54.56  ? 150  PHE A CE1 1 
ATOM   952  C  CE2 . PHE A 1 161 ? 7.304   13.461 -0.789 1.00 52.11  ? 150  PHE A CE2 1 
ATOM   953  C  CZ  . PHE A 1 161 ? 8.129   12.822 -1.687 1.00 54.44  ? 150  PHE A CZ  1 
ATOM   954  N  N   . CYS A 1 162 ? 7.824   17.952 0.252  1.00 49.58  ? 151  CYS A N   1 
ATOM   955  C  CA  . CYS A 1 162 ? 6.610   18.464 -0.355 1.00 48.86  ? 151  CYS A CA  1 
ATOM   956  C  C   . CYS A 1 162 ? 6.888   19.733 -1.140 1.00 50.64  ? 151  CYS A C   1 
ATOM   957  O  O   . CYS A 1 162 ? 6.472   19.815 -2.279 1.00 56.17  ? 151  CYS A O   1 
ATOM   958  C  CB  . CYS A 1 162 ? 5.499   18.635 0.694  1.00 46.11  ? 151  CYS A CB  1 
ATOM   959  S  SG  . CYS A 1 162 ? 5.043   17.022 1.388  1.00 46.47  ? 151  CYS A SG  1 
ATOM   960  N  N   . ARG A 1 163 ? 7.623   20.683 -0.562 1.00 49.66  ? 152  ARG A N   1 
ATOM   961  C  CA  . ARG A 1 163 ? 7.954   21.948 -1.206 1.00 49.84  ? 152  ARG A CA  1 
ATOM   962  C  C   . ARG A 1 163 ? 8.645   21.703 -2.534 1.00 52.20  ? 152  ARG A C   1 
ATOM   963  O  O   . ARG A 1 163 ? 8.205   22.233 -3.521 1.00 52.80  ? 152  ARG A O   1 
ATOM   964  C  CB  . ARG A 1 163 ? 8.829   22.787 -0.295 1.00 50.86  ? 152  ARG A CB  1 
ATOM   965  C  CG  . ARG A 1 163 ? 9.101   24.185 -0.787 1.00 54.97  ? 152  ARG A CG  1 
ATOM   966  C  CD  . ARG A 1 163 ? 10.264  24.865 -0.069 1.00 57.70  ? 152  ARG A CD  1 
ATOM   967  N  NE  . ARG A 1 163 ? 9.894   25.193 1.304  1.00 57.62  ? 152  ARG A NE  1 
ATOM   968  C  CZ  . ARG A 1 163 ? 10.475  24.728 2.410  1.00 56.27  ? 152  ARG A CZ  1 
ATOM   969  N  NH1 . ARG A 1 163 ? 11.521  23.899 2.361  1.00 56.42  ? 152  ARG A NH1 1 
ATOM   970  N  NH2 . ARG A 1 163 ? 9.986   25.093 3.586  1.00 55.17  ? 152  ARG A NH2 1 
ATOM   971  N  N   . SER A 1 164 ? 9.684   20.865 -2.573 1.00 55.71  ? 153  SER A N   1 
ATOM   972  C  CA  . SER A 1 164 ? 10.412  20.494 -3.831 1.00 59.62  ? 153  SER A CA  1 
ATOM   973  C  C   . SER A 1 164 ? 9.538   20.036 -4.929 1.00 60.93  ? 153  SER A C   1 
ATOM   974  O  O   . SER A 1 164 ? 9.780   20.313 -6.076 1.00 65.05  ? 153  SER A O   1 
ATOM   975  C  CB  . SER A 1 164 ? 11.304  19.303 -3.607 1.00 60.24  ? 153  SER A CB  1 
ATOM   976  O  OG  . SER A 1 164 ? 12.220  19.658 -2.634 1.00 66.46  ? 153  SER A OG  1 
ATOM   977  N  N   . GLN A 1 165 ? 8.543   19.268 -4.527 1.00 59.76  ? 154  GLN A N   1 
ATOM   978  C  CA  . GLN A 1 165 ? 7.572   18.654 -5.389 1.00 59.01  ? 154  GLN A CA  1 
ATOM   979  C  C   . GLN A 1 165 ? 6.546   19.629 -5.907 1.00 58.51  ? 154  GLN A C   1 
ATOM   980  O  O   . GLN A 1 165 ? 5.726   19.223 -6.671 1.00 59.67  ? 154  GLN A O   1 
ATOM   981  C  CB  . GLN A 1 165 ? 6.823   17.614 -4.550 1.00 57.75  ? 154  GLN A CB  1 
ATOM   982  C  CG  . GLN A 1 165 ? 6.612   16.303 -5.214 1.00 58.53  ? 154  GLN A CG  1 
ATOM   983  C  CD  . GLN A 1 165 ? 7.706   15.333 -4.982 1.00 56.55  ? 154  GLN A CD  1 
ATOM   984  O  OE1 . GLN A 1 165 ? 8.835   15.682 -4.729 1.00 55.84  ? 154  GLN A OE1 1 
ATOM   985  N  NE2 . GLN A 1 165 ? 7.365   14.110 -5.045 1.00 57.62  ? 154  GLN A NE2 1 
ATOM   986  N  N   . ARG A 1 166 ? 6.558   20.873 -5.445 1.00 58.51  ? 155  ARG A N   1 
ATOM   987  C  CA  . ARG A 1 166 ? 5.643   21.919 -5.845 1.00 62.56  ? 155  ARG A CA  1 
ATOM   988  C  C   . ARG A 1 166 ? 4.286   21.726 -5.180 1.00 56.33  ? 155  ARG A C   1 
ATOM   989  O  O   . ARG A 1 166 ? 3.287   22.160 -5.691 1.00 57.87  ? 155  ARG A O   1 
ATOM   990  C  CB  . ARG A 1 166 ? 5.487   22.072 -7.391 1.00 75.03  ? 155  ARG A CB  1 
ATOM   991  C  CG  . ARG A 1 166 ? 6.619   21.618 -8.372 1.00 86.94  ? 155  ARG A CG  1 
ATOM   992  C  CD  . ARG A 1 166 ? 7.912   22.443 -8.415 1.00 93.06  ? 155  ARG A CD  1 
ATOM   993  N  NE  . ARG A 1 166 ? 7.695   23.785 -8.961 1.00 101.03 ? 155  ARG A NE  1 
ATOM   994  C  CZ  . ARG A 1 166 ? 7.482   24.912 -8.260 1.00 105.68 ? 155  ARG A CZ  1 
ATOM   995  N  NH1 . ARG A 1 166 ? 7.458   24.941 -6.916 1.00 103.82 ? 155  ARG A NH1 1 
ATOM   996  N  NH2 . ARG A 1 166 ? 7.292   26.053 -8.923 1.00 110.97 ? 155  ARG A NH2 1 
ATOM   997  N  N   . PHE A 1 167 ? 4.218   21.095 -4.035 1.00 51.93  ? 156  PHE A N   1 
ATOM   998  C  CA  . PHE A 1 167 ? 2.938   21.041 -3.326 1.00 52.38  ? 156  PHE A CA  1 
ATOM   999  C  C   . PHE A 1 167 ? 2.839   22.034 -2.168 1.00 54.28  ? 156  PHE A C   1 
ATOM   1000 O  O   . PHE A 1 167 ? 3.846   22.314 -1.496 1.00 54.47  ? 156  PHE A O   1 
ATOM   1001 C  CB  . PHE A 1 167 ? 2.687   19.664 -2.739 1.00 50.52  ? 156  PHE A CB  1 
ATOM   1002 C  CG  . PHE A 1 167 ? 2.411   18.629 -3.747 1.00 50.49  ? 156  PHE A CG  1 
ATOM   1003 C  CD1 . PHE A 1 167 ? 1.291   18.700 -4.525 1.00 52.86  ? 156  PHE A CD1 1 
ATOM   1004 C  CD2 . PHE A 1 167 ? 3.267   17.597 -3.915 1.00 50.12  ? 156  PHE A CD2 1 
ATOM   1005 C  CE1 . PHE A 1 167 ? 1.035   17.753 -5.489 1.00 56.16  ? 156  PHE A CE1 1 
ATOM   1006 C  CE2 . PHE A 1 167 ? 3.022   16.642 -4.854 1.00 52.85  ? 156  PHE A CE2 1 
ATOM   1007 C  CZ  . PHE A 1 167 ? 1.908   16.708 -5.653 1.00 55.94  ? 156  PHE A CZ  1 
ATOM   1008 N  N   . LYS A 1 168 ? 1.621   22.508 -1.878 1.00 56.15  ? 157  LYS A N   1 
ATOM   1009 C  CA  . LYS A 1 168 ? 1.453   23.565 -0.881 1.00 57.29  ? 157  LYS A CA  1 
ATOM   1010 C  C   . LYS A 1 168 ? 1.160   23.105 0.494  1.00 52.14  ? 157  LYS A C   1 
ATOM   1011 O  O   . LYS A 1 168 ? 1.187   23.914 1.391  1.00 51.32  ? 157  LYS A O   1 
ATOM   1012 C  CB  . LYS A 1 168 ? 0.474   24.675 -1.322 1.00 65.49  ? 157  LYS A CB  1 
ATOM   1013 C  CG  . LYS A 1 168 ? -0.963  24.324 -1.665 1.00 72.30  ? 157  LYS A CG  1 
ATOM   1014 C  CD  . LYS A 1 168 ? -1.847  25.538 -1.462 1.00 81.42  ? 157  LYS A CD  1 
ATOM   1015 C  CE  . LYS A 1 168 ? -3.205  25.433 -2.138 1.00 88.48  ? 157  LYS A CE  1 
ATOM   1016 N  NZ  . LYS A 1 168 ? -3.525  26.753 -2.753 1.00 96.13  ? 157  LYS A NZ  1 
ATOM   1017 N  N   . PHE A 1 169 ? 0.920   21.812 0.668  1.00 50.29  ? 158  PHE A N   1 
ATOM   1018 C  CA  . PHE A 1 169 ? 0.697   21.234 1.987  1.00 50.03  ? 158  PHE A CA  1 
ATOM   1019 C  C   . PHE A 1 169 ? 1.538   19.999 2.199  1.00 50.15  ? 158  PHE A C   1 
ATOM   1020 O  O   . PHE A 1 169 ? 1.701   19.166 1.302  1.00 51.54  ? 158  PHE A O   1 
ATOM   1021 C  CB  . PHE A 1 169 ? -0.781  20.838 2.228  1.00 51.37  ? 158  PHE A CB  1 
ATOM   1022 C  CG  . PHE A 1 169 ? -1.743  21.948 1.973  1.00 53.10  ? 158  PHE A CG  1 
ATOM   1023 C  CD1 . PHE A 1 169 ? -1.629  23.126 2.670  1.00 53.07  ? 158  PHE A CD1 1 
ATOM   1024 C  CD2 . PHE A 1 169 ? -2.719  21.844 1.000  1.00 54.26  ? 158  PHE A CD2 1 
ATOM   1025 C  CE1 . PHE A 1 169 ? -2.462  24.185 2.402  1.00 54.30  ? 158  PHE A CE1 1 
ATOM   1026 C  CE2 . PHE A 1 169 ? -3.552  22.909 0.726  1.00 55.43  ? 158  PHE A CE2 1 
ATOM   1027 C  CZ  . PHE A 1 169 ? -3.422  24.080 1.426  1.00 55.47  ? 158  PHE A CZ  1 
ATOM   1028 N  N   . ALA A 1 170 ? 2.008   19.868 3.433  1.00 50.13  ? 159  ALA A N   1 
ATOM   1029 C  CA  . ALA A 1 170 ? 2.638   18.657 3.919  1.00 49.90  ? 159  ALA A CA  1 
ATOM   1030 C  C   . ALA A 1 170 ? 1.902   18.084 5.121  1.00 48.18  ? 159  ALA A C   1 
ATOM   1031 O  O   . ALA A 1 170 ? 1.422   18.818 5.964  1.00 45.13  ? 159  ALA A O   1 
ATOM   1032 C  CB  . ALA A 1 170 ? 4.058   18.964 4.312  1.00 52.62  ? 159  ALA A CB  1 
ATOM   1033 N  N   . GLY A 1 171 ? 1.867   16.756 5.192  1.00 50.40  ? 160  GLY A N   1 
ATOM   1034 C  CA  . GLY A 1 171 ? 1.162   15.984 6.227  1.00 49.43  ? 160  GLY A CA  1 
ATOM   1035 C  C   . GLY A 1 171 ? 2.010   14.844 6.780  1.00 48.48  ? 160  GLY A C   1 
ATOM   1036 O  O   . GLY A 1 171 ? 2.589   14.051 6.037  1.00 46.98  ? 160  GLY A O   1 
ATOM   1037 N  N   . MET A 1 172 ? 2.063   14.752 8.102  1.00 49.88  ? 161  MET A N   1 
ATOM   1038 C  CA  . MET A 1 172 ? 2.917   13.777 8.800  1.00 51.05  ? 161  MET A CA  1 
ATOM   1039 C  C   . MET A 1 172 ? 2.097   12.847 9.669  1.00 49.77  ? 161  MET A C   1 
ATOM   1040 O  O   . MET A 1 172 ? 1.250   13.297 10.411 1.00 50.20  ? 161  MET A O   1 
ATOM   1041 C  CB  . MET A 1 172 ? 3.932   14.522 9.655  1.00 51.72  ? 161  MET A CB  1 
ATOM   1042 C  CG  . MET A 1 172 ? 4.900   15.341 8.825  1.00 52.53  ? 161  MET A CG  1 
ATOM   1043 S  SD  . MET A 1 172 ? 5.069   17.035 9.387  1.00 52.69  ? 161  MET A SD  1 
ATOM   1044 C  CE  . MET A 1 172 ? 3.743   17.804 8.559  1.00 52.66  ? 161  MET A CE  1 
ATOM   1045 N  N   . GLU A 1 173 ? 2.355   11.559 9.556  1.00 48.82  ? 162  GLU A N   1 
ATOM   1046 C  CA  . GLU A 1 173 ? 1.564   10.574 10.229 1.00 51.79  ? 162  GLU A CA  1 
ATOM   1047 C  C   . GLU A 1 173 ? 2.475   9.568  10.855 1.00 54.83  ? 162  GLU A C   1 
ATOM   1048 O  O   . GLU A 1 173 ? 3.540   9.220  10.319 1.00 52.55  ? 162  GLU A O   1 
ATOM   1049 C  CB  . GLU A 1 173 ? 0.708   9.785  9.262  1.00 53.74  ? 162  GLU A CB  1 
ATOM   1050 C  CG  . GLU A 1 173 ? -0.505  10.479 8.700  1.00 54.04  ? 162  GLU A CG  1 
ATOM   1051 C  CD  . GLU A 1 173 ? -1.591  9.482  8.240  1.00 57.75  ? 162  GLU A CD  1 
ATOM   1052 O  OE1 . GLU A 1 173 ? -1.890  8.479  9.000  1.00 55.65  ? 162  GLU A OE1 1 
ATOM   1053 O  OE2 . GLU A 1 173 ? -2.139  9.740  7.115  1.00 57.76  ? 162  GLU A OE2 1 
ATOM   1054 N  N   . SER A 1 174 ? 2.016   9.073  12.000 1.00 59.00  ? 163  SER A N   1 
ATOM   1055 C  CA  . SER A 1 174 ? 2.618   7.908  12.658 1.00 59.12  ? 163  SER A CA  1 
ATOM   1056 C  C   . SER A 1 174 ? 4.112   8.051  12.946 1.00 55.21  ? 163  SER A C   1 
ATOM   1057 O  O   . SER A 1 174 ? 4.793   7.059  13.159 1.00 55.60  ? 163  SER A O   1 
ATOM   1058 C  CB  . SER A 1 174 ? 2.308   6.666  11.828 1.00 60.28  ? 163  SER A CB  1 
ATOM   1059 O  OG  . SER A 1 174 ? 0.915   6.659  11.546 1.00 61.01  ? 163  SER A OG  1 
ATOM   1060 N  N   . GLY A 1 175 ? 4.595   9.290  12.974 1.00 50.94  ? 164  GLY A N   1 
ATOM   1061 C  CA  . GLY A 1 175 ? 5.956   9.562  13.298 1.00 51.47  ? 164  GLY A CA  1 
ATOM   1062 C  C   . GLY A 1 175 ? 6.947   9.487  12.167 1.00 52.07  ? 164  GLY A C   1 
ATOM   1063 O  O   . GLY A 1 175 ? 7.990   10.116 12.260 1.00 53.19  ? 164  GLY A O   1 
ATOM   1064 N  N   . TYR A 1 176 ? 6.656   8.729  11.107 1.00 54.22  ? 165  TYR A N   1 
ATOM   1065 C  CA  . TYR A 1 176 ? 7.623   8.503  10.006 1.00 53.49  ? 165  TYR A CA  1 
ATOM   1066 C  C   . TYR A 1 176 ? 7.086   8.748  8.611  1.00 53.33  ? 165  TYR A C   1 
ATOM   1067 O  O   . TYR A 1 176 ? 7.834   8.695  7.653  1.00 55.25  ? 165  TYR A O   1 
ATOM   1068 C  CB  . TYR A 1 176 ? 8.144   7.068  10.055 1.00 55.22  ? 165  TYR A CB  1 
ATOM   1069 C  CG  . TYR A 1 176 ? 7.083   6.017  9.864  1.00 57.94  ? 165  TYR A CG  1 
ATOM   1070 C  CD1 . TYR A 1 176 ? 6.318   5.565  10.918 1.00 60.91  ? 165  TYR A CD1 1 
ATOM   1071 C  CD2 . TYR A 1 176 ? 6.852   5.474  8.645  1.00 59.66  ? 165  TYR A CD2 1 
ATOM   1072 C  CE1 . TYR A 1 176 ? 5.345   4.605  10.734 1.00 63.87  ? 165  TYR A CE1 1 
ATOM   1073 C  CE2 . TYR A 1 176 ? 5.891   4.505  8.447  1.00 61.92  ? 165  TYR A CE2 1 
ATOM   1074 C  CZ  . TYR A 1 176 ? 5.153   4.081  9.496  1.00 64.06  ? 165  TYR A CZ  1 
ATOM   1075 O  OH  . TYR A 1 176 ? 4.220   3.115  9.317  1.00 72.63  ? 165  TYR A OH  1 
ATOM   1076 N  N   . ALA A 1 177 ? 5.801   8.994  8.469  1.00 53.24  ? 166  ALA A N   1 
ATOM   1077 C  CA  . ALA A 1 177 ? 5.214   9.031  7.157  1.00 53.16  ? 166  ALA A CA  1 
ATOM   1078 C  C   . ALA A 1 177 ? 4.925   10.465 6.793  1.00 50.80  ? 166  ALA A C   1 
ATOM   1079 O  O   . ALA A 1 177 ? 4.585   11.284 7.659  1.00 49.92  ? 166  ALA A O   1 
ATOM   1080 C  CB  . ALA A 1 177 ? 3.948   8.225  7.164  1.00 56.98  ? 166  ALA A CB  1 
ATOM   1081 N  N   . CYS A 1 178 ? 5.048   10.751 5.505  1.00 50.20  ? 167  CYS A N   1 
ATOM   1082 C  CA  . CYS A 1 178 ? 5.006   12.109 4.993  1.00 49.77  ? 167  CYS A CA  1 
ATOM   1083 C  C   . CYS A 1 178 ? 4.212   12.143 3.684  1.00 49.48  ? 167  CYS A C   1 
ATOM   1084 O  O   . CYS A 1 178 ? 4.441   11.346 2.794  1.00 50.45  ? 167  CYS A O   1 
ATOM   1085 C  CB  . CYS A 1 178 ? 6.446   12.592 4.806  1.00 50.51  ? 167  CYS A CB  1 
ATOM   1086 S  SG  . CYS A 1 178 ? 6.648   14.153 3.942  1.00 51.42  ? 167  CYS A SG  1 
ATOM   1087 N  N   . PHE A 1 179 ? 3.266   13.058 3.584  1.00 48.41  ? 168  PHE A N   1 
ATOM   1088 C  CA  . PHE A 1 179 ? 2.334   13.113 2.465  1.00 49.89  ? 168  PHE A CA  1 
ATOM   1089 C  C   . PHE A 1 179 ? 2.271   14.538 1.955  1.00 49.50  ? 168  PHE A C   1 
ATOM   1090 O  O   . PHE A 1 179 ? 2.251   15.492 2.747  1.00 48.11  ? 168  PHE A O   1 
ATOM   1091 C  CB  . PHE A 1 179 ? 0.943   12.746 2.947  1.00 51.88  ? 168  PHE A CB  1 
ATOM   1092 C  CG  . PHE A 1 179 ? 0.822   11.331 3.393  1.00 52.92  ? 168  PHE A CG  1 
ATOM   1093 C  CD1 . PHE A 1 179 ? 1.242   10.947 4.623  1.00 50.80  ? 168  PHE A CD1 1 
ATOM   1094 C  CD2 . PHE A 1 179 ? 0.264   10.402 2.572  1.00 56.75  ? 168  PHE A CD2 1 
ATOM   1095 C  CE1 . PHE A 1 179 ? 1.137   9.666  5.025  1.00 51.66  ? 168  PHE A CE1 1 
ATOM   1096 C  CE2 . PHE A 1 179 ? 0.130   9.118  2.971  1.00 57.62  ? 168  PHE A CE2 1 
ATOM   1097 C  CZ  . PHE A 1 179 ? 0.587   8.754  4.200  1.00 56.09  ? 168  PHE A CZ  1 
ATOM   1098 N  N   . CYS A 1 180 ? 2.198   14.688 0.635  1.00 49.53  ? 169  CYS A N   1 
ATOM   1099 C  CA  . CYS A 1 180 ? 2.142   16.003 0.038  1.00 47.71  ? 169  CYS A CA  1 
ATOM   1100 C  C   . CYS A 1 180 ? 0.844   16.137 -0.663 1.00 50.13  ? 169  CYS A C   1 
ATOM   1101 O  O   . CYS A 1 180 ? 0.174   15.115 -0.979 1.00 52.44  ? 169  CYS A O   1 
ATOM   1102 C  CB  . CYS A 1 180 ? 3.254   16.187 -0.948 1.00 47.42  ? 169  CYS A CB  1 
ATOM   1103 S  SG  . CYS A 1 180 ? 4.872   15.821 -0.246 1.00 47.42  ? 169  CYS A SG  1 
ATOM   1104 N  N   . GLY A 1 181 ? 0.463   17.392 -0.885 1.00 49.68  ? 170  GLY A N   1 
ATOM   1105 C  CA  . GLY A 1 181 ? -0.718  17.660 -1.681 1.00 51.53  ? 170  GLY A CA  1 
ATOM   1106 C  C   . GLY A 1 181 ? -1.144  19.096 -1.738 1.00 50.50  ? 170  GLY A C   1 
ATOM   1107 O  O   . GLY A 1 181 ? -0.810  19.846 -0.819 1.00 47.72  ? 170  GLY A O   1 
ATOM   1108 N  N   . ASN A 1 182 ? -1.881  19.447 -2.811 1.00 52.11  ? 171  ASN A N   1 
ATOM   1109 C  CA  . ASN A 1 182 ? -2.487  20.783 -2.979 1.00 53.60  ? 171  ASN A CA  1 
ATOM   1110 C  C   . ASN A 1 182 ? -3.982  20.888 -2.648 1.00 56.88  ? 171  ASN A C   1 
ATOM   1111 O  O   . ASN A 1 182 ? -4.608  21.928 -2.932 1.00 60.36  ? 171  ASN A O   1 
ATOM   1112 C  CB  . ASN A 1 182 ? -2.319  21.255 -4.404 1.00 55.03  ? 171  ASN A CB  1 
ATOM   1113 C  CG  . ASN A 1 182 ? -0.916  21.516 -4.753 1.00 54.75  ? 171  ASN A CG  1 
ATOM   1114 O  OD1 . ASN A 1 182 ? -0.087  21.721 -3.907 1.00 54.30  ? 171  ASN A OD1 1 
ATOM   1115 N  ND2 . ASN A 1 182 ? -0.638  21.537 -6.011 1.00 58.72  ? 171  ASN A ND2 1 
ATOM   1116 N  N   . ASN A 1 183 ? -4.519  19.877 -1.961 1.00 55.92  ? 172  ASN A N   1 
ATOM   1117 C  CA  . ASN A 1 183 ? -5.945  19.658 -1.799 1.00 56.99  ? 172  ASN A CA  1 
ATOM   1118 C  C   . ASN A 1 183 ? -6.309  20.671 -0.772 1.00 55.73  ? 172  ASN A C   1 
ATOM   1119 O  O   . ASN A 1 183 ? -5.714  20.656 0.284  1.00 56.58  ? 172  ASN A O   1 
ATOM   1120 C  CB  . ASN A 1 183 ? -6.256  18.326 -1.132 1.00 57.81  ? 172  ASN A CB  1 
ATOM   1121 C  CG  . ASN A 1 183 ? -5.454  17.173 -1.678 1.00 60.61  ? 172  ASN A CG  1 
ATOM   1122 O  OD1 . ASN A 1 183 ? -5.949  16.066 -1.722 1.00 67.82  ? 172  ASN A OD1 1 
ATOM   1123 N  ND2 . ASN A 1 183 ? -4.219  17.398 -2.061 1.00 60.67  ? 172  ASN A ND2 1 
ATOM   1124 N  N   . PRO A 1 184 ? -7.245  21.578 -1.042 1.00 55.80  ? 173  PRO A N   1 
ATOM   1125 C  CA  . PRO A 1 184 ? -7.580  22.396 0.097  1.00 54.63  ? 173  PRO A CA  1 
ATOM   1126 C  C   . PRO A 1 184 ? -8.602  21.710 1.004  1.00 55.58  ? 173  PRO A C   1 
ATOM   1127 O  O   . PRO A 1 184 ? -8.825  22.187 2.117  1.00 55.12  ? 173  PRO A O   1 
ATOM   1128 C  CB  . PRO A 1 184 ? -8.112  23.672 -0.538 1.00 56.99  ? 173  PRO A CB  1 
ATOM   1129 C  CG  . PRO A 1 184 ? -8.305  23.370 -1.988 1.00 58.56  ? 173  PRO A CG  1 
ATOM   1130 C  CD  . PRO A 1 184 ? -8.014  21.945 -2.231 1.00 58.00  ? 173  PRO A CD  1 
ATOM   1131 N  N   . ASP A 1 185 ? -9.173  20.582 0.555  1.00 57.30  ? 174  ASP A N   1 
ATOM   1132 C  CA  . ASP A 1 185 ? -10.139 19.843 1.350  1.00 59.79  ? 174  ASP A CA  1 
ATOM   1133 C  C   . ASP A 1 185 ? -9.535  18.667 2.104  1.00 61.47  ? 174  ASP A C   1 
ATOM   1134 O  O   . ASP A 1 185 ? -10.203 17.652 2.284  1.00 64.80  ? 174  ASP A O   1 
ATOM   1135 C  CB  . ASP A 1 185 ? -11.310 19.394 0.491  1.00 62.27  ? 174  ASP A CB  1 
ATOM   1136 C  CG  . ASP A 1 185 ? -10.946 18.348 -0.543 1.00 62.52  ? 174  ASP A CG  1 
ATOM   1137 O  OD1 . ASP A 1 185 ? -9.734  18.005 -0.691 1.00 58.15  ? 174  ASP A OD1 1 
ATOM   1138 O  OD2 . ASP A 1 185 ? -11.933 17.885 -1.196 1.00 65.37  ? 174  ASP A OD2 1 
ATOM   1139 N  N   . TYR A 1 186 ? -8.278  18.817 2.549  1.00 59.97  ? 175  TYR A N   1 
ATOM   1140 C  CA  . TYR A 1 186 ? -7.629  17.914 3.531  1.00 57.55  ? 175  TYR A CA  1 
ATOM   1141 C  C   . TYR A 1 186 ? -8.412  17.720 4.818  1.00 57.82  ? 175  TYR A C   1 
ATOM   1142 O  O   . TYR A 1 186 ? -8.355  16.642 5.493  1.00 58.72  ? 175  TYR A O   1 
ATOM   1143 C  CB  . TYR A 1 186 ? -6.249  18.423 3.905  1.00 55.97  ? 175  TYR A CB  1 
ATOM   1144 C  CG  . TYR A 1 186 ? -6.198  19.834 4.418  1.00 56.35  ? 175  TYR A CG  1 
ATOM   1145 C  CD1 . TYR A 1 186 ? -6.548  20.136 5.721  1.00 57.26  ? 175  TYR A CD1 1 
ATOM   1146 C  CD2 . TYR A 1 186 ? -5.733  20.865 3.600  1.00 57.29  ? 175  TYR A CD2 1 
ATOM   1147 C  CE1 . TYR A 1 186 ? -6.481  21.438 6.195  1.00 58.14  ? 175  TYR A CE1 1 
ATOM   1148 C  CE2 . TYR A 1 186 ? -5.648  22.169 4.051  1.00 57.50  ? 175  TYR A CE2 1 
ATOM   1149 C  CZ  . TYR A 1 186 ? -6.032  22.459 5.350  1.00 58.14  ? 175  TYR A CZ  1 
ATOM   1150 O  OH  . TYR A 1 186 ? -5.947  23.751 5.822  1.00 56.81  ? 175  TYR A OH  1 
ATOM   1151 N  N   . TRP A 1 187 ? -9.155  18.766 5.162  1.00 56.72  ? 176  TRP A N   1 
ATOM   1152 C  CA  . TRP A 1 187 ? -10.052 18.698 6.304  1.00 56.90  ? 176  TRP A CA  1 
ATOM   1153 C  C   . TRP A 1 187 ? -11.250 17.772 6.120  1.00 59.83  ? 176  TRP A C   1 
ATOM   1154 O  O   . TRP A 1 187 ? -12.052 17.670 7.001  1.00 60.97  ? 176  TRP A O   1 
ATOM   1155 C  CB  . TRP A 1 187 ? -10.504 20.105 6.672  1.00 56.51  ? 176  TRP A CB  1 
ATOM   1156 C  CG  . TRP A 1 187 ? -11.162 20.864 5.558  1.00 57.83  ? 176  TRP A CG  1 
ATOM   1157 C  CD1 . TRP A 1 187 ? -10.598 21.811 4.779  1.00 56.81  ? 176  TRP A CD1 1 
ATOM   1158 C  CD2 . TRP A 1 187 ? -12.509 20.727 5.105  1.00 60.97  ? 176  TRP A CD2 1 
ATOM   1159 N  NE1 . TRP A 1 187 ? -11.505 22.281 3.859  1.00 58.33  ? 176  TRP A NE1 1 
ATOM   1160 C  CE2 . TRP A 1 187 ? -12.688 21.623 4.048  1.00 60.75  ? 176  TRP A CE2 1 
ATOM   1161 C  CE3 . TRP A 1 187 ? -13.595 19.923 5.492  1.00 64.37  ? 176  TRP A CE3 1 
ATOM   1162 C  CZ2 . TRP A 1 187 ? -13.908 21.747 3.378  1.00 64.01  ? 176  TRP A CZ2 1 
ATOM   1163 C  CZ3 . TRP A 1 187 ? -14.817 20.062 4.817  1.00 66.47  ? 176  TRP A CZ3 1 
ATOM   1164 C  CH2 . TRP A 1 187 ? -14.954 20.964 3.778  1.00 65.70  ? 176  TRP A CH2 1 
ATOM   1165 N  N   . LYS A 1 188 ? -11.353 17.091 4.991  1.00 63.08  ? 177  LYS A N   1 
ATOM   1166 C  CA  . LYS A 1 188 ? -12.555 16.396 4.600  1.00 68.55  ? 177  LYS A CA  1 
ATOM   1167 C  C   . LYS A 1 188 ? -13.069 15.391 5.602  1.00 71.14  ? 177  LYS A C   1 
ATOM   1168 O  O   . LYS A 1 188 ? -14.285 15.349 5.833  1.00 72.63  ? 177  LYS A O   1 
ATOM   1169 C  CB  . LYS A 1 188 ? -12.407 15.725 3.215  1.00 71.71  ? 177  LYS A CB  1 
ATOM   1170 C  CG  . LYS A 1 188 ? -11.296 14.678 3.000  1.00 71.97  ? 177  LYS A CG  1 
ATOM   1171 C  CD  . LYS A 1 188 ? -11.105 14.268 1.505  1.00 75.61  ? 177  LYS A CD  1 
ATOM   1172 C  CE  . LYS A 1 188 ? -12.450 14.181 0.710  1.00 82.23  ? 177  LYS A CE  1 
ATOM   1173 N  NZ  . LYS A 1 188 ? -12.556 13.490 -0.636 1.00 84.44  ? 177  LYS A NZ  1 
ATOM   1174 N  N   . TYR A 1 189 ? -12.174 14.595 6.198  1.00 71.92  ? 178  TYR A N   1 
ATOM   1175 C  CA  . TYR A 1 189 ? -12.631 13.549 7.132  1.00 74.42  ? 178  TYR A CA  1 
ATOM   1176 C  C   . TYR A 1 189 ? -12.690 13.990 8.582  1.00 70.35  ? 178  TYR A C   1 
ATOM   1177 O  O   . TYR A 1 189 ? -12.854 13.169 9.467  1.00 70.25  ? 178  TYR A O   1 
ATOM   1178 C  CB  . TYR A 1 189 ? -11.775 12.302 7.019  1.00 78.78  ? 178  TYR A CB  1 
ATOM   1179 C  CG  . TYR A 1 189 ? -11.683 11.660 5.637  1.00 84.67  ? 178  TYR A CG  1 
ATOM   1180 C  CD1 . TYR A 1 189 ? -12.678 11.836 4.670  1.00 89.26  ? 178  TYR A CD1 1 
ATOM   1181 C  CD2 . TYR A 1 189 ? -10.617 10.821 5.331  1.00 85.25  ? 178  TYR A CD2 1 
ATOM   1182 C  CE1 . TYR A 1 189 ? -12.567 11.245 3.432  1.00 92.15  ? 178  TYR A CE1 1 
ATOM   1183 C  CE2 . TYR A 1 189 ? -10.504 10.219 4.099  1.00 87.30  ? 178  TYR A CE2 1 
ATOM   1184 C  CZ  . TYR A 1 189 ? -11.481 10.440 3.159  1.00 91.67  ? 178  TYR A CZ  1 
ATOM   1185 O  OH  . TYR A 1 189 ? -11.406 9.868  1.915  1.00 103.22 ? 178  TYR A OH  1 
ATOM   1186 N  N   . GLY A 1 190 ? -12.558 15.289 8.816  1.00 66.77  ? 179  GLY A N   1 
ATOM   1187 C  CA  . GLY A 1 190 ? -12.887 15.901 10.082 1.00 66.47  ? 179  GLY A CA  1 
ATOM   1188 C  C   . GLY A 1 190 ? -11.614 16.232 10.795 1.00 64.45  ? 179  GLY A C   1 
ATOM   1189 O  O   . GLY A 1 190 ? -10.628 15.509 10.691 1.00 61.72  ? 179  GLY A O   1 
ATOM   1190 N  N   . GLU A 1 191 ? -11.640 17.320 11.552 1.00 66.53  ? 180  GLU A N   1 
ATOM   1191 C  CA  . GLU A 1 191 ? -10.500 17.706 12.372 1.00 65.78  ? 180  GLU A CA  1 
ATOM   1192 C  C   . GLU A 1 191 ? -10.425 16.868 13.648 1.00 67.08  ? 180  GLU A C   1 
ATOM   1193 O  O   . GLU A 1 191 ? -11.432 16.358 14.134 1.00 72.99  ? 180  GLU A O   1 
ATOM   1194 C  CB  . GLU A 1 191 ? -10.630 19.174 12.736 1.00 69.14  ? 180  GLU A CB  1 
ATOM   1195 C  CG  . GLU A 1 191 ? -9.314  19.781 13.161 1.00 71.79  ? 180  GLU A CG  1 
ATOM   1196 C  CD  . GLU A 1 191 ? -9.420  21.184 13.710 1.00 77.11  ? 180  GLU A CD  1 
ATOM   1197 O  OE1 . GLU A 1 191 ? -10.525 21.793 13.604 1.00 81.98  ? 180  GLU A OE1 1 
ATOM   1198 O  OE2 . GLU A 1 191 ? -8.378  21.649 14.270 1.00 78.95  ? 180  GLU A OE2 1 
ATOM   1199 N  N   . ALA A 1 192 ? -9.238  16.733 14.203 1.00 64.81  ? 181  ALA A N   1 
ATOM   1200 C  CA  . ALA A 1 192 ? -9.043  16.031 15.464 1.00 67.85  ? 181  ALA A CA  1 
ATOM   1201 C  C   . ALA A 1 192 ? -8.397  16.944 16.498 1.00 67.79  ? 181  ALA A C   1 
ATOM   1202 O  O   . ALA A 1 192 ? -7.789  17.966 16.131 1.00 67.25  ? 181  ALA A O   1 
ATOM   1203 C  CB  . ALA A 1 192 ? -8.146  14.834 15.218 1.00 68.75  ? 181  ALA A CB  1 
ATOM   1204 N  N   . ALA A 1 193 ? -8.481  16.549 17.776 1.00 68.63  ? 182  ALA A N   1 
ATOM   1205 C  CA  . ALA A 1 193 ? -7.758  17.246 18.847 1.00 67.06  ? 182  ALA A CA  1 
ATOM   1206 C  C   . ALA A 1 193 ? -6.270  17.081 18.612 1.00 64.39  ? 182  ALA A C   1 
ATOM   1207 O  O   . ALA A 1 193 ? -5.824  15.997 18.273 1.00 64.31  ? 182  ALA A O   1 
ATOM   1208 C  CB  . ALA A 1 193 ? -8.132  16.684 20.190 1.00 70.19  ? 182  ALA A CB  1 
ATOM   1209 N  N   . SER A 1 194 ? -5.507  18.157 18.778 1.00 63.75  ? 183  SER A N   1 
ATOM   1210 C  CA  . SER A 1 194 ? -4.058  18.142 18.514 1.00 62.19  ? 183  SER A CA  1 
ATOM   1211 C  C   . SER A 1 194 ? -3.279  17.093 19.308 1.00 62.58  ? 183  SER A C   1 
ATOM   1212 O  O   . SER A 1 194 ? -2.222  16.670 18.859 1.00 60.29  ? 183  SER A O   1 
ATOM   1213 C  CB  . SER A 1 194 ? -3.453  19.503 18.824 1.00 62.93  ? 183  SER A CB  1 
ATOM   1214 O  OG  . SER A 1 194 ? -3.593  19.773 20.204 1.00 66.36  ? 183  SER A OG  1 
ATOM   1215 N  N   . THR A 1 195 ? -3.806  16.683 20.469 1.00 65.16  ? 184  THR A N   1 
ATOM   1216 C  CA  . THR A 1 195 ? -3.237  15.586 21.250 1.00 66.50  ? 184  THR A CA  1 
ATOM   1217 C  C   . THR A 1 195 ? -3.275  14.227 20.587 1.00 67.88  ? 184  THR A C   1 
ATOM   1218 O  O   . THR A 1 195 ? -2.630  13.299 21.091 1.00 72.81  ? 184  THR A O   1 
ATOM   1219 C  CB  . THR A 1 195 ? -3.917  15.418 22.608 1.00 69.84  ? 184  THR A CB  1 
ATOM   1220 O  OG1 . THR A 1 195 ? -5.339  15.356 22.457 1.00 71.39  ? 184  THR A OG1 1 
ATOM   1221 C  CG2 . THR A 1 195 ? -3.566  16.563 23.458 1.00 72.31  ? 184  THR A CG2 1 
ATOM   1222 N  N   . GLU A 1 196 ? -4.031  14.087 19.499 1.00 65.64  ? 185  GLU A N   1 
ATOM   1223 C  CA  . GLU A 1 196 ? -4.054  12.856 18.752 1.00 64.46  ? 185  GLU A CA  1 
ATOM   1224 C  C   . GLU A 1 196 ? -2.963  12.855 17.711 1.00 61.65  ? 185  GLU A C   1 
ATOM   1225 O  O   . GLU A 1 196 ? -2.616  11.799 17.193 1.00 63.98  ? 185  GLU A O   1 
ATOM   1226 C  CB  . GLU A 1 196 ? -5.408  12.673 18.109 1.00 65.96  ? 185  GLU A CB  1 
ATOM   1227 C  CG  . GLU A 1 196 ? -6.540  12.551 19.107 1.00 70.47  ? 185  GLU A CG  1 
ATOM   1228 C  CD  . GLU A 1 196 ? -7.881  12.354 18.434 1.00 73.24  ? 185  GLU A CD  1 
ATOM   1229 O  OE1 . GLU A 1 196 ? -7.980  11.529 17.512 1.00 72.95  ? 185  GLU A OE1 1 
ATOM   1230 O  OE2 . GLU A 1 196 ? -8.846  13.035 18.813 1.00 77.07  ? 185  GLU A OE2 1 
ATOM   1231 N  N   . CYS A 1 197 ? -2.406  14.025 17.410 1.00 59.56  ? 186  CYS A N   1 
ATOM   1232 C  CA  . CYS A 1 197 ? -1.265  14.129 16.503 1.00 57.91  ? 186  CYS A CA  1 
ATOM   1233 C  C   . CYS A 1 197 ? 0.055   14.255 17.277 1.00 56.37  ? 186  CYS A C   1 
ATOM   1234 O  O   . CYS A 1 197 ? 0.978   14.888 16.838 1.00 51.64  ? 186  CYS A O   1 
ATOM   1235 C  CB  . CYS A 1 197 ? -1.433  15.323 15.556 1.00 58.83  ? 186  CYS A CB  1 
ATOM   1236 S  SG  . CYS A 1 197 ? -2.532  15.154 14.116 1.00 59.63  ? 186  CYS A SG  1 
ATOM   1237 N  N   . ASN A 1 198 ? 0.163   13.594 18.412 1.00 60.88  ? 187  ASN A N   1 
ATOM   1238 C  CA  . ASN A 1 198 ? 1.357   13.707 19.227 1.00 63.35  ? 187  ASN A CA  1 
ATOM   1239 C  C   . ASN A 1 198 ? 2.406   12.582 19.057 1.00 62.11  ? 187  ASN A C   1 
ATOM   1240 O  O   . ASN A 1 198 ? 3.360   12.540 19.826 1.00 63.69  ? 187  ASN A O   1 
ATOM   1241 C  CB  . ASN A 1 198 ? 0.952   13.883 20.719 1.00 68.62  ? 187  ASN A CB  1 
ATOM   1242 C  CG  . ASN A 1 198 ? 0.644   15.354 21.107 1.00 69.80  ? 187  ASN A CG  1 
ATOM   1243 O  OD1 . ASN A 1 198 ? 0.805   16.302 20.312 1.00 67.54  ? 187  ASN A OD1 1 
ATOM   1244 N  ND2 . ASN A 1 198 ? 0.188   15.539 22.359 1.00 73.51  ? 187  ASN A ND2 1 
ATOM   1245 N  N   . SER A 1 199 ? 2.290   11.696 18.073 1.00 60.45  ? 188  SER A N   1 
ATOM   1246 C  CA  . SER A 1 199 ? 3.372   10.710 17.874 1.00 62.23  ? 188  SER A CA  1 
ATOM   1247 C  C   . SER A 1 199 ? 4.641   11.428 17.534 1.00 60.29  ? 188  SER A C   1 
ATOM   1248 O  O   . SER A 1 199 ? 4.620   12.347 16.754 1.00 62.02  ? 188  SER A O   1 
ATOM   1249 C  CB  . SER A 1 199 ? 3.095   9.731  16.750 1.00 62.80  ? 188  SER A CB  1 
ATOM   1250 O  OG  . SER A 1 199 ? 2.015   8.910  17.105 1.00 67.51  ? 188  SER A OG  1 
ATOM   1251 N  N   . VAL A 1 200 ? 5.743   11.026 18.133 1.00 60.86  ? 189  VAL A N   1 
ATOM   1252 C  CA  . VAL A 1 200 ? 7.005   11.745 17.942 1.00 57.96  ? 189  VAL A CA  1 
ATOM   1253 C  C   . VAL A 1 200 ? 7.534   11.621 16.570 1.00 53.77  ? 189  VAL A C   1 
ATOM   1254 O  O   . VAL A 1 200 ? 7.376   10.571 15.960 1.00 53.70  ? 189  VAL A O   1 
ATOM   1255 C  CB  . VAL A 1 200 ? 8.132   11.194 18.823 1.00 62.36  ? 189  VAL A CB  1 
ATOM   1256 C  CG1 . VAL A 1 200 ? 8.134   11.962 20.114 1.00 66.42  ? 189  VAL A CG1 1 
ATOM   1257 C  CG2 . VAL A 1 200 ? 8.027   9.669  19.070 1.00 64.85  ? 189  VAL A CG2 1 
ATOM   1258 N  N   . CYS A 1 201 ? 8.205   12.668 16.112 1.00 51.55  ? 190  CYS A N   1 
ATOM   1259 C  CA  . CYS A 1 201 ? 8.919   12.612 14.829 1.00 50.91  ? 190  CYS A CA  1 
ATOM   1260 C  C   . CYS A 1 201 ? 10.120  11.714 15.007 1.00 49.26  ? 190  CYS A C   1 
ATOM   1261 O  O   . CYS A 1 201 ? 10.865  11.811 15.981 1.00 50.30  ? 190  CYS A O   1 
ATOM   1262 C  CB  . CYS A 1 201 ? 9.332   14.007 14.313 1.00 50.93  ? 190  CYS A CB  1 
ATOM   1263 S  SG  . CYS A 1 201 ? 7.928   15.130 13.933 1.00 51.93  ? 190  CYS A SG  1 
ATOM   1264 N  N   . PHE A 1 202 ? 10.277  10.797 14.076 1.00 47.75  ? 191  PHE A N   1 
ATOM   1265 C  CA  . PHE A 1 202 ? 11.367  9.834  14.142 1.00 49.08  ? 191  PHE A CA  1 
ATOM   1266 C  C   . PHE A 1 202 ? 12.664  10.512 14.126 1.00 48.31  ? 191  PHE A C   1 
ATOM   1267 O  O   . PHE A 1 202 ? 13.596  9.999  14.695 1.00 51.57  ? 191  PHE A O   1 
ATOM   1268 C  CB  . PHE A 1 202 ? 11.355  8.851  12.964 1.00 49.50  ? 191  PHE A CB  1 
ATOM   1269 C  CG  . PHE A 1 202 ? 10.536  7.619  13.216 1.00 50.57  ? 191  PHE A CG  1 
ATOM   1270 C  CD1 . PHE A 1 202 ? 9.411   7.654  14.049 1.00 50.17  ? 191  PHE A CD1 1 
ATOM   1271 C  CD2 . PHE A 1 202 ? 10.885  6.419  12.611 1.00 51.72  ? 191  PHE A CD2 1 
ATOM   1272 C  CE1 . PHE A 1 202 ? 8.681   6.513  14.268 1.00 52.09  ? 191  PHE A CE1 1 
ATOM   1273 C  CE2 . PHE A 1 202 ? 10.150  5.274  12.840 1.00 52.87  ? 191  PHE A CE2 1 
ATOM   1274 C  CZ  . PHE A 1 202 ? 9.051   5.326  13.662 1.00 52.81  ? 191  PHE A CZ  1 
ATOM   1275 N  N   . GLY A 1 203 ? 12.717  11.635 13.433 1.00 46.87  ? 192  GLY A N   1 
ATOM   1276 C  CA  . GLY A 1 203 ? 13.920  12.439 13.335 1.00 47.76  ? 192  GLY A CA  1 
ATOM   1277 C  C   . GLY A 1 203 ? 14.172  13.414 14.465 1.00 48.02  ? 192  GLY A C   1 
ATOM   1278 O  O   . GLY A 1 203 ? 15.273  13.933 14.610 1.00 47.48  ? 192  GLY A O   1 
ATOM   1279 N  N   . ASP A 1 204 ? 13.165  13.691 15.263 1.00 50.34  ? 193  ASP A N   1 
ATOM   1280 C  CA  . ASP A 1 204 ? 13.347  14.644 16.328 1.00 53.90  ? 193  ASP A CA  1 
ATOM   1281 C  C   . ASP A 1 204 ? 12.254  14.477 17.357 1.00 55.11  ? 193  ASP A C   1 
ATOM   1282 O  O   . ASP A 1 204 ? 11.129  14.913 17.168 1.00 52.19  ? 193  ASP A O   1 
ATOM   1283 C  CB  . ASP A 1 204 ? 13.333  16.039 15.732 1.00 55.22  ? 193  ASP A CB  1 
ATOM   1284 C  CG  . ASP A 1 204 ? 13.657  17.099 16.723 1.00 58.21  ? 193  ASP A CG  1 
ATOM   1285 O  OD1 . ASP A 1 204 ? 13.532  16.877 17.954 1.00 58.75  ? 193  ASP A OD1 1 
ATOM   1286 O  OD2 . ASP A 1 204 ? 14.012  18.180 16.211 1.00 61.46  ? 193  ASP A OD2 1 
ATOM   1287 N  N   . HIS A 1 205 ? 12.623  13.892 18.476 1.00 60.03  ? 194  HIS A N   1 
ATOM   1288 C  CA  . HIS A 1 205 ? 11.676  13.581 19.514 1.00 63.87  ? 194  HIS A CA  1 
ATOM   1289 C  C   . HIS A 1 205 ? 11.070  14.782 20.231 1.00 61.80  ? 194  HIS A C   1 
ATOM   1290 O  O   . HIS A 1 205 ? 10.297  14.597 21.171 1.00 64.45  ? 194  HIS A O   1 
ATOM   1291 C  CB  . HIS A 1 205 ? 12.316  12.598 20.481 1.00 71.74  ? 194  HIS A CB  1 
ATOM   1292 C  CG  . HIS A 1 205 ? 12.538  11.242 19.867 1.00 80.66  ? 194  HIS A CG  1 
ATOM   1293 N  ND1 . HIS A 1 205 ? 12.870  10.116 20.610 1.00 88.30  ? 194  HIS A ND1 1 
ATOM   1294 C  CD2 . HIS A 1 205 ? 12.448  10.827 18.576 1.00 80.15  ? 194  HIS A CD2 1 
ATOM   1295 C  CE1 . HIS A 1 205 ? 12.996  9.076  19.802 1.00 86.79  ? 194  HIS A CE1 1 
ATOM   1296 N  NE2 . HIS A 1 205 ? 12.741  9.480  18.564 1.00 86.04  ? 194  HIS A NE2 1 
ATOM   1297 N  N   . THR A 1 206 ? 11.366  15.992 19.765 1.00 57.17  ? 195  THR A N   1 
ATOM   1298 C  CA  . THR A 1 206 ? 10.772  17.185 20.308 1.00 56.91  ? 195  THR A CA  1 
ATOM   1299 C  C   . THR A 1 206 ? 9.638   17.705 19.444 1.00 54.84  ? 195  THR A C   1 
ATOM   1300 O  O   . THR A 1 206 ? 9.029   18.724 19.753 1.00 55.22  ? 195  THR A O   1 
ATOM   1301 C  CB  . THR A 1 206 ? 11.841  18.275 20.473 1.00 58.18  ? 195  THR A CB  1 
ATOM   1302 O  OG1 . THR A 1 206 ? 12.203  18.825 19.187 1.00 58.00  ? 195  THR A OG1 1 
ATOM   1303 C  CG2 . THR A 1 206 ? 13.065  17.691 21.231 1.00 59.45  ? 195  THR A CG2 1 
ATOM   1304 N  N   . GLN A 1 207 ? 9.364   17.022 18.345 1.00 54.01  ? 196  GLN A N   1 
ATOM   1305 C  CA  . GLN A 1 207 ? 8.333   17.461 17.411 1.00 53.17  ? 196  GLN A CA  1 
ATOM   1306 C  C   . GLN A 1 207 ? 7.235   16.401 17.246 1.00 52.41  ? 196  GLN A C   1 
ATOM   1307 O  O   . GLN A 1 207 ? 7.507   15.189 17.154 1.00 54.60  ? 196  GLN A O   1 
ATOM   1308 C  CB  . GLN A 1 207 ? 8.934   17.771 16.039 1.00 52.37  ? 196  GLN A CB  1 
ATOM   1309 C  CG  . GLN A 1 207 ? 10.144  18.686 16.068 1.00 55.40  ? 196  GLN A CG  1 
ATOM   1310 C  CD  . GLN A 1 207 ? 10.686  19.045 14.689 1.00 55.97  ? 196  GLN A CD  1 
ATOM   1311 O  OE1 . GLN A 1 207 ? 11.603  19.840 14.573 1.00 63.18  ? 196  GLN A OE1 1 
ATOM   1312 N  NE2 . GLN A 1 207 ? 10.146  18.467 13.663 1.00 53.52  ? 196  GLN A NE2 1 
ATOM   1313 N  N   . PRO A 1 208 ? 5.986   16.844 17.199 1.00 50.43  ? 197  PRO A N   1 
ATOM   1314 C  CA  . PRO A 1 208 ? 4.918   15.979 16.802 1.00 50.01  ? 197  PRO A CA  1 
ATOM   1315 C  C   . PRO A 1 208 ? 4.913   15.692 15.292 1.00 46.78  ? 197  PRO A C   1 
ATOM   1316 O  O   . PRO A 1 208 ? 5.077   16.605 14.507 1.00 41.51  ? 197  PRO A O   1 
ATOM   1317 C  CB  . PRO A 1 208 ? 3.685   16.787 17.180 1.00 51.50  ? 197  PRO A CB  1 
ATOM   1318 C  CG  . PRO A 1 208 ? 4.093   18.177 16.952 1.00 51.22  ? 197  PRO A CG  1 
ATOM   1319 C  CD  . PRO A 1 208 ? 5.499   18.197 17.473 1.00 51.69  ? 197  PRO A CD  1 
ATOM   1320 N  N   . CYS A 1 209 ? 4.694   14.419 14.944 1.00 48.29  ? 198  CYS A N   1 
ATOM   1321 C  CA  . CYS A 1 209 ? 4.538   13.940 13.576 1.00 48.82  ? 198  CYS A CA  1 
ATOM   1322 C  C   . CYS A 1 209 ? 3.234   13.120 13.406 1.00 50.33  ? 198  CYS A C   1 
ATOM   1323 O  O   . CYS A 1 209 ? 3.225   12.016 12.840 1.00 51.15  ? 198  CYS A O   1 
ATOM   1324 C  CB  . CYS A 1 209 ? 5.801   13.174 13.146 1.00 48.52  ? 198  CYS A CB  1 
ATOM   1325 S  SG  . CYS A 1 209 ? 7.033   14.240 12.333 1.00 48.98  ? 198  CYS A SG  1 
ATOM   1326 N  N   . GLY A 1 210 ? 2.129   13.684 13.890 1.00 51.30  ? 199  GLY A N   1 
ATOM   1327 C  CA  . GLY A 1 210 ? 0.816   13.078 13.705 1.00 54.94  ? 199  GLY A CA  1 
ATOM   1328 C  C   . GLY A 1 210 ? 0.571   11.860 14.564 1.00 58.17  ? 199  GLY A C   1 
ATOM   1329 O  O   . GLY A 1 210 ? 1.084   11.789 15.658 1.00 63.62  ? 199  GLY A O   1 
ATOM   1330 N  N   . GLY A 1 211 ? -0.239  10.923 14.087 1.00 59.34  ? 200  GLY A N   1 
ATOM   1331 C  CA  . GLY A 1 211 ? -0.654  9.758  14.881 1.00 63.39  ? 200  GLY A CA  1 
ATOM   1332 C  C   . GLY A 1 211 ? -1.237  8.772  13.918 1.00 66.51  ? 200  GLY A C   1 
ATOM   1333 O  O   . GLY A 1 211 ? -1.464  9.153  12.785 1.00 70.53  ? 200  GLY A O   1 
ATOM   1334 N  N   . ASP A 1 212 ? -1.456  7.513  14.298 1.00 71.41  ? 201  ASP A N   1 
ATOM   1335 C  CA  . ASP A 1 212 ? -2.018  6.563  13.305 1.00 73.96  ? 201  ASP A CA  1 
ATOM   1336 C  C   . ASP A 1 212 ? -3.457  6.970  13.128 1.00 69.55  ? 201  ASP A C   1 
ATOM   1337 O  O   . ASP A 1 212 ? -4.148  7.200  14.077 1.00 67.68  ? 201  ASP A O   1 
ATOM   1338 C  CB  . ASP A 1 212 ? -1.851  5.062  13.627 1.00 80.21  ? 201  ASP A CB  1 
ATOM   1339 C  CG  . ASP A 1 212 ? -2.486  4.690  14.902 1.00 87.36  ? 201  ASP A CG  1 
ATOM   1340 O  OD1 . ASP A 1 212 ? -2.434  5.566  15.780 1.00 90.38  ? 201  ASP A OD1 1 
ATOM   1341 O  OD2 . ASP A 1 212 ? -3.034  3.562  15.044 1.00 97.36  ? 201  ASP A OD2 1 
ATOM   1342 N  N   . GLY A 1 213 ? -3.834  7.156  11.876 1.00 67.25  ? 202  GLY A N   1 
ATOM   1343 C  CA  . GLY A 1 213 ? -5.114  7.693  11.508 1.00 66.12  ? 202  GLY A CA  1 
ATOM   1344 C  C   . GLY A 1 213 ? -5.175  9.177  11.646 1.00 60.87  ? 202  GLY A C   1 
ATOM   1345 O  O   . GLY A 1 213 ? -6.217  9.738  11.570 1.00 62.39  ? 202  GLY A O   1 
ATOM   1346 N  N   . ARG A 1 214 ? -4.067  9.827  11.876 1.00 57.74  ? 203  ARG A N   1 
ATOM   1347 C  CA  . ARG A 1 214 ? -4.083  11.238 12.205 1.00 55.45  ? 203  ARG A CA  1 
ATOM   1348 C  C   . ARG A 1 214 ? -2.973  11.913 11.484 1.00 52.66  ? 203  ARG A C   1 
ATOM   1349 O  O   . ARG A 1 214 ? -1.888  11.370 11.330 1.00 54.31  ? 203  ARG A O   1 
ATOM   1350 C  CB  . ARG A 1 214 ? -3.906  11.421 13.701 1.00 56.54  ? 203  ARG A CB  1 
ATOM   1351 C  CG  . ARG A 1 214 ? -5.079  10.897 14.505 1.00 60.47  ? 203  ARG A CG  1 
ATOM   1352 C  CD  . ARG A 1 214 ? -6.287  11.766 14.235 1.00 60.94  ? 203  ARG A CD  1 
ATOM   1353 N  NE  . ARG A 1 214 ? -7.465  11.361 14.972 1.00 63.88  ? 203  ARG A NE  1 
ATOM   1354 C  CZ  . ARG A 1 214 ? -8.295  10.393 14.617 1.00 66.90  ? 203  ARG A CZ  1 
ATOM   1355 N  NH1 . ARG A 1 214 ? -8.100  9.659  13.535 1.00 66.76  ? 203  ARG A NH1 1 
ATOM   1356 N  NH2 . ARG A 1 214 ? -9.351  10.164 15.372 1.00 71.65  ? 203  ARG A NH2 1 
ATOM   1357 N  N   . ILE A 1 215 ? -3.218  13.103 11.007 1.00 51.85  ? 204  ILE A N   1 
ATOM   1358 C  CA  . ILE A 1 215 ? -2.215  13.699 10.160 1.00 51.71  ? 204  ILE A CA  1 
ATOM   1359 C  C   . ILE A 1 215 ? -2.125  15.162 10.505 1.00 50.80  ? 204  ILE A C   1 
ATOM   1360 O  O   . ILE A 1 215 ? -3.143  15.848 10.627 1.00 51.09  ? 204  ILE A O   1 
ATOM   1361 C  CB  . ILE A 1 215 ? -2.470  13.367 8.666  1.00 53.56  ? 204  ILE A CB  1 
ATOM   1362 C  CG1 . ILE A 1 215 ? -1.339  13.909 7.805  1.00 54.41  ? 204  ILE A CG1 1 
ATOM   1363 C  CG2 . ILE A 1 215 ? -3.806  13.889 8.175  1.00 54.19  ? 204  ILE A CG2 1 
ATOM   1364 C  CD1 . ILE A 1 215 ? -1.400  13.454 6.361  1.00 56.68  ? 204  ILE A CD1 1 
ATOM   1365 N  N   . ILE A 1 216 ? -0.899  15.603 10.750 1.00 50.69  ? 205  ILE A N   1 
ATOM   1366 C  CA  . ILE A 1 216 ? -0.656  16.981 11.162 1.00 53.66  ? 205  ILE A CA  1 
ATOM   1367 C  C   . ILE A 1 216 ? -0.214  17.736 9.920  1.00 51.67  ? 205  ILE A C   1 
ATOM   1368 O  O   . ILE A 1 216 ? 0.637   17.247 9.215  1.00 55.72  ? 205  ILE A O   1 
ATOM   1369 C  CB  . ILE A 1 216 ? 0.355   17.066 12.319 1.00 55.64  ? 205  ILE A CB  1 
ATOM   1370 C  CG1 . ILE A 1 216 ? 0.371   18.474 12.915 1.00 57.66  ? 205  ILE A CG1 1 
ATOM   1371 C  CG2 . ILE A 1 216 ? 1.759   16.687 11.890 1.00 56.97  ? 205  ILE A CG2 1 
ATOM   1372 C  CD1 . ILE A 1 216 ? 1.051   18.528 14.284 1.00 59.42  ? 205  ILE A CD1 1 
ATOM   1373 N  N   . LEU A 1 217 ? -0.830  18.877 9.629  1.00 49.39  ? 206  LEU A N   1 
ATOM   1374 C  CA  . LEU A 1 217 ? -0.763  19.494 8.305  1.00 47.92  ? 206  LEU A CA  1 
ATOM   1375 C  C   . LEU A 1 217 ? 0.022   20.764 8.401  1.00 47.36  ? 206  LEU A C   1 
ATOM   1376 O  O   . LEU A 1 217 ? -0.230  21.580 9.287  1.00 49.91  ? 206  LEU A O   1 
ATOM   1377 C  CB  . LEU A 1 217 ? -2.154  19.860 7.808  1.00 50.31  ? 206  LEU A CB  1 
ATOM   1378 C  CG  . LEU A 1 217 ? -2.950  18.903 6.929  1.00 53.37  ? 206  LEU A CG  1 
ATOM   1379 C  CD1 . LEU A 1 217 ? -2.555  19.068 5.490  1.00 54.74  ? 206  LEU A CD1 1 
ATOM   1380 C  CD2 . LEU A 1 217 ? -2.747  17.460 7.300  1.00 55.51  ? 206  LEU A CD2 1 
ATOM   1381 N  N   . PHE A 1 218 ? 0.936   20.986 7.468  1.00 45.11  ? 207  PHE A N   1 
ATOM   1382 C  CA  . PHE A 1 218 ? 1.691   22.215 7.470  1.00 44.46  ? 207  PHE A CA  1 
ATOM   1383 C  C   . PHE A 1 218 ? 1.682   22.878 6.137  1.00 44.76  ? 207  PHE A C   1 
ATOM   1384 O  O   . PHE A 1 218 ? 1.698   22.196 5.129  1.00 45.08  ? 207  PHE A O   1 
ATOM   1385 C  CB  . PHE A 1 218 ? 3.122   21.934 7.888  1.00 44.58  ? 207  PHE A CB  1 
ATOM   1386 C  CG  . PHE A 1 218 ? 3.296   21.825 9.363  1.00 45.30  ? 207  PHE A CG  1 
ATOM   1387 C  CD1 . PHE A 1 218 ? 3.058   20.609 9.993  1.00 46.12  ? 207  PHE A CD1 1 
ATOM   1388 C  CD2 . PHE A 1 218 ? 3.647   22.935 10.133 1.00 45.84  ? 207  PHE A CD2 1 
ATOM   1389 C  CE1 . PHE A 1 218 ? 3.188   20.463 11.358 1.00 45.62  ? 207  PHE A CE1 1 
ATOM   1390 C  CE2 . PHE A 1 218 ? 3.742   22.820 11.503 1.00 45.93  ? 207  PHE A CE2 1 
ATOM   1391 C  CZ  . PHE A 1 218 ? 3.519   21.585 12.114 1.00 45.72  ? 207  PHE A CZ  1 
ATOM   1392 N  N   . ASP A 1 219 ? 1.685   24.209 6.145  1.00 46.80  ? 208  ASP A N   1 
ATOM   1393 C  CA  . ASP A 1 219 ? 1.941   25.004 4.926  1.00 50.90  ? 208  ASP A CA  1 
ATOM   1394 C  C   . ASP A 1 219 ? 3.402   24.795 4.486  1.00 48.16  ? 208  ASP A C   1 
ATOM   1395 O  O   . ASP A 1 219 ? 4.273   24.921 5.317  1.00 46.49  ? 208  ASP A O   1 
ATOM   1396 C  CB  . ASP A 1 219 ? 1.643   26.493 5.209  1.00 55.02  ? 208  ASP A CB  1 
ATOM   1397 C  CG  . ASP A 1 219 ? 1.856   27.416 3.994  1.00 58.61  ? 208  ASP A CG  1 
ATOM   1398 O  OD1 . ASP A 1 219 ? 2.433   27.011 2.957  1.00 59.42  ? 208  ASP A OD1 1 
ATOM   1399 O  OD2 . ASP A 1 219 ? 1.450   28.588 4.108  1.00 61.53  ? 208  ASP A OD2 1 
ATOM   1400 N  N   . THR A 1 220 ? 3.661   24.488 3.207  1.00 47.12  ? 209  THR A N   1 
ATOM   1401 C  CA  . THR A 1 220 ? 5.033   24.165 2.765  1.00 48.16  ? 209  THR A CA  1 
ATOM   1402 C  C   . THR A 1 220 ? 5.983   25.360 2.678  1.00 48.45  ? 209  THR A C   1 
ATOM   1403 O  O   . THR A 1 220 ? 7.199   25.194 2.484  1.00 47.88  ? 209  THR A O   1 
ATOM   1404 C  CB  . THR A 1 220 ? 5.101   23.358 1.452  1.00 49.90  ? 209  THR A CB  1 
ATOM   1405 O  OG1 . THR A 1 220 ? 4.583   24.115 0.364  1.00 51.67  ? 209  THR A OG1 1 
ATOM   1406 C  CG2 . THR A 1 220 ? 4.321   22.069 1.602  1.00 50.20  ? 209  THR A CG2 1 
ATOM   1407 N  N   . LEU A 1 221 ? 5.443   26.550 2.891  1.00 48.28  ? 210  LEU A N   1 
ATOM   1408 C  CA  . LEU A 1 221 ? 6.276   27.728 2.999  1.00 50.59  ? 210  LEU A CA  1 
ATOM   1409 C  C   . LEU A 1 221 ? 7.085   27.811 4.263  1.00 50.33  ? 210  LEU A C   1 
ATOM   1410 O  O   . LEU A 1 221 ? 8.089   28.510 4.321  1.00 54.18  ? 210  LEU A O   1 
ATOM   1411 C  CB  . LEU A 1 221 ? 5.423   28.993 2.870  1.00 52.48  ? 210  LEU A CB  1 
ATOM   1412 C  CG  . LEU A 1 221 ? 4.945   29.185 1.435  1.00 53.11  ? 210  LEU A CG  1 
ATOM   1413 C  CD1 . LEU A 1 221 ? 4.090   30.432 1.438  1.00 55.13  ? 210  LEU A CD1 1 
ATOM   1414 C  CD2 . LEU A 1 221 ? 6.108   29.225 0.405  1.00 54.65  ? 210  LEU A CD2 1 
ATOM   1415 N  N   . VAL A 1 222 ? 6.656   27.104 5.282  1.00 48.20  ? 211  VAL A N   1 
ATOM   1416 C  CA  . VAL A 1 222 ? 7.270   27.238 6.573  1.00 48.25  ? 211  VAL A CA  1 
ATOM   1417 C  C   . VAL A 1 222 ? 8.713   26.823 6.520  1.00 47.04  ? 211  VAL A C   1 
ATOM   1418 O  O   . VAL A 1 222 ? 8.998   25.670 6.220  1.00 45.84  ? 211  VAL A O   1 
ATOM   1419 C  CB  . VAL A 1 222 ? 6.596   26.311 7.567  1.00 48.02  ? 211  VAL A CB  1 
ATOM   1420 C  CG1 . VAL A 1 222 ? 7.328   26.378 8.902  1.00 49.94  ? 211  VAL A CG1 1 
ATOM   1421 C  CG2 . VAL A 1 222 ? 5.110   26.647 7.722  1.00 48.71  ? 211  VAL A CG2 1 
ATOM   1422 N  N   . GLY A 1 223 ? 9.613   27.752 6.791  1.00 48.26  ? 212  GLY A N   1 
ATOM   1423 C  CA  . GLY A 1 223 ? 11.020  27.402 6.888  1.00 49.30  ? 212  GLY A CA  1 
ATOM   1424 C  C   . GLY A 1 223 ? 11.790  27.353 5.595  1.00 50.68  ? 212  GLY A C   1 
ATOM   1425 O  O   . GLY A 1 223 ? 12.937  26.883 5.575  1.00 49.95  ? 212  GLY A O   1 
ATOM   1426 N  N   . ALA A 1 224 ? 11.183  27.861 4.525  1.00 54.88  ? 213  ALA A N   1 
ATOM   1427 C  CA  . ALA A 1 224 ? 11.847  27.905 3.229  1.00 56.40  ? 213  ALA A CA  1 
ATOM   1428 C  C   . ALA A 1 224 ? 12.988  28.881 3.335  1.00 57.57  ? 213  ALA A C   1 
ATOM   1429 O  O   . ALA A 1 224 ? 12.944  29.831 4.143  1.00 56.18  ? 213  ALA A O   1 
ATOM   1430 C  CB  . ALA A 1 224 ? 10.909  28.342 2.119  1.00 56.19  ? 213  ALA A CB  1 
ATOM   1431 N  N   . CYS A 1 225 ? 14.006  28.637 2.515  1.00 60.27  ? 214  CYS A N   1 
ATOM   1432 C  CA  . CYS A 1 225 ? 15.126  29.519 2.449  1.00 61.49  ? 214  CYS A CA  1 
ATOM   1433 C  C   . CYS A 1 225 ? 14.778  30.585 1.454  1.00 61.32  ? 214  CYS A C   1 
ATOM   1434 O  O   . CYS A 1 225 ? 15.003  30.421 0.276  1.00 62.10  ? 214  CYS A O   1 
ATOM   1435 C  CB  . CYS A 1 225 ? 16.381  28.778 2.058  1.00 65.36  ? 214  CYS A CB  1 
ATOM   1436 S  SG  . CYS A 1 225 ? 17.819  29.877 1.950  1.00 72.51  ? 214  CYS A SG  1 
ATOM   1437 N  N   . GLY A 1 226 ? 14.203  31.681 1.947  1.00 62.59  ? 215  GLY A N   1 
ATOM   1438 C  CA  . GLY A 1 226 ? 13.771  32.806 1.111  1.00 64.28  ? 215  GLY A CA  1 
ATOM   1439 C  C   . GLY A 1 226 ? 12.355  32.723 0.561  1.00 65.95  ? 215  GLY A C   1 
ATOM   1440 O  O   . GLY A 1 226 ? 11.650  31.722 0.681  1.00 69.15  ? 215  GLY A O   1 
ATOM   1441 N  N   . GLY A 1 227 ? 11.932  33.803 -0.049 1.00 68.03  ? 216  GLY A N   1 
ATOM   1442 C  CA  . GLY A 1 227 ? 10.605  33.875 -0.601 1.00 71.00  ? 216  GLY A CA  1 
ATOM   1443 C  C   . GLY A 1 227 ? 10.299  35.265 -1.102 1.00 73.03  ? 216  GLY A C   1 
ATOM   1444 O  O   . GLY A 1 227 ? 11.075  36.213 -0.933 1.00 74.79  ? 216  GLY A O   1 
ATOM   1445 N  N   . ASN A 1 228 ? 9.166   35.370 -1.755 1.00 74.06  ? 217  ASN A N   1 
ATOM   1446 C  CA  . ASN A 1 228 ? 8.574   36.636 -1.989 1.00 75.78  ? 217  ASN A CA  1 
ATOM   1447 C  C   . ASN A 1 228 ? 7.354   36.638 -1.109 1.00 74.22  ? 217  ASN A C   1 
ATOM   1448 O  O   . ASN A 1 228 ? 6.713   35.614 -0.952 1.00 75.76  ? 217  ASN A O   1 
ATOM   1449 C  CB  . ASN A 1 228 ? 8.268   36.764 -3.465 1.00 80.88  ? 217  ASN A CB  1 
ATOM   1450 C  CG  . ASN A 1 228 ? 9.535   36.739 -4.311 1.00 82.70  ? 217  ASN A CG  1 
ATOM   1451 O  OD1 . ASN A 1 228 ? 10.456  37.552 -4.124 1.00 81.47  ? 217  ASN A OD1 1 
ATOM   1452 N  ND2 . ASN A 1 228 ? 9.586   35.810 -5.247 1.00 85.80  ? 217  ASN A ND2 1 
ATOM   1453 N  N   . TYR A 1 229 ? 7.095   37.762 -0.465 1.00 73.98  ? 218  TYR A N   1 
ATOM   1454 C  CA  . TYR A 1 229 ? 5.880   37.971 0.298  1.00 76.12  ? 218  TYR A CA  1 
ATOM   1455 C  C   . TYR A 1 229 ? 5.202   39.246 -0.162 1.00 79.32  ? 218  TYR A C   1 
ATOM   1456 O  O   . TYR A 1 229 ? 5.872   40.262 -0.432 1.00 81.17  ? 218  TYR A O   1 
ATOM   1457 C  CB  . TYR A 1 229 ? 6.196   38.065 1.775  1.00 74.31  ? 218  TYR A CB  1 
ATOM   1458 C  CG  . TYR A 1 229 ? 6.477   36.715 2.347  1.00 75.44  ? 218  TYR A CG  1 
ATOM   1459 C  CD1 . TYR A 1 229 ? 7.747   36.132 2.244  1.00 74.19  ? 218  TYR A CD1 1 
ATOM   1460 C  CD2 . TYR A 1 229 ? 5.452   35.971 2.959  1.00 78.97  ? 218  TYR A CD2 1 
ATOM   1461 C  CE1 . TYR A 1 229 ? 7.999   34.865 2.785  1.00 72.55  ? 218  TYR A CE1 1 
ATOM   1462 C  CE2 . TYR A 1 229 ? 5.691   34.714 3.495  1.00 76.53  ? 218  TYR A CE2 1 
ATOM   1463 C  CZ  . TYR A 1 229 ? 6.959   34.169 3.412  1.00 74.06  ? 218  TYR A CZ  1 
ATOM   1464 O  OH  . TYR A 1 229 ? 7.147   32.921 3.943  1.00 74.15  ? 218  TYR A OH  1 
ATOM   1465 N  N   . SER A 1 230 ? 3.875   39.189 -0.264 1.00 79.06  ? 219  SER A N   1 
ATOM   1466 C  CA  . SER A 1 230 ? 3.074   40.370 -0.565 1.00 78.93  ? 219  SER A CA  1 
ATOM   1467 C  C   . SER A 1 230 ? 1.942   40.608 0.401  1.00 80.78  ? 219  SER A C   1 
ATOM   1468 O  O   . SER A 1 230 ? 1.436   41.699 0.463  1.00 80.54  ? 219  SER A O   1 
ATOM   1469 C  CB  . SER A 1 230 ? 2.527   40.202 -1.944 1.00 80.56  ? 219  SER A CB  1 
ATOM   1470 O  OG  . SER A 1 230 ? 2.225   38.842 -2.103 1.00 79.07  ? 219  SER A OG  1 
ATOM   1471 N  N   . ALA A 1 231 ? 1.564   39.606 1.178  1.00 82.58  ? 220  ALA A N   1 
ATOM   1472 C  CA  . ALA A 1 231 ? 0.403   39.709 2.056  1.00 88.94  ? 220  ALA A CA  1 
ATOM   1473 C  C   . ALA A 1 231 ? 0.443   40.933 2.992  1.00 91.09  ? 220  ALA A C   1 
ATOM   1474 O  O   . ALA A 1 231 ? 1.512   41.489 3.252  1.00 86.67  ? 220  ALA A O   1 
ATOM   1475 C  CB  . ALA A 1 231 ? 0.270   38.417 2.864  1.00 88.67  ? 220  ALA A CB  1 
ATOM   1476 N  N   . MET A 1 232 ? -0.730  41.344 3.486  1.00 98.08  ? 221  MET A N   1 
ATOM   1477 C  CA  . MET A 1 232 ? -0.817  42.447 4.469  1.00 101.73 ? 221  MET A CA  1 
ATOM   1478 C  C   . MET A 1 232 ? 0.051   42.159 5.693  1.00 96.42  ? 221  MET A C   1 
ATOM   1479 O  O   . MET A 1 232 ? 0.674   43.058 6.248  1.00 95.20  ? 221  MET A O   1 
ATOM   1480 C  CB  . MET A 1 232 ? -2.278  42.722 4.922  1.00 109.76 ? 221  MET A CB  1 
ATOM   1481 C  CG  . MET A 1 232 ? -2.585  44.212 5.169  1.00 114.66 ? 221  MET A CG  1 
ATOM   1482 S  SD  . MET A 1 232 ? -2.204  45.340 3.783  1.00 114.63 ? 221  MET A SD  1 
ATOM   1483 C  CE  . MET A 1 232 ? -3.144  44.527 2.480  1.00 116.72 ? 221  MET A CE  1 
ATOM   1484 N  N   . SER A 1 233 ? 0.061   40.898 6.111  1.00 93.48  ? 222  SER A N   1 
ATOM   1485 C  CA  . SER A 1 233 ? 0.925   40.441 7.177  1.00 88.73  ? 222  SER A CA  1 
ATOM   1486 C  C   . SER A 1 233 ? 1.114   38.940 7.070  1.00 84.75  ? 222  SER A C   1 
ATOM   1487 O  O   . SER A 1 233 ? 0.240   38.223 6.613  1.00 85.24  ? 222  SER A O   1 
ATOM   1488 C  CB  . SER A 1 233 ? 0.311   40.820 8.539  1.00 91.88  ? 222  SER A CB  1 
ATOM   1489 O  OG  . SER A 1 233 ? -0.135  39.693 9.255  1.00 91.87  ? 222  SER A OG  1 
ATOM   1490 N  N   . SER A 1 234 ? 2.268   38.470 7.496  1.00 83.07  ? 223  SER A N   1 
ATOM   1491 C  CA  . SER A 1 234 ? 2.494   37.022 7.673  1.00 82.43  ? 223  SER A CA  1 
ATOM   1492 C  C   . SER A 1 234 ? 3.758   36.776 8.497  1.00 78.24  ? 223  SER A C   1 
ATOM   1493 O  O   . SER A 1 234 ? 4.429   37.735 8.958  1.00 77.63  ? 223  SER A O   1 
ATOM   1494 C  CB  . SER A 1 234 ? 2.526   36.274 6.334  1.00 81.61  ? 223  SER A CB  1 
ATOM   1495 O  OG  . SER A 1 234 ? 3.118   37.071 5.351  1.00 84.44  ? 223  SER A OG  1 
ATOM   1496 N  N   . VAL A 1 235 ? 4.033   35.501 8.747  1.00 73.53  ? 224  VAL A N   1 
ATOM   1497 C  CA  . VAL A 1 235 ? 5.146   35.133 9.585  1.00 70.97  ? 224  VAL A CA  1 
ATOM   1498 C  C   . VAL A 1 235 ? 6.194   34.488 8.735  1.00 68.95  ? 224  VAL A C   1 
ATOM   1499 O  O   . VAL A 1 235 ? 5.877   33.701 7.839  1.00 69.86  ? 224  VAL A O   1 
ATOM   1500 C  CB  . VAL A 1 235 ? 4.737   34.152 10.673 1.00 70.39  ? 224  VAL A CB  1 
ATOM   1501 C  CG1 . VAL A 1 235 ? 5.954   33.772 11.517 1.00 69.28  ? 224  VAL A CG1 1 
ATOM   1502 C  CG2 . VAL A 1 235 ? 3.632   34.760 11.517 1.00 73.13  ? 224  VAL A CG2 1 
ATOM   1503 N  N   . VAL A 1 236 ? 7.444   34.824 9.021  1.00 67.23  ? 225  VAL A N   1 
ATOM   1504 C  CA  . VAL A 1 236 ? 8.555   34.230 8.317  1.00 65.34  ? 225  VAL A CA  1 
ATOM   1505 C  C   . VAL A 1 236 ? 9.496   33.618 9.327  1.00 65.52  ? 225  VAL A C   1 
ATOM   1506 O  O   . VAL A 1 236 ? 9.981   34.299 10.249 1.00 67.80  ? 225  VAL A O   1 
ATOM   1507 C  CB  . VAL A 1 236 ? 9.289   35.258 7.488  1.00 63.78  ? 225  VAL A CB  1 
ATOM   1508 C  CG1 . VAL A 1 236 ? 10.335  34.576 6.622  1.00 63.90  ? 225  VAL A CG1 1 
ATOM   1509 C  CG2 . VAL A 1 236 ? 8.281   35.985 6.640  1.00 64.70  ? 225  VAL A CG2 1 
ATOM   1510 N  N   . TYR A 1 237 ? 9.750   32.326 9.155  1.00 62.10  ? 226  TYR A N   1 
ATOM   1511 C  CA  . TYR A 1 237 ? 10.541  31.595 10.121 1.00 59.40  ? 226  TYR A CA  1 
ATOM   1512 C  C   . TYR A 1 237 ? 11.955  31.432 9.595  1.00 56.67  ? 226  TYR A C   1 
ATOM   1513 O  O   . TYR A 1 237 ? 12.175  31.545 8.370  1.00 55.62  ? 226  TYR A O   1 
ATOM   1514 C  CB  . TYR A 1 237 ? 9.934   30.223 10.359 1.00 58.52  ? 226  TYR A CB  1 
ATOM   1515 C  CG  . TYR A 1 237 ? 8.605   30.170 11.063 1.00 58.11  ? 226  TYR A CG  1 
ATOM   1516 C  CD1 . TYR A 1 237 ? 8.508   30.222 12.455 1.00 59.40  ? 226  TYR A CD1 1 
ATOM   1517 C  CD2 . TYR A 1 237 ? 7.455   29.961 10.351 1.00 57.47  ? 226  TYR A CD2 1 
ATOM   1518 C  CE1 . TYR A 1 237 ? 7.277   30.113 13.096 1.00 60.49  ? 226  TYR A CE1 1 
ATOM   1519 C  CE2 . TYR A 1 237 ? 6.226   29.839 10.987 1.00 58.98  ? 226  TYR A CE2 1 
ATOM   1520 C  CZ  . TYR A 1 237 ? 6.139   29.926 12.346 1.00 60.19  ? 226  TYR A CZ  1 
ATOM   1521 O  OH  . TYR A 1 237 ? 4.896   29.820 12.890 1.00 62.47  ? 226  TYR A OH  1 
ATOM   1522 N  N   . SER A 1 238 ? 12.885  31.119 10.507 1.00 55.78  ? 227  SER A N   1 
ATOM   1523 C  CA  . SER A 1 238 ? 14.240  30.762 10.114 1.00 54.80  ? 227  SER A CA  1 
ATOM   1524 C  C   . SER A 1 238 ? 14.240  29.717 8.999  1.00 52.39  ? 227  SER A C   1 
ATOM   1525 O  O   . SER A 1 238 ? 13.306  28.992 8.833  1.00 51.76  ? 227  SER A O   1 
ATOM   1526 C  CB  . SER A 1 238 ? 15.085  30.268 11.301 1.00 57.21  ? 227  SER A CB  1 
ATOM   1527 O  OG  . SER A 1 238 ? 14.450  29.268 12.071 1.00 58.35  ? 227  SER A OG  1 
ATOM   1528 N  N   . PRO A 1 239 ? 15.298  29.645 8.230  1.00 51.67  ? 228  PRO A N   1 
ATOM   1529 C  CA  . PRO A 1 239 ? 15.435  28.501 7.376  1.00 52.63  ? 228  PRO A CA  1 
ATOM   1530 C  C   . PRO A 1 239 ? 15.274  27.201 8.146  1.00 54.39  ? 228  PRO A C   1 
ATOM   1531 O  O   . PRO A 1 239 ? 15.825  27.073 9.261  1.00 57.74  ? 228  PRO A O   1 
ATOM   1532 C  CB  . PRO A 1 239 ? 16.879  28.621 6.893  1.00 54.98  ? 228  PRO A CB  1 
ATOM   1533 C  CG  . PRO A 1 239 ? 17.145  30.080 6.934  1.00 53.73  ? 228  PRO A CG  1 
ATOM   1534 C  CD  . PRO A 1 239 ? 16.447  30.549 8.146  1.00 52.80  ? 228  PRO A CD  1 
ATOM   1535 N  N   . ASP A 1 240 ? 14.515  26.274 7.561  1.00 53.20  ? 229  ASP A N   1 
ATOM   1536 C  CA  . ASP A 1 240 ? 14.337  24.923 8.082  1.00 55.30  ? 229  ASP A CA  1 
ATOM   1537 C  C   . ASP A 1 240 ? 13.596  24.793 9.393  1.00 55.97  ? 229  ASP A C   1 
ATOM   1538 O  O   . ASP A 1 240 ? 13.515  23.695 9.950  1.00 58.09  ? 229  ASP A O   1 
ATOM   1539 C  CB  . ASP A 1 240 ? 15.670  24.230 8.267  1.00 58.98  ? 229  ASP A CB  1 
ATOM   1540 C  CG  . ASP A 1 240 ? 16.527  24.356 7.087  1.00 59.90  ? 229  ASP A CG  1 
ATOM   1541 O  OD1 . ASP A 1 240 ? 16.145  23.768 6.074  1.00 60.44  ? 229  ASP A OD1 1 
ATOM   1542 O  OD2 . ASP A 1 240 ? 17.582  25.015 7.163  1.00 62.09  ? 229  ASP A OD2 1 
ATOM   1543 N  N   . PHE A 1 241 ? 13.079  25.902 9.908  1.00 54.17  ? 230  PHE A N   1 
ATOM   1544 C  CA  . PHE A 1 241 ? 12.194  25.858 11.031 1.00 54.27  ? 230  PHE A CA  1 
ATOM   1545 C  C   . PHE A 1 241 ? 11.085  24.844 10.772 1.00 53.50  ? 230  PHE A C   1 
ATOM   1546 O  O   . PHE A 1 241 ? 10.552  24.803 9.687  1.00 51.60  ? 230  PHE A O   1 
ATOM   1547 C  CB  . PHE A 1 241 ? 11.563  27.203 11.202 1.00 52.98  ? 230  PHE A CB  1 
ATOM   1548 C  CG  . PHE A 1 241 ? 10.972  27.393 12.523 1.00 55.76  ? 230  PHE A CG  1 
ATOM   1549 C  CD1 . PHE A 1 241 ? 11.761  27.783 13.567 1.00 58.70  ? 230  PHE A CD1 1 
ATOM   1550 C  CD2 . PHE A 1 241 ? 9.648   27.151 12.742 1.00 56.92  ? 230  PHE A CD2 1 
ATOM   1551 C  CE1 . PHE A 1 241 ? 11.243  27.944 14.827 1.00 61.90  ? 230  PHE A CE1 1 
ATOM   1552 C  CE2 . PHE A 1 241 ? 9.110   27.328 13.992 1.00 60.05  ? 230  PHE A CE2 1 
ATOM   1553 C  CZ  . PHE A 1 241 ? 9.913   27.720 15.044 1.00 62.44  ? 230  PHE A CZ  1 
ATOM   1554 N  N   . PRO A 1 242 ? 10.718  24.031 11.735 1.00 55.52  ? 231  PRO A N   1 
ATOM   1555 C  CA  . PRO A 1 242 ? 11.169  24.072 13.107 1.00 58.88  ? 231  PRO A CA  1 
ATOM   1556 C  C   . PRO A 1 242 ? 12.470  23.282 13.429 1.00 63.47  ? 231  PRO A C   1 
ATOM   1557 O  O   . PRO A 1 242 ? 12.937  23.302 14.573 1.00 66.47  ? 231  PRO A O   1 
ATOM   1558 C  CB  . PRO A 1 242 ? 9.998   23.474 13.814 1.00 59.81  ? 231  PRO A CB  1 
ATOM   1559 C  CG  . PRO A 1 242 ? 9.621   22.384 12.868 1.00 59.44  ? 231  PRO A CG  1 
ATOM   1560 C  CD  . PRO A 1 242 ? 9.850   22.887 11.485 1.00 56.07  ? 231  PRO A CD  1 
ATOM   1561 N  N   . ASP A 1 243 ? 13.091  22.633 12.453 1.00 65.41  ? 232  ASP A N   1 
ATOM   1562 C  CA  . ASP A 1 243 ? 14.411  22.095 12.703 1.00 70.26  ? 232  ASP A CA  1 
ATOM   1563 C  C   . ASP A 1 243 ? 15.345  23.259 12.964 1.00 73.11  ? 232  ASP A C   1 
ATOM   1564 O  O   . ASP A 1 243 ? 15.049  24.441 12.671 1.00 68.80  ? 232  ASP A O   1 
ATOM   1565 C  CB  . ASP A 1 243 ? 14.907  21.266 11.517 1.00 70.14  ? 232  ASP A CB  1 
ATOM   1566 C  CG  . ASP A 1 243 ? 14.165  19.945 11.357 1.00 70.70  ? 232  ASP A CG  1 
ATOM   1567 O  OD1 . ASP A 1 243 ? 13.187  19.677 12.066 1.00 71.62  ? 232  ASP A OD1 1 
ATOM   1568 O  OD2 . ASP A 1 243 ? 14.564  19.143 10.513 1.00 70.93  ? 232  ASP A OD2 1 
ATOM   1569 N  N   . THR A 1 244 ? 16.476  22.911 13.548 1.00 83.25  ? 233  THR A N   1 
ATOM   1570 C  CA  . THR A 1 244 ? 17.582  23.861 13.723 1.00 89.30  ? 233  THR A CA  1 
ATOM   1571 C  C   . THR A 1 244 ? 18.087  24.251 12.318 1.00 91.21  ? 233  THR A C   1 
ATOM   1572 O  O   . THR A 1 244 ? 18.199  23.381 11.436 1.00 90.74  ? 233  THR A O   1 
ATOM   1573 C  CB  . THR A 1 244 ? 18.689  23.236 14.585 1.00 94.92  ? 233  THR A CB  1 
ATOM   1574 O  OG1 . THR A 1 244 ? 19.178  22.051 13.937 1.00 98.63  ? 233  THR A OG1 1 
ATOM   1575 C  CG2 . THR A 1 244 ? 18.122  22.852 15.986 1.00 97.15  ? 233  THR A CG2 1 
ATOM   1576 N  N   . TYR A 1 245 ? 18.302  25.554 12.087 1.00 94.30  ? 234  TYR A N   1 
ATOM   1577 C  CA  . TYR A 1 245 ? 18.712  26.067 10.745 1.00 93.43  ? 234  TYR A CA  1 
ATOM   1578 C  C   . TYR A 1 245 ? 20.034  25.444 10.281 1.00 99.93  ? 234  TYR A C   1 
ATOM   1579 O  O   . TYR A 1 245 ? 20.989  25.345 11.068 1.00 107.38 ? 234  TYR A O   1 
ATOM   1580 C  CB  . TYR A 1 245 ? 18.818  27.582 10.718 1.00 90.61  ? 234  TYR A CB  1 
ATOM   1581 C  CG  . TYR A 1 245 ? 19.656  28.198 11.835 1.00 95.75  ? 234  TYR A CG  1 
ATOM   1582 C  CD1 . TYR A 1 245 ? 21.031  28.390 11.691 1.00 100.34 ? 234  TYR A CD1 1 
ATOM   1583 C  CD2 . TYR A 1 245 ? 19.057  28.614 13.029 1.00 97.51  ? 234  TYR A CD2 1 
ATOM   1584 C  CE1 . TYR A 1 245 ? 21.785  28.981 12.701 1.00 107.15 ? 234  TYR A CE1 1 
ATOM   1585 C  CE2 . TYR A 1 245 ? 19.788  29.200 14.040 1.00 103.56 ? 234  TYR A CE2 1 
ATOM   1586 C  CZ  . TYR A 1 245 ? 21.156  29.387 13.882 1.00 109.60 ? 234  TYR A CZ  1 
ATOM   1587 O  OH  . TYR A 1 245 ? 21.890  29.961 14.913 1.00 120.59 ? 234  TYR A OH  1 
ATOM   1588 N  N   . ALA A 1 246 ? 20.083  24.990 9.023  1.00 97.97  ? 235  ALA A N   1 
ATOM   1589 C  CA  . ALA A 1 246 ? 21.268  24.283 8.501  1.00 99.34  ? 235  ALA A CA  1 
ATOM   1590 C  C   . ALA A 1 246 ? 22.475  25.199 8.507  1.00 100.01 ? 235  ALA A C   1 
ATOM   1591 O  O   . ALA A 1 246 ? 22.384  26.403 8.770  1.00 99.35  ? 235  ALA A O   1 
ATOM   1592 C  CB  . ALA A 1 246 ? 21.034  23.722 7.106  1.00 96.82  ? 235  ALA A CB  1 
ATOM   1593 N  N   . THR A 1 247 ? 23.621  24.610 8.252  1.00 102.32 ? 236  THR A N   1 
ATOM   1594 C  CA  . THR A 1 247 ? 24.841  25.360 8.287  1.00 103.03 ? 236  THR A CA  1 
ATOM   1595 C  C   . THR A 1 247 ? 24.998  26.076 6.974  1.00 100.48 ? 236  THR A C   1 
ATOM   1596 O  O   . THR A 1 247 ? 24.430  25.680 5.971  1.00 97.01  ? 236  THR A O   1 
ATOM   1597 C  CB  . THR A 1 247 ? 26.006  24.421 8.542  1.00 108.50 ? 236  THR A CB  1 
ATOM   1598 O  OG1 . THR A 1 247 ? 25.856  23.277 7.715  1.00 107.03 ? 236  THR A OG1 1 
ATOM   1599 C  CG2 . THR A 1 247 ? 25.962  23.985 9.964  1.00 111.42 ? 236  THR A CG2 1 
ATOM   1600 N  N   . GLY A 1 248 ? 25.751  27.163 7.010  1.00 102.61 ? 237  GLY A N   1 
ATOM   1601 C  CA  . GLY A 1 248 ? 26.043  27.946 5.834  1.00 101.72 ? 237  GLY A CA  1 
ATOM   1602 C  C   . GLY A 1 248 ? 24.793  28.316 5.084  1.00 95.15  ? 237  GLY A C   1 
ATOM   1603 O  O   . GLY A 1 248 ? 24.773  28.249 3.882  1.00 96.03  ? 237  GLY A O   1 
ATOM   1604 N  N   . ARG A 1 249 ? 23.740  28.664 5.798  1.00 91.37  ? 238  ARG A N   1 
ATOM   1605 C  CA  . ARG A 1 249 ? 22.546  29.206 5.171  1.00 87.81  ? 238  ARG A CA  1 
ATOM   1606 C  C   . ARG A 1 249 ? 22.646  30.660 4.811  1.00 84.89  ? 238  ARG A C   1 
ATOM   1607 O  O   . ARG A 1 249 ? 23.087  31.466 5.614  1.00 88.22  ? 238  ARG A O   1 
ATOM   1608 C  CB  . ARG A 1 249 ? 21.370  29.094 6.106  1.00 86.97  ? 238  ARG A CB  1 
ATOM   1609 C  CG  . ARG A 1 249 ? 20.758  27.726 6.050  1.00 88.87  ? 238  ARG A CG  1 
ATOM   1610 C  CD  . ARG A 1 249 ? 19.870  27.519 4.826  1.00 83.56  ? 238  ARG A CD  1 
ATOM   1611 N  NE  . ARG A 1 249 ? 19.335  26.180 4.945  1.00 83.31  ? 238  ARG A NE  1 
ATOM   1612 C  CZ  . ARG A 1 249 ? 18.789  25.471 3.984  1.00 82.86  ? 238  ARG A CZ  1 
ATOM   1613 N  NH1 . ARG A 1 249 ? 18.632  25.964 2.784  1.00 85.09  ? 238  ARG A NH1 1 
ATOM   1614 N  NH2 . ARG A 1 249 ? 18.379  24.246 4.242  1.00 84.44  ? 238  ARG A NH2 1 
ATOM   1615 N  N   . VAL A 1 250 ? 22.192  30.999 3.615  1.00 80.10  ? 239  VAL A N   1 
ATOM   1616 C  CA  . VAL A 1 250 ? 22.112  32.379 3.211  1.00 77.33  ? 239  VAL A CA  1 
ATOM   1617 C  C   . VAL A 1 250 ? 20.765  32.555 2.586  1.00 71.97  ? 239  VAL A C   1 
ATOM   1618 O  O   . VAL A 1 250 ? 20.521  32.038 1.532  1.00 72.48  ? 239  VAL A O   1 
ATOM   1619 C  CB  . VAL A 1 250 ? 23.214  32.763 2.200  1.00 80.70  ? 239  VAL A CB  1 
ATOM   1620 C  CG1 . VAL A 1 250 ? 23.178  34.288 1.935  1.00 78.63  ? 239  VAL A CG1 1 
ATOM   1621 C  CG2 . VAL A 1 250 ? 24.588  32.266 2.687  1.00 85.64  ? 239  VAL A CG2 1 
ATOM   1622 N  N   . CYS A 1 251 ? 19.885  33.285 3.233  1.00 69.32  ? 240  CYS A N   1 
ATOM   1623 C  CA  . CYS A 1 251 ? 18.546  33.436 2.720  1.00 68.35  ? 240  CYS A CA  1 
ATOM   1624 C  C   . CYS A 1 251 ? 18.128  34.895 2.684  1.00 67.67  ? 240  CYS A C   1 
ATOM   1625 O  O   . CYS A 1 251 ? 18.488  35.659 3.577  1.00 64.67  ? 240  CYS A O   1 
ATOM   1626 C  CB  . CYS A 1 251 ? 17.580  32.620 3.577  1.00 68.61  ? 240  CYS A CB  1 
ATOM   1627 S  SG  . CYS A 1 251 ? 18.091  30.891 3.778  1.00 74.04  ? 240  CYS A SG  1 
ATOM   1628 N  N   . TYR A 1 252 ? 17.384  35.249 1.622  1.00 70.59  ? 241  TYR A N   1 
ATOM   1629 C  CA  . TYR A 1 252 ? 16.761  36.569 1.414  1.00 70.31  ? 241  TYR A CA  1 
ATOM   1630 C  C   . TYR A 1 252 ? 15.269  36.313 1.228  1.00 68.26  ? 241  TYR A C   1 
ATOM   1631 O  O   . TYR A 1 252 ? 14.891  35.468 0.436  1.00 66.37  ? 241  TYR A O   1 
ATOM   1632 C  CB  . TYR A 1 252 ? 17.308  37.248 0.145  1.00 72.72  ? 241  TYR A CB  1 
ATOM   1633 C  CG  . TYR A 1 252 ? 18.813  37.514 0.130  1.00 78.00  ? 241  TYR A CG  1 
ATOM   1634 C  CD1 . TYR A 1 252 ? 19.742  36.503 -0.242 1.00 82.43  ? 241  TYR A CD1 1 
ATOM   1635 C  CD2 . TYR A 1 252 ? 19.331  38.793 0.474  1.00 80.07  ? 241  TYR A CD2 1 
ATOM   1636 C  CE1 . TYR A 1 252 ? 21.133  36.756 -0.228 1.00 86.87  ? 241  TYR A CE1 1 
ATOM   1637 C  CE2 . TYR A 1 252 ? 20.713  39.064 0.470  1.00 82.35  ? 241  TYR A CE2 1 
ATOM   1638 C  CZ  . TYR A 1 252 ? 21.604  38.054 0.125  1.00 86.88  ? 241  TYR A CZ  1 
ATOM   1639 O  OH  . TYR A 1 252 ? 22.946  38.343 0.134  1.00 94.25  ? 241  TYR A OH  1 
ATOM   1640 N  N   . TRP A 1 253 ? 14.430  37.030 1.958  1.00 67.87  ? 242  TRP A N   1 
ATOM   1641 C  CA  . TRP A 1 253 ? 12.990  37.041 1.702  1.00 67.57  ? 242  TRP A CA  1 
ATOM   1642 C  C   . TRP A 1 253 ? 12.593  38.471 1.331  1.00 69.99  ? 242  TRP A C   1 
ATOM   1643 O  O   . TRP A 1 253 ? 12.848  39.397 2.136  1.00 73.69  ? 242  TRP A O   1 
ATOM   1644 C  CB  . TRP A 1 253 ? 12.197  36.676 2.947  1.00 65.61  ? 242  TRP A CB  1 
ATOM   1645 C  CG  . TRP A 1 253 ? 12.470  35.377 3.530  1.00 65.24  ? 242  TRP A CG  1 
ATOM   1646 C  CD1 . TRP A 1 253 ? 11.732  34.255 3.394  1.00 65.20  ? 242  TRP A CD1 1 
ATOM   1647 C  CD2 . TRP A 1 253 ? 13.526  35.051 4.426  1.00 65.67  ? 242  TRP A CD2 1 
ATOM   1648 N  NE1 . TRP A 1 253 ? 12.272  33.227 4.139  1.00 64.27  ? 242  TRP A NE1 1 
ATOM   1649 C  CE2 . TRP A 1 253 ? 13.373  33.700 4.785  1.00 65.10  ? 242  TRP A CE2 1 
ATOM   1650 C  CE3 . TRP A 1 253 ? 14.597  35.762 4.950  1.00 66.98  ? 242  TRP A CE3 1 
ATOM   1651 C  CZ2 . TRP A 1 253 ? 14.247  33.056 5.638  1.00 67.56  ? 242  TRP A CZ2 1 
ATOM   1652 C  CZ3 . TRP A 1 253 ? 15.473  35.115 5.817  1.00 68.53  ? 242  TRP A CZ3 1 
ATOM   1653 C  CH2 . TRP A 1 253 ? 15.291  33.780 6.151  1.00 68.21  ? 242  TRP A CH2 1 
ATOM   1654 N  N   . THR A 1 254 ? 11.965  38.663 0.163  1.00 68.07  ? 243  THR A N   1 
ATOM   1655 C  CA  . THR A 1 254 ? 11.424  39.974 -0.206 1.00 68.81  ? 243  THR A CA  1 
ATOM   1656 C  C   . THR A 1 254 ? 10.034  40.138 0.353  1.00 67.93  ? 243  THR A C   1 
ATOM   1657 O  O   . THR A 1 254 ? 9.187   39.293 0.133  1.00 69.11  ? 243  THR A O   1 
ATOM   1658 C  CB  . THR A 1 254 ? 11.360  40.149 -1.725 1.00 72.60  ? 243  THR A CB  1 
ATOM   1659 O  OG1 . THR A 1 254 ? 12.662  40.450 -2.204 1.00 74.56  ? 243  THR A OG1 1 
ATOM   1660 C  CG2 . THR A 1 254 ? 10.502  41.317 -2.144 1.00 76.78  ? 243  THR A CG2 1 
ATOM   1661 N  N   . ILE A 1 255 ? 9.804   41.239 1.054  1.00 67.61  ? 244  ILE A N   1 
ATOM   1662 C  CA  . ILE A 1 255 ? 8.477   41.615 1.503  1.00 69.30  ? 244  ILE A CA  1 
ATOM   1663 C  C   . ILE A 1 255 ? 8.192   42.906 0.790  1.00 74.43  ? 244  ILE A C   1 
ATOM   1664 O  O   . ILE A 1 255 ? 8.843   43.941 1.040  1.00 74.47  ? 244  ILE A O   1 
ATOM   1665 C  CB  . ILE A 1 255 ? 8.417   41.836 3.008  1.00 69.06  ? 244  ILE A CB  1 
ATOM   1666 C  CG1 . ILE A 1 255 ? 8.811   40.532 3.724  1.00 68.17  ? 244  ILE A CG1 1 
ATOM   1667 C  CG2 . ILE A 1 255 ? 7.025   42.296 3.418  1.00 70.68  ? 244  ILE A CG2 1 
ATOM   1668 C  CD1 . ILE A 1 255 ? 9.337   40.701 5.142  1.00 67.23  ? 244  ILE A CD1 1 
ATOM   1669 N  N   . ARG A 1 256 ? 7.239   42.827 -0.133 1.00 78.91  ? 245  ARG A N   1 
ATOM   1670 C  CA  . ARG A 1 256 ? 6.949   43.909 -1.077 1.00 82.85  ? 245  ARG A CA  1 
ATOM   1671 C  C   . ARG A 1 256 ? 5.455   44.088 -0.994 1.00 85.80  ? 245  ARG A C   1 
ATOM   1672 O  O   . ARG A 1 256 ? 4.709   43.196 -1.438 1.00 90.97  ? 245  ARG A O   1 
ATOM   1673 C  CB  . ARG A 1 256 ? 7.400   43.482 -2.497 1.00 83.90  ? 245  ARG A CB  1 
ATOM   1674 C  CG  . ARG A 1 256 ? 7.174   44.495 -3.596 1.00 87.60  ? 245  ARG A CG  1 
ATOM   1675 C  CD  . ARG A 1 256 ? 8.307   44.569 -4.607 1.00 87.67  ? 245  ARG A CD  1 
ATOM   1676 N  NE  . ARG A 1 256 ? 8.442   45.966 -5.014 1.00 93.17  ? 245  ARG A NE  1 
ATOM   1677 C  CZ  . ARG A 1 256 ? 9.340   46.439 -5.873 1.00 96.63  ? 245  ARG A CZ  1 
ATOM   1678 N  NH1 . ARG A 1 256 ? 10.206  45.615 -6.470 1.00 97.30  ? 245  ARG A NH1 1 
ATOM   1679 N  NH2 . ARG A 1 256 ? 9.354   47.750 -6.148 1.00 98.23  ? 245  ARG A NH2 1 
ATOM   1680 N  N   . VAL A 1 257 ? 5.010   45.190 -0.389 1.00 84.97  ? 246  VAL A N   1 
ATOM   1681 C  CA  . VAL A 1 257 ? 3.574   45.435 -0.199 1.00 88.82  ? 246  VAL A CA  1 
ATOM   1682 C  C   . VAL A 1 257 ? 3.239   46.763 -0.820 1.00 93.53  ? 246  VAL A C   1 
ATOM   1683 O  O   . VAL A 1 257 ? 3.279   47.792 -0.142 1.00 95.68  ? 246  VAL A O   1 
ATOM   1684 C  CB  . VAL A 1 257 ? 3.158   45.395 1.293  1.00 88.65  ? 246  VAL A CB  1 
ATOM   1685 C  CG1 . VAL A 1 257 ? 1.643   45.586 1.462  1.00 94.14  ? 246  VAL A CG1 1 
ATOM   1686 C  CG2 . VAL A 1 257 ? 3.605   44.074 1.919  1.00 84.45  ? 246  VAL A CG2 1 
ATOM   1687 N  N   . PRO A 1 258 ? 2.925   46.761 -2.129 1.00 97.46  ? 247  PRO A N   1 
ATOM   1688 C  CA  . PRO A 1 258 ? 2.691   48.084 -2.706 1.00 102.54 ? 247  PRO A CA  1 
ATOM   1689 C  C   . PRO A 1 258 ? 1.527   48.773 -2.002 1.00 106.63 ? 247  PRO A C   1 
ATOM   1690 O  O   . PRO A 1 258 ? 0.526   48.112 -1.635 1.00 105.94 ? 247  PRO A O   1 
ATOM   1691 C  CB  . PRO A 1 258 ? 2.420   47.786 -4.192 1.00 105.98 ? 247  PRO A CB  1 
ATOM   1692 C  CG  . PRO A 1 258 ? 3.165   46.502 -4.442 1.00 101.02 ? 247  PRO A CG  1 
ATOM   1693 C  CD  . PRO A 1 258 ? 2.964   45.710 -3.168 1.00 96.95  ? 247  PRO A CD  1 
ATOM   1694 N  N   . GLY A 1 259 ? 1.724   50.067 -1.742 1.00 108.56 ? 248  GLY A N   1 
ATOM   1695 C  CA  . GLY A 1 259 ? 0.720   50.902 -1.106 1.00 113.67 ? 248  GLY A CA  1 
ATOM   1696 C  C   . GLY A 1 259 ? 0.908   51.022 0.381  1.00 110.73 ? 248  GLY A C   1 
ATOM   1697 O  O   . GLY A 1 259 ? 0.195   51.788 1.007  1.00 116.23 ? 248  GLY A O   1 
ATOM   1698 N  N   . ALA A 1 260 ? 1.856   50.279 0.951  1.00 103.40 ? 249  ALA A N   1 
ATOM   1699 C  CA  . ALA A 1 260 ? 2.125   50.371 2.375  1.00 101.51 ? 249  ALA A CA  1 
ATOM   1700 C  C   . ALA A 1 260 ? 2.860   51.646 2.626  1.00 102.70 ? 249  ALA A C   1 
ATOM   1701 O  O   . ALA A 1 260 ? 3.790   51.938 1.916  1.00 100.06 ? 249  ALA A O   1 
ATOM   1702 C  CB  . ALA A 1 260 ? 2.986   49.234 2.828  1.00 95.65  ? 249  ALA A CB  1 
ATOM   1703 N  N   . SER A 1 261 ? 2.445   52.394 3.638  1.00 107.67 ? 250  SER A N   1 
ATOM   1704 C  CA  . SER A 1 261 ? 3.080   53.656 3.989  1.00 110.61 ? 250  SER A CA  1 
ATOM   1705 C  C   . SER A 1 261 ? 4.274   53.366 4.879  1.00 107.27 ? 250  SER A C   1 
ATOM   1706 O  O   . SER A 1 261 ? 5.315   54.012 4.766  1.00 105.92 ? 250  SER A O   1 
ATOM   1707 C  CB  . SER A 1 261 ? 2.082   54.599 4.677  1.00 117.56 ? 250  SER A CB  1 
ATOM   1708 O  OG  . SER A 1 261 ? 1.840   54.226 6.018  1.00 116.93 ? 250  SER A OG  1 
ATOM   1709 N  N   . HIS A 1 262 ? 4.107   52.406 5.780  1.00 107.48 ? 251  HIS A N   1 
ATOM   1710 C  CA  . HIS A 1 262 ? 5.234   51.849 6.535  1.00 106.39 ? 251  HIS A CA  1 
ATOM   1711 C  C   . HIS A 1 262 ? 4.939   50.346 6.943  1.00 105.73 ? 251  HIS A C   1 
ATOM   1712 O  O   . HIS A 1 262 ? 3.798   49.867 6.724  1.00 109.16 ? 251  HIS A O   1 
ATOM   1713 C  CB  . HIS A 1 262 ? 5.599   52.807 7.699  1.00 109.24 ? 251  HIS A CB  1 
ATOM   1714 C  CG  . HIS A 1 262 ? 4.556   52.909 8.759  1.00 116.24 ? 251  HIS A CG  1 
ATOM   1715 N  ND1 . HIS A 1 262 ? 4.583   52.131 9.901  1.00 118.88 ? 251  HIS A ND1 1 
ATOM   1716 C  CD2 . HIS A 1 262 ? 3.462   53.694 8.866  1.00 123.43 ? 251  HIS A CD2 1 
ATOM   1717 C  CE1 . HIS A 1 262 ? 3.539   52.416 10.658 1.00 123.71 ? 251  HIS A CE1 1 
ATOM   1718 N  NE2 . HIS A 1 262 ? 2.833   53.350 10.043 1.00 128.55 ? 251  HIS A NE2 1 
ATOM   1719 N  N   . ILE A 1 263 ? 5.946   49.599 7.456  1.00 100.82 ? 252  ILE A N   1 
ATOM   1720 C  CA  . ILE A 1 263 ? 5.781   48.159 7.876  1.00 96.82  ? 252  ILE A CA  1 
ATOM   1721 C  C   . ILE A 1 263 ? 6.329   47.869 9.261  1.00 96.51  ? 252  ILE A C   1 
ATOM   1722 O  O   . ILE A 1 263 ? 7.470   48.172 9.533  1.00 94.92  ? 252  ILE A O   1 
ATOM   1723 C  CB  . ILE A 1 263 ? 6.507   47.185 6.935  1.00 91.42  ? 252  ILE A CB  1 
ATOM   1724 C  CG1 . ILE A 1 263 ? 5.915   47.296 5.543  1.00 93.23  ? 252  ILE A CG1 1 
ATOM   1725 C  CG2 . ILE A 1 263 ? 6.386   45.732 7.414  1.00 87.37  ? 252  ILE A CG2 1 
ATOM   1726 C  CD1 . ILE A 1 263 ? 6.772   46.662 4.481  1.00 90.35  ? 252  ILE A CD1 1 
ATOM   1727 N  N   . HIS A 1 264 ? 5.532   47.215 10.098 1.00 99.60  ? 253  HIS A N   1 
ATOM   1728 C  CA  . HIS A 1 264 ? 5.852   46.952 11.510 1.00 103.33 ? 253  HIS A CA  1 
ATOM   1729 C  C   . HIS A 1 264 ? 6.440   45.522 11.596 1.00 94.19  ? 253  HIS A C   1 
ATOM   1730 O  O   . HIS A 1 264 ? 5.910   44.590 11.001 1.00 97.22  ? 253  HIS A O   1 
ATOM   1731 C  CB  . HIS A 1 264 ? 4.533   47.125 12.305 1.00 114.27 ? 253  HIS A CB  1 
ATOM   1732 C  CG  . HIS A 1 264 ? 4.618   46.937 13.800 1.00 123.83 ? 253  HIS A CG  1 
ATOM   1733 N  ND1 . HIS A 1 264 ? 4.361   45.727 14.424 1.00 125.22 ? 253  HIS A ND1 1 
ATOM   1734 C  CD2 . HIS A 1 264 ? 4.774   47.841 14.800 1.00 131.68 ? 253  HIS A CD2 1 
ATOM   1735 C  CE1 . HIS A 1 264 ? 4.429   45.879 15.735 1.00 130.37 ? 253  HIS A CE1 1 
ATOM   1736 N  NE2 . HIS A 1 264 ? 4.680   47.152 15.991 1.00 136.21 ? 253  HIS A NE2 1 
ATOM   1737 N  N   . PHE A 1 265 ? 7.534   45.356 12.322 1.00 86.16  ? 254  PHE A N   1 
ATOM   1738 C  CA  . PHE A 1 265 ? 8.173   44.061 12.489 1.00 79.93  ? 254  PHE A CA  1 
ATOM   1739 C  C   . PHE A 1 265 ? 8.204   43.709 13.943 1.00 81.62  ? 254  PHE A C   1 
ATOM   1740 O  O   . PHE A 1 265 ? 8.462   44.585 14.751 1.00 86.04  ? 254  PHE A O   1 
ATOM   1741 C  CB  . PHE A 1 265 ? 9.598   44.168 12.021 1.00 77.14  ? 254  PHE A CB  1 
ATOM   1742 C  CG  . PHE A 1 265 ? 9.726   44.117 10.553 1.00 75.10  ? 254  PHE A CG  1 
ATOM   1743 C  CD1 . PHE A 1 265 ? 9.565   45.234 9.801  1.00 77.78  ? 254  PHE A CD1 1 
ATOM   1744 C  CD2 . PHE A 1 265 ? 9.961   42.929 9.914  1.00 73.05  ? 254  PHE A CD2 1 
ATOM   1745 C  CE1 . PHE A 1 265 ? 9.668   45.177 8.418  1.00 76.64  ? 254  PHE A CE1 1 
ATOM   1746 C  CE2 . PHE A 1 265 ? 10.071  42.852 8.546  1.00 71.22  ? 254  PHE A CE2 1 
ATOM   1747 C  CZ  . PHE A 1 265 ? 9.925   43.980 7.792  1.00 73.01  ? 254  PHE A CZ  1 
ATOM   1748 N  N   . SER A 1 266 ? 7.962   42.448 14.294 1.00 79.35  ? 255  SER A N   1 
ATOM   1749 C  CA  . SER A 1 266 ? 8.180   41.980 15.690 1.00 81.72  ? 255  SER A CA  1 
ATOM   1750 C  C   . SER A 1 266 ? 8.756   40.582 15.647 1.00 79.39  ? 255  SER A C   1 
ATOM   1751 O  O   . SER A 1 266 ? 8.653   39.928 14.618 1.00 77.47  ? 255  SER A O   1 
ATOM   1752 C  CB  . SER A 1 266 ? 6.883   41.973 16.493 1.00 84.43  ? 255  SER A CB  1 
ATOM   1753 O  OG  . SER A 1 266 ? 5.913   41.187 15.829 1.00 81.51  ? 255  SER A OG  1 
ATOM   1754 N  N   . PHE A 1 267 ? 9.347   40.124 16.751 1.00 80.40  ? 256  PHE A N   1 
ATOM   1755 C  CA  . PHE A 1 267 ? 9.970   38.802 16.783 1.00 78.67  ? 256  PHE A CA  1 
ATOM   1756 C  C   . PHE A 1 267 ? 9.411   37.920 17.894 1.00 80.74  ? 256  PHE A C   1 
ATOM   1757 O  O   . PHE A 1 267 ? 9.993   37.795 18.969 1.00 84.71  ? 256  PHE A O   1 
ATOM   1758 C  CB  . PHE A 1 267 ? 11.466  38.948 16.916 1.00 79.65  ? 256  PHE A CB  1 
ATOM   1759 C  CG  . PHE A 1 267 ? 12.102  39.517 15.710 1.00 78.01  ? 256  PHE A CG  1 
ATOM   1760 C  CD1 . PHE A 1 267 ? 12.053  40.876 15.477 1.00 81.14  ? 256  PHE A CD1 1 
ATOM   1761 C  CD2 . PHE A 1 267 ? 12.726  38.698 14.790 1.00 76.48  ? 256  PHE A CD2 1 
ATOM   1762 C  CE1 . PHE A 1 267 ? 12.628  41.418 14.340 1.00 80.80  ? 256  PHE A CE1 1 
ATOM   1763 C  CE2 . PHE A 1 267 ? 13.314  39.223 13.648 1.00 75.54  ? 256  PHE A CE2 1 
ATOM   1764 C  CZ  . PHE A 1 267 ? 13.261  40.586 13.416 1.00 77.51  ? 256  PHE A CZ  1 
ATOM   1765 N  N   . PRO A 1 268 ? 8.281   37.269 17.633 1.00 78.13  ? 257  PRO A N   1 
ATOM   1766 C  CA  . PRO A 1 268 ? 7.734   36.415 18.663 1.00 79.57  ? 257  PRO A CA  1 
ATOM   1767 C  C   . PRO A 1 268 ? 8.576   35.202 18.918 1.00 77.85  ? 257  PRO A C   1 
ATOM   1768 O  O   . PRO A 1 268 ? 8.194   34.392 19.746 1.00 81.05  ? 257  PRO A O   1 
ATOM   1769 C  CB  . PRO A 1 268 ? 6.384   36.001 18.102 1.00 79.56  ? 257  PRO A CB  1 
ATOM   1770 C  CG  . PRO A 1 268 ? 6.527   36.182 16.648 1.00 76.46  ? 257  PRO A CG  1 
ATOM   1771 C  CD  . PRO A 1 268 ? 7.372   37.392 16.494 1.00 76.05  ? 257  PRO A CD  1 
ATOM   1772 N  N   . LEU A 1 269 ? 9.677   35.036 18.200 1.00 74.28  ? 258  LEU A N   1 
ATOM   1773 C  CA  . LEU A 1 269 ? 10.665  34.027 18.564 1.00 76.11  ? 258  LEU A CA  1 
ATOM   1774 C  C   . LEU A 1 269 ? 12.018  34.472 18.065 1.00 76.23  ? 258  LEU A C   1 
ATOM   1775 O  O   . LEU A 1 269 ? 12.111  34.995 16.943 1.00 75.04  ? 258  LEU A O   1 
ATOM   1776 C  CB  . LEU A 1 269 ? 10.317  32.651 17.951 1.00 73.10  ? 258  LEU A CB  1 
ATOM   1777 C  CG  . LEU A 1 269 ? 11.368  31.553 18.132 1.00 72.47  ? 258  LEU A CG  1 
ATOM   1778 C  CD1 . LEU A 1 269 ? 11.527  31.216 19.606 1.00 77.17  ? 258  LEU A CD1 1 
ATOM   1779 C  CD2 . LEU A 1 269 ? 10.950  30.351 17.329 1.00 69.70  ? 258  LEU A CD2 1 
ATOM   1780 N  N   . PHE A 1 270 ? 13.062  34.241 18.867 1.00 79.77  ? 259  PHE A N   1 
ATOM   1781 C  CA  . PHE A 1 270 ? 14.412  34.608 18.468 1.00 80.54  ? 259  PHE A CA  1 
ATOM   1782 C  C   . PHE A 1 270 ? 15.478  33.869 19.241 1.00 85.13  ? 259  PHE A C   1 
ATOM   1783 O  O   . PHE A 1 270 ? 15.918  34.349 20.287 1.00 89.19  ? 259  PHE A O   1 
ATOM   1784 C  CB  . PHE A 1 270 ? 14.616  36.135 18.617 1.00 81.84  ? 259  PHE A CB  1 
ATOM   1785 C  CG  . PHE A 1 270 ? 15.803  36.649 17.861 1.00 80.69  ? 259  PHE A CG  1 
ATOM   1786 C  CD1 . PHE A 1 270 ? 15.711  36.907 16.508 1.00 76.89  ? 259  PHE A CD1 1 
ATOM   1787 C  CD2 . PHE A 1 270 ? 17.013  36.825 18.485 1.00 84.85  ? 259  PHE A CD2 1 
ATOM   1788 C  CE1 . PHE A 1 270 ? 16.803  37.320 15.786 1.00 76.14  ? 259  PHE A CE1 1 
ATOM   1789 C  CE2 . PHE A 1 270 ? 18.112  37.264 17.777 1.00 84.41  ? 259  PHE A CE2 1 
ATOM   1790 C  CZ  . PHE A 1 270 ? 18.007  37.499 16.425 1.00 80.03  ? 259  PHE A CZ  1 
ATOM   1791 N  N   . ASP A 1 271 ? 15.901  32.717 18.723 1.00 86.26  ? 260  ASP A N   1 
ATOM   1792 C  CA  . ASP A 1 271 ? 17.012  31.989 19.313 1.00 92.92  ? 260  ASP A CA  1 
ATOM   1793 C  C   . ASP A 1 271 ? 18.158  31.968 18.340 1.00 93.42  ? 260  ASP A C   1 
ATOM   1794 O  O   . ASP A 1 271 ? 18.052  31.433 17.252 1.00 90.81  ? 260  ASP A O   1 
ATOM   1795 C  CB  . ASP A 1 271 ? 16.625  30.555 19.675 1.00 95.12  ? 260  ASP A CB  1 
ATOM   1796 C  CG  . ASP A 1 271 ? 17.626  29.881 20.663 1.00 102.20 ? 260  ASP A CG  1 
ATOM   1797 O  OD1 . ASP A 1 271 ? 18.591  30.540 21.141 1.00 104.96 ? 260  ASP A OD1 1 
ATOM   1798 O  OD2 . ASP A 1 271 ? 17.438  28.677 20.973 1.00 103.24 ? 260  ASP A OD2 1 
ATOM   1799 N  N   . ILE A 1 272 ? 19.257  32.563 18.748 1.00 99.76  ? 261  ILE A N   1 
ATOM   1800 C  CA  . ILE A 1 272 ? 20.482  32.479 18.009 1.00 104.75 ? 261  ILE A CA  1 
ATOM   1801 C  C   . ILE A 1 272 ? 21.648  32.258 18.998 1.00 116.74 ? 261  ILE A C   1 
ATOM   1802 O  O   . ILE A 1 272 ? 21.831  32.967 20.012 1.00 116.16 ? 261  ILE A O   1 
ATOM   1803 C  CB  . ILE A 1 272 ? 20.723  33.760 17.176 1.00 102.58 ? 261  ILE A CB  1 
ATOM   1804 C  CG1 . ILE A 1 272 ? 19.602  34.032 16.180 1.00 93.96  ? 261  ILE A CG1 1 
ATOM   1805 C  CG2 . ILE A 1 272 ? 22.061  33.682 16.450 1.00 106.70 ? 261  ILE A CG2 1 
ATOM   1806 C  CD1 . ILE A 1 272 ? 19.578  33.056 15.045 1.00 91.82  ? 261  ILE A CD1 1 
ATOM   1807 N  N   . ARG A 1 273 ? 22.473  31.285 18.662 1.00 126.52 ? 262  ARG A N   1 
ATOM   1808 C  CA  . ARG A 1 273 ? 23.569  30.946 19.527 1.00 139.64 ? 262  ARG A CA  1 
ATOM   1809 C  C   . ARG A 1 273 ? 24.795  31.819 19.270 1.00 144.86 ? 262  ARG A C   1 
ATOM   1810 O  O   . ARG A 1 273 ? 25.492  32.150 20.208 1.00 152.39 ? 262  ARG A O   1 
ATOM   1811 C  CB  . ARG A 1 273 ? 23.917  29.458 19.382 1.00 145.71 ? 262  ARG A CB  1 
ATOM   1812 C  CG  . ARG A 1 273 ? 24.509  28.844 20.658 1.00 154.44 ? 262  ARG A CG  1 
ATOM   1813 C  CD  . ARG A 1 273 ? 23.549  28.842 21.863 1.00 153.37 ? 262  ARG A CD  1 
ATOM   1814 N  NE  . ARG A 1 273 ? 22.130  28.573 21.519 1.00 143.89 ? 262  ARG A NE  1 
ATOM   1815 C  CZ  . ARG A 1 273 ? 21.255  27.873 22.252 1.00 140.37 ? 262  ARG A CZ  1 
ATOM   1816 N  NH1 . ARG A 1 273 ? 21.578  27.328 23.430 1.00 146.36 ? 262  ARG A NH1 1 
ATOM   1817 N  NH2 . ARG A 1 273 ? 20.019  27.724 21.793 1.00 131.52 ? 262  ARG A NH2 1 
ATOM   1818 N  N   . ASP A 1 274 ? 25.084  32.185 18.023 1.00 144.11 ? 263  ASP A N   1 
ATOM   1819 C  CA  . ASP A 1 274 ? 26.391  32.787 17.717 1.00 150.77 ? 263  ASP A CA  1 
ATOM   1820 C  C   . ASP A 1 274 ? 26.221  34.199 17.293 1.00 145.69 ? 263  ASP A C   1 
ATOM   1821 O  O   . ASP A 1 274 ? 25.229  34.521 16.635 1.00 140.81 ? 263  ASP A O   1 
ATOM   1822 C  CB  . ASP A 1 274 ? 27.095  32.035 16.597 1.00 157.19 ? 263  ASP A CB  1 
ATOM   1823 C  CG  . ASP A 1 274 ? 27.177  30.570 16.857 1.00 171.08 ? 263  ASP A CG  1 
ATOM   1824 O  OD1 . ASP A 1 274 ? 26.928  30.164 18.020 1.00 185.10 ? 263  ASP A OD1 1 
ATOM   1825 O  OD2 . ASP A 1 274 ? 27.476  29.820 15.893 1.00 178.28 ? 263  ASP A OD2 1 
ATOM   1826 N  N   . SER A 1 275 ? 27.202  35.029 17.640 1.00 146.79 ? 264  SER A N   1 
ATOM   1827 C  CA  . SER A 1 275 ? 27.295  36.366 17.058 1.00 141.91 ? 264  SER A CA  1 
ATOM   1828 C  C   . SER A 1 275 ? 27.367  36.305 15.499 1.00 134.74 ? 264  SER A C   1 
ATOM   1829 O  O   . SER A 1 275 ? 26.703  37.106 14.819 1.00 130.22 ? 264  SER A O   1 
ATOM   1830 C  CB  . SER A 1 275 ? 28.475  37.133 17.668 1.00 147.24 ? 264  SER A CB  1 
ATOM   1831 O  OG  . SER A 1 275 ? 28.182  37.484 19.019 1.00 151.69 ? 264  SER A OG  1 
ATOM   1832 N  N   . ALA A 1 276 ? 28.131  35.336 14.963 1.00 131.58 ? 265  ALA A N   1 
ATOM   1833 C  CA  . ALA A 1 276 ? 28.265  35.084 13.501 1.00 121.54 ? 265  ALA A CA  1 
ATOM   1834 C  C   . ALA A 1 276 ? 26.926  34.872 12.771 1.00 109.64 ? 265  ALA A C   1 
ATOM   1835 O  O   . ALA A 1 276 ? 26.724  35.397 11.683 1.00 103.88 ? 265  ALA A O   1 
ATOM   1836 C  CB  . ALA A 1 276 ? 29.207  33.907 13.244 1.00 125.64 ? 265  ALA A CB  1 
ATOM   1837 N  N   . ASP A 1 277 ? 26.010  34.131 13.378 1.00 105.60 ? 266  ASP A N   1 
ATOM   1838 C  CA  . ASP A 1 277 ? 24.679  33.962 12.807 1.00 98.47  ? 266  ASP A CA  1 
ATOM   1839 C  C   . ASP A 1 277 ? 23.977  35.326 12.910 1.00 91.89  ? 266  ASP A C   1 
ATOM   1840 O  O   . ASP A 1 277 ? 24.017  35.949 13.943 1.00 91.84  ? 266  ASP A O   1 
ATOM   1841 C  CB  . ASP A 1 277 ? 23.863  32.886 13.552 1.00 101.26 ? 266  ASP A CB  1 
ATOM   1842 C  CG  . ASP A 1 277 ? 24.584  31.509 13.665 1.00 107.74 ? 266  ASP A CG  1 
ATOM   1843 O  OD1 . ASP A 1 277 ? 25.188  31.050 12.688 1.00 110.88 ? 266  ASP A OD1 1 
ATOM   1844 O  OD2 . ASP A 1 277 ? 24.537  30.872 14.747 1.00 111.30 ? 266  ASP A OD2 1 
ATOM   1845 N  N   . MET A 1 278 ? 23.355  35.783 11.831 1.00 86.56  ? 267  MET A N   1 
ATOM   1846 C  CA  . MET A 1 278 ? 22.740  37.109 11.755 1.00 83.43  ? 267  MET A CA  1 
ATOM   1847 C  C   . MET A 1 278 ? 21.393  37.130 11.062 1.00 76.58  ? 267  MET A C   1 
ATOM   1848 O  O   . MET A 1 278 ? 21.153  36.390 10.087 1.00 74.17  ? 267  MET A O   1 
ATOM   1849 C  CB  . MET A 1 278 ? 23.554  37.973 10.850 1.00 87.69  ? 267  MET A CB  1 
ATOM   1850 C  CG  . MET A 1 278 ? 24.774  38.621 11.413 1.00 97.58  ? 267  MET A CG  1 
ATOM   1851 S  SD  . MET A 1 278 ? 25.362  39.632 10.029 1.00 105.42 ? 267  MET A SD  1 
ATOM   1852 C  CE  . MET A 1 278 ? 26.203  38.459 8.952  1.00 107.61 ? 267  MET A CE  1 
ATOM   1853 N  N   . VAL A 1 279 ? 20.550  38.055 11.502 1.00 72.68  ? 268  VAL A N   1 
ATOM   1854 C  CA  . VAL A 1 279 ? 19.380  38.470 10.727 1.00 68.24  ? 268  VAL A CA  1 
ATOM   1855 C  C   . VAL A 1 279 ? 19.530  39.955 10.447 1.00 67.35  ? 268  VAL A C   1 
ATOM   1856 O  O   . VAL A 1 279 ? 19.802  40.710 11.377 1.00 69.83  ? 268  VAL A O   1 
ATOM   1857 C  CB  . VAL A 1 279 ? 18.067  38.336 11.499 1.00 67.90  ? 268  VAL A CB  1 
ATOM   1858 C  CG1 . VAL A 1 279 ? 16.881  38.665 10.608 1.00 64.72  ? 268  VAL A CG1 1 
ATOM   1859 C  CG2 . VAL A 1 279 ? 17.915  36.944 12.059 1.00 70.15  ? 268  VAL A CG2 1 
ATOM   1860 N  N   . GLU A 1 280 ? 19.325  40.357 9.185  1.00 62.88  ? 269  GLU A N   1 
ATOM   1861 C  CA  . GLU A 1 280 ? 19.392  41.742 8.750  1.00 61.01  ? 269  GLU A CA  1 
ATOM   1862 C  C   . GLU A 1 280 ? 18.087  42.176 8.090  1.00 60.90  ? 269  GLU A C   1 
ATOM   1863 O  O   . GLU A 1 280 ? 17.373  41.372 7.518  1.00 58.83  ? 269  GLU A O   1 
ATOM   1864 C  CB  . GLU A 1 280 ? 20.561  41.924 7.784  1.00 59.28  ? 269  GLU A CB  1 
ATOM   1865 C  CG  . GLU A 1 280 ? 21.771  42.460 8.455  1.00 61.06  ? 269  GLU A CG  1 
ATOM   1866 C  CD  . GLU A 1 280 ? 22.999  42.585 7.600  1.00 61.65  ? 269  GLU A CD  1 
ATOM   1867 O  OE1 . GLU A 1 280 ? 23.036  42.377 6.376  1.00 59.52  ? 269  GLU A OE1 1 
ATOM   1868 O  OE2 . GLU A 1 280 ? 23.984  42.949 8.227  1.00 64.45  ? 269  GLU A OE2 1 
ATOM   1869 N  N   . LEU A 1 281 ? 17.786  43.463 8.173  1.00 66.01  ? 270  LEU A N   1 
ATOM   1870 C  CA  . LEU A 1 281 ? 16.752  44.071 7.334  1.00 68.53  ? 270  LEU A CA  1 
ATOM   1871 C  C   . LEU A 1 281 ? 17.362  45.065 6.376  1.00 68.22  ? 270  LEU A C   1 
ATOM   1872 O  O   . LEU A 1 281 ? 18.140  45.927 6.789  1.00 68.49  ? 270  LEU A O   1 
ATOM   1873 C  CB  . LEU A 1 281 ? 15.740  44.813 8.176  1.00 75.13  ? 270  LEU A CB  1 
ATOM   1874 C  CG  . LEU A 1 281 ? 14.367  44.156 8.201  1.00 78.24  ? 270  LEU A CG  1 
ATOM   1875 C  CD1 . LEU A 1 281 ? 14.432  42.946 9.101  1.00 79.08  ? 270  LEU A CD1 1 
ATOM   1876 C  CD2 . LEU A 1 281 ? 13.356  45.148 8.748  1.00 83.38  ? 270  LEU A CD2 1 
ATOM   1877 N  N   . LEU A 1 282 ? 16.984  44.951 5.107  1.00 67.08  ? 271  LEU A N   1 
ATOM   1878 C  CA  . LEU A 1 282 ? 17.564  45.747 4.037  1.00 68.02  ? 271  LEU A CA  1 
ATOM   1879 C  C   . LEU A 1 282 ? 16.477  46.588 3.323  1.00 67.31  ? 271  LEU A C   1 
ATOM   1880 O  O   . LEU A 1 282 ? 15.391  46.073 2.997  1.00 67.67  ? 271  LEU A O   1 
ATOM   1881 C  CB  . LEU A 1 282 ? 18.253  44.819 3.036  1.00 69.88  ? 271  LEU A CB  1 
ATOM   1882 C  CG  . LEU A 1 282 ? 19.701  44.354 3.260  1.00 72.86  ? 271  LEU A CG  1 
ATOM   1883 C  CD1 . LEU A 1 282 ? 19.858  43.678 4.584  1.00 74.81  ? 271  LEU A CD1 1 
ATOM   1884 C  CD2 . LEU A 1 282 ? 20.158  43.361 2.203  1.00 73.87  ? 271  LEU A CD2 1 
ATOM   1885 N  N   . ASP A 1 283 ? 16.760  47.876 3.098  1.00 65.82  ? 272  ASP A N   1 
ATOM   1886 C  CA  . ASP A 1 283 ? 15.933  48.717 2.239  1.00 64.87  ? 272  ASP A CA  1 
ATOM   1887 C  C   . ASP A 1 283 ? 15.957  48.076 0.847  1.00 63.23  ? 272  ASP A C   1 
ATOM   1888 O  O   . ASP A 1 283 ? 17.019  47.850 0.277  1.00 62.24  ? 272  ASP A O   1 
ATOM   1889 C  CB  . ASP A 1 283 ? 16.487  50.138 2.254  1.00 67.30  ? 272  ASP A CB  1 
ATOM   1890 C  CG  . ASP A 1 283 ? 15.730  51.112 1.361  1.00 69.83  ? 272  ASP A CG  1 
ATOM   1891 O  OD1 . ASP A 1 283 ? 15.288  50.690 0.285  1.00 70.73  ? 272  ASP A OD1 1 
ATOM   1892 O  OD2 . ASP A 1 283 ? 15.641  52.325 1.701  1.00 71.73  ? 272  ASP A OD2 1 
ATOM   1893 N  N   . GLY A 1 284 ? 14.784  47.717 0.335  1.00 61.90  ? 273  GLY A N   1 
ATOM   1894 C  CA  . GLY A 1 284 ? 14.706  47.067 -0.958 1.00 62.24  ? 273  GLY A CA  1 
ATOM   1895 C  C   . GLY A 1 284 ? 15.290  47.896 -2.094 1.00 65.45  ? 273  GLY A C   1 
ATOM   1896 O  O   . GLY A 1 284 ? 15.908  47.367 -2.990 1.00 65.38  ? 273  GLY A O   1 
ATOM   1897 N  N   . TYR A 1 285 ? 15.080  49.206 -2.033 1.00 69.22  ? 274  TYR A N   1 
ATOM   1898 C  CA  . TYR A 1 285 ? 15.505  50.148 -3.060 1.00 72.74  ? 274  TYR A CA  1 
ATOM   1899 C  C   . TYR A 1 285 ? 17.008  50.372 -2.981 1.00 73.23  ? 274  TYR A C   1 
ATOM   1900 O  O   . TYR A 1 285 ? 17.694  50.293 -3.971 1.00 75.07  ? 274  TYR A O   1 
ATOM   1901 C  CB  . TYR A 1 285 ? 14.745  51.490 -2.927 1.00 76.26  ? 274  TYR A CB  1 
ATOM   1902 C  CG  . TYR A 1 285 ? 13.212  51.365 -2.986 1.00 77.98  ? 274  TYR A CG  1 
ATOM   1903 C  CD1 . TYR A 1 285 ? 12.545  51.193 -4.195 1.00 80.25  ? 274  TYR A CD1 1 
ATOM   1904 C  CD2 . TYR A 1 285 ? 12.438  51.423 -1.830 1.00 78.49  ? 274  TYR A CD2 1 
ATOM   1905 C  CE1 . TYR A 1 285 ? 11.169  51.071 -4.251 1.00 81.95  ? 274  TYR A CE1 1 
ATOM   1906 C  CE2 . TYR A 1 285 ? 11.056  51.305 -1.887 1.00 80.51  ? 274  TYR A CE2 1 
ATOM   1907 C  CZ  . TYR A 1 285 ? 10.434  51.127 -3.103 1.00 82.03  ? 274  TYR A CZ  1 
ATOM   1908 O  OH  . TYR A 1 285 ? 9.070   50.996 -3.154 1.00 85.10  ? 274  TYR A OH  1 
ATOM   1909 N  N   . THR A 1 286 ? 17.526  50.598 -1.789 1.00 73.27  ? 275  THR A N   1 
ATOM   1910 C  CA  . THR A 1 286 ? 18.934  50.909 -1.618 1.00 74.76  ? 275  THR A CA  1 
ATOM   1911 C  C   . THR A 1 286 ? 19.827  49.726 -1.171 1.00 71.54  ? 275  THR A C   1 
ATOM   1912 O  O   . THR A 1 286 ? 21.037  49.850 -1.215 1.00 72.80  ? 275  THR A O   1 
ATOM   1913 C  CB  . THR A 1 286 ? 19.071  52.041 -0.601 1.00 77.94  ? 275  THR A CB  1 
ATOM   1914 O  OG1 . THR A 1 286 ? 18.745  51.551 0.688  1.00 77.34  ? 275  THR A OG1 1 
ATOM   1915 C  CG2 . THR A 1 286 ? 18.088  53.169 -0.908 1.00 81.31  ? 275  THR A CG2 1 
ATOM   1916 N  N   . HIS A 1 287 ? 19.238  48.608 -0.729 1.00 67.02  ? 276  HIS A N   1 
ATOM   1917 C  CA  . HIS A 1 287 ? 19.956  47.550 0.029  1.00 63.92  ? 276  HIS A CA  1 
ATOM   1918 C  C   . HIS A 1 287 ? 20.722  47.976 1.303  1.00 63.12  ? 276  HIS A C   1 
ATOM   1919 O  O   . HIS A 1 287 ? 21.560  47.212 1.812  1.00 62.08  ? 276  HIS A O   1 
ATOM   1920 C  CB  . HIS A 1 287 ? 20.881  46.747 -0.879 1.00 64.77  ? 276  HIS A CB  1 
ATOM   1921 C  CG  . HIS A 1 287 ? 20.155  45.849 -1.797 1.00 63.78  ? 276  HIS A CG  1 
ATOM   1922 N  ND1 . HIS A 1 287 ? 20.749  45.300 -2.909 1.00 66.09  ? 276  HIS A ND1 1 
ATOM   1923 C  CD2 . HIS A 1 287 ? 18.870  45.430 -1.799 1.00 61.72  ? 276  HIS A CD2 1 
ATOM   1924 C  CE1 . HIS A 1 287 ? 19.861  44.560 -3.552 1.00 65.39  ? 276  HIS A CE1 1 
ATOM   1925 N  NE2 . HIS A 1 287 ? 18.712  44.624 -2.901 1.00 62.58  ? 276  HIS A NE2 1 
ATOM   1926 N  N   . ARG A 1 288 ? 20.399  49.156 1.829  1.00 62.60  ? 277  ARG A N   1 
ATOM   1927 C  CA  . ARG A 1 288 ? 20.967  49.654 3.084  1.00 63.09  ? 277  ARG A CA  1 
ATOM   1928 C  C   . ARG A 1 288 ? 20.430  48.793 4.224  1.00 61.37  ? 277  ARG A C   1 
ATOM   1929 O  O   . ARG A 1 288 ? 19.363  48.215 4.116  1.00 59.40  ? 277  ARG A O   1 
ATOM   1930 C  CB  . ARG A 1 288 ? 20.601  51.132 3.274  1.00 64.34  ? 277  ARG A CB  1 
ATOM   1931 C  CG  . ARG A 1 288 ? 20.720  51.721 4.654  1.00 64.84  ? 277  ARG A CG  1 
ATOM   1932 C  CD  . ARG A 1 288 ? 20.347  53.195 4.621  1.00 66.99  ? 277  ARG A CD  1 
ATOM   1933 N  NE  . ARG A 1 288 ? 19.679  53.564 5.863  1.00 67.66  ? 277  ARG A NE  1 
ATOM   1934 C  CZ  . ARG A 1 288 ? 18.371  53.728 6.028  1.00 66.70  ? 277  ARG A CZ  1 
ATOM   1935 N  NH1 . ARG A 1 288 ? 17.540  53.614 5.010  1.00 65.63  ? 277  ARG A NH1 1 
ATOM   1936 N  NH2 . ARG A 1 288 ? 17.894  54.015 7.239  1.00 67.86  ? 277  ARG A NH2 1 
ATOM   1937 N  N   . VAL A 1 289 ? 21.201  48.695 5.297  1.00 62.89  ? 278  VAL A N   1 
ATOM   1938 C  CA  . VAL A 1 289 ? 20.936  47.762 6.362  1.00 61.76  ? 278  VAL A CA  1 
ATOM   1939 C  C   . VAL A 1 289 ? 20.325  48.558 7.425  1.00 62.33  ? 278  VAL A C   1 
ATOM   1940 O  O   . VAL A 1 289 ? 20.990  49.387 8.045  1.00 65.06  ? 278  VAL A O   1 
ATOM   1941 C  CB  . VAL A 1 289 ? 22.214  47.147 6.907  1.00 64.79  ? 278  VAL A CB  1 
ATOM   1942 C  CG1 . VAL A 1 289 ? 21.990  46.479 8.273  1.00 65.71  ? 278  VAL A CG1 1 
ATOM   1943 C  CG2 . VAL A 1 289 ? 22.735  46.164 5.872  1.00 64.64  ? 278  VAL A CG2 1 
ATOM   1944 N  N   . LEU A 1 290 ? 19.058  48.255 7.644  1.00 60.61  ? 279  LEU A N   1 
ATOM   1945 C  CA  . LEU A 1 290 ? 18.198  48.997 8.551  1.00 61.74  ? 279  LEU A CA  1 
ATOM   1946 C  C   . LEU A 1 290 ? 18.432  48.518 9.979  1.00 62.68  ? 279  LEU A C   1 
ATOM   1947 O  O   . LEU A 1 290 ? 18.577  49.321 10.911 1.00 63.79  ? 279  LEU A O   1 
ATOM   1948 C  CB  . LEU A 1 290 ? 16.733  48.850 8.100  1.00 59.92  ? 279  LEU A CB  1 
ATOM   1949 C  CG  . LEU A 1 290 ? 16.502  49.356 6.652  1.00 59.52  ? 279  LEU A CG  1 
ATOM   1950 C  CD1 . LEU A 1 290 ? 15.249  48.739 6.056  1.00 58.44  ? 279  LEU A CD1 1 
ATOM   1951 C  CD2 . LEU A 1 290 ? 16.453  50.874 6.545  1.00 61.69  ? 279  LEU A CD2 1 
ATOM   1952 N  N   . ALA A 1 291 ? 18.494  47.194 10.108 1.00 62.26  ? 280  ALA A N   1 
ATOM   1953 C  CA  . ALA A 1 291 ? 18.682  46.521 11.384 1.00 63.99  ? 280  ALA A CA  1 
ATOM   1954 C  C   . ALA A 1 291 ? 19.466  45.213 11.225 1.00 62.64  ? 280  ALA A C   1 
ATOM   1955 O  O   . ALA A 1 291 ? 19.402  44.555 10.199 1.00 58.38  ? 280  ALA A O   1 
ATOM   1956 C  CB  . ALA A 1 291 ? 17.327  46.259 12.038 1.00 63.96  ? 280  ALA A CB  1 
ATOM   1957 N  N   . ARG A 1 292 ? 20.212  44.894 12.274 1.00 66.34  ? 281  ARG A N   1 
ATOM   1958 C  CA  . ARG A 1 292 ? 20.987  43.690 12.383 1.00 67.87  ? 281  ARG A CA  1 
ATOM   1959 C  C   . ARG A 1 292 ? 20.844  43.124 13.797 1.00 71.12  ? 281  ARG A C   1 
ATOM   1960 O  O   . ARG A 1 292 ? 21.019  43.806 14.782 1.00 72.29  ? 281  ARG A O   1 
ATOM   1961 C  CB  . ARG A 1 292 ? 22.432  43.980 12.086 1.00 70.78  ? 281  ARG A CB  1 
ATOM   1962 C  CG  . ARG A 1 292 ? 23.248  42.755 11.783 1.00 72.19  ? 281  ARG A CG  1 
ATOM   1963 C  CD  . ARG A 1 292 ? 24.703  43.039 12.046 1.00 78.66  ? 281  ARG A CD  1 
ATOM   1964 N  NE  . ARG A 1 292 ? 25.108  44.356 11.570 1.00 80.49  ? 281  ARG A NE  1 
ATOM   1965 C  CZ  . ARG A 1 292 ? 25.572  44.625 10.361 1.00 80.50  ? 281  ARG A CZ  1 
ATOM   1966 N  NH1 . ARG A 1 292 ? 25.751  43.707 9.455  1.00 79.56  ? 281  ARG A NH1 1 
ATOM   1967 N  NH2 . ARG A 1 292 ? 25.881  45.838 10.063 1.00 83.32  ? 281  ARG A NH2 1 
ATOM   1968 N  N   . PHE A 1 293 ? 20.491  41.851 13.840 1.00 72.87  ? 282  PHE A N   1 
ATOM   1969 C  CA  . PHE A 1 293 ? 20.248  41.102 15.035 1.00 76.29  ? 282  PHE A CA  1 
ATOM   1970 C  C   . PHE A 1 293 ? 21.030  39.792 14.975 1.00 80.33  ? 282  PHE A C   1 
ATOM   1971 O  O   . PHE A 1 293 ? 20.912  39.033 13.996 1.00 78.17  ? 282  PHE A O   1 
ATOM   1972 C  CB  . PHE A 1 293 ? 18.783  40.779 15.077 1.00 73.07  ? 282  PHE A CB  1 
ATOM   1973 C  CG  . PHE A 1 293 ? 17.911  41.973 15.068 1.00 72.97  ? 282  PHE A CG  1 
ATOM   1974 C  CD1 . PHE A 1 293 ? 17.987  42.881 16.076 1.00 78.11  ? 282  PHE A CD1 1 
ATOM   1975 C  CD2 . PHE A 1 293 ? 16.994  42.182 14.071 1.00 70.61  ? 282  PHE A CD2 1 
ATOM   1976 C  CE1 . PHE A 1 293 ? 17.171  44.000 16.094 1.00 78.80  ? 282  PHE A CE1 1 
ATOM   1977 C  CE2 . PHE A 1 293 ? 16.165  43.293 14.087 1.00 71.16  ? 282  PHE A CE2 1 
ATOM   1978 C  CZ  . PHE A 1 293 ? 16.245  44.200 15.109 1.00 74.52  ? 282  PHE A CZ  1 
ATOM   1979 N  N   . HIS A 1 294 ? 21.799  39.517 16.022 1.00 87.63  ? 283  HIS A N   1 
ATOM   1980 C  CA  . HIS A 1 294 ? 22.601  38.302 16.111 1.00 93.46  ? 283  HIS A CA  1 
ATOM   1981 C  C   . HIS A 1 294 ? 22.491  37.685 17.523 1.00 98.39  ? 283  HIS A C   1 
ATOM   1982 O  O   . HIS A 1 294 ? 21.663  38.128 18.312 1.00 96.97  ? 283  HIS A O   1 
ATOM   1983 C  CB  . HIS A 1 294 ? 24.060  38.571 15.656 1.00 98.08  ? 283  HIS A CB  1 
ATOM   1984 C  CG  . HIS A 1 294 ? 24.689  39.780 16.265 1.00 103.24 ? 283  HIS A CG  1 
ATOM   1985 N  ND1 . HIS A 1 294 ? 24.904  40.935 15.550 1.00 103.18 ? 283  HIS A ND1 1 
ATOM   1986 C  CD2 . HIS A 1 294 ? 25.150  40.023 17.518 1.00 110.76 ? 283  HIS A CD2 1 
ATOM   1987 C  CE1 . HIS A 1 294 ? 25.461  41.845 16.332 1.00 108.54 ? 283  HIS A CE1 1 
ATOM   1988 N  NE2 . HIS A 1 294 ? 25.620  41.317 17.532 1.00 113.68 ? 283  HIS A NE2 1 
ATOM   1989 N  N   . GLY A 1 295 ? 23.292  36.655 17.827 1.00 104.51 ? 284  GLY A N   1 
ATOM   1990 C  CA  . GLY A 1 295 ? 23.229  35.955 19.108 1.00 111.06 ? 284  GLY A CA  1 
ATOM   1991 C  C   . GLY A 1 295 ? 23.270  36.893 20.296 1.00 118.34 ? 284  GLY A C   1 
ATOM   1992 O  O   . GLY A 1 295 ? 22.555  36.718 21.270 1.00 120.43 ? 284  GLY A O   1 
ATOM   1993 N  N   . ARG A 1 296 ? 24.106  37.906 20.204 1.00 124.23 ? 285  ARG A N   1 
ATOM   1994 C  CA  . ARG A 1 296 ? 24.232  38.877 21.273 1.00 134.42 ? 285  ARG A CA  1 
ATOM   1995 C  C   . ARG A 1 296 ? 23.473  40.198 21.093 1.00 135.55 ? 285  ARG A C   1 
ATOM   1996 O  O   . ARG A 1 296 ? 23.487  41.030 21.981 1.00 137.40 ? 285  ARG A O   1 
ATOM   1997 C  CB  . ARG A 1 296 ? 25.720  39.120 21.520 1.00 143.07 ? 285  ARG A CB  1 
ATOM   1998 C  CG  . ARG A 1 296 ? 26.462  37.859 21.953 1.00 148.02 ? 285  ARG A CG  1 
ATOM   1999 C  CD  . ARG A 1 296 ? 27.835  38.196 22.516 1.00 154.54 ? 285  ARG A CD  1 
ATOM   2000 N  NE  . ARG A 1 296 ? 27.758  38.824 23.841 1.00 160.19 ? 285  ARG A NE  1 
ATOM   2001 C  CZ  . ARG A 1 296 ? 28.796  39.348 24.516 1.00 170.15 ? 285  ARG A CZ  1 
ATOM   2002 N  NH1 . ARG A 1 296 ? 30.031  39.349 24.008 1.00 174.45 ? 285  ARG A NH1 1 
ATOM   2003 N  NH2 . ARG A 1 296 ? 28.612  39.888 25.724 1.00 174.76 ? 285  ARG A NH2 1 
ATOM   2004 N  N   . SER A 1 297 ? 22.797  40.379 19.968 1.00 140.62 ? 286  SER A N   1 
ATOM   2005 C  CA  . SER A 1 297 ? 21.927  41.545 19.732 1.00 145.18 ? 286  SER A CA  1 
ATOM   2006 C  C   . SER A 1 297 ? 20.460  41.054 19.676 1.00 147.12 ? 286  SER A C   1 
ATOM   2007 O  O   . SER A 1 297 ? 20.128  40.149 18.909 1.00 147.10 ? 286  SER A O   1 
ATOM   2008 C  CB  . SER A 1 297 ? 22.357  42.269 18.451 1.00 141.49 ? 286  SER A CB  1 
ATOM   2009 O  OG  . SER A 1 297 ? 22.513  41.349 17.387 1.00 141.03 ? 286  SER A OG  1 
ATOM   2010 N  N   . ARG A 1 298 ? 19.607  41.625 20.530 1.00 151.22 ? 287  ARG A N   1 
ATOM   2011 C  CA  . ARG A 1 298 ? 18.285  41.059 20.855 1.00 146.27 ? 287  ARG A CA  1 
ATOM   2012 C  C   . ARG A 1 298 ? 17.139  41.942 20.303 1.00 144.70 ? 287  ARG A C   1 
ATOM   2013 O  O   . ARG A 1 298 ? 17.073  43.136 20.632 1.00 155.04 ? 287  ARG A O   1 
ATOM   2014 C  CB  . ARG A 1 298 ? 18.174  40.902 22.378 1.00 144.64 ? 287  ARG A CB  1 
ATOM   2015 C  CG  . ARG A 1 298 ? 19.280  40.034 22.981 1.00 144.36 ? 287  ARG A CG  1 
ATOM   2016 C  CD  . ARG A 1 298 ? 18.768  39.127 24.101 1.00 145.72 ? 287  ARG A CD  1 
ATOM   2017 N  NE  . ARG A 1 298 ? 17.536  38.437 23.698 1.00 139.34 ? 287  ARG A NE  1 
ATOM   2018 C  CZ  . ARG A 1 298 ? 17.457  37.372 22.898 1.00 132.44 ? 287  ARG A CZ  1 
ATOM   2019 N  NH1 . ARG A 1 298 ? 18.550  36.796 22.408 1.00 132.00 ? 287  ARG A NH1 1 
ATOM   2020 N  NH2 . ARG A 1 298 ? 16.264  36.871 22.579 1.00 127.31 ? 287  ARG A NH2 1 
ATOM   2021 N  N   . PRO A 1 299 ? 16.237  41.366 19.469 1.00 133.04 ? 288  PRO A N   1 
ATOM   2022 C  CA  . PRO A 1 299 ? 15.298  42.172 18.674 1.00 124.01 ? 288  PRO A CA  1 
ATOM   2023 C  C   . PRO A 1 299 ? 14.311  42.948 19.532 1.00 120.28 ? 288  PRO A C   1 
ATOM   2024 O  O   . PRO A 1 299 ? 13.757  42.356 20.464 1.00 114.29 ? 288  PRO A O   1 
ATOM   2025 C  CB  . PRO A 1 299 ? 14.574  41.134 17.815 1.00 120.60 ? 288  PRO A CB  1 
ATOM   2026 C  CG  . PRO A 1 299 ? 14.659  39.888 18.615 1.00 125.44 ? 288  PRO A CG  1 
ATOM   2027 C  CD  . PRO A 1 299 ? 16.002  39.926 19.280 1.00 130.43 ? 288  PRO A CD  1 
ATOM   2028 N  N   . PRO A 1 300 ? 14.095  44.257 19.213 1.00 120.36 ? 289  PRO A N   1 
ATOM   2029 C  CA  . PRO A 1 300 ? 13.212  45.009 20.070 1.00 123.04 ? 289  PRO A CA  1 
ATOM   2030 C  C   . PRO A 1 300 ? 11.803  44.508 19.913 1.00 121.10 ? 289  PRO A C   1 
ATOM   2031 O  O   . PRO A 1 300 ? 11.464  43.868 18.911 1.00 116.19 ? 289  PRO A O   1 
ATOM   2032 C  CB  . PRO A 1 300 ? 13.334  46.459 19.569 1.00 124.76 ? 289  PRO A CB  1 
ATOM   2033 C  CG  . PRO A 1 300 ? 14.269  46.444 18.390 1.00 120.95 ? 289  PRO A CG  1 
ATOM   2034 C  CD  . PRO A 1 300 ? 14.441  45.020 17.989 1.00 118.50 ? 289  PRO A CD  1 
ATOM   2035 N  N   . LEU A 1 301 ? 11.025  44.774 20.952 1.00 127.14 ? 290  LEU A N   1 
ATOM   2036 C  CA  . LEU A 1 301 ? 9.575   44.540 21.028 1.00 127.59 ? 290  LEU A CA  1 
ATOM   2037 C  C   . LEU A 1 301 ? 8.904   44.560 19.646 1.00 120.34 ? 290  LEU A C   1 
ATOM   2038 O  O   . LEU A 1 301 ? 8.184   43.637 19.228 1.00 112.60 ? 290  LEU A O   1 
ATOM   2039 C  CB  . LEU A 1 301 ? 9.008   45.651 21.942 1.00 134.40 ? 290  LEU A CB  1 
ATOM   2040 C  CG  . LEU A 1 301 ? 7.558   45.754 22.399 1.00 137.02 ? 290  LEU A CG  1 
ATOM   2041 C  CD1 . LEU A 1 301 ? 7.077   44.430 22.980 1.00 137.08 ? 290  LEU A CD1 1 
ATOM   2042 C  CD2 . LEU A 1 301 ? 7.438   46.889 23.433 1.00 140.68 ? 290  LEU A CD2 1 
ATOM   2043 N  N   . SER A 1 302 ? 9.221   45.632 18.939 1.00 118.35 ? 291  SER A N   1 
ATOM   2044 C  CA  . SER A 1 302 ? 8.712   45.910 17.632 1.00 115.71 ? 291  SER A CA  1 
ATOM   2045 C  C   . SER A 1 302 ? 9.612   46.996 17.045 1.00 111.27 ? 291  SER A C   1 
ATOM   2046 O  O   . SER A 1 302 ? 10.340  47.670 17.773 1.00 113.61 ? 291  SER A O   1 
ATOM   2047 C  CB  . SER A 1 302 ? 7.265   46.415 17.773 1.00 123.23 ? 291  SER A CB  1 
ATOM   2048 O  OG  . SER A 1 302 ? 6.770   47.012 16.595 1.00 126.50 ? 291  SER A OG  1 
ATOM   2049 N  N   . PHE A 1 303 ? 9.600   47.137 15.728 1.00 104.69 ? 292  PHE A N   1 
ATOM   2050 C  CA  . PHE A 1 303 ? 10.028  48.386 15.103 1.00 102.03 ? 292  PHE A CA  1 
ATOM   2051 C  C   . PHE A 1 303 ? 9.329   48.576 13.762 1.00 94.60  ? 292  PHE A C   1 
ATOM   2052 O  O   . PHE A 1 303 ? 8.853   47.632 13.155 1.00 91.39  ? 292  PHE A O   1 
ATOM   2053 C  CB  . PHE A 1 303 ? 11.559  48.492 14.983 1.00 103.94 ? 292  PHE A CB  1 
ATOM   2054 C  CG  . PHE A 1 303 ? 12.158  47.487 14.069 1.00 103.37 ? 292  PHE A CG  1 
ATOM   2055 C  CD1 . PHE A 1 303 ? 11.998  47.617 12.705 1.00 102.04 ? 292  PHE A CD1 1 
ATOM   2056 C  CD2 . PHE A 1 303 ? 12.864  46.396 14.568 1.00 107.15 ? 292  PHE A CD2 1 
ATOM   2057 C  CE1 . PHE A 1 303 ? 12.508  46.677 11.834 1.00 101.28 ? 292  PHE A CE1 1 
ATOM   2058 C  CE2 . PHE A 1 303 ? 13.386  45.454 13.699 1.00 105.76 ? 292  PHE A CE2 1 
ATOM   2059 C  CZ  . PHE A 1 303 ? 13.215  45.596 12.327 1.00 102.54 ? 292  PHE A CZ  1 
ATOM   2060 N  N   . ASN A 1 304 ? 9.299   49.818 13.320 1.00 92.28  ? 293  ASN A N   1 
ATOM   2061 C  CA  . ASN A 1 304 ? 8.585   50.239 12.142 1.00 89.87  ? 293  ASN A CA  1 
ATOM   2062 C  C   . ASN A 1 304 ? 9.607   50.530 11.082 1.00 84.79  ? 293  ASN A C   1 
ATOM   2063 O  O   . ASN A 1 304 ? 10.681  50.956 11.403 1.00 84.34  ? 293  ASN A O   1 
ATOM   2064 C  CB  . ASN A 1 304 ? 7.817   51.526 12.467 1.00 96.12  ? 293  ASN A CB  1 
ATOM   2065 C  CG  . ASN A 1 304 ? 6.486   51.268 13.169 1.00 100.81 ? 293  ASN A CG  1 
ATOM   2066 O  OD1 . ASN A 1 304 ? 5.839   50.206 12.982 1.00 97.73  ? 293  ASN A OD1 1 
ATOM   2067 N  ND2 . ASN A 1 304 ? 6.041   52.272 13.958 1.00 106.89 ? 293  ASN A ND2 1 
ATOM   2068 N  N   . VAL A 1 305 ? 9.303   50.290 9.819  1.00 82.77  ? 294  VAL A N   1 
ATOM   2069 C  CA  . VAL A 1 305 ? 10.148  50.809 8.751  1.00 82.62  ? 294  VAL A CA  1 
ATOM   2070 C  C   . VAL A 1 305 ? 9.329   51.644 7.824  1.00 85.34  ? 294  VAL A C   1 
ATOM   2071 O  O   . VAL A 1 305 ? 8.297   51.179 7.342  1.00 85.17  ? 294  VAL A O   1 
ATOM   2072 C  CB  . VAL A 1 305 ? 10.787  49.724 7.879  1.00 79.74  ? 294  VAL A CB  1 
ATOM   2073 C  CG1 . VAL A 1 305 ? 11.836  50.361 6.976  1.00 79.47  ? 294  VAL A CG1 1 
ATOM   2074 C  CG2 . VAL A 1 305 ? 11.432  48.659 8.735  1.00 78.82  ? 294  VAL A CG2 1 
ATOM   2075 N  N   . SER A 1 306 ? 9.839   52.833 7.508  1.00 88.60  ? 295  SER A N   1 
ATOM   2076 C  CA  . SER A 1 306 ? 9.165   53.765 6.586  1.00 93.64  ? 295  SER A CA  1 
ATOM   2077 C  C   . SER A 1 306 ? 9.346   53.398 5.067  1.00 90.87  ? 295  SER A C   1 
ATOM   2078 O  O   . SER A 1 306 ? 9.813   54.211 4.253  1.00 91.43  ? 295  SER A O   1 
ATOM   2079 C  CB  . SER A 1 306 ? 9.594   55.209 6.918  1.00 96.92  ? 295  SER A CB  1 
ATOM   2080 O  OG  . SER A 1 306 ? 9.650   55.362 8.327  1.00 98.01  ? 295  SER A OG  1 
ATOM   2081 N  N   . LEU A 1 307 ? 8.929   52.179 4.720  1.00 87.62  ? 296  LEU A N   1 
ATOM   2082 C  CA  . LEU A 1 307 ? 9.062   51.616 3.381  1.00 87.08  ? 296  LEU A CA  1 
ATOM   2083 C  C   . LEU A 1 307 ? 7.955   50.580 3.091  1.00 87.09  ? 296  LEU A C   1 
ATOM   2084 O  O   . LEU A 1 307 ? 7.400   49.966 4.014  1.00 86.78  ? 296  LEU A O   1 
ATOM   2085 C  CB  . LEU A 1 307 ? 10.422  50.910 3.212  1.00 83.42  ? 296  LEU A CB  1 
ATOM   2086 C  CG  . LEU A 1 307 ? 11.741  51.652 3.441  1.00 82.95  ? 296  LEU A CG  1 
ATOM   2087 C  CD1 . LEU A 1 307 ? 12.865  50.659 3.310  1.00 78.86  ? 296  LEU A CD1 1 
ATOM   2088 C  CD2 . LEU A 1 307 ? 11.984  52.802 2.473  1.00 87.75  ? 296  LEU A CD2 1 
ATOM   2089 N  N   . ASP A 1 308 ? 7.667   50.381 1.804  1.00 86.74  ? 297  ASP A N   1 
ATOM   2090 C  CA  . ASP A 1 308 ? 6.718   49.365 1.360  1.00 86.30  ? 297  ASP A CA  1 
ATOM   2091 C  C   . ASP A 1 308 ? 7.461   48.157 0.811  1.00 82.58  ? 297  ASP A C   1 
ATOM   2092 O  O   . ASP A 1 308 ? 6.832   47.196 0.359  1.00 80.22  ? 297  ASP A O   1 
ATOM   2093 C  CB  . ASP A 1 308 ? 5.715   49.946 0.323  1.00 91.80  ? 297  ASP A CB  1 
ATOM   2094 C  CG  . ASP A 1 308 ? 6.356   50.320 -1.034 1.00 91.96  ? 297  ASP A CG  1 
ATOM   2095 O  OD1 . ASP A 1 308 ? 7.577   50.598 -1.059 1.00 90.30  ? 297  ASP A OD1 1 
ATOM   2096 O  OD2 . ASP A 1 308 ? 5.624   50.354 -2.057 1.00 91.73  ? 297  ASP A OD2 1 
ATOM   2097 N  N   . PHE A 1 309 ? 8.796   48.200 0.873  1.00 82.65  ? 298  PHE A N   1 
ATOM   2098 C  CA  . PHE A 1 309 ? 9.680   47.227 0.170  1.00 81.91  ? 298  PHE A CA  1 
ATOM   2099 C  C   . PHE A 1 309 ? 10.929  46.955 1.033  1.00 78.60  ? 298  PHE A C   1 
ATOM   2100 O  O   . PHE A 1 309 ? 11.868  47.781 1.079  1.00 79.77  ? 298  PHE A O   1 
ATOM   2101 C  CB  . PHE A 1 309 ? 10.042  47.793 -1.236 1.00 83.94  ? 298  PHE A CB  1 
ATOM   2102 C  CG  . PHE A 1 309 ? 10.983  46.935 -2.086 1.00 80.79  ? 298  PHE A CG  1 
ATOM   2103 C  CD1 . PHE A 1 309 ? 11.092  45.554 -1.934 1.00 78.49  ? 298  PHE A CD1 1 
ATOM   2104 C  CD2 . PHE A 1 309 ? 11.713  47.535 -3.119 1.00 81.84  ? 298  PHE A CD2 1 
ATOM   2105 C  CE1 . PHE A 1 309 ? 11.941  44.811 -2.763 1.00 77.54  ? 298  PHE A CE1 1 
ATOM   2106 C  CE2 . PHE A 1 309 ? 12.573  46.805 -3.934 1.00 80.14  ? 298  PHE A CE2 1 
ATOM   2107 C  CZ  . PHE A 1 309 ? 12.684  45.442 -3.757 1.00 78.40  ? 298  PHE A CZ  1 
ATOM   2108 N  N   . VAL A 1 310 ? 10.909  45.814 1.731  1.00 73.50  ? 299  VAL A N   1 
ATOM   2109 C  CA  . VAL A 1 310 ? 11.983  45.450 2.639  1.00 69.66  ? 299  VAL A CA  1 
ATOM   2110 C  C   . VAL A 1 310 ? 12.411  44.029 2.346  1.00 68.10  ? 299  VAL A C   1 
ATOM   2111 O  O   . VAL A 1 310 ? 11.620  43.188 1.933  1.00 65.61  ? 299  VAL A O   1 
ATOM   2112 C  CB  . VAL A 1 310 ? 11.584  45.600 4.112  1.00 67.93  ? 299  VAL A CB  1 
ATOM   2113 C  CG1 . VAL A 1 310 ? 12.746  45.236 5.010  1.00 67.05  ? 299  VAL A CG1 1 
ATOM   2114 C  CG2 . VAL A 1 310 ? 11.193  47.029 4.403  1.00 69.97  ? 299  VAL A CG2 1 
ATOM   2115 N  N   . ILE A 1 311 ? 13.698  43.800 2.534  1.00 69.40  ? 300  ILE A N   1 
ATOM   2116 C  CA  . ILE A 1 311 ? 14.273  42.492 2.404  1.00 70.43  ? 300  ILE A CA  1 
ATOM   2117 C  C   . ILE A 1 311 ? 14.778  42.010 3.747  1.00 69.47  ? 300  ILE A C   1 
ATOM   2118 O  O   . ILE A 1 311 ? 15.456  42.755 4.476  1.00 71.08  ? 300  ILE A O   1 
ATOM   2119 C  CB  . ILE A 1 311 ? 15.430  42.514 1.417  1.00 73.17  ? 300  ILE A CB  1 
ATOM   2120 C  CG1 . ILE A 1 311 ? 14.867  42.946 0.066  1.00 76.26  ? 300  ILE A CG1 1 
ATOM   2121 C  CG2 . ILE A 1 311 ? 16.115  41.138 1.365  1.00 72.94  ? 300  ILE A CG2 1 
ATOM   2122 C  CD1 . ILE A 1 311 ? 15.866  42.911 -1.067 1.00 80.27  ? 300  ILE A CD1 1 
ATOM   2123 N  N   . LEU A 1 312 ? 14.456  40.751 4.048  1.00 65.44  ? 301  LEU A N   1 
ATOM   2124 C  CA  . LEU A 1 312 ? 14.915  40.102 5.247  1.00 62.29  ? 301  LEU A CA  1 
ATOM   2125 C  C   . LEU A 1 312 ? 16.057  39.215 4.824  1.00 62.59  ? 301  LEU A C   1 
ATOM   2126 O  O   . LEU A 1 312 ? 15.924  38.532 3.792  1.00 64.16  ? 301  LEU A O   1 
ATOM   2127 C  CB  . LEU A 1 312 ? 13.787  39.290 5.769  1.00 60.67  ? 301  LEU A CB  1 
ATOM   2128 C  CG  . LEU A 1 312 ? 14.025  38.728 7.142  1.00 61.24  ? 301  LEU A CG  1 
ATOM   2129 C  CD1 . LEU A 1 312 ? 14.121  39.849 8.125  1.00 62.37  ? 301  LEU A CD1 1 
ATOM   2130 C  CD2 . LEU A 1 312 ? 12.867  37.811 7.514  1.00 61.46  ? 301  LEU A CD2 1 
ATOM   2131 N  N   . TYR A 1 313 ? 17.179  39.255 5.564  1.00 62.42  ? 302  TYR A N   1 
ATOM   2132 C  CA  . TYR A 1 313 ? 18.446  38.568 5.169  1.00 62.33  ? 302  TYR A CA  1 
ATOM   2133 C  C   . TYR A 1 313 ? 18.963  37.738 6.319  1.00 63.91  ? 302  TYR A C   1 
ATOM   2134 O  O   . TYR A 1 313 ? 19.106  38.244 7.408  1.00 66.17  ? 302  TYR A O   1 
ATOM   2135 C  CB  . TYR A 1 313 ? 19.537  39.561 4.693  1.00 62.68  ? 302  TYR A CB  1 
ATOM   2136 C  CG  . TYR A 1 313 ? 20.916  38.943 4.498  1.00 65.01  ? 302  TYR A CG  1 
ATOM   2137 C  CD1 . TYR A 1 313 ? 21.198  38.091 3.456  1.00 66.43  ? 302  TYR A CD1 1 
ATOM   2138 C  CD2 . TYR A 1 313 ? 21.927  39.209 5.367  1.00 69.13  ? 302  TYR A CD2 1 
ATOM   2139 C  CE1 . TYR A 1 313 ? 22.449  37.510 3.307  1.00 70.45  ? 302  TYR A CE1 1 
ATOM   2140 C  CE2 . TYR A 1 313 ? 23.193  38.657 5.227  1.00 73.01  ? 302  TYR A CE2 1 
ATOM   2141 C  CZ  . TYR A 1 313 ? 23.452  37.809 4.201  1.00 73.81  ? 302  TYR A CZ  1 
ATOM   2142 O  OH  . TYR A 1 313 ? 24.726  37.301 4.108  1.00 80.23  ? 302  TYR A OH  1 
ATOM   2143 N  N   . PHE A 1 314 ? 19.269  36.471 6.087  1.00 65.12  ? 303  PHE A N   1 
ATOM   2144 C  CA  . PHE A 1 314 ? 19.743  35.603 7.169  1.00 67.97  ? 303  PHE A CA  1 
ATOM   2145 C  C   . PHE A 1 314 ? 21.026  34.870 6.765  1.00 71.49  ? 303  PHE A C   1 
ATOM   2146 O  O   . PHE A 1 314 ? 21.048  34.179 5.761  1.00 69.99  ? 303  PHE A O   1 
ATOM   2147 C  CB  . PHE A 1 314 ? 18.625  34.617 7.586  1.00 66.67  ? 303  PHE A CB  1 
ATOM   2148 C  CG  . PHE A 1 314 ? 19.068  33.583 8.601  1.00 67.89  ? 303  PHE A CG  1 
ATOM   2149 C  CD1 . PHE A 1 314 ? 19.252  33.920 9.927  1.00 68.27  ? 303  PHE A CD1 1 
ATOM   2150 C  CD2 . PHE A 1 314 ? 19.329  32.283 8.217  1.00 67.52  ? 303  PHE A CD2 1 
ATOM   2151 C  CE1 . PHE A 1 314 ? 19.673  32.978 10.843 1.00 70.11  ? 303  PHE A CE1 1 
ATOM   2152 C  CE2 . PHE A 1 314 ? 19.766  31.344 9.131  1.00 69.11  ? 303  PHE A CE2 1 
ATOM   2153 C  CZ  . PHE A 1 314 ? 19.936  31.692 10.445 1.00 70.51  ? 303  PHE A CZ  1 
ATOM   2154 N  N   . PHE A 1 315 ? 22.084  35.018 7.556  1.00 77.25  ? 304  PHE A N   1 
ATOM   2155 C  CA  . PHE A 1 315 ? 23.385  34.398 7.264  1.00 86.23  ? 304  PHE A CA  1 
ATOM   2156 C  C   . PHE A 1 315 ? 23.658  33.481 8.435  1.00 88.32  ? 304  PHE A C   1 
ATOM   2157 O  O   . PHE A 1 315 ? 23.432  33.882 9.572  1.00 89.50  ? 304  PHE A O   1 
ATOM   2158 C  CB  . PHE A 1 315 ? 24.481  35.482 7.116  1.00 94.12  ? 304  PHE A CB  1 
ATOM   2159 C  CG  . PHE A 1 315 ? 25.922  34.949 6.909  1.00 106.98 ? 304  PHE A CG  1 
ATOM   2160 C  CD1 . PHE A 1 315 ? 26.708  34.513 8.009  1.00 112.66 ? 304  PHE A CD1 1 
ATOM   2161 C  CD2 . PHE A 1 315 ? 26.534  34.939 5.616  1.00 111.55 ? 304  PHE A CD2 1 
ATOM   2162 C  CE1 . PHE A 1 315 ? 28.025  34.061 7.823  1.00 117.69 ? 304  PHE A CE1 1 
ATOM   2163 C  CE2 . PHE A 1 315 ? 27.851  34.477 5.438  1.00 116.31 ? 304  PHE A CE2 1 
ATOM   2164 C  CZ  . PHE A 1 315 ? 28.591  34.042 6.542  1.00 119.86 ? 304  PHE A CZ  1 
ATOM   2165 N  N   . SER A 1 316 ? 24.134  32.264 8.166  1.00 90.12  ? 305  SER A N   1 
ATOM   2166 C  CA  . SER A 1 316 ? 24.389  31.310 9.215  1.00 93.72  ? 305  SER A CA  1 
ATOM   2167 C  C   . SER A 1 316 ? 25.804  30.780 9.165  1.00 102.51 ? 305  SER A C   1 
ATOM   2168 O  O   . SER A 1 316 ? 26.362  30.485 8.118  1.00 100.74 ? 305  SER A O   1 
ATOM   2169 C  CB  . SER A 1 316 ? 23.385  30.181 9.157  1.00 91.86  ? 305  SER A CB  1 
ATOM   2170 O  OG  . SER A 1 316 ? 23.737  29.141 10.046 1.00 98.06  ? 305  SER A OG  1 
ATOM   2171 N  N   . ASP A 1 317 ? 26.365  30.678 10.358 1.00 114.95 ? 306  ASP A N   1 
ATOM   2172 C  CA  . ASP A 1 317 ? 27.668  30.110 10.586 1.00 126.12 ? 306  ASP A CA  1 
ATOM   2173 C  C   . ASP A 1 317 ? 27.554  28.623 10.410 1.00 129.96 ? 306  ASP A C   1 
ATOM   2174 O  O   . ASP A 1 317 ? 26.576  28.008 10.873 1.00 126.93 ? 306  ASP A O   1 
ATOM   2175 C  CB  . ASP A 1 317 ? 28.107  30.383 12.024 1.00 131.89 ? 306  ASP A CB  1 
ATOM   2176 C  CG  . ASP A 1 317 ? 29.505  29.956 12.279 1.00 142.30 ? 306  ASP A CG  1 
ATOM   2177 O  OD1 . ASP A 1 317 ? 30.140  29.417 11.355 1.00 147.00 ? 306  ASP A OD1 1 
ATOM   2178 O  OD2 . ASP A 1 317 ? 29.991  30.152 13.402 1.00 150.75 ? 306  ASP A OD2 1 
ATOM   2179 N  N   . ARG A 1 318 ? 28.556  28.041 9.756  1.00 137.63 ? 307  ARG A N   1 
ATOM   2180 C  CA  . ARG A 1 318 ? 28.686  26.582 9.731  1.00 146.25 ? 307  ARG A CA  1 
ATOM   2181 C  C   . ARG A 1 318 ? 28.701  25.979 11.128 1.00 154.28 ? 307  ARG A C   1 
ATOM   2182 O  O   . ARG A 1 318 ? 28.009  25.005 11.413 1.00 155.90 ? 307  ARG A O   1 
ATOM   2183 C  CB  . ARG A 1 318 ? 29.987  26.139 9.074  1.00 152.95 ? 307  ARG A CB  1 
ATOM   2184 C  CG  . ARG A 1 318 ? 30.022  26.202 7.556  1.00 152.30 ? 307  ARG A CG  1 
ATOM   2185 C  CD  . ARG A 1 318 ? 30.693  24.957 6.950  1.00 159.13 ? 307  ARG A CD  1 
ATOM   2186 N  NE  . ARG A 1 318 ? 31.639  25.235 5.847  1.00 163.21 ? 307  ARG A NE  1 
ATOM   2187 C  CZ  . ARG A 1 318 ? 31.339  25.818 4.680  1.00 158.33 ? 307  ARG A CZ  1 
ATOM   2188 N  NH1 . ARG A 1 318 ? 30.093  26.228 4.377  1.00 147.90 ? 307  ARG A NH1 1 
ATOM   2189 N  NH2 . ARG A 1 318 ? 32.319  25.998 3.787  1.00 162.35 ? 307  ARG A NH2 1 
ATOM   2190 N  N   . ILE A 1 319 ? 29.537  26.560 11.985 1.00 162.72 ? 308  ILE A N   1 
ATOM   2191 C  CA  . ILE A 1 319 ? 29.889  25.941 13.262 1.00 169.35 ? 308  ILE A CA  1 
ATOM   2192 C  C   . ILE A 1 319 ? 28.634  25.758 14.125 1.00 166.24 ? 308  ILE A C   1 
ATOM   2193 O  O   . ILE A 1 319 ? 28.469  24.689 14.720 1.00 169.06 ? 308  ILE A O   1 
ATOM   2194 C  CB  . ILE A 1 319 ? 31.026  26.688 14.037 1.00 175.39 ? 308  ILE A CB  1 
ATOM   2195 C  CG1 . ILE A 1 319 ? 32.320  26.832 13.192 1.00 178.95 ? 308  ILE A CG1 1 
ATOM   2196 C  CG2 . ILE A 1 319 ? 31.392  25.901 15.300 1.00 182.05 ? 308  ILE A CG2 1 
ATOM   2197 C  CD1 . ILE A 1 319 ? 33.350  27.805 13.743 1.00 181.95 ? 308  ILE A CD1 1 
ATOM   2198 N  N   . ASN A 1 320 ? 27.748  26.764 14.185 1.00 160.77 ? 309  ASN A N   1 
ATOM   2199 C  CA  . ASN A 1 320 ? 26.537  26.610 14.997 1.00 156.40 ? 309  ASN A CA  1 
ATOM   2200 C  C   . ASN A 1 320 ? 25.233  26.757 14.301 1.00 145.83 ? 309  ASN A C   1 
ATOM   2201 O  O   . ASN A 1 320 ? 25.033  27.607 13.435 1.00 136.41 ? 309  ASN A O   1 
ATOM   2202 C  CB  . ASN A 1 320 ? 26.465  27.553 16.183 1.00 157.82 ? 309  ASN A CB  1 
ATOM   2203 C  CG  . ASN A 1 320 ? 27.658  27.437 17.110 1.00 165.70 ? 309  ASN A CG  1 
ATOM   2204 O  OD1 . ASN A 1 320 ? 28.703  26.883 16.762 1.00 170.84 ? 309  ASN A OD1 1 
ATOM   2205 N  ND2 . ASN A 1 320 ? 27.506  27.982 18.306 1.00 166.14 ? 309  ASN A ND2 1 
ATOM   2206 N  N   . GLN A 1 321 ? 24.339  25.919 14.803 1.00 145.13 ? 310  GLN A N   1 
ATOM   2207 C  CA  . GLN A 1 321 ? 22.937  26.021 14.593 1.00 139.58 ? 310  GLN A CA  1 
ATOM   2208 C  C   . GLN A 1 321 ? 22.179  26.015 15.960 1.00 134.69 ? 310  GLN A C   1 
ATOM   2209 O  O   . GLN A 1 321 ? 22.561  25.336 16.933 1.00 132.29 ? 310  GLN A O   1 
ATOM   2210 C  CB  . GLN A 1 321 ? 22.488  24.892 13.661 1.00 144.73 ? 310  GLN A CB  1 
ATOM   2211 C  CG  . GLN A 1 321 ? 22.850  23.474 14.102 1.00 155.29 ? 310  GLN A CG  1 
ATOM   2212 C  CD  . GLN A 1 321 ? 22.245  22.390 13.196 1.00 156.33 ? 310  GLN A CD  1 
ATOM   2213 O  OE1 . GLN A 1 321 ? 21.935  22.625 12.025 1.00 149.08 ? 310  GLN A OE1 1 
ATOM   2214 N  NE2 . GLN A 1 321 ? 22.086  21.192 13.743 1.00 159.56 ? 310  GLN A NE2 1 
ATOM   2215 N  N   . ALA A 1 322 ? 21.057  26.738 15.954 1.00 128.00 ? 311  ALA A N   1 
ATOM   2216 C  CA  . ALA A 1 322 ? 20.220  27.075 17.118 1.00 123.76 ? 311  ALA A CA  1 
ATOM   2217 C  C   . ALA A 1 322 ? 18.711  26.899 16.752 1.00 116.28 ? 311  ALA A C   1 
ATOM   2218 O  O   . ALA A 1 322 ? 18.368  26.680 15.570 1.00 110.08 ? 311  ALA A O   1 
ATOM   2219 C  CB  . ALA A 1 322 ? 20.514  28.515 17.563 1.00 123.04 ? 311  ALA A CB  1 
ATOM   2220 N  N   . GLN A 1 323 ? 17.825  27.001 17.751 1.00 113.80 ? 312  GLN A N   1 
ATOM   2221 C  CA  . GLN A 1 323 ? 16.346  26.901 17.539 1.00 108.87 ? 312  GLN A CA  1 
ATOM   2222 C  C   . GLN A 1 323 ? 15.793  27.651 16.298 1.00 97.53  ? 312  GLN A C   1 
ATOM   2223 O  O   . GLN A 1 323 ? 14.946  27.115 15.578 1.00 93.24  ? 312  GLN A O   1 
ATOM   2224 C  CB  . GLN A 1 323 ? 15.596  27.367 18.799 1.00 113.39 ? 312  GLN A CB  1 
ATOM   2225 C  CG  . GLN A 1 323 ? 14.060  27.346 18.760 1.00 113.50 ? 312  GLN A CG  1 
ATOM   2226 C  CD  . GLN A 1 323 ? 13.451  27.543 20.161 1.00 120.43 ? 312  GLN A CD  1 
ATOM   2227 O  OE1 . GLN A 1 323 ? 14.055  28.185 21.021 1.00 124.24 ? 312  GLN A OE1 1 
ATOM   2228 N  NE2 . GLN A 1 323 ? 12.259  26.977 20.399 1.00 122.79 ? 312  GLN A NE2 1 
ATOM   2229 N  N   . GLY A 1 324 ? 16.292  28.872 16.077 1.00 90.12  ? 313  GLY A N   1 
ATOM   2230 C  CA  . GLY A 1 324 ? 15.968  29.695 14.924 1.00 80.33  ? 313  GLY A CA  1 
ATOM   2231 C  C   . GLY A 1 324 ? 15.170  30.881 15.362 1.00 76.58  ? 313  GLY A C   1 
ATOM   2232 O  O   . GLY A 1 324 ? 15.303  31.317 16.483 1.00 79.83  ? 313  GLY A O   1 
ATOM   2233 N  N   . PHE A 1 325 ? 14.302  31.389 14.499 1.00 72.02  ? 314  PHE A N   1 
ATOM   2234 C  CA  . PHE A 1 325 ? 13.473  32.569 14.833 1.00 70.74  ? 314  PHE A CA  1 
ATOM   2235 C  C   . PHE A 1 325 ? 12.142  32.576 14.082 1.00 67.11  ? 314  PHE A C   1 
ATOM   2236 O  O   . PHE A 1 325 ? 11.956  31.833 13.118 1.00 63.39  ? 314  PHE A O   1 
ATOM   2237 C  CB  . PHE A 1 325 ? 14.210  33.870 14.497 1.00 69.90  ? 314  PHE A CB  1 
ATOM   2238 C  CG  . PHE A 1 325 ? 14.365  34.090 13.027 1.00 67.58  ? 314  PHE A CG  1 
ATOM   2239 C  CD1 . PHE A 1 325 ? 13.302  34.600 12.259 1.00 65.26  ? 314  PHE A CD1 1 
ATOM   2240 C  CD2 . PHE A 1 325 ? 15.544  33.733 12.386 1.00 67.76  ? 314  PHE A CD2 1 
ATOM   2241 C  CE1 . PHE A 1 325 ? 13.428  34.764 10.895 1.00 62.85  ? 314  PHE A CE1 1 
ATOM   2242 C  CE2 . PHE A 1 325 ? 15.678  33.908 11.018 1.00 65.69  ? 314  PHE A CE2 1 
ATOM   2243 C  CZ  . PHE A 1 325 ? 14.620  34.430 10.272 1.00 63.75  ? 314  PHE A CZ  1 
ATOM   2244 N  N   . ALA A 1 326 ? 11.260  33.481 14.503 1.00 67.03  ? 315  ALA A N   1 
ATOM   2245 C  CA  . ALA A 1 326 ? 10.013  33.762 13.811 1.00 65.34  ? 315  ALA A CA  1 
ATOM   2246 C  C   . ALA A 1 326 ? 9.748   35.255 13.840 1.00 66.69  ? 315  ALA A C   1 
ATOM   2247 O  O   . ALA A 1 326 ? 9.699   35.850 14.930 1.00 68.74  ? 315  ALA A O   1 
ATOM   2248 C  CB  . ALA A 1 326 ? 8.881   33.055 14.496 1.00 67.35  ? 315  ALA A CB  1 
ATOM   2249 N  N   . VAL A 1 327 ? 9.548   35.844 12.654 1.00 65.31  ? 316  VAL A N   1 
ATOM   2250 C  CA  . VAL A 1 327 ? 9.282   37.285 12.511 1.00 65.79  ? 316  VAL A CA  1 
ATOM   2251 C  C   . VAL A 1 327 ? 7.964   37.566 11.820 1.00 65.05  ? 316  VAL A C   1 
ATOM   2252 O  O   . VAL A 1 327 ? 7.689   37.063 10.732 1.00 64.55  ? 316  VAL A O   1 
ATOM   2253 C  CB  . VAL A 1 327 ? 10.403  38.045 11.779 1.00 64.79  ? 316  VAL A CB  1 
ATOM   2254 C  CG1 . VAL A 1 327 ? 10.794  37.372 10.507 1.00 64.64  ? 316  VAL A CG1 1 
ATOM   2255 C  CG2 . VAL A 1 327 ? 9.992   39.457 11.438 1.00 65.66  ? 316  VAL A CG2 1 
ATOM   2256 N  N   . LEU A 1 328 ? 7.191   38.426 12.457 1.00 66.21  ? 317  LEU A N   1 
ATOM   2257 C  CA  . LEU A 1 328 ? 5.878   38.747 12.042 1.00 67.89  ? 317  LEU A CA  1 
ATOM   2258 C  C   . LEU A 1 328 ? 5.914   40.183 11.550 1.00 70.54  ? 317  LEU A C   1 
ATOM   2259 O  O   . LEU A 1 328 ? 6.327   41.099 12.300 1.00 73.12  ? 317  LEU A O   1 
ATOM   2260 C  CB  . LEU A 1 328 ? 4.997   38.629 13.258 1.00 71.26  ? 317  LEU A CB  1 
ATOM   2261 C  CG  . LEU A 1 328 ? 3.495   38.502 13.084 1.00 73.94  ? 317  LEU A CG  1 
ATOM   2262 C  CD1 . LEU A 1 328 ? 2.856   38.898 14.395 1.00 78.10  ? 317  LEU A CD1 1 
ATOM   2263 C  CD2 . LEU A 1 328 ? 2.913   39.345 11.955 1.00 75.41  ? 317  LEU A CD2 1 
ATOM   2264 N  N   . TYR A 1 329 ? 5.470   40.391 10.306 1.00 71.10  ? 318  TYR A N   1 
ATOM   2265 C  CA  . TYR A 1 329 ? 5.432   41.731 9.720  1.00 72.99  ? 318  TYR A CA  1 
ATOM   2266 C  C   . TYR A 1 329 ? 4.007   42.109 9.487  1.00 76.69  ? 318  TYR A C   1 
ATOM   2267 O  O   . TYR A 1 329 ? 3.264   41.272 9.020  1.00 75.82  ? 318  TYR A O   1 
ATOM   2268 C  CB  . TYR A 1 329 ? 6.230   41.800 8.405  1.00 70.87  ? 318  TYR A CB  1 
ATOM   2269 C  CG  . TYR A 1 329 ? 5.568   41.201 7.158  1.00 70.57  ? 318  TYR A CG  1 
ATOM   2270 C  CD1 . TYR A 1 329 ? 4.549   41.856 6.506  1.00 74.60  ? 318  TYR A CD1 1 
ATOM   2271 C  CD2 . TYR A 1 329 ? 5.986   40.005 6.621  1.00 67.82  ? 318  TYR A CD2 1 
ATOM   2272 C  CE1 . TYR A 1 329 ? 3.950   41.330 5.372  1.00 75.44  ? 318  TYR A CE1 1 
ATOM   2273 C  CE2 . TYR A 1 329 ? 5.396   39.474 5.480  1.00 68.66  ? 318  TYR A CE2 1 
ATOM   2274 C  CZ  . TYR A 1 329 ? 4.382   40.150 4.852  1.00 72.46  ? 318  TYR A CZ  1 
ATOM   2275 O  OH  . TYR A 1 329 ? 3.792   39.655 3.705  1.00 75.24  ? 318  TYR A OH  1 
ATOM   2276 N  N   . GLN A 1 330 ? 3.658   43.363 9.787  1.00 83.24  ? 319  GLN A N   1 
ATOM   2277 C  CA  . GLN A 1 330 ? 2.328   43.948 9.508  1.00 91.66  ? 319  GLN A CA  1 
ATOM   2278 C  C   . GLN A 1 330 ? 2.465   45.244 8.716  1.00 94.82  ? 319  GLN A C   1 
ATOM   2279 O  O   . GLN A 1 330 ? 3.050   46.208 9.209  1.00 97.20  ? 319  GLN A O   1 
ATOM   2280 C  CB  . GLN A 1 330 ? 1.555   44.207 10.810 1.00 97.37  ? 319  GLN A CB  1 
ATOM   2281 C  CG  . GLN A 1 330 ? 1.065   42.910 11.458 1.00 99.91  ? 319  GLN A CG  1 
ATOM   2282 C  CD  . GLN A 1 330 ? 1.060   42.878 12.993 1.00 103.74 ? 319  GLN A CD  1 
ATOM   2283 O  OE1 . GLN A 1 330 ? 1.740   43.653 13.679 1.00 105.73 ? 319  GLN A OE1 1 
ATOM   2284 N  NE2 . GLN A 1 330 ? 0.320   41.926 13.530 1.00 105.84 ? 319  GLN A NE2 1 
ATOM   2285 N  N   . ALA A 1 331 ? 1.935   45.254 7.489  1.00 96.24  ? 320  ALA A N   1 
ATOM   2286 C  CA  . ALA A 1 331 ? 1.950   46.434 6.610  1.00 97.54  ? 320  ALA A CA  1 
ATOM   2287 C  C   . ALA A 1 331 ? 0.782   47.378 6.923  1.00 103.66 ? 320  ALA A C   1 
ATOM   2288 O  O   . ALA A 1 331 ? -0.282  46.929 7.343  1.00 104.55 ? 320  ALA A O   1 
ATOM   2289 C  CB  . ALA A 1 331 ? 1.879   45.992 5.162  1.00 96.24  ? 320  ALA A CB  1 
ATOM   2290 N  N   . VAL A 1 332 ? 0.986   48.675 6.682  1.00 106.47 ? 321  VAL A N   1 
ATOM   2291 C  CA  . VAL A 1 332 ? 0.014   49.719 7.033  1.00 114.52 ? 321  VAL A CA  1 
ATOM   2292 C  C   . VAL A 1 332 ? -0.293  50.658 5.840  1.00 120.32 ? 321  VAL A C   1 
ATOM   2293 O  O   . VAL A 1 332 ? 0.647   51.149 5.214  1.00 121.29 ? 321  VAL A O   1 
ATOM   2294 C  CB  . VAL A 1 332 ? 0.554   50.596 8.202  1.00 115.05 ? 321  VAL A CB  1 
ATOM   2295 C  CG1 . VAL A 1 332 ? -0.488  51.618 8.634  1.00 123.00 ? 321  VAL A CG1 1 
ATOM   2296 C  CG2 . VAL A 1 332 ? 0.983   49.768 9.403  1.00 111.27 ? 321  VAL A CG2 1 
ATOM   2297 N  N   . LYS A 1 333 ? -1.579  50.959 5.575  1.00 127.36 ? 322  LYS A N   1 
ATOM   2298 C  CA  . LYS A 1 333 ? -1.997  51.874 4.477  1.00 132.50 ? 322  LYS A CA  1 
ATOM   2299 C  C   . LYS A 1 333 ? -2.597  53.174 4.979  1.00 135.07 ? 322  LYS A C   1 
ATOM   2300 O  O   . LYS A 1 333 ? -1.880  54.142 5.151  1.00 129.94 ? 322  LYS A O   1 
ATOM   2301 C  CB  . LYS A 1 333 ? -2.972  51.158 3.529  1.00 139.47 ? 322  LYS A CB  1 
ATOM   2302 C  CG  . LYS A 1 333 ? -2.313  49.940 2.866  1.00 137.00 ? 322  LYS A CG  1 
ATOM   2303 C  CD  . LYS A 1 333 ? -3.101  49.270 1.751  1.00 141.76 ? 322  LYS A CD  1 
ATOM   2304 C  CE  . LYS A 1 333 ? -2.328  48.042 1.271  1.00 136.25 ? 322  LYS A CE  1 
ATOM   2305 N  NZ  . LYS A 1 333 ? -3.118  47.226 0.315  1.00 139.92 ? 322  LYS A NZ  1 
HETATM 2306 CL CL  . CL  B 2 .   ? -11.457 7.718  14.100 1.00 88.69  ? 1323 CL  A CL  1 
HETATM 2307 CL CL  . CL  C 2 .   ? 13.882  13.882 0.000  0.50 67.26  ? 1324 CL  A CL  1 
HETATM 2308 CL CL  . CL  D 2 .   ? 8.286   12.940 34.939 1.00 50.45  ? 1325 CL  A CL  1 
HETATM 2309 CL CL  . CL  E 2 .   ? 19.629  40.737 -2.865 1.00 91.42  ? 1326 CL  A CL  1 
HETATM 2310 C  C1  . NAG F 3 .   ? -5.680  29.292 36.727 1.00 81.25  ? 1327 NAG A C1  1 
HETATM 2311 C  C2  . NAG F 3 .   ? -6.367  28.902 38.031 1.00 82.10  ? 1327 NAG A C2  1 
HETATM 2312 C  C3  . NAG F 3 .   ? -7.114  30.120 38.556 1.00 86.99  ? 1327 NAG A C3  1 
HETATM 2313 C  C4  . NAG F 3 .   ? -6.144  31.248 38.884 1.00 91.97  ? 1327 NAG A C4  1 
HETATM 2314 C  C5  . NAG F 3 .   ? -4.892  31.364 37.986 1.00 96.21  ? 1327 NAG A C5  1 
HETATM 2315 C  C6  . NAG F 3 .   ? -3.672  31.113 38.896 1.00 104.59 ? 1327 NAG A C6  1 
HETATM 2316 C  C7  . NAG F 3 .   ? -7.325  26.697 38.530 1.00 70.40  ? 1327 NAG A C7  1 
HETATM 2317 C  C8  . NAG F 3 .   ? -8.361  25.664 38.178 1.00 68.50  ? 1327 NAG A C8  1 
HETATM 2318 N  N2  . NAG F 3 .   ? -7.307  27.811 37.805 1.00 75.98  ? 1327 NAG A N2  1 
HETATM 2319 O  O3  . NAG F 3 .   ? -7.868  29.820 39.738 1.00 81.98  ? 1327 NAG A O3  1 
HETATM 2320 O  O4  . NAG F 3 .   ? -6.888  32.460 38.815 1.00 97.08  ? 1327 NAG A O4  1 
HETATM 2321 O  O5  . NAG F 3 .   ? -4.920  30.534 36.791 1.00 87.51  ? 1327 NAG A O5  1 
HETATM 2322 O  O6  . NAG F 3 .   ? -2.412  31.158 38.219 1.00 109.09 ? 1327 NAG A O6  1 
HETATM 2323 O  O7  . NAG F 3 .   ? -6.533  26.515 39.426 1.00 64.63  ? 1327 NAG A O7  1 
HETATM 2324 C  C1  . NAG G 3 .   ? 3.153   28.376 45.179 1.00 77.54  ? 1328 NAG A C1  1 
HETATM 2325 C  C2  . NAG G 3 .   ? 2.730   28.468 46.628 1.00 83.38  ? 1328 NAG A C2  1 
HETATM 2326 C  C3  . NAG G 3 .   ? 1.211   28.460 46.676 1.00 88.43  ? 1328 NAG A C3  1 
HETATM 2327 C  C4  . NAG G 3 .   ? 0.654   29.559 45.753 1.00 85.73  ? 1328 NAG A C4  1 
HETATM 2328 C  C5  . NAG G 3 .   ? 1.236   29.387 44.358 1.00 84.36  ? 1328 NAG A C5  1 
HETATM 2329 C  C6  . NAG G 3 .   ? 0.673   30.400 43.377 1.00 85.01  ? 1328 NAG A C6  1 
HETATM 2330 C  C7  . NAG G 3 .   ? 4.552   27.372 47.803 1.00 82.13  ? 1328 NAG A C7  1 
HETATM 2331 C  C8  . NAG G 3 .   ? 5.041   26.144 48.520 1.00 80.43  ? 1328 NAG A C8  1 
HETATM 2332 N  N2  . NAG G 3 .   ? 3.293   27.339 47.349 1.00 79.61  ? 1328 NAG A N2  1 
HETATM 2333 O  O3  . NAG G 3 .   ? 0.808   28.596 48.047 1.00 95.96  ? 1328 NAG A O3  1 
HETATM 2334 O  O4  . NAG G 3 .   ? -0.770  29.493 45.641 1.00 77.10  ? 1328 NAG A O4  1 
HETATM 2335 O  O5  . NAG G 3 .   ? 2.664   29.496 44.466 1.00 80.91  ? 1328 NAG A O5  1 
HETATM 2336 O  O6  . NAG G 3 .   ? 1.232   31.674 43.682 1.00 88.54  ? 1328 NAG A O6  1 
HETATM 2337 O  O7  . NAG G 3 .   ? 5.282   28.344 47.641 1.00 85.76  ? 1328 NAG A O7  1 
HETATM 2338 CL CL  . CL  H 2 .   ? 18.461  19.586 40.624 1.00 79.16  ? 1330 CL  A CL  1 
HETATM 2339 O  O   . HOH I 4 .   ? 6.256   14.624 30.217 1.00 25.12  ? 2001 HOH A O   1 
HETATM 2340 O  O   . HOH I 4 .   ? 13.956  12.499 5.868  1.00 9.63   ? 2002 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
12   N N   . GLU A 42  ? 1.2655 1.0576 1.0063 0.1967  -0.1049 0.0670  31  GLU A N   
13   C CA  . GLU A 42  ? 1.1716 0.9334 0.9028 0.1723  -0.0984 0.0670  31  GLU A CA  
14   C C   . GLU A 42  ? 1.0714 0.8621 0.8369 0.1283  -0.0957 0.0688  31  GLU A C   
15   O O   . GLU A 42  ? 1.0469 0.8247 0.8098 0.1086  -0.0917 0.0682  31  GLU A O   
16   C CB  . GLU A 42  ? 1.1497 0.9557 0.9165 0.1931  -0.0892 0.0597  31  GLU A CB  
17   C CG  . GLU A 42  ? 1.2047 0.9984 0.9367 0.2470  -0.0892 0.0583  31  GLU A CG  
18   C CD  . GLU A 42  ? 1.1826 1.0045 0.9297 0.2658  -0.0768 0.0550  31  GLU A CD  
19   O OE1 . GLU A 42  ? 1.1876 0.9519 0.8996 0.2524  -0.0740 0.0539  31  GLU A OE1 
20   O OE2 . GLU A 42  ? 1.1548 1.0626 0.9491 0.2918  -0.0704 0.0547  31  GLU A OE2 
21   N N   . CYS A 43  ? 1.0242 0.8587 0.8199 0.1188  -0.0985 0.0700  32  CYS A N   
22   C CA  . CYS A 43  ? 0.9487 0.8148 0.7671 0.0872  -0.0959 0.0726  32  CYS A CA  
23   C C   . CYS A 43  ? 0.9456 0.8173 0.7490 0.0840  -0.1006 0.0808  32  CYS A C   
24   O O   . CYS A 43  ? 0.9698 0.8487 0.7744 0.1087  -0.1067 0.0776  32  CYS A O   
25   C CB  . CYS A 43  ? 0.8887 0.8125 0.7618 0.0895  -0.0935 0.0621  32  CYS A CB  
26   S SG  . CYS A 43  ? 0.8974 0.8256 0.7925 0.0925  -0.0845 0.0554  32  CYS A SG  
27   N N   . PHE A 44  ? 0.9126 0.7888 0.7017 0.0549  -0.0979 0.0925  33  PHE A N   
28   C CA  . PHE A 44  ? 0.8982 0.7946 0.6739 0.0497  -0.0985 0.1042  33  PHE A CA  
29   C C   . PHE A 44  ? 0.8515 0.8170 0.6580 0.0402  -0.0930 0.1048  33  PHE A C   
30   O O   . PHE A 44  ? 0.8470 0.8423 0.6402 0.0242  -0.0888 0.1205  33  PHE A O   
31   C CB  . PHE A 44  ? 0.9568 0.7997 0.6751 0.0215  -0.0992 0.1244  33  PHE A CB  
32   C CG  . PHE A 44  ? 1.0240 0.7856 0.6901 0.0417  -0.1062 0.1252  33  PHE A CG  
33   C CD1 . PHE A 44  ? 1.0640 0.7695 0.7088 0.0543  -0.1096 0.1163  33  PHE A CD1 
34   C CD2 . PHE A 44  ? 1.0583 0.7979 0.6889 0.0557  -0.1094 0.1349  33  PHE A CD2 
35   C CE1 . PHE A 44  ? 1.1323 0.7613 0.7179 0.0854  -0.1165 0.1163  33  PHE A CE1 
36   C CE2 . PHE A 44  ? 1.1365 0.7969 0.7092 0.0833  -0.1169 0.1352  33  PHE A CE2 
37   C CZ  . PHE A 44  ? 1.1699 0.7751 0.7185 0.1005  -0.1207 0.1256  33  PHE A CZ  
38   N N   . THR A 45  ? 0.8223 0.8133 0.6640 0.0512  -0.0923 0.0897  34  THR A N   
39   C CA  . THR A 45  ? 0.8013 0.8467 0.6606 0.0563  -0.0891 0.0867  34  THR A CA  
40   C C   . THR A 45  ? 0.7883 0.8328 0.6621 0.0829  -0.0965 0.0698  34  THR A C   
41   O O   . THR A 45  ? 0.7991 0.8176 0.6834 0.0891  -0.1024 0.0615  34  THR A O   
42   C CB  . THR A 45  ? 0.7892 0.8467 0.6629 0.0443  -0.0844 0.0832  34  THR A CB  
43   O OG1 . THR A 45  ? 0.7873 0.8054 0.6724 0.0484  -0.0857 0.0719  34  THR A OG1 
44   C CG2 . THR A 45  ? 0.8115 0.8787 0.6711 0.0109  -0.0812 0.0991  34  THR A CG2 
45   N N   . ALA A 46  ? 0.7689 0.8425 0.6392 0.0990  -0.0977 0.0648  35  ALA A N   
46   C CA  . ALA A 46  ? 0.7783 0.8337 0.6489 0.1182  -0.1097 0.0480  35  ALA A CA  
47   C C   . ALA A 46  ? 0.7511 0.7832 0.6396 0.1100  -0.1109 0.0374  35  ALA A C   
48   O O   . ALA A 46  ? 0.7621 0.7735 0.6558 0.1112  -0.1226 0.0266  35  ALA A O   
49   C CB  . ALA A 46  ? 0.8182 0.8921 0.6601 0.1448  -0.1132 0.0444  35  ALA A CB  
50   N N   . ASN A 47  ? 0.7031 0.7411 0.5988 0.0989  -0.1001 0.0417  36  ASN A N   
51   C CA  . ASN A 47  ? 0.6885 0.7055 0.5921 0.0946  -0.0987 0.0341  36  ASN A CA  
52   C C   . ASN A 47  ? 0.6729 0.6832 0.5956 0.0779  -0.0895 0.0388  36  ASN A C   
53   O O   . ASN A 47  ? 0.6485 0.6488 0.5737 0.0742  -0.0837 0.0368  36  ASN A O   
54   C CB  . ASN A 47  ? 0.6986 0.7259 0.5794 0.1094  -0.0957 0.0325  36  ASN A CB  
55   C CG  . ASN A 47  ? 0.6835 0.7545 0.5679 0.1026  -0.0858 0.0440  36  ASN A CG  
56   O OD1 . ASN A 47  ? 0.6827 0.7642 0.5775 0.0833  -0.0828 0.0539  36  ASN A OD1 
57   N ND2 . ASN A 47  ? 0.6983 0.7930 0.5683 0.1177  -0.0826 0.0433  36  ASN A ND2 
58   N N   . GLY A 48  ? 0.6865 0.6945 0.6119 0.0719  -0.0884 0.0455  37  GLY A N   
59   C CA  . GLY A 48  ? 0.6981 0.6874 0.6247 0.0632  -0.0817 0.0491  37  GLY A CA  
60   C C   . GLY A 48  ? 0.7120 0.7011 0.6284 0.0516  -0.0757 0.0523  37  GLY A C   
61   O O   . GLY A 48  ? 0.7558 0.7241 0.6700 0.0493  -0.0709 0.0511  37  GLY A O   
62   N N   . ALA A 49  ? 0.7290 0.7485 0.6376 0.0467  -0.0763 0.0568  38  ALA A N   
63   C CA  . ALA A 49  ? 0.7330 0.7701 0.6334 0.0315  -0.0741 0.0618  38  ALA A CA  
64   C C   . ALA A 49  ? 0.7453 0.7434 0.6270 0.0099  -0.0763 0.0670  38  ALA A C   
65   O O   . ALA A 49  ? 0.7652 0.7492 0.6382 0.0020  -0.0763 0.0646  38  ALA A O   
66   C CB  . ALA A 49  ? 0.7454 0.8411 0.6424 0.0269  -0.0751 0.0715  38  ALA A CB  
67   N N   . ASP A 50  ? 0.7636 0.7354 0.6295 0.0041  -0.0801 0.0735  39  ASP A N   
68   C CA  . ASP A 50  ? 0.7969 0.7098 0.6239 -0.0135 -0.0857 0.0795  39  ASP A CA  
69   C C   . ASP A 50  ? 0.7898 0.6476 0.6028 0.0107  -0.0845 0.0711  39  ASP A C   
70   O O   . ASP A 50  ? 0.8412 0.6339 0.6060 0.0063  -0.0908 0.0744  39  ASP A O   
71   C CB  . ASP A 50  ? 0.8287 0.7318 0.6312 -0.0292 -0.0902 0.0935  39  ASP A CB  
72   C CG  . ASP A 50  ? 0.8230 0.7213 0.6330 0.0003  -0.0892 0.0901  39  ASP A CG  
73   O OD1 . ASP A 50  ? 0.7986 0.7287 0.6441 0.0246  -0.0860 0.0790  39  ASP A OD1 
74   O OD2 . ASP A 50  ? 0.9041 0.7620 0.6789 -0.0018 -0.0936 0.0987  39  ASP A OD2 
75   N N   . TYR A 51  ? 0.7427 0.6240 0.5897 0.0359  -0.0774 0.0618  40  TYR A N   
76   C CA  . TYR A 51  ? 0.7800 0.6330 0.6194 0.0619  -0.0739 0.0570  40  TYR A CA  
77   C C   . TYR A 51  ? 0.8361 0.6477 0.6433 0.0612  -0.0726 0.0546  40  TYR A C   
78   O O   . TYR A 51  ? 0.8346 0.6665 0.6559 0.0503  -0.0691 0.0519  40  TYR A O   
79   C CB  . TYR A 51  ? 0.7409 0.6399 0.6267 0.0780  -0.0662 0.0515  40  TYR A CB  
80   C CG  . TYR A 51  ? 0.7583 0.6548 0.6432 0.1056  -0.0600 0.0503  40  TYR A CG  
81   C CD1 . TYR A 51  ? 0.7989 0.6894 0.6703 0.1295  -0.0645 0.0518  40  TYR A CD1 
82   C CD2 . TYR A 51  ? 0.7550 0.6623 0.6496 0.1130  -0.0489 0.0491  40  TYR A CD2 
83   C CE1 . TYR A 51  ? 0.8117 0.7180 0.6826 0.1634  -0.0580 0.0517  40  TYR A CE1 
84   C CE2 . TYR A 51  ? 0.7835 0.7061 0.6786 0.1428  -0.0405 0.0506  40  TYR A CE2 
85   C CZ  . TYR A 51  ? 0.8055 0.7329 0.6901 0.1699  -0.0451 0.0518  40  TYR A CZ  
86   O OH  . TYR A 51  ? 0.8312 0.7891 0.7149 0.2082  -0.0362 0.0543  40  TYR A OH  
87   N N   . ARG A 52  ? 0.8970 0.6452 0.6524 0.0777  -0.0769 0.0547  41  ARG A N   
88   C CA  . ARG A 52  ? 0.9292 0.6185 0.6347 0.0835  -0.0792 0.0505  41  ARG A CA  
89   C C   . ARG A 52  ? 0.9645 0.6268 0.6421 0.1316  -0.0734 0.0467  41  ARG A C   
90   O O   . ARG A 52  ? 1.0307 0.6218 0.6432 0.1477  -0.0784 0.0429  41  ARG A O   
91   C CB  . ARG A 52  ? 1.0031 0.6169 0.6425 0.0513  -0.0965 0.0552  41  ARG A CB  
92   C CG  . ARG A 52  ? 0.9700 0.6277 0.6356 0.0028  -0.1018 0.0613  41  ARG A CG  
93   C CD  . ARG A 52  ? 0.9503 0.6340 0.6314 -0.0038 -0.0999 0.0545  41  ARG A CD  
94   N NE  . ARG A 52  ? 0.9117 0.6580 0.6225 -0.0407 -0.1042 0.0606  41  ARG A NE  
95   C CZ  . ARG A 52  ? 0.8469 0.6740 0.6137 -0.0366 -0.0949 0.0631  41  ARG A CZ  
96   N NH1 . ARG A 52  ? 0.8284 0.6778 0.6288 -0.0065 -0.0835 0.0595  41  ARG A NH1 
97   N NH2 . ARG A 52  ? 0.8353 0.7239 0.6202 -0.0620 -0.0989 0.0692  41  ARG A NH2 
98   N N   . GLY A 53  ? 0.9493 0.6727 0.6730 0.1570  -0.0640 0.0479  42  GLY A N   
99   C CA  . GLY A 53  ? 0.9854 0.7087 0.6886 0.2088  -0.0577 0.0469  42  GLY A CA  
100  C C   . GLY A 53  ? 0.9541 0.7158 0.6797 0.2228  -0.0422 0.0455  42  GLY A C   
101  O O   . GLY A 53  ? 0.9167 0.6752 0.6523 0.1947  -0.0402 0.0438  42  GLY A O   
102  N N   . THR A 54  ? 0.9515 0.7590 0.6859 0.2677  -0.0305 0.0480  43  THR A N   
103  C CA  . THR A 54  ? 0.9334 0.7669 0.6678 0.2918  -0.0137 0.0495  43  THR A CA  
104  C C   . THR A 54  ? 0.8719 0.8241 0.6886 0.2887  0.0044  0.0592  43  THR A C   
105  O O   . THR A 54  ? 0.8881 0.8782 0.7060 0.3151  0.0215  0.0648  43  THR A O   
106  C CB  . THR A 54  ? 1.0005 0.7836 0.6559 0.3548  -0.0135 0.0467  43  THR A CB  
107  O OG1 . THR A 54  ? 0.9776 0.8207 0.6520 0.3913  -0.0115 0.0513  43  THR A OG1 
108  C CG2 . THR A 54  ? 1.0859 0.7308 0.6445 0.3494  -0.0353 0.0380  43  THR A CG2 
109  N N   . GLN A 55  ? 0.8203 0.8283 0.7001 0.2545  0.0000  0.0623  44  GLN A N   
110  C CA  . GLN A 55  ? 0.8009 0.9104 0.7512 0.2397  0.0124  0.0725  44  GLN A CA  
111  C C   . GLN A 55  ? 0.8225 0.9218 0.7773 0.2163  0.0246  0.0758  44  GLN A C   
112  O O   . GLN A 55  ? 0.8388 0.8792 0.7769 0.1895  0.0165  0.0689  44  GLN A O   
113  C CB  . GLN A 55  ? 0.7719 0.9161 0.7726 0.2010  -0.0007 0.0721  44  GLN A CB  
114  C CG  . GLN A 55  ? 0.7559 0.9963 0.8229 0.1744  0.0067  0.0834  44  GLN A CG  
115  C CD  . GLN A 55  ? 0.7334 1.0200 0.8423 0.1503  -0.0106 0.0822  44  GLN A CD  
116  O OE1 . GLN A 55  ? 0.7341 1.0115 0.8301 0.1712  -0.0239 0.0756  44  GLN A OE1 
117  N NE2 . GLN A 55  ? 0.7232 1.0525 0.8745 0.1054  -0.0120 0.0891  44  GLN A NE2 
118  N N   . ASN A 56  ? 0.8653 1.0288 0.8406 0.2290  0.0447  0.0878  45  ASN A N   
119  C CA  . ASN A 56  ? 0.8675 1.0299 0.8492 0.2054  0.0588  0.0949  45  ASN A CA  
120  C C   . ASN A 56  ? 0.8359 1.0902 0.8792 0.1727  0.0715  0.1130  45  ASN A C   
121  O O   . ASN A 56  ? 0.8336 1.1056 0.8781 0.1650  0.0896  0.1252  45  ASN A O   
122  C CB  . ASN A 56  ? 0.9609 1.0864 0.8866 0.2469  0.0718  0.0938  45  ASN A CB  
123  C CG  . ASN A 56  ? 1.0806 1.2443 0.9842 0.3069  0.0811  0.0973  45  ASN A CG  
124  O OD1 . ASN A 56  ? 1.0637 1.3162 1.0106 0.3164  0.0847  0.1063  45  ASN A OD1 
125  N ND2 . ASN A 56  ? 1.2695 1.3645 1.0979 0.3517  0.0830  0.0895  45  ASN A ND2 
126  N N   . TRP A 57  ? 0.8348 1.1417 0.9245 0.1477  0.0599  0.1155  46  TRP A N   
127  C CA  . TRP A 57  ? 0.8493 1.2262 0.9913 0.0993  0.0636  0.1316  46  TRP A CA  
128  C C   . TRP A 57  ? 0.8274 1.1571 0.9766 0.0539  0.0395  0.1218  46  TRP A C   
129  O O   . TRP A 57  ? 0.8344 1.1246 0.9698 0.0666  0.0220  0.1063  46  TRP A O   
130  C CB  . TRP A 57  ? 0.9043 1.4080 1.0949 0.1136  0.0692  0.1448  46  TRP A CB  
131  C CG  . TRP A 57  ? 0.9808 1.5523 1.1670 0.1568  0.0975  0.1601  46  TRP A CG  
132  C CD1 . TRP A 57  ? 1.0420 1.6007 1.1835 0.2287  0.1053  0.1530  46  TRP A CD1 
133  C CD2 . TRP A 57  ? 0.9944 1.6515 1.2122 0.1329  0.1218  0.1862  46  TRP A CD2 
134  N NE1 . TRP A 57  ? 1.0704 1.7055 1.2134 0.2586  0.1336  0.1715  46  TRP A NE1 
135  C CE2 . TRP A 57  ? 1.0219 1.7257 1.2161 0.1993  0.1459  0.1936  46  TRP A CE2 
136  C CE3 . TRP A 57  ? 0.9691 1.6601 1.2237 0.0612  0.1249  0.2053  46  TRP A CE3 
137  C CZ2 . TRP A 57  ? 1.0151 1.8136 1.2297 0.1980  0.1759  0.2207  46  TRP A CZ2 
138  C CZ3 . TRP A 57  ? 0.9917 1.7706 1.2660 0.0517  0.1537  0.2339  46  TRP A CZ3 
139  C CH2 . TRP A 57  ? 1.0050 1.8451 1.2636 0.1211  0.1805  0.2421  46  TRP A CH2 
140  N N   . THR A 58  ? 0.8356 1.1618 0.9970 0.0028  0.0379  0.1314  47  THR A N   
141  C CA  . THR A 58  ? 0.8789 1.1518 1.0337 -0.0338 0.0128  0.1210  47  THR A CA  
142  C C   . THR A 58  ? 0.9079 1.2429 1.1010 -0.0392 -0.0060 0.1172  47  THR A C   
143  O O   . THR A 58  ? 0.9166 1.2082 1.0978 -0.0473 -0.0286 0.1031  47  THR A O   
144  C CB  . THR A 58  ? 0.9269 1.1690 1.0719 -0.0898 0.0106  0.1329  47  THR A CB  
145  O OG1 . THR A 58  ? 0.9344 1.2729 1.1254 -0.1246 0.0188  0.1553  47  THR A OG1 
146  C CG2 . THR A 58  ? 0.9532 1.1237 1.0513 -0.0830 0.0263  0.1359  47  THR A CG2 
147  N N   . ALA A 59  ? 0.9647 1.4102 1.2029 -0.0318 0.0037  0.1311  48  ALA A N   
148  C CA  . ALA A 59  ? 0.9965 1.5215 1.2733 -0.0260 -0.0123 0.1287  48  ALA A CA  
149  C C   . ALA A 59  ? 1.0153 1.6558 1.3225 0.0178  0.0074  0.1419  48  ALA A C   
150  O O   . ALA A 59  ? 1.0464 1.7299 1.3602 0.0224  0.0323  0.1586  48  ALA A O   
151  C CB  . ALA A 59  ? 1.0103 1.5695 1.3183 -0.0926 -0.0329 0.1355  48  ALA A CB  
152  N N   . LEU A 60  ? 1.0211 1.7106 1.3397 0.0565  -0.0034 0.1347  49  LEU A N   
153  C CA  . LEU A 60  ? 1.0167 1.8162 1.3538 0.1119  0.0126  0.1454  49  LEU A CA  
154  C C   . LEU A 60  ? 0.9614 1.9170 1.3713 0.0715  0.0167  0.1687  49  LEU A C   
155  O O   . LEU A 60  ? 0.9438 2.0067 1.3766 0.0983  0.0406  0.1874  49  LEU A O   
156  C CB  . LEU A 60  ? 1.0565 1.8482 1.3715 0.1682  -0.0030 0.1303  49  LEU A CB  
157  C CG  . LEU A 60  ? 1.0914 1.7269 1.3311 0.1964  -0.0081 0.1110  49  LEU A CG  
158  C CD1 . LEU A 60  ? 1.0825 1.6917 1.2939 0.2364  -0.0268 0.0983  49  LEU A CD1 
159  C CD2 . LEU A 60  ? 1.1492 1.7341 1.3383 0.2394  0.0146  0.1126  49  LEU A CD2 
160  N N   . GLN A 61  ? 0.9434 1.9088 1.3849 0.0031  -0.0073 0.1687  50  GLN A N   
161  C CA  . GLN A 61  ? 0.9556 2.0639 1.4650 -0.0523 -0.0104 0.1913  50  GLN A CA  
162  C C   . GLN A 61  ? 0.9216 1.9677 1.4256 -0.1400 -0.0129 0.2024  50  GLN A C   
163  O O   . GLN A 61  ? 0.9408 1.8656 1.4094 -0.1777 -0.0369 0.1865  50  GLN A O   
164  C CB  . GLN A 61  ? 1.0000 2.1756 1.5433 -0.0604 -0.0435 0.1819  50  GLN A CB  
165  C CG  . GLN A 61  ? 1.0255 2.4109 1.6471 -0.0728 -0.0427 0.2050  50  GLN A CG  
166  C CD  . GLN A 61  ? 1.0738 2.5239 1.7385 -0.1695 -0.0406 0.2318  50  GLN A CD  
167  O OE1 . GLN A 61  ? 1.1404 2.5035 1.7906 -0.2473 -0.0663 0.2268  50  GLN A OE1 
168  N NE2 . GLN A 61  ? 1.0697 2.6672 1.7790 -0.1643 -0.0103 0.2615  50  GLN A NE2 
169  N N   . GLY A 62  ? 0.8720 1.9968 1.4022 -0.1680 0.0124  0.2307  51  GLY A N   
170  C CA  . GLY A 62  ? 0.8661 1.9255 1.3797 -0.2503 0.0124  0.2455  51  GLY A CA  
171  C C   . GLY A 62  ? 0.8413 1.7306 1.2807 -0.2386 0.0241  0.2349  51  GLY A C   
172  O O   . GLY A 62  ? 0.8528 1.6639 1.2623 -0.2996 0.0207  0.2441  51  GLY A O   
173  N N   . GLY A 63  ? 0.8028 1.6337 1.2069 -0.1613 0.0366  0.2168  52  GLY A N   
174  C CA  . GLY A 63  ? 0.8402 1.5146 1.1756 -0.1477 0.0409  0.2023  52  GLY A CA  
175  C C   . GLY A 63  ? 0.8849 1.5424 1.1947 -0.1379 0.0734  0.2188  52  GLY A C   
176  O O   . GLY A 63  ? 0.9392 1.7125 1.2846 -0.1372 0.0975  0.2440  52  GLY A O   
177  N N   . LYS A 64  ? 0.8999 1.4215 1.1474 -0.1272 0.0738  0.2053  53  LYS A N   
178  C CA  . LYS A 64  ? 0.9095 1.3955 1.1200 -0.1047 0.1014  0.2146  53  LYS A CA  
179  C C   . LYS A 64  ? 0.8561 1.2825 1.0278 -0.0348 0.1046  0.1921  53  LYS A C   
180  O O   . LYS A 64  ? 0.8649 1.2432 1.0263 -0.0174 0.0833  0.1692  53  LYS A O   
181  C CB  . LYS A 64  ? 0.9976 1.3678 1.1567 -0.1478 0.0962  0.2167  53  LYS A CB  
182  C CG  . LYS A 64  ? 1.0906 1.4660 1.2600 -0.2286 0.0841  0.2355  53  LYS A CG  
183  C CD  . LYS A 64  ? 1.2009 1.4802 1.3083 -0.2591 0.0955  0.2507  53  LYS A CD  
184  C CE  . LYS A 64  ? 1.3131 1.5041 1.3822 -0.3322 0.0698  0.2556  53  LYS A CE  
185  N NZ  . LYS A 64  ? 1.3564 1.6500 1.4837 -0.4001 0.0590  0.2756  53  LYS A NZ  
186  N N   . PRO A 65  ? 0.8330 1.2563 0.9769 0.0019  0.1296  0.1990  54  PRO A N   
187  C CA  . PRO A 65  ? 0.8053 1.1744 0.9079 0.0642  0.1289  0.1781  54  PRO A CA  
188  C C   . PRO A 65  ? 0.8063 1.0524 0.8539 0.0632  0.1190  0.1616  54  PRO A C   
189  O O   . PRO A 65  ? 0.8367 1.0399 0.8644 0.0324  0.1236  0.1702  54  PRO A O   
190  C CB  . PRO A 65  ? 0.8233 1.2573 0.9187 0.1074  0.1587  0.1939  54  PRO A CB  
191  C CG  . PRO A 65  ? 0.8605 1.3328 0.9714 0.0608  0.1783  0.2220  54  PRO A CG  
192  C CD  . PRO A 65  ? 0.8668 1.3319 1.0088 -0.0115 0.1585  0.2265  54  PRO A CD  
193  N N   . CYS A 66  ? 0.7791 0.9718 0.7987 0.0970  0.1048  0.1394  55  CYS A N   
194  C CA  . CYS A 66  ? 0.7902 0.8890 0.7650 0.0986  0.0923  0.1229  55  CYS A CA  
195  C C   . CYS A 66  ? 0.8336 0.8940 0.7609 0.1257  0.1057  0.1229  55  CYS A C   
196  O O   . CYS A 66  ? 0.8868 0.9711 0.8000 0.1621  0.1193  0.1263  55  CYS A O   
197  C CB  . CYS A 66  ? 0.7869 0.8561 0.7498 0.1195  0.0731  0.1036  55  CYS A CB  
198  S SG  . CYS A 66  ? 0.7884 0.8767 0.7906 0.0920  0.0517  0.0979  55  CYS A SG  
199  N N   . LEU A 67  ? 0.8536 0.8511 0.7485 0.1147  0.0997  0.1171  56  LEU A N   
200  C CA  . LEU A 67  ? 0.8667 0.8222 0.7111 0.1425  0.1068  0.1131  56  LEU A CA  
201  C C   . LEU A 67  ? 0.8922 0.8090 0.7085 0.1652  0.0878  0.0921  56  LEU A C   
202  O O   . LEU A 67  ? 0.8732 0.7845 0.7052 0.1535  0.0689  0.0813  56  LEU A O   
203  C CB  . LEU A 67  ? 0.8569 0.7619 0.6710 0.1275  0.1052  0.1144  56  LEU A CB  
204  C CG  . LEU A 67  ? 0.8587 0.7727 0.6804 0.0963  0.1207  0.1367  56  LEU A CG  
205  C CD1 . LEU A 67  ? 0.8929 0.7366 0.6629 0.0932  0.1181  0.1368  56  LEU A CD1 
206  C CD2 . LEU A 67  ? 0.8587 0.8357 0.6966 0.1026  0.1485  0.1587  56  LEU A CD2 
207  N N   . PHE A 68  ? 0.9557 0.8411 0.7245 0.1940  0.0918  0.0873  57  PHE A N   
208  C CA  . PHE A 68  ? 0.9843 0.8229 0.7139 0.2095  0.0713  0.0686  57  PHE A CA  
209  C C   . PHE A 68  ? 0.9962 0.8032 0.7112 0.1911  0.0524  0.0575  57  PHE A C   
210  O O   . PHE A 68  ? 0.9647 0.7634 0.6649 0.1917  0.0589  0.0614  57  PHE A O   
211  C CB  . PHE A 68  ? 1.0404 0.8540 0.7167 0.2493  0.0794  0.0665  57  PHE A CB  
212  C CG  . PHE A 68  ? 1.0804 0.9235 0.7582 0.2800  0.0920  0.0727  57  PHE A CG  
213  C CD1 . PHE A 68  ? 1.0911 1.0092 0.8067 0.2866  0.1202  0.0941  57  PHE A CD1 
214  C CD2 . PHE A 68  ? 1.1435 0.9408 0.7794 0.3031  0.0749  0.0589  57  PHE A CD2 
215  C CE1 . PHE A 68  ? 1.1239 1.0892 0.8422 0.3231  0.1328  0.1010  57  PHE A CE1 
216  C CE2 . PHE A 68  ? 1.1905 1.0120 0.8150 0.3449  0.0860  0.0639  57  PHE A CE2 
217  C CZ  . PHE A 68  ? 1.1753 1.0906 0.8451 0.3585  0.1158  0.0848  57  PHE A CZ  
218  N N   . TRP A 69  ? 0.9961 0.7897 0.7120 0.1766  0.0294  0.0455  58  TRP A N   
219  C CA  . TRP A 69  ? 0.9661 0.7573 0.6806 0.1575  0.0112  0.0375  58  TRP A CA  
220  C C   . TRP A 69  ? 0.9811 0.7437 0.6476 0.1686  0.0014  0.0287  58  TRP A C   
221  O O   . TRP A 69  ? 0.9645 0.7391 0.6280 0.1600  -0.0105 0.0240  58  TRP A O   
222  C CB  . TRP A 69  ? 0.9781 0.7756 0.7092 0.1347  -0.0082 0.0316  58  TRP A CB  
223  C CG  . TRP A 69  ? 0.9836 0.8095 0.7597 0.1249  -0.0023 0.0384  58  TRP A CG  
224  C CD1 . TRP A 69  ? 1.0216 0.8471 0.8065 0.1300  -0.0003 0.0405  58  TRP A CD1 
225  C CD2 . TRP A 69  ? 0.9768 0.8304 0.7857 0.1122  -0.0004 0.0426  58  TRP A CD2 
226  N NE1 . TRP A 69  ? 1.0127 0.8720 0.8406 0.1178  0.0018  0.0456  58  TRP A NE1 
227  C CE2 . TRP A 69  ? 0.9809 0.8524 0.8213 0.1054  0.0012  0.0465  58  TRP A CE2 
228  C CE3 . TRP A 69  ? 1.0092 0.8675 0.8139 0.1108  -0.0022 0.0422  58  TRP A CE3 
229  C CZ2 . TRP A 69  ? 0.9839 0.8742 0.8518 0.0922  -0.0005 0.0493  58  TRP A CZ2 
230  C CZ3 . TRP A 69  ? 0.9917 0.8598 0.8161 0.1023  -0.0029 0.0452  58  TRP A CZ3 
231  C CH2 . TRP A 69  ? 0.9878 0.8700 0.8435 0.0905  -0.0029 0.0482  58  TRP A CH2 
232  N N   . ASN A 70  ? 1.0628 0.7901 0.6876 0.1916  0.0048  0.0258  59  ASN A N   
233  C CA  . ASN A 70  ? 1.1479 0.8402 0.7170 0.2062  -0.0052 0.0163  59  ASN A CA  
234  C C   . ASN A 70  ? 1.1393 0.8338 0.6919 0.2341  0.0180  0.0251  59  ASN A C   
235  O O   . ASN A 70  ? 1.1696 0.8323 0.6696 0.2546  0.0126  0.0179  59  ASN A O   
236  C CB  . ASN A 70  ? 1.2743 0.9072 0.7867 0.2182  -0.0198 0.0057  59  ASN A CB  
237  C CG  . ASN A 70  ? 1.3874 1.0101 0.8849 0.2572  0.0035  0.0131  59  ASN A CG  
238  O OD1 . ASN A 70  ? 1.3373 1.0075 0.8859 0.2575  0.0234  0.0261  59  ASN A OD1 
239  N ND2 . ASN A 70  ? 1.5862 1.1502 1.0088 0.2924  -0.0004 0.0047  59  ASN A ND2 
240  N N   . GLU A 71  ? 1.0881 0.8157 0.6801 0.2315  0.0421  0.0414  60  GLU A N   
241  C CA  . GLU A 71  ? 1.0738 0.8028 0.6517 0.2465  0.0652  0.0551  60  GLU A CA  
242  C C   . GLU A 71  ? 1.0014 0.7428 0.6058 0.2250  0.0687  0.0639  60  GLU A C   
243  O O   . GLU A 71  ? 1.0335 0.7651 0.6231 0.2289  0.0872  0.0785  60  GLU A O   
244  C CB  . GLU A 71  ? 1.0902 0.8388 0.6726 0.2645  0.0942  0.0716  60  GLU A CB  
245  C CG  . GLU A 71  ? 1.1475 0.8755 0.6921 0.2964  0.0901  0.0619  60  GLU A CG  
246  C CD  . GLU A 71  ? 1.1922 0.9621 0.7489 0.3209  0.1182  0.0785  60  GLU A CD  
247  O OE1 . GLU A 71  ? 1.1722 0.9974 0.7775 0.3019  0.1405  0.0998  60  GLU A OE1 
248  O OE2 . GLU A 71  ? 1.2391 0.9862 0.7513 0.3595  0.1160  0.0705  60  GLU A OE2 
249  N N   . THR A 72  ? 0.9267 0.6814 0.5593 0.2042  0.0505  0.0559  61  THR A N   
250  C CA  . THR A 72  ? 0.9276 0.6824 0.5736 0.1903  0.0532  0.0635  61  THR A CA  
251  C C   . THR A 72  ? 0.9331 0.6730 0.5424 0.2059  0.0401  0.0557  61  THR A C   
252  O O   . THR A 72  ? 0.9090 0.6630 0.5278 0.2016  0.0251  0.0492  61  THR A O   
253  C CB  . THR A 72  ? 0.8950 0.6756 0.5883 0.1661  0.0430  0.0606  61  THR A CB  
254  O OG1 . THR A 72  ? 0.8854 0.6812 0.5853 0.1638  0.0229  0.0464  61  THR A OG1 
255  C CG2 . THR A 72  ? 0.8810 0.6818 0.6094 0.1532  0.0590  0.0729  61  THR A CG2 
256  N N   . PHE A 73  ? 0.9618 0.6778 0.5250 0.2300  0.0464  0.0571  62  PHE A N   
257  C CA  . PHE A 73  ? 0.9682 0.6823 0.4938 0.2527  0.0303  0.0470  62  PHE A CA  
258  C C   . PHE A 73  ? 1.0224 0.7012 0.5113 0.2675  0.0364  0.0553  62  PHE A C   
259  O O   . PHE A 73  ? 1.0437 0.7296 0.5034 0.2922  0.0217  0.0468  62  PHE A O   
260  C CB  . PHE A 73  ? 0.9804 0.6849 0.4670 0.2748  0.0273  0.0404  62  PHE A CB  
261  C CG  . PHE A 73  ? 0.9429 0.6639 0.4456 0.2618  0.0125  0.0283  62  PHE A CG  
262  C CD1 . PHE A 73  ? 0.9120 0.6701 0.4382 0.2418  -0.0141 0.0157  62  PHE A CD1 
263  C CD2 . PHE A 73  ? 0.9557 0.6526 0.4436 0.2695  0.0247  0.0310  62  PHE A CD2 
264  C CE1 . PHE A 73  ? 0.9095 0.6644 0.4377 0.2231  -0.0305 0.0061  62  PHE A CE1 
265  C CE2 . PHE A 73  ? 0.9638 0.6543 0.4484 0.2611  0.0079  0.0188  62  PHE A CE2 
266  C CZ  . PHE A 73  ? 0.9400 0.6515 0.4420 0.2344  -0.0206 0.0065  62  PHE A CZ  
267  N N   . GLN A 74  ? 1.0646 0.7057 0.5506 0.2521  0.0566  0.0727  63  GLN A N   
268  C CA  . GLN A 74  ? 1.1344 0.7189 0.5765 0.2560  0.0598  0.0822  63  GLN A CA  
269  C C   . GLN A 74  ? 1.1000 0.6962 0.5644 0.2468  0.0427  0.0735  63  GLN A C   
270  O O   . GLN A 74  ? 1.1585 0.7042 0.5745 0.2606  0.0371  0.0748  63  GLN A O   
271  C CB  . GLN A 74  ? 1.2025 0.7430 0.6330 0.2294  0.0845  0.1066  63  GLN A CB  
272  C CG  . GLN A 74  ? 1.2079 0.7887 0.7063 0.1874  0.0931  0.1151  63  GLN A CG  
273  C CD  . GLN A 74  ? 1.2288 0.8728 0.7736 0.1908  0.1004  0.1112  63  GLN A CD  
274  O OE1 . GLN A 74  ? 1.3220 0.9746 0.8489 0.2195  0.0945  0.0991  63  GLN A OE1 
275  N NE2 . GLN A 74  ? 1.2228 0.9078 0.8202 0.1638  0.1104  0.1207  63  GLN A NE2 
276  N N   . HIS A 75  ? 1.0263 0.6806 0.5536 0.2271  0.0340  0.0649  64  HIS A N   
277  C CA  . HIS A 75  ? 1.0047 0.6749 0.5495 0.2228  0.0186  0.0571  64  HIS A CA  
278  C C   . HIS A 75  ? 0.9551 0.6928 0.5189 0.2386  0.0002  0.0422  64  HIS A C   
279  O O   . HIS A 75  ? 0.9371 0.7045 0.5043 0.2439  -0.0030 0.0371  64  HIS A O   
280  C CB  . HIS A 75  ? 0.9732 0.6528 0.5698 0.1838  0.0230  0.0629  64  HIS A CB  
281  C CG  . HIS A 75  ? 1.0086 0.6475 0.5995 0.1577  0.0415  0.0813  64  HIS A CG  
282  N ND1 . HIS A 75  ? 0.9947 0.6699 0.6290 0.1377  0.0568  0.0905  64  HIS A ND1 
283  C CD2 . HIS A 75  ? 1.0610 0.6312 0.6070 0.1449  0.0462  0.0939  64  HIS A CD2 
284  C CE1 . HIS A 75  ? 1.0171 0.6669 0.6438 0.1121  0.0719  0.1098  64  HIS A CE1 
285  N NE2 . HIS A 75  ? 1.0653 0.6450 0.6373 0.1105  0.0647  0.1125  64  HIS A NE2 
286  N N   . PRO A 76  ? 0.9490 0.7121 0.5188 0.2462  -0.0128 0.0360  65  PRO A N   
287  C CA  . PRO A 76  ? 0.9144 0.7610 0.5116 0.2518  -0.0287 0.0265  65  PRO A CA  
288  C C   . PRO A 76  ? 0.8547 0.7398 0.5067 0.2142  -0.0311 0.0253  65  PRO A C   
289  O O   . PRO A 76  ? 0.8405 0.7723 0.5019 0.2087  -0.0425 0.0201  65  PRO A O   
290  C CB  . PRO A 76  ? 0.9130 0.7778 0.5082 0.2653  -0.0371 0.0240  65  PRO A CB  
291  C CG  . PRO A 76  ? 0.9817 0.7554 0.5170 0.2849  -0.0311 0.0280  65  PRO A CG  
292  C CD  . PRO A 76  ? 0.9896 0.7061 0.5306 0.2535  -0.0154 0.0378  65  PRO A CD  
293  N N   . TYR A 77  ? 0.8364 0.6970 0.5172 0.1884  -0.0224 0.0303  66  TYR A N   
294  C CA  . TYR A 77  ? 0.7911 0.6835 0.5156 0.1594  -0.0278 0.0289  66  TYR A CA  
295  C C   . TYR A 77  ? 0.7967 0.6644 0.5186 0.1513  -0.0204 0.0299  66  TYR A C   
296  O O   . TYR A 77  ? 0.8049 0.6399 0.5262 0.1512  -0.0045 0.0370  66  TYR A O   
297  C CB  . TYR A 77  ? 0.7588 0.6466 0.5120 0.1440  -0.0255 0.0323  66  TYR A CB  
298  C CG  . TYR A 77  ? 0.7553 0.6780 0.5080 0.1549  -0.0367 0.0291  66  TYR A CG  
299  C CD1 . TYR A 77  ? 0.7374 0.7230 0.5129 0.1445  -0.0479 0.0275  66  TYR A CD1 
300  C CD2 . TYR A 77  ? 0.8080 0.6989 0.5271 0.1781  -0.0367 0.0286  66  TYR A CD2 
301  C CE1 . TYR A 77  ? 0.7491 0.7841 0.5243 0.1596  -0.0555 0.0271  66  TYR A CE1 
302  C CE2 . TYR A 77  ? 0.8263 0.7510 0.5340 0.2003  -0.0467 0.0248  66  TYR A CE2 
303  C CZ  . TYR A 77  ? 0.7768 0.7840 0.5173 0.1931  -0.0545 0.0248  66  TYR A CZ  
304  O OH  . TYR A 77  ? 0.7301 0.7881 0.4623 0.2179  -0.0613 0.0239  66  TYR A OH  
305  N N   . ASN A 78  ? 0.8083 0.6941 0.5231 0.1452  -0.0335 0.0234  67  ASN A N   
306  C CA  . ASN A 78  ? 0.8323 0.6841 0.5253 0.1459  -0.0312 0.0210  67  ASN A CA  
307  C C   . ASN A 78  ? 0.8431 0.7105 0.5254 0.1263  -0.0551 0.0125  67  ASN A C   
308  O O   . ASN A 78  ? 0.8420 0.7624 0.5383 0.1129  -0.0704 0.0110  67  ASN A O   
309  C CB  . ASN A 78  ? 0.8613 0.6856 0.5163 0.1736  -0.0197 0.0226  67  ASN A CB  
310  C CG  . ASN A 78  ? 0.8917 0.7433 0.5238 0.1898  -0.0329 0.0169  67  ASN A CG  
311  O OD1 . ASN A 78  ? 0.8888 0.7779 0.5211 0.1782  -0.0543 0.0087  67  ASN A OD1 
312  N ND2 . ASN A 78  ? 0.9183 0.7526 0.5265 0.2155  -0.0218 0.0222  67  ASN A ND2 
313  N N   . THR A 79  ? 0.8701 0.6919 0.5214 0.1251  -0.0590 0.0078  68  THR A N   
314  C CA  . THR A 79  ? 0.8941 0.7063 0.5202 0.0989  -0.0854 -0.0001 68  THR A CA  
315  C C   . THR A 79  ? 0.9069 0.7566 0.5156 0.0941  -0.1054 -0.0067 68  THR A C   
316  O O   . THR A 79  ? 0.9303 0.7822 0.5213 0.0611  -0.1315 -0.0118 68  THR A O   
317  C CB  . THR A 79  ? 0.9639 0.6968 0.5395 0.1079  -0.0872 -0.0057 68  THR A CB  
318  O OG1 . THR A 79  ? 0.9830 0.6899 0.5269 0.1455  -0.0726 -0.0075 68  THR A OG1 
319  C CG2 . THR A 79  ? 0.9664 0.6756 0.5576 0.1110  -0.0738 0.0003  68  THR A CG2 
320  N N   . LEU A 80  ? 0.9013 0.7780 0.5090 0.1251  -0.0956 -0.0062 69  LEU A N   
321  C CA  . LEU A 80  ? 0.9404 0.8663 0.5330 0.1265  -0.1158 -0.0125 69  LEU A CA  
322  C C   . LEU A 80  ? 0.9469 0.9638 0.5812 0.1125  -0.1242 -0.0075 69  LEU A C   
323  O O   . LEU A 80  ? 0.9670 1.0436 0.6069 0.0833  -0.1488 -0.0095 69  LEU A O   
324  C CB  . LEU A 80  ? 0.9543 0.8664 0.5145 0.1722  -0.1040 -0.0142 69  LEU A CB  
325  C CG  . LEU A 80  ? 1.0090 0.8682 0.5151 0.1804  -0.1138 -0.0238 69  LEU A CG  
326  C CD1 . LEU A 80  ? 1.0392 0.8735 0.5113 0.2278  -0.0949 -0.0212 69  LEU A CD1 
327  C CD2 . LEU A 80  ? 1.0464 0.9489 0.5380 0.1536  -0.1509 -0.0346 69  LEU A CD2 
328  N N   . LYS A 81  ? 0.9910 1.0217 0.6512 0.1322  -0.1051 -0.0001 70  LYS A N   
329  C CA  . LYS A 81  ? 1.0170 1.1350 0.7117 0.1276  -0.1109 0.0051  70  LYS A CA  
330  C C   . LYS A 81  ? 0.9551 1.0944 0.6781 0.0764  -0.1226 0.0098  70  LYS A C   
331  O O   . LYS A 81  ? 0.9389 1.1641 0.6816 0.0523  -0.1387 0.0141  70  LYS A O   
332  C CB  . LYS A 81  ? 1.0855 1.1864 0.7868 0.1593  -0.0904 0.0101  70  LYS A CB  
333  C CG  . LYS A 81  ? 1.1389 1.3195 0.8652 0.1659  -0.0939 0.0149  70  LYS A CG  
334  C CD  . LYS A 81  ? 1.1844 1.3187 0.9186 0.1748  -0.0782 0.0188  70  LYS A CD  
335  C CE  . LYS A 81  ? 1.2131 1.4034 0.9447 0.2071  -0.0791 0.0209  70  LYS A CE  
336  N NZ  . LYS A 81  ? 1.2617 1.4509 0.9451 0.2617  -0.0789 0.0168  70  LYS A NZ  
337  N N   . TYR A 82  ? 0.9296 0.9928 0.6504 0.0609  -0.1144 0.0106  71  TYR A N   
338  C CA  . TYR A 82  ? 0.9295 0.9855 0.6608 0.0161  -0.1249 0.0155  71  TYR A CA  
339  C C   . TYR A 82  ? 0.9561 0.9272 0.6427 -0.0078 -0.1386 0.0092  71  TYR A C   
340  O O   . TYR A 82  ? 0.9294 0.8266 0.6022 -0.0035 -0.1291 0.0092  71  TYR A O   
341  C CB  . TYR A 82  ? 0.9265 0.9654 0.6850 0.0242  -0.1066 0.0218  71  TYR A CB  
342  C CG  . TYR A 82  ? 0.9114 1.0257 0.7030 0.0387  -0.1002 0.0282  71  TYR A CG  
343  C CD1 . TYR A 82  ? 0.9140 1.1184 0.7123 0.0498  -0.1081 0.0296  71  TYR A CD1 
344  C CD2 . TYR A 82  ? 0.9176 1.0156 0.7283 0.0454  -0.0879 0.0322  71  TYR A CD2 
345  C CE1 . TYR A 82  ? 0.9013 1.1694 0.7174 0.0735  -0.1020 0.0347  71  TYR A CE1 
346  C CE2 . TYR A 82  ? 0.9201 1.0746 0.7481 0.0633  -0.0841 0.0362  71  TYR A CE2 
347  C CZ  . TYR A 82  ? 0.9076 1.1438 0.7348 0.0805  -0.0902 0.0374  71  TYR A CZ  
348  O OH  . TYR A 82  ? 0.9318 1.2192 0.7649 0.1086  -0.0860 0.0408  71  TYR A OH  
349  N N   . PRO A 83  ? 0.9856 0.9671 0.6431 -0.0316 -0.1636 0.0035  72  PRO A N   
350  C CA  . PRO A 83  ? 1.0862 0.9770 0.6870 -0.0605 -0.1838 -0.0029 72  PRO A CA  
351  C C   . PRO A 83  ? 1.1838 1.0855 0.7939 -0.1150 -0.1976 0.0079  72  PRO A C   
352  O O   . PRO A 83  ? 1.1569 1.1429 0.8204 -0.1212 -0.1878 0.0194  72  PRO A O   
353  C CB  . PRO A 83  ? 1.0926 1.0099 0.6660 -0.0735 -0.2092 -0.0113 72  PRO A CB  
354  C CG  . PRO A 83  ? 1.0232 1.0770 0.6524 -0.0814 -0.2113 -0.0028 72  PRO A CG  
355  C CD  . PRO A 83  ? 0.9551 1.0419 0.6308 -0.0430 -0.1799 0.0048  72  PRO A CD  
356  N N   . ASN A 84  ? 1.3385 1.1524 0.8899 -0.1541 -0.2208 0.0055  73  ASN A N   
357  C CA  . ASN A 84  ? 1.3900 1.2029 0.9411 -0.2125 -0.2339 0.0198  73  ASN A CA  
358  C C   . ASN A 84  ? 1.3065 1.0988 0.8820 -0.1903 -0.2089 0.0280  73  ASN A C   
359  O O   . ASN A 84  ? 1.2939 1.1056 0.8805 -0.2299 -0.2133 0.0425  73  ASN A O   
360  C CB  . ASN A 84  ? 1.3706 1.3259 0.9756 -0.2610 -0.2455 0.0346  73  ASN A CB  
361  C CG  . ASN A 84  ? 1.4146 1.4288 1.0107 -0.2855 -0.2721 0.0285  73  ASN A CG  
362  O OD1 . ASN A 84  ? 1.3186 1.4745 0.9701 -0.2860 -0.2711 0.0356  73  ASN A OD1 
363  N ND2 . ASN A 84  ? 1.5543 1.4628 1.0758 -0.3029 -0.2977 0.0153  73  ASN A ND2 
364  N N   . GLY A 85  ? 1.2437 1.0047 0.8280 -0.1302 -0.1836 0.0206  74  GLY A N   
365  C CA  . GLY A 85  ? 1.2058 0.9393 0.8050 -0.1084 -0.1643 0.0260  74  GLY A CA  
366  C C   . GLY A 85  ? 1.1194 0.9485 0.7867 -0.1110 -0.1502 0.0376  74  GLY A C   
367  O O   . GLY A 85  ? 1.1058 0.9177 0.7833 -0.1039 -0.1402 0.0434  74  GLY A O   
368  N N   . GLU A 86  ? 1.0718 1.0010 0.7798 -0.1134 -0.1498 0.0400  75  GLU A N   
369  C CA  . GLU A 86  ? 0.9951 1.0186 0.7567 -0.1095 -0.1386 0.0502  75  GLU A CA  
370  C C   . GLU A 86  ? 0.9179 0.9159 0.6995 -0.0641 -0.1158 0.0464  75  GLU A C   
371  O O   . GLU A 86  ? 0.9361 0.8993 0.7113 -0.0305 -0.1053 0.0374  75  GLU A O   
372  C CB  . GLU A 86  ? 0.9984 1.1252 0.7866 -0.0985 -0.1406 0.0497  75  GLU A CB  
373  C CG  . GLU A 86  ? 1.1138 1.2892 0.8893 -0.1457 -0.1661 0.0534  75  GLU A CG  
374  C CD  . GLU A 86  ? 1.1589 1.4224 0.9480 -0.1215 -0.1704 0.0478  75  GLU A CD  
375  O OE1 . GLU A 86  ? 1.2087 1.5127 1.0180 -0.0681 -0.1532 0.0446  75  GLU A OE1 
376  O OE2 . GLU A 86  ? 1.1685 1.4587 0.9412 -0.1558 -0.1939 0.0465  75  GLU A OE2 
377  N N   . GLY A 87  ? 0.8442 0.8575 0.6466 -0.0665 -0.1092 0.0545  76  GLY A N   
378  C CA  . GLY A 87  ? 0.8061 0.8054 0.6294 -0.0299 -0.0922 0.0509  76  GLY A CA  
379  C C   . GLY A 87  ? 0.8299 0.7496 0.6347 -0.0167 -0.0867 0.0466  76  GLY A C   
380  O O   . GLY A 87  ? 0.7944 0.7088 0.6188 0.0085  -0.0742 0.0444  76  GLY A O   
381  N N   . GLY A 88  ? 0.9079 0.7665 0.6696 -0.0338 -0.0979 0.0459  77  GLY A N   
382  C CA  . GLY A 88  ? 0.9545 0.7412 0.6873 -0.0114 -0.0934 0.0414  77  GLY A CA  
383  C C   . GLY A 88  ? 0.9783 0.7522 0.7050 0.0181  -0.0835 0.0332  77  GLY A C   
384  O O   . GLY A 88  ? 1.0360 0.7673 0.7424 0.0450  -0.0761 0.0306  77  GLY A O   
385  N N   . LEU A 89  ? 0.9539 0.7665 0.6931 0.0176  -0.0828 0.0303  78  LEU A N   
386  C CA  . LEU A 89  ? 0.9921 0.7887 0.7196 0.0465  -0.0717 0.0247  78  LEU A CA  
387  C C   . LEU A 89  ? 1.0682 0.8013 0.7350 0.0455  -0.0848 0.0174  78  LEU A C   
388  O O   . LEU A 89  ? 1.1607 0.8804 0.8010 0.0121  -0.1066 0.0161  78  LEU A O   
389  C CB  . LEU A 89  ? 0.9847 0.8323 0.7328 0.0522  -0.0676 0.0239  78  LEU A CB  
390  C CG  . LEU A 89  ? 0.9587 0.8548 0.7479 0.0597  -0.0576 0.0285  78  LEU A CG  
391  C CD1 . LEU A 89  ? 0.9420 0.8601 0.7249 0.0780  -0.0538 0.0262  78  LEU A CD1 
392  C CD2 . LEU A 89  ? 0.9524 0.8337 0.7623 0.0725  -0.0423 0.0322  78  LEU A CD2 
393  N N   . GLY A 90  ? 1.0536 0.7510 0.6953 0.0803  -0.0724 0.0138  79  GLY A N   
394  C CA  . GLY A 90  ? 1.1178 0.7395 0.6867 0.0906  -0.0849 0.0049  79  GLY A CA  
395  C C   . GLY A 90  ? 1.1401 0.7440 0.6910 0.1397  -0.0633 0.0045  79  GLY A C   
396  O O   . GLY A 90  ? 1.0506 0.7096 0.6493 0.1549  -0.0400 0.0122  79  GLY A O   
397  N N   . GLU A 91  ? 1.2555 0.7816 0.7323 0.1653  -0.0705 -0.0028 80  GLU A N   
398  C CA  . GLU A 91  ? 1.3138 0.8347 0.7683 0.2187  -0.0477 -0.0016 80  GLU A CA  
399  C C   . GLU A 91  ? 1.2509 0.8066 0.7356 0.2500  -0.0249 0.0086  80  GLU A C   
400  O O   . GLU A 91  ? 1.2866 0.8005 0.7172 0.2933  -0.0216 0.0062  80  GLU A O   
401  C CB  . GLU A 91  ? 1.4930 0.9171 0.8441 0.2458  -0.0641 -0.0150 80  GLU A CB  
402  C CG  . GLU A 91  ? 1.5416 0.9624 0.8685 0.2484  -0.0680 -0.0217 80  GLU A CG  
403  C CD  . GLU A 91  ? 1.5770 0.9870 0.8969 0.1947  -0.1009 -0.0303 80  GLU A CD  
404  O OE1 . GLU A 91  ? 1.7215 1.0510 0.9760 0.1741  -0.1307 -0.0397 80  GLU A OE1 
405  O OE2 . GLU A 91  ? 1.4919 0.9726 0.8656 0.1730  -0.0985 -0.0268 80  GLU A OE2 
406  N N   . HIS A 92  ? 1.1506 0.7857 0.7174 0.2310  -0.0105 0.0196  81  HIS A N   
407  C CA  . HIS A 92  ? 1.1134 0.8019 0.7227 0.2506  0.0079  0.0304  81  HIS A CA  
408  C C   . HIS A 92  ? 1.0616 0.8316 0.7491 0.2280  0.0255  0.0425  81  HIS A C   
409  O O   . HIS A 92  ? 1.0448 0.8190 0.7425 0.2069  0.0248  0.0421  81  HIS A O   
410  C CB  . HIS A 92  ? 1.0975 0.7647 0.7049 0.2399  -0.0079 0.0279  81  HIS A CB  
411  C CG  . HIS A 92  ? 1.0565 0.7300 0.6955 0.1892  -0.0243 0.0264  81  HIS A CG  
412  N ND1 . HIS A 92  ? 1.1131 0.7264 0.7067 0.1612  -0.0489 0.0188  81  HIS A ND1 
413  C CD2 . HIS A 92  ? 0.9928 0.7282 0.6990 0.1622  -0.0202 0.0324  81  HIS A CD2 
414  C CE1 . HIS A 92  ? 1.0609 0.7134 0.6988 0.1221  -0.0561 0.0220  81  HIS A CE1 
415  N NE2 . HIS A 92  ? 0.9982 0.7188 0.7003 0.1264  -0.0392 0.0288  81  HIS A NE2 
416  N N   . ASN A 93  ? 1.0377 0.8678 0.7718 0.2345  0.0391  0.0531  82  ASN A N   
417  C CA  . ASN A 93  ? 0.9510 0.8480 0.7519 0.2070  0.0511  0.0652  82  ASN A CA  
418  C C   . ASN A 93  ? 0.8874 0.8152 0.7294 0.1913  0.0418  0.0658  82  ASN A C   
419  O O   . ASN A 93  ? 0.8881 0.8784 0.7788 0.1807  0.0512  0.0765  82  ASN A O   
420  C CB  . ASN A 93  ? 0.9643 0.9201 0.7835 0.2240  0.0787  0.0819  82  ASN A CB  
421  C CG  . ASN A 93  ? 1.0103 1.0132 0.8299 0.2654  0.0899  0.0884  82  ASN A CG  
422  O OD1 . ASN A 93  ? 1.0750 1.0378 0.8522 0.2979  0.0780  0.0776  82  ASN A OD1 
423  N ND2 . ASN A 93  ? 0.9990 1.0884 0.8605 0.2658  0.1128  0.1077  82  ASN A ND2 
424  N N   . TYR A 94  ? 0.8698 0.7531 0.6882 0.1874  0.0220  0.0553  83  TYR A N   
425  C CA  . TYR A 94  ? 0.8498 0.7537 0.6975 0.1758  0.0119  0.0552  83  TYR A CA  
426  C C   . TYR A 94  ? 0.8011 0.7226 0.6863 0.1385  0.0047  0.0550  83  TYR A C   
427  O O   . TYR A 94  ? 0.7933 0.6913 0.6659 0.1225  0.0000  0.0510  83  TYR A O   
428  C CB  . TYR A 94  ? 0.9056 0.7452 0.7029 0.1832  -0.0058 0.0469  83  TYR A CB  
429  C CG  . TYR A 94  ? 0.9839 0.7789 0.7196 0.2273  -0.0039 0.0442  83  TYR A CG  
430  C CD1 . TYR A 94  ? 0.9926 0.8397 0.7393 0.2685  0.0139  0.0513  83  TYR A CD1 
431  C CD2 . TYR A 94  ? 1.0428 0.7446 0.7034 0.2288  -0.0213 0.0354  83  TYR A CD2 
432  C CE1 . TYR A 94  ? 1.0638 0.8685 0.7432 0.3208  0.0155  0.0480  83  TYR A CE1 
433  C CE2 . TYR A 94  ? 1.1359 0.7764 0.7214 0.2749  -0.0230 0.0309  83  TYR A CE2 
434  C CZ  . TYR A 94  ? 1.1443 0.8363 0.7379 0.3259  -0.0037 0.0366  83  TYR A CZ  
435  O OH  . TYR A 94  ? 1.2674 0.8978 0.7763 0.3829  -0.0049 0.0315  83  TYR A OH  
436  N N   . CYS A 95  ? 0.7711 0.7338 0.6961 0.1291  0.0017  0.0584  84  CYS A N   
437  C CA  . CYS A 95  ? 0.7374 0.7082 0.6867 0.1004  -0.0074 0.0567  84  CYS A CA  
438  C C   . CYS A 95  ? 0.7313 0.6650 0.6545 0.0920  -0.0217 0.0493  84  CYS A C   
439  O O   . CYS A 95  ? 0.7317 0.6407 0.6307 0.0994  -0.0291 0.0473  84  CYS A O   
440  C CB  . CYS A 95  ? 0.7188 0.7338 0.7057 0.0942  -0.0126 0.0596  84  CYS A CB  
441  S SG  . CYS A 95  ? 0.7307 0.8137 0.7578 0.0899  0.0026  0.0728  84  CYS A SG  
442  N N   . ARG A 96  ? 0.7177 0.6474 0.6392 0.0779  -0.0250 0.0469  85  ARG A N   
443  C CA  . ARG A 96  ? 0.7203 0.6425 0.6262 0.0682  -0.0370 0.0433  85  ARG A CA  
444  C C   . ARG A 96  ? 0.7043 0.6436 0.6188 0.0635  -0.0411 0.0416  85  ARG A C   
445  O O   . ARG A 96  ? 0.6991 0.6365 0.6210 0.0641  -0.0374 0.0419  85  ARG A O   
446  C CB  . ARG A 96  ? 0.7644 0.6658 0.6396 0.0669  -0.0386 0.0411  85  ARG A CB  
447  C CG  . ARG A 96  ? 0.8170 0.6789 0.6603 0.0745  -0.0398 0.0403  85  ARG A CG  
448  C CD  . ARG A 96  ? 0.8461 0.6842 0.6693 0.0634  -0.0527 0.0417  85  ARG A CD  
449  N NE  . ARG A 96  ? 0.9047 0.6807 0.6759 0.0745  -0.0576 0.0396  85  ARG A NE  
450  C CZ  . ARG A 96  ? 0.9196 0.6751 0.6764 0.1038  -0.0525 0.0399  85  ARG A CZ  
451  N NH1 . ARG A 96  ? 0.8805 0.6847 0.6809 0.1189  -0.0429 0.0433  85  ARG A NH1 
452  N NH2 . ARG A 96  ? 0.9828 0.6676 0.6746 0.1201  -0.0594 0.0366  85  ARG A NH2 
453  N N   . ASN A 97  ? 0.7493 0.7035 0.6562 0.0591  -0.0498 0.0409  86  ASN A N   
454  C CA  . ASN A 97  ? 0.7810 0.7525 0.6842 0.0663  -0.0542 0.0386  86  ASN A CA  
455  C C   . ASN A 97  ? 0.8099 0.8138 0.7002 0.0661  -0.0581 0.0402  86  ASN A C   
456  O O   . ASN A 97  ? 0.8514 0.8890 0.7445 0.0596  -0.0636 0.0446  86  ASN A O   
457  C CB  . ASN A 97  ? 0.7876 0.7689 0.7006 0.0666  -0.0612 0.0384  86  ASN A CB  
458  C CG  . ASN A 97  ? 0.8350 0.8280 0.7305 0.0825  -0.0670 0.0349  86  ASN A CG  
459  O OD1 . ASN A 97  ? 0.8377 0.8239 0.7117 0.0967  -0.0656 0.0321  86  ASN A OD1 
460  N ND2 . ASN A 97  ? 0.8802 0.8869 0.7760 0.0869  -0.0740 0.0349  86  ASN A ND2 
461  N N   . PRO A 98  ? 0.8115 0.8130 0.6881 0.0716  -0.0554 0.0383  87  PRO A N   
462  C CA  . PRO A 98  ? 0.8022 0.8488 0.6700 0.0701  -0.0612 0.0399  87  PRO A CA  
463  C C   . PRO A 98  ? 0.7995 0.8794 0.6529 0.0993  -0.0622 0.0377  87  PRO A C   
464  O O   . PRO A 98  ? 0.8201 0.9557 0.6690 0.1039  -0.0668 0.0397  87  PRO A O   
465  C CB  . PRO A 98  ? 0.8229 0.8431 0.6767 0.0673  -0.0593 0.0371  87  PRO A CB  
466  C CG  . PRO A 98  ? 0.8257 0.7998 0.6749 0.0831  -0.0481 0.0346  87  PRO A CG  
467  C CD  . PRO A 98  ? 0.8177 0.7803 0.6868 0.0772  -0.0465 0.0364  87  PRO A CD  
468  N N   . ASP A 99  ? 0.8103 0.8544 0.6499 0.1199  -0.0598 0.0335  88  ASP A N   
469  C CA  . ASP A 99  ? 0.8401 0.8941 0.6458 0.1572  -0.0628 0.0297  88  ASP A CA  
470  C C   . ASP A 99  ? 0.8287 0.9054 0.6318 0.1697  -0.0678 0.0299  88  ASP A C   
471  O O   . ASP A 99  ? 0.8567 0.9159 0.6189 0.2062  -0.0717 0.0246  88  ASP A O   
472  C CB  . ASP A 99  ? 0.8995 0.8746 0.6662 0.1744  -0.0600 0.0247  88  ASP A CB  
473  C CG  . ASP A 99  ? 0.9056 0.8181 0.6749 0.1563  -0.0604 0.0237  88  ASP A CG  
474  O OD1 . ASP A 99  ? 0.8480 0.7749 0.6578 0.1295  -0.0594 0.0266  88  ASP A OD1 
475  O OD2 . ASP A 99  ? 0.9567 0.8029 0.6824 0.1675  -0.0633 0.0209  88  ASP A OD2 
476  N N   . GLY A 100 ? 0.7931 0.9014 0.6294 0.1430  -0.0683 0.0362  89  GLY A N   
477  C CA  . GLY A 100 ? 0.7819 0.8974 0.6177 0.1494  -0.0721 0.0369  89  GLY A CA  
478  C C   . GLY A 100 ? 0.8061 0.8546 0.6099 0.1704  -0.0782 0.0268  89  GLY A C   
479  O O   . GLY A 100 ? 0.8191 0.8746 0.5899 0.2029  -0.0835 0.0233  89  GLY A O   
480  N N   . ASP A 101 ? 0.8306 0.8152 0.6381 0.1520  -0.0783 0.0228  90  ASP A N   
481  C CA  . ASP A 101 ? 0.9150 0.8327 0.6937 0.1559  -0.0881 0.0151  90  ASP A CA  
482  C C   . ASP A 101 ? 0.8788 0.8093 0.6826 0.1417  -0.0948 0.0151  90  ASP A C   
483  O O   . ASP A 101 ? 0.8447 0.8283 0.6778 0.1349  -0.0901 0.0219  90  ASP A O   
484  C CB  . ASP A 101 ? 0.9793 0.8397 0.7575 0.1330  -0.0852 0.0155  90  ASP A CB  
485  C CG  . ASP A 101 ? 1.0874 0.8627 0.8035 0.1418  -0.0974 0.0088  90  ASP A CG  
486  O OD1 . ASP A 101 ? 1.0943 0.8425 0.7804 0.1524  -0.1128 0.0012  90  ASP A OD1 
487  O OD2 . ASP A 101 ? 1.1549 0.8827 0.8442 0.1377  -0.0926 0.0116  90  ASP A OD2 
488  N N   . VAL A 102 ? 0.8682 0.7474 0.6550 0.1353  -0.1075 0.0081  91  VAL A N   
489  C CA  . VAL A 102 ? 0.8558 0.7476 0.6591 0.1282  -0.1170 0.0062  91  VAL A CA  
490  C C   . VAL A 102 ? 0.8103 0.7246 0.6674 0.0972  -0.1128 0.0119  91  VAL A C   
491  O O   . VAL A 102 ? 0.8038 0.7323 0.6753 0.0937  -0.1207 0.0109  91  VAL A O   
492  C CB  . VAL A 102 ? 0.9569 0.7853 0.7144 0.1329  -0.1378 -0.0050 91  VAL A CB  
493  C CG1 . VAL A 102 ? 1.0558 0.8505 0.7416 0.1770  -0.1437 -0.0124 91  VAL A CG1 
494  C CG2 . VAL A 102 ? 0.9871 0.7657 0.7472 0.0973  -0.1440 -0.0055 91  VAL A CG2 
495  N N   . SER A 103 ? 0.8009 0.7189 0.6821 0.0809  -0.1006 0.0177  92  SER A N   
496  C CA  . SER A 103 ? 0.7724 0.7148 0.6967 0.0622  -0.0953 0.0233  92  SER A CA  
497  C C   . SER A 103 ? 0.7515 0.6982 0.6874 0.0569  -0.0790 0.0297  92  SER A C   
498  O O   . SER A 103 ? 0.7657 0.6915 0.6789 0.0618  -0.0742 0.0292  92  SER A O   
499  C CB  . SER A 103 ? 0.7975 0.7300 0.7335 0.0428  -0.1068 0.0209  92  SER A CB  
500  O OG  . SER A 103 ? 0.8078 0.7670 0.7799 0.0270  -0.0962 0.0288  92  SER A OG  
501  N N   . PRO A 104 ? 0.7074 0.6762 0.6696 0.0532  -0.0716 0.0349  93  PRO A N   
502  C CA  . PRO A 104 ? 0.6954 0.6615 0.6597 0.0528  -0.0575 0.0397  93  PRO A CA  
503  C C   . PRO A 104 ? 0.7127 0.6729 0.6842 0.0407  -0.0510 0.0435  93  PRO A C   
504  O O   . PRO A 104 ? 0.7033 0.6676 0.6864 0.0252  -0.0587 0.0441  93  PRO A O   
505  C CB  . PRO A 104 ? 0.6884 0.6700 0.6652 0.0598  -0.0541 0.0431  93  PRO A CB  
506  C CG  . PRO A 104 ? 0.6899 0.6765 0.6641 0.0632  -0.0655 0.0412  93  PRO A CG  
507  C CD  . PRO A 104 ? 0.6926 0.6823 0.6707 0.0571  -0.0762 0.0362  93  PRO A CD  
508  N N   . TRP A 105 ? 0.7363 0.6856 0.6969 0.0445  -0.0380 0.0473  94  TRP A N   
509  C CA  . TRP A 105 ? 0.7619 0.6994 0.7191 0.0322  -0.0287 0.0545  94  TRP A CA  
510  C C   . TRP A 105 ? 0.7565 0.6964 0.7075 0.0436  -0.0115 0.0600  94  TRP A C   
511  O O   . TRP A 105 ? 0.7400 0.6818 0.6840 0.0600  -0.0101 0.0562  94  TRP A O   
512  C CB  . TRP A 105 ? 0.7957 0.6846 0.7136 0.0302  -0.0363 0.0505  94  TRP A CB  
513  C CG  . TRP A 105 ? 0.8097 0.6848 0.6970 0.0538  -0.0372 0.0439  94  TRP A CG  
514  C CD1 . TRP A 105 ? 0.8144 0.7042 0.6963 0.0672  -0.0471 0.0369  94  TRP A CD1 
515  C CD2 . TRP A 105 ? 0.8487 0.7029 0.7064 0.0665  -0.0286 0.0453  94  TRP A CD2 
516  N NE1 . TRP A 105 ? 0.8470 0.7384 0.7036 0.0852  -0.0457 0.0346  94  TRP A NE1 
517  C CE2 . TRP A 105 ? 0.8581 0.7249 0.6984 0.0868  -0.0356 0.0382  94  TRP A CE2 
518  C CE3 . TRP A 105 ? 0.8607 0.6927 0.7042 0.0632  -0.0153 0.0533  94  TRP A CE3 
519  C CZ2 . TRP A 105 ? 0.8732 0.7354 0.6850 0.1048  -0.0323 0.0370  94  TRP A CZ2 
520  C CZ3 . TRP A 105 ? 0.8798 0.6937 0.6883 0.0836  -0.0112 0.0516  94  TRP A CZ3 
521  C CH2 . TRP A 105 ? 0.8942 0.7250 0.6885 0.1047  -0.0209 0.0425  94  TRP A CH2 
522  N N   . CYS A 106 ? 0.7708 0.7049 0.7178 0.0329  0.0003  0.0700  95  CYS A N   
523  C CA  . CYS A 106 ? 0.8063 0.7344 0.7362 0.0479  0.0164  0.0747  95  CYS A CA  
524  C C   . CYS A 106 ? 0.8802 0.7836 0.7900 0.0336  0.0272  0.0862  95  CYS A C   
525  O O   . CYS A 106 ? 0.9047 0.7924 0.8134 0.0064  0.0210  0.0916  95  CYS A O   
526  C CB  . CYS A 106 ? 0.8010 0.7725 0.7528 0.0625  0.0281  0.0800  95  CYS A CB  
527  S SG  . CYS A 106 ? 0.8100 0.8489 0.8042 0.0447  0.0425  0.0990  95  CYS A SG  
528  N N   . TYR A 107 ? 0.9276 0.8182 0.8126 0.0506  0.0415  0.0903  96  TYR A N   
529  C CA  . TYR A 107 ? 0.9751 0.8322 0.8295 0.0396  0.0532  0.1031  96  TYR A CA  
530  C C   . TYR A 107 ? 0.9870 0.8936 0.8701 0.0231  0.0733  0.1234  96  TYR A C   
531  O O   . TYR A 107 ? 0.9865 0.9345 0.8822 0.0457  0.0874  0.1268  96  TYR A O   
532  C CB  . TYR A 107 ? 1.0004 0.8243 0.8111 0.0690  0.0584  0.0981  96  TYR A CB  
533  C CG  . TYR A 107 ? 0.9823 0.7665 0.7582 0.0839  0.0406  0.0833  96  TYR A CG  
534  C CD1 . TYR A 107 ? 1.0234 0.7558 0.7627 0.0768  0.0327  0.0845  96  TYR A CD1 
535  C CD2 . TYR A 107 ? 0.9439 0.7423 0.7157 0.1062  0.0310  0.0694  96  TYR A CD2 
536  C CE1 . TYR A 107 ? 1.0410 0.7479 0.7432 0.1022  0.0177  0.0715  96  TYR A CE1 
537  C CE2 . TYR A 107 ? 0.9488 0.7355 0.6945 0.1215  0.0161  0.0587  96  TYR A CE2 
538  C CZ  . TYR A 107 ? 0.9919 0.7381 0.7033 0.1251  0.0106  0.0595  96  TYR A CZ  
539  O OH  . TYR A 107 ? 0.9888 0.7313 0.6680 0.1514  -0.0029 0.0496  96  TYR A OH  
540  N N   . VAL A 108 ? 1.0486 0.9523 0.9372 -0.0165 0.0736  0.1378  97  VAL A N   
541  C CA  . VAL A 108 ? 1.1328 1.1040 1.0552 -0.0393 0.0935  0.1616  97  VAL A CA  
542  C C   . VAL A 108 ? 1.1611 1.1195 1.0502 -0.0333 0.1187  0.1797  97  VAL A C   
543  O O   . VAL A 108 ? 1.2179 1.2498 1.1330 -0.0227 0.1410  0.1949  97  VAL A O   
544  C CB  . VAL A 108 ? 1.2524 1.2351 1.1952 -0.0977 0.0832  0.1750  97  VAL A CB  
545  C CG1 . VAL A 108 ? 1.2526 1.2683 1.2353 -0.1009 0.0603  0.1593  97  VAL A CG1 
546  C CG2 . VAL A 108 ? 1.3584 1.2325 1.2352 -0.1276 0.0727  0.1784  97  VAL A CG2 
547  N N   . ALA A 109 ? 1.1693 1.0377 0.9965 -0.0347 0.1160  0.1791  98  ALA A N   
548  C CA  . ALA A 109 ? 1.2317 1.0754 1.0183 -0.0422 0.1394  0.2024  98  ALA A CA  
549  C C   . ALA A 109 ? 1.2869 1.1188 1.0682 -0.1057 0.1428  0.2290  98  ALA A C   
550  O O   . ALA A 109 ? 1.2088 1.1273 1.0480 -0.1425 0.1484  0.2455  98  ALA A O   
551  C CB  . ALA A 109 ? 1.2116 1.1276 1.0162 -0.0115 0.1675  0.2140  98  ALA A CB  
552  N N   . GLU A 110 ? 1.4009 1.1246 1.1048 -0.1158 0.1398  0.2346  99  GLU A N   
553  C CA  . GLU A 110 ? 1.5175 1.1672 1.1809 -0.1759 0.1273  0.2496  99  GLU A CA  
554  C C   . GLU A 110 ? 1.5844 1.2879 1.2655 -0.2297 0.1524  0.2889  99  GLU A C   
555  O O   . GLU A 110 ? 1.5677 1.3099 1.2470 -0.2069 0.1817  0.3047  99  GLU A O   
556  C CB  . GLU A 110 ? 1.6183 1.1220 1.1759 -0.1530 0.1150  0.2401  99  GLU A CB  
557  C CG  . GLU A 110 ? 1.8201 1.2106 1.2998 -0.2110 0.1061  0.2610  99  GLU A CG  
558  C CD  . GLU A 110 ? 1.9655 1.2023 1.3289 -0.1737 0.0884  0.2461  99  GLU A CD  
559  O OE1 . GLU A 110 ? 1.9465 1.1872 1.3082 -0.1073 0.0783  0.2164  99  GLU A OE1 
560  O OE2 . GLU A 110 ? 2.0717 1.1877 1.3428 -0.2111 0.0845  0.2656  99  GLU A OE2 
561  N N   . HIS A 111 ? 1.6807 1.3942 1.3791 -0.3025 0.1407  0.3058  100 HIS A N   
562  C CA  . HIS A 111 ? 1.7742 1.5659 1.5014 -0.3634 0.1651  0.3479  100 HIS A CA  
563  C C   . HIS A 111 ? 1.9242 1.6023 1.5742 -0.4432 0.1551  0.3742  100 HIS A C   
564  O O   . HIS A 111 ? 2.0209 1.7699 1.7051 -0.5196 0.1635  0.4090  100 HIS A O   
565  C CB  . HIS A 111 ? 1.7255 1.6934 1.5670 -0.3818 0.1693  0.3547  100 HIS A CB  
566  C CG  . HIS A 111 ? 1.6772 1.7734 1.5735 -0.3210 0.2024  0.3588  100 HIS A CG  
567  N ND1 . HIS A 111 ? 1.7139 1.8682 1.6066 -0.3223 0.2400  0.3924  100 HIS A ND1 
568  C CD2 . HIS A 111 ? 1.5954 1.7578 1.5366 -0.2532 0.2025  0.3331  100 HIS A CD2 
569  C CE1 . HIS A 111 ? 1.6344 1.8861 1.5663 -0.2535 0.2608  0.3853  100 HIS A CE1 
570  N NE2 . HIS A 111 ? 1.5720 1.8244 1.5310 -0.2127 0.2375  0.3494  100 HIS A NE2 
571  N N   . GLU A 112 ? 1.9729 1.4766 1.5123 -0.4244 0.1385  0.3604  101 GLU A N   
572  C CA  . GLU A 112 ? 2.1064 1.4577 1.5424 -0.4939 0.1211  0.3800  101 GLU A CA  
573  C C   . GLU A 112 ? 2.1214 1.4014 1.5381 -0.5300 0.0762  0.3589  101 GLU A C   
574  O O   . GLU A 112 ? 2.2459 1.3580 1.5506 -0.5664 0.0512  0.3616  101 GLU A O   
575  C CB  . GLU A 112 ? 2.1644 1.5700 1.6115 -0.5805 0.1465  0.4326  101 GLU A CB  
576  C CG  . GLU A 112 ? 2.3430 1.5839 1.6763 -0.6655 0.1274  0.4575  101 GLU A CG  
577  C CD  . GLU A 112 ? 2.4590 1.4875 1.6429 -0.6159 0.1172  0.4435  101 GLU A CD  
578  O OE1 . GLU A 112 ? 2.4350 1.4667 1.6023 -0.5385 0.1422  0.4373  101 GLU A OE1 
579  O OE2 . GLU A 112 ? 2.5895 1.4449 1.6654 -0.6513 0.0823  0.4380  101 GLU A OE2 
580  N N   . ASP A 113 ? 1.9883 1.3947 1.5084 -0.5208 0.0663  0.3400  102 ASP A N   
581  C CA  . ASP A 113 ? 1.9380 1.3001 1.4536 -0.5103 0.0273  0.3060  102 ASP A CA  
582  C C   . ASP A 113 ? 1.9761 1.1674 1.3770 -0.4510 0.0068  0.2774  102 ASP A C   
583  O O   . ASP A 113 ? 2.0249 1.0991 1.3545 -0.4714 -0.0282 0.2641  102 ASP A O   
584  C CB  . ASP A 113 ? 1.7670 1.2873 1.3996 -0.4565 0.0341  0.2838  102 ASP A CB  
585  C CG  . ASP A 113 ? 1.7083 1.3508 1.4316 -0.5104 0.0212  0.2897  102 ASP A CG  
586  O OD1 . ASP A 113 ? 1.7725 1.3881 1.4774 -0.5955 0.0033  0.3093  102 ASP A OD1 
587  O OD2 . ASP A 113 ? 1.5823 1.3455 1.3908 -0.4661 0.0268  0.2740  102 ASP A OD2 
588  N N   . GLY A 114 ? 1.9308 1.1139 1.3118 -0.3750 0.0275  0.2678  103 GLY A N   
589  C CA  . GLY A 114 ? 1.9303 1.0036 1.2294 -0.3018 0.0104  0.2372  103 GLY A CA  
590  C C   . GLY A 114 ? 1.7742 0.9425 1.1503 -0.2462 0.0026  0.2051  103 GLY A C   
591  O O   . GLY A 114 ? 1.7539 0.8593 1.0769 -0.1877 -0.0123 0.1803  103 GLY A O   
592  N N   . VAL A 115 ? 1.6585 0.9791 1.1532 -0.2601 0.0142  0.2076  104 VAL A N   
593  C CA  . VAL A 115 ? 1.5788 0.9779 1.1398 -0.2198 0.0036  0.1803  104 VAL A CA  
594  C C   . VAL A 115 ? 1.4784 0.9797 1.1015 -0.1684 0.0292  0.1758  104 VAL A C   
595  O O   . VAL A 115 ? 1.4670 1.0730 1.1614 -0.1857 0.0493  0.1913  104 VAL A O   
596  C CB  . VAL A 115 ? 1.5536 1.0363 1.1908 -0.2714 -0.0094 0.1834  104 VAL A CB  
597  C CG1 . VAL A 115 ? 1.4601 1.0206 1.1608 -0.2280 -0.0186 0.1574  104 VAL A CG1 
598  C CG2 . VAL A 115 ? 1.6761 1.0491 1.2446 -0.3287 -0.0406 0.1862  104 VAL A CG2 
599  N N   . TYR A 116 ? 1.4239 0.8999 1.0186 -0.1056 0.0266  0.1547  105 TYR A N   
600  C CA  . TYR A 116 ? 1.3055 0.8636 0.9469 -0.0622 0.0460  0.1495  105 TYR A CA  
601  C C   . TYR A 116 ? 1.1732 0.8296 0.8955 -0.0493 0.0424  0.1356  105 TYR A C   
602  O O   . TYR A 116 ? 1.1274 0.8569 0.8942 -0.0335 0.0597  0.1390  105 TYR A O   
603  C CB  . TYR A 116 ? 1.3321 0.8366 0.9118 -0.0070 0.0457  0.1368  105 TYR A CB  
604  C CG  . TYR A 116 ? 1.3333 0.7795 0.8615 0.0278  0.0215  0.1151  105 TYR A CG  
605  C CD1 . TYR A 116 ? 1.2578 0.7648 0.8254 0.0592  0.0116  0.0952  105 TYR A CD1 
606  C CD2 . TYR A 116 ? 1.4239 0.7536 0.8541 0.0357  0.0101  0.1161  105 TYR A CD2 
607  C CE1 . TYR A 116 ? 1.2862 0.7597 0.8085 0.0965  -0.0071 0.0784  105 TYR A CE1 
608  C CE2 . TYR A 116 ? 1.4501 0.7343 0.8255 0.0809  -0.0104 0.0965  105 TYR A CE2 
609  C CZ  . TYR A 116 ? 1.3707 0.7374 0.7977 0.1117  -0.0179 0.0782  105 TYR A CZ  
610  O OH  . TYR A 116 ? 1.3601 0.7043 0.7385 0.1597  -0.0354 0.0614  105 TYR A OH  
611  N N   . TRP A 117 ? 1.1305 0.7786 0.8606 -0.0539 0.0193  0.1209  106 TRP A N   
612  C CA  . TRP A 117 ? 1.0105 0.7329 0.8023 -0.0405 0.0119  0.1071  106 TRP A CA  
613  C C   . TRP A 117 ? 1.0113 0.7487 0.8306 -0.0753 -0.0061 0.1058  106 TRP A C   
614  O O   . TRP A 117 ? 1.0815 0.7514 0.8579 -0.1034 -0.0214 0.1079  106 TRP A O   
615  C CB  . TRP A 117 ? 0.9710 0.6738 0.7380 0.0024  0.0001  0.0868  106 TRP A CB  
616  C CG  . TRP A 117 ? 1.0072 0.6411 0.7214 0.0067  -0.0220 0.0762  106 TRP A CG  
617  C CD1 . TRP A 117 ? 1.1011 0.6455 0.7355 0.0194  -0.0282 0.0755  106 TRP A CD1 
618  C CD2 . TRP A 117 ? 0.9886 0.6322 0.7160 0.0054  -0.0410 0.0644  106 TRP A CD2 
619  N NE1 . TRP A 117 ? 1.1371 0.6310 0.7293 0.0289  -0.0506 0.0633  106 TRP A NE1 
620  C CE2 . TRP A 117 ? 1.0602 0.6176 0.7113 0.0199  -0.0584 0.0562  106 TRP A CE2 
621  C CE3 . TRP A 117 ? 0.9560 0.6672 0.7441 -0.0022 -0.0455 0.0602  106 TRP A CE3 
622  C CZ2 . TRP A 117 ? 1.0841 0.6249 0.7191 0.0280  -0.0794 0.0434  106 TRP A CZ2 
623  C CZ3 . TRP A 117 ? 0.9631 0.6609 0.7398 0.0029  -0.0659 0.0482  106 TRP A CZ3 
624  C CH2 . TRP A 117 ? 1.0353 0.6497 0.7364 0.0178  -0.0825 0.0398  106 TRP A CH2 
625  N N   . LYS A 118 ? 0.9549 0.7721 0.8363 -0.0701 -0.0071 0.1010  107 LYS A N   
626  C CA  . LYS A 118 ? 0.9629 0.8048 0.8731 -0.0930 -0.0266 0.0961  107 LYS A CA  
627  C C   . LYS A 118 ? 0.9194 0.8043 0.8602 -0.0607 -0.0334 0.0808  107 LYS A C   
628  O O   . LYS A 118 ? 0.8662 0.7849 0.8240 -0.0314 -0.0200 0.0792  107 LYS A O   
629  C CB  . LYS A 118 ? 0.9759 0.8900 0.9370 -0.1351 -0.0198 0.1151  107 LYS A CB  
630  C CG  . LYS A 118 ? 1.1019 0.9634 1.0322 -0.1924 -0.0361 0.1249  107 LYS A CG  
631  C CD  . LYS A 118 ? 1.1495 1.0761 1.1159 -0.2436 -0.0217 0.1530  107 LYS A CD  
632  C CE  . LYS A 118 ? 1.1001 1.1721 1.1549 -0.2421 -0.0129 0.1607  107 LYS A CE  
633  N NZ  . LYS A 118 ? 1.1100 1.2315 1.2002 -0.2900 -0.0376 0.1631  107 LYS A NZ  
634  N N   . TYR A 119 ? 0.9438 0.8177 0.8824 -0.0673 -0.0557 0.0702  108 TYR A N   
635  C CA  . TYR A 119 ? 0.8812 0.7989 0.8492 -0.0437 -0.0626 0.0597  108 TYR A CA  
636  C C   . TYR A 119 ? 0.8303 0.8324 0.8566 -0.0475 -0.0534 0.0685  108 TYR A C   
637  O O   . TYR A 119 ? 0.8448 0.8842 0.8965 -0.0773 -0.0497 0.0814  108 TYR A O   
638  C CB  . TYR A 119 ? 0.9111 0.8005 0.8604 -0.0507 -0.0885 0.0483  108 TYR A CB  
639  C CG  . TYR A 119 ? 0.9370 0.7504 0.8209 -0.0287 -0.0995 0.0365  108 TYR A CG  
640  C CD1 . TYR A 119 ? 0.8933 0.7169 0.7680 0.0091  -0.0940 0.0298  108 TYR A CD1 
641  C CD2 . TYR A 119 ? 0.9981 0.7316 0.8239 -0.0450 -0.1176 0.0327  108 TYR A CD2 
642  C CE1 . TYR A 119 ? 0.9148 0.6913 0.7330 0.0364  -0.1023 0.0208  108 TYR A CE1 
643  C CE2 . TYR A 119 ? 1.0264 0.6922 0.7828 -0.0119 -0.1277 0.0211  108 TYR A CE2 
644  C CZ  . TYR A 119 ? 0.9792 0.6777 0.7371 0.0316  -0.1185 0.0157  108 TYR A CZ  
645  O OH  . TYR A 119 ? 1.0415 0.6973 0.7359 0.0716  -0.1264 0.0060  108 TYR A OH  
646  N N   . CYS A 120 ? 0.7871 0.8187 0.8283 -0.0168 -0.0501 0.0632  109 CYS A N   
647  C CA  . CYS A 120 ? 0.7770 0.8798 0.8584 -0.0057 -0.0426 0.0696  109 CYS A CA  
648  C C   . CYS A 120 ? 0.7989 0.9274 0.8975 -0.0067 -0.0623 0.0629  109 CYS A C   
649  O O   . CYS A 120 ? 0.7822 0.8707 0.8568 0.0007  -0.0754 0.0521  109 CYS A O   
650  C CB  . CYS A 120 ? 0.7507 0.8469 0.8178 0.0311  -0.0302 0.0673  109 CYS A CB  
651  S SG  . CYS A 120 ? 0.7548 0.8349 0.8030 0.0393  -0.0071 0.0754  109 CYS A SG  
652  N N   . GLU A 121 ? 0.8578 1.0616 0.9977 -0.0142 -0.0642 0.0702  110 GLU A N   
653  C CA  . GLU A 121 ? 0.9061 1.1451 1.0641 -0.0124 -0.0845 0.0640  110 GLU A CA  
654  C C   . GLU A 121 ? 0.8463 1.1240 1.0105 0.0346  -0.0754 0.0648  110 GLU A C   
655  O O   . GLU A 121 ? 0.8571 1.2089 1.0501 0.0484  -0.0637 0.0751  110 GLU A O   
656  C CB  . GLU A 121 ? 1.0177 1.3207 1.2145 -0.0562 -0.0965 0.0725  110 GLU A CB  
657  C CG  . GLU A 121 ? 1.1549 1.4447 1.3465 -0.0779 -0.1283 0.0612  110 GLU A CG  
658  C CD  . GLU A 121 ? 1.2745 1.6143 1.4826 -0.0436 -0.1396 0.0542  110 GLU A CD  
659  O OE1 . GLU A 121 ? 1.3911 1.7997 1.6251 -0.0104 -0.1255 0.0615  110 GLU A OE1 
660  O OE2 . GLU A 121 ? 1.3468 1.6532 1.5337 -0.0442 -0.1633 0.0414  110 GLU A OE2 
661  N N   . ILE A 122 ? 0.7875 1.0122 0.9170 0.0608  -0.0801 0.0555  111 ILE A N   
662  C CA  . ILE A 122 ? 0.7702 0.9933 0.8797 0.1046  -0.0731 0.0561  111 ILE A CA  
663  C C   . ILE A 122 ? 0.7631 0.9939 0.8663 0.1226  -0.0902 0.0507  111 ILE A C   
664  O O   . ILE A 122 ? 0.7607 0.9367 0.8336 0.1214  -0.0988 0.0448  111 ILE A O   
665  C CB  . ILE A 122 ? 0.7926 0.9362 0.8544 0.1151  -0.0646 0.0534  111 ILE A CB  
666  C CG1 . ILE A 122 ? 0.8146 0.9405 0.8761 0.0961  -0.0511 0.0564  111 ILE A CG1 
667  C CG2 . ILE A 122 ? 0.8168 0.9388 0.8419 0.1564  -0.0592 0.0549  111 ILE A CG2 
668  C CD1 . ILE A 122 ? 0.8238 0.8830 0.8420 0.1012  -0.0466 0.0531  111 ILE A CD1 
669  N N   . PRO A 123 ? 0.7547 1.0608 0.8845 0.1427  -0.0945 0.0541  112 PRO A N   
670  C CA  . PRO A 123 ? 0.7562 1.0735 0.8798 0.1597  -0.1131 0.0485  112 PRO A CA  
671  C C   . PRO A 123 ? 0.7673 1.0066 0.8289 0.1953  -0.1123 0.0464  112 PRO A C   
672  O O   . PRO A 123 ? 0.7798 0.9930 0.8223 0.1966  -0.1261 0.0419  112 PRO A O   
673  C CB  . PRO A 123 ? 0.7584 1.1876 0.9252 0.1779  -0.1157 0.0545  112 PRO A CB  
674  C CG  . PRO A 123 ? 0.7726 1.2195 0.9368 0.2010  -0.0919 0.0636  112 PRO A CG  
675  C CD  . PRO A 123 ? 0.7626 1.1489 0.9207 0.1624  -0.0806 0.0642  112 PRO A CD  
676  N N   . ALA A 124 ? 0.7835 0.9766 0.8061 0.2196  -0.0977 0.0503  113 ALA A N   
677  C CA  . ALA A 124 ? 0.8380 0.9414 0.7903 0.2425  -0.1000 0.0505  113 ALA A CA  
678  C C   . ALA A 124 ? 0.8338 0.8671 0.7619 0.2060  -0.1010 0.0500  113 ALA A C   
679  O O   . ALA A 124 ? 0.8810 0.8459 0.7540 0.2108  -0.1044 0.0537  113 ALA A O   
680  C CB  . ALA A 124 ? 0.8844 0.9494 0.7885 0.2813  -0.0889 0.0537  113 ALA A CB  
681  N N   . CYS A 125 ? 0.7867 0.8408 0.7521 0.1704  -0.0984 0.0474  114 CYS A N   
682  C CA  . CYS A 125 ? 0.7886 0.8002 0.7371 0.1429  -0.0975 0.0475  114 CYS A CA  
683  C C   . CYS A 125 ? 0.7781 0.8091 0.7404 0.1319  -0.1099 0.0433  114 CYS A C   
684  O O   . CYS A 125 ? 0.7632 0.8126 0.7498 0.1127  -0.1128 0.0381  114 CYS A O   
685  C CB  . CYS A 125 ? 0.7766 0.7912 0.7436 0.1218  -0.0868 0.0465  114 CYS A CB  
686  S SG  . CYS A 125 ? 0.7453 0.7358 0.7003 0.0950  -0.0864 0.0459  114 CYS A SG  
687  N N   . GLN A 126 ? 0.8066 0.8234 0.7427 0.1464  -0.1184 0.0453  115 GLN A N   
688  C CA  . GLN A 126 ? 0.7937 0.8288 0.7363 0.1433  -0.1317 0.0400  115 GLN A CA  
689  C C   . GLN A 126 ? 0.8144 0.8149 0.7124 0.1515  -0.1326 0.0480  115 GLN A C   
690  O O   . GLN A 126 ? 0.8340 0.8172 0.7047 0.1740  -0.1362 0.0526  115 GLN A O   
691  C CB  . GLN A 126 ? 0.8004 0.8853 0.7726 0.1557  -0.1461 0.0332  115 GLN A CB  
692  C CG  . GLN A 126 ? 0.8148 0.9149 0.7939 0.1465  -0.1650 0.0237  115 GLN A CG  
693  C CD  . GLN A 126 ? 0.8363 0.9907 0.8415 0.1549  -0.1845 0.0174  115 GLN A CD  
694  O OE1 . GLN A 126 ? 0.8784 1.0416 0.8857 0.1443  -0.2047 0.0077  115 GLN A OE1 
695  N NE2 . GLN A 126 ? 0.8465 1.0385 0.8659 0.1770  -0.1804 0.0223  115 GLN A NE2 
696  N N   . MET A 127 ? 0.7896 0.7827 0.6756 0.1359  -0.1286 0.0514  116 MET A N   
697  C CA  . MET A 127 ? 0.8071 0.7743 0.6509 0.1341  -0.1242 0.0653  116 MET A CA  
698  C C   . MET A 127 ? 0.8212 0.7853 0.6426 0.1580  -0.1351 0.0661  116 MET A C   
699  O O   . MET A 127 ? 0.8220 0.8155 0.6620 0.1707  -0.1481 0.0539  116 MET A O   
700  C CB  . MET A 127 ? 0.7907 0.7777 0.6317 0.1183  -0.1175 0.0705  116 MET A CB  
701  C CG  . MET A 127 ? 0.7917 0.8067 0.6392 0.1332  -0.1265 0.0599  116 MET A CG  
702  S SD  . MET A 127 ? 0.7864 0.8347 0.6149 0.1319  -0.1165 0.0699  116 MET A SD  
703  C CE  . MET A 127 ? 0.8195 0.8707 0.6094 0.1447  -0.1164 0.0851  116 MET A CE  
704  N N   . PRO A 128 ? 0.8518 0.7726 0.6259 0.1635  -0.1323 0.0801  117 PRO A N   
705  C CA  . PRO A 128 ? 0.8880 0.8013 0.6315 0.1893  -0.1419 0.0828  117 PRO A CA  
706  C C   . PRO A 128 ? 0.8757 0.8233 0.6230 0.1894  -0.1446 0.0814  117 PRO A C   
707  O O   . PRO A 128 ? 0.8401 0.8006 0.5852 0.1689  -0.1334 0.0905  117 PRO A O   
708  C CB  . PRO A 128 ? 0.9482 0.7943 0.6269 0.1830  -0.1349 0.1031  117 PRO A CB  
709  C CG  . PRO A 128 ? 0.9539 0.7648 0.6300 0.1717  -0.1298 0.1025  117 PRO A CG  
710  C CD  . PRO A 128 ? 0.8857 0.7492 0.6222 0.1499  -0.1242 0.0923  117 PRO A CD  
711  N N   . GLY A 129 ? 0.6844 0.6321 0.6745 0.0692  -0.1078 -0.0406 118 GLY A N   
712  C CA  . GLY A 129 ? 0.6735 0.6403 0.6676 0.0443  -0.0936 -0.0194 118 GLY A CA  
713  C C   . GLY A 129 ? 0.6665 0.6790 0.6434 0.0381  -0.0835 -0.0208 118 GLY A C   
714  O O   . GLY A 129 ? 0.6427 0.6751 0.6172 0.0232  -0.0717 -0.0060 118 GLY A O   
715  N N   . ASN A 130 ? 0.6914 0.7192 0.6560 0.0497  -0.0876 -0.0381 119 ASN A N   
716  C CA  . ASN A 130 ? 0.6897 0.7592 0.6393 0.0453  -0.0753 -0.0344 119 ASN A CA  
717  C C   . ASN A 130 ? 0.6913 0.7968 0.6337 0.0581  -0.0698 -0.0304 119 ASN A C   
718  O O   . ASN A 130 ? 0.7093 0.8231 0.6440 0.0837  -0.0760 -0.0420 119 ASN A O   
719  C CB  . ASN A 130 ? 0.7091 0.7870 0.6455 0.0572  -0.0794 -0.0492 119 ASN A CB  
720  C CG  . ASN A 130 ? 0.7076 0.8237 0.6303 0.0515  -0.0633 -0.0390 119 ASN A CG  
721  O OD1 . ASN A 130 ? 0.7113 0.8547 0.6357 0.0425  -0.0512 -0.0271 119 ASN A OD1 
722  N ND2 . ASN A 130 ? 0.7385 0.8577 0.6488 0.0576  -0.0637 -0.0436 119 ASN A ND2 
723  N N   . LEU A 131 ? 0.6656 0.7965 0.6112 0.0419  -0.0594 -0.0169 120 LEU A N   
724  C CA  . LEU A 131 ? 0.7053 0.8793 0.6506 0.0517  -0.0561 -0.0134 120 LEU A CA  
725  C C   . LEU A 131 ? 0.6909 0.9171 0.6345 0.0508  -0.0459 -0.0142 120 LEU A C   
726  O O   . LEU A 131 ? 0.6671 0.9404 0.6161 0.0590  -0.0434 -0.0124 120 LEU A O   
727  C CB  . LEU A 131 ? 0.7378 0.9202 0.6889 0.0356  -0.0531 -0.0018 120 LEU A CB  
728  C CG  . LEU A 131 ? 0.7865 0.9247 0.7399 0.0378  -0.0588 0.0063  120 LEU A CG  
729  C CD1 . LEU A 131 ? 0.7972 0.9523 0.7494 0.0274  -0.0549 0.0182  120 LEU A CD1 
730  C CD2 . LEU A 131 ? 0.8145 0.9311 0.7675 0.0664  -0.0686 0.0045  120 LEU A CD2 
731  N N   . GLY A 132 ? 0.6892 0.9103 0.6273 0.0409  -0.0391 -0.0143 121 GLY A N   
732  C CA  . GLY A 132 ? 0.6858 0.9514 0.6227 0.0389  -0.0256 -0.0092 121 GLY A CA  
733  C C   . GLY A 132 ? 0.6407 0.9044 0.5839 0.0075  -0.0127 0.0023  121 GLY A C   
734  O O   . GLY A 132 ? 0.5803 0.8085 0.5255 -0.0104 -0.0146 0.0035  121 GLY A O   
735  N N   . CYS A 133 ? 0.6576 0.9613 0.6050 0.0026  0.0019  0.0119  122 CYS A N   
736  C CA  . CYS A 133 ? 0.6772 0.9738 0.6308 -0.0248 0.0164  0.0253  122 CYS A CA  
737  C C   . CYS A 133 ? 0.6452 0.9883 0.6262 -0.0477 0.0245  0.0303  122 CYS A C   
738  O O   . CYS A 133 ? 0.6746 1.0731 0.6654 -0.0365 0.0290  0.0325  122 CYS A O   
739  C CB  . CYS A 133 ? 0.7153 1.0202 0.6519 -0.0103 0.0287  0.0368  122 CYS A CB  
740  S SG  . CYS A 133 ? 0.7539 1.0404 0.6948 -0.0392 0.0500  0.0606  122 CYS A SG  
741  N N   . TYR A 134 ? 0.6062 0.9314 0.6015 -0.0785 0.0252  0.0293  123 TYR A N   
742  C CA  . TYR A 134 ? 0.5867 0.9586 0.6122 -0.1019 0.0277  0.0277  123 TYR A CA  
743  C C   . TYR A 134 ? 0.5943 0.9475 0.6368 -0.1382 0.0399  0.0351  123 TYR A C   
744  O O   . TYR A 134 ? 0.5952 0.8906 0.6218 -0.1431 0.0433  0.0389  123 TYR A O   
745  C CB  . TYR A 134 ? 0.5812 0.9560 0.6086 -0.1007 0.0101  0.0114  123 TYR A CB  
746  C CG  . TYR A 134 ? 0.5782 0.9700 0.5928 -0.0646 -0.0002 0.0076  123 TYR A CG  
747  C CD1 . TYR A 134 ? 0.5992 0.9408 0.5895 -0.0431 -0.0079 0.0055  123 TYR A CD1 
748  C CD2 . TYR A 134 ? 0.5632 1.0214 0.5930 -0.0510 -0.0021 0.0062  123 TYR A CD2 
749  C CE1 . TYR A 134 ? 0.6072 0.9538 0.5880 -0.0111 -0.0177 0.0013  123 TYR A CE1 
750  C CE2 . TYR A 134 ? 0.5544 1.0201 0.5704 -0.0138 -0.0115 0.0026  123 TYR A CE2 
751  C CZ  . TYR A 134 ? 0.5849 0.9893 0.5762 0.0046  -0.0191 0.0000  123 TYR A CZ  
752  O OH  . TYR A 134 ? 0.6342 1.0323 0.6135 0.0390  -0.0288 -0.0043 123 TYR A OH  
753  N N   . LYS A 135 ? 0.5992 1.0032 0.6773 -0.1634 0.0458  0.0364  124 LYS A N   
754  C CA  . LYS A 135 ? 0.6207 1.0081 0.7252 -0.2042 0.0562  0.0409  124 LYS A CA  
755  C C   . LYS A 135 ? 0.6488 1.0074 0.7581 -0.2249 0.0394  0.0157  124 LYS A C   
756  O O   . LYS A 135 ? 0.6537 1.0471 0.7648 -0.2164 0.0220  -0.0025 124 LYS A O   
757  C CB  . LYS A 135 ? 0.6127 1.0728 0.7606 -0.2252 0.0687  0.0516  124 LYS A CB  
758  C CG  . LYS A 135 ? 0.6143 1.1156 0.7553 -0.2002 0.0865  0.0759  124 LYS A CG  
759  C CD  . LYS A 135 ? 0.6465 1.2158 0.8370 -0.2292 0.1068  0.0950  124 LYS A CD  
760  C CE  . LYS A 135 ? 0.6328 1.2647 0.8170 -0.1987 0.1256  0.1183  124 LYS A CE  
761  N NZ  . LYS A 135 ? 0.6467 1.3467 0.8833 -0.2301 0.1495  0.1422  124 LYS A NZ  
762  N N   . ASP A 136 ? 0.6909 0.9857 0.7976 -0.2463 0.0448  0.0155  125 ASP A N   
763  C CA  . ASP A 136 ? 0.7319 0.9923 0.8397 -0.2650 0.0313  -0.0098 125 ASP A CA  
764  C C   . ASP A 136 ? 0.8020 1.0543 0.9485 -0.3077 0.0414  -0.0083 125 ASP A C   
765  O O   . ASP A 136 ? 0.8257 1.0309 0.9707 -0.3160 0.0594  0.0127  125 ASP A O   
766  C CB  . ASP A 136 ? 0.7644 0.9486 0.8333 -0.2476 0.0303  -0.0112 125 ASP A CB  
767  C CG  . ASP A 136 ? 0.8322 0.9773 0.8978 -0.2634 0.0184  -0.0391 125 ASP A CG  
768  O OD1 . ASP A 136 ? 0.8759 1.0514 0.9681 -0.2885 0.0078  -0.0610 125 ASP A OD1 
769  O OD2 . ASP A 136 ? 0.8281 0.9168 0.8645 -0.2486 0.0184  -0.0414 125 ASP A OD2 
770  N N   . HIS A 137 ? 0.8945 1.1902 1.0765 -0.3350 0.0290  -0.0310 126 HIS A N   
771  C CA  . HIS A 137 ? 1.0286 1.3218 1.2594 -0.3829 0.0363  -0.0331 126 HIS A CA  
772  C C   . HIS A 137 ? 1.1370 1.3722 1.3678 -0.4053 0.0211  -0.0672 126 HIS A C   
773  O O   . HIS A 137 ? 1.1770 1.4130 1.4531 -0.4483 0.0189  -0.0813 126 HIS A O   
774  C CB  . HIS A 137 ? 1.0492 1.4425 1.3305 -0.4018 0.0334  -0.0354 126 HIS A CB  
775  C CG  . HIS A 137 ? 1.1142 1.5548 1.4049 -0.3891 0.0565  0.0024  126 HIS A CG  
776  N ND1 . HIS A 137 ? 1.1372 1.6701 1.4392 -0.3690 0.0528  0.0047  126 HIS A ND1 
777  C CD2 . HIS A 137 ? 1.1470 1.5567 1.4319 -0.3878 0.0839  0.0394  126 HIS A CD2 
778  C CE1 . HIS A 137 ? 1.1160 1.6741 1.4197 -0.3567 0.0769  0.0389  126 HIS A CE1 
779  N NE2 . HIS A 137 ? 1.1421 1.6282 1.4341 -0.3675 0.0961  0.0612  126 HIS A NE2 
780  N N   . GLY A 138 ? 1.2082 1.3909 1.3900 -0.3764 0.0119  -0.0799 127 GLY A N   
781  C CA  . GLY A 138 ? 1.2423 1.3817 1.4131 -0.3850 -0.0054 -0.1177 127 GLY A CA  
782  C C   . GLY A 138 ? 1.2483 1.4587 1.4272 -0.3849 -0.0313 -0.1518 127 GLY A C   
783  O O   . GLY A 138 ? 1.2135 1.4919 1.3886 -0.3632 -0.0358 -0.1430 127 GLY A O   
784  N N   . ASN A 139 ? 1.3172 1.5127 1.5092 -0.4091 -0.0486 -0.1912 128 ASN A N   
785  C CA  . ASN A 139 ? 1.3402 1.5952 1.5267 -0.4015 -0.0764 -0.2290 128 ASN A CA  
786  C C   . ASN A 139 ? 1.2353 1.5973 1.4578 -0.4075 -0.0865 -0.2291 128 ASN A C   
787  O O   . ASN A 139 ? 1.1853 1.5808 1.4640 -0.4445 -0.0803 -0.2227 128 ASN A O   
788  C CB  . ASN A 139 ? 1.4854 1.7063 1.6866 -0.4319 -0.0949 -0.2768 128 ASN A CB  
789  C CG  . ASN A 139 ? 1.5656 1.6905 1.7207 -0.4139 -0.0913 -0.2876 128 ASN A CG  
790  O OD1 . ASN A 139 ? 1.5246 1.6216 1.6340 -0.3751 -0.0784 -0.2620 128 ASN A OD1 
791  N ND2 . ASN A 139 ? 1.5939 1.6689 1.7628 -0.4413 -0.1037 -0.3277 128 ASN A ND2 
792  N N   . PRO A 140 ? 1.1440 1.5614 1.3355 -0.3700 -0.1007 -0.2339 129 PRO A N   
793  C CA  . PRO A 140 ? 1.0803 1.4626 1.2085 -0.3241 -0.1001 -0.2264 129 PRO A CA  
794  C C   . PRO A 140 ? 1.0372 1.3955 1.1492 -0.3008 -0.0771 -0.1818 129 PRO A C   
795  O O   . PRO A 140 ? 1.0632 1.4674 1.2006 -0.3028 -0.0696 -0.1612 129 PRO A O   
796  C CB  . PRO A 140 ? 1.0621 1.5252 1.1759 -0.2974 -0.1212 -0.2403 129 PRO A CB  
797  C CG  . PRO A 140 ? 1.0841 1.6320 1.2521 -0.3209 -0.1294 -0.2453 129 PRO A CG  
798  C CD  . PRO A 140 ? 1.1226 1.6422 1.3419 -0.3735 -0.1226 -0.2548 129 PRO A CD  
799  N N   . PRO A 141 ? 1.0110 1.3027 1.0829 -0.2780 -0.0665 -0.1684 130 PRO A N   
800  C CA  . PRO A 141 ? 0.9201 1.1925 0.9807 -0.2582 -0.0481 -0.1309 130 PRO A CA  
801  C C   . PRO A 141 ? 0.8362 1.1573 0.8809 -0.2240 -0.0527 -0.1163 130 PRO A C   
802  O O   . PRO A 141 ? 0.7979 1.1674 0.8360 -0.2119 -0.0688 -0.1310 130 PRO A O   
803  C CB  . PRO A 141 ? 0.9556 1.1505 0.9828 -0.2455 -0.0396 -0.1271 130 PRO A CB  
804  C CG  . PRO A 141 ? 0.9953 1.1925 1.0006 -0.2375 -0.0552 -0.1566 130 PRO A CG  
805  C CD  . PRO A 141 ? 1.0528 1.2836 1.0923 -0.2709 -0.0693 -0.1867 130 PRO A CD  
806  N N   . PRO A 142 ? 0.7826 1.0904 0.8207 -0.2067 -0.0394 -0.0880 131 PRO A N   
807  C CA  . PRO A 142 ? 0.7407 1.0921 0.7724 -0.1778 -0.0434 -0.0750 131 PRO A CA  
808  C C   . PRO A 142 ? 0.7245 1.0628 0.7231 -0.1493 -0.0505 -0.0734 131 PRO A C   
809  O O   . PRO A 142 ? 0.7110 1.0934 0.7048 -0.1295 -0.0603 -0.0724 131 PRO A O   
810  C CB  . PRO A 142 ? 0.7229 1.0524 0.7543 -0.1683 -0.0283 -0.0508 131 PRO A CB  
811  C CG  . PRO A 142 ? 0.7574 1.0482 0.8006 -0.1951 -0.0154 -0.0480 131 PRO A CG  
812  C CD  . PRO A 142 ? 0.7906 1.0453 0.8262 -0.2104 -0.0217 -0.0684 131 PRO A CD  
813  N N   . LEU A 143 ? 0.7278 1.0075 0.7052 -0.1456 -0.0439 -0.0698 132 LEU A N   
814  C CA  . LEU A 143 ? 0.7190 0.9862 0.6682 -0.1234 -0.0474 -0.0674 132 LEU A CA  
815  C C   . LEU A 143 ? 0.7454 1.0038 0.6829 -0.1339 -0.0531 -0.0916 132 LEU A C   
816  O O   . LEU A 143 ? 0.7999 1.0165 0.7407 -0.1518 -0.0474 -0.1016 132 LEU A O   
817  C CB  . LEU A 143 ? 0.7013 0.9194 0.6396 -0.1113 -0.0364 -0.0482 132 LEU A CB  
818  C CG  . LEU A 143 ? 0.6709 0.8931 0.6163 -0.0965 -0.0341 -0.0294 132 LEU A CG  
819  C CD1 . LEU A 143 ? 0.6818 0.8575 0.6191 -0.0878 -0.0271 -0.0167 132 LEU A CD1 
820  C CD2 . LEU A 143 ? 0.6499 0.9081 0.5916 -0.0745 -0.0423 -0.0219 132 LEU A CD2 
821  N N   . THR A 144 ? 0.7334 1.0308 0.6549 -0.1193 -0.0647 -0.1015 133 THR A N   
822  C CA  . THR A 144 ? 0.7819 1.0843 0.6896 -0.1254 -0.0746 -0.1315 133 THR A CA  
823  C C   . THR A 144 ? 0.7815 1.0688 0.6527 -0.1000 -0.0706 -0.1269 133 THR A C   
824  O O   . THR A 144 ? 0.8078 1.1129 0.6595 -0.0953 -0.0809 -0.1525 133 THR A O   
825  C CB  . THR A 144 ? 0.8110 1.1829 0.7238 -0.1256 -0.0942 -0.1534 133 THR A CB  
826  O OG1 . THR A 144 ? 0.7960 1.2090 0.6996 -0.0970 -0.0960 -0.1297 133 THR A OG1 
827  C CG2 . THR A 144 ? 0.8440 1.2363 0.7998 -0.1606 -0.1001 -0.1702 133 THR A CG2 
828  N N   . GLY A 145 ? 0.7467 1.0038 0.6102 -0.0847 -0.0562 -0.0972 134 GLY A N   
829  C CA  . GLY A 145 ? 0.7612 1.0019 0.5968 -0.0651 -0.0480 -0.0909 134 GLY A CA  
830  C C   . GLY A 145 ? 0.7597 0.9547 0.5892 -0.0739 -0.0418 -0.1085 134 GLY A C   
831  O O   . GLY A 145 ? 0.8095 0.9967 0.6386 -0.0883 -0.0503 -0.1398 134 GLY A O   
832  N N   . THR A 146 ? 0.7360 0.9002 0.5631 -0.0645 -0.0275 -0.0885 135 THR A N   
833  C CA  . THR A 146 ? 0.7524 0.8806 0.5677 -0.0616 -0.0203 -0.1008 135 THR A CA  
834  C C   . THR A 146 ? 0.7714 0.8573 0.6084 -0.0714 -0.0104 -0.0842 135 THR A C   
835  O O   . THR A 146 ? 0.7973 0.8890 0.6512 -0.0723 -0.0078 -0.0606 135 THR A O   
836  C CB  . THR A 146 ? 0.7311 0.8804 0.5206 -0.0334 -0.0116 -0.0898 135 THR A CB  
837  O OG1 . THR A 146 ? 0.7700 0.8891 0.5473 -0.0259 -0.0040 -0.1028 135 THR A OG1 
838  C CG2 . THR A 146 ? 0.6913 0.8468 0.4939 -0.0246 0.0000  -0.0514 135 THR A CG2 
839  N N   . SER A 147 ? 0.8074 0.8502 0.6430 -0.0771 -0.0063 -0.0978 136 SER A N   
840  C CA  . SER A 147 ? 0.7874 0.7931 0.6399 -0.0837 0.0017  -0.0823 136 SER A CA  
841  C C   . SER A 147 ? 0.7660 0.7402 0.6097 -0.0677 0.0121  -0.0790 136 SER A C   
842  O O   . SER A 147 ? 0.7754 0.7481 0.5991 -0.0523 0.0144  -0.0929 136 SER A O   
843  C CB  . SER A 147 ? 0.8537 0.8332 0.7200 -0.1089 -0.0017 -0.0947 136 SER A CB  
844  O OG  . SER A 147 ? 0.9572 0.9081 0.8120 -0.1147 -0.0054 -0.1243 136 SER A OG  
845  N N   . LYS A 148 ? 0.7295 0.6832 0.5873 -0.0684 0.0177  -0.0613 137 LYS A N   
846  C CA  . LYS A 148 ? 0.7274 0.6513 0.5803 -0.0531 0.0262  -0.0575 137 LYS A CA  
847  C C   . LYS A 148 ? 0.7197 0.6106 0.5823 -0.0620 0.0285  -0.0479 137 LYS A C   
848  O O   . LYS A 148 ? 0.6796 0.5801 0.5548 -0.0774 0.0251  -0.0399 137 LYS A O   
849  C CB  . LYS A 148 ? 0.7082 0.6614 0.5700 -0.0360 0.0312  -0.0380 137 LYS A CB  
850  C CG  . LYS A 148 ? 0.6800 0.6494 0.5644 -0.0432 0.0274  -0.0186 137 LYS A CG  
851  C CD  . LYS A 148 ? 0.6925 0.6949 0.5928 -0.0334 0.0298  -0.0024 137 LYS A CD  
852  C CE  . LYS A 148 ? 0.7066 0.7080 0.6226 -0.0228 0.0321  0.0071  137 LYS A CE  
853  N NZ  . LYS A 148 ? 0.6914 0.7296 0.6314 -0.0178 0.0351  0.0219  137 LYS A NZ  
854  N N   . THR A 149 ? 0.7478 0.6033 0.6023 -0.0478 0.0353  -0.0467 138 THR A N   
855  C CA  . THR A 149 ? 0.7349 0.5594 0.5929 -0.0467 0.0402  -0.0315 138 THR A CA  
856  C C   . THR A 149 ? 0.7308 0.5693 0.5897 -0.0198 0.0432  -0.0190 138 THR A C   
857  O O   . THR A 149 ? 0.7511 0.6060 0.6057 -0.0051 0.0450  -0.0264 138 THR A O   
858  C CB  . THR A 149 ? 0.7781 0.5428 0.6259 -0.0544 0.0450  -0.0427 138 THR A CB  
859  O OG1 . THR A 149 ? 0.8141 0.5519 0.6648 -0.0553 0.0517  -0.0219 138 THR A OG1 
860  C CG2 . THR A 149 ? 0.8134 0.5429 0.6425 -0.0323 0.0492  -0.0570 138 THR A CG2 
861  N N   . SER A 150 ? 0.7188 0.5620 0.5850 -0.0123 0.0429  -0.0011 139 SER A N   
862  C CA  . SER A 150 ? 0.7153 0.5843 0.5893 0.0118  0.0422  0.0080  139 SER A CA  
863  C C   . SER A 150 ? 0.7298 0.5880 0.6004 0.0273  0.0423  0.0227  139 SER A C   
864  O O   . SER A 150 ? 0.7468 0.6081 0.6187 0.0182  0.0390  0.0317  139 SER A O   
865  C CB  . SER A 150 ? 0.6669 0.5904 0.5653 0.0066  0.0343  0.0119  139 SER A CB  
866  O OG  . SER A 150 ? 0.6277 0.5811 0.5432 0.0242  0.0313  0.0197  139 SER A OG  
867  N N   . ASN A 151 ? 0.7407 0.5949 0.6063 0.0546  0.0458  0.0261  140 ASN A N   
868  C CA  . ASN A 151 ? 0.7640 0.6178 0.6246 0.0751  0.0441  0.0415  140 ASN A CA  
869  C C   . ASN A 151 ? 0.7349 0.6441 0.6164 0.0779  0.0308  0.0454  140 ASN A C   
870  O O   . ASN A 151 ? 0.7606 0.6733 0.6341 0.0919  0.0269  0.0558  140 ASN A O   
871  C CB  . ASN A 151 ? 0.8147 0.6453 0.6612 0.1077  0.0512  0.0449  140 ASN A CB  
872  C CG  . ASN A 151 ? 0.8031 0.6783 0.6665 0.1243  0.0495  0.0372  140 ASN A CG  
873  O OD1 . ASN A 151 ? 0.7867 0.7177 0.6780 0.1142  0.0414  0.0353  140 ASN A OD1 
874  N ND2 . ASN A 151 ? 0.8465 0.6969 0.6948 0.1514  0.0583  0.0337  140 ASN A ND2 
875  N N   . LYS A 152 ? 0.7285 0.6791 0.6364 0.0645  0.0236  0.0372  141 LYS A N   
876  C CA  . LYS A 152 ? 0.7243 0.7184 0.6559 0.0606  0.0086  0.0365  141 LYS A CA  
877  C C   . LYS A 152 ? 0.6846 0.6841 0.6264 0.0340  0.0035  0.0312  141 LYS A C   
878  O O   . LYS A 152 ? 0.6360 0.6683 0.6061 0.0256  -0.0070 0.0269  141 LYS A O   
879  C CB  . LYS A 152 ? 0.7876 0.8284 0.7509 0.0699  0.0037  0.0342  141 LYS A CB  
880  C CG  . LYS A 152 ? 0.8250 0.8877 0.8127 0.0535  0.0091  0.0318  141 LYS A CG  
881  C CD  . LYS A 152 ? 0.9038 0.9867 0.8982 0.0722  0.0202  0.0340  141 LYS A CD  
882  C CE  . LYS A 152 ? 0.9617 1.0771 0.9696 0.0997  0.0150  0.0369  141 LYS A CE  
883  N NZ  . LYS A 152 ? 0.9806 1.1611 1.0403 0.0917  0.0065  0.0380  141 LYS A NZ  
884  N N   . LEU A 153 ? 0.6951 0.6629 0.6171 0.0208  0.0104  0.0316  142 LEU A N   
885  C CA  . LEU A 153 ? 0.6924 0.6682 0.6229 -0.0005 0.0065  0.0266  142 LEU A CA  
886  C C   . LEU A 153 ? 0.6530 0.6510 0.5940 0.0000  -0.0071 0.0248  142 LEU A C   
887  O O   . LEU A 153 ? 0.7021 0.6991 0.6294 0.0127  -0.0099 0.0282  142 LEU A O   
888  C CB  . LEU A 153 ? 0.7303 0.6776 0.6422 -0.0148 0.0148  0.0261  142 LEU A CB  
889  C CG  . LEU A 153 ? 0.7240 0.6864 0.6446 -0.0333 0.0107  0.0205  142 LEU A CG  
890  C CD1 . LEU A 153 ? 0.7126 0.6839 0.6391 -0.0387 0.0129  0.0154  142 LEU A CD1 
891  C CD2 . LEU A 153 ? 0.7243 0.6734 0.6339 -0.0467 0.0155  0.0207  142 LEU A CD2 
892  N N   . THR A 154 ? 0.6065 0.6229 0.5698 -0.0109 -0.0153 0.0195  143 THR A N   
893  C CA  . THR A 154 ? 0.6148 0.6432 0.5858 -0.0117 -0.0292 0.0127  143 THR A CA  
894  C C   . THR A 154 ? 0.5891 0.6136 0.5643 -0.0265 -0.0283 0.0117  143 THR A C   
895  O O   . THR A 154 ? 0.6418 0.6620 0.6179 -0.0355 -0.0192 0.0163  143 THR A O   
896  C CB  . THR A 154 ? 0.6174 0.6698 0.6200 -0.0087 -0.0448 0.0049  143 THR A CB  
897  O OG1 . THR A 154 ? 0.6088 0.6664 0.6399 -0.0241 -0.0433 0.0080  143 THR A OG1 
898  C CG2 . THR A 154 ? 0.6388 0.7061 0.6446 0.0066  -0.0457 0.0066  143 THR A CG2 
899  N N   . ILE A 155 ? 0.5337 0.5621 0.5085 -0.0249 -0.0381 0.0048  144 ILE A N   
900  C CA  . ILE A 155 ? 0.5248 0.5519 0.5079 -0.0340 -0.0404 0.0039  144 ILE A CA  
901  C C   . ILE A 155 ? 0.5026 0.5304 0.5108 -0.0439 -0.0391 0.0105  144 ILE A C   
902  O O   . ILE A 155 ? 0.4924 0.5191 0.4955 -0.0502 -0.0304 0.0183  144 ILE A O   
903  C CB  . ILE A 155 ? 0.5473 0.5775 0.5319 -0.0255 -0.0544 -0.0076 144 ILE A CB  
904  C CG1 . ILE A 155 ? 0.5798 0.6178 0.5373 -0.0137 -0.0514 -0.0095 144 ILE A CG1 
905  C CG2 . ILE A 155 ? 0.5485 0.5742 0.5380 -0.0301 -0.0553 -0.0064 144 ILE A CG2 
906  C CD1 . ILE A 155 ? 0.5959 0.6426 0.5489 0.0022  -0.0658 -0.0246 144 ILE A CD1 
907  N N   . GLN A 156 ? 0.4946 0.5288 0.5309 -0.0451 -0.0475 0.0085  145 GLN A N   
908  C CA  . GLN A 156 ? 0.5061 0.5433 0.5704 -0.0561 -0.0435 0.0199  145 GLN A CA  
909  C C   . GLN A 156 ? 0.5195 0.5658 0.5744 -0.0570 -0.0263 0.0324  145 GLN A C   
910  O O   . GLN A 156 ? 0.5538 0.6032 0.6125 -0.0621 -0.0173 0.0455  145 GLN A O   
911  C CB  . GLN A 156 ? 0.5217 0.5707 0.6272 -0.0616 -0.0543 0.0162  145 GLN A CB  
912  C CG  . GLN A 156 ? 0.5216 0.5771 0.6633 -0.0763 -0.0460 0.0345  145 GLN A CG  
913  C CD  . GLN A 156 ? 0.5162 0.5501 0.6556 -0.0816 -0.0416 0.0473  145 GLN A CD  
914  O OE1 . GLN A 156 ? 0.5145 0.5559 0.6543 -0.0848 -0.0258 0.0684  145 GLN A OE1 
915  N NE2 . GLN A 156 ? 0.5117 0.5218 0.6463 -0.0783 -0.0553 0.0350  145 GLN A NE2 
916  N N   . THR A 157 ? 0.5214 0.5723 0.5631 -0.0487 -0.0218 0.0288  146 THR A N   
917  C CA  . THR A 157 ? 0.5201 0.5753 0.5479 -0.0449 -0.0065 0.0353  146 THR A CA  
918  C C   . THR A 157 ? 0.5617 0.6057 0.5626 -0.0481 0.0003  0.0351  146 THR A C   
919  O O   . THR A 157 ? 0.5780 0.6316 0.5733 -0.0471 0.0104  0.0413  146 THR A O   
920  C CB  . THR A 157 ? 0.5058 0.5546 0.5171 -0.0322 -0.0046 0.0292  146 THR A CB  
921  O OG1 . THR A 157 ? 0.4980 0.5689 0.5368 -0.0269 -0.0109 0.0298  146 THR A OG1 
922  C CG2 . THR A 157 ? 0.5147 0.5556 0.5046 -0.0245 0.0090  0.0295  146 THR A CG2 
923  N N   . CYS A 158 ? 0.5799 0.6100 0.5639 -0.0504 -0.0049 0.0273  147 CYS A N   
924  C CA  . CYS A 158 ? 0.6199 0.6477 0.5843 -0.0555 -0.0010 0.0247  147 CYS A CA  
925  C C   . CYS A 158 ? 0.6038 0.6445 0.5771 -0.0577 -0.0026 0.0338  147 CYS A C   
926  O O   . CYS A 158 ? 0.5884 0.6399 0.5501 -0.0567 0.0033  0.0373  147 CYS A O   
927  C CB  . CYS A 158 ? 0.6406 0.6601 0.5926 -0.0589 -0.0046 0.0173  147 CYS A CB  
928  S SG  . CYS A 158 ? 0.6972 0.7218 0.6322 -0.0688 -0.0008 0.0100  147 CYS A SG  
929  N N   . ILE A 159 ? 0.5875 0.6255 0.5799 -0.0581 -0.0114 0.0372  148 ILE A N   
930  C CA  . ILE A 159 ? 0.5831 0.6237 0.5858 -0.0583 -0.0126 0.0491  148 ILE A CA  
931  C C   . ILE A 159 ? 0.5790 0.6316 0.5906 -0.0588 -0.0012 0.0661  148 ILE A C   
932  O O   . ILE A 159 ? 0.6282 0.6897 0.6297 -0.0549 0.0041  0.0778  148 ILE A O   
933  C CB  . ILE A 159 ? 0.6005 0.6268 0.6272 -0.0587 -0.0249 0.0472  148 ILE A CB  
934  C CG1 . ILE A 159 ? 0.5967 0.6191 0.6072 -0.0520 -0.0337 0.0334  148 ILE A CG1 
935  C CG2 . ILE A 159 ? 0.6202 0.6389 0.6671 -0.0605 -0.0235 0.0654  148 ILE A CG2 
936  C CD1 . ILE A 159 ? 0.6168 0.6243 0.6430 -0.0472 -0.0481 0.0235  148 ILE A CD1 
937  N N   . SER A 160 ? 0.5714 0.6299 0.6023 -0.0611 0.0026  0.0689  149 SER A N   
938  C CA  . SER A 160 ? 0.5875 0.6657 0.6331 -0.0611 0.0161  0.0884  149 SER A CA  
939  C C   . SER A 160 ? 0.6009 0.6959 0.6134 -0.0506 0.0288  0.0896  149 SER A C   
940  O O   . SER A 160 ? 0.6280 0.7409 0.6376 -0.0458 0.0398  0.1083  149 SER A O   
941  C CB  . SER A 160 ? 0.5934 0.6840 0.6694 -0.0643 0.0168  0.0882  149 SER A CB  
942  O OG  . SER A 160 ? 0.6436 0.7623 0.7315 -0.0621 0.0335  0.1080  149 SER A OG  
943  N N   . PHE A 161 ? 0.6206 0.7084 0.6074 -0.0461 0.0271  0.0693  150 PHE A N   
944  C CA  . PHE A 161 ? 0.6213 0.7180 0.5746 -0.0365 0.0345  0.0606  150 PHE A CA  
945  C C   . PHE A 161 ? 0.6353 0.7406 0.5697 -0.0354 0.0314  0.0624  150 PHE A C   
946  O O   . PHE A 161 ? 0.6722 0.8008 0.5896 -0.0246 0.0395  0.0707  150 PHE A O   
947  C CB  . PHE A 161 ? 0.6207 0.6944 0.5564 -0.0370 0.0300  0.0373  150 PHE A CB  
948  C CG  . PHE A 161 ? 0.6515 0.7244 0.5545 -0.0313 0.0323  0.0199  150 PHE A CG  
949  C CD1 . PHE A 161 ? 0.6748 0.7583 0.5627 -0.0160 0.0425  0.0160  150 PHE A CD1 
950  C CD2 . PHE A 161 ? 0.6586 0.7215 0.5479 -0.0410 0.0233  0.0040  150 PHE A CD2 
951  C CE1 . PHE A 161 ? 0.7126 0.7914 0.5688 -0.0096 0.0413  -0.0068 150 PHE A CE1 
952  C CE2 . PHE A 161 ? 0.6847 0.7463 0.5487 -0.0391 0.0218  -0.0175 150 PHE A CE2 
953  C CZ  . PHE A 161 ? 0.7188 0.7849 0.5646 -0.0230 0.0297  -0.0249 150 PHE A CZ  
954  N N   . CYS A 162 ? 0.6185 0.7104 0.5547 -0.0432 0.0197  0.0552  151 CYS A N   
955  C CA  . CYS A 162 ? 0.6097 0.7151 0.5315 -0.0399 0.0145  0.0564  151 CYS A CA  
956  C C   . CYS A 162 ? 0.6256 0.7438 0.5546 -0.0315 0.0208  0.0844  151 CYS A C   
957  O O   . CYS A 162 ? 0.6951 0.8372 0.6017 -0.0197 0.0243  0.0907  151 CYS A O   
958  C CB  . CYS A 162 ? 0.5767 0.6712 0.5039 -0.0474 0.0025  0.0454  151 CYS A CB  
959  S SG  . CYS A 162 ? 0.5888 0.6709 0.5059 -0.0586 0.0000  0.0194  151 CYS A SG  
960  N N   . ARG A 163 ? 0.6078 0.7105 0.5683 -0.0371 0.0222  0.1012  152 ARG A N   
961  C CA  . ARG A 163 ? 0.6043 0.7095 0.5797 -0.0331 0.0299  0.1322  152 ARG A CA  
962  C C   . ARG A 163 ? 0.6285 0.7643 0.5906 -0.0227 0.0475  0.1508  152 ARG A C   
963  O O   . ARG A 163 ? 0.6366 0.7885 0.5808 -0.0095 0.0534  0.1700  152 ARG A O   
964  C CB  . ARG A 163 ? 0.6108 0.6920 0.6296 -0.0464 0.0274  0.1408  152 ARG A CB  
965  C CG  . ARG A 163 ? 0.6584 0.7289 0.7010 -0.0474 0.0343  0.1733  152 ARG A CG  
966  C CD  . ARG A 163 ? 0.6817 0.7347 0.7760 -0.0658 0.0330  0.1802  152 ARG A CD  
967  N NE  . ARG A 163 ? 0.6866 0.7086 0.7940 -0.0719 0.0124  0.1546  152 ARG A NE  
968  C CZ  . ARG A 163 ? 0.6643 0.6853 0.7882 -0.0806 0.0016  0.1311  152 ARG A CZ  
969  N NH1 . ARG A 163 ? 0.6540 0.7014 0.7881 -0.0851 0.0089  0.1298  152 ARG A NH1 
970  N NH2 . ARG A 163 ? 0.6576 0.6541 0.7846 -0.0803 -0.0167 0.1084  152 ARG A NH2 
971  N N   . SER A 164 ? 0.6673 0.8151 0.6340 -0.0241 0.0560  0.1451  153 SER A N   
972  C CA  . SER A 164 ? 0.7102 0.8944 0.6605 -0.0094 0.0746  0.1598  153 SER A CA  
973  C C   . SER A 164 ? 0.7352 0.9422 0.6376 0.0093  0.0744  0.1513  153 SER A C   
974  O O   . SER A 164 ? 0.7826 1.0213 0.6676 0.0259  0.0885  0.1734  153 SER A O   
975  C CB  . SER A 164 ? 0.7159 0.9073 0.6655 -0.0074 0.0787  0.1409  153 SER A CB  
976  O OG  . SER A 164 ? 0.7832 0.9644 0.7775 -0.0221 0.0778  0.1472  153 SER A OG  
977  N N   . GLN A 165 ? 0.7314 0.9252 0.6141 0.0061  0.0581  0.1180  154 GLN A N   
978  C CA  . GLN A 165 ? 0.7284 0.9433 0.5702 0.0191  0.0511  0.0979  154 GLN A CA  
979  C C   . GLN A 165 ? 0.7206 0.9516 0.5509 0.0285  0.0456  0.1137  154 GLN A C   
980  O O   . GLN A 165 ? 0.7372 0.9946 0.5353 0.0407  0.0378  0.0976  154 GLN A O   
981  C CB  . GLN A 165 ? 0.7212 0.9122 0.5605 0.0047  0.0350  0.0600  154 GLN A CB  
982  C CG  . GLN A 165 ? 0.7387 0.9385 0.5466 0.0116  0.0311  0.0277  154 GLN A CG  
983  C CD  . GLN A 165 ? 0.7193 0.9008 0.5285 0.0131  0.0395  0.0166  154 GLN A CD  
984  O OE1 . GLN A 165 ? 0.7038 0.8851 0.5327 0.0157  0.0521  0.0379  154 GLN A OE1 
985  N NE2 . GLN A 165 ? 0.7440 0.9099 0.5354 0.0113  0.0319  -0.0170 154 GLN A NE2 
986  N N   . ARG A 166 ? 0.7175 0.9308 0.5746 0.0234  0.0475  0.1418  155 ARG A N   
987  C CA  . ARG A 166 ? 0.7690 0.9902 0.6177 0.0360  0.0434  0.1613  155 ARG A CA  
988  C C   . ARG A 166 ? 0.6926 0.9095 0.5382 0.0309  0.0230  0.1336  155 ARG A C   
989  O O   . ARG A 166 ? 0.7104 0.9499 0.5382 0.0462  0.0157  0.1374  155 ARG A O   
990  C CB  . ARG A 166 ? 0.9249 1.1911 0.7345 0.0639  0.0525  0.1802  155 ARG A CB  
991  C CG  . ARG A 166 ? 1.0717 1.3670 0.8644 0.0765  0.0724  0.1931  155 ARG A CG  
992  C CD  . ARG A 166 ? 1.1411 1.4282 0.9662 0.0717  0.0959  0.2373  155 ARG A CD  
993  N NE  . ARG A 166 ? 1.2414 1.5291 1.0682 0.0841  0.1060  0.2839  155 ARG A NE  
994  C CZ  . ARG A 166 ? 1.3031 1.5481 1.1640 0.0718  0.1024  0.3039  155 ARG A CZ  
995  N NH1 . ARG A 166 ? 1.2819 1.4842 1.1786 0.0468  0.0879  0.2806  155 ARG A NH1 
996  N NH2 . ARG A 166 ? 1.3721 1.6155 1.2287 0.0878  0.1137  0.3489  155 ARG A NH2 
997  N N   . PHE A 167 ? 0.6387 0.8320 0.5021 0.0114  0.0147  0.1081  156 PHE A N   
998  C CA  . PHE A 167 ? 0.6431 0.8373 0.5095 0.0063  -0.0010 0.0882  156 PHE A CA  
999  C C   . PHE A 167 ? 0.6687 0.8309 0.5627 0.0015  -0.0048 0.0979  156 PHE A C   
1000 O O   . PHE A 167 ? 0.6737 0.8050 0.5907 -0.0083 0.0003  0.1058  156 PHE A O   
1001 C CB  . PHE A 167 ? 0.6207 0.8118 0.4870 -0.0110 -0.0075 0.0541  156 PHE A CB  
1002 C CG  . PHE A 167 ? 0.6198 0.8388 0.4596 -0.0076 -0.0104 0.0328  156 PHE A CG  
1003 C CD1 . PHE A 167 ? 0.6421 0.9017 0.4645 0.0027  -0.0213 0.0238  156 PHE A CD1 
1004 C CD2 . PHE A 167 ? 0.6219 0.8282 0.4542 -0.0123 -0.0040 0.0194  156 PHE A CD2 
1005 C CE1 . PHE A 167 ? 0.6828 0.9704 0.4804 0.0064  -0.0275 -0.0015 156 PHE A CE1 
1006 C CE2 . PHE A 167 ? 0.6581 0.8853 0.4644 -0.0072 -0.0087 -0.0054 156 PHE A CE2 
1007 C CZ  . PHE A 167 ? 0.6895 0.9575 0.4783 0.0009  -0.0214 -0.0179 156 PHE A CZ  
1008 N N   . LYS A 168 ? 0.6892 0.8621 0.5819 0.0093  -0.0157 0.0931  157 LYS A N   
1009 C CA  . LYS A 168 ? 0.7068 0.8499 0.6201 0.0120  -0.0202 0.1005  157 LYS A CA  
1010 C C   . LYS A 168 ? 0.6407 0.7728 0.5674 -0.0006 -0.0273 0.0775  157 LYS A C   
1011 O O   . LYS A 168 ? 0.6341 0.7402 0.5756 0.0028  -0.0316 0.0791  157 LYS A O   
1012 C CB  . LYS A 168 ? 0.8096 0.9640 0.7145 0.0363  -0.0254 0.1161  157 LYS A CB  
1013 C CG  . LYS A 168 ? 0.8845 1.0894 0.7731 0.0479  -0.0357 0.1013  157 LYS A CG  
1014 C CD  . LYS A 168 ? 0.9999 1.2036 0.8900 0.0727  -0.0424 0.1131  157 LYS A CD  
1015 C CE  . LYS A 168 ? 1.0743 1.3395 0.9479 0.0919  -0.0521 0.1068  157 LYS A CE  
1016 N NZ  . LYS A 168 ? 1.1770 1.4365 1.0388 0.1261  -0.0519 0.1366  157 LYS A NZ  
1017 N N   . PHE A 169 ? 0.6134 0.7629 0.5343 -0.0144 -0.0280 0.0565  158 PHE A N   
1018 C CA  . PHE A 169 ? 0.6095 0.7502 0.5412 -0.0266 -0.0309 0.0396  158 PHE A CA  
1019 C C   . PHE A 169 ? 0.6159 0.7425 0.5471 -0.0430 -0.0247 0.0300  158 PHE A C   
1020 O O   . PHE A 169 ? 0.6341 0.7710 0.5530 -0.0476 -0.0212 0.0242  158 PHE A O   
1021 C CB  . PHE A 169 ? 0.6144 0.7923 0.5449 -0.0274 -0.0371 0.0256  158 PHE A CB  
1022 C CG  . PHE A 169 ? 0.6292 0.8298 0.5583 -0.0063 -0.0439 0.0333  158 PHE A CG  
1023 C CD1 . PHE A 169 ? 0.6351 0.8098 0.5713 0.0088  -0.0463 0.0420  158 PHE A CD1 
1024 C CD2 . PHE A 169 ? 0.6315 0.8784 0.5515 0.0011  -0.0492 0.0305  158 PHE A CD2 
1025 C CE1 . PHE A 169 ? 0.6473 0.8354 0.5801 0.0330  -0.0521 0.0504  158 PHE A CE1 
1026 C CE2 . PHE A 169 ? 0.6401 0.9089 0.5570 0.0262  -0.0554 0.0404  158 PHE A CE2 
1027 C CZ  . PHE A 169 ? 0.6496 0.8859 0.5722 0.0431  -0.0559 0.0517  158 PHE A CZ  
1028 N N   . ALA A 170 ? 0.6196 0.7235 0.5616 -0.0483 -0.0245 0.0263  159 ALA A N   
1029 C CA  . ALA A 170 ? 0.6219 0.7114 0.5627 -0.0601 -0.0192 0.0179  159 ALA A CA  
1030 C C   . ALA A 170 ? 0.5985 0.6906 0.5412 -0.0659 -0.0198 0.0094  159 ALA A C   
1031 O O   . ALA A 170 ? 0.5564 0.6540 0.5041 -0.0577 -0.0244 0.0102  159 ALA A O   
1032 C CB  . ALA A 170 ? 0.6607 0.7264 0.6120 -0.0579 -0.0172 0.0252  159 ALA A CB  
1033 N N   . GLY A 171 ? 0.6304 0.7161 0.5683 -0.0787 -0.0139 0.0023  160 GLY A N   
1034 C CA  . GLY A 171 ? 0.6164 0.7044 0.5572 -0.0876 -0.0098 -0.0002 160 GLY A CA  
1035 C C   . GLY A 171 ? 0.6170 0.6726 0.5525 -0.0926 -0.0018 0.0012  160 GLY A C   
1036 O O   . GLY A 171 ? 0.6062 0.6431 0.5356 -0.0976 0.0013  -0.0038 160 GLY A O   
1037 N N   . MET A 172 ? 0.6366 0.6872 0.5714 -0.0873 0.0014  0.0082  161 MET A N   
1038 C CA  . MET A 172 ? 0.6639 0.6848 0.5907 -0.0851 0.0088  0.0141  161 MET A CA  
1039 C C   . MET A 172 ? 0.6485 0.6677 0.5745 -0.0943 0.0196  0.0226  161 MET A C   
1040 O O   . MET A 172 ? 0.6438 0.6905 0.5731 -0.0916 0.0207  0.0277  161 MET A O   
1041 C CB  . MET A 172 ? 0.6737 0.6928 0.5984 -0.0659 0.0025  0.0175  161 MET A CB  
1042 C CG  . MET A 172 ? 0.6815 0.6996 0.6146 -0.0611 -0.0052 0.0134  161 MET A CG  
1043 S SD  . MET A 172 ? 0.6750 0.7068 0.6200 -0.0489 -0.0192 0.0103  161 MET A SD  
1044 C CE  . MET A 172 ? 0.6678 0.7173 0.6156 -0.0534 -0.0212 0.0091  161 MET A CE  
1045 N N   . GLU A 173 ? 0.6488 0.6351 0.5709 -0.1040 0.0288  0.0254  162 GLU A N   
1046 C CA  . GLU A 173 ? 0.6878 0.6658 0.6141 -0.1179 0.0418  0.0373  162 GLU A CA  
1047 C C   . GLU A 173 ? 0.7455 0.6800 0.6575 -0.1085 0.0514  0.0504  162 GLU A C   
1048 O O   . GLU A 173 ? 0.7295 0.6345 0.6325 -0.0997 0.0486  0.0435  162 GLU A O   
1049 C CB  . GLU A 173 ? 0.7093 0.6811 0.6513 -0.1463 0.0436  0.0258  162 GLU A CB  
1050 C CG  . GLU A 173 ? 0.6907 0.7121 0.6505 -0.1588 0.0360  0.0152  162 GLU A CG  
1051 C CD  . GLU A 173 ? 0.7289 0.7526 0.7125 -0.1917 0.0399  0.0076  162 GLU A CD  
1052 O OE1 . GLU A 173 ? 0.7065 0.7073 0.7003 -0.2074 0.0548  0.0231  162 GLU A OE1 
1053 O OE2 . GLU A 173 ? 0.7170 0.7674 0.7100 -0.2014 0.0276  -0.0131 162 GLU A OE2 
1054 N N   . SER A 174 ? 0.7996 0.7334 0.7087 -0.1081 0.0646  0.0717  163 SER A N   
1055 C CA  . SER A 174 ? 0.8207 0.7093 0.7159 -0.1004 0.0779  0.0910  163 SER A CA  
1056 C C   . SER A 174 ? 0.7828 0.6574 0.6572 -0.0693 0.0710  0.0912  163 SER A C   
1057 O O   . SER A 174 ? 0.8060 0.6385 0.6679 -0.0593 0.0792  0.1025  163 SER A O   
1058 C CB  . SER A 174 ? 0.8473 0.6883 0.7545 -0.1268 0.0852  0.0857  163 SER A CB  
1059 O OG  . SER A 174 ? 0.8391 0.7061 0.7727 -0.1577 0.0881  0.0821  163 SER A OG  
1060 N N   . GLY A 175 ? 0.7170 0.6275 0.5907 -0.0540 0.0558  0.0790  164 GLY A N   
1061 C CA  . GLY A 175 ? 0.7273 0.6380 0.5901 -0.0278 0.0470  0.0772  164 GLY A CA  
1062 C C   . GLY A 175 ? 0.7381 0.6331 0.6071 -0.0269 0.0406  0.0625  164 GLY A C   
1063 O O   . GLY A 175 ? 0.7453 0.6587 0.6169 -0.0102 0.0300  0.0568  164 GLY A O   
1064 N N   . TYR A 176 ? 0.7740 0.6395 0.6466 -0.0441 0.0467  0.0550  165 TYR A N   
1065 C CA  . TYR A 176 ? 0.7692 0.6209 0.6421 -0.0381 0.0436  0.0415  165 TYR A CA  
1066 C C   . TYR A 176 ? 0.7621 0.6204 0.6436 -0.0569 0.0398  0.0228  165 TYR A C   
1067 O O   . TYR A 176 ? 0.7877 0.6442 0.6671 -0.0496 0.0380  0.0120  165 TYR A O   
1068 C CB  . TYR A 176 ? 0.8133 0.6133 0.6715 -0.0279 0.0544  0.0476  165 TYR A CB  
1069 C CG  . TYR A 176 ? 0.8619 0.6194 0.7202 -0.0511 0.0646  0.0482  165 TYR A CG  
1070 C CD1 . TYR A 176 ? 0.9039 0.6487 0.7615 -0.0589 0.0754  0.0699  165 TYR A CD1 
1071 C CD2 . TYR A 176 ? 0.8910 0.6238 0.7517 -0.0653 0.0636  0.0269  165 TYR A CD2 
1072 C CE1 . TYR A 176 ? 0.9511 0.6579 0.8177 -0.0856 0.0856  0.0719  165 TYR A CE1 
1073 C CE2 . TYR A 176 ? 0.9308 0.6238 0.7980 -0.0905 0.0701  0.0228  165 TYR A CE2 
1074 C CZ  . TYR A 176 ? 0.9604 0.6397 0.8339 -0.1027 0.0815  0.0464  165 TYR A CZ  
1075 O OH  . TYR A 176 ? 1.0772 0.7172 0.9650 -0.1322 0.0889  0.0443  165 TYR A OH  
1076 N N   . ALA A 177 ? 0.7536 0.6254 0.6438 -0.0783 0.0389  0.0193  166 ALA A N   
1077 C CA  . ALA A 177 ? 0.7486 0.6275 0.6436 -0.0940 0.0344  0.0007  166 ALA A CA  
1078 C C   . ALA A 177 ? 0.7002 0.6257 0.6042 -0.0934 0.0247  -0.0016 166 ALA A C   
1079 O O   . ALA A 177 ? 0.6794 0.6275 0.5897 -0.0904 0.0220  0.0079  166 ALA A O   
1080 C CB  . ALA A 177 ? 0.7989 0.6638 0.7022 -0.1194 0.0389  -0.0030 166 ALA A CB  
1081 N N   . CYS A 178 ? 0.6892 0.6271 0.5910 -0.0935 0.0200  -0.0143 167 CYS A N   
1082 C CA  . CYS A 178 ? 0.6694 0.6441 0.5773 -0.0884 0.0128  -0.0122 167 CYS A CA  
1083 C C   . CYS A 178 ? 0.6607 0.6548 0.5643 -0.0966 0.0081  -0.0263 167 CYS A C   
1084 O O   . CYS A 178 ? 0.6811 0.6628 0.5728 -0.0964 0.0093  -0.0404 167 CYS A O   
1085 C CB  . CYS A 178 ? 0.6776 0.6546 0.5866 -0.0715 0.0139  -0.0051 167 CYS A CB  
1086 S SG  . CYS A 178 ? 0.6744 0.6859 0.5933 -0.0663 0.0091  0.0023  167 CYS A SG  
1087 N N   . PHE A 179 ? 0.6339 0.6603 0.5452 -0.1003 0.0016  -0.0242 168 PHE A N   
1088 C CA  . PHE A 179 ? 0.6445 0.6988 0.5520 -0.1061 -0.0052 -0.0374 168 PHE A CA  
1089 C C   . PHE A 179 ? 0.6293 0.7148 0.5365 -0.0921 -0.0099 -0.0259 168 PHE A C   
1090 O O   . PHE A 179 ? 0.6071 0.6958 0.5249 -0.0864 -0.0108 -0.0123 168 PHE A O   
1091 C CB  . PHE A 179 ? 0.6599 0.7293 0.5817 -0.1248 -0.0083 -0.0441 168 PHE A CB  
1092 C CG  . PHE A 179 ? 0.6828 0.7184 0.6095 -0.1430 -0.0024 -0.0524 168 PHE A CG  
1093 C CD1 . PHE A 179 ? 0.6647 0.6707 0.5944 -0.1429 0.0073  -0.0375 168 PHE A CD1 
1094 C CD2 . PHE A 179 ? 0.7318 0.7644 0.6600 -0.1593 -0.0075 -0.0752 168 PHE A CD2 
1095 C CE1 . PHE A 179 ? 0.6866 0.6559 0.6201 -0.1580 0.0148  -0.0397 168 PHE A CE1 
1096 C CE2 . PHE A 179 ? 0.7533 0.7463 0.6897 -0.1783 -0.0018 -0.0819 168 PHE A CE2 
1097 C CZ  . PHE A 179 ? 0.7446 0.7033 0.6833 -0.1770 0.0108  -0.0613 168 PHE A CZ  
1098 N N   . CYS A 180 ? 0.6270 0.7343 0.5204 -0.0846 -0.0132 -0.0318 169 CYS A N   
1099 C CA  . CYS A 180 ? 0.5963 0.7296 0.4869 -0.0691 -0.0154 -0.0160 169 CYS A CA  
1100 C C   . CYS A 180 ? 0.6153 0.7884 0.5007 -0.0687 -0.0256 -0.0263 169 CYS A C   
1101 O O   . CYS A 180 ? 0.6419 0.8251 0.5252 -0.0818 -0.0316 -0.0500 169 CYS A O   
1102 C CB  . CYS A 180 ? 0.5970 0.7310 0.4735 -0.0546 -0.0080 -0.0066 169 CYS A CB  
1103 S SG  . CYS A 180 ? 0.6055 0.7042 0.4919 -0.0545 0.0031  0.0015  169 CYS A SG  
1104 N N   . GLY A 181 ? 0.6022 0.7973 0.4881 -0.0537 -0.0286 -0.0095 170 GLY A N   
1105 C CA  . GLY A 181 ? 0.6126 0.8544 0.4909 -0.0460 -0.0392 -0.0163 170 GLY A CA  
1106 C C   . GLY A 181 ? 0.5937 0.8516 0.4731 -0.0256 -0.0416 0.0058  170 GLY A C   
1107 O O   . GLY A 181 ? 0.5633 0.7930 0.4565 -0.0234 -0.0375 0.0205  170 GLY A O   
1108 N N   . ASN A 182 ? 0.6047 0.9070 0.4681 -0.0088 -0.0495 0.0061  171 ASN A N   
1109 C CA  . ASN A 182 ? 0.6181 0.9389 0.4794 0.0157  -0.0530 0.0276  171 ASN A CA  
1110 C C   . ASN A 182 ? 0.6402 1.0068 0.5140 0.0183  -0.0657 0.0150  171 ASN A C   
1111 O O   . ASN A 182 ? 0.6785 1.0678 0.5469 0.0444  -0.0703 0.0306  171 ASN A O   
1112 C CB  . ASN A 182 ? 0.6375 0.9835 0.4698 0.0409  -0.0520 0.0436  171 ASN A CB  
1113 C CG  . ASN A 182 ? 0.6487 0.9587 0.4728 0.0444  -0.0363 0.0665  171 ASN A CG  
1114 O OD1 . ASN A 182 ? 0.6514 0.9163 0.4951 0.0322  -0.0278 0.0755  171 ASN A OD1 
1115 N ND2 . ASN A 182 ? 0.6998 1.0357 0.4954 0.0627  -0.0324 0.0766  171 ASN A ND2 
1116 N N   . ASN A 183 ? 0.6178 0.9956 0.5113 -0.0073 -0.0693 -0.0093 172 ASN A N   
1117 C CA  . ASN A 183 ? 0.6061 1.0416 0.5174 -0.0118 -0.0806 -0.0253 172 ASN A CA  
1118 C C   . ASN A 183 ? 0.5882 1.0169 0.5123 0.0028  -0.0772 -0.0092 172 ASN A C   
1119 O O   . ASN A 183 ? 0.6110 0.9950 0.5437 -0.0067 -0.0680 -0.0044 172 ASN A O   
1120 C CB  . ASN A 183 ? 0.6079 1.0446 0.5437 -0.0480 -0.0800 -0.0488 172 ASN A CB  
1121 C CG  . ASN A 183 ? 0.6571 1.0638 0.5819 -0.0671 -0.0784 -0.0656 172 ASN A CG  
1122 O OD1 . ASN A 183 ? 0.7385 1.1592 0.6790 -0.0929 -0.0839 -0.0900 172 ASN A OD1 
1123 N ND2 . ASN A 183 ? 0.6797 1.0446 0.5809 -0.0552 -0.0703 -0.0531 172 ASN A ND2 
1124 N N   . PRO A 184 ? 0.5750 1.0468 0.4980 0.0298  -0.0852 -0.0016 173 PRO A N   
1125 C CA  . PRO A 184 ? 0.5598 1.0202 0.4954 0.0432  -0.0816 0.0078  173 PRO A CA  
1126 C C   . PRO A 184 ? 0.5469 1.0531 0.5115 0.0252  -0.0821 -0.0087 173 PRO A C   
1127 O O   . PRO A 184 ? 0.5407 1.0390 0.5145 0.0343  -0.0768 -0.0040 173 PRO A O   
1128 C CB  . PRO A 184 ? 0.5875 1.0689 0.5088 0.0838  -0.0884 0.0249  173 PRO A CB  
1129 C CG  . PRO A 184 ? 0.5991 1.1228 0.5028 0.0899  -0.0969 0.0226  173 PRO A CG  
1130 C CD  . PRO A 184 ? 0.5879 1.1185 0.4972 0.0535  -0.0976 -0.0012 173 PRO A CD  
1131 N N   . ASP A 185 ? 0.5484 1.1005 0.5282 -0.0009 -0.0876 -0.0283 174 ASP A N   
1132 C CA  . ASP A 185 ? 0.5528 1.1512 0.5675 -0.0241 -0.0856 -0.0406 174 ASP A CA  
1133 C C   . ASP A 185 ? 0.5848 1.1396 0.6112 -0.0613 -0.0736 -0.0462 174 ASP A C   
1134 O O   . ASP A 185 ? 0.6058 1.1943 0.6617 -0.0921 -0.0729 -0.0592 174 ASP A O   
1135 C CB  . ASP A 185 ? 0.5494 1.2322 0.5841 -0.0319 -0.1005 -0.0590 174 ASP A CB  
1136 C CG  . ASP A 185 ? 0.5565 1.2334 0.5856 -0.0572 -0.1093 -0.0802 174 ASP A CG  
1137 O OD1 . ASP A 185 ? 0.5321 1.1391 0.5380 -0.0646 -0.1022 -0.0780 174 ASP A OD1 
1138 O OD2 . ASP A 185 ? 0.5613 1.3107 0.6115 -0.0679 -0.1245 -0.1014 174 ASP A OD2 
1139 N N   . TYR A 186 ? 0.5971 1.0782 0.6031 -0.0582 -0.0643 -0.0353 175 TYR A N   
1140 C CA  . TYR A 186 ? 0.5795 1.0150 0.5919 -0.0829 -0.0512 -0.0343 175 TYR A CA  
1141 C C   . TYR A 186 ? 0.5656 1.0299 0.6013 -0.0897 -0.0412 -0.0291 175 TYR A C   
1142 O O   . TYR A 186 ? 0.5766 1.0274 0.6270 -0.1173 -0.0300 -0.0285 175 TYR A O   
1143 C CB  . TYR A 186 ? 0.5902 0.9571 0.5790 -0.0693 -0.0454 -0.0222 175 TYR A CB  
1144 C CG  . TYR A 186 ? 0.6006 0.9599 0.5805 -0.0373 -0.0471 -0.0102 175 TYR A CG  
1145 C CD1 . TYR A 186 ? 0.6078 0.9731 0.5944 -0.0284 -0.0415 -0.0069 175 TYR A CD1 
1146 C CD2 . TYR A 186 ? 0.6242 0.9651 0.5875 -0.0147 -0.0534 -0.0016 175 TYR A CD2 
1147 C CE1 . TYR A 186 ? 0.6267 0.9784 0.6038 0.0029  -0.0453 -0.0015 175 TYR A CE1 
1148 C CE2 . TYR A 186 ? 0.6351 0.9569 0.5926 0.0131  -0.0556 0.0082  175 TYR A CE2 
1149 C CZ  . TYR A 186 ? 0.6397 0.9653 0.6040 0.0223  -0.0531 0.0052  175 TYR A CZ  
1150 O OH  . TYR A 186 ? 0.6333 0.9344 0.5908 0.0516  -0.0576 0.0093  175 TYR A OH  
1151 N N   . TRP A 187 ? 0.5375 1.0420 0.5756 -0.0619 -0.0438 -0.0231 176 TRP A N   
1152 C CA  . TRP A 187 ? 0.5177 1.0668 0.5772 -0.0617 -0.0337 -0.0178 176 TRP A CA  
1153 C C   . TRP A 187 ? 0.5178 1.1380 0.6174 -0.0914 -0.0323 -0.0249 176 TRP A C   
1154 O O   . TRP A 187 ? 0.5089 1.1763 0.6311 -0.0932 -0.0214 -0.0174 176 TRP A O   
1155 C CB  . TRP A 187 ? 0.5088 1.0807 0.5577 -0.0186 -0.0378 -0.0125 176 TRP A CB  
1156 C CG  . TRP A 187 ? 0.5119 1.1253 0.5600 0.0031  -0.0526 -0.0165 176 TRP A CG  
1157 C CD1 . TRP A 187 ? 0.5199 1.0967 0.5419 0.0288  -0.0625 -0.0123 176 TRP A CD1 
1158 C CD2 . TRP A 187 ? 0.5123 1.2159 0.5883 0.0022  -0.0589 -0.0230 176 TRP A CD2 
1159 N NE1 . TRP A 187 ? 0.5183 1.1537 0.5442 0.0479  -0.0742 -0.0141 176 TRP A NE1 
1160 C CE2 . TRP A 187 ? 0.5104 1.2276 0.5702 0.0323  -0.0738 -0.0230 176 TRP A CE2 
1161 C CE3 . TRP A 187 ? 0.5166 1.2955 0.6335 -0.0219 -0.0529 -0.0274 176 TRP A CE3 
1162 C CZ2 . TRP A 187 ? 0.5153 1.3218 0.5948 0.0427  -0.0852 -0.0296 176 TRP A CZ2 
1163 C CZ3 . TRP A 187 ? 0.5039 1.3746 0.6470 -0.0157 -0.0645 -0.0355 176 TRP A CZ3 
1164 C CH2 . TRP A 187 ? 0.4963 1.3811 0.6189 0.0180  -0.0815 -0.0379 176 TRP A CH2 
1165 N N   . LYS A 188 ? 0.5523 1.1822 0.6622 -0.1150 -0.0432 -0.0402 177 LYS A N   
1166 C CA  . LYS A 188 ? 0.5822 1.2875 0.7347 -0.1420 -0.0485 -0.0530 177 LYS A CA  
1167 C C   . LYS A 188 ? 0.5960 1.3195 0.7873 -0.1772 -0.0307 -0.0450 177 LYS A C   
1168 O O   . LYS A 188 ? 0.5735 1.3806 0.8052 -0.1852 -0.0286 -0.0442 177 LYS A O   
1169 C CB  . LYS A 188 ? 0.6236 1.3250 0.7759 -0.1626 -0.0658 -0.0770 177 LYS A CB  
1170 C CG  . LYS A 188 ? 0.6591 1.2787 0.7968 -0.1890 -0.0620 -0.0848 177 LYS A CG  
1171 C CD  . LYS A 188 ? 0.7093 1.3287 0.8347 -0.1955 -0.0818 -0.1123 177 LYS A CD  
1172 C CE  . LYS A 188 ? 0.7501 1.4655 0.9088 -0.2048 -0.1014 -0.1350 177 LYS A CE  
1173 N NZ  . LYS A 188 ? 0.7727 1.5051 0.9304 -0.2196 -0.1237 -0.1705 177 LYS A NZ  
1174 N N   . TYR A 189 ? 0.6336 1.2841 0.8148 -0.1966 -0.0167 -0.0364 178 TYR A N   
1175 C CA  . TYR A 189 ? 0.6497 1.3106 0.8672 -0.2314 0.0032  -0.0230 178 TYR A CA  
1176 C C   . TYR A 189 ? 0.5977 1.2682 0.8069 -0.2093 0.0240  0.0038  178 TYR A C   
1177 O O   . TYR A 189 ? 0.5906 1.2588 0.8195 -0.2319 0.0447  0.0223  178 TYR A O   
1178 C CB  . TYR A 189 ? 0.7327 1.3137 0.9469 -0.2643 0.0085  -0.0261 178 TYR A CB  
1179 C CG  . TYR A 189 ? 0.8099 1.3760 1.0309 -0.2879 -0.0114 -0.0571 178 TYR A CG  
1180 C CD1 . TYR A 189 ? 0.8341 1.4754 1.0820 -0.2950 -0.0310 -0.0803 178 TYR A CD1 
1181 C CD2 . TYR A 189 ? 0.8528 1.3335 1.0527 -0.3010 -0.0110 -0.0650 178 TYR A CD2 
1182 C CE1 . TYR A 189 ? 0.8741 1.5040 1.1229 -0.3128 -0.0510 -0.1122 178 TYR A CE1 
1183 C CE2 . TYR A 189 ? 0.8833 1.3494 1.0844 -0.3181 -0.0292 -0.0966 178 TYR A CE2 
1184 C CZ  . TYR A 189 ? 0.9059 1.4468 1.1302 -0.3241 -0.0496 -0.1210 178 TYR A CZ  
1185 O OH  . TYR A 189 ? 1.0555 1.5890 1.2772 -0.3374 -0.0704 -0.1567 178 TYR A OH  
1186 N N   . GLY A 190 ? 0.5594 1.2392 0.7380 -0.1634 0.0187  0.0060  179 GLY A N   
1187 C CA  . GLY A 190 ? 0.5478 1.2583 0.7192 -0.1346 0.0337  0.0236  179 GLY A CA  
1188 C C   . GLY A 190 ? 0.5637 1.1963 0.6888 -0.1113 0.0374  0.0305  179 GLY A C   
1189 O O   . GLY A 190 ? 0.5563 1.1204 0.6684 -0.1300 0.0391  0.0315  179 GLY A O   
1190 N N   . GLU A 191 ? 0.5937 1.2389 0.6950 -0.0689 0.0379  0.0332  180 GLU A N   
1191 C CA  . GLU A 191 ? 0.6190 1.2007 0.6797 -0.0449 0.0392  0.0361  180 GLU A CA  
1192 C C   . GLU A 191 ? 0.6353 1.2192 0.6941 -0.0528 0.0621  0.0569  180 GLU A C   
1193 O O   . GLU A 191 ? 0.6799 1.3268 0.7665 -0.0649 0.0797  0.0722  180 GLU A O   
1194 C CB  . GLU A 191 ? 0.6651 1.2591 0.7026 0.0036  0.0292  0.0269  180 GLU A CB  
1195 C CG  . GLU A 191 ? 0.7360 1.2556 0.7359 0.0253  0.0202  0.0197  180 GLU A CG  
1196 C CD  . GLU A 191 ? 0.8098 1.3324 0.7874 0.0727  0.0104  0.0077  180 GLU A CD  
1197 O OE1 . GLU A 191 ? 0.8487 1.4292 0.8370 0.0938  0.0095  0.0049  180 GLU A OE1 
1198 O OE2 . GLU A 191 ? 0.8605 1.3278 0.8114 0.0891  0.0026  -0.0006 180 GLU A OE2 
1199 N N   . ALA A 192 ? 0.6383 1.1585 0.6654 -0.0447 0.0627  0.0599  181 ALA A N   
1200 C CA  . ALA A 192 ? 0.6812 1.2000 0.6966 -0.0431 0.0834  0.0818  181 ALA A CA  
1201 C C   . ALA A 192 ? 0.6990 1.2043 0.6721 0.0023  0.0778  0.0756  181 ALA A C   
1202 O O   . ALA A 192 ? 0.7090 1.1815 0.6644 0.0234  0.0563  0.0533  181 ALA A O   
1203 C CB  . ALA A 192 ? 0.7141 1.1686 0.7293 -0.0745 0.0885  0.0909  181 ALA A CB  
1204 N N   . ALA A 193 ? 0.7075 1.2354 0.6645 0.0166  0.0968  0.0953  182 ALA A N   
1205 C CA  . ALA A 193 ? 0.7070 1.2212 0.6197 0.0598  0.0899  0.0866  182 ALA A CA  
1206 C C   . ALA A 193 ? 0.7053 1.1419 0.5993 0.0544  0.0748  0.0771  182 ALA A C   
1207 O O   . ALA A 193 ? 0.7123 1.1148 0.6163 0.0241  0.0832  0.0923  182 ALA A O   
1208 C CB  . ALA A 193 ? 0.7373 1.2954 0.6340 0.0755  0.1155  0.1138  182 ALA A CB  
1209 N N   . SER A 194 ? 0.7141 1.1236 0.5844 0.0835  0.0522  0.0511  183 SER A N   
1210 C CA  . SER A 194 ? 0.7195 1.0643 0.5788 0.0787  0.0359  0.0399  183 SER A CA  
1211 C C   . SER A 194 ? 0.7366 1.0640 0.5768 0.0781  0.0473  0.0591  183 SER A C   
1212 O O   . SER A 194 ? 0.7233 1.0027 0.5647 0.0639  0.0402  0.0577  183 SER A O   
1213 C CB  . SER A 194 ? 0.7409 1.0682 0.5818 0.1111  0.0109  0.0091  183 SER A CB  
1214 O OG  . SER A 194 ? 0.7839 1.1439 0.5936 0.1483  0.0130  0.0052  183 SER A OG  
1215 N N   . THR A 195 ? 0.7616 1.1310 0.5832 0.0965  0.0663  0.0791  184 THR A N   
1216 C CA  . THR A 195 ? 0.7891 1.1465 0.5910 0.0982  0.0820  0.1060  184 THR A CA  
1217 C C   . THR A 195 ? 0.8085 1.1349 0.6354 0.0567  0.1003  0.1330  184 THR A C   
1218 O O   . THR A 195 ? 0.8851 1.1857 0.6957 0.0582  0.1113  0.1552  184 THR A O   
1219 C CB  . THR A 195 ? 0.8208 1.2362 0.5965 0.1281  0.1030  0.1282  184 THR A CB  
1220 O OG1 . THR A 195 ? 0.8138 1.2825 0.6161 0.1150  0.1226  0.1429  184 THR A OG1 
1221 C CG2 . THR A 195 ? 0.8575 1.2929 0.5970 0.1755  0.0827  0.0988  184 THR A CG2 
1222 N N   . GLU A 196 ? 0.7667 1.0956 0.6315 0.0223  0.1028  0.1305  185 GLU A N   
1223 C CA  . GLU A 196 ? 0.7549 1.0485 0.6457 -0.0184 0.1151  0.1470  185 GLU A CA  
1224 C C   . GLU A 196 ? 0.7385 0.9726 0.6311 -0.0300 0.0954  0.1258  185 GLU A C   
1225 O O   . GLU A 196 ? 0.7789 0.9700 0.6818 -0.0550 0.1024  0.1352  185 GLU A O   
1226 C CB  . GLU A 196 ? 0.7469 1.0804 0.6789 -0.0492 0.1251  0.1508  185 GLU A CB  
1227 C CG  . GLU A 196 ? 0.7793 1.1806 0.7173 -0.0415 0.1494  0.1770  185 GLU A CG  
1228 C CD  . GLU A 196 ? 0.7818 1.2317 0.7693 -0.0750 0.1579  0.1796  185 GLU A CD  
1229 O OE1 . GLU A 196 ? 0.7772 1.1973 0.7970 -0.1165 0.1581  0.1787  185 GLU A OE1 
1230 O OE2 . GLU A 196 ? 0.8037 1.3255 0.7989 -0.0581 0.1629  0.1796  185 GLU A OE2 
1231 N N   . CYS A 197 ? 0.7166 0.9466 0.5999 -0.0112 0.0717  0.0980  186 CYS A N   
1232 C CA  . CYS A 197 ? 0.7114 0.8926 0.5961 -0.0182 0.0548  0.0809  186 CYS A CA  
1233 C C   . CYS A 197 ? 0.7081 0.8673 0.5661 0.0079  0.0454  0.0779  186 CYS A C   
1234 O O   . CYS A 197 ? 0.6547 0.7935 0.5136 0.0133  0.0271  0.0590  186 CYS A O   
1235 C CB  . CYS A 197 ? 0.7162 0.9048 0.6141 -0.0183 0.0360  0.0562  186 CYS A CB  
1236 S SG  . CYS A 197 ? 0.7103 0.9149 0.6404 -0.0503 0.0377  0.0520  186 CYS A SG  
1237 N N   . ASN A 198 ? 0.7703 0.9364 0.6063 0.0237  0.0589  0.0990  187 ASN A N   
1238 C CA  . ASN A 198 ? 0.8138 0.9702 0.6229 0.0528  0.0481  0.0952  187 ASN A CA  
1239 C C   . ASN A 198 ? 0.8144 0.9266 0.6186 0.0477  0.0533  0.1095  187 ASN A C   
1240 O O   . ASN A 198 ? 0.8421 0.9542 0.6236 0.0745  0.0458  0.1101  187 ASN A O   
1241 C CB  . ASN A 198 ? 0.8763 1.0767 0.6542 0.0869  0.0554  0.1062  187 ASN A CB  
1242 C CG  . ASN A 198 ? 0.8818 1.1179 0.6523 0.1114  0.0362  0.0760  187 ASN A CG  
1243 O OD1 . ASN A 198 ? 0.8512 1.0741 0.6407 0.1034  0.0167  0.0486  187 ASN A OD1 
1244 N ND2 . ASN A 198 ? 0.9241 1.2044 0.6644 0.1444  0.0428  0.0822  187 ASN A ND2 
1245 N N   . SER A 199 ? 0.7988 0.8752 0.6226 0.0174  0.0638  0.1179  188 SER A N   
1246 C CA  . SER A 199 ? 0.8388 0.8698 0.6557 0.0186  0.0667  0.1271  188 SER A CA  
1247 C C   . SER A 199 ? 0.8151 0.8426 0.6330 0.0321  0.0436  0.1028  188 SER A C   
1248 O O   . SER A 199 ? 0.8282 0.8637 0.6645 0.0216  0.0297  0.0805  188 SER A O   
1249 C CB  . SER A 199 ? 0.8531 0.8421 0.6907 -0.0144 0.0776  0.1312  188 SER A CB  
1250 O OG  . SER A 199 ? 0.9112 0.8990 0.7547 -0.0313 0.1000  0.1562  188 SER A OG  
1251 N N   . VAL A 200 ? 0.8310 0.8500 0.6311 0.0561  0.0401  0.1092  189 VAL A N   
1252 C CA  . VAL A 200 ? 0.7893 0.8163 0.5965 0.0690  0.0174  0.0864  189 VAL A CA  
1253 C C   . VAL A 200 ? 0.7371 0.7377 0.5681 0.0484  0.0148  0.0758  189 VAL A C   
1254 O O   . VAL A 200 ? 0.7478 0.7132 0.5791 0.0350  0.0298  0.0878  189 VAL A O   
1255 C CB  . VAL A 200 ? 0.8513 0.8810 0.6368 0.1008  0.0139  0.0962  189 VAL A CB  
1256 C CG1 . VAL A 200 ? 0.8947 0.9691 0.6596 0.1297  0.0006  0.0883  189 VAL A CG1 
1257 C CG2 . VAL A 200 ? 0.9017 0.8948 0.6674 0.1056  0.0381  0.1302  189 VAL A CG2 
1258 N N   . CYS A 201 ? 0.6971 0.7138 0.5477 0.0472  -0.0038 0.0537  190 CYS A N   
1259 C CA  . CYS A 201 ? 0.6871 0.6877 0.5591 0.0332  -0.0055 0.0460  190 CYS A CA  
1260 C C   . CYS A 201 ? 0.6721 0.6624 0.5369 0.0515  -0.0033 0.0540  190 CYS A C   
1261 O O   . CYS A 201 ? 0.6807 0.6927 0.5374 0.0758  -0.0133 0.0541  190 CYS A O   
1262 C CB  . CYS A 201 ? 0.6714 0.6930 0.5705 0.0259  -0.0231 0.0262  190 CYS A CB  
1263 S SG  . CYS A 201 ? 0.6790 0.7080 0.5861 0.0090  -0.0259 0.0174  190 CYS A SG  
1264 N N   . PHE A 202 ? 0.6635 0.6218 0.5288 0.0431  0.0088  0.0594  191 PHE A N   
1265 C CA  . PHE A 202 ? 0.6883 0.6316 0.5448 0.0640  0.0132  0.0676  191 PHE A CA  
1266 C C   . PHE A 202 ? 0.6595 0.6399 0.5360 0.0773  -0.0024 0.0560  191 PHE A C   
1267 O O   . PHE A 202 ? 0.7005 0.6894 0.5693 0.1033  -0.0048 0.0623  191 PHE A O   
1268 C CB  . PHE A 202 ? 0.7079 0.6093 0.5633 0.0536  0.0268  0.0680  191 PHE A CB  
1269 C CG  . PHE A 202 ? 0.7446 0.5971 0.5796 0.0492  0.0438  0.0841  191 PHE A CG  
1270 C CD1 . PHE A 202 ? 0.7418 0.5955 0.5687 0.0399  0.0500  0.0972  191 PHE A CD1 
1271 C CD2 . PHE A 202 ? 0.7782 0.5826 0.6042 0.0541  0.0547  0.0864  191 PHE A CD2 
1272 C CE1 . PHE A 202 ? 0.7848 0.5940 0.6003 0.0315  0.0678  0.1156  191 PHE A CE1 
1273 C CE2 . PHE A 202 ? 0.8151 0.5661 0.6276 0.0465  0.0703  0.1014  191 PHE A CE2 
1274 C CZ  . PHE A 202 ? 0.8140 0.5682 0.6240 0.0329  0.0774  0.1176  191 PHE A CZ  
1275 N N   . GLY A 203 ? 0.6246 0.6274 0.5288 0.0593  -0.0121 0.0410  192 GLY A N   
1276 C CA  . GLY A 203 ? 0.6127 0.6543 0.5476 0.0639  -0.0269 0.0301  192 GLY A CA  
1277 C C   . GLY A 203 ? 0.6009 0.6778 0.5456 0.0721  -0.0480 0.0183  192 GLY A C   
1278 O O   . GLY A 203 ? 0.5728 0.6852 0.5458 0.0776  -0.0626 0.0083  192 GLY A O   
1279 N N   . ASP A 204 ? 0.6390 0.7105 0.5630 0.0733  -0.0505 0.0171  193 ASP A N   
1280 C CA  . ASP A 204 ? 0.6718 0.7754 0.6006 0.0841  -0.0724 0.0003  193 ASP A CA  
1281 C C   . ASP A 204 ? 0.7011 0.8003 0.5924 0.0972  -0.0684 0.0058  193 ASP A C   
1282 O O   . ASP A 204 ? 0.6694 0.7569 0.5567 0.0833  -0.0631 0.0046  193 ASP A O   
1283 C CB  . ASP A 204 ? 0.6738 0.7844 0.6397 0.0609  -0.0854 -0.0178 193 ASP A CB  
1284 C CG  . ASP A 204 ? 0.6984 0.8368 0.6764 0.0696  -0.1117 -0.0422 193 ASP A CG  
1285 O OD1 . ASP A 204 ? 0.7096 0.8645 0.6579 0.0953  -0.1200 -0.0471 193 ASP A OD1 
1286 O OD2 . ASP A 204 ? 0.7252 0.8670 0.7429 0.0503  -0.1237 -0.0561 193 ASP A OD2 
1287 N N   . HIS A 205 ? 0.7668 0.8828 0.6313 0.1271  -0.0713 0.0127  194 HIS A N   
1288 C CA  . HIS A 205 ? 0.8279 0.9457 0.6530 0.1444  -0.0630 0.0248  194 HIS A CA  
1289 C C   . HIS A 205 ? 0.7944 0.9381 0.6154 0.1496  -0.0796 0.0022  194 HIS A C   
1290 O O   . HIS A 205 ? 0.8356 0.9910 0.6220 0.1686  -0.0725 0.0117  194 HIS A O   
1291 C CB  . HIS A 205 ? 0.9341 1.0637 0.7279 0.1798  -0.0601 0.0429  194 HIS A CB  
1292 C CG  . HIS A 205 ? 1.0626 1.1520 0.8502 0.1781  -0.0375 0.0703  194 HIS A CG  
1293 N ND1 . HIS A 205 ? 1.1728 1.2546 0.9273 0.2093  -0.0264 0.0969  194 HIS A ND1 
1294 C CD2 . HIS A 205 ? 1.0621 1.1135 0.8697 0.1514  -0.0242 0.0740  194 HIS A CD2 
1295 C CE1 . HIS A 205 ? 1.1685 1.2034 0.9255 0.2007  -0.0078 0.1143  194 HIS A CE1 
1296 N NE2 . HIS A 205 ? 1.1542 1.1722 0.9424 0.1659  -0.0069 0.0986  194 HIS A NE2 
1297 N N   . THR A 206 ? 0.7221 0.8722 0.5778 0.1334  -0.0994 -0.0256 195 THR A N   
1298 C CA  . THR A 206 ? 0.7148 0.8783 0.5689 0.1377  -0.1158 -0.0506 195 THR A CA  
1299 C C   . THR A 206 ? 0.6933 0.8316 0.5587 0.1132  -0.1047 -0.0486 195 THR A C   
1300 O O   . THR A 206 ? 0.6967 0.8398 0.5616 0.1172  -0.1161 -0.0683 195 THR A O   
1301 C CB  . THR A 206 ? 0.7132 0.8961 0.6011 0.1371  -0.1479 -0.0851 195 THR A CB  
1302 O OG1 . THR A 206 ? 0.7024 0.8636 0.6376 0.1034  -0.1481 -0.0878 195 THR A OG1 
1303 C CG2 . THR A 206 ? 0.7196 0.9375 0.6016 0.1617  -0.1608 -0.0875 195 THR A CG2 
1304 N N   . GLN A 207 ? 0.6882 0.8006 0.5631 0.0904  -0.0840 -0.0272 196 GLN A N   
1305 C CA  . GLN A 207 ? 0.6797 0.7742 0.5663 0.0682  -0.0747 -0.0250 196 GLN A CA  
1306 C C   . GLN A 207 ? 0.6798 0.7654 0.5462 0.0618  -0.0491 0.0000  196 GLN A C   
1307 O O   . GLN A 207 ? 0.7152 0.7873 0.5720 0.0605  -0.0344 0.0192  196 GLN A O   
1308 C CB  . GLN A 207 ? 0.6637 0.7402 0.5856 0.0434  -0.0757 -0.0262 196 GLN A CB  
1309 C CG  . GLN A 207 ? 0.6886 0.7741 0.6420 0.0422  -0.0976 -0.0455 196 GLN A CG  
1310 C CD  . GLN A 207 ? 0.6881 0.7608 0.6775 0.0179  -0.0941 -0.0405 196 GLN A CD  
1311 O OE1 . GLN A 207 ? 0.7657 0.8455 0.7894 0.0107  -0.1087 -0.0521 196 GLN A OE1 
1312 N NE2 . GLN A 207 ? 0.6642 0.7216 0.6475 0.0054  -0.0751 -0.0235 196 GLN A NE2 
1313 N N   . PRO A 208 ? 0.6536 0.7461 0.5164 0.0574  -0.0438 -0.0007 197 PRO A N   
1314 C CA  . PRO A 208 ? 0.6515 0.7392 0.5094 0.0425  -0.0216 0.0197  197 PRO A CA  
1315 C C   . PRO A 208 ? 0.6113 0.6751 0.4911 0.0146  -0.0158 0.0222  197 PRO A C   
1316 O O   . PRO A 208 ? 0.5394 0.6002 0.4375 0.0070  -0.0266 0.0094  197 PRO A O   
1317 C CB  . PRO A 208 ? 0.6631 0.7771 0.5165 0.0496  -0.0222 0.0131  197 PRO A CB  
1318 C CG  . PRO A 208 ? 0.6559 0.7667 0.5235 0.0549  -0.0444 -0.0123 197 PRO A CG  
1319 C CD  . PRO A 208 ? 0.6637 0.7693 0.5306 0.0663  -0.0591 -0.0222 197 PRO A CD  
1320 N N   . CYS A 209 ? 0.6375 0.6837 0.5134 0.0014  0.0014  0.0390  198 CYS A N   
1321 C CA  . CYS A 209 ? 0.6462 0.6720 0.5365 -0.0224 0.0076  0.0390  198 CYS A CA  
1322 C C   . CYS A 209 ? 0.6645 0.6912 0.5564 -0.0412 0.0236  0.0500  198 CYS A C   
1323 O O   . CYS A 209 ? 0.6832 0.6826 0.5774 -0.0569 0.0338  0.0557  198 CYS A O   
1324 C CB  . CYS A 209 ? 0.6519 0.6501 0.5414 -0.0206 0.0089  0.0411  198 CYS A CB  
1325 S SG  . CYS A 209 ? 0.6492 0.6533 0.5585 -0.0181 -0.0072 0.0259  198 CYS A SG  
1326 N N   . GLY A 210 ? 0.6652 0.7249 0.5588 -0.0395 0.0249  0.0509  199 GLY A N   
1327 C CA  . GLY A 210 ? 0.7027 0.7769 0.6076 -0.0599 0.0386  0.0601  199 GLY A CA  
1328 C C   . GLY A 210 ? 0.7495 0.8133 0.6472 -0.0639 0.0583  0.0841  199 GLY A C   
1329 O O   . GLY A 210 ? 0.8253 0.8896 0.7021 -0.0411 0.0615  0.0957  199 GLY A O   
1330 N N   . GLY A 211 ? 0.7608 0.8169 0.6767 -0.0925 0.0710  0.0918  200 GLY A N   
1331 C CA  . GLY A 211 ? 0.8161 0.8602 0.7323 -0.1018 0.0932  0.1198  200 GLY A CA  
1332 C C   . GLY A 211 ? 0.8548 0.8739 0.7983 -0.1396 0.0994  0.1166  200 GLY A C   
1333 O O   . GLY A 211 ? 0.8981 0.9256 0.8560 -0.1529 0.0857  0.0921  200 GLY A O   
1334 N N   . ASP A 212 ? 0.9255 0.9113 0.8762 -0.1566 0.1187  0.1394  201 ASP A N   
1335 C CA  . ASP A 212 ? 0.9574 0.9139 0.9388 -0.1963 0.1209  0.1291  201 ASP A CA  
1336 C C   . ASP A 212 ? 0.8687 0.8891 0.8848 -0.2200 0.1218  0.1251  201 ASP A C   
1337 O O   . ASP A 212 ? 0.8283 0.8932 0.8500 -0.2156 0.1358  0.1479  201 ASP A O   
1338 C CB  . ASP A 212 ? 1.0572 0.9477 1.0426 -0.2122 0.1400  0.1520  201 ASP A CB  
1339 C CG  . ASP A 212 ? 1.1400 1.0487 1.1303 -0.2136 0.1653  0.1932  201 ASP A CG  
1340 O OD1 . ASP A 212 ? 1.1692 1.1269 1.1379 -0.1832 0.1663  0.2045  201 ASP A OD1 
1341 O OD2 . ASP A 212 ? 1.2695 1.1447 1.2850 -0.2439 0.1843  0.2144  201 ASP A OD2 
1342 N N   . GLY A 213 ? 0.8293 0.8611 0.8648 -0.2393 0.1051  0.0943  202 GLY A N   
1343 C CA  . GLY A 213 ? 0.7812 0.8821 0.8488 -0.2565 0.1000  0.0841  202 GLY A CA  
1344 C C   . GLY A 213 ? 0.7023 0.8570 0.7536 -0.2246 0.0885  0.0773  202 GLY A C   
1345 O O   . GLY A 213 ? 0.6934 0.9109 0.7663 -0.2291 0.0863  0.0738  202 GLY A O   
1346 N N   . ARG A 214 ? 0.6822 0.8133 0.6981 -0.1920 0.0810  0.0753  203 ARG A N   
1347 C CA  . ARG A 214 ? 0.6445 0.8167 0.6455 -0.1610 0.0712  0.0706  203 ARG A CA  
1348 C C   . ARG A 214 ? 0.6259 0.7686 0.6063 -0.1435 0.0534  0.0523  203 ARG A C   
1349 O O   . ARG A 214 ? 0.6682 0.7610 0.6342 -0.1414 0.0531  0.0519  203 ARG A O   
1350 C CB  . ARG A 214 ? 0.6616 0.8442 0.6424 -0.1358 0.0837  0.0929  203 ARG A CB  
1351 C CG  . ARG A 214 ? 0.6903 0.9156 0.6917 -0.1491 0.1054  0.1170  203 ARG A CG  
1352 C CD  . ARG A 214 ? 0.6650 0.9617 0.6886 -0.1488 0.1000  0.1067  203 ARG A CD  
1353 N NE  . ARG A 214 ? 0.6753 1.0276 0.7243 -0.1608 0.1217  0.1300  203 ARG A NE  
1354 C CZ  . ARG A 214 ? 0.6949 1.0604 0.7863 -0.2020 0.1334  0.1388  203 ARG A CZ  
1355 N NH1 . ARG A 214 ? 0.7012 1.0238 0.8112 -0.2345 0.1240  0.1225  203 ARG A NH1 
1356 N NH2 . ARG A 214 ? 0.7262 1.1523 0.8437 -0.2107 0.1550  0.1634  203 ARG A NH2 
1357 N N   . ILE A 215 ? 0.6054 0.7789 0.5857 -0.1298 0.0395  0.0390  204 ILE A N   
1358 C CA  . ILE A 215 ? 0.6170 0.7634 0.5841 -0.1186 0.0252  0.0254  204 ILE A CA  
1359 C C   . ILE A 215 ? 0.6021 0.7678 0.5602 -0.0911 0.0150  0.0221  204 ILE A C   
1360 O O   . ILE A 215 ? 0.5888 0.7971 0.5550 -0.0838 0.0128  0.0206  204 ILE A O   
1361 C CB  . ILE A 215 ? 0.6369 0.7834 0.6146 -0.1376 0.0177  0.0097  204 ILE A CB  
1362 C CG1 . ILE A 215 ? 0.6615 0.7821 0.6236 -0.1243 0.0076  0.0015  204 ILE A CG1 
1363 C CG2 . ILE A 215 ? 0.6198 0.8230 0.6159 -0.1428 0.0116  0.0027  204 ILE A CG2 
1364 C CD1 . ILE A 215 ? 0.6905 0.8092 0.6539 -0.1373 0.0015  -0.0137 204 ILE A CD1 
1365 N N   . ILE A 216 ? 0.6160 0.7504 0.5596 -0.0752 0.0087  0.0206  205 ILE A N   
1366 C CA  . ILE A 216 ? 0.6534 0.7942 0.5910 -0.0509 -0.0028 0.0146  205 ILE A CA  
1367 C C   . ILE A 216 ? 0.6307 0.7588 0.5735 -0.0512 -0.0135 0.0077  205 ILE A C   
1368 O O   . ILE A 216 ? 0.6902 0.7940 0.6327 -0.0608 -0.0126 0.0080  205 ILE A O   
1369 C CB  . ILE A 216 ? 0.6895 0.8114 0.6129 -0.0339 -0.0050 0.0157  205 ILE A CB  
1370 C CG1 . ILE A 216 ? 0.7135 0.8442 0.6328 -0.0094 -0.0186 0.0041  205 ILE A CG1 
1371 C CG2 . ILE A 216 ? 0.7186 0.8046 0.6413 -0.0387 -0.0080 0.0150  205 ILE A CG2 
1372 C CD1 . ILE A 216 ? 0.7423 0.8702 0.6452 0.0105  -0.0225 0.0007  205 ILE A CD1 
1373 N N   . LEU A 217 ? 0.5946 0.7408 0.5411 -0.0386 -0.0216 0.0037  206 LEU A N   
1374 C CA  . LEU A 217 ? 0.5757 0.7187 0.5264 -0.0391 -0.0280 0.0035  206 LEU A CA  
1375 C C   . LEU A 217 ? 0.5769 0.6937 0.5289 -0.0233 -0.0375 0.0031  206 LEU A C   
1376 O O   . LEU A 217 ? 0.6095 0.7266 0.5601 -0.0059 -0.0439 -0.0026 206 LEU A O   
1377 C CB  . LEU A 217 ? 0.5905 0.7751 0.5460 -0.0344 -0.0301 0.0024  206 LEU A CB  
1378 C CG  . LEU A 217 ? 0.6168 0.8320 0.5790 -0.0538 -0.0266 -0.0002 206 LEU A CG  
1379 C CD1 . LEU A 217 ? 0.6383 0.8467 0.5949 -0.0549 -0.0317 -0.0004 206 LEU A CD1 
1380 C CD2 . LEU A 217 ? 0.6465 0.8504 0.6120 -0.0771 -0.0166 -0.0011 206 LEU A CD2 
1381 N N   . PHE A 218 ? 0.5542 0.6492 0.5103 -0.0286 -0.0385 0.0089  207 PHE A N   
1382 C CA  . PHE A 218 ? 0.5518 0.6199 0.5174 -0.0190 -0.0465 0.0114  207 PHE A CA  
1383 C C   . PHE A 218 ? 0.5556 0.6210 0.5241 -0.0170 -0.0455 0.0246  207 PHE A C   
1384 O O   . PHE A 218 ? 0.5571 0.6364 0.5190 -0.0256 -0.0386 0.0306  207 PHE A O   
1385 C CB  . PHE A 218 ? 0.5580 0.6032 0.5324 -0.0270 -0.0469 0.0100  207 PHE A CB  
1386 C CG  . PHE A 218 ? 0.5688 0.6120 0.5400 -0.0194 -0.0530 -0.0025 207 PHE A CG  
1387 C CD1 . PHE A 218 ? 0.5791 0.6365 0.5368 -0.0226 -0.0451 -0.0035 207 PHE A CD1 
1388 C CD2 . PHE A 218 ? 0.5782 0.6049 0.5584 -0.0075 -0.0667 -0.0138 207 PHE A CD2 
1389 C CE1 . PHE A 218 ? 0.5744 0.6356 0.5233 -0.0113 -0.0488 -0.0113 207 PHE A CE1 
1390 C CE2 . PHE A 218 ? 0.5806 0.6128 0.5516 0.0041  -0.0737 -0.0283 207 PHE A CE2 
1391 C CZ  . PHE A 218 ? 0.5771 0.6296 0.5305 0.0039  -0.0639 -0.0251 207 PHE A CZ  
1392 N N   . ASP A 219 ? 0.5854 0.6304 0.5621 -0.0038 -0.0526 0.0291  208 ASP A N   
1393 C CA  . ASP A 219 ? 0.6399 0.6727 0.6213 -0.0004 -0.0496 0.0492  208 ASP A CA  
1394 C C   . ASP A 219 ? 0.6058 0.6220 0.6019 -0.0166 -0.0428 0.0599  208 ASP A C   
1395 O O   . ASP A 219 ? 0.5855 0.5819 0.5989 -0.0238 -0.0477 0.0517  208 ASP A O   
1396 C CB  . ASP A 219 ? 0.6992 0.7023 0.6889 0.0176  -0.0586 0.0520  208 ASP A CB  
1397 C CG  . ASP A 219 ? 0.7491 0.7338 0.7437 0.0237  -0.0534 0.0795  208 ASP A CG  
1398 O OD1 . ASP A 219 ? 0.7562 0.7520 0.7494 0.0138  -0.0423 0.0975  208 ASP A OD1 
1399 O OD2 . ASP A 219 ? 0.7941 0.7508 0.7926 0.0413  -0.0597 0.0841  208 ASP A OD2 
1400 N N   . THR A 220 ? 0.5901 0.6208 0.5793 -0.0197 -0.0322 0.0768  209 THR A N   
1401 C CA  . THR A 220 ? 0.6003 0.6265 0.6030 -0.0325 -0.0228 0.0875  209 THR A CA  
1402 C C   . THR A 220 ? 0.6032 0.6007 0.6370 -0.0370 -0.0216 0.1060  209 THR A C   
1403 O O   . THR A 220 ? 0.5885 0.5873 0.6431 -0.0494 -0.0142 0.1148  209 THR A O   
1404 C CB  . THR A 220 ? 0.6194 0.6746 0.6018 -0.0316 -0.0107 0.0970  209 THR A CB  
1405 O OG1 . THR A 220 ? 0.6425 0.7071 0.6135 -0.0178 -0.0066 0.1181  209 THR A OG1 
1406 C CG2 . THR A 220 ? 0.6235 0.7001 0.5835 -0.0338 -0.0134 0.0747  209 THR A CG2 
1407 N N   . LEU A 221 ? 0.6074 0.5785 0.6484 -0.0275 -0.0292 0.1106  210 LEU A N   
1408 C CA  . LEU A 221 ? 0.6374 0.5705 0.7143 -0.0354 -0.0307 0.1241  210 LEU A CA  
1409 C C   . LEU A 221 ? 0.6304 0.5456 0.7361 -0.0489 -0.0439 0.1004  210 LEU A C   
1410 O O   . LEU A 221 ? 0.6736 0.5665 0.8183 -0.0640 -0.0450 0.1085  210 LEU A O   
1411 C CB  . LEU A 221 ? 0.6728 0.5736 0.7474 -0.0180 -0.0361 0.1343  210 LEU A CB  
1412 C CG  . LEU A 221 ? 0.6824 0.5994 0.7358 -0.0039 -0.0217 0.1675  210 LEU A CG  
1413 C CD1 . LEU A 221 ? 0.7209 0.6025 0.7712 0.0177  -0.0283 0.1770  210 LEU A CD1 
1414 C CD2 . LEU A 221 ? 0.6940 0.6172 0.7651 -0.0175 -0.0028 0.2012  210 LEU A CD2 
1415 N N   . VAL A 222 ? 0.6050 0.5330 0.6931 -0.0436 -0.0540 0.0720  211 VAL A N   
1416 C CA  . VAL A 222 ? 0.6034 0.5188 0.7109 -0.0491 -0.0695 0.0467  211 VAL A CA  
1417 C C   . VAL A 222 ? 0.5741 0.5021 0.7112 -0.0684 -0.0658 0.0508  211 VAL A C   
1418 O O   . VAL A 222 ? 0.5534 0.5118 0.6764 -0.0705 -0.0552 0.0546  211 VAL A O   
1419 C CB  . VAL A 222 ? 0.6032 0.5409 0.6805 -0.0378 -0.0753 0.0229  211 VAL A CB  
1420 C CG1 . VAL A 222 ? 0.6244 0.5568 0.7163 -0.0393 -0.0917 -0.0027 211 VAL A CG1 
1421 C CG2 . VAL A 222 ? 0.6206 0.5587 0.6714 -0.0175 -0.0783 0.0173  211 VAL A CG2 
1422 N N   . GLY A 223 ? 0.5826 0.4880 0.7630 -0.0821 -0.0748 0.0494  212 GLY A N   
1423 C CA  . GLY A 223 ? 0.5767 0.5037 0.7929 -0.1004 -0.0740 0.0500  212 GLY A CA  
1424 C C   . GLY A 223 ? 0.5810 0.5254 0.8192 -0.1139 -0.0523 0.0851  212 GLY A C   
1425 O O   . GLY A 223 ? 0.5526 0.5273 0.8180 -0.1258 -0.0480 0.0878  212 GLY A O   
1426 N N   . ALA A 224 ? 0.9020 0.6550 0.5280 -0.1198 -0.0542 0.0561  213 ALA A N   
1427 C CA  . ALA A 224 ? 0.9270 0.6601 0.5556 -0.1266 -0.0393 0.0478  213 ALA A CA  
1428 C C   . ALA A 224 ? 0.9173 0.6756 0.5944 -0.1085 -0.0387 0.0359  213 ALA A C   
1429 O O   . ALA A 224 ? 0.8801 0.6734 0.5808 -0.0988 -0.0527 0.0357  213 ALA A O   
1430 C CB  . ALA A 224 ? 0.9334 0.6634 0.5380 -0.1557 -0.0400 0.0538  213 ALA A CB  
1431 N N   . CYS A 225 ? 0.9540 0.6908 0.6450 -0.1073 -0.0178 0.0239  214 CYS A N   
1432 C CA  . CYS A 225 ? 0.9439 0.7057 0.6864 -0.0963 -0.0121 0.0104  214 CYS A CA  
1433 C C   . CYS A 225 ? 0.9500 0.7079 0.6720 -0.1193 -0.0043 0.0071  214 CYS A C   
1434 O O   . CYS A 225 ? 0.9814 0.7015 0.6764 -0.1396 0.0200  -0.0005 214 CYS A O   
1435 C CB  . CYS A 225 ? 0.9861 0.7301 0.7672 -0.0843 0.0128  -0.0026 214 CYS A CB  
1436 S SG  . CYS A 225 ? 1.0363 0.8214 0.8974 -0.0756 0.0232  -0.0216 214 CYS A SG  
1437 N N   . GLY A 226 ? 0.9537 0.7421 0.6822 -0.1179 -0.0240 0.0134  215 GLY A N   
1438 C CA  . GLY A 226 ? 0.9831 0.7650 0.6943 -0.1360 -0.0245 0.0159  215 GLY A CA  
1439 C C   . GLY A 226 ? 1.0220 0.7902 0.6936 -0.1552 -0.0393 0.0350  215 GLY A C   
1440 O O   . GLY A 226 ? 1.0715 0.8331 0.7226 -0.1609 -0.0444 0.0443  215 GLY A O   
1441 N N   . GLY A 227 ? 1.0523 0.8160 0.7165 -0.1665 -0.0492 0.0428  216 GLY A N   
1442 C CA  . GLY A 227 ? 1.0986 0.8571 0.7419 -0.1839 -0.0726 0.0654  216 GLY A CA  
1443 C C   . GLY A 227 ? 1.1237 0.8778 0.7729 -0.1876 -0.0881 0.0761  216 GLY A C   
1444 O O   . GLY A 227 ? 1.1412 0.8947 0.8056 -0.1773 -0.0771 0.0639  216 GLY A O   
1445 N N   . ASN A 228 ? 1.1429 0.8909 0.7799 -0.2046 -0.1167 0.1009  217 ASN A N   
1446 C CA  . ASN A 228 ? 1.1550 0.9073 0.8169 -0.1992 -0.1400 0.1186  217 ASN A CA  
1447 C C   . ASN A 228 ? 1.0925 0.9020 0.8252 -0.1782 -0.1545 0.1320  217 ASN A C   
1448 O O   . ASN A 228 ? 1.1049 0.9335 0.8399 -0.1874 -0.1598 0.1378  217 ASN A O   
1449 C CB  . ASN A 228 ? 1.2595 0.9570 0.8564 -0.2371 -0.1664 0.1399  217 ASN A CB  
1450 C CG  . ASN A 228 ? 1.3297 0.9622 0.8501 -0.2627 -0.1382 0.1204  217 ASN A CG  
1451 O OD1 . ASN A 228 ? 1.3135 0.9386 0.8432 -0.2512 -0.1158 0.1031  217 ASN A OD1 
1452 N ND2 . ASN A 228 ? 1.4114 0.9935 0.8551 -0.3012 -0.1349 0.1210  217 ASN A ND2 
1453 N N   . TYR A 229 ? 1.0626 0.8957 0.8525 -0.1511 -0.1529 0.1327  218 TYR A N   
1454 C CA  . TYR A 229 ? 1.0468 0.9303 0.9151 -0.1310 -0.1586 0.1438  218 TYR A CA  
1455 C C   . TYR A 229 ? 1.0721 0.9537 0.9880 -0.1192 -0.1823 0.1667  218 TYR A C   
1456 O O   . TYR A 229 ? 1.1152 0.9590 1.0099 -0.1136 -0.1786 0.1626  218 TYR A O   
1457 C CB  . TYR A 229 ? 1.0068 0.9141 0.9024 -0.1064 -0.1227 0.1181  218 TYR A CB  
1458 C CG  . TYR A 229 ? 1.0290 0.9439 0.8933 -0.1150 -0.1090 0.1051  218 TYR A CG  
1459 C CD1 . TYR A 229 ? 1.0412 0.9274 0.8500 -0.1225 -0.0990 0.0889  218 TYR A CD1 
1460 C CD2 . TYR A 229 ? 1.0522 1.0011 0.9472 -0.1165 -0.1052 0.1102  218 TYR A CD2 
1461 C CE1 . TYR A 229 ? 1.0287 0.9153 0.8124 -0.1265 -0.0893 0.0806  218 TYR A CE1 
1462 C CE2 . TYR A 229 ? 1.0356 0.9800 0.8922 -0.1258 -0.0935 0.1004  218 TYR A CE2 
1463 C CZ  . TYR A 229 ? 1.0343 0.9451 0.8346 -0.1288 -0.0879 0.0872  218 TYR A CZ  
1464 O OH  . TYR A 229 ? 1.0498 0.9505 0.8167 -0.1347 -0.0796 0.0815  218 TYR A OH  
1465 N N   . SER A 230 ? 1.0324 0.9538 1.0174 -0.1160 -0.2078 0.1921  219 SER A N   
1466 C CA  . SER A 230 ? 1.0040 0.9329 1.0621 -0.0965 -0.2330 0.2180  219 SER A CA  
1467 C C   . SER A 230 ? 0.9659 0.9585 1.1448 -0.0664 -0.2168 0.2195  219 SER A C   
1468 O O   . SER A 230 ? 0.9364 0.9338 1.1898 -0.0391 -0.2206 0.2320  219 SER A O   
1469 C CB  . SER A 230 ? 1.0382 0.9490 1.0734 -0.1260 -0.2921 0.2562  219 SER A CB  
1470 O OG  . SER A 230 ? 1.0217 0.9530 1.0293 -0.1558 -0.3001 0.2569  219 SER A OG  
1471 N N   . ALA A 231 ? 0.9681 1.0034 1.1661 -0.0716 -0.1932 0.2052  220 ALA A N   
1472 C CA  . ALA A 231 ? 0.9894 1.0861 1.3035 -0.0505 -0.1708 0.2046  220 ALA A CA  
1473 C C   . ALA A 231 ? 1.0015 1.0902 1.3691 -0.0130 -0.1264 0.1854  220 ALA A C   
1474 O O   . ALA A 231 ? 0.9856 1.0234 1.2839 -0.0076 -0.1062 0.1648  220 ALA A O   
1475 C CB  . ALA A 231 ? 0.9848 1.1075 1.2766 -0.0681 -0.1414 0.1845  220 ALA A CB  
1476 N N   . MET A 232 ? 1.0313 1.1694 1.5259 0.0103  -0.1087 0.1911  221 MET A N   
1477 C CA  . MET A 232 ? 1.0642 1.1886 1.6124 0.0441  -0.0540 0.1684  221 MET A CA  
1478 C C   . MET A 232 ? 1.0398 1.1289 1.4946 0.0345  0.0020  0.1247  221 MET A C   
1479 O O   . MET A 232 ? 1.0514 1.0928 1.4729 0.0475  0.0341  0.1030  221 MET A O   
1480 C CB  . MET A 232 ? 1.0901 1.2790 1.8011 0.0684  -0.0297 0.1755  221 MET A CB  
1481 C CG  . MET A 232 ? 1.1294 1.2975 1.9294 0.1113  -0.0022 0.1746  221 MET A CG  
1482 S SD  . MET A 232 ? 1.1489 1.2669 1.9393 0.1277  -0.0710 0.2151  221 MET A SD  
1483 C CE  . MET A 232 ? 1.1309 1.3161 1.9877 0.1083  -0.1596 0.2692  221 MET A CE  
1484 N N   . SER A 233 ? 1.0111 1.1194 1.4210 0.0089  0.0102  0.1142  222 SER A N   
1485 C CA  . SER A 233 ? 0.9969 1.0682 1.3063 -0.0054 0.0474  0.0806  222 SER A CA  
1486 C C   . SER A 233 ? 0.9639 1.0461 1.2097 -0.0350 0.0286  0.0837  222 SER A C   
1487 O O   . SER A 233 ? 0.9392 1.0654 1.2340 -0.0463 0.0101  0.1022  222 SER A O   
1488 C CB  . SER A 233 ? 1.0240 1.0942 1.3729 0.0034  0.1149  0.0527  222 SER A CB  
1489 O OG  . SER A 233 ? 1.0235 1.1127 1.3545 -0.0193 0.1388  0.0418  222 SER A OG  
1490 N N   . SER A 234 ? 0.9919 1.0324 1.1318 -0.0480 0.0320  0.0664  223 SER A N   
1491 C CA  . SER A 234 ? 1.0063 1.0443 1.0813 -0.0725 0.0246  0.0651  223 SER A CA  
1492 C C   . SER A 234 ? 1.0021 0.9919 0.9785 -0.0786 0.0347  0.0439  223 SER A C   
1493 O O   . SER A 234 ? 1.0101 0.9720 0.9671 -0.0686 0.0476  0.0287  223 SER A O   
1494 C CB  . SER A 234 ? 0.9957 1.0448 1.0601 -0.0869 -0.0219 0.0898  223 SER A CB  
1495 O OG  . SER A 234 ? 1.0390 1.0704 1.0989 -0.0785 -0.0493 0.1003  223 SER A OG  
1496 N N   . VAL A 235 ? 0.9663 0.9443 0.8832 -0.0965 0.0280  0.0438  224 VAL A N   
1497 C CA  . VAL A 235 ? 0.9759 0.9116 0.8090 -0.1023 0.0294  0.0295  224 VAL A CA  
1498 C C   . VAL A 235 ? 0.9657 0.8899 0.7641 -0.1034 -0.0050 0.0387  224 VAL A C   
1499 O O   . VAL A 235 ? 0.9715 0.9065 0.7763 -0.1116 -0.0209 0.0533  224 VAL A O   
1500 C CB  . VAL A 235 ? 0.9911 0.9078 0.7757 -0.1208 0.0500  0.0228  224 VAL A CB  
1501 C CG1 . VAL A 235 ? 1.0229 0.8909 0.7183 -0.1270 0.0384  0.0145  224 VAL A CG1 
1502 C CG2 . VAL A 235 ? 1.0104 0.9356 0.8325 -0.1238 0.0968  0.0092  224 VAL A CG2 
1503 N N   . VAL A 236 ? 0.9634 0.8642 0.7269 -0.0979 -0.0138 0.0287  225 VAL A N   
1504 C CA  . VAL A 236 ? 0.9496 0.8404 0.6924 -0.0970 -0.0380 0.0332  225 VAL A CA  
1505 C C   . VAL A 236 ? 0.9769 0.8420 0.6704 -0.0987 -0.0466 0.0269  225 VAL A C   
1506 O O   . VAL A 236 ? 1.0163 0.8692 0.6906 -0.0991 -0.0450 0.0155  225 VAL A O   
1507 C CB  . VAL A 236 ? 0.9206 0.8151 0.6875 -0.0892 -0.0453 0.0299  225 VAL A CB  
1508 C CG1 . VAL A 236 ? 0.9292 0.8143 0.6843 -0.0912 -0.0597 0.0321  225 VAL A CG1 
1509 C CG2 . VAL A 236 ? 0.9120 0.8234 0.7227 -0.0874 -0.0431 0.0406  225 VAL A CG2 
1510 N N   . TYR A 237 ? 0.9462 0.7974 0.6158 -0.1014 -0.0583 0.0359  226 TYR A N   
1511 C CA  . TYR A 237 ? 0.9362 0.7587 0.5618 -0.1014 -0.0738 0.0367  226 TYR A CA  
1512 C C   . TYR A 237 ? 0.8926 0.7181 0.5423 -0.0879 -0.0944 0.0368  226 TYR A C   
1513 O O   . TYR A 237 ? 0.8629 0.7024 0.5479 -0.0837 -0.0886 0.0358  226 TYR A O   
1514 C CB  . TYR A 237 ? 0.9472 0.7437 0.5327 -0.1111 -0.0720 0.0476  226 TYR A CB  
1515 C CG  . TYR A 237 ? 0.9519 0.7432 0.5128 -0.1290 -0.0477 0.0460  226 TYR A CG  
1516 C CD1 . TYR A 237 ? 0.9985 0.7564 0.5018 -0.1417 -0.0409 0.0403  226 TYR A CD1 
1517 C CD2 . TYR A 237 ? 0.9257 0.7408 0.5169 -0.1380 -0.0315 0.0505  226 TYR A CD2 
1518 C CE1 . TYR A 237 ? 1.0227 0.7717 0.5040 -0.1620 -0.0080 0.0351  226 TYR A CE1 
1519 C CE2 . TYR A 237 ? 0.9460 0.7639 0.5310 -0.1556 -0.0049 0.0478  226 TYR A CE2 
1520 C CZ  . TYR A 237 ? 0.9899 0.7748 0.5222 -0.1669 0.0116  0.0383  226 TYR A CZ  
1521 O OH  . TYR A 237 ? 1.0171 0.8058 0.5506 -0.1869 0.0477  0.0322  226 TYR A OH  
1522 N N   . SER A 238 ? 0.8930 0.7026 0.5235 -0.0840 -0.1183 0.0390  227 SER A N   
1523 C CA  . SER A 238 ? 0.8640 0.6822 0.5358 -0.0686 -0.1383 0.0410  227 SER A CA  
1524 C C   . SER A 238 ? 0.8304 0.6393 0.5206 -0.0607 -0.1256 0.0462  227 SER A C   
1525 O O   . SER A 238 ? 0.8413 0.6287 0.4965 -0.0691 -0.1136 0.0529  227 SER A O   
1526 C CB  . SER A 238 ? 0.9079 0.7068 0.5588 -0.0653 -0.1757 0.0511  227 SER A CB  
1527 O OG  . SER A 238 ? 0.9596 0.7138 0.5435 -0.0728 -0.1824 0.0647  227 SER A OG  
1528 N N   . PRO A 239 ? 0.7990 0.6209 0.5431 -0.0483 -0.1240 0.0409  228 PRO A N   
1529 C CA  . PRO A 239 ? 0.8173 0.6143 0.5680 -0.0419 -0.1087 0.0441  228 PRO A CA  
1530 C C   . PRO A 239 ? 0.8655 0.6227 0.5784 -0.0353 -0.1242 0.0601  228 PRO A C   
1531 O O   . PRO A 239 ? 0.9095 0.6633 0.6211 -0.0258 -0.1569 0.0700  228 PRO A O   
1532 C CB  . PRO A 239 ? 0.8147 0.6326 0.6413 -0.0256 -0.1065 0.0346  228 PRO A CB  
1533 C CG  . PRO A 239 ? 0.7782 0.6347 0.6284 -0.0339 -0.1092 0.0228  228 PRO A CG  
1534 C CD  . PRO A 239 ? 0.7828 0.6387 0.5844 -0.0421 -0.1315 0.0299  228 PRO A CD  
1535 N N   . ASP A 240 ? 0.8751 0.5965 0.5494 -0.0448 -0.1041 0.0640  229 ASP A N   
1536 C CA  . ASP A 240 ? 0.9332 0.6034 0.5644 -0.0411 -0.1118 0.0785  229 ASP A CA  
1537 C C   . ASP A 240 ? 0.9695 0.6208 0.5362 -0.0535 -0.1312 0.0905  229 ASP A C   
1538 O O   . ASP A 240 ? 1.0285 0.6286 0.5498 -0.0523 -0.1413 0.1047  229 ASP A O   
1539 C CB  . ASP A 240 ? 0.9680 0.6235 0.6491 -0.0108 -0.1277 0.0851  229 ASP A CB  
1540 C CG  . ASP A 240 ? 0.9507 0.6228 0.7025 0.0009  -0.1006 0.0695  229 ASP A CG  
1541 O OD1 . ASP A 240 ? 0.9771 0.6146 0.7048 -0.0100 -0.0658 0.0622  229 ASP A OD1 
1542 O OD2 . ASP A 240 ? 0.9390 0.6541 0.7660 0.0166  -0.1118 0.0634  229 ASP A OD2 
1543 N N   . PHE A 241 ? 0.9390 0.6223 0.4967 -0.0668 -0.1328 0.0841  230 PHE A N   
1544 C CA  . PHE A 241 ? 0.9703 0.6309 0.4607 -0.0863 -0.1354 0.0893  230 PHE A CA  
1545 C C   . PHE A 241 ? 0.9873 0.6148 0.4307 -0.1051 -0.1138 0.0947  230 PHE A C   
1546 O O   . PHE A 241 ? 0.9501 0.5948 0.4155 -0.1125 -0.0930 0.0895  230 PHE A O   
1547 C CB  . PHE A 241 ? 0.9372 0.6373 0.4383 -0.0988 -0.1208 0.0759  230 PHE A CB  
1548 C CG  . PHE A 241 ? 1.0021 0.6768 0.4395 -0.1181 -0.1196 0.0756  230 PHE A CG  
1549 C CD1 . PHE A 241 ? 1.0550 0.7119 0.4633 -0.1185 -0.1469 0.0773  230 PHE A CD1 
1550 C CD2 . PHE A 241 ? 1.0315 0.6961 0.4348 -0.1404 -0.0904 0.0734  230 PHE A CD2 
1551 C CE1 . PHE A 241 ? 1.1356 0.7524 0.4640 -0.1438 -0.1423 0.0753  230 PHE A CE1 
1552 C CE2 . PHE A 241 ? 1.1034 0.7360 0.4420 -0.1627 -0.0791 0.0692  230 PHE A CE2 
1553 C CZ  . PHE A 241 ? 1.1596 0.7615 0.4512 -0.1659 -0.1037 0.0696  230 PHE A CZ  
1554 N N   . PRO A 242 ? 1.0538 0.6296 0.4261 -0.1180 -0.1198 0.1056  231 PRO A N   
1555 C CA  . PRO A 242 ? 1.1249 0.6664 0.4457 -0.1198 -0.1475 0.1144  231 PRO A CA  
1556 C C   . PRO A 242 ? 1.1953 0.6982 0.5181 -0.0945 -0.1898 0.1336  231 PRO A C   
1557 O O   . PRO A 242 ? 1.2597 0.7299 0.5359 -0.0981 -0.2251 0.1460  231 PRO A O   
1558 C CB  . PRO A 242 ? 1.1802 0.6757 0.4165 -0.1521 -0.1272 0.1172  231 PRO A CB  
1559 C CG  . PRO A 242 ? 1.1802 0.6579 0.4201 -0.1530 -0.1114 0.1221  231 PRO A CG  
1560 C CD  . PRO A 242 ? 1.0901 0.6253 0.4151 -0.1371 -0.1011 0.1116  231 PRO A CD  
1561 N N   . ASP A 243 ? 1.2008 0.7050 0.5794 -0.0698 -0.1877 0.1364  232 ASP A N   
1562 C CA  . ASP A 243 ? 1.2561 0.7411 0.6721 -0.0386 -0.2262 0.1530  232 ASP A CA  
1563 C C   . ASP A 243 ? 1.2513 0.7950 0.7313 -0.0273 -0.2534 0.1476  232 ASP A C   
1564 O O   . ASP A 243 ? 1.1719 0.7678 0.6740 -0.0391 -0.2342 0.1282  232 ASP A O   
1565 C CB  . ASP A 243 ? 1.2376 0.7135 0.7136 -0.0139 -0.2051 0.1509  232 ASP A CB  
1566 C CG  . ASP A 243 ? 1.2934 0.6947 0.6980 -0.0255 -0.1845 0.1592  232 ASP A CG  
1567 O OD1 . ASP A 243 ? 1.3476 0.7117 0.6618 -0.0547 -0.1830 0.1654  232 ASP A OD1 
1568 O OD2 . ASP A 243 ? 1.2949 0.6688 0.7311 -0.0081 -0.1650 0.1578  232 ASP A OD2 
1569 N N   . THR A 244 ? 1.3733 0.9056 0.8842 -0.0053 -0.3015 0.1670  233 THR A N   
1570 C CA  . THR A 244 ? 1.4037 0.9954 0.9935 0.0065  -0.3336 0.1642  233 THR A CA  
1571 C C   . THR A 244 ? 1.3705 1.0230 1.0718 0.0262  -0.2958 0.1422  233 THR A C   
1572 O O   . THR A 244 ? 1.3587 0.9934 1.0955 0.0447  -0.2679 0.1407  233 THR A O   
1573 C CB  . THR A 244 ? 1.4750 1.0433 1.0882 0.0269  -0.4003 0.1950  233 THR A CB  
1574 O OG1 . THR A 244 ? 1.5081 1.0544 1.1848 0.0627  -0.3935 0.2061  233 THR A OG1 
1575 C CG2 . THR A 244 ? 1.5761 1.0652 1.0498 -0.0020 -0.4376 0.2178  233 THR A CG2 
1576 N N   . TYR A 245 ? 1.3770 1.0886 1.1174 0.0167  -0.2882 0.1233  234 TYR A N   
1577 C CA  . TYR A 245 ? 1.3206 1.0813 1.1480 0.0263  -0.2481 0.1005  234 TYR A CA  
1578 C C   . TYR A 245 ? 1.3595 1.1382 1.2990 0.0598  -0.2544 0.1042  234 TYR A C   
1579 O O   . TYR A 245 ? 1.4309 1.2266 1.4222 0.0752  -0.3045 0.1209  234 TYR A O   
1580 C CB  . TYR A 245 ? 1.2619 1.0736 1.1070 0.0095  -0.2447 0.0825  234 TYR A CB  
1581 C CG  . TYR A 245 ? 1.3141 1.1489 1.1750 0.0053  -0.2972 0.0908  234 TYR A CG  
1582 C CD1 . TYR A 245 ? 1.3191 1.2035 1.2896 0.0219  -0.3202 0.0906  234 TYR A CD1 
1583 C CD2 . TYR A 245 ? 1.3784 1.1835 1.1427 -0.0203 -0.3215 0.0973  234 TYR A CD2 
1584 C CE1 . TYR A 245 ? 1.3933 1.3012 1.3767 0.0114  -0.3748 0.0996  234 TYR A CE1 
1585 C CE2 . TYR A 245 ? 1.4533 1.2685 1.2129 -0.0332 -0.3708 0.1043  234 TYR A CE2 
1586 C CZ  . TYR A 245 ? 1.4756 1.3442 1.3443 -0.0182 -0.4024 0.1070  234 TYR A CZ  
1587 O OH  . TYR A 245 ? 1.6135 1.4931 1.4754 -0.0370 -0.4598 0.1163  234 TYR A OH  
1588 N N   . ALA A 246 ? 1.3246 1.0958 1.3019 0.0692  -0.2040 0.0893  235 ALA A N   
1589 C CA  . ALA A 246 ? 1.3021 1.0813 1.3911 0.1024  -0.1938 0.0886  235 ALA A CA  
1590 C C   . ALA A 246 ? 1.2468 1.1019 1.4510 0.1106  -0.2086 0.0791  235 ALA A C   
1591 O O   . ALA A 246 ? 1.2308 1.1253 1.4185 0.0879  -0.2210 0.0704  235 ALA A O   
1592 C CB  . ALA A 246 ? 1.2819 1.0263 1.3703 0.1011  -0.1261 0.0684  235 ALA A CB  
1593 N N   . THR A 247 ? 1.2286 1.1033 1.5558 0.1431  -0.2063 0.0808  236 THR A N   
1594 C CA  . THR A 247 ? 1.1684 1.1219 1.6242 0.1510  -0.2217 0.0731  236 THR A CA  
1595 C C   . THR A 247 ? 1.1174 1.0943 1.6058 0.1342  -0.1512 0.0362  236 THR A C   
1596 O O   . THR A 247 ? 1.1072 1.0346 1.5442 0.1262  -0.0923 0.0202  236 THR A O   
1597 C CB  . THR A 247 ? 1.1856 1.1567 1.7802 0.1950  -0.2470 0.0909  236 THR A CB  
1598 O OG1 . THR A 247 ? 1.1848 1.0964 1.7853 0.2164  -0.1911 0.0841  236 THR A OG1 
1599 C CG2 . THR A 247 ? 1.2420 1.1936 1.7979 0.2038  -0.3330 0.1315  236 THR A CG2 
1600 N N   . GLY A 248 ? 1.0972 1.1431 1.6584 0.1228  -0.1602 0.0237  237 GLY A N   
1601 C CA  . GLY A 248 ? 1.0681 1.1351 1.6616 0.1028  -0.0967 -0.0105 237 GLY A CA  
1602 C C   . GLY A 248 ? 1.0501 1.0609 1.5043 0.0716  -0.0560 -0.0233 237 GLY A C   
1603 O O   . GLY A 248 ? 1.0729 1.0556 1.5202 0.0602  0.0067  -0.0458 237 GLY A O   
1604 N N   . ARG A 249 ? 1.0457 1.0362 1.3895 0.0565  -0.0920 -0.0081 238 ARG A N   
1605 C CA  . ARG A 249 ? 1.0509 1.0033 1.2819 0.0272  -0.0634 -0.0170 238 ARG A CA  
1606 C C   . ARG A 249 ? 1.0055 0.9866 1.2330 0.0012  -0.0513 -0.0345 238 ARG A C   
1607 O O   . ARG A 249 ? 1.0241 1.0475 1.2801 -0.0025 -0.0863 -0.0325 238 ARG A O   
1608 C CB  . ARG A 249 ? 1.0828 1.0081 1.2133 0.0214  -0.1004 0.0036  238 ARG A CB  
1609 C CG  . ARG A 249 ? 1.1405 1.0110 1.2251 0.0325  -0.0936 0.0168  238 ARG A CG  
1610 C CD  . ARG A 249 ? 1.1105 0.9358 1.1285 0.0119  -0.0451 0.0055  238 ARG A CD  
1611 N NE  . ARG A 249 ? 1.1402 0.9121 1.1128 0.0199  -0.0437 0.0189  238 ARG A NE  
1612 C CZ  . ARG A 249 ? 1.1688 0.8879 1.0914 0.0063  -0.0054 0.0127  238 ARG A CZ  
1613 N NH1 . ARG A 249 ? 1.2079 0.9157 1.1093 -0.0184 0.0326  -0.0050 238 ARG A NH1 
1614 N NH2 . ARG A 249 ? 1.2191 0.8876 1.1013 0.0133  -0.0074 0.0255  238 ARG A NH2 
1615 N N   . VAL A 250 ? 0.9716 0.9203 1.1515 -0.0206 -0.0045 -0.0500 239 VAL A N   
1616 C CA  . VAL A 250 ? 0.9411 0.8997 1.0973 -0.0471 0.0066  -0.0631 239 VAL A CA  
1617 C C   . VAL A 250 ? 0.9258 0.8336 0.9750 -0.0666 0.0186  -0.0575 239 VAL A C   
1618 O O   . VAL A 250 ? 0.9581 0.8224 0.9731 -0.0782 0.0536  -0.0632 239 VAL A O   
1619 C CB  . VAL A 250 ? 0.9575 0.9281 1.1804 -0.0596 0.0541  -0.0891 239 VAL A CB  
1620 C CG1 . VAL A 250 ? 0.9397 0.9160 1.1319 -0.0887 0.0591  -0.1003 239 VAL A CG1 
1621 C CG2 . VAL A 250 ? 0.9558 0.9830 1.3148 -0.0348 0.0466  -0.0935 239 VAL A CG2 
1622 N N   . CYS A 251 ? 0.9081 0.8194 0.9062 -0.0722 -0.0100 -0.0463 240 CYS A N   
1623 C CA  . CYS A 251 ? 0.9353 0.8092 0.8523 -0.0870 -0.0056 -0.0369 240 CYS A CA  
1624 C C   . CYS A 251 ? 0.9339 0.8110 0.8261 -0.1015 -0.0108 -0.0384 240 CYS A C   
1625 O O   . CYS A 251 ? 0.8785 0.7842 0.7942 -0.0971 -0.0285 -0.0420 240 CYS A O   
1626 C CB  . CYS A 251 ? 0.9524 0.8198 0.8345 -0.0753 -0.0307 -0.0182 240 CYS A CB  
1627 S SG  . CYS A 251 ? 1.0180 0.8705 0.9247 -0.0551 -0.0289 -0.0130 240 CYS A SG  
1628 N N   . TYR A 252 ? 1.0004 0.8407 0.8408 -0.1208 0.0029  -0.0346 241 TYR A N   
1629 C CA  . TYR A 252 ? 1.0102 0.8397 0.8213 -0.1324 -0.0034 -0.0301 241 TYR A CA  
1630 C C   . TYR A 252 ? 1.0045 0.8165 0.7723 -0.1343 -0.0187 -0.0087 241 TYR A C   
1631 O O   . TYR A 252 ? 1.0004 0.7853 0.7359 -0.1465 -0.0130 -0.0019 241 TYR A O   
1632 C CB  . TYR A 252 ? 1.0594 0.8537 0.8496 -0.1582 0.0225  -0.0409 241 TYR A CB  
1633 C CG  . TYR A 252 ? 1.1021 0.9163 0.9453 -0.1626 0.0462  -0.0650 241 TYR A CG  
1634 C CD1 . TYR A 252 ? 1.1434 0.9622 1.0264 -0.1614 0.0736  -0.0791 241 TYR A CD1 
1635 C CD2 . TYR A 252 ? 1.1176 0.9458 0.9788 -0.1692 0.0445  -0.0750 241 TYR A CD2 
1636 C CE1 . TYR A 252 ? 1.1650 1.0145 1.1208 -0.1642 0.0963  -0.1015 241 TYR A CE1 
1637 C CE2 . TYR A 252 ? 1.1180 0.9728 1.0381 -0.1778 0.0649  -0.0975 241 TYR A CE2 
1638 C CZ  . TYR A 252 ? 1.1517 1.0228 1.1263 -0.1746 0.0898  -0.1102 241 TYR A CZ  
1639 O OH  . TYR A 252 ? 1.2070 1.1146 1.2595 -0.1823 0.1103  -0.1322 241 TYR A OH  
1640 N N   . TRP A 253 ? 0.9936 0.8205 0.7646 -0.1246 -0.0356 0.0004  242 TRP A N   
1641 C CA  . TRP A 253 ? 0.9984 0.8181 0.7506 -0.1268 -0.0496 0.0210  242 TRP A CA  
1642 C C   . TRP A 253 ? 1.0342 0.8394 0.7856 -0.1296 -0.0546 0.0273  242 TRP A C   
1643 O O   . TRP A 253 ? 1.0706 0.8865 0.8428 -0.1182 -0.0504 0.0175  242 TRP A O   
1644 C CB  . TRP A 253 ? 0.9582 0.8068 0.7277 -0.1103 -0.0583 0.0263  242 TRP A CB  
1645 C CG  . TRP A 253 ? 0.9527 0.8085 0.7176 -0.1054 -0.0582 0.0237  242 TRP A CG  
1646 C CD1 . TRP A 253 ? 0.9601 0.8103 0.7066 -0.1109 -0.0616 0.0349  242 TRP A CD1 
1647 C CD2 . TRP A 253 ? 0.9499 0.8168 0.7285 -0.0948 -0.0588 0.0117  242 TRP A CD2 
1648 N NE1 . TRP A 253 ? 0.9498 0.7995 0.6924 -0.1023 -0.0612 0.0304  242 TRP A NE1 
1649 C CE2 . TRP A 253 ? 0.9489 0.8105 0.7142 -0.0910 -0.0630 0.0181  242 TRP A CE2 
1650 C CE3 . TRP A 253 ? 0.9546 0.8342 0.7559 -0.0905 -0.0603 -0.0020 242 TRP A CE3 
1651 C CZ2 . TRP A 253 ? 0.9751 0.8410 0.7509 -0.0795 -0.0722 0.0144  242 TRP A CZ2 
1652 C CZ3 . TRP A 253 ? 0.9648 0.8570 0.7818 -0.0817 -0.0725 -0.0060 242 TRP A CZ3 
1653 C CH2 . TRP A 253 ? 0.9675 0.8516 0.7726 -0.0744 -0.0801 0.0037  242 TRP A CH2 
1654 N N   . THR A 254 ? 1.0299 0.8042 0.7522 -0.1464 -0.0658 0.0450  243 THR A N   
1655 C CA  . THR A 254 ? 1.0454 0.7998 0.7693 -0.1458 -0.0781 0.0584  243 THR A CA  
1656 C C   . THR A 254 ? 1.0097 0.7935 0.7776 -0.1265 -0.0957 0.0773  243 THR A C   
1657 O O   . THR A 254 ? 1.0182 0.8172 0.7903 -0.1318 -0.1111 0.0930  243 THR A O   
1658 C CB  . THR A 254 ? 1.1308 0.8302 0.7974 -0.1759 -0.0900 0.0738  243 THR A CB  
1659 O OG1 . THR A 254 ? 1.1780 0.8440 0.8109 -0.1940 -0.0637 0.0526  243 THR A OG1 
1660 C CG2 . THR A 254 ? 1.1900 0.8664 0.8609 -0.1726 -0.1163 0.0990  243 THR A CG2 
1661 N N   . ILE A 255 ? 0.9920 0.7816 0.7953 -0.1065 -0.0893 0.0741  244 ILE A N   
1662 C CA  . ILE A 255 ? 0.9864 0.8000 0.8464 -0.0861 -0.0975 0.0903  244 ILE A CA  
1663 C C   . ILE A 255 ? 1.0611 0.8384 0.9282 -0.0820 -0.1116 0.1074  244 ILE A C   
1664 O O   . ILE A 255 ? 1.0753 0.8230 0.9312 -0.0770 -0.0945 0.0931  244 ILE A O   
1665 C CB  . ILE A 255 ? 0.9648 0.8023 0.8566 -0.0661 -0.0694 0.0694  244 ILE A CB  
1666 C CG1 . ILE A 255 ? 0.9524 0.8141 0.8234 -0.0728 -0.0611 0.0555  244 ILE A CG1 
1667 C CG2 . ILE A 255 ? 0.9548 0.8144 0.9163 -0.0449 -0.0664 0.0826  244 ILE A CG2 
1668 C CD1 . ILE A 255 ? 0.9425 0.8067 0.8050 -0.0664 -0.0378 0.0308  244 ILE A CD1 
1669 N N   . ARG A 256 ? 1.1142 0.8887 0.9950 -0.0876 -0.1469 0.1399  245 ARG A N   
1670 C CA  . ARG A 256 ? 1.1818 0.9099 1.0562 -0.0891 -0.1744 0.1660  245 ARG A CA  
1671 C C   . ARG A 256 ? 1.1759 0.9420 1.1419 -0.0663 -0.2010 0.1961  245 ARG A C   
1672 O O   . ARG A 256 ? 1.2265 1.0231 1.2068 -0.0800 -0.2310 0.2168  245 ARG A O   
1673 C CB  . ARG A 256 ? 1.2422 0.9192 1.0261 -0.1303 -0.2002 0.1800  245 ARG A CB  
1674 C CG  . ARG A 256 ? 1.3224 0.9342 1.0716 -0.1421 -0.2353 0.2106  245 ARG A CG  
1675 C CD  . ARG A 256 ? 1.3868 0.9224 1.0216 -0.1838 -0.2267 0.2012  245 ARG A CD  
1676 N NE  . ARG A 256 ? 1.4856 0.9570 1.0974 -0.1819 -0.2358 0.2142  245 ARG A NE  
1677 C CZ  . ARG A 256 ? 1.5885 0.9797 1.1030 -0.2171 -0.2264 0.2087  245 ARG A CZ  
1678 N NH1 . ARG A 256 ? 1.6316 0.9982 1.0670 -0.2576 -0.2036 0.1885  245 ARG A NH1 
1679 N NH2 . ARG A 256 ? 1.6357 0.9648 1.1316 -0.2128 -0.2360 0.2230  245 ARG A NH2 
1680 N N   . VAL A 257 ? 1.1425 0.9090 1.1768 -0.0327 -0.1869 0.1967  246 VAL A N   
1681 C CA  . VAL A 257 ? 1.1377 0.9488 1.2879 -0.0041 -0.2038 0.2227  246 VAL A CA  
1682 C C   . VAL A 257 ? 1.2036 0.9673 1.3826 0.0142  -0.2301 0.2514  246 VAL A C   
1683 O O   . VAL A 257 ? 1.2253 0.9680 1.4419 0.0435  -0.1957 0.2374  246 VAL A O   
1684 C CB  . VAL A 257 ? 1.0945 0.9536 1.3200 0.0236  -0.1505 0.1940  246 VAL A CB  
1685 C CG1 . VAL A 257 ? 1.0998 1.0131 1.4638 0.0524  -0.1599 0.2183  246 VAL A CG1 
1686 C CG2 . VAL A 257 ? 1.0464 0.9375 1.2248 0.0026  -0.1284 0.1677  246 VAL A CG2 
1687 N N   . PRO A 258 ? 1.2722 1.0077 1.4232 -0.0061 -0.2922 0.2927  247 PRO A N   
1688 C CA  . PRO A 258 ? 1.3508 1.0270 1.5181 0.0114  -0.3204 0.3227  247 PRO A CA  
1689 C C   . PRO A 258 ? 1.3353 1.0562 1.6596 0.0640  -0.3122 0.3355  247 PRO A C   
1690 O O   . PRO A 258 ? 1.2640 1.0674 1.6936 0.0767  -0.3179 0.3438  247 PRO A O   
1691 C CB  . PRO A 258 ? 1.4268 1.0672 1.5327 -0.0256 -0.3961 0.3688  247 PRO A CB  
1692 C CG  . PRO A 258 ? 1.3971 1.0418 1.3991 -0.0718 -0.3841 0.3451  247 PRO A CG  
1693 C CD  . PRO A 258 ? 1.2921 1.0230 1.3683 -0.0511 -0.3362 0.3115  247 PRO A CD  
1694 N N   . GLY A 259 ? 1.3739 1.0383 1.7124 0.0926  -0.2888 0.3312  248 GLY A N   
1695 C CA  . GLY A 259 ? 1.3818 1.0691 1.8679 0.1461  -0.2706 0.3403  248 GLY A CA  
1696 C C   . GLY A 259 ? 1.3270 1.0349 1.8453 0.1669  -0.1842 0.2876  248 GLY A C   
1697 O O   . GLY A 259 ? 1.3580 1.0705 1.9875 0.2096  -0.1511 0.2854  248 GLY A O   
1698 N N   . ALA A 260 ? 1.2641 0.9789 1.6856 0.1360  -0.1474 0.2459  249 ALA A N   
1699 C CA  . ALA A 260 ? 1.2367 0.9578 1.6622 0.1460  -0.0715 0.1968  249 ALA A CA  
1700 C C   . ALA A 260 ? 1.2985 0.9330 1.6706 0.1532  -0.0387 0.1777  249 ALA A C   
1701 O O   . ALA A 260 ? 1.3167 0.8954 1.5897 0.1284  -0.0616 0.1817  249 ALA A O   
1702 C CB  . ALA A 260 ? 1.1849 0.9311 1.5182 0.1096  -0.0552 0.1651  249 ALA A CB  
1703 N N   . SER A 261 ? 1.3461 0.9647 1.7798 0.1831  0.0200  0.1546  250 SER A N   
1704 C CA  . SER A 261 ? 1.4310 0.9588 1.8126 0.1884  0.0588  0.1328  250 SER A CA  
1705 C C   . SER A 261 ? 1.4336 0.9437 1.6982 0.1510  0.0998  0.0838  250 SER A C   
1706 O O   . SER A 261 ? 1.4700 0.9141 1.6404 0.1293  0.1054  0.0690  250 SER A O   
1707 C CB  . SER A 261 ? 1.4868 0.9949 1.9849 0.2359  0.1092  0.1279  250 SER A CB  
1708 O OG  . SER A 261 ? 1.4630 0.9990 1.9808 0.2352  0.1782  0.0856  250 SER A OG  
1709 N N   . HIS A 262 ? 1.4143 0.9821 1.6870 0.1415  0.1265  0.0602  251 HIS A N   
1710 C CA  . HIS A 262 ? 1.4379 1.0025 1.6018 0.1024  0.1459  0.0230  251 HIS A CA  
1711 C C   . HIS A 262 ? 1.3991 1.0431 1.5747 0.0899  0.1392  0.0199  251 HIS A C   
1712 O O   . HIS A 262 ? 1.3925 1.0910 1.6640 0.1107  0.1292  0.0420  251 HIS A O   
1713 C CB  . HIS A 262 ? 1.5122 1.0074 1.6310 0.0980  0.2098  -0.0178 251 HIS A CB  
1714 C CG  . HIS A 262 ? 1.5764 1.0761 1.7640 0.1198  0.2698  -0.0365 251 HIS A CG  
1715 N ND1 . HIS A 262 ? 1.6160 1.1361 1.7647 0.0973  0.3043  -0.0666 251 HIS A ND1 
1716 C CD2 . HIS A 262 ? 1.6381 1.1201 1.9316 0.1605  0.3057  -0.0304 251 HIS A CD2 
1717 C CE1 . HIS A 262 ? 1.6554 1.1686 1.8764 0.1192  0.3642  -0.0812 251 HIS A CE1 
1718 N NE2 . HIS A 262 ? 1.6893 1.1853 2.0098 0.1604  0.3675  -0.0600 251 HIS A NE2 
1719 N N   . ILE A 263 ? 1.3648 1.0159 1.4497 0.0560  0.1393  -0.0033 252 ILE A N   
1720 C CA  . ILE A 263 ? 1.2957 1.0071 1.3756 0.0421  0.1325  -0.0060 252 ILE A CA  
1721 C C   . ILE A 263 ? 1.3223 1.0150 1.3295 0.0186  0.1689  -0.0424 252 ILE A C   
1722 O O   . ILE A 263 ? 1.3402 0.9975 1.2687 -0.0039 0.1664  -0.0602 252 ILE A O   
1723 C CB  . ILE A 263 ? 1.2312 0.9728 1.2695 0.0219  0.0803  0.0111  252 ILE A CB  
1724 C CG1 . ILE A 263 ? 1.2328 0.9868 1.3228 0.0350  0.0384  0.0496  252 ILE A CG1 
1725 C CG2 . ILE A 263 ? 1.1677 0.9579 1.1939 0.0084  0.0760  0.0076  252 ILE A CG2 
1726 C CD1 . ILE A 263 ? 1.2159 0.9709 1.2458 0.0101  -0.0031 0.0621  252 ILE A CD1 
1727 N N   . HIS A 264 ? 1.3455 1.0626 1.3762 0.0192  0.1981  -0.0515 253 HIS A N   
1728 C CA  . HIS A 264 ? 1.4291 1.1151 1.3815 -0.0067 0.2356  -0.0843 253 HIS A CA  
1729 C C   . HIS A 264 ? 1.3197 1.0415 1.2174 -0.0302 0.1980  -0.0783 253 HIS A C   
1730 O O   . HIS A 264 ? 1.3252 1.0995 1.2688 -0.0227 0.1740  -0.0564 253 HIS A O   
1731 C CB  . HIS A 264 ? 1.5486 1.2312 1.5619 0.0068  0.2975  -0.0976 253 HIS A CB  
1732 C CG  . HIS A 264 ? 1.7150 1.3491 1.6408 -0.0240 0.3479  -0.1329 253 HIS A CG  
1733 N ND1 . HIS A 264 ? 1.7369 1.3925 1.6284 -0.0452 0.3513  -0.1359 253 HIS A ND1 
1734 C CD2 . HIS A 264 ? 1.8615 1.4168 1.7249 -0.0396 0.4029  -0.1666 253 HIS A CD2 
1735 C CE1 . HIS A 264 ? 1.8536 1.4436 1.6561 -0.0751 0.4011  -0.1684 253 HIS A CE1 
1736 N NE2 . HIS A 264 ? 1.9550 1.4830 1.7371 -0.0737 0.4339  -0.1885 253 HIS A NE2 
1737 N N   . PHE A 265 ? 1.2603 0.9509 1.0621 -0.0593 0.1903  -0.0960 254 PHE A N   
1738 C CA  . PHE A 265 ? 1.1893 0.9051 0.9424 -0.0781 0.1541  -0.0894 254 PHE A CA  
1739 C C   . PHE A 265 ? 1.2512 0.9272 0.9225 -0.1058 0.1786  -0.1104 254 PHE A C   
1740 O O   . PHE A 265 ? 1.3443 0.9635 0.9611 -0.1226 0.2071  -0.1339 254 PHE A O   
1741 C CB  . PHE A 265 ? 1.1656 0.8812 0.8839 -0.0896 0.1130  -0.0875 254 PHE A CB  
1742 C CG  . PHE A 265 ? 1.1097 0.8602 0.8834 -0.0726 0.0835  -0.0654 254 PHE A CG  
1743 C CD1 . PHE A 265 ? 1.1377 0.8713 0.9460 -0.0591 0.0905  -0.0612 254 PHE A CD1 
1744 C CD2 . PHE A 265 ? 1.0675 0.8575 0.8504 -0.0727 0.0508  -0.0482 254 PHE A CD2 
1745 C CE1 . PHE A 265 ? 1.1058 0.8589 0.9472 -0.0504 0.0616  -0.0393 254 PHE A CE1 
1746 C CE2 . PHE A 265 ? 1.0266 0.8361 0.8434 -0.0646 0.0278  -0.0299 254 PHE A CE2 
1747 C CZ  . PHE A 265 ? 1.0475 0.8374 0.8890 -0.0556 0.0318  -0.0249 254 PHE A CZ  
1748 N N   . SER A 266 ? 1.2238 0.9180 0.8732 -0.1154 0.1678  -0.1023 255 SER A N   
1749 C CA  . SER A 266 ? 1.3053 0.9491 0.8504 -0.1498 0.1794  -0.1182 255 SER A CA  
1750 C C   . SER A 266 ? 1.2791 0.9455 0.7916 -0.1582 0.1297  -0.0991 255 SER A C   
1751 O O   . SER A 266 ? 1.2162 0.9352 0.7919 -0.1375 0.1042  -0.0783 255 SER A O   
1752 C CB  . SER A 266 ? 1.3487 0.9666 0.8924 -0.1566 0.2435  -0.1341 255 SER A CB  
1753 O OG  . SER A 266 ? 1.2639 0.9409 0.8919 -0.1365 0.2449  -0.1159 255 SER A OG  
1754 N N   . PHE A 267 ? 1.3417 0.9611 0.7518 -0.1899 0.1150  -0.1048 256 PHE A N   
1755 C CA  . PHE A 267 ? 1.3258 0.9578 0.7055 -0.1952 0.0641  -0.0841 256 PHE A CA  
1756 C C   . PHE A 267 ? 1.3977 0.9803 0.6896 -0.2227 0.0793  -0.0853 256 PHE A C   
1757 O O   . PHE A 267 ? 1.5032 1.0262 0.6891 -0.2557 0.0615  -0.0892 256 PHE A O   
1758 C CB  . PHE A 267 ? 1.3500 0.9776 0.6986 -0.2058 0.0107  -0.0800 256 PHE A CB  
1759 C CG  . PHE A 267 ? 1.2836 0.9625 0.7178 -0.1816 -0.0064 -0.0761 256 PHE A CG  
1760 C CD1 . PHE A 267 ? 1.3196 0.9891 0.7742 -0.1799 0.0208  -0.0929 256 PHE A CD1 
1761 C CD2 . PHE A 267 ? 1.2297 0.9571 0.7191 -0.1624 -0.0443 -0.0569 256 PHE A CD2 
1762 C CE1 . PHE A 267 ? 1.2801 0.9872 0.8024 -0.1624 0.0072  -0.0890 256 PHE A CE1 
1763 C CE2 . PHE A 267 ? 1.1817 0.9478 0.7404 -0.1461 -0.0529 -0.0559 256 PHE A CE2 
1764 C CZ  . PHE A 267 ? 1.2057 0.9613 0.7778 -0.1474 -0.0287 -0.0711 256 PHE A CZ  
1765 N N   . PRO A 268 ? 1.3447 0.9485 0.6750 -0.2138 0.1094  -0.0805 257 PRO A N   
1766 C CA  . PRO A 268 ? 1.4099 0.9615 0.6517 -0.2443 0.1290  -0.0829 257 PRO A CA  
1767 C C   . PRO A 268 ? 1.4169 0.9483 0.5925 -0.2544 0.0694  -0.0599 257 PRO A C   
1768 O O   . PRO A 268 ? 1.5035 0.9825 0.5934 -0.2816 0.0783  -0.0575 257 PRO A O   
1769 C CB  . PRO A 268 ? 1.3675 0.9638 0.6915 -0.2300 0.1699  -0.0810 257 PRO A CB  
1770 C CG  . PRO A 268 ? 1.2643 0.9368 0.7038 -0.1920 0.1421  -0.0652 257 PRO A CG  
1771 C CD  . PRO A 268 ? 1.2577 0.9259 0.7059 -0.1828 0.1304  -0.0744 257 PRO A CD  
1772 N N   . LEU A 269 ? 1.3446 0.9144 0.5632 -0.2325 0.0124  -0.0427 258 LEU A N   
1773 C CA  . LEU A 269 ? 1.3939 0.9400 0.5577 -0.2392 -0.0481 -0.0206 258 LEU A CA  
1774 C C   . LEU A 269 ? 1.3663 0.9493 0.5807 -0.2227 -0.0975 -0.0142 258 LEU A C   
1775 O O   . LEU A 269 ? 1.2994 0.9412 0.6105 -0.1958 -0.0892 -0.0179 258 LEU A O   
1776 C CB  . LEU A 269 ? 1.3395 0.9053 0.5325 -0.2227 -0.0586 0.0001  258 LEU A CB  
1777 C CG  . LEU A 269 ? 1.3488 0.8942 0.5105 -0.2184 -0.1214 0.0261  258 LEU A CG  
1778 C CD1 . LEU A 269 ? 1.4827 0.9408 0.5084 -0.2569 -0.1413 0.0319  258 LEU A CD1 
1779 C CD2 . LEU A 269 ? 1.2945 0.8584 0.4952 -0.1997 -0.1194 0.0415  258 LEU A CD2 
1780 N N   . PHE A 270 ? 1.4435 0.9921 0.5951 -0.2409 -0.1507 -0.0030 259 PHE A N   
1781 C CA  . PHE A 270 ? 1.4193 1.0099 0.6308 -0.2284 -0.1999 0.0033  259 PHE A CA  
1782 C C   . PHE A 270 ? 1.5016 1.0654 0.6673 -0.2409 -0.2714 0.0275  259 PHE A C   
1783 O O   . PHE A 270 ? 1.5974 1.1136 0.6777 -0.2773 -0.2982 0.0253  259 PHE A O   
1784 C CB  . PHE A 270 ? 1.4373 1.0269 0.6453 -0.2449 -0.1800 -0.0214 259 PHE A CB  
1785 C CG  . PHE A 270 ? 1.3730 1.0222 0.6705 -0.2290 -0.2126 -0.0203 259 PHE A CG  
1786 C CD1 . PHE A 270 ? 1.2705 0.9790 0.6720 -0.1968 -0.1882 -0.0246 259 PHE A CD1 
1787 C CD2 . PHE A 270 ? 1.4338 1.0787 0.7112 -0.2499 -0.2692 -0.0135 259 PHE A CD2 
1788 C CE1 . PHE A 270 ? 1.2181 0.9765 0.6983 -0.1863 -0.2108 -0.0256 259 PHE A CE1 
1789 C CE2 . PHE A 270 ? 1.3760 1.0826 0.7483 -0.2375 -0.2946 -0.0142 259 PHE A CE2 
1790 C CZ  . PHE A 270 ? 1.2689 1.0304 0.7412 -0.2058 -0.2611 -0.0217 259 PHE A CZ  
1791 N N   . ASP A 271 ? 1.4888 1.0784 0.7103 -0.2121 -0.3036 0.0513  260 ASP A N   
1792 C CA  . ASP A 271 ? 1.5818 1.1568 0.7917 -0.2137 -0.3786 0.0794  260 ASP A CA  
1793 C C   . ASP A 271 ? 1.5143 1.1696 0.8654 -0.1783 -0.4067 0.0857  260 ASP A C   
1794 O O   . ASP A 271 ? 1.4400 1.1348 0.8752 -0.1441 -0.3825 0.0863  260 ASP A O   
1795 C CB  . ASP A 271 ? 1.6460 1.1685 0.7994 -0.2097 -0.3940 0.1045  260 ASP A CB  
1796 C CG  . ASP A 271 ? 1.7670 1.2456 0.8704 -0.2216 -0.4793 0.1383  260 ASP A CG  
1797 O OD1 . ASP A 271 ? 1.7956 1.2872 0.9052 -0.2378 -0.5297 0.1423  260 ASP A OD1 
1798 O OD2 . ASP A 271 ? 1.8131 1.2404 0.8688 -0.2167 -0.4998 0.1632  260 ASP A OD2 
1799 N N   . ILE A 272 ? 1.5801 1.2564 0.9539 -0.1915 -0.4554 0.0888  261 ILE A N   
1800 C CA  . ILE A 272 ? 1.5716 1.3239 1.0844 -0.1627 -0.4870 0.0961  261 ILE A CA  
1801 C C   . ILE A 272 ? 1.7260 1.4736 1.2359 -0.1784 -0.5757 0.1231  261 ILE A C   
1802 O O   . ILE A 272 ? 1.7606 1.4718 1.1812 -0.2227 -0.6082 0.1218  261 ILE A O   
1803 C CB  . ILE A 272 ? 1.5009 1.3109 1.0857 -0.1634 -0.4487 0.0664  261 ILE A CB  
1804 C CG1 . ILE A 272 ? 1.3886 1.2020 0.9793 -0.1490 -0.3725 0.0454  261 ILE A CG1 
1805 C CG2 . ILE A 272 ? 1.4778 1.3666 1.2097 -0.1394 -0.4761 0.0710  261 ILE A CG2 
1806 C CD1 . ILE A 272 ? 1.3238 1.1678 0.9970 -0.1107 -0.3535 0.0528  261 ILE A CD1 
1807 N N   . ARG A 273 ? 1.8030 1.5873 1.4168 -0.1427 -0.6161 0.1481  262 ARG A N   
1808 C CA  . ARG A 273 ? 1.9620 1.7485 1.5951 -0.1507 -0.7084 0.1805  262 ARG A CA  
1809 C C   . ARG A 273 ? 1.9581 1.8315 1.7144 -0.1551 -0.7381 0.1723  262 ARG A C   
1810 O O   . ARG A 273 ? 2.0644 1.9325 1.7930 -0.1879 -0.8105 0.1888  262 ARG A O   
1811 C CB  . ARG A 273 ? 2.0192 1.8004 1.7166 -0.1073 -0.7426 0.2149  262 ARG A CB  
1812 C CG  . ARG A 273 ? 2.1657 1.8965 1.8057 -0.1237 -0.8440 0.2595  262 ARG A CG  
1813 C CD  . ARG A 273 ? 2.2647 1.8778 1.6848 -0.1756 -0.8528 0.2660  262 ARG A CD  
1814 N NE  . ARG A 273 ? 2.1917 1.7527 1.5226 -0.1748 -0.7660 0.2439  262 ARG A NE  
1815 C CZ  . ARG A 273 ? 2.2311 1.6906 1.4117 -0.1966 -0.7622 0.2570  262 ARG A CZ  
1816 N NH1 . ARG A 273 ? 2.3690 1.7485 1.4433 -0.2240 -0.8407 0.2941  262 ARG A NH1 
1817 N NH2 . ARG A 273 ? 2.1424 1.5781 1.2764 -0.1947 -0.6793 0.2333  262 ARG A NH2 
1818 N N   . ASP A 274 ? 1.8797 1.8290 1.7665 -0.1277 -0.6851 0.1477  263 ASP A N   
1819 C CA  . ASP A 274 ? 1.8867 1.9257 1.9161 -0.1280 -0.7142 0.1428  263 ASP A CA  
1820 C C   . ASP A 274 ? 1.8216 1.8799 1.8341 -0.1569 -0.6627 0.1048  263 ASP A C   
1821 O O   . ASP A 274 ? 1.7854 1.8173 1.7471 -0.1522 -0.5881 0.0806  263 ASP A O   
1822 C CB  . ASP A 274 ? 1.8842 1.9946 2.0936 -0.0753 -0.6936 0.1447  263 ASP A CB  
1823 C CG  . ASP A 274 ? 2.0617 2.1443 2.2941 -0.0385 -0.7314 0.1805  263 ASP A CG  
1824 O OD1 . ASP A 274 ? 2.2987 2.3155 2.4187 -0.0573 -0.7932 0.2102  263 ASP A OD1 
1825 O OD2 . ASP A 274 ? 2.1012 2.2174 2.4549 0.0067  -0.6959 0.1784  263 ASP A OD2 
1826 N N   . SER A 275 ? 1.8041 1.9086 1.8646 -0.1869 -0.7051 0.1012  264 SER A N   
1827 C CA  . SER A 275 ? 1.7273 1.8607 1.8037 -0.2106 -0.6555 0.0647  264 SER A CA  
1828 C C   . SER A 275 ? 1.5775 1.7656 1.7764 -0.1723 -0.5814 0.0428  264 SER A C   
1829 O O   . SER A 275 ? 1.5417 1.7098 1.6962 -0.1799 -0.5139 0.0146  264 SER A O   
1830 C CB  . SER A 275 ? 1.7636 1.9440 1.8866 -0.2513 -0.7194 0.0667  264 SER A CB  
1831 O OG  . SER A 275 ? 1.8982 2.0030 1.8620 -0.3012 -0.7697 0.0772  264 SER A OG  
1832 N N   . ALA A 276 ? 1.4697 1.7160 1.8136 -0.1326 -0.5935 0.0570  265 ALA A N   
1833 C CA  . ALA A 276 ? 1.2930 1.5787 1.7460 -0.0990 -0.5217 0.0370  265 ALA A CA  
1834 C C   . ALA A 276 ? 1.1955 1.4178 1.5522 -0.0849 -0.4509 0.0247  265 ALA A C   
1835 O O   . ALA A 276 ? 1.1152 1.3438 1.4878 -0.0856 -0.3863 -0.0010 265 ALA A O   
1836 C CB  . ALA A 276 ? 1.2740 1.6143 1.8852 -0.0569 -0.5463 0.0567  265 ALA A CB  
1837 N N   . ASP A 277 ? 1.1997 1.3590 1.4534 -0.0768 -0.4657 0.0440  266 ASP A N   
1838 C CA  . ASP A 277 ? 1.1578 1.2621 1.3213 -0.0694 -0.4066 0.0344  266 ASP A CA  
1839 C C   . ASP A 277 ? 1.1141 1.1919 1.1853 -0.1033 -0.3777 0.0124  266 ASP A C   
1840 O O   . ASP A 277 ? 1.1419 1.2003 1.1472 -0.1332 -0.4120 0.0142  266 ASP A O   
1841 C CB  . ASP A 277 ? 1.2439 1.2865 1.3168 -0.0595 -0.4296 0.0594  266 ASP A CB  
1842 C CG  . ASP A 277 ? 1.2949 1.3492 1.4493 -0.0253 -0.4690 0.0870  266 ASP A CG  
1843 O OD1 . ASP A 277 ? 1.2824 1.3765 1.5540 0.0035  -0.4416 0.0808  266 ASP A OD1 
1844 O OD2 . ASP A 277 ? 1.3726 1.3875 1.4687 -0.0281 -0.5258 0.1152  266 ASP A OD2 
1845 N N   . MET A 278 ? 1.0511 1.1220 1.1157 -0.0998 -0.3156 -0.0072 267 MET A N   
1846 C CA  . MET A 278 ? 1.0418 1.0882 1.0396 -0.1250 -0.2843 -0.0271 267 MET A CA  
1847 C C   . MET A 278 ? 0.9873 0.9945 0.9278 -0.1158 -0.2343 -0.0317 267 MET A C   
1848 O O   . MET A 278 ? 0.9449 0.9558 0.9173 -0.0951 -0.2086 -0.0287 267 MET A O   
1849 C CB  . MET A 278 ? 1.0576 1.1439 1.1300 -0.1342 -0.2592 -0.0475 267 MET A CB  
1850 C CG  . MET A 278 ? 1.1517 1.2799 1.2759 -0.1585 -0.2964 -0.0531 267 MET A CG  
1851 S SD  . MET A 278 ? 1.2188 1.3758 1.4106 -0.1706 -0.2412 -0.0819 267 MET A SD  
1852 C CE  . MET A 278 ? 1.1834 1.3936 1.5116 -0.1395 -0.2210 -0.0807 267 MET A CE  
1853 N N   . VAL A 279 ? 0.9769 0.9462 0.8383 -0.1336 -0.2185 -0.0405 268 VAL A N   
1854 C CA  . VAL A 279 ? 0.9393 0.8830 0.7704 -0.1274 -0.1723 -0.0467 268 VAL A CA  
1855 C C   . VAL A 279 ? 0.9322 0.8685 0.7583 -0.1454 -0.1512 -0.0653 268 VAL A C   
1856 O O   . VAL A 279 ? 0.9812 0.9018 0.7699 -0.1678 -0.1646 -0.0740 268 VAL A O   
1857 C CB  . VAL A 279 ? 0.9759 0.8763 0.7277 -0.1291 -0.1629 -0.0412 268 VAL A CB  
1858 C CG1 . VAL A 279 ? 0.9411 0.8288 0.6892 -0.1187 -0.1224 -0.0429 268 VAL A CG1 
1859 C CG2 . VAL A 279 ? 1.0128 0.9060 0.7462 -0.1195 -0.1871 -0.0228 268 VAL A CG2 
1860 N N   . GLU A 280 ? 0.8671 0.8037 0.7181 -0.1395 -0.1189 -0.0706 269 GLU A N   
1861 C CA  . GLU A 280 ? 0.8528 0.7710 0.6942 -0.1549 -0.0961 -0.0854 269 GLU A CA  
1862 C C   . GLU A 280 ? 0.8737 0.7559 0.6843 -0.1441 -0.0670 -0.0801 269 GLU A C   
1863 O O   . GLU A 280 ? 0.8453 0.7293 0.6605 -0.1282 -0.0624 -0.0664 269 GLU A O   
1864 C CB  . GLU A 280 ? 0.8009 0.7482 0.7032 -0.1639 -0.0882 -0.0955 269 GLU A CB  
1865 C CG  . GLU A 280 ? 0.8052 0.7792 0.7353 -0.1870 -0.1094 -0.1083 269 GLU A CG  
1866 C CD  . GLU A 280 ? 0.7743 0.7868 0.7811 -0.1985 -0.0980 -0.1208 269 GLU A CD  
1867 O OE1 . GLU A 280 ? 0.7404 0.7501 0.7709 -0.1933 -0.0661 -0.1236 269 GLU A OE1 
1868 O OE2 . GLU A 280 ? 0.7876 0.8319 0.8289 -0.2187 -0.1214 -0.1293 269 GLU A OE2 
1869 N N   . LEU A 281 ? 0.9593 0.8071 0.7415 -0.1539 -0.0496 -0.0897 270 LEU A N   
1870 C CA  . LEU A 281 ? 1.0053 0.8209 0.7776 -0.1430 -0.0267 -0.0821 270 LEU A CA  
1871 C C   . LEU A 281 ? 1.0073 0.8022 0.7825 -0.1578 -0.0134 -0.0899 270 LEU A C   
1872 O O   . LEU A 281 ? 1.0177 0.8019 0.7827 -0.1781 -0.0101 -0.1070 270 LEU A O   
1873 C CB  . LEU A 281 ? 1.1116 0.8911 0.8518 -0.1377 -0.0110 -0.0851 270 LEU A CB  
1874 C CG  . LEU A 281 ? 1.1468 0.9305 0.8953 -0.1155 -0.0054 -0.0688 270 LEU A CG  
1875 C CD1 . LEU A 281 ? 1.1537 0.9608 0.8898 -0.1166 -0.0208 -0.0670 270 LEU A CD1 
1876 C CD2 . LEU A 281 ? 1.2282 0.9736 0.9660 -0.1076 0.0223  -0.0740 270 LEU A CD2 
1877 N N   . LEU A 282 ? 0.9957 0.7779 0.7749 -0.1526 -0.0066 -0.0770 271 LEU A N   
1878 C CA  . LEU A 282 ? 1.0211 0.7734 0.7900 -0.1715 0.0072  -0.0822 271 LEU A CA  
1879 C C   . LEU A 282 ? 1.0399 0.7376 0.7799 -0.1634 0.0125  -0.0648 271 LEU A C   
1880 O O   . LEU A 282 ? 1.0426 0.7413 0.7870 -0.1453 0.0019  -0.0433 271 LEU A O   
1881 C CB  . LEU A 282 ? 1.0316 0.8039 0.8192 -0.1809 0.0109  -0.0821 271 LEU A CB  
1882 C CG  . LEU A 282 ? 1.0385 0.8566 0.8732 -0.1946 0.0138  -0.1017 271 LEU A CG  
1883 C CD1 . LEU A 282 ? 1.0384 0.9020 0.9019 -0.1809 -0.0108 -0.1023 271 LEU A CD1 
1884 C CD2 . LEU A 282 ? 1.0411 0.8686 0.8967 -0.1989 0.0286  -0.1020 271 LEU A CD2 
1885 N N   . ASP A 283 ? 1.0456 0.6954 0.7597 -0.1776 0.0257  -0.0723 272 ASP A N   
1886 C CA  . ASP A 283 ? 1.0628 0.6519 0.7501 -0.1720 0.0260  -0.0524 272 ASP A CA  
1887 C C   . ASP A 283 ? 1.0518 0.6303 0.7202 -0.1848 0.0175  -0.0363 272 ASP A C   
1888 O O   . ASP A 283 ? 1.0434 0.6224 0.6988 -0.2120 0.0310  -0.0510 272 ASP A O   
1889 C CB  . ASP A 283 ? 1.1233 0.6559 0.7778 -0.1907 0.0441  -0.0666 272 ASP A CB  
1890 C CG  . ASP A 283 ? 1.1911 0.6482 0.8138 -0.1851 0.0412  -0.0434 272 ASP A CG  
1891 O OD1 . ASP A 283 ? 1.2113 0.6549 0.8210 -0.1856 0.0237  -0.0190 272 ASP A OD1 
1892 O OD2 . ASP A 283 ? 1.2395 0.6423 0.8434 -0.1839 0.0553  -0.0490 272 ASP A OD2 
1893 N N   . GLY A 284 ? 1.0375 0.6079 0.7065 -0.1682 -0.0032 -0.0075 273 GLY A N   
1894 C CA  . GLY A 284 ? 1.0601 0.6101 0.6946 -0.1865 -0.0145 0.0089  273 GLY A CA  
1895 C C   . GLY A 284 ? 1.1473 0.6227 0.7167 -0.2200 -0.0051 0.0098  273 GLY A C   
1896 O O   . GLY A 284 ? 1.1654 0.6224 0.6960 -0.2499 0.0063  0.0039  273 GLY A O   
1897 N N   . TYR A 285 ? 1.2175 0.6419 0.7705 -0.2163 -0.0055 0.0158  274 TYR A N   
1898 C CA  . TYR A 285 ? 1.3151 0.6531 0.7954 -0.2484 0.0011  0.0206  274 TYR A CA  
1899 C C   . TYR A 285 ? 1.3252 0.6650 0.7920 -0.2819 0.0408  -0.0172 274 TYR A C   
1900 O O   . TYR A 285 ? 1.3797 0.6791 0.7934 -0.3202 0.0586  -0.0241 274 TYR A O   
1901 C CB  . TYR A 285 ? 1.3817 0.6601 0.8556 -0.2284 -0.0124 0.0411  274 TYR A CB  
1902 C CG  . TYR A 285 ? 1.3881 0.6732 0.9015 -0.1914 -0.0528 0.0807  274 TYR A CG  
1903 C CD1 . TYR A 285 ? 1.4458 0.6860 0.9170 -0.2033 -0.0918 0.1189  274 TYR A CD1 
1904 C CD2 . TYR A 285 ? 1.3512 0.6863 0.9448 -0.1488 -0.0514 0.0796  274 TYR A CD2 
1905 C CE1 . TYR A 285 ? 1.4443 0.7017 0.9677 -0.1716 -0.1340 0.1568  274 TYR A CE1 
1906 C CE2 . TYR A 285 ? 1.3531 0.7040 1.0017 -0.1159 -0.0836 0.1138  274 TYR A CE2 
1907 C CZ  . TYR A 285 ? 1.3926 0.7104 1.0134 -0.1264 -0.1278 0.1534  274 TYR A CZ  
1908 O OH  . TYR A 285 ? 1.3994 0.7437 1.0903 -0.0953 -0.1653 0.1892  274 TYR A OH  
1909 N N   . THR A 286 ? 1.2930 0.6812 0.8094 -0.2712 0.0555  -0.0428 275 THR A N   
1910 C CA  . THR A 286 ? 1.3072 0.7065 0.8267 -0.3039 0.0871  -0.0772 275 THR A CA  
1911 C C   . THR A 286 ? 1.2151 0.7039 0.7990 -0.3066 0.0967  -0.1002 275 THR A C   
1912 O O   . THR A 286 ? 1.2190 0.7258 0.8212 -0.3357 0.1218  -0.1267 275 THR A O   
1913 C CB  . THR A 286 ? 1.3501 0.7361 0.8753 -0.3000 0.0938  -0.0913 275 THR A CB  
1914 O OG1 . THR A 286 ? 1.3025 0.7538 0.8820 -0.2705 0.0816  -0.0965 275 THR A OG1 
1915 C CG2 . THR A 286 ? 1.4377 0.7358 0.9157 -0.2865 0.0846  -0.0667 275 THR A CG2 
1916 N N   . HIS A 287 ? 1.1264 0.6701 0.7500 -0.2765 0.0766  -0.0892 276 HIS A N   
1917 C CA  . HIS A 287 ? 1.0364 0.6637 0.7285 -0.2687 0.0767  -0.1063 276 HIS A CA  
1918 C C   . HIS A 287 ? 0.9975 0.6688 0.7317 -0.2714 0.0742  -0.1279 276 HIS A C   
1919 O O   . HIS A 287 ? 0.9425 0.6793 0.7367 -0.2719 0.0705  -0.1412 276 HIS A O   
1920 C CB  . HIS A 287 ? 1.0376 0.6782 0.7452 -0.2912 0.1019  -0.1196 276 HIS A CB  
1921 C CG  . HIS A 287 ? 1.0452 0.6601 0.7179 -0.2870 0.0987  -0.1006 276 HIS A CG  
1922 N ND1 . HIS A 287 ? 1.0896 0.6797 0.7418 -0.3147 0.1300  -0.1108 276 HIS A ND1 
1923 C CD2 . HIS A 287 ? 1.0298 0.6350 0.6803 -0.2637 0.0701  -0.0731 276 HIS A CD2 
1924 C CE1 . HIS A 287 ? 1.1054 0.6659 0.7130 -0.3107 0.1176  -0.0897 276 HIS A CE1 
1925 N NE2 . HIS A 287 ? 1.0641 0.6384 0.6753 -0.2798 0.0784  -0.0654 276 HIS A NE2 
1926 N N   . ARG A 288 ? 1.0152 0.6463 0.7169 -0.2732 0.0733  -0.1294 277 ARG A N   
1927 C CA  . ARG A 288 ? 1.0077 0.6633 0.7262 -0.2821 0.0684  -0.1487 277 ARG A CA  
1928 C C   . ARG A 288 ? 0.9622 0.6641 0.7054 -0.2541 0.0437  -0.1415 277 ARG A C   
1929 O O   . ARG A 288 ? 0.9399 0.6387 0.6783 -0.2260 0.0358  -0.1218 277 ARG A O   
1930 C CB  . ARG A 288 ? 1.0669 0.6478 0.7296 -0.2914 0.0807  -0.1520 277 ARG A CB  
1931 C CG  . ARG A 288 ? 1.0772 0.6568 0.7293 -0.2978 0.0769  -0.1680 277 ARG A CG  
1932 C CD  . ARG A 288 ? 1.1543 0.6439 0.7471 -0.3067 0.0983  -0.1720 277 ARG A CD  
1933 N NE  . ARG A 288 ? 1.1776 0.6445 0.7486 -0.2934 0.1001  -0.1773 277 ARG A NE  
1934 C CZ  . ARG A 288 ? 1.1803 0.6104 0.7435 -0.2576 0.1075  -0.1617 277 ARG A CZ  
1935 N NH1 . ARG A 288 ? 1.1682 0.5809 0.7445 -0.2305 0.1041  -0.1351 277 ARG A NH1 
1936 N NH2 . ARG A 288 ? 1.2089 0.6177 0.7515 -0.2520 0.1189  -0.1733 277 ARG A NH2 
1937 N N   . VAL A 289 ? 0.9598 0.7029 0.7268 -0.2667 0.0295  -0.1567 278 VAL A N   
1938 C CA  . VAL A 289 ? 0.9266 0.7104 0.7096 -0.2488 0.0033  -0.1503 278 VAL A CA  
1939 C C   . VAL A 289 ? 0.9660 0.7065 0.6956 -0.2512 0.0049  -0.1556 278 VAL A C   
1940 O O   . VAL A 289 ? 1.0133 0.7382 0.7206 -0.2809 0.0048  -0.1737 278 VAL A O   
1941 C CB  . VAL A 289 ? 0.9240 0.7742 0.7635 -0.2645 -0.0209 -0.1601 278 VAL A CB  
1942 C CG1 . VAL A 289 ? 0.9323 0.8029 0.7615 -0.2558 -0.0547 -0.1532 278 VAL A CG1 
1943 C CG2 . VAL A 289 ? 0.8866 0.7793 0.7899 -0.2554 -0.0141 -0.1559 278 VAL A CG2 
1944 N N   . LEU A 290 ? 0.9570 0.6781 0.6678 -0.2227 0.0090  -0.1413 279 LEU A N   
1945 C CA  . LEU A 290 ? 1.0044 0.6739 0.6675 -0.2190 0.0247  -0.1468 279 LEU A CA  
1946 C C   . LEU A 290 ? 1.0202 0.7039 0.6574 -0.2325 0.0066  -0.1554 279 LEU A C   
1947 O O   . LEU A 290 ? 1.0664 0.7070 0.6502 -0.2569 0.0151  -0.1731 279 LEU A O   
1948 C CB  . LEU A 290 ? 0.9846 0.6352 0.6568 -0.1832 0.0391  -0.1272 279 LEU A CB  
1949 C CG  . LEU A 290 ? 0.9835 0.6093 0.6685 -0.1751 0.0466  -0.1132 279 LEU A CG  
1950 C CD1 . LEU A 290 ? 0.9574 0.5930 0.6698 -0.1435 0.0413  -0.0868 279 LEU A CD1 
1951 C CD2 . LEU A 290 ? 1.0458 0.6002 0.6978 -0.1840 0.0701  -0.1220 279 LEU A CD2 
1952 N N   . ALA A 291 ? 0.9879 0.7233 0.6544 -0.2199 -0.0192 -0.1422 280 ALA A N   
1953 C CA  . ALA A 291 ? 1.0160 0.7618 0.6534 -0.2315 -0.0449 -0.1431 280 ALA A CA  
1954 C C   . ALA A 291 ? 0.9590 0.7704 0.6504 -0.2250 -0.0833 -0.1296 280 ALA A C   
1955 O O   . ALA A 291 ? 0.8775 0.7199 0.6205 -0.2029 -0.0796 -0.1182 280 ALA A O   
1956 C CB  . ALA A 291 ? 1.0407 0.7521 0.6374 -0.2151 -0.0245 -0.1384 280 ALA A CB  
1957 N N   . ARG A 292 ? 1.0075 0.8313 0.6816 -0.2470 -0.1204 -0.1308 281 ARG A N   
1958 C CA  . ARG A 292 ? 0.9909 0.8702 0.7175 -0.2400 -0.1628 -0.1159 281 ARG A CA  
1959 C C   . ARG A 292 ? 1.0620 0.9176 0.7225 -0.2537 -0.1976 -0.1072 281 ARG A C   
1960 O O   . ARG A 292 ? 1.1130 0.9296 0.7039 -0.2882 -0.2087 -0.1178 281 ARG A O   
1961 C CB  . ARG A 292 ? 0.9881 0.9170 0.7840 -0.2591 -0.1852 -0.1234 281 ARG A CB  
1962 C CG  . ARG A 292 ? 0.9530 0.9483 0.8414 -0.2405 -0.2165 -0.1085 281 ARG A CG  
1963 C CD  . ARG A 292 ? 0.9949 1.0425 0.9511 -0.2668 -0.2525 -0.1144 281 ARG A CD  
1964 N NE  . ARG A 292 ? 1.0206 1.0603 0.9774 -0.2953 -0.2236 -0.1377 281 ARG A NE  
1965 C CZ  . ARG A 292 ? 0.9894 1.0554 1.0136 -0.2927 -0.1885 -0.1493 281 ARG A CZ  
1966 N NH1 . ARG A 292 ? 0.9398 1.0430 1.0401 -0.2645 -0.1740 -0.1429 281 ARG A NH1 
1967 N NH2 . ARG A 292 ? 1.0378 1.0836 1.0443 -0.3230 -0.1644 -0.1692 281 ARG A NH2 
1968 N N   . PHE A 293 ? 1.0753 0.9451 0.7480 -0.2295 -0.2124 -0.0877 282 PHE A N   
1969 C CA  . PHE A 293 ? 1.1512 0.9911 0.7561 -0.2394 -0.2437 -0.0748 282 PHE A CA  
1970 C C   . PHE A 293 ? 1.1647 1.0523 0.8349 -0.2214 -0.2924 -0.0513 282 PHE A C   
1971 O O   . PHE A 293 ? 1.1036 1.0240 0.8423 -0.1882 -0.2772 -0.0432 282 PHE A O   
1972 C CB  . PHE A 293 ? 1.1411 0.9403 0.6948 -0.2235 -0.2030 -0.0731 282 PHE A CB  
1973 C CG  . PHE A 293 ? 1.1685 0.9237 0.6801 -0.2315 -0.1508 -0.0937 282 PHE A CG  
1974 C CD1 . PHE A 293 ? 1.2791 0.9798 0.7089 -0.2677 -0.1457 -0.1108 282 PHE A CD1 
1975 C CD2 . PHE A 293 ? 1.1230 0.8852 0.6746 -0.2040 -0.1080 -0.0948 282 PHE A CD2 
1976 C CE1 . PHE A 293 ? 1.3153 0.9676 0.7109 -0.2719 -0.0911 -0.1312 282 PHE A CE1 
1977 C CE2 . PHE A 293 ? 1.1523 0.8731 0.6782 -0.2061 -0.0619 -0.1107 282 PHE A CE2 
1978 C CZ  . PHE A 293 ? 1.2386 0.9032 0.6894 -0.2377 -0.0495 -0.1300 282 PHE A CZ  
1979 N N   . HIS A 294 ? 1.2666 1.1509 0.9119 -0.2444 -0.3513 -0.0392 283 HIS A N   
1980 C CA  . HIS A 294 ? 1.3043 1.2292 1.0172 -0.2259 -0.4057 -0.0130 283 HIS A CA  
1981 C C   . HIS A 294 ? 1.4192 1.2888 1.0301 -0.2484 -0.4588 0.0082  283 HIS A C   
1982 O O   . HIS A 294 ? 1.4670 1.2648 0.9523 -0.2771 -0.4393 -0.0013 283 HIS A O   
1983 C CB  . HIS A 294 ? 1.2953 1.2976 1.1335 -0.2270 -0.4365 -0.0145 283 HIS A CB  
1984 C CG  . HIS A 294 ? 1.3718 1.3711 1.1795 -0.2733 -0.4583 -0.0290 283 HIS A CG  
1985 N ND1 . HIS A 294 ? 1.3548 1.3717 1.1936 -0.2860 -0.4169 -0.0556 283 HIS A ND1 
1986 C CD2 . HIS A 294 ? 1.4991 1.4715 1.2375 -0.3154 -0.5178 -0.0204 283 HIS A CD2 
1987 C CE1 . HIS A 294 ? 1.4425 1.4454 1.2362 -0.3329 -0.4464 -0.0649 283 HIS A CE1 
1988 N NE2 . HIS A 294 ? 1.5374 1.5137 1.2681 -0.3532 -0.5089 -0.0440 283 HIS A NE2 
1989 N N   . GLY A 295 ? 1.4709 1.3665 1.1334 -0.2356 -0.5223 0.0373  284 GLY A N   
1990 C CA  . GLY A 295 ? 1.6080 1.4428 1.1688 -0.2567 -0.5806 0.0637  284 GLY A CA  
1991 C C   . GLY A 295 ? 1.7635 1.5378 1.1949 -0.3170 -0.6055 0.0552  284 GLY A C   
1992 O O   . GLY A 295 ? 1.8679 1.5542 1.1534 -0.3462 -0.6072 0.0595  284 GLY A O   
1993 N N   . ARG A 296 ? 1.8090 1.6240 1.2871 -0.3403 -0.6199 0.0407  285 ARG A N   
1994 C CA  . ARG A 296 ? 2.0001 1.7541 1.3530 -0.4036 -0.6420 0.0294  285 ARG A CA  
1995 C C   . ARG A 296 ? 2.0519 1.7628 1.3356 -0.4252 -0.5616 -0.0114 285 ARG A C   
1996 O O   . ARG A 296 ? 2.1363 1.7815 1.3025 -0.4799 -0.5678 -0.0254 285 ARG A O   
1997 C CB  . ARG A 296 ? 2.0612 1.8783 1.4962 -0.4270 -0.7243 0.0436  285 ARG A CB  
1998 C CG  . ARG A 296 ? 2.0958 1.9409 1.5874 -0.4104 -0.8158 0.0892  285 ARG A CG  
1999 C CD  . ARG A 296 ? 2.1438 2.0372 1.6905 -0.4479 -0.9102 0.1066  285 ARG A CD  
2000 N NE  . ARG A 296 ? 2.3093 2.1072 1.6699 -0.5239 -0.9526 0.1068  285 ARG A NE  
2001 C CZ  . ARG A 296 ? 2.4300 2.2456 1.7892 -0.5775 -1.0350 0.1178  285 ARG A CZ  
2002 N NH1 . ARG A 296 ? 2.3792 2.3168 1.9320 -0.5615 -1.0853 0.1297  285 ARG A NH1 
2003 N NH2 . ARG A 296 ? 2.5902 2.2984 1.7515 -0.6528 -1.0668 0.1158  285 ARG A NH2 
2004 N N   . SER A 297 ? 2.0844 1.8237 1.4346 -0.3841 -0.4879 -0.0290 286 SER A N   
2005 C CA  . SER A 297 ? 2.1755 1.8698 1.4706 -0.3943 -0.4097 -0.0629 286 SER A CA  
2006 C C   . SER A 297 ? 2.2330 1.8809 1.4758 -0.3696 -0.3510 -0.0652 286 SER A C   
2007 O O   . SER A 297 ? 2.1939 1.8837 1.5111 -0.3255 -0.3413 -0.0511 286 SER A O   
2008 C CB  . SER A 297 ? 2.0660 1.8282 1.4816 -0.3719 -0.3781 -0.0788 286 SER A CB  
2009 O OG  . SER A 297 ? 1.9957 1.8293 1.5334 -0.3223 -0.3778 -0.0635 286 SER A OG  
2010 N N   . ARG A 298 ? 2.3574 1.9164 1.4717 -0.4022 -0.3110 -0.0839 287 ARG A N   
2011 C CA  . ARG A 298 ? 2.3343 1.8405 1.3824 -0.3929 -0.2642 -0.0848 287 ARG A CA  
2012 C C   . ARG A 298 ? 2.3144 1.8048 1.3787 -0.3749 -0.1758 -0.1123 287 ARG A C   
2013 O O   . ARG A 298 ? 2.4783 1.9207 1.4915 -0.4019 -0.1422 -0.1383 287 ARG A O   
2014 C CB  . ARG A 298 ? 2.4018 1.8089 1.2849 -0.4486 -0.2843 -0.0843 287 ARG A CB  
2015 C CG  . ARG A 298 ? 2.4017 1.8176 1.2655 -0.4674 -0.3828 -0.0506 287 ARG A CG  
2016 C CD  . ARG A 298 ? 2.4952 1.8226 1.2186 -0.4968 -0.3996 -0.0348 287 ARG A CD  
2017 N NE  . ARG A 298 ? 2.4104 1.7344 1.1495 -0.4619 -0.3374 -0.0369 287 ARG A NE  
2018 C CZ  . ARG A 298 ? 2.2682 1.6552 1.1085 -0.4120 -0.3497 -0.0143 287 ARG A CZ  
2019 N NH1 . ARG A 298 ? 2.2055 1.6626 1.1472 -0.3856 -0.4181 0.0124  287 ARG A NH1 
2020 N NH2 . ARG A 298 ? 2.2048 1.5835 1.0489 -0.3900 -0.2897 -0.0198 287 ARG A NH2 
2021 N N   . PRO A 299 ? 2.1303 1.6576 1.2667 -0.3304 -0.1404 -0.1055 288 PRO A N   
2022 C CA  . PRO A 299 ? 1.9948 1.5304 1.1865 -0.3040 -0.0729 -0.1229 288 PRO A CA  
2023 C C   . PRO A 299 ? 2.0040 1.4572 1.1087 -0.3282 -0.0084 -0.1495 288 PRO A C   
2024 O O   . PRO A 299 ? 1.9739 1.3754 0.9932 -0.3500 0.0038  -0.1504 288 PRO A O   
2025 C CB  . PRO A 299 ? 1.9089 1.4956 1.1777 -0.2622 -0.0646 -0.1042 288 PRO A CB  
2026 C CG  . PRO A 299 ? 1.9981 1.5637 1.2044 -0.2764 -0.0998 -0.0866 288 PRO A CG  
2027 C CD  . PRO A 299 ? 2.0794 1.6343 1.2421 -0.3063 -0.1637 -0.0797 288 PRO A CD  
2028 N N   . PRO A 300 ? 2.0044 1.4392 1.1294 -0.3250 0.0365  -0.1717 289 PRO A N   
2029 C CA  . PRO A 300 ? 2.0928 1.4425 1.1394 -0.3474 0.1045  -0.2000 289 PRO A CA  
2030 C C   . PRO A 300 ? 2.0504 1.4096 1.1412 -0.3184 0.1572  -0.1987 289 PRO A C   
2031 O O   . PRO A 300 ? 1.9289 1.3629 1.1227 -0.2773 0.1440  -0.1773 289 PRO A O   
2032 C CB  . PRO A 300 ? 2.1087 1.4428 1.1888 -0.3410 0.1373  -0.2194 289 PRO A CB  
2033 C CG  . PRO A 300 ? 2.0023 1.4164 1.1765 -0.3174 0.0857  -0.2005 289 PRO A CG  
2034 C CD  . PRO A 300 ? 1.9315 1.4156 1.1552 -0.2965 0.0376  -0.1714 289 PRO A CD  
2035 N N   . LEU A 301 ? 2.1822 1.4608 1.1876 -0.3464 0.2173  -0.2231 290 LEU A N   
2036 C CA  . LEU A 301 ? 2.1762 1.4507 1.2208 -0.3277 0.2869  -0.2316 290 LEU A CA  
2037 C C   . LEU A 301 ? 1.9995 1.3645 1.2084 -0.2676 0.2939  -0.2145 290 LEU A C   
2038 O O   . LEU A 301 ? 1.8622 1.2805 1.1356 -0.2450 0.2931  -0.1973 290 LEU A O   
2039 C CB  . LEU A 301 ? 2.3199 1.4947 1.2919 -0.3557 0.3705  -0.2716 290 LEU A CB  
2040 C CG  . LEU A 301 ? 2.3582 1.4981 1.3497 -0.3509 0.4660  -0.2949 290 LEU A CG  
2041 C CD1 . LEU A 301 ? 2.3768 1.5143 1.3171 -0.3715 0.4655  -0.2863 290 LEU A CD1 
2042 C CD2 . LEU A 301 ? 2.4811 1.4998 1.3642 -0.3919 0.5403  -0.3379 290 LEU A CD2 
2043 N N   . SER A 302 ? 1.9523 1.3273 1.2171 -0.2476 0.2949  -0.2180 291 SER A N   
2044 C CA  . SER A 302 ? 1.8514 1.2926 1.2525 -0.1976 0.2958  -0.2012 291 SER A CA  
2045 C C   . SER A 302 ? 1.7956 1.2270 1.2048 -0.1946 0.2757  -0.2039 291 SER A C   
2046 O O   . SER A 302 ? 1.8768 1.2449 1.1949 -0.2302 0.2800  -0.2249 291 SER A O   
2047 C CB  . SER A 302 ? 1.9301 1.3556 1.3963 -0.1756 0.3731  -0.2153 291 SER A CB  
2048 O OG  . SER A 302 ? 1.9140 1.3855 1.5068 -0.1296 0.3739  -0.1995 291 SER A OG  
2049 N N   . PHE A 303 ? 1.6605 1.1491 1.1679 -0.1584 0.2513  -0.1822 292 PHE A N   
2050 C CA  . PHE A 303 ? 1.6276 1.0932 1.1556 -0.1500 0.2548  -0.1868 292 PHE A CA  
2051 C C   . PHE A 303 ? 1.4800 0.9914 1.1227 -0.1048 0.2498  -0.1619 292 PHE A C   
2052 O O   . PHE A 303 ? 1.3995 0.9723 1.1003 -0.0859 0.2261  -0.1385 292 PHE A O   
2053 C CB  . PHE A 303 ? 1.6687 1.1363 1.1439 -0.1788 0.2048  -0.1877 292 PHE A CB  
2054 C CG  . PHE A 303 ? 1.6205 1.1647 1.1422 -0.1678 0.1475  -0.1615 292 PHE A CG  
2055 C CD1 . PHE A 303 ? 1.5650 1.1467 1.1651 -0.1382 0.1353  -0.1419 292 PHE A CD1 
2056 C CD2 . PHE A 303 ? 1.6724 1.2429 1.1557 -0.1881 0.1066  -0.1557 292 PHE A CD2 
2057 C CE1 . PHE A 303 ? 1.5239 1.1650 1.1593 -0.1313 0.0922  -0.1213 292 PHE A CE1 
2058 C CE2 . PHE A 303 ? 1.6164 1.2518 1.1502 -0.1746 0.0625  -0.1336 292 PHE A CE2 
2059 C CZ  . PHE A 303 ? 1.5399 1.2090 1.1469 -0.1478 0.0594  -0.1188 292 PHE A CZ  
2060 N N   . ASN A 304 ? 1.4564 0.9286 1.1212 -0.0919 0.2693  -0.1661 293 ASN A N   
2061 C CA  . ASN A 304 ? 1.3857 0.8800 1.1485 -0.0516 0.2648  -0.1414 293 ASN A CA  
2062 C C   . ASN A 304 ? 1.3234 0.8237 1.0745 -0.0580 0.2198  -0.1276 293 ASN A C   
2063 O O   . ASN A 304 ? 1.3518 0.8195 1.0333 -0.0883 0.2151  -0.1456 293 ASN A O   
2064 C CB  . ASN A 304 ? 1.4774 0.9059 1.2688 -0.0322 0.3241  -0.1562 293 ASN A CB  
2065 C CG  . ASN A 304 ? 1.5150 0.9507 1.3644 -0.0134 0.3767  -0.1642 293 ASN A CG  
2066 O OD1 . ASN A 304 ? 1.4344 0.9391 1.3398 -0.0024 0.3606  -0.1466 293 ASN A OD1 
2067 N ND2 . ASN A 304 ? 1.6202 0.9806 1.4603 -0.0110 0.4461  -0.1927 293 ASN A ND2 
2068 N N   . VAL A 305 ? 1.2638 0.8032 1.0778 -0.0351 0.1868  -0.0965 294 VAL A N   
2069 C CA  . VAL A 305 ? 1.2725 0.7966 1.0701 -0.0429 0.1573  -0.0857 294 VAL A CA  
2070 C C   . VAL A 305 ? 1.2963 0.7940 1.1521 -0.0119 0.1573  -0.0616 294 VAL A C   
2071 O O   . VAL A 305 ? 1.2570 0.7936 1.1852 0.0144  0.1435  -0.0357 294 VAL A O   
2072 C CB  . VAL A 305 ? 1.2180 0.7981 1.0136 -0.0543 0.1105  -0.0684 294 VAL A CB  
2073 C CG1 . VAL A 305 ? 1.2351 0.7868 0.9975 -0.0730 0.0946  -0.0677 294 VAL A CG1 
2074 C CG2 . VAL A 305 ? 1.2060 0.8229 0.9656 -0.0759 0.1019  -0.0834 294 VAL A CG2 
2075 N N   . SER A 306 ? 1.3706 0.8023 1.1933 -0.0184 0.1660  -0.0671 295 SER A N   
2076 C CA  . SER A 306 ? 1.4337 0.8227 1.3011 0.0100  0.1605  -0.0405 295 SER A CA  
2077 C C   . SER A 306 ? 1.3922 0.7991 1.2611 0.0060  0.1060  -0.0049 295 SER A C   
2078 O O   . SER A 306 ? 1.4314 0.7801 1.2623 -0.0037 0.0945  0.0048  295 SER A O   
2079 C CB  . SER A 306 ? 1.5224 0.8177 1.3424 0.0026  0.1965  -0.0614 295 SER A CB  
2080 O OG  . SER A 306 ? 1.5534 0.8281 1.3424 -0.0091 0.2447  -0.0990 295 SER A OG  
2081 N N   . LEU A 307 ? 1.3159 0.7935 1.2197 0.0099  0.0764  0.0133  296 LEU A N   
2082 C CA  . LEU A 307 ? 1.3079 0.8010 1.1997 -0.0014 0.0288  0.0431  296 LEU A CA  
2083 C C   . LEU A 307 ? 1.2637 0.8219 1.2233 0.0161  0.0014  0.0703  296 LEU A C   
2084 O O   . LEU A 307 ? 1.2290 0.8356 1.2323 0.0281  0.0212  0.0587  296 LEU A O   
2085 C CB  . LEU A 307 ? 1.2789 0.7894 1.1010 -0.0404 0.0227  0.0238  296 LEU A CB  
2086 C CG  . LEU A 307 ? 1.3088 0.7762 1.0666 -0.0697 0.0437  -0.0051 296 LEU A CG  
2087 C CD1 . LEU A 307 ? 1.2519 0.7635 0.9807 -0.0996 0.0347  -0.0197 296 LEU A CD1 
2088 C CD2 . LEU A 307 ? 1.4084 0.7976 1.1281 -0.0790 0.0393  0.0073  296 LEU A CD2 
2089 N N   . ASP A 308 ? 1.2619 0.8145 1.2193 0.0110  -0.0441 0.1058  297 ASP A N   
2090 C CA  . ASP A 308 ? 1.2199 0.8303 1.2285 0.0169  -0.0784 0.1336  297 ASP A CA  
2091 C C   . ASP A 308 ? 1.1877 0.8197 1.1300 -0.0184 -0.0960 0.1294  297 ASP A C   
2092 O O   . ASP A 308 ? 1.1381 0.8095 1.1004 -0.0235 -0.1246 0.1497  297 ASP A O   
2093 C CB  . ASP A 308 ? 1.2815 0.8685 1.3379 0.0337  -0.1244 0.1811  297 ASP A CB  
2094 C CG  . ASP A 308 ? 1.3381 0.8536 1.3021 0.0031  -0.1615 0.2026  297 ASP A CG  
2095 O OD1 . ASP A 308 ? 1.3600 0.8320 1.2389 -0.0225 -0.1370 0.1760  297 ASP A OD1 
2096 O OD2 . ASP A 308 ? 1.3360 0.8366 1.3124 0.0018  -0.2152 0.2465  297 ASP A OD2 
2097 N N   . PHE A 309 ? 1.2214 0.8281 1.0909 -0.0435 -0.0762 0.1018  298 PHE A N   
2098 C CA  . PHE A 309 ? 1.2311 0.8427 1.0383 -0.0774 -0.0860 0.0963  298 PHE A CA  
2099 C C   . PHE A 309 ? 1.1911 0.8208 0.9746 -0.0894 -0.0531 0.0570  298 PHE A C   
2100 O O   . PHE A 309 ? 1.2292 0.8224 0.9792 -0.1029 -0.0352 0.0386  298 PHE A O   
2101 C CB  . PHE A 309 ? 1.3023 0.8437 1.0433 -0.1036 -0.1071 0.1151  298 PHE A CB  
2102 C CG  . PHE A 309 ? 1.2900 0.8191 0.9605 -0.1429 -0.1057 0.1059  298 PHE A CG  
2103 C CD1 . PHE A 309 ? 1.2420 0.8211 0.9189 -0.1493 -0.1028 0.0970  298 PHE A CD1 
2104 C CD2 . PHE A 309 ? 1.3533 0.8095 0.9468 -0.1757 -0.1036 0.1071  298 PHE A CD2 
2105 C CE1 . PHE A 309 ? 1.2572 0.8152 0.8737 -0.1837 -0.0936 0.0869  298 PHE A CE1 
2106 C CE2 . PHE A 309 ? 1.3595 0.7959 0.8893 -0.2142 -0.0911 0.0949  298 PHE A CE2 
2107 C CZ  . PHE A 309 ? 1.3149 0.8030 0.8606 -0.2164 -0.0847 0.0842  298 PHE A CZ  
2108 N N   . VAL A 310 ? 1.1018 0.7861 0.9047 -0.0858 -0.0487 0.0466  299 VAL A N   
2109 C CA  . VAL A 310 ? 1.0497 0.7564 0.8403 -0.0943 -0.0288 0.0161  299 VAL A CA  
2110 C C   . VAL A 310 ? 1.0221 0.7613 0.8038 -0.1059 -0.0371 0.0151  299 VAL A C   
2111 O O   . VAL A 310 ? 0.9828 0.7374 0.7724 -0.1029 -0.0524 0.0336  299 VAL A O   
2112 C CB  . VAL A 310 ? 1.0133 0.7391 0.8287 -0.0772 -0.0111 0.0016  299 VAL A CB  
2113 C CG1 . VAL A 310 ? 1.0038 0.7466 0.7971 -0.0917 -0.0029 -0.0244 299 VAL A CG1 
2114 C CG2 . VAL A 310 ? 1.0507 0.7338 0.8739 -0.0656 0.0062  -0.0012 299 VAL A CG2 
2115 N N   . ILE A 311 ? 1.0400 0.7874 0.8093 -0.1203 -0.0265 -0.0064 300 ILE A N   
2116 C CA  . ILE A 311 ? 1.0429 0.8184 0.8145 -0.1268 -0.0284 -0.0111 300 ILE A CA  
2117 C C   . ILE A 311 ? 1.0118 0.8241 0.8035 -0.1184 -0.0284 -0.0262 300 ILE A C   
2118 O O   . ILE A 311 ? 1.0314 0.8440 0.8251 -0.1233 -0.0233 -0.0427 300 ILE A O   
2119 C CB  . ILE A 311 ? 1.0896 0.8461 0.8442 -0.1505 -0.0154 -0.0225 300 ILE A CB  
2120 C CG1 . ILE A 311 ? 1.1605 0.8648 0.8721 -0.1658 -0.0195 -0.0042 300 ILE A CG1 
2121 C CG2 . ILE A 311 ? 1.0716 0.8565 0.8430 -0.1524 -0.0103 -0.0305 300 ILE A CG2 
2122 C CD1 . ILE A 311 ? 1.2349 0.9038 0.9110 -0.1971 0.0010  -0.0156 300 ILE A CD1 
2123 N N   . LEU A 312 ? 0.9506 0.7868 0.7489 -0.1101 -0.0368 -0.0192 301 LEU A N   
2124 C CA  . LEU A 312 ? 0.8994 0.7612 0.7061 -0.1044 -0.0440 -0.0276 301 LEU A CA  
2125 C C   . LEU A 312 ? 0.8912 0.7689 0.7178 -0.1088 -0.0459 -0.0335 301 LEU A C   
2126 O O   . LEU A 312 ? 0.9161 0.7834 0.7381 -0.1121 -0.0388 -0.0267 301 LEU A O   
2127 C CB  . LEU A 312 ? 0.8793 0.7477 0.6780 -0.0938 -0.0491 -0.0148 301 LEU A CB  
2128 C CG  . LEU A 312 ? 0.8871 0.7654 0.6742 -0.0913 -0.0578 -0.0201 301 LEU A CG  
2129 C CD1 . LEU A 312 ? 0.9112 0.7762 0.6821 -0.0969 -0.0519 -0.0336 301 LEU A CD1 
2130 C CD2 . LEU A 312 ? 0.8941 0.7731 0.6678 -0.0858 -0.0570 -0.0077 301 LEU A CD2 
2131 N N   . TYR A 313 ? 0.8736 0.7734 0.7245 -0.1110 -0.0545 -0.0460 302 TYR A N   
2132 C CA  . TYR A 313 ? 0.8491 0.7724 0.7467 -0.1122 -0.0533 -0.0538 302 TYR A CA  
2133 C C   . TYR A 313 ? 0.8522 0.8024 0.7735 -0.1011 -0.0810 -0.0499 302 TYR A C   
2134 O O   . TYR A 313 ? 0.8831 0.8389 0.7920 -0.1065 -0.1013 -0.0521 302 TYR A O   
2135 C CB  . TYR A 313 ? 0.8413 0.7719 0.7682 -0.1301 -0.0390 -0.0720 302 TYR A CB  
2136 C CG  . TYR A 313 ? 0.8342 0.8018 0.8338 -0.1303 -0.0352 -0.0829 302 TYR A CG  
2137 C CD1 . TYR A 313 ? 0.8471 0.8078 0.8689 -0.1280 -0.0089 -0.0857 302 TYR A CD1 
2138 C CD2 . TYR A 313 ? 0.8560 0.8641 0.9061 -0.1342 -0.0571 -0.0906 302 TYR A CD2 
2139 C CE1 . TYR A 313 ? 0.8581 0.8547 0.9639 -0.1239 0.0014  -0.0973 302 TYR A CE1 
2140 C CE2 . TYR A 313 ? 0.8600 0.9129 1.0008 -0.1311 -0.0565 -0.0987 302 TYR A CE2 
2141 C CZ  . TYR A 313 ? 0.8601 0.9088 1.0354 -0.1231 -0.0240 -0.1028 302 TYR A CZ  
2142 O OH  . TYR A 313 ? 0.8897 0.9861 1.1726 -0.1168 -0.0179 -0.1127 302 TYR A OH  
2143 N N   . PHE A 314 ? 0.8555 0.8139 0.8047 -0.0881 -0.0832 -0.0433 303 PHE A N   
2144 C CA  . PHE A 314 ? 0.8788 0.8547 0.8489 -0.0752 -0.1164 -0.0337 303 PHE A CA  
2145 C C   . PHE A 314 ? 0.8846 0.8904 0.9411 -0.0635 -0.1158 -0.0375 303 PHE A C   
2146 O O   . PHE A 314 ? 0.8645 0.8572 0.9375 -0.0570 -0.0859 -0.0404 303 PHE A O   
2147 C CB  . PHE A 314 ? 0.8904 0.8373 0.8055 -0.0657 -0.1234 -0.0167 303 PHE A CB  
2148 C CG  . PHE A 314 ? 0.9026 0.8513 0.8254 -0.0533 -0.1585 -0.0026 303 PHE A CG  
2149 C CD1 . PHE A 314 ? 0.9168 0.8650 0.8118 -0.0619 -0.1942 0.0024  303 PHE A CD1 
2150 C CD2 . PHE A 314 ? 0.8913 0.8322 0.8420 -0.0355 -0.1564 0.0062  303 PHE A CD2 
2151 C CE1 . PHE A 314 ? 0.9434 0.8841 0.8360 -0.0535 -0.2342 0.0200  303 PHE A CE1 
2152 C CE2 . PHE A 314 ? 0.9103 0.8459 0.8697 -0.0217 -0.1930 0.0231  303 PHE A CE2 
2153 C CZ  . PHE A 314 ? 0.9380 0.8738 0.8672 -0.0310 -0.2357 0.0319  303 PHE A CZ  
2154 N N   . PHE A 315 ? 0.9258 0.9698 1.0394 -0.0626 -0.1483 -0.0376 304 PHE A N   
2155 C CA  . PHE A 315 ? 0.9889 1.0740 1.2131 -0.0482 -0.1500 -0.0406 304 PHE A CA  
2156 C C   . PHE A 315 ? 1.0073 1.1003 1.2482 -0.0301 -0.2040 -0.0173 304 PHE A C   
2157 O O   . PHE A 315 ? 1.0424 1.1286 1.2295 -0.0428 -0.2456 -0.0072 304 PHE A O   
2158 C CB  . PHE A 315 ? 1.0498 1.1819 1.3443 -0.0670 -0.1467 -0.0594 304 PHE A CB  
2159 C CG  . PHE A 315 ? 1.1455 1.3363 1.5829 -0.0530 -0.1488 -0.0641 304 PHE A CG  
2160 C CD1 . PHE A 315 ? 1.1793 1.4138 1.6873 -0.0405 -0.2103 -0.0458 304 PHE A CD1 
2161 C CD2 . PHE A 315 ? 1.1767 1.3785 1.6830 -0.0554 -0.0889 -0.0871 304 PHE A CD2 
2162 C CE1 . PHE A 315 ? 1.1704 1.4683 1.8329 -0.0242 -0.2146 -0.0482 304 PHE A CE1 
2163 C CE2 . PHE A 315 ? 1.1678 1.4283 1.8230 -0.0414 -0.0823 -0.0945 304 PHE A CE2 
2164 C CZ  . PHE A 315 ? 1.1653 1.4798 1.9090 -0.0228 -0.1467 -0.0741 304 PHE A CZ  
2165 N N   . SER A 316 ? 1.0064 1.1038 1.3137 -0.0026 -0.2023 -0.0084 305 SER A N   
2166 C CA  . SER A 316 ? 1.0483 1.1428 1.3696 0.0170  -0.2570 0.0185  305 SER A CA  
2167 C C   . SER A 316 ? 1.0916 1.2401 1.5630 0.0415  -0.2751 0.0231  305 SER A C   
2168 O O   . SER A 316 ? 1.0335 1.2003 1.5936 0.0553  -0.2266 0.0064  305 SER A O   
2169 C CB  . SER A 316 ? 1.0707 1.1035 1.3159 0.0308  -0.2453 0.0324  305 SER A CB  
2170 O OG  . SER A 316 ? 1.1474 1.1678 1.4105 0.0524  -0.2951 0.0600  305 SER A OG  
2171 N N   . ASP A 317 ? 1.2332 1.4039 1.7304 0.0440  -0.3474 0.0468  306 ASP A N   
2172 C CA  . ASP A 317 ? 1.3057 1.5320 1.9543 0.0703  -0.3856 0.0612  306 ASP A CA  
2173 C C   . ASP A 317 ? 1.3599 1.5464 2.0316 0.1103  -0.3793 0.0794  306 ASP A C   
2174 O O   . ASP A 317 ? 1.3856 1.5017 1.9355 0.1107  -0.3917 0.0967  306 ASP A O   
2175 C CB  . ASP A 317 ? 1.3766 1.6208 2.0139 0.0553  -0.4786 0.0888  306 ASP A CB  
2176 C CG  . ASP A 317 ? 1.4263 1.7421 2.2382 0.0795  -0.5292 0.1067  306 ASP A CG  
2177 O OD1 . ASP A 317 ? 1.4274 1.7796 2.3783 0.1121  -0.4846 0.0954  306 ASP A OD1 
2178 O OD2 . ASP A 317 ? 1.5262 1.8610 2.3406 0.0646  -0.6139 0.1325  306 ASP A OD2 
2179 N N   . ARG A 318 ? 1.3903 1.6184 2.2203 0.1426  -0.3560 0.0741  307 ARG A N   
2180 C CA  . ARG A 318 ? 1.4960 1.6876 2.3733 0.1862  -0.3585 0.0950  307 ARG A CA  
2181 C C   . ARG A 318 ? 1.6171 1.7845 2.4602 0.1977  -0.4539 0.1408  307 ARG A C   
2182 O O   . ARG A 318 ? 1.6926 1.7831 2.4478 0.2113  -0.4616 0.1610  307 ARG A O   
2183 C CB  . ARG A 318 ? 1.4913 1.7438 2.5761 0.2222  -0.3308 0.0857  307 ARG A CB  
2184 C CG  . ARG A 318 ? 1.4740 1.7194 2.5931 0.2193  -0.2222 0.0423  307 ARG A CG  
2185 C CD  . ARG A 318 ? 1.5198 1.7534 2.7731 0.2670  -0.1782 0.0403  307 ARG A CD  
2186 N NE  . ARG A 318 ? 1.5051 1.7897 2.9061 0.2691  -0.0981 0.0015  307 ARG A NE  
2187 C CZ  . ARG A 318 ? 1.4716 1.7318 2.8121 0.2345  -0.0110 -0.0398 307 ARG A CZ  
2188 N NH1 . ARG A 318 ? 1.4277 1.6196 2.5721 0.1971  0.0061  -0.0472 307 ARG A NH1 
2189 N NH2 . ARG A 318 ? 1.4604 1.7645 2.9437 0.2356  0.0605  -0.0738 307 ARG A NH2 
2190 N N   . ILE A 319 ? 1.6804 1.9105 2.5916 0.1879  -0.5283 0.1578  308 ILE A N   
2191 C CA  . ILE A 319 ? 1.7687 1.9839 2.6816 0.2002  -0.6299 0.2059  308 ILE A CA  
2192 C C   . ILE A 319 ? 1.8357 1.9509 2.5294 0.1731  -0.6566 0.2238  308 ILE A C   
2193 O O   . ILE A 319 ? 1.9056 1.9584 2.5595 0.1937  -0.6988 0.2587  308 ILE A O   
2194 C CB  . ILE A 319 ? 1.7809 2.0830 2.7998 0.1843  -0.7134 0.2219  308 ILE A CB  
2195 C CG1 . ILE A 319 ? 1.7097 2.1207 2.9686 0.2108  -0.6833 0.2031  308 ILE A CG1 
2196 C CG2 . ILE A 319 ? 1.8751 2.1498 2.8918 0.1981  -0.8257 0.2781  308 ILE A CG2 
2197 C CD1 . ILE A 319 ? 1.6807 2.1891 3.0433 0.1830  -0.7488 0.2078  308 ILE A CD1 
2198 N N   . ASN A 320 ? 1.8191 1.9143 2.3749 0.1278  -0.6283 0.1999  309 ASN A N   
2199 C CA  . ASN A 320 ? 1.8600 1.8633 2.2189 0.1003  -0.6426 0.2125  309 ASN A CA  
2200 C C   . ASN A 320 ? 1.7778 1.7360 2.0269 0.0865  -0.5613 0.1841  309 ASN A C   
2201 O O   . ASN A 320 ? 1.6409 1.6344 1.9075 0.0747  -0.5024 0.1503  309 ASN A O   
2202 C CB  . ASN A 320 ? 1.9154 1.9090 2.1717 0.0521  -0.7019 0.2205  309 ASN A CB  
2203 C CG  . ASN A 320 ? 1.9783 2.0054 2.3119 0.0531  -0.8037 0.2564  309 ASN A CG  
2204 O OD1 . ASN A 320 ? 1.9662 2.0524 2.4722 0.0934  -0.8271 0.2709  309 ASN A OD1 
2205 N ND2 . ASN A 320 ? 2.0392 2.0269 2.2464 0.0061  -0.8649 0.2709  309 ASN A ND2 
2206 N N   . GLN A 321 ? 1.8368 1.7118 1.9654 0.0842  -0.5677 0.2024  310 GLN A N   
2207 C CA  . GLN A 321 ? 1.8280 1.6504 1.8249 0.0612  -0.5129 0.1852  310 GLN A CA  
2208 C C   . GLN A 321 ? 1.8444 1.5938 1.6793 0.0255  -0.5535 0.2039  310 GLN A C   
2209 O O   . GLN A 321 ? 1.8395 1.5457 1.6411 0.0271  -0.6201 0.2384  310 GLN A O   
2210 C CB  . GLN A 321 ? 1.9008 1.6878 1.9103 0.0885  -0.4610 0.1825  310 GLN A CB  
2211 C CG  . GLN A 321 ? 2.0483 1.7820 2.0699 0.1189  -0.5003 0.2171  310 GLN A CG  
2212 C CD  . GLN A 321 ? 2.0837 1.7659 2.0900 0.1371  -0.4406 0.2104  310 GLN A CD  
2213 O OE1 . GLN A 321 ? 1.9766 1.6794 2.0081 0.1354  -0.3733 0.1802  310 GLN A OE1 
2214 N NE2 . GLN A 321 ? 2.1672 1.7731 2.1220 0.1504  -0.4678 0.2398  310 GLN A NE2 
2215 N N   . ALA A 322 ? 1.7991 1.5296 1.5344 -0.0065 -0.5074 0.1804  311 ALA A N   
2216 C CA  . ALA A 322 ? 1.8176 1.4847 1.3997 -0.0490 -0.5201 0.1838  311 ALA A CA  
2217 C C   . ALA A 322 ? 1.7634 1.3921 1.2626 -0.0615 -0.4511 0.1665  311 ALA A C   
2218 O O   . ALA A 322 ? 1.6555 1.3125 1.2144 -0.0412 -0.4011 0.1522  311 ALA A O   
2219 C CB  . ALA A 322 ? 1.8022 1.5010 1.3717 -0.0802 -0.5312 0.1664  311 ALA A CB  
2220 N N   . GLN A 323 ? 1.7986 1.3626 1.1624 -0.0986 -0.4478 0.1673  312 GLN A N   
2221 C CA  . GLN A 323 ? 1.7690 1.3038 1.0637 -0.1152 -0.3831 0.1505  312 GLN A CA  
2222 C C   . GLN A 323 ? 1.5784 1.1780 0.9490 -0.1047 -0.3223 0.1218  312 GLN A C   
2223 O O   . GLN A 323 ? 1.5233 1.1209 0.8984 -0.0991 -0.2819 0.1172  312 GLN A O   
2224 C CB  . GLN A 323 ? 1.8933 1.3645 1.0501 -0.1622 -0.3769 0.1449  312 GLN A CB  
2225 C CG  . GLN A 323 ? 1.9236 1.3693 1.0192 -0.1834 -0.3085 0.1263  312 GLN A CG  
2226 C CD  . GLN A 323 ? 2.0882 1.4511 1.0362 -0.2326 -0.3017 0.1228  312 GLN A CD  
2227 O OE1 . GLN A 323 ? 2.1637 1.5000 1.0568 -0.2558 -0.3356 0.1238  312 GLN A OE1 
2228 N NE2 . GLN A 323 ? 2.1566 1.4738 1.0349 -0.2539 -0.2557 0.1177  312 GLN A NE2 
2229 N N   . GLY A 324 ? 1.4502 1.1007 0.8732 -0.1057 -0.3213 0.1051  313 GLY A N   
2230 C CA  . GLY A 324 ? 1.2844 0.9900 0.7775 -0.0963 -0.2752 0.0821  313 GLY A CA  
2231 C C   . GLY A 324 ? 1.2553 0.9549 0.6994 -0.1221 -0.2443 0.0621  313 GLY A C   
2232 O O   . GLY A 324 ? 1.3315 0.9962 0.7054 -0.1472 -0.2628 0.0611  313 GLY A O   
2233 N N   . PHE A 325 ? 1.1778 0.9041 0.6545 -0.1180 -0.1971 0.0470  314 PHE A N   
2234 C CA  . PHE A 325 ? 1.1723 0.8942 0.6212 -0.1361 -0.1611 0.0275  314 PHE A CA  
2235 C C   . PHE A 325 ? 1.1124 0.8507 0.5867 -0.1316 -0.1150 0.0218  314 PHE A C   
2236 O O   . PHE A 325 ? 1.0455 0.8034 0.5595 -0.1174 -0.1126 0.0309  314 PHE A O   
2237 C CB  . PHE A 325 ? 1.1349 0.8896 0.6313 -0.1338 -0.1635 0.0130  314 PHE A CB  
2238 C CG  . PHE A 325 ? 1.0602 0.8632 0.6441 -0.1117 -0.1496 0.0102  314 PHE A CG  
2239 C CD1 . PHE A 325 ? 1.0188 0.8347 0.6258 -0.1076 -0.1112 0.0033  314 PHE A CD1 
2240 C CD2 . PHE A 325 ? 1.0329 0.8649 0.6767 -0.0966 -0.1744 0.0158  314 PHE A CD2 
2241 C CE1 . PHE A 325 ? 0.9580 0.8045 0.6254 -0.0941 -0.1031 0.0037  314 PHE A CE1 
2242 C CE2 . PHE A 325 ? 0.9753 0.8380 0.6824 -0.0835 -0.1550 0.0109  314 PHE A CE2 
2243 C CZ  . PHE A 325 ? 0.9496 0.8143 0.6581 -0.0848 -0.1217 0.0057  314 PHE A CZ  
2244 N N   . ALA A 326 ? 1.1199 0.8499 0.5767 -0.1447 -0.0787 0.0063  315 ALA A N   
2245 C CA  . ALA A 326 ? 1.0738 0.8307 0.5780 -0.1388 -0.0391 0.0016  315 ALA A CA  
2246 C C   . ALA A 326 ? 1.0793 0.8443 0.6103 -0.1377 -0.0118 -0.0158 315 ALA A C   
2247 O O   . ALA A 326 ? 1.1368 0.8628 0.6122 -0.1560 0.0052  -0.0307 315 ALA A O   
2248 C CB  . ALA A 326 ? 1.1229 0.8533 0.5826 -0.1565 -0.0118 0.0021  315 ALA A CB  
2249 N N   . VAL A 327 ? 1.0234 0.8283 0.6296 -0.1194 -0.0065 -0.0138 316 VAL A N   
2250 C CA  . VAL A 327 ? 1.0169 0.8255 0.6571 -0.1134 0.0176  -0.0269 316 VAL A CA  
2251 C C   . VAL A 327 ? 0.9748 0.8126 0.6840 -0.1009 0.0432  -0.0213 316 VAL A C   
2252 O O   . VAL A 327 ? 0.9438 0.8131 0.6956 -0.0924 0.0266  -0.0045 316 VAL A O   
2253 C CB  . VAL A 327 ? 0.9925 0.8121 0.6568 -0.1053 -0.0042 -0.0286 316 VAL A CB  
2254 C CG1 . VAL A 327 ? 0.9681 0.8174 0.6703 -0.0945 -0.0281 -0.0133 316 VAL A CG1 
2255 C CG2 . VAL A 327 ? 0.9922 0.8094 0.6929 -0.0971 0.0205  -0.0377 316 VAL A CG2 
2256 N N   . LEU A 328 ? 0.9903 0.8140 0.7113 -0.1014 0.0833  -0.0356 317 LEU A N   
2257 C CA  . LEU A 328 ? 0.9749 0.8287 0.7760 -0.0882 0.1101  -0.0308 317 LEU A CA  
2258 C C   . LEU A 328 ? 0.9928 0.8442 0.8432 -0.0696 0.1184  -0.0343 317 LEU A C   
2259 O O   . LEU A 328 ? 1.0520 0.8610 0.8649 -0.0745 0.1418  -0.0551 317 LEU A O   
2260 C CB  . LEU A 328 ? 1.0314 0.8632 0.8126 -0.1028 0.1596  -0.0479 317 LEU A CB  
2261 C CG  . LEU A 328 ? 1.0217 0.8945 0.8931 -0.0955 0.1923  -0.0434 317 LEU A CG  
2262 C CD1 . LEU A 328 ? 1.0947 0.9288 0.9437 -0.1097 0.2585  -0.0713 317 LEU A CD1 
2263 C CD2 . LEU A 328 ? 0.9865 0.9050 0.9736 -0.0661 0.1832  -0.0277 317 LEU A CD2 
2264 N N   . TYR A 329 ? 0.9630 0.8505 0.8878 -0.0518 0.0979  -0.0132 318 TYR A N   
2265 C CA  . TYR A 329 ? 0.9742 0.8529 0.9461 -0.0328 0.1005  -0.0106 318 TYR A CA  
2266 C C   . TYR A 329 ? 0.9767 0.8862 1.0509 -0.0130 0.1197  0.0007  318 TYR A C   
2267 O O   . TYR A 329 ? 0.9362 0.8900 1.0546 -0.0148 0.1031  0.0191  318 TYR A O   
2268 C CB  . TYR A 329 ? 0.9487 0.8307 0.9131 -0.0317 0.0553  0.0071  318 TYR A CB  
2269 C CG  . TYR A 329 ? 0.9170 0.8357 0.9284 -0.0290 0.0217  0.0370  318 TYR A CG  
2270 C CD1 . TYR A 329 ? 0.9355 0.8717 1.0272 -0.0121 0.0150  0.0571  318 TYR A CD1 
2271 C CD2 . TYR A 329 ? 0.8914 0.8211 0.8644 -0.0454 -0.0053 0.0461  318 TYR A CD2 
2272 C CE1 . TYR A 329 ? 0.9253 0.8903 1.0504 -0.0168 -0.0239 0.0870  318 TYR A CE1 
2273 C CE2 . TYR A 329 ? 0.8861 0.8375 0.8848 -0.0512 -0.0355 0.0717  318 TYR A CE2 
2274 C CZ  . TYR A 329 ? 0.9043 0.8736 0.9750 -0.0395 -0.0483 0.0931  318 TYR A CZ  
2275 O OH  . TYR A 329 ? 0.9278 0.9145 1.0162 -0.0518 -0.0870 0.1216  318 TYR A OH  
2276 N N   . GLN A 330 ? 1.0538 0.9392 1.1697 0.0050  0.1533  -0.0097 319 GLN A N   
2277 C CA  . GLN A 330 ? 1.1089 1.0246 1.3491 0.0324  0.1714  0.0033  319 GLN A CA  
2278 C C   . GLN A 330 ? 1.1447 1.0347 1.4232 0.0566  0.1559  0.0169  319 GLN A C   
2279 O O   . GLN A 330 ? 1.2086 1.0411 1.4435 0.0586  0.1843  -0.0046 319 GLN A O   
2280 C CB  . GLN A 330 ? 1.1760 1.0787 1.4446 0.0344  0.2441  -0.0255 319 GLN A CB  
2281 C CG  . GLN A 330 ? 1.2039 1.1363 1.4558 0.0108  0.2605  -0.0325 319 GLN A CG  
2282 C CD  . GLN A 330 ? 1.2938 1.1745 1.4732 -0.0117 0.3276  -0.0709 319 GLN A CD  
2283 O OE1 . GLN A 330 ? 1.3666 1.1802 1.4701 -0.0195 0.3541  -0.0954 319 GLN A OE1 
2284 N NE2 . GLN A 330 ? 1.3092 1.2142 1.4978 -0.0294 0.3534  -0.0762 319 GLN A NE2 
2285 N N   . ALA A 331 ? 1.1273 1.0523 1.4769 0.0705  0.1082  0.0537  320 ALA A N   
2286 C CA  . ALA A 331 ? 1.1417 1.0370 1.5272 0.0927  0.0843  0.0749  320 ALA A CA  
2287 C C   . ALA A 331 ? 1.1739 1.0760 1.6886 0.1304  0.1194  0.0787  320 ALA A C   
2288 O O   . ALA A 331 ? 1.1354 1.0922 1.7445 0.1396  0.1423  0.0792  320 ALA A O   
2289 C CB  . ALA A 331 ? 1.1154 1.0344 1.5068 0.0848  0.0132  0.1154  320 ALA A CB  
2290 N N   . VAL A 332 ? 1.2253 1.0707 1.7492 0.1520  0.1249  0.0818  321 VAL A N   
2291 C CA  . VAL A 332 ? 1.2900 1.1254 1.9356 0.1929  0.1665  0.0821  321 VAL A CA  
2292 C C   . VAL A 332 ? 1.3482 1.1634 2.0600 0.2225  0.1145  0.1258  321 VAL A C   
2293 O O   . VAL A 332 ? 1.4128 1.1672 2.0283 0.2098  0.0842  0.1326  321 VAL A O   
2294 C CB  . VAL A 332 ? 1.3445 1.1009 1.9259 0.1918  0.2425  0.0354  321 VAL A CB  
2295 C CG1 . VAL A 332 ? 1.4075 1.1471 2.1187 0.2351  0.2992  0.0303  321 VAL A CG1 
2296 C CG2 . VAL A 332 ? 1.3273 1.0834 1.8169 0.1563  0.2867  -0.0054 321 VAL A CG2 
2297 N N   . LYS A 333 ? 1.3674 1.2282 2.2434 0.2608  0.1064  0.1548  322 LYS A N   
2298 C CA  . LYS A 333 ? 1.4145 1.2535 2.3662 0.2925  0.0497  0.2033  322 LYS A CA  
2299 C C   . LYS A 333 ? 1.4239 1.2215 2.4865 0.3427  0.1037  0.1967  322 LYS A C   
2300 O O   . LYS A 333 ? 1.4164 1.1205 2.4001 0.3463  0.1314  0.1792  322 LYS A O   
2301 C CB  . LYS A 333 ? 1.4382 1.3641 2.4969 0.2950  -0.0263 0.2545  322 LYS A CB  
2302 C CG  . LYS A 333 ? 1.4425 1.3884 2.3745 0.2427  -0.0812 0.2627  322 LYS A CG  
2303 C CD  . LYS A 333 ? 1.4601 1.4692 2.4567 0.2320  -0.1672 0.3155  322 LYS A CD  
2304 C CE  . LYS A 333 ? 1.4383 1.4496 2.2890 0.1770  -0.1997 0.3109  322 LYS A CE  
2305 N NZ  . LYS A 333 ? 1.4491 1.5200 2.3471 0.1562  -0.2757 0.3554  322 LYS A NZ  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -10 ?   ?   ?   A . n 
A 1 2   GLY 2   -9  ?   ?   ?   A . n 
A 1 3   ILE 3   -8  ?   ?   ?   A . n 
A 1 4   LEU 4   -7  ?   ?   ?   A . n 
A 1 5   PRO 5   -6  ?   ?   ?   A . n 
A 1 6   SER 6   -5  ?   ?   ?   A . n 
A 1 7   PRO 7   -4  ?   ?   ?   A . n 
A 1 8   GLY 8   -3  ?   ?   ?   A . n 
A 1 9   MET 9   -2  ?   ?   ?   A . n 
A 1 10  PRO 10  -1  ?   ?   ?   A . n 
A 1 11  ALA 11  0   ?   ?   ?   A . n 
A 1 12  LEU 12  1   ?   ?   ?   A . n 
A 1 13  LEU 13  2   ?   ?   ?   A . n 
A 1 14  SER 14  3   ?   ?   ?   A . n 
A 1 15  LEU 15  4   ?   ?   ?   A . n 
A 1 16  VAL 16  5   ?   ?   ?   A . n 
A 1 17  SER 17  6   ?   ?   ?   A . n 
A 1 18  LEU 18  7   ?   ?   ?   A . n 
A 1 19  LEU 19  8   ?   ?   ?   A . n 
A 1 20  SER 20  9   ?   ?   ?   A . n 
A 1 21  VAL 21  10  ?   ?   ?   A . n 
A 1 22  LEU 22  11  ?   ?   ?   A . n 
A 1 23  LEU 23  12  ?   ?   ?   A . n 
A 1 24  MET 24  13  ?   ?   ?   A . n 
A 1 25  GLY 25  14  ?   ?   ?   A . n 
A 1 26  CYS 26  15  ?   ?   ?   A . n 
A 1 27  VAL 27  16  ?   ?   ?   A . n 
A 1 28  ALA 28  17  ?   ?   ?   A . n 
A 1 29  GLU 29  18  ?   ?   ?   A . n 
A 1 30  THR 30  19  ?   ?   ?   A . n 
A 1 31  GLY 31  20  ?   ?   ?   A . n 
A 1 32  ALA 32  21  ?   ?   ?   A . n 
A 1 33  PRO 33  22  ?   ?   ?   A . n 
A 1 34  SER 34  23  ?   ?   ?   A . n 
A 1 35  PRO 35  24  ?   ?   ?   A . n 
A 1 36  GLY 36  25  ?   ?   ?   A . n 
A 1 37  LEU 37  26  ?   ?   ?   A . n 
A 1 38  GLY 38  27  ?   ?   ?   A . n 
A 1 39  PRO 39  28  ?   ?   ?   A . n 
A 1 40  GLY 40  29  29  GLY GLY A . n 
A 1 41  PRO 41  30  30  PRO PRO A . n 
A 1 42  GLU 42  31  31  GLU GLU A . n 
A 1 43  CYS 43  32  32  CYS CYS A . n 
A 1 44  PHE 44  33  33  PHE PHE A . n 
A 1 45  THR 45  34  34  THR THR A . n 
A 1 46  ALA 46  35  35  ALA ALA A . n 
A 1 47  ASN 47  36  36  ASN ASN A . n 
A 1 48  GLY 48  37  37  GLY GLY A . n 
A 1 49  ALA 49  38  38  ALA ALA A . n 
A 1 50  ASP 50  39  39  ASP ASP A . n 
A 1 51  TYR 51  40  40  TYR TYR A . n 
A 1 52  ARG 52  41  41  ARG ARG A . n 
A 1 53  GLY 53  42  42  GLY GLY A . n 
A 1 54  THR 54  43  43  THR THR A . n 
A 1 55  GLN 55  44  44  GLN GLN A . n 
A 1 56  ASN 56  45  45  ASN ASN A . n 
A 1 57  TRP 57  46  46  TRP TRP A . n 
A 1 58  THR 58  47  47  THR THR A . n 
A 1 59  ALA 59  48  48  ALA ALA A . n 
A 1 60  LEU 60  49  49  LEU LEU A . n 
A 1 61  GLN 61  50  50  GLN GLN A . n 
A 1 62  GLY 62  51  51  GLY GLY A . n 
A 1 63  GLY 63  52  52  GLY GLY A . n 
A 1 64  LYS 64  53  53  LYS LYS A . n 
A 1 65  PRO 65  54  54  PRO PRO A . n 
A 1 66  CYS 66  55  55  CYS CYS A . n 
A 1 67  LEU 67  56  56  LEU LEU A . n 
A 1 68  PHE 68  57  57  PHE PHE A . n 
A 1 69  TRP 69  58  58  TRP TRP A . n 
A 1 70  ASN 70  59  59  ASN ASN A . n 
A 1 71  GLU 71  60  60  GLU GLU A . n 
A 1 72  THR 72  61  61  THR THR A . n 
A 1 73  PHE 73  62  62  PHE PHE A . n 
A 1 74  GLN 74  63  63  GLN GLN A . n 
A 1 75  HIS 75  64  64  HIS HIS A . n 
A 1 76  PRO 76  65  65  PRO PRO A . n 
A 1 77  TYR 77  66  66  TYR TYR A . n 
A 1 78  ASN 78  67  67  ASN ASN A . n 
A 1 79  THR 79  68  68  THR THR A . n 
A 1 80  LEU 80  69  69  LEU LEU A . n 
A 1 81  LYS 81  70  70  LYS LYS A . n 
A 1 82  TYR 82  71  71  TYR TYR A . n 
A 1 83  PRO 83  72  72  PRO PRO A . n 
A 1 84  ASN 84  73  73  ASN ASN A . n 
A 1 85  GLY 85  74  74  GLY GLY A . n 
A 1 86  GLU 86  75  75  GLU GLU A . n 
A 1 87  GLY 87  76  76  GLY GLY A . n 
A 1 88  GLY 88  77  77  GLY GLY A . n 
A 1 89  LEU 89  78  78  LEU LEU A . n 
A 1 90  GLY 90  79  79  GLY GLY A . n 
A 1 91  GLU 91  80  80  GLU GLU A . n 
A 1 92  HIS 92  81  81  HIS HIS A . n 
A 1 93  ASN 93  82  82  ASN ASN A . n 
A 1 94  TYR 94  83  83  TYR TYR A . n 
A 1 95  CYS 95  84  84  CYS CYS A . n 
A 1 96  ARG 96  85  85  ARG ARG A . n 
A 1 97  ASN 97  86  86  ASN ASN A . n 
A 1 98  PRO 98  87  87  PRO PRO A . n 
A 1 99  ASP 99  88  88  ASP ASP A . n 
A 1 100 GLY 100 89  89  GLY GLY A . n 
A 1 101 ASP 101 90  90  ASP ASP A . n 
A 1 102 VAL 102 91  91  VAL VAL A . n 
A 1 103 SER 103 92  92  SER SER A . n 
A 1 104 PRO 104 93  93  PRO PRO A . n 
A 1 105 TRP 105 94  94  TRP TRP A . n 
A 1 106 CYS 106 95  95  CYS CYS A . n 
A 1 107 TYR 107 96  96  TYR TYR A . n 
A 1 108 VAL 108 97  97  VAL VAL A . n 
A 1 109 ALA 109 98  98  ALA ALA A . n 
A 1 110 GLU 110 99  99  GLU GLU A . n 
A 1 111 HIS 111 100 100 HIS HIS A . n 
A 1 112 GLU 112 101 101 GLU GLU A . n 
A 1 113 ASP 113 102 102 ASP ASP A . n 
A 1 114 GLY 114 103 103 GLY GLY A . n 
A 1 115 VAL 115 104 104 VAL VAL A . n 
A 1 116 TYR 116 105 105 TYR TYR A . n 
A 1 117 TRP 117 106 106 TRP TRP A . n 
A 1 118 LYS 118 107 107 LYS LYS A . n 
A 1 119 TYR 119 108 108 TYR TYR A . n 
A 1 120 CYS 120 109 109 CYS CYS A . n 
A 1 121 GLU 121 110 110 GLU GLU A . n 
A 1 122 ILE 122 111 111 ILE ILE A . n 
A 1 123 PRO 123 112 112 PRO PRO A . n 
A 1 124 ALA 124 113 113 ALA ALA A . n 
A 1 125 CYS 125 114 114 CYS CYS A . n 
A 1 126 GLN 126 115 115 GLN GLN A . n 
A 1 127 MET 127 116 116 MET MET A . n 
A 1 128 PRO 128 117 117 PRO PRO A . n 
A 1 129 GLY 129 118 118 GLY GLY A . n 
A 1 130 ASN 130 119 119 ASN ASN A . n 
A 1 131 LEU 131 120 120 LEU LEU A . n 
A 1 132 GLY 132 121 121 GLY GLY A . n 
A 1 133 CYS 133 122 122 CYS CYS A . n 
A 1 134 TYR 134 123 123 TYR TYR A . n 
A 1 135 LYS 135 124 124 LYS LYS A . n 
A 1 136 ASP 136 125 125 ASP ASP A . n 
A 1 137 HIS 137 126 126 HIS HIS A . n 
A 1 138 GLY 138 127 127 GLY GLY A . n 
A 1 139 ASN 139 128 128 ASN ASN A . n 
A 1 140 PRO 140 129 129 PRO PRO A . n 
A 1 141 PRO 141 130 130 PRO PRO A . n 
A 1 142 PRO 142 131 131 PRO PRO A . n 
A 1 143 LEU 143 132 132 LEU LEU A . n 
A 1 144 THR 144 133 133 THR THR A . n 
A 1 145 GLY 145 134 134 GLY GLY A . n 
A 1 146 THR 146 135 135 THR THR A . n 
A 1 147 SER 147 136 136 SER SER A . n 
A 1 148 LYS 148 137 137 LYS LYS A . n 
A 1 149 THR 149 138 138 THR THR A . n 
A 1 150 SER 150 139 139 SER SER A . n 
A 1 151 ASN 151 140 140 ASN ASN A . n 
A 1 152 LYS 152 141 141 LYS LYS A . n 
A 1 153 LEU 153 142 142 LEU LEU A . n 
A 1 154 THR 154 143 143 THR THR A . n 
A 1 155 ILE 155 144 144 ILE ILE A . n 
A 1 156 GLN 156 145 145 GLN GLN A . n 
A 1 157 THR 157 146 146 THR THR A . n 
A 1 158 CYS 158 147 147 CYS CYS A . n 
A 1 159 ILE 159 148 148 ILE ILE A . n 
A 1 160 SER 160 149 149 SER SER A . n 
A 1 161 PHE 161 150 150 PHE PHE A . n 
A 1 162 CYS 162 151 151 CYS CYS A . n 
A 1 163 ARG 163 152 152 ARG ARG A . n 
A 1 164 SER 164 153 153 SER SER A . n 
A 1 165 GLN 165 154 154 GLN GLN A . n 
A 1 166 ARG 166 155 155 ARG ARG A . n 
A 1 167 PHE 167 156 156 PHE PHE A . n 
A 1 168 LYS 168 157 157 LYS LYS A . n 
A 1 169 PHE 169 158 158 PHE PHE A . n 
A 1 170 ALA 170 159 159 ALA ALA A . n 
A 1 171 GLY 171 160 160 GLY GLY A . n 
A 1 172 MET 172 161 161 MET MET A . n 
A 1 173 GLU 173 162 162 GLU GLU A . n 
A 1 174 SER 174 163 163 SER SER A . n 
A 1 175 GLY 175 164 164 GLY GLY A . n 
A 1 176 TYR 176 165 165 TYR TYR A . n 
A 1 177 ALA 177 166 166 ALA ALA A . n 
A 1 178 CYS 178 167 167 CYS CYS A . n 
A 1 179 PHE 179 168 168 PHE PHE A . n 
A 1 180 CYS 180 169 169 CYS CYS A . n 
A 1 181 GLY 181 170 170 GLY GLY A . n 
A 1 182 ASN 182 171 171 ASN ASN A . n 
A 1 183 ASN 183 172 172 ASN ASN A . n 
A 1 184 PRO 184 173 173 PRO PRO A . n 
A 1 185 ASP 185 174 174 ASP ASP A . n 
A 1 186 TYR 186 175 175 TYR TYR A . n 
A 1 187 TRP 187 176 176 TRP TRP A . n 
A 1 188 LYS 188 177 177 LYS LYS A . n 
A 1 189 TYR 189 178 178 TYR TYR A . n 
A 1 190 GLY 190 179 179 GLY GLY A . n 
A 1 191 GLU 191 180 180 GLU GLU A . n 
A 1 192 ALA 192 181 181 ALA ALA A . n 
A 1 193 ALA 193 182 182 ALA ALA A . n 
A 1 194 SER 194 183 183 SER SER A . n 
A 1 195 THR 195 184 184 THR THR A . n 
A 1 196 GLU 196 185 185 GLU GLU A . n 
A 1 197 CYS 197 186 186 CYS CYS A . n 
A 1 198 ASN 198 187 187 ASN ASN A . n 
A 1 199 SER 199 188 188 SER SER A . n 
A 1 200 VAL 200 189 189 VAL VAL A . n 
A 1 201 CYS 201 190 190 CYS CYS A . n 
A 1 202 PHE 202 191 191 PHE PHE A . n 
A 1 203 GLY 203 192 192 GLY GLY A . n 
A 1 204 ASP 204 193 193 ASP ASP A . n 
A 1 205 HIS 205 194 194 HIS HIS A . n 
A 1 206 THR 206 195 195 THR THR A . n 
A 1 207 GLN 207 196 196 GLN GLN A . n 
A 1 208 PRO 208 197 197 PRO PRO A . n 
A 1 209 CYS 209 198 198 CYS CYS A . n 
A 1 210 GLY 210 199 199 GLY GLY A . n 
A 1 211 GLY 211 200 200 GLY GLY A . n 
A 1 212 ASP 212 201 201 ASP ASP A . n 
A 1 213 GLY 213 202 202 GLY GLY A . n 
A 1 214 ARG 214 203 203 ARG ARG A . n 
A 1 215 ILE 215 204 204 ILE ILE A . n 
A 1 216 ILE 216 205 205 ILE ILE A . n 
A 1 217 LEU 217 206 206 LEU LEU A . n 
A 1 218 PHE 218 207 207 PHE PHE A . n 
A 1 219 ASP 219 208 208 ASP ASP A . n 
A 1 220 THR 220 209 209 THR THR A . n 
A 1 221 LEU 221 210 210 LEU LEU A . n 
A 1 222 VAL 222 211 211 VAL VAL A . n 
A 1 223 GLY 223 212 212 GLY GLY A . n 
A 1 224 ALA 224 213 213 ALA ALA A . n 
A 1 225 CYS 225 214 214 CYS CYS A . n 
A 1 226 GLY 226 215 215 GLY GLY A . n 
A 1 227 GLY 227 216 216 GLY GLY A . n 
A 1 228 ASN 228 217 217 ASN ASN A . n 
A 1 229 TYR 229 218 218 TYR TYR A . n 
A 1 230 SER 230 219 219 SER SER A . n 
A 1 231 ALA 231 220 220 ALA ALA A . n 
A 1 232 MET 232 221 221 MET MET A . n 
A 1 233 SER 233 222 222 SER SER A . n 
A 1 234 SER 234 223 223 SER SER A . n 
A 1 235 VAL 235 224 224 VAL VAL A . n 
A 1 236 VAL 236 225 225 VAL VAL A . n 
A 1 237 TYR 237 226 226 TYR TYR A . n 
A 1 238 SER 238 227 227 SER SER A . n 
A 1 239 PRO 239 228 228 PRO PRO A . n 
A 1 240 ASP 240 229 229 ASP ASP A . n 
A 1 241 PHE 241 230 230 PHE PHE A . n 
A 1 242 PRO 242 231 231 PRO PRO A . n 
A 1 243 ASP 243 232 232 ASP ASP A . n 
A 1 244 THR 244 233 233 THR THR A . n 
A 1 245 TYR 245 234 234 TYR TYR A . n 
A 1 246 ALA 246 235 235 ALA ALA A . n 
A 1 247 THR 247 236 236 THR THR A . n 
A 1 248 GLY 248 237 237 GLY GLY A . n 
A 1 249 ARG 249 238 238 ARG ARG A . n 
A 1 250 VAL 250 239 239 VAL VAL A . n 
A 1 251 CYS 251 240 240 CYS CYS A . n 
A 1 252 TYR 252 241 241 TYR TYR A . n 
A 1 253 TRP 253 242 242 TRP TRP A . n 
A 1 254 THR 254 243 243 THR THR A . n 
A 1 255 ILE 255 244 244 ILE ILE A . n 
A 1 256 ARG 256 245 245 ARG ARG A . n 
A 1 257 VAL 257 246 246 VAL VAL A . n 
A 1 258 PRO 258 247 247 PRO PRO A . n 
A 1 259 GLY 259 248 248 GLY GLY A . n 
A 1 260 ALA 260 249 249 ALA ALA A . n 
A 1 261 SER 261 250 250 SER SER A . n 
A 1 262 HIS 262 251 251 HIS HIS A . n 
A 1 263 ILE 263 252 252 ILE ILE A . n 
A 1 264 HIS 264 253 253 HIS HIS A . n 
A 1 265 PHE 265 254 254 PHE PHE A . n 
A 1 266 SER 266 255 255 SER SER A . n 
A 1 267 PHE 267 256 256 PHE PHE A . n 
A 1 268 PRO 268 257 257 PRO PRO A . n 
A 1 269 LEU 269 258 258 LEU LEU A . n 
A 1 270 PHE 270 259 259 PHE PHE A . n 
A 1 271 ASP 271 260 260 ASP ASP A . n 
A 1 272 ILE 272 261 261 ILE ILE A . n 
A 1 273 ARG 273 262 262 ARG ARG A . n 
A 1 274 ASP 274 263 263 ASP ASP A . n 
A 1 275 SER 275 264 264 SER SER A . n 
A 1 276 ALA 276 265 265 ALA ALA A . n 
A 1 277 ASP 277 266 266 ASP ASP A . n 
A 1 278 MET 278 267 267 MET MET A . n 
A 1 279 VAL 279 268 268 VAL VAL A . n 
A 1 280 GLU 280 269 269 GLU GLU A . n 
A 1 281 LEU 281 270 270 LEU LEU A . n 
A 1 282 LEU 282 271 271 LEU LEU A . n 
A 1 283 ASP 283 272 272 ASP ASP A . n 
A 1 284 GLY 284 273 273 GLY GLY A . n 
A 1 285 TYR 285 274 274 TYR TYR A . n 
A 1 286 THR 286 275 275 THR THR A . n 
A 1 287 HIS 287 276 276 HIS HIS A . n 
A 1 288 ARG 288 277 277 ARG ARG A . n 
A 1 289 VAL 289 278 278 VAL VAL A . n 
A 1 290 LEU 290 279 279 LEU LEU A . n 
A 1 291 ALA 291 280 280 ALA ALA A . n 
A 1 292 ARG 292 281 281 ARG ARG A . n 
A 1 293 PHE 293 282 282 PHE PHE A . n 
A 1 294 HIS 294 283 283 HIS HIS A . n 
A 1 295 GLY 295 284 284 GLY GLY A . n 
A 1 296 ARG 296 285 285 ARG ARG A . n 
A 1 297 SER 297 286 286 SER SER A . n 
A 1 298 ARG 298 287 287 ARG ARG A . n 
A 1 299 PRO 299 288 288 PRO PRO A . n 
A 1 300 PRO 300 289 289 PRO PRO A . n 
A 1 301 LEU 301 290 290 LEU LEU A . n 
A 1 302 SER 302 291 291 SER SER A . n 
A 1 303 PHE 303 292 292 PHE PHE A . n 
A 1 304 ASN 304 293 293 ASN ASN A . n 
A 1 305 VAL 305 294 294 VAL VAL A . n 
A 1 306 SER 306 295 295 SER SER A . n 
A 1 307 LEU 307 296 296 LEU LEU A . n 
A 1 308 ASP 308 297 297 ASP ASP A . n 
A 1 309 PHE 309 298 298 PHE PHE A . n 
A 1 310 VAL 310 299 299 VAL VAL A . n 
A 1 311 ILE 311 300 300 ILE ILE A . n 
A 1 312 LEU 312 301 301 LEU LEU A . n 
A 1 313 TYR 313 302 302 TYR TYR A . n 
A 1 314 PHE 314 303 303 PHE PHE A . n 
A 1 315 PHE 315 304 304 PHE PHE A . n 
A 1 316 SER 316 305 305 SER SER A . n 
A 1 317 ASP 317 306 306 ASP ASP A . n 
A 1 318 ARG 318 307 307 ARG ARG A . n 
A 1 319 ILE 319 308 308 ILE ILE A . n 
A 1 320 ASN 320 309 309 ASN ASN A . n 
A 1 321 GLN 321 310 310 GLN GLN A . n 
A 1 322 ALA 322 311 311 ALA ALA A . n 
A 1 323 GLN 323 312 312 GLN GLN A . n 
A 1 324 GLY 324 313 313 GLY GLY A . n 
A 1 325 PHE 325 314 314 PHE PHE A . n 
A 1 326 ALA 326 315 315 ALA ALA A . n 
A 1 327 VAL 327 316 316 VAL VAL A . n 
A 1 328 LEU 328 317 317 LEU LEU A . n 
A 1 329 TYR 329 318 318 TYR TYR A . n 
A 1 330 GLN 330 319 319 GLN GLN A . n 
A 1 331 ALA 331 320 320 ALA ALA A . n 
A 1 332 VAL 332 321 321 VAL VAL A . n 
A 1 333 LYS 333 322 322 LYS LYS A . n 
A 1 334 GLU 334 323 ?   ?   ?   A . n 
A 1 335 GLU 335 324 ?   ?   ?   A . n 
A 1 336 GLY 336 325 ?   ?   ?   A . n 
A 1 337 SER 337 326 ?   ?   ?   A . n 
A 1 338 GLU 338 327 ?   ?   ?   A . n 
A 1 339 ASN 339 328 ?   ?   ?   A . n 
A 1 340 LEU 340 329 ?   ?   ?   A . n 
A 1 341 TYR 341 330 ?   ?   ?   A . n 
A 1 342 PHE 342 331 ?   ?   ?   A . n 
A 1 343 GLN 343 332 ?   ?   ?   A . n 
A 1 344 GLY 344 333 ?   ?   ?   A . n 
A 1 345 GLY 345 334 ?   ?   ?   A . n 
A 1 346 SER 346 335 ?   ?   ?   A . n 
A 1 347 LEU 347 336 ?   ?   ?   A . n 
A 1 348 PRO 348 337 ?   ?   ?   A . n 
A 1 349 GLN 349 338 ?   ?   ?   A . n 
A 1 350 GLU 350 339 ?   ?   ?   A . n 
A 1 351 ARG 351 340 ?   ?   ?   A . n 
A 1 352 PRO 352 341 ?   ?   ?   A . n 
A 1 353 ALA 353 342 ?   ?   ?   A . n 
A 1 354 VAL 354 343 ?   ?   ?   A . n 
A 1 355 ASN 355 344 ?   ?   ?   A . n 
A 1 356 GLN 356 345 ?   ?   ?   A . n 
A 1 357 THR 357 346 ?   ?   ?   A . n 
A 1 358 VAL 358 347 ?   ?   ?   A . n 
A 1 359 ALA 359 348 ?   ?   ?   A . n 
A 1 360 GLU 360 349 ?   ?   ?   A . n 
A 1 361 VAL 361 350 ?   ?   ?   A . n 
A 1 362 ILE 362 351 ?   ?   ?   A . n 
A 1 363 THR 363 352 ?   ?   ?   A . n 
A 1 364 GLU 364 353 ?   ?   ?   A . n 
A 1 365 GLN 365 354 ?   ?   ?   A . n 
A 1 366 ALA 366 355 ?   ?   ?   A . n 
A 1 367 ASN 367 356 ?   ?   ?   A . n 
A 1 368 LEU 368 357 ?   ?   ?   A . n 
A 1 369 SER 369 358 ?   ?   ?   A . n 
A 1 370 VAL 370 359 ?   ?   ?   A . n 
A 1 371 SER 371 360 ?   ?   ?   A . n 
A 1 372 ALA 372 361 ?   ?   ?   A . n 
A 1 373 ALA 373 362 ?   ?   ?   A . n 
A 1 374 ARG 374 363 ?   ?   ?   A . n 
A 1 375 SER 375 364 ?   ?   ?   A . n 
A 1 376 SER 376 365 ?   ?   ?   A . n 
A 1 377 LYS 377 366 ?   ?   ?   A . n 
A 1 378 VAL 378 367 ?   ?   ?   A . n 
A 1 379 LEU 379 368 ?   ?   ?   A . n 
A 1 380 TYR 380 369 ?   ?   ?   A . n 
A 1 381 VAL 381 370 ?   ?   ?   A . n 
A 1 382 ILE 382 371 ?   ?   ?   A . n 
A 1 383 THR 383 372 ?   ?   ?   A . n 
A 1 384 THR 384 373 ?   ?   ?   A . n 
A 1 385 SER 385 374 ?   ?   ?   A . n 
A 1 386 PRO 386 375 ?   ?   ?   A . n 
A 1 387 SER 387 376 ?   ?   ?   A . n 
A 1 388 HIS 388 377 ?   ?   ?   A . n 
A 1 389 PRO 389 378 ?   ?   ?   A . n 
A 1 390 PRO 390 379 ?   ?   ?   A . n 
A 1 391 GLN 391 380 ?   ?   ?   A . n 
A 1 392 THR 392 381 ?   ?   ?   A . n 
A 1 393 VAL 393 382 ?   ?   ?   A . n 
A 1 394 PRO 394 383 ?   ?   ?   A . n 
A 1 395 GLY 395 384 ?   ?   ?   A . n 
A 1 396 THR 396 385 ?   ?   ?   A . n 
A 1 397 HIS 397 386 ?   ?   ?   A . n 
A 1 398 HIS 398 387 ?   ?   ?   A . n 
A 1 399 HIS 399 388 ?   ?   ?   A . n 
A 1 400 HIS 400 389 ?   ?   ?   A . n 
A 1 401 HIS 401 390 ?   ?   ?   A . n 
A 1 402 HIS 402 391 ?   ?   ?   A . n 
A 1 403 HIS 403 392 ?   ?   ?   A . n 
A 1 404 HIS 404 393 ?   ?   ?   A . n 
A 1 405 HIS 405 394 ?   ?   ?   A . n 
A 1 406 HIS 406 395 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CL  1 1323 1323 CL  CL  A . 
C 2 CL  1 1324 1324 CL  CL  A . 
D 2 CL  1 1325 1325 CL  CL  A . 
E 2 CL  1 1326 1326 CL  CL  A . 
F 3 NAG 1 1327 1327 NAG NAG A . 
G 3 NAG 1 1328 1328 NAG NAG A . 
H 2 CL  1 1330 1330 CL  CL  A . 
I 4 HOH 1 2001 2001 HOH HOH A . 
I 4 HOH 2 2002 2002 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 56 A ASN 45 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 70 A ASN 59 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3100  ? 
1 MORE         -54.2 ? 
1 'SSA (A^2)'  26510 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z  1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    CL 
_pdbx_struct_special_symmetry.auth_seq_id     1324 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   C 
_pdbx_struct_special_symmetry.label_comp_id   CL 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-07-20 
2 'Structure model' 1 1 2016-07-27 
3 'Structure model' 1 2 2016-08-24 
4 'Structure model' 1 3 2016-09-28 
5 'Structure model' 1 4 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Other                  
2 2 'Structure model' 'Structure summary'    
3 3 'Structure model' 'Database references'  
4 4 'Structure model' 'Database references'  
5 5 'Structure model' 'Data collection'      
6 5 'Structure model' 'Derived calculations' 
7 5 'Structure model' Other                  
8 5 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' chem_comp                 
2 5 'Structure model' entity                    
3 5 'Structure model' pdbx_chem_comp_identifier 
4 5 'Structure model' pdbx_database_status      
5 5 'Structure model' pdbx_entity_nonpoly       
6 5 'Structure model' struct_conn               
7 5 'Structure model' struct_site               
8 5 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_chem_comp.name'                      
2 5 'Structure model' '_chem_comp.type'                      
3 5 'Structure model' '_entity.pdbx_description'             
4 5 'Structure model' '_pdbx_database_status.status_code_sf' 
5 5 'Structure model' '_pdbx_entity_nonpoly.name'            
6 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'  
7 5 'Structure model' '_struct_conn.pdbx_role'               
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 2.3625  21.8018 32.1761 0.2548 0.1882 0.1827 0.0732  -0.0042 0.0555  2.1671 3.0077  11.9046 
-1.9513 1.5928  -1.1920 -0.1522 -0.1260 -0.1459 0.3758  0.2365  0.5290  0.0775  -0.5314 -0.0842 
'X-RAY DIFFRACTION' 2 ? refined 1.4135  15.8893 7.1239  0.0801 0.1585 0.0207 -0.0845 -0.0075 0.0035  6.1168 2.9939  5.3841  
-2.5266 0.0175  -0.0818 -0.1891 0.0923  -0.2157 -0.0102 0.0373  0.1030  0.2807  -0.5935 0.1518  
'X-RAY DIFFRACTION' 3 ? refined 14.3684 38.8378 9.0740  0.4268 0.2976 0.1784 -0.0983 -0.0681 -0.0314 3.0427 10.6686 5.5280  4.2725 
-1.2619 -0.1311 0.2923  -0.4885 0.2349  0.7486  -0.0046 -0.2582 -0.2473 0.2437  -0.2877 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 31  ? ? A 117 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 118 ? ? A 212 ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 A 213 ? ? A 322 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC  refinement       5.8.0135 ? 1 
XDS     'data reduction' .        ? 2 
Aimless 'data scaling'   .        ? 3 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   NE2 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HIS 
_pdbx_validate_close_contact.auth_seq_id_1    253 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   OG 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   SER 
_pdbx_validate_close_contact.auth_seq_id_2    291 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 THR A 61  ? ? -96.60  57.66  
2  1 TYR A 71  ? ? -114.70 73.39  
3  1 ALA A 98  ? ? 84.95   122.19 
4  1 GLU A 101 ? ? 87.04   -21.65 
5  1 CYS A 114 ? ? -103.06 79.37  
6  1 ASP A 174 ? ? -97.67  34.06  
7  1 TRP A 176 ? ? -68.66  2.16   
8  1 CYS A 186 ? ? -99.11  35.11  
9  1 ASP A 193 ? ? -161.75 105.38 
10 1 HIS A 194 ? ? -67.99  5.98   
11 1 SER A 227 ? ? -48.54  156.25 
12 1 PHE A 259 ? ? -160.13 90.54  
13 1 HIS A 276 ? ? 54.38   17.60  
14 1 LEU A 290 ? ? -26.25  -50.63 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET -10 ? A MET 1   
2   1 Y 1 A GLY -9  ? A GLY 2   
3   1 Y 1 A ILE -8  ? A ILE 3   
4   1 Y 1 A LEU -7  ? A LEU 4   
5   1 Y 1 A PRO -6  ? A PRO 5   
6   1 Y 1 A SER -5  ? A SER 6   
7   1 Y 1 A PRO -4  ? A PRO 7   
8   1 Y 1 A GLY -3  ? A GLY 8   
9   1 Y 1 A MET -2  ? A MET 9   
10  1 Y 1 A PRO -1  ? A PRO 10  
11  1 Y 1 A ALA 0   ? A ALA 11  
12  1 Y 1 A LEU 1   ? A LEU 12  
13  1 Y 1 A LEU 2   ? A LEU 13  
14  1 Y 1 A SER 3   ? A SER 14  
15  1 Y 1 A LEU 4   ? A LEU 15  
16  1 Y 1 A VAL 5   ? A VAL 16  
17  1 Y 1 A SER 6   ? A SER 17  
18  1 Y 1 A LEU 7   ? A LEU 18  
19  1 Y 1 A LEU 8   ? A LEU 19  
20  1 Y 1 A SER 9   ? A SER 20  
21  1 Y 1 A VAL 10  ? A VAL 21  
22  1 Y 1 A LEU 11  ? A LEU 22  
23  1 Y 1 A LEU 12  ? A LEU 23  
24  1 Y 1 A MET 13  ? A MET 24  
25  1 Y 1 A GLY 14  ? A GLY 25  
26  1 Y 1 A CYS 15  ? A CYS 26  
27  1 Y 1 A VAL 16  ? A VAL 27  
28  1 Y 1 A ALA 17  ? A ALA 28  
29  1 Y 1 A GLU 18  ? A GLU 29  
30  1 Y 1 A THR 19  ? A THR 30  
31  1 Y 1 A GLY 20  ? A GLY 31  
32  1 Y 1 A ALA 21  ? A ALA 32  
33  1 Y 1 A PRO 22  ? A PRO 33  
34  1 Y 1 A SER 23  ? A SER 34  
35  1 Y 1 A PRO 24  ? A PRO 35  
36  1 Y 1 A GLY 25  ? A GLY 36  
37  1 Y 1 A LEU 26  ? A LEU 37  
38  1 Y 1 A GLY 27  ? A GLY 38  
39  1 Y 1 A PRO 28  ? A PRO 39  
40  1 Y 1 A GLU 323 ? A GLU 334 
41  1 Y 1 A GLU 324 ? A GLU 335 
42  1 Y 1 A GLY 325 ? A GLY 336 
43  1 Y 1 A SER 326 ? A SER 337 
44  1 Y 1 A GLU 327 ? A GLU 338 
45  1 Y 1 A ASN 328 ? A ASN 339 
46  1 Y 1 A LEU 329 ? A LEU 340 
47  1 Y 1 A TYR 330 ? A TYR 341 
48  1 Y 1 A PHE 331 ? A PHE 342 
49  1 Y 1 A GLN 332 ? A GLN 343 
50  1 Y 1 A GLY 333 ? A GLY 344 
51  1 Y 1 A GLY 334 ? A GLY 345 
52  1 Y 1 A SER 335 ? A SER 346 
53  1 Y 1 A LEU 336 ? A LEU 347 
54  1 Y 1 A PRO 337 ? A PRO 348 
55  1 Y 1 A GLN 338 ? A GLN 349 
56  1 Y 1 A GLU 339 ? A GLU 350 
57  1 Y 1 A ARG 340 ? A ARG 351 
58  1 Y 1 A PRO 341 ? A PRO 352 
59  1 Y 1 A ALA 342 ? A ALA 353 
60  1 Y 1 A VAL 343 ? A VAL 354 
61  1 Y 1 A ASN 344 ? A ASN 355 
62  1 Y 1 A GLN 345 ? A GLN 356 
63  1 Y 1 A THR 346 ? A THR 357 
64  1 Y 1 A VAL 347 ? A VAL 358 
65  1 Y 1 A ALA 348 ? A ALA 359 
66  1 Y 1 A GLU 349 ? A GLU 360 
67  1 Y 1 A VAL 350 ? A VAL 361 
68  1 Y 1 A ILE 351 ? A ILE 362 
69  1 Y 1 A THR 352 ? A THR 363 
70  1 Y 1 A GLU 353 ? A GLU 364 
71  1 Y 1 A GLN 354 ? A GLN 365 
72  1 Y 1 A ALA 355 ? A ALA 366 
73  1 Y 1 A ASN 356 ? A ASN 367 
74  1 Y 1 A LEU 357 ? A LEU 368 
75  1 Y 1 A SER 358 ? A SER 369 
76  1 Y 1 A VAL 359 ? A VAL 370 
77  1 Y 1 A SER 360 ? A SER 371 
78  1 Y 1 A ALA 361 ? A ALA 372 
79  1 Y 1 A ALA 362 ? A ALA 373 
80  1 Y 1 A ARG 363 ? A ARG 374 
81  1 Y 1 A SER 364 ? A SER 375 
82  1 Y 1 A SER 365 ? A SER 376 
83  1 Y 1 A LYS 366 ? A LYS 377 
84  1 Y 1 A VAL 367 ? A VAL 378 
85  1 Y 1 A LEU 368 ? A LEU 379 
86  1 Y 1 A TYR 369 ? A TYR 380 
87  1 Y 1 A VAL 370 ? A VAL 381 
88  1 Y 1 A ILE 371 ? A ILE 382 
89  1 Y 1 A THR 372 ? A THR 383 
90  1 Y 1 A THR 373 ? A THR 384 
91  1 Y 1 A SER 374 ? A SER 385 
92  1 Y 1 A PRO 375 ? A PRO 386 
93  1 Y 1 A SER 376 ? A SER 387 
94  1 Y 1 A HIS 377 ? A HIS 388 
95  1 Y 1 A PRO 378 ? A PRO 389 
96  1 Y 1 A PRO 379 ? A PRO 390 
97  1 Y 1 A GLN 380 ? A GLN 391 
98  1 Y 1 A THR 381 ? A THR 392 
99  1 Y 1 A VAL 382 ? A VAL 393 
100 1 Y 1 A PRO 383 ? A PRO 394 
101 1 Y 1 A GLY 384 ? A GLY 395 
102 1 Y 1 A THR 385 ? A THR 396 
103 1 Y 1 A HIS 386 ? A HIS 397 
104 1 Y 1 A HIS 387 ? A HIS 398 
105 1 Y 1 A HIS 388 ? A HIS 399 
106 1 Y 1 A HIS 389 ? A HIS 400 
107 1 Y 1 A HIS 390 ? A HIS 401 
108 1 Y 1 A HIS 391 ? A HIS 402 
109 1 Y 1 A HIS 392 ? A HIS 403 
110 1 Y 1 A HIS 393 ? A HIS 404 
111 1 Y 1 A HIS 394 ? A HIS 405 
112 1 Y 1 A HIS 395 ? A HIS 406 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION'                           CL  
3 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
4 water                                    HOH 
#